data_4PJO
# 
_entry.id   4PJO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4PJO         
WWPDB D_1000201407 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3CW1 'U1 snRNP structure at 5.5 Angstrom resolution' unspecified 
PDB 2Y9A 'U4 snRNP core structure'                       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  . 
_pdbx_database_status.entry_id                        4PJO 
_pdbx_database_status.status_code_cs                  . 
_pdbx_database_status.methods_development_category    . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-05-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.pdbx_ordinal 
_audit_author.name 
1 'Kondo, Y.'      
2 'Oubridge, C.'   
3 'van Roon, A.M.' 
4 'Nagai, K.'      
# 
_citation.abstract                  . 
_citation.abstract_id_CAS           . 
_citation.journal_volume            4 
_citation.journal_id_ISSN           2050-084X 
_citation.database_id_Medline       . 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.unpublished_flag          . 
_citation.id                        primary 
_citation.coordinate_linkage        . 
_citation.database_id_CSD           . 
_citation.book_title                . 
_citation.book_publisher_city       . 
_citation.journal_full              . 
_citation.details                   . 
_citation.book_id_ISBN              . 
_citation.journal_issue             . 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25555158 
_citation.page_last                 ? 
_citation.journal_abbrev            Elife 
_citation.pdbx_database_id_DOI      10.7554/eLife.04986 
_citation.journal_id_CSD            ? 
_citation.language                  . 
_citation.country                   US 
_citation.title                     
;Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
;
_citation.page_first                ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kondo, Y.'      1 
primary 'Oubridge, C.'   2 
primary 'van Roon, A.M.' 3 
primary 'Nagai, K.'      4 
# 
_cell.length_a           120.359 
_cell.Z_PDB              16 
_cell.length_c           256.322 
_cell.length_b           172.627 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.angle_alpha        90.00 
_cell.entry_id           4PJO 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.pdbx_full_space_group_name_H-M   . 
_symmetry.cell_setting                     . 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.space_group_name_Hall            . 
_symmetry.Int_Tables_number                19 
_symmetry.entry_id                         4PJO 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Small nuclear ribonucleoprotein Sm D3' 13940.308 4  ? ?   ? ? 
2  polymer     man 
;Small nuclear ribonucleoprotein-associated proteins B and B'
;
10911.931 4  ? ?   ? ? 
3  polymer     man 'Small nuclear ribonucleoprotein Sm D1' 10026.635 4  ? M1V ? 
;Expressed as a fusion protein with the N-terminal 59 residues of U1-70k protein joined via a (Gly-Ser)3 linker to its N-terminus.  This fusion protein is co-expressed with SmD2.
;
4  polymer     man 'Small nuclear ribonucleoprotein Sm D2' 13551.928 4  ? ?   ? ? 
5  polymer     man 'Small nuclear ribonucleoprotein E' 10817.601 4  ? ?   ? ? 
6  polymer     man 'Small nuclear ribonucleoprotein F' 8369.846  4  ? ?   ? ? 
7  polymer     man 'Small nuclear ribonucleoprotein G' 8508.084  4  ? ?   ? ? 
8  polymer     man 'U1 small nuclear ribonucleoprotein 70 kDa' 6862.841  4  ? M1G ? 
;Expressed as a fusion protein with SmD1 (1-85) joined via a (Gly-Ser)3 linker at its C-terminus.  This fusion protein is co-expressed with SmD2.  An N-terminal tag is cleaved by TEV protease during purification, leaving an N-terminal Gly residue.
;
9  polymer     man 'U1 small nuclear ribonucleoprotein C' 7279.186  4  ? ?   ? ? 
10 polymer     syn 
'U1 RNA variant (48-MER) with 4-helix junction replaced by kissing loop (HIV-1 (Mal) DIS) and shorter stem-loop 4.' 19575.514 4  ? 
?   ? 
;Made by in vitro transcription using T7 RNA polymerase from a linearised pUC plasmid template containing a T7 promoter followed by the template sequence.
;
11 polymer     syn 
;RNA (5'-R(*AP*GP*GP*UP*AP*AP*GP*UP*CP*C)-3')
;
3200.972  4  ? ?   ? 
;RNA made by chemical synthesis. Sequence based on consensus human 5' splice site.
;
12 non-polymer syn 'ZINC ION' 65.409    4  ? ?   ? ? 
13 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305   2  ? ?   ? ? 
14 non-polymer syn 'MAGNESIUM ION' 24.305    20 ? ?   ? ? 
15 non-polymer syn 'POTASSIUM ION' 39.098    6  ? ?   ? ? 
16 non-polymer syn ETHANOL 46.068    1  ? ?   ? ? 
17 non-polymer syn 'CHLORIDE ION' 35.453    1  ? ?   ? ? 
18 non-polymer syn 'SULFATE ION' 96.063    1  ? ?   ? ? 
19 water       nat water 18.015    48 ? ?   ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Sm-D3,snRNP core protein D3'                  
2 
;snRNP-B,Sm protein B/B',SmB/B'
;
3 'Sm-D1,Sm-D autoantigen,snRNP core protein D1' 
4 'Sm-D2,snRNP core protein D2'                  
5 'snRNP-E,Sm protein E,SmE'                     
6 'snRNP-F,Sm protein F,SmF'                     
7 'snRNP-G,Sm protein G,SmG'                     
8 snRNP70                                        
9 U1C                                            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'   no no  
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
A,a,O,o ? 
2  'polypeptide(L)'   no no  
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARV
;
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARV
;
B,b,P,p ? 
3  'polypeptide(L)'   no no  
;GSGSGSVKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSL
PLDTLLVDVEP
;
;GSGSGSVKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSL
PLDTLLVDVEP
;
C,c,Q,q ? 
4  'polypeptide(L)'   no no  
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
D,d,R,r ? 
5  'polypeptide(L)'   no no  
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
E,e,S,s ? 
6  'polypeptide(L)'   no no  MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGV 
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGV                                                       
F,f,T,t ? 
7  'polypeptide(L)'   no no  MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV                                                      
G,g,U,u ? 
8  'polypeptide(L)'   no no  GTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRA 
GTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRA                                                                      
K,k,N,n ? 
9  'polypeptide(L)'   no no  MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGK 
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGK                                                                     
L,l,M,m ? 
10 polyribonucleotide no yes '(GTP)GACUUACCUGGCAGUGAGGUGCACACACUGCAUAAUUUGUGGUAGUGGGCGAAAGCCCG' 
GGACUUACCUGGCAGUGAGGUGCACACACUGCAUAAUUUGUGGUAGUGGGCGAAAGCCCG                                                                      
1,2,3,4 ? 
11 polyribonucleotide no no  AGGUAAGUCC AGGUAAGUCC X,x,Y,y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   SER n 
1  3   ILE n 
1  4   GLY n 
1  5   VAL n 
1  6   PRO n 
1  7   ILE n 
1  8   LYS n 
1  9   VAL n 
1  10  LEU n 
1  11  HIS n 
1  12  GLU n 
1  13  ALA n 
1  14  GLU n 
1  15  GLY n 
1  16  HIS n 
1  17  ILE n 
1  18  VAL n 
1  19  THR n 
1  20  CYS n 
1  21  GLU n 
1  22  THR n 
1  23  ASN n 
1  24  THR n 
1  25  GLY n 
1  26  GLU n 
1  27  VAL n 
1  28  TYR n 
1  29  ARG n 
1  30  GLY n 
1  31  LYS n 
1  32  LEU n 
1  33  ILE n 
1  34  GLU n 
1  35  ALA n 
1  36  GLU n 
1  37  ASP n 
1  38  ASN n 
1  39  MET n 
1  40  ASN n 
1  41  CYS n 
1  42  GLN n 
1  43  MET n 
1  44  SER n 
1  45  ASN n 
1  46  ILE n 
1  47  THR n 
1  48  VAL n 
1  49  THR n 
1  50  TYR n 
1  51  ARG n 
1  52  ASP n 
1  53  GLY n 
1  54  ARG n 
1  55  VAL n 
1  56  ALA n 
1  57  GLN n 
1  58  LEU n 
1  59  GLU n 
1  60  GLN n 
1  61  VAL n 
1  62  TYR n 
1  63  ILE n 
1  64  ARG n 
1  65  GLY n 
1  66  SER n 
1  67  LYS n 
1  68  ILE n 
1  69  ARG n 
1  70  PHE n 
1  71  LEU n 
1  72  ILE n 
1  73  LEU n 
1  74  PRO n 
1  75  ASP n 
1  76  MET n 
1  77  LEU n 
1  78  LYS n 
1  79  ASN n 
1  80  ALA n 
1  81  PRO n 
1  82  MET n 
1  83  LEU n 
1  84  LYS n 
1  85  SER n 
1  86  MET n 
1  87  LYS n 
1  88  ASN n 
1  89  LYS n 
1  90  ASN n 
1  91  GLN n 
1  92  GLY n 
1  93  SER n 
1  94  GLY n 
1  95  ALA n 
1  96  GLY n 
1  97  ARG n 
1  98  GLY n 
1  99  LYS n 
1  100 ALA n 
1  101 ALA n 
1  102 ILE n 
1  103 LEU n 
1  104 LYS n 
1  105 ALA n 
1  106 GLN n 
1  107 VAL n 
1  108 ALA n 
1  109 ALA n 
1  110 ARG n 
1  111 GLY n 
1  112 ARG n 
1  113 GLY n 
1  114 ARG n 
1  115 GLY n 
1  116 MET n 
1  117 GLY n 
1  118 ARG n 
1  119 GLY n 
1  120 ASN n 
1  121 ILE n 
1  122 PHE n 
1  123 GLN n 
1  124 LYS n 
1  125 ARG n 
1  126 ARG n 
2  1   MET n 
2  2   THR n 
2  3   VAL n 
2  4   GLY n 
2  5   LYS n 
2  6   SER n 
2  7   SER n 
2  8   LYS n 
2  9   MET n 
2  10  LEU n 
2  11  GLN n 
2  12  HIS n 
2  13  ILE n 
2  14  ASP n 
2  15  TYR n 
2  16  ARG n 
2  17  MET n 
2  18  ARG n 
2  19  CYS n 
2  20  ILE n 
2  21  LEU n 
2  22  GLN n 
2  23  ASP n 
2  24  GLY n 
2  25  ARG n 
2  26  ILE n 
2  27  PHE n 
2  28  ILE n 
2  29  GLY n 
2  30  THR n 
2  31  PHE n 
2  32  LYS n 
2  33  ALA n 
2  34  PHE n 
2  35  ASP n 
2  36  LYS n 
2  37  HIS n 
2  38  MET n 
2  39  ASN n 
2  40  LEU n 
2  41  ILE n 
2  42  LEU n 
2  43  CYS n 
2  44  ASP n 
2  45  CYS n 
2  46  ASP n 
2  47  GLU n 
2  48  PHE n 
2  49  ARG n 
2  50  LYS n 
2  51  ILE n 
2  52  LYS n 
2  53  PRO n 
2  54  LYS n 
2  55  ASN n 
2  56  SER n 
2  57  LYS n 
2  58  GLN n 
2  59  ALA n 
2  60  GLU n 
2  61  ARG n 
2  62  GLU n 
2  63  GLU n 
2  64  LYS n 
2  65  ARG n 
2  66  VAL n 
2  67  LEU n 
2  68  GLY n 
2  69  LEU n 
2  70  VAL n 
2  71  LEU n 
2  72  LEU n 
2  73  ARG n 
2  74  GLY n 
2  75  GLU n 
2  76  ASN n 
2  77  LEU n 
2  78  VAL n 
2  79  SER n 
2  80  MET n 
2  81  THR n 
2  82  VAL n 
2  83  GLU n 
2  84  GLY n 
2  85  PRO n 
2  86  PRO n 
2  87  PRO n 
2  88  LYS n 
2  89  ASP n 
2  90  THR n 
2  91  GLY n 
2  92  ILE n 
2  93  ALA n 
2  94  ARG n 
2  95  VAL n 
3  1   GLY n 
3  2   SER n 
3  3   GLY n 
3  4   SER n 
3  5   GLY n 
3  6   SER n 
3  7   VAL n 
3  8   LYS n 
3  9   LEU n 
3  10  VAL n 
3  11  ARG n 
3  12  PHE n 
3  13  LEU n 
3  14  MET n 
3  15  LYS n 
3  16  LEU n 
3  17  SER n 
3  18  HIS n 
3  19  GLU n 
3  20  THR n 
3  21  VAL n 
3  22  THR n 
3  23  ILE n 
3  24  GLU n 
3  25  LEU n 
3  26  LYS n 
3  27  ASN n 
3  28  GLY n 
3  29  THR n 
3  30  GLN n 
3  31  VAL n 
3  32  HIS n 
3  33  GLY n 
3  34  THR n 
3  35  ILE n 
3  36  THR n 
3  37  GLY n 
3  38  VAL n 
3  39  ASP n 
3  40  VAL n 
3  41  SER n 
3  42  MET n 
3  43  ASN n 
3  44  THR n 
3  45  HIS n 
3  46  LEU n 
3  47  LYS n 
3  48  ALA n 
3  49  VAL n 
3  50  LYS n 
3  51  MET n 
3  52  THR n 
3  53  LEU n 
3  54  LYS n 
3  55  ASN n 
3  56  ARG n 
3  57  GLU n 
3  58  PRO n 
3  59  VAL n 
3  60  GLN n 
3  61  LEU n 
3  62  GLU n 
3  63  THR n 
3  64  LEU n 
3  65  SER n 
3  66  ILE n 
3  67  ARG n 
3  68  GLY n 
3  69  ASN n 
3  70  ASN n 
3  71  ILE n 
3  72  ARG n 
3  73  TYR n 
3  74  PHE n 
3  75  ILE n 
3  76  LEU n 
3  77  PRO n 
3  78  ASP n 
3  79  SER n 
3  80  LEU n 
3  81  PRO n 
3  82  LEU n 
3  83  ASP n 
3  84  THR n 
3  85  LEU n 
3  86  LEU n 
3  87  VAL n 
3  88  ASP n 
3  89  VAL n 
3  90  GLU n 
3  91  PRO n 
4  1   MET n 
4  2   SER n 
4  3   LEU n 
4  4   LEU n 
4  5   ASN n 
4  6   LYS n 
4  7   PRO n 
4  8   LYS n 
4  9   SER n 
4  10  GLU n 
4  11  MET n 
4  12  THR n 
4  13  PRO n 
4  14  GLU n 
4  15  GLU n 
4  16  LEU n 
4  17  GLN n 
4  18  LYS n 
4  19  ARG n 
4  20  GLU n 
4  21  GLU n 
4  22  GLU n 
4  23  GLU n 
4  24  PHE n 
4  25  ASN n 
4  26  THR n 
4  27  GLY n 
4  28  PRO n 
4  29  LEU n 
4  30  SER n 
4  31  VAL n 
4  32  LEU n 
4  33  THR n 
4  34  GLN n 
4  35  SER n 
4  36  VAL n 
4  37  LYS n 
4  38  ASN n 
4  39  ASN n 
4  40  THR n 
4  41  GLN n 
4  42  VAL n 
4  43  LEU n 
4  44  ILE n 
4  45  ASN n 
4  46  CYS n 
4  47  ARG n 
4  48  ASN n 
4  49  ASN n 
4  50  LYS n 
4  51  LYS n 
4  52  LEU n 
4  53  LEU n 
4  54  GLY n 
4  55  ARG n 
4  56  VAL n 
4  57  LYS n 
4  58  ALA n 
4  59  PHE n 
4  60  ASP n 
4  61  ARG n 
4  62  HIS n 
4  63  CYS n 
4  64  ASN n 
4  65  MET n 
4  66  VAL n 
4  67  LEU n 
4  68  GLU n 
4  69  ASN n 
4  70  VAL n 
4  71  LYS n 
4  72  GLU n 
4  73  MET n 
4  74  TRP n 
4  75  THR n 
4  76  GLU n 
4  77  VAL n 
4  78  PRO n 
4  79  LYS n 
4  80  SER n 
4  81  GLY n 
4  82  LYS n 
4  83  GLY n 
4  84  LYS n 
4  85  LYS n 
4  86  LYS n 
4  87  SER n 
4  88  LYS n 
4  89  PRO n 
4  90  VAL n 
4  91  ASN n 
4  92  LYS n 
4  93  ASP n 
4  94  ARG n 
4  95  TYR n 
4  96  ILE n 
4  97  SER n 
4  98  LYS n 
4  99  MET n 
4  100 PHE n 
4  101 LEU n 
4  102 ARG n 
4  103 GLY n 
4  104 ASP n 
4  105 SER n 
4  106 VAL n 
4  107 ILE n 
4  108 VAL n 
4  109 VAL n 
4  110 LEU n 
4  111 ARG n 
4  112 ASN n 
4  113 PRO n 
4  114 LEU n 
4  115 ILE n 
4  116 ALA n 
4  117 GLY n 
4  118 LYS n 
5  1   MET n 
5  2   ALA n 
5  3   TYR n 
5  4   ARG n 
5  5   GLY n 
5  6   GLN n 
5  7   GLY n 
5  8   GLN n 
5  9   LYS n 
5  10  VAL n 
5  11  GLN n 
5  12  LYS n 
5  13  VAL n 
5  14  MET n 
5  15  VAL n 
5  16  GLN n 
5  17  PRO n 
5  18  ILE n 
5  19  ASN n 
5  20  LEU n 
5  21  ILE n 
5  22  PHE n 
5  23  ARG n 
5  24  TYR n 
5  25  LEU n 
5  26  GLN n 
5  27  ASN n 
5  28  ARG n 
5  29  SER n 
5  30  ARG n 
5  31  ILE n 
5  32  GLN n 
5  33  VAL n 
5  34  TRP n 
5  35  LEU n 
5  36  TYR n 
5  37  GLU n 
5  38  GLN n 
5  39  VAL n 
5  40  ASN n 
5  41  MET n 
5  42  ARG n 
5  43  ILE n 
5  44  GLU n 
5  45  GLY n 
5  46  CYS n 
5  47  ILE n 
5  48  ILE n 
5  49  GLY n 
5  50  PHE n 
5  51  ASP n 
5  52  GLU n 
5  53  TYR n 
5  54  MET n 
5  55  ASN n 
5  56  LEU n 
5  57  VAL n 
5  58  LEU n 
5  59  ASP n 
5  60  ASP n 
5  61  ALA n 
5  62  GLU n 
5  63  GLU n 
5  64  ILE n 
5  65  HIS n 
5  66  SER n 
5  67  LYS n 
5  68  THR n 
5  69  LYS n 
5  70  SER n 
5  71  ARG n 
5  72  LYS n 
5  73  GLN n 
5  74  LEU n 
5  75  GLY n 
5  76  ARG n 
5  77  ILE n 
5  78  MET n 
5  79  LEU n 
5  80  LYS n 
5  81  GLY n 
5  82  ASP n 
5  83  ASN n 
5  84  ILE n 
5  85  THR n 
5  86  LEU n 
5  87  LEU n 
5  88  GLN n 
5  89  SER n 
5  90  VAL n 
5  91  SER n 
5  92  ASN n 
6  1   MET n 
6  2   SER n 
6  3   LEU n 
6  4   PRO n 
6  5   LEU n 
6  6   ASN n 
6  7   PRO n 
6  8   LYS n 
6  9   PRO n 
6  10  PHE n 
6  11  LEU n 
6  12  ASN n 
6  13  GLY n 
6  14  LEU n 
6  15  THR n 
6  16  GLY n 
6  17  LYS n 
6  18  PRO n 
6  19  VAL n 
6  20  MET n 
6  21  VAL n 
6  22  LYS n 
6  23  LEU n 
6  24  LYS n 
6  25  TRP n 
6  26  GLY n 
6  27  MET n 
6  28  GLU n 
6  29  TYR n 
6  30  LYS n 
6  31  GLY n 
6  32  TYR n 
6  33  LEU n 
6  34  VAL n 
6  35  SER n 
6  36  VAL n 
6  37  ASP n 
6  38  GLY n 
6  39  TYR n 
6  40  MET n 
6  41  ASN n 
6  42  MET n 
6  43  GLN n 
6  44  LEU n 
6  45  ALA n 
6  46  ASN n 
6  47  THR n 
6  48  GLU n 
6  49  GLU n 
6  50  TYR n 
6  51  ILE n 
6  52  ASP n 
6  53  GLY n 
6  54  ALA n 
6  55  LEU n 
6  56  SER n 
6  57  GLY n 
6  58  HIS n 
6  59  LEU n 
6  60  GLY n 
6  61  GLU n 
6  62  VAL n 
6  63  LEU n 
6  64  ILE n 
6  65  ARG n 
6  66  CYS n 
6  67  ASN n 
6  68  ASN n 
6  69  VAL n 
6  70  LEU n 
6  71  TYR n 
6  72  ILE n 
6  73  ARG n 
6  74  GLY n 
6  75  VAL n 
7  1   MET n 
7  2   SER n 
7  3   LYS n 
7  4   ALA n 
7  5   HIS n 
7  6   PRO n 
7  7   PRO n 
7  8   GLU n 
7  9   LEU n 
7  10  LYS n 
7  11  LYS n 
7  12  PHE n 
7  13  MET n 
7  14  ASP n 
7  15  LYS n 
7  16  LYS n 
7  17  LEU n 
7  18  SER n 
7  19  LEU n 
7  20  LYS n 
7  21  LEU n 
7  22  ASN n 
7  23  GLY n 
7  24  GLY n 
7  25  ARG n 
7  26  HIS n 
7  27  VAL n 
7  28  GLN n 
7  29  GLY n 
7  30  ILE n 
7  31  LEU n 
7  32  ARG n 
7  33  GLY n 
7  34  PHE n 
7  35  ASP n 
7  36  PRO n 
7  37  PHE n 
7  38  MET n 
7  39  ASN n 
7  40  LEU n 
7  41  VAL n 
7  42  ILE n 
7  43  ASP n 
7  44  GLU n 
7  45  CYS n 
7  46  VAL n 
7  47  GLU n 
7  48  MET n 
7  49  ALA n 
7  50  THR n 
7  51  SER n 
7  52  GLY n 
7  53  GLN n 
7  54  GLN n 
7  55  ASN n 
7  56  ASN n 
7  57  ILE n 
7  58  GLY n 
7  59  MET n 
7  60  VAL n 
7  61  VAL n 
7  62  ILE n 
7  63  ARG n 
7  64  GLY n 
7  65  ASN n 
7  66  SER n 
7  67  ILE n 
7  68  ILE n 
7  69  MET n 
7  70  LEU n 
7  71  GLU n 
7  72  ALA n 
7  73  LEU n 
7  74  GLU n 
7  75  ARG n 
7  76  VAL n 
8  1   GLY n 
8  2   THR n 
8  3   GLN n 
8  4   PHE n 
8  5   LEU n 
8  6   PRO n 
8  7   PRO n 
8  8   ASN n 
8  9   LEU n 
8  10  LEU n 
8  11  ALA n 
8  12  LEU n 
8  13  PHE n 
8  14  ALA n 
8  15  PRO n 
8  16  ARG n 
8  17  ASP n 
8  18  PRO n 
8  19  ILE n 
8  20  PRO n 
8  21  TYR n 
8  22  LEU n 
8  23  PRO n 
8  24  PRO n 
8  25  LEU n 
8  26  GLU n 
8  27  LYS n 
8  28  LEU n 
8  29  PRO n 
8  30  HIS n 
8  31  GLU n 
8  32  LYS n 
8  33  HIS n 
8  34  HIS n 
8  35  ASN n 
8  36  GLN n 
8  37  PRO n 
8  38  TYR n 
8  39  CYS n 
8  40  GLY n 
8  41  ILE n 
8  42  ALA n 
8  43  PRO n 
8  44  TYR n 
8  45  ILE n 
8  46  ARG n 
8  47  GLU n 
8  48  PHE n 
8  49  GLU n 
8  50  ASP n 
8  51  PRO n 
8  52  ARG n 
8  53  ASP n 
8  54  ALA n 
8  55  PRO n 
8  56  PRO n 
8  57  PRO n 
8  58  THR n 
8  59  ARG n 
8  60  ALA n 
9  1   MET n 
9  2   PRO n 
9  3   LYS n 
9  4   PHE n 
9  5   TYR n 
9  6   CYS n 
9  7   ASP n 
9  8   TYR n 
9  9   CYS n 
9  10  ASP n 
9  11  THR n 
9  12  TYR n 
9  13  LEU n 
9  14  THR n 
9  15  HIS n 
9  16  ASP n 
9  17  SER n 
9  18  PRO n 
9  19  SER n 
9  20  VAL n 
9  21  ARG n 
9  22  LYS n 
9  23  THR n 
9  24  HIS n 
9  25  CYS n 
9  26  SER n 
9  27  GLY n 
9  28  ARG n 
9  29  LYS n 
9  30  HIS n 
9  31  LYS n 
9  32  GLU n 
9  33  ASN n 
9  34  VAL n 
9  35  LYS n 
9  36  ASP n 
9  37  TYR n 
9  38  TYR n 
9  39  GLN n 
9  40  LYS n 
9  41  TRP n 
9  42  MET n 
9  43  GLU n 
9  44  GLU n 
9  45  GLN n 
9  46  ALA n 
9  47  GLN n 
9  48  SER n 
9  49  LEU n 
9  50  ILE n 
9  51  ASP n 
9  52  LYS n 
9  53  THR n 
9  54  THR n 
9  55  ALA n 
9  56  ALA n 
9  57  PHE n 
9  58  GLN n 
9  59  GLN n 
9  60  GLY n 
9  61  LYS n 
10 1   GTP n 
10 2   G   n 
10 3   A   n 
10 4   C   n 
10 5   U   n 
10 6   U   n 
10 7   A   n 
10 8   C   n 
10 9   C   n 
10 10  U   n 
10 11  G   n 
10 12  G   n 
10 13  C   n 
10 14  A   n 
10 15  G   n 
10 16  U   n 
10 17  G   n 
10 18  A   n 
10 19  G   n 
10 20  G   n 
10 21  U   n 
10 22  G   n 
10 23  C   n 
10 24  A   n 
10 25  C   n 
10 26  A   n 
10 27  C   n 
10 28  A   n 
10 29  C   n 
10 30  U   n 
10 31  G   n 
10 32  C   n 
10 33  A   n 
10 34  U   n 
10 35  A   n 
10 36  A   n 
10 37  U   n 
10 38  U   n 
10 39  U   n 
10 40  G   n 
10 41  U   n 
10 42  G   n 
10 43  G   n 
10 44  U   n 
10 45  A   n 
10 46  G   n 
10 47  U   n 
10 48  G   n 
10 49  G   n 
10 50  G   n 
10 51  C   n 
10 52  G   n 
10 53  A   n 
10 54  A   n 
10 55  A   n 
10 56  G   n 
10 57  C   n 
10 58  C   n 
10 59  C   n 
10 60  G   n 
11 1   A   n 
11 2   G   n 
11 3   G   n 
11 4   U   n 
11 5   A   n 
11 6   A   n 
11 7   G   n 
11 8   U   n 
11 9   C   n 
11 10  C   n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 126 Human ? SNRPD3                                 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 
? ? 'Escherichia coli'            562    ? ? ? ? ? ? 'SG13009 (pREP4)' ? ? ? ? ? ? ? Plasmid ? 'Coexpressed with SmB' ? pQE30  ? ? 
2 1 sample 'Biological sequence' 1 95  Human ? 'SNRPB, COD, SNRPB1'                   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 
? ? 'Escherichia coli '           562    ? ? ? ? ? ? 'SG13009 (pREP4)' ? ? ? ? ? ? ? Plasmid ? 'Coexpressed with SmD3' ? pQE30  ? 
? 
3 1 sample 'Biological sequence' 1 91  Human ? SNRPD1                                 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 
? ? 'Escherichia coli BL21 (DE3)' 469008 ? ? ? ? ? ? pLysS             ? ? ? ? ? ? ? Plasmid ? 'Coexpressed with SmD1' ? pET    ? 
? 
4 1 sample 'Biological sequence' 1 118 Human ? SNRPD2                                 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 
? ? 'Escherichia coli BL21(DE3)'  469008 ? ? ? ? ? ? pLysS             ? ? ? ? ? ? ? Plasmid ? 
'Coexpressed with 70k-SmD1 fusion protein' ? pET    ? ? 
5 1 sample 'Biological sequence' 1 92  Human ? SNRPE                                  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 
? ? 'Escherichia coli BL21(DE3)'  469008 ? ? ? ? ? ? ?                 ? ? ? ? ? ? ? Plasmid ? 'Co-expressed with SmF and SmG' ? 
pET15b ? ? 
6 1 sample 'Biological sequence' 1 75  Human ? 'SNRPF, PBSCF'                         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 
? ? 'Escherichia coli BL21(DE3)'  469008 ? ? ? ? ? ? ?                 ? ? ? ? ? ? ? Plasmid ? 'Co-expressed with SmE and SmG' ? 
pET15b ? ? 
7 1 sample 'Biological sequence' 1 76  Human ? 'SNRPG, PBSCG'                         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 
? ? 'Escherichia coli BL21(DE3)'  469008 ? ? ? ? ? ? ?                 ? ? ? ? ? ? ? Plasmid ? 'Co-expressed with SmE and SmF' ? 
pET15b ? ? 
8 1 sample 'Biological sequence' 1 60  Human ? 'SNRNP70, RNPU1Z, RPU1, SNRP70, U1AP1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 
? ? 'Escherichia coli BL21(DE3)'  469008 ? ? ? ? ? ? pLysS             ? ? ? ? ? ? ? Plasmid ? 'Co-expressed with SmD2' ? pET    ? 
? 
9 1 sample 'Biological sequence' 1 61  Human ? SNRPC                                  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 
? ? 'Escherichia coli B'          37762  ? ? ? ? ? ? 'B834 (DE3)'      ? ? ? ? ? ? ? Plasmid ? ? ? pET3b  ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
10 1 sample 1 60 'Homo sapiens' human 9606 ? 
11 1 sample 1 10 'Homo sapiens' human 9606 ? 
# 
loop_
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.id 
_struct_ref.pdbx_align_begin 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_isoform 
1  P62318 
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
1  1 UNP SMD3_HUMAN ? 
2  P14678 
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARV
;
2  1 UNP RSMB_HUMAN ? 
3  P62314 
;KLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLV
DVEP
;
3  2 UNP SMD1_HUMAN ? 
4  P62316 
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
4  1 UNP SMD2_HUMAN ? 
5  P62304 
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
5  1 UNP RUXE_HUMAN ? 
6  P62306 MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGV 6  1 UNP RUXF_HUMAN ? 
7  P62308 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 7  1 UNP RUXG_HUMAN ? 
8  P08621 TQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRA 8  2 UNP RU17_HUMAN ? 
9  P09234 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGK 9  1 UNP RU1C_HUMAN ? 
10 4PJO   ? 10 1 PDB 4PJO       ? 
11 4PJO   ? 11 1 PDB 4PJO       ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  4PJO A 1 ? 126 ? P62318 1 ? 126 ? 1 126 
2  2  4PJO B 1 ? 95  ? P14678 1 ? 95  ? 1 95  
3  3  4PJO C 8 ? 91  ? P62314 2 ? 85  ? 2 85  
4  4  4PJO D 1 ? 118 ? P62316 1 ? 118 ? 1 118 
5  5  4PJO E 1 ? 92  ? P62304 1 ? 92  ? 1 92  
6  6  4PJO F 1 ? 75  ? P62306 1 ? 75  ? 1 75  
7  7  4PJO G 1 ? 76  ? P62308 1 ? 76  ? 1 76  
8  8  4PJO K 2 ? 60  ? P08621 2 ? 60  ? 2 60  
9  9  4PJO L 1 ? 61  ? P09234 1 ? 61  ? 1 61  
10 10 4PJO 1 1 ? 60  ? 4PJO   1 ? 150 ? 1 150 
11 11 4PJO X 1 ? 10  ? 4PJO   1 ? 10  ? 1 10  
12 1  4PJO a 1 ? 126 ? P62318 1 ? 126 ? 1 126 
13 2  4PJO b 1 ? 95  ? P14678 1 ? 95  ? 1 95  
14 3  4PJO c 8 ? 91  ? P62314 2 ? 85  ? 2 85  
15 4  4PJO d 1 ? 118 ? P62316 1 ? 118 ? 1 118 
16 5  4PJO e 1 ? 92  ? P62304 1 ? 92  ? 1 92  
17 6  4PJO f 1 ? 75  ? P62306 1 ? 75  ? 1 75  
18 7  4PJO g 1 ? 76  ? P62308 1 ? 76  ? 1 76  
19 8  4PJO k 2 ? 60  ? P08621 2 ? 60  ? 2 60  
20 9  4PJO l 1 ? 61  ? P09234 1 ? 61  ? 1 61  
21 10 4PJO 2 1 ? 60  ? 4PJO   1 ? 150 ? 1 150 
22 11 4PJO x 1 ? 10  ? 4PJO   1 ? 10  ? 1 10  
23 1  4PJO O 1 ? 126 ? P62318 1 ? 126 ? 1 126 
24 2  4PJO P 1 ? 95  ? P14678 1 ? 95  ? 1 95  
25 3  4PJO Q 8 ? 91  ? P62314 2 ? 85  ? 2 85  
26 4  4PJO R 1 ? 118 ? P62316 1 ? 118 ? 1 118 
27 5  4PJO S 1 ? 92  ? P62304 1 ? 92  ? 1 92  
28 6  4PJO T 1 ? 75  ? P62306 1 ? 75  ? 1 75  
29 7  4PJO U 1 ? 76  ? P62308 1 ? 76  ? 1 76  
30 8  4PJO N 2 ? 60  ? P08621 2 ? 60  ? 2 60  
31 9  4PJO M 1 ? 61  ? P09234 1 ? 61  ? 1 61  
32 10 4PJO 3 1 ? 60  ? 4PJO   1 ? 150 ? 1 150 
33 11 4PJO Y 1 ? 10  ? 4PJO   1 ? 10  ? 1 10  
34 1  4PJO o 1 ? 126 ? P62318 1 ? 126 ? 1 126 
35 2  4PJO p 1 ? 95  ? P14678 1 ? 95  ? 1 95  
36 3  4PJO q 8 ? 91  ? P62314 2 ? 85  ? 2 85  
37 4  4PJO r 1 ? 118 ? P62316 1 ? 118 ? 1 118 
38 5  4PJO s 1 ? 92  ? P62304 1 ? 92  ? 1 92  
39 6  4PJO t 1 ? 75  ? P62306 1 ? 75  ? 1 75  
40 7  4PJO u 1 ? 76  ? P62308 1 ? 76  ? 1 76  
41 8  4PJO n 2 ? 60  ? P08621 2 ? 60  ? 2 60  
42 9  4PJO m 1 ? 61  ? P09234 1 ? 61  ? 1 61  
43 10 4PJO 4 1 ? 60  ? 4PJO   1 ? 150 ? 1 150 
44 11 4PJO y 1 ? 10  ? 4PJO   1 ? 10  ? 1 10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3  4PJO GLY C 1 ? UNP P62314 ? ? linker           -5 1  
3  4PJO SER C 2 ? UNP P62314 ? ? linker           -4 2  
3  4PJO GLY C 3 ? UNP P62314 ? ? linker           -3 3  
3  4PJO SER C 4 ? UNP P62314 ? ? linker           -2 4  
3  4PJO GLY C 5 ? UNP P62314 ? ? linker           -1 5  
3  4PJO SER C 6 ? UNP P62314 ? ? linker           0  6  
3  4PJO VAL C 7 ? UNP P62314 ? ? linker           1  7  
8  4PJO GLY K 1 ? UNP P08621 ? ? 'expression tag' 1  8  
14 4PJO GLY c 1 ? UNP P62314 ? ? linker           -5 9  
14 4PJO SER c 2 ? UNP P62314 ? ? linker           -4 10 
14 4PJO GLY c 3 ? UNP P62314 ? ? linker           -3 11 
14 4PJO SER c 4 ? UNP P62314 ? ? linker           -2 12 
14 4PJO GLY c 5 ? UNP P62314 ? ? linker           -1 13 
14 4PJO SER c 6 ? UNP P62314 ? ? linker           0  14 
14 4PJO VAL c 7 ? UNP P62314 ? ? linker           1  15 
19 4PJO GLY k 1 ? UNP P08621 ? ? 'expression tag' 1  16 
25 4PJO GLY Q 1 ? UNP P62314 ? ? linker           -5 17 
25 4PJO SER Q 2 ? UNP P62314 ? ? linker           -4 18 
25 4PJO GLY Q 3 ? UNP P62314 ? ? linker           -3 19 
25 4PJO SER Q 4 ? UNP P62314 ? ? linker           -2 20 
25 4PJO GLY Q 5 ? UNP P62314 ? ? linker           -1 21 
25 4PJO SER Q 6 ? UNP P62314 ? ? linker           0  22 
25 4PJO VAL Q 7 ? UNP P62314 ? ? linker           1  23 
30 4PJO GLY N 1 ? UNP P08621 ? ? 'expression tag' 1  24 
36 4PJO GLY q 1 ? UNP P62314 ? ? linker           -5 25 
36 4PJO SER q 2 ? UNP P62314 ? ? linker           -4 26 
36 4PJO GLY q 3 ? UNP P62314 ? ? linker           -3 27 
36 4PJO SER q 4 ? UNP P62314 ? ? linker           -2 28 
36 4PJO GLY q 5 ? UNP P62314 ? ? linker           -1 29 
36 4PJO SER q 6 ? UNP P62314 ? ? linker           0  30 
36 4PJO VAL q 7 ? UNP P62314 ? ? linker           1  31 
41 4PJO GLY n 1 ? UNP P08621 ? ? 'expression tag' 1  32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                          ?     'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                               ?     'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                              ?     'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ?     'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ?     'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                           ?     'C9 H14 N3 O8 P'    323.197 
CL  non-polymer         . 'CHLORIDE ION'                                        ?     'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                                              ?     'C3 H7 N O2 S'      121.158 
EOH non-polymer         . ETHANOL                                               ?     'C2 H6 O'           46.068  
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S'    238.305 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                          ?     'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                             ?     'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ?     'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                               ?     'C2 H5 N O2'        75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE"                           ?     'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                                             ?     'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                 ?     'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ?     'C6 H13 N O2'       131.173 
K   non-polymer         . 'POTASSIUM ION'                                       ?     'K 1'               39.098  
LEU 'L-peptide linking' y LEUCINE                                               ?     'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                ?     'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                            ?     'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                       ?     'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                         ?     'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                               ?     'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                ?     'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                                         ?     'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                                             ?     'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ?     'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                              ?     'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                            ?     'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                                ?     'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                            ?     'Zn 2'              65.409  
# 
_exptl.absorpt_process_details    . 
_exptl.method_details             . 
_exptl.absorpt_correction_T_max   . 
_exptl.entry_id                   4PJO 
_exptl.details                    . 
_exptl.absorpt_correction_type    . 
_exptl.crystals_number            . 
_exptl.absorpt_coefficient_mu     . 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.absorpt_correction_T_min   . 
# 
_exptl_crystal.density_percent_sol         55.7 
_exptl_crystal.density_meas_temp_gt        . 
_exptl_crystal.colour_primary              . 
_exptl_crystal.pdbx_crystal_image_url      . 
_exptl_crystal.density_meas_esd            . 
_exptl_crystal.pdbx_crystal_image_format   . 
_exptl_crystal.density_meas_gt             . 
_exptl_crystal.id                          1 
_exptl_crystal.density_meas_temp           . 
_exptl_crystal.F_000                       . 
_exptl_crystal.colour_lustre               . 
_exptl_crystal.density_method              . 
_exptl_crystal.pdbx_mosaicity_esd          . 
_exptl_crystal.description                 '0.3 x 0.04 x 0.04 mm^3 rods' 
_exptl_crystal.pdbx_mosaicity              . 
_exptl_crystal.size_min                    . 
_exptl_crystal.size_rad                    . 
_exptl_crystal.size_mid                    . 
_exptl_crystal.density_diffrn              . 
_exptl_crystal.colour_modifier             . 
_exptl_crystal.density_meas                . 
_exptl_crystal.density_meas_temp_esd       . 
_exptl_crystal.colour                      . 
_exptl_crystal.size_max                    . 
_exptl_crystal.preparation                 . 
_exptl_crystal.density_Matthews            2.77 
_exptl_crystal.density_meas_temp_lt        . 
_exptl_crystal.density_meas_lt             . 
# 
_exptl_crystal_grow.pressure_esd    . 
_exptl_crystal_grow.seeding_ref     . 
_exptl_crystal_grow.atmosphere      . 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.apparatus       . 
_exptl_crystal_grow.temp_esd        . 
_exptl_crystal_grow.method_ref      . 
_exptl_crystal_grow.temp_details    'Cold room' 
_exptl_crystal_grow.pressure        . 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         . 
_exptl_crystal_grow.pdbx_pH_range   . 
_exptl_crystal_grow.time            . 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.seeding         . 
_exptl_crystal_grow.pdbx_details    
;Minimal U1 snRNP at 4 mg/ml in 300mM KCl, 20mM KHepes, pH 7.5, 5mM MgCl2, 1mM DTT, 0.15 mM polyamine-9 mixed 1:1 with 7% MPD, 180mM KCl, 5mM MgSO4, 50mM NaHepes pH 6.4.  Streak seeded.
;
# 
_diffrn.ambient_pressure_lt    . 
_diffrn.ambient_environment    . 
_diffrn.ambient_temp           100 
_diffrn.ambient_pressure       . 
_diffrn.ambient_temp_lt        . 
_diffrn.ambient_temp_esd       . 
_diffrn.crystal_id             1 
_diffrn.details                . 
_diffrn.ambient_temp_details   . 
_diffrn.ambient_pressure_esd   . 
_diffrn.crystal_support        . 
_diffrn.crystal_treatment      . 
_diffrn.id                     1 
_diffrn.ambient_temp_gt        . 
_diffrn.ambient_pressure_gt    . 
# 
_diffrn_detector.pdbx_frames_total            . 
_diffrn_detector.area_resol_mean              . 
_diffrn_detector.dtime                        . 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.pdbx_collection_date         2013-01-13 
_diffrn_detector.details                      . 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_time_total   . 
# 
_diffrn_radiation.pdbx_scattering_type             x-ray 
_diffrn_radiation.probe                            . 
_diffrn_radiation.xray_symbol                      . 
_diffrn_radiation.pdbx_wavelength                  . 
_diffrn_radiation.type                             . 
_diffrn_radiation.pdbx_analyzer                    . 
_diffrn_radiation.monochromator                    'Single crystal' 
_diffrn_radiation.filter_edge                      . 
_diffrn_radiation.polarisn_norm                    . 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.collimation                      . 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.inhomogeneity                    . 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.polarisn_ratio                   . 
_diffrn_radiation.pdbx_wavelength_list             . 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97949 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.target                      . 
_diffrn_source.power                       . 
_diffrn_source.take-off_angle              . 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_wavelength_list        0.97949 
_diffrn_source.current                     . 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.voltage                     . 
_diffrn_source.pdbx_wavelength             . 
_diffrn_source.details                     . 
_diffrn_source.diffrn_id                   1 
_diffrn_source.size                        . 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_synchrotron_beamline   I02 
# 
_reflns.Friedel_coverage                 . 
_reflns.limit_k_max                      . 
_reflns.observed_criterion_I_min         . 
_reflns.observed_criterion_F_max         . 
_reflns.pdbx_scaling_rejects             . 
_reflns.pdbx_d_opt                       . 
_reflns.pdbx_res_netI_over_sigmaI_2      . 
_reflns.number_all                       80571 
_reflns.pdbx_Rpim_I_all                  . 
_reflns.data_reduction_details           . 
_reflns.entry_id                         4PJO 
_reflns.pdbx_res_netI_over_av_sigmaI_2   . 
_reflns.pdbx_Rrim_I_all                  . 
_reflns.pdbx_chi_squared                 . 
_reflns.number_gt                        . 
_reflns.observed_criterion_sigma_F       . 
_reflns.limit_l_min                      . 
_reflns.limit_l_max                      . 
_reflns.observed_criterion_sigma_I       . 
_reflns.pdbx_netI_over_av_sigmaI         . 
_reflns.number_obs                       80571 
_reflns.data_reduction_method            . 
_reflns.percent_possible_obs             99.5 
_reflns.d_resolution_high                3.3 
_reflns.details                          . 
_reflns.pdbx_d_res_opt_method            . 
_reflns.pdbx_d_res_low_opt               . 
_reflns.observed_criterion               . 
_reflns.pdbx_Rsym_value                  . 
_reflns.pdbx_d_res_high_opt              . 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_redundancy                  4.6 
_reflns.limit_h_min                      . 
_reflns.pdbx_Rmerge_I_obs                0.100 
_reflns.pdbx_diffrn_id                   1 
_reflns.Rmerge_F_obs                     . 
_reflns.phase_calculation_details        . 
_reflns.threshold_expression             . 
_reflns.pdbx_netI_over_sigmaI            172.1 
_reflns.Rmerge_F_all                     . 
_reflns.R_free_details                   . 
_reflns.limit_h_max                      . 
_reflns.limit_k_min                      . 
_reflns.observed_criterion_F_min         . 
_reflns.observed_criterion_I_max         . 
_reflns.B_iso_Wilson_estimate            . 
_reflns.d_resolution_low                 70 
_reflns.pdbx_Rmerge_I_all                . 
_reflns.pdbx_number_measured_all         . 
# 
_reflns_shell.number_unique_obs           . 
_reflns_shell.d_res_high                  3.30 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.percent_possible_all        99.3 
_reflns_shell.number_measured_gt          . 
_reflns_shell.pdbx_Rsym_value             . 
_reflns_shell.meanI_over_sigI_gt          . 
_reflns_shell.Rmerge_I_gt                 . 
_reflns_shell.pdbx_Rrim_I_all             . 
_reflns_shell.pdbx_chi_squared            . 
_reflns_shell.percent_possible_gt         . 
_reflns_shell.pdbx_netI_over_sigmaI_obs   . 
_reflns_shell.number_possible             . 
_reflns_shell.percent_possible_obs        . 
_reflns_shell.pdbx_redundancy             4.7 
_reflns_shell.meanI_over_uI_gt            . 
_reflns_shell.d_res_low                   3.36 
_reflns_shell.pdbx_rejects                . 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.meanI_over_sigI_obs         2.7 
_reflns_shell.number_measured_obs         . 
_reflns_shell.meanI_over_sigI_all         . 
_reflns_shell.pdbx_netI_over_sigmaI_all   . 
_reflns_shell.Rmerge_F_all                . 
_reflns_shell.meanI_over_uI_all           . 
_reflns_shell.pdbx_Rpim_I_all             . 
_reflns_shell.Rmerge_F_gt                 . 
_reflns_shell.Rmerge_I_obs                0.534 
_reflns_shell.Rmerge_I_all                . 
_reflns_shell.number_measured_all         . 
_reflns_shell.Rmerge_F_obs                . 
_reflns_shell.number_unique_all           . 
_reflns_shell.number_unique_gt            . 
# 
_refine.ls_abs_structure_Rogers                  . 
_refine.pdbx_pd_proc_ls_prof_R_factor            . 
_refine.ls_number_reflns_all                     . 
_refine.pdbx_TLS_residual_ADP_flag               . 
_refine.ls_goodness_of_fit_ref                   . 
_refine.ls_wR_factor_R_free                      . 
_refine.ls_number_reflns_R_free                  3972 
_refine.aniso_B[2][2]                            -0.97 
_refine.pdbx_overall_ESU_R_Free                  0.518 
_refine.ls_shift_over_su_max                     . 
_refine.pdbx_stereochem_target_val_spec_case     . 
_refine.ls_extinction_coef_esd                   . 
_refine.ls_extinction_expression                 . 
_refine.ls_redundancy_reflns_obs                 . 
_refine.ls_goodness_of_fit_all                   . 
_refine.correlation_coeff_Fo_to_Fc_free          . 
_refine.ls_R_factor_R_free_error                 . 
_refine.pdbx_pd_proc_ls_prof_wR_factor           . 
_refine.ls_goodness_of_fit_gt                    . 
_refine.pdbx_data_cutoff_low_absF                . 
_refine.ls_shift_over_su_max_lt                  . 
_refine.ls_R_factor_R_free                       0.25493 
_refine.overall_SU_B                             . 
_refine.diff_density_max                         . 
_refine.solvent_model_param_ksol                 . 
_refine.pdbx_ls_sigma_Fsqd                       . 
_refine.ls_wR_factor_obs                         . 
_refine.ls_extinction_method                     . 
_refine.ls_abs_structure_Flack_esd               . 
_refine.ls_R_factor_R_work                       0.20698 
_refine.pdbx_overall_phase_error                 . 
_refine.occupancy_max                            . 
_refine.aniso_B[1][1]                            3.77 
_refine.ls_wR_factor_all                         . 
_refine.ls_goodness_of_fit_obs                   . 
_refine.ls_R_Fsqd_factor_obs                     . 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   . 
_refine.ls_hydrogen_treatment                    . 
_refine.ls_shift_over_esd_mean                   . 
_refine.pdbx_data_cutoff_high_rms_absF           . 
_refine.diff_density_rms                         . 
_refine.B_iso_max                                . 
_refine.ls_number_parameters                     . 
_refine.pdbx_pd_meas_number_of_points            . 
_refine.B_iso_min                                . 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.overall_FOM_work_R_set                   . 
_refine.correlation_coeff_Fo_to_Fc               . 
_refine.ls_percent_reflns_obs                    97.41 
_refine.ls_d_res_low                             70 
_refine.ls_R_factor_gt                           . 
_refine.pdbx_pd_Fsqrd_R_factor                   . 
_refine.pdbx_diffrn_id                           1 
_refine.ls_weighting_scheme                      . 
_refine.pdbx_overall_ESU_R                       . 
_refine.pdbx_pd_Marquardt_correlation_coeff      . 
_refine.ls_goodness_of_fit_all_esd               . 
_refine.ls_R_factor_all                          . 
_refine.pdbx_solvent_shrinkage_radii             . 
_refine.diff_density_min_esd                     . 
_refine.B_iso_mean                               99.241 
_refine.ls_extinction_coef                       . 
_refine.ls_matrix_type                           . 
_refine.ls_structure_factor_coef                 . 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_pd_number_of_powder_patterns        . 
_refine.overall_SU_R_Cruickshank_DPI             . 
_refine.ls_restrained_S_obs                      . 
_refine.aniso_B[1][3]                            0 
_refine.ls_wR_factor_R_work                      . 
_refine.diff_density_rms_esd                     . 
_refine.pdbx_overall_SU_R_free_Blow_DPI          . 
_refine.diff_density_max_esd                     . 
_refine.overall_FOM_free_R_set                   . 
_refine.aniso_B[2][3]                            0 
_refine.pdbx_data_cutoff_high_absF               . 
_refine.ls_abs_structure_Rogers_esd              . 
_refine.ls_R_factor_obs                          0.20943 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_real_space_R                        . 
_refine.pdbx_pd_number_of_points                 . 
_refine.overall_SU_ML                            0.423 
_refine.ls_shift_over_esd_max                    . 
_refine.pdbx_overall_SU_R_Blow_DPI               . 
_refine.ls_shift_over_su_mean                    . 
_refine.ls_weighting_details                     . 
_refine.ls_abs_structure_Flack                   . 
_refine.diff_density_min                         . 
_refine.ls_number_restraints                     . 
_refine.aniso_B[3][3]                            -2.79 
_refine.ls_number_reflns_R_work                  . 
_refine.solvent_model_details                    . 
_refine.entry_id                                 4PJO 
_refine.ls_shift_over_su_mean_lt                 . 
_refine.pdbx_solvent_ion_probe_radii             . 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.ls_R_I_factor_obs                        . 
_refine.occupancy_min                            . 
_refine.pdbx_pd_ls_matrix_band_width             . 
_refine.ls_redundancy_reflns_all                 . 
_refine.pdbx_stereochemistry_target_values       . 
_refine.ls_goodness_of_fit_obs_esd               . 
_refine.ls_number_constraints                    . 
_refine.details                                  . 
_refine.ls_d_res_high                            3.3 
_refine.ls_R_factor_R_free_error_details         . 
_refine.aniso_B[1][2]                            0 
_refine.overall_SU_R_free                        . 
_refine.pdbx_starting_model                      2Y9A 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_ls_sigma_I                          . 
_refine.ls_abs_structure_details                 . 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_obs                     74960 
_refine.pdbx_solvent_vdw_probe_radii             . 
_refine.pdbx_density_correlation                 . 
_refine.ls_restrained_S_all                      . 
_refine.pdbx_isotropic_thermal_model             . 
_refine.solvent_model_param_bsol                 . 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        21796 
_refine_hist.pdbx_number_atoms_nucleic_acid   4992 
_refine_hist.pdbx_number_atoms_ligand         69 
_refine_hist.number_atoms_solvent             48 
_refine_hist.number_atoms_total               26905 
_refine_hist.d_res_high                       3.3 
_refine_hist.d_res_low                        70 
# 
_refine_ls_shell.wR_factor_obs                    . 
_refine_ls_shell.pdbx_phase_error                 . 
_refine_ls_shell.d_res_high                       3.300 
_refine_ls_shell.R_factor_R_free_error            . 
_refine_ls_shell.redundancy_reflns_obs            . 
_refine_ls_shell.R_factor_all                     . 
_refine_ls_shell.R_factor_R_free                  0.347 
_refine_ls_shell.number_reflns_R_work             5286 
_refine_ls_shell.number_reflns_obs                . 
_refine_ls_shell.wR_factor_R_work                 . 
_refine_ls_shell.wR_factor_all                    . 
_refine_ls_shell.pdbx_total_number_of_bins_used   . 
_refine_ls_shell.R_factor_R_work                  0.322 
_refine_ls_shell.number_reflns_all                . 
_refine_ls_shell.d_res_low                        3.386 
_refine_ls_shell.percent_reflns_obs               93.5 
_refine_ls_shell.redundancy_reflns_all            . 
_refine_ls_shell.number_reflns_R_free             285 
_refine_ls_shell.wR_factor_R_free                 . 
_refine_ls_shell.R_factor_obs                     . 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.percent_reflns_R_free            5.0 
# 
_struct.pdbx_CASP_flag               . 
_struct.title                        'Minimal U1 snRNP' 
_struct.pdbx_formula_weight_method   . 
_struct.pdbx_descriptor              
'SmD3, SmB (1-95), SmD1 (1-85) plus N-terminal (GlySer)3 linker, SmD2, SmE, SmF (1-75), SmG, U1-70k (1-59), U1-C (1-61)/RNA Complex' 
_struct.pdbx_model_type_details      . 
_struct.entry_id                     4PJO 
_struct.pdbx_model_details           . 
_struct.pdbx_formula_weight          . 
# 
_struct_keywords.pdbx_keywords   SPLICING 
_struct_keywords.text            'U1 snRNP, Spliceosome, Pre-mRNA splicing, Ribonucleoprotein, splicing' 
_struct_keywords.entry_id        4PJO 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 1  ? 
M  N N 2  ? 
N  N N 3  ? 
O  N N 4  ? 
P  N N 5  ? 
Q  N N 6  ? 
R  N N 7  ? 
S  N N 8  ? 
T  N N 9  ? 
U  N N 10 ? 
V  N N 11 ? 
W  N N 1  ? 
X  N N 2  ? 
Y  N N 3  ? 
Z  N N 4  ? 
AA N N 5  ? 
BA N N 6  ? 
CA N N 7  ? 
DA N N 8  ? 
EA N N 9  ? 
FA N N 10 ? 
GA N N 11 ? 
HA N N 1  ? 
IA N N 2  ? 
JA N N 3  ? 
KA N N 4  ? 
LA N N 5  ? 
MA N N 6  ? 
NA N N 7  ? 
OA N N 8  ? 
PA N N 9  ? 
QA N N 10 ? 
RA N N 11 ? 
SA N N 12 ? 
TA N N 13 ? 
UA N N 14 ? 
VA N N 14 ? 
WA N N 14 ? 
XA N N 14 ? 
YA N N 14 ? 
ZA N N 14 ? 
AB N N 14 ? 
BB N N 14 ? 
CB N N 15 ? 
DB N N 15 ? 
EB N N 15 ? 
FB N N 12 ? 
GB N N 14 ? 
HB N N 13 ? 
IB N N 14 ? 
JB N N 14 ? 
KB N N 14 ? 
LB N N 14 ? 
MB N N 15 ? 
NB N N 12 ? 
OB N N 14 ? 
PB N N 14 ? 
QB N N 14 ? 
RB N N 14 ? 
SB N N 15 ? 
TB N N 15 ? 
UB N N 12 ? 
VB N N 16 ? 
WB N N 14 ? 
XB N N 17 ? 
YB N N 14 ? 
ZB N N 14 ? 
AC N N 18 ? 
BC N N 19 ? 
CC N N 19 ? 
DC N N 19 ? 
EC N N 19 ? 
FC N N 19 ? 
GC N N 19 ? 
HC N N 19 ? 
IC N N 19 ? 
JC N N 19 ? 
KC N N 19 ? 
LC N N 19 ? 
MC N N 19 ? 
NC N N 19 ? 
OC N N 19 ? 
PC N N 19 ? 
QC N N 19 ? 
RC N N 19 ? 
SC N N 19 ? 
TC N N 19 ? 
UC N N 19 ? 
VC N N 19 ? 
WC N N 19 ? 
XC N N 19 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A  4  ? ALA A  13 ? GLY A 4  ALA A 13 1 ? 10 
HELX_P HELX_P2  AA2 PRO A  74 ? ALA A  80 ? PRO A 74 ALA A 80 5 ? 7  
HELX_P HELX_P3  AA3 SER B  7  ? GLN B  11 ? SER B 7  GLN B 11 1 ? 5  
HELX_P HELX_P4  AA4 LEU C  9  ? LYS C  15 ? LEU C 3  LYS C 9  1 ? 7  
HELX_P HELX_P5  AA5 PRO C  81 ? LEU C  86 ? PRO C 75 LEU C 80 1 ? 6  
HELX_P HELX_P6  AA6 LYS D  18 ? GLY D  27 ? LYS D 18 GLY D 27 1 ? 10 
HELX_P HELX_P7  AA7 LEU D  29 ? ASN D  38 ? LEU D 29 ASN D 38 1 ? 10 
HELX_P HELX_P8  AA8 GLN E  16 ? ARG E  28 ? GLN E 16 ARG E 28 1 ? 13 
HELX_P HELX_P9  AA9 ASN F  6  ? THR F  15 ? ASN F 6  THR F 15 1 ? 10 
HELX_P HELX_P10 AB1 PRO H  6  ? ALA H  11 ? PRO K 6  ALA K 11 1 ? 6  
HELX_P HELX_P11 AB2 LEU H  28 ? LYS H  32 ? LEU K 28 LYS K 32 5 ? 5  
HELX_P HELX_P12 AB3 ILE H  41 ? PHE H  48 ? ILE K 41 PHE K 48 5 ? 8  
HELX_P HELX_P13 AB4 ASP H  50 ? ALA H  54 ? ASP K 50 ALA K 54 5 ? 5  
HELX_P HELX_P14 AB5 SER I  17 ? SER I  26 ? SER L 17 SER L 26 1 ? 10 
HELX_P HELX_P15 AB6 GLY I  27 ? THR I  54 ? GLY L 27 THR L 54 1 ? 28 
HELX_P HELX_P16 AB7 GLY L  4  ? ALA L  13 ? GLY a 4  ALA a 13 1 ? 10 
HELX_P HELX_P17 AB8 PRO L  74 ? ALA L  80 ? PRO a 74 ALA a 80 5 ? 7  
HELX_P HELX_P18 AB9 SER M  7  ? GLN M  11 ? SER b 7  GLN b 11 1 ? 5  
HELX_P HELX_P19 AC1 LEU N  9  ? LYS N  15 ? LEU c 3  LYS c 9  1 ? 7  
HELX_P HELX_P20 AC2 PRO N  81 ? ASP N  88 ? PRO c 75 ASP c 82 1 ? 8  
HELX_P HELX_P21 AC3 GLU O  14 ? GLY O  27 ? GLU d 14 GLY d 27 1 ? 14 
HELX_P HELX_P22 AC4 LEU O  29 ? ASN O  39 ? LEU d 29 ASN d 39 1 ? 11 
HELX_P HELX_P23 AC5 GLN P  16 ? ASN P  27 ? GLN e 16 ASN e 27 1 ? 12 
HELX_P HELX_P24 AC6 ASN Q  6  ? THR Q  15 ? ASN f 6  THR f 15 1 ? 10 
HELX_P HELX_P25 AC7 PRO S  6  ? ALA S  11 ? PRO k 6  ALA k 11 1 ? 6  
HELX_P HELX_P26 AC8 LEU S  28 ? LYS S  32 ? LEU k 28 LYS k 32 5 ? 5  
HELX_P HELX_P27 AC9 ILE S  41 ? PHE S  48 ? ILE k 41 PHE k 48 5 ? 8  
HELX_P HELX_P28 AD1 SER T  17 ? SER T  26 ? SER l 17 SER l 26 1 ? 10 
HELX_P HELX_P29 AD2 GLY T  27 ? MET T  42 ? GLY l 27 MET l 42 1 ? 16 
HELX_P HELX_P30 AD3 MET T  42 ? ILE T  50 ? MET l 42 ILE l 50 1 ? 9  
HELX_P HELX_P31 AD4 ASP T  51 ? THR T  54 ? ASP l 51 THR l 54 5 ? 4  
HELX_P HELX_P32 AD5 GLY W  4  ? ALA W  13 ? GLY O 4  ALA O 13 1 ? 10 
HELX_P HELX_P33 AD6 PRO W  74 ? ALA W  80 ? PRO O 74 ALA O 80 5 ? 7  
HELX_P HELX_P34 AD7 SER X  7  ? GLN X  11 ? SER P 7  GLN P 11 1 ? 5  
HELX_P HELX_P35 AD8 LEU Y  9  ? LYS Y  15 ? LEU Q 3  LYS Q 9  1 ? 7  
HELX_P HELX_P36 AD9 PRO Y  81 ? LEU Y  86 ? PRO Q 75 LEU Q 80 1 ? 6  
HELX_P HELX_P37 AE1 LYS Z  18 ? GLY Z  27 ? LYS R 18 GLY R 27 1 ? 10 
HELX_P HELX_P38 AE2 LEU Z  29 ? ASN Z  39 ? LEU R 29 ASN R 39 1 ? 11 
HELX_P HELX_P39 AE3 GLN AA 16 ? ARG AA 28 ? GLN S 16 ARG S 28 1 ? 13 
HELX_P HELX_P40 AE4 ASN BA 6  ? THR BA 15 ? ASN T 6  THR T 15 1 ? 10 
HELX_P HELX_P41 AE5 PRO DA 7  ? ALA DA 11 ? PRO N 7  ALA N 11 1 ? 5  
HELX_P HELX_P42 AE6 LEU DA 28 ? LYS DA 32 ? LEU N 28 LYS N 32 5 ? 5  
HELX_P HELX_P43 AE7 ILE DA 41 ? PHE DA 48 ? ILE N 41 PHE N 48 5 ? 8  
HELX_P HELX_P44 AE8 ASP DA 50 ? ALA DA 54 ? ASP N 50 ALA N 54 5 ? 5  
HELX_P HELX_P45 AE9 SER EA 17 ? SER EA 26 ? SER M 17 SER M 26 1 ? 10 
HELX_P HELX_P46 AF1 GLY EA 27 ? THR EA 54 ? GLY M 27 THR M 54 1 ? 28 
HELX_P HELX_P47 AF2 GLY HA 4  ? ALA HA 13 ? GLY o 4  ALA o 13 1 ? 10 
HELX_P HELX_P48 AF3 PRO HA 74 ? ALA HA 80 ? PRO o 74 ALA o 80 5 ? 7  
HELX_P HELX_P49 AF4 SER IA 7  ? GLN IA 11 ? SER p 7  GLN p 11 1 ? 5  
HELX_P HELX_P50 AF5 LEU JA 9  ? LYS JA 15 ? LEU q 3  LYS q 9  1 ? 7  
HELX_P HELX_P51 AF6 PRO JA 81 ? LEU JA 86 ? PRO q 75 LEU q 80 1 ? 6  
HELX_P HELX_P52 AF7 LYS KA 18 ? GLY KA 27 ? LYS r 18 GLY r 27 1 ? 10 
HELX_P HELX_P53 AF8 LEU KA 29 ? ASN KA 39 ? LEU r 29 ASN r 39 1 ? 11 
HELX_P HELX_P54 AF9 GLN LA 16 ? ARG LA 28 ? GLN s 16 ARG s 28 1 ? 13 
HELX_P HELX_P55 AG1 ASN MA 6  ? THR MA 15 ? ASN t 6  THR t 15 1 ? 10 
HELX_P HELX_P56 AG2 ARG NA 63 ? ASN NA 65 ? ARG u 63 ASN u 65 5 ? 3  
HELX_P HELX_P57 AG3 PRO OA 6  ? ALA OA 11 ? PRO n 6  ALA n 11 1 ? 6  
HELX_P HELX_P58 AG4 LEU OA 28 ? LYS OA 32 ? LEU n 28 LYS n 32 5 ? 5  
HELX_P HELX_P59 AG5 ILE OA 41 ? ILE OA 45 ? ILE n 41 ILE n 45 5 ? 5  
HELX_P HELX_P60 AG6 GLU OA 49 ? ASP OA 53 ? GLU n 49 ASP n 53 5 ? 5  
HELX_P HELX_P61 AG7 SER PA 17 ? SER PA 26 ? SER m 17 SER m 26 1 ? 10 
HELX_P HELX_P62 AG8 GLY PA 27 ? ASP PA 51 ? GLY m 27 ASP m 51 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ?    ? I  CYS 6  SG    ? ? ? 1_555 SA ZN .  ZN ? ? L CYS 6   L ZN 201 1_555 ? ? ? ? ? ? ?             2.250 ? 
metalc2   metalc ?    ? I  CYS 9  SG    ? ? ? 1_555 SA ZN .  ZN ? ? L CYS 9   L ZN 201 1_555 ? ? ? ? ? ? ?             2.160 ? 
metalc3   metalc ?    ? I  HIS 24 NE2   ? ? ? 1_555 SA ZN .  ZN ? ? L HIS 24  L ZN 201 1_555 ? ? ? ? ? ? ?             1.949 ? 
metalc4   metalc ?    ? I  HIS 30 ND1   ? ? ? 1_555 SA ZN .  ZN ? ? L HIS 30  L ZN 201 1_555 ? ? ? ? ? ? ?             2.093 ? 
covale1   covale both ? J  GTP 1  "O3'" ? ? ? 1_555 J  G  2  P  ? ? 1 GTP 1   1 G  2   1_555 ? ? ? ? ? ? ?             1.485 ? 
metalc5   metalc ?    ? J  U   34 "O2'" ? ? ? 1_555 CB K  .  K  ? ? 1 U   124 1 K  210 1_555 ? ? ? ? ? ? ?             2.373 ? 
metalc6   metalc ?    ? J  A   36 OP1   ? ? ? 1_555 WA MG .  MG ? ? 1 A   126 1 MG 204 1_555 ? ? ? ? ? ? ?             2.956 ? 
metalc7   metalc ?    ? J  U   38 OP2   ? ? ? 1_555 ZA MG .  MG ? ? 1 U   128 1 MG 207 1_555 ? ? ? ? ? ? ?             2.784 ? 
metalc8   metalc ?    ? J  G   42 OP1   ? ? ? 1_555 VA MG .  MG ? ? 1 G   132 1 MG 203 1_555 ? ? ? ? ? ? ?             2.446 ? 
metalc9   metalc ?    ? M  GLN 22 OE1   ? ? ? 1_555 EB K  .  K  ? ? b GLN 22  b K  102 1_555 ? ? ? ? ? ? ?             2.877 ? 
metalc10  metalc ?    ? T  CYS 6  SG    ? ? ? 1_555 FB ZN .  ZN ? ? l CYS 6   l ZN 201 1_555 ? ? ? ? ? ? ?             2.418 ? 
metalc11  metalc ?    ? T  HIS 24 NE2   ? ? ? 1_555 FB ZN .  ZN ? ? l HIS 24  l ZN 201 1_555 ? ? ? ? ? ? ?             2.012 ? 
metalc12  metalc ?    ? T  HIS 30 ND1   ? ? ? 1_555 FB ZN .  ZN ? ? l HIS 30  l ZN 201 1_555 ? ? ? ? ? ? ?             2.172 ? 
covale2   covale both ? U  GTP 1  "O3'" ? ? ? 1_555 U  G  2  P  ? ? 2 GTP 1   2 G  2   1_555 ? ? ? ? ? ? ?             1.486 ? 
metalc13  metalc ?    ? U  U   34 "O2'" ? ? ? 1_555 LB MG .  MG ? ? 2 U   124 2 MG 205 1_555 ? ? ? ? ? ? ?             2.687 ? 
metalc14  metalc ?    ? Y  SER 79 OG    ? ? ? 1_555 MB K  .  K  ? ? Q SER 73  Q K  101 1_555 ? ? ? ? ? ? ?             2.845 ? 
metalc15  metalc ?    ? EA CYS 6  SG    ? ? ? 1_555 NB ZN .  ZN ? ? M CYS 6   M ZN 201 1_555 ? ? ? ? ? ? ?             2.188 ? 
metalc16  metalc ?    ? EA CYS 9  SG    ? ? ? 1_555 NB ZN .  ZN ? ? M CYS 9   M ZN 201 1_555 ? ? ? ? ? ? ?             2.161 ? 
metalc17  metalc ?    ? EA HIS 24 NE2   ? ? ? 1_555 NB ZN .  ZN ? ? M HIS 24  M ZN 201 1_555 ? ? ? ? ? ? ?             2.117 ? 
metalc18  metalc ?    ? EA HIS 30 ND1   ? ? ? 1_555 NB ZN .  ZN ? ? M HIS 30  M ZN 201 1_555 ? ? ? ? ? ? ?             2.025 ? 
covale3   covale both ? FA GTP 1  "O3'" ? ? ? 1_555 FA G  2  P  ? ? 3 GTP 1   3 G  2   1_555 ? ? ? ? ? ? ?             1.505 ? 
metalc19  metalc ?    ? PA CYS 6  SG    ? ? ? 1_555 UB ZN .  ZN ? ? m CYS 6   m ZN 201 1_555 ? ? ? ? ? ? ?             2.459 ? 
metalc20  metalc ?    ? PA CYS 9  SG    ? ? ? 1_555 UB ZN .  ZN ? ? m CYS 9   m ZN 201 1_555 ? ? ? ? ? ? ?             2.305 ? 
metalc21  metalc ?    ? PA HIS 24 NE2   ? ? ? 1_555 UB ZN .  ZN ? ? m HIS 24  m ZN 201 1_555 ? ? ? ? ? ? ?             1.835 ? 
metalc22  metalc ?    ? PA HIS 30 ND1   ? ? ? 1_555 UB ZN .  ZN ? ? m HIS 30  m ZN 201 1_555 ? ? ? ? ? ? ?             1.987 ? 
covale4   covale both ? QA GTP 1  "O3'" ? ? ? 1_555 QA G  2  P  ? ? 4 GTP 1   4 G  2   1_555 ? ? ? ? ? ? ?             1.491 ? 
metalc23  metalc ?    ? RA U   4  OP1   ? ? ? 1_555 ZB MG .  MG ? ? y U   4   y MG 102 1_555 ? ? ? ? ? ? ?             2.303 ? 
metalc24  metalc ?    ? OA THR 58 OG1   ? ? ? 1_555 MB K  .  K  ? ? n THR 58  Q K  101 2_355 ? ? ? ? ? ? ?             3.384 ? 
hydrog1   hydrog ?    ? J  GTP 1  N1    ? ? ? 1_555 K  C  10 N3 ? ? 1 GTP 1   X C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog2   hydrog ?    ? J  GTP 1  N2    ? ? ? 1_555 K  C  10 O2 ? ? 1 GTP 1   X C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog3   hydrog ?    ? J  GTP 1  O6    ? ? ? 1_555 K  C  10 N4 ? ? 1 GTP 1   X C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog4   hydrog ?    ? J  G   2  N1    ? ? ? 1_555 K  C  9  N3 ? ? 1 G   2   X C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog5   hydrog ?    ? J  G   2  N2    ? ? ? 1_555 K  C  9  O2 ? ? 1 G   2   X C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog6   hydrog ?    ? J  G   2  O6    ? ? ? 1_555 K  C  9  N4 ? ? 1 G   2   X C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog7   hydrog ?    ? J  A   3  N6    ? ? ? 1_555 K  G  7  O6 ? ? 1 A   3   X G  7   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ?     ? 
hydrog8   hydrog ?    ? J  A   3  N1    ? ? ? 1_555 K  U  8  N3 ? ? 1 A   3   X U  8   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog9   hydrog ?    ? J  A   3  N6    ? ? ? 1_555 K  U  8  O4 ? ? 1 A   3   X U  8   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog10  hydrog ?    ? J  C   4  N3    ? ? ? 1_555 K  G  7  N1 ? ? 1 C   4   X G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog11  hydrog ?    ? J  C   4  N4    ? ? ? 1_555 K  G  7  O6 ? ? 1 C   4   X G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog12  hydrog ?    ? J  C   4  O2    ? ? ? 1_555 K  G  7  N2 ? ? 1 C   4   X G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog13  hydrog ?    ? J  U   5  N3    ? ? ? 1_555 K  A  6  N1 ? ? 1 U   5   X A  6   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog14  hydrog ?    ? J  U   5  O4    ? ? ? 1_555 K  A  6  N6 ? ? 1 U   5   X A  6   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog15  hydrog ?    ? J  U   6  N3    ? ? ? 1_555 K  A  5  N1 ? ? 1 U   6   X A  5   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog16  hydrog ?    ? J  U   6  O4    ? ? ? 1_555 K  A  5  N6 ? ? 1 U   6   X A  5   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog17  hydrog ?    ? J  A   7  N1    ? ? ? 1_555 K  U  4  N3 ? ? 1 A   7   X U  4   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog18  hydrog ?    ? J  A   7  N6    ? ? ? 1_555 K  U  4  O4 ? ? 1 A   7   X U  4   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog19  hydrog ?    ? J  C   8  N3    ? ? ? 1_555 K  G  3  N1 ? ? 1 C   8   X G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog20  hydrog ?    ? J  C   8  N4    ? ? ? 1_555 K  G  3  O6 ? ? 1 C   8   X G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog21  hydrog ?    ? J  C   8  O2    ? ? ? 1_555 K  G  3  N2 ? ? 1 C   8   X G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog22  hydrog ?    ? J  C   9  N3    ? ? ? 1_555 K  G  2  N1 ? ? 1 C   9   X G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog23  hydrog ?    ? J  C   9  N4    ? ? ? 1_555 K  G  2  O6 ? ? 1 C   9   X G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog24  hydrog ?    ? J  C   9  O2    ? ? ? 1_555 K  G  2  N2 ? ? 1 C   9   X G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog25  hydrog ?    ? J  U   10 N3    ? ? ? 1_555 K  A  1  N1 ? ? 1 U   10  X A  1   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog26  hydrog ?    ? J  U   10 O4    ? ? ? 1_555 K  A  1  N6 ? ? 1 U   10  X A  1   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog27  hydrog ?    ? J  G   12 N1    ? ? ? 1_555 J  C  32 N3 ? ? 1 G   12  1 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog28  hydrog ?    ? J  G   12 N2    ? ? ? 1_555 J  C  32 O2 ? ? 1 G   12  1 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog29  hydrog ?    ? J  G   12 O6    ? ? ? 1_555 J  C  32 N4 ? ? 1 G   12  1 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog30  hydrog ?    ? J  C   13 N3    ? ? ? 1_555 J  G  31 N1 ? ? 1 C   13  1 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog31  hydrog ?    ? J  C   13 N4    ? ? ? 1_555 J  G  31 O6 ? ? 1 C   13  1 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog32  hydrog ?    ? J  C   13 O2    ? ? ? 1_555 J  G  31 N2 ? ? 1 C   13  1 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog33  hydrog ?    ? J  A   14 N1    ? ? ? 1_555 J  U  30 N3 ? ? 1 A   14  1 U  30  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog34  hydrog ?    ? J  A   14 N6    ? ? ? 1_555 J  U  30 O4 ? ? 1 A   14  1 U  30  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog35  hydrog ?    ? J  G   15 N1    ? ? ? 1_555 J  C  29 N3 ? ? 1 G   15  1 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog36  hydrog ?    ? J  G   15 N2    ? ? ? 1_555 J  C  29 O2 ? ? 1 G   15  1 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog37  hydrog ?    ? J  G   15 O6    ? ? ? 1_555 J  C  29 N4 ? ? 1 G   15  1 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog38  hydrog ?    ? J  U   16 N3    ? ? ? 1_555 J  A  28 N1 ? ? 1 U   16  1 A  28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog39  hydrog ?    ? J  U   16 O4    ? ? ? 1_555 J  A  28 N6 ? ? 1 U   16  1 A  28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog40  hydrog ?    ? J  G   17 N1    ? ? ? 1_555 J  C  27 N3 ? ? 1 G   17  1 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog41  hydrog ?    ? J  G   17 N2    ? ? ? 1_555 J  C  27 O2 ? ? 1 G   17  1 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog42  hydrog ?    ? J  G   17 O6    ? ? ? 1_555 J  C  27 N4 ? ? 1 G   17  1 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog43  hydrog ?    ? U  GTP 1  N1    ? ? ? 1_555 V  C  10 N3 ? ? 2 GTP 1   x C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog44  hydrog ?    ? U  GTP 1  N2    ? ? ? 1_555 V  C  10 O2 ? ? 2 GTP 1   x C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog45  hydrog ?    ? U  GTP 1  O6    ? ? ? 1_555 V  C  10 N4 ? ? 2 GTP 1   x C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog46  hydrog ?    ? U  G   2  N1    ? ? ? 1_555 V  C  9  N3 ? ? 2 G   2   x C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog47  hydrog ?    ? U  G   2  N2    ? ? ? 1_555 V  C  9  O2 ? ? 2 G   2   x C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog48  hydrog ?    ? U  G   2  O6    ? ? ? 1_555 V  C  9  N4 ? ? 2 G   2   x C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog49  hydrog ?    ? U  A   3  N6    ? ? ? 1_555 V  G  7  O6 ? ? 2 A   3   x G  7   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ?     ? 
hydrog50  hydrog ?    ? U  A   3  N1    ? ? ? 1_555 V  U  8  N3 ? ? 2 A   3   x U  8   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog51  hydrog ?    ? U  A   3  N6    ? ? ? 1_555 V  U  8  O4 ? ? 2 A   3   x U  8   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog52  hydrog ?    ? U  C   4  N3    ? ? ? 1_555 V  G  7  N1 ? ? 2 C   4   x G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog53  hydrog ?    ? U  C   4  N4    ? ? ? 1_555 V  G  7  O6 ? ? 2 C   4   x G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog54  hydrog ?    ? U  C   4  O2    ? ? ? 1_555 V  G  7  N2 ? ? 2 C   4   x G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog55  hydrog ?    ? U  U   5  N3    ? ? ? 1_555 V  A  6  N1 ? ? 2 U   5   x A  6   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog56  hydrog ?    ? U  U   5  O4    ? ? ? 1_555 V  A  6  N6 ? ? 2 U   5   x A  6   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog57  hydrog ?    ? U  U   6  N3    ? ? ? 1_555 V  A  5  N1 ? ? 2 U   6   x A  5   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog58  hydrog ?    ? U  U   6  O4    ? ? ? 1_555 V  A  5  N6 ? ? 2 U   6   x A  5   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog59  hydrog ?    ? U  A   7  N1    ? ? ? 1_555 V  U  4  N3 ? ? 2 A   7   x U  4   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog60  hydrog ?    ? U  A   7  N6    ? ? ? 1_555 V  U  4  O4 ? ? 2 A   7   x U  4   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog61  hydrog ?    ? U  C   8  N3    ? ? ? 1_555 V  G  3  N1 ? ? 2 C   8   x G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog62  hydrog ?    ? U  C   8  N4    ? ? ? 1_555 V  G  3  O6 ? ? 2 C   8   x G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog63  hydrog ?    ? U  C   8  O2    ? ? ? 1_555 V  G  3  N2 ? ? 2 C   8   x G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog64  hydrog ?    ? U  C   9  N3    ? ? ? 1_555 V  G  2  N1 ? ? 2 C   9   x G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog65  hydrog ?    ? U  C   9  N4    ? ? ? 1_555 V  G  2  O6 ? ? 2 C   9   x G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog66  hydrog ?    ? U  C   9  O2    ? ? ? 1_555 V  G  2  N2 ? ? 2 C   9   x G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog67  hydrog ?    ? U  U   10 N3    ? ? ? 1_555 V  A  1  N1 ? ? 2 U   10  x A  1   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog68  hydrog ?    ? U  U   10 O4    ? ? ? 1_555 V  A  1  N6 ? ? 2 U   10  x A  1   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog69  hydrog ?    ? U  G   12 N1    ? ? ? 1_555 U  C  32 N3 ? ? 2 G   12  2 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog70  hydrog ?    ? U  G   12 N2    ? ? ? 1_555 U  C  32 O2 ? ? 2 G   12  2 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog71  hydrog ?    ? U  G   12 O6    ? ? ? 1_555 U  C  32 N4 ? ? 2 G   12  2 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog72  hydrog ?    ? U  C   13 N3    ? ? ? 1_555 U  G  31 N1 ? ? 2 C   13  2 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog73  hydrog ?    ? U  C   13 N4    ? ? ? 1_555 U  G  31 O6 ? ? 2 C   13  2 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog74  hydrog ?    ? U  C   13 O2    ? ? ? 1_555 U  G  31 N2 ? ? 2 C   13  2 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog75  hydrog ?    ? U  A   14 N1    ? ? ? 1_555 U  U  30 N3 ? ? 2 A   14  2 U  30  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog76  hydrog ?    ? U  A   14 N6    ? ? ? 1_555 U  U  30 O4 ? ? 2 A   14  2 U  30  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog77  hydrog ?    ? U  G   15 N1    ? ? ? 1_555 U  C  29 N3 ? ? 2 G   15  2 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog78  hydrog ?    ? U  G   15 N2    ? ? ? 1_555 U  C  29 O2 ? ? 2 G   15  2 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog79  hydrog ?    ? U  G   15 O6    ? ? ? 1_555 U  C  29 N4 ? ? 2 G   15  2 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog80  hydrog ?    ? U  U   16 N3    ? ? ? 1_555 U  A  28 N1 ? ? 2 U   16  2 A  28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog81  hydrog ?    ? U  U   16 O4    ? ? ? 1_555 U  A  28 N6 ? ? 2 U   16  2 A  28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog82  hydrog ?    ? U  G   17 N1    ? ? ? 1_555 U  C  27 N3 ? ? 2 G   17  2 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog83  hydrog ?    ? U  G   17 N2    ? ? ? 1_555 U  C  27 O2 ? ? 2 G   17  2 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog84  hydrog ?    ? U  G   17 O6    ? ? ? 1_555 U  C  27 N4 ? ? 2 G   17  2 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog85  hydrog ?    ? U  A   18 N1    ? ? ? 1_555 U  A  26 N6 ? ? 2 A   18  2 A  26  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ?     ? 
hydrog86  hydrog ?    ? FA GTP 1  N1    ? ? ? 1_555 GA C  10 N3 ? ? 3 GTP 1   Y C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog87  hydrog ?    ? FA GTP 1  N2    ? ? ? 1_555 GA C  10 O2 ? ? 3 GTP 1   Y C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog88  hydrog ?    ? FA GTP 1  O6    ? ? ? 1_555 GA C  10 N4 ? ? 3 GTP 1   Y C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog89  hydrog ?    ? FA G   2  N1    ? ? ? 1_555 GA C  9  N3 ? ? 3 G   2   Y C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog90  hydrog ?    ? FA G   2  N2    ? ? ? 1_555 GA C  9  O2 ? ? 3 G   2   Y C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog91  hydrog ?    ? FA G   2  O6    ? ? ? 1_555 GA C  9  N4 ? ? 3 G   2   Y C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog92  hydrog ?    ? FA A   3  N1    ? ? ? 1_555 GA U  8  N3 ? ? 3 A   3   Y U  8   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog93  hydrog ?    ? FA A   3  N6    ? ? ? 1_555 GA U  8  O4 ? ? 3 A   3   Y U  8   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog94  hydrog ?    ? FA C   4  N3    ? ? ? 1_555 GA G  7  N1 ? ? 3 C   4   Y G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog95  hydrog ?    ? FA C   4  N4    ? ? ? 1_555 GA G  7  O6 ? ? 3 C   4   Y G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog96  hydrog ?    ? FA C   4  O2    ? ? ? 1_555 GA G  7  N2 ? ? 3 C   4   Y G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog97  hydrog ?    ? FA U   5  N3    ? ? ? 1_555 GA A  6  N1 ? ? 3 U   5   Y A  6   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog98  hydrog ?    ? FA U   5  O4    ? ? ? 1_555 GA A  6  N6 ? ? 3 U   5   Y A  6   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog99  hydrog ?    ? FA U   6  N3    ? ? ? 1_555 GA A  5  N1 ? ? 3 U   6   Y A  5   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog100 hydrog ?    ? FA U   6  O4    ? ? ? 1_555 GA A  5  N6 ? ? 3 U   6   Y A  5   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog101 hydrog ?    ? FA A   7  N1    ? ? ? 1_555 GA U  4  N3 ? ? 3 A   7   Y U  4   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog102 hydrog ?    ? FA A   7  N6    ? ? ? 1_555 GA U  4  O4 ? ? 3 A   7   Y U  4   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog103 hydrog ?    ? FA C   8  N3    ? ? ? 1_555 GA G  3  N1 ? ? 3 C   8   Y G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog104 hydrog ?    ? FA C   8  N4    ? ? ? 1_555 GA G  3  O6 ? ? 3 C   8   Y G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog105 hydrog ?    ? FA C   8  O2    ? ? ? 1_555 GA G  3  N2 ? ? 3 C   8   Y G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog106 hydrog ?    ? FA C   9  N3    ? ? ? 1_555 GA G  2  N1 ? ? 3 C   9   Y G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog107 hydrog ?    ? FA C   9  N4    ? ? ? 1_555 GA G  2  O6 ? ? 3 C   9   Y G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog108 hydrog ?    ? FA C   9  O2    ? ? ? 1_555 GA G  2  N2 ? ? 3 C   9   Y G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog109 hydrog ?    ? FA U   10 N3    ? ? ? 1_555 GA A  1  N1 ? ? 3 U   10  Y A  1   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog110 hydrog ?    ? FA U   10 O4    ? ? ? 1_555 GA A  1  N6 ? ? 3 U   10  Y A  1   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog111 hydrog ?    ? FA G   12 N1    ? ? ? 1_555 FA C  32 N3 ? ? 3 G   12  3 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog112 hydrog ?    ? FA G   12 N2    ? ? ? 1_555 FA C  32 O2 ? ? 3 G   12  3 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog113 hydrog ?    ? FA G   12 O6    ? ? ? 1_555 FA C  32 N4 ? ? 3 G   12  3 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog114 hydrog ?    ? FA C   13 N3    ? ? ? 1_555 FA G  31 N1 ? ? 3 C   13  3 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog115 hydrog ?    ? FA C   13 N4    ? ? ? 1_555 FA G  31 O6 ? ? 3 C   13  3 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog116 hydrog ?    ? FA C   13 O2    ? ? ? 1_555 FA G  31 N2 ? ? 3 C   13  3 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog117 hydrog ?    ? FA A   14 N1    ? ? ? 1_555 FA U  30 N3 ? ? 3 A   14  3 U  30  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog118 hydrog ?    ? FA A   14 N6    ? ? ? 1_555 FA U  30 O4 ? ? 3 A   14  3 U  30  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog119 hydrog ?    ? FA G   15 N1    ? ? ? 1_555 FA C  29 N3 ? ? 3 G   15  3 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog120 hydrog ?    ? FA G   15 N2    ? ? ? 1_555 FA C  29 O2 ? ? 3 G   15  3 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog121 hydrog ?    ? FA G   15 O6    ? ? ? 1_555 FA C  29 N4 ? ? 3 G   15  3 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog122 hydrog ?    ? FA U   16 N3    ? ? ? 1_555 FA A  28 N1 ? ? 3 U   16  3 A  28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog123 hydrog ?    ? FA U   16 O4    ? ? ? 1_555 FA A  28 N6 ? ? 3 U   16  3 A  28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog124 hydrog ?    ? FA G   17 N1    ? ? ? 1_555 FA C  27 N3 ? ? 3 G   17  3 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog125 hydrog ?    ? FA G   17 N2    ? ? ? 1_555 FA C  27 O2 ? ? 3 G   17  3 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog126 hydrog ?    ? FA G   17 O6    ? ? ? 1_555 FA C  27 N4 ? ? 3 G   17  3 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog127 hydrog ?    ? FA A   18 N1    ? ? ? 1_555 FA A  26 N6 ? ? 3 A   18  3 A  26  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ?     ? 
hydrog128 hydrog ?    ? QA GTP 1  N1    ? ? ? 1_555 RA C  10 N3 ? ? 4 GTP 1   y C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog129 hydrog ?    ? QA GTP 1  N2    ? ? ? 1_555 RA C  10 O2 ? ? 4 GTP 1   y C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog130 hydrog ?    ? QA GTP 1  O6    ? ? ? 1_555 RA C  10 N4 ? ? 4 GTP 1   y C  10  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog131 hydrog ?    ? QA G   2  N1    ? ? ? 1_555 RA C  9  N3 ? ? 4 G   2   y C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog132 hydrog ?    ? QA G   2  N2    ? ? ? 1_555 RA C  9  O2 ? ? 4 G   2   y C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog133 hydrog ?    ? QA G   2  O6    ? ? ? 1_555 RA C  9  N4 ? ? 4 G   2   y C  9   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog134 hydrog ?    ? QA A   3  N6    ? ? ? 1_555 RA G  7  O6 ? ? 4 A   3   y G  7   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ?     ? 
hydrog135 hydrog ?    ? QA A   3  N1    ? ? ? 1_555 RA U  8  N3 ? ? 4 A   3   y U  8   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog136 hydrog ?    ? QA A   3  N6    ? ? ? 1_555 RA U  8  O4 ? ? 4 A   3   y U  8   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog137 hydrog ?    ? QA C   4  N3    ? ? ? 1_555 RA G  7  N1 ? ? 4 C   4   y G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog138 hydrog ?    ? QA C   4  N4    ? ? ? 1_555 RA G  7  O6 ? ? 4 C   4   y G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog139 hydrog ?    ? QA C   4  O2    ? ? ? 1_555 RA G  7  N2 ? ? 4 C   4   y G  7   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog140 hydrog ?    ? QA U   5  N3    ? ? ? 1_555 RA A  6  N1 ? ? 4 U   5   y A  6   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog141 hydrog ?    ? QA U   5  O4    ? ? ? 1_555 RA A  6  N6 ? ? 4 U   5   y A  6   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog142 hydrog ?    ? QA U   6  N3    ? ? ? 1_555 RA A  5  N1 ? ? 4 U   6   y A  5   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog143 hydrog ?    ? QA U   6  O4    ? ? ? 1_555 RA A  5  N6 ? ? 4 U   6   y A  5   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog144 hydrog ?    ? QA A   7  N1    ? ? ? 1_555 RA U  4  N3 ? ? 4 A   7   y U  4   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog145 hydrog ?    ? QA A   7  N6    ? ? ? 1_555 RA U  4  O4 ? ? 4 A   7   y U  4   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog146 hydrog ?    ? QA C   8  N3    ? ? ? 1_555 RA G  3  N1 ? ? 4 C   8   y G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog147 hydrog ?    ? QA C   8  N4    ? ? ? 1_555 RA G  3  O6 ? ? 4 C   8   y G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog148 hydrog ?    ? QA C   8  O2    ? ? ? 1_555 RA G  3  N2 ? ? 4 C   8   y G  3   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog149 hydrog ?    ? QA C   9  N3    ? ? ? 1_555 RA G  2  N1 ? ? 4 C   9   y G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog150 hydrog ?    ? QA C   9  N4    ? ? ? 1_555 RA G  2  O6 ? ? 4 C   9   y G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog151 hydrog ?    ? QA C   9  O2    ? ? ? 1_555 RA G  2  N2 ? ? 4 C   9   y G  2   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog152 hydrog ?    ? QA U   10 N3    ? ? ? 1_555 RA A  1  N1 ? ? 4 U   10  y A  1   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog153 hydrog ?    ? QA U   10 O4    ? ? ? 1_555 RA A  1  N6 ? ? 4 U   10  y A  1   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog154 hydrog ?    ? QA G   12 N1    ? ? ? 1_555 QA C  32 N3 ? ? 4 G   12  4 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog155 hydrog ?    ? QA G   12 N2    ? ? ? 1_555 QA C  32 O2 ? ? 4 G   12  4 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog156 hydrog ?    ? QA G   12 O6    ? ? ? 1_555 QA C  32 N4 ? ? 4 G   12  4 C  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog157 hydrog ?    ? QA C   13 N3    ? ? ? 1_555 QA G  31 N1 ? ? 4 C   13  4 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog158 hydrog ?    ? QA C   13 N4    ? ? ? 1_555 QA G  31 O6 ? ? 4 C   13  4 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog159 hydrog ?    ? QA C   13 O2    ? ? ? 1_555 QA G  31 N2 ? ? 4 C   13  4 G  31  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog160 hydrog ?    ? QA A   14 N1    ? ? ? 1_555 QA U  30 N3 ? ? 4 A   14  4 U  30  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog161 hydrog ?    ? QA A   14 N6    ? ? ? 1_555 QA U  30 O4 ? ? 4 A   14  4 U  30  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog162 hydrog ?    ? QA G   15 N1    ? ? ? 1_555 QA C  29 N3 ? ? 4 G   15  4 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog163 hydrog ?    ? QA G   15 N2    ? ? ? 1_555 QA C  29 O2 ? ? 4 G   15  4 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog164 hydrog ?    ? QA G   15 O6    ? ? ? 1_555 QA C  29 N4 ? ? 4 G   15  4 C  29  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog165 hydrog ?    ? QA U   16 N3    ? ? ? 1_555 QA A  28 N1 ? ? 4 U   16  4 A  28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog166 hydrog ?    ? QA U   16 O4    ? ? ? 1_555 QA A  28 N6 ? ? 4 U   16  4 A  28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog167 hydrog ?    ? QA G   17 N1    ? ? ? 1_555 QA C  27 N3 ? ? 4 G   17  4 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog168 hydrog ?    ? QA G   17 N2    ? ? ? 1_555 QA C  27 O2 ? ? 4 G   17  4 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog169 hydrog ?    ? QA G   17 O6    ? ? ? 1_555 QA C  27 N4 ? ? 4 G   17  4 C  27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog170 hydrog ?    ? QA A   18 N1    ? ? ? 1_555 QA A  26 N6 ? ? 4 A   18  4 A  26  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 37 ? 
AA2 ? 2  ? 
AA3 ? 2  ? 
AA4 ? 38 ? 
AA5 ? 2  ? 
AA6 ? 2  ? 
AA7 ? 33 ? 
AA8 ? 8  ? 
AA9 ? 2  ? 
AB1 ? 2  ? 
AB2 ? 37 ? 
AB3 ? 2  ? 
AB4 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? anti-parallel 
AA1 4  5  ? anti-parallel 
AA1 5  6  ? anti-parallel 
AA1 6  7  ? anti-parallel 
AA1 7  8  ? anti-parallel 
AA1 8  9  ? anti-parallel 
AA1 9  10 ? anti-parallel 
AA1 10 11 ? anti-parallel 
AA1 11 12 ? anti-parallel 
AA1 12 13 ? anti-parallel 
AA1 13 14 ? anti-parallel 
AA1 14 15 ? anti-parallel 
AA1 15 16 ? anti-parallel 
AA1 16 17 ? anti-parallel 
AA1 17 18 ? anti-parallel 
AA1 18 19 ? anti-parallel 
AA1 19 20 ? anti-parallel 
AA1 20 21 ? anti-parallel 
AA1 21 22 ? anti-parallel 
AA1 22 23 ? anti-parallel 
AA1 23 24 ? anti-parallel 
AA1 24 25 ? anti-parallel 
AA1 25 26 ? anti-parallel 
AA1 26 27 ? anti-parallel 
AA1 27 28 ? anti-parallel 
AA1 28 29 ? anti-parallel 
AA1 29 30 ? anti-parallel 
AA1 30 31 ? anti-parallel 
AA1 31 32 ? anti-parallel 
AA1 32 33 ? anti-parallel 
AA1 33 34 ? anti-parallel 
AA1 34 35 ? anti-parallel 
AA1 35 36 ? anti-parallel 
AA1 36 37 ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA4 3  4  ? anti-parallel 
AA4 4  5  ? anti-parallel 
AA4 5  6  ? anti-parallel 
AA4 6  7  ? anti-parallel 
AA4 7  8  ? anti-parallel 
AA4 8  9  ? anti-parallel 
AA4 9  10 ? anti-parallel 
AA4 10 11 ? anti-parallel 
AA4 11 12 ? anti-parallel 
AA4 12 13 ? anti-parallel 
AA4 13 14 ? anti-parallel 
AA4 14 15 ? anti-parallel 
AA4 15 16 ? anti-parallel 
AA4 16 17 ? anti-parallel 
AA4 17 18 ? anti-parallel 
AA4 18 19 ? anti-parallel 
AA4 19 20 ? anti-parallel 
AA4 20 21 ? anti-parallel 
AA4 21 22 ? anti-parallel 
AA4 22 23 ? anti-parallel 
AA4 23 24 ? anti-parallel 
AA4 24 25 ? anti-parallel 
AA4 25 26 ? anti-parallel 
AA4 26 27 ? anti-parallel 
AA4 27 28 ? anti-parallel 
AA4 28 29 ? anti-parallel 
AA4 29 30 ? anti-parallel 
AA4 30 31 ? anti-parallel 
AA4 31 32 ? anti-parallel 
AA4 32 33 ? anti-parallel 
AA4 33 34 ? anti-parallel 
AA4 34 35 ? anti-parallel 
AA4 35 36 ? anti-parallel 
AA4 36 37 ? anti-parallel 
AA4 37 38 ? anti-parallel 
AA5 1  2  ? anti-parallel 
AA6 1  2  ? anti-parallel 
AA7 1  2  ? anti-parallel 
AA7 2  3  ? anti-parallel 
AA7 3  4  ? anti-parallel 
AA7 4  5  ? anti-parallel 
AA7 5  6  ? anti-parallel 
AA7 6  7  ? anti-parallel 
AA7 7  8  ? anti-parallel 
AA7 8  9  ? anti-parallel 
AA7 9  10 ? anti-parallel 
AA7 10 11 ? anti-parallel 
AA7 11 12 ? anti-parallel 
AA7 12 13 ? anti-parallel 
AA7 13 14 ? anti-parallel 
AA7 14 15 ? anti-parallel 
AA7 15 16 ? anti-parallel 
AA7 16 17 ? anti-parallel 
AA7 17 18 ? anti-parallel 
AA7 18 19 ? anti-parallel 
AA7 19 20 ? anti-parallel 
AA7 20 21 ? anti-parallel 
AA7 21 22 ? anti-parallel 
AA7 22 23 ? anti-parallel 
AA7 23 24 ? anti-parallel 
AA7 24 25 ? anti-parallel 
AA7 25 26 ? anti-parallel 
AA7 26 27 ? anti-parallel 
AA7 27 28 ? anti-parallel 
AA7 28 29 ? anti-parallel 
AA7 29 30 ? anti-parallel 
AA7 30 31 ? anti-parallel 
AA7 31 32 ? anti-parallel 
AA7 32 33 ? anti-parallel 
AA8 1  2  ? anti-parallel 
AA8 2  3  ? anti-parallel 
AA8 3  4  ? anti-parallel 
AA8 4  5  ? anti-parallel 
AA8 5  6  ? anti-parallel 
AA8 6  7  ? anti-parallel 
AA8 7  8  ? anti-parallel 
AA9 1  2  ? anti-parallel 
AB1 1  2  ? anti-parallel 
AB2 1  2  ? anti-parallel 
AB2 2  3  ? anti-parallel 
AB2 3  4  ? anti-parallel 
AB2 4  5  ? anti-parallel 
AB2 5  6  ? anti-parallel 
AB2 6  7  ? anti-parallel 
AB2 7  8  ? anti-parallel 
AB2 8  9  ? anti-parallel 
AB2 9  10 ? anti-parallel 
AB2 10 11 ? anti-parallel 
AB2 11 12 ? anti-parallel 
AB2 12 13 ? anti-parallel 
AB2 13 14 ? anti-parallel 
AB2 14 15 ? anti-parallel 
AB2 15 16 ? anti-parallel 
AB2 16 17 ? anti-parallel 
AB2 17 18 ? anti-parallel 
AB2 18 19 ? anti-parallel 
AB2 19 20 ? anti-parallel 
AB2 20 21 ? anti-parallel 
AB2 21 22 ? anti-parallel 
AB2 22 23 ? anti-parallel 
AB2 23 24 ? anti-parallel 
AB2 24 25 ? anti-parallel 
AB2 25 26 ? anti-parallel 
AB2 26 27 ? anti-parallel 
AB2 27 28 ? anti-parallel 
AB2 28 29 ? anti-parallel 
AB2 29 30 ? anti-parallel 
AB2 30 31 ? anti-parallel 
AB2 31 32 ? anti-parallel 
AB2 32 33 ? anti-parallel 
AB2 33 34 ? anti-parallel 
AB2 34 35 ? anti-parallel 
AB2 35 36 ? anti-parallel 
AB2 36 37 ? anti-parallel 
AB3 1  2  ? anti-parallel 
AB4 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  ASN G  56  ? ILE G  57  ? ASN G 56  ILE G 57  
AA1 2  LEU G  40  ? VAL G  46  ? LEU G 40  VAL G 46  
AA1 3  VAL G  60  ? ILE G  62  ? VAL G 60  ILE G 62  
AA1 4  ILE E  84  ? SER E  89  ? ILE E 84  SER E 89  
AA1 5  ARG E  30  ? LEU E  35  ? ARG E 30  LEU E 35  
AA1 6  MET E  41  ? PHE E  50  ? MET E 41  PHE E 50  
AA1 7  LEU E  56  ? HIS E  65  ? LEU E 56  HIS E 65  
AA1 8  ARG E  71  ? LEU E  79  ? ARG E 71  LEU E 79  
AA1 9  VAL F  69  ? GLY F  74  ? VAL F 69  GLY F 74  
AA1 10 PRO F  18  ? LEU F  23  ? PRO F 18  LEU F 23  
AA1 11 GLU F  28  ? VAL F  36  ? GLU F 28  VAL F 36  
AA1 12 MET F  42  ? ILE F  51  ? MET F 42  ILE F 51  
AA1 13 ALA F  54  ? ILE F  64  ? ALA F 54  ILE F 64  
AA1 14 VAL D  106 ? ARG D  111 ? VAL D 106 ARG D 111 
AA1 15 GLN D  41  ? CYS D  46  ? GLN D 41  CYS D 46  
AA1 16 LYS D  51  ? PHE D  59  ? LYS D 51  PHE D 59  
AA1 17 MET D  65  ? GLU D  76  ? MET D 65  GLU D 76  
AA1 18 VAL D  90  ? LEU D  101 ? VAL D 90  LEU D 101 
AA1 19 ILE C  71  ? ILE C  75  ? ILE C 65  ILE C 69  
AA1 20 THR C  20  ? LEU C  25  ? THR C 14  LEU C 19  
AA1 21 GLN C  30  ? VAL C  38  ? GLN C 24  VAL C 32  
AA1 22 THR C  44  ? THR C  52  ? THR C 38  THR C 46  
AA1 23 VAL C  59  ? ILE C  66  ? VAL C 53  ILE C 60  
AA1 24 LEU B  77  ? GLY B  84  ? LEU B 77  GLY B 84  
AA1 25 ARG B  16  ? LEU B  21  ? ARG B 16  LEU B 21  
AA1 26 ILE B  26  ? PHE B  34  ? ILE B 26  PHE B 34  
AA1 27 LEU B  40  ? PHE B  48  ? LEU B 40  PHE B 48  
AA1 28 ARG B  65  ? LEU B  72  ? ARG B 65  LEU B 72  
AA1 29 ILE A  68  ? LEU A  73  ? ILE A 68  LEU A 73  
AA1 30 ILE A  17  ? THR A  22  ? ILE A 17  THR A 22  
AA1 31 VAL A  27  ? ALA A  35  ? VAL A 27  ALA A 35  
AA1 32 CYS A  41  ? THR A  49  ? CYS A 41  THR A 49  
AA1 33 VAL A  55  ? ILE A  63  ? VAL A 55  ILE A 63  
AA1 34 ILE G  67  ? ALA G  72  ? ILE G 67  ALA G 72  
AA1 35 LYS G  16  ? LEU G  21  ? LYS G 16  LEU G 21  
AA1 36 HIS G  26  ? PHE G  34  ? HIS G 26  PHE G 34  
AA1 37 LEU G  40  ? VAL G  46  ? LEU G 40  VAL G 46  
AA2 1  LYS B  50  ? ILE B  51  ? LYS B 50  ILE B 51  
AA2 2  ARG B  61  ? GLU B  62  ? ARG B 61  GLU B 62  
AA3 1  PHE I  4   ? CYS I  6   ? PHE L 4   CYS L 6   
AA3 2  THR I  11  ? LEU I  13  ? THR L 11  LEU L 13  
AA4 1  VAL N  59  ? LEU N  61  ? VAL c 53  LEU c 55  
AA4 2  VAL N  49  ? THR N  52  ? VAL c 43  THR c 46  
AA4 3  GLN N  30  ? VAL N  38  ? GLN c 24  VAL c 32  
AA4 4  THR N  44  ? LEU N  46  ? THR c 38  LEU c 40  
AA4 5  LEU N  64  ? ILE N  66  ? LEU c 58  ILE c 60  
AA4 6  LEU M  77  ? GLY M  84  ? LEU b 77  GLY b 84  
AA4 7  ARG M  16  ? LEU M  21  ? ARG b 16  LEU b 21  
AA4 8  ILE M  26  ? PHE M  34  ? ILE b 26  PHE b 34  
AA4 9  LEU M  40  ? PHE M  48  ? LEU b 40  PHE b 48  
AA4 10 ARG M  65  ? LEU M  72  ? ARG b 65  LEU b 72  
AA4 11 ILE L  68  ? LEU L  73  ? ILE a 68  LEU a 73  
AA4 12 ILE L  17  ? THR L  22  ? ILE a 17  THR a 22  
AA4 13 VAL L  27  ? ALA L  35  ? VAL a 27  ALA a 35  
AA4 14 CYS L  41  ? THR L  49  ? CYS a 41  THR a 49  
AA4 15 VAL L  55  ? ILE L  63  ? VAL a 55  ILE a 63  
AA4 16 ILE R  67  ? ALA R  72  ? ILE g 67  ALA g 72  
AA4 17 LYS R  16  ? LEU R  21  ? LYS g 16  LEU g 21  
AA4 18 HIS R  26  ? PHE R  34  ? HIS g 26  PHE g 34  
AA4 19 LEU R  40  ? VAL R  46  ? LEU g 40  VAL g 46  
AA4 20 ASN R  56  ? ILE R  62  ? ASN g 56  ILE g 62  
AA4 21 ILE P  84  ? SER P  89  ? ILE e 84  SER e 89  
AA4 22 ARG P  30  ? LEU P  35  ? ARG e 30  LEU e 35  
AA4 23 MET P  41  ? PHE P  50  ? MET e 41  PHE e 50  
AA4 24 LEU P  56  ? HIS P  65  ? LEU e 56  HIS e 65  
AA4 25 ARG P  71  ? LEU P  79  ? ARG e 71  LEU e 79  
AA4 26 VAL Q  69  ? GLY Q  74  ? VAL f 69  GLY f 74  
AA4 27 PRO Q  18  ? LEU Q  23  ? PRO f 18  LEU f 23  
AA4 28 GLU Q  28  ? VAL Q  36  ? GLU f 28  VAL f 36  
AA4 29 MET Q  42  ? ILE Q  51  ? MET f 42  ILE f 51  
AA4 30 ALA Q  54  ? ILE Q  64  ? ALA f 54  ILE f 64  
AA4 31 VAL O  106 ? ARG O  111 ? VAL d 106 ARG d 111 
AA4 32 GLN O  41  ? CYS O  46  ? GLN d 41  CYS d 46  
AA4 33 LYS O  51  ? PHE O  59  ? LYS d 51  PHE d 59  
AA4 34 MET O  65  ? GLU O  76  ? MET d 65  GLU d 76  
AA4 35 VAL O  90  ? LEU O  101 ? VAL d 90  LEU d 101 
AA4 36 ILE N  71  ? ILE N  75  ? ILE c 65  ILE c 69  
AA4 37 THR N  20  ? LEU N  25  ? THR c 14  LEU c 19  
AA4 38 GLN N  30  ? VAL N  38  ? GLN c 24  VAL c 32  
AA5 1  LYS M  50  ? ILE M  51  ? LYS b 50  ILE b 51  
AA5 2  ARG M  61  ? GLU M  62  ? ARG b 61  GLU b 62  
AA6 1  PHE T  4   ? CYS T  6   ? PHE l 4   CYS l 6   
AA6 2  THR T  11  ? LEU T  13  ? THR l 11  LEU l 13  
AA7 1  ARG AA 71  ? GLN AA 73  ? ARG S 71  GLN S 73  
AA7 2  LEU AA 56  ? HIS AA 65  ? LEU S 56  HIS S 65  
AA7 3  MET AA 41  ? PHE AA 50  ? MET S 41  PHE S 50  
AA7 4  ARG AA 30  ? LEU AA 35  ? ARG S 30  LEU S 35  
AA7 5  ILE AA 84  ? SER AA 89  ? ILE S 84  SER S 89  
AA7 6  ASN CA 56  ? ILE CA 62  ? ASN U 56  ILE U 62  
AA7 7  LEU CA 40  ? VAL CA 46  ? LEU U 40  VAL U 46  
AA7 8  HIS CA 26  ? PHE CA 34  ? HIS U 26  PHE U 34  
AA7 9  LYS CA 16  ? LEU CA 21  ? LYS U 16  LEU U 21  
AA7 10 ILE CA 67  ? ALA CA 72  ? ILE U 67  ALA U 72  
AA7 11 VAL W  55  ? ILE W  63  ? VAL O 55  ILE O 63  
AA7 12 CYS W  41  ? THR W  49  ? CYS O 41  THR O 49  
AA7 13 VAL W  27  ? ALA W  35  ? VAL O 27  ALA O 35  
AA7 14 ILE W  17  ? THR W  22  ? ILE O 17  THR O 22  
AA7 15 ILE W  68  ? LEU W  73  ? ILE O 68  LEU O 73  
AA7 16 ARG X  65  ? LEU X  72  ? ARG P 65  LEU P 72  
AA7 17 LEU X  40  ? PHE X  48  ? LEU P 40  PHE P 48  
AA7 18 ILE X  26  ? PHE X  34  ? ILE P 26  PHE P 34  
AA7 19 ARG X  16  ? LEU X  21  ? ARG P 16  LEU P 21  
AA7 20 LEU X  77  ? GLY X  84  ? LEU P 77  GLY P 84  
AA7 21 VAL Y  59  ? ILE Y  66  ? VAL Q 53  ILE Q 60  
AA7 22 THR Y  44  ? THR Y  52  ? THR Q 38  THR Q 46  
AA7 23 GLN Y  30  ? VAL Y  38  ? GLN Q 24  VAL Q 32  
AA7 24 THR Y  20  ? LEU Y  25  ? THR Q 14  LEU Q 19  
AA7 25 ILE Y  71  ? ILE Y  75  ? ILE Q 65  ILE Q 69  
AA7 26 VAL Z  90  ? LEU Z  101 ? VAL R 90  LEU R 101 
AA7 27 MET Z  65  ? GLU Z  76  ? MET R 65  GLU R 76  
AA7 28 LYS Z  51  ? PHE Z  59  ? LYS R 51  PHE R 59  
AA7 29 GLN Z  41  ? CYS Z  46  ? GLN R 41  CYS R 46  
AA7 30 VAL Z  106 ? ARG Z  111 ? VAL R 106 ARG R 111 
AA7 31 VAL BA 62  ? ILE BA 64  ? VAL T 62  ILE T 64  
AA7 32 MET BA 42  ? ILE BA 51  ? MET T 42  ILE T 51  
AA7 33 ALA BA 54  ? HIS BA 58  ? ALA T 54  HIS T 58  
AA8 1  ARG AA 71  ? GLN AA 73  ? ARG S 71  GLN S 73  
AA8 2  LEU AA 56  ? HIS AA 65  ? LEU S 56  HIS S 65  
AA8 3  ILE AA 77  ? LEU AA 79  ? ILE S 77  LEU S 79  
AA8 4  VAL BA 69  ? GLY BA 74  ? VAL T 69  GLY T 74  
AA8 5  PRO BA 18  ? LEU BA 23  ? PRO T 18  LEU T 23  
AA8 6  GLU BA 28  ? VAL BA 36  ? GLU T 28  VAL T 36  
AA8 7  MET BA 42  ? ILE BA 51  ? MET T 42  ILE T 51  
AA8 8  ALA BA 54  ? HIS BA 58  ? ALA T 54  HIS T 58  
AA9 1  LYS X  50  ? ILE X  51  ? LYS P 50  ILE P 51  
AA9 2  ARG X  61  ? GLU X  62  ? ARG P 61  GLU P 62  
AB1 1  PHE EA 4   ? CYS EA 6   ? PHE M 4   CYS M 6   
AB1 2  THR EA 11  ? LEU EA 13  ? THR M 11  LEU M 13  
AB2 1  ALA MA 54  ? HIS MA 58  ? ALA t 54  HIS t 58  
AB2 2  MET MA 42  ? ILE MA 51  ? MET t 42  ILE t 51  
AB2 3  VAL MA 62  ? ILE MA 64  ? VAL t 62  ILE t 64  
AB2 4  VAL KA 106 ? ARG KA 111 ? VAL r 106 ARG r 111 
AB2 5  GLN KA 41  ? CYS KA 46  ? GLN r 41  CYS r 46  
AB2 6  LYS KA 51  ? PHE KA 59  ? LYS r 51  PHE r 59  
AB2 7  MET KA 65  ? GLU KA 76  ? MET r 65  GLU r 76  
AB2 8  VAL KA 90  ? LEU KA 101 ? VAL r 90  LEU r 101 
AB2 9  ILE JA 71  ? ILE JA 75  ? ILE q 65  ILE q 69  
AB2 10 THR JA 20  ? LEU JA 25  ? THR q 14  LEU q 19  
AB2 11 GLN JA 30  ? VAL JA 38  ? GLN q 24  VAL q 32  
AB2 12 THR JA 44  ? THR JA 52  ? THR q 38  THR q 46  
AB2 13 VAL JA 59  ? ILE JA 66  ? VAL q 53  ILE q 60  
AB2 14 LEU IA 77  ? GLY IA 84  ? LEU p 77  GLY p 84  
AB2 15 ARG IA 16  ? LEU IA 21  ? ARG p 16  LEU p 21  
AB2 16 ILE IA 26  ? PHE IA 34  ? ILE p 26  PHE p 34  
AB2 17 LEU IA 40  ? PHE IA 48  ? LEU p 40  PHE p 48  
AB2 18 ARG IA 65  ? LEU IA 72  ? ARG p 65  LEU p 72  
AB2 19 ILE HA 68  ? LEU HA 73  ? ILE o 68  LEU o 73  
AB2 20 ILE HA 17  ? THR HA 22  ? ILE o 17  THR o 22  
AB2 21 VAL HA 27  ? ALA HA 35  ? VAL o 27  ALA o 35  
AB2 22 CYS HA 41  ? THR HA 49  ? CYS o 41  THR o 49  
AB2 23 VAL HA 55  ? ILE HA 63  ? VAL o 55  ILE o 63  
AB2 24 ILE NA 67  ? ALA NA 72  ? ILE u 67  ALA u 72  
AB2 25 LYS NA 16  ? LEU NA 21  ? LYS u 16  LEU u 21  
AB2 26 HIS NA 26  ? PHE NA 34  ? HIS u 26  PHE u 34  
AB2 27 LEU NA 40  ? VAL NA 46  ? LEU u 40  VAL u 46  
AB2 28 ASN NA 56  ? ILE NA 62  ? ASN u 56  ILE u 62  
AB2 29 ILE LA 84  ? SER LA 89  ? ILE s 84  SER s 89  
AB2 30 ARG LA 30  ? LEU LA 35  ? ARG s 30  LEU s 35  
AB2 31 MET LA 41  ? PHE LA 50  ? MET s 41  PHE s 50  
AB2 32 LEU LA 56  ? HIS LA 65  ? LEU s 56  HIS s 65  
AB2 33 ARG LA 71  ? LEU LA 79  ? ARG s 71  LEU s 79  
AB2 34 VAL MA 69  ? GLY MA 74  ? VAL t 69  GLY t 74  
AB2 35 PRO MA 18  ? LEU MA 23  ? PRO t 18  LEU t 23  
AB2 36 GLU MA 28  ? VAL MA 36  ? GLU t 28  VAL t 36  
AB2 37 MET MA 42  ? ILE MA 51  ? MET t 42  ILE t 51  
AB3 1  LYS IA 50  ? ILE IA 51  ? LYS p 50  ILE p 51  
AB3 2  ARG IA 61  ? GLU IA 62  ? ARG p 61  GLU p 62  
AB4 1  PHE PA 4   ? CYS PA 6   ? PHE m 4   CYS m 6   
AB4 2  THR PA 11  ? LEU PA 13  ? THR m 11  LEU m 13  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  O ILE G  57  ? O ILE G 57  N CYS G  45  ? N CYS G 45  
AA1 2  3  N LEU G  40  ? N LEU G 40  O ILE G  62  ? O ILE G 62  
AA1 3  4  O VAL G  61  ? O VAL G 61  N LEU E  87  ? N LEU E 87  
AA1 4  5  O LEU E  86  ? O LEU E 86  N TRP E  34  ? N TRP E 34  
AA1 5  6  N VAL E  33  ? N VAL E 33  O ILE E  43  ? O ILE E 43  
AA1 6  7  N CYS E  46  ? N CYS E 46  O ASP E  59  ? O ASP E 59  
AA1 7  8  N GLU E  63  ? N GLU E 63  O LYS E  72  ? O LYS E 72  
AA1 8  9  N MET E  78  ? N MET E 78  O ILE F  72  ? O ILE F 72  
AA1 9  10 O LEU F  70  ? O LEU F 70  N LYS F  22  ? N LYS F 22  
AA1 10 11 N VAL F  19  ? N VAL F 19  O GLY F  31  ? O GLY F 31  
AA1 11 12 N GLU F  28  ? N GLU F 28  O TYR F  50  ? O TYR F 50  
AA1 12 13 N GLU F  49  ? N GLU F 49  O SER F  56  ? O SER F 56  
AA1 13 14 O LEU F  63  ? O LEU F 63  N VAL D  109 ? N VAL D 109 
AA1 14 15 O ILE D  107 ? O ILE D 107 N ASN D  45  ? N ASN D 45  
AA1 15 16 N VAL D  42  ? N VAL D 42  O GLY D  54  ? O GLY D 54  
AA1 16 17 N LYS D  51  ? N LYS D 51  O MET D  73  ? O MET D 73  
AA1 17 18 N GLU D  76  ? N GLU D 76  O VAL D  90  ? O VAL D 90  
AA1 18 19 O PHE D  100 ? O PHE D 100 N PHE C  74  ? N PHE C 68  
AA1 19 20 O ILE C  75  ? O ILE C 69  N THR C  22  ? N THR C 16  
AA1 20 21 N ILE C  23  ? N ILE C 17  O VAL C  31  ? O VAL C 25  
AA1 21 22 N GLY C  37  ? N GLY C 31  O HIS C  45  ? O HIS C 39  
AA1 22 23 N VAL C  49  ? N VAL C 43  O LEU C  61  ? O LEU C 55  
AA1 23 24 O SER C  65  ? O SER C 59  N MET B  80  ? N MET B 80  
AA1 24 25 O GLU B  83  ? O GLU B 83  N ARG B  16  ? N ARG B 16  
AA1 25 26 N CYS B  19  ? N CYS B 19  O PHE B  27  ? O PHE B 27  
AA1 26 27 N ILE B  28  ? N ILE B 28  O ASP B  46  ? O ASP B 46  
AA1 27 28 N CYS B  45  ? N CYS B 45  O GLY B  68  ? O GLY B 68  
AA1 28 29 O LEU B  71  ? O LEU B 71  N LEU A  71  ? N LEU A 71  
AA1 29 30 O ILE A  72  ? O ILE A 72  N THR A  19  ? N THR A 19  
AA1 30 31 N VAL A  18  ? N VAL A 18  O GLY A  30  ? O GLY A 30  
AA1 31 32 N ARG A  29  ? N ARG A 29  O THR A  47  ? O THR A 47  
AA1 32 33 N CYS A  41  ? N CYS A 41  O ILE A  63  ? O ILE A 63  
AA1 33 34 N TYR A  62  ? N TYR A 62  O LEU G  70  ? O LEU G 70  
AA1 34 35 O MET G  69  ? O MET G 69  N LYS G  20  ? N LYS G 20  
AA1 35 36 N LEU G  19  ? N LEU G 19  O VAL G  27  ? O VAL G 27  
AA1 36 37 N GLN G  28  ? N GLN G 28  O VAL G  46  ? O VAL G 46  
AA2 1  2  N ILE B  51  ? N ILE B 51  O ARG B  61  ? O ARG B 61  
AA3 1  2  N PHE I  4   ? N PHE L 4   O LEU I  13  ? O LEU L 13  
AA4 1  2  O LEU N  61  ? O LEU c 55  N VAL N  49  ? N VAL c 43  
AA4 2  3  O THR N  52  ? O THR c 46  N GLN N  30  ? N GLN c 24  
AA4 3  4  N GLY N  37  ? N GLY c 31  O HIS N  45  ? O HIS c 39  
AA4 4  5  N THR N  44  ? N THR c 38  O ILE N  66  ? O ILE c 60  
AA4 5  6  O SER N  65  ? O SER c 59  N MET M  80  ? N MET b 80  
AA4 6  7  O GLU M  83  ? O GLU b 83  N ARG M  16  ? N ARG b 16  
AA4 7  8  N CYS M  19  ? N CYS b 19  O PHE M  27  ? O PHE b 27  
AA4 8  9  N ILE M  28  ? N ILE b 28  O ASP M  46  ? O ASP b 46  
AA4 9  10 N CYS M  45  ? N CYS b 45  O GLY M  68  ? O GLY b 68  
AA4 10 11 O LEU M  71  ? O LEU b 71  N LEU L  71  ? N LEU a 71  
AA4 11 12 O ILE L  72  ? O ILE a 72  N THR L  19  ? N THR a 19  
AA4 12 13 N CYS L  20  ? N CYS a 20  O TYR L  28  ? O TYR a 28  
AA4 13 14 N GLU L  34  ? N GLU a 34  O GLN L  42  ? O GLN a 42  
AA4 14 15 N CYS L  41  ? N CYS a 41  O ILE L  63  ? O ILE a 63  
AA4 15 16 N TYR L  62  ? N TYR a 62  O LEU R  70  ? O LEU g 70  
AA4 16 17 O MET R  69  ? O MET g 69  N LYS R  20  ? N LYS g 20  
AA4 17 18 N LEU R  19  ? N LEU g 19  O VAL R  27  ? O VAL g 27  
AA4 18 19 N GLN R  28  ? N GLN g 28  O VAL R  46  ? O VAL g 46  
AA4 19 20 N LEU R  40  ? N LEU g 40  O ILE R  62  ? O ILE g 62  
AA4 20 21 O VAL R  61  ? O VAL g 61  N LEU P  87  ? N LEU e 87  
AA4 21 22 O LEU P  86  ? O LEU e 86  N TRP P  34  ? N TRP e 34  
AA4 22 23 N VAL P  33  ? N VAL e 33  O ILE P  43  ? O ILE e 43  
AA4 23 24 N CYS P  46  ? N CYS e 46  O ASP P  59  ? O ASP e 59  
AA4 24 25 N LEU P  58  ? N LEU e 58  O ILE P  77  ? O ILE e 77  
AA4 25 26 N MET P  78  ? N MET e 78  O ILE Q  72  ? O ILE f 72  
AA4 26 27 O TYR Q  71  ? O TYR f 71  N LYS Q  22  ? N LYS f 22  
AA4 27 28 N VAL Q  19  ? N VAL f 19  O GLY Q  31  ? O GLY f 31  
AA4 28 29 N GLU Q  28  ? N GLU f 28  O TYR Q  50  ? O TYR f 50  
AA4 29 30 N GLU Q  49  ? N GLU f 49  O SER Q  56  ? O SER f 56  
AA4 30 31 O LEU Q  63  ? O LEU f 63  N VAL O  109 ? N VAL d 109 
AA4 31 32 O VAL O  108 ? O VAL d 108 N ASN O  45  ? N ASN d 45  
AA4 32 33 N ILE O  44  ? N ILE d 44  O LEU O  52  ? O LEU d 52  
AA4 33 34 N LYS O  51  ? N LYS d 51  O MET O  73  ? O MET d 73  
AA4 34 35 N GLU O  72  ? N GLU d 72  O ARG O  94  ? O ARG d 94  
AA4 35 36 O PHE O  100 ? O PHE d 100 N PHE N  74  ? N PHE c 68  
AA4 36 37 O ILE N  75  ? O ILE c 69  N THR N  22  ? N THR c 16  
AA4 37 38 N ILE N  23  ? N ILE c 17  O VAL N  31  ? O VAL c 25  
AA5 1  2  N ILE M  51  ? N ILE b 51  O ARG M  61  ? O ARG b 61  
AA6 1  2  N PHE T  4   ? N PHE l 4   O LEU T  13  ? O LEU l 13  
AA7 1  2  O LYS AA 72  ? O LYS S 72  N GLU AA 63  ? N GLU S 63  
AA7 2  3  O VAL AA 57  ? O VAL S 57  N GLY AA 49  ? N GLY S 49  
AA7 3  4  O ILE AA 43  ? O ILE S 43  N VAL AA 33  ? N VAL S 33  
AA7 4  5  N TRP AA 34  ? N TRP S 34  O THR AA 85  ? O THR S 85  
AA7 5  6  N LEU AA 87  ? N LEU S 87  O VAL CA 61  ? O VAL U 61  
AA7 6  7  O ILE CA 62  ? O ILE U 62  N LEU CA 40  ? N LEU U 40  
AA7 7  8  O VAL CA 46  ? O VAL U 46  N GLN CA 28  ? N GLN U 28  
AA7 8  9  O VAL CA 27  ? O VAL U 27  N LEU CA 19  ? N LEU U 19  
AA7 9  10 N SER CA 18  ? N SER U 18  O GLU CA 71  ? O GLU U 71  
AA7 10 11 O LEU CA 70  ? O LEU U 70  N TYR W  62  ? N TYR O 62  
AA7 11 12 O ILE W  63  ? O ILE O 63  N CYS W  41  ? N CYS O 41  
AA7 12 13 O GLN W  42  ? O GLN O 42  N GLU W  34  ? N GLU O 34  
AA7 13 14 O GLY W  30  ? O GLY O 30  N VAL W  18  ? N VAL O 18  
AA7 14 15 N THR W  19  ? N THR O 19  O ILE W  72  ? O ILE O 72  
AA7 15 16 N LEU W  73  ? N LEU O 73  O LEU X  69  ? O LEU P 69  
AA7 16 17 O GLY X  68  ? O GLY P 68  N CYS X  45  ? N CYS P 45  
AA7 17 18 O ASP X  46  ? O ASP P 46  N ILE X  28  ? N ILE P 28  
AA7 18 19 O PHE X  27  ? O PHE P 27  N CYS X  19  ? N CYS P 19  
AA7 19 20 N ARG X  16  ? N ARG P 16  O GLU X  83  ? O GLU P 83  
AA7 20 21 N MET X  80  ? N MET P 80  O SER Y  65  ? O SER Q 59  
AA7 21 22 O LEU Y  61  ? O LEU Q 55  N VAL Y  49  ? N VAL Q 43  
AA7 22 23 O HIS Y  45  ? O HIS Q 39  N GLY Y  37  ? N GLY Q 31  
AA7 23 24 O VAL Y  31  ? O VAL Q 25  N ILE Y  23  ? N ILE Q 17  
AA7 24 25 N THR Y  22  ? N THR Q 16  O ILE Y  75  ? O ILE Q 69  
AA7 25 26 N PHE Y  74  ? N PHE Q 68  O PHE Z  100 ? O PHE R 100 
AA7 26 27 O ARG Z  94  ? O ARG R 94  N GLU Z  72  ? N GLU R 72  
AA7 27 28 O MET Z  73  ? O MET R 73  N LYS Z  51  ? N LYS R 51  
AA7 28 29 O LEU Z  52  ? O LEU R 52  N ILE Z  44  ? N ILE R 44  
AA7 29 30 N ASN Z  45  ? N ASN R 45  O ILE Z  107 ? O ILE R 107 
AA7 30 31 N VAL Z  109 ? N VAL R 109 O LEU BA 63  ? O LEU T 63  
AA7 31 32 O ILE BA 64  ? O ILE T 64  N MET BA 42  ? N MET T 42  
AA7 32 33 N GLU BA 49  ? N GLU T 49  O SER BA 56  ? O SER T 56  
AA8 1  2  O LYS AA 72  ? O LYS S 72  N GLU AA 63  ? N GLU S 63  
AA8 2  3  N LEU AA 58  ? N LEU S 58  O ILE AA 77  ? O ILE S 77  
AA8 3  4  N MET AA 78  ? N MET S 78  O ILE BA 72  ? O ILE T 72  
AA8 4  5  O TYR BA 71  ? O TYR T 71  N LYS BA 22  ? N LYS T 22  
AA8 5  6  N VAL BA 19  ? N VAL T 19  O GLY BA 31  ? O GLY T 31  
AA8 6  7  N GLU BA 28  ? N GLU T 28  O TYR BA 50  ? O TYR T 50  
AA8 7  8  N GLU BA 49  ? N GLU T 49  O SER BA 56  ? O SER T 56  
AA9 1  2  N ILE X  51  ? N ILE P 51  O ARG X  61  ? O ARG P 61  
AB1 1  2  N PHE EA 4   ? N PHE M 4   O LEU EA 13  ? O LEU M 13  
AB2 1  2  O SER MA 56  ? O SER t 56  N GLU MA 49  ? N GLU t 49  
AB2 2  3  N MET MA 42  ? N MET t 42  O ILE MA 64  ? O ILE t 64  
AB2 3  4  O LEU MA 63  ? O LEU t 63  N VAL KA 109 ? N VAL r 109 
AB2 4  5  O VAL KA 108 ? O VAL r 108 N ASN KA 45  ? N ASN r 45  
AB2 5  6  N ILE KA 44  ? N ILE r 44  O LEU KA 52  ? O LEU r 52  
AB2 6  7  N LYS KA 51  ? N LYS r 51  O MET KA 73  ? O MET r 73  
AB2 7  8  N GLU KA 72  ? N GLU r 72  O ARG KA 94  ? O ARG r 94  
AB2 8  9  O PHE KA 100 ? O PHE r 100 N PHE JA 74  ? N PHE q 68  
AB2 9  10 O ILE JA 75  ? O ILE q 69  N THR JA 22  ? N THR q 16  
AB2 10 11 N ILE JA 23  ? N ILE q 17  O VAL JA 31  ? O VAL q 25  
AB2 11 12 N GLY JA 37  ? N GLY q 31  O HIS JA 45  ? O HIS q 39  
AB2 12 13 N VAL JA 49  ? N VAL q 43  O LEU JA 61  ? O LEU q 55  
AB2 13 14 O SER JA 65  ? O SER q 59  N MET IA 80  ? N MET p 80  
AB2 14 15 O SER IA 79  ? O SER p 79  N ILE IA 20  ? N ILE p 20  
AB2 15 16 N CYS IA 19  ? N CYS p 19  O PHE IA 27  ? O PHE p 27  
AB2 16 17 N ILE IA 28  ? N ILE p 28  O ASP IA 46  ? O ASP p 46  
AB2 17 18 N CYS IA 45  ? N CYS p 45  O GLY IA 68  ? O GLY p 68  
AB2 18 19 O LEU IA 69  ? O LEU p 69  N LEU HA 73  ? N LEU o 73  
AB2 19 20 O ILE HA 72  ? O ILE o 72  N THR HA 19  ? N THR o 19  
AB2 20 21 N VAL HA 18  ? N VAL o 18  O GLY HA 30  ? O GLY o 30  
AB2 21 22 N GLU HA 34  ? N GLU o 34  O GLN HA 42  ? O GLN o 42  
AB2 22 23 N CYS HA 41  ? N CYS o 41  O ILE HA 63  ? O ILE o 63  
AB2 23 24 N GLN HA 60  ? N GLN o 60  O ALA NA 72  ? O ALA u 72  
AB2 24 25 O GLU NA 71  ? O GLU u 71  N SER NA 18  ? N SER u 18  
AB2 25 26 N LEU NA 19  ? N LEU u 19  O VAL NA 27  ? O VAL u 27  
AB2 26 27 N GLN NA 28  ? N GLN u 28  O VAL NA 46  ? O VAL u 46  
AB2 27 28 N LEU NA 40  ? N LEU u 40  O ILE NA 62  ? O ILE u 62  
AB2 28 29 O VAL NA 61  ? O VAL u 61  N LEU LA 87  ? N LEU s 87  
AB2 29 30 O LEU LA 86  ? O LEU s 86  N TRP LA 34  ? N TRP s 34  
AB2 30 31 N VAL LA 33  ? N VAL s 33  O ILE LA 43  ? O ILE s 43  
AB2 31 32 N CYS LA 46  ? N CYS s 46  O ASP LA 59  ? O ASP s 59  
AB2 32 33 N LEU LA 58  ? N LEU s 58  O ILE LA 77  ? O ILE s 77  
AB2 33 34 N MET LA 78  ? N MET s 78  O ILE MA 72  ? O ILE t 72  
AB2 34 35 O TYR MA 71  ? O TYR t 71  N LYS MA 22  ? N LYS t 22  
AB2 35 36 N VAL MA 21  ? N VAL t 21  O TYR MA 29  ? O TYR t 29  
AB2 36 37 N GLU MA 28  ? N GLU t 28  O TYR MA 50  ? O TYR t 50  
AB3 1  2  N ILE IA 51  ? N ILE p 51  O ARG IA 61  ? O ARG p 61  
AB4 1  2  N PHE PA 4   ? N PHE m 4   O LEU PA 13  ? O LEU m 13  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software L ZN  201 ? 4 'binding site for residue ZN L 201'                
AC2 Software 1 EPE 201 ? 6 'binding site for residue EPE 1 201'               
AC3 Software 1 MG  202 ? 3 'binding site for residue MG 1 202'                
AC4 Software 1 MG  203 ? 4 'binding site for residue MG 1 203'                
AC5 Software 1 MG  204 ? 2 'binding site for residue MG 1 204'                
AC6 Software 1 MG  206 ? 3 'binding site for residue MG 1 206'                
AC7 Software 1 MG  207 ? 3 'binding site for residue MG 1 207'                
AC8 Software 1 MG  208 ? 2 'binding site for residue MG 1 208'                
AC9 Software 1 MG  209 ? 2 'binding site for residue MG 1 209'                
AD1 Software 1 K   210 ? 1 'binding site for residue K 1 210'                 
AD2 Software b K   101 ? 1 'binding site for residue K b 101'                 
AD3 Software b K   102 ? 1 'binding site for residue K b 102'                 
AD4 Software l ZN  201 ? 4 'binding site for residue ZN l 201'                
AD5 Software l MG  202 ? 3 'binding site for residue MG l 202'                
AD6 Software 2 EPE 201 ? 5 'binding site for residue EPE 2 201'               
AD7 Software 2 MG  203 ? 1 'binding site for residue MG 2 203'                
AD8 Software 2 MG  204 ? 1 'binding site for residue MG 2 204'                
AD9 Software 2 MG  205 ? 1 'binding site for residue MG 2 205'                
AE1 Software Q K   101 ? 2 'binding site for residue K Q 101'                 
AE2 Software M ZN  201 ? 4 'binding site for residue ZN M 201'                
AE3 Software 3 MG  201 ? 2 'binding site for residue MG 3 201'                
AE4 Software 3 MG  204 ? 2 'binding site for residue MG 3 204'                
AE5 Software m ZN  201 ? 4 'binding site for residue ZN m 201'                
AE6 Software 4 EOH 201 ? 2 'binding site for residue EOH 4 201'               
AE7 Software 4 CL  203 ? 4 'binding site for residue CL 4 203'                
AE8 Software y MG  101 ? 3 'binding site for residue MG y 101'                
AE9 Software y MG  102 ? 4 'binding site for residue MG y 102'                
AF1 Software y SO4 103 ? 3 'binding site for residue SO4 y 103'               
AF2 Software 2 GTP 1   ? 9 'binding site for Di-nucleotide GTP 2 1 and G 2 2' 
AF3 Software 3 GTP 1   ? 8 'binding site for Di-nucleotide GTP 3 1 and G 3 2' 
AF4 Software 4 GTP 1   ? 5 'binding site for Di-nucleotide GTP 4 1 and G 4 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS I  6  ? CYS L 6   . ? 1_555 ? 
2  AC1 4 CYS I  9  ? CYS L 9   . ? 1_555 ? 
3  AC1 4 HIS I  24 ? HIS L 24  . ? 1_555 ? 
4  AC1 4 HIS I  30 ? HIS L 30  . ? 1_555 ? 
5  AC2 6 G   J  11 ? G   1 11  . ? 1_555 ? 
6  AC2 6 G   J  12 ? G   1 12  . ? 1_555 ? 
7  AC2 6 C   J  13 ? C   1 13  . ? 1_555 ? 
8  AC2 6 C   J  25 ? C   1 25  . ? 1_555 ? 
9  AC2 6 A   J  26 ? A   1 26  . ? 1_555 ? 
10 AC2 6 HIS I  15 ? HIS L 15  . ? 1_555 ? 
11 AC3 3 G   J  40 ? G   1 130 . ? 1_555 ? 
12 AC3 3 MG  VA .  ? MG  1 203 . ? 1_555 ? 
13 AC3 3 MG  ZA .  ? MG  1 207 . ? 1_555 ? 
14 AC4 4 G   J  42 ? G   1 132 . ? 1_555 ? 
15 AC4 4 MG  UA .  ? MG  1 202 . ? 1_555 ? 
16 AC4 4 MG  YA .  ? MG  1 206 . ? 1_555 ? 
17 AC4 4 MG  ZA .  ? MG  1 207 . ? 1_555 ? 
18 AC5 2 A   J  36 ? A   1 126 . ? 1_555 ? 
19 AC5 2 MG  YA .  ? MG  1 206 . ? 1_555 ? 
20 AC6 3 U   J  41 ? U   1 131 . ? 1_555 ? 
21 AC6 3 MG  VA .  ? MG  1 203 . ? 1_555 ? 
22 AC6 3 MG  WA .  ? MG  1 204 . ? 1_555 ? 
23 AC7 3 U   J  38 ? U   1 128 . ? 1_555 ? 
24 AC7 3 MG  UA .  ? MG  1 202 . ? 1_555 ? 
25 AC7 3 MG  VA .  ? MG  1 203 . ? 1_555 ? 
26 AC8 2 G   J  40 ? G   1 130 . ? 1_555 ? 
27 AC8 2 GLU B  75 ? GLU B 75  . ? 1_555 ? 
28 AC9 2 A   J  18 ? A   1 18  . ? 1_555 ? 
29 AC9 2 G   J  19 ? G   1 19  . ? 1_555 ? 
30 AD1 1 U   J  34 ? U   1 124 . ? 1_555 ? 
31 AD2 1 GLU M  62 ? GLU b 62  . ? 1_555 ? 
32 AD3 1 GLN M  22 ? GLN b 22  . ? 1_555 ? 
33 AD4 4 CYS T  6  ? CYS l 6   . ? 1_555 ? 
34 AD4 4 CYS T  9  ? CYS l 9   . ? 1_555 ? 
35 AD4 4 HIS T  24 ? HIS l 24  . ? 1_555 ? 
36 AD4 4 HIS T  30 ? HIS l 30  . ? 1_555 ? 
37 AD5 3 GLU T  32 ? GLU l 32  . ? 1_555 ? 
38 AD5 3 ASN T  33 ? ASN l 33  . ? 1_555 ? 
39 AD5 3 ASP T  36 ? ASP l 36  . ? 1_555 ? 
40 AD6 5 G   U  11 ? G   2 11  . ? 1_555 ? 
41 AD6 5 C   U  13 ? C   2 13  . ? 1_555 ? 
42 AD6 5 A   U  26 ? A   2 26  . ? 1_555 ? 
43 AD6 5 C   U  27 ? C   2 27  . ? 1_555 ? 
44 AD6 5 HIS T  15 ? HIS l 15  . ? 1_555 ? 
45 AD7 1 U   J  21 ? U   1 21  . ? 2_454 ? 
46 AD8 1 G   U  15 ? G   2 15  . ? 1_555 ? 
47 AD9 1 U   U  34 ? U   2 124 . ? 1_555 ? 
48 AE1 2 SER Y  79 ? SER Q 73  . ? 1_555 ? 
49 AE1 2 THR OA 58 ? THR n 58  . ? 2_354 ? 
50 AE2 4 CYS EA 6  ? CYS M 6   . ? 1_555 ? 
51 AE2 4 CYS EA 9  ? CYS M 9   . ? 1_555 ? 
52 AE2 4 HIS EA 24 ? HIS M 24  . ? 1_555 ? 
53 AE2 4 HIS EA 30 ? HIS M 30  . ? 1_555 ? 
54 AE3 2 A   FA 36 ? A   3 126 . ? 1_555 ? 
55 AE3 2 U   FA 37 ? U   3 127 . ? 1_555 ? 
56 AE4 2 A   FA 18 ? A   3 18  . ? 1_555 ? 
57 AE4 2 G   FA 19 ? G   3 19  . ? 1_555 ? 
58 AE5 4 CYS PA 6  ? CYS m 6   . ? 1_555 ? 
59 AE5 4 CYS PA 9  ? CYS m 9   . ? 1_555 ? 
60 AE5 4 HIS PA 24 ? HIS m 24  . ? 1_555 ? 
61 AE5 4 HIS PA 30 ? HIS m 30  . ? 1_555 ? 
62 AE6 2 A   QA 28 ? A   4 28  . ? 1_555 ? 
63 AE6 2 C   QA 29 ? C   4 29  . ? 1_555 ? 
64 AE7 4 A   QA 45 ? A   4 135 . ? 1_555 ? 
65 AE7 4 U   QA 47 ? U   4 137 . ? 1_555 ? 
66 AE7 4 HIS OA 34 ? HIS n 34  . ? 1_555 ? 
67 AE7 4 GLN OA 36 ? GLN n 36  . ? 1_555 ? 
68 AE8 3 GTP U  1  ? GTP 2 1   . ? 4_455 ? 
69 AE8 3 C   RA 10 ? C   y 10  . ? 1_555 ? 
70 AE8 3 SO4 AC .  ? SO4 y 103 . ? 1_555 ? 
71 AE9 4 HIS PA 24 ? HIS m 24  . ? 1_555 ? 
72 AE9 4 GLY PA 27 ? GLY m 27  . ? 1_555 ? 
73 AE9 4 HIS PA 30 ? HIS m 30  . ? 1_555 ? 
74 AE9 4 U   RA 4  ? U   y 4   . ? 1_555 ? 
75 AF1 3 GTP U  1  ? GTP 2 1   . ? 4_455 ? 
76 AF1 3 ASN T  33 ? ASN l 33  . ? 4_455 ? 
77 AF1 3 MG  YB .  ? MG  y 101 . ? 1_555 ? 
78 AF2 9 A   U  3  ? A   2 3   . ? 1_555 ? 
79 AF2 9 GTP QA 1  ? GTP 4 1   . ? 4_555 ? 
80 AF2 9 LYS T  29 ? LYS l 29  . ? 1_555 ? 
81 AF2 9 GLU T  32 ? GLU l 32  . ? 1_555 ? 
82 AF2 9 C   V  9  ? C   x 9   . ? 1_555 ? 
83 AF2 9 C   V  10 ? C   x 10  . ? 1_555 ? 
84 AF2 9 C   RA 10 ? C   y 10  . ? 4_555 ? 
85 AF2 9 MG  YB .  ? MG  y 101 . ? 4_555 ? 
86 AF2 9 SO4 AC .  ? SO4 y 103 . ? 4_555 ? 
87 AF3 8 GTP J  1  ? GTP 1 1   . ? 4_455 ? 
88 AF3 8 A   FA 3  ? A   3 3   . ? 1_555 ? 
89 AF3 8 HOH QC .  ? HOH 3 301 . ? 1_555 ? 
90 AF3 8 LYS EA 29 ? LYS M 29  . ? 1_555 ? 
91 AF3 8 GLU EA 32 ? GLU M 32  . ? 1_555 ? 
92 AF3 8 C   K  10 ? C   X 10  . ? 4_455 ? 
93 AF3 8 C   GA 9  ? C   Y 9   . ? 1_555 ? 
94 AF3 8 C   GA 10 ? C   Y 10  . ? 1_555 ? 
95 AF4 5 GTP U  1  ? GTP 2 1   . ? 4_455 ? 
96 AF4 5 A   QA 3  ? A   4 3   . ? 1_555 ? 
97 AF4 5 C   V  10 ? C   x 10  . ? 4_455 ? 
98 AF4 5 C   RA 9  ? C   y 9   . ? 1_555 ? 
99 AF4 5 C   RA 10 ? C   y 10  . ? 1_555 ? 
# 
_atom_sites.fract_transf_matrix[2][2]   0.005793 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.entry_id                    4PJO 
_atom_sites.fract_transf_matrix[1][1]   0.008309 
_atom_sites.fract_transf_matrix[3][3]   0.003901 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
K  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . MET A  1  1   ? -26.154  -7.907  44.978  1.00 156.73 ? 1   MET A N     1 
ATOM   2     C  CA    . MET A  1  1   ? -25.837  -9.342  44.693  1.00 155.62 ? 1   MET A CA    1 
ATOM   3     C  C     . MET A  1  1   ? -26.645  -9.888  43.491  1.00 150.89 ? 1   MET A C     1 
ATOM   4     O  O     . MET A  1  1   ? -26.104  -10.029 42.372  1.00 153.32 ? 1   MET A O     1 
ATOM   5     C  CB    . MET A  1  1   ? -25.957  -10.216 45.960  1.00 135.87 ? 1   MET A CB    1 
ATOM   6     N  N     . SER A  1  2   ? -27.926  -10.150 43.699  1.00 145.43 ? 2   SER A N     1 
ATOM   7     C  CA    . SER A  1  2   ? -28.631  -11.215 43.005  1.00 150.84 ? 2   SER A CA    1 
ATOM   8     C  C     . SER A  1  2   ? -28.654  -11.115 41.480  1.00 156.44 ? 2   SER A C     1 
ATOM   9     O  O     . SER A  1  2   ? -28.526  -12.135 40.802  1.00 165.66 ? 2   SER A O     1 
ATOM   10    C  CB    . SER A  1  2   ? -30.069  -11.326 43.512  1.00 151.93 ? 2   SER A CB    1 
ATOM   11    O  OG    . SER A  1  2   ? -30.800  -12.262 42.738  1.00 159.96 ? 2   SER A OG    1 
ATOM   12    N  N     . ILE A  1  3   ? -28.824  -9.920  40.929  1.00 140.63 ? 3   ILE A N     1 
ATOM   13    C  CA    . ILE A  1  3   ? -28.860  -9.786  39.472  1.00 121.85 ? 3   ILE A CA    1 
ATOM   14    C  C     . ILE A  1  3   ? -27.495  -10.068 38.850  1.00 108.90 ? 3   ILE A C     1 
ATOM   15    O  O     . ILE A  1  3   ? -26.462  -9.813  39.462  1.00 112.77 ? 3   ILE A O     1 
ATOM   16    C  CB    . ILE A  1  3   ? -29.376  -8.409  39.030  1.00 118.11 ? 3   ILE A CB    1 
ATOM   17    C  CG1   . ILE A  1  3   ? -29.647  -8.427  37.529  1.00 106.40 ? 3   ILE A CG1   1 
ATOM   18    C  CG2   . ILE A  1  3   ? -28.391  -7.308  39.405  1.00 120.72 ? 3   ILE A CG2   1 
ATOM   19    C  CD1   . ILE A  1  3   ? -30.778  -9.348  37.139  1.00 101.65 ? 3   ILE A CD1   1 
ATOM   20    N  N     . GLY A  1  4   ? -27.499  -10.598 37.632  1.00 100.22 ? 4   GLY A N     1 
ATOM   21    C  CA    . GLY A  1  4   ? -26.285  -11.088 37.009  1.00 90.73  ? 4   GLY A CA    1 
ATOM   22    C  C     . GLY A  1  4   ? -26.026  -10.528 35.632  1.00 76.28  ? 4   GLY A C     1 
ATOM   23    O  O     . GLY A  1  4   ? -26.938  -10.110 34.935  1.00 73.59  ? 4   GLY A O     1 
ATOM   24    N  N     . VAL A  1  5   ? -24.758  -10.513 35.250  1.00 67.59  ? 5   VAL A N     1 
ATOM   25    C  CA    . VAL A  1  5   ? -24.338  -9.841  34.025  1.00 71.39  ? 5   VAL A CA    1 
ATOM   26    C  C     . VAL A  1  5   ? -25.058  -10.237 32.724  1.00 68.76  ? 5   VAL A C     1 
ATOM   27    O  O     . VAL A  1  5   ? -25.405  -9.378  31.935  1.00 70.84  ? 5   VAL A O     1 
ATOM   28    C  CB    . VAL A  1  5   ? -22.837  -10.018 33.737  1.00 72.94  ? 5   VAL A CB    1 
ATOM   29    C  CG1   . VAL A  1  5   ? -22.413  -9.138  32.547  1.00 69.94  ? 5   VAL A CG1   1 
ATOM   30    C  CG2   . VAL A  1  5   ? -21.989  -9.824  34.995  1.00 77.71  ? 5   VAL A CG2   1 
ATOM   31    N  N     . PRO A  1  6   ? -25.333  -11.520 32.504  1.00 65.62  ? 6   PRO A N     1 
ATOM   32    C  CA    . PRO A  1  6   ? -25.928  -11.886 31.244  1.00 65.37  ? 6   PRO A CA    1 
ATOM   33    C  C     . PRO A  1  6   ? -27.383  -11.489 31.119  1.00 65.12  ? 6   PRO A C     1 
ATOM   34    O  O     . PRO A  1  6   ? -27.791  -11.156 30.000  1.00 65.46  ? 6   PRO A O     1 
ATOM   35    C  CB    . PRO A  1  6   ? -25.797  -13.420 31.208  1.00 67.12  ? 6   PRO A CB    1 
ATOM   36    C  CG    . PRO A  1  6   ? -24.700  -13.733 32.160  1.00 63.55  ? 6   PRO A CG    1 
ATOM   37    C  CD    . PRO A  1  6   ? -24.925  -12.723 33.242  1.00 67.87  ? 6   PRO A CD    1 
ATOM   38    N  N     . ILE A  1  7   ? -28.131  -11.517 32.220  1.00 62.69  ? 7   ILE A N     1 
ATOM   39    C  CA    . ILE A  1  7   ? -29.501  -11.016 32.180  1.00 62.88  ? 7   ILE A CA    1 
ATOM   40    C  C     . ILE A  1  7   ? -29.575  -9.492  31.955  1.00 64.31  ? 7   ILE A C     1 
ATOM   41    O  O     . ILE A  1  7   ? -30.395  -9.008  31.197  1.00 57.75  ? 7   ILE A O     1 
ATOM   42    C  CB    . ILE A  1  7   ? -30.203  -11.394 33.473  1.00 64.92  ? 7   ILE A CB    1 
ATOM   43    C  CG1   . ILE A  1  7   ? -30.384  -12.880 33.557  1.00 68.71  ? 7   ILE A CG1   1 
ATOM   44    C  CG2   . ILE A  1  7   ? -31.553  -10.711 33.623  1.00 70.98  ? 7   ILE A CG2   1 
ATOM   45    C  CD1   . ILE A  1  7   ? -31.299  -13.451 32.497  1.00 72.68  ? 7   ILE A CD1   1 
ATOM   46    N  N     . LYS A  1  8   ? -28.697  -8.728  32.601  1.00 71.30  ? 8   LYS A N     1 
ATOM   47    C  CA    . LYS A  1  8   ? -28.557  -7.302  32.327  1.00 75.49  ? 8   LYS A CA    1 
ATOM   48    C  C     . LYS A  1  8   ? -28.457  -7.117  30.831  1.00 72.77  ? 8   LYS A C     1 
ATOM   49    O  O     . LYS A  1  8   ? -29.245  -6.362  30.277  1.00 79.55  ? 8   LYS A O     1 
ATOM   50    C  CB    . LYS A  1  8   ? -27.315  -6.672  32.977  1.00 80.99  ? 8   LYS A CB    1 
ATOM   51    C  CG    . LYS A  1  8   ? -27.421  -6.486  34.479  1.00 86.56  ? 8   LYS A CG    1 
ATOM   52    C  CD    . LYS A  1  8   ? -26.159  -5.863  35.079  1.00 96.62  ? 8   LYS A CD    1 
ATOM   53    C  CE    . LYS A  1  8   ? -26.402  -5.516  36.552  1.00 98.65  ? 8   LYS A CE    1 
ATOM   54    N  NZ    . LYS A  1  8   ? -25.123  -5.228  37.257  1.00 95.76  ? 8   LYS A NZ    1 
ATOM   55    N  N     . VAL A  1  9   ? -27.515  -7.837  30.208  1.00 62.97  ? 9   VAL A N     1 
ATOM   56    C  CA    . VAL A  1  9   ? -27.280  -7.753  28.764  1.00 56.86  ? 9   VAL A CA    1 
ATOM   57    C  C     . VAL A  1  9   ? -28.557  -8.011  27.973  1.00 56.64  ? 9   VAL A C     1 
ATOM   58    O  O     . VAL A  1  9   ? -28.778  -7.350  26.958  1.00 60.95  ? 9   VAL A O     1 
ATOM   59    C  CB    . VAL A  1  9   ? -26.185  -8.708  28.253  1.00 54.38  ? 9   VAL A CB    1 
ATOM   60    C  CG1   . VAL A  1  9   ? -26.010  -8.620  26.744  1.00 55.11  ? 9   VAL A CG1   1 
ATOM   61    C  CG2   . VAL A  1  9   ? -24.848  -8.340  28.864  1.00 55.71  ? 9   VAL A CG2   1 
ATOM   62    N  N     . LEU A  1  10  ? -29.377  -8.946  28.432  1.00 53.33  ? 10  LEU A N     1 
ATOM   63    C  CA    . LEU A  1  10  ? -30.663  -9.181  27.830  1.00 54.80  ? 10  LEU A CA    1 
ATOM   64    C  C     . LEU A  1  10  ? -31.530  -7.967  27.901  1.00 56.09  ? 10  LEU A C     1 
ATOM   65    O  O     . LEU A  1  10  ? -32.107  -7.558  26.888  1.00 61.98  ? 10  LEU A O     1 
ATOM   66    C  CB    . LEU A  1  10  ? -31.388  -10.360 28.491  1.00 57.86  ? 10  LEU A CB    1 
ATOM   67    C  CG    . LEU A  1  10  ? -32.803  -10.649 27.980  1.00 61.42  ? 10  LEU A CG    1 
ATOM   68    C  CD1   . LEU A  1  10  ? -32.890  -10.837 26.469  1.00 62.98  ? 10  LEU A CD1   1 
ATOM   69    C  CD2   . LEU A  1  10  ? -33.299  -11.901 28.631  1.00 65.06  ? 10  LEU A CD2   1 
ATOM   70    N  N     . HIS A  1  11  ? -31.647  -7.382  29.083  1.00 63.29  ? 11  HIS A N     1 
ATOM   71    C  CA    . HIS A  1  11  ? -32.448  -6.158  29.239  1.00 70.53  ? 11  HIS A CA    1 
ATOM   72    C  C     . HIS A  1  11  ? -31.939  -4.970  28.427  1.00 71.71  ? 11  HIS A C     1 
ATOM   73    O  O     . HIS A  1  11  ? -32.742  -4.136  27.994  1.00 73.94  ? 11  HIS A O     1 
ATOM   74    C  CB    . HIS A  1  11  ? -32.505  -5.726  30.681  1.00 74.64  ? 11  HIS A CB    1 
ATOM   75    C  CG    . HIS A  1  11  ? -33.469  -6.519  31.481  1.00 79.92  ? 11  HIS A CG    1 
ATOM   76    N  ND1   . HIS A  1  11  ? -33.123  -7.701  32.094  1.00 86.62  ? 11  HIS A ND1   1 
ATOM   77    C  CD2   . HIS A  1  11  ? -34.748  -6.263  31.824  1.00 83.74  ? 11  HIS A CD2   1 
ATOM   78    C  CE1   . HIS A  1  11  ? -34.172  -8.159  32.757  1.00 89.84  ? 11  HIS A CE1   1 
ATOM   79    N  NE2   . HIS A  1  11  ? -35.165  -7.303  32.610  1.00 91.25  ? 11  HIS A NE2   1 
ATOM   80    N  N     . GLU A  1  12  ? -30.633  -4.919  28.198  1.00 67.50  ? 12  GLU A N     1 
ATOM   81    C  CA    . GLU A  1  12  ? -30.065  -3.876  27.380  1.00 74.07  ? 12  GLU A CA    1 
ATOM   82    C  C     . GLU A  1  12  ? -30.510  -3.974  25.921  1.00 66.44  ? 12  GLU A C     1 
ATOM   83    O  O     . GLU A  1  12  ? -30.457  -2.988  25.183  1.00 72.81  ? 12  GLU A O     1 
ATOM   84    C  CB    . GLU A  1  12  ? -28.533  -3.874  27.509  1.00 83.93  ? 12  GLU A CB    1 
ATOM   85    C  CG    . GLU A  1  12  ? -27.830  -2.511  27.614  1.00 90.53  ? 12  GLU A CG    1 
ATOM   86    C  CD    . GLU A  1  12  ? -28.265  -1.729  28.847  1.00 100.77 ? 12  GLU A CD    1 
ATOM   87    O  OE1   . GLU A  1  12  ? -28.161  -2.340  29.959  1.00 118.27 ? 12  GLU A OE1   1 
ATOM   88    O  OE2   . GLU A  1  12  ? -28.759  -0.568  28.691  1.00 91.78  ? 12  GLU A OE2   1 
ATOM   89    N  N     . ALA A  1  13  ? -30.866  -5.165  25.497  1.00 56.94  ? 13  ALA A N     1 
ATOM   90    C  CA    . ALA A  1  13  ? -31.343  -5.332  24.166  1.00 59.56  ? 13  ALA A CA    1 
ATOM   91    C  C     . ALA A  1  13  ? -32.803  -5.050  24.036  1.00 64.82  ? 13  ALA A C     1 
ATOM   92    O  O     . ALA A  1  13  ? -33.360  -5.264  22.942  1.00 72.98  ? 13  ALA A O     1 
ATOM   93    C  CB    . ALA A  1  13  ? -31.068  -6.763  23.705  1.00 63.36  ? 13  ALA A CB    1 
ATOM   94    N  N     . GLU A  1  14  ? -33.483  -4.729  25.131  1.00 75.61  ? 14  GLU A N     1 
ATOM   95    C  CA    . GLU A  1  14  ? -34.900  -4.355  25.054  1.00 82.82  ? 14  GLU A CA    1 
ATOM   96    C  C     . GLU A  1  14  ? -34.973  -3.184  24.099  1.00 82.09  ? 14  GLU A C     1 
ATOM   97    O  O     . GLU A  1  14  ? -34.142  -2.270  24.160  1.00 88.66  ? 14  GLU A O     1 
ATOM   98    C  CB    . GLU A  1  14  ? -35.473  -3.917  26.395  1.00 85.11  ? 14  GLU A CB    1 
ATOM   99    C  CG    . GLU A  1  14  ? -35.727  -5.029  27.404  1.00 90.08  ? 14  GLU A CG    1 
ATOM   100   C  CD    . GLU A  1  14  ? -36.024  -4.537  28.830  1.00 95.33  ? 14  GLU A CD    1 
ATOM   101   O  OE1   . GLU A  1  14  ? -35.838  -3.333  29.132  1.00 106.57 ? 14  GLU A OE1   1 
ATOM   102   O  OE2   . GLU A  1  14  ? -36.538  -5.329  29.654  1.00 88.63  ? 14  GLU A OE2   1 
ATOM   103   N  N     . GLY A  1  15  ? -35.944  -3.258  23.202  1.00 76.86  ? 15  GLY A N     1 
ATOM   104   C  CA    . GLY A  1  15  ? -36.134  -2.252  22.183  1.00 79.61  ? 15  GLY A CA    1 
ATOM   105   C  C     . GLY A  1  15  ? -35.568  -2.581  20.838  1.00 77.49  ? 15  GLY A C     1 
ATOM   106   O  O     . GLY A  1  15  ? -35.911  -1.924  19.862  1.00 78.92  ? 15  GLY A O     1 
ATOM   107   N  N     . HIS A  1  16  ? -34.697  -3.574  20.761  1.00 80.01  ? 16  HIS A N     1 
ATOM   108   C  CA    . HIS A  1  16  ? -34.040  -3.876  19.478  1.00 80.17  ? 16  HIS A CA    1 
ATOM   109   C  C     . HIS A  1  16  ? -34.459  -5.221  18.899  1.00 77.01  ? 16  HIS A C     1 
ATOM   110   O  O     . HIS A  1  16  ? -35.284  -5.941  19.503  1.00 67.26  ? 16  HIS A O     1 
ATOM   111   C  CB    . HIS A  1  16  ? -32.537  -3.798  19.643  1.00 79.55  ? 16  HIS A CB    1 
ATOM   112   C  CG    . HIS A  1  16  ? -32.088  -2.528  20.288  1.00 75.79  ? 16  HIS A CG    1 
ATOM   113   N  ND1   . HIS A  1  16  ? -31.710  -1.386  19.607  1.00 76.18  ? 16  HIS A ND1   1 
ATOM   114   C  CD2   . HIS A  1  16  ? -31.998  -2.232  21.600  1.00 76.38  ? 16  HIS A CD2   1 
ATOM   115   C  CE1   . HIS A  1  16  ? -31.377  -0.455  20.489  1.00 79.23  ? 16  HIS A CE1   1 
ATOM   116   N  NE2   . HIS A  1  16  ? -31.545  -0.945  21.702  1.00 81.33  ? 16  HIS A NE2   1 
ATOM   117   N  N     . ILE A  1  17  ? -33.874  -5.524  17.737  1.00 70.72  ? 17  ILE A N     1 
ATOM   118   C  CA    . ILE A  1  17  ? -34.137  -6.800  17.111  1.00 68.33  ? 17  ILE A CA    1 
ATOM   119   C  C     . ILE A  1  17  ? -33.319  -7.962  17.731  1.00 66.41  ? 17  ILE A C     1 
ATOM   120   O  O     . ILE A  1  17  ? -32.084  -7.913  17.866  1.00 59.89  ? 17  ILE A O     1 
ATOM   121   C  CB    . ILE A  1  17  ? -33.914  -6.700  15.613  1.00 67.47  ? 17  ILE A CB    1 
ATOM   122   C  CG1   . ILE A  1  17  ? -34.809  -5.630  15.025  1.00 69.07  ? 17  ILE A CG1   1 
ATOM   123   C  CG2   . ILE A  1  17  ? -34.214  -8.044  14.933  1.00 71.75  ? 17  ILE A CG2   1 
ATOM   124   C  CD1   . ILE A  1  17  ? -36.304  -5.845  15.171  1.00 72.70  ? 17  ILE A CD1   1 
ATOM   125   N  N     . VAL A  1  18  ? -34.044  -9.008  18.110  1.00 63.39  ? 18  VAL A N     1 
ATOM   126   C  CA    . VAL A  1  18  ? -33.450  -10.217 18.661  1.00 64.22  ? 18  VAL A CA    1 
ATOM   127   C  C     . VAL A  1  18  ? -34.023  -11.421 17.950  1.00 65.09  ? 18  VAL A C     1 
ATOM   128   O  O     . VAL A  1  18  ? -35.187  -11.452 17.591  1.00 65.28  ? 18  VAL A O     1 
ATOM   129   C  CB    . VAL A  1  18  ? -33.662  -10.400 20.193  1.00 61.08  ? 18  VAL A CB    1 
ATOM   130   C  CG1   . VAL A  1  18  ? -33.152  -9.160  20.922  1.00 65.22  ? 18  VAL A CG1   1 
ATOM   131   C  CG2   . VAL A  1  18  ? -35.104  -10.692 20.560  1.00 56.75  ? 18  VAL A CG2   1 
ATOM   132   N  N     . THR A  1  19  ? -33.176  -12.420 17.769  1.00 66.58  ? 19  THR A N     1 
ATOM   133   C  CA    . THR A  1  19  ? -33.645  -13.739 17.420  1.00 68.05  ? 19  THR A CA    1 
ATOM   134   C  C     . THR A  1  19  ? -33.627  -14.605 18.671  1.00 63.44  ? 19  THR A C     1 
ATOM   135   O  O     . THR A  1  19  ? -32.808  -14.405 19.560  1.00 68.64  ? 19  THR A O     1 
ATOM   136   C  CB    . THR A  1  19  ? -32.727  -14.282 16.349  1.00 75.75  ? 19  THR A CB    1 
ATOM   137   O  OG1   . THR A  1  19  ? -32.421  -13.218 15.415  1.00 75.66  ? 19  THR A OG1   1 
ATOM   138   C  CG2   . THR A  1  19  ? -33.402  -15.484 15.676  1.00 78.11  ? 19  THR A CG2   1 
ATOM   139   N  N     . CYS A  1  20  ? -34.557  -15.531 18.756  1.00 57.73  ? 20  CYS A N     1 
ATOM   140   C  CA    . CYS A  1  20  ? -34.739  -16.335 19.944  1.00 54.70  ? 20  CYS A CA    1 
ATOM   141   C  C     . CYS A  1  20  ? -35.169  -17.761 19.535  1.00 55.54  ? 20  CYS A C     1 
ATOM   142   O  O     . CYS A  1  20  ? -36.175  -17.941 18.862  1.00 60.13  ? 20  CYS A O     1 
ATOM   143   C  CB    . CYS A  1  20  ? -35.784  -15.663 20.798  1.00 53.81  ? 20  CYS A CB    1 
ATOM   144   S  SG    . CYS A  1  20  ? -36.577  -16.780 21.961  1.00 62.56  ? 20  CYS A SG    1 
ATOM   145   N  N     . GLU A  1  21  ? -34.379  -18.784 19.863  1.00 53.12  ? 21  GLU A N     1 
ATOM   146   C  CA    . GLU A  1  21  ? -34.749  -20.141 19.577  1.00 53.56  ? 21  GLU A CA    1 
ATOM   147   C  C     . GLU A  1  21  ? -35.386  -20.745 20.805  1.00 52.27  ? 21  GLU A C     1 
ATOM   148   O  O     . GLU A  1  21  ? -34.813  -20.727 21.865  1.00 54.74  ? 21  GLU A O     1 
ATOM   149   C  CB    . GLU A  1  21  ? -33.555  -20.951 19.141  1.00 57.21  ? 21  GLU A CB    1 
ATOM   150   C  CG    . GLU A  1  21  ? -33.930  -22.425 18.978  1.00 67.26  ? 21  GLU A CG    1 
ATOM   151   C  CD    . GLU A  1  21  ? -33.201  -23.186 17.853  1.00 75.95  ? 21  GLU A CD    1 
ATOM   152   O  OE1   . GLU A  1  21  ? -32.163  -22.684 17.347  1.00 74.82  ? 21  GLU A OE1   1 
ATOM   153   O  OE2   . GLU A  1  21  ? -33.639  -24.329 17.507  1.00 74.96  ? 21  GLU A OE2   1 
ATOM   154   N  N     . THR A  1  22  ? -36.575  -21.294 20.666  1.00 53.23  ? 22  THR A N     1 
ATOM   155   C  CA    . THR A  1  22  ? -37.239  -21.994 21.751  1.00 56.88  ? 22  THR A CA    1 
ATOM   156   C  C     . THR A  1  22  ? -36.836  -23.435 21.807  1.00 55.02  ? 22  THR A C     1 
ATOM   157   O  O     . THR A  1  22  ? -36.293  -23.961 20.839  1.00 49.76  ? 22  THR A O     1 
ATOM   158   C  CB    . THR A  1  22  ? -38.765  -22.039 21.528  1.00 66.87  ? 22  THR A CB    1 
ATOM   159   O  OG1   . THR A  1  22  ? -39.116  -22.548 20.226  1.00 68.15  ? 22  THR A OG1   1 
ATOM   160   C  CG2   . THR A  1  22  ? -39.312  -20.643 21.583  1.00 74.11  ? 22  THR A CG2   1 
ATOM   161   N  N     . ASN A  1  23  ? -37.251  -24.102 22.875  1.00 60.88  ? 23  ASN A N     1 
ATOM   162   C  CA    . ASN A  1  23  ? -36.942  -25.507 23.116  1.00 71.79  ? 23  ASN A CA    1 
ATOM   163   C  C     . ASN A  1  23  ? -37.484  -26.385 22.001  1.00 65.59  ? 23  ASN A C     1 
ATOM   164   O  O     . ASN A  1  23  ? -36.893  -27.399 21.656  1.00 69.33  ? 23  ASN A O     1 
ATOM   165   C  CB    . ASN A  1  23  ? -37.536  -25.961 24.453  1.00 83.63  ? 23  ASN A CB    1 
ATOM   166   C  CG    . ASN A  1  23  ? -36.500  -26.055 25.557  1.00 107.85 ? 23  ASN A CG    1 
ATOM   167   O  OD1   . ASN A  1  23  ? -35.307  -25.882 25.326  1.00 118.84 ? 23  ASN A OD1   1 
ATOM   168   N  ND2   . ASN A  1  23  ? -36.960  -26.335 26.771  1.00 123.03 ? 23  ASN A ND2   1 
ATOM   169   N  N     . THR A  1  24  ? -38.642  -26.011 21.480  1.00 66.50  ? 24  THR A N     1 
ATOM   170   C  CA    . THR A  1  24  ? -39.303  -26.738 20.404  1.00 63.97  ? 24  THR A CA    1 
ATOM   171   C  C     . THR A  1  24  ? -38.511  -26.706 19.101  1.00 61.93  ? 24  THR A C     1 
ATOM   172   O  O     . THR A  1  24  ? -38.713  -27.539 18.229  1.00 59.47  ? 24  THR A O     1 
ATOM   173   C  CB    . THR A  1  24  ? -40.718  -26.204 20.167  1.00 73.78  ? 24  THR A CB    1 
ATOM   174   O  OG1   . THR A  1  24  ? -40.714  -24.774 20.210  1.00 83.47  ? 24  THR A OG1   1 
ATOM   175   C  CG2   . THR A  1  24  ? -41.638  -26.725 21.232  1.00 79.61  ? 24  THR A CG2   1 
ATOM   176   N  N     . GLY A  1  25  ? -37.615  -25.737 18.969  1.00 57.82  ? 25  GLY A N     1 
ATOM   177   C  CA    . GLY A  1  25  ? -36.837  -25.572 17.755  1.00 53.85  ? 25  GLY A CA    1 
ATOM   178   C  C     . GLY A  1  25  ? -37.398  -24.559 16.785  1.00 52.42  ? 25  GLY A C     1 
ATOM   179   O  O     . GLY A  1  25  ? -36.881  -24.385 15.691  1.00 54.31  ? 25  GLY A O     1 
ATOM   180   N  N     . GLU A  1  26  ? -38.464  -23.890 17.192  1.00 50.81  ? 26  GLU A N     1 
ATOM   181   C  CA    . GLU A  1  26  ? -38.978  -22.742 16.474  1.00 53.96  ? 26  GLU A CA    1 
ATOM   182   C  C     . GLU A  1  26  ? -38.050  -21.576 16.730  1.00 51.38  ? 26  GLU A C     1 
ATOM   183   O  O     . GLU A  1  26  ? -37.339  -21.570 17.718  1.00 51.61  ? 26  GLU A O     1 
ATOM   184   C  CB    . GLU A  1  26  ? -40.384  -22.402 16.943  1.00 63.27  ? 26  GLU A CB    1 
ATOM   185   C  CG    . GLU A  1  26  ? -41.462  -23.303 16.374  1.00 72.92  ? 26  GLU A CG    1 
ATOM   186   C  CD    . GLU A  1  26  ? -41.879  -24.399 17.326  1.00 85.11  ? 26  GLU A CD    1 
ATOM   187   O  OE1   . GLU A  1  26  ? -41.702  -24.233 18.550  1.00 92.58  ? 26  GLU A OE1   1 
ATOM   188   O  OE2   . GLU A  1  26  ? -42.389  -25.431 16.850  1.00 84.45  ? 26  GLU A OE2   1 
ATOM   189   N  N     . VAL A  1  27  ? -38.053  -20.587 15.846  1.00 52.08  ? 27  VAL A N     1 
ATOM   190   C  CA    . VAL A  1  27  ? -37.175  -19.429 16.010  1.00 50.61  ? 27  VAL A CA    1 
ATOM   191   C  C     . VAL A  1  27  ? -38.006  -18.200 15.760  1.00 49.29  ? 27  VAL A C     1 
ATOM   192   O  O     . VAL A  1  27  ? -38.577  -18.075 14.687  1.00 54.07  ? 27  VAL A O     1 
ATOM   193   C  CB    . VAL A  1  27  ? -36.050  -19.476 14.980  1.00 47.50  ? 27  VAL A CB    1 
ATOM   194   C  CG1   . VAL A  1  27  ? -35.061  -18.356 15.140  1.00 44.58  ? 27  VAL A CG1   1 
ATOM   195   C  CG2   . VAL A  1  27  ? -35.347  -20.825 15.068  1.00 50.25  ? 27  VAL A CG2   1 
ATOM   196   N  N     . TYR A  1  28  ? -37.933  -17.263 16.683  1.00 45.70  ? 28  TYR A N     1 
ATOM   197   C  CA    . TYR A  1  28  ? -38.693  -16.066 16.617  1.00 48.15  ? 28  TYR A CA    1 
ATOM   198   C  C     . TYR A  1  28  ? -37.725  -14.899 16.417  1.00 54.09  ? 28  TYR A C     1 
ATOM   199   O  O     . TYR A  1  28  ? -36.865  -14.637 17.254  1.00 56.49  ? 28  TYR A O     1 
ATOM   200   C  CB    . TYR A  1  28  ? -39.492  -15.930 17.906  1.00 49.71  ? 28  TYR A CB    1 
ATOM   201   C  CG    . TYR A  1  28  ? -40.436  -17.099 18.079  1.00 50.80  ? 28  TYR A CG    1 
ATOM   202   C  CD1   . TYR A  1  28  ? -39.998  -18.316 18.452  1.00 51.68  ? 28  TYR A CD1   1 
ATOM   203   C  CD2   . TYR A  1  28  ? -41.779  -16.980 17.853  1.00 55.50  ? 28  TYR A CD2   1 
ATOM   204   C  CE1   . TYR A  1  28  ? -40.872  -19.372 18.621  1.00 57.46  ? 28  TYR A CE1   1 
ATOM   205   C  CE2   . TYR A  1  28  ? -42.659  -18.044 17.996  1.00 56.78  ? 28  TYR A CE2   1 
ATOM   206   C  CZ    . TYR A  1  28  ? -42.213  -19.263 18.389  1.00 56.47  ? 28  TYR A CZ    1 
ATOM   207   O  OH    . TYR A  1  28  ? -43.062  -20.338 18.593  1.00 53.85  ? 28  TYR A OH    1 
ATOM   208   N  N     . ARG A  1  29  ? -37.904  -14.136 15.336  1.00 59.24  ? 29  ARG A N     1 
ATOM   209   C  CA    . ARG A  1  29  ? -37.111  -12.924 15.095  1.00 63.38  ? 29  ARG A CA    1 
ATOM   210   C  C     . ARG A  1  29  ? -38.000  -11.710 15.117  1.00 65.09  ? 29  ARG A C     1 
ATOM   211   O  O     . ARG A  1  29  ? -39.009  -11.686 14.412  1.00 68.37  ? 29  ARG A O     1 
ATOM   212   C  CB    . ARG A  1  29  ? -36.464  -12.989 13.730  1.00 67.76  ? 29  ARG A CB    1 
ATOM   213   C  CG    . ARG A  1  29  ? -35.242  -12.128 13.664  1.00 72.44  ? 29  ARG A CG    1 
ATOM   214   C  CD    . ARG A  1  29  ? -35.157  -11.380 12.354  1.00 75.85  ? 29  ARG A CD    1 
ATOM   215   N  NE    . ARG A  1  29  ? -33.752  -11.003 12.179  1.00 75.54  ? 29  ARG A NE    1 
ATOM   216   C  CZ    . ARG A  1  29  ? -33.320  -9.897  11.610  1.00 75.23  ? 29  ARG A CZ    1 
ATOM   217   N  NH1   . ARG A  1  29  ? -34.164  -8.985  11.135  1.00 89.58  ? 29  ARG A NH1   1 
ATOM   218   N  NH2   . ARG A  1  29  ? -32.025  -9.693  11.538  1.00 73.83  ? 29  ARG A NH2   1 
ATOM   219   N  N     . GLY A  1  30  ? -37.634  -10.711 15.914  1.00 67.54  ? 30  GLY A N     1 
ATOM   220   C  CA    . GLY A  1  30  ? -38.464  -9.508  16.063  1.00 72.65  ? 30  GLY A CA    1 
ATOM   221   C  C     . GLY A  1  30  ? -37.980  -8.480  17.065  1.00 73.25  ? 30  GLY A C     1 
ATOM   222   O  O     . GLY A  1  30  ? -36.844  -8.564  17.526  1.00 68.23  ? 30  GLY A O     1 
ATOM   223   N  N     . LYS A  1  31  ? -38.809  -7.468  17.320  1.00 77.50  ? 31  LYS A N     1 
ATOM   224   C  CA    . LYS A  1  31  ? -38.441  -6.429  18.267  1.00 82.36  ? 31  LYS A CA    1 
ATOM   225   C  C     . LYS A  1  31  ? -38.742  -6.958  19.644  1.00 78.68  ? 31  LYS A C     1 
ATOM   226   O  O     . LYS A  1  31  ? -39.872  -7.367  19.910  1.00 70.34  ? 31  LYS A O     1 
ATOM   227   C  CB    . LYS A  1  31  ? -39.110  -5.050  18.066  1.00 90.68  ? 31  LYS A CB    1 
ATOM   228   C  CG    . LYS A  1  31  ? -38.256  -3.922  18.700  1.00 97.83  ? 31  LYS A CG    1 
ATOM   229   C  CD    . LYS A  1  31  ? -38.948  -2.624  19.138  1.00 98.36  ? 31  LYS A CD    1 
ATOM   230   C  CE    . LYS A  1  31  ? -39.456  -1.804  17.956  1.00 103.29 ? 31  LYS A CE    1 
ATOM   231   N  NZ    . LYS A  1  31  ? -40.833  -1.262  18.146  1.00 104.57 ? 31  LYS A NZ    1 
ATOM   232   N  N     . LEU A  1  32  ? -37.705  -6.929  20.482  1.00 74.34  ? 32  LEU A N     1 
ATOM   233   C  CA    . LEU A  1  32  ? -37.854  -7.296  21.868  1.00 74.93  ? 32  LEU A CA    1 
ATOM   234   C  C     . LEU A  1  32  ? -38.424  -6.073  22.535  1.00 75.13  ? 32  LEU A C     1 
ATOM   235   O  O     . LEU A  1  32  ? -37.754  -5.057  22.637  1.00 77.51  ? 32  LEU A O     1 
ATOM   236   C  CB    . LEU A  1  32  ? -36.504  -7.626  22.503  1.00 74.37  ? 32  LEU A CB    1 
ATOM   237   C  CG    . LEU A  1  32  ? -36.503  -7.853  24.020  1.00 74.10  ? 32  LEU A CG    1 
ATOM   238   C  CD1   . LEU A  1  32  ? -37.384  -9.052  24.409  1.00 72.63  ? 32  LEU A CD1   1 
ATOM   239   C  CD2   . LEU A  1  32  ? -35.061  -8.025  24.483  1.00 71.70  ? 32  LEU A CD2   1 
ATOM   240   N  N     . ILE A  1  33  ? -39.709  -6.123  22.859  1.00 75.55  ? 33  ILE A N     1 
ATOM   241   C  CA    . ILE A  1  33  ? -40.341  -5.058  23.619  1.00 71.55  ? 33  ILE A CA    1 
ATOM   242   C  C     . ILE A  1  33  ? -39.851  -4.970  25.059  1.00 73.87  ? 33  ILE A C     1 
ATOM   243   O  O     . ILE A  1  33  ? -39.526  -3.898  25.553  1.00 76.14  ? 33  ILE A O     1 
ATOM   244   C  CB    . ILE A  1  33  ? -41.859  -5.265  23.657  1.00 68.00  ? 33  ILE A CB    1 
ATOM   245   C  CG1   . ILE A  1  33  ? -42.419  -5.263  22.246  1.00 70.08  ? 33  ILE A CG1   1 
ATOM   246   C  CG2   . ILE A  1  33  ? -42.526  -4.173  24.460  1.00 74.02  ? 33  ILE A CG2   1 
ATOM   247   C  CD1   . ILE A  1  33  ? -42.392  -3.902  21.603  1.00 76.56  ? 33  ILE A CD1   1 
ATOM   248   N  N     . GLU A  1  34  ? -39.791  -6.113  25.728  1.00 81.13  ? 34  GLU A N     1 
ATOM   249   C  CA    . GLU A  1  34  ? -39.407  -6.152  27.127  1.00 84.23  ? 34  GLU A CA    1 
ATOM   250   C  C     . GLU A  1  34  ? -38.953  -7.555  27.504  1.00 75.41  ? 34  GLU A C     1 
ATOM   251   O  O     . GLU A  1  34  ? -39.389  -8.528  26.906  1.00 78.68  ? 34  GLU A O     1 
ATOM   252   C  CB    . GLU A  1  34  ? -40.592  -5.683  27.985  1.00 91.65  ? 34  GLU A CB    1 
ATOM   253   C  CG    . GLU A  1  34  ? -40.756  -6.334  29.350  1.00 100.61 ? 34  GLU A CG    1 
ATOM   254   C  CD    . GLU A  1  34  ? -40.999  -5.323  30.447  1.00 109.08 ? 34  GLU A CD    1 
ATOM   255   O  OE1   . GLU A  1  34  ? -42.007  -4.599  30.368  1.00 131.89 ? 34  GLU A OE1   1 
ATOM   256   O  OE2   . GLU A  1  34  ? -40.183  -5.254  31.387  1.00 111.82 ? 34  GLU A OE2   1 
ATOM   257   N  N     . ALA A  1  35  ? -38.101  -7.655  28.515  1.00 62.30  ? 35  ALA A N     1 
ATOM   258   C  CA    . ALA A  1  35  ? -37.678  -8.937  29.033  1.00 63.47  ? 35  ALA A CA    1 
ATOM   259   C  C     . ALA A  1  35  ? -37.733  -8.911  30.545  1.00 61.69  ? 35  ALA A C     1 
ATOM   260   O  O     . ALA A  1  35  ? -37.449  -7.889  31.156  1.00 65.29  ? 35  ALA A O     1 
ATOM   261   C  CB    . ALA A  1  35  ? -36.274  -9.244  28.572  1.00 64.85  ? 35  ALA A CB    1 
ATOM   262   N  N     . GLU A  1  36  ? -38.089  -10.034 31.154  1.00 57.04  ? 36  GLU A N     1 
ATOM   263   C  CA    . GLU A  1  36  ? -38.091  -10.125 32.589  1.00 59.37  ? 36  GLU A CA    1 
ATOM   264   C  C     . GLU A  1  36  ? -36.847  -10.837 33.040  1.00 63.22  ? 36  GLU A C     1 
ATOM   265   O  O     . GLU A  1  36  ? -36.107  -11.317 32.214  1.00 66.86  ? 36  GLU A O     1 
ATOM   266   C  CB    . GLU A  1  36  ? -39.339  -10.836 33.059  1.00 64.39  ? 36  GLU A CB    1 
ATOM   267   C  CG    . GLU A  1  36  ? -40.611  -10.033 32.752  1.00 71.99  ? 36  GLU A CG    1 
ATOM   268   C  CD    . GLU A  1  36  ? -41.866  -10.875 32.508  1.00 75.77  ? 36  GLU A CD    1 
ATOM   269   O  OE1   . GLU A  1  36  ? -42.185  -11.714 33.407  1.00 77.03  ? 36  GLU A OE1   1 
ATOM   270   O  OE2   . GLU A  1  36  ? -42.494  -10.688 31.425  1.00 72.20  ? 36  GLU A OE2   1 
ATOM   271   N  N     . ASP A  1  37  ? -36.628  -10.852 34.354  1.00 69.94  ? 37  ASP A N     1 
ATOM   272   C  CA    . ASP A  1  37  ? -35.408  -11.377 34.975  1.00 69.65  ? 37  ASP A CA    1 
ATOM   273   C  C     . ASP A  1  37  ? -35.260  -12.851 34.696  1.00 66.61  ? 37  ASP A C     1 
ATOM   274   O  O     . ASP A  1  37  ? -34.176  -13.344 34.417  1.00 69.36  ? 37  ASP A O     1 
ATOM   275   C  CB    . ASP A  1  37  ? -35.430  -11.139 36.481  1.00 79.78  ? 37  ASP A CB    1 
ATOM   276   C  CG    . ASP A  1  37  ? -34.620  -9.939  36.888  1.00 87.65  ? 37  ASP A CG    1 
ATOM   277   O  OD1   . ASP A  1  37  ? -34.228  -9.163  35.998  1.00 85.18  ? 37  ASP A OD1   1 
ATOM   278   O  OD2   . ASP A  1  37  ? -34.375  -9.774  38.099  1.00 102.16 ? 37  ASP A OD2   1 
ATOM   279   N  N     . ASN A  1  38  ? -36.380  -13.552 34.762  1.00 58.45  ? 38  ASN A N     1 
ATOM   280   C  CA    . ASN A  1  38  ? -36.507  -14.834 34.099  1.00 57.41  ? 38  ASN A CA    1 
ATOM   281   C  C     . ASN A  1  38  ? -36.554  -14.336 32.686  1.00 57.43  ? 38  ASN A C     1 
ATOM   282   O  O     . ASN A  1  38  ? -36.730  -13.141 32.478  1.00 65.57  ? 38  ASN A O     1 
ATOM   283   C  CB    . ASN A  1  38  ? -37.752  -15.638 34.482  1.00 64.80  ? 38  ASN A CB    1 
ATOM   284   C  CG    . ASN A  1  38  ? -38.941  -14.778 34.845  1.00 69.08  ? 38  ASN A CG    1 
ATOM   285   O  OD1   . ASN A  1  38  ? -39.489  -14.080 34.004  1.00 75.17  ? 38  ASN A OD1   1 
ATOM   286   N  ND2   . ASN A  1  38  ? -39.336  -14.815 36.097  1.00 72.96  ? 38  ASN A ND2   1 
ATOM   287   N  N     . MET A  1  39  ? -36.327  -15.192 31.715  1.00 54.34  ? 39  MET A N     1 
ATOM   288   C  CA    . MET A  1  39  ? -36.050  -14.709 30.384  1.00 55.48  ? 39  MET A CA    1 
ATOM   289   C  C     . MET A  1  39  ? -37.335  -14.537 29.604  1.00 59.66  ? 39  MET A C     1 
ATOM   290   O  O     . MET A  1  39  ? -37.313  -14.394 28.389  1.00 75.03  ? 39  MET A O     1 
ATOM   291   C  CB    . MET A  1  39  ? -35.122  -15.653 29.643  1.00 57.78  ? 39  MET A CB    1 
ATOM   292   C  CG    . MET A  1  39  ? -33.729  -15.697 30.229  1.00 59.80  ? 39  MET A CG    1 
ATOM   293   S  SD    . MET A  1  39  ? -32.695  -16.882 29.383  1.00 64.95  ? 39  MET A SD    1 
ATOM   294   C  CE    . MET A  1  39  ? -31.209  -16.711 30.345  1.00 72.99  ? 39  MET A CE    1 
ATOM   295   N  N     . ASN A  1  40  ? -38.462  -14.539 30.305  1.00 58.90  ? 40  ASN A N     1 
ATOM   296   C  CA    . ASN A  1  40  ? -39.742  -14.427 29.632  1.00 60.24  ? 40  ASN A CA    1 
ATOM   297   C  C     . ASN A  1  40  ? -39.671  -13.157 28.821  1.00 60.37  ? 40  ASN A C     1 
ATOM   298   O  O     . ASN A  1  40  ? -39.253  -12.120 29.305  1.00 60.38  ? 40  ASN A O     1 
ATOM   299   C  CB    . ASN A  1  40  ? -40.869  -14.287 30.647  1.00 61.29  ? 40  ASN A CB    1 
ATOM   300   C  CG    . ASN A  1  40  ? -41.127  -15.555 31.416  1.00 66.60  ? 40  ASN A CG    1 
ATOM   301   O  OD1   . ASN A  1  40  ? -40.500  -16.577 31.175  1.00 75.01  ? 40  ASN A OD1   1 
ATOM   302   N  ND2   . ASN A  1  40  ? -42.057  -15.496 32.349  1.00 68.00  ? 40  ASN A ND2   1 
ATOM   303   N  N     . CYS A  1  41  ? -40.085  -13.260 27.569  1.00 64.05  ? 41  CYS A N     1 
ATOM   304   C  CA    . CYS A  1  41  ? -39.900  -12.199 26.610  1.00 65.68  ? 41  CYS A CA    1 
ATOM   305   C  C     . CYS A  1  41  ? -41.183  -11.865 25.924  1.00 67.86  ? 41  CYS A C     1 
ATOM   306   O  O     . CYS A  1  41  ? -41.844  -12.737 25.398  1.00 59.21  ? 41  CYS A O     1 
ATOM   307   C  CB    . CYS A  1  41  ? -38.936  -12.646 25.523  1.00 63.94  ? 41  CYS A CB    1 
ATOM   308   S  SG    . CYS A  1  41  ? -37.212  -12.646 25.973  1.00 70.82  ? 41  CYS A SG    1 
ATOM   309   N  N     . GLN A  1  42  ? -41.506  -10.588 25.874  1.00 67.60  ? 42  GLN A N     1 
ATOM   310   C  CA    . GLN A  1  42  ? -42.529  -10.142 24.976  1.00 71.04  ? 42  GLN A CA    1 
ATOM   311   C  C     . GLN A  1  42  ? -41.846  -9.612  23.707  1.00 69.64  ? 42  GLN A C     1 
ATOM   312   O  O     . GLN A  1  42  ? -40.864  -8.846  23.791  1.00 66.47  ? 42  GLN A O     1 
ATOM   313   C  CB    . GLN A  1  42  ? -43.378  -9.076  25.644  1.00 83.73  ? 42  GLN A CB    1 
ATOM   314   C  CG    . GLN A  1  42  ? -44.653  -8.821  24.883  1.00 97.38  ? 42  GLN A CG    1 
ATOM   315   C  CD    . GLN A  1  42  ? -45.051  -7.367  24.910  1.00 104.59 ? 42  GLN A CD    1 
ATOM   316   O  OE1   . GLN A  1  42  ? -45.154  -6.749  25.979  1.00 95.16  ? 42  GLN A OE1   1 
ATOM   317   N  NE2   . GLN A  1  42  ? -45.253  -6.802  23.738  1.00 102.81 ? 42  GLN A NE2   1 
ATOM   318   N  N     . MET A  1  43  ? -42.344  -10.008 22.533  1.00 69.85  ? 43  MET A N     1 
ATOM   319   C  CA    . MET A  1  43  ? -41.814  -9.481  21.287  1.00 71.23  ? 43  MET A CA    1 
ATOM   320   C  C     . MET A  1  43  ? -42.919  -9.028  20.336  1.00 77.98  ? 43  MET A C     1 
ATOM   321   O  O     . MET A  1  43  ? -44.069  -9.485  20.467  1.00 86.25  ? 43  MET A O     1 
ATOM   322   C  CB    . MET A  1  43  ? -40.971  -10.545 20.643  1.00 73.67  ? 43  MET A CB    1 
ATOM   323   C  CG    . MET A  1  43  ? -39.761  -11.019 21.425  1.00 77.99  ? 43  MET A CG    1 
ATOM   324   S  SD    . MET A  1  43  ? -38.901  -12.474 20.752  1.00 80.48  ? 43  MET A SD    1 
ATOM   325   C  CE    . MET A  1  43  ? -38.143  -11.810 19.287  1.00 79.11  ? 43  MET A CE    1 
ATOM   326   N  N     . SER A  1  44  ? -42.571  -8.134  19.396  1.00 82.03  ? 44  SER A N     1 
ATOM   327   C  CA    . SER A  1  44  ? -43.476  -7.612  18.331  1.00 83.99  ? 44  SER A CA    1 
ATOM   328   C  C     . SER A  1  44  ? -42.942  -7.835  16.922  1.00 80.95  ? 44  SER A C     1 
ATOM   329   O  O     . SER A  1  44  ? -41.731  -7.806  16.726  1.00 86.40  ? 44  SER A O     1 
ATOM   330   C  CB    . SER A  1  44  ? -43.676  -6.110  18.486  1.00 82.41  ? 44  SER A CB    1 
ATOM   331   O  OG    . SER A  1  44  ? -44.436  -5.856  19.642  1.00 89.32  ? 44  SER A OG    1 
ATOM   332   N  N     . ASN A  1  45  ? -43.819  -8.026  15.948  1.00 78.31  ? 45  ASN A N     1 
ATOM   333   C  CA    . ASN A  1  45  ? -43.418  -8.071  14.529  1.00 88.80  ? 45  ASN A CA    1 
ATOM   334   C  C     . ASN A  1  45  ? -42.445  -9.167  14.274  1.00 82.31  ? 45  ASN A C     1 
ATOM   335   O  O     . ASN A  1  45  ? -41.302  -8.944  13.899  1.00 80.19  ? 45  ASN A O     1 
ATOM   336   C  CB    . ASN A  1  45  ? -42.767  -6.787  14.030  1.00 98.60  ? 45  ASN A CB    1 
ATOM   337   C  CG    . ASN A  1  45  ? -43.673  -5.607  14.182  1.00 119.51 ? 45  ASN A CG    1 
ATOM   338   O  OD1   . ASN A  1  45  ? -44.838  -5.618  13.772  1.00 122.54 ? 45  ASN A OD1   1 
ATOM   339   N  ND2   . ASN A  1  45  ? -43.167  -4.591  14.882  1.00 141.90 ? 45  ASN A ND2   1 
ATOM   340   N  N     . ILE A  1  46  ? -42.934  -10.379 14.486  1.00 80.16  ? 46  ILE A N     1 
ATOM   341   C  CA    . ILE A  1  46  ? -42.111  -11.559 14.585  1.00 71.60  ? 46  ILE A CA    1 
ATOM   342   C  C     . ILE A  1  46  ? -42.222  -12.398 13.339  1.00 64.20  ? 46  ILE A C     1 
ATOM   343   O  O     . ILE A  1  46  ? -43.314  -12.712 12.893  1.00 59.39  ? 46  ILE A O     1 
ATOM   344   C  CB    . ILE A  1  46  ? -42.588  -12.435 15.757  1.00 75.56  ? 46  ILE A CB    1 
ATOM   345   C  CG1   . ILE A  1  46  ? -42.483  -11.675 17.070  1.00 79.42  ? 46  ILE A CG1   1 
ATOM   346   C  CG2   . ILE A  1  46  ? -41.792  -13.720 15.833  1.00 79.70  ? 46  ILE A CG2   1 
ATOM   347   C  CD1   . ILE A  1  46  ? -41.078  -11.603 17.610  1.00 85.72  ? 46  ILE A CD1   1 
ATOM   348   N  N     . THR A  1  47  ? -41.083  -12.764 12.778  1.00 61.98  ? 47  THR A N     1 
ATOM   349   C  CA    . THR A  1  47  ? -41.064  -13.777 11.755  1.00 64.76  ? 47  THR A CA    1 
ATOM   350   C  C     . THR A  1  47  ? -40.702  -15.075 12.444  1.00 61.29  ? 47  THR A C     1 
ATOM   351   O  O     . THR A  1  47  ? -39.537  -15.347 12.703  1.00 59.11  ? 47  THR A O     1 
ATOM   352   C  CB    . THR A  1  47  ? -40.015  -13.463 10.683  1.00 73.45  ? 47  THR A CB    1 
ATOM   353   O  OG1   . THR A  1  47  ? -39.730  -12.061 10.691  1.00 79.42  ? 47  THR A OG1   1 
ATOM   354   C  CG2   . THR A  1  47  ? -40.511  -13.863 9.315   1.00 72.57  ? 47  THR A CG2   1 
ATOM   355   N  N     . VAL A  1  48  ? -41.708  -15.881 12.741  1.00 53.94  ? 48  VAL A N     1 
ATOM   356   C  CA    . VAL A  1  48  ? -41.476  -17.185 13.312  1.00 54.73  ? 48  VAL A CA    1 
ATOM   357   C  C     . VAL A  1  48  ? -40.967  -18.080 12.221  1.00 51.11  ? 48  VAL A C     1 
ATOM   358   O  O     . VAL A  1  48  ? -41.353  -17.931 11.074  1.00 49.71  ? 48  VAL A O     1 
ATOM   359   C  CB    . VAL A  1  48  ? -42.756  -17.794 13.873  1.00 66.75  ? 48  VAL A CB    1 
ATOM   360   C  CG1   . VAL A  1  48  ? -43.782  -17.947 12.772  1.00 75.47  ? 48  VAL A CG1   1 
ATOM   361   C  CG2   . VAL A  1  48  ? -42.458  -19.135 14.510  1.00 69.67  ? 48  VAL A CG2   1 
ATOM   362   N  N     . THR A  1  49  ? -40.113  -19.025 12.569  1.00 51.36  ? 49  THR A N     1 
ATOM   363   C  CA    . THR A  1  49  ? -39.639  -19.999 11.572  1.00 54.89  ? 49  THR A CA    1 
ATOM   364   C  C     . THR A  1  49  ? -39.817  -21.394 12.154  1.00 57.01  ? 49  THR A C     1 
ATOM   365   O  O     . THR A  1  49  ? -39.060  -21.797 13.025  1.00 56.51  ? 49  THR A O     1 
ATOM   366   C  CB    . THR A  1  49  ? -38.169  -19.770 11.177  1.00 54.24  ? 49  THR A CB    1 
ATOM   367   O  OG1   . THR A  1  49  ? -37.977  -18.380 10.844  1.00 56.82  ? 49  THR A OG1   1 
ATOM   368   C  CG2   . THR A  1  49  ? -37.715  -20.711 10.048  1.00 49.58  ? 49  THR A CG2   1 
ATOM   369   N  N     . TYR A  1  50  ? -40.830  -22.123 11.667  1.00 57.65  ? 50  TYR A N     1 
ATOM   370   C  CA    . TYR A  1  50  ? -41.246  -23.387 12.279  1.00 55.67  ? 50  TYR A CA    1 
ATOM   371   C  C     . TYR A  1  50  ? -40.169  -24.395 12.015  1.00 53.38  ? 50  TYR A C     1 
ATOM   372   O  O     . TYR A  1  50  ? -39.207  -24.133 11.255  1.00 48.88  ? 50  TYR A O     1 
ATOM   373   C  CB    . TYR A  1  50  ? -42.608  -23.857 11.735  1.00 61.66  ? 50  TYR A CB    1 
ATOM   374   C  CG    . TYR A  1  50  ? -43.738  -22.899 12.114  1.00 63.56  ? 50  TYR A CG    1 
ATOM   375   C  CD1   . TYR A  1  50  ? -44.086  -22.734 13.440  1.00 68.06  ? 50  TYR A CD1   1 
ATOM   376   C  CD2   . TYR A  1  50  ? -44.392  -22.136 11.190  1.00 63.05  ? 50  TYR A CD2   1 
ATOM   377   C  CE1   . TYR A  1  50  ? -45.046  -21.831 13.844  1.00 70.59  ? 50  TYR A CE1   1 
ATOM   378   C  CE2   . TYR A  1  50  ? -45.313  -21.207 11.597  1.00 65.59  ? 50  TYR A CE2   1 
ATOM   379   C  CZ    . TYR A  1  50  ? -45.663  -21.071 12.912  1.00 68.06  ? 50  TYR A CZ    1 
ATOM   380   O  OH    . TYR A  1  50  ? -46.666  -20.238 13.388  1.00 72.88  ? 50  TYR A OH    1 
ATOM   381   N  N     . ARG A  1  51  ? -40.298  -25.519 12.712  1.00 52.87  ? 51  ARG A N     1 
ATOM   382   C  CA    . ARG A  1  51  ? -39.290  -26.605 12.561  1.00 54.23  ? 51  ARG A CA    1 
ATOM   383   C  C     . ARG A  1  51  ? -38.994  -27.055 11.114  1.00 51.40  ? 51  ARG A C     1 
ATOM   384   O  O     . ARG A  1  51  ? -37.831  -27.221 10.752  1.00 45.72  ? 51  ARG A O     1 
ATOM   385   C  CB    . ARG A  1  51  ? -39.644  -27.844 13.432  1.00 57.68  ? 51  ARG A CB    1 
ATOM   386   C  CG    . ARG A  1  51  ? -39.757  -27.549 14.927  1.00 60.28  ? 51  ARG A CG    1 
ATOM   387   C  CD    . ARG A  1  51  ? -40.129  -28.763 15.721  1.00 62.78  ? 51  ARG A CD    1 
ATOM   388   N  NE    . ARG A  1  51  ? -38.849  -29.327 16.066  1.00 61.46  ? 51  ARG A NE    1 
ATOM   389   C  CZ    . ARG A  1  51  ? -38.680  -30.611 16.199  1.00 71.35  ? 51  ARG A CZ    1 
ATOM   390   N  NH1   . ARG A  1  51  ? -39.701  -31.465 16.043  1.00 80.60  ? 51  ARG A NH1   1 
ATOM   391   N  NH2   . ARG A  1  51  ? -37.462  -31.039 16.475  1.00 74.63  ? 51  ARG A NH2   1 
ATOM   392   N  N     . ASP A  1  52  ? -40.062  -27.185 10.328  1.00 55.05  ? 52  ASP A N     1 
ATOM   393   C  CA    . ASP A  1  52  ? -39.990  -27.518 8.909   1.00 59.86  ? 52  ASP A CA    1 
ATOM   394   C  C     . ASP A  1  52  ? -39.290  -26.544 7.929   1.00 60.60  ? 52  ASP A C     1 
ATOM   395   O  O     . ASP A  1  52  ? -38.725  -26.983 6.908   1.00 63.19  ? 52  ASP A O     1 
ATOM   396   C  CB    . ASP A  1  52  ? -41.353  -27.935 8.338   1.00 64.52  ? 52  ASP A CB    1 
ATOM   397   C  CG    . ASP A  1  52  ? -42.375  -26.858 8.411   1.00 70.03  ? 52  ASP A CG    1 
ATOM   398   O  OD1   . ASP A  1  52  ? -41.993  -25.679 8.210   1.00 72.84  ? 52  ASP A OD1   1 
ATOM   399   O  OD2   . ASP A  1  52  ? -43.550  -27.239 8.594   1.00 75.60  ? 52  ASP A OD2   1 
ATOM   400   N  N     . GLY A  1  53  ? -39.277  -25.252 8.249   1.00 61.87  ? 53  GLY A N     1 
ATOM   401   C  CA    . GLY A  1  53  ? -38.652  -24.215 7.400   1.00 61.41  ? 53  GLY A CA    1 
ATOM   402   C  C     . GLY A  1  53  ? -39.604  -23.105 6.971   1.00 59.08  ? 53  GLY A C     1 
ATOM   403   O  O     . GLY A  1  53  ? -39.161  -21.968 6.666   1.00 52.50  ? 53  GLY A O     1 
ATOM   404   N  N     . ARG A  1  54  ? -40.889  -23.447 6.983   1.00 59.43  ? 54  ARG A N     1 
ATOM   405   C  CA    . ARG A  1  54  ? -41.928  -22.467 6.788   1.00 67.89  ? 54  ARG A CA    1 
ATOM   406   C  C     . ARG A  1  54  ? -41.846  -21.339 7.824   1.00 66.70  ? 54  ARG A C     1 
ATOM   407   O  O     . ARG A  1  54  ? -41.498  -21.578 8.978   1.00 59.04  ? 54  ARG A O     1 
ATOM   408   C  CB    . ARG A  1  54  ? -43.306  -23.087 6.949   1.00 74.31  ? 54  ARG A CB    1 
ATOM   409   C  CG    . ARG A  1  54  ? -43.654  -24.126 5.906   1.00 76.77  ? 54  ARG A CG    1 
ATOM   410   C  CD    . ARG A  1  54  ? -45.177  -24.257 5.883   1.00 84.88  ? 54  ARG A CD    1 
ATOM   411   N  NE    . ARG A  1  54  ? -45.569  -25.585 6.299   1.00 85.66  ? 54  ARG A NE    1 
ATOM   412   C  CZ    . ARG A  1  54  ? -45.576  -26.649 5.531   1.00 94.54  ? 54  ARG A CZ    1 
ATOM   413   N  NH1   . ARG A  1  54  ? -45.318  -26.575 4.229   1.00 98.70  ? 54  ARG A NH1   1 
ATOM   414   N  NH2   . ARG A  1  54  ? -45.899  -27.799 6.094   1.00 106.34 ? 54  ARG A NH2   1 
ATOM   415   N  N     . VAL A  1  55  ? -42.232  -20.139 7.384   1.00 62.82  ? 55  VAL A N     1 
ATOM   416   C  CA    . VAL A  1  55  ? -42.261  -18.987 8.236   1.00 59.69  ? 55  VAL A CA    1 
ATOM   417   C  C     . VAL A  1  55  ? -43.671  -18.455 8.336   1.00 59.43  ? 55  VAL A C     1 
ATOM   418   O  O     . VAL A  1  55  ? -44.541  -18.739 7.516   1.00 62.86  ? 55  VAL A O     1 
ATOM   419   C  CB    . VAL A  1  55  ? -41.275  -17.927 7.765   1.00 60.52  ? 55  VAL A CB    1 
ATOM   420   C  CG1   . VAL A  1  55  ? -39.948  -18.566 7.355   1.00 65.82  ? 55  VAL A CG1   1 
ATOM   421   C  CG2   . VAL A  1  55  ? -41.806  -17.117 6.609   1.00 61.55  ? 55  VAL A CG2   1 
ATOM   422   N  N     . ALA A  1  56  ? -43.856  -17.585 9.306   1.00 57.80  ? 56  ALA A N     1 
ATOM   423   C  CA    . ALA A  1  56  ? -45.114  -16.897 9.476   1.00 60.16  ? 56  ALA A CA    1 
ATOM   424   C  C     . ALA A  1  56  ? -44.863  -15.494 10.069  1.00 61.34  ? 56  ALA A C     1 
ATOM   425   O  O     . ALA A  1  56  ? -43.716  -15.209 10.428  1.00 68.29  ? 56  ALA A O     1 
ATOM   426   C  CB    . ALA A  1  56  ? -46.018  -17.741 10.345  1.00 59.97  ? 56  ALA A CB    1 
ATOM   427   N  N     . GLN A  1  57  ? -45.882  -14.630 10.093  1.00 58.35  ? 57  GLN A N     1 
ATOM   428   C  CA    . GLN A  1  57  ? -45.778  -13.322 10.698  1.00 65.36  ? 57  GLN A CA    1 
ATOM   429   C  C     . GLN A  1  57  ? -46.643  -13.296 11.922  1.00 68.58  ? 57  GLN A C     1 
ATOM   430   O  O     . GLN A  1  57  ? -47.789  -13.725 11.842  1.00 72.57  ? 57  GLN A O     1 
ATOM   431   C  CB    . GLN A  1  57  ? -46.258  -12.283 9.725   1.00 72.48  ? 57  GLN A CB    1 
ATOM   432   C  CG    . GLN A  1  57  ? -45.326  -12.093 8.536   1.00 84.23  ? 57  GLN A CG    1 
ATOM   433   C  CD    . GLN A  1  57  ? -43.952  -11.636 8.941   1.00 86.58  ? 57  GLN A CD    1 
ATOM   434   O  OE1   . GLN A  1  57  ? -42.950  -12.162 8.438   1.00 90.62  ? 57  GLN A OE1   1 
ATOM   435   N  NE2   . GLN A  1  57  ? -43.896  -10.739 9.927   1.00 91.31  ? 57  GLN A NE2   1 
ATOM   436   N  N     . LEU A  1  58  ? -46.143  -12.769 13.030  1.00 69.41  ? 58  LEU A N     1 
ATOM   437   C  CA    . LEU A  1  58  ? -46.976  -12.690 14.215  1.00 72.91  ? 58  LEU A CA    1 
ATOM   438   C  C     . LEU A  1  58  ? -46.856  -11.299 14.815  1.00 81.14  ? 58  LEU A C     1 
ATOM   439   O  O     . LEU A  1  58  ? -45.779  -10.656 14.773  1.00 90.61  ? 58  LEU A O     1 
ATOM   440   C  CB    . LEU A  1  58  ? -46.608  -13.768 15.219  1.00 75.03  ? 58  LEU A CB    1 
ATOM   441   C  CG    . LEU A  1  58  ? -46.545  -15.213 14.728  1.00 75.18  ? 58  LEU A CG    1 
ATOM   442   C  CD1   . LEU A  1  58  ? -46.056  -16.149 15.807  1.00 72.85  ? 58  LEU A CD1   1 
ATOM   443   C  CD2   . LEU A  1  58  ? -47.905  -15.680 14.222  1.00 84.23  ? 58  LEU A CD2   1 
ATOM   444   N  N     . GLU A  1  59  ? -47.977  -10.819 15.357  1.00 85.85  ? 59  GLU A N     1 
ATOM   445   C  CA    . GLU A  1  59  ? -48.065  -9.433  15.802  1.00 90.52  ? 59  GLU A CA    1 
ATOM   446   C  C     . GLU A  1  59  ? -47.388  -9.261  17.144  1.00 82.90  ? 59  GLU A C     1 
ATOM   447   O  O     . GLU A  1  59  ? -46.427  -8.502  17.304  1.00 71.26  ? 59  GLU A O     1 
ATOM   448   C  CB    . GLU A  1  59  ? -49.527  -9.039  15.903  1.00 109.94 ? 59  GLU A CB    1 
ATOM   449   C  CG    . GLU A  1  59  ? -50.133  -8.799  14.538  1.00 121.44 ? 59  GLU A CG    1 
ATOM   450   C  CD    . GLU A  1  59  ? -49.860  -7.385  14.035  1.00 130.84 ? 59  GLU A CD    1 
ATOM   451   O  OE1   . GLU A  1  59  ? -50.017  -6.396  14.790  1.00 134.68 ? 59  GLU A OE1   1 
ATOM   452   O  OE2   . GLU A  1  59  ? -49.531  -7.227  12.843  1.00 145.88 ? 59  GLU A OE2   1 
ATOM   453   N  N     . GLN A  1  60  ? -47.927  -10.006 18.103  1.00 83.63  ? 60  GLN A N     1 
ATOM   454   C  CA    . GLN A  1  60  ? -47.505  -9.909  19.485  1.00 83.94  ? 60  GLN A CA    1 
ATOM   455   C  C     . GLN A  1  60  ? -47.354  -11.304 20.025  1.00 73.97  ? 60  GLN A C     1 
ATOM   456   O  O     . GLN A  1  60  ? -48.295  -12.118 19.930  1.00 76.98  ? 60  GLN A O     1 
ATOM   457   C  CB    . GLN A  1  60  ? -48.566  -9.160  20.286  1.00 95.50  ? 60  GLN A CB    1 
ATOM   458   C  CG    . GLN A  1  60  ? -48.748  -7.713  19.861  1.00 102.65 ? 60  GLN A CG    1 
ATOM   459   C  CD    . GLN A  1  60  ? -47.620  -6.835  20.343  1.00 109.08 ? 60  GLN A CD    1 
ATOM   460   O  OE1   . GLN A  1  60  ? -46.498  -7.293  20.618  1.00 115.10 ? 60  GLN A OE1   1 
ATOM   461   N  NE2   . GLN A  1  60  ? -47.927  -5.556  20.499  1.00 117.57 ? 60  GLN A NE2   1 
ATOM   462   N  N     . VAL A  1  61  ? -46.199  -11.550 20.624  1.00 64.19  ? 61  VAL A N     1 
ATOM   463   C  CA    . VAL A  1  61  ? -45.953  -12.828 21.279  1.00 60.27  ? 61  VAL A CA    1 
ATOM   464   C  C     . VAL A  1  61  ? -45.344  -12.580 22.643  1.00 55.40  ? 61  VAL A C     1 
ATOM   465   O  O     . VAL A  1  61  ? -44.700  -11.546 22.876  1.00 49.26  ? 61  VAL A O     1 
ATOM   466   C  CB    . VAL A  1  61  ? -44.956  -13.708 20.500  1.00 64.46  ? 61  VAL A CB    1 
ATOM   467   C  CG1   . VAL A  1  61  ? -45.445  -14.120 19.121  1.00 64.12  ? 61  VAL A CG1   1 
ATOM   468   C  CG2   . VAL A  1  61  ? -43.600  -13.005 20.316  1.00 67.84  ? 61  VAL A CG2   1 
ATOM   469   N  N     . TYR A  1  62  ? -45.483  -13.605 23.472  1.00 53.42  ? 62  TYR A N     1 
ATOM   470   C  CA    . TYR A  1  62  ? -44.777  -13.685 24.755  1.00 56.16  ? 62  TYR A CA    1 
ATOM   471   C  C     . TYR A  1  62  ? -44.260  -15.107 24.989  1.00 60.39  ? 62  TYR A C     1 
ATOM   472   O  O     . TYR A  1  62  ? -45.003  -16.090 24.758  1.00 61.90  ? 62  TYR A O     1 
ATOM   473   C  CB    . TYR A  1  62  ? -45.763  -13.347 25.829  1.00 55.55  ? 62  TYR A CB    1 
ATOM   474   C  CG    . TYR A  1  62  ? -45.237  -13.192 27.209  1.00 52.80  ? 62  TYR A CG    1 
ATOM   475   C  CD1   . TYR A  1  62  ? -44.856  -11.941 27.689  1.00 51.62  ? 62  TYR A CD1   1 
ATOM   476   C  CD2   . TYR A  1  62  ? -45.243  -14.260 28.076  1.00 52.83  ? 62  TYR A CD2   1 
ATOM   477   C  CE1   . TYR A  1  62  ? -44.393  -11.804 28.983  1.00 50.96  ? 62  TYR A CE1   1 
ATOM   478   C  CE2   . TYR A  1  62  ? -44.829  -14.112 29.402  1.00 55.14  ? 62  TYR A CE2   1 
ATOM   479   C  CZ    . TYR A  1  62  ? -44.378  -12.902 29.843  1.00 51.43  ? 62  TYR A CZ    1 
ATOM   480   O  OH    . TYR A  1  62  ? -43.950  -12.841 31.140  1.00 49.73  ? 62  TYR A OH    1 
ATOM   481   N  N     . ILE A  1  63  ? -42.983  -15.221 25.386  1.00 60.85  ? 63  ILE A N     1 
ATOM   482   C  CA    . ILE A  1  63  ? -42.267  -16.523 25.441  1.00 56.74  ? 63  ILE A CA    1 
ATOM   483   C  C     . ILE A  1  63  ? -41.755  -16.795 26.855  1.00 51.31  ? 63  ILE A C     1 
ATOM   484   O  O     . ILE A  1  63  ? -41.127  -15.908 27.447  1.00 47.93  ? 63  ILE A O     1 
ATOM   485   C  CB    . ILE A  1  63  ? -41.069  -16.555 24.495  1.00 57.21  ? 63  ILE A CB    1 
ATOM   486   C  CG1   . ILE A  1  63  ? -41.430  -15.848 23.186  1.00 59.74  ? 63  ILE A CG1   1 
ATOM   487   C  CG2   . ILE A  1  63  ? -40.659  -18.000 24.248  1.00 57.63  ? 63  ILE A CG2   1 
ATOM   488   C  CD1   . ILE A  1  63  ? -40.424  -15.999 22.073  1.00 65.57  ? 63  ILE A CD1   1 
ATOM   489   N  N     . ARG A  1  64  ? -42.084  -17.976 27.389  1.00 46.67  ? 64  ARG A N     1 
ATOM   490   C  CA    . ARG A  1  64  ? -41.624  -18.388 28.705  1.00 47.36  ? 64  ARG A CA    1 
ATOM   491   C  C     . ARG A  1  64  ? -40.102  -18.577 28.716  1.00 47.21  ? 64  ARG A C     1 
ATOM   492   O  O     . ARG A  1  64  ? -39.525  -19.164 27.798  1.00 47.08  ? 64  ARG A O     1 
ATOM   493   C  CB    . ARG A  1  64  ? -42.287  -19.666 29.162  1.00 47.55  ? 64  ARG A CB    1 
ATOM   494   C  CG    . ARG A  1  64  ? -41.940  -20.085 30.582  1.00 49.89  ? 64  ARG A CG    1 
ATOM   495   C  CD    . ARG A  1  64  ? -43.009  -21.006 31.165  1.00 52.30  ? 64  ARG A CD    1 
ATOM   496   N  NE    . ARG A  1  64  ? -42.602  -21.803 32.325  1.00 57.16  ? 64  ARG A NE    1 
ATOM   497   C  CZ    . ARG A  1  64  ? -42.836  -21.552 33.604  1.00 60.86  ? 64  ARG A CZ    1 
ATOM   498   N  NH1   . ARG A  1  64  ? -43.511  -20.473 33.964  1.00 67.42  ? 64  ARG A NH1   1 
ATOM   499   N  NH2   . ARG A  1  64  ? -42.361  -22.367 34.545  1.00 62.68  ? 64  ARG A NH2   1 
ATOM   500   N  N     . GLY A  1  65  ? -39.443  -18.000 29.711  1.00 47.89  ? 65  GLY A N     1 
ATOM   501   C  CA    . GLY A  1  65  ? -37.994  -18.010 29.766  1.00 51.79  ? 65  GLY A CA    1 
ATOM   502   C  C     . GLY A  1  65  ? -37.440  -19.426 29.881  1.00 54.52  ? 65  GLY A C     1 
ATOM   503   O  O     . GLY A  1  65  ? -36.453  -19.762 29.215  1.00 52.97  ? 65  GLY A O     1 
ATOM   504   N  N     . SER A  1  66  ? -38.126  -20.237 30.687  1.00 52.34  ? 66  SER A N     1 
ATOM   505   C  CA    . SER A  1  66  ? -37.740  -21.590 30.914  1.00 53.36  ? 66  SER A CA    1 
ATOM   506   C  C     . SER A  1  66  ? -37.746  -22.372 29.612  1.00 53.40  ? 66  SER A C     1 
ATOM   507   O  O     . SER A  1  66  ? -37.162  -23.458 29.570  1.00 63.72  ? 66  SER A O     1 
ATOM   508   C  CB    . SER A  1  66  ? -38.646  -22.244 31.995  1.00 58.14  ? 66  SER A CB    1 
ATOM   509   O  OG    . SER A  1  66  ? -39.876  -22.770 31.527  1.00 57.95  ? 66  SER A OG    1 
ATOM   510   N  N     . LYS A  1  67  ? -38.407  -21.891 28.567  1.00 49.25  ? 67  LYS A N     1 
ATOM   511   C  CA    . LYS A  1  67  ? -38.449  -22.601 27.306  1.00 48.79  ? 67  LYS A CA    1 
ATOM   512   C  C     . LYS A  1  67  ? -37.556  -21.982 26.215  1.00 50.70  ? 67  LYS A C     1 
ATOM   513   O  O     . LYS A  1  67  ? -37.783  -22.195 25.023  1.00 55.63  ? 67  LYS A O     1 
ATOM   514   C  CB    . LYS A  1  67  ? -39.879  -22.635 26.820  1.00 50.82  ? 67  LYS A CB    1 
ATOM   515   C  CG    . LYS A  1  67  ? -40.908  -23.037 27.867  1.00 53.03  ? 67  LYS A CG    1 
ATOM   516   C  CD    . LYS A  1  67  ? -40.984  -24.537 27.999  1.00 54.22  ? 67  LYS A CD    1 
ATOM   517   C  CE    . LYS A  1  67  ? -41.809  -24.894 29.216  1.00 52.21  ? 67  LYS A CE    1 
ATOM   518   N  NZ    . LYS A  1  67  ? -41.881  -26.373 29.425  1.00 51.31  ? 67  LYS A NZ    1 
ATOM   519   N  N     . ILE A  1  68  ? -36.540  -21.218 26.581  1.00 47.95  ? 68  ILE A N     1 
ATOM   520   C  CA    . ILE A  1  68  ? -35.645  -20.647 25.615  1.00 48.15  ? 68  ILE A CA    1 
ATOM   521   C  C     . ILE A  1  68  ? -34.273  -21.339 25.618  1.00 50.67  ? 68  ILE A C     1 
ATOM   522   O  O     . ILE A  1  68  ? -33.671  -21.543 26.655  1.00 50.08  ? 68  ILE A O     1 
ATOM   523   C  CB    . ILE A  1  68  ? -35.462  -19.164 25.899  1.00 48.86  ? 68  ILE A CB    1 
ATOM   524   C  CG1   . ILE A  1  68  ? -36.778  -18.446 25.681  1.00 50.74  ? 68  ILE A CG1   1 
ATOM   525   C  CG2   . ILE A  1  68  ? -34.417  -18.574 24.961  1.00 49.72  ? 68  ILE A CG2   1 
ATOM   526   C  CD1   . ILE A  1  68  ? -36.700  -16.952 25.923  1.00 53.77  ? 68  ILE A CD1   1 
ATOM   527   N  N     . ARG A  1  69  ? -33.783  -21.687 24.427  1.00 53.28  ? 69  ARG A N     1 
ATOM   528   C  CA    . ARG A  1  69  ? -32.452  -22.205 24.264  1.00 52.28  ? 69  ARG A CA    1 
ATOM   529   C  C     . ARG A  1  69  ? -31.471  -21.095 24.357  1.00 50.39  ? 69  ARG A C     1 
ATOM   530   O  O     . ARG A  1  69  ? -30.588  -21.148 25.184  1.00 58.78  ? 69  ARG A O     1 
ATOM   531   C  CB    . ARG A  1  69  ? -32.284  -22.949 22.963  1.00 56.37  ? 69  ARG A CB    1 
ATOM   532   C  CG    . ARG A  1  69  ? -32.898  -24.333 23.026  1.00 66.73  ? 69  ARG A CG    1 
ATOM   533   C  CD    . ARG A  1  69  ? -31.911  -25.338 22.411  1.00 77.79  ? 69  ARG A CD    1 
ATOM   534   N  NE    . ARG A  1  69  ? -32.585  -26.600 22.112  1.00 80.18  ? 69  ARG A NE    1 
ATOM   535   C  CZ    . ARG A  1  69  ? -33.496  -26.769 21.149  1.00 80.38  ? 69  ARG A CZ    1 
ATOM   536   N  NH1   . ARG A  1  69  ? -33.918  -25.787 20.351  1.00 80.21  ? 69  ARG A NH1   1 
ATOM   537   N  NH2   . ARG A  1  69  ? -33.987  -27.982 20.935  1.00 87.18  ? 69  ARG A NH2   1 
ATOM   538   N  N     . PHE A  1  70  ? -31.588  -20.121 23.479  1.00 48.04  ? 70  PHE A N     1 
ATOM   539   C  CA    . PHE A  1  70  ? -30.650  -19.012 23.427  1.00 47.07  ? 70  PHE A CA    1 
ATOM   540   C  C     . PHE A  1  70  ? -31.214  -17.876 22.642  1.00 50.03  ? 70  PHE A C     1 
ATOM   541   O  O     . PHE A  1  70  ? -32.156  -18.085 21.877  1.00 63.34  ? 70  PHE A O     1 
ATOM   542   C  CB    . PHE A  1  70  ? -29.380  -19.394 22.727  1.00 46.97  ? 70  PHE A CB    1 
ATOM   543   C  CG    . PHE A  1  70  ? -29.565  -19.722 21.278  1.00 48.07  ? 70  PHE A CG    1 
ATOM   544   C  CD1   . PHE A  1  70  ? -29.910  -21.007 20.887  1.00 51.19  ? 70  PHE A CD1   1 
ATOM   545   C  CD2   . PHE A  1  70  ? -29.332  -18.783 20.307  1.00 49.30  ? 70  PHE A CD2   1 
ATOM   546   C  CE1   . PHE A  1  70  ? -30.100  -21.321 19.556  1.00 54.07  ? 70  PHE A CE1   1 
ATOM   547   C  CE2   . PHE A  1  70  ? -29.483  -19.093 18.962  1.00 53.69  ? 70  PHE A CE2   1 
ATOM   548   C  CZ    . PHE A  1  70  ? -29.893  -20.358 18.579  1.00 55.48  ? 70  PHE A CZ    1 
ATOM   549   N  N     . LEU A  1  71  ? -30.669  -16.690 22.834  1.00 50.08  ? 71  LEU A N     1 
ATOM   550   C  CA    . LEU A  1  71  ? -31.072  -15.534 22.094  1.00 52.06  ? 71  LEU A CA    1 
ATOM   551   C  C     . LEU A  1  71  ? -29.866  -14.992 21.352  1.00 55.98  ? 71  LEU A C     1 
ATOM   552   O  O     . LEU A  1  71  ? -28.714  -15.190 21.755  1.00 56.69  ? 71  LEU A O     1 
ATOM   553   C  CB    . LEU A  1  71  ? -31.591  -14.451 22.989  1.00 54.93  ? 71  LEU A CB    1 
ATOM   554   C  CG    . LEU A  1  71  ? -32.847  -14.874 23.743  1.00 60.00  ? 71  LEU A CG    1 
ATOM   555   C  CD1   . LEU A  1  71  ? -32.529  -14.953 25.236  1.00 65.35  ? 71  LEU A CD1   1 
ATOM   556   C  CD2   . LEU A  1  71  ? -34.044  -13.951 23.538  1.00 61.63  ? 71  LEU A CD2   1 
ATOM   557   N  N     . ILE A  1  72  ? -30.154  -14.283 20.261  1.00 57.61  ? 72  ILE A N     1 
ATOM   558   C  CA    . ILE A  1  72  ? -29.157  -13.543 19.530  1.00 54.22  ? 72  ILE A CA    1 
ATOM   559   C  C     . ILE A  1  72  ? -29.475  -12.064 19.741  1.00 52.85  ? 72  ILE A C     1 
ATOM   560   O  O     . ILE A  1  72  ? -30.388  -11.542 19.154  1.00 50.17  ? 72  ILE A O     1 
ATOM   561   C  CB    . ILE A  1  72  ? -29.127  -13.880 18.049  1.00 51.51  ? 72  ILE A CB    1 
ATOM   562   C  CG1   . ILE A  1  72  ? -28.935  -15.361 17.846  1.00 52.10  ? 72  ILE A CG1   1 
ATOM   563   C  CG2   . ILE A  1  72  ? -27.957  -13.156 17.420  1.00 54.27  ? 72  ILE A CG2   1 
ATOM   564   C  CD1   . ILE A  1  72  ? -29.048  -15.800 16.391  1.00 55.03  ? 72  ILE A CD1   1 
ATOM   565   N  N     . LEU A  1  73  ? -28.573  -11.397 20.440  1.00 55.88  ? 73  LEU A N     1 
ATOM   566   C  CA    . LEU A  1  73  ? -28.649  -9.980  20.622  1.00 57.90  ? 73  LEU A CA    1 
ATOM   567   C  C     . LEU A  1  73  ? -27.750  -9.165  19.665  1.00 60.81  ? 73  LEU A C     1 
ATOM   568   O  O     . LEU A  1  73  ? -26.942  -9.755  18.877  1.00 61.47  ? 73  LEU A O     1 
ATOM   569   C  CB    . LEU A  1  73  ? -28.268  -9.662  22.040  1.00 57.48  ? 73  LEU A CB    1 
ATOM   570   C  CG    . LEU A  1  73  ? -28.935  -10.554 23.061  1.00 58.31  ? 73  LEU A CG    1 
ATOM   571   C  CD1   . LEU A  1  73  ? -28.606  -10.185 24.495  1.00 59.92  ? 73  LEU A CD1   1 
ATOM   572   C  CD2   . LEU A  1  73  ? -30.429  -10.623 22.912  1.00 58.38  ? 73  LEU A CD2   1 
ATOM   573   N  N     . PRO A  1  74  ? -27.978  -7.825  19.670  1.00 58.69  ? 74  PRO A N     1 
ATOM   574   C  CA    . PRO A  1  74  ? -27.319  -6.956  18.697  1.00 61.87  ? 74  PRO A CA    1 
ATOM   575   C  C     . PRO A  1  74  ? -25.864  -6.806  19.013  1.00 66.25  ? 74  PRO A C     1 
ATOM   576   O  O     . PRO A  1  74  ? -25.586  -6.676  20.205  1.00 68.51  ? 74  PRO A O     1 
ATOM   577   C  CB    . PRO A  1  74  ? -27.996  -5.620  18.922  1.00 60.51  ? 74  PRO A CB    1 
ATOM   578   C  CG    . PRO A  1  74  ? -29.347  -5.956  19.415  1.00 60.20  ? 74  PRO A CG    1 
ATOM   579   C  CD    . PRO A  1  74  ? -29.314  -7.300  20.021  1.00 58.39  ? 74  PRO A CD    1 
ATOM   580   N  N     . ASP A  1  75  ? -24.972  -6.819  18.009  1.00 66.43  ? 75  ASP A N     1 
ATOM   581   C  CA    . ASP A  1  75  ? -23.534  -6.918  18.319  1.00 68.52  ? 75  ASP A CA    1 
ATOM   582   C  C     . ASP A  1  75  ? -23.039  -5.757  19.127  1.00 70.95  ? 75  ASP A C     1 
ATOM   583   O  O     . ASP A  1  75  ? -22.173  -5.941  19.984  1.00 76.08  ? 75  ASP A O     1 
ATOM   584   C  CB    . ASP A  1  75  ? -22.639  -7.044  17.122  1.00 69.95  ? 75  ASP A CB    1 
ATOM   585   C  CG    . ASP A  1  75  ? -22.956  -8.242  16.300  1.00 79.13  ? 75  ASP A CG    1 
ATOM   586   O  OD1   . ASP A  1  75  ? -23.434  -9.273  16.840  1.00 82.57  ? 75  ASP A OD1   1 
ATOM   587   O  OD2   . ASP A  1  75  ? -22.697  -8.158  15.063  1.00 89.20  ? 75  ASP A OD2   1 
ATOM   588   N  N     . MET A  1  76  ? -23.651  -4.592  18.932  1.00 73.34  ? 76  MET A N     1 
ATOM   589   C  CA    . MET A  1  76  ? -23.287  -3.393  19.720  1.00 72.51  ? 76  MET A CA    1 
ATOM   590   C  C     . MET A  1  76  ? -23.246  -3.646  21.221  1.00 63.51  ? 76  MET A C     1 
ATOM   591   O  O     . MET A  1  76  ? -22.417  -3.057  21.925  1.00 60.67  ? 76  MET A O     1 
ATOM   592   C  CB    . MET A  1  76  ? -24.206  -2.195  19.381  1.00 75.97  ? 76  MET A CB    1 
ATOM   593   C  CG    . MET A  1  76  ? -23.816  -0.844  19.950  1.00 80.36  ? 76  MET A CG    1 
ATOM   594   S  SD    . MET A  1  76  ? -22.074  -0.311  19.947  1.00 86.84  ? 76  MET A SD    1 
ATOM   595   C  CE    . MET A  1  76  ? -21.662  -0.786  18.246  1.00 95.25  ? 76  MET A CE    1 
ATOM   596   N  N     . LEU A  1  77  ? -24.114  -4.537  21.691  1.00 58.44  ? 77  LEU A N     1 
ATOM   597   C  CA    . LEU A  1  77  ? -24.196  -4.798  23.101  1.00 59.91  ? 77  LEU A CA    1 
ATOM   598   C  C     . LEU A  1  77  ? -22.929  -5.296  23.742  1.00 59.94  ? 77  LEU A C     1 
ATOM   599   O  O     . LEU A  1  77  ? -22.725  -5.023  24.931  1.00 55.09  ? 77  LEU A O     1 
ATOM   600   C  CB    . LEU A  1  77  ? -25.277  -5.771  23.430  1.00 61.89  ? 77  LEU A CB    1 
ATOM   601   C  CG    . LEU A  1  77  ? -26.639  -5.081  23.241  1.00 66.32  ? 77  LEU A CG    1 
ATOM   602   C  CD1   . LEU A  1  77  ? -27.671  -6.184  23.192  1.00 70.19  ? 77  LEU A CD1   1 
ATOM   603   C  CD2   . LEU A  1  77  ? -27.070  -4.174  24.375  1.00 67.92  ? 77  LEU A CD2   1 
ATOM   604   N  N     . LYS A  1  78  ? -22.041  -5.885  22.948  1.00 63.01  ? 78  LYS A N     1 
ATOM   605   C  CA    . LYS A  1  78  ? -20.703  -6.252  23.458  1.00 72.26  ? 78  LYS A CA    1 
ATOM   606   C  C     . LYS A  1  78  ? -19.843  -5.101  23.942  1.00 75.44  ? 78  LYS A C     1 
ATOM   607   O  O     . LYS A  1  78  ? -18.856  -5.314  24.639  1.00 82.85  ? 78  LYS A O     1 
ATOM   608   C  CB    . LYS A  1  78  ? -19.871  -7.048  22.452  1.00 72.43  ? 78  LYS A CB    1 
ATOM   609   C  CG    . LYS A  1  78  ? -19.494  -6.359  21.170  1.00 77.43  ? 78  LYS A CG    1 
ATOM   610   C  CD    . LYS A  1  78  ? -18.646  -7.257  20.270  1.00 82.79  ? 78  LYS A CD    1 
ATOM   611   C  CE    . LYS A  1  78  ? -18.254  -6.582  18.970  1.00 93.42  ? 78  LYS A CE    1 
ATOM   612   N  NZ    . LYS A  1  78  ? -17.431  -7.533  18.162  1.00 102.91 ? 78  LYS A NZ    1 
ATOM   613   N  N     . ASN A  1  79  ? -20.263  -3.888  23.610  1.00 78.94  ? 79  ASN A N     1 
ATOM   614   C  CA    . ASN A  1  79  ? -19.582  -2.693  24.040  1.00 81.00  ? 79  ASN A CA    1 
ATOM   615   C  C     . ASN A  1  79  ? -20.297  -2.052  25.196  1.00 82.06  ? 79  ASN A C     1 
ATOM   616   O  O     . ASN A  1  79  ? -19.945  -0.935  25.571  1.00 88.68  ? 79  ASN A O     1 
ATOM   617   C  CB    . ASN A  1  79  ? -19.462  -1.688  22.894  1.00 86.77  ? 79  ASN A CB    1 
ATOM   618   C  CG    . ASN A  1  79  ? -18.721  -2.249  21.682  1.00 90.88  ? 79  ASN A CG    1 
ATOM   619   O  OD1   . ASN A  1  79  ? -19.298  -2.329  20.582  1.00 96.10  ? 79  ASN A OD1   1 
ATOM   620   N  ND2   . ASN A  1  79  ? -17.472  -2.688  21.880  1.00 88.31  ? 79  ASN A ND2   1 
ATOM   621   N  N     . ALA A  1  80  ? -21.216  -2.785  25.801  1.00 81.24  ? 80  ALA A N     1 
ATOM   622   C  CA    . ALA A  1  80  ? -21.949  -2.302  26.955  1.00 86.01  ? 80  ALA A CA    1 
ATOM   623   C  C     . ALA A  1  80  ? -21.029  -2.215  28.165  1.00 90.07  ? 80  ALA A C     1 
ATOM   624   O  O     . ALA A  1  80  ? -19.987  -2.865  28.212  1.00 84.93  ? 80  ALA A O     1 
ATOM   625   C  CB    . ALA A  1  80  ? -23.132  -3.206  27.245  1.00 87.57  ? 80  ALA A CB    1 
ATOM   626   N  N     . PRO A  1  81  ? -21.456  -1.339  29.176  1.00 92.09  ? 81  PRO A N     1 
ATOM   627   C  CA    . PRO A  1  81  ? -20.490  -1.210  30.285  1.00 91.60  ? 81  PRO A CA    1 
ATOM   628   C  C     . PRO A  1  81  ? -20.217  -2.501  31.046  1.00 93.23  ? 81  PRO A C     1 
ATOM   629   O  O     . PRO A  1  81  ? -19.093  -2.720  31.485  1.00 97.64  ? 81  PRO A O     1 
ATOM   630   C  CB    . PRO A  1  81  ? -21.135  -0.182  31.216  1.00 89.72  ? 81  PRO A CB    1 
ATOM   631   C  CG    . PRO A  1  81  ? -22.579  -0.334  31.007  1.00 88.38  ? 81  PRO A CG    1 
ATOM   632   C  CD    . PRO A  1  81  ? -22.659  -0.435  29.533  1.00 90.39  ? 81  PRO A CD    1 
ATOM   633   N  N     . MET A  1  82  ? -21.239  -3.324  31.224  1.00 89.52  ? 82  MET A N     1 
ATOM   634   C  CA    . MET A  1  82  ? -21.138  -4.525  32.054  1.00 85.37  ? 82  MET A CA    1 
ATOM   635   C  C     . MET A  1  82  ? -20.093  -5.505  31.546  1.00 83.08  ? 82  MET A C     1 
ATOM   636   O  O     . MET A  1  82  ? -19.413  -6.152  32.333  1.00 85.82  ? 82  MET A O     1 
ATOM   637   C  CB    . MET A  1  82  ? -22.488  -5.238  32.153  1.00 85.25  ? 82  MET A CB    1 
ATOM   638   C  CG    . MET A  1  82  ? -23.315  -5.240  30.883  1.00 89.67  ? 82  MET A CG    1 
ATOM   639   S  SD    . MET A  1  82  ? -24.755  -4.179  31.045  1.00 106.79 ? 82  MET A SD    1 
ATOM   640   C  CE    . MET A  1  82  ? -25.069  -3.759  29.342  1.00 119.46 ? 82  MET A CE    1 
ATOM   641   N  N     . LEU A  1  83  ? -19.990  -5.640  30.232  1.00 77.85  ? 83  LEU A N     1 
ATOM   642   C  CA    . LEU A  1  83  ? -19.120  -6.645  29.645  1.00 78.36  ? 83  LEU A CA    1 
ATOM   643   C  C     . LEU A  1  83  ? -17.654  -6.254  29.754  1.00 91.25  ? 83  LEU A C     1 
ATOM   644   O  O     . LEU A  1  83  ? -16.807  -6.784  29.043  1.00 91.48  ? 83  LEU A O     1 
ATOM   645   C  CB    . LEU A  1  83  ? -19.499  -6.879  28.188  1.00 75.57  ? 83  LEU A CB    1 
ATOM   646   C  CG    . LEU A  1  83  ? -20.907  -7.428  27.981  1.00 70.30  ? 83  LEU A CG    1 
ATOM   647   C  CD1   . LEU A  1  83  ? -21.126  -7.835  26.541  1.00 64.46  ? 83  LEU A CD1   1 
ATOM   648   C  CD2   . LEU A  1  83  ? -21.161  -8.602  28.900  1.00 72.18  ? 83  LEU A CD2   1 
ATOM   649   N  N     . LYS A  1  84  ? -17.362  -5.330  30.661  1.00 104.50 ? 84  LYS A N     1 
ATOM   650   C  CA    . LYS A  1  84  ? -15.996  -4.877  30.884  1.00 101.33 ? 84  LYS A CA    1 
ATOM   651   C  C     . LYS A  1  84  ? -15.731  -4.681  32.370  1.00 92.73  ? 84  LYS A C     1 
ATOM   652   O  O     . LYS A  1  84  ? -15.690  -5.643  33.136  1.00 81.47  ? 84  LYS A O     1 
ATOM   653   C  CB    . LYS A  1  84  ? -15.750  -3.568  30.139  1.00 107.10 ? 84  LYS A CB    1 
ATOM   654   C  CG    . LYS A  1  84  ? -16.592  -3.404  28.887  1.00 110.26 ? 84  LYS A CG    1 
ATOM   655   C  CD    . LYS A  1  84  ? -16.032  -2.321  27.983  1.00 115.26 ? 84  LYS A CD    1 
ATOM   656   C  CE    . LYS A  1  84  ? -16.485  -2.507  26.547  1.00 119.71 ? 84  LYS A CE    1 
ATOM   657   N  NZ    . LYS A  1  84  ? -15.393  -3.014  25.673  1.00 123.40 ? 84  LYS A NZ    1 
ATOM   658   N  N     . SER B  2  6   ? -14.950  -18.217 42.302  1.00 135.74 ? 6   SER B N     1 
ATOM   659   C  CA    . SER B  2  6   ? -15.417  -18.688 40.948  1.00 125.30 ? 6   SER B CA    1 
ATOM   660   C  C     . SER B  2  6   ? -14.327  -18.763 39.891  1.00 125.21 ? 6   SER B C     1 
ATOM   661   O  O     . SER B  2  6   ? -14.627  -19.129 38.756  1.00 109.72 ? 6   SER B O     1 
ATOM   662   C  CB    . SER B  2  6   ? -16.516  -17.761 40.402  1.00 118.48 ? 6   SER B CB    1 
ATOM   663   O  OG    . SER B  2  6   ? -17.077  -18.345 39.252  1.00 110.85 ? 6   SER B OG    1 
ATOM   664   N  N     . SER B  2  7   ? -13.075  -18.568 40.312  1.00 146.60 ? 7   SER B N     1 
ATOM   665   C  CA    . SER B  2  7   ? -11.987  -18.255 39.390  1.00 152.78 ? 7   SER B CA    1 
ATOM   666   C  C     . SER B  2  7   ? -11.786  -19.324 38.316  1.00 151.14 ? 7   SER B C     1 
ATOM   667   O  O     . SER B  2  7   ? -11.201  -19.032 37.268  1.00 149.31 ? 7   SER B O     1 
ATOM   668   C  CB    . SER B  2  7   ? -10.640  -17.936 40.057  1.00 147.77 ? 7   SER B CB    1 
ATOM   669   O  OG    . SER B  2  7   ? -10.211  -19.060 40.809  1.00 147.30 ? 7   SER B OG    1 
ATOM   670   N  N     . LYS B  2  8   ? -12.303  -20.530 38.555  1.00 140.58 ? 8   LYS B N     1 
ATOM   671   C  CA    . LYS B  2  8   ? -12.330  -21.567 37.521  1.00 127.60 ? 8   LYS B CA    1 
ATOM   672   C  C     . LYS B  2  8   ? -12.965  -21.085 36.227  1.00 117.62 ? 8   LYS B C     1 
ATOM   673   O  O     . LYS B  2  8   ? -12.525  -21.467 35.141  1.00 122.82 ? 8   LYS B O     1 
ATOM   674   C  CB    . LYS B  2  8   ? -12.941  -22.867 38.044  1.00 119.60 ? 8   LYS B CB    1 
ATOM   675   C  CG    . LYS B  2  8   ? -11.995  -23.641 38.955  1.00 125.56 ? 8   LYS B CG    1 
ATOM   676   C  CD    . LYS B  2  8   ? -10.594  -23.945 38.380  1.00 116.09 ? 8   LYS B CD    1 
ATOM   677   C  CE    . LYS B  2  8   ? -9.904   -25.057 39.146  1.00 111.63 ? 8   LYS B CE    1 
ATOM   678   N  NZ    . LYS B  2  8   ? -9.872   -24.893 40.625  1.00 114.49 ? 8   LYS B NZ    1 
ATOM   679   N  N     . MET B  2  9   ? -13.989  -20.248 36.351  1.00 102.56 ? 9   MET B N     1 
ATOM   680   C  CA    . MET B  2  9   ? -14.654  -19.700 35.181  1.00 87.43  ? 9   MET B CA    1 
ATOM   681   C  C     . MET B  2  9   ? -14.055  -18.429 34.692  1.00 85.63  ? 9   MET B C     1 
ATOM   682   O  O     . MET B  2  9   ? -13.969  -18.234 33.493  1.00 86.98  ? 9   MET B O     1 
ATOM   683   C  CB    . MET B  2  9   ? -16.137  -19.511 35.427  1.00 83.74  ? 9   MET B CB    1 
ATOM   684   C  CG    . MET B  2  9   ? -16.923  -20.786 35.270  1.00 89.51  ? 9   MET B CG    1 
ATOM   685   S  SD    . MET B  2  9   ? -16.477  -21.518 33.670  1.00 95.23  ? 9   MET B SD    1 
ATOM   686   C  CE    . MET B  2  9   ? -17.322  -23.104 33.521  1.00 105.36 ? 9   MET B CE    1 
ATOM   687   N  N     . LEU B  2  10  ? -13.640  -17.585 35.623  1.00 86.48  ? 10  LEU B N     1 
ATOM   688   C  CA    . LEU B  2  10  ? -13.016  -16.324 35.223  1.00 89.09  ? 10  LEU B CA    1 
ATOM   689   C  C     . LEU B  2  10  ? -11.695  -16.554 34.478  1.00 88.41  ? 10  LEU B C     1 
ATOM   690   O  O     . LEU B  2  10  ? -11.192  -15.766 33.718  1.00 85.05  ? 10  LEU B O     1 
ATOM   691   C  CB    . LEU B  2  10  ? -12.757  -15.497 36.471  1.00 90.76  ? 10  LEU B CB    1 
ATOM   692   C  CG    . LEU B  2  10  ? -14.074  -15.039 37.086  1.00 96.43  ? 10  LEU B CG    1 
ATOM   693   C  CD1   . LEU B  2  10  ? -14.012  -14.925 38.602  1.00 102.02 ? 10  LEU B CD1   1 
ATOM   694   C  CD2   . LEU B  2  10  ? -14.610  -13.787 36.373  1.00 94.40  ? 10  LEU B CD2   1 
ATOM   695   N  N     . GLN B  2  11  ? -11.111  -17.697 34.739  1.00 85.18  ? 11  GLN B N     1 
ATOM   696   C  CA    . GLN B  2  11  ? -9.856   -18.127 34.181  1.00 93.62  ? 11  GLN B CA    1 
ATOM   697   C  C     . GLN B  2  11  ? -9.946   -18.058 32.680  1.00 89.92  ? 11  GLN B C     1 
ATOM   698   O  O     . GLN B  2  11  ? -9.000   -17.679 31.993  1.00 105.95 ? 11  GLN B O     1 
ATOM   699   C  CB    . GLN B  2  11  ? -9.564   -19.588 34.587  1.00 108.83 ? 11  GLN B CB    1 
ATOM   700   C  CG    . GLN B  2  11  ? -8.185   -19.944 35.096  1.00 116.02 ? 11  GLN B CG    1 
ATOM   701   C  CD    . GLN B  2  11  ? -8.037   -19.636 36.635  1.00 124.63 ? 11  GLN B CD    1 
ATOM   702   O  OE1   . GLN B  2  11  ? -8.558   -20.351 37.510  1.00 107.52 ? 11  GLN B OE1   1 
ATOM   703   N  NE2   . GLN B  2  11  ? -7.317   -18.565 36.996  1.00 132.47 ? 11  GLN B NE2   1 
ATOM   704   N  N     . HIS B  2  12  ? -11.092  -18.483 32.169  1.00 87.32  ? 12  HIS B N     1 
ATOM   705   C  CA    . HIS B  2  12  ? -11.296  -18.625 30.740  1.00 86.29  ? 12  HIS B CA    1 
ATOM   706   C  C     . HIS B  2  12  ? -11.983  -17.435 30.110  1.00 79.42  ? 12  HIS B C     1 
ATOM   707   O  O     . HIS B  2  12  ? -12.245  -17.440 28.917  1.00 81.13  ? 12  HIS B O     1 
ATOM   708   C  CB    . HIS B  2  12  ? -12.132  -19.862 30.460  1.00 89.82  ? 12  HIS B CB    1 
ATOM   709   C  CG    . HIS B  2  12  ? -11.664  -21.082 31.183  1.00 90.60  ? 12  HIS B CG    1 
ATOM   710   N  ND1   . HIS B  2  12  ? -12.384  -21.661 32.203  1.00 94.23  ? 12  HIS B ND1   1 
ATOM   711   C  CD2   . HIS B  2  12  ? -10.554  -21.837 31.028  1.00 88.73  ? 12  HIS B CD2   1 
ATOM   712   C  CE1   . HIS B  2  12  ? -11.736  -22.720 32.649  1.00 90.01  ? 12  HIS B CE1   1 
ATOM   713   N  NE2   . HIS B  2  12  ? -10.623  -22.849 31.952  1.00 99.14  ? 12  HIS B NE2   1 
ATOM   714   N  N     . ILE B  2  13  ? -12.288  -16.418 30.897  1.00 69.05  ? 13  ILE B N     1 
ATOM   715   C  CA    . ILE B  2  13  ? -13.042  -15.301 30.367  1.00 66.25  ? 13  ILE B CA    1 
ATOM   716   C  C     . ILE B  2  13  ? -12.227  -14.649 29.260  1.00 68.32  ? 13  ILE B C     1 
ATOM   717   O  O     . ILE B  2  13  ? -11.016  -14.529 29.367  1.00 69.62  ? 13  ILE B O     1 
ATOM   718   C  CB    . ILE B  2  13  ? -13.464  -14.315 31.486  1.00 64.22  ? 13  ILE B CB    1 
ATOM   719   C  CG1   . ILE B  2  13  ? -14.856  -13.769 31.205  1.00 69.79  ? 13  ILE B CG1   1 
ATOM   720   C  CG2   . ILE B  2  13  ? -12.472  -13.175 31.683  1.00 61.10  ? 13  ILE B CG2   1 
ATOM   721   C  CD1   . ILE B  2  13  ? -15.878  -14.234 32.208  1.00 79.46  ? 13  ILE B CD1   1 
ATOM   722   N  N     . ASP B  2  14  ? -12.916  -14.286 28.188  1.00 73.24  ? 14  ASP B N     1 
ATOM   723   C  CA    . ASP B  2  14  ? -12.341  -13.586 27.047  1.00 71.16  ? 14  ASP B CA    1 
ATOM   724   C  C     . ASP B  2  14  ? -11.593  -14.533 26.122  1.00 64.41  ? 14  ASP B C     1 
ATOM   725   O  O     . ASP B  2  14  ? -11.055  -14.105 25.112  1.00 64.20  ? 14  ASP B O     1 
ATOM   726   C  CB    . ASP B  2  14  ? -11.454  -12.416 27.479  1.00 75.31  ? 14  ASP B CB    1 
ATOM   727   C  CG    . ASP B  2  14  ? -12.117  -11.073 27.260  1.00 84.86  ? 14  ASP B CG    1 
ATOM   728   O  OD1   . ASP B  2  14  ? -12.907  -10.940 26.305  1.00 85.88  ? 14  ASP B OD1   1 
ATOM   729   O  OD2   . ASP B  2  14  ? -11.852  -10.147 28.051  1.00 91.31  ? 14  ASP B OD2   1 
ATOM   730   N  N     . TYR B  2  15  ? -11.531  -15.796 26.510  1.00 65.70  ? 15  TYR B N     1 
ATOM   731   C  CA    . TYR B  2  15  ? -11.002  -16.849 25.670  1.00 68.13  ? 15  TYR B CA    1 
ATOM   732   C  C     . TYR B  2  15  ? -12.077  -17.250 24.688  1.00 63.94  ? 15  TYR B C     1 
ATOM   733   O  O     . TYR B  2  15  ? -13.217  -16.851 24.832  1.00 67.90  ? 15  TYR B O     1 
ATOM   734   C  CB    . TYR B  2  15  ? -10.592  -18.049 26.510  1.00 70.05  ? 15  TYR B CB    1 
ATOM   735   C  CG    . TYR B  2  15  ? -9.192   -17.971 27.064  1.00 76.55  ? 15  TYR B CG    1 
ATOM   736   C  CD1   . TYR B  2  15  ? -8.840   -16.993 27.971  1.00 78.82  ? 15  TYR B CD1   1 
ATOM   737   C  CD2   . TYR B  2  15  ? -8.229   -18.883 26.686  1.00 75.51  ? 15  TYR B CD2   1 
ATOM   738   C  CE1   . TYR B  2  15  ? -7.565   -16.921 28.484  1.00 80.08  ? 15  TYR B CE1   1 
ATOM   739   C  CE2   . TYR B  2  15  ? -6.951   -18.821 27.196  1.00 75.77  ? 15  TYR B CE2   1 
ATOM   740   C  CZ    . TYR B  2  15  ? -6.627   -17.837 28.094  1.00 77.22  ? 15  TYR B CZ    1 
ATOM   741   O  OH    . TYR B  2  15  ? -5.353   -17.771 28.602  1.00 82.31  ? 15  TYR B OH    1 
ATOM   742   N  N     . ARG B  2  16  ? -11.720  -18.023 23.676  1.00 63.00  ? 16  ARG B N     1 
ATOM   743   C  CA    . ARG B  2  16  ? -12.717  -18.547 22.770  1.00 66.64  ? 16  ARG B CA    1 
ATOM   744   C  C     . ARG B  2  16  ? -13.051  -19.953 23.218  1.00 65.92  ? 16  ARG B C     1 
ATOM   745   O  O     . ARG B  2  16  ? -12.179  -20.811 23.286  1.00 72.13  ? 16  ARG B O     1 
ATOM   746   C  CB    . ARG B  2  16  ? -12.194  -18.547 21.344  1.00 76.30  ? 16  ARG B CB    1 
ATOM   747   C  CG    . ARG B  2  16  ? -13.153  -17.912 20.365  1.00 85.52  ? 16  ARG B CG    1 
ATOM   748   C  CD    . ARG B  2  16  ? -12.848  -18.294 18.934  1.00 82.68  ? 16  ARG B CD    1 
ATOM   749   N  NE    . ARG B  2  16  ? -14.038  -18.222 18.096  1.00 82.13  ? 16  ARG B NE    1 
ATOM   750   C  CZ    . ARG B  2  16  ? -14.766  -17.128 17.926  1.00 90.94  ? 16  ARG B CZ    1 
ATOM   751   N  NH1   . ARG B  2  16  ? -14.435  -16.001 18.533  1.00 91.24  ? 16  ARG B NH1   1 
ATOM   752   N  NH2   . ARG B  2  16  ? -15.833  -17.162 17.145  1.00 100.29 ? 16  ARG B NH2   1 
ATOM   753   N  N     . MET B  2  17  ? -14.323  -20.184 23.518  1.00 62.57  ? 17  MET B N     1 
ATOM   754   C  CA    . MET B  2  17  ? -14.748  -21.398 24.192  1.00 59.13  ? 17  MET B CA    1 
ATOM   755   C  C     . MET B  2  17  ? -15.752  -22.206 23.391  1.00 54.46  ? 17  MET B C     1 
ATOM   756   O  O     . MET B  2  17  ? -16.654  -21.658 22.789  1.00 53.23  ? 17  MET B O     1 
ATOM   757   C  CB    . MET B  2  17  ? -15.351  -21.040 25.543  1.00 58.23  ? 17  MET B CB    1 
ATOM   758   C  CG    . MET B  2  17  ? -14.387  -20.346 26.479  1.00 62.28  ? 17  MET B CG    1 
ATOM   759   S  SD    . MET B  2  17  ? -13.903  -21.408 27.835  1.00 64.84  ? 17  MET B SD    1 
ATOM   760   C  CE    . MET B  2  17  ? -12.814  -22.542 26.992  1.00 60.61  ? 17  MET B CE    1 
ATOM   761   N  N     . ARG B  2  18  ? -15.575  -23.519 23.390  1.00 53.66  ? 18  ARG B N     1 
ATOM   762   C  CA    . ARG B  2  18  ? -16.448  -24.401 22.693  1.00 54.93  ? 18  ARG B CA    1 
ATOM   763   C  C     . ARG B  2  18  ? -17.410  -25.028 23.689  1.00 56.64  ? 18  ARG B C     1 
ATOM   764   O  O     . ARG B  2  18  ? -17.031  -25.908 24.465  1.00 66.07  ? 18  ARG B O     1 
ATOM   765   C  CB    . ARG B  2  18  ? -15.641  -25.451 21.959  1.00 56.84  ? 18  ARG B CB    1 
ATOM   766   C  CG    . ARG B  2  18  ? -16.428  -26.634 21.450  1.00 61.86  ? 18  ARG B CG    1 
ATOM   767   C  CD    . ARG B  2  18  ? -15.583  -27.855 21.193  1.00 68.63  ? 18  ARG B CD    1 
ATOM   768   N  NE    . ARG B  2  18  ? -14.742  -27.485 20.061  1.00 69.60  ? 18  ARG B NE    1 
ATOM   769   C  CZ    . ARG B  2  18  ? -14.805  -28.068 18.891  1.00 73.19  ? 18  ARG B CZ    1 
ATOM   770   N  NH1   . ARG B  2  18  ? -15.609  -29.127 18.683  1.00 81.33  ? 18  ARG B NH1   1 
ATOM   771   N  NH2   . ARG B  2  18  ? -13.966  -27.645 17.959  1.00 69.63  ? 18  ARG B NH2   1 
ATOM   772   N  N     . CYS B  2  19  ? -18.682  -24.659 23.555  1.00 54.14  ? 19  CYS B N     1 
ATOM   773   C  CA    . CYS B  2  19  ? -19.736  -25.141 24.384  1.00 51.69  ? 19  CYS B CA    1 
ATOM   774   C  C     . CYS B  2  19  ? -20.551  -26.211 23.716  1.00 50.38  ? 19  CYS B C     1 
ATOM   775   O  O     . CYS B  2  19  ? -20.958  -26.025 22.597  1.00 57.75  ? 19  CYS B O     1 
ATOM   776   C  CB    . CYS B  2  19  ? -20.615  -23.957 24.653  1.00 54.17  ? 19  CYS B CB    1 
ATOM   777   S  SG    . CYS B  2  19  ? -19.635  -22.569 25.163  1.00 55.14  ? 19  CYS B SG    1 
ATOM   778   N  N     . ILE B  2  20  ? -20.826  -27.303 24.400  1.00 50.85  ? 20  ILE B N     1 
ATOM   779   C  CA    . ILE B  2  20  ? -21.659  -28.374 23.896  1.00 51.58  ? 20  ILE B CA    1 
ATOM   780   C  C     . ILE B  2  20  ? -22.987  -28.127 24.546  1.00 55.37  ? 20  ILE B C     1 
ATOM   781   O  O     . ILE B  2  20  ? -23.069  -28.040 25.774  1.00 62.58  ? 20  ILE B O     1 
ATOM   782   C  CB    . ILE B  2  20  ? -21.141  -29.759 24.262  1.00 52.95  ? 20  ILE B CB    1 
ATOM   783   C  CG1   . ILE B  2  20  ? -19.864  -30.116 23.462  1.00 55.34  ? 20  ILE B CG1   1 
ATOM   784   C  CG2   . ILE B  2  20  ? -22.166  -30.838 24.021  1.00 58.31  ? 20  ILE B CG2   1 
ATOM   785   C  CD1   . ILE B  2  20  ? -18.568  -29.675 24.171  1.00 67.02  ? 20  ILE B CD1   1 
ATOM   786   N  N     . LEU B  2  21  ? -24.039  -28.053 23.721  1.00 56.82  ? 21  LEU B N     1 
ATOM   787   C  CA    . LEU B  2  21  ? -25.431  -27.877 24.171  1.00 55.08  ? 21  LEU B CA    1 
ATOM   788   C  C     . LEU B  2  21  ? -26.168  -29.191 24.283  1.00 52.83  ? 21  LEU B C     1 
ATOM   789   O  O     . LEU B  2  21  ? -25.641  -30.237 23.867  1.00 61.20  ? 21  LEU B O     1 
ATOM   790   C  CB    . LEU B  2  21  ? -26.142  -27.000 23.199  1.00 59.23  ? 21  LEU B CB    1 
ATOM   791   C  CG    . LEU B  2  21  ? -25.958  -25.517 23.439  1.00 65.93  ? 21  LEU B CG    1 
ATOM   792   C  CD1   . LEU B  2  21  ? -24.489  -25.152 23.588  1.00 66.76  ? 21  LEU B CD1   1 
ATOM   793   C  CD2   . LEU B  2  21  ? -26.609  -24.751 22.284  1.00 70.76  ? 21  LEU B CD2   1 
ATOM   794   N  N     . GLN B  2  22  ? -27.344  -29.211 24.884  1.00 52.74  ? 22  GLN B N     1 
ATOM   795   C  CA    . GLN B  2  22  ? -27.955  -30.511 25.195  1.00 58.65  ? 22  GLN B CA    1 
ATOM   796   C  C     . GLN B  2  22  ? -28.390  -31.281 23.977  1.00 61.53  ? 22  GLN B C     1 
ATOM   797   O  O     . GLN B  2  22  ? -28.436  -32.521 24.026  1.00 67.83  ? 22  GLN B O     1 
ATOM   798   C  CB    . GLN B  2  22  ? -29.113  -30.370 26.178  1.00 61.97  ? 22  GLN B CB    1 
ATOM   799   C  CG    . GLN B  2  22  ? -28.592  -29.938 27.535  1.00 69.33  ? 22  GLN B CG    1 
ATOM   800   C  CD    . GLN B  2  22  ? -29.361  -30.477 28.716  1.00 78.33  ? 22  GLN B CD    1 
ATOM   801   O  OE1   . GLN B  2  22  ? -28.765  -30.785 29.754  1.00 95.65  ? 22  GLN B OE1   1 
ATOM   802   N  NE2   . GLN B  2  22  ? -30.676  -30.524 28.608  1.00 80.23  ? 22  GLN B NE2   1 
ATOM   803   N  N     . ASP B  2  23  ? -28.689  -30.554 22.902  1.00 61.11  ? 23  ASP B N     1 
ATOM   804   C  CA    . ASP B  2  23  ? -29.055  -31.173 21.627  1.00 63.47  ? 23  ASP B CA    1 
ATOM   805   C  C     . ASP B  2  23  ? -27.915  -31.528 20.715  1.00 61.12  ? 23  ASP B C     1 
ATOM   806   O  O     . ASP B  2  23  ? -28.126  -32.080 19.635  1.00 61.84  ? 23  ASP B O     1 
ATOM   807   C  CB    . ASP B  2  23  ? -30.118  -30.369 20.874  1.00 71.53  ? 23  ASP B CB    1 
ATOM   808   C  CG    . ASP B  2  23  ? -29.628  -29.044 20.333  1.00 76.45  ? 23  ASP B CG    1 
ATOM   809   O  OD1   . ASP B  2  23  ? -29.075  -28.294 21.166  1.00 94.26  ? 23  ASP B OD1   1 
ATOM   810   O  OD2   . ASP B  2  23  ? -29.888  -28.744 19.132  1.00 79.16  ? 23  ASP B OD2   1 
ATOM   811   N  N     . GLY B  2  24  ? -26.699  -31.236 21.153  1.00 60.93  ? 24  GLY B N     1 
ATOM   812   C  CA    . GLY B  2  24  ? -25.505  -31.683 20.453  1.00 60.16  ? 24  GLY B CA    1 
ATOM   813   C  C     . GLY B  2  24  ? -24.888  -30.641 19.562  1.00 58.85  ? 24  GLY B C     1 
ATOM   814   O  O     . GLY B  2  24  ? -23.822  -30.892 19.019  1.00 64.15  ? 24  GLY B O     1 
ATOM   815   N  N     . ARG B  2  25  ? -25.545  -29.496 19.420  1.00 53.75  ? 25  ARG B N     1 
ATOM   816   C  CA    . ARG B  2  25  ? -24.870  -28.342 18.885  1.00 53.36  ? 25  ARG B CA    1 
ATOM   817   C  C     . ARG B  2  25  ? -23.612  -27.985 19.643  1.00 51.31  ? 25  ARG B C     1 
ATOM   818   O  O     . ARG B  2  25  ? -23.459  -28.239 20.829  1.00 53.06  ? 25  ARG B O     1 
ATOM   819   C  CB    . ARG B  2  25  ? -25.780  -27.135 18.976  1.00 58.52  ? 25  ARG B CB    1 
ATOM   820   C  CG    . ARG B  2  25  ? -26.897  -27.274 17.988  1.00 67.66  ? 25  ARG B CG    1 
ATOM   821   C  CD    . ARG B  2  25  ? -27.746  -26.039 17.798  1.00 65.57  ? 25  ARG B CD    1 
ATOM   822   N  NE    . ARG B  2  25  ? -28.976  -26.191 18.518  1.00 63.71  ? 25  ARG B NE    1 
ATOM   823   C  CZ    . ARG B  2  25  ? -30.012  -25.418 18.300  1.00 69.41  ? 25  ARG B CZ    1 
ATOM   824   N  NH1   . ARG B  2  25  ? -29.932  -24.402 17.436  1.00 74.02  ? 25  ARG B NH1   1 
ATOM   825   N  NH2   . ARG B  2  25  ? -31.110  -25.602 19.002  1.00 72.18  ? 25  ARG B NH2   1 
ATOM   826   N  N     . ILE B  2  26  ? -22.736  -27.323 18.938  1.00 48.06  ? 26  ILE B N     1 
ATOM   827   C  CA    . ILE B  2  26  ? -21.572  -26.714 19.511  1.00 49.23  ? 26  ILE B CA    1 
ATOM   828   C  C     . ILE B  2  26  ? -21.712  -25.210 19.274  1.00 44.88  ? 26  ILE B C     1 
ATOM   829   O  O     . ILE B  2  26  ? -21.968  -24.803 18.163  1.00 47.74  ? 26  ILE B O     1 
ATOM   830   C  CB    . ILE B  2  26  ? -20.315  -27.147 18.732  1.00 54.88  ? 26  ILE B CB    1 
ATOM   831   C  CG1   . ILE B  2  26  ? -20.205  -28.657 18.628  1.00 59.87  ? 26  ILE B CG1   1 
ATOM   832   C  CG2   . ILE B  2  26  ? -19.080  -26.513 19.331  1.00 55.56  ? 26  ILE B CG2   1 
ATOM   833   C  CD1   . ILE B  2  26  ? -19.463  -29.290 19.788  1.00 68.67  ? 26  ILE B CD1   1 
ATOM   834   N  N     . PHE B  2  27  ? -21.491  -24.386 20.276  1.00 42.29  ? 27  PHE B N     1 
ATOM   835   C  CA    . PHE B  2  27  ? -21.337  -22.965 20.095  1.00 40.86  ? 27  PHE B CA    1 
ATOM   836   C  C     . PHE B  2  27  ? -19.905  -22.711 20.372  1.00 43.50  ? 27  PHE B C     1 
ATOM   837   O  O     . PHE B  2  27  ? -19.383  -23.067 21.431  1.00 47.96  ? 27  PHE B O     1 
ATOM   838   C  CB    . PHE B  2  27  ? -22.135  -22.238 21.112  1.00 39.93  ? 27  PHE B CB    1 
ATOM   839   C  CG    . PHE B  2  27  ? -23.592  -22.099 20.801  1.00 42.50  ? 27  PHE B CG    1 
ATOM   840   C  CD1   . PHE B  2  27  ? -24.183  -22.656 19.675  1.00 46.27  ? 27  PHE B CD1   1 
ATOM   841   C  CD2   . PHE B  2  27  ? -24.420  -21.359 21.653  1.00 43.55  ? 27  PHE B CD2   1 
ATOM   842   C  CE1   . PHE B  2  27  ? -25.554  -22.430 19.375  1.00 47.14  ? 27  PHE B CE1   1 
ATOM   843   C  CE2   . PHE B  2  27  ? -25.768  -21.138 21.343  1.00 44.57  ? 27  PHE B CE2   1 
ATOM   844   C  CZ    . PHE B  2  27  ? -26.354  -21.679 20.210  1.00 43.47  ? 27  PHE B CZ    1 
ATOM   845   N  N     . ILE B  2  28  ? -19.209  -22.162 19.394  1.00 45.75  ? 28  ILE B N     1 
ATOM   846   C  CA    . ILE B  2  28  ? -17.902  -21.583 19.677  1.00 44.88  ? 28  ILE B CA    1 
ATOM   847   C  C     . ILE B  2  28  ? -17.970  -20.044 19.616  1.00 47.66  ? 28  ILE B C     1 
ATOM   848   O  O     . ILE B  2  28  ? -18.534  -19.464 18.687  1.00 48.59  ? 28  ILE B O     1 
ATOM   849   C  CB    . ILE B  2  28  ? -16.894  -22.032 18.688  1.00 42.44  ? 28  ILE B CB    1 
ATOM   850   C  CG1   . ILE B  2  28  ? -16.918  -23.519 18.587  1.00 42.89  ? 28  ILE B CG1   1 
ATOM   851   C  CG2   . ILE B  2  28  ? -15.561  -21.630 19.233  1.00 46.44  ? 28  ILE B CG2   1 
ATOM   852   C  CD1   . ILE B  2  28  ? -15.889  -24.125 17.631  1.00 43.26  ? 28  ILE B CD1   1 
ATOM   853   N  N     . GLY B  2  29  ? -17.391  -19.399 20.621  1.00 46.86  ? 29  GLY B N     1 
ATOM   854   C  CA    . GLY B  2  29  ? -17.624  -17.990 20.862  1.00 48.24  ? 29  GLY B CA    1 
ATOM   855   C  C     . GLY B  2  29  ? -16.742  -17.367 21.929  1.00 49.21  ? 29  GLY B C     1 
ATOM   856   O  O     . GLY B  2  29  ? -16.164  -18.065 22.762  1.00 50.30  ? 29  GLY B O     1 
ATOM   857   N  N     . THR B  2  30  ? -16.626  -16.049 21.889  1.00 50.29  ? 30  THR B N     1 
ATOM   858   C  CA    . THR B  2  30  ? -15.720  -15.377 22.796  1.00 52.73  ? 30  THR B CA    1 
ATOM   859   C  C     . THR B  2  30  ? -16.481  -15.120 24.062  1.00 47.66  ? 30  THR B C     1 
ATOM   860   O  O     . THR B  2  30  ? -17.584  -14.667 24.052  1.00 46.73  ? 30  THR B O     1 
ATOM   861   C  CB    . THR B  2  30  ? -15.156  -14.105 22.182  1.00 57.49  ? 30  THR B CB    1 
ATOM   862   O  OG1   . THR B  2  30  ? -14.504  -14.416 20.937  1.00 59.11  ? 30  THR B OG1   1 
ATOM   863   C  CG2   . THR B  2  30  ? -14.176  -13.501 23.158  1.00 62.84  ? 30  THR B CG2   1 
ATOM   864   N  N     . PHE B  2  31  ? -15.888  -15.507 25.157  1.00 49.24  ? 31  PHE B N     1 
ATOM   865   C  CA    . PHE B  2  31  ? -16.641  -15.865 26.340  1.00 52.08  ? 31  PHE B CA    1 
ATOM   866   C  C     . PHE B  2  31  ? -16.623  -14.607 27.131  1.00 57.31  ? 31  PHE B C     1 
ATOM   867   O  O     . PHE B  2  31  ? -15.687  -14.338 27.844  1.00 63.66  ? 31  PHE B O     1 
ATOM   868   C  CB    . PHE B  2  31  ? -16.013  -17.094 27.066  1.00 49.16  ? 31  PHE B CB    1 
ATOM   869   C  CG    . PHE B  2  31  ? -16.542  -17.353 28.451  1.00 47.51  ? 31  PHE B CG    1 
ATOM   870   C  CD1   . PHE B  2  31  ? -17.871  -17.129 28.803  1.00 47.61  ? 31  PHE B CD1   1 
ATOM   871   C  CD2   . PHE B  2  31  ? -15.708  -17.904 29.403  1.00 46.85  ? 31  PHE B CD2   1 
ATOM   872   C  CE1   . PHE B  2  31  ? -18.342  -17.418 30.068  1.00 46.90  ? 31  PHE B CE1   1 
ATOM   873   C  CE2   . PHE B  2  31  ? -16.172  -18.154 30.679  1.00 48.38  ? 31  PHE B CE2   1 
ATOM   874   C  CZ    . PHE B  2  31  ? -17.495  -17.929 31.020  1.00 46.39  ? 31  PHE B CZ    1 
ATOM   875   N  N     . LYS B  2  32  ? -17.683  -13.836 27.029  1.00 66.48  ? 32  LYS B N     1 
ATOM   876   C  CA    . LYS B  2  32  ? -17.712  -12.504 27.643  1.00 69.47  ? 32  LYS B CA    1 
ATOM   877   C  C     . LYS B  2  32  ? -18.287  -12.459 29.036  1.00 63.65  ? 32  LYS B C     1 
ATOM   878   O  O     . LYS B  2  32  ? -17.881  -11.606 29.794  1.00 66.34  ? 32  LYS B O     1 
ATOM   879   C  CB    . LYS B  2  32  ? -18.479  -11.510 26.772  1.00 73.47  ? 32  LYS B CB    1 
ATOM   880   C  CG    . LYS B  2  32  ? -17.875  -11.305 25.396  1.00 77.86  ? 32  LYS B CG    1 
ATOM   881   C  CD    . LYS B  2  32  ? -16.430  -10.792 25.416  1.00 85.01  ? 32  LYS B CD    1 
ATOM   882   C  CE    . LYS B  2  32  ? -16.316  -9.434  26.107  1.00 90.57  ? 32  LYS B CE    1 
ATOM   883   N  NZ    . LYS B  2  32  ? -14.981  -8.842  25.865  1.00 91.83  ? 32  LYS B NZ    1 
ATOM   884   N  N     . ALA B  2  33  ? -19.187  -13.359 29.401  1.00 62.06  ? 33  ALA B N     1 
ATOM   885   C  CA    . ALA B  2  33  ? -19.818  -13.274 30.726  1.00 62.94  ? 33  ALA B CA    1 
ATOM   886   C  C     . ALA B  2  33  ? -20.650  -14.474 31.129  1.00 59.93  ? 33  ALA B C     1 
ATOM   887   O  O     . ALA B  2  33  ? -21.162  -15.204 30.280  1.00 58.95  ? 33  ALA B O     1 
ATOM   888   C  CB    . ALA B  2  33  ? -20.662  -12.012 30.859  1.00 63.52  ? 33  ALA B CB    1 
ATOM   889   N  N     . PHE B  2  34  ? -20.741  -14.657 32.439  1.00 58.42  ? 34  PHE B N     1 
ATOM   890   C  CA    . PHE B  2  34  ? -21.563  -15.716 32.987  1.00 59.78  ? 34  PHE B CA    1 
ATOM   891   C  C     . PHE B  2  34  ? -22.268  -15.328 34.306  1.00 59.74  ? 34  PHE B C     1 
ATOM   892   O  O     . PHE B  2  34  ? -22.154  -14.181 34.745  1.00 62.04  ? 34  PHE B O     1 
ATOM   893   C  CB    . PHE B  2  34  ? -20.723  -16.939 33.148  1.00 56.31  ? 34  PHE B CB    1 
ATOM   894   C  CG    . PHE B  2  34  ? -19.756  -16.828 34.240  1.00 57.87  ? 34  PHE B CG    1 
ATOM   895   C  CD1   . PHE B  2  34  ? -20.093  -17.162 35.522  1.00 61.11  ? 34  PHE B CD1   1 
ATOM   896   C  CD2   . PHE B  2  34  ? -18.487  -16.441 33.974  1.00 60.83  ? 34  PHE B CD2   1 
ATOM   897   C  CE1   . PHE B  2  34  ? -19.145  -17.077 36.530  1.00 68.29  ? 34  PHE B CE1   1 
ATOM   898   C  CE2   . PHE B  2  34  ? -17.513  -16.389 34.964  1.00 68.06  ? 34  PHE B CE2   1 
ATOM   899   C  CZ    . PHE B  2  34  ? -17.842  -16.693 36.272  1.00 68.95  ? 34  PHE B CZ    1 
ATOM   900   N  N     . ASP B  2  35  ? -23.047  -16.258 34.863  1.00 54.39  ? 35  ASP B N     1 
ATOM   901   C  CA    . ASP B  2  35  ? -23.757  -16.051 36.106  1.00 54.91  ? 35  ASP B CA    1 
ATOM   902   C  C     . ASP B  2  35  ? -24.025  -17.321 36.844  1.00 52.78  ? 35  ASP B C     1 
ATOM   903   O  O     . ASP B  2  35  ? -23.537  -18.371 36.438  1.00 55.28  ? 35  ASP B O     1 
ATOM   904   C  CB    . ASP B  2  35  ? -25.053  -15.306 35.852  1.00 60.58  ? 35  ASP B CB    1 
ATOM   905   C  CG    . ASP B  2  35  ? -26.064  -16.069 34.981  1.00 63.52  ? 35  ASP B CG    1 
ATOM   906   O  OD1   . ASP B  2  35  ? -26.018  -17.315 34.955  1.00 56.71  ? 35  ASP B OD1   1 
ATOM   907   O  OD2   . ASP B  2  35  ? -26.929  -15.348 34.377  1.00 67.49  ? 35  ASP B OD2   1 
ATOM   908   N  N     . LYS B  2  36  ? -24.757  -17.243 37.944  1.00 53.08  ? 36  LYS B N     1 
ATOM   909   C  CA    . LYS B  2  36  ? -24.936  -18.412 38.805  1.00 55.07  ? 36  LYS B CA    1 
ATOM   910   C  C     . LYS B  2  36  ? -25.628  -19.562 38.107  1.00 53.79  ? 36  LYS B C     1 
ATOM   911   O  O     . LYS B  2  36  ? -25.542  -20.705 38.579  1.00 56.22  ? 36  LYS B O     1 
ATOM   912   C  CB    . LYS B  2  36  ? -25.664  -18.064 40.099  1.00 57.36  ? 36  LYS B CB    1 
ATOM   913   C  CG    . LYS B  2  36  ? -27.088  -17.603 39.861  1.00 63.75  ? 36  LYS B CG    1 
ATOM   914   C  CD    . LYS B  2  36  ? -27.726  -17.066 41.116  1.00 72.32  ? 36  LYS B CD    1 
ATOM   915   C  CE    . LYS B  2  36  ? -28.911  -16.171 40.777  1.00 81.27  ? 36  LYS B CE    1 
ATOM   916   N  NZ    . LYS B  2  36  ? -29.823  -16.087 41.966  1.00 92.79  ? 36  LYS B NZ    1 
ATOM   917   N  N     . HIS B  2  37  ? -26.323  -19.269 37.017  1.00 51.55  ? 37  HIS B N     1 
ATOM   918   C  CA    . HIS B  2  37  ? -26.923  -20.348 36.258  1.00 54.34  ? 37  HIS B CA    1 
ATOM   919   C  C     . HIS B  2  37  ? -26.021  -21.005 35.231  1.00 60.29  ? 37  HIS B C     1 
ATOM   920   O  O     . HIS B  2  37  ? -26.305  -22.058 34.710  1.00 58.40  ? 37  HIS B O     1 
ATOM   921   C  CB    . HIS B  2  37  ? -28.152  -19.804 35.594  1.00 53.95  ? 37  HIS B CB    1 
ATOM   922   C  CG    . HIS B  2  37  ? -29.109  -19.236 36.581  1.00 53.16  ? 37  HIS B CG    1 
ATOM   923   N  ND1   . HIS B  2  37  ? -29.735  -20.001 37.549  1.00 52.93  ? 37  HIS B ND1   1 
ATOM   924   C  CD2   . HIS B  2  37  ? -29.511  -17.967 36.775  1.00 51.15  ? 37  HIS B CD2   1 
ATOM   925   C  CE1   . HIS B  2  37  ? -30.509  -19.233 38.285  1.00 53.59  ? 37  HIS B CE1   1 
ATOM   926   N  NE2   . HIS B  2  37  ? -30.378  -17.994 37.838  1.00 54.62  ? 37  HIS B NE2   1 
ATOM   927   N  N     . MET B  2  38  ? -24.913  -20.339 34.931  1.00 65.07  ? 38  MET B N     1 
ATOM   928   C  CA    . MET B  2  38  ? -24.075  -20.606 33.778  1.00 58.39  ? 38  MET B CA    1 
ATOM   929   C  C     . MET B  2  38  ? -24.776  -20.219 32.523  1.00 51.43  ? 38  MET B C     1 
ATOM   930   O  O     . MET B  2  38  ? -24.419  -20.751 31.492  1.00 59.74  ? 38  MET B O     1 
ATOM   931   C  CB    . MET B  2  38  ? -23.524  -21.999 33.782  1.00 64.81  ? 38  MET B CB    1 
ATOM   932   C  CG    . MET B  2  38  ? -22.552  -22.167 34.939  1.00 78.28  ? 38  MET B CG    1 
ATOM   933   S  SD    . MET B  2  38  ? -20.874  -22.209 34.280  1.00 102.06 ? 38  MET B SD    1 
ATOM   934   C  CE    . MET B  2  38  ? -20.519  -24.015 34.172  1.00 101.05 ? 38  MET B CE    1 
ATOM   935   N  N     . ASN B  2  39  ? -25.662  -19.233 32.564  1.00 47.82  ? 39  ASN B N     1 
ATOM   936   C  CA    . ASN B  2  39  ? -26.019  -18.518 31.356  1.00 50.07  ? 39  ASN B CA    1 
ATOM   937   C  C     . ASN B  2  39  ? -24.735  -17.970 30.808  1.00 50.80  ? 39  ASN B C     1 
ATOM   938   O  O     . ASN B  2  39  ? -23.876  -17.588 31.566  1.00 49.34  ? 39  ASN B O     1 
ATOM   939   C  CB    . ASN B  2  39  ? -26.931  -17.327 31.610  1.00 53.13  ? 39  ASN B CB    1 
ATOM   940   C  CG    . ASN B  2  39  ? -28.351  -17.726 32.040  1.00 55.19  ? 39  ASN B CG    1 
ATOM   941   O  OD1   . ASN B  2  39  ? -28.937  -18.651 31.478  1.00 62.16  ? 39  ASN B OD1   1 
ATOM   942   N  ND2   . ASN B  2  39  ? -28.910  -17.042 33.014  1.00 51.37  ? 39  ASN B ND2   1 
ATOM   943   N  N     . LEU B  2  40  ? -24.564  -17.970 29.497  1.00 55.17  ? 40  LEU B N     1 
ATOM   944   C  CA    . LEU B  2  40  ? -23.337  -17.464 28.887  1.00 55.65  ? 40  LEU B CA    1 
ATOM   945   C  C     . LEU B  2  40  ? -23.622  -16.277 27.952  1.00 59.92  ? 40  LEU B C     1 
ATOM   946   O  O     . LEU B  2  40  ? -24.740  -16.086 27.473  1.00 58.89  ? 40  LEU B O     1 
ATOM   947   C  CB    . LEU B  2  40  ? -22.656  -18.531 28.078  1.00 54.77  ? 40  LEU B CB    1 
ATOM   948   C  CG    . LEU B  2  40  ? -22.302  -19.828 28.794  1.00 56.82  ? 40  LEU B CG    1 
ATOM   949   C  CD1   . LEU B  2  40  ? -21.568  -20.821 27.854  1.00 56.22  ? 40  LEU B CD1   1 
ATOM   950   C  CD2   . LEU B  2  40  ? -21.471  -19.485 30.002  1.00 59.14  ? 40  LEU B CD2   1 
ATOM   951   N  N     . ILE B  2  41  ? -22.592  -15.447 27.765  1.00 57.49  ? 41  ILE B N     1 
ATOM   952   C  CA    . ILE B  2  41  ? -22.582  -14.448 26.725  1.00 53.03  ? 41  ILE B CA    1 
ATOM   953   C  C     . ILE B  2  41  ? -21.414  -14.768 25.850  1.00 53.54  ? 41  ILE B C     1 
ATOM   954   O  O     . ILE B  2  41  ? -20.275  -14.822 26.321  1.00 50.64  ? 41  ILE B O     1 
ATOM   955   C  CB    . ILE B  2  41  ? -22.411  -13.054 27.281  1.00 52.35  ? 41  ILE B CB    1 
ATOM   956   C  CG1   . ILE B  2  41  ? -23.595  -12.668 28.164  1.00 54.80  ? 41  ILE B CG1   1 
ATOM   957   C  CG2   . ILE B  2  41  ? -22.345  -12.066 26.150  1.00 54.36  ? 41  ILE B CG2   1 
ATOM   958   C  CD1   . ILE B  2  41  ? -24.938  -12.489 27.488  1.00 57.18  ? 41  ILE B CD1   1 
ATOM   959   N  N     . LEU B  2  42  ? -21.710  -15.036 24.586  1.00 58.19  ? 42  LEU B N     1 
ATOM   960   C  CA    . LEU B  2  42  ? -20.678  -15.418 23.628  1.00 63.51  ? 42  LEU B CA    1 
ATOM   961   C  C     . LEU B  2  42  ? -20.655  -14.390 22.520  1.00 67.86  ? 42  LEU B C     1 
ATOM   962   O  O     . LEU B  2  42  ? -21.706  -14.090 21.974  1.00 81.81  ? 42  LEU B O     1 
ATOM   963   C  CB    . LEU B  2  42  ? -20.945  -16.820 23.081  1.00 59.55  ? 42  LEU B CB    1 
ATOM   964   C  CG    . LEU B  2  42  ? -20.892  -17.889 24.176  1.00 57.59  ? 42  LEU B CG    1 
ATOM   965   C  CD1   . LEU B  2  42  ? -21.131  -19.247 23.593  1.00 62.18  ? 42  LEU B CD1   1 
ATOM   966   C  CD2   . LEU B  2  42  ? -19.573  -17.922 24.882  1.00 54.97  ? 42  LEU B CD2   1 
ATOM   967   N  N     . CYS B  2  43  ? -19.477  -13.909 22.162  1.00 66.38  ? 43  CYS B N     1 
ATOM   968   C  CA    . CYS B  2  43  ? -19.334  -12.962 21.086  1.00 73.82  ? 43  CYS B CA    1 
ATOM   969   C  C     . CYS B  2  43  ? -18.911  -13.643 19.811  1.00 74.67  ? 43  CYS B C     1 
ATOM   970   O  O     . CYS B  2  43  ? -18.228  -14.655 19.840  1.00 69.40  ? 43  CYS B O     1 
ATOM   971   C  CB    . CYS B  2  43  ? -18.232  -11.985 21.405  1.00 85.09  ? 43  CYS B CB    1 
ATOM   972   S  SG    . CYS B  2  43  ? -18.945  -10.554 22.150  1.00 104.89 ? 43  CYS B SG    1 
ATOM   973   N  N     . ASP B  2  44  ? -19.296  -13.063 18.679  1.00 76.83  ? 44  ASP B N     1 
ATOM   974   C  CA    . ASP B  2  44  ? -18.886  -13.601 17.385  1.00 74.34  ? 44  ASP B CA    1 
ATOM   975   C  C     . ASP B  2  44  ? -19.078  -15.117 17.404  1.00 69.51  ? 44  ASP B C     1 
ATOM   976   O  O     . ASP B  2  44  ? -18.212  -15.869 16.956  1.00 70.43  ? 44  ASP B O     1 
ATOM   977   C  CB    . ASP B  2  44  ? -17.433  -13.237 17.118  1.00 76.55  ? 44  ASP B CB    1 
ATOM   978   C  CG    . ASP B  2  44  ? -17.127  -11.799 17.443  1.00 81.49  ? 44  ASP B CG    1 
ATOM   979   O  OD1   . ASP B  2  44  ? -17.606  -10.929 16.689  1.00 85.47  ? 44  ASP B OD1   1 
ATOM   980   O  OD2   . ASP B  2  44  ? -16.395  -11.557 18.448  1.00 89.91  ? 44  ASP B OD2   1 
ATOM   981   N  N     . CYS B  2  45  ? -20.211  -15.545 17.953  1.00 63.37  ? 45  CYS B N     1 
ATOM   982   C  CA    . CYS B  2  45  ? -20.441  -16.929 18.257  1.00 63.29  ? 45  CYS B CA    1 
ATOM   983   C  C     . CYS B  2  45  ? -20.854  -17.632 16.983  1.00 65.66  ? 45  CYS B C     1 
ATOM   984   O  O     . CYS B  2  45  ? -21.688  -17.131 16.209  1.00 68.80  ? 45  CYS B O     1 
ATOM   985   C  CB    . CYS B  2  45  ? -21.516  -17.051 19.309  1.00 63.90  ? 45  CYS B CB    1 
ATOM   986   S  SG    . CYS B  2  45  ? -21.950  -18.748 19.682  1.00 78.87  ? 45  CYS B SG    1 
ATOM   987   N  N     . ASP B  2  46  ? -20.240  -18.784 16.735  1.00 67.08  ? 46  ASP B N     1 
ATOM   988   C  CA    . ASP B  2  46  ? -20.517  -19.617 15.548  1.00 69.08  ? 46  ASP B CA    1 
ATOM   989   C  C     . ASP B  2  46  ? -21.091  -20.948 16.041  1.00 63.81  ? 46  ASP B C     1 
ATOM   990   O  O     . ASP B  2  46  ? -20.690  -21.414 17.107  1.00 64.27  ? 46  ASP B O     1 
ATOM   991   C  CB    . ASP B  2  46  ? -19.250  -19.859 14.717  1.00 73.25  ? 46  ASP B CB    1 
ATOM   992   C  CG    . ASP B  2  46  ? -18.715  -18.581 14.048  1.00 82.11  ? 46  ASP B CG    1 
ATOM   993   O  OD1   . ASP B  2  46  ? -19.029  -17.443 14.489  1.00 91.27  ? 46  ASP B OD1   1 
ATOM   994   O  OD2   . ASP B  2  46  ? -18.005  -18.690 13.018  1.00 92.23  ? 46  ASP B OD2   1 
ATOM   995   N  N     . GLU B  2  47  ? -22.096  -21.490 15.351  1.00 54.99  ? 47  GLU B N     1 
ATOM   996   C  CA    . GLU B  2  47  ? -22.735  -22.698 15.775  1.00 51.36  ? 47  GLU B CA    1 
ATOM   997   C  C     . GLU B  2  47  ? -22.304  -23.728 14.825  1.00 49.03  ? 47  GLU B C     1 
ATOM   998   O  O     . GLU B  2  47  ? -22.402  -23.521 13.647  1.00 52.31  ? 47  GLU B O     1 
ATOM   999   C  CB    . GLU B  2  47  ? -24.241  -22.572 15.741  1.00 57.58  ? 47  GLU B CB    1 
ATOM   1000  C  CG    . GLU B  2  47  ? -24.993  -23.903 15.585  1.00 64.35  ? 47  GLU B CG    1 
ATOM   1001  C  CD    . GLU B  2  47  ? -26.491  -23.750 15.416  1.00 69.25  ? 47  GLU B CD    1 
ATOM   1002  O  OE1   . GLU B  2  47  ? -27.058  -24.419 14.490  1.00 83.43  ? 47  GLU B OE1   1 
ATOM   1003  O  OE2   . GLU B  2  47  ? -27.086  -22.917 16.148  1.00 61.36  ? 47  GLU B OE2   1 
ATOM   1004  N  N     . PHE B  2  48  ? -21.945  -24.908 15.310  1.00 51.67  ? 48  PHE B N     1 
ATOM   1005  C  CA    . PHE B  2  48  ? -21.626  -26.061 14.456  1.00 51.64  ? 48  PHE B CA    1 
ATOM   1006  C  C     . PHE B  2  48  ? -22.462  -27.236 14.849  1.00 53.30  ? 48  PHE B C     1 
ATOM   1007  O  O     . PHE B  2  48  ? -22.973  -27.296 15.977  1.00 53.69  ? 48  PHE B O     1 
ATOM   1008  C  CB    . PHE B  2  48  ? -20.193  -26.436 14.612  1.00 53.88  ? 48  PHE B CB    1 
ATOM   1009  C  CG    . PHE B  2  48  ? -19.255  -25.322 14.284  1.00 58.61  ? 48  PHE B CG    1 
ATOM   1010  C  CD1   . PHE B  2  48  ? -19.013  -24.319 15.213  1.00 61.84  ? 48  PHE B CD1   1 
ATOM   1011  C  CD2   . PHE B  2  48  ? -18.623  -25.262 13.055  1.00 60.00  ? 48  PHE B CD2   1 
ATOM   1012  C  CE1   . PHE B  2  48  ? -18.155  -23.267 14.917  1.00 63.31  ? 48  PHE B CE1   1 
ATOM   1013  C  CE2   . PHE B  2  48  ? -17.743  -24.240 12.769  1.00 59.79  ? 48  PHE B CE2   1 
ATOM   1014  C  CZ    . PHE B  2  48  ? -17.509  -23.242 13.692  1.00 60.96  ? 48  PHE B CZ    1 
ATOM   1015  N  N     . ARG B  2  49  ? -22.651  -28.158 13.906  1.00 58.52  ? 49  ARG B N     1 
ATOM   1016  C  CA    . ARG B  2  49  ? -23.450  -29.352 14.168  1.00 60.59  ? 49  ARG B CA    1 
ATOM   1017  C  C     . ARG B  2  49  ? -23.153  -30.489 13.270  1.00 63.16  ? 49  ARG B C     1 
ATOM   1018  O  O     . ARG B  2  49  ? -22.787  -30.272 12.158  1.00 63.19  ? 49  ARG B O     1 
ATOM   1019  C  CB    . ARG B  2  49  ? -24.918  -29.031 14.053  1.00 60.85  ? 49  ARG B CB    1 
ATOM   1020  C  CG    . ARG B  2  49  ? -25.329  -28.498 12.735  1.00 64.90  ? 49  ARG B CG    1 
ATOM   1021  C  CD    . ARG B  2  49  ? -26.837  -28.462 12.682  1.00 71.17  ? 49  ARG B CD    1 
ATOM   1022  N  NE    . ARG B  2  49  ? -27.388  -27.411 13.542  1.00 65.43  ? 49  ARG B NE    1 
ATOM   1023  C  CZ    . ARG B  2  49  ? -28.706  -27.245 13.664  1.00 63.59  ? 49  ARG B CZ    1 
ATOM   1024  N  NH1   . ARG B  2  49  ? -29.586  -28.043 13.041  1.00 68.93  ? 49  ARG B NH1   1 
ATOM   1025  N  NH2   . ARG B  2  49  ? -29.169  -26.208 14.310  1.00 60.59  ? 49  ARG B NH2   1 
ATOM   1026  N  N     . LYS B  2  50  ? -23.261  -31.710 13.764  1.00 80.72  ? 50  LYS B N     1 
ATOM   1027  C  CA    . LYS B  2  50  ? -22.895  -32.898 12.981  1.00 86.25  ? 50  LYS B CA    1 
ATOM   1028  C  C     . LYS B  2  50  ? -24.172  -33.473 12.439  1.00 90.13  ? 50  LYS B C     1 
ATOM   1029  O  O     . LYS B  2  50  ? -25.128  -33.676 13.189  1.00 95.87  ? 50  LYS B O     1 
ATOM   1030  C  CB    . LYS B  2  50  ? -22.182  -33.920 13.856  1.00 93.85  ? 50  LYS B CB    1 
ATOM   1031  C  CG    . LYS B  2  50  ? -21.000  -33.390 14.673  1.00 105.91 ? 50  LYS B CG    1 
ATOM   1032  C  CD    . LYS B  2  50  ? -20.002  -32.521 13.901  1.00 117.27 ? 50  LYS B CD    1 
ATOM   1033  C  CE    . LYS B  2  50  ? -19.380  -33.261 12.718  1.00 123.23 ? 50  LYS B CE    1 
ATOM   1034  N  NZ    . LYS B  2  50  ? -18.354  -34.252 13.138  1.00 131.22 ? 50  LYS B NZ    1 
ATOM   1035  N  N     . ILE B  2  51  ? -24.210  -33.709 11.138  1.00 102.74 ? 51  ILE B N     1 
ATOM   1036  C  CA    . ILE B  2  51  ? -25.407  -34.258 10.485  1.00 113.68 ? 51  ILE B CA    1 
ATOM   1037  C  C     . ILE B  2  51  ? -25.138  -35.682 10.001  1.00 126.51 ? 51  ILE B C     1 
ATOM   1038  O  O     . ILE B  2  51  ? -24.280  -35.861 9.149   1.00 123.33 ? 51  ILE B O     1 
ATOM   1039  C  CB    . ILE B  2  51  ? -25.872  -33.396 9.294   1.00 109.16 ? 51  ILE B CB    1 
ATOM   1040  C  CG1   . ILE B  2  51  ? -26.119  -31.952 9.753   1.00 113.65 ? 51  ILE B CG1   1 
ATOM   1041  C  CG2   . ILE B  2  51  ? -27.124  -33.988 8.661   1.00 111.39 ? 51  ILE B CG2   1 
ATOM   1042  C  CD1   . ILE B  2  51  ? -27.037  -31.781 10.953  1.00 113.69 ? 51  ILE B CD1   1 
ATOM   1043  N  N     . LYS B  2  52  ? -25.906  -36.640 10.522  1.00 144.77 ? 52  LYS B N     1 
ATOM   1044  C  CA    . LYS B  2  52  ? -25.733  -38.063 10.199  1.00 152.93 ? 52  LYS B CA    1 
ATOM   1045  C  C     . LYS B  2  52  ? -26.131  -38.369 8.760   1.00 162.08 ? 52  LYS B C     1 
ATOM   1046  O  O     . LYS B  2  52  ? -27.116  -37.828 8.243   1.00 163.11 ? 52  LYS B O     1 
ATOM   1047  C  CB    . LYS B  2  52  ? -26.500  -39.027 11.132  1.00 150.26 ? 52  LYS B CB    1 
ATOM   1048  C  CG    . LYS B  2  52  ? -26.405  -38.720 12.648  1.00 152.56 ? 52  LYS B CG    1 
ATOM   1049  C  CD    . LYS B  2  52  ? -24.918  -38.721 13.062  1.00 154.61 ? 52  LYS B CD    1 
ATOM   1050  C  CE    . LYS B  2  52  ? -24.523  -37.708 14.135  1.00 149.32 ? 52  LYS B CE    1 
ATOM   1051  N  NZ    . LYS B  2  52  ? -24.830  -38.213 15.492  1.00 147.26 ? 52  LYS B NZ    1 
ATOM   1052  N  N     . PRO B  2  53  ? -25.355  -39.237 8.111   1.00 176.63 ? 53  PRO B N     1 
ATOM   1053  C  CA    . PRO B  2  53  ? -25.801  -39.732 6.807   1.00 192.93 ? 53  PRO B CA    1 
ATOM   1054  C  C     . PRO B  2  53  ? -26.884  -40.801 6.997   1.00 203.29 ? 53  PRO B C     1 
ATOM   1055  O  O     . PRO B  2  53  ? -26.544  -41.799 7.626   1.00 219.47 ? 53  PRO B O     1 
ATOM   1056  C  CB    . PRO B  2  53  ? -24.528  -40.367 6.208   1.00 191.57 ? 53  PRO B CB    1 
ATOM   1057  C  CG    . PRO B  2  53  ? -23.541  -40.483 7.331   1.00 184.09 ? 53  PRO B CG    1 
ATOM   1058  C  CD    . PRO B  2  53  ? -24.034  -39.753 8.521   1.00 178.17 ? 53  PRO B CD    1 
ATOM   1059  N  N     . LYS B  2  54  ? -28.067  -40.716 6.371   1.00 209.88 ? 54  LYS B N     1 
ATOM   1060  C  CA    . LYS B  2  54  ? -29.137  -41.742 6.598   1.00 207.39 ? 54  LYS B CA    1 
ATOM   1061  C  C     . LYS B  2  54  ? -28.680  -43.109 6.049   1.00 224.22 ? 54  LYS B C     1 
ATOM   1062  O  O     . LYS B  2  54  ? -28.972  -44.143 6.654   1.00 229.41 ? 54  LYS B O     1 
ATOM   1063  C  CB    . LYS B  2  54  ? -30.534  -41.443 6.034   1.00 187.92 ? 54  LYS B CB    1 
ATOM   1064  C  CG    . LYS B  2  54  ? -31.583  -42.551 6.167   1.00 179.81 ? 54  LYS B CG    1 
ATOM   1065  C  CD    . LYS B  2  54  ? -32.382  -42.710 7.464   1.00 173.86 ? 54  LYS B CD    1 
ATOM   1066  C  CE    . LYS B  2  54  ? -32.954  -44.105 7.632   1.00 164.72 ? 54  LYS B CE    1 
ATOM   1067  N  NZ    . LYS B  2  54  ? -34.287  -44.208 7.001   1.00 168.12 ? 54  LYS B NZ    1 
ATOM   1068  N  N     . ASN B  2  55  ? -27.992  -43.127 4.909   1.00 226.83 ? 55  ASN B N     1 
ATOM   1069  C  CA    . ASN B  2  55  ? -27.287  -44.348 4.455   1.00 221.07 ? 55  ASN B CA    1 
ATOM   1070  C  C     . ASN B  2  55  ? -26.149  -44.738 5.417   1.00 233.38 ? 55  ASN B C     1 
ATOM   1071  O  O     . ASN B  2  55  ? -25.568  -43.855 6.041   1.00 254.46 ? 55  ASN B O     1 
ATOM   1072  C  CB    . ASN B  2  55  ? -26.834  -44.234 3.000   1.00 203.96 ? 55  ASN B CB    1 
ATOM   1073  C  CG    . ASN B  2  55  ? -26.642  -45.586 2.343   1.00 195.43 ? 55  ASN B CG    1 
ATOM   1074  O  OD1   . ASN B  2  55  ? -26.109  -46.496 2.964   1.00 202.11 ? 55  ASN B OD1   1 
ATOM   1075  N  ND2   . ASN B  2  55  ? -27.086  -45.737 1.099   1.00 189.44 ? 55  ASN B ND2   1 
ATOM   1076  N  N     . SER B  2  56  ? -25.910  -46.039 5.611   1.00 231.75 ? 56  SER B N     1 
ATOM   1077  C  CA    . SER B  2  56  ? -25.165  -46.476 6.825   1.00 219.64 ? 56  SER B CA    1 
ATOM   1078  C  C     . SER B  2  56  ? -23.735  -45.943 6.900   1.00 207.47 ? 56  SER B C     1 
ATOM   1079  O  O     . SER B  2  56  ? -23.280  -45.647 7.992   1.00 200.20 ? 56  SER B O     1 
ATOM   1080  C  CB    . SER B  2  56  ? -25.163  -48.008 7.080   1.00 221.67 ? 56  SER B CB    1 
ATOM   1081  O  OG    . SER B  2  56  ? -24.656  -48.710 5.974   1.00 234.16 ? 56  SER B OG    1 
ATOM   1082  N  N     . LYS B  2  57  ? -23.063  -45.789 5.760   1.00 201.66 ? 57  LYS B N     1 
ATOM   1083  C  CA    . LYS B  2  57  ? -21.728  -45.169 5.691   1.00 199.44 ? 57  LYS B CA    1 
ATOM   1084  C  C     . LYS B  2  57  ? -21.555  -44.158 4.550   1.00 220.14 ? 57  LYS B C     1 
ATOM   1085  O  O     . LYS B  2  57  ? -21.244  -44.524 3.417   1.00 230.29 ? 57  LYS B O     1 
ATOM   1086  C  CB    . LYS B  2  57  ? -20.623  -46.219 5.573   1.00 178.56 ? 57  LYS B CB    1 
ATOM   1087  C  CG    . LYS B  2  57  ? -20.555  -47.225 6.693   1.00 167.49 ? 57  LYS B CG    1 
ATOM   1088  C  CD    . LYS B  2  57  ? -20.180  -46.646 8.046   1.00 150.12 ? 57  LYS B CD    1 
ATOM   1089  C  CE    . LYS B  2  57  ? -20.450  -47.712 9.092   1.00 137.29 ? 57  LYS B CE    1 
ATOM   1090  N  NZ    . LYS B  2  57  ? -20.009  -47.266 10.429  1.00 131.13 ? 57  LYS B NZ    1 
ATOM   1091  N  N     . GLN B  2  58  ? -21.760  -42.875 4.850   1.00 225.49 ? 58  GLN B N     1 
ATOM   1092  C  CA    . GLN B  2  58  ? -21.266  -41.763 4.035   1.00 208.63 ? 58  GLN B CA    1 
ATOM   1093  C  C     . GLN B  2  58  ? -20.640  -40.753 4.970   1.00 207.39 ? 58  GLN B C     1 
ATOM   1094  O  O     . GLN B  2  58  ? -20.925  -40.759 6.163   1.00 193.24 ? 58  GLN B O     1 
ATOM   1095  C  CB    . GLN B  2  58  ? -22.379  -41.076 3.282   1.00 195.39 ? 58  GLN B CB    1 
ATOM   1096  C  CG    . GLN B  2  58  ? -23.255  -42.032 2.503   1.00 182.10 ? 58  GLN B CG    1 
ATOM   1097  C  CD    . GLN B  2  58  ? -24.453  -41.323 1.930   1.00 167.89 ? 58  GLN B CD    1 
ATOM   1098  O  OE1   . GLN B  2  58  ? -24.679  -40.155 2.193   1.00 149.44 ? 58  GLN B OE1   1 
ATOM   1099  N  NE2   . GLN B  2  58  ? -25.245  -42.041 1.173   1.00 167.82 ? 58  GLN B NE2   1 
ATOM   1100  N  N     . ALA B  2  59  ? -19.804  -39.889 4.406   1.00 210.63 ? 59  ALA B N     1 
ATOM   1101  C  CA    . ALA B  2  59  ? -19.151  -38.830 5.170   1.00 207.21 ? 59  ALA B CA    1 
ATOM   1102  C  C     . ALA B  2  59  ? -20.177  -37.944 5.882   1.00 203.51 ? 59  ALA B C     1 
ATOM   1103  O  O     . ALA B  2  59  ? -21.253  -37.645 5.371   1.00 207.39 ? 59  ALA B O     1 
ATOM   1104  C  CB    . ALA B  2  59  ? -18.221  -38.003 4.292   1.00 197.87 ? 59  ALA B CB    1 
ATOM   1105  N  N     . GLU B  2  60  ? -19.847  -37.556 7.103   1.00 187.92 ? 60  GLU B N     1 
ATOM   1106  C  CA    . GLU B  2  60  ? -20.762  -36.828 7.933   1.00 169.38 ? 60  GLU B CA    1 
ATOM   1107  C  C     . GLU B  2  60  ? -20.573  -35.355 7.620   1.00 155.71 ? 60  GLU B C     1 
ATOM   1108  O  O     . GLU B  2  60  ? -19.443  -34.937 7.354   1.00 151.66 ? 60  GLU B O     1 
ATOM   1109  C  CB    . GLU B  2  60  ? -20.429  -37.143 9.370   1.00 175.55 ? 60  GLU B CB    1 
ATOM   1110  C  CG    . GLU B  2  60  ? -21.421  -36.765 10.425  1.00 173.93 ? 60  GLU B CG    1 
ATOM   1111  C  CD    . GLU B  2  60  ? -20.799  -36.817 11.803  1.00 173.23 ? 60  GLU B CD    1 
ATOM   1112  O  OE1   . GLU B  2  60  ? -19.581  -37.091 11.937  1.00 161.76 ? 60  GLU B OE1   1 
ATOM   1113  O  OE2   . GLU B  2  60  ? -21.578  -36.624 12.759  1.00 179.13 ? 60  GLU B OE2   1 
ATOM   1114  N  N     . ARG B  2  61  ? -21.648  -34.571 7.663   1.00 142.31 ? 61  ARG B N     1 
ATOM   1115  C  CA    . ARG B  2  61  ? -21.572  -33.115 7.417   1.00 137.80 ? 61  ARG B CA    1 
ATOM   1116  C  C     . ARG B  2  61  ? -21.335  -32.354 8.727   1.00 116.80 ? 61  ARG B C     1 
ATOM   1117  O  O     . ARG B  2  61  ? -21.968  -32.668 9.734   1.00 113.30 ? 61  ARG B O     1 
ATOM   1118  C  CB    . ARG B  2  61  ? -22.853  -32.587 6.752   1.00 147.30 ? 61  ARG B CB    1 
ATOM   1119  C  CG    . ARG B  2  61  ? -23.109  -33.061 5.286   1.00 154.29 ? 61  ARG B CG    1 
ATOM   1120  C  CD    . ARG B  2  61  ? -22.076  -32.346 4.421   1.00 162.61 ? 61  ARG B CD    1 
ATOM   1121  N  NE    . ARG B  2  61  ? -22.317  -30.902 4.406   1.00 166.46 ? 61  ARG B NE    1 
ATOM   1122  C  CZ    . ARG B  2  61  ? -21.424  -29.953 4.118   1.00 153.96 ? 61  ARG B CZ    1 
ATOM   1123  N  NH1   . ARG B  2  61  ? -20.169  -30.260 3.814   1.00 144.72 ? 61  ARG B NH1   1 
ATOM   1124  N  NH2   . ARG B  2  61  ? -21.792  -28.677 4.197   1.00 151.20 ? 61  ARG B NH2   1 
ATOM   1125  N  N     . GLU B  2  62  ? -20.380  -31.420 8.715   1.00 97.50  ? 62  GLU B N     1 
ATOM   1126  C  CA    . GLU B  2  62  ? -20.300  -30.360 9.691   1.00 96.67  ? 62  GLU B CA    1 
ATOM   1127  C  C     . GLU B  2  62  ? -21.010  -29.175 9.028   1.00 87.81  ? 62  GLU B C     1 
ATOM   1128  O  O     . GLU B  2  62  ? -20.764  -28.879 7.881   1.00 87.24  ? 62  GLU B O     1 
ATOM   1129  C  CB    . GLU B  2  62  ? -18.838  -30.061 10.068  1.00 107.80 ? 62  GLU B CB    1 
ATOM   1130  C  CG    . GLU B  2  62  ? -18.621  -29.053 11.203  1.00 123.81 ? 62  GLU B CG    1 
ATOM   1131  C  CD    . GLU B  2  62  ? -17.513  -29.402 12.219  1.00 136.54 ? 62  GLU B CD    1 
ATOM   1132  O  OE1   . GLU B  2  62  ? -17.460  -30.561 12.684  1.00 137.11 ? 62  GLU B OE1   1 
ATOM   1133  O  OE2   . GLU B  2  62  ? -16.742  -28.501 12.660  1.00 145.92 ? 62  GLU B OE2   1 
ATOM   1134  N  N     . GLU B  2  63  ? -21.896  -28.503 9.755   1.00 81.26  ? 63  GLU B N     1 
ATOM   1135  C  CA    . GLU B  2  63  ? -22.634  -27.345 9.282   1.00 76.76  ? 63  GLU B CA    1 
ATOM   1136  C  C     . GLU B  2  63  ? -22.393  -26.144 10.206  1.00 69.94  ? 63  GLU B C     1 
ATOM   1137  O  O     . GLU B  2  63  ? -23.033  -26.037 11.269  1.00 88.97  ? 63  GLU B O     1 
ATOM   1138  C  CB    . GLU B  2  63  ? -24.151  -27.635 9.239   1.00 80.98  ? 63  GLU B CB    1 
ATOM   1139  C  CG    . GLU B  2  63  ? -24.644  -28.578 8.164   1.00 89.65  ? 63  GLU B CG    1 
ATOM   1140  C  CD    . GLU B  2  63  ? -26.064  -28.231 7.704   1.00 101.15 ? 63  GLU B CD    1 
ATOM   1141  O  OE1   . GLU B  2  63  ? -27.016  -29.037 7.918   1.00 101.62 ? 63  GLU B OE1   1 
ATOM   1142  O  OE2   . GLU B  2  63  ? -26.225  -27.131 7.108   1.00 106.61 ? 63  GLU B OE2   1 
ATOM   1143  N  N     . LYS B  2  64  ? -21.614  -25.176 9.750   1.00 60.55  ? 64  LYS B N     1 
ATOM   1144  C  CA    . LYS B  2  64  ? -21.505  -23.898 10.419  1.00 57.23  ? 64  LYS B CA    1 
ATOM   1145  C  C     . LYS B  2  64  ? -22.674  -22.965 10.137  1.00 55.32  ? 64  LYS B C     1 
ATOM   1146  O  O     . LYS B  2  64  ? -23.409  -23.125 9.196   1.00 63.08  ? 64  LYS B O     1 
ATOM   1147  C  CB    . LYS B  2  64  ? -20.221  -23.185 10.076  1.00 58.47  ? 64  LYS B CB    1 
ATOM   1148  C  CG    . LYS B  2  64  ? -20.063  -21.876 10.824  1.00 65.16  ? 64  LYS B CG    1 
ATOM   1149  C  CD    . LYS B  2  64  ? -18.644  -21.362 10.852  1.00 69.34  ? 64  LYS B CD    1 
ATOM   1150  C  CE    . LYS B  2  64  ? -18.359  -20.553 9.613   1.00 73.37  ? 64  LYS B CE    1 
ATOM   1151  N  NZ    . LYS B  2  64  ? -16.926  -20.211 9.733   1.00 82.64  ? 64  LYS B NZ    1 
ATOM   1152  N  N     . ARG B  2  65  ? -22.929  -22.034 11.043  1.00 53.72  ? 65  ARG B N     1 
ATOM   1153  C  CA    . ARG B  2  65  ? -23.969  -21.062 10.921  1.00 52.96  ? 65  ARG B CA    1 
ATOM   1154  C  C     . ARG B  2  65  ? -23.598  -19.971 11.886  1.00 53.80  ? 65  ARG B C     1 
ATOM   1155  O  O     . ARG B  2  65  ? -23.467  -20.237 13.084  1.00 57.15  ? 65  ARG B O     1 
ATOM   1156  C  CB    . ARG B  2  65  ? -25.274  -21.728 11.356  1.00 54.52  ? 65  ARG B CB    1 
ATOM   1157  C  CG    . ARG B  2  65  ? -26.391  -20.725 11.444  1.00 56.93  ? 65  ARG B CG    1 
ATOM   1158  C  CD    . ARG B  2  65  ? -27.752  -21.378 11.437  1.00 60.55  ? 65  ARG B CD    1 
ATOM   1159  N  NE    . ARG B  2  65  ? -28.122  -21.925 12.735  1.00 61.22  ? 65  ARG B NE    1 
ATOM   1160  C  CZ    . ARG B  2  65  ? -29.367  -22.098 13.139  1.00 67.23  ? 65  ARG B CZ    1 
ATOM   1161  N  NH1   . ARG B  2  65  ? -30.405  -21.706 12.410  1.00 74.34  ? 65  ARG B NH1   1 
ATOM   1162  N  NH2   . ARG B  2  65  ? -29.604  -22.630 14.313  1.00 71.08  ? 65  ARG B NH2   1 
ATOM   1163  N  N     . VAL B  2  66  ? -23.496  -18.743 11.412  1.00 56.71  ? 66  VAL B N     1 
ATOM   1164  C  CA    . VAL B  2  66  ? -23.061  -17.666 12.289  1.00 59.02  ? 66  VAL B CA    1 
ATOM   1165  C  C     . VAL B  2  66  ? -24.210  -17.047 13.072  1.00 63.68  ? 66  VAL B C     1 
ATOM   1166  O  O     . VAL B  2  66  ? -25.229  -16.707 12.487  1.00 76.78  ? 66  VAL B O     1 
ATOM   1167  C  CB    . VAL B  2  66  ? -22.332  -16.573 11.523  1.00 57.74  ? 66  VAL B CB    1 
ATOM   1168  C  CG1   . VAL B  2  66  ? -21.913  -15.447 12.467  1.00 63.47  ? 66  VAL B CG1   1 
ATOM   1169  C  CG2   . VAL B  2  66  ? -21.110  -17.207 10.880  1.00 58.35  ? 66  VAL B CG2   1 
ATOM   1170  N  N     . LEU B  2  67  ? -24.014  -16.841 14.371  1.00 63.33  ? 67  LEU B N     1 
ATOM   1171  C  CA    . LEU B  2  67  ? -25.007  -16.226 15.206  1.00 63.13  ? 67  LEU B CA    1 
ATOM   1172  C  C     . LEU B  2  67  ? -24.636  -14.864 15.699  1.00 59.64  ? 67  LEU B C     1 
ATOM   1173  O  O     . LEU B  2  67  ? -25.517  -14.063 15.933  1.00 68.28  ? 67  LEU B O     1 
ATOM   1174  C  CB    . LEU B  2  67  ? -25.268  -17.132 16.392  1.00 65.87  ? 67  LEU B CB    1 
ATOM   1175  C  CG    . LEU B  2  67  ? -25.512  -18.618 16.104  1.00 66.74  ? 67  LEU B CG    1 
ATOM   1176  C  CD1   . LEU B  2  67  ? -25.685  -19.448 17.386  1.00 71.11  ? 67  LEU B CD1   1 
ATOM   1177  C  CD2   . LEU B  2  67  ? -26.690  -18.844 15.173  1.00 60.84  ? 67  LEU B CD2   1 
ATOM   1178  N  N     . GLY B  2  68  ? -23.377  -14.590 15.917  1.00 60.79  ? 68  GLY B N     1 
ATOM   1179  C  CA    . GLY B  2  68  ? -23.005  -13.262 16.413  1.00 71.17  ? 68  GLY B CA    1 
ATOM   1180  C  C     . GLY B  2  68  ? -23.018  -13.176 17.929  1.00 72.91  ? 68  GLY B C     1 
ATOM   1181  O  O     . GLY B  2  68  ? -22.392  -14.048 18.570  1.00 72.43  ? 68  GLY B O     1 
ATOM   1182  N  N     . LEU B  2  69  ? -23.681  -12.165 18.511  1.00 70.87  ? 69  LEU B N     1 
ATOM   1183  C  CA    . LEU B  2  69  ? -23.737  -12.068 20.000  1.00 65.85  ? 69  LEU B CA    1 
ATOM   1184  C  C     . LEU B  2  69  ? -24.875  -12.870 20.638  1.00 58.53  ? 69  LEU B C     1 
ATOM   1185  O  O     . LEU B  2  69  ? -26.035  -12.496 20.443  1.00 64.46  ? 69  LEU B O     1 
ATOM   1186  C  CB    . LEU B  2  69  ? -23.848  -10.639 20.487  1.00 62.50  ? 69  LEU B CB    1 
ATOM   1187  C  CG    . LEU B  2  69  ? -23.852  -10.617 22.008  1.00 63.00  ? 69  LEU B CG    1 
ATOM   1188  C  CD1   . LEU B  2  69  ? -22.474  -10.754 22.585  1.00 64.72  ? 69  LEU B CD1   1 
ATOM   1189  C  CD2   . LEU B  2  69  ? -24.407  -9.309  22.500  1.00 71.91  ? 69  LEU B CD2   1 
ATOM   1190  N  N     . VAL B  2  70  ? -24.531  -13.899 21.405  1.00 48.90  ? 70  VAL B N     1 
ATOM   1191  C  CA    . VAL B  2  70  ? -25.463  -14.890 21.815  1.00 47.93  ? 70  VAL B CA    1 
ATOM   1192  C  C     . VAL B  2  70  ? -25.575  -14.930 23.313  1.00 46.97  ? 70  VAL B C     1 
ATOM   1193  O  O     . VAL B  2  70  ? -24.559  -14.813 24.030  1.00 46.65  ? 70  VAL B O     1 
ATOM   1194  C  CB    . VAL B  2  70  ? -24.966  -16.257 21.389  1.00 53.85  ? 70  VAL B CB    1 
ATOM   1195  C  CG1   . VAL B  2  70  ? -25.926  -17.357 21.830  1.00 57.28  ? 70  VAL B CG1   1 
ATOM   1196  C  CG2   . VAL B  2  70  ? -24.879  -16.335 19.880  1.00 59.00  ? 70  VAL B CG2   1 
ATOM   1197  N  N     . LEU B  2  71  ? -26.805  -15.108 23.807  1.00 43.32  ? 71  LEU B N     1 
ATOM   1198  C  CA    . LEU B  2  71  ? -27.024  -15.339 25.217  1.00 44.56  ? 71  LEU B CA    1 
ATOM   1199  C  C     . LEU B  2  71  ? -27.548  -16.741 25.319  1.00 47.16  ? 71  LEU B C     1 
ATOM   1200  O  O     . LEU B  2  71  ? -28.712  -16.983 24.978  1.00 53.77  ? 71  LEU B O     1 
ATOM   1201  C  CB    . LEU B  2  71  ? -28.052  -14.384 25.730  1.00 47.12  ? 71  LEU B CB    1 
ATOM   1202  C  CG    . LEU B  2  71  ? -28.311  -14.319 27.231  1.00 52.21  ? 71  LEU B CG    1 
ATOM   1203  C  CD1   . LEU B  2  71  ? -28.684  -12.874 27.613  1.00 54.73  ? 71  LEU B CD1   1 
ATOM   1204  C  CD2   . LEU B  2  71  ? -29.454  -15.184 27.713  1.00 54.39  ? 71  LEU B CD2   1 
ATOM   1205  N  N     . LEU B  2  72  ? -26.743  -17.663 25.853  1.00 45.95  ? 72  LEU B N     1 
ATOM   1206  C  CA    . LEU B  2  72  ? -27.164  -19.055 26.051  1.00 42.96  ? 72  LEU B CA    1 
ATOM   1207  C  C     . LEU B  2  72  ? -27.766  -19.320 27.447  1.00 43.90  ? 72  LEU B C     1 
ATOM   1208  O  O     . LEU B  2  72  ? -27.173  -18.998 28.481  1.00 44.67  ? 72  LEU B O     1 
ATOM   1209  C  CB    . LEU B  2  72  ? -25.935  -19.881 25.943  1.00 43.39  ? 72  LEU B CB    1 
ATOM   1210  C  CG    . LEU B  2  72  ? -26.144  -21.383 26.113  1.00 46.41  ? 72  LEU B CG    1 
ATOM   1211  C  CD1   . LEU B  2  72  ? -27.101  -21.900 25.023  1.00 47.22  ? 72  LEU B CD1   1 
ATOM   1212  C  CD2   . LEU B  2  72  ? -24.772  -22.066 26.063  1.00 46.44  ? 72  LEU B CD2   1 
ATOM   1213  N  N     . ARG B  2  73  ? -28.972  -19.845 27.514  1.00 43.58  ? 73  ARG B N     1 
ATOM   1214  C  CA    . ARG B  2  73  ? -29.550  -20.169 28.807  1.00 45.88  ? 73  ARG B CA    1 
ATOM   1215  C  C     . ARG B  2  73  ? -28.749  -21.338 29.412  1.00 44.22  ? 73  ARG B C     1 
ATOM   1216  O  O     . ARG B  2  73  ? -28.655  -22.403 28.785  1.00 46.90  ? 73  ARG B O     1 
ATOM   1217  C  CB    . ARG B  2  73  ? -31.092  -20.432 28.747  1.00 48.18  ? 73  ARG B CB    1 
ATOM   1218  C  CG    . ARG B  2  73  ? -31.800  -20.407 30.088  1.00 49.29  ? 73  ARG B CG    1 
ATOM   1219  C  CD    . ARG B  2  73  ? -33.239  -20.784 29.970  1.00 52.96  ? 73  ARG B CD    1 
ATOM   1220  N  NE    . ARG B  2  73  ? -33.917  -21.092 31.241  1.00 58.26  ? 73  ARG B NE    1 
ATOM   1221  C  CZ    . ARG B  2  73  ? -34.412  -20.195 32.102  1.00 60.66  ? 73  ARG B CZ    1 
ATOM   1222  N  NH1   . ARG B  2  73  ? -34.236  -18.888 31.925  1.00 59.45  ? 73  ARG B NH1   1 
ATOM   1223  N  NH2   . ARG B  2  73  ? -35.047  -20.609 33.183  1.00 61.74  ? 73  ARG B NH2   1 
ATOM   1224  N  N     . GLY B  2  74  ? -28.334  -21.177 30.662  1.00 42.67  ? 74  GLY B N     1 
ATOM   1225  C  CA    . GLY B  2  74  ? -27.648  -22.184 31.450  1.00 43.86  ? 74  GLY B CA    1 
ATOM   1226  C  C     . GLY B  2  74  ? -28.165  -23.610 31.386  1.00 46.83  ? 74  GLY B C     1 
ATOM   1227  O  O     . GLY B  2  74  ? -27.380  -24.528 31.178  1.00 46.19  ? 74  GLY B O     1 
ATOM   1228  N  N     . GLU B  2  75  ? -29.476  -23.807 31.505  1.00 50.06  ? 75  GLU B N     1 
ATOM   1229  C  CA    . GLU B  2  75  ? -30.071  -25.128 31.415  1.00 54.27  ? 75  GLU B CA    1 
ATOM   1230  C  C     . GLU B  2  75  ? -29.604  -25.934 30.185  1.00 50.58  ? 75  GLU B C     1 
ATOM   1231  O  O     . GLU B  2  75  ? -29.439  -27.139 30.282  1.00 51.43  ? 75  GLU B O     1 
ATOM   1232  C  CB    . GLU B  2  75  ? -31.605  -25.016 31.353  1.00 68.35  ? 75  GLU B CB    1 
ATOM   1233  C  CG    . GLU B  2  75  ? -32.450  -24.957 32.627  1.00 77.28  ? 75  GLU B CG    1 
ATOM   1234  C  CD    . GLU B  2  75  ? -33.969  -24.738 32.347  1.00 91.02  ? 75  GLU B CD    1 
ATOM   1235  O  OE1   . GLU B  2  75  ? -34.613  -25.798 32.457  1.00 101.44 ? 75  GLU B OE1   1 
ATOM   1236  O  OE2   . GLU B  2  75  ? -34.560  -23.641 32.036  1.00 89.29  ? 75  GLU B OE2   1 
ATOM   1237  N  N     . ASN B  2  76  ? -29.389  -25.288 29.048  1.00 49.51  ? 76  ASN B N     1 
ATOM   1238  C  CA    . ASN B  2  76  ? -29.074  -26.003 27.839  1.00 54.05  ? 76  ASN B CA    1 
ATOM   1239  C  C     . ASN B  2  76  ? -27.599  -26.261 27.652  1.00 53.10  ? 76  ASN B C     1 
ATOM   1240  O  O     . ASN B  2  76  ? -27.190  -26.891 26.691  1.00 56.35  ? 76  ASN B O     1 
ATOM   1241  C  CB    . ASN B  2  76  ? -29.618  -25.253 26.624  1.00 62.78  ? 76  ASN B CB    1 
ATOM   1242  C  CG    . ASN B  2  76  ? -31.112  -24.990 26.723  1.00 76.14  ? 76  ASN B CG    1 
ATOM   1243  O  OD1   . ASN B  2  76  ? -31.529  -23.904 27.143  1.00 93.61  ? 76  ASN B OD1   1 
ATOM   1244  N  ND2   . ASN B  2  76  ? -31.924  -25.973 26.364  1.00 83.12  ? 76  ASN B ND2   1 
ATOM   1245  N  N     . LEU B  2  77  ? -26.772  -25.760 28.559  1.00 54.36  ? 77  LEU B N     1 
ATOM   1246  C  CA    . LEU B  2  77  ? -25.327  -26.004 28.553  1.00 49.09  ? 77  LEU B CA    1 
ATOM   1247  C  C     . LEU B  2  77  ? -24.990  -27.320 29.176  1.00 46.15  ? 77  LEU B C     1 
ATOM   1248  O  O     . LEU B  2  77  ? -25.586  -27.724 30.164  1.00 52.20  ? 77  LEU B O     1 
ATOM   1249  C  CB    . LEU B  2  77  ? -24.650  -24.953 29.386  1.00 49.25  ? 77  LEU B CB    1 
ATOM   1250  C  CG    . LEU B  2  77  ? -23.145  -24.982 29.251  1.00 54.66  ? 77  LEU B CG    1 
ATOM   1251  C  CD1   . LEU B  2  77  ? -22.599  -25.039 27.823  1.00 54.27  ? 77  LEU B CD1   1 
ATOM   1252  C  CD2   . LEU B  2  77  ? -22.615  -23.715 29.947  1.00 59.80  ? 77  LEU B CD2   1 
ATOM   1253  N  N     . VAL B  2  78  ? -24.077  -28.043 28.559  1.00 45.77  ? 78  VAL B N     1 
ATOM   1254  C  CA    . VAL B  2  78  ? -23.522  -29.308 29.092  1.00 42.81  ? 78  VAL B CA    1 
ATOM   1255  C  C     . VAL B  2  78  ? -22.117  -29.141 29.601  1.00 44.37  ? 78  VAL B C     1 
ATOM   1256  O  O     . VAL B  2  78  ? -21.868  -29.267 30.795  1.00 40.92  ? 78  VAL B O     1 
ATOM   1257  C  CB    . VAL B  2  78  ? -23.461  -30.423 28.063  1.00 37.12  ? 78  VAL B CB    1 
ATOM   1258  C  CG1   . VAL B  2  78  ? -22.970  -31.663 28.746  1.00 36.75  ? 78  VAL B CG1   1 
ATOM   1259  C  CG2   . VAL B  2  78  ? -24.834  -30.667 27.579  1.00 37.66  ? 78  VAL B CG2   1 
ATOM   1260  N  N     . SER B  2  79  ? -21.249  -28.816 28.643  1.00 48.86  ? 79  SER B N     1 
ATOM   1261  C  CA    . SER B  2  79  ? -19.870  -28.592 28.916  1.00 51.47  ? 79  SER B CA    1 
ATOM   1262  C  C     . SER B  2  79  ? -19.211  -27.432 28.171  1.00 51.39  ? 79  SER B C     1 
ATOM   1263  O  O     . SER B  2  79  ? -19.637  -27.122 27.099  1.00 47.47  ? 79  SER B O     1 
ATOM   1264  C  CB    . SER B  2  79  ? -19.179  -29.915 28.650  1.00 54.23  ? 79  SER B CB    1 
ATOM   1265  O  OG    . SER B  2  79  ? -19.155  -30.255 27.284  1.00 55.61  ? 79  SER B OG    1 
ATOM   1266  N  N     . MET B  2  80  ? -18.145  -26.874 28.742  1.00 54.79  ? 80  MET B N     1 
ATOM   1267  C  CA    . MET B  2  80  ? -17.213  -25.999 28.065  1.00 54.21  ? 80  MET B CA    1 
ATOM   1268  C  C     . MET B  2  80  ? -15.770  -26.430 28.174  1.00 55.81  ? 80  MET B C     1 
ATOM   1269  O  O     . MET B  2  80  ? -15.297  -26.756 29.258  1.00 55.30  ? 80  MET B O     1 
ATOM   1270  C  CB    . MET B  2  80  ? -17.356  -24.564 28.568  1.00 51.11  ? 80  MET B CB    1 
ATOM   1271  C  CG    . MET B  2  80  ? -18.678  -23.873 28.268  1.00 55.97  ? 80  MET B CG    1 
ATOM   1272  S  SD    . MET B  2  80  ? -18.786  -22.157 28.798  1.00 62.06  ? 80  MET B SD    1 
ATOM   1273  C  CE    . MET B  2  80  ? -19.023  -22.140 30.563  1.00 68.16  ? 80  MET B CE    1 
ATOM   1274  N  N     . THR B  2  81  ? -15.092  -26.396 27.026  1.00 59.66  ? 81  THR B N     1 
ATOM   1275  C  CA    . THR B  2  81  ? -13.635  -26.448 26.934  1.00 60.30  ? 81  THR B CA    1 
ATOM   1276  C  C     . THR B  2  81  ? -13.142  -25.291 26.099  1.00 60.06  ? 81  THR B C     1 
ATOM   1277  O  O     . THR B  2  81  ? -13.906  -24.670 25.391  1.00 56.59  ? 81  THR B O     1 
ATOM   1278  C  CB    . THR B  2  81  ? -13.087  -27.702 26.266  1.00 63.51  ? 81  THR B CB    1 
ATOM   1279  O  OG1   . THR B  2  81  ? -11.666  -27.776 26.410  1.00 65.38  ? 81  THR B OG1   1 
ATOM   1280  C  CG2   . THR B  2  81  ? -13.398  -27.727 24.776  1.00 67.25  ? 81  THR B CG2   1 
ATOM   1281  N  N     . VAL B  2  82  ? -11.860  -24.975 26.253  1.00 65.60  ? 82  VAL B N     1 
ATOM   1282  C  CA    . VAL B  2  82  ? -11.248  -23.820 25.607  1.00 61.89  ? 82  VAL B CA    1 
ATOM   1283  C  C     . VAL B  2  82  ? -10.896  -24.214 24.200  1.00 62.34  ? 82  VAL B C     1 
ATOM   1284  O  O     . VAL B  2  82  ? -10.252  -25.226 23.978  1.00 60.45  ? 82  VAL B O     1 
ATOM   1285  C  CB    . VAL B  2  82  ? -9.994   -23.388 26.335  1.00 59.93  ? 82  VAL B CB    1 
ATOM   1286  C  CG1   . VAL B  2  82  ? -9.262   -22.361 25.498  1.00 63.75  ? 82  VAL B CG1   1 
ATOM   1287  C  CG2   . VAL B  2  82  ? -10.349  -22.781 27.655  1.00 57.30  ? 82  VAL B CG2   1 
ATOM   1288  N  N     . GLU B  2  83  ? -11.265  -23.353 23.272  1.00 66.90  ? 83  GLU B N     1 
ATOM   1289  C  CA    . GLU B  2  83  ? -11.048  -23.591 21.868  1.00 70.19  ? 83  GLU B CA    1 
ATOM   1290  C  C     . GLU B  2  83  ? -9.724   -22.923 21.487  1.00 75.03  ? 83  GLU B C     1 
ATOM   1291  O  O     . GLU B  2  83  ? -8.956   -23.511 20.701  1.00 90.14  ? 83  GLU B O     1 
ATOM   1292  C  CB    . GLU B  2  83  ? -12.230  -23.029 21.051  1.00 66.73  ? 83  GLU B CB    1 
ATOM   1293  C  CG    . GLU B  2  83  ? -12.091  -23.163 19.544  1.00 69.89  ? 83  GLU B CG    1 
ATOM   1294  C  CD    . GLU B  2  83  ? -12.294  -24.569 19.038  1.00 73.12  ? 83  GLU B CD    1 
ATOM   1295  O  OE1   . GLU B  2  83  ? -12.464  -25.502 19.859  1.00 71.19  ? 83  GLU B OE1   1 
ATOM   1296  O  OE2   . GLU B  2  83  ? -12.268  -24.684 17.786  1.00 75.54  ? 83  GLU B OE2   1 
ATOM   1297  N  N     . GLY B  2  84  ? -9.546   -21.670 21.907  1.00 70.05  ? 84  GLY B N     1 
ATOM   1298  C  CA    . GLY B  2  84  ? -8.455   -20.835 21.442  1.00 74.56  ? 84  GLY B CA    1 
ATOM   1299  C  C     . GLY B  2  84  ? -8.298   -19.618 22.337  1.00 86.04  ? 84  GLY B C     1 
ATOM   1300  O  O     . GLY B  2  84  ? -9.073   -19.419 23.293  1.00 83.80  ? 84  GLY B O     1 
ATOM   1301  N  N     . PRO B  2  85  ? -7.191   -18.862 22.144  1.00 90.50  ? 85  PRO B N     1 
ATOM   1302  C  CA    . PRO B  2  85  ? -6.882   -17.741 23.052  1.00 85.61  ? 85  PRO B CA    1 
ATOM   1303  C  C     . PRO B  2  85  ? -7.684   -16.527 22.625  1.00 81.23  ? 85  PRO B C     1 
ATOM   1304  O  O     . PRO B  2  85  ? -8.235   -16.569 21.525  1.00 84.77  ? 85  PRO B O     1 
ATOM   1305  C  CB    . PRO B  2  85  ? -5.371   -17.509 22.865  1.00 86.90  ? 85  PRO B CB    1 
ATOM   1306  C  CG    . PRO B  2  85  ? -4.976   -18.294 21.660  1.00 89.85  ? 85  PRO B CG    1 
ATOM   1307  C  CD    . PRO B  2  85  ? -6.181   -18.977 21.077  1.00 91.09  ? 85  PRO B CD    1 
ATOM   1308  N  N     . PRO B  2  86  ? -7.766   -15.480 23.471  1.00 80.10  ? 86  PRO B N     1 
ATOM   1309  C  CA    . PRO B  2  86  ? -8.552   -14.291 23.125  1.00 81.13  ? 86  PRO B CA    1 
ATOM   1310  C  C     . PRO B  2  86  ? -8.051   -13.677 21.824  1.00 92.86  ? 86  PRO B C     1 
ATOM   1311  O  O     . PRO B  2  86  ? -6.825   -13.612 21.636  1.00 98.69  ? 86  PRO B O     1 
ATOM   1312  C  CB    . PRO B  2  86  ? -8.310   -13.332 24.286  1.00 77.44  ? 86  PRO B CB    1 
ATOM   1313  C  CG    . PRO B  2  86  ? -7.550   -14.066 25.335  1.00 78.61  ? 86  PRO B CG    1 
ATOM   1314  C  CD    . PRO B  2  86  ? -7.248   -15.441 24.854  1.00 80.95  ? 86  PRO B CD    1 
ATOM   1315  N  N     . PRO B  2  87  ? -8.961   -13.248 20.929  1.00 104.06 ? 87  PRO B N     1 
ATOM   1316  C  CA    . PRO B  2  87  ? -8.544   -12.495 19.743  1.00 117.72 ? 87  PRO B CA    1 
ATOM   1317  C  C     . PRO B  2  87  ? -7.900   -11.139 20.049  1.00 128.90 ? 87  PRO B C     1 
ATOM   1318  O  O     . PRO B  2  87  ? -8.025   -10.650 21.174  1.00 128.42 ? 87  PRO B O     1 
ATOM   1319  C  CB    . PRO B  2  87  ? -9.863   -12.267 19.022  1.00 118.86 ? 87  PRO B CB    1 
ATOM   1320  C  CG    . PRO B  2  87  ? -10.591  -13.538 19.291  1.00 110.77 ? 87  PRO B CG    1 
ATOM   1321  C  CD    . PRO B  2  87  ? -10.332  -13.742 20.759  1.00 104.40 ? 87  PRO B CD    1 
ATOM   1322  N  N     . LYS B  2  88  ? -7.213   -10.556 19.064  1.00 139.36 ? 88  LYS B N     1 
ATOM   1323  C  CA    . LYS B  2  88  ? -6.366   -9.370  19.267  1.00 144.30 ? 88  LYS B CA    1 
ATOM   1324  C  C     . LYS B  2  88  ? -7.007   -8.159  18.585  1.00 134.04 ? 88  LYS B C     1 
ATOM   1325  O  O     . LYS B  2  88  ? -7.978   -8.287  17.842  1.00 112.97 ? 88  LYS B O     1 
ATOM   1326  C  CB    . LYS B  2  88  ? -4.937   -9.626  18.759  1.00 141.81 ? 88  LYS B CB    1 
ATOM   1327  C  CG    . LYS B  2  88  ? -4.519   -11.080 18.566  1.00 137.66 ? 88  LYS B CG    1 
ATOM   1328  C  CD    . LYS B  2  88  ? -3.026   -11.280 18.570  1.00 130.77 ? 88  LYS B CD    1 
ATOM   1329  C  CE    . LYS B  2  88  ? -2.721   -12.762 18.459  1.00 131.77 ? 88  LYS B CE    1 
ATOM   1330  N  NZ    . LYS B  2  88  ? -1.254   -13.011 18.455  1.00 138.25 ? 88  LYS B NZ    1 
ATOM   1331  N  N     . GLY C  3  3   ? -23.516  -44.839 60.132  1.00 117.99 ? -3  GLY C N     1 
ATOM   1332  C  CA    . GLY C  3  3   ? -24.254  -43.669 60.697  1.00 126.56 ? -3  GLY C CA    1 
ATOM   1333  C  C     . GLY C  3  3   ? -25.506  -43.309 59.917  1.00 131.94 ? -3  GLY C C     1 
ATOM   1334  O  O     . GLY C  3  3   ? -26.477  -44.045 59.995  1.00 132.87 ? -3  GLY C O     1 
ATOM   1335  N  N     . SER C  3  4   ? -25.506  -42.208 59.160  1.00 130.86 ? -2  SER C N     1 
ATOM   1336  C  CA    . SER C  3  4   ? -26.681  -41.783 58.376  1.00 125.47 ? -2  SER C CA    1 
ATOM   1337  C  C     . SER C  3  4   ? -26.315  -40.851 57.212  1.00 135.58 ? -2  SER C C     1 
ATOM   1338  O  O     . SER C  3  4   ? -25.201  -40.930 56.675  1.00 138.51 ? -2  SER C O     1 
ATOM   1339  C  CB    . SER C  3  4   ? -27.691  -41.141 59.326  1.00 118.85 ? -2  SER C CB    1 
ATOM   1340  O  OG    . SER C  3  4   ? -27.133  -39.993 59.910  1.00 103.75 ? -2  SER C OG    1 
ATOM   1341  N  N     . GLY C  3  5   ? -27.245  -40.002 56.778  1.00 132.85 ? -1  GLY C N     1 
ATOM   1342  C  CA    . GLY C  3  5   ? -26.988  -39.085 55.696  1.00 124.82 ? -1  GLY C CA    1 
ATOM   1343  C  C     . GLY C  3  5   ? -26.231  -37.859 56.129  1.00 118.18 ? -1  GLY C C     1 
ATOM   1344  O  O     . GLY C  3  5   ? -26.572  -37.297 57.155  1.00 111.76 ? -1  GLY C O     1 
ATOM   1345  N  N     . SER C  3  6   ? -25.259  -37.426 55.325  1.00 122.43 ? 0   SER C N     1 
ATOM   1346  C  CA    . SER C  3  6   ? -24.659  -36.097 55.474  1.00 124.06 ? 0   SER C CA    1 
ATOM   1347  C  C     . SER C  3  6   ? -25.684  -34.996 55.229  1.00 121.74 ? 0   SER C C     1 
ATOM   1348  O  O     . SER C  3  6   ? -26.767  -35.234 54.690  1.00 114.02 ? 0   SER C O     1 
ATOM   1349  C  CB    . SER C  3  6   ? -23.486  -35.887 54.524  1.00 119.31 ? 0   SER C CB    1 
ATOM   1350  O  OG    . SER C  3  6   ? -22.489  -36.860 54.773  1.00 120.76 ? 0   SER C OG    1 
ATOM   1351  N  N     . VAL C  3  7   ? -25.333  -33.790 55.655  1.00 133.50 ? 1   VAL C N     1 
ATOM   1352  C  CA    . VAL C  3  7   ? -26.207  -32.628 55.442  1.00 141.56 ? 1   VAL C CA    1 
ATOM   1353  C  C     . VAL C  3  7   ? -26.212  -32.347 53.936  1.00 139.55 ? 1   VAL C C     1 
ATOM   1354  O  O     . VAL C  3  7   ? -27.291  -32.399 53.289  1.00 153.27 ? 1   VAL C O     1 
ATOM   1355  C  CB    . VAL C  3  7   ? -25.790  -31.383 56.264  1.00 139.05 ? 1   VAL C CB    1 
ATOM   1356  C  CG1   . VAL C  3  7   ? -26.588  -30.141 55.846  1.00 127.44 ? 1   VAL C CG1   1 
ATOM   1357  C  CG2   . VAL C  3  7   ? -25.914  -31.681 57.764  1.00 136.20 ? 1   VAL C CG2   1 
ATOM   1358  N  N     . LYS C  3  8   ? -25.000  -32.098 53.421  1.00 114.06 ? 2   LYS C N     1 
ATOM   1359  C  CA    . LYS C  3  8   ? -24.738  -32.038 51.982  1.00 98.17  ? 2   LYS C CA    1 
ATOM   1360  C  C     . LYS C  3  8   ? -23.548  -32.926 51.635  1.00 85.55  ? 2   LYS C C     1 
ATOM   1361  O  O     . LYS C  3  8   ? -22.644  -33.142 52.415  1.00 84.86  ? 2   LYS C O     1 
ATOM   1362  C  CB    . LYS C  3  8   ? -24.558  -30.608 51.505  1.00 92.91  ? 2   LYS C CB    1 
ATOM   1363  C  CG    . LYS C  3  8   ? -25.864  -29.879 51.211  1.00 97.72  ? 2   LYS C CG    1 
ATOM   1364  C  CD    . LYS C  3  8   ? -25.886  -28.440 51.715  1.00 106.05 ? 2   LYS C CD    1 
ATOM   1365  C  CE    . LYS C  3  8   ? -24.715  -27.566 51.241  1.00 110.03 ? 2   LYS C CE    1 
ATOM   1366  N  NZ    . LYS C  3  8   ? -24.829  -27.175 49.813  1.00 112.68 ? 2   LYS C NZ    1 
ATOM   1367  N  N     . LEU C  3  9   ? -23.661  -33.537 50.459  1.00 73.18  ? 3   LEU C N     1 
ATOM   1368  C  CA    . LEU C  3  9   ? -22.722  -34.542 49.991  1.00 64.19  ? 3   LEU C CA    1 
ATOM   1369  C  C     . LEU C  3  9   ? -21.875  -34.046 48.829  1.00 62.80  ? 3   LEU C C     1 
ATOM   1370  O  O     . LEU C  3  9   ? -20.929  -34.703 48.424  1.00 64.65  ? 3   LEU C O     1 
ATOM   1371  C  CB    . LEU C  3  9   ? -23.487  -35.792 49.575  1.00 63.43  ? 3   LEU C CB    1 
ATOM   1372  C  CG    . LEU C  3  9   ? -22.806  -37.137 49.778  1.00 66.78  ? 3   LEU C CG    1 
ATOM   1373  C  CD1   . LEU C  3  9   ? -22.407  -37.336 51.222  1.00 71.74  ? 3   LEU C CD1   1 
ATOM   1374  C  CD2   . LEU C  3  9   ? -23.729  -38.245 49.336  1.00 67.92  ? 3   LEU C CD2   1 
ATOM   1375  N  N     . VAL C  3  10  ? -22.219  -32.885 48.293  1.00 59.13  ? 4   VAL C N     1 
ATOM   1376  C  CA    . VAL C  3  10  ? -21.341  -32.194 47.356  1.00 60.27  ? 4   VAL C CA    1 
ATOM   1377  C  C     . VAL C  3  10  ? -20.082  -31.819 48.098  1.00 67.01  ? 4   VAL C C     1 
ATOM   1378  O  O     . VAL C  3  10  ? -19.009  -31.736 47.520  1.00 73.57  ? 4   VAL C O     1 
ATOM   1379  C  CB    . VAL C  3  10  ? -21.928  -30.917 46.747  1.00 64.20  ? 4   VAL C CB    1 
ATOM   1380  C  CG1   . VAL C  3  10  ? -22.641  -31.232 45.452  1.00 70.29  ? 4   VAL C CG1   1 
ATOM   1381  C  CG2   . VAL C  3  10  ? -22.824  -30.184 47.727  1.00 72.31  ? 4   VAL C CG2   1 
ATOM   1382  N  N     . ARG C  3  11  ? -20.227  -31.589 49.394  1.00 77.04  ? 5   ARG C N     1 
ATOM   1383  C  CA    . ARG C  3  11  ? -19.131  -31.118 50.213  1.00 71.43  ? 5   ARG C CA    1 
ATOM   1384  C  C     . ARG C  3  11  ? -18.037  -32.144 50.083  1.00 63.99  ? 5   ARG C C     1 
ATOM   1385  O  O     . ARG C  3  11  ? -16.867  -31.801 50.079  1.00 67.51  ? 5   ARG C O     1 
ATOM   1386  C  CB    . ARG C  3  11  ? -19.559  -30.965 51.669  1.00 73.35  ? 5   ARG C CB    1 
ATOM   1387  C  CG    . ARG C  3  11  ? -20.522  -29.821 51.905  1.00 78.36  ? 5   ARG C CG    1 
ATOM   1388  C  CD    . ARG C  3  11  ? -19.992  -28.539 51.299  1.00 87.75  ? 5   ARG C CD    1 
ATOM   1389  N  NE    . ARG C  3  11  ? -20.951  -27.446 51.382  1.00 90.44  ? 5   ARG C NE    1 
ATOM   1390  C  CZ    . ARG C  3  11  ? -20.631  -26.167 51.239  1.00 92.39  ? 5   ARG C CZ    1 
ATOM   1391  N  NH1   . ARG C  3  11  ? -19.376  -25.820 51.011  1.00 95.77  ? 5   ARG C NH1   1 
ATOM   1392  N  NH2   . ARG C  3  11  ? -21.564  -25.235 51.324  1.00 93.96  ? 5   ARG C NH2   1 
ATOM   1393  N  N     . PHE C  3  12  ? -18.414  -33.409 49.990  1.00 53.93  ? 6   PHE C N     1 
ATOM   1394  C  CA    . PHE C  3  12  ? -17.450  -34.448 49.630  1.00 54.18  ? 6   PHE C CA    1 
ATOM   1395  C  C     . PHE C  3  12  ? -16.799  -34.307 48.261  1.00 55.83  ? 6   PHE C C     1 
ATOM   1396  O  O     . PHE C  3  12  ? -15.617  -34.421 48.093  1.00 53.96  ? 6   PHE C O     1 
ATOM   1397  C  CB    . PHE C  3  12  ? -18.140  -35.818 49.753  1.00 53.98  ? 6   PHE C CB    1 
ATOM   1398  C  CG    . PHE C  3  12  ? -17.415  -36.957 49.135  1.00 49.83  ? 6   PHE C CG    1 
ATOM   1399  C  CD1   . PHE C  3  12  ? -16.604  -37.727 49.871  1.00 51.30  ? 6   PHE C CD1   1 
ATOM   1400  C  CD2   . PHE C  3  12  ? -17.688  -37.310 47.846  1.00 51.74  ? 6   PHE C CD2   1 
ATOM   1401  C  CE1   . PHE C  3  12  ? -15.989  -38.832 49.304  1.00 56.37  ? 6   PHE C CE1   1 
ATOM   1402  C  CE2   . PHE C  3  12  ? -17.106  -38.405 47.276  1.00 55.85  ? 6   PHE C CE2   1 
ATOM   1403  C  CZ    . PHE C  3  12  ? -16.247  -39.191 48.012  1.00 56.27  ? 6   PHE C CZ    1 
ATOM   1404  N  N     . LEU C  3  13  ? -17.593  -34.115 47.224  1.00 61.96  ? 7   LEU C N     1 
ATOM   1405  C  CA    . LEU C  3  13  ? -17.052  -34.018 45.865  1.00 58.71  ? 7   LEU C CA    1 
ATOM   1406  C  C     . LEU C  3  13  ? -16.111  -32.864 45.794  1.00 53.64  ? 7   LEU C C     1 
ATOM   1407  O  O     . LEU C  3  13  ? -15.173  -32.975 45.040  1.00 55.23  ? 7   LEU C O     1 
ATOM   1408  C  CB    . LEU C  3  13  ? -18.166  -33.844 44.834  1.00 62.59  ? 7   LEU C CB    1 
ATOM   1409  C  CG    . LEU C  3  13  ? -19.016  -35.102 44.550  1.00 70.12  ? 7   LEU C CG    1 
ATOM   1410  C  CD1   . LEU C  3  13  ? -20.121  -34.755 43.535  1.00 72.40  ? 7   LEU C CD1   1 
ATOM   1411  C  CD2   . LEU C  3  13  ? -18.143  -36.239 44.027  1.00 68.73  ? 7   LEU C CD2   1 
ATOM   1412  N  N     . MET C  3  14  ? -16.335  -31.814 46.579  1.00 49.48  ? 8   MET C N     1 
ATOM   1413  C  CA    . MET C  3  14  ? -15.524  -30.611 46.556  1.00 50.53  ? 8   MET C CA    1 
ATOM   1414  C  C     . MET C  3  14  ? -14.120  -30.888 47.131  1.00 58.07  ? 8   MET C C     1 
ATOM   1415  O  O     . MET C  3  14  ? -13.133  -30.185 46.799  1.00 60.27  ? 8   MET C O     1 
ATOM   1416  C  CB    . MET C  3  14  ? -16.211  -29.454 47.294  1.00 47.19  ? 8   MET C CB    1 
ATOM   1417  C  CG    . MET C  3  14  ? -17.524  -28.967 46.670  1.00 45.80  ? 8   MET C CG    1 
ATOM   1418  S  SD    . MET C  3  14  ? -18.368  -27.499 47.291  1.00 40.33  ? 8   MET C SD    1 
ATOM   1419  C  CE    . MET C  3  14  ? -18.999  -28.201 48.775  1.00 41.89  ? 8   MET C CE    1 
ATOM   1420  N  N     . LYS C  3  15  ? -14.016  -31.932 47.943  1.00 58.11  ? 9   LYS C N     1 
ATOM   1421  C  CA    . LYS C  3  15  ? -12.725  -32.343 48.429  1.00 61.54  ? 9   LYS C CA    1 
ATOM   1422  C  C     . LYS C  3  15  ? -11.893  -33.109 47.447  1.00 59.60  ? 9   LYS C C     1 
ATOM   1423  O  O     . LYS C  3  15  ? -10.730  -33.351 47.710  1.00 60.26  ? 9   LYS C O     1 
ATOM   1424  C  CB    . LYS C  3  15  ? -12.898  -33.222 49.669  1.00 67.18  ? 9   LYS C CB    1 
ATOM   1425  C  CG    . LYS C  3  15  ? -13.584  -32.538 50.853  1.00 73.53  ? 9   LYS C CG    1 
ATOM   1426  C  CD    . LYS C  3  15  ? -13.754  -33.546 51.977  1.00 80.20  ? 9   LYS C CD    1 
ATOM   1427  C  CE    . LYS C  3  15  ? -14.672  -33.031 53.063  1.00 88.24  ? 9   LYS C CE    1 
ATOM   1428  N  NZ    . LYS C  3  15  ? -14.543  -33.996 54.186  1.00 97.51  ? 9   LYS C NZ    1 
ATOM   1429  N  N     . LEU C  3  16  ? -12.469  -33.560 46.349  1.00 59.60  ? 10  LEU C N     1 
ATOM   1430  C  CA    . LEU C  3  16  ? -11.730  -34.400 45.430  1.00 61.13  ? 10  LEU C CA    1 
ATOM   1431  C  C     . LEU C  3  16  ? -10.768  -33.702 44.431  1.00 58.20  ? 10  LEU C C     1 
ATOM   1432  O  O     . LEU C  3  16  ? -10.635  -34.165 43.311  1.00 52.88  ? 10  LEU C O     1 
ATOM   1433  C  CB    . LEU C  3  16  ? -12.709  -35.278 44.683  1.00 64.38  ? 10  LEU C CB    1 
ATOM   1434  C  CG    . LEU C  3  16  ? -13.595  -36.128 45.562  1.00 66.14  ? 10  LEU C CG    1 
ATOM   1435  C  CD1   . LEU C  3  16  ? -14.404  -36.999 44.601  1.00 76.89  ? 10  LEU C CD1   1 
ATOM   1436  C  CD2   . LEU C  3  16  ? -12.823  -36.988 46.526  1.00 60.71  ? 10  LEU C CD2   1 
ATOM   1437  N  N     . SER C  3  17  ? -10.137  -32.615 44.845  1.00 55.22  ? 11  SER C N     1 
ATOM   1438  C  CA    . SER C  3  17  ? -9.203   -31.927 43.980  1.00 52.29  ? 11  SER C CA    1 
ATOM   1439  C  C     . SER C  3  17  ? -7.997   -32.807 43.750  1.00 52.86  ? 11  SER C C     1 
ATOM   1440  O  O     . SER C  3  17  ? -7.565   -33.531 44.633  1.00 50.13  ? 11  SER C O     1 
ATOM   1441  C  CB    . SER C  3  17  ? -8.783   -30.597 44.583  1.00 54.88  ? 11  SER C CB    1 
ATOM   1442  O  OG    . SER C  3  17  ? -9.912   -29.821 44.920  1.00 73.41  ? 11  SER C OG    1 
ATOM   1443  N  N     . HIS C  3  18  ? -7.470   -32.738 42.540  1.00 58.47  ? 12  HIS C N     1 
ATOM   1444  C  CA    . HIS C  3  18  ? -6.369   -33.566 42.102  1.00 55.45  ? 12  HIS C CA    1 
ATOM   1445  C  C     . HIS C  3  18  ? -6.680   -35.011 42.005  1.00 53.47  ? 12  HIS C C     1 
ATOM   1446  O  O     . HIS C  3  18  ? -5.785   -35.731 41.594  1.00 64.38  ? 12  HIS C O     1 
ATOM   1447  C  CB    . HIS C  3  18  ? -5.164   -33.409 43.001  1.00 59.87  ? 12  HIS C CB    1 
ATOM   1448  C  CG    . HIS C  3  18  ? -4.836   -31.995 43.345  1.00 64.94  ? 12  HIS C CG    1 
ATOM   1449  N  ND1   . HIS C  3  18  ? -4.380   -31.106 42.400  1.00 71.45  ? 12  HIS C ND1   1 
ATOM   1450  C  CD2   . HIS C  3  18  ? -4.882   -31.318 44.516  1.00 66.99  ? 12  HIS C CD2   1 
ATOM   1451  C  CE1   . HIS C  3  18  ? -4.244   -29.915 42.957  1.00 71.92  ? 12  HIS C CE1   1 
ATOM   1452  N  NE2   . HIS C  3  18  ? -4.521   -30.020 44.243  1.00 71.65  ? 12  HIS C NE2   1 
ATOM   1453  N  N     . GLU C  3  19  ? -7.891   -35.463 42.292  1.00 55.97  ? 13  GLU C N     1 
ATOM   1454  C  CA    . GLU C  3  19  ? -8.257   -36.861 42.078  1.00 59.23  ? 13  GLU C CA    1 
ATOM   1455  C  C     . GLU C  3  19  ? -8.665   -37.113 40.652  1.00 56.31  ? 13  GLU C C     1 
ATOM   1456  O  O     . GLU C  3  19  ? -9.230   -36.251 39.985  1.00 55.42  ? 13  GLU C O     1 
ATOM   1457  C  CB    . GLU C  3  19  ? -9.392   -37.263 43.006  1.00 61.73  ? 13  GLU C CB    1 
ATOM   1458  C  CG    . GLU C  3  19  ? -8.935   -37.378 44.454  1.00 70.28  ? 13  GLU C CG    1 
ATOM   1459  C  CD    . GLU C  3  19  ? -7.987   -38.562 44.687  1.00 76.24  ? 13  GLU C CD    1 
ATOM   1460  O  OE1   . GLU C  3  19  ? -7.460   -38.741 45.821  1.00 82.42  ? 13  GLU C OE1   1 
ATOM   1461  O  OE2   . GLU C  3  19  ? -7.773   -39.362 43.726  1.00 82.86  ? 13  GLU C OE2   1 
ATOM   1462  N  N     . THR C  3  20  ? -8.330   -38.292 40.158  1.00 54.39  ? 14  THR C N     1 
ATOM   1463  C  CA    . THR C  3  20  ? -8.635   -38.573 38.769  1.00 52.31  ? 14  THR C CA    1 
ATOM   1464  C  C     . THR C  3  20  ? -9.794   -39.506 38.713  1.00 50.66  ? 14  THR C C     1 
ATOM   1465  O  O     . THR C  3  20  ? -9.758   -40.588 39.277  1.00 54.76  ? 14  THR C O     1 
ATOM   1466  C  CB    . THR C  3  20  ? -7.438   -39.183 38.071  1.00 56.03  ? 14  THR C CB    1 
ATOM   1467  O  OG1   . THR C  3  20  ? -6.460   -38.156 37.888  1.00 56.03  ? 14  THR C OG1   1 
ATOM   1468  C  CG2   . THR C  3  20  ? -7.793   -39.797 36.710  1.00 55.84  ? 14  THR C CG2   1 
ATOM   1469  N  N     . VAL C  3  21  ? -10.831  -39.103 38.000  1.00 48.99  ? 15  VAL C N     1 
ATOM   1470  C  CA    . VAL C  3  21  ? -12.111  -39.793 38.021  1.00 45.95  ? 15  VAL C CA    1 
ATOM   1471  C  C     . VAL C  3  21  ? -12.624  -40.023 36.629  1.00 45.21  ? 15  VAL C C     1 
ATOM   1472  O  O     . VAL C  3  21  ? -12.064  -39.566 35.655  1.00 42.37  ? 15  VAL C O     1 
ATOM   1473  C  CB    . VAL C  3  21  ? -13.148  -38.966 38.778  1.00 46.03  ? 15  VAL C CB    1 
ATOM   1474  C  CG1   . VAL C  3  21  ? -12.700  -38.762 40.222  1.00 46.65  ? 15  VAL C CG1   1 
ATOM   1475  C  CG2   . VAL C  3  21  ? -13.392  -37.612 38.100  1.00 47.21  ? 15  VAL C CG2   1 
ATOM   1476  N  N     . THR C  3  22  ? -13.757  -40.696 36.568  1.00 49.10  ? 16  THR C N     1 
ATOM   1477  C  CA    . THR C  3  22  ? -14.498  -40.872 35.350  1.00 50.01  ? 16  THR C CA    1 
ATOM   1478  C  C     . THR C  3  22  ? -15.908  -40.515 35.692  1.00 46.75  ? 16  THR C C     1 
ATOM   1479  O  O     . THR C  3  22  ? -16.517  -41.136 36.546  1.00 52.02  ? 16  THR C O     1 
ATOM   1480  C  CB    . THR C  3  22  ? -14.451  -42.322 34.850  1.00 53.35  ? 16  THR C CB    1 
ATOM   1481  O  OG1   . THR C  3  22  ? -13.089  -42.678 34.562  1.00 53.20  ? 16  THR C OG1   1 
ATOM   1482  C  CG2   . THR C  3  22  ? -15.256  -42.457 33.563  1.00 57.22  ? 16  THR C CG2   1 
ATOM   1483  N  N     . ILE C  3  23  ? -16.441  -39.603 34.907  1.00 44.74  ? 17  ILE C N     1 
ATOM   1484  C  CA    . ILE C  3  23  ? -17.790  -39.125 35.004  1.00 42.13  ? 17  ILE C CA    1 
ATOM   1485  C  C     . ILE C  3  23  ? -18.644  -39.639 33.836  1.00 40.81  ? 17  ILE C C     1 
ATOM   1486  O  O     . ILE C  3  23  ? -18.297  -39.502 32.678  1.00 40.17  ? 17  ILE C O     1 
ATOM   1487  C  CB    . ILE C  3  23  ? -17.723  -37.605 34.965  1.00 41.99  ? 17  ILE C CB    1 
ATOM   1488  C  CG1   . ILE C  3  23  ? -16.870  -37.142 36.132  1.00 44.70  ? 17  ILE C CG1   1 
ATOM   1489  C  CG2   . ILE C  3  23  ? -19.107  -37.017 35.164  1.00 43.47  ? 17  ILE C CG2   1 
ATOM   1490  C  CD1   . ILE C  3  23  ? -16.775  -35.622 36.290  1.00 46.61  ? 17  ILE C CD1   1 
ATOM   1491  N  N     . GLU C  3  24  ? -19.839  -40.096 34.135  1.00 42.44  ? 18  GLU C N     1 
ATOM   1492  C  CA    . GLU C  3  24  ? -20.841  -40.352 33.114  1.00 44.98  ? 18  GLU C CA    1 
ATOM   1493  C  C     . GLU C  3  24  ? -21.889  -39.313 33.134  1.00 40.14  ? 18  GLU C C     1 
ATOM   1494  O  O     . GLU C  3  24  ? -22.419  -39.003 34.189  1.00 36.79  ? 18  GLU C O     1 
ATOM   1495  C  CB    . GLU C  3  24  ? -21.509  -41.681 33.392  1.00 52.50  ? 18  GLU C CB    1 
ATOM   1496  C  CG    . GLU C  3  24  ? -20.442  -42.755 33.468  1.00 62.27  ? 18  GLU C CG    1 
ATOM   1497  C  CD    . GLU C  3  24  ? -20.761  -43.981 32.670  1.00 71.12  ? 18  GLU C CD    1 
ATOM   1498  O  OE1   . GLU C  3  24  ? -21.882  -43.987 32.082  1.00 74.90  ? 18  GLU C OE1   1 
ATOM   1499  O  OE2   . GLU C  3  24  ? -19.832  -44.851 32.655  1.00 80.67  ? 18  GLU C OE2   1 
ATOM   1500  N  N     . LEU C  3  25  ? -22.208  -38.833 31.955  1.00 40.23  ? 19  LEU C N     1 
ATOM   1501  C  CA    . LEU C  3  25  ? -23.230  -37.818 31.817  1.00 42.41  ? 19  LEU C CA    1 
ATOM   1502  C  C     . LEU C  3  25  ? -24.569  -38.439 31.443  1.00 43.65  ? 19  LEU C C     1 
ATOM   1503  O  O     . LEU C  3  25  ? -24.631  -39.539 30.876  1.00 48.12  ? 19  LEU C O     1 
ATOM   1504  C  CB    . LEU C  3  25  ? -22.804  -36.761 30.800  1.00 41.97  ? 19  LEU C CB    1 
ATOM   1505  C  CG    . LEU C  3  25  ? -21.931  -35.599 31.267  1.00 42.34  ? 19  LEU C CG    1 
ATOM   1506  C  CD1   . LEU C  3  25  ? -20.618  -36.225 31.659  1.00 43.76  ? 19  LEU C CD1   1 
ATOM   1507  C  CD2   . LEU C  3  25  ? -21.621  -34.433 30.337  1.00 42.69  ? 19  LEU C CD2   1 
ATOM   1508  N  N     . LYS C  3  26  ? -25.606  -37.656 31.670  1.00 43.59  ? 20  LYS C N     1 
ATOM   1509  C  CA    . LYS C  3  26  ? -26.948  -38.060 31.405  1.00 47.36  ? 20  LYS C CA    1 
ATOM   1510  C  C     . LYS C  3  26  ? -27.166  -38.322 29.937  1.00 48.73  ? 20  LYS C C     1 
ATOM   1511  O  O     . LYS C  3  26  ? -28.079  -39.067 29.607  1.00 49.79  ? 20  LYS C O     1 
ATOM   1512  C  CB    . LYS C  3  26  ? -27.944  -37.043 31.979  1.00 51.55  ? 20  LYS C CB    1 
ATOM   1513  C  CG    . LYS C  3  26  ? -27.923  -36.909 33.506  1.00 53.04  ? 20  LYS C CG    1 
ATOM   1514  C  CD    . LYS C  3  26  ? -29.297  -36.642 34.111  1.00 57.32  ? 20  LYS C CD    1 
ATOM   1515  C  CE    . LYS C  3  26  ? -29.293  -35.719 35.338  1.00 60.60  ? 20  LYS C CE    1 
ATOM   1516  N  NZ    . LYS C  3  26  ? -28.581  -36.319 36.513  1.00 59.04  ? 20  LYS C NZ    1 
ATOM   1517  N  N     . ASN C  3  27  ? -26.331  -37.746 29.081  1.00 49.32  ? 21  ASN C N     1 
ATOM   1518  C  CA    . ASN C  3  27  ? -26.336  -38.050 27.646  1.00 50.35  ? 21  ASN C CA    1 
ATOM   1519  C  C     . ASN C  3  27  ? -25.315  -39.076 27.120  1.00 52.52  ? 21  ASN C C     1 
ATOM   1520  O  O     . ASN C  3  27  ? -24.949  -39.073 25.949  1.00 51.98  ? 21  ASN C O     1 
ATOM   1521  C  CB    . ASN C  3  27  ? -26.140  -36.737 26.898  1.00 48.15  ? 21  ASN C CB    1 
ATOM   1522  C  CG    . ASN C  3  27  ? -24.754  -36.225 26.997  1.00 46.95  ? 21  ASN C CG    1 
ATOM   1523  O  OD1   . ASN C  3  27  ? -23.870  -36.927 27.457  1.00 53.29  ? 21  ASN C OD1   1 
ATOM   1524  N  ND2   . ASN C  3  27  ? -24.545  -34.992 26.597  1.00 50.24  ? 21  ASN C ND2   1 
ATOM   1525  N  N     . GLY C  3  28  ? -24.810  -39.948 27.977  1.00 55.11  ? 22  GLY C N     1 
ATOM   1526  C  CA    . GLY C  3  28  ? -23.939  -41.024 27.502  1.00 58.27  ? 22  GLY C CA    1 
ATOM   1527  C  C     . GLY C  3  28  ? -22.472  -40.679 27.294  1.00 58.02  ? 22  GLY C C     1 
ATOM   1528  O  O     . GLY C  3  28  ? -21.635  -41.587 27.214  1.00 60.07  ? 22  GLY C O     1 
ATOM   1529  N  N     . THR C  3  29  ? -22.158  -39.401 27.219  1.00 55.72  ? 23  THR C N     1 
ATOM   1530  C  CA    . THR C  3  29  ? -20.799  -38.983 27.201  1.00 53.26  ? 23  THR C CA    1 
ATOM   1531  C  C     . THR C  3  29  ? -20.093  -39.504 28.435  1.00 52.07  ? 23  THR C C     1 
ATOM   1532  O  O     . THR C  3  29  ? -20.639  -39.439 29.523  1.00 56.82  ? 23  THR C O     1 
ATOM   1533  C  CB    . THR C  3  29  ? -20.748  -37.446 27.213  1.00 53.04  ? 23  THR C CB    1 
ATOM   1534  O  OG1   . THR C  3  29  ? -21.508  -36.865 26.127  1.00 47.81  ? 23  THR C OG1   1 
ATOM   1535  C  CG2   . THR C  3  29  ? -19.291  -37.028 27.104  1.00 55.33  ? 23  THR C CG2   1 
ATOM   1536  N  N     . GLN C  3  30  ? -18.843  -39.929 28.276  1.00 52.27  ? 24  GLN C N     1 
ATOM   1537  C  CA    . GLN C  3  30  ? -17.969  -40.307 29.381  1.00 49.43  ? 24  GLN C CA    1 
ATOM   1538  C  C     . GLN C  3  30  ? -16.812  -39.410 29.389  1.00 46.46  ? 24  GLN C C     1 
ATOM   1539  O  O     . GLN C  3  30  ? -16.175  -39.130 28.356  1.00 53.56  ? 24  GLN C O     1 
ATOM   1540  C  CB    . GLN C  3  30  ? -17.418  -41.687 29.175  1.00 55.99  ? 24  GLN C CB    1 
ATOM   1541  C  CG    . GLN C  3  30  ? -18.451  -42.728 29.506  1.00 65.69  ? 24  GLN C CG    1 
ATOM   1542  C  CD    . GLN C  3  30  ? -17.824  -44.087 29.565  1.00 74.52  ? 24  GLN C CD    1 
ATOM   1543  O  OE1   . GLN C  3  30  ? -16.954  -44.364 30.413  1.00 76.04  ? 24  GLN C OE1   1 
ATOM   1544  N  NE2   . GLN C  3  30  ? -18.379  -44.993 28.777  1.00 86.65  ? 24  GLN C NE2   1 
ATOM   1545  N  N     . VAL C  3  31  ? -16.486  -38.940 30.568  1.00 43.28  ? 25  VAL C N     1 
ATOM   1546  C  CA    . VAL C  3  31  ? -15.335  -38.052 30.729  1.00 43.68  ? 25  VAL C CA    1 
ATOM   1547  C  C     . VAL C  3  31  ? -14.354  -38.663 31.706  1.00 41.56  ? 25  VAL C C     1 
ATOM   1548  O  O     . VAL C  3  31  ? -14.743  -39.064 32.805  1.00 40.60  ? 25  VAL C O     1 
ATOM   1549  C  CB    . VAL C  3  31  ? -15.830  -36.744 31.299  1.00 46.81  ? 25  VAL C CB    1 
ATOM   1550  C  CG1   . VAL C  3  31  ? -14.687  -35.891 31.817  1.00 51.24  ? 25  VAL C CG1   1 
ATOM   1551  C  CG2   . VAL C  3  31  ? -16.564  -36.002 30.215  1.00 49.70  ? 25  VAL C CG2   1 
ATOM   1552  N  N     . HIS C  3  32  ? -13.093  -38.722 31.324  1.00 40.98  ? 26  HIS C N     1 
ATOM   1553  C  CA    . HIS C  3  32  ? -12.113  -39.187 32.256  1.00 46.20  ? 26  HIS C CA    1 
ATOM   1554  C  C     . HIS C  3  32  ? -11.205  -38.050 32.379  1.00 47.90  ? 26  HIS C C     1 
ATOM   1555  O  O     . HIS C  3  32  ? -10.779  -37.487 31.385  1.00 50.59  ? 26  HIS C O     1 
ATOM   1556  C  CB    . HIS C  3  32  ? -11.358  -40.379 31.747  1.00 51.62  ? 26  HIS C CB    1 
ATOM   1557  C  CG    . HIS C  3  32  ? -10.181  -40.744 32.589  1.00 58.70  ? 26  HIS C CG    1 
ATOM   1558  N  ND1   . HIS C  3  32  ? -10.198  -41.810 33.470  1.00 67.75  ? 26  HIS C ND1   1 
ATOM   1559  C  CD2   . HIS C  3  32  ? -8.938   -40.227 32.666  1.00 63.89  ? 26  HIS C CD2   1 
ATOM   1560  C  CE1   . HIS C  3  32  ? -9.029   -41.917 34.085  1.00 67.24  ? 26  HIS C CE1   1 
ATOM   1561  N  NE2   . HIS C  3  32  ? -8.245   -40.974 33.598  1.00 70.35  ? 26  HIS C NE2   1 
ATOM   1562  N  N     . GLY C  3  33  ? -10.872  -37.727 33.620  1.00 53.78  ? 27  GLY C N     1 
ATOM   1563  C  CA    . GLY C  3  33  ? -10.041  -36.546 33.861  1.00 56.94  ? 27  GLY C CA    1 
ATOM   1564  C  C     . GLY C  3  33  ? -9.661   -36.344 35.302  1.00 53.64  ? 27  GLY C C     1 
ATOM   1565  O  O     . GLY C  3  33  ? -9.995   -37.154 36.166  1.00 57.71  ? 27  GLY C O     1 
ATOM   1566  N  N     . THR C  3  34  ? -8.926   -35.273 35.531  1.00 49.84  ? 28  THR C N     1 
ATOM   1567  C  CA    . THR C  3  34  ? -8.488   -34.981 36.869  1.00 50.09  ? 28  THR C CA    1 
ATOM   1568  C  C     . THR C  3  34  ? -9.160   -33.747 37.385  1.00 50.40  ? 28  THR C C     1 
ATOM   1569  O  O     . THR C  3  34  ? -9.093   -32.699 36.730  1.00 52.76  ? 28  THR C O     1 
ATOM   1570  C  CB    . THR C  3  34  ? -7.004   -34.761 36.871  1.00 52.20  ? 28  THR C CB    1 
ATOM   1571  O  OG1   . THR C  3  34  ? -6.392   -35.922 36.293  1.00 57.27  ? 28  THR C OG1   1 
ATOM   1572  C  CG2   . THR C  3  34  ? -6.565   -34.484 38.277  1.00 56.53  ? 28  THR C CG2   1 
ATOM   1573  N  N     . ILE C  3  35  ? -9.779   -33.859 38.561  1.00 47.01  ? 29  ILE C N     1 
ATOM   1574  C  CA    . ILE C  3  35  ? -10.674  -32.813 39.031  1.00 44.46  ? 29  ILE C CA    1 
ATOM   1575  C  C     . ILE C  3  35  ? -9.830   -31.684 39.495  1.00 47.44  ? 29  ILE C C     1 
ATOM   1576  O  O     . ILE C  3  35  ? -9.026   -31.895 40.391  1.00 60.83  ? 29  ILE C O     1 
ATOM   1577  C  CB    . ILE C  3  35  ? -11.497  -33.270 40.218  1.00 41.37  ? 29  ILE C CB    1 
ATOM   1578  C  CG1   . ILE C  3  35  ? -12.539  -34.282 39.762  1.00 42.38  ? 29  ILE C CG1   1 
ATOM   1579  C  CG2   . ILE C  3  35  ? -12.198  -32.091 40.854  1.00 40.69  ? 29  ILE C CG2   1 
ATOM   1580  C  CD1   . ILE C  3  35  ? -13.231  -35.046 40.884  1.00 43.41  ? 29  ILE C CD1   1 
ATOM   1581  N  N     . THR C  3  36  ? -10.019  -30.510 38.928  1.00 46.50  ? 30  THR C N     1 
ATOM   1582  C  CA    . THR C  3  36  ? -9.402   -29.290 39.435  1.00 49.12  ? 30  THR C CA    1 
ATOM   1583  C  C     . THR C  3  36  ? -10.323  -28.590 40.449  1.00 49.53  ? 30  THR C C     1 
ATOM   1584  O  O     . THR C  3  36  ? -9.854   -28.014 41.446  1.00 51.12  ? 30  THR C O     1 
ATOM   1585  C  CB    . THR C  3  36  ? -9.113   -28.298 38.333  1.00 50.96  ? 30  THR C CB    1 
ATOM   1586  O  OG1   . THR C  3  36  ? -10.343  -27.917 37.731  1.00 58.61  ? 30  THR C OG1   1 
ATOM   1587  C  CG2   . THR C  3  36  ? -8.277   -28.933 37.249  1.00 56.06  ? 30  THR C CG2   1 
ATOM   1588  N  N     . GLY C  3  37  ? -11.620  -28.701 40.213  1.00 47.18  ? 31  GLY C N     1 
ATOM   1589  C  CA    . GLY C  3  37  ? -12.550  -28.271 41.201  1.00 47.87  ? 31  GLY C CA    1 
ATOM   1590  C  C     . GLY C  3  37  ? -13.937  -28.765 40.959  1.00 47.53  ? 31  GLY C C     1 
ATOM   1591  O  O     . GLY C  3  37  ? -14.373  -28.911 39.828  1.00 52.96  ? 31  GLY C O     1 
ATOM   1592  N  N     . VAL C  3  38  ? -14.643  -28.977 42.059  1.00 48.61  ? 32  VAL C N     1 
ATOM   1593  C  CA    . VAL C  3  38  ? -16.058  -29.269 42.048  1.00 50.60  ? 32  VAL C CA    1 
ATOM   1594  C  C     . VAL C  3  38  ? -16.694  -28.148 42.835  1.00 57.41  ? 32  VAL C C     1 
ATOM   1595  O  O     . VAL C  3  38  ? -16.039  -27.479 43.624  1.00 64.86  ? 32  VAL C O     1 
ATOM   1596  C  CB    . VAL C  3  38  ? -16.400  -30.605 42.707  1.00 49.18  ? 32  VAL C CB    1 
ATOM   1597  C  CG1   . VAL C  3  38  ? -17.898  -30.828 42.696  1.00 47.98  ? 32  VAL C CG1   1 
ATOM   1598  C  CG2   . VAL C  3  38  ? -15.697  -31.736 41.996  1.00 50.94  ? 32  VAL C CG2   1 
ATOM   1599  N  N     . ASP C  3  39  ? -17.972  -27.937 42.586  1.00 60.63  ? 33  ASP C N     1 
ATOM   1600  C  CA    . ASP C  3  39  ? -18.669  -26.737 42.972  1.00 59.13  ? 33  ASP C CA    1 
ATOM   1601  C  C     . ASP C  3  39  ? -19.962  -27.136 43.650  1.00 61.76  ? 33  ASP C C     1 
ATOM   1602  O  O     . ASP C  3  39  ? -20.398  -28.271 43.533  1.00 62.16  ? 33  ASP C O     1 
ATOM   1603  C  CB    . ASP C  3  39  ? -18.924  -25.882 41.738  1.00 63.92  ? 33  ASP C CB    1 
ATOM   1604  C  CG    . ASP C  3  39  ? -19.559  -24.567 42.058  1.00 67.96  ? 33  ASP C CG    1 
ATOM   1605  O  OD1   . ASP C  3  39  ? -19.792  -24.294 43.246  1.00 83.99  ? 33  ASP C OD1   1 
ATOM   1606  O  OD2   . ASP C  3  39  ? -19.822  -23.799 41.115  1.00 72.85  ? 33  ASP C OD2   1 
ATOM   1607  N  N     . VAL C  3  40  ? -20.570  -26.211 44.376  1.00 71.77  ? 34  VAL C N     1 
ATOM   1608  C  CA    . VAL C  3  40  ? -21.739  -26.528 45.182  1.00 72.46  ? 34  VAL C CA    1 
ATOM   1609  C  C     . VAL C  3  40  ? -22.865  -27.068 44.321  1.00 66.68  ? 34  VAL C C     1 
ATOM   1610  O  O     . VAL C  3  40  ? -23.627  -27.922 44.758  1.00 70.86  ? 34  VAL C O     1 
ATOM   1611  C  CB    . VAL C  3  40  ? -22.223  -25.307 45.982  1.00 77.51  ? 34  VAL C CB    1 
ATOM   1612  C  CG1   . VAL C  3  40  ? -21.054  -24.628 46.667  1.00 81.66  ? 34  VAL C CG1   1 
ATOM   1613  C  CG2   . VAL C  3  40  ? -22.957  -24.321 45.091  1.00 81.07  ? 34  VAL C CG2   1 
ATOM   1614  N  N     . SER C  3  41  ? -22.982  -26.542 43.110  1.00 58.94  ? 35  SER C N     1 
ATOM   1615  C  CA    . SER C  3  41  ? -24.007  -26.982 42.182  1.00 57.70  ? 35  SER C CA    1 
ATOM   1616  C  C     . SER C  3  41  ? -23.489  -28.188 41.423  1.00 54.83  ? 35  SER C C     1 
ATOM   1617  O  O     . SER C  3  41  ? -24.049  -28.544 40.395  1.00 54.73  ? 35  SER C O     1 
ATOM   1618  C  CB    . SER C  3  41  ? -24.299  -25.910 41.151  1.00 60.75  ? 35  SER C CB    1 
ATOM   1619  O  OG    . SER C  3  41  ? -24.620  -24.725 41.829  1.00 68.87  ? 35  SER C OG    1 
ATOM   1620  N  N     . MET C  3  42  ? -22.442  -28.838 41.925  1.00 49.95  ? 36  MET C N     1 
ATOM   1621  C  CA    . MET C  3  42  ? -21.868  -30.032 41.344  1.00 42.59  ? 36  MET C CA    1 
ATOM   1622  C  C     . MET C  3  42  ? -21.245  -29.672 40.031  1.00 41.48  ? 36  MET C C     1 
ATOM   1623  O  O     . MET C  3  42  ? -20.873  -30.578 39.309  1.00 40.77  ? 36  MET C O     1 
ATOM   1624  C  CB    . MET C  3  42  ? -22.867  -31.194 41.235  1.00 39.33  ? 36  MET C CB    1 
ATOM   1625  C  CG    . MET C  3  42  ? -22.179  -32.556 41.180  1.00 37.66  ? 36  MET C CG    1 
ATOM   1626  S  SD    . MET C  3  42  ? -23.110  -34.081 41.257  1.00 30.90  ? 36  MET C SD    1 
ATOM   1627  C  CE    . MET C  3  42  ? -23.937  -33.706 42.796  1.00 32.17  ? 36  MET C CE    1 
ATOM   1628  N  N     . ASN C  3  43  ? -21.064  -28.392 39.702  1.00 42.82  ? 37  ASN C N     1 
ATOM   1629  C  CA    . ASN C  3  43  ? -20.336  -28.113 38.477  1.00 45.44  ? 37  ASN C CA    1 
ATOM   1630  C  C     . ASN C  3  43  ? -18.889  -28.489 38.628  1.00 42.14  ? 37  ASN C C     1 
ATOM   1631  O  O     . ASN C  3  43  ? -18.318  -28.351 39.696  1.00 44.47  ? 37  ASN C O     1 
ATOM   1632  C  CB    . ASN C  3  43  ? -20.391  -26.670 38.102  1.00 52.51  ? 37  ASN C CB    1 
ATOM   1633  C  CG    . ASN C  3  43  ? -21.787  -26.208 37.799  1.00 59.02  ? 37  ASN C CG    1 
ATOM   1634  O  OD1   . ASN C  3  43  ? -22.606  -26.954 37.296  1.00 64.07  ? 37  ASN C OD1   1 
ATOM   1635  N  ND2   . ASN C  3  43  ? -22.040  -24.947 38.025  1.00 66.69  ? 37  ASN C ND2   1 
ATOM   1636  N  N     . THR C  3  44  ? -18.329  -29.048 37.586  1.00 39.56  ? 38  THR C N     1 
ATOM   1637  C  CA    . THR C  3  44  ? -17.120  -29.785 37.781  1.00 40.62  ? 38  THR C CA    1 
ATOM   1638  C  C     . THR C  3  44  ? -16.133  -29.436 36.703  1.00 43.35  ? 38  THR C C     1 
ATOM   1639  O  O     . THR C  3  44  ? -16.475  -29.337 35.534  1.00 44.14  ? 38  THR C O     1 
ATOM   1640  C  CB    . THR C  3  44  ? -17.381  -31.272 37.762  1.00 40.95  ? 38  THR C CB    1 
ATOM   1641  O  OG1   . THR C  3  44  ? -18.259  -31.580 38.847  1.00 42.64  ? 38  THR C OG1   1 
ATOM   1642  C  CG2   . THR C  3  44  ? -16.121  -32.040 37.988  1.00 40.87  ? 38  THR C CG2   1 
ATOM   1643  N  N     . HIS C  3  45  ? -14.894  -29.238 37.135  1.00 44.34  ? 39  HIS C N     1 
ATOM   1644  C  CA    . HIS C  3  45  ? -13.847  -28.817 36.260  1.00 45.86  ? 39  HIS C CA    1 
ATOM   1645  C  C     . HIS C  3  45  ? -12.815  -29.888 36.288  1.00 45.87  ? 39  HIS C C     1 
ATOM   1646  O  O     . HIS C  3  45  ? -12.496  -30.424 37.339  1.00 47.25  ? 39  HIS C O     1 
ATOM   1647  C  CB    . HIS C  3  45  ? -13.343  -27.500 36.745  1.00 47.47  ? 39  HIS C CB    1 
ATOM   1648  C  CG    . HIS C  3  45  ? -14.441  -26.490 36.906  1.00 52.19  ? 39  HIS C CG    1 
ATOM   1649  N  ND1   . HIS C  3  45  ? -14.864  -25.670 35.877  1.00 54.88  ? 39  HIS C ND1   1 
ATOM   1650  C  CD2   . HIS C  3  45  ? -15.177  -26.142 37.986  1.00 55.33  ? 39  HIS C CD2   1 
ATOM   1651  C  CE1   . HIS C  3  45  ? -15.818  -24.870 36.314  1.00 57.49  ? 39  HIS C CE1   1 
ATOM   1652  N  NE2   . HIS C  3  45  ? -16.046  -25.158 37.584  1.00 59.25  ? 39  HIS C NE2   1 
ATOM   1653  N  N     . LEU C  3  46  ? -12.289  -30.184 35.118  1.00 45.46  ? 40  LEU C N     1 
ATOM   1654  C  CA    . LEU C  3  46  ? -11.314  -31.226 35.015  1.00 44.09  ? 40  LEU C CA    1 
ATOM   1655  C  C     . LEU C  3  46  ? -10.157  -30.748 34.134  1.00 46.92  ? 40  LEU C C     1 
ATOM   1656  O  O     . LEU C  3  46  ? -10.260  -29.714 33.432  1.00 49.50  ? 40  LEU C O     1 
ATOM   1657  C  CB    . LEU C  3  46  ? -11.980  -32.374 34.366  1.00 44.76  ? 40  LEU C CB    1 
ATOM   1658  C  CG    . LEU C  3  46  ? -13.078  -32.980 35.198  1.00 44.64  ? 40  LEU C CG    1 
ATOM   1659  C  CD1   . LEU C  3  46  ? -14.168  -33.347 34.236  1.00 48.53  ? 40  LEU C CD1   1 
ATOM   1660  C  CD2   . LEU C  3  46  ? -12.660  -34.253 35.888  1.00 45.18  ? 40  LEU C CD2   1 
ATOM   1661  N  N     . LYS C  3  47  ? -9.045   -31.461 34.244  1.00 45.75  ? 41  LYS C N     1 
ATOM   1662  C  CA    . LYS C  3  47  ? -7.894   -31.178 33.422  1.00 46.93  ? 41  LYS C CA    1 
ATOM   1663  C  C     . LYS C  3  47  ? -7.439   -32.556 32.895  1.00 48.24  ? 41  LYS C C     1 
ATOM   1664  O  O     . LYS C  3  47  ? -7.724   -33.556 33.579  1.00 48.70  ? 41  LYS C O     1 
ATOM   1665  C  CB    . LYS C  3  47  ? -6.834   -30.444 34.230  1.00 46.72  ? 41  LYS C CB    1 
ATOM   1666  C  CG    . LYS C  3  47  ? -6.104   -31.326 35.193  1.00 50.55  ? 41  LYS C CG    1 
ATOM   1667  C  CD    . LYS C  3  47  ? -5.145   -30.543 36.055  1.00 59.95  ? 41  LYS C CD    1 
ATOM   1668  C  CE    . LYS C  3  47  ? -4.198   -31.547 36.784  1.00 66.14  ? 41  LYS C CE    1 
ATOM   1669  N  NZ    . LYS C  3  47  ? -3.298   -30.910 37.793  1.00 71.05  ? 41  LYS C NZ    1 
ATOM   1670  N  N     . ALA C  3  48  ? -6.743   -32.615 31.752  1.00 46.04  ? 42  ALA C N     1 
ATOM   1671  C  CA    . ALA C  3  48  ? -6.202   -33.858 31.234  1.00 48.82  ? 42  ALA C CA    1 
ATOM   1672  C  C     . ALA C  3  48  ? -7.334   -34.813 30.949  1.00 52.41  ? 42  ALA C C     1 
ATOM   1673  O  O     . ALA C  3  48  ? -7.401   -35.958 31.501  1.00 56.57  ? 42  ALA C O     1 
ATOM   1674  C  CB    . ALA C  3  48  ? -5.220   -34.511 32.205  1.00 50.16  ? 42  ALA C CB    1 
ATOM   1675  N  N     . VAL C  3  49  ? -8.198   -34.338 30.050  1.00 47.35  ? 43  VAL C N     1 
ATOM   1676  C  CA    . VAL C  3  49  ? -9.462   -34.970 29.849  1.00 45.63  ? 43  VAL C CA    1 
ATOM   1677  C  C     . VAL C  3  49  ? -9.498   -35.774 28.583  1.00 48.18  ? 43  VAL C C     1 
ATOM   1678  O  O     . VAL C  3  49  ? -8.958   -35.390 27.564  1.00 50.07  ? 43  VAL C O     1 
ATOM   1679  C  CB    . VAL C  3  49  ? -10.510  -33.931 29.749  1.00 47.30  ? 43  VAL C CB    1 
ATOM   1680  C  CG1   . VAL C  3  49  ? -11.837  -34.544 29.314  1.00 50.75  ? 43  VAL C CG1   1 
ATOM   1681  C  CG2   . VAL C  3  49  ? -10.654  -33.255 31.098  1.00 48.49  ? 43  VAL C CG2   1 
ATOM   1682  N  N     . LYS C  3  50  ? -10.136  -36.928 28.671  1.00 51.59  ? 44  LYS C N     1 
ATOM   1683  C  CA    . LYS C  3  50  ? -10.470  -37.739 27.526  1.00 53.70  ? 44  LYS C CA    1 
ATOM   1684  C  C     . LYS C  3  50  ? -12.018  -37.888 27.527  1.00 49.92  ? 44  LYS C C     1 
ATOM   1685  O  O     . LYS C  3  50  ? -12.591  -38.665 28.304  1.00 48.92  ? 44  LYS C O     1 
ATOM   1686  C  CB    . LYS C  3  50  ? -9.715   -39.054 27.667  1.00 64.40  ? 44  LYS C CB    1 
ATOM   1687  C  CG    . LYS C  3  50  ? -10.229  -40.169 26.762  1.00 82.64  ? 44  LYS C CG    1 
ATOM   1688  C  CD    . LYS C  3  50  ? -9.117   -40.949 26.050  1.00 99.08  ? 44  LYS C CD    1 
ATOM   1689  C  CE    . LYS C  3  50  ? -8.154   -41.633 27.017  1.00 105.07 ? 44  LYS C CE    1 
ATOM   1690  N  NZ    . LYS C  3  50  ? -8.830   -42.667 27.832  1.00 110.60 ? 44  LYS C NZ    1 
ATOM   1691  N  N     . MET C  3  51  ? -12.670  -37.151 26.633  1.00 45.36  ? 45  MET C N     1 
ATOM   1692  C  CA    . MET C  3  51  ? -14.119  -37.123 26.471  1.00 40.98  ? 45  MET C CA    1 
ATOM   1693  C  C     . MET C  3  51  ? -14.528  -38.001 25.364  1.00 42.59  ? 45  MET C C     1 
ATOM   1694  O  O     . MET C  3  51  ? -13.946  -37.995 24.276  1.00 45.49  ? 45  MET C O     1 
ATOM   1695  C  CB    . MET C  3  51  ? -14.568  -35.734 26.082  1.00 40.19  ? 45  MET C CB    1 
ATOM   1696  C  CG    . MET C  3  51  ? -16.042  -35.422 26.258  1.00 37.72  ? 45  MET C CG    1 
ATOM   1697  S  SD    . MET C  3  51  ? -16.255  -33.616 26.287  1.00 34.55  ? 45  MET C SD    1 
ATOM   1698  C  CE    . MET C  3  51  ? -16.527  -33.697 24.508  1.00 30.01  ? 45  MET C CE    1 
ATOM   1699  N  N     . THR C  3  52  ? -15.523  -38.826 25.633  1.00 48.26  ? 46  THR C N     1 
ATOM   1700  C  CA    . THR C  3  52  ? -15.931  -39.876 24.680  1.00 51.00  ? 46  THR C CA    1 
ATOM   1701  C  C     . THR C  3  52  ? -17.424  -39.801 24.499  1.00 49.54  ? 46  THR C C     1 
ATOM   1702  O  O     . THR C  3  52  ? -18.172  -40.424 25.224  1.00 51.36  ? 46  THR C O     1 
ATOM   1703  C  CB    . THR C  3  52  ? -15.502  -41.251 25.197  1.00 52.14  ? 46  THR C CB    1 
ATOM   1704  O  OG1   . THR C  3  52  ? -14.242  -41.167 25.880  1.00 56.16  ? 46  THR C OG1   1 
ATOM   1705  C  CG2   . THR C  3  52  ? -15.394  -42.223 24.075  1.00 53.88  ? 46  THR C CG2   1 
ATOM   1706  N  N     . LEU C  3  53  ? -17.858  -38.981 23.549  1.00 51.18  ? 47  LEU C N     1 
ATOM   1707  C  CA    . LEU C  3  53  ? -19.289  -38.806 23.324  1.00 52.29  ? 47  LEU C CA    1 
ATOM   1708  C  C     . LEU C  3  53  ? -19.877  -40.122 22.838  1.00 56.45  ? 47  LEU C C     1 
ATOM   1709  O  O     . LEU C  3  53  ? -19.141  -40.994 22.398  1.00 61.99  ? 47  LEU C O     1 
ATOM   1710  C  CB    . LEU C  3  53  ? -19.524  -37.782 22.264  1.00 50.14  ? 47  LEU C CB    1 
ATOM   1711  C  CG    . LEU C  3  53  ? -19.097  -36.406 22.717  1.00 54.62  ? 47  LEU C CG    1 
ATOM   1712  C  CD1   . LEU C  3  53  ? -18.967  -35.537 21.480  1.00 57.24  ? 47  LEU C CD1   1 
ATOM   1713  C  CD2   . LEU C  3  53  ? -20.105  -35.698 23.629  1.00 63.12  ? 47  LEU C CD2   1 
ATOM   1714  N  N     . LYS C  3  54  ? -21.177  -40.301 22.959  1.00 59.43  ? 48  LYS C N     1 
ATOM   1715  C  CA    . LYS C  3  54  ? -21.789  -41.613 22.713  1.00 61.49  ? 48  LYS C CA    1 
ATOM   1716  C  C     . LYS C  3  54  ? -21.531  -42.019 21.315  1.00 60.94  ? 48  LYS C C     1 
ATOM   1717  O  O     . LYS C  3  54  ? -21.788  -41.269 20.406  1.00 62.39  ? 48  LYS C O     1 
ATOM   1718  C  CB    . LYS C  3  54  ? -23.318  -41.661 23.001  1.00 64.09  ? 48  LYS C CB    1 
ATOM   1719  C  CG    . LYS C  3  54  ? -23.930  -43.046 23.134  1.00 67.15  ? 48  LYS C CG    1 
ATOM   1720  C  CD    . LYS C  3  54  ? -23.297  -43.831 24.289  1.00 79.43  ? 48  LYS C CD    1 
ATOM   1721  C  CE    . LYS C  3  54  ? -23.574  -45.321 24.328  1.00 84.90  ? 48  LYS C CE    1 
ATOM   1722  N  NZ    . LYS C  3  54  ? -24.535  -45.549 25.450  1.00 91.40  ? 48  LYS C NZ    1 
ATOM   1723  N  N     . ASN C  3  55  ? -20.970  -43.210 21.168  1.00 69.41  ? 49  ASN C N     1 
ATOM   1724  C  CA    . ASN C  3  55  ? -20.628  -43.763 19.853  1.00 70.44  ? 49  ASN C CA    1 
ATOM   1725  C  C     . ASN C  3  55  ? -19.820  -42.760 19.069  1.00 66.79  ? 49  ASN C C     1 
ATOM   1726  O  O     . ASN C  3  55  ? -20.135  -42.471 17.922  1.00 74.70  ? 49  ASN C O     1 
ATOM   1727  C  CB    . ASN C  3  55  ? -21.889  -44.141 19.050  1.00 70.12  ? 49  ASN C CB    1 
ATOM   1728  C  CG    . ASN C  3  55  ? -22.877  -44.968 19.848  1.00 71.99  ? 49  ASN C CG    1 
ATOM   1729  O  OD1   . ASN C  3  55  ? -22.541  -45.760 20.749  1.00 62.84  ? 49  ASN C OD1   1 
ATOM   1730  N  ND2   . ASN C  3  55  ? -24.147  -44.700 19.568  1.00 75.55  ? 49  ASN C ND2   1 
ATOM   1731  N  N     . ARG C  3  56  ? -18.796  -42.218 19.695  1.00 64.30  ? 50  ARG C N     1 
ATOM   1732  C  CA    . ARG C  3  56  ? -17.798  -41.493 18.973  1.00 64.21  ? 50  ARG C CA    1 
ATOM   1733  C  C     . ARG C  3  56  ? -16.444  -41.825 19.558  1.00 65.92  ? 50  ARG C C     1 
ATOM   1734  O  O     . ARG C  3  56  ? -16.304  -42.429 20.617  1.00 64.84  ? 50  ARG C O     1 
ATOM   1735  C  CB    . ARG C  3  56  ? -18.033  -40.025 19.059  1.00 70.76  ? 50  ARG C CB    1 
ATOM   1736  C  CG    . ARG C  3  56  ? -19.347  -39.525 18.523  1.00 78.68  ? 50  ARG C CG    1 
ATOM   1737  C  CD    . ARG C  3  56  ? -19.189  -38.030 18.196  1.00 88.39  ? 50  ARG C CD    1 
ATOM   1738  N  NE    . ARG C  3  56  ? -19.408  -37.864 16.783  1.00 96.46  ? 50  ARG C NE    1 
ATOM   1739  C  CZ    . ARG C  3  56  ? -20.618  -37.751 16.231  1.00 113.92 ? 50  ARG C CZ    1 
ATOM   1740  N  NH1   . ARG C  3  56  ? -21.746  -37.647 16.947  1.00 119.88 ? 50  ARG C NH1   1 
ATOM   1741  N  NH2   . ARG C  3  56  ? -20.704  -37.702 14.905  1.00 123.95 ? 50  ARG C NH2   1 
ATOM   1742  N  N     . GLU C  3  57  ? -15.430  -41.494 18.773  1.00 69.02  ? 51  GLU C N     1 
ATOM   1743  C  CA    . GLU C  3  57  ? -14.052  -41.824 19.074  1.00 68.16  ? 51  GLU C CA    1 
ATOM   1744  C  C     . GLU C  3  57  ? -13.670  -40.771 20.126  1.00 59.54  ? 51  GLU C C     1 
ATOM   1745  O  O     . GLU C  3  57  ? -14.193  -39.650 20.149  1.00 56.90  ? 51  GLU C O     1 
ATOM   1746  C  CB    . GLU C  3  57  ? -13.206  -41.882 17.784  1.00 81.65  ? 51  GLU C CB    1 
ATOM   1747  C  CG    . GLU C  3  57  ? -12.931  -40.513 17.056  1.00 104.99 ? 51  GLU C CG    1 
ATOM   1748  C  CD    . GLU C  3  57  ? -14.123  -39.556 16.721  1.00 115.51 ? 51  GLU C CD    1 
ATOM   1749  O  OE1   . GLU C  3  57  ? -15.307  -39.904 16.902  1.00 125.63 ? 51  GLU C OE1   1 
ATOM   1750  O  OE2   . GLU C  3  57  ? -13.955  -38.405 16.265  1.00 123.31 ? 51  GLU C OE2   1 
ATOM   1751  N  N     . PRO C  3  58  ? -12.791  -41.129 21.050  1.00 57.75  ? 52  PRO C N     1 
ATOM   1752  C  CA    . PRO C  3  58  ? -12.381  -40.234 22.097  1.00 60.27  ? 52  PRO C CA    1 
ATOM   1753  C  C     . PRO C  3  58  ? -11.729  -39.012 21.558  1.00 59.37  ? 52  PRO C C     1 
ATOM   1754  O  O     . PRO C  3  58  ? -11.296  -39.008 20.416  1.00 63.54  ? 52  PRO C O     1 
ATOM   1755  C  CB    . PRO C  3  58  ? -11.310  -41.031 22.820  1.00 68.71  ? 52  PRO C CB    1 
ATOM   1756  C  CG    . PRO C  3  58  ? -11.866  -42.410 22.782  1.00 72.08  ? 52  PRO C CG    1 
ATOM   1757  C  CD    . PRO C  3  58  ? -12.403  -42.507 21.374  1.00 65.88  ? 52  PRO C CD    1 
ATOM   1758  N  N     . VAL C  3  59  ? -11.617  -38.004 22.407  1.00 55.63  ? 53  VAL C N     1 
ATOM   1759  C  CA    . VAL C  3  59  ? -11.080  -36.721 22.039  1.00 53.68  ? 53  VAL C CA    1 
ATOM   1760  C  C     . VAL C  3  59  ? -10.379  -36.222 23.290  1.00 58.10  ? 53  VAL C C     1 
ATOM   1761  O  O     . VAL C  3  59  ? -10.950  -36.297 24.388  1.00 61.94  ? 53  VAL C O     1 
ATOM   1762  C  CB    . VAL C  3  59  ? -12.243  -35.814 21.796  1.00 54.80  ? 53  VAL C CB    1 
ATOM   1763  C  CG1   . VAL C  3  59  ? -11.868  -34.359 21.635  1.00 58.64  ? 53  VAL C CG1   1 
ATOM   1764  C  CG2   . VAL C  3  59  ? -12.980  -36.323 20.582  1.00 60.87  ? 53  VAL C CG2   1 
ATOM   1765  N  N     . GLN C  3  60  ? -9.162   -35.672 23.144  1.00 56.82  ? 54  GLN C N     1 
ATOM   1766  C  CA    . GLN C  3  60  ? -8.413   -35.227 24.324  1.00 52.56  ? 54  GLN C CA    1 
ATOM   1767  C  C     . GLN C  3  60  ? -8.482   -33.770 24.478  1.00 46.91  ? 54  GLN C C     1 
ATOM   1768  O  O     . GLN C  3  60  ? -8.496   -33.078 23.480  1.00 40.73  ? 54  GLN C O     1 
ATOM   1769  C  CB    . GLN C  3  60  ? -7.009   -35.791 24.330  1.00 56.88  ? 54  GLN C CB    1 
ATOM   1770  C  CG    . GLN C  3  60  ? -7.133   -37.321 24.278  1.00 62.88  ? 54  GLN C CG    1 
ATOM   1771  C  CD    . GLN C  3  60  ? -5.996   -38.081 24.878  1.00 67.24  ? 54  GLN C CD    1 
ATOM   1772  O  OE1   . GLN C  3  60  ? -6.193   -39.092 25.573  1.00 76.05  ? 54  GLN C OE1   1 
ATOM   1773  N  NE2   . GLN C  3  60  ? -4.786   -37.648 24.544  1.00 69.35  ? 54  GLN C NE2   1 
ATOM   1774  N  N     . LEU C  3  61  ? -8.559   -33.333 25.721  1.00 45.85  ? 55  LEU C N     1 
ATOM   1775  C  CA    . LEU C  3  61  ? -8.729   -31.923 25.987  1.00 52.68  ? 55  LEU C CA    1 
ATOM   1776  C  C     . LEU C  3  61  ? -7.968   -31.513 27.212  1.00 58.64  ? 55  LEU C C     1 
ATOM   1777  O  O     . LEU C  3  61  ? -7.901   -32.248 28.205  1.00 72.81  ? 55  LEU C O     1 
ATOM   1778  C  CB    . LEU C  3  61  ? -10.190  -31.572 26.238  1.00 55.63  ? 55  LEU C CB    1 
ATOM   1779  C  CG    . LEU C  3  61  ? -11.277  -32.052 25.281  1.00 55.95  ? 55  LEU C CG    1 
ATOM   1780  C  CD1   . LEU C  3  61  ? -12.610  -31.677 25.864  1.00 56.14  ? 55  LEU C CD1   1 
ATOM   1781  C  CD2   . LEU C  3  61  ? -11.137  -31.425 23.935  1.00 55.88  ? 55  LEU C CD2   1 
ATOM   1782  N  N     . GLU C  3  62  ? -7.463   -30.293 27.181  1.00 59.97  ? 56  GLU C N     1 
ATOM   1783  C  CA    . GLU C  3  62  ? -6.635   -29.774 28.247  1.00 63.38  ? 56  GLU C CA    1 
ATOM   1784  C  C     . GLU C  3  62  ? -7.495   -29.430 29.466  1.00 60.40  ? 56  GLU C C     1 
ATOM   1785  O  O     . GLU C  3  62  ? -7.058   -29.348 30.588  1.00 59.73  ? 56  GLU C O     1 
ATOM   1786  C  CB    . GLU C  3  62  ? -5.934   -28.534 27.703  1.00 74.82  ? 56  GLU C CB    1 
ATOM   1787  C  CG    . GLU C  3  62  ? -4.480   -28.428 28.062  1.00 91.75  ? 56  GLU C CG    1 
ATOM   1788  C  CD    . GLU C  3  62  ? -3.834   -27.144 27.572  1.00 109.77 ? 56  GLU C CD    1 
ATOM   1789  O  OE1   . GLU C  3  62  ? -4.534   -26.359 26.853  1.00 116.26 ? 56  GLU C OE1   1 
ATOM   1790  O  OE2   . GLU C  3  62  ? -2.620   -26.987 27.890  1.00 132.81 ? 56  GLU C OE2   1 
ATOM   1791  N  N     . THR C  3  63  ? -8.774   -29.233 29.259  1.00 58.72  ? 57  THR C N     1 
ATOM   1792  C  CA    . THR C  3  63  ? -9.597   -28.640 30.278  1.00 54.70  ? 57  THR C CA    1 
ATOM   1793  C  C     . THR C  3  63  ? -11.080  -28.914 29.863  1.00 52.85  ? 57  THR C C     1 
ATOM   1794  O  O     . THR C  3  63  ? -11.427  -28.955 28.674  1.00 52.93  ? 57  THR C O     1 
ATOM   1795  C  CB    . THR C  3  63  ? -9.274   -27.162 30.310  1.00 53.58  ? 57  THR C CB    1 
ATOM   1796  O  OG1   . THR C  3  63  ? -10.258  -26.528 31.116  1.00 61.45  ? 57  THR C OG1   1 
ATOM   1797  C  CG2   . THR C  3  63  ? -9.383   -26.540 28.870  1.00 55.20  ? 57  THR C CG2   1 
ATOM   1798  N  N     . LEU C  3  64  ? -11.936  -29.127 30.843  1.00 46.40  ? 58  LEU C N     1 
ATOM   1799  C  CA    . LEU C  3  64  ? -13.322  -29.245 30.552  1.00 43.60  ? 58  LEU C CA    1 
ATOM   1800  C  C     . LEU C  3  64  ? -14.091  -28.928 31.797  1.00 45.30  ? 58  LEU C C     1 
ATOM   1801  O  O     . LEU C  3  64  ? -13.726  -29.421 32.896  1.00 42.95  ? 58  LEU C O     1 
ATOM   1802  C  CB    . LEU C  3  64  ? -13.616  -30.693 30.218  1.00 44.73  ? 58  LEU C CB    1 
ATOM   1803  C  CG    . LEU C  3  64  ? -15.102  -31.023 29.916  1.00 42.58  ? 58  LEU C CG    1 
ATOM   1804  C  CD1   . LEU C  3  64  ? -15.465  -30.452 28.558  1.00 41.94  ? 58  LEU C CD1   1 
ATOM   1805  C  CD2   . LEU C  3  64  ? -15.371  -32.524 30.075  1.00 41.57  ? 58  LEU C CD2   1 
ATOM   1806  N  N     . SER C  3  65  ? -15.191  -28.187 31.616  1.00 46.07  ? 59  SER C N     1 
ATOM   1807  C  CA    . SER C  3  65  ? -16.128  -27.917 32.704  1.00 47.29  ? 59  SER C CA    1 
ATOM   1808  C  C     . SER C  3  65  ? -17.503  -28.460 32.358  1.00 47.14  ? 59  SER C C     1 
ATOM   1809  O  O     . SER C  3  65  ? -17.910  -28.364 31.225  1.00 50.34  ? 59  SER C O     1 
ATOM   1810  C  CB    . SER C  3  65  ? -16.176  -26.429 32.934  1.00 51.09  ? 59  SER C CB    1 
ATOM   1811  O  OG    . SER C  3  65  ? -14.854  -25.857 32.946  1.00 61.11  ? 59  SER C OG    1 
ATOM   1812  N  N     . ILE C  3  66  ? -18.226  -29.008 33.322  1.00 45.09  ? 60  ILE C N     1 
ATOM   1813  C  CA    . ILE C  3  66  ? -19.446  -29.734 33.094  1.00 41.34  ? 60  ILE C CA    1 
ATOM   1814  C  C     . ILE C  3  66  ? -20.462  -29.173 34.057  1.00 39.39  ? 60  ILE C C     1 
ATOM   1815  O  O     . ILE C  3  66  ? -20.227  -29.135 35.257  1.00 37.88  ? 60  ILE C O     1 
ATOM   1816  C  CB    . ILE C  3  66  ? -19.259  -31.179 33.483  1.00 44.41  ? 60  ILE C CB    1 
ATOM   1817  C  CG1   . ILE C  3  66  ? -18.159  -31.803 32.636  1.00 47.78  ? 60  ILE C CG1   1 
ATOM   1818  C  CG2   . ILE C  3  66  ? -20.547  -31.931 33.218  1.00 47.04  ? 60  ILE C CG2   1 
ATOM   1819  C  CD1   . ILE C  3  66  ? -17.809  -33.227 33.011  1.00 49.16  ? 60  ILE C CD1   1 
ATOM   1820  N  N     . ARG C  3  67  ? -21.595  -28.719 33.537  1.00 39.93  ? 61  ARG C N     1 
ATOM   1821  C  CA    . ARG C  3  67  ? -22.664  -28.161 34.361  1.00 40.12  ? 61  ARG C CA    1 
ATOM   1822  C  C     . ARG C  3  67  ? -23.332  -29.302 35.069  1.00 40.54  ? 61  ARG C C     1 
ATOM   1823  O  O     . ARG C  3  67  ? -23.719  -30.272 34.463  1.00 43.33  ? 61  ARG C O     1 
ATOM   1824  C  CB    . ARG C  3  67  ? -23.688  -27.409 33.547  1.00 41.32  ? 61  ARG C CB    1 
ATOM   1825  C  CG    . ARG C  3  67  ? -24.630  -26.505 34.325  1.00 43.09  ? 61  ARG C CG    1 
ATOM   1826  C  CD    . ARG C  3  67  ? -25.657  -25.960 33.339  1.00 43.96  ? 61  ARG C CD    1 
ATOM   1827  N  NE    . ARG C  3  67  ? -26.524  -24.910 33.855  1.00 46.76  ? 61  ARG C NE    1 
ATOM   1828  C  CZ    . ARG C  3  67  ? -27.621  -25.095 34.582  1.00 49.01  ? 61  ARG C CZ    1 
ATOM   1829  N  NH1   . ARG C  3  67  ? -28.373  -24.048 34.922  1.00 47.21  ? 61  ARG C NH1   1 
ATOM   1830  N  NH2   . ARG C  3  67  ? -28.007  -26.328 34.952  1.00 50.37  ? 61  ARG C NH2   1 
ATOM   1831  N  N     . GLY C  3  68  ? -23.407  -29.208 36.383  1.00 42.42  ? 62  GLY C N     1 
ATOM   1832  C  CA    . GLY C  3  68  ? -23.520  -30.372 37.258  1.00 43.68  ? 62  GLY C CA    1 
ATOM   1833  C  C     . GLY C  3  68  ? -24.751  -31.215 37.059  1.00 42.61  ? 62  GLY C C     1 
ATOM   1834  O  O     . GLY C  3  68  ? -24.767  -32.403 37.352  1.00 43.79  ? 62  GLY C O     1 
ATOM   1835  N  N     . ASN C  3  69  ? -25.817  -30.551 36.657  1.00 41.05  ? 63  ASN C N     1 
ATOM   1836  C  CA    . ASN C  3  69  ? -27.054  -31.241 36.427  1.00 41.02  ? 63  ASN C CA    1 
ATOM   1837  C  C     . ASN C  3  69  ? -26.918  -32.333 35.397  1.00 38.96  ? 63  ASN C C     1 
ATOM   1838  O  O     . ASN C  3  69  ? -27.612  -33.325 35.466  1.00 42.50  ? 63  ASN C O     1 
ATOM   1839  C  CB    . ASN C  3  69  ? -28.052  -30.222 35.926  1.00 43.54  ? 63  ASN C CB    1 
ATOM   1840  C  CG    . ASN C  3  69  ? -27.704  -29.794 34.550  1.00 45.46  ? 63  ASN C CG    1 
ATOM   1841  O  OD1   . ASN C  3  69  ? -26.914  -28.867 34.359  1.00 48.17  ? 63  ASN C OD1   1 
ATOM   1842  N  ND2   . ASN C  3  69  ? -28.265  -30.498 33.577  1.00 49.78  ? 63  ASN C ND2   1 
ATOM   1843  N  N     . ASN C  3  70  ? -25.982  -32.169 34.485  1.00 37.62  ? 64  ASN C N     1 
ATOM   1844  C  CA    . ASN C  3  70  ? -25.650  -33.180 33.504  1.00 38.07  ? 64  ASN C CA    1 
ATOM   1845  C  C     . ASN C  3  70  ? -24.969  -34.468 33.984  1.00 39.76  ? 64  ASN C C     1 
ATOM   1846  O  O     . ASN C  3  70  ? -24.840  -35.439 33.233  1.00 41.45  ? 64  ASN C O     1 
ATOM   1847  C  CB    . ASN C  3  70  ? -24.788  -32.563 32.415  1.00 37.43  ? 64  ASN C CB    1 
ATOM   1848  C  CG    . ASN C  3  70  ? -25.558  -31.594 31.576  1.00 40.40  ? 64  ASN C CG    1 
ATOM   1849  O  OD1   . ASN C  3  70  ? -25.388  -30.377 31.679  1.00 52.18  ? 64  ASN C OD1   1 
ATOM   1850  N  ND2   . ASN C  3  70  ? -26.439  -32.120 30.759  1.00 40.62  ? 64  ASN C ND2   1 
ATOM   1851  N  N     . ILE C  3  71  ? -24.533  -34.509 35.230  1.00 41.09  ? 65  ILE C N     1 
ATOM   1852  C  CA    . ILE C  3  71  ? -23.772  -35.655 35.727  1.00 41.30  ? 65  ILE C CA    1 
ATOM   1853  C  C     . ILE C  3  71  ? -24.692  -36.730 36.195  1.00 39.69  ? 65  ILE C C     1 
ATOM   1854  O  O     . ILE C  3  71  ? -25.598  -36.464 36.889  1.00 39.57  ? 65  ILE C O     1 
ATOM   1855  C  CB    . ILE C  3  71  ? -22.865  -35.242 36.894  1.00 42.34  ? 65  ILE C CB    1 
ATOM   1856  C  CG1   . ILE C  3  71  ? -21.757  -34.316 36.341  1.00 43.89  ? 65  ILE C CG1   1 
ATOM   1857  C  CG2   . ILE C  3  71  ? -22.328  -36.472 37.598  1.00 41.04  ? 65  ILE C CG2   1 
ATOM   1858  C  CD1   . ILE C  3  71  ? -20.938  -33.679 37.466  1.00 44.44  ? 65  ILE C CD1   1 
ATOM   1859  N  N     . ARG C  3  72  ? -24.414  -37.973 35.860  1.00 42.95  ? 66  ARG C N     1 
ATOM   1860  C  CA    . ARG C  3  72  ? -25.256  -39.115 36.296  1.00 44.37  ? 66  ARG C CA    1 
ATOM   1861  C  C     . ARG C  3  72  ? -24.423  -39.720 37.372  1.00 44.51  ? 66  ARG C C     1 
ATOM   1862  O  O     . ARG C  3  72  ? -24.911  -39.771 38.490  1.00 42.15  ? 66  ARG C O     1 
ATOM   1863  C  CB    . ARG C  3  72  ? -25.506  -40.070 35.116  1.00 47.92  ? 66  ARG C CB    1 
ATOM   1864  C  CG    . ARG C  3  72  ? -26.081  -41.402 35.428  1.00 50.61  ? 66  ARG C CG    1 
ATOM   1865  C  CD    . ARG C  3  72  ? -27.574  -41.362 35.657  1.00 58.83  ? 66  ARG C CD    1 
ATOM   1866  N  NE    . ARG C  3  72  ? -28.540  -40.568 34.830  1.00 58.20  ? 66  ARG C NE    1 
ATOM   1867  C  CZ    . ARG C  3  72  ? -28.745  -40.694 33.515  1.00 55.05  ? 66  ARG C CZ    1 
ATOM   1868  N  NH1   . ARG C  3  72  ? -27.959  -41.435 32.767  1.00 57.78  ? 66  ARG C NH1   1 
ATOM   1869  N  NH2   . ARG C  3  72  ? -29.659  -39.994 32.906  1.00 51.26  ? 66  ARG C NH2   1 
ATOM   1870  N  N     . TYR C  3  73  ? -23.150  -40.051 37.090  1.00 45.14  ? 67  TYR C N     1 
ATOM   1871  C  CA    . TYR C  3  73  ? -22.254  -40.309 38.196  1.00 48.76  ? 67  TYR C CA    1 
ATOM   1872  C  C     . TYR C  3  73  ? -20.787  -40.164 38.047  1.00 48.54  ? 67  TYR C C     1 
ATOM   1873  O  O     . TYR C  3  73  ? -20.286  -40.086 36.960  1.00 50.49  ? 67  TYR C O     1 
ATOM   1874  C  CB    . TYR C  3  73  ? -22.496  -41.705 38.711  1.00 56.55  ? 67  TYR C CB    1 
ATOM   1875  C  CG    . TYR C  3  73  ? -22.635  -42.806 37.718  1.00 58.37  ? 67  TYR C CG    1 
ATOM   1876  C  CD1   . TYR C  3  73  ? -21.516  -43.325 37.168  1.00 59.98  ? 67  TYR C CD1   1 
ATOM   1877  C  CD2   . TYR C  3  73  ? -23.862  -43.398 37.483  1.00 60.46  ? 67  TYR C CD2   1 
ATOM   1878  C  CE1   . TYR C  3  73  ? -21.596  -44.343 36.273  1.00 63.78  ? 67  TYR C CE1   1 
ATOM   1879  C  CE2   . TYR C  3  73  ? -23.949  -44.439 36.633  1.00 66.22  ? 67  TYR C CE2   1 
ATOM   1880  C  CZ    . TYR C  3  73  ? -22.795  -44.894 36.013  1.00 69.11  ? 67  TYR C CZ    1 
ATOM   1881  O  OH    . TYR C  3  73  ? -22.766  -45.932 35.085  1.00 87.71  ? 67  TYR C OH    1 
ATOM   1882  N  N     . PHE C  3  74  ? -20.108  -40.075 39.188  1.00 50.52  ? 68  PHE C N     1 
ATOM   1883  C  CA    . PHE C  3  74  ? -18.627  -40.124 39.324  1.00 49.46  ? 68  PHE C CA    1 
ATOM   1884  C  C     . PHE C  3  74  ? -18.233  -41.538 39.676  1.00 44.45  ? 68  PHE C C     1 
ATOM   1885  O  O     . PHE C  3  74  ? -18.699  -42.049 40.641  1.00 42.39  ? 68  PHE C O     1 
ATOM   1886  C  CB    . PHE C  3  74  ? -18.096  -39.257 40.481  1.00 48.81  ? 68  PHE C CB    1 
ATOM   1887  C  CG    . PHE C  3  74  ? -18.146  -37.771 40.230  1.00 46.01  ? 68  PHE C CG    1 
ATOM   1888  C  CD1   . PHE C  3  74  ? -19.351  -37.108 40.220  1.00 44.33  ? 68  PHE C CD1   1 
ATOM   1889  C  CD2   . PHE C  3  74  ? -16.972  -37.027 40.168  1.00 43.95  ? 68  PHE C CD2   1 
ATOM   1890  C  CE1   . PHE C  3  74  ? -19.351  -35.721 40.049  1.00 45.51  ? 68  PHE C CE1   1 
ATOM   1891  C  CE2   . PHE C  3  74  ? -16.974  -35.655 40.026  1.00 41.39  ? 68  PHE C CE2   1 
ATOM   1892  C  CZ    . PHE C  3  74  ? -18.162  -34.990 39.938  1.00 41.39  ? 68  PHE C CZ    1 
ATOM   1893  N  N     . ILE C  3  75  ? -17.262  -42.076 38.969  1.00 46.92  ? 69  ILE C N     1 
ATOM   1894  C  CA    . ILE C  3  75  ? -16.578  -43.299 39.339  1.00 44.61  ? 69  ILE C CA    1 
ATOM   1895  C  C     . ILE C  3  75  ? -15.233  -42.959 39.934  1.00 45.69  ? 69  ILE C C     1 
ATOM   1896  O  O     . ILE C  3  75  ? -14.373  -42.353 39.313  1.00 48.35  ? 69  ILE C O     1 
ATOM   1897  C  CB    . ILE C  3  75  ? -16.351  -44.128 38.108  1.00 45.44  ? 69  ILE C CB    1 
ATOM   1898  C  CG1   . ILE C  3  75  ? -17.696  -44.601 37.575  1.00 46.02  ? 69  ILE C CG1   1 
ATOM   1899  C  CG2   . ILE C  3  75  ? -15.588  -45.348 38.541  1.00 48.44  ? 69  ILE C CG2   1 
ATOM   1900  C  CD1   . ILE C  3  75  ? -17.655  -45.347 36.257  1.00 43.94  ? 69  ILE C CD1   1 
ATOM   1901  N  N     . LEU C  3  76  ? -15.051  -43.336 41.181  1.00 49.06  ? 70  LEU C N     1 
ATOM   1902  C  CA    . LEU C  3  76  ? -13.949  -42.848 42.022  1.00 46.35  ? 70  LEU C CA    1 
ATOM   1903  C  C     . LEU C  3  76  ? -12.818  -43.858 42.019  1.00 47.85  ? 70  LEU C C     1 
ATOM   1904  O  O     . LEU C  3  76  ? -13.039  -45.054 41.760  1.00 45.33  ? 70  LEU C O     1 
ATOM   1905  C  CB    . LEU C  3  76  ? -14.448  -42.668 43.450  1.00 45.04  ? 70  LEU C CB    1 
ATOM   1906  C  CG    . LEU C  3  76  ? -15.658  -41.740 43.481  1.00 48.30  ? 70  LEU C CG    1 
ATOM   1907  C  CD1   . LEU C  3  76  ? -16.303  -41.606 44.856  1.00 48.56  ? 70  LEU C CD1   1 
ATOM   1908  C  CD2   . LEU C  3  76  ? -15.280  -40.374 42.882  1.00 48.08  ? 70  LEU C CD2   1 
ATOM   1909  N  N     . PRO C  3  77  ? -11.615  -43.386 42.339  1.00 49.98  ? 71  PRO C N     1 
ATOM   1910  C  CA    . PRO C  3  77  ? -10.410  -44.184 42.514  1.00 52.52  ? 71  PRO C CA    1 
ATOM   1911  C  C     . PRO C  3  77  ? -10.570  -45.240 43.521  1.00 57.23  ? 71  PRO C C     1 
ATOM   1912  O  O     . PRO C  3  77  ? -11.207  -45.026 44.525  1.00 55.18  ? 71  PRO C O     1 
ATOM   1913  C  CB    . PRO C  3  77  ? -9.433   -43.222 43.117  1.00 53.46  ? 71  PRO C CB    1 
ATOM   1914  C  CG    . PRO C  3  77  ? -9.843   -41.912 42.511  1.00 54.86  ? 71  PRO C CG    1 
ATOM   1915  C  CD    . PRO C  3  77  ? -11.326  -41.949 42.418  1.00 51.77  ? 71  PRO C CD    1 
ATOM   1916  N  N     . ASP C  3  78  ? -10.100  -46.427 43.191  1.00 73.48  ? 72  ASP C N     1 
ATOM   1917  C  CA    . ASP C  3  78  ? -10.391  -47.616 44.023  1.00 83.41  ? 72  ASP C CA    1 
ATOM   1918  C  C     . ASP C  3  78  ? -9.836   -47.458 45.420  1.00 75.68  ? 72  ASP C C     1 
ATOM   1919  O  O     . ASP C  3  78  ? -10.399  -47.981 46.320  1.00 75.30  ? 72  ASP C O     1 
ATOM   1920  C  CB    . ASP C  3  78  ? -9.986   -48.877 43.263  1.00 94.93  ? 72  ASP C CB    1 
ATOM   1921  C  CG    . ASP C  3  78  ? -10.361  -50.176 43.929  1.00 110.03 ? 72  ASP C CG    1 
ATOM   1922  O  OD1   . ASP C  3  78  ? -11.125  -50.184 44.924  1.00 126.82 ? 72  ASP C OD1   1 
ATOM   1923  O  OD2   . ASP C  3  78  ? -9.932   -51.239 43.398  1.00 129.26 ? 72  ASP C OD2   1 
ATOM   1924  N  N     . SER C  3  79  ? -8.770   -46.694 45.552  1.00 74.34  ? 73  SER C N     1 
ATOM   1925  C  CA    . SER C  3  79  ? -8.072   -46.455 46.789  1.00 73.77  ? 73  SER C CA    1 
ATOM   1926  C  C     . SER C  3  79  ? -8.628   -45.277 47.571  1.00 73.64  ? 73  SER C C     1 
ATOM   1927  O  O     . SER C  3  79  ? -8.200   -45.037 48.689  1.00 88.83  ? 73  SER C O     1 
ATOM   1928  C  CB    . SER C  3  79  ? -6.626   -46.095 46.431  1.00 78.81  ? 73  SER C CB    1 
ATOM   1929  O  OG    . SER C  3  79  ? -6.472   -44.775 45.925  1.00 81.86  ? 73  SER C OG    1 
ATOM   1930  N  N     . LEU C  3  80  ? -9.565   -44.519 47.029  1.00 66.92  ? 74  LEU C N     1 
ATOM   1931  C  CA    . LEU C  3  80  ? -9.957   -43.250 47.628  1.00 61.57  ? 74  LEU C CA    1 
ATOM   1932  C  C     . LEU C  3  80  ? -10.466  -43.500 49.020  1.00 60.75  ? 74  LEU C C     1 
ATOM   1933  O  O     . LEU C  3  80  ? -11.368  -44.294 49.169  1.00 66.21  ? 74  LEU C O     1 
ATOM   1934  C  CB    . LEU C  3  80  ? -11.083  -42.636 46.803  1.00 61.17  ? 74  LEU C CB    1 
ATOM   1935  C  CG    . LEU C  3  80  ? -11.627  -41.283 47.229  1.00 61.82  ? 74  LEU C CG    1 
ATOM   1936  C  CD1   . LEU C  3  80  ? -10.601  -40.208 46.952  1.00 63.08  ? 74  LEU C CD1   1 
ATOM   1937  C  CD2   . LEU C  3  80  ? -12.892  -40.981 46.445  1.00 64.86  ? 74  LEU C CD2   1 
ATOM   1938  N  N     . PRO C  3  81  ? -9.936   -42.845 50.047  1.00 60.97  ? 75  PRO C N     1 
ATOM   1939  C  CA    . PRO C  3  81  ? -10.225  -43.143 51.437  1.00 65.52  ? 75  PRO C CA    1 
ATOM   1940  C  C     . PRO C  3  81  ? -11.542  -42.585 51.922  1.00 71.91  ? 75  PRO C C     1 
ATOM   1941  O  O     . PRO C  3  81  ? -11.603  -41.466 52.419  1.00 68.51  ? 75  PRO C O     1 
ATOM   1942  C  CB    . PRO C  3  81  ? -9.098   -42.439 52.157  1.00 69.03  ? 75  PRO C CB    1 
ATOM   1943  C  CG    . PRO C  3  81  ? -8.878   -41.221 51.341  1.00 67.67  ? 75  PRO C CG    1 
ATOM   1944  C  CD    . PRO C  3  81  ? -9.012   -41.721 49.934  1.00 65.53  ? 75  PRO C CD    1 
ATOM   1945  N  N     . LEU C  3  82  ? -12.621  -43.356 51.773  1.00 81.31  ? 76  LEU C N     1 
ATOM   1946  C  CA    . LEU C  3  82  ? -13.979  -42.751 51.870  1.00 79.22  ? 76  LEU C CA    1 
ATOM   1947  C  C     . LEU C  3  82  ? -14.272  -42.287 53.287  1.00 87.18  ? 76  LEU C C     1 
ATOM   1948  O  O     . LEU C  3  82  ? -14.683  -41.141 53.469  1.00 86.41  ? 76  LEU C O     1 
ATOM   1949  C  CB    . LEU C  3  82  ? -15.081  -43.708 51.434  1.00 75.17  ? 76  LEU C CB    1 
ATOM   1950  C  CG    . LEU C  3  82  ? -15.075  -44.063 49.950  1.00 70.39  ? 76  LEU C CG    1 
ATOM   1951  C  CD1   . LEU C  3  82  ? -16.066  -45.201 49.725  1.00 65.06  ? 76  LEU C CD1   1 
ATOM   1952  C  CD2   . LEU C  3  82  ? -15.330  -42.819 49.109  1.00 70.86  ? 76  LEU C CD2   1 
ATOM   1953  N  N     . ASP C  3  83  ? -13.946  -43.137 54.268  1.00 92.66  ? 77  ASP C N     1 
ATOM   1954  C  CA    . ASP C  3  83  ? -14.330  -42.881 55.654  1.00 91.97  ? 77  ASP C CA    1 
ATOM   1955  C  C     . ASP C  3  83  ? -13.679  -41.616 56.139  1.00 85.49  ? 77  ASP C C     1 
ATOM   1956  O  O     . ASP C  3  83  ? -14.353  -40.736 56.681  1.00 86.08  ? 77  ASP C O     1 
ATOM   1957  C  CB    . ASP C  3  83  ? -13.988  -44.061 56.549  1.00 95.49  ? 77  ASP C CB    1 
ATOM   1958  C  CG    . ASP C  3  83  ? -14.779  -45.314 56.183  1.00 104.19 ? 77  ASP C CG    1 
ATOM   1959  O  OD1   . ASP C  3  83  ? -16.002  -45.178 55.914  1.00 102.93 ? 77  ASP C OD1   1 
ATOM   1960  O  OD2   . ASP C  3  83  ? -14.167  -46.416 56.105  1.00 112.27 ? 77  ASP C OD2   1 
ATOM   1961  N  N     . THR C  3  84  ? -12.394  -41.514 55.838  1.00 78.56  ? 78  THR C N     1 
ATOM   1962  C  CA    . THR C  3  84  ? -11.698  -40.257 56.038  1.00 81.44  ? 78  THR C CA    1 
ATOM   1963  C  C     . THR C  3  84  ? -12.476  -39.053 55.483  1.00 76.94  ? 78  THR C C     1 
ATOM   1964  O  O     . THR C  3  84  ? -12.647  -38.053 56.177  1.00 78.07  ? 78  THR C O     1 
ATOM   1965  C  CB    . THR C  3  84  ? -10.328  -40.327 55.332  1.00 85.16  ? 78  THR C CB    1 
ATOM   1966  O  OG1   . THR C  3  84  ? -9.597   -41.396 55.916  1.00 90.90  ? 78  THR C OG1   1 
ATOM   1967  C  CG2   . THR C  3  84  ? -9.513   -38.996 55.331  1.00 83.67  ? 78  THR C CG2   1 
ATOM   1968  N  N     . LEU C  3  85  ? -12.824  -39.116 54.201  1.00 71.43  ? 79  LEU C N     1 
ATOM   1969  C  CA    . LEU C  3  85  ? -13.340  -37.975 53.464  1.00 67.88  ? 79  LEU C CA    1 
ATOM   1970  C  C     . LEU C  3  85  ? -14.770  -37.669 53.809  1.00 66.82  ? 79  LEU C C     1 
ATOM   1971  O  O     . LEU C  3  85  ? -15.249  -36.592 53.507  1.00 60.93  ? 79  LEU C O     1 
ATOM   1972  C  CB    . LEU C  3  85  ? -13.249  -38.262 51.982  1.00 70.93  ? 79  LEU C CB    1 
ATOM   1973  C  CG    . LEU C  3  85  ? -11.899  -37.977 51.369  1.00 77.11  ? 79  LEU C CG    1 
ATOM   1974  C  CD1   . LEU C  3  85  ? -11.597  -38.889 50.172  1.00 82.78  ? 79  LEU C CD1   1 
ATOM   1975  C  CD2   . LEU C  3  85  ? -11.887  -36.522 50.919  1.00 77.74  ? 79  LEU C CD2   1 
ATOM   1976  N  N     . LEU C  3  86  ? -15.459  -38.635 54.409  1.00 71.49  ? 80  LEU C N     1 
ATOM   1977  C  CA    . LEU C  3  86  ? -16.878  -38.478 54.732  1.00 76.73  ? 80  LEU C CA    1 
ATOM   1978  C  C     . LEU C  3  86  ? -17.146  -37.898 56.117  1.00 86.75  ? 80  LEU C C     1 
ATOM   1979  O  O     . LEU C  3  86  ? -18.285  -37.687 56.488  1.00 94.28  ? 80  LEU C O     1 
ATOM   1980  C  CB    . LEU C  3  86  ? -17.604  -39.815 54.543  1.00 69.00  ? 80  LEU C CB    1 
ATOM   1981  C  CG    . LEU C  3  86  ? -17.839  -40.123 53.066  1.00 68.52  ? 80  LEU C CG    1 
ATOM   1982  C  CD1   . LEU C  3  86  ? -18.247  -41.569 52.888  1.00 70.92  ? 80  LEU C CD1   1 
ATOM   1983  C  CD2   . LEU C  3  86  ? -18.880  -39.225 52.414  1.00 68.56  ? 80  LEU C CD2   1 
ATOM   1984  N  N     . VAL C  3  87  ? -16.122  -37.637 56.921  1.00 94.90  ? 81  VAL C N     1 
ATOM   1985  C  CA    . VAL C  3  87  ? -16.400  -37.114 58.247  1.00 95.85  ? 81  VAL C CA    1 
ATOM   1986  C  C     . VAL C  3  87  ? -16.853  -35.663 58.186  1.00 103.27 ? 81  VAL C C     1 
ATOM   1987  O  O     . VAL C  3  87  ? -17.536  -35.250 59.093  1.00 124.35 ? 81  VAL C O     1 
ATOM   1988  C  CB    . VAL C  3  87  ? -15.351  -37.489 59.304  1.00 94.41  ? 81  VAL C CB    1 
ATOM   1989  C  CG1   . VAL C  3  87  ? -15.349  -39.026 59.460  1.00 87.83  ? 81  VAL C CG1   1 
ATOM   1990  C  CG2   . VAL C  3  87  ? -14.007  -36.895 58.966  1.00 95.80  ? 81  VAL C CG2   1 
ATOM   1991  N  N     . ASP C  3  88  ? -16.660  -34.920 57.109  1.00 107.99 ? 82  ASP C N     1 
ATOM   1992  C  CA    . ASP C  3  88  ? -17.648  -33.828 56.746  1.00 118.60 ? 82  ASP C CA    1 
ATOM   1993  C  C     . ASP C  3  88  ? -17.631  -32.705 57.804  1.00 112.16 ? 82  ASP C C     1 
ATOM   1994  O  O     . ASP C  3  88  ? -16.750  -31.850 57.854  1.00 102.08 ? 82  ASP C O     1 
ATOM   1995  C  CB    . ASP C  3  88  ? -19.075  -34.451 56.506  1.00 127.16 ? 82  ASP C CB    1 
ATOM   1996  C  CG    . ASP C  3  88  ? -20.243  -33.454 56.226  1.00 131.50 ? 82  ASP C CG    1 
ATOM   1997  O  OD1   . ASP C  3  88  ? -20.348  -32.406 56.885  1.00 147.39 ? 82  ASP C OD1   1 
ATOM   1998  O  OD2   . ASP C  3  88  ? -21.176  -33.732 55.422  1.00 113.64 ? 82  ASP C OD2   1 
ATOM   1999  N  N     . GLU D  4  10  ? -38.456  -20.979 56.425  1.00 138.39 ? 10  GLU D N     1 
ATOM   2000  C  CA    . GLU D  4  10  ? -39.390  -22.128 56.184  1.00 151.18 ? 10  GLU D CA    1 
ATOM   2001  C  C     . GLU D  4  10  ? -40.511  -22.203 57.255  1.00 167.37 ? 10  GLU D C     1 
ATOM   2002  O  O     . GLU D  4  10  ? -40.695  -21.230 57.988  1.00 177.77 ? 10  GLU D O     1 
ATOM   2003  C  CB    . GLU D  4  10  ? -38.561  -23.402 56.171  1.00 147.65 ? 10  GLU D CB    1 
ATOM   2004  C  CG    . GLU D  4  10  ? -38.805  -24.280 54.949  1.00 151.16 ? 10  GLU D CG    1 
ATOM   2005  C  CD    . GLU D  4  10  ? -37.947  -25.531 54.847  1.00 148.91 ? 10  GLU D CD    1 
ATOM   2006  O  OE1   . GLU D  4  10  ? -37.312  -25.896 55.857  1.00 144.44 ? 10  GLU D OE1   1 
ATOM   2007  O  OE2   . GLU D  4  10  ? -37.892  -26.142 53.746  1.00 131.54 ? 10  GLU D OE2   1 
ATOM   2008  N  N     . MET D  4  11  ? -41.262  -23.312 57.343  1.00 177.88 ? 11  MET D N     1 
ATOM   2009  C  CA    . MET D  4  11  ? -42.074  -23.638 58.547  1.00 181.74 ? 11  MET D CA    1 
ATOM   2010  C  C     . MET D  4  11  ? -41.134  -23.739 59.763  1.00 194.54 ? 11  MET D C     1 
ATOM   2011  O  O     . MET D  4  11  ? -41.517  -23.372 60.878  1.00 210.08 ? 11  MET D O     1 
ATOM   2012  C  CB    . MET D  4  11  ? -43.005  -24.873 58.399  1.00 173.86 ? 11  MET D CB    1 
ATOM   2013  C  CG    . MET D  4  11  ? -43.888  -25.294 59.611  1.00 176.46 ? 11  MET D CG    1 
ATOM   2014  S  SD    . MET D  4  11  ? -45.187  -26.568 59.490  1.00 177.28 ? 11  MET D SD    1 
ATOM   2015  C  CE    . MET D  4  11  ? -45.770  -26.801 61.176  1.00 159.94 ? 11  MET D CE    1 
ATOM   2016  N  N     . THR D  4  12  ? -39.912  -24.232 59.541  1.00 178.71 ? 12  THR D N     1 
ATOM   2017  C  CA    . THR D  4  12  ? -38.807  -24.224 60.515  1.00 159.40 ? 12  THR D CA    1 
ATOM   2018  C  C     . THR D  4  12  ? -37.704  -23.181 60.218  1.00 180.52 ? 12  THR D C     1 
ATOM   2019  O  O     . THR D  4  12  ? -36.562  -23.591 59.965  1.00 201.41 ? 12  THR D O     1 
ATOM   2020  C  CB    . THR D  4  12  ? -38.123  -25.627 60.570  1.00 131.69 ? 12  THR D CB    1 
ATOM   2021  O  OG1   . THR D  4  12  ? -39.077  -26.688 60.776  1.00 115.32 ? 12  THR D OG1   1 
ATOM   2022  C  CG2   . THR D  4  12  ? -37.039  -25.658 61.654  1.00 121.41 ? 12  THR D CG2   1 
ATOM   2023  N  N     . PRO D  4  13  ? -38.002  -21.847 60.292  1.00 189.77 ? 13  PRO D N     1 
ATOM   2024  C  CA    . PRO D  4  13  ? -36.951  -20.852 59.927  1.00 180.56 ? 13  PRO D CA    1 
ATOM   2025  C  C     . PRO D  4  13  ? -35.766  -20.705 60.905  1.00 162.37 ? 13  PRO D C     1 
ATOM   2026  O  O     . PRO D  4  13  ? -34.735  -20.144 60.526  1.00 145.19 ? 13  PRO D O     1 
ATOM   2027  C  CB    . PRO D  4  13  ? -37.734  -19.536 59.811  1.00 177.90 ? 13  PRO D CB    1 
ATOM   2028  C  CG    . PRO D  4  13  ? -38.831  -19.685 60.815  1.00 181.21 ? 13  PRO D CG    1 
ATOM   2029  C  CD    . PRO D  4  13  ? -39.172  -21.151 60.881  1.00 187.36 ? 13  PRO D CD    1 
ATOM   2030  N  N     . GLU D  4  14  ? -35.938  -21.202 62.129  1.00 154.39 ? 14  GLU D N     1 
ATOM   2031  C  CA    . GLU D  4  14  ? -34.883  -21.429 63.121  1.00 148.28 ? 14  GLU D CA    1 
ATOM   2032  C  C     . GLU D  4  14  ? -33.752  -22.237 62.496  1.00 140.81 ? 14  GLU D C     1 
ATOM   2033  O  O     . GLU D  4  14  ? -34.012  -23.134 61.702  1.00 125.69 ? 14  GLU D O     1 
ATOM   2034  C  CB    . GLU D  4  14  ? -35.509  -22.099 64.350  1.00 139.67 ? 14  GLU D CB    1 
ATOM   2035  C  CG    . GLU D  4  14  ? -34.538  -22.444 65.494  1.00 131.83 ? 14  GLU D CG    1 
ATOM   2036  C  CD    . GLU D  4  14  ? -34.586  -23.904 65.945  1.00 129.69 ? 14  GLU D CD    1 
ATOM   2037  O  OE1   . GLU D  4  14  ? -35.308  -24.739 65.347  1.00 125.16 ? 14  GLU D OE1   1 
ATOM   2038  O  OE2   . GLU D  4  14  ? -33.886  -24.254 66.936  1.00 129.17 ? 14  GLU D OE2   1 
ATOM   2039  N  N     . GLU D  4  15  ? -32.515  -21.868 62.831  1.00 134.83 ? 15  GLU D N     1 
ATOM   2040  C  CA    . GLU D  4  15  ? -31.320  -22.466 62.206  1.00 126.92 ? 15  GLU D CA    1 
ATOM   2041  C  C     . GLU D  4  15  ? -30.746  -23.844 62.561  1.00 125.84 ? 15  GLU D C     1 
ATOM   2042  O  O     . GLU D  4  15  ? -29.629  -24.201 62.114  1.00 122.10 ? 15  GLU D O     1 
ATOM   2043  C  CB    . GLU D  4  15  ? -30.125  -21.528 62.342  1.00 129.73 ? 15  GLU D CB    1 
ATOM   2044  C  CG    . GLU D  4  15  ? -30.263  -20.147 61.681  1.00 138.24 ? 15  GLU D CG    1 
ATOM   2045  C  CD    . GLU D  4  15  ? -30.170  -20.203 60.137  1.00 141.76 ? 15  GLU D CD    1 
ATOM   2046  O  OE1   . GLU D  4  15  ? -30.110  -21.303 59.533  1.00 140.28 ? 15  GLU D OE1   1 
ATOM   2047  O  OE2   . GLU D  4  15  ? -30.098  -19.149 59.452  1.00 148.75 ? 15  GLU D OE2   1 
ATOM   2048  N  N     . LEU D  4  16  ? -31.544  -24.647 63.242  1.00 130.86 ? 16  LEU D N     1 
ATOM   2049  C  CA    . LEU D  4  16  ? -31.165  -26.012 63.508  1.00 127.92 ? 16  LEU D CA    1 
ATOM   2050  C  C     . LEU D  4  16  ? -32.407  -26.808 63.130  1.00 128.02 ? 16  LEU D C     1 
ATOM   2051  O  O     . LEU D  4  16  ? -33.307  -27.077 63.923  1.00 106.40 ? 16  LEU D O     1 
ATOM   2052  C  CB    . LEU D  4  16  ? -30.763  -26.210 64.968  1.00 127.97 ? 16  LEU D CB    1 
ATOM   2053  C  CG    . LEU D  4  16  ? -29.505  -25.469 65.417  1.00 129.89 ? 16  LEU D CG    1 
ATOM   2054  C  CD1   . LEU D  4  16  ? -29.314  -25.638 66.913  1.00 135.30 ? 16  LEU D CD1   1 
ATOM   2055  C  CD2   . LEU D  4  16  ? -28.273  -25.932 64.656  1.00 118.84 ? 16  LEU D CD2   1 
ATOM   2056  N  N     . GLN D  4  17  ? -32.486  -27.058 61.829  1.00 134.51 ? 17  GLN D N     1 
ATOM   2057  C  CA    . GLN D  4  17  ? -33.471  -27.951 61.258  1.00 128.27 ? 17  GLN D CA    1 
ATOM   2058  C  C     . GLN D  4  17  ? -32.876  -29.336 61.192  1.00 132.06 ? 17  GLN D C     1 
ATOM   2059  O  O     . GLN D  4  17  ? -32.472  -29.801 60.130  1.00 114.99 ? 17  GLN D O     1 
ATOM   2060  C  CB    . GLN D  4  17  ? -33.807  -27.549 59.830  1.00 121.89 ? 17  GLN D CB    1 
ATOM   2061  C  CG    . GLN D  4  17  ? -34.269  -26.114 59.692  1.00 129.00 ? 17  GLN D CG    1 
ATOM   2062  C  CD    . GLN D  4  17  ? -33.637  -25.417 58.510  1.00 125.00 ? 17  GLN D CD    1 
ATOM   2063  O  OE1   . GLN D  4  17  ? -32.421  -25.433 58.343  1.00 132.69 ? 17  GLN D OE1   1 
ATOM   2064  N  NE2   . GLN D  4  17  ? -34.463  -24.800 57.682  1.00 115.83 ? 17  GLN D NE2   1 
ATOM   2065  N  N     . LYS D  4  18  ? -32.819  -29.990 62.339  1.00 138.40 ? 18  LYS D N     1 
ATOM   2066  C  CA    . LYS D  4  18  ? -32.413  -31.373 62.402  1.00 134.22 ? 18  LYS D CA    1 
ATOM   2067  C  C     . LYS D  4  18  ? -33.728  -32.116 62.345  1.00 130.17 ? 18  LYS D C     1 
ATOM   2068  O  O     . LYS D  4  18  ? -33.817  -33.327 62.526  1.00 130.64 ? 18  LYS D O     1 
ATOM   2069  C  CB    . LYS D  4  18  ? -31.689  -31.675 63.706  1.00 136.21 ? 18  LYS D CB    1 
ATOM   2070  C  CG    . LYS D  4  18  ? -30.433  -30.836 63.910  1.00 140.73 ? 18  LYS D CG    1 
ATOM   2071  C  CD    . LYS D  4  18  ? -29.413  -31.027 62.795  1.00 135.31 ? 18  LYS D CD    1 
ATOM   2072  C  CE    . LYS D  4  18  ? -28.781  -32.408 62.850  1.00 127.13 ? 18  LYS D CE    1 
ATOM   2073  N  NZ    . LYS D  4  18  ? -27.663  -32.569 61.880  1.00 123.31 ? 18  LYS D NZ    1 
ATOM   2074  N  N     . ARG D  4  19  ? -34.761  -31.364 62.005  1.00 125.35 ? 19  ARG D N     1 
ATOM   2075  C  CA    . ARG D  4  19  ? -35.991  -31.977 61.558  1.00 118.61 ? 19  ARG D CA    1 
ATOM   2076  C  C     . ARG D  4  19  ? -35.463  -32.767 60.359  1.00 110.44 ? 19  ARG D C     1 
ATOM   2077  O  O     . ARG D  4  19  ? -35.987  -33.824 60.028  1.00 97.92  ? 19  ARG D O     1 
ATOM   2078  C  CB    . ARG D  4  19  ? -36.997  -30.918 61.121  1.00 123.34 ? 19  ARG D CB    1 
ATOM   2079  C  CG    . ARG D  4  19  ? -38.363  -31.467 60.747  1.00 127.45 ? 19  ARG D CG    1 
ATOM   2080  C  CD    . ARG D  4  19  ? -39.337  -30.345 60.418  1.00 134.38 ? 19  ARG D CD    1 
ATOM   2081  N  NE    . ARG D  4  19  ? -40.654  -30.845 60.032  1.00 148.35 ? 19  ARG D NE    1 
ATOM   2082  C  CZ    . ARG D  4  19  ? -41.602  -31.196 60.895  1.00 159.11 ? 19  ARG D CZ    1 
ATOM   2083  N  NH1   . ARG D  4  19  ? -41.381  -31.104 62.199  1.00 168.33 ? 19  ARG D NH1   1 
ATOM   2084  N  NH2   . ARG D  4  19  ? -42.771  -31.640 60.456  1.00 156.39 ? 19  ARG D NH2   1 
ATOM   2085  N  N     . GLU D  4  20  ? -34.343  -32.315 59.812  1.00 113.36 ? 20  GLU D N     1 
ATOM   2086  C  CA    . GLU D  4  20  ? -33.649  -33.077 58.781  1.00 109.10 ? 20  GLU D CA    1 
ATOM   2087  C  C     . GLU D  4  20  ? -33.349  -34.512 59.210  1.00 110.23 ? 20  GLU D C     1 
ATOM   2088  O  O     . GLU D  4  20  ? -33.733  -35.472 58.555  1.00 116.73 ? 20  GLU D O     1 
ATOM   2089  C  CB    . GLU D  4  20  ? -32.381  -32.345 58.348  1.00 112.94 ? 20  GLU D CB    1 
ATOM   2090  C  CG    . GLU D  4  20  ? -31.646  -33.003 57.197  1.00 116.02 ? 20  GLU D CG    1 
ATOM   2091  C  CD    . GLU D  4  20  ? -32.453  -32.994 55.917  1.00 123.78 ? 20  GLU D CD    1 
ATOM   2092  O  OE1   . GLU D  4  20  ? -33.468  -32.270 55.854  1.00 124.83 ? 20  GLU D OE1   1 
ATOM   2093  O  OE2   . GLU D  4  20  ? -32.066  -33.708 54.973  1.00 114.11 ? 20  GLU D OE2   1 
ATOM   2094  N  N     . GLU D  4  21  ? -32.689  -34.637 60.354  1.00 112.18 ? 21  GLU D N     1 
ATOM   2095  C  CA    . GLU D  4  21  ? -32.409  -35.943 60.944  1.00 116.96 ? 21  GLU D CA    1 
ATOM   2096  C  C     . GLU D  4  21  ? -33.551  -36.838 61.415  1.00 112.40 ? 21  GLU D C     1 
ATOM   2097  O  O     . GLU D  4  21  ? -33.477  -38.059 61.358  1.00 109.91 ? 21  GLU D O     1 
ATOM   2098  C  CB    . GLU D  4  21  ? -31.495  -35.682 62.138  1.00 133.30 ? 21  GLU D CB    1 
ATOM   2099  C  CG    . GLU D  4  21  ? -31.046  -36.949 62.846  1.00 153.30 ? 21  GLU D CG    1 
ATOM   2100  C  CD    . GLU D  4  21  ? -30.100  -36.671 63.999  1.00 170.63 ? 21  GLU D CD    1 
ATOM   2101  O  OE1   . GLU D  4  21  ? -29.822  -35.484 64.273  1.00 187.44 ? 21  GLU D OE1   1 
ATOM   2102  O  OE2   . GLU D  4  21  ? -29.633  -37.643 64.633  1.00 179.55 ? 21  GLU D OE2   1 
ATOM   2103  N  N     . GLU D  4  22  ? -34.605  -36.193 61.894  1.00 113.24 ? 22  GLU D N     1 
ATOM   2104  C  CA    . GLU D  4  22  ? -35.774  -36.871 62.447  1.00 111.82 ? 22  GLU D CA    1 
ATOM   2105  C  C     . GLU D  4  22  ? -36.472  -37.598 61.303  1.00 97.48  ? 22  GLU D C     1 
ATOM   2106  O  O     . GLU D  4  22  ? -36.920  -38.731 61.434  1.00 88.63  ? 22  GLU D O     1 
ATOM   2107  C  CB    . GLU D  4  22  ? -36.837  -36.036 63.167  1.00 123.10 ? 22  GLU D CB    1 
ATOM   2108  C  CG    . GLU D  4  22  ? -36.370  -35.416 64.474  1.00 140.23 ? 22  GLU D CG    1 
ATOM   2109  C  CD    . GLU D  4  22  ? -37.423  -34.537 65.123  1.00 147.76 ? 22  GLU D CD    1 
ATOM   2110  O  OE1   . GLU D  4  22  ? -38.450  -34.251 64.473  1.00 156.58 ? 22  GLU D OE1   1 
ATOM   2111  O  OE2   . GLU D  4  22  ? -37.228  -34.138 66.289  1.00 149.14 ? 22  GLU D OE2   1 
ATOM   2112  N  N     . GLU D  4  23  ? -36.560  -36.870 60.193  1.00 92.89  ? 23  GLU D N     1 
ATOM   2113  C  CA    . GLU D  4  23  ? -37.132  -37.353 58.941  1.00 92.02  ? 23  GLU D CA    1 
ATOM   2114  C  C     . GLU D  4  23  ? -36.297  -38.504 58.435  1.00 90.30  ? 23  GLU D C     1 
ATOM   2115  O  O     . GLU D  4  23  ? -36.812  -39.487 57.914  1.00 92.22  ? 23  GLU D O     1 
ATOM   2116  C  CB    . GLU D  4  23  ? -37.110  -36.245 57.883  1.00 94.63  ? 23  GLU D CB    1 
ATOM   2117  C  CG    . GLU D  4  23  ? -38.409  -35.488 57.704  1.00 104.19 ? 23  GLU D CG    1 
ATOM   2118  C  CD    . GLU D  4  23  ? -38.347  -34.530 56.531  1.00 114.94 ? 23  GLU D CD    1 
ATOM   2119  O  OE1   . GLU D  4  23  ? -37.244  -34.324 55.984  1.00 125.28 ? 23  GLU D OE1   1 
ATOM   2120  O  OE2   . GLU D  4  23  ? -39.401  -33.983 56.152  1.00 126.47 ? 23  GLU D OE2   1 
ATOM   2121  N  N     . PHE D  4  24  ? -34.990  -38.353 58.574  1.00 88.63  ? 24  PHE D N     1 
ATOM   2122  C  CA    . PHE D  4  24  ? -34.054  -39.342 58.067  1.00 84.86  ? 24  PHE D CA    1 
ATOM   2123  C  C     . PHE D  4  24  ? -34.310  -40.614 58.854  1.00 81.03  ? 24  PHE D C     1 
ATOM   2124  O  O     . PHE D  4  24  ? -34.326  -41.700 58.293  1.00 86.02  ? 24  PHE D O     1 
ATOM   2125  C  CB    . PHE D  4  24  ? -32.572  -38.971 58.106  1.00 82.70  ? 24  PHE D CB    1 
ATOM   2126  C  CG    . PHE D  4  24  ? -32.132  -38.091 56.966  1.00 81.04  ? 24  PHE D CG    1 
ATOM   2127  C  CD1   . PHE D  4  24  ? -32.989  -37.786 55.927  1.00 82.93  ? 24  PHE D CD1   1 
ATOM   2128  C  CD2   . PHE D  4  24  ? -30.857  -37.574 56.936  1.00 85.00  ? 24  PHE D CD2   1 
ATOM   2129  C  CE1   . PHE D  4  24  ? -32.584  -36.984 54.884  1.00 80.72  ? 24  PHE D CE1   1 
ATOM   2130  C  CE2   . PHE D  4  24  ? -30.444  -36.770 55.896  1.00 84.17  ? 24  PHE D CE2   1 
ATOM   2131  C  CZ    . PHE D  4  24  ? -31.309  -36.474 54.870  1.00 81.04  ? 24  PHE D CZ    1 
ATOM   2132  N  N     . ASN D  4  25  ? -34.496  -40.485 60.158  1.00 75.03  ? 25  ASN D N     1 
ATOM   2133  C  CA    . ASN D  4  25  ? -34.726  -41.656 60.978  1.00 78.19  ? 25  ASN D CA    1 
ATOM   2134  C  C     . ASN D  4  25  ? -36.090  -42.295 60.896  1.00 75.37  ? 25  ASN D C     1 
ATOM   2135  O  O     . ASN D  4  25  ? -36.189  -43.528 60.977  1.00 71.77  ? 25  ASN D O     1 
ATOM   2136  C  CB    . ASN D  4  25  ? -34.322  -41.372 62.418  1.00 82.04  ? 25  ASN D CB    1 
ATOM   2137  C  CG    . ASN D  4  25  ? -32.831  -41.607 62.626  1.00 89.89  ? 25  ASN D CG    1 
ATOM   2138  O  OD1   . ASN D  4  25  ? -32.341  -42.692 62.332  1.00 87.48  ? 25  ASN D OD1   1 
ATOM   2139  N  ND2   . ASN D  4  25  ? -32.118  -40.620 63.170  1.00 102.11 ? 25  ASN D ND2   1 
ATOM   2140  N  N     . THR D  4  26  ? -37.112  -41.478 60.697  1.00 75.65  ? 26  THR D N     1 
ATOM   2141  C  CA    . THR D  4  26  ? -38.491  -41.994 60.640  1.00 79.54  ? 26  THR D CA    1 
ATOM   2142  C  C     . THR D  4  26  ? -39.135  -41.972 59.247  1.00 78.80  ? 26  THR D C     1 
ATOM   2143  O  O     . THR D  4  26  ? -39.788  -42.930 58.837  1.00 67.34  ? 26  THR D O     1 
ATOM   2144  C  CB    . THR D  4  26  ? -39.382  -41.179 61.577  1.00 87.43  ? 26  THR D CB    1 
ATOM   2145  O  OG1   . THR D  4  26  ? -39.272  -39.792 61.236  1.00 89.78  ? 26  THR D OG1   1 
ATOM   2146  C  CG2   . THR D  4  26  ? -38.960  -41.378 63.041  1.00 91.64  ? 26  THR D CG2   1 
ATOM   2147  N  N     . GLY D  4  27  ? -38.874  -40.887 58.503  1.00 81.91  ? 27  GLY D N     1 
ATOM   2148  C  CA    . GLY D  4  27  ? -39.401  -40.637 57.155  1.00 78.12  ? 27  GLY D CA    1 
ATOM   2149  C  C     . GLY D  4  27  ? -38.970  -41.662 56.128  1.00 73.87  ? 27  GLY D C     1 
ATOM   2150  O  O     . GLY D  4  27  ? -38.481  -42.723 56.492  1.00 69.59  ? 27  GLY D O     1 
ATOM   2151  N  N     . PRO D  4  28  ? -39.157  -41.346 54.839  1.00 69.28  ? 28  PRO D N     1 
ATOM   2152  C  CA    . PRO D  4  28  ? -38.973  -42.427 53.894  1.00 66.15  ? 28  PRO D CA    1 
ATOM   2153  C  C     . PRO D  4  28  ? -37.512  -42.663 53.590  1.00 62.69  ? 28  PRO D C     1 
ATOM   2154  O  O     . PRO D  4  28  ? -37.124  -43.799 53.285  1.00 62.61  ? 28  PRO D O     1 
ATOM   2155  C  CB    . PRO D  4  28  ? -39.799  -41.989 52.680  1.00 68.56  ? 28  PRO D CB    1 
ATOM   2156  C  CG    . PRO D  4  28  ? -40.489  -40.719 53.072  1.00 70.13  ? 28  PRO D CG    1 
ATOM   2157  C  CD    . PRO D  4  28  ? -39.677  -40.141 54.179  1.00 69.43  ? 28  PRO D CD    1 
ATOM   2158  N  N     . LEU D  4  29  ? -36.675  -41.647 53.744  1.00 62.40  ? 29  LEU D N     1 
ATOM   2159  C  CA    . LEU D  4  29  ? -35.252  -41.897 53.547  1.00 64.41  ? 29  LEU D CA    1 
ATOM   2160  C  C     . LEU D  4  29  ? -34.655  -42.748 54.642  1.00 62.51  ? 29  LEU D C     1 
ATOM   2161  O  O     . LEU D  4  29  ? -33.455  -42.966 54.681  1.00 63.16  ? 29  LEU D O     1 
ATOM   2162  C  CB    . LEU D  4  29  ? -34.484  -40.601 53.370  1.00 72.49  ? 29  LEU D CB    1 
ATOM   2163  C  CG    . LEU D  4  29  ? -34.407  -40.098 51.919  1.00 82.07  ? 29  LEU D CG    1 
ATOM   2164  C  CD1   . LEU D  4  29  ? -35.769  -39.779 51.311  1.00 83.19  ? 29  LEU D CD1   1 
ATOM   2165  C  CD2   . LEU D  4  29  ? -33.560  -38.827 51.796  1.00 88.19  ? 29  LEU D CD2   1 
ATOM   2166  N  N     . SER D  4  30  ? -35.456  -43.229 55.590  1.00 65.37  ? 30  SER D N     1 
ATOM   2167  C  CA    . SER D  4  30  ? -34.998  -44.252 56.532  1.00 64.09  ? 30  SER D CA    1 
ATOM   2168  C  C     . SER D  4  30  ? -34.508  -45.496 55.821  1.00 64.61  ? 30  SER D C     1 
ATOM   2169  O  O     . SER D  4  30  ? -33.662  -46.218 56.341  1.00 64.87  ? 30  SER D O     1 
ATOM   2170  C  CB    . SER D  4  30  ? -36.108  -44.652 57.484  1.00 69.31  ? 30  SER D CB    1 
ATOM   2171  O  OG    . SER D  4  30  ? -37.160  -45.344 56.811  1.00 70.63  ? 30  SER D OG    1 
ATOM   2172  N  N     . VAL D  4  31  ? -35.014  -45.720 54.611  1.00 62.73  ? 31  VAL D N     1 
ATOM   2173  C  CA    . VAL D  4  31  ? -34.539  -46.831 53.775  1.00 60.46  ? 31  VAL D CA    1 
ATOM   2174  C  C     . VAL D  4  31  ? -33.006  -46.817 53.622  1.00 55.02  ? 31  VAL D C     1 
ATOM   2175  O  O     . VAL D  4  31  ? -32.347  -47.840 53.617  1.00 47.50  ? 31  VAL D O     1 
ATOM   2176  C  CB    . VAL D  4  31  ? -35.189  -46.844 52.369  1.00 58.95  ? 31  VAL D CB    1 
ATOM   2177  C  CG1   . VAL D  4  31  ? -34.757  -48.061 51.581  1.00 58.58  ? 31  VAL D CG1   1 
ATOM   2178  C  CG2   . VAL D  4  31  ? -36.689  -46.965 52.487  1.00 61.50  ? 31  VAL D CG2   1 
ATOM   2179  N  N     . LEU D  4  32  ? -32.486  -45.620 53.466  1.00 52.53  ? 32  LEU D N     1 
ATOM   2180  C  CA    . LEU D  4  32  ? -31.085  -45.404 53.289  1.00 53.44  ? 32  LEU D CA    1 
ATOM   2181  C  C     . LEU D  4  32  ? -30.420  -45.423 54.649  1.00 59.74  ? 32  LEU D C     1 
ATOM   2182  O  O     . LEU D  4  32  ? -29.410  -46.100 54.804  1.00 62.39  ? 32  LEU D O     1 
ATOM   2183  C  CB    . LEU D  4  32  ? -30.861  -44.078 52.551  1.00 51.43  ? 32  LEU D CB    1 
ATOM   2184  C  CG    . LEU D  4  32  ? -31.577  -43.941 51.188  1.00 51.36  ? 32  LEU D CG    1 
ATOM   2185  C  CD1   . LEU D  4  32  ? -31.312  -42.663 50.374  1.00 51.65  ? 32  LEU D CD1   1 
ATOM   2186  C  CD2   . LEU D  4  32  ? -31.551  -45.213 50.318  1.00 48.21  ? 32  LEU D CD2   1 
ATOM   2187  N  N     . THR D  4  33  ? -30.989  -44.726 55.624  1.00 64.69  ? 33  THR D N     1 
ATOM   2188  C  CA    . THR D  4  33  ? -30.332  -44.517 56.904  1.00 63.00  ? 33  THR D CA    1 
ATOM   2189  C  C     . THR D  4  33  ? -30.078  -45.864 57.520  1.00 60.56  ? 33  THR D C     1 
ATOM   2190  O  O     . THR D  4  33  ? -29.039  -46.105 58.111  1.00 71.65  ? 33  THR D O     1 
ATOM   2191  C  CB    . THR D  4  33  ? -31.211  -43.687 57.857  1.00 64.76  ? 33  THR D CB    1 
ATOM   2192  O  OG1   . THR D  4  33  ? -32.370  -43.222 57.160  1.00 66.15  ? 33  THR D OG1   1 
ATOM   2193  C  CG2   . THR D  4  33  ? -30.450  -42.504 58.383  1.00 71.59  ? 33  THR D CG2   1 
ATOM   2194  N  N     . GLN D  4  34  ? -31.050  -46.743 57.372  1.00 57.32  ? 34  GLN D N     1 
ATOM   2195  C  CA    . GLN D  4  34  ? -30.911  -48.102 57.816  1.00 61.59  ? 34  GLN D CA    1 
ATOM   2196  C  C     . GLN D  4  34  ? -29.910  -48.912 56.976  1.00 60.45  ? 34  GLN D C     1 
ATOM   2197  O  O     . GLN D  4  34  ? -29.204  -49.794 57.503  1.00 68.42  ? 34  GLN D O     1 
ATOM   2198  C  CB    . GLN D  4  34  ? -32.317  -48.737 57.896  1.00 64.71  ? 34  GLN D CB    1 
ATOM   2199  C  CG    . GLN D  4  34  ? -33.173  -48.369 59.085  1.00 68.69  ? 34  GLN D CG    1 
ATOM   2200  C  CD    . GLN D  4  34  ? -32.567  -48.928 60.370  1.00 76.37  ? 34  GLN D CD    1 
ATOM   2201  O  OE1   . GLN D  4  34  ? -32.335  -50.134 60.484  1.00 70.88  ? 34  GLN D OE1   1 
ATOM   2202  N  NE2   . GLN D  4  34  ? -32.222  -48.030 61.327  1.00 84.69  ? 34  GLN D NE2   1 
ATOM   2203  N  N     . SER D  4  35  ? -29.952  -48.737 55.661  1.00 59.45  ? 35  SER D N     1 
ATOM   2204  C  CA    . SER D  4  35  ? -29.085  -49.491 54.749  1.00 58.94  ? 35  SER D CA    1 
ATOM   2205  C  C     . SER D  4  35  ? -27.634  -49.161 55.056  1.00 60.78  ? 35  SER D C     1 
ATOM   2206  O  O     . SER D  4  35  ? -26.769  -50.027 54.999  1.00 58.45  ? 35  SER D O     1 
ATOM   2207  C  CB    . SER D  4  35  ? -29.413  -49.155 53.280  1.00 59.05  ? 35  SER D CB    1 
ATOM   2208  O  OG    . SER D  4  35  ? -30.623  -49.738 52.882  1.00 55.71  ? 35  SER D OG    1 
ATOM   2209  N  N     . VAL D  4  36  ? -27.375  -47.879 55.338  1.00 60.67  ? 36  VAL D N     1 
ATOM   2210  C  CA    . VAL D  4  36  ? -26.043  -47.427 55.658  1.00 59.10  ? 36  VAL D CA    1 
ATOM   2211  C  C     . VAL D  4  36  ? -25.593  -48.042 56.949  1.00 64.43  ? 36  VAL D C     1 
ATOM   2212  O  O     . VAL D  4  36  ? -24.494  -48.590 57.004  1.00 70.52  ? 36  VAL D O     1 
ATOM   2213  C  CB    . VAL D  4  36  ? -26.009  -45.927 55.818  1.00 58.29  ? 36  VAL D CB    1 
ATOM   2214  C  CG1   . VAL D  4  36  ? -24.688  -45.513 56.438  1.00 61.91  ? 36  VAL D CG1   1 
ATOM   2215  C  CG2   . VAL D  4  36  ? -26.144  -45.224 54.487  1.00 58.80  ? 36  VAL D CG2   1 
ATOM   2216  N  N     . LYS D  4  37  ? -26.430  -47.941 57.976  1.00 69.13  ? 37  LYS D N     1 
ATOM   2217  C  CA    . LYS D  4  37  ? -26.099  -48.479 59.287  1.00 78.64  ? 37  LYS D CA    1 
ATOM   2218  C  C     . LYS D  4  37  ? -25.834  -49.988 59.320  1.00 71.32  ? 37  LYS D C     1 
ATOM   2219  O  O     . LYS D  4  37  ? -24.804  -50.443 59.849  1.00 76.21  ? 37  LYS D O     1 
ATOM   2220  C  CB    . LYS D  4  37  ? -27.193  -48.176 60.331  1.00 93.39  ? 37  LYS D CB    1 
ATOM   2221  C  CG    . LYS D  4  37  ? -27.420  -46.695 60.705  1.00 114.79 ? 37  LYS D CG    1 
ATOM   2222  C  CD    . LYS D  4  37  ? -28.526  -46.438 61.754  1.00 126.28 ? 37  LYS D CD    1 
ATOM   2223  C  CE    . LYS D  4  37  ? -28.788  -44.975 62.093  1.00 135.39 ? 37  LYS D CE    1 
ATOM   2224  N  NZ    . LYS D  4  37  ? -27.586  -44.330 62.713  1.00 145.61 ? 37  LYS D NZ    1 
ATOM   2225  N  N     . ASN D  4  38  ? -26.703  -50.732 58.668  1.00 65.45  ? 38  ASN D N     1 
ATOM   2226  C  CA    . ASN D  4  38  ? -26.572  -52.170 58.656  1.00 70.26  ? 38  ASN D CA    1 
ATOM   2227  C  C     . ASN D  4  38  ? -25.759  -52.727 57.511  1.00 66.36  ? 38  ASN D C     1 
ATOM   2228  O  O     . ASN D  4  38  ? -25.700  -53.936 57.344  1.00 67.99  ? 38  ASN D O     1 
ATOM   2229  C  CB    . ASN D  4  38  ? -27.897  -52.924 58.770  1.00 79.37  ? 38  ASN D CB    1 
ATOM   2230  C  CG    . ASN D  4  38  ? -28.722  -52.453 59.935  1.00 84.85  ? 38  ASN D CG    1 
ATOM   2231  O  OD1   . ASN D  4  38  ? -28.262  -51.650 60.727  1.00 87.94  ? 38  ASN D OD1   1 
ATOM   2232  N  ND2   . ASN D  4  38  ? -29.966  -52.901 60.008  1.00 94.86  ? 38  ASN D ND2   1 
ATOM   2233  N  N     . ASN D  4  39  ? -25.184  -51.881 56.680  1.00 66.65  ? 39  ASN D N     1 
ATOM   2234  C  CA    . ASN D  4  39  ? -24.392  -52.321 55.532  1.00 67.59  ? 39  ASN D CA    1 
ATOM   2235  C  C     . ASN D  4  39  ? -25.115  -53.297 54.626  1.00 64.80  ? 39  ASN D C     1 
ATOM   2236  O  O     . ASN D  4  39  ? -24.535  -54.239 54.135  1.00 61.75  ? 39  ASN D O     1 
ATOM   2237  C  CB    . ASN D  4  39  ? -23.073  -52.844 55.970  1.00 69.08  ? 39  ASN D CB    1 
ATOM   2238  C  CG    . ASN D  4  39  ? -22.228  -51.755 56.546  1.00 83.93  ? 39  ASN D CG    1 
ATOM   2239  O  OD1   . ASN D  4  39  ? -22.642  -50.618 56.759  1.00 91.93  ? 39  ASN D OD1   1 
ATOM   2240  N  ND2   . ASN D  4  39  ? -20.981  -52.068 56.722  1.00 103.56 ? 39  ASN D ND2   1 
ATOM   2241  N  N     . THR D  4  40  ? -26.395  -53.027 54.391  1.00 62.85  ? 40  THR D N     1 
ATOM   2242  C  CA    . THR D  4  40  ? -27.196  -53.882 53.563  1.00 62.25  ? 40  THR D CA    1 
ATOM   2243  C  C     . THR D  4  40  ? -26.979  -53.465 52.119  1.00 57.83  ? 40  THR D C     1 
ATOM   2244  O  O     . THR D  4  40  ? -26.783  -52.293 51.779  1.00 50.58  ? 40  THR D O     1 
ATOM   2245  C  CB    . THR D  4  40  ? -28.705  -53.821 53.926  1.00 70.07  ? 40  THR D CB    1 
ATOM   2246  O  OG1   . THR D  4  40  ? -29.338  -52.637 53.407  1.00 72.42  ? 40  THR D OG1   1 
ATOM   2247  C  CG2   . THR D  4  40  ? -28.920  -53.947 55.457  1.00 69.42  ? 40  THR D CG2   1 
ATOM   2248  N  N     . GLN D  4  41  ? -27.058  -54.455 51.244  1.00 58.46  ? 41  GLN D N     1 
ATOM   2249  C  CA    . GLN D  4  41  ? -27.023  -54.224 49.812  1.00 55.71  ? 41  GLN D CA    1 
ATOM   2250  C  C     . GLN D  4  41  ? -28.298  -53.522 49.396  1.00 61.55  ? 41  GLN D C     1 
ATOM   2251  O  O     . GLN D  4  41  ? -29.344  -53.724 49.998  1.00 70.03  ? 41  GLN D O     1 
ATOM   2252  C  CB    . GLN D  4  41  ? -26.890  -55.544 49.060  1.00 53.14  ? 41  GLN D CB    1 
ATOM   2253  C  CG    . GLN D  4  41  ? -25.517  -55.787 48.483  1.00 51.66  ? 41  GLN D CG    1 
ATOM   2254  C  CD    . GLN D  4  41  ? -25.528  -56.867 47.440  1.00 54.00  ? 41  GLN D CD    1 
ATOM   2255  O  OE1   . GLN D  4  41  ? -26.552  -57.482 47.194  1.00 59.33  ? 41  GLN D OE1   1 
ATOM   2256  N  NE2   . GLN D  4  41  ? -24.388  -57.104 46.821  1.00 55.49  ? 41  GLN D NE2   1 
ATOM   2257  N  N     . VAL D  4  42  ? -28.205  -52.693 48.365  1.00 56.88  ? 42  VAL D N     1 
ATOM   2258  C  CA    . VAL D  4  42  ? -29.352  -51.971 47.854  1.00 49.24  ? 42  VAL D CA    1 
ATOM   2259  C  C     . VAL D  4  42  ? -29.401  -52.117 46.344  1.00 48.48  ? 42  VAL D C     1 
ATOM   2260  O  O     . VAL D  4  42  ? -28.371  -52.237 45.707  1.00 48.56  ? 42  VAL D O     1 
ATOM   2261  C  CB    . VAL D  4  42  ? -29.264  -50.492 48.237  1.00 48.40  ? 42  VAL D CB    1 
ATOM   2262  C  CG1   . VAL D  4  42  ? -30.322  -49.686 47.526  1.00 49.47  ? 42  VAL D CG1   1 
ATOM   2263  C  CG2   . VAL D  4  42  ? -29.424  -50.338 49.731  1.00 51.35  ? 42  VAL D CG2   1 
ATOM   2264  N  N     . LEU D  4  43  ? -30.598  -52.129 45.775  1.00 51.35  ? 43  LEU D N     1 
ATOM   2265  C  CA    . LEU D  4  43  ? -30.759  -52.188 44.331  1.00 52.37  ? 43  LEU D CA    1 
ATOM   2266  C  C     . LEU D  4  43  ? -31.461  -50.933 43.864  1.00 54.00  ? 43  LEU D C     1 
ATOM   2267  O  O     . LEU D  4  43  ? -32.550  -50.630 44.321  1.00 66.62  ? 43  LEU D O     1 
ATOM   2268  C  CB    . LEU D  4  43  ? -31.593  -53.402 43.960  1.00 51.36  ? 43  LEU D CB    1 
ATOM   2269  C  CG    . LEU D  4  43  ? -31.910  -53.646 42.493  1.00 53.31  ? 43  LEU D CG    1 
ATOM   2270  C  CD1   . LEU D  4  43  ? -30.693  -54.149 41.755  1.00 62.02  ? 43  LEU D CD1   1 
ATOM   2271  C  CD2   . LEU D  4  43  ? -33.027  -54.657 42.383  1.00 54.75  ? 43  LEU D CD2   1 
ATOM   2272  N  N     . ILE D  4  44  ? -30.846  -50.206 42.944  1.00 49.72  ? 44  ILE D N     1 
ATOM   2273  C  CA    . ILE D  4  44  ? -31.387  -48.938 42.521  1.00 46.22  ? 44  ILE D CA    1 
ATOM   2274  C  C     . ILE D  4  44  ? -31.707  -48.937 41.042  1.00 46.68  ? 44  ILE D C     1 
ATOM   2275  O  O     . ILE D  4  44  ? -30.912  -49.347 40.238  1.00 46.69  ? 44  ILE D O     1 
ATOM   2276  C  CB    . ILE D  4  44  ? -30.400  -47.845 42.714  1.00 46.85  ? 44  ILE D CB    1 
ATOM   2277  C  CG1   . ILE D  4  44  ? -29.816  -47.906 44.121  1.00 50.40  ? 44  ILE D CG1   1 
ATOM   2278  C  CG2   . ILE D  4  44  ? -31.104  -46.525 42.443  1.00 46.97  ? 44  ILE D CG2   1 
ATOM   2279  C  CD1   . ILE D  4  44  ? -28.642  -46.954 44.406  1.00 52.85  ? 44  ILE D CD1   1 
ATOM   2280  N  N     . ASN D  4  45  ? -32.910  -48.532 40.675  1.00 49.47  ? 45  ASN D N     1 
ATOM   2281  C  CA    . ASN D  4  45  ? -33.316  -48.458 39.289  1.00 48.64  ? 45  ASN D CA    1 
ATOM   2282  C  C     . ASN D  4  45  ? -33.102  -47.005 38.992  1.00 52.01  ? 45  ASN D C     1 
ATOM   2283  O  O     . ASN D  4  45  ? -33.610  -46.119 39.664  1.00 53.17  ? 45  ASN D O     1 
ATOM   2284  C  CB    . ASN D  4  45  ? -34.769  -48.782 39.092  1.00 49.35  ? 45  ASN D CB    1 
ATOM   2285  C  CG    . ASN D  4  45  ? -35.154  -48.970 37.636  1.00 53.17  ? 45  ASN D CG    1 
ATOM   2286  O  OD1   . ASN D  4  45  ? -34.319  -49.190 36.755  1.00 49.44  ? 45  ASN D OD1   1 
ATOM   2287  N  ND2   . ASN D  4  45  ? -36.474  -48.836 37.368  1.00 58.06  ? 45  ASN D ND2   1 
ATOM   2288  N  N     . CYS D  4  46  ? -32.306  -46.792 37.963  1.00 54.51  ? 46  CYS D N     1 
ATOM   2289  C  CA    . CYS D  4  46  ? -31.647  -45.557 37.700  1.00 53.80  ? 46  CYS D CA    1 
ATOM   2290  C  C     . CYS D  4  46  ? -32.233  -44.995 36.391  1.00 46.84  ? 46  CYS D C     1 
ATOM   2291  O  O     . CYS D  4  46  ? -32.638  -45.727 35.539  1.00 45.86  ? 46  CYS D O     1 
ATOM   2292  C  CB    . CYS D  4  46  ? -30.180  -45.934 37.681  1.00 55.45  ? 46  CYS D CB    1 
ATOM   2293  S  SG    . CYS D  4  46  ? -29.116  -44.511 37.741  1.00 73.27  ? 46  CYS D SG    1 
ATOM   2294  N  N     . ARG D  4  47  ? -32.297  -43.690 36.218  1.00 42.91  ? 47  ARG D N     1 
ATOM   2295  C  CA    . ARG D  4  47  ? -32.864  -43.112 35.012  1.00 41.33  ? 47  ARG D CA    1 
ATOM   2296  C  C     . ARG D  4  47  ? -32.019  -43.265 33.736  1.00 45.33  ? 47  ARG D C     1 
ATOM   2297  O  O     . ARG D  4  47  ? -32.424  -42.804 32.696  1.00 45.67  ? 47  ARG D O     1 
ATOM   2298  C  CB    . ARG D  4  47  ? -33.085  -41.626 35.230  1.00 41.88  ? 47  ARG D CB    1 
ATOM   2299  C  CG    . ARG D  4  47  ? -34.158  -41.281 36.236  1.00 42.05  ? 47  ARG D CG    1 
ATOM   2300  C  CD    . ARG D  4  47  ? -35.520  -41.363 35.598  1.00 40.25  ? 47  ARG D CD    1 
ATOM   2301  N  NE    . ARG D  4  47  ? -35.832  -40.202 34.784  1.00 39.83  ? 47  ARG D NE    1 
ATOM   2302  C  CZ    . ARG D  4  47  ? -36.291  -39.058 35.249  1.00 39.79  ? 47  ARG D CZ    1 
ATOM   2303  N  NH1   . ARG D  4  47  ? -36.465  -38.871 36.542  1.00 43.49  ? 47  ARG D NH1   1 
ATOM   2304  N  NH2   . ARG D  4  47  ? -36.613  -38.086 34.410  1.00 39.81  ? 47  ARG D NH2   1 
ATOM   2305  N  N     . ASN D  4  48  ? -30.816  -43.841 33.760  1.00 47.86  ? 48  ASN D N     1 
ATOM   2306  C  CA    . ASN D  4  48  ? -30.204  -44.296 32.505  1.00 47.36  ? 48  ASN D CA    1 
ATOM   2307  C  C     . ASN D  4  48  ? -30.753  -45.627 32.159  1.00 44.90  ? 48  ASN D C     1 
ATOM   2308  O  O     . ASN D  4  48  ? -30.215  -46.342 31.340  1.00 49.01  ? 48  ASN D O     1 
ATOM   2309  C  CB    . ASN D  4  48  ? -28.679  -44.479 32.603  1.00 50.94  ? 48  ASN D CB    1 
ATOM   2310  C  CG    . ASN D  4  48  ? -28.255  -45.177 33.861  1.00 52.77  ? 48  ASN D CG    1 
ATOM   2311  O  OD1   . ASN D  4  48  ? -29.076  -45.828 34.505  1.00 52.00  ? 48  ASN D OD1   1 
ATOM   2312  N  ND2   . ASN D  4  48  ? -26.975  -45.030 34.234  1.00 56.93  ? 48  ASN D ND2   1 
ATOM   2313  N  N     . ASN D  4  49  ? -31.710  -46.061 32.928  1.00 46.11  ? 49  ASN D N     1 
ATOM   2314  C  CA    . ASN D  4  49  ? -32.268  -47.388 32.769  1.00 49.58  ? 49  ASN D CA    1 
ATOM   2315  C  C     . ASN D  4  49  ? -31.344  -48.539 33.054  1.00 47.58  ? 49  ASN D C     1 
ATOM   2316  O  O     . ASN D  4  49  ? -31.480  -49.564 32.422  1.00 46.83  ? 49  ASN D O     1 
ATOM   2317  C  CB    . ASN D  4  49  ? -32.921  -47.586 31.401  1.00 49.58  ? 49  ASN D CB    1 
ATOM   2318  C  CG    . ASN D  4  49  ? -33.981  -48.638 31.447  1.00 49.36  ? 49  ASN D CG    1 
ATOM   2319  O  OD1   . ASN D  4  49  ? -34.421  -49.100 32.514  1.00 53.72  ? 49  ASN D OD1   1 
ATOM   2320  N  ND2   . ASN D  4  49  ? -34.462  -48.962 30.297  1.00 50.73  ? 49  ASN D ND2   1 
ATOM   2321  N  N     . LYS D  4  50  ? -30.426  -48.333 33.981  1.00 46.59  ? 50  LYS D N     1 
ATOM   2322  C  CA    . LYS D  4  50  ? -29.486  -49.339 34.387  1.00 46.09  ? 50  LYS D CA    1 
ATOM   2323  C  C     . LYS D  4  50  ? -29.682  -49.683 35.828  1.00 48.53  ? 50  LYS D C     1 
ATOM   2324  O  O     . LYS D  4  50  ? -30.094  -48.843 36.610  1.00 53.23  ? 50  LYS D O     1 
ATOM   2325  C  CB    . LYS D  4  50  ? -28.060  -48.880 34.155  1.00 46.84  ? 50  LYS D CB    1 
ATOM   2326  C  CG    . LYS D  4  50  ? -27.512  -49.237 32.792  1.00 52.68  ? 50  LYS D CG    1 
ATOM   2327  C  CD    . LYS D  4  50  ? -26.277  -48.426 32.480  1.00 60.69  ? 50  LYS D CD    1 
ATOM   2328  C  CE    . LYS D  4  50  ? -26.042  -48.323 30.991  1.00 67.18  ? 50  LYS D CE    1 
ATOM   2329  N  NZ    . LYS D  4  50  ? -24.691  -47.775 30.701  1.00 73.74  ? 50  LYS D NZ    1 
ATOM   2330  N  N     . LYS D  4  51  ? -29.419  -50.931 36.170  1.00 49.73  ? 51  LYS D N     1 
ATOM   2331  C  CA    . LYS D  4  51  ? -29.579  -51.381 37.532  1.00 51.17  ? 51  LYS D CA    1 
ATOM   2332  C  C     . LYS D  4  51  ? -28.343  -51.441 38.380  1.00 50.71  ? 51  LYS D C     1 
ATOM   2333  O  O     . LYS D  4  51  ? -27.385  -52.082 37.987  1.00 55.88  ? 51  LYS D O     1 
ATOM   2334  C  CB    . LYS D  4  51  ? -30.102  -52.819 37.450  1.00 51.85  ? 51  LYS D CB    1 
ATOM   2335  C  CG    . LYS D  4  51  ? -31.434  -53.003 36.730  1.00 51.17  ? 51  LYS D CG    1 
ATOM   2336  C  CD    . LYS D  4  51  ? -32.590  -52.390 37.493  1.00 57.11  ? 51  LYS D CD    1 
ATOM   2337  C  CE    . LYS D  4  51  ? -33.926  -52.659 36.824  1.00 63.01  ? 51  LYS D CE    1 
ATOM   2338  N  NZ    . LYS D  4  51  ? -34.095  -51.891 35.555  1.00 65.33  ? 51  LYS D NZ    1 
ATOM   2339  N  N     . LEU D  4  52  ? -28.317  -50.712 39.487  1.00 49.60  ? 52  LEU D N     1 
ATOM   2340  C  CA    . LEU D  4  52  ? -27.125  -50.653 40.310  1.00 51.75  ? 52  LEU D CA    1 
ATOM   2341  C  C     . LEU D  4  52  ? -27.382  -51.382 41.603  1.00 50.60  ? 52  LEU D C     1 
ATOM   2342  O  O     . LEU D  4  52  ? -28.265  -51.017 42.357  1.00 52.86  ? 52  LEU D O     1 
ATOM   2343  C  CB    . LEU D  4  52  ? -26.539  -49.279 40.624  1.00 51.84  ? 52  LEU D CB    1 
ATOM   2344  C  CG    . LEU D  4  52  ? -26.759  -48.168 39.609  1.00 55.61  ? 52  LEU D CG    1 
ATOM   2345  C  CD1   . LEU D  4  52  ? -26.895  -46.833 40.311  1.00 58.21  ? 52  LEU D CD1   1 
ATOM   2346  C  CD2   . LEU D  4  52  ? -25.621  -48.131 38.613  1.00 59.52  ? 52  LEU D CD2   1 
ATOM   2347  N  N     . LEU D  4  53  ? -26.592  -52.409 41.866  1.00 49.50  ? 53  LEU D N     1 
ATOM   2348  C  CA    . LEU D  4  53  ? -26.733  -53.149 43.103  1.00 51.02  ? 53  LEU D CA    1 
ATOM   2349  C  C     . LEU D  4  53  ? -25.468  -53.006 43.882  1.00 47.45  ? 53  LEU D C     1 
ATOM   2350  O  O     . LEU D  4  53  ? -24.428  -53.429 43.421  1.00 53.05  ? 53  LEU D O     1 
ATOM   2351  C  CB    . LEU D  4  53  ? -27.003  -54.602 42.761  1.00 56.49  ? 53  LEU D CB    1 
ATOM   2352  C  CG    . LEU D  4  53  ? -26.917  -55.623 43.885  1.00 58.84  ? 53  LEU D CG    1 
ATOM   2353  C  CD1   . LEU D  4  53  ? -27.516  -55.111 45.175  1.00 62.52  ? 53  LEU D CD1   1 
ATOM   2354  C  CD2   . LEU D  4  53  ? -27.660  -56.861 43.441  1.00 59.16  ? 53  LEU D CD2   1 
ATOM   2355  N  N     . GLY D  4  54  ? -25.575  -52.464 45.074  1.00 45.51  ? 54  GLY D N     1 
ATOM   2356  C  CA    . GLY D  4  54  ? -24.388  -52.219 45.875  1.00 49.21  ? 54  GLY D CA    1 
ATOM   2357  C  C     . GLY D  4  54  ? -24.626  -51.821 47.317  1.00 49.52  ? 54  GLY D C     1 
ATOM   2358  O  O     . GLY D  4  54  ? -25.759  -51.946 47.789  1.00 46.44  ? 54  GLY D O     1 
ATOM   2359  N  N     . ARG D  4  55  ? -23.577  -51.300 47.956  1.00 47.46  ? 55  ARG D N     1 
ATOM   2360  C  CA    . ARG D  4  55  ? -23.729  -50.767 49.287  1.00 51.35  ? 55  ARG D CA    1 
ATOM   2361  C  C     . ARG D  4  55  ? -23.680  -49.285 49.393  1.00 49.23  ? 55  ARG D C     1 
ATOM   2362  O  O     . ARG D  4  55  ? -22.998  -48.671 48.600  1.00 51.70  ? 55  ARG D O     1 
ATOM   2363  C  CB    . ARG D  4  55  ? -22.588  -51.279 50.122  1.00 56.98  ? 55  ARG D CB    1 
ATOM   2364  C  CG    . ARG D  4  55  ? -22.550  -52.794 50.124  1.00 61.40  ? 55  ARG D CG    1 
ATOM   2365  C  CD    . ARG D  4  55  ? -21.758  -53.355 51.301  1.00 61.18  ? 55  ARG D CD    1 
ATOM   2366  N  NE    . ARG D  4  55  ? -21.657  -54.754 50.998  1.00 62.27  ? 55  ARG D NE    1 
ATOM   2367  C  CZ    . ARG D  4  55  ? -22.640  -55.621 51.159  1.00 64.43  ? 55  ARG D CZ    1 
ATOM   2368  N  NH1   . ARG D  4  55  ? -23.780  -55.290 51.722  1.00 68.10  ? 55  ARG D NH1   1 
ATOM   2369  N  NH2   . ARG D  4  55  ? -22.452  -56.878 50.795  1.00 71.49  ? 55  ARG D NH2   1 
ATOM   2370  N  N     . VAL D  4  56  ? -24.325  -48.741 50.418  1.00 46.97  ? 56  VAL D N     1 
ATOM   2371  C  CA    . VAL D  4  56  ? -24.496  -47.315 50.552  1.00 45.42  ? 56  VAL D CA    1 
ATOM   2372  C  C     . VAL D  4  56  ? -23.626  -46.848 51.649  1.00 49.71  ? 56  VAL D C     1 
ATOM   2373  O  O     . VAL D  4  56  ? -23.843  -47.205 52.779  1.00 53.58  ? 56  VAL D O     1 
ATOM   2374  C  CB    . VAL D  4  56  ? -25.912  -46.932 50.928  1.00 43.57  ? 56  VAL D CB    1 
ATOM   2375  C  CG1   . VAL D  4  56  ? -26.130  -45.477 50.623  1.00 44.42  ? 56  VAL D CG1   1 
ATOM   2376  C  CG2   . VAL D  4  56  ? -26.916  -47.744 50.135  1.00 47.11  ? 56  VAL D CG2   1 
ATOM   2377  N  N     . LYS D  4  57  ? -22.616  -46.070 51.326  1.00 59.61  ? 57  LYS D N     1 
ATOM   2378  C  CA    . LYS D  4  57  ? -21.727  -45.510 52.340  1.00 66.37  ? 57  LYS D CA    1 
ATOM   2379  C  C     . LYS D  4  57  ? -22.243  -44.252 52.888  1.00 55.26  ? 57  LYS D C     1 
ATOM   2380  O  O     . LYS D  4  57  ? -21.991  -43.979 54.036  1.00 56.69  ? 57  LYS D O     1 
ATOM   2381  C  CB    . LYS D  4  57  ? -20.301  -45.282 51.849  1.00 77.72  ? 57  LYS D CB    1 
ATOM   2382  C  CG    . LYS D  4  57  ? -19.579  -46.613 51.632  1.00 94.05  ? 57  LYS D CG    1 
ATOM   2383  C  CD    . LYS D  4  57  ? -19.105  -47.280 52.921  1.00 107.26 ? 57  LYS D CD    1 
ATOM   2384  C  CE    . LYS D  4  57  ? -17.992  -46.441 53.574  1.00 112.68 ? 57  LYS D CE    1 
ATOM   2385  N  NZ    . LYS D  4  57  ? -17.122  -47.197 54.534  1.00 122.42 ? 57  LYS D NZ    1 
ATOM   2386  N  N     . ALA D  4  58  ? -22.959  -43.508 52.091  1.00 51.05  ? 58  ALA D N     1 
ATOM   2387  C  CA    . ALA D  4  58  ? -23.573  -42.290 52.606  1.00 56.12  ? 58  ALA D CA    1 
ATOM   2388  C  C     . ALA D  4  58  ? -24.657  -41.798 51.675  1.00 52.65  ? 58  ALA D C     1 
ATOM   2389  O  O     . ALA D  4  58  ? -24.663  -42.180 50.508  1.00 55.75  ? 58  ALA D O     1 
ATOM   2390  C  CB    . ALA D  4  58  ? -22.517  -41.188 52.816  1.00 58.80  ? 58  ALA D CB    1 
ATOM   2391  N  N     . PHE D  4  59  ? -25.499  -40.902 52.158  1.00 50.31  ? 59  PHE D N     1 
ATOM   2392  C  CA    . PHE D  4  59  ? -26.448  -40.248 51.295  1.00 50.49  ? 59  PHE D CA    1 
ATOM   2393  C  C     . PHE D  4  59  ? -26.924  -38.899 51.777  1.00 50.86  ? 59  PHE D C     1 
ATOM   2394  O  O     . PHE D  4  59  ? -26.569  -38.515 52.858  1.00 58.80  ? 59  PHE D O     1 
ATOM   2395  C  CB    . PHE D  4  59  ? -27.638  -41.146 51.203  1.00 51.18  ? 59  PHE D CB    1 
ATOM   2396  C  CG    . PHE D  4  59  ? -28.459  -41.140 52.441  1.00 50.91  ? 59  PHE D CG    1 
ATOM   2397  C  CD1   . PHE D  4  59  ? -29.485  -40.228 52.606  1.00 53.97  ? 59  PHE D CD1   1 
ATOM   2398  C  CD2   . PHE D  4  59  ? -28.245  -42.089 53.392  1.00 50.79  ? 59  PHE D CD2   1 
ATOM   2399  C  CE1   . PHE D  4  59  ? -30.270  -40.254 53.748  1.00 57.98  ? 59  PHE D CE1   1 
ATOM   2400  C  CE2   . PHE D  4  59  ? -29.043  -42.131 54.514  1.00 54.41  ? 59  PHE D CE2   1 
ATOM   2401  C  CZ    . PHE D  4  59  ? -30.035  -41.202 54.721  1.00 55.17  ? 59  PHE D CZ    1 
ATOM   2402  N  N     . ASP D  4  60  ? -27.744  -38.215 50.996  1.00 51.19  ? 60  ASP D N     1 
ATOM   2403  C  CA    . ASP D  4  60  ? -28.215  -36.889 51.361  1.00 52.11  ? 60  ASP D CA    1 
ATOM   2404  C  C     . ASP D  4  60  ? -29.628  -36.686 50.852  1.00 48.83  ? 60  ASP D C     1 
ATOM   2405  O  O     . ASP D  4  60  ? -30.250  -37.620 50.376  1.00 46.96  ? 60  ASP D O     1 
ATOM   2406  C  CB    . ASP D  4  60  ? -27.230  -35.785 50.939  1.00 55.99  ? 60  ASP D CB    1 
ATOM   2407  C  CG    . ASP D  4  60  ? -27.431  -35.298 49.533  1.00 56.29  ? 60  ASP D CG    1 
ATOM   2408  O  OD1   . ASP D  4  60  ? -28.107  -35.961 48.741  1.00 57.26  ? 60  ASP D OD1   1 
ATOM   2409  O  OD2   . ASP D  4  60  ? -26.882  -34.235 49.205  1.00 53.50  ? 60  ASP D OD2   1 
ATOM   2410  N  N     . ARG D  4  61  ? -30.139  -35.473 50.973  1.00 52.32  ? 61  ARG D N     1 
ATOM   2411  C  CA    . ARG D  4  61  ? -31.561  -35.213 50.816  1.00 56.98  ? 61  ARG D CA    1 
ATOM   2412  C  C     . ARG D  4  61  ? -32.039  -35.662 49.455  1.00 57.63  ? 61  ARG D C     1 
ATOM   2413  O  O     . ARG D  4  61  ? -33.156  -36.139 49.310  1.00 68.84  ? 61  ARG D O     1 
ATOM   2414  C  CB    . ARG D  4  61  ? -31.868  -33.723 50.944  1.00 62.57  ? 61  ARG D CB    1 
ATOM   2415  C  CG    . ARG D  4  61  ? -31.049  -32.964 51.967  1.00 76.60  ? 61  ARG D CG    1 
ATOM   2416  C  CD    . ARG D  4  61  ? -31.505  -31.521 52.054  1.00 88.90  ? 61  ARG D CD    1 
ATOM   2417  N  NE    . ARG D  4  61  ? -30.396  -30.584 51.944  1.00 101.15 ? 61  ARG D NE    1 
ATOM   2418  C  CZ    . ARG D  4  61  ? -30.139  -29.633 52.835  1.00 113.93 ? 61  ARG D CZ    1 
ATOM   2419  N  NH1   . ARG D  4  61  ? -30.909  -29.502 53.903  1.00 111.91 ? 61  ARG D NH1   1 
ATOM   2420  N  NH2   . ARG D  4  61  ? -29.112  -28.815 52.660  1.00 131.40 ? 61  ARG D NH2   1 
ATOM   2421  N  N     . HIS D  4  62  ? -31.202  -35.482 48.449  1.00 53.09  ? 62  HIS D N     1 
ATOM   2422  C  CA    . HIS D  4  62  ? -31.584  -35.745 47.079  1.00 54.98  ? 62  HIS D CA    1 
ATOM   2423  C  C     . HIS D  4  62  ? -31.384  -37.192 46.682  1.00 51.53  ? 62  HIS D C     1 
ATOM   2424  O  O     . HIS D  4  62  ? -31.639  -37.561 45.551  1.00 53.91  ? 62  HIS D O     1 
ATOM   2425  C  CB    . HIS D  4  62  ? -30.784  -34.860 46.150  1.00 54.13  ? 62  HIS D CB    1 
ATOM   2426  C  CG    . HIS D  4  62  ? -30.509  -33.500 46.702  1.00 54.34  ? 62  HIS D CG    1 
ATOM   2427  N  ND1   . HIS D  4  62  ? -31.173  -32.376 46.269  1.00 55.73  ? 62  HIS D ND1   1 
ATOM   2428  C  CD2   . HIS D  4  62  ? -29.629  -33.079 47.635  1.00 56.16  ? 62  HIS D CD2   1 
ATOM   2429  C  CE1   . HIS D  4  62  ? -30.720  -31.322 46.919  1.00 53.08  ? 62  HIS D CE1   1 
ATOM   2430  N  NE2   . HIS D  4  62  ? -29.782  -31.722 47.754  1.00 55.38  ? 62  HIS D NE2   1 
ATOM   2431  N  N     . CYS D  4  63  ? -30.907  -38.010 47.604  1.00 49.18  ? 63  CYS D N     1 
ATOM   2432  C  CA    . CYS D  4  63  ? -30.592  -39.353 47.293  1.00 48.32  ? 63  CYS D CA    1 
ATOM   2433  C  C     . CYS D  4  63  ? -29.352  -39.367 46.461  1.00 45.04  ? 63  CYS D C     1 
ATOM   2434  O  O     . CYS D  4  63  ? -29.071  -40.354 45.821  1.00 43.21  ? 63  CYS D O     1 
ATOM   2435  C  CB    . CYS D  4  63  ? -31.711  -40.147 46.627  1.00 54.77  ? 63  CYS D CB    1 
ATOM   2436  S  SG    . CYS D  4  63  ? -33.345  -40.210 47.425  1.00 64.74  ? 63  CYS D SG    1 
ATOM   2437  N  N     . ASN D  4  64  ? -28.513  -38.332 46.551  1.00 44.50  ? 64  ASN D N     1 
ATOM   2438  C  CA    . ASN D  4  64  ? -27.078  -38.516 46.273  1.00 40.56  ? 64  ASN D CA    1 
ATOM   2439  C  C     . ASN D  4  64  ? -26.593  -39.610 47.137  1.00 38.61  ? 64  ASN D C     1 
ATOM   2440  O  O     . ASN D  4  64  ? -26.883  -39.648 48.312  1.00 38.85  ? 64  ASN D O     1 
ATOM   2441  C  CB    . ASN D  4  64  ? -26.240  -37.329 46.613  1.00 39.48  ? 64  ASN D CB    1 
ATOM   2442  C  CG    . ASN D  4  64  ? -26.453  -36.200 45.645  1.00 42.29  ? 64  ASN D CG    1 
ATOM   2443  O  OD1   . ASN D  4  64  ? -26.848  -36.383 44.513  1.00 50.06  ? 64  ASN D OD1   1 
ATOM   2444  N  ND2   . ASN D  4  64  ? -26.228  -34.996 46.081  1.00 43.33  ? 64  ASN D ND2   1 
ATOM   2445  N  N     . MET D  4  65  ? -25.962  -40.578 46.534  1.00 39.90  ? 65  MET D N     1 
ATOM   2446  C  CA    . MET D  4  65  ? -25.400  -41.688 47.301  1.00 42.43  ? 65  MET D CA    1 
ATOM   2447  C  C     . MET D  4  65  ? -23.937  -41.905 46.910  1.00 42.44  ? 65  MET D C     1 
ATOM   2448  O  O     . MET D  4  65  ? -23.510  -41.492 45.830  1.00 48.07  ? 65  MET D O     1 
ATOM   2449  C  CB    . MET D  4  65  ? -26.212  -42.955 47.079  1.00 42.58  ? 65  MET D CB    1 
ATOM   2450  C  CG    . MET D  4  65  ? -27.594  -42.936 47.756  1.00 41.98  ? 65  MET D CG    1 
ATOM   2451  S  SD    . MET D  4  65  ? -28.713  -44.054 46.913  1.00 43.40  ? 65  MET D SD    1 
ATOM   2452  C  CE    . MET D  4  65  ? -27.999  -45.502 47.607  1.00 39.55  ? 65  MET D CE    1 
ATOM   2453  N  N     . VAL D  4  66  ? -23.147  -42.310 47.884  1.00 40.25  ? 66  VAL D N     1 
ATOM   2454  C  CA    . VAL D  4  66  ? -21.833  -42.803 47.626  1.00 40.08  ? 66  VAL D CA    1 
ATOM   2455  C  C     . VAL D  4  66  ? -21.994  -44.290 47.752  1.00 42.79  ? 66  VAL D C     1 
ATOM   2456  O  O     . VAL D  4  66  ? -22.498  -44.743 48.762  1.00 48.43  ? 66  VAL D O     1 
ATOM   2457  C  CB    . VAL D  4  66  ? -20.802  -42.305 48.641  1.00 37.59  ? 66  VAL D CB    1 
ATOM   2458  C  CG1   . VAL D  4  66  ? -19.604  -43.221 48.605  1.00 37.34  ? 66  VAL D CG1   1 
ATOM   2459  C  CG2   . VAL D  4  66  ? -20.329  -40.910 48.283  1.00 37.80  ? 66  VAL D CG2   1 
ATOM   2460  N  N     . LEU D  4  67  ? -21.530  -45.042 46.771  1.00 45.43  ? 67  LEU D N     1 
ATOM   2461  C  CA    . LEU D  4  67  ? -21.757  -46.460 46.750  1.00 46.42  ? 67  LEU D CA    1 
ATOM   2462  C  C     . LEU D  4  67  ? -20.464  -47.187 46.662  1.00 50.67  ? 67  LEU D C     1 
ATOM   2463  O  O     . LEU D  4  67  ? -19.477  -46.659 46.162  1.00 53.94  ? 67  LEU D O     1 
ATOM   2464  C  CB    . LEU D  4  67  ? -22.605  -46.828 45.558  1.00 48.34  ? 67  LEU D CB    1 
ATOM   2465  C  CG    . LEU D  4  67  ? -23.982  -46.157 45.491  1.00 53.33  ? 67  LEU D CG    1 
ATOM   2466  C  CD1   . LEU D  4  67  ? -24.729  -46.456 44.211  1.00 53.48  ? 67  LEU D CD1   1 
ATOM   2467  C  CD2   . LEU D  4  67  ? -24.836  -46.648 46.630  1.00 58.68  ? 67  LEU D CD2   1 
ATOM   2468  N  N     . GLU D  4  68  ? -20.462  -48.416 47.157  1.00 53.41  ? 68  GLU D N     1 
ATOM   2469  C  CA    . GLU D  4  68  ? -19.302  -49.282 47.084  1.00 53.06  ? 68  GLU D CA    1 
ATOM   2470  C  C     . GLU D  4  68  ? -19.730  -50.589 46.513  1.00 51.14  ? 68  GLU D C     1 
ATOM   2471  O  O     . GLU D  4  68  ? -20.863  -51.076 46.756  1.00 50.21  ? 68  GLU D O     1 
ATOM   2472  C  CB    . GLU D  4  68  ? -18.768  -49.537 48.477  1.00 65.30  ? 68  GLU D CB    1 
ATOM   2473  C  CG    . GLU D  4  68  ? -17.731  -48.574 49.021  1.00 75.78  ? 68  GLU D CG    1 
ATOM   2474  C  CD    . GLU D  4  68  ? -16.780  -49.282 50.000  1.00 93.04  ? 68  GLU D CD    1 
ATOM   2475  O  OE1   . GLU D  4  68  ? -16.945  -49.127 51.243  1.00 96.95  ? 68  GLU D OE1   1 
ATOM   2476  O  OE2   . GLU D  4  68  ? -15.884  -50.029 49.512  1.00 104.65 ? 68  GLU D OE2   1 
ATOM   2477  N  N     . ASN D  4  69  ? -18.797  -51.226 45.832  1.00 51.85  ? 69  ASN D N     1 
ATOM   2478  C  CA    . ASN D  4  69  ? -18.997  -52.601 45.322  1.00 58.39  ? 69  ASN D CA    1 
ATOM   2479  C  C     . ASN D  4  69  ? -20.260  -52.776 44.533  1.00 55.68  ? 69  ASN D C     1 
ATOM   2480  O  O     . ASN D  4  69  ? -21.146  -53.590 44.842  1.00 55.33  ? 69  ASN D O     1 
ATOM   2481  C  CB    . ASN D  4  69  ? -19.025  -53.619 46.447  1.00 66.59  ? 69  ASN D CB    1 
ATOM   2482  C  CG    . ASN D  4  69  ? -17.875  -53.430 47.407  1.00 74.49  ? 69  ASN D CG    1 
ATOM   2483  O  OD1   . ASN D  4  69  ? -16.709  -53.252 46.983  1.00 67.87  ? 69  ASN D OD1   1 
ATOM   2484  N  ND2   . ASN D  4  69  ? -18.212  -53.478 48.736  1.00 79.13  ? 69  ASN D ND2   1 
ATOM   2485  N  N     . VAL D  4  70  ? -20.404  -51.850 43.597  1.00 52.87  ? 70  VAL D N     1 
ATOM   2486  C  CA    . VAL D  4  70  ? -21.627  -51.755 42.839  1.00 51.64  ? 70  VAL D CA    1 
ATOM   2487  C  C     . VAL D  4  70  ? -21.480  -52.719 41.664  1.00 52.34  ? 70  VAL D C     1 
ATOM   2488  O  O     . VAL D  4  70  ? -20.389  -52.930 41.182  1.00 55.40  ? 70  VAL D O     1 
ATOM   2489  C  CB    . VAL D  4  70  ? -21.821  -50.346 42.340  1.00 52.29  ? 70  VAL D CB    1 
ATOM   2490  C  CG1   . VAL D  4  70  ? -23.144  -50.257 41.606  1.00 57.86  ? 70  VAL D CG1   1 
ATOM   2491  C  CG2   . VAL D  4  70  ? -21.825  -49.361 43.474  1.00 51.59  ? 70  VAL D CG2   1 
ATOM   2492  N  N     . LYS D  4  71  ? -22.581  -53.307 41.239  1.00 49.50  ? 71  LYS D N     1 
ATOM   2493  C  CA    . LYS D  4  71  ? -22.650  -54.001 40.002  1.00 48.91  ? 71  LYS D CA    1 
ATOM   2494  C  C     . LYS D  4  71  ? -23.747  -53.316 39.212  1.00 47.59  ? 71  LYS D C     1 
ATOM   2495  O  O     . LYS D  4  71  ? -24.914  -53.279 39.581  1.00 44.15  ? 71  LYS D O     1 
ATOM   2496  C  CB    . LYS D  4  71  ? -23.036  -55.412 40.308  1.00 53.77  ? 71  LYS D CB    1 
ATOM   2497  C  CG    . LYS D  4  71  ? -23.310  -56.282 39.091  1.00 61.84  ? 71  LYS D CG    1 
ATOM   2498  C  CD    . LYS D  4  71  ? -23.646  -57.705 39.522  1.00 67.95  ? 71  LYS D CD    1 
ATOM   2499  C  CE    . LYS D  4  71  ? -23.934  -58.622 38.341  1.00 71.53  ? 71  LYS D CE    1 
ATOM   2500  N  NZ    . LYS D  4  71  ? -23.390  -59.983 38.568  1.00 80.76  ? 71  LYS D NZ    1 
ATOM   2501  N  N     . GLU D  4  72  ? -23.350  -52.709 38.116  1.00 49.88  ? 72  GLU D N     1 
ATOM   2502  C  CA    . GLU D  4  72  ? -24.269  -51.980 37.229  1.00 49.55  ? 72  GLU D CA    1 
ATOM   2503  C  C     . GLU D  4  72  ? -24.753  -53.015 36.254  1.00 46.77  ? 72  GLU D C     1 
ATOM   2504  O  O     . GLU D  4  72  ? -23.938  -53.795 35.782  1.00 48.61  ? 72  GLU D O     1 
ATOM   2505  C  CB    . GLU D  4  72  ? -23.487  -50.903 36.482  1.00 50.71  ? 72  GLU D CB    1 
ATOM   2506  C  CG    . GLU D  4  72  ? -24.325  -50.111 35.537  1.00 51.93  ? 72  GLU D CG    1 
ATOM   2507  C  CD    . GLU D  4  72  ? -23.545  -49.054 34.816  1.00 55.45  ? 72  GLU D CD    1 
ATOM   2508  O  OE1   . GLU D  4  72  ? -22.436  -49.315 34.316  1.00 58.36  ? 72  GLU D OE1   1 
ATOM   2509  O  OE2   . GLU D  4  72  ? -24.081  -47.926 34.755  1.00 61.42  ? 72  GLU D OE2   1 
ATOM   2510  N  N     . MET D  4  73  ? -26.051  -53.080 36.021  1.00 44.00  ? 73  MET D N     1 
ATOM   2511  C  CA    . MET D  4  73  ? -26.613  -54.145 35.197  1.00 45.68  ? 73  MET D CA    1 
ATOM   2512  C  C     . MET D  4  73  ? -27.599  -53.554 34.242  1.00 44.90  ? 73  MET D C     1 
ATOM   2513  O  O     . MET D  4  73  ? -28.404  -52.749 34.668  1.00 45.67  ? 73  MET D O     1 
ATOM   2514  C  CB    . MET D  4  73  ? -27.335  -55.227 36.017  1.00 45.70  ? 73  MET D CB    1 
ATOM   2515  C  CG    . MET D  4  73  ? -26.521  -55.851 37.132  1.00 46.61  ? 73  MET D CG    1 
ATOM   2516  S  SD    . MET D  4  73  ? -27.436  -56.718 38.436  1.00 48.57  ? 73  MET D SD    1 
ATOM   2517  C  CE    . MET D  4  73  ? -27.226  -58.139 37.361  1.00 47.72  ? 73  MET D CE    1 
ATOM   2518  N  N     . TRP D  4  74  ? -27.553  -53.953 32.975  1.00 47.43  ? 74  TRP D N     1 
ATOM   2519  C  CA    . TRP D  4  74  ? -28.426  -53.397 31.945  1.00 49.62  ? 74  TRP D CA    1 
ATOM   2520  C  C     . TRP D  4  74  ? -28.603  -54.326 30.747  1.00 51.02  ? 74  TRP D C     1 
ATOM   2521  O  O     . TRP D  4  74  ? -27.962  -55.359 30.664  1.00 52.43  ? 74  TRP D O     1 
ATOM   2522  C  CB    . TRP D  4  74  ? -27.933  -52.030 31.497  1.00 52.90  ? 74  TRP D CB    1 
ATOM   2523  C  CG    . TRP D  4  74  ? -26.744  -52.048 30.621  1.00 55.57  ? 74  TRP D CG    1 
ATOM   2524  C  CD1   . TRP D  4  74  ? -26.731  -51.930 29.275  1.00 56.77  ? 74  TRP D CD1   1 
ATOM   2525  C  CD2   . TRP D  4  74  ? -25.381  -52.152 31.028  1.00 57.18  ? 74  TRP D CD2   1 
ATOM   2526  N  NE1   . TRP D  4  74  ? -25.448  -51.971 28.811  1.00 58.90  ? 74  TRP D NE1   1 
ATOM   2527  C  CE2   . TRP D  4  74  ? -24.600  -52.110 29.874  1.00 53.48  ? 74  TRP D CE2   1 
ATOM   2528  C  CE3   . TRP D  4  74  ? -24.749  -52.292 32.259  1.00 65.75  ? 74  TRP D CE3   1 
ATOM   2529  C  CZ2   . TRP D  4  74  ? -23.222  -52.199 29.911  1.00 54.95  ? 74  TRP D CZ2   1 
ATOM   2530  C  CZ3   . TRP D  4  74  ? -23.390  -52.378 32.292  1.00 69.33  ? 74  TRP D CZ3   1 
ATOM   2531  C  CH2   . TRP D  4  74  ? -22.638  -52.330 31.130  1.00 62.78  ? 74  TRP D CH2   1 
ATOM   2532  N  N     . THR D  4  75  ? -29.517  -53.967 29.852  1.00 57.10  ? 75  THR D N     1 
ATOM   2533  C  CA    . THR D  4  75  ? -29.913  -54.812 28.726  1.00 63.34  ? 75  THR D CA    1 
ATOM   2534  C  C     . THR D  4  75  ? -29.711  -54.136 27.352  1.00 68.40  ? 75  THR D C     1 
ATOM   2535  O  O     . THR D  4  75  ? -30.085  -52.984 27.171  1.00 70.98  ? 75  THR D O     1 
ATOM   2536  C  CB    . THR D  4  75  ? -31.386  -55.226 28.903  1.00 64.41  ? 75  THR D CB    1 
ATOM   2537  O  OG1   . THR D  4  75  ? -31.663  -56.397 28.136  1.00 64.45  ? 75  THR D OG1   1 
ATOM   2538  C  CG2   . THR D  4  75  ? -32.328  -54.109 28.485  1.00 67.23  ? 75  THR D CG2   1 
ATOM   2539  N  N     . GLU D  4  76  ? -29.114  -54.870 26.418  1.00 75.57  ? 76  GLU D N     1 
ATOM   2540  C  CA    . GLU D  4  76  ? -28.875  -54.381 25.066  1.00 83.91  ? 76  GLU D CA    1 
ATOM   2541  C  C     . GLU D  4  76  ? -29.367  -55.394 24.044  1.00 91.73  ? 76  GLU D C     1 
ATOM   2542  O  O     . GLU D  4  76  ? -29.870  -56.451 24.409  1.00 95.17  ? 76  GLU D O     1 
ATOM   2543  C  CB    . GLU D  4  76  ? -27.387  -54.139 24.840  1.00 84.90  ? 76  GLU D CB    1 
ATOM   2544  C  CG    . GLU D  4  76  ? -26.783  -53.080 25.740  1.00 93.22  ? 76  GLU D CG    1 
ATOM   2545  C  CD    . GLU D  4  76  ? -25.524  -52.476 25.159  1.00 104.62 ? 76  GLU D CD    1 
ATOM   2546  O  OE1   . GLU D  4  76  ? -25.179  -52.815 24.012  1.00 123.12 ? 76  GLU D OE1   1 
ATOM   2547  O  OE2   . GLU D  4  76  ? -24.878  -51.664 25.847  1.00 107.05 ? 76  GLU D OE2   1 
ATOM   2548  N  N     . VAL D  4  77  ? -29.207  -55.073 22.764  1.00 103.69 ? 77  VAL D N     1 
ATOM   2549  C  CA    . VAL D  4  77  ? -29.597  -55.986 21.693  1.00 108.70 ? 77  VAL D CA    1 
ATOM   2550  C  C     . VAL D  4  77  ? -28.382  -56.626 21.031  1.00 106.84 ? 77  VAL D C     1 
ATOM   2551  O  O     . VAL D  4  77  ? -28.446  -57.762 20.560  1.00 99.32  ? 77  VAL D O     1 
ATOM   2552  C  CB    . VAL D  4  77  ? -30.410  -55.272 20.605  1.00 102.46 ? 77  VAL D CB    1 
ATOM   2553  C  CG1   . VAL D  4  77  ? -31.851  -55.106 21.048  1.00 91.09  ? 77  VAL D CG1   1 
ATOM   2554  C  CG2   . VAL D  4  77  ? -29.779  -53.935 20.266  1.00 101.84 ? 77  VAL D CG2   1 
ATOM   2555  N  N     . SER D  4  87  ? -31.346  -57.818 17.464  1.00 150.22 ? 87  SER D N     1 
ATOM   2556  C  CA    . SER D  4  87  ? -31.571  -59.225 17.767  1.00 153.78 ? 87  SER D CA    1 
ATOM   2557  C  C     . SER D  4  87  ? -32.232  -59.390 19.130  1.00 158.86 ? 87  SER D C     1 
ATOM   2558  O  O     . SER D  4  87  ? -32.930  -58.497 19.604  1.00 166.11 ? 87  SER D O     1 
ATOM   2559  C  CB    . SER D  4  87  ? -30.250  -59.992 17.740  1.00 149.93 ? 87  SER D CB    1 
ATOM   2560  O  OG    . SER D  4  87  ? -30.396  -61.268 18.334  1.00 146.05 ? 87  SER D OG    1 
ATOM   2561  N  N     . LYS D  4  88  ? -32.010  -60.541 19.753  1.00 157.69 ? 88  LYS D N     1 
ATOM   2562  C  CA    . LYS D  4  88  ? -32.568  -60.825 21.068  1.00 152.13 ? 88  LYS D CA    1 
ATOM   2563  C  C     . LYS D  4  88  ? -31.893  -59.984 22.144  1.00 152.50 ? 88  LYS D C     1 
ATOM   2564  O  O     . LYS D  4  88  ? -30.736  -59.581 21.991  1.00 146.90 ? 88  LYS D O     1 
ATOM   2565  C  CB    . LYS D  4  88  ? -32.436  -62.311 21.392  1.00 154.14 ? 88  LYS D CB    1 
ATOM   2566  C  CG    . LYS D  4  88  ? -33.442  -63.183 20.659  1.00 158.77 ? 88  LYS D CG    1 
ATOM   2567  C  CD    . LYS D  4  88  ? -34.850  -62.616 20.775  1.00 158.89 ? 88  LYS D CD    1 
ATOM   2568  C  CE    . LYS D  4  88  ? -35.803  -63.253 19.776  1.00 162.11 ? 88  LYS D CE    1 
ATOM   2569  N  NZ    . LYS D  4  88  ? -35.756  -62.583 18.448  1.00 165.39 ? 88  LYS D NZ    1 
ATOM   2570  N  N     . PRO D  4  89  ? -32.684  -59.707 23.272  1.00 140.43 ? 89  PRO D N     1 
ATOM   2571  C  CA    . PRO D  4  89  ? -32.010  -58.832 24.249  1.00 124.96 ? 89  PRO D CA    1 
ATOM   2572  C  C     . PRO D  4  89  ? -30.945  -59.532 25.089  1.00 106.84 ? 89  PRO D C     1 
ATOM   2573  O  O     . PRO D  4  89  ? -31.208  -60.537 25.742  1.00 106.15 ? 89  PRO D O     1 
ATOM   2574  C  CB    . PRO D  4  89  ? -33.149  -58.337 25.134  1.00 124.41 ? 89  PRO D CB    1 
ATOM   2575  C  CG    . PRO D  4  89  ? -34.039  -59.498 25.244  1.00 131.06 ? 89  PRO D CG    1 
ATOM   2576  C  CD    . PRO D  4  89  ? -34.084  -60.032 23.849  1.00 135.59 ? 89  PRO D CD    1 
ATOM   2577  N  N     . VAL D  4  90  ? -29.747  -58.962 25.059  1.00 93.01  ? 90  VAL D N     1 
ATOM   2578  C  CA    . VAL D  4  90  ? -28.574  -59.440 25.830  1.00 88.91  ? 90  VAL D CA    1 
ATOM   2579  C  C     . VAL D  4  90  ? -28.364  -58.703 27.181  1.00 83.81  ? 90  VAL D C     1 
ATOM   2580  O  O     . VAL D  4  90  ? -28.531  -57.486 27.258  1.00 76.29  ? 90  VAL D O     1 
ATOM   2581  C  CB    . VAL D  4  90  ? -27.272  -59.400 24.984  1.00 84.81  ? 90  VAL D CB    1 
ATOM   2582  C  CG1   . VAL D  4  90  ? -27.011  -58.029 24.357  1.00 87.57  ? 90  VAL D CG1   1 
ATOM   2583  C  CG2   . VAL D  4  90  ? -26.032  -59.916 25.712  1.00 81.72  ? 90  VAL D CG2   1 
ATOM   2584  N  N     . ASN D  4  91  ? -28.013  -59.452 28.228  1.00 76.62  ? 91  ASN D N     1 
ATOM   2585  C  CA    . ASN D  4  91  ? -27.685  -58.874 29.519  1.00 73.97  ? 91  ASN D CA    1 
ATOM   2586  C  C     . ASN D  4  91  ? -26.279  -58.417 29.587  1.00 70.03  ? 91  ASN D C     1 
ATOM   2587  O  O     . ASN D  4  91  ? -25.441  -58.961 28.942  1.00 68.11  ? 91  ASN D O     1 
ATOM   2588  C  CB    . ASN D  4  91  ? -27.785  -59.851 30.670  1.00 77.87  ? 91  ASN D CB    1 
ATOM   2589  C  CG    . ASN D  4  91  ? -29.163  -60.399 30.829  1.00 83.52  ? 91  ASN D CG    1 
ATOM   2590  O  OD1   . ASN D  4  91  ? -30.175  -59.778 30.470  1.00 75.38  ? 91  ASN D OD1   1 
ATOM   2591  N  ND2   . ASN D  4  91  ? -29.203  -61.630 31.328  1.00 93.18  ? 91  ASN D ND2   1 
ATOM   2592  N  N     . LYS D  4  92  ? -26.039  -57.403 30.405  1.00 74.92  ? 92  LYS D N     1 
ATOM   2593  C  CA    . LYS D  4  92  ? -24.730  -56.798 30.557  1.00 72.71  ? 92  LYS D CA    1 
ATOM   2594  C  C     . LYS D  4  92  ? -24.571  -56.373 31.976  1.00 68.88  ? 92  LYS D C     1 
ATOM   2595  O  O     . LYS D  4  92  ? -25.551  -56.108 32.679  1.00 78.52  ? 92  LYS D O     1 
ATOM   2596  C  CB    . LYS D  4  92  ? -24.557  -55.609 29.612  1.00 77.61  ? 92  LYS D CB    1 
ATOM   2597  C  CG    . LYS D  4  92  ? -24.407  -56.063 28.162  1.00 86.19  ? 92  LYS D CG    1 
ATOM   2598  C  CD    . LYS D  4  92  ? -23.424  -55.210 27.403  1.00 95.26  ? 92  LYS D CD    1 
ATOM   2599  C  CE    . LYS D  4  92  ? -23.388  -55.650 25.947  1.00 106.63 ? 92  LYS D CE    1 
ATOM   2600  N  NZ    . LYS D  4  92  ? -22.494  -54.703 25.208  1.00 115.67 ? 92  LYS D NZ    1 
ATOM   2601  N  N     . ASP D  4  93  ? -23.343  -56.451 32.461  1.00 63.49  ? 93  ASP D N     1 
ATOM   2602  C  CA    . ASP D  4  93  ? -23.031  -55.998 33.798  1.00 60.88  ? 93  ASP D CA    1 
ATOM   2603  C  C     . ASP D  4  93  ? -21.604  -55.507 33.851  1.00 58.38  ? 93  ASP D C     1 
ATOM   2604  O  O     . ASP D  4  93  ? -20.743  -55.986 33.123  1.00 54.42  ? 93  ASP D O     1 
ATOM   2605  C  CB    . ASP D  4  93  ? -23.255  -57.108 34.827  1.00 68.19  ? 93  ASP D CB    1 
ATOM   2606  C  CG    . ASP D  4  93  ? -22.569  -58.404 34.461  1.00 79.38  ? 93  ASP D CG    1 
ATOM   2607  O  OD1   . ASP D  4  93  ? -21.422  -58.619 34.897  1.00 93.39  ? 93  ASP D OD1   1 
ATOM   2608  O  OD2   . ASP D  4  93  ? -23.184  -59.226 33.757  1.00 89.42  ? 93  ASP D OD2   1 
ATOM   2609  N  N     . ARG D  4  94  ? -21.359  -54.550 34.729  1.00 59.79  ? 94  ARG D N     1 
ATOM   2610  C  CA    . ARG D  4  94  ? -20.019  -54.066 34.964  1.00 59.44  ? 94  ARG D CA    1 
ATOM   2611  C  C     . ARG D  4  94  ? -19.891  -53.837 36.454  1.00 61.58  ? 94  ARG D C     1 
ATOM   2612  O  O     . ARG D  4  94  ? -20.876  -53.579 37.127  1.00 55.77  ? 94  ARG D O     1 
ATOM   2613  C  CB    . ARG D  4  94  ? -19.735  -52.810 34.122  1.00 56.25  ? 94  ARG D CB    1 
ATOM   2614  C  CG    . ARG D  4  94  ? -19.563  -51.495 34.863  1.00 56.93  ? 94  ARG D CG    1 
ATOM   2615  C  CD    . ARG D  4  94  ? -20.116  -50.336 34.062  1.00 58.32  ? 94  ARG D CD    1 
ATOM   2616  N  NE    . ARG D  4  94  ? -19.079  -49.400 33.662  1.00 59.88  ? 94  ARG D NE    1 
ATOM   2617  C  CZ    . ARG D  4  94  ? -19.260  -48.090 33.572  1.00 65.42  ? 94  ARG D CZ    1 
ATOM   2618  N  NH1   . ARG D  4  94  ? -20.436  -47.567 33.857  1.00 71.91  ? 94  ARG D NH1   1 
ATOM   2619  N  NH2   . ARG D  4  94  ? -18.272  -47.300 33.197  1.00 69.94  ? 94  ARG D NH2   1 
ATOM   2620  N  N     . TYR D  4  95  ? -18.673  -53.929 36.961  1.00 66.28  ? 95  TYR D N     1 
ATOM   2621  C  CA    . TYR D  4  95  ? -18.431  -53.753 38.377  1.00 75.46  ? 95  TYR D CA    1 
ATOM   2622  C  C     . TYR D  4  95  ? -17.674  -52.466 38.606  1.00 67.13  ? 95  TYR D C     1 
ATOM   2623  O  O     . TYR D  4  95  ? -16.729  -52.152 37.896  1.00 56.16  ? 95  TYR D O     1 
ATOM   2624  C  CB    . TYR D  4  95  ? -17.654  -54.929 38.941  1.00 87.58  ? 95  TYR D CB    1 
ATOM   2625  C  CG    . TYR D  4  95  ? -18.482  -56.179 39.092  1.00 103.79 ? 95  TYR D CG    1 
ATOM   2626  C  CD1   . TYR D  4  95  ? -18.938  -56.866 37.982  1.00 106.52 ? 95  TYR D CD1   1 
ATOM   2627  C  CD2   . TYR D  4  95  ? -18.807  -56.670 40.345  1.00 115.81 ? 95  TYR D CD2   1 
ATOM   2628  C  CE1   . TYR D  4  95  ? -19.692  -58.012 38.115  1.00 107.15 ? 95  TYR D CE1   1 
ATOM   2629  C  CE2   . TYR D  4  95  ? -19.563  -57.814 40.486  1.00 113.55 ? 95  TYR D CE2   1 
ATOM   2630  C  CZ    . TYR D  4  95  ? -20.002  -58.479 39.366  1.00 109.78 ? 95  TYR D CZ    1 
ATOM   2631  O  OH    . TYR D  4  95  ? -20.753  -59.618 39.500  1.00 128.57 ? 95  TYR D OH    1 
ATOM   2632  N  N     . ILE D  4  96  ? -18.125  -51.715 39.597  1.00 65.72  ? 96  ILE D N     1 
ATOM   2633  C  CA    . ILE D  4  96  ? -17.630  -50.398 39.856  1.00 61.24  ? 96  ILE D CA    1 
ATOM   2634  C  C     . ILE D  4  96  ? -17.411  -50.450 41.364  1.00 63.12  ? 96  ILE D C     1 
ATOM   2635  O  O     . ILE D  4  96  ? -18.375  -50.751 42.085  1.00 63.39  ? 96  ILE D O     1 
ATOM   2636  C  CB    . ILE D  4  96  ? -18.726  -49.369 39.549  1.00 59.94  ? 96  ILE D CB    1 
ATOM   2637  C  CG1   . ILE D  4  96  ? -19.149  -49.483 38.106  1.00 60.87  ? 96  ILE D CG1   1 
ATOM   2638  C  CG2   . ILE D  4  96  ? -18.243  -47.963 39.906  1.00 62.46  ? 96  ILE D CG2   1 
ATOM   2639  C  CD1   . ILE D  4  96  ? -19.884  -48.298 37.492  1.00 65.64  ? 96  ILE D CD1   1 
ATOM   2640  N  N     . SER D  4  97  ? -16.221  -50.123 41.862  1.00 61.26  ? 97  SER D N     1 
ATOM   2641  C  CA    . SER D  4  97  ? -15.987  -50.342 43.290  1.00 58.12  ? 97  SER D CA    1 
ATOM   2642  C  C     . SER D  4  97  ? -16.267  -49.132 44.111  1.00 54.27  ? 97  SER D C     1 
ATOM   2643  O  O     . SER D  4  97  ? -16.718  -49.302 45.269  1.00 62.41  ? 97  SER D O     1 
ATOM   2644  C  CB    . SER D  4  97  ? -14.621  -50.899 43.615  1.00 58.84  ? 97  SER D CB    1 
ATOM   2645  O  OG    . SER D  4  97  ? -13.669  -49.950 43.252  1.00 67.67  ? 97  SER D OG    1 
ATOM   2646  N  N     . LYS D  4  98  ? -16.120  -47.936 43.556  1.00 49.96  ? 98  LYS D N     1 
ATOM   2647  C  CA    . LYS D  4  98  ? -16.611  -46.760 44.310  1.00 51.98  ? 98  LYS D CA    1 
ATOM   2648  C  C     . LYS D  4  98  ? -17.224  -45.701 43.454  1.00 50.11  ? 98  LYS D C     1 
ATOM   2649  O  O     . LYS D  4  98  ? -16.557  -45.174 42.571  1.00 53.47  ? 98  LYS D O     1 
ATOM   2650  C  CB    . LYS D  4  98  ? -15.496  -46.085 45.114  1.00 55.10  ? 98  LYS D CB    1 
ATOM   2651  C  CG    . LYS D  4  98  ? -14.845  -47.027 46.116  1.00 58.38  ? 98  LYS D CG    1 
ATOM   2652  C  CD    . LYS D  4  98  ? -13.850  -46.321 47.002  1.00 62.37  ? 98  LYS D CD    1 
ATOM   2653  C  CE    . LYS D  4  98  ? -13.302  -47.341 47.976  1.00 67.11  ? 98  LYS D CE    1 
ATOM   2654  N  NZ    . LYS D  4  98  ? -12.016  -46.786 48.481  1.00 74.13  ? 98  LYS D NZ    1 
ATOM   2655  N  N     . MET D  4  99  ? -18.467  -45.358 43.719  1.00 48.35  ? 99  MET D N     1 
ATOM   2656  C  CA    . MET D  4  99  ? -19.054  -44.284 42.942  1.00 48.80  ? 99  MET D CA    1 
ATOM   2657  C  C     . MET D  4  99  ? -19.722  -43.241 43.791  1.00 44.03  ? 99  MET D C     1 
ATOM   2658  O  O     . MET D  4  99  ? -20.004  -43.478 44.933  1.00 42.84  ? 99  MET D O     1 
ATOM   2659  C  CB    . MET D  4  99  ? -20.004  -44.832 41.834  1.00 49.65  ? 99  MET D CB    1 
ATOM   2660  C  CG    . MET D  4  99  ? -21.259  -45.592 42.205  1.00 46.45  ? 99  MET D CG    1 
ATOM   2661  S  SD    . MET D  4  99  ? -22.293  -45.887 40.719  1.00 42.24  ? 99  MET D SD    1 
ATOM   2662  C  CE    . MET D  4  99  ? -21.484  -47.367 40.432  1.00 43.83  ? 99  MET D CE    1 
ATOM   2663  N  N     . PHE D  4  100 ? -20.004  -42.129 43.158  1.00 41.76  ? 100 PHE D N     1 
ATOM   2664  C  CA    . PHE D  4  100 ? -20.945  -41.179 43.675  1.00 45.85  ? 100 PHE D CA    1 
ATOM   2665  C  C     . PHE D  4  100 ? -22.063  -41.106 42.648  1.00 47.21  ? 100 PHE D C     1 
ATOM   2666  O  O     . PHE D  4  100 ? -21.801  -40.687 41.526  1.00 49.04  ? 100 PHE D O     1 
ATOM   2667  C  CB    . PHE D  4  100 ? -20.287  -39.822 43.746  1.00 47.05  ? 100 PHE D CB    1 
ATOM   2668  C  CG    . PHE D  4  100 ? -21.165  -38.762 44.273  1.00 47.28  ? 100 PHE D CG    1 
ATOM   2669  C  CD1   . PHE D  4  100 ? -22.101  -38.199 43.442  1.00 53.31  ? 100 PHE D CD1   1 
ATOM   2670  C  CD2   . PHE D  4  100 ? -21.024  -38.296 45.549  1.00 46.18  ? 100 PHE D CD2   1 
ATOM   2671  C  CE1   . PHE D  4  100 ? -22.958  -37.205 43.895  1.00 56.90  ? 100 PHE D CE1   1 
ATOM   2672  C  CE2   . PHE D  4  100 ? -21.789  -37.262 45.999  1.00 49.13  ? 100 PHE D CE2   1 
ATOM   2673  C  CZ    . PHE D  4  100 ? -22.785  -36.734 45.191  1.00 55.55  ? 100 PHE D CZ    1 
ATOM   2674  N  N     . LEU D  4  101 ? -23.297  -41.394 43.038  1.00 45.20  ? 101 LEU D N     1 
ATOM   2675  C  CA    . LEU D  4  101 ? -24.440  -41.262 42.165  1.00 42.56  ? 101 LEU D CA    1 
ATOM   2676  C  C     . LEU D  4  101 ? -25.198  -40.009 42.486  1.00 39.47  ? 101 LEU D C     1 
ATOM   2677  O  O     . LEU D  4  101 ? -25.516  -39.756 43.619  1.00 38.31  ? 101 LEU D O     1 
ATOM   2678  C  CB    . LEU D  4  101 ? -25.373  -42.431 42.351  1.00 45.68  ? 101 LEU D CB    1 
ATOM   2679  C  CG    . LEU D  4  101 ? -26.749  -42.321 41.688  1.00 49.30  ? 101 LEU D CG    1 
ATOM   2680  C  CD1   . LEU D  4  101 ? -26.616  -42.018 40.211  1.00 48.33  ? 101 LEU D CD1   1 
ATOM   2681  C  CD2   . LEU D  4  101 ? -27.506  -43.648 41.898  1.00 53.50  ? 101 LEU D CD2   1 
ATOM   2682  N  N     . ARG D  4  102 ? -25.506  -39.238 41.460  1.00 39.46  ? 102 ARG D N     1 
ATOM   2683  C  CA    . ARG D  4  102 ? -26.362  -38.064 41.594  1.00 38.72  ? 102 ARG D CA    1 
ATOM   2684  C  C     . ARG D  4  102 ? -27.824  -38.448 41.793  1.00 36.82  ? 102 ARG D C     1 
ATOM   2685  O  O     . ARG D  4  102 ? -28.398  -39.155 40.994  1.00 36.96  ? 102 ARG D O     1 
ATOM   2686  C  CB    . ARG D  4  102 ? -26.268  -37.153 40.381  1.00 39.52  ? 102 ARG D CB    1 
ATOM   2687  C  CG    . ARG D  4  102 ? -26.746  -35.732 40.713  1.00 40.93  ? 102 ARG D CG    1 
ATOM   2688  C  CD    . ARG D  4  102 ? -26.562  -34.797 39.534  1.00 43.16  ? 102 ARG D CD    1 
ATOM   2689  N  NE    . ARG D  4  102 ? -27.550  -33.775 39.418  1.00 41.89  ? 102 ARG D NE    1 
ATOM   2690  C  CZ    . ARG D  4  102 ? -27.425  -32.619 39.975  1.00 45.71  ? 102 ARG D CZ    1 
ATOM   2691  N  NH1   . ARG D  4  102 ? -28.416  -31.778 39.761  1.00 53.69  ? 102 ARG D NH1   1 
ATOM   2692  N  NH2   . ARG D  4  102 ? -26.402  -32.301 40.751  1.00 47.24  ? 102 ARG D NH2   1 
ATOM   2693  N  N     . GLY D  4  103 ? -28.409  -37.902 42.844  1.00 37.04  ? 103 GLY D N     1 
ATOM   2694  C  CA    . GLY D  4  103 ? -29.731  -38.259 43.333  1.00 39.55  ? 103 GLY D CA    1 
ATOM   2695  C  C     . GLY D  4  103 ? -30.912  -38.143 42.361  1.00 40.04  ? 103 GLY D C     1 
ATOM   2696  O  O     . GLY D  4  103 ? -31.784  -39.008 42.335  1.00 36.47  ? 103 GLY D O     1 
ATOM   2697  N  N     . ASP D  4  104 ? -30.892  -37.110 41.534  1.00 40.78  ? 104 ASP D N     1 
ATOM   2698  C  CA    . ASP D  4  104 ? -31.941  -36.912 40.564  1.00 43.54  ? 104 ASP D CA    1 
ATOM   2699  C  C     . ASP D  4  104 ? -32.191  -38.118 39.699  1.00 42.99  ? 104 ASP D C     1 
ATOM   2700  O  O     . ASP D  4  104 ? -33.311  -38.395 39.290  1.00 40.91  ? 104 ASP D O     1 
ATOM   2701  C  CB    . ASP D  4  104 ? -31.717  -35.636 39.746  1.00 48.63  ? 104 ASP D CB    1 
ATOM   2702  C  CG    . ASP D  4  104 ? -30.398  -35.555 39.040  1.00 55.45  ? 104 ASP D CG    1 
ATOM   2703  O  OD1   . ASP D  4  104 ? -29.613  -36.547 39.144  1.00 66.15  ? 104 ASP D OD1   1 
ATOM   2704  O  OD2   . ASP D  4  104 ? -30.142  -34.495 38.391  1.00 54.84  ? 104 ASP D OD2   1 
ATOM   2705  N  N     . SER D  4  105 ? -31.127  -38.880 39.480  1.00 45.13  ? 105 SER D N     1 
ATOM   2706  C  CA    . SER D  4  105 ? -31.169  -40.051 38.602  1.00 47.87  ? 105 SER D CA    1 
ATOM   2707  C  C     . SER D  4  105 ? -31.645  -41.301 39.272  1.00 45.69  ? 105 SER D C     1 
ATOM   2708  O  O     . SER D  4  105 ? -31.791  -42.290 38.591  1.00 46.64  ? 105 SER D O     1 
ATOM   2709  C  CB    . SER D  4  105 ? -29.798  -40.322 38.004  1.00 49.56  ? 105 SER D CB    1 
ATOM   2710  O  OG    . SER D  4  105 ? -29.242  -39.152 37.360  1.00 51.14  ? 105 SER D OG    1 
ATOM   2711  N  N     . VAL D  4  106 ? -32.063  -41.209 40.522  1.00 45.09  ? 106 VAL D N     1 
ATOM   2712  C  CA    . VAL D  4  106 ? -32.792  -42.304 41.134  1.00 45.21  ? 106 VAL D CA    1 
ATOM   2713  C  C     . VAL D  4  106 ? -34.272  -42.322 40.824  1.00 43.12  ? 106 VAL D C     1 
ATOM   2714  O  O     . VAL D  4  106 ? -34.937  -41.305 40.930  1.00 46.54  ? 106 VAL D O     1 
ATOM   2715  C  CB    . VAL D  4  106 ? -32.678  -42.241 42.662  1.00 47.34  ? 106 VAL D CB    1 
ATOM   2716  C  CG1   . VAL D  4  106 ? -33.493  -43.376 43.288  1.00 47.39  ? 106 VAL D CG1   1 
ATOM   2717  C  CG2   . VAL D  4  106 ? -31.208  -42.345 43.096  1.00 47.25  ? 106 VAL D CG2   1 
ATOM   2718  N  N     . ILE D  4  107 ? -34.778  -43.494 40.502  1.00 43.70  ? 107 ILE D N     1 
ATOM   2719  C  CA    . ILE D  4  107 ? -36.218  -43.753 40.417  1.00 44.12  ? 107 ILE D CA    1 
ATOM   2720  C  C     . ILE D  4  107 ? -36.715  -44.420 41.678  1.00 44.04  ? 107 ILE D C     1 
ATOM   2721  O  O     . ILE D  4  107 ? -37.603  -43.901 42.358  1.00 41.53  ? 107 ILE D O     1 
ATOM   2722  C  CB    . ILE D  4  107 ? -36.536  -44.724 39.292  1.00 45.16  ? 107 ILE D CB    1 
ATOM   2723  C  CG1   . ILE D  4  107 ? -36.085  -44.152 37.945  1.00 46.70  ? 107 ILE D CG1   1 
ATOM   2724  C  CG2   . ILE D  4  107 ? -38.027  -45.000 39.277  1.00 45.54  ? 107 ILE D CG2   1 
ATOM   2725  C  CD1   . ILE D  4  107 ? -36.097  -45.129 36.795  1.00 44.99  ? 107 ILE D CD1   1 
ATOM   2726  N  N     . VAL D  4  108 ? -36.072  -45.544 41.997  1.00 43.91  ? 108 VAL D N     1 
ATOM   2727  C  CA    . VAL D  4  108 ? -36.491  -46.441 43.052  1.00 44.82  ? 108 VAL D CA    1 
ATOM   2728  C  C     . VAL D  4  108 ? -35.323  -47.144 43.723  1.00 44.81  ? 108 VAL D C     1 
ATOM   2729  O  O     . VAL D  4  108 ? -34.402  -47.596 43.067  1.00 46.74  ? 108 VAL D O     1 
ATOM   2730  C  CB    . VAL D  4  108 ? -37.408  -47.473 42.428  1.00 45.17  ? 108 VAL D CB    1 
ATOM   2731  C  CG1   . VAL D  4  108 ? -37.308  -48.835 43.071  1.00 45.84  ? 108 VAL D CG1   1 
ATOM   2732  C  CG2   . VAL D  4  108 ? -38.818  -46.970 42.565  1.00 48.06  ? 108 VAL D CG2   1 
ATOM   2733  N  N     . VAL D  4  109 ? -35.333  -47.224 45.051  1.00 44.54  ? 109 VAL D N     1 
ATOM   2734  C  CA    . VAL D  4  109 ? -34.260  -47.934 45.743  1.00 44.95  ? 109 VAL D CA    1 
ATOM   2735  C  C     . VAL D  4  109 ? -34.891  -49.068 46.495  1.00 46.52  ? 109 VAL D C     1 
ATOM   2736  O  O     . VAL D  4  109 ? -35.998  -48.892 47.016  1.00 49.57  ? 109 VAL D O     1 
ATOM   2737  C  CB    . VAL D  4  109 ? -33.587  -47.024 46.756  1.00 44.92  ? 109 VAL D CB    1 
ATOM   2738  C  CG1   . VAL D  4  109 ? -32.478  -47.779 47.462  1.00 46.29  ? 109 VAL D CG1   1 
ATOM   2739  C  CG2   . VAL D  4  109 ? -33.057  -45.786 46.069  1.00 45.64  ? 109 VAL D CG2   1 
ATOM   2740  N  N     . LEU D  4  110 ? -34.226  -50.211 46.553  1.00 43.99  ? 110 LEU D N     1 
ATOM   2741  C  CA    . LEU D  4  110 ? -34.849  -51.378 47.135  1.00 46.78  ? 110 LEU D CA    1 
ATOM   2742  C  C     . LEU D  4  110 ? -33.842  -52.056 48.040  1.00 49.42  ? 110 LEU D C     1 
ATOM   2743  O  O     . LEU D  4  110 ? -32.865  -52.619 47.582  1.00 51.91  ? 110 LEU D O     1 
ATOM   2744  C  CB    . LEU D  4  110 ? -35.401  -52.342 46.083  1.00 46.60  ? 110 LEU D CB    1 
ATOM   2745  C  CG    . LEU D  4  110 ? -35.535  -53.778 46.621  1.00 50.70  ? 110 LEU D CG    1 
ATOM   2746  C  CD1   . LEU D  4  110 ? -36.751  -53.997 47.496  1.00 52.98  ? 110 LEU D CD1   1 
ATOM   2747  C  CD2   . LEU D  4  110 ? -35.604  -54.748 45.458  1.00 52.11  ? 110 LEU D CD2   1 
ATOM   2748  N  N     . ARG D  4  111 ? -34.147  -52.077 49.333  1.00 52.97  ? 111 ARG D N     1 
ATOM   2749  C  CA    . ARG D  4  111 ? -33.369  -52.802 50.306  1.00 52.89  ? 111 ARG D CA    1 
ATOM   2750  C  C     . ARG D  4  111 ? -33.438  -54.305 50.075  1.00 55.97  ? 111 ARG D C     1 
ATOM   2751  O  O     . ARG D  4  111 ? -34.514  -54.830 49.744  1.00 55.48  ? 111 ARG D O     1 
ATOM   2752  C  CB    . ARG D  4  111 ? -33.854  -52.469 51.694  1.00 54.43  ? 111 ARG D CB    1 
ATOM   2753  C  CG    . ARG D  4  111 ? -33.164  -51.283 52.326  1.00 57.10  ? 111 ARG D CG    1 
ATOM   2754  C  CD    . ARG D  4  111 ? -33.600  -51.115 53.785  1.00 62.50  ? 111 ARG D CD    1 
ATOM   2755  N  NE    . ARG D  4  111 ? -33.240  -52.203 54.688  1.00 66.77  ? 111 ARG D NE    1 
ATOM   2756  C  CZ    . ARG D  4  111 ? -32.511  -52.135 55.781  1.00 76.26  ? 111 ARG D CZ    1 
ATOM   2757  N  NH1   . ARG D  4  111 ? -31.912  -51.036 56.115  1.00 83.60  ? 111 ARG D NH1   1 
ATOM   2758  N  NH2   . ARG D  4  111 ? -32.288  -53.218 56.525  1.00 91.18  ? 111 ARG D NH2   1 
ATOM   2759  N  N     . ASN D  4  112 ? -32.307  -54.974 50.330  1.00 57.47  ? 112 ASN D N     1 
ATOM   2760  C  CA    . ASN D  4  112 ? -32.184  -56.411 50.125  1.00 57.90  ? 112 ASN D CA    1 
ATOM   2761  C  C     . ASN D  4  112 ? -33.138  -57.215 50.966  1.00 58.36  ? 112 ASN D C     1 
ATOM   2762  O  O     . ASN D  4  112 ? -33.045  -57.210 52.173  1.00 57.36  ? 112 ASN D O     1 
ATOM   2763  C  CB    . ASN D  4  112 ? -30.787  -56.869 50.442  1.00 61.26  ? 112 ASN D CB    1 
ATOM   2764  C  CG    . ASN D  4  112 ? -30.580  -58.362 50.210  1.00 66.80  ? 112 ASN D CG    1 
ATOM   2765  O  OD1   . ASN D  4  112 ? -31.458  -59.091 49.695  1.00 65.11  ? 112 ASN D OD1   1 
ATOM   2766  N  ND2   . ASN D  4  112 ? -29.380  -58.830 50.614  1.00 70.50  ? 112 ASN D ND2   1 
ATOM   2767  N  N     . PRO D  4  113 ? -34.113  -57.869 50.341  1.00 69.11  ? 113 PRO D N     1 
ATOM   2768  C  CA    . PRO D  4  113 ? -35.051  -58.678 51.135  1.00 76.21  ? 113 PRO D CA    1 
ATOM   2769  C  C     . PRO D  4  113 ? -34.325  -59.980 51.474  1.00 82.63  ? 113 PRO D C     1 
ATOM   2770  O  O     . PRO D  4  113 ? -33.836  -60.703 50.624  1.00 89.17  ? 113 PRO D O     1 
ATOM   2771  C  CB    . PRO D  4  113 ? -36.215  -58.818 50.184  1.00 77.43  ? 113 PRO D CB    1 
ATOM   2772  C  CG    . PRO D  4  113 ? -35.608  -58.783 48.805  1.00 73.89  ? 113 PRO D CG    1 
ATOM   2773  C  CD    . PRO D  4  113 ? -34.345  -58.010 48.891  1.00 69.93  ? 113 PRO D CD    1 
ATOM   2774  N  N     . LEU D  4  114 ? -34.134  -60.186 52.770  1.00 93.17  ? 114 LEU D N     1 
ATOM   2775  C  CA    . LEU D  4  114 ? -33.216  -61.205 53.253  1.00 95.43  ? 114 LEU D CA    1 
ATOM   2776  C  C     . LEU D  4  114 ? -33.775  -62.594 53.028  1.00 99.06  ? 114 LEU D C     1 
ATOM   2777  O  O     . LEU D  4  114 ? -34.252  -63.259 53.949  1.00 100.16 ? 114 LEU D O     1 
ATOM   2778  C  CB    . LEU D  4  114 ? -32.892  -60.970 54.721  1.00 97.63  ? 114 LEU D CB    1 
ATOM   2779  C  CG    . LEU D  4  114 ? -32.362  -59.569 55.030  1.00 97.61  ? 114 LEU D CG    1 
ATOM   2780  C  CD1   . LEU D  4  114 ? -32.483  -59.267 56.513  1.00 103.72 ? 114 LEU D CD1   1 
ATOM   2781  C  CD2   . LEU D  4  114 ? -30.925  -59.413 54.570  1.00 91.11  ? 114 LEU D CD2   1 
ATOM   2782  N  N     . ILE D  4  115 ? -33.703  -63.008 51.772  1.00 100.29 ? 115 ILE D N     1 
ATOM   2783  C  CA    . ILE D  4  115 ? -34.251  -64.279 51.313  1.00 104.81 ? 115 ILE D CA    1 
ATOM   2784  C  C     . ILE D  4  115 ? -33.626  -65.536 51.924  1.00 110.80 ? 115 ILE D C     1 
ATOM   2785  O  O     . ILE D  4  115 ? -34.339  -66.479 52.261  1.00 113.94 ? 115 ILE D O     1 
ATOM   2786  C  CB    . ILE D  4  115 ? -34.113  -64.399 49.784  1.00 103.90 ? 115 ILE D CB    1 
ATOM   2787  C  CG1   . ILE D  4  115 ? -32.690  -64.011 49.337  1.00 95.19  ? 115 ILE D CG1   1 
ATOM   2788  C  CG2   . ILE D  4  115 ? -35.186  -63.567 49.097  1.00 102.40 ? 115 ILE D CG2   1 
ATOM   2789  C  CD1   . ILE D  4  115 ? -32.519  -62.577 48.869  1.00 79.45  ? 115 ILE D CD1   1 
ATOM   2790  N  N     . ALA D  4  116 ? -32.306  -65.555 52.066  1.00 101.49 ? 116 ALA D N     1 
ATOM   2791  C  CA    . ALA D  4  116 ? -31.606  -66.758 52.493  1.00 86.33  ? 116 ALA D CA    1 
ATOM   2792  C  C     . ALA D  4  116 ? -31.626  -67.790 51.370  1.00 82.76  ? 116 ALA D C     1 
ATOM   2793  O  O     . ALA D  4  116 ? -31.487  -68.988 51.604  1.00 70.33  ? 116 ALA D O     1 
ATOM   2794  C  CB    . ALA D  4  116 ? -32.244  -67.329 53.743  1.00 78.50  ? 116 ALA D CB    1 
ATOM   2795  N  N     . MET E  5  14  ? -59.807  -9.809  37.794  1.00 101.33 ? 14  MET E N     1 
ATOM   2796  C  CA    . MET E  5  14  ? -58.979  -10.924 37.354  1.00 106.38 ? 14  MET E CA    1 
ATOM   2797  C  C     . MET E  5  14  ? -59.279  -12.176 38.161  1.00 101.97 ? 14  MET E C     1 
ATOM   2798  O  O     . MET E  5  14  ? -59.491  -12.106 39.367  1.00 102.67 ? 14  MET E O     1 
ATOM   2799  C  CB    . MET E  5  14  ? -57.501  -10.567 37.502  1.00 112.16 ? 14  MET E CB    1 
ATOM   2800  C  CG    . MET E  5  14  ? -56.557  -11.755 37.414  1.00 109.71 ? 14  MET E CG    1 
ATOM   2801  S  SD    . MET E  5  14  ? -54.829  -11.271 37.459  1.00 119.24 ? 14  MET E SD    1 
ATOM   2802  C  CE    . MET E  5  14  ? -54.205  -12.398 38.694  1.00 115.08 ? 14  MET E CE    1 
ATOM   2803  N  N     . VAL E  5  15  ? -59.267  -13.325 37.496  1.00 94.31  ? 15  VAL E N     1 
ATOM   2804  C  CA    . VAL E  5  15  ? -59.497  -14.587 38.176  1.00 93.76  ? 15  VAL E CA    1 
ATOM   2805  C  C     . VAL E  5  15  ? -58.176  -15.302 38.397  1.00 101.96 ? 15  VAL E C     1 
ATOM   2806  O  O     . VAL E  5  15  ? -57.517  -15.705 37.450  1.00 115.36 ? 15  VAL E O     1 
ATOM   2807  C  CB    . VAL E  5  15  ? -60.397  -15.500 37.335  1.00 85.78  ? 15  VAL E CB    1 
ATOM   2808  C  CG1   . VAL E  5  15  ? -60.958  -16.622 38.181  1.00 77.06  ? 15  VAL E CG1   1 
ATOM   2809  C  CG2   . VAL E  5  15  ? -61.513  -14.697 36.702  1.00 94.25  ? 15  VAL E CG2   1 
ATOM   2810  N  N     . GLN E  5  16  ? -57.799  -15.473 39.656  1.00 102.20 ? 16  GLN E N     1 
ATOM   2811  C  CA    . GLN E  5  16  ? -56.571  -16.170 39.983  1.00 97.63  ? 16  GLN E CA    1 
ATOM   2812  C  C     . GLN E  5  16  ? -56.739  -17.644 39.679  1.00 88.86  ? 16  GLN E C     1 
ATOM   2813  O  O     . GLN E  5  16  ? -57.795  -18.215 39.956  1.00 88.65  ? 16  GLN E O     1 
ATOM   2814  C  CB    . GLN E  5  16  ? -56.218  -15.967 41.454  1.00 105.90 ? 16  GLN E CB    1 
ATOM   2815  C  CG    . GLN E  5  16  ? -55.001  -15.094 41.681  1.00 114.33 ? 16  GLN E CG    1 
ATOM   2816  C  CD    . GLN E  5  16  ? -55.217  -14.083 42.782  1.00 120.06 ? 16  GLN E CD    1 
ATOM   2817  O  OE1   . GLN E  5  16  ? -55.226  -12.880 42.538  1.00 95.61  ? 16  GLN E OE1   1 
ATOM   2818  N  NE2   . GLN E  5  16  ? -55.395  -14.567 44.001  1.00 136.98 ? 16  GLN E NE2   1 
ATOM   2819  N  N     . PRO E  5  17  ? -55.628  -18.273 39.095  1.00 78.92  ? 17  PRO E N     1 
ATOM   2820  C  CA    . PRO E  5  17  ? -55.862  -19.696 38.800  1.00 71.46  ? 17  PRO E CA    1 
ATOM   2821  C  C     . PRO E  5  17  ? -56.163  -20.511 40.044  1.00 74.03  ? 17  PRO E C     1 
ATOM   2822  O  O     . PRO E  5  17  ? -56.820  -21.536 39.943  1.00 73.37  ? 17  PRO E O     1 
ATOM   2823  C  CB    . PRO E  5  17  ? -54.550  -20.162 38.178  1.00 71.57  ? 17  PRO E CB    1 
ATOM   2824  C  CG    . PRO E  5  17  ? -53.986  -18.965 37.547  1.00 72.02  ? 17  PRO E CG    1 
ATOM   2825  C  CD    . PRO E  5  17  ? -54.196  -17.962 38.612  1.00 78.86  ? 17  PRO E CD    1 
ATOM   2826  N  N     . ILE E  5  18  ? -55.682  -20.078 41.201  1.00 79.34  ? 18  ILE E N     1 
ATOM   2827  C  CA    . ILE E  5  18  ? -55.930  -20.844 42.425  1.00 85.03  ? 18  ILE E CA    1 
ATOM   2828  C  C     . ILE E  5  18  ? -57.418  -20.818 42.764  1.00 84.30  ? 18  ILE E C     1 
ATOM   2829  O  O     . ILE E  5  18  ? -57.981  -21.842 43.131  1.00 87.45  ? 18  ILE E O     1 
ATOM   2830  C  CB    . ILE E  5  18  ? -55.057  -20.382 43.615  1.00 90.43  ? 18  ILE E CB    1 
ATOM   2831  C  CG1   . ILE E  5  18  ? -53.545  -20.599 43.311  1.00 104.87 ? 18  ILE E CG1   1 
ATOM   2832  C  CG2   . ILE E  5  18  ? -55.434  -21.145 44.882  1.00 82.66  ? 18  ILE E CG2   1 
ATOM   2833  C  CD1   . ILE E  5  18  ? -52.941  -22.015 43.411  1.00 98.44  ? 18  ILE E CD1   1 
ATOM   2834  N  N     . ASN E  5  19  ? -58.041  -19.654 42.620  1.00 79.80  ? 19  ASN E N     1 
ATOM   2835  C  CA    . ASN E  5  19  ? -59.460  -19.500 42.890  1.00 74.84  ? 19  ASN E CA    1 
ATOM   2836  C  C     . ASN E  5  19  ? -60.312  -20.394 42.021  1.00 68.01  ? 19  ASN E C     1 
ATOM   2837  O  O     . ASN E  5  19  ? -61.143  -21.121 42.539  1.00 83.07  ? 19  ASN E O     1 
ATOM   2838  C  CB    . ASN E  5  19  ? -59.977  -18.063 42.672  1.00 82.99  ? 19  ASN E CB    1 
ATOM   2839  C  CG    . ASN E  5  19  ? -59.271  -16.996 43.503  1.00 85.71  ? 19  ASN E CG    1 
ATOM   2840  O  OD1   . ASN E  5  19  ? -59.144  -15.849 43.061  1.00 81.72  ? 19  ASN E OD1   1 
ATOM   2841  N  ND2   . ASN E  5  19  ? -58.796  -17.370 44.692  1.00 84.12  ? 19  ASN E ND2   1 
ATOM   2842  N  N     . LEU E  5  20  ? -60.130  -20.341 40.718  1.00 58.96  ? 20  LEU E N     1 
ATOM   2843  C  CA    . LEU E  5  20  ? -60.922  -21.182 39.838  1.00 62.18  ? 20  LEU E CA    1 
ATOM   2844  C  C     . LEU E  5  20  ? -60.754  -22.702 40.065  1.00 67.10  ? 20  LEU E C     1 
ATOM   2845  O  O     . LEU E  5  20  ? -61.658  -23.507 39.790  1.00 70.50  ? 20  LEU E O     1 
ATOM   2846  C  CB    . LEU E  5  20  ? -60.579  -20.851 38.394  1.00 62.33  ? 20  LEU E CB    1 
ATOM   2847  C  CG    . LEU E  5  20  ? -61.142  -21.567 37.158  1.00 62.19  ? 20  LEU E CG    1 
ATOM   2848  C  CD1   . LEU E  5  20  ? -62.657  -21.408 37.025  1.00 65.12  ? 20  LEU E CD1   1 
ATOM   2849  C  CD2   . LEU E  5  20  ? -60.469  -21.190 35.874  1.00 59.02  ? 20  LEU E CD2   1 
ATOM   2850  N  N     . ILE E  5  21  ? -59.624  -23.093 40.636  1.00 70.46  ? 21  ILE E N     1 
ATOM   2851  C  CA    . ILE E  5  21  ? -59.454  -24.476 41.109  1.00 75.27  ? 21  ILE E CA    1 
ATOM   2852  C  C     . ILE E  5  21  ? -60.367  -24.612 42.327  1.00 80.74  ? 21  ILE E C     1 
ATOM   2853  O  O     . ILE E  5  21  ? -61.116  -25.583 42.418  1.00 82.39  ? 21  ILE E O     1 
ATOM   2854  C  CB    . ILE E  5  21  ? -57.996  -24.913 41.418  1.00 74.68  ? 21  ILE E CB    1 
ATOM   2855  C  CG1   . ILE E  5  21  ? -57.194  -24.961 40.104  1.00 75.16  ? 21  ILE E CG1   1 
ATOM   2856  C  CG2   . ILE E  5  21  ? -57.890  -26.247 42.145  1.00 66.70  ? 21  ILE E CG2   1 
ATOM   2857  C  CD1   . ILE E  5  21  ? -55.714  -25.157 40.268  1.00 73.16  ? 21  ILE E CD1   1 
ATOM   2858  N  N     . PHE E  5  22  ? -60.327  -23.640 43.242  1.00 84.04  ? 22  PHE E N     1 
ATOM   2859  C  CA    . PHE E  5  22  ? -61.245  -23.645 44.382  1.00 88.13  ? 22  PHE E CA    1 
ATOM   2860  C  C     . PHE E  5  22  ? -62.730  -23.657 43.955  1.00 85.41  ? 22  PHE E C     1 
ATOM   2861  O  O     . PHE E  5  22  ? -63.485  -24.495 44.441  1.00 84.32  ? 22  PHE E O     1 
ATOM   2862  C  CB    . PHE E  5  22  ? -60.967  -22.477 45.311  1.00 93.46  ? 22  PHE E CB    1 
ATOM   2863  C  CG    . PHE E  5  22  ? -61.524  -22.640 46.697  1.00 104.73 ? 22  PHE E CG    1 
ATOM   2864  C  CD1   . PHE E  5  22  ? -61.701  -23.894 47.305  1.00 105.57 ? 22  PHE E CD1   1 
ATOM   2865  C  CD2   . PHE E  5  22  ? -61.840  -21.495 47.438  1.00 115.55 ? 22  PHE E CD2   1 
ATOM   2866  C  CE1   . PHE E  5  22  ? -62.207  -24.008 48.596  1.00 104.60 ? 22  PHE E CE1   1 
ATOM   2867  C  CE2   . PHE E  5  22  ? -62.336  -21.605 48.738  1.00 118.17 ? 22  PHE E CE2   1 
ATOM   2868  C  CZ    . PHE E  5  22  ? -62.528  -22.865 49.311  1.00 109.89 ? 22  PHE E CZ    1 
ATOM   2869  N  N     . ARG E  5  23  ? -63.082  -22.843 42.958  1.00 82.80  ? 23  ARG E N     1 
ATOM   2870  C  CA    . ARG E  5  23  ? -64.371  -22.913 42.314  1.00 86.84  ? 23  ARG E CA    1 
ATOM   2871  C  C     . ARG E  5  23  ? -64.662  -24.354 41.860  1.00 84.05  ? 23  ARG E C     1 
ATOM   2872  O  O     . ARG E  5  23  ? -65.636  -24.936 42.305  1.00 84.91  ? 23  ARG E O     1 
ATOM   2873  C  CB    . ARG E  5  23  ? -64.481  -21.896 41.181  1.00 96.06  ? 23  ARG E CB    1 
ATOM   2874  C  CG    . ARG E  5  23  ? -65.927  -21.650 40.687  1.00 111.56 ? 23  ARG E CG    1 
ATOM   2875  C  CD    . ARG E  5  23  ? -66.177  -20.438 39.760  1.00 118.77 ? 23  ARG E CD    1 
ATOM   2876  N  NE    . ARG E  5  23  ? -65.270  -19.312 40.053  1.00 123.40 ? 23  ARG E NE    1 
ATOM   2877  C  CZ    . ARG E  5  23  ? -64.895  -18.325 39.227  1.00 112.68 ? 23  ARG E CZ    1 
ATOM   2878  N  NH1   . ARG E  5  23  ? -65.352  -18.246 37.972  1.00 116.50 ? 23  ARG E NH1   1 
ATOM   2879  N  NH2   . ARG E  5  23  ? -64.064  -17.386 39.678  1.00 94.03  ? 23  ARG E NH2   1 
ATOM   2880  N  N     . TYR E  5  24  ? -63.785  -24.974 41.071  1.00 83.83  ? 24  TYR E N     1 
ATOM   2881  C  CA    . TYR E  5  24  ? -63.963  -26.391 40.679  1.00 82.56  ? 24  TYR E CA    1 
ATOM   2882  C  C     . TYR E  5  24  ? -64.188  -27.355 41.859  1.00 84.41  ? 24  TYR E C     1 
ATOM   2883  O  O     . TYR E  5  24  ? -64.945  -28.314 41.732  1.00 80.76  ? 24  TYR E O     1 
ATOM   2884  C  CB    . TYR E  5  24  ? -62.758  -26.980 39.933  1.00 80.59  ? 24  TYR E CB    1 
ATOM   2885  C  CG    . TYR E  5  24  ? -62.377  -26.398 38.625  1.00 76.54  ? 24  TYR E CG    1 
ATOM   2886  C  CD1   . TYR E  5  24  ? -63.331  -26.008 37.731  1.00 81.30  ? 24  TYR E CD1   1 
ATOM   2887  C  CD2   . TYR E  5  24  ? -61.062  -26.322 38.230  1.00 79.10  ? 24  TYR E CD2   1 
ATOM   2888  C  CE1   . TYR E  5  24  ? -62.993  -25.523 36.460  1.00 87.15  ? 24  TYR E CE1   1 
ATOM   2889  C  CE2   . TYR E  5  24  ? -60.718  -25.826 36.980  1.00 86.39  ? 24  TYR E CE2   1 
ATOM   2890  C  CZ    . TYR E  5  24  ? -61.689  -25.446 36.074  1.00 84.10  ? 24  TYR E CZ    1 
ATOM   2891  O  OH    . TYR E  5  24  ? -61.400  -24.872 34.864  1.00 80.53  ? 24  TYR E OH    1 
ATOM   2892  N  N     . LEU E  5  25  ? -63.511  -27.093 42.979  1.00 79.11  ? 25  LEU E N     1 
ATOM   2893  C  CA    . LEU E  5  25  ? -63.632  -27.928 44.150  1.00 76.95  ? 25  LEU E CA    1 
ATOM   2894  C  C     . LEU E  5  25  ? -65.055  -27.807 44.656  1.00 79.06  ? 25  LEU E C     1 
ATOM   2895  O  O     . LEU E  5  25  ? -65.726  -28.831 44.860  1.00 83.95  ? 25  LEU E O     1 
ATOM   2896  C  CB    . LEU E  5  25  ? -62.626  -27.523 45.240  1.00 76.46  ? 25  LEU E CB    1 
ATOM   2897  C  CG    . LEU E  5  25  ? -62.497  -28.423 46.474  1.00 75.10  ? 25  LEU E CG    1 
ATOM   2898  C  CD1   . LEU E  5  25  ? -61.070  -28.394 46.962  1.00 75.75  ? 25  LEU E CD1   1 
ATOM   2899  C  CD2   . LEU E  5  25  ? -63.373  -28.014 47.641  1.00 81.59  ? 25  LEU E CD2   1 
ATOM   2900  N  N     . GLN E  5  26  ? -65.503  -26.576 44.869  1.00 79.60  ? 26  GLN E N     1 
ATOM   2901  C  CA    . GLN E  5  26  ? -66.786  -26.321 45.491  1.00 78.11  ? 26  GLN E CA    1 
ATOM   2902  C  C     . GLN E  5  26  ? -67.902  -26.870 44.644  1.00 78.37  ? 26  GLN E C     1 
ATOM   2903  O  O     . GLN E  5  26  ? -68.818  -27.497 45.146  1.00 86.98  ? 26  GLN E O     1 
ATOM   2904  C  CB    . GLN E  5  26  ? -67.006  -24.827 45.658  1.00 78.33  ? 26  GLN E CB    1 
ATOM   2905  C  CG    . GLN E  5  26  ? -66.073  -24.157 46.638  1.00 87.96  ? 26  GLN E CG    1 
ATOM   2906  C  CD    . GLN E  5  26  ? -66.243  -22.655 46.650  1.00 103.37 ? 26  GLN E CD    1 
ATOM   2907  O  OE1   . GLN E  5  26  ? -67.056  -22.108 45.914  1.00 106.35 ? 26  GLN E OE1   1 
ATOM   2908  N  NE2   . GLN E  5  26  ? -65.473  -21.979 47.486  1.00 113.57 ? 26  GLN E NE2   1 
ATOM   2909  N  N     . ASN E  5  27  ? -67.810  -26.628 43.347  1.00 74.23  ? 27  ASN E N     1 
ATOM   2910  C  CA    . ASN E  5  27  ? -68.847  -27.019 42.409  1.00 76.74  ? 27  ASN E CA    1 
ATOM   2911  C  C     . ASN E  5  27  ? -69.007  -28.520 42.351  1.00 75.68  ? 27  ASN E C     1 
ATOM   2912  O  O     . ASN E  5  27  ? -70.026  -29.021 41.899  1.00 80.99  ? 27  ASN E O     1 
ATOM   2913  C  CB    . ASN E  5  27  ? -68.554  -26.477 41.016  1.00 83.87  ? 27  ASN E CB    1 
ATOM   2914  C  CG    . ASN E  5  27  ? -68.806  -24.993 40.909  1.00 95.30  ? 27  ASN E CG    1 
ATOM   2915  O  OD1   . ASN E  5  27  ? -69.069  -24.329 41.906  1.00 107.03 ? 27  ASN E OD1   1 
ATOM   2916  N  ND2   . ASN E  5  27  ? -68.727  -24.463 39.695  1.00 102.03 ? 27  ASN E ND2   1 
ATOM   2917  N  N     . ARG E  5  28  ? -67.973  -29.237 42.758  1.00 80.49  ? 28  ARG E N     1 
ATOM   2918  C  CA    . ARG E  5  28  ? -67.967  -30.681 42.639  1.00 95.39  ? 28  ARG E CA    1 
ATOM   2919  C  C     . ARG E  5  28  ? -68.096  -31.007 41.165  1.00 92.71  ? 28  ARG E C     1 
ATOM   2920  O  O     . ARG E  5  28  ? -68.740  -31.978 40.774  1.00 80.73  ? 28  ARG E O     1 
ATOM   2921  C  CB    . ARG E  5  28  ? -69.105  -31.309 43.440  1.00 106.12 ? 28  ARG E CB    1 
ATOM   2922  C  CG    . ARG E  5  28  ? -68.976  -31.160 44.947  1.00 118.44 ? 28  ARG E CG    1 
ATOM   2923  C  CD    . ARG E  5  28  ? -70.175  -31.771 45.652  1.00 126.68 ? 28  ARG E CD    1 
ATOM   2924  N  NE    . ARG E  5  28  ? -70.094  -31.678 47.106  1.00 139.25 ? 28  ARG E NE    1 
ATOM   2925  C  CZ    . ARG E  5  28  ? -70.443  -30.608 47.812  1.00 138.24 ? 28  ARG E CZ    1 
ATOM   2926  N  NH1   . ARG E  5  28  ? -70.892  -29.523 47.199  1.00 136.11 ? 28  ARG E NH1   1 
ATOM   2927  N  NH2   . ARG E  5  28  ? -70.339  -30.620 49.134  1.00 131.60 ? 28  ARG E NH2   1 
ATOM   2928  N  N     . SER E  5  29  ? -67.473  -30.159 40.356  1.00 92.31  ? 29  SER E N     1 
ATOM   2929  C  CA    . SER E  5  29  ? -67.405  -30.343 38.914  1.00 85.62  ? 29  SER E CA    1 
ATOM   2930  C  C     . SER E  5  29  ? -66.486  -31.509 38.644  1.00 79.10  ? 29  SER E C     1 
ATOM   2931  O  O     . SER E  5  29  ? -65.627  -31.808 39.459  1.00 96.76  ? 29  SER E O     1 
ATOM   2932  C  CB    . SER E  5  29  ? -66.864  -29.090 38.230  1.00 95.68  ? 29  SER E CB    1 
ATOM   2933  O  OG    . SER E  5  29  ? -67.500  -28.860 36.989  1.00 104.33 ? 29  SER E OG    1 
ATOM   2934  N  N     . ARG E  5  30  ? -66.660  -32.179 37.513  1.00 75.80  ? 30  ARG E N     1 
ATOM   2935  C  CA    . ARG E  5  30  ? -65.748  -33.251 37.161  1.00 75.12  ? 30  ARG E CA    1 
ATOM   2936  C  C     . ARG E  5  30  ? -64.696  -32.690 36.235  1.00 75.12  ? 30  ARG E C     1 
ATOM   2937  O  O     . ARG E  5  30  ? -64.993  -32.217 35.146  1.00 73.34  ? 30  ARG E O     1 
ATOM   2938  C  CB    . ARG E  5  30  ? -66.470  -34.412 36.491  1.00 72.97  ? 30  ARG E CB    1 
ATOM   2939  C  CG    . ARG E  5  30  ? -65.555  -35.590 36.222  1.00 74.73  ? 30  ARG E CG    1 
ATOM   2940  C  CD    . ARG E  5  30  ? -66.293  -36.779 35.646  1.00 75.45  ? 30  ARG E CD    1 
ATOM   2941  N  NE    . ARG E  5  30  ? -65.401  -37.897 35.369  1.00 68.36  ? 30  ARG E NE    1 
ATOM   2942  C  CZ    . ARG E  5  30  ? -65.005  -38.784 36.273  1.00 69.25  ? 30  ARG E CZ    1 
ATOM   2943  N  NH1   . ARG E  5  30  ? -65.417  -38.695 37.525  1.00 74.39  ? 30  ARG E NH1   1 
ATOM   2944  N  NH2   . ARG E  5  30  ? -64.196  -39.769 35.924  1.00 62.30  ? 30  ARG E NH2   1 
ATOM   2945  N  N     . ILE E  5  31  ? -63.455  -32.764 36.690  1.00 79.85  ? 31  ILE E N     1 
ATOM   2946  C  CA    . ILE E  5  31  ? -62.329  -32.167 36.004  1.00 72.52  ? 31  ILE E CA    1 
ATOM   2947  C  C     . ILE E  5  31  ? -61.538  -33.197 35.243  1.00 73.69  ? 31  ILE E C     1 
ATOM   2948  O  O     . ILE E  5  31  ? -61.350  -34.338 35.716  1.00 69.67  ? 31  ILE E O     1 
ATOM   2949  C  CB    . ILE E  5  31  ? -61.411  -31.525 37.031  1.00 70.44  ? 31  ILE E CB    1 
ATOM   2950  C  CG1   . ILE E  5  31  ? -62.159  -30.405 37.761  1.00 69.36  ? 31  ILE E CG1   1 
ATOM   2951  C  CG2   . ILE E  5  31  ? -60.174  -30.966 36.374  1.00 73.84  ? 31  ILE E CG2   1 
ATOM   2952  C  CD1   . ILE E  5  31  ? -62.751  -29.314 36.922  1.00 68.09  ? 31  ILE E CD1   1 
ATOM   2953  N  N     . GLN E  5  32  ? -61.130  -32.766 34.052  1.00 73.52  ? 32  GLN E N     1 
ATOM   2954  C  CA    . GLN E  5  32  ? -60.270  -33.569 33.176  1.00 80.90  ? 32  GLN E CA    1 
ATOM   2955  C  C     . GLN E  5  32  ? -58.906  -32.893 33.117  1.00 75.27  ? 32  GLN E C     1 
ATOM   2956  O  O     . GLN E  5  32  ? -58.857  -31.700 32.804  1.00 73.74  ? 32  GLN E O     1 
ATOM   2957  C  CB    . GLN E  5  32  ? -60.914  -33.705 31.775  1.00 84.98  ? 32  GLN E CB    1 
ATOM   2958  C  CG    . GLN E  5  32  ? -59.972  -34.135 30.654  1.00 80.96  ? 32  GLN E CG    1 
ATOM   2959  C  CD    . GLN E  5  32  ? -60.636  -34.966 29.564  1.00 78.95  ? 32  GLN E CD    1 
ATOM   2960  O  OE1   . GLN E  5  32  ? -60.589  -34.612 28.388  1.00 71.28  ? 32  GLN E OE1   1 
ATOM   2961  N  NE2   . GLN E  5  32  ? -61.253  -36.092 29.967  1.00 76.25  ? 32  GLN E NE2   1 
ATOM   2962  N  N     . VAL E  5  33  ? -57.839  -33.664 33.332  1.00 69.42  ? 33  VAL E N     1 
ATOM   2963  C  CA    . VAL E  5  33  ? -56.487  -33.121 33.363  1.00 69.14  ? 33  VAL E CA    1 
ATOM   2964  C  C     . VAL E  5  33  ? -55.752  -33.626 32.134  1.00 67.84  ? 33  VAL E C     1 
ATOM   2965  O  O     . VAL E  5  33  ? -55.763  -34.820 31.797  1.00 63.80  ? 33  VAL E O     1 
ATOM   2966  C  CB    . VAL E  5  33  ? -55.659  -33.442 34.611  1.00 73.42  ? 33  VAL E CB    1 
ATOM   2967  C  CG1   . VAL E  5  33  ? -56.349  -32.991 35.880  1.00 76.41  ? 33  VAL E CG1   1 
ATOM   2968  C  CG2   . VAL E  5  33  ? -55.421  -34.930 34.780  1.00 79.89  ? 33  VAL E CG2   1 
ATOM   2969  N  N     . TRP E  5  34  ? -55.118  -32.692 31.456  1.00 66.36  ? 34  TRP E N     1 
ATOM   2970  C  CA    . TRP E  5  34  ? -54.193  -33.039 30.404  1.00 67.24  ? 34  TRP E CA    1 
ATOM   2971  C  C     . TRP E  5  34  ? -52.873  -33.232 31.086  1.00 64.58  ? 34  TRP E C     1 
ATOM   2972  O  O     . TRP E  5  34  ? -52.602  -32.564 32.078  1.00 70.51  ? 34  TRP E O     1 
ATOM   2973  C  CB    . TRP E  5  34  ? -54.041  -31.878 29.455  1.00 73.28  ? 34  TRP E CB    1 
ATOM   2974  C  CG    . TRP E  5  34  ? -55.284  -31.499 28.717  1.00 70.27  ? 34  TRP E CG    1 
ATOM   2975  C  CD1   . TRP E  5  34  ? -56.548  -31.859 29.006  1.00 64.71  ? 34  TRP E CD1   1 
ATOM   2976  C  CD2   . TRP E  5  34  ? -55.336  -30.609 27.574  1.00 66.44  ? 34  TRP E CD2   1 
ATOM   2977  N  NE1   . TRP E  5  34  ? -57.380  -31.283 28.089  1.00 69.60  ? 34  TRP E NE1   1 
ATOM   2978  C  CE2   . TRP E  5  34  ? -56.671  -30.511 27.211  1.00 63.75  ? 34  TRP E CE2   1 
ATOM   2979  C  CE3   . TRP E  5  34  ? -54.365  -29.932 26.806  1.00 63.31  ? 34  TRP E CE3   1 
ATOM   2980  C  CZ2   . TRP E  5  34  ? -57.085  -29.742 26.157  1.00 65.88  ? 34  TRP E CZ2   1 
ATOM   2981  C  CZ3   . TRP E  5  34  ? -54.767  -29.156 25.778  1.00 61.24  ? 34  TRP E CZ3   1 
ATOM   2982  C  CH2   . TRP E  5  34  ? -56.111  -29.077 25.443  1.00 65.90  ? 34  TRP E CH2   1 
ATOM   2983  N  N     . LEU E  5  35  ? -52.071  -34.153 30.580  1.00 61.11  ? 35  LEU E N     1 
ATOM   2984  C  CA    . LEU E  5  35  ? -50.868  -34.468 31.300  1.00 59.43  ? 35  LEU E CA    1 
ATOM   2985  C  C     . LEU E  5  35  ? -49.623  -33.846 30.643  1.00 63.97  ? 35  LEU E C     1 
ATOM   2986  O  O     . LEU E  5  35  ? -49.630  -33.510 29.466  1.00 59.33  ? 35  LEU E O     1 
ATOM   2987  C  CB    . LEU E  5  35  ? -50.781  -35.975 31.409  1.00 58.04  ? 35  LEU E CB    1 
ATOM   2988  C  CG    . LEU E  5  35  ? -51.802  -36.590 32.339  1.00 55.78  ? 35  LEU E CG    1 
ATOM   2989  C  CD1   . LEU E  5  35  ? -51.787  -38.103 32.207  1.00 58.23  ? 35  LEU E CD1   1 
ATOM   2990  C  CD2   . LEU E  5  35  ? -51.581  -36.218 33.776  1.00 57.21  ? 35  LEU E CD2   1 
ATOM   2991  N  N     . TYR E  5  36  ? -48.523  -33.802 31.386  1.00 68.62  ? 36  TYR E N     1 
ATOM   2992  C  CA    . TYR E  5  36  ? -47.318  -33.149 30.932  1.00 68.41  ? 36  TYR E CA    1 
ATOM   2993  C  C     . TYR E  5  36  ? -46.550  -34.222 30.216  1.00 64.94  ? 36  TYR E C     1 
ATOM   2994  O  O     . TYR E  5  36  ? -46.122  -35.197 30.838  1.00 68.22  ? 36  TYR E O     1 
ATOM   2995  C  CB    . TYR E  5  36  ? -46.531  -32.610 32.139  1.00 73.94  ? 36  TYR E CB    1 
ATOM   2996  C  CG    . TYR E  5  36  ? -45.294  -31.837 31.727  1.00 72.66  ? 36  TYR E CG    1 
ATOM   2997  C  CD1   . TYR E  5  36  ? -44.105  -32.457 31.417  1.00 66.52  ? 36  TYR E CD1   1 
ATOM   2998  C  CD2   . TYR E  5  36  ? -45.330  -30.449 31.709  1.00 80.95  ? 36  TYR E CD2   1 
ATOM   2999  C  CE1   . TYR E  5  36  ? -43.023  -31.748 31.009  1.00 70.21  ? 36  TYR E CE1   1 
ATOM   3000  C  CE2   . TYR E  5  36  ? -44.211  -29.713 31.367  1.00 78.72  ? 36  TYR E CE2   1 
ATOM   3001  C  CZ    . TYR E  5  36  ? -43.072  -30.387 31.011  1.00 75.26  ? 36  TYR E CZ    1 
ATOM   3002  O  OH    . TYR E  5  36  ? -41.969  -29.703 30.605  1.00 81.63  ? 36  TYR E OH    1 
ATOM   3003  N  N     . GLU E  5  37  ? -46.412  -34.084 28.911  1.00 66.82  ? 37  GLU E N     1 
ATOM   3004  C  CA    . GLU E  5  37  ? -45.474  -34.878 28.148  1.00 71.42  ? 37  GLU E CA    1 
ATOM   3005  C  C     . GLU E  5  37  ? -45.987  -36.284 27.941  1.00 75.75  ? 37  GLU E C     1 
ATOM   3006  O  O     . GLU E  5  37  ? -45.314  -37.115 27.343  1.00 87.36  ? 37  GLU E O     1 
ATOM   3007  C  CB    . GLU E  5  37  ? -44.124  -34.906 28.838  1.00 74.08  ? 37  GLU E CB    1 
ATOM   3008  C  CG    . GLU E  5  37  ? -43.174  -33.829 28.352  1.00 79.46  ? 37  GLU E CG    1 
ATOM   3009  C  CD    . GLU E  5  37  ? -42.820  -33.988 26.892  1.00 84.42  ? 37  GLU E CD    1 
ATOM   3010  O  OE1   . GLU E  5  37  ? -42.692  -35.140 26.440  1.00 93.04  ? 37  GLU E OE1   1 
ATOM   3011  O  OE2   . GLU E  5  37  ? -42.670  -32.965 26.200  1.00 84.17  ? 37  GLU E OE2   1 
ATOM   3012  N  N     . GLN E  5  38  ? -47.191  -36.549 28.424  1.00 81.44  ? 38  GLN E N     1 
ATOM   3013  C  CA    . GLN E  5  38  ? -47.888  -37.760 28.064  1.00 80.06  ? 38  GLN E CA    1 
ATOM   3014  C  C     . GLN E  5  38  ? -49.110  -37.323 27.306  1.00 80.39  ? 38  GLN E C     1 
ATOM   3015  O  O     . GLN E  5  38  ? -50.037  -36.775 27.882  1.00 86.16  ? 38  GLN E O     1 
ATOM   3016  C  CB    . GLN E  5  38  ? -48.304  -38.532 29.304  1.00 74.55  ? 38  GLN E CB    1 
ATOM   3017  C  CG    . GLN E  5  38  ? -49.269  -39.654 29.010  1.00 76.20  ? 38  GLN E CG    1 
ATOM   3018  C  CD    . GLN E  5  38  ? -48.646  -41.013 29.192  1.00 83.78  ? 38  GLN E CD    1 
ATOM   3019  O  OE1   . GLN E  5  38  ? -48.136  -41.331 30.261  1.00 75.62  ? 38  GLN E OE1   1 
ATOM   3020  N  NE2   . GLN E  5  38  ? -48.686  -41.825 28.149  1.00 86.80  ? 38  GLN E NE2   1 
ATOM   3021  N  N     . VAL E  5  39  ? -49.124  -37.571 26.009  1.00 77.71  ? 39  VAL E N     1 
ATOM   3022  C  CA    . VAL E  5  39  ? -50.234  -37.122 25.201  1.00 79.05  ? 39  VAL E CA    1 
ATOM   3023  C  C     . VAL E  5  39  ? -51.262  -38.209 24.947  1.00 74.69  ? 39  VAL E C     1 
ATOM   3024  O  O     . VAL E  5  39  ? -52.301  -37.936 24.359  1.00 76.36  ? 39  VAL E O     1 
ATOM   3025  C  CB    . VAL E  5  39  ? -49.746  -36.559 23.860  1.00 80.61  ? 39  VAL E CB    1 
ATOM   3026  C  CG1   . VAL E  5  39  ? -50.913  -36.010 23.064  1.00 86.05  ? 39  VAL E CG1   1 
ATOM   3027  C  CG2   . VAL E  5  39  ? -48.711  -35.479 24.096  1.00 77.25  ? 39  VAL E CG2   1 
ATOM   3028  N  N     . ASN E  5  40  ? -51.003  -39.437 25.385  1.00 76.46  ? 40  ASN E N     1 
ATOM   3029  C  CA    . ASN E  5  40  ? -51.963  -40.483 25.093  1.00 80.82  ? 40  ASN E CA    1 
ATOM   3030  C  C     . ASN E  5  40  ? -52.988  -40.653 26.162  1.00 74.97  ? 40  ASN E C     1 
ATOM   3031  O  O     . ASN E  5  40  ? -54.150  -40.841 25.855  1.00 95.49  ? 40  ASN E O     1 
ATOM   3032  C  CB    . ASN E  5  40  ? -51.258  -41.799 24.883  1.00 89.08  ? 40  ASN E CB    1 
ATOM   3033  C  CG    . ASN E  5  40  ? -50.344  -41.741 23.709  1.00 99.67  ? 40  ASN E CG    1 
ATOM   3034  O  OD1   . ASN E  5  40  ? -50.600  -40.995 22.751  1.00 114.70 ? 40  ASN E OD1   1 
ATOM   3035  N  ND2   . ASN E  5  40  ? -49.263  -42.479 23.768  1.00 98.86  ? 40  ASN E ND2   1 
ATOM   3036  N  N     . MET E  5  41  ? -52.549  -40.612 27.398  1.00 66.54  ? 41  MET E N     1 
ATOM   3037  C  CA    . MET E  5  41  ? -53.423  -40.644 28.555  1.00 61.86  ? 41  MET E CA    1 
ATOM   3038  C  C     . MET E  5  41  ? -53.863  -39.231 29.036  1.00 60.71  ? 41  MET E C     1 
ATOM   3039  O  O     . MET E  5  41  ? -53.139  -38.232 28.896  1.00 59.49  ? 41  MET E O     1 
ATOM   3040  C  CB    . MET E  5  41  ? -52.697  -41.396 29.634  1.00 60.98  ? 41  MET E CB    1 
ATOM   3041  C  CG    . MET E  5  41  ? -53.425  -41.510 30.934  1.00 66.14  ? 41  MET E CG    1 
ATOM   3042  S  SD    . MET E  5  41  ? -52.510  -42.599 32.032  1.00 83.55  ? 41  MET E SD    1 
ATOM   3043  C  CE    . MET E  5  41  ? -50.793  -42.107 31.887  1.00 81.97  ? 41  MET E CE    1 
ATOM   3044  N  N     . ARG E  5  42  ? -55.107  -39.142 29.524  1.00 56.99  ? 42  ARG E N     1 
ATOM   3045  C  CA    . ARG E  5  42  ? -55.563  -38.073 30.416  1.00 50.38  ? 42  ARG E CA    1 
ATOM   3046  C  C     . ARG E  5  42  ? -56.123  -38.699 31.652  1.00 49.50  ? 42  ARG E C     1 
ATOM   3047  O  O     . ARG E  5  42  ? -56.173  -39.935 31.780  1.00 49.13  ? 42  ARG E O     1 
ATOM   3048  C  CB    . ARG E  5  42  ? -56.593  -37.225 29.755  1.00 49.56  ? 42  ARG E CB    1 
ATOM   3049  C  CG    . ARG E  5  42  ? -56.008  -36.247 28.767  1.00 53.82  ? 42  ARG E CG    1 
ATOM   3050  C  CD    . ARG E  5  42  ? -57.103  -35.504 28.010  1.00 55.75  ? 42  ARG E CD    1 
ATOM   3051  N  NE    . ARG E  5  42  ? -56.600  -34.708 26.919  1.00 60.12  ? 42  ARG E NE    1 
ATOM   3052  C  CZ    . ARG E  5  42  ? -57.310  -33.852 26.199  1.00 66.63  ? 42  ARG E CZ    1 
ATOM   3053  N  NH1   . ARG E  5  42  ? -58.599  -33.695 26.424  1.00 68.61  ? 42  ARG E NH1   1 
ATOM   3054  N  NH2   . ARG E  5  42  ? -56.704  -33.130 25.243  1.00 74.81  ? 42  ARG E NH2   1 
ATOM   3055  N  N     . ILE E  5  43  ? -56.451  -37.846 32.600  1.00 52.22  ? 43  ILE E N     1 
ATOM   3056  C  CA    . ILE E  5  43  ? -57.047  -38.317 33.839  1.00 56.75  ? 43  ILE E CA    1 
ATOM   3057  C  C     . ILE E  5  43  ? -58.190  -37.396 34.165  1.00 61.21  ? 43  ILE E C     1 
ATOM   3058  O  O     . ILE E  5  43  ? -58.080  -36.179 33.938  1.00 62.65  ? 43  ILE E O     1 
ATOM   3059  C  CB    . ILE E  5  43  ? -56.013  -38.347 34.944  1.00 61.13  ? 43  ILE E CB    1 
ATOM   3060  C  CG1   . ILE E  5  43  ? -55.144  -39.594 34.752  1.00 68.15  ? 43  ILE E CG1   1 
ATOM   3061  C  CG2   . ILE E  5  43  ? -56.662  -38.324 36.325  1.00 60.04  ? 43  ILE E CG2   1 
ATOM   3062  C  CD1   . ILE E  5  43  ? -53.998  -39.719 35.727  1.00 74.30  ? 43  ILE E CD1   1 
ATOM   3063  N  N     . GLU E  5  44  ? -59.323  -37.973 34.587  1.00 67.97  ? 44  GLU E N     1 
ATOM   3064  C  CA    . GLU E  5  44  ? -60.459  -37.145 35.031  1.00 71.25  ? 44  GLU E CA    1 
ATOM   3065  C  C     . GLU E  5  44  ? -60.982  -37.588 36.372  1.00 64.57  ? 44  GLU E C     1 
ATOM   3066  O  O     . GLU E  5  44  ? -60.821  -38.768 36.716  1.00 60.19  ? 44  GLU E O     1 
ATOM   3067  C  CB    . GLU E  5  44  ? -61.509  -36.964 33.933  1.00 79.68  ? 44  GLU E CB    1 
ATOM   3068  C  CG    . GLU E  5  44  ? -62.642  -37.958 33.913  1.00 90.80  ? 44  GLU E CG    1 
ATOM   3069  C  CD    . GLU E  5  44  ? -63.754  -37.539 32.949  1.00 101.66 ? 44  GLU E CD    1 
ATOM   3070  O  OE1   . GLU E  5  44  ? -63.989  -36.327 32.751  1.00 96.28  ? 44  GLU E OE1   1 
ATOM   3071  O  OE2   . GLU E  5  44  ? -64.456  -38.441 32.438  1.00 105.91 ? 44  GLU E OE2   1 
ATOM   3072  N  N     . GLY E  5  45  ? -61.539  -36.636 37.111  1.00 62.34  ? 45  GLY E N     1 
ATOM   3073  C  CA    . GLY E  5  45  ? -62.098  -36.935 38.438  1.00 71.25  ? 45  GLY E CA    1 
ATOM   3074  C  C     . GLY E  5  45  ? -62.591  -35.672 39.128  1.00 79.17  ? 45  GLY E C     1 
ATOM   3075  O  O     . GLY E  5  45  ? -62.447  -34.573 38.577  1.00 72.44  ? 45  GLY E O     1 
ATOM   3076  N  N     . CYS E  5  46  ? -63.197  -35.812 40.315  1.00 89.09  ? 46  CYS E N     1 
ATOM   3077  C  CA    . CYS E  5  46  ? -63.706  -34.640 41.082  1.00 93.73  ? 46  CYS E CA    1 
ATOM   3078  C  C     . CYS E  5  46  ? -62.685  -34.131 42.082  1.00 78.70  ? 46  CYS E C     1 
ATOM   3079  O  O     . CYS E  5  46  ? -62.210  -34.921 42.897  1.00 71.58  ? 46  CYS E O     1 
ATOM   3080  C  CB    . CYS E  5  46  ? -64.999  -34.939 41.851  1.00 104.82 ? 46  CYS E CB    1 
ATOM   3081  S  SG    . CYS E  5  46  ? -66.447  -34.923 40.781  1.00 137.68 ? 46  CYS E SG    1 
ATOM   3082  N  N     . ILE E  5  47  ? -62.377  -32.842 42.043  1.00 67.99  ? 47  ILE E N     1 
ATOM   3083  C  CA    . ILE E  5  47  ? -61.350  -32.329 42.938  1.00 73.75  ? 47  ILE E CA    1 
ATOM   3084  C  C     . ILE E  5  47  ? -61.827  -32.161 44.383  1.00 73.56  ? 47  ILE E C     1 
ATOM   3085  O  O     . ILE E  5  47  ? -62.386  -31.134 44.726  1.00 78.81  ? 47  ILE E O     1 
ATOM   3086  C  CB    . ILE E  5  47  ? -60.801  -30.988 42.439  1.00 79.30  ? 47  ILE E CB    1 
ATOM   3087  C  CG1   . ILE E  5  47  ? -60.229  -31.139 41.021  1.00 85.63  ? 47  ILE E CG1   1 
ATOM   3088  C  CG2   . ILE E  5  47  ? -59.707  -30.476 43.385  1.00 81.55  ? 47  ILE E CG2   1 
ATOM   3089  C  CD1   . ILE E  5  47  ? -59.503  -29.908 40.490  1.00 89.65  ? 47  ILE E CD1   1 
ATOM   3090  N  N     . ILE E  5  48  ? -61.599  -33.165 45.214  1.00 67.19  ? 48  ILE E N     1 
ATOM   3091  C  CA    . ILE E  5  48  ? -61.897  -33.057 46.641  1.00 65.92  ? 48  ILE E CA    1 
ATOM   3092  C  C     . ILE E  5  48  ? -60.945  -32.091 47.309  1.00 69.83  ? 48  ILE E C     1 
ATOM   3093  O  O     . ILE E  5  48  ? -61.339  -31.366 48.182  1.00 72.69  ? 48  ILE E O     1 
ATOM   3094  C  CB    . ILE E  5  48  ? -62.004  -34.403 47.345  1.00 66.50  ? 48  ILE E CB    1 
ATOM   3095  C  CG1   . ILE E  5  48  ? -60.705  -35.160 47.324  1.00 75.09  ? 48  ILE E CG1   1 
ATOM   3096  C  CG2   . ILE E  5  48  ? -63.101  -35.176 46.655  1.00 66.96  ? 48  ILE E CG2   1 
ATOM   3097  C  CD1   . ILE E  5  48  ? -60.875  -36.445 48.092  1.00 80.77  ? 48  ILE E CD1   1 
ATOM   3098  N  N     . GLY E  5  49  ? -59.677  -32.058 46.923  1.00 75.98  ? 49  GLY E N     1 
ATOM   3099  C  CA    . GLY E  5  49  ? -58.720  -31.136 47.555  1.00 77.28  ? 49  GLY E CA    1 
ATOM   3100  C  C     . GLY E  5  49  ? -57.455  -30.905 46.767  1.00 70.25  ? 49  GLY E C     1 
ATOM   3101  O  O     . GLY E  5  49  ? -57.300  -31.495 45.708  1.00 71.78  ? 49  GLY E O     1 
ATOM   3102  N  N     . PHE E  5  50  ? -56.608  -29.994 47.243  1.00 63.93  ? 50  PHE E N     1 
ATOM   3103  C  CA    . PHE E  5  50  ? -55.362  -29.685 46.574  1.00 63.34  ? 50  PHE E CA    1 
ATOM   3104  C  C     . PHE E  5  50  ? -54.379  -28.912 47.415  1.00 61.34  ? 50  PHE E C     1 
ATOM   3105  O  O     . PHE E  5  50  ? -54.636  -28.771 48.590  1.00 62.66  ? 50  PHE E O     1 
ATOM   3106  C  CB    . PHE E  5  50  ? -55.637  -28.956 45.276  1.00 64.45  ? 50  PHE E CB    1 
ATOM   3107  C  CG    . PHE E  5  50  ? -56.204  -27.608 45.466  1.00 66.09  ? 50  PHE E CG    1 
ATOM   3108  C  CD1   . PHE E  5  50  ? -57.540  -27.441 45.752  1.00 66.92  ? 50  PHE E CD1   1 
ATOM   3109  C  CD2   . PHE E  5  50  ? -55.414  -26.494 45.224  1.00 66.89  ? 50  PHE E CD2   1 
ATOM   3110  C  CE1   . PHE E  5  50  ? -58.076  -26.162 45.811  1.00 72.18  ? 50  PHE E CE1   1 
ATOM   3111  C  CE2   . PHE E  5  50  ? -55.936  -25.213 45.272  1.00 65.81  ? 50  PHE E CE2   1 
ATOM   3112  C  CZ    . PHE E  5  50  ? -57.270  -25.041 45.570  1.00 70.11  ? 50  PHE E CZ    1 
ATOM   3113  N  N     . ASP E  5  51  ? -53.233  -28.502 46.866  1.00 65.17  ? 51  ASP E N     1 
ATOM   3114  C  CA    . ASP E  5  51  ? -52.219  -27.717 47.604  1.00 68.58  ? 51  ASP E CA    1 
ATOM   3115  C  C     . ASP E  5  51  ? -51.392  -26.762 46.763  1.00 66.39  ? 51  ASP E C     1 
ATOM   3116  O  O     . ASP E  5  51  ? -51.450  -26.739 45.565  1.00 68.45  ? 51  ASP E O     1 
ATOM   3117  C  CB    . ASP E  5  51  ? -51.307  -28.612 48.482  1.00 72.34  ? 51  ASP E CB    1 
ATOM   3118  C  CG    . ASP E  5  51  ? -50.379  -29.539 47.676  1.00 71.76  ? 51  ASP E CG    1 
ATOM   3119  O  OD1   . ASP E  5  51  ? -50.229  -29.331 46.444  1.00 63.12  ? 51  ASP E OD1   1 
ATOM   3120  O  OD2   . ASP E  5  51  ? -49.821  -30.505 48.316  1.00 76.05  ? 51  ASP E OD2   1 
ATOM   3121  N  N     . GLU E  5  52  ? -50.596  -25.972 47.445  1.00 71.53  ? 52  GLU E N     1 
ATOM   3122  C  CA    . GLU E  5  52  ? -49.602  -25.068 46.872  1.00 74.57  ? 52  GLU E CA    1 
ATOM   3123  C  C     . GLU E  5  52  ? -48.794  -25.572 45.695  1.00 71.79  ? 52  GLU E C     1 
ATOM   3124  O  O     . GLU E  5  52  ? -48.316  -24.783 44.905  1.00 70.61  ? 52  GLU E O     1 
ATOM   3125  C  CB    . GLU E  5  52  ? -48.623  -24.618 47.981  1.00 83.15  ? 52  GLU E CB    1 
ATOM   3126  C  CG    . GLU E  5  52  ? -48.137  -25.715 48.925  1.00 90.41  ? 52  GLU E CG    1 
ATOM   3127  C  CD    . GLU E  5  52  ? -47.096  -25.255 49.931  1.00 98.12  ? 52  GLU E CD    1 
ATOM   3128  O  OE1   . GLU E  5  52  ? -46.187  -24.448 49.576  1.00 100.72 ? 52  GLU E OE1   1 
ATOM   3129  O  OE2   . GLU E  5  52  ? -47.220  -25.738 51.094  1.00 102.51 ? 52  GLU E OE2   1 
ATOM   3130  N  N     . TYR E  5  53  ? -48.558  -26.876 45.627  1.00 68.74  ? 53  TYR E N     1 
ATOM   3131  C  CA    . TYR E  5  53  ? -47.778  -27.456 44.551  1.00 64.82  ? 53  TYR E CA    1 
ATOM   3132  C  C     . TYR E  5  53  ? -48.646  -27.787 43.350  1.00 60.11  ? 53  TYR E C     1 
ATOM   3133  O  O     . TYR E  5  53  ? -48.153  -28.025 42.257  1.00 61.05  ? 53  TYR E O     1 
ATOM   3134  C  CB    . TYR E  5  53  ? -47.063  -28.697 45.074  1.00 64.98  ? 53  TYR E CB    1 
ATOM   3135  C  CG    . TYR E  5  53  ? -46.309  -28.441 46.359  1.00 60.67  ? 53  TYR E CG    1 
ATOM   3136  C  CD1   . TYR E  5  53  ? -45.397  -27.398 46.472  1.00 59.72  ? 53  TYR E CD1   1 
ATOM   3137  C  CD2   . TYR E  5  53  ? -46.515  -29.238 47.438  1.00 60.24  ? 53  TYR E CD2   1 
ATOM   3138  C  CE1   . TYR E  5  53  ? -44.739  -27.137 47.651  1.00 60.17  ? 53  TYR E CE1   1 
ATOM   3139  C  CE2   . TYR E  5  53  ? -45.849  -29.013 48.626  1.00 64.94  ? 53  TYR E CE2   1 
ATOM   3140  C  CZ    . TYR E  5  53  ? -44.968  -27.958 48.737  1.00 65.87  ? 53  TYR E CZ    1 
ATOM   3141  O  OH    . TYR E  5  53  ? -44.365  -27.753 49.969  1.00 71.90  ? 53  TYR E OH    1 
ATOM   3142  N  N     . MET E  5  54  ? -49.947  -27.724 43.539  1.00 57.78  ? 54  MET E N     1 
ATOM   3143  C  CA    . MET E  5  54  ? -50.979  -28.057 42.548  1.00 55.75  ? 54  MET E CA    1 
ATOM   3144  C  C     . MET E  5  54  ? -51.218  -29.552 42.506  1.00 54.78  ? 54  MET E C     1 
ATOM   3145  O  O     . MET E  5  54  ? -51.715  -30.053 41.511  1.00 54.03  ? 54  MET E O     1 
ATOM   3146  C  CB    . MET E  5  54  ? -50.727  -27.424 41.179  1.00 52.21  ? 54  MET E CB    1 
ATOM   3147  C  CG    . MET E  5  54  ? -52.004  -27.210 40.417  1.00 51.47  ? 54  MET E CG    1 
ATOM   3148  S  SD    . MET E  5  54  ? -51.740  -26.835 38.680  1.00 56.66  ? 54  MET E SD    1 
ATOM   3149  C  CE    . MET E  5  54  ? -51.472  -25.054 38.660  1.00 58.19  ? 54  MET E CE    1 
ATOM   3150  N  N     . ASN E  5  55  ? -50.763  -30.271 43.532  1.00 55.48  ? 55  ASN E N     1 
ATOM   3151  C  CA    . ASN E  5  55  ? -51.145  -31.662 43.665  1.00 58.34  ? 55  ASN E CA    1 
ATOM   3152  C  C     . ASN E  5  55  ? -52.652  -31.704 43.901  1.00 57.81  ? 55  ASN E C     1 
ATOM   3153  O  O     . ASN E  5  55  ? -53.172  -30.891 44.658  1.00 66.45  ? 55  ASN E O     1 
ATOM   3154  C  CB    . ASN E  5  55  ? -50.465  -32.301 44.876  1.00 64.92  ? 55  ASN E CB    1 
ATOM   3155  C  CG    . ASN E  5  55  ? -48.961  -32.336 44.770  1.00 67.83  ? 55  ASN E CG    1 
ATOM   3156  O  OD1   . ASN E  5  55  ? -48.414  -32.341 43.664  1.00 78.40  ? 55  ASN E OD1   1 
ATOM   3157  N  ND2   . ASN E  5  55  ? -48.284  -32.325 45.915  1.00 66.19  ? 55  ASN E ND2   1 
ATOM   3158  N  N     . LEU E  5  56  ? -53.341  -32.643 43.281  1.00 54.49  ? 56  LEU E N     1 
ATOM   3159  C  CA    . LEU E  5  56  ? -54.775  -32.764 43.362  1.00 51.59  ? 56  LEU E CA    1 
ATOM   3160  C  C     . LEU E  5  56  ? -55.180  -34.044 44.017  1.00 55.64  ? 56  LEU E C     1 
ATOM   3161  O  O     . LEU E  5  56  ? -54.583  -35.079 43.759  1.00 57.43  ? 56  LEU E O     1 
ATOM   3162  C  CB    . LEU E  5  56  ? -55.352  -32.857 41.971  1.00 49.43  ? 56  LEU E CB    1 
ATOM   3163  C  CG    . LEU E  5  56  ? -54.976  -31.701 41.062  1.00 49.77  ? 56  LEU E CG    1 
ATOM   3164  C  CD1   . LEU E  5  56  ? -55.696  -31.831 39.722  1.00 50.28  ? 56  LEU E CD1   1 
ATOM   3165  C  CD2   . LEU E  5  56  ? -55.261  -30.373 41.734  1.00 50.14  ? 56  LEU E CD2   1 
ATOM   3166  N  N     . VAL E  5  57  ? -56.195  -33.959 44.876  1.00 60.74  ? 57  VAL E N     1 
ATOM   3167  C  CA    . VAL E  5  57  ? -56.896  -35.136 45.359  1.00 61.87  ? 57  VAL E CA    1 
ATOM   3168  C  C     . VAL E  5  57  ? -58.161  -35.271 44.538  1.00 62.84  ? 57  VAL E C     1 
ATOM   3169  O  O     . VAL E  5  57  ? -58.919  -34.334 44.454  1.00 62.51  ? 57  VAL E O     1 
ATOM   3170  C  CB    . VAL E  5  57  ? -57.219  -35.071 46.836  1.00 62.26  ? 57  VAL E CB    1 
ATOM   3171  C  CG1   . VAL E  5  57  ? -57.473  -36.493 47.303  1.00 65.33  ? 57  VAL E CG1   1 
ATOM   3172  C  CG2   . VAL E  5  57  ? -56.045  -34.491 47.634  1.00 63.34  ? 57  VAL E CG2   1 
ATOM   3173  N  N     . LEU E  5  58  ? -58.339  -36.403 43.867  1.00 66.41  ? 58  LEU E N     1 
ATOM   3174  C  CA    . LEU E  5  58  ? -59.410  -36.560 42.903  1.00 65.69  ? 58  LEU E CA    1 
ATOM   3175  C  C     . LEU E  5  58  ? -60.263  -37.730 43.324  1.00 74.08  ? 58  LEU E C     1 
ATOM   3176  O  O     . LEU E  5  58  ? -59.724  -38.833 43.489  1.00 60.48  ? 58  LEU E O     1 
ATOM   3177  C  CB    . LEU E  5  58  ? -58.917  -36.819 41.487  1.00 62.10  ? 58  LEU E CB    1 
ATOM   3178  C  CG    . LEU E  5  58  ? -58.068  -35.744 40.835  1.00 63.99  ? 58  LEU E CG    1 
ATOM   3179  C  CD1   . LEU E  5  58  ? -57.372  -36.275 39.566  1.00 66.15  ? 58  LEU E CD1   1 
ATOM   3180  C  CD2   . LEU E  5  58  ? -58.873  -34.532 40.460  1.00 66.12  ? 58  LEU E CD2   1 
ATOM   3181  N  N     . ASP E  5  59  ? -61.530  -37.474 43.635  1.00 85.14  ? 59  ASP E N     1 
ATOM   3182  C  CA    . ASP E  5  59  ? -62.394  -38.465 44.278  1.00 92.22  ? 59  ASP E CA    1 
ATOM   3183  C  C     . ASP E  5  59  ? -62.782  -39.701 43.482  1.00 91.52  ? 59  ASP E C     1 
ATOM   3184  O  O     . ASP E  5  59  ? -62.829  -40.794 44.033  1.00 108.64 ? 59  ASP E O     1 
ATOM   3185  C  CB    . ASP E  5  59  ? -63.664  -37.818 44.805  1.00 89.13  ? 59  ASP E CB    1 
ATOM   3186  C  CG    . ASP E  5  59  ? -64.529  -38.799 45.553  1.00 90.26  ? 59  ASP E CG    1 
ATOM   3187  O  OD1   . ASP E  5  59  ? -63.979  -39.787 46.078  1.00 79.52  ? 59  ASP E OD1   1 
ATOM   3188  O  OD2   . ASP E  5  59  ? -65.756  -38.592 45.607  1.00 107.13 ? 59  ASP E OD2   1 
ATOM   3189  N  N     . ASP E  5  60  ? -63.101  -39.537 42.206  1.00 82.39  ? 60  ASP E N     1 
ATOM   3190  C  CA    . ASP E  5  60  ? -63.487  -40.681 41.400  1.00 89.56  ? 60  ASP E CA    1 
ATOM   3191  C  C     . ASP E  5  60  ? -62.700  -40.625 40.119  1.00 85.10  ? 60  ASP E C     1 
ATOM   3192  O  O     . ASP E  5  60  ? -63.231  -40.382 39.041  1.00 80.35  ? 60  ASP E O     1 
ATOM   3193  C  CB    . ASP E  5  60  ? -64.988  -40.680 41.137  1.00 100.30 ? 60  ASP E CB    1 
ATOM   3194  C  CG    . ASP E  5  60  ? -65.691  -41.837 41.804  1.00 108.76 ? 60  ASP E CG    1 
ATOM   3195  O  OD1   . ASP E  5  60  ? -65.075  -42.913 41.939  1.00 103.60 ? 60  ASP E OD1   1 
ATOM   3196  O  OD2   . ASP E  5  60  ? -66.864  -41.669 42.192  1.00 130.93 ? 60  ASP E OD2   1 
ATOM   3197  N  N     . ALA E  5  61  ? -61.398  -40.839 40.256  1.00 82.95  ? 61  ALA E N     1 
ATOM   3198  C  CA    . ALA E  5  61  ? -60.463  -40.690 39.152  1.00 74.42  ? 61  ALA E CA    1 
ATOM   3199  C  C     . ALA E  5  61  ? -60.607  -41.778 38.111  1.00 70.42  ? 61  ALA E C     1 
ATOM   3200  O  O     . ALA E  5  61  ? -60.964  -42.905 38.419  1.00 68.41  ? 61  ALA E O     1 
ATOM   3201  C  CB    . ALA E  5  61  ? -59.041  -40.651 39.674  1.00 77.89  ? 61  ALA E CB    1 
ATOM   3202  N  N     . GLU E  5  62  ? -60.321  -41.413 36.869  1.00 67.99  ? 62  GLU E N     1 
ATOM   3203  C  CA    . GLU E  5  62  ? -60.335  -42.341 35.756  1.00 72.91  ? 62  GLU E CA    1 
ATOM   3204  C  C     . GLU E  5  62  ? -59.102  -42.117 34.919  1.00 68.67  ? 62  GLU E C     1 
ATOM   3205  O  O     . GLU E  5  62  ? -58.607  -41.006 34.829  1.00 65.33  ? 62  GLU E O     1 
ATOM   3206  C  CB    . GLU E  5  62  ? -61.544  -42.088 34.869  1.00 86.14  ? 62  GLU E CB    1 
ATOM   3207  C  CG    . GLU E  5  62  ? -62.814  -42.804 35.277  1.00 94.59  ? 62  GLU E CG    1 
ATOM   3208  C  CD    . GLU E  5  62  ? -64.031  -42.255 34.567  1.00 101.53 ? 62  GLU E CD    1 
ATOM   3209  O  OE1   . GLU E  5  62  ? -63.889  -41.280 33.799  1.00 86.69  ? 62  GLU E OE1   1 
ATOM   3210  O  OE2   . GLU E  5  62  ? -65.134  -42.800 34.776  1.00 121.16 ? 62  GLU E OE2   1 
ATOM   3211  N  N     . GLU E  5  63  ? -58.630  -43.172 34.275  1.00 66.97  ? 63  GLU E N     1 
ATOM   3212  C  CA    . GLU E  5  63  ? -57.551  -43.057 33.322  1.00 65.75  ? 63  GLU E CA    1 
ATOM   3213  C  C     . GLU E  5  63  ? -58.196  -43.163 31.959  1.00 64.07  ? 63  GLU E C     1 
ATOM   3214  O  O     . GLU E  5  63  ? -58.847  -44.150 31.654  1.00 69.36  ? 63  GLU E O     1 
ATOM   3215  C  CB    . GLU E  5  63  ? -56.556  -44.199 33.520  1.00 66.98  ? 63  GLU E CB    1 
ATOM   3216  C  CG    . GLU E  5  63  ? -55.130  -43.780 33.792  1.00 70.29  ? 63  GLU E CG    1 
ATOM   3217  C  CD    . GLU E  5  63  ? -54.229  -44.972 34.017  1.00 76.27  ? 63  GLU E CD    1 
ATOM   3218  O  OE1   . GLU E  5  63  ? -53.618  -45.064 35.095  1.00 76.68  ? 63  GLU E OE1   1 
ATOM   3219  O  OE2   . GLU E  5  63  ? -54.139  -45.827 33.118  1.00 78.21  ? 63  GLU E OE2   1 
ATOM   3220  N  N     . ILE E  5  64  ? -58.008  -42.148 31.133  1.00 64.12  ? 64  ILE E N     1 
ATOM   3221  C  CA    . ILE E  5  64  ? -58.593  -42.139 29.810  1.00 63.37  ? 64  ILE E CA    1 
ATOM   3222  C  C     . ILE E  5  64  ? -57.481  -42.308 28.807  1.00 65.99  ? 64  ILE E C     1 
ATOM   3223  O  O     . ILE E  5  64  ? -56.551  -41.516 28.783  1.00 73.01  ? 64  ILE E O     1 
ATOM   3224  C  CB    . ILE E  5  64  ? -59.264  -40.795 29.522  1.00 60.26  ? 64  ILE E CB    1 
ATOM   3225  C  CG1   . ILE E  5  64  ? -60.278  -40.467 30.605  1.00 65.21  ? 64  ILE E CG1   1 
ATOM   3226  C  CG2   . ILE E  5  64  ? -59.913  -40.812 28.156  1.00 62.26  ? 64  ILE E CG2   1 
ATOM   3227  C  CD1   . ILE E  5  64  ? -60.502  -38.988 30.783  1.00 66.90  ? 64  ILE E CD1   1 
ATOM   3228  N  N     . HIS E  5  65  ? -57.565  -43.323 27.962  1.00 67.20  ? 65  HIS E N     1 
ATOM   3229  C  CA    . HIS E  5  65  ? -56.521  -43.501 26.977  1.00 78.88  ? 65  HIS E CA    1 
ATOM   3230  C  C     . HIS E  5  65  ? -57.035  -43.155 25.606  1.00 84.84  ? 65  HIS E C     1 
ATOM   3231  O  O     . HIS E  5  65  ? -58.037  -43.685 25.162  1.00 102.01 ? 65  HIS E O     1 
ATOM   3232  C  CB    . HIS E  5  65  ? -56.006  -44.925 27.004  1.00 84.87  ? 65  HIS E CB    1 
ATOM   3233  C  CG    . HIS E  5  65  ? -55.461  -45.339 28.331  1.00 96.32  ? 65  HIS E CG    1 
ATOM   3234  N  ND1   . HIS E  5  65  ? -54.155  -45.115 28.700  1.00 101.72 ? 65  HIS E ND1   1 
ATOM   3235  C  CD2   . HIS E  5  65  ? -56.044  -45.966 29.377  1.00 98.10  ? 65  HIS E CD2   1 
ATOM   3236  C  CE1   . HIS E  5  65  ? -53.958  -45.582 29.917  1.00 98.52  ? 65  HIS E CE1   1 
ATOM   3237  N  NE2   . HIS E  5  65  ? -55.089  -46.105 30.350  1.00 97.36  ? 65  HIS E NE2   1 
ATOM   3238  N  N     . SER E  5  66  ? -56.344  -42.239 24.946  1.00 97.69  ? 66  SER E N     1 
ATOM   3239  C  CA    . SER E  5  66  ? -56.802  -41.705 23.679  1.00 107.62 ? 66  SER E CA    1 
ATOM   3240  C  C     . SER E  5  66  ? -56.871  -42.723 22.546  1.00 118.63 ? 66  SER E C     1 
ATOM   3241  O  O     . SER E  5  66  ? -57.819  -42.711 21.765  1.00 120.49 ? 66  SER E O     1 
ATOM   3242  C  CB    . SER E  5  66  ? -55.963  -40.492 23.284  1.00 103.86 ? 66  SER E CB    1 
ATOM   3243  O  OG    . SER E  5  66  ? -56.231  -39.396 24.147  1.00 98.76  ? 66  SER E OG    1 
ATOM   3244  N  N     . LYS E  5  67  ? -55.870  -43.588 22.427  1.00 114.00 ? 67  LYS E N     1 
ATOM   3245  C  CA    . LYS E  5  67  ? -55.947  -44.628 21.414  1.00 125.95 ? 67  LYS E CA    1 
ATOM   3246  C  C     . LYS E  5  67  ? -57.069  -45.620 21.698  1.00 121.85 ? 67  LYS E C     1 
ATOM   3247  O  O     . LYS E  5  67  ? -57.866  -45.938 20.826  1.00 116.72 ? 67  LYS E O     1 
ATOM   3248  C  CB    . LYS E  5  67  ? -54.616  -45.375 21.333  1.00 139.79 ? 67  LYS E CB    1 
ATOM   3249  C  CG    . LYS E  5  67  ? -54.491  -46.322 20.147  1.00 149.83 ? 67  LYS E CG    1 
ATOM   3250  C  CD    . LYS E  5  67  ? -53.062  -46.382 19.629  1.00 147.60 ? 67  LYS E CD    1 
ATOM   3251  C  CE    . LYS E  5  67  ? -52.885  -47.492 18.607  1.00 146.92 ? 67  LYS E CE    1 
ATOM   3252  N  NZ    . LYS E  5  67  ? -51.941  -48.542 19.076  1.00 144.30 ? 67  LYS E NZ    1 
ATOM   3253  N  N     . THR E  5  68  ? -57.133  -46.080 22.941  1.00 116.90 ? 68  THR E N     1 
ATOM   3254  C  CA    . THR E  5  68  ? -58.125  -47.058 23.379  1.00 111.85 ? 68  THR E CA    1 
ATOM   3255  C  C     . THR E  5  68  ? -59.562  -46.589 23.412  1.00 111.94 ? 68  THR E C     1 
ATOM   3256  O  O     . THR E  5  68  ? -60.471  -47.342 23.105  1.00 116.98 ? 68  THR E O     1 
ATOM   3257  C  CB    . THR E  5  68  ? -57.802  -47.616 24.765  1.00 111.58 ? 68  THR E CB    1 
ATOM   3258  O  OG1   . THR E  5  68  ? -56.449  -48.074 24.788  1.00 112.03 ? 68  THR E OG1   1 
ATOM   3259  C  CG2   . THR E  5  68  ? -58.713  -48.764 25.076  1.00 118.43 ? 68  THR E CG2   1 
ATOM   3260  N  N     . LYS E  5  69  ? -59.774  -45.350 23.830  1.00 118.55 ? 69  LYS E N     1 
ATOM   3261  C  CA    . LYS E  5  69  ? -61.121  -44.874 24.070  1.00 120.52 ? 69  LYS E CA    1 
ATOM   3262  C  C     . LYS E  5  69  ? -61.921  -45.769 25.006  1.00 115.67 ? 69  LYS E C     1 
ATOM   3263  O  O     . LYS E  5  69  ? -63.085  -46.070 24.762  1.00 104.43 ? 69  LYS E O     1 
ATOM   3264  C  CB    . LYS E  5  69  ? -61.922  -44.856 22.773  1.00 125.40 ? 69  LYS E CB    1 
ATOM   3265  C  CG    . LYS E  5  69  ? -61.749  -43.579 21.967  1.00 124.47 ? 69  LYS E CG    1 
ATOM   3266  C  CD    . LYS E  5  69  ? -62.950  -43.309 21.078  1.00 127.78 ? 69  LYS E CD    1 
ATOM   3267  C  CE    . LYS E  5  69  ? -63.012  -44.282 19.913  1.00 127.89 ? 69  LYS E CE    1 
ATOM   3268  N  NZ    . LYS E  5  69  ? -63.851  -43.763 18.798  1.00 125.09 ? 69  LYS E NZ    1 
ATOM   3269  N  N     . SER E  5  70  ? -61.260  -46.204 26.073  1.00 115.53 ? 70  SER E N     1 
ATOM   3270  C  CA    . SER E  5  70  ? -61.857  -46.923 27.182  1.00 109.36 ? 70  SER E CA    1 
ATOM   3271  C  C     . SER E  5  70  ? -61.184  -46.440 28.440  1.00 96.44  ? 70  SER E C     1 
ATOM   3272  O  O     . SER E  5  70  ? -60.080  -45.926 28.350  1.00 101.68 ? 70  SER E O     1 
ATOM   3273  C  CB    . SER E  5  70  ? -61.698  -48.432 27.009  1.00 110.39 ? 70  SER E CB    1 
ATOM   3274  O  OG    . SER E  5  70  ? -62.245  -49.140 28.107  1.00 112.67 ? 70  SER E OG    1 
ATOM   3275  N  N     . ARG E  5  71  ? -61.830  -46.547 29.593  1.00 83.13  ? 71  ARG E N     1 
ATOM   3276  C  CA    . ARG E  5  71  ? -61.293  -45.959 30.812  1.00 79.20  ? 71  ARG E CA    1 
ATOM   3277  C  C     . ARG E  5  71  ? -60.932  -46.960 31.894  1.00 81.20  ? 71  ARG E C     1 
ATOM   3278  O  O     . ARG E  5  71  ? -61.587  -47.986 32.044  1.00 95.06  ? 71  ARG E O     1 
ATOM   3279  C  CB    . ARG E  5  71  ? -62.438  -45.076 31.294  1.00 73.10  ? 71  ARG E CB    1 
ATOM   3280  C  CG    . ARG E  5  71  ? -63.047  -44.235 30.197  1.00 71.57  ? 71  ARG E CG    1 
ATOM   3281  C  CD    . ARG E  5  71  ? -63.439  -42.857 30.679  1.00 64.39  ? 71  ARG E CD    1 
ATOM   3282  N  NE    . ARG E  5  71  ? -63.610  -41.942 29.560  1.00 57.99  ? 71  ARG E NE    1 
ATOM   3283  C  CZ    . ARG E  5  71  ? -63.967  -40.674 29.686  1.00 60.56  ? 71  ARG E CZ    1 
ATOM   3284  N  NH1   . ARG E  5  71  ? -64.197  -40.174 30.885  1.00 61.86  ? 71  ARG E NH1   1 
ATOM   3285  N  NH2   . ARG E  5  71  ? -64.096  -39.911 28.616  1.00 60.33  ? 71  ARG E NH2   1 
ATOM   3286  N  N     . LYS E  5  72  ? -59.876  -46.649 32.638  1.00 78.66  ? 72  LYS E N     1 
ATOM   3287  C  CA    . LYS E  5  72  ? -59.464  -47.457 33.771  1.00 78.33  ? 72  LYS E CA    1 
ATOM   3288  C  C     . LYS E  5  72  ? -59.827  -46.702 35.032  1.00 75.07  ? 72  LYS E C     1 
ATOM   3289  O  O     . LYS E  5  72  ? -59.490  -45.538 35.185  1.00 66.23  ? 72  LYS E O     1 
ATOM   3290  C  CB    . LYS E  5  72  ? -57.961  -47.724 33.724  1.00 89.32  ? 72  LYS E CB    1 
ATOM   3291  C  CG    . LYS E  5  72  ? -57.343  -48.105 35.059  1.00 95.87  ? 72  LYS E CG    1 
ATOM   3292  C  CD    . LYS E  5  72  ? -56.308  -49.204 34.913  1.00 92.56  ? 72  LYS E CD    1 
ATOM   3293  C  CE    . LYS E  5  72  ? -55.777  -49.638 36.265  1.00 90.30  ? 72  LYS E CE    1 
ATOM   3294  N  NZ    . LYS E  5  72  ? -54.320  -49.927 36.227  1.00 95.56  ? 72  LYS E NZ    1 
ATOM   3295  N  N     . GLN E  5  73  ? -60.528  -47.379 35.930  1.00 80.13  ? 73  GLN E N     1 
ATOM   3296  C  CA    . GLN E  5  73  ? -61.076  -46.743 37.139  1.00 78.54  ? 73  GLN E CA    1 
ATOM   3297  C  C     . GLN E  5  73  ? -60.016  -46.865 38.211  1.00 77.16  ? 73  GLN E C     1 
ATOM   3298  O  O     . GLN E  5  73  ? -59.351  -47.892 38.309  1.00 74.55  ? 73  GLN E O     1 
ATOM   3299  C  CB    . GLN E  5  73  ? -62.359  -47.403 37.621  1.00 76.88  ? 73  GLN E CB    1 
ATOM   3300  C  CG    . GLN E  5  73  ? -63.507  -47.298 36.638  1.00 80.43  ? 73  GLN E CG    1 
ATOM   3301  C  CD    . GLN E  5  73  ? -63.777  -45.883 36.243  1.00 87.96  ? 73  GLN E CD    1 
ATOM   3302  O  OE1   . GLN E  5  73  ? -63.938  -45.024 37.133  1.00 94.15  ? 73  GLN E OE1   1 
ATOM   3303  N  NE2   . GLN E  5  73  ? -63.861  -45.619 34.921  1.00 91.64  ? 73  GLN E NE2   1 
ATOM   3304  N  N     . LEU E  5  74  ? -59.865  -45.812 39.003  1.00 73.96  ? 74  LEU E N     1 
ATOM   3305  C  CA    . LEU E  5  74  ? -58.794  -45.738 40.005  1.00 69.05  ? 74  LEU E CA    1 
ATOM   3306  C  C     . LEU E  5  74  ? -59.311  -45.585 41.420  1.00 64.73  ? 74  LEU E C     1 
ATOM   3307  O  O     . LEU E  5  74  ? -58.777  -46.155 42.358  1.00 59.96  ? 74  LEU E O     1 
ATOM   3308  C  CB    . LEU E  5  74  ? -57.857  -44.581 39.625  1.00 71.13  ? 74  LEU E CB    1 
ATOM   3309  C  CG    . LEU E  5  74  ? -57.389  -44.514 38.147  1.00 72.39  ? 74  LEU E CG    1 
ATOM   3310  C  CD1   . LEU E  5  74  ? -56.962  -43.183 37.537  1.00 72.37  ? 74  LEU E CD1   1 
ATOM   3311  C  CD2   . LEU E  5  74  ? -56.307  -45.511 37.939  1.00 73.45  ? 74  LEU E CD2   1 
ATOM   3312  N  N     . GLY E  5  75  ? -60.383  -44.836 41.616  1.00 64.87  ? 75  GLY E N     1 
ATOM   3313  C  CA    . GLY E  5  75  ? -60.820  -44.596 43.002  1.00 65.38  ? 75  GLY E CA    1 
ATOM   3314  C  C     . GLY E  5  75  ? -60.326  -43.239 43.357  1.00 65.00  ? 75  GLY E C     1 
ATOM   3315  O  O     . GLY E  5  75  ? -60.300  -42.331 42.511  1.00 66.19  ? 75  GLY E O     1 
ATOM   3316  N  N     . ARG E  5  76  ? -59.939  -43.087 44.613  1.00 67.53  ? 76  ARG E N     1 
ATOM   3317  C  CA    . ARG E  5  76  ? -59.446  -41.775 45.065  1.00 68.41  ? 76  ARG E CA    1 
ATOM   3318  C  C     . ARG E  5  76  ? -57.933  -41.718 44.938  1.00 70.56  ? 76  ARG E C     1 
ATOM   3319  O  O     . ARG E  5  76  ? -57.200  -42.561 45.521  1.00 79.02  ? 76  ARG E O     1 
ATOM   3320  C  CB    . ARG E  5  76  ? -59.829  -41.545 46.497  1.00 73.91  ? 76  ARG E CB    1 
ATOM   3321  C  CG    . ARG E  5  76  ? -59.533  -40.136 46.988  1.00 73.09  ? 76  ARG E CG    1 
ATOM   3322  C  CD    . ARG E  5  76  ? -59.974  -40.057 48.432  1.00 78.69  ? 76  ARG E CD    1 
ATOM   3323  N  NE    . ARG E  5  76  ? -61.403  -39.873 48.371  1.00 80.90  ? 76  ARG E NE    1 
ATOM   3324  C  CZ    . ARG E  5  76  ? -62.112  -39.436 49.384  1.00 88.36  ? 76  ARG E CZ    1 
ATOM   3325  N  NH1   . ARG E  5  76  ? -63.408  -39.281 49.219  1.00 99.79  ? 76  ARG E NH1   1 
ATOM   3326  N  NH2   . ARG E  5  76  ? -61.559  -39.221 50.564  1.00 89.04  ? 76  ARG E NH2   1 
ATOM   3327  N  N     . ILE E  5  77  ? -57.470  -40.673 44.252  1.00 63.36  ? 77  ILE E N     1 
ATOM   3328  C  CA    . ILE E  5  77  ? -56.057  -40.563 43.920  1.00 55.51  ? 77  ILE E CA    1 
ATOM   3329  C  C     . ILE E  5  77  ? -55.513  -39.199 44.281  1.00 55.29  ? 77  ILE E C     1 
ATOM   3330  O  O     . ILE E  5  77  ? -56.229  -38.215 44.307  1.00 56.95  ? 77  ILE E O     1 
ATOM   3331  C  CB    . ILE E  5  77  ? -55.811  -40.862 42.450  1.00 53.12  ? 77  ILE E CB    1 
ATOM   3332  C  CG1   . ILE E  5  77  ? -56.160  -39.679 41.568  1.00 51.74  ? 77  ILE E CG1   1 
ATOM   3333  C  CG2   . ILE E  5  77  ? -56.581  -42.117 42.059  1.00 54.41  ? 77  ILE E CG2   1 
ATOM   3334  C  CD1   . ILE E  5  77  ? -55.800  -39.909 40.111  1.00 57.02  ? 77  ILE E CD1   1 
ATOM   3335  N  N     . MET E  5  78  ? -54.232  -39.165 44.612  1.00 56.74  ? 78  MET E N     1 
ATOM   3336  C  CA    . MET E  5  78  ? -53.469  -37.928 44.585  1.00 53.60  ? 78  MET E CA    1 
ATOM   3337  C  C     . MET E  5  78  ? -52.574  -37.923 43.356  1.00 50.37  ? 78  MET E C     1 
ATOM   3338  O  O     . MET E  5  78  ? -51.856  -38.884 43.086  1.00 42.35  ? 78  MET E O     1 
ATOM   3339  C  CB    . MET E  5  78  ? -52.613  -37.794 45.800  1.00 58.38  ? 78  MET E CB    1 
ATOM   3340  C  CG    . MET E  5  78  ? -52.257  -36.353 46.071  1.00 63.95  ? 78  MET E CG    1 
ATOM   3341  S  SD    . MET E  5  78  ? -50.539  -36.072 45.823  1.00 74.22  ? 78  MET E SD    1 
ATOM   3342  C  CE    . MET E  5  78  ? -49.883  -36.943 47.222  1.00 67.38  ? 78  MET E CE    1 
ATOM   3343  N  N     . LEU E  5  79  ? -52.711  -36.866 42.569  1.00 49.75  ? 79  LEU E N     1 
ATOM   3344  C  CA    . LEU E  5  79  ? -51.988  -36.730 41.328  1.00 48.26  ? 79  LEU E CA    1 
ATOM   3345  C  C     . LEU E  5  79  ? -51.013  -35.613 41.538  1.00 51.53  ? 79  LEU E C     1 
ATOM   3346  O  O     . LEU E  5  79  ? -51.402  -34.499 41.844  1.00 55.33  ? 79  LEU E O     1 
ATOM   3347  C  CB    . LEU E  5  79  ? -52.949  -36.376 40.200  1.00 46.84  ? 79  LEU E CB    1 
ATOM   3348  C  CG    . LEU E  5  79  ? -52.327  -36.027 38.852  1.00 45.84  ? 79  LEU E CG    1 
ATOM   3349  C  CD1   . LEU E  5  79  ? -52.375  -37.220 37.922  1.00 47.62  ? 79  LEU E CD1   1 
ATOM   3350  C  CD2   . LEU E  5  79  ? -53.022  -34.841 38.221  1.00 45.74  ? 79  LEU E CD2   1 
ATOM   3351  N  N     . LYS E  5  80  ? -49.735  -35.911 41.389  1.00 51.80  ? 80  LYS E N     1 
ATOM   3352  C  CA    . LYS E  5  80  ? -48.719  -34.929 41.672  1.00 52.49  ? 80  LYS E CA    1 
ATOM   3353  C  C     . LYS E  5  80  ? -48.694  -33.865 40.598  1.00 49.43  ? 80  LYS E C     1 
ATOM   3354  O  O     . LYS E  5  80  ? -48.874  -34.146 39.426  1.00 52.35  ? 80  LYS E O     1 
ATOM   3355  C  CB    . LYS E  5  80  ? -47.374  -35.607 41.865  1.00 57.58  ? 80  LYS E CB    1 
ATOM   3356  C  CG    . LYS E  5  80  ? -47.353  -36.465 43.114  1.00 63.97  ? 80  LYS E CG    1 
ATOM   3357  C  CD    . LYS E  5  80  ? -46.011  -36.436 43.812  1.00 76.79  ? 80  LYS E CD    1 
ATOM   3358  C  CE    . LYS E  5  80  ? -45.566  -35.025 44.108  1.00 83.23  ? 80  LYS E CE    1 
ATOM   3359  N  NZ    . LYS E  5  80  ? -44.094  -34.907 43.973  1.00 97.02  ? 80  LYS E NZ    1 
ATOM   3360  N  N     . GLY E  5  81  ? -48.462  -32.634 41.029  1.00 47.75  ? 81  GLY E N     1 
ATOM   3361  C  CA    . GLY E  5  81  ? -48.658  -31.446 40.230  1.00 51.35  ? 81  GLY E CA    1 
ATOM   3362  C  C     . GLY E  5  81  ? -47.774  -31.320 39.022  1.00 56.95  ? 81  GLY E C     1 
ATOM   3363  O  O     . GLY E  5  81  ? -48.103  -30.615 38.081  1.00 63.04  ? 81  GLY E O     1 
ATOM   3364  N  N     . ASP E  5  82  ? -46.635  -31.989 39.063  1.00 61.69  ? 82  ASP E N     1 
ATOM   3365  C  CA    . ASP E  5  82  ? -45.591  -31.814 38.050  1.00 65.15  ? 82  ASP E CA    1 
ATOM   3366  C  C     . ASP E  5  82  ? -46.177  -32.193 36.707  1.00 61.35  ? 82  ASP E C     1 
ATOM   3367  O  O     . ASP E  5  82  ? -45.859  -31.607 35.686  1.00 61.29  ? 82  ASP E O     1 
ATOM   3368  C  CB    . ASP E  5  82  ? -44.350  -32.690 38.301  1.00 80.44  ? 82  ASP E CB    1 
ATOM   3369  C  CG    . ASP E  5  82  ? -44.118  -33.018 39.766  1.00 89.93  ? 82  ASP E CG    1 
ATOM   3370  O  OD1   . ASP E  5  82  ? -44.418  -32.165 40.620  1.00 99.77  ? 82  ASP E OD1   1 
ATOM   3371  O  OD2   . ASP E  5  82  ? -43.660  -34.139 40.059  1.00 77.17  ? 82  ASP E OD2   1 
ATOM   3372  N  N     . ASN E  5  83  ? -47.009  -33.222 36.737  1.00 55.91  ? 83  ASN E N     1 
ATOM   3373  C  CA    . ASN E  5  83  ? -47.677  -33.774 35.557  1.00 52.04  ? 83  ASN E CA    1 
ATOM   3374  C  C     . ASN E  5  83  ? -48.678  -32.875 34.844  1.00 50.23  ? 83  ASN E C     1 
ATOM   3375  O  O     . ASN E  5  83  ? -48.818  -32.954 33.635  1.00 48.75  ? 83  ASN E O     1 
ATOM   3376  C  CB    . ASN E  5  83  ? -48.352  -35.087 35.906  1.00 48.33  ? 83  ASN E CB    1 
ATOM   3377  C  CG    . ASN E  5  83  ? -47.510  -35.928 36.812  1.00 55.35  ? 83  ASN E CG    1 
ATOM   3378  O  OD1   . ASN E  5  83  ? -46.557  -36.555 36.381  1.00 65.96  ? 83  ASN E OD1   1 
ATOM   3379  N  ND2   . ASN E  5  83  ? -47.834  -35.911 38.088  1.00 59.57  ? 83  ASN E ND2   1 
ATOM   3380  N  N     . ILE E  5  84  ? -49.424  -32.077 35.590  1.00 49.90  ? 84  ILE E N     1 
ATOM   3381  C  CA    . ILE E  5  84  ? -50.525  -31.333 35.005  1.00 54.06  ? 84  ILE E CA    1 
ATOM   3382  C  C     . ILE E  5  84  ? -50.081  -30.338 33.942  1.00 56.30  ? 84  ILE E C     1 
ATOM   3383  O  O     . ILE E  5  84  ? -49.167  -29.551 34.145  1.00 59.83  ? 84  ILE E O     1 
ATOM   3384  C  CB    . ILE E  5  84  ? -51.291  -30.565 36.096  1.00 58.16  ? 84  ILE E CB    1 
ATOM   3385  C  CG1   . ILE E  5  84  ? -51.914  -31.528 37.092  1.00 55.40  ? 84  ILE E CG1   1 
ATOM   3386  C  CG2   . ILE E  5  84  ? -52.394  -29.724 35.499  1.00 63.43  ? 84  ILE E CG2   1 
ATOM   3387  C  CD1   . ILE E  5  84  ? -52.298  -30.872 38.390  1.00 56.89  ? 84  ILE E CD1   1 
ATOM   3388  N  N     . THR E  5  85  ? -50.774  -30.383 32.810  1.00 60.47  ? 85  THR E N     1 
ATOM   3389  C  CA    . THR E  5  85  ? -50.653  -29.402 31.743  1.00 62.20  ? 85  THR E CA    1 
ATOM   3390  C  C     . THR E  5  85  ? -51.857  -28.451 31.728  1.00 60.10  ? 85  THR E C     1 
ATOM   3391  O  O     . THR E  5  85  ? -51.715  -27.215 31.569  1.00 51.66  ? 85  THR E O     1 
ATOM   3392  C  CB    . THR E  5  85  ? -50.354  -30.086 30.385  1.00 59.45  ? 85  THR E CB    1 
ATOM   3393  O  OG1   . THR E  5  85  ? -48.935  -30.253 30.300  1.00 60.13  ? 85  THR E OG1   1 
ATOM   3394  C  CG2   . THR E  5  85  ? -50.784  -29.293 29.188  1.00 58.62  ? 85  THR E CG2   1 
ATOM   3395  N  N     . LEU E  5  86  ? -53.029  -29.048 31.854  1.00 60.69  ? 86  LEU E N     1 
ATOM   3396  C  CA    . LEU E  5  86  ? -54.251  -28.271 31.733  1.00 63.65  ? 86  LEU E CA    1 
ATOM   3397  C  C     . LEU E  5  86  ? -55.414  -28.905 32.457  1.00 63.40  ? 86  LEU E C     1 
ATOM   3398  O  O     . LEU E  5  86  ? -55.605  -30.135 32.402  1.00 64.66  ? 86  LEU E O     1 
ATOM   3399  C  CB    . LEU E  5  86  ? -54.562  -28.089 30.255  1.00 61.17  ? 86  LEU E CB    1 
ATOM   3400  C  CG    . LEU E  5  86  ? -55.872  -27.378 29.937  1.00 61.33  ? 86  LEU E CG    1 
ATOM   3401  C  CD1   . LEU E  5  86  ? -55.765  -26.526 28.668  1.00 64.99  ? 86  LEU E CD1   1 
ATOM   3402  C  CD2   . LEU E  5  86  ? -57.018  -28.366 29.767  1.00 60.08  ? 86  LEU E CD2   1 
ATOM   3403  N  N     . LEU E  5  87  ? -56.211  -28.044 33.073  1.00 63.43  ? 87  LEU E N     1 
ATOM   3404  C  CA    . LEU E  5  87  ? -57.467  -28.463 33.702  1.00 66.53  ? 87  LEU E CA    1 
ATOM   3405  C  C     . LEU E  5  87  ? -58.729  -28.018 32.950  1.00 69.91  ? 87  LEU E C     1 
ATOM   3406  O  O     . LEU E  5  87  ? -58.880  -26.847 32.653  1.00 61.33  ? 87  LEU E O     1 
ATOM   3407  C  CB    . LEU E  5  87  ? -57.522  -27.949 35.131  1.00 62.55  ? 87  LEU E CB    1 
ATOM   3408  C  CG    . LEU E  5  87  ? -56.344  -28.396 36.010  1.00 61.32  ? 87  LEU E CG    1 
ATOM   3409  C  CD1   . LEU E  5  87  ? -56.362  -27.860 37.425  1.00 65.52  ? 87  LEU E CD1   1 
ATOM   3410  C  CD2   . LEU E  5  87  ? -56.485  -29.873 36.123  1.00 59.45  ? 87  LEU E CD2   1 
ATOM   3411  N  N     . GLN E  5  88  ? -59.669  -28.952 32.787  1.00 77.78  ? 88  GLN E N     1 
ATOM   3412  C  CA    . GLN E  5  88  ? -60.861  -28.833 31.935  1.00 78.32  ? 88  GLN E CA    1 
ATOM   3413  C  C     . GLN E  5  88  ? -62.122  -29.193 32.768  1.00 80.01  ? 88  GLN E C     1 
ATOM   3414  O  O     . GLN E  5  88  ? -62.003  -29.712 33.876  1.00 86.49  ? 88  GLN E O     1 
ATOM   3415  C  CB    . GLN E  5  88  ? -60.619  -29.806 30.788  1.00 74.63  ? 88  GLN E CB    1 
ATOM   3416  C  CG    . GLN E  5  88  ? -61.603  -29.806 29.652  1.00 72.49  ? 88  GLN E CG    1 
ATOM   3417  C  CD    . GLN E  5  88  ? -61.151  -30.691 28.504  1.00 73.97  ? 88  GLN E CD    1 
ATOM   3418  O  OE1   . GLN E  5  88  ? -59.982  -30.901 28.315  1.00 87.29  ? 88  GLN E OE1   1 
ATOM   3419  N  NE2   . GLN E  5  88  ? -62.067  -31.207 27.718  1.00 78.92  ? 88  GLN E NE2   1 
ATOM   3420  N  N     . SER E  5  89  ? -63.316  -28.937 32.250  1.00 79.73  ? 89  SER E N     1 
ATOM   3421  C  CA    . SER E  5  89  ? -64.537  -29.405 32.900  1.00 82.25  ? 89  SER E CA    1 
ATOM   3422  C  C     . SER E  5  89  ? -65.325  -30.538 32.231  1.00 93.79  ? 89  SER E C     1 
ATOM   3423  O  O     . SER E  5  89  ? -65.187  -30.812 31.053  1.00 87.62  ? 89  SER E O     1 
ATOM   3424  C  CB    . SER E  5  89  ? -65.427  -28.212 33.119  1.00 85.60  ? 89  SER E CB    1 
ATOM   3425  O  OG    . SER E  5  89  ? -65.110  -27.678 34.378  1.00 92.10  ? 89  SER E OG    1 
ATOM   3426  N  N     . VAL E  5  90  ? -66.231  -31.125 33.014  1.00 120.04 ? 90  VAL E N     1 
ATOM   3427  C  CA    . VAL E  5  90  ? -66.981  -32.368 32.744  1.00 125.25 ? 90  VAL E CA    1 
ATOM   3428  C  C     . VAL E  5  90  ? -66.095  -33.396 32.037  1.00 117.06 ? 90  VAL E C     1 
ATOM   3429  O  O     . VAL E  5  90  ? -66.079  -33.470 30.825  1.00 118.41 ? 90  VAL E O     1 
ATOM   3430  C  CB    . VAL E  5  90  ? -68.423  -32.129 32.163  1.00 128.37 ? 90  VAL E CB    1 
ATOM   3431  C  CG1   . VAL E  5  90  ? -68.433  -31.335 30.850  1.00 125.81 ? 90  VAL E CG1   1 
ATOM   3432  C  CG2   . VAL E  5  90  ? -69.202  -33.443 32.028  1.00 126.65 ? 90  VAL E CG2   1 
ATOM   3433  N  N     . LEU F  6  3   ? -66.249  -31.455 53.602  1.00 132.76 ? 3   LEU F N     1 
ATOM   3434  C  CA    . LEU F  6  3   ? -65.001  -32.248 53.521  1.00 131.10 ? 3   LEU F CA    1 
ATOM   3435  C  C     . LEU F  6  3   ? -64.070  -31.737 52.394  1.00 132.77 ? 3   LEU F C     1 
ATOM   3436  O  O     . LEU F  6  3   ? -64.158  -32.365 51.330  1.00 148.08 ? 3   LEU F O     1 
ATOM   3437  C  CB    . LEU F  6  3   ? -65.351  -33.732 53.376  1.00 119.88 ? 3   LEU F CB    1 
ATOM   3438  N  N     . PRO F  6  4   ? -63.232  -30.646 52.560  1.00 120.98 ? 4   PRO F N     1 
ATOM   3439  C  CA    . PRO F  6  4   ? -62.129  -30.482 51.566  1.00 113.24 ? 4   PRO F CA    1 
ATOM   3440  C  C     . PRO F  6  4   ? -60.845  -31.241 51.923  1.00 95.56  ? 4   PRO F C     1 
ATOM   3441  O  O     . PRO F  6  4   ? -60.223  -30.889 52.920  1.00 97.76  ? 4   PRO F O     1 
ATOM   3442  C  CB    . PRO F  6  4   ? -61.844  -28.971 51.565  1.00 109.95 ? 4   PRO F CB    1 
ATOM   3443  C  CG    . PRO F  6  4   ? -62.136  -28.536 52.942  1.00 115.33 ? 4   PRO F CG    1 
ATOM   3444  C  CD    . PRO F  6  4   ? -63.164  -29.507 53.503  1.00 120.21 ? 4   PRO F CD    1 
ATOM   3445  N  N     . LEU F  6  5   ? -60.493  -32.287 51.168  1.00 80.92  ? 5   LEU F N     1 
ATOM   3446  C  CA    . LEU F  6  5   ? -59.521  -33.286 51.629  1.00 74.96  ? 5   LEU F CA    1 
ATOM   3447  C  C     . LEU F  6  5   ? -58.224  -33.137 50.838  1.00 75.32  ? 5   LEU F C     1 
ATOM   3448  O  O     . LEU F  6  5   ? -58.140  -33.520 49.663  1.00 73.00  ? 5   LEU F O     1 
ATOM   3449  C  CB    . LEU F  6  5   ? -60.040  -34.695 51.503  1.00 63.97  ? 5   LEU F CB    1 
ATOM   3450  C  CG    . LEU F  6  5   ? -59.030  -35.724 51.969  1.00 59.39  ? 5   LEU F CG    1 
ATOM   3451  C  CD1   . LEU F  6  5   ? -58.843  -35.675 53.477  1.00 62.49  ? 5   LEU F CD1   1 
ATOM   3452  C  CD2   . LEU F  6  5   ? -59.448  -37.059 51.430  1.00 58.76  ? 5   LEU F CD2   1 
ATOM   3453  N  N     . ASN F  6  6   ? -57.244  -32.552 51.518  1.00 70.03  ? 6   ASN F N     1 
ATOM   3454  C  CA    . ASN F  6  6   ? -56.107  -32.145 50.829  1.00 66.10  ? 6   ASN F CA    1 
ATOM   3455  C  C     . ASN F  6  6   ? -55.046  -33.212 50.777  1.00 65.02  ? 6   ASN F C     1 
ATOM   3456  O  O     . ASN F  6  6   ? -55.126  -34.228 51.448  1.00 67.94  ? 6   ASN F O     1 
ATOM   3457  C  CB    . ASN F  6  6   ? -55.657  -30.879 51.501  1.00 70.10  ? 6   ASN F CB    1 
ATOM   3458  C  CG    . ASN F  6  6   ? -56.581  -29.747 51.186  1.00 71.23  ? 6   ASN F CG    1 
ATOM   3459  O  OD1   . ASN F  6  6   ? -57.336  -29.767 50.194  1.00 68.58  ? 6   ASN F OD1   1 
ATOM   3460  N  ND2   . ASN F  6  6   ? -56.437  -28.684 51.962  1.00 80.95  ? 6   ASN F ND2   1 
ATOM   3461  N  N     . PRO F  6  7   ? -53.994  -32.984 50.007  1.00 60.91  ? 7   PRO F N     1 
ATOM   3462  C  CA    . PRO F  6  7   ? -53.011  -34.041 49.774  1.00 57.90  ? 7   PRO F CA    1 
ATOM   3463  C  C     . PRO F  6  7   ? -52.242  -34.567 50.990  1.00 60.43  ? 7   PRO F C     1 
ATOM   3464  O  O     . PRO F  6  7   ? -52.107  -35.777 51.107  1.00 55.58  ? 7   PRO F O     1 
ATOM   3465  C  CB    . PRO F  6  7   ? -52.041  -33.382 48.805  1.00 63.12  ? 7   PRO F CB    1 
ATOM   3466  C  CG    . PRO F  6  7   ? -52.874  -32.421 48.056  1.00 63.73  ? 7   PRO F CG    1 
ATOM   3467  C  CD    . PRO F  6  7   ? -53.830  -31.873 49.061  1.00 64.82  ? 7   PRO F CD    1 
ATOM   3468  N  N     . LYS F  6  8   ? -51.742  -33.711 51.872  1.00 65.07  ? 8   LYS F N     1 
ATOM   3469  C  CA    . LYS F  6  8   ? -50.990  -34.206 53.022  1.00 72.26  ? 8   LYS F CA    1 
ATOM   3470  C  C     . LYS F  6  8   ? -51.869  -35.015 53.954  1.00 66.87  ? 8   LYS F C     1 
ATOM   3471  O  O     . LYS F  6  8   ? -51.477  -36.078 54.424  1.00 63.06  ? 8   LYS F O     1 
ATOM   3472  C  CB    . LYS F  6  8   ? -50.358  -33.051 53.787  1.00 84.47  ? 8   LYS F CB    1 
ATOM   3473  C  CG    . LYS F  6  8   ? -49.389  -32.232 52.956  1.00 99.33  ? 8   LYS F CG    1 
ATOM   3474  C  CD    . LYS F  6  8   ? -47.958  -32.703 53.139  1.00 120.29 ? 8   LYS F CD    1 
ATOM   3475  C  CE    . LYS F  6  8   ? -47.030  -32.039 52.137  1.00 128.60 ? 8   LYS F CE    1 
ATOM   3476  N  NZ    . LYS F  6  8   ? -46.385  -30.822 52.697  1.00 127.57 ? 8   LYS F NZ    1 
ATOM   3477  N  N     . PRO F  6  9   ? -53.129  -34.454 54.213  1.00 65.13  ? 9   PRO F N     1 
ATOM   3478  C  CA    . PRO F  6  9   ? -53.990  -35.307 55.045  1.00 65.61  ? 9   PRO F CA    1 
ATOM   3479  C  C     . PRO F  6  9   ? -54.335  -36.618 54.364  1.00 67.30  ? 9   PRO F C     1 
ATOM   3480  O  O     . PRO F  6  9   ? -54.474  -37.642 55.020  1.00 67.44  ? 9   PRO F O     1 
ATOM   3481  C  CB    . PRO F  6  9   ? -55.248  -34.467 55.258  1.00 67.64  ? 9   PRO F CB    1 
ATOM   3482  C  CG    . PRO F  6  9   ? -55.330  -33.592 54.083  1.00 65.06  ? 9   PRO F CG    1 
ATOM   3483  C  CD    . PRO F  6  9   ? -53.923  -33.151 53.965  1.00 66.94  ? 9   PRO F CD    1 
ATOM   3484  N  N     . PHE F  6  10  ? -54.516  -36.562 53.053  1.00 66.97  ? 10  PHE F N     1 
ATOM   3485  C  CA    . PHE F  6  10  ? -54.927  -37.739 52.273  1.00 67.99  ? 10  PHE F CA    1 
ATOM   3486  C  C     . PHE F  6  10  ? -53.941  -38.872 52.385  1.00 65.39  ? 10  PHE F C     1 
ATOM   3487  O  O     . PHE F  6  10  ? -54.343  -40.018 52.568  1.00 60.48  ? 10  PHE F O     1 
ATOM   3488  C  CB    . PHE F  6  10  ? -55.098  -37.381 50.783  1.00 66.11  ? 10  PHE F CB    1 
ATOM   3489  C  CG    . PHE F  6  10  ? -55.326  -38.550 49.910  1.00 63.08  ? 10  PHE F CG    1 
ATOM   3490  C  CD1   . PHE F  6  10  ? -56.445  -39.348 50.077  1.00 69.27  ? 10  PHE F CD1   1 
ATOM   3491  C  CD2   . PHE F  6  10  ? -54.387  -38.919 49.025  1.00 63.90  ? 10  PHE F CD2   1 
ATOM   3492  C  CE1   . PHE F  6  10  ? -56.634  -40.479 49.325  1.00 72.39  ? 10  PHE F CE1   1 
ATOM   3493  C  CE2   . PHE F  6  10  ? -54.605  -39.998 48.176  1.00 67.69  ? 10  PHE F CE2   1 
ATOM   3494  C  CZ    . PHE F  6  10  ? -55.699  -40.817 48.349  1.00 68.53  ? 10  PHE F CZ    1 
ATOM   3495  N  N     . LEU F  6  11  ? -52.679  -38.495 52.277  1.00 66.46  ? 11  LEU F N     1 
ATOM   3496  C  CA    . LEU F  6  11  ? -51.639  -39.482 52.441  1.00 75.77  ? 11  LEU F CA    1 
ATOM   3497  C  C     . LEU F  6  11  ? -51.542  -39.988 53.853  1.00 75.33  ? 11  LEU F C     1 
ATOM   3498  O  O     . LEU F  6  11  ? -51.340  -41.184 54.055  1.00 82.93  ? 11  LEU F O     1 
ATOM   3499  C  CB    . LEU F  6  11  ? -50.283  -38.885 52.034  1.00 74.89  ? 11  LEU F CB    1 
ATOM   3500  C  CG    . LEU F  6  11  ? -50.188  -38.679 50.541  1.00 72.81  ? 11  LEU F CG    1 
ATOM   3501  C  CD1   . LEU F  6  11  ? -49.778  -37.262 50.320  1.00 74.20  ? 11  LEU F CD1   1 
ATOM   3502  C  CD2   . LEU F  6  11  ? -49.364  -39.634 49.780  1.00 71.49  ? 11  LEU F CD2   1 
ATOM   3503  N  N     . ASN F  6  12  ? -51.538  -39.041 54.773  1.00 72.97  ? 12  ASN F N     1 
ATOM   3504  C  CA    . ASN F  6  12  ? -51.437  -39.423 56.153  1.00 80.44  ? 12  ASN F CA    1 
ATOM   3505  C  C     . ASN F  6  12  ? -52.480  -40.445 56.477  1.00 83.44  ? 12  ASN F C     1 
ATOM   3506  O  O     . ASN F  6  12  ? -52.293  -41.323 57.334  1.00 87.60  ? 12  ASN F O     1 
ATOM   3507  C  CB    . ASN F  6  12  ? -51.498  -38.192 57.040  1.00 86.12  ? 12  ASN F CB    1 
ATOM   3508  C  CG    . ASN F  6  12  ? -50.182  -37.418 56.969  1.00 93.25  ? 12  ASN F CG    1 
ATOM   3509  O  OD1   . ASN F  6  12  ? -49.131  -38.039 57.035  1.00 102.00 ? 12  ASN F OD1   1 
ATOM   3510  N  ND2   . ASN F  6  12  ? -50.223  -36.096 56.860  1.00 90.69  ? 12  ASN F ND2   1 
ATOM   3511  N  N     . GLY F  6  13  ? -53.604  -40.280 55.793  1.00 79.33  ? 13  GLY F N     1 
ATOM   3512  C  CA    . GLY F  6  13  ? -54.663  -41.247 55.849  1.00 77.39  ? 13  GLY F CA    1 
ATOM   3513  C  C     . GLY F  6  13  ? -54.147  -42.595 55.444  1.00 73.34  ? 13  GLY F C     1 
ATOM   3514  O  O     . GLY F  6  13  ? -54.231  -43.542 56.251  1.00 85.37  ? 13  GLY F O     1 
ATOM   3515  N  N     . LEU F  6  14  ? -53.730  -42.682 54.192  1.00 69.17  ? 14  LEU F N     1 
ATOM   3516  C  CA    . LEU F  6  14  ? -53.292  -43.957 53.619  1.00 61.08  ? 14  LEU F CA    1 
ATOM   3517  C  C     . LEU F  6  14  ? -52.079  -44.591 54.253  1.00 60.25  ? 14  LEU F C     1 
ATOM   3518  O  O     . LEU F  6  14  ? -51.847  -45.778 53.988  1.00 50.59  ? 14  LEU F O     1 
ATOM   3519  C  CB    . LEU F  6  14  ? -52.938  -43.763 52.172  1.00 59.35  ? 14  LEU F CB    1 
ATOM   3520  C  CG    . LEU F  6  14  ? -54.023  -43.388 51.214  1.00 64.38  ? 14  LEU F CG    1 
ATOM   3521  C  CD1   . LEU F  6  14  ? -53.503  -43.087 49.835  1.00 74.59  ? 14  LEU F CD1   1 
ATOM   3522  C  CD2   . LEU F  6  14  ? -55.064  -44.480 51.044  1.00 67.33  ? 14  LEU F CD2   1 
ATOM   3523  N  N     . THR F  6  15  ? -51.366  -43.843 55.116  1.00 62.93  ? 15  THR F N     1 
ATOM   3524  C  CA    . THR F  6  15  ? -50.134  -44.384 55.701  1.00 66.06  ? 15  THR F CA    1 
ATOM   3525  C  C     . THR F  6  15  ? -50.705  -45.489 56.545  1.00 63.59  ? 15  THR F C     1 
ATOM   3526  O  O     . THR F  6  15  ? -51.760  -45.363 57.152  1.00 71.27  ? 15  THR F O     1 
ATOM   3527  C  CB    . THR F  6  15  ? -49.208  -43.509 56.538  1.00 69.41  ? 15  THR F CB    1 
ATOM   3528  O  OG1   . THR F  6  15  ? -49.826  -43.248 57.803  1.00 86.00  ? 15  THR F OG1   1 
ATOM   3529  C  CG2   . THR F  6  15  ? -48.865  -42.142 55.899  1.00 72.56  ? 15  THR F CG2   1 
ATOM   3530  N  N     . GLY F  6  16  ? -50.024  -46.608 56.543  1.00 59.23  ? 16  GLY F N     1 
ATOM   3531  C  CA    . GLY F  6  16  ? -50.502  -47.821 57.170  1.00 56.71  ? 16  GLY F CA    1 
ATOM   3532  C  C     . GLY F  6  16  ? -51.186  -48.735 56.193  1.00 55.43  ? 16  GLY F C     1 
ATOM   3533  O  O     . GLY F  6  16  ? -51.122  -49.952 56.327  1.00 55.26  ? 16  GLY F O     1 
ATOM   3534  N  N     . LYS F  6  17  ? -51.889  -48.176 55.229  1.00 59.52  ? 17  LYS F N     1 
ATOM   3535  C  CA    . LYS F  6  17  ? -52.809  -48.986 54.433  1.00 72.19  ? 17  LYS F CA    1 
ATOM   3536  C  C     . LYS F  6  17  ? -52.088  -49.398 53.178  1.00 71.16  ? 17  LYS F C     1 
ATOM   3537  O  O     . LYS F  6  17  ? -51.128  -48.754 52.830  1.00 73.99  ? 17  LYS F O     1 
ATOM   3538  C  CB    . LYS F  6  17  ? -54.121  -48.223 54.158  1.00 82.14  ? 17  LYS F CB    1 
ATOM   3539  C  CG    . LYS F  6  17  ? -54.728  -47.635 55.476  1.00 90.92  ? 17  LYS F CG    1 
ATOM   3540  C  CD    . LYS F  6  17  ? -56.241  -47.447 55.581  1.00 95.06  ? 17  LYS F CD    1 
ATOM   3541  C  CE    . LYS F  6  17  ? -56.798  -46.424 54.588  1.00 97.78  ? 17  LYS F CE    1 
ATOM   3542  N  NZ    . LYS F  6  17  ? -56.678  -44.999 55.031  1.00 92.83  ? 17  LYS F NZ    1 
ATOM   3543  N  N     . PRO F  6  18  ? -52.500  -50.486 52.519  1.00 73.40  ? 18  PRO F N     1 
ATOM   3544  C  CA    . PRO F  6  18  ? -51.962  -50.834 51.223  1.00 69.95  ? 18  PRO F CA    1 
ATOM   3545  C  C     . PRO F  6  18  ? -52.395  -49.784 50.240  1.00 69.76  ? 18  PRO F C     1 
ATOM   3546  O  O     . PRO F  6  18  ? -53.497  -49.229 50.387  1.00 66.31  ? 18  PRO F O     1 
ATOM   3547  C  CB    . PRO F  6  18  ? -52.585  -52.154 50.870  1.00 68.88  ? 18  PRO F CB    1 
ATOM   3548  C  CG    . PRO F  6  18  ? -53.757  -52.241 51.726  1.00 79.18  ? 18  PRO F CG    1 
ATOM   3549  C  CD    . PRO F  6  18  ? -53.405  -51.528 53.000  1.00 81.81  ? 18  PRO F CD    1 
ATOM   3550  N  N     . VAL F  6  19  ? -51.468  -49.469 49.332  1.00 71.47  ? 19  VAL F N     1 
ATOM   3551  C  CA    . VAL F  6  19  ? -51.595  -48.405 48.327  1.00 67.26  ? 19  VAL F CA    1 
ATOM   3552  C  C     . VAL F  6  19  ? -50.902  -48.852 47.066  1.00 64.09  ? 19  VAL F C     1 
ATOM   3553  O  O     . VAL F  6  19  ? -50.044  -49.746 47.114  1.00 63.41  ? 19  VAL F O     1 
ATOM   3554  C  CB    . VAL F  6  19  ? -50.938  -47.062 48.722  1.00 68.71  ? 19  VAL F CB    1 
ATOM   3555  C  CG1   . VAL F  6  19  ? -51.645  -46.480 49.930  1.00 72.41  ? 19  VAL F CG1   1 
ATOM   3556  C  CG2   . VAL F  6  19  ? -49.443  -47.193 49.003  1.00 67.25  ? 19  VAL F CG2   1 
ATOM   3557  N  N     . MET F  6  20  ? -51.278  -48.202 45.969  1.00 60.78  ? 20  MET F N     1 
ATOM   3558  C  CA    . MET F  6  20  ? -50.595  -48.399 44.714  1.00 62.50  ? 20  MET F CA    1 
ATOM   3559  C  C     . MET F  6  20  ? -50.195  -47.049 44.105  1.00 61.82  ? 20  MET F C     1 
ATOM   3560  O  O     . MET F  6  20  ? -51.064  -46.194 43.906  1.00 57.75  ? 20  MET F O     1 
ATOM   3561  C  CB    . MET F  6  20  ? -51.431  -49.221 43.776  1.00 66.68  ? 20  MET F CB    1 
ATOM   3562  C  CG    . MET F  6  20  ? -50.949  -49.107 42.349  1.00 73.38  ? 20  MET F CG    1 
ATOM   3563  S  SD    . MET F  6  20  ? -51.425  -50.553 41.428  1.00 84.52  ? 20  MET F SD    1 
ATOM   3564  C  CE    . MET F  6  20  ? -50.147  -51.701 41.921  1.00 76.39  ? 20  MET F CE    1 
ATOM   3565  N  N     . VAL F  6  21  ? -48.891  -46.940 43.778  1.00 60.17  ? 21  VAL F N     1 
ATOM   3566  C  CA    . VAL F  6  21  ? -48.217  -45.745 43.284  1.00 56.07  ? 21  VAL F CA    1 
ATOM   3567  C  C     . VAL F  6  21  ? -47.857  -45.932 41.831  1.00 51.74  ? 21  VAL F C     1 
ATOM   3568  O  O     . VAL F  6  21  ? -47.309  -46.961 41.499  1.00 54.86  ? 21  VAL F O     1 
ATOM   3569  C  CB    . VAL F  6  21  ? -46.831  -45.557 43.917  1.00 58.26  ? 21  VAL F CB    1 
ATOM   3570  C  CG1   . VAL F  6  21  ? -46.304  -44.186 43.554  1.00 60.63  ? 21  VAL F CG1   1 
ATOM   3571  C  CG2   . VAL F  6  21  ? -46.845  -45.627 45.427  1.00 61.84  ? 21  VAL F CG2   1 
ATOM   3572  N  N     . LYS F  6  22  ? -48.219  -45.017 40.948  1.00 48.94  ? 22  LYS F N     1 
ATOM   3573  C  CA    . LYS F  6  22  ? -47.968  -45.215 39.524  1.00 51.19  ? 22  LYS F CA    1 
ATOM   3574  C  C     . LYS F  6  22  ? -46.931  -44.195 39.173  1.00 53.59  ? 22  LYS F C     1 
ATOM   3575  O  O     . LYS F  6  22  ? -47.110  -42.995 39.459  1.00 60.29  ? 22  LYS F O     1 
ATOM   3576  C  CB    . LYS F  6  22  ? -49.181  -44.949 38.659  1.00 56.29  ? 22  LYS F CB    1 
ATOM   3577  C  CG    . LYS F  6  22  ? -48.888  -45.164 37.180  1.00 65.68  ? 22  LYS F CG    1 
ATOM   3578  C  CD    . LYS F  6  22  ? -50.143  -45.024 36.289  1.00 75.53  ? 22  LYS F CD    1 
ATOM   3579  C  CE    . LYS F  6  22  ? -49.982  -45.547 34.863  1.00 78.00  ? 22  LYS F CE    1 
ATOM   3580  N  NZ    . LYS F  6  22  ? -49.570  -46.994 34.888  1.00 82.45  ? 22  LYS F NZ    1 
ATOM   3581  N  N     . LEU F  6  23  ? -45.902  -44.646 38.475  1.00 51.53  ? 23  LEU F N     1 
ATOM   3582  C  CA    . LEU F  6  23  ? -44.805  -43.782 38.153  1.00 49.48  ? 23  LEU F CA    1 
ATOM   3583  C  C     . LEU F  6  23  ? -45.009  -43.220 36.773  1.00 50.57  ? 23  LEU F C     1 
ATOM   3584  O  O     . LEU F  6  23  ? -45.616  -43.850 35.922  1.00 51.74  ? 23  LEU F O     1 
ATOM   3585  C  CB    . LEU F  6  23  ? -43.500  -44.540 38.210  1.00 49.68  ? 23  LEU F CB    1 
ATOM   3586  C  CG    . LEU F  6  23  ? -42.841  -44.651 39.583  1.00 52.62  ? 23  LEU F CG    1 
ATOM   3587  C  CD1   . LEU F  6  23  ? -43.579  -45.464 40.636  1.00 56.42  ? 23  LEU F CD1   1 
ATOM   3588  C  CD2   . LEU F  6  23  ? -41.498  -45.300 39.405  1.00 50.34  ? 23  LEU F CD2   1 
ATOM   3589  N  N     . LYS F  6  24  ? -44.447  -42.033 36.554  1.00 51.38  ? 24  LYS F N     1 
ATOM   3590  C  CA    . LYS F  6  24  ? -44.459  -41.339 35.280  1.00 51.09  ? 24  LYS F CA    1 
ATOM   3591  C  C     . LYS F  6  24  ? -43.972  -42.230 34.147  1.00 54.32  ? 24  LYS F C     1 
ATOM   3592  O  O     . LYS F  6  24  ? -44.416  -42.030 32.994  1.00 64.31  ? 24  LYS F O     1 
ATOM   3593  C  CB    . LYS F  6  24  ? -43.525  -40.155 35.320  1.00 50.29  ? 24  LYS F CB    1 
ATOM   3594  C  CG    . LYS F  6  24  ? -43.992  -39.015 36.187  1.00 50.10  ? 24  LYS F CG    1 
ATOM   3595  C  CD    . LYS F  6  24  ? -42.928  -37.919 36.331  1.00 50.38  ? 24  LYS F CD    1 
ATOM   3596  C  CE    . LYS F  6  24  ? -43.500  -36.844 37.219  1.00 51.93  ? 24  LYS F CE    1 
ATOM   3597  N  NZ    . LYS F  6  24  ? -42.578  -35.718 37.343  1.00 54.51  ? 24  LYS F NZ    1 
ATOM   3598  N  N     . TRP F  6  25  ? -43.158  -43.221 34.483  1.00 48.06  ? 25  TRP F N     1 
ATOM   3599  C  CA    . TRP F  6  25  ? -42.482  -44.084 33.523  1.00 49.98  ? 25  TRP F CA    1 
ATOM   3600  C  C     . TRP F  6  25  ? -43.290  -45.336 33.205  1.00 57.57  ? 25  TRP F C     1 
ATOM   3601  O  O     . TRP F  6  25  ? -42.846  -46.192 32.454  1.00 58.73  ? 25  TRP F O     1 
ATOM   3602  C  CB    . TRP F  6  25  ? -41.097  -44.459 34.053  1.00 48.36  ? 25  TRP F CB    1 
ATOM   3603  C  CG    . TRP F  6  25  ? -40.454  -43.344 34.805  1.00 43.48  ? 25  TRP F CG    1 
ATOM   3604  C  CD1   . TRP F  6  25  ? -39.908  -43.402 36.036  1.00 44.59  ? 25  TRP F CD1   1 
ATOM   3605  C  CD2   . TRP F  6  25  ? -40.346  -41.989 34.381  1.00 37.87  ? 25  TRP F CD2   1 
ATOM   3606  N  NE1   . TRP F  6  25  ? -39.447  -42.173 36.407  1.00 42.32  ? 25  TRP F NE1   1 
ATOM   3607  C  CE2   . TRP F  6  25  ? -39.710  -41.286 35.403  1.00 38.76  ? 25  TRP F CE2   1 
ATOM   3608  C  CE3   . TRP F  6  25  ? -40.725  -41.304 33.230  1.00 39.36  ? 25  TRP F CE3   1 
ATOM   3609  C  CZ2   . TRP F  6  25  ? -39.439  -39.938 35.310  1.00 41.38  ? 25  TRP F CZ2   1 
ATOM   3610  C  CZ3   . TRP F  6  25  ? -40.453  -39.971 33.143  1.00 42.04  ? 25  TRP F CZ3   1 
ATOM   3611  C  CH2   . TRP F  6  25  ? -39.822  -39.300 34.173  1.00 44.01  ? 25  TRP F CH2   1 
ATOM   3612  N  N     . GLY F  6  26  ? -44.479  -45.428 33.787  1.00 68.58  ? 26  GLY F N     1 
ATOM   3613  C  CA    . GLY F  6  26  ? -45.426  -46.488 33.491  1.00 76.47  ? 26  GLY F CA    1 
ATOM   3614  C  C     . GLY F  6  26  ? -45.421  -47.727 34.368  1.00 73.02  ? 26  GLY F C     1 
ATOM   3615  O  O     . GLY F  6  26  ? -46.313  -48.556 34.254  1.00 83.52  ? 26  GLY F O     1 
ATOM   3616  N  N     . MET F  6  27  ? -44.445  -47.865 35.251  1.00 66.83  ? 27  MET F N     1 
ATOM   3617  C  CA    . MET F  6  27  ? -44.486  -48.928 36.241  1.00 66.26  ? 27  MET F CA    1 
ATOM   3618  C  C     . MET F  6  27  ? -45.335  -48.482 37.414  1.00 68.45  ? 27  MET F C     1 
ATOM   3619  O  O     . MET F  6  27  ? -45.526  -47.293 37.619  1.00 68.29  ? 27  MET F O     1 
ATOM   3620  C  CB    . MET F  6  27  ? -43.093  -49.302 36.730  1.00 66.27  ? 27  MET F CB    1 
ATOM   3621  C  CG    . MET F  6  27  ? -41.984  -49.122 35.722  1.00 76.37  ? 27  MET F CG    1 
ATOM   3622  S  SD    . MET F  6  27  ? -40.689  -48.109 36.429  1.00 93.88  ? 27  MET F SD    1 
ATOM   3623  C  CE    . MET F  6  27  ? -40.029  -47.319 34.975  1.00 83.60  ? 27  MET F CE    1 
ATOM   3624  N  N     . GLU F  6  28  ? -45.841  -49.437 38.183  1.00 63.08  ? 28  GLU F N     1 
ATOM   3625  C  CA    . GLU F  6  28  ? -46.561  -49.131 39.408  1.00 60.19  ? 28  GLU F CA    1 
ATOM   3626  C  C     . GLU F  6  28  ? -46.055  -50.022 40.527  1.00 55.48  ? 28  GLU F C     1 
ATOM   3627  O  O     . GLU F  6  28  ? -45.657  -51.152 40.288  1.00 50.66  ? 28  GLU F O     1 
ATOM   3628  C  CB    . GLU F  6  28  ? -48.067  -49.317 39.237  1.00 69.37  ? 28  GLU F CB    1 
ATOM   3629  C  CG    . GLU F  6  28  ? -48.543  -49.470 37.809  1.00 80.91  ? 28  GLU F CG    1 
ATOM   3630  C  CD    . GLU F  6  28  ? -50.007  -49.820 37.738  1.00 92.19  ? 28  GLU F CD    1 
ATOM   3631  O  OE1   . GLU F  6  28  ? -50.369  -50.666 36.902  1.00 103.73 ? 28  GLU F OE1   1 
ATOM   3632  O  OE2   . GLU F  6  28  ? -50.794  -49.254 38.523  1.00 91.89  ? 28  GLU F OE2   1 
ATOM   3633  N  N     . TYR F  6  29  ? -46.069  -49.504 41.748  1.00 54.49  ? 29  TYR F N     1 
ATOM   3634  C  CA    . TYR F  6  29  ? -45.632  -50.268 42.903  1.00 54.20  ? 29  TYR F CA    1 
ATOM   3635  C  C     . TYR F  6  29  ? -46.730  -50.341 43.948  1.00 56.84  ? 29  TYR F C     1 
ATOM   3636  O  O     . TYR F  6  29  ? -47.296  -49.332 44.339  1.00 56.07  ? 29  TYR F O     1 
ATOM   3637  C  CB    . TYR F  6  29  ? -44.356  -49.659 43.486  1.00 56.32  ? 29  TYR F CB    1 
ATOM   3638  C  CG    . TYR F  6  29  ? -43.171  -49.814 42.567  1.00 56.57  ? 29  TYR F CG    1 
ATOM   3639  C  CD1   . TYR F  6  29  ? -42.906  -48.877 41.588  1.00 56.59  ? 29  TYR F CD1   1 
ATOM   3640  C  CD2   . TYR F  6  29  ? -42.340  -50.914 42.657  1.00 56.25  ? 29  TYR F CD2   1 
ATOM   3641  C  CE1   . TYR F  6  29  ? -41.837  -49.025 40.736  1.00 57.67  ? 29  TYR F CE1   1 
ATOM   3642  C  CE2   . TYR F  6  29  ? -41.273  -51.068 41.805  1.00 51.80  ? 29  TYR F CE2   1 
ATOM   3643  C  CZ    . TYR F  6  29  ? -41.030  -50.118 40.849  1.00 53.94  ? 29  TYR F CZ    1 
ATOM   3644  O  OH    . TYR F  6  29  ? -39.970  -50.262 40.000  1.00 59.46  ? 29  TYR F OH    1 
ATOM   3645  N  N     . LYS F  6  30  ? -47.013  -51.553 44.402  1.00 61.70  ? 30  LYS F N     1 
ATOM   3646  C  CA    . LYS F  6  30  ? -48.093  -51.808 45.336  1.00 63.29  ? 30  LYS F CA    1 
ATOM   3647  C  C     . LYS F  6  30  ? -47.487  -52.214 46.653  1.00 61.00  ? 30  LYS F C     1 
ATOM   3648  O  O     . LYS F  6  30  ? -46.669  -53.134 46.689  1.00 61.11  ? 30  LYS F O     1 
ATOM   3649  C  CB    . LYS F  6  30  ? -48.940  -52.982 44.869  1.00 69.59  ? 30  LYS F CB    1 
ATOM   3650  C  CG    . LYS F  6  30  ? -50.178  -53.233 45.712  1.00 80.43  ? 30  LYS F CG    1 
ATOM   3651  C  CD    . LYS F  6  30  ? -51.451  -53.343 44.884  1.00 90.61  ? 30  LYS F CD    1 
ATOM   3652  C  CE    . LYS F  6  30  ? -51.569  -54.633 44.086  1.00 94.66  ? 30  LYS F CE    1 
ATOM   3653  N  NZ    . LYS F  6  30  ? -52.242  -55.660 44.912  1.00 96.28  ? 30  LYS F NZ    1 
ATOM   3654  N  N     . GLY F  6  31  ? -47.990  -51.649 47.746  1.00 59.88  ? 31  GLY F N     1 
ATOM   3655  C  CA    . GLY F  6  31  ? -47.527  -52.068 49.089  1.00 59.67  ? 31  GLY F CA    1 
ATOM   3656  C  C     . GLY F  6  31  ? -48.035  -51.210 50.231  1.00 58.29  ? 31  GLY F C     1 
ATOM   3657  O  O     . GLY F  6  31  ? -48.775  -50.233 50.003  1.00 57.31  ? 31  GLY F O     1 
ATOM   3658  N  N     . TYR F  6  32  ? -47.530  -51.480 51.430  1.00 54.47  ? 32  TYR F N     1 
ATOM   3659  C  CA    . TYR F  6  32  ? -48.047  -50.784 52.605  1.00 59.65  ? 32  TYR F CA    1 
ATOM   3660  C  C     . TYR F  6  32  ? -47.294  -49.473 52.733  1.00 56.89  ? 32  TYR F C     1 
ATOM   3661  O  O     . TYR F  6  32  ? -46.082  -49.456 53.012  1.00 55.20  ? 32  TYR F O     1 
ATOM   3662  C  CB    . TYR F  6  32  ? -47.913  -51.625 53.887  1.00 68.24  ? 32  TYR F CB    1 
ATOM   3663  C  CG    . TYR F  6  32  ? -48.844  -52.823 53.898  1.00 72.42  ? 32  TYR F CG    1 
ATOM   3664  C  CD1   . TYR F  6  32  ? -50.192  -52.702 54.219  1.00 74.37  ? 32  TYR F CD1   1 
ATOM   3665  C  CD2   . TYR F  6  32  ? -48.375  -54.077 53.486  1.00 79.70  ? 32  TYR F CD2   1 
ATOM   3666  C  CE1   . TYR F  6  32  ? -51.026  -53.798 54.177  1.00 78.59  ? 32  TYR F CE1   1 
ATOM   3667  C  CE2   . TYR F  6  32  ? -49.210  -55.176 53.413  1.00 83.26  ? 32  TYR F CE2   1 
ATOM   3668  C  CZ    . TYR F  6  32  ? -50.529  -55.016 53.777  1.00 85.03  ? 32  TYR F CZ    1 
ATOM   3669  O  OH    . TYR F  6  32  ? -51.358  -56.103 53.739  1.00 96.12  ? 32  TYR F OH    1 
ATOM   3670  N  N     . LEU F  6  33  ? -47.983  -48.380 52.423  1.00 52.97  ? 33  LEU F N     1 
ATOM   3671  C  CA    . LEU F  6  33  ? -47.366  -47.081 52.577  1.00 52.79  ? 33  LEU F CA    1 
ATOM   3672  C  C     . LEU F  6  33  ? -46.888  -46.902 54.014  1.00 49.87  ? 33  LEU F C     1 
ATOM   3673  O  O     . LEU F  6  33  ? -47.638  -47.050 54.924  1.00 53.94  ? 33  LEU F O     1 
ATOM   3674  C  CB    . LEU F  6  33  ? -48.366  -46.009 52.220  1.00 57.13  ? 33  LEU F CB    1 
ATOM   3675  C  CG    . LEU F  6  33  ? -47.939  -44.554 52.323  1.00 64.30  ? 33  LEU F CG    1 
ATOM   3676  C  CD1   . LEU F  6  33  ? -46.525  -44.321 51.829  1.00 67.53  ? 33  LEU F CD1   1 
ATOM   3677  C  CD2   . LEU F  6  33  ? -48.888  -43.700 51.498  1.00 66.49  ? 33  LEU F CD2   1 
ATOM   3678  N  N     . VAL F  6  34  ? -45.619  -46.646 54.236  1.00 47.66  ? 34  VAL F N     1 
ATOM   3679  C  CA    . VAL F  6  34  ? -45.041  -46.565 55.555  1.00 45.67  ? 34  VAL F CA    1 
ATOM   3680  C  C     . VAL F  6  34  ? -44.868  -45.111 55.923  1.00 50.05  ? 34  VAL F C     1 
ATOM   3681  O  O     . VAL F  6  34  ? -45.179  -44.733 57.061  1.00 62.95  ? 34  VAL F O     1 
ATOM   3682  C  CB    . VAL F  6  34  ? -43.686  -47.284 55.600  1.00 43.33  ? 34  VAL F CB    1 
ATOM   3683  C  CG1   . VAL F  6  34  ? -42.976  -47.111 56.944  1.00 42.60  ? 34  VAL F CG1   1 
ATOM   3684  C  CG2   . VAL F  6  34  ? -43.835  -48.744 55.132  1.00 41.37  ? 34  VAL F CG2   1 
ATOM   3685  N  N     . SER F  6  35  ? -44.304  -44.313 55.037  1.00 52.15  ? 35  SER F N     1 
ATOM   3686  C  CA    . SER F  6  35  ? -43.957  -42.938 55.379  1.00 57.57  ? 35  SER F CA    1 
ATOM   3687  C  C     . SER F  6  35  ? -43.931  -42.078 54.181  1.00 56.03  ? 35  SER F C     1 
ATOM   3688  O  O     . SER F  6  35  ? -43.958  -42.546 53.056  1.00 57.81  ? 35  SER F O     1 
ATOM   3689  C  CB    . SER F  6  35  ? -42.570  -42.823 56.030  1.00 64.68  ? 35  SER F CB    1 
ATOM   3690  O  OG    . SER F  6  35  ? -41.590  -43.706 55.519  1.00 65.65  ? 35  SER F OG    1 
ATOM   3691  N  N     . VAL F  6  36  ? -44.025  -40.797 54.459  1.00 56.02  ? 36  VAL F N     1 
ATOM   3692  C  CA    . VAL F  6  36  ? -44.037  -39.807 53.431  1.00 56.76  ? 36  VAL F CA    1 
ATOM   3693  C  C     . VAL F  6  36  ? -43.314  -38.583 53.968  1.00 55.56  ? 36  VAL F C     1 
ATOM   3694  O  O     . VAL F  6  36  ? -43.369  -38.370 55.145  1.00 60.33  ? 36  VAL F O     1 
ATOM   3695  C  CB    . VAL F  6  36  ? -45.511  -39.557 53.073  1.00 55.21  ? 36  VAL F CB    1 
ATOM   3696  C  CG1   . VAL F  6  36  ? -45.602  -38.447 52.032  1.00 64.08  ? 36  VAL F CG1   1 
ATOM   3697  C  CG2   . VAL F  6  36  ? -46.157  -40.777 52.428  1.00 53.90  ? 36  VAL F CG2   1 
ATOM   3698  N  N     . ASP F  6  37  ? -42.696  -37.775 53.127  1.00 55.27  ? 37  ASP F N     1 
ATOM   3699  C  CA    . ASP F  6  37  ? -42.137  -36.524 53.581  1.00 62.21  ? 37  ASP F CA    1 
ATOM   3700  C  C     . ASP F  6  37  ? -42.684  -35.285 52.829  1.00 60.12  ? 37  ASP F C     1 
ATOM   3701  O  O     . ASP F  6  37  ? -43.658  -35.317 52.065  1.00 54.95  ? 37  ASP F O     1 
ATOM   3702  C  CB    . ASP F  6  37  ? -40.627  -36.634 53.509  1.00 74.07  ? 37  ASP F CB    1 
ATOM   3703  C  CG    . ASP F  6  37  ? -40.091  -36.796 52.092  1.00 81.02  ? 37  ASP F CG    1 
ATOM   3704  O  OD1   . ASP F  6  37  ? -40.888  -36.820 51.130  1.00 95.96  ? 37  ASP F OD1   1 
ATOM   3705  O  OD2   . ASP F  6  37  ? -38.850  -36.815 51.954  1.00 83.15  ? 37  ASP F OD2   1 
ATOM   3706  N  N     . GLY F  6  38  ? -42.098  -34.134 53.093  1.00 62.07  ? 38  GLY F N     1 
ATOM   3707  C  CA    . GLY F  6  38  ? -42.718  -32.905 52.588  1.00 66.58  ? 38  GLY F CA    1 
ATOM   3708  C  C     . GLY F  6  38  ? -42.566  -32.714 51.102  1.00 63.57  ? 38  GLY F C     1 
ATOM   3709  O  O     . GLY F  6  38  ? -43.000  -31.682 50.535  1.00 63.67  ? 38  GLY F O     1 
ATOM   3710  N  N     . TYR F  6  39  ? -41.743  -33.607 50.559  1.00 55.73  ? 39  TYR F N     1 
ATOM   3711  C  CA    . TYR F  6  39  ? -41.541  -33.637 49.150  1.00 51.91  ? 39  TYR F CA    1 
ATOM   3712  C  C     . TYR F  6  39  ? -42.327  -34.760 48.542  1.00 49.51  ? 39  TYR F C     1 
ATOM   3713  O  O     . TYR F  6  39  ? -42.345  -34.865 47.343  1.00 52.66  ? 39  TYR F O     1 
ATOM   3714  C  CB    . TYR F  6  39  ? -40.064  -33.759 48.874  1.00 51.32  ? 39  TYR F CB    1 
ATOM   3715  C  CG    . TYR F  6  39  ? -39.266  -32.488 49.001  1.00 51.27  ? 39  TYR F CG    1 
ATOM   3716  C  CD1   . TYR F  6  39  ? -39.341  -31.536 48.066  1.00 52.17  ? 39  TYR F CD1   1 
ATOM   3717  C  CD2   . TYR F  6  39  ? -38.369  -32.300 50.003  1.00 56.47  ? 39  TYR F CD2   1 
ATOM   3718  C  CE1   . TYR F  6  39  ? -38.549  -30.428 48.111  1.00 55.73  ? 39  TYR F CE1   1 
ATOM   3719  C  CE2   . TYR F  6  39  ? -37.553  -31.202 50.068  1.00 59.23  ? 39  TYR F CE2   1 
ATOM   3720  C  CZ    . TYR F  6  39  ? -37.636  -30.242 49.099  1.00 59.30  ? 39  TYR F CZ    1 
ATOM   3721  O  OH    . TYR F  6  39  ? -36.815  -29.108 49.167  1.00 65.33  ? 39  TYR F OH    1 
ATOM   3722  N  N     . MET F  6  40  ? -43.007  -35.545 49.354  1.00 50.48  ? 40  MET F N     1 
ATOM   3723  C  CA    . MET F  6  40  ? -43.776  -36.738 48.975  1.00 50.90  ? 40  MET F CA    1 
ATOM   3724  C  C     . MET F  6  40  ? -43.010  -37.870 48.352  1.00 49.77  ? 40  MET F C     1 
ATOM   3725  O  O     . MET F  6  40  ? -43.449  -38.474 47.372  1.00 51.09  ? 40  MET F O     1 
ATOM   3726  C  CB    . MET F  6  40  ? -45.005  -36.346 48.184  1.00 53.91  ? 40  MET F CB    1 
ATOM   3727  C  CG    . MET F  6  40  ? -46.066  -35.687 49.053  1.00 58.71  ? 40  MET F CG    1 
ATOM   3728  S  SD    . MET F  6  40  ? -47.278  -34.924 47.971  1.00 66.60  ? 40  MET F SD    1 
ATOM   3729  C  CE    . MET F  6  40  ? -47.980  -33.658 49.023  1.00 69.91  ? 40  MET F CE    1 
ATOM   3730  N  N     . ASN F  6  41  ? -41.806  -38.060 48.886  1.00 51.02  ? 41  ASN F N     1 
ATOM   3731  C  CA    . ASN F  6  41  ? -41.075  -39.297 48.706  1.00 53.88  ? 41  ASN F CA    1 
ATOM   3732  C  C     . ASN F  6  41  ? -41.888  -40.312 49.456  1.00 54.74  ? 41  ASN F C     1 
ATOM   3733  O  O     . ASN F  6  41  ? -42.521  -39.960 50.439  1.00 55.92  ? 41  ASN F O     1 
ATOM   3734  C  CB    . ASN F  6  41  ? -39.648  -39.255 49.257  1.00 54.44  ? 41  ASN F CB    1 
ATOM   3735  C  CG    . ASN F  6  41  ? -38.758  -38.347 48.427  1.00 59.33  ? 41  ASN F CG    1 
ATOM   3736  O  OD1   . ASN F  6  41  ? -38.840  -38.359 47.204  1.00 59.24  ? 41  ASN F OD1   1 
ATOM   3737  N  ND2   . ASN F  6  41  ? -37.865  -37.581 49.073  1.00 60.51  ? 41  ASN F ND2   1 
ATOM   3738  N  N     . MET F  6  42  ? -41.864  -41.565 49.006  1.00 53.14  ? 42  MET F N     1 
ATOM   3739  C  CA    . MET F  6  42  ? -42.637  -42.616 49.642  1.00 48.59  ? 42  MET F CA    1 
ATOM   3740  C  C     . MET F  6  42  ? -41.809  -43.829 49.943  1.00 46.23  ? 42  MET F C     1 
ATOM   3741  O  O     . MET F  6  42  ? -41.062  -44.319 49.067  1.00 45.87  ? 42  MET F O     1 
ATOM   3742  C  CB    . MET F  6  42  ? -43.759  -42.990 48.702  1.00 50.52  ? 42  MET F CB    1 
ATOM   3743  C  CG    . MET F  6  42  ? -44.775  -41.869 48.489  1.00 54.31  ? 42  MET F CG    1 
ATOM   3744  S  SD    . MET F  6  42  ? -45.755  -42.232 47.012  1.00 54.36  ? 42  MET F SD    1 
ATOM   3745  C  CE    . MET F  6  42  ? -46.231  -40.532 46.630  1.00 56.19  ? 42  MET F CE    1 
ATOM   3746  N  N     . GLN F  6  43  ? -41.961  -44.306 51.176  1.00 44.61  ? 43  GLN F N     1 
ATOM   3747  C  CA    . GLN F  6  43  ? -41.451  -45.616 51.557  1.00 45.90  ? 43  GLN F CA    1 
ATOM   3748  C  C     . GLN F  6  43  ? -42.562  -46.621 51.525  1.00 46.59  ? 43  GLN F C     1 
ATOM   3749  O  O     . GLN F  6  43  ? -43.607  -46.388 52.059  1.00 47.91  ? 43  GLN F O     1 
ATOM   3750  C  CB    . GLN F  6  43  ? -40.928  -45.576 52.954  1.00 47.05  ? 43  GLN F CB    1 
ATOM   3751  C  CG    . GLN F  6  43  ? -40.496  -46.922 53.501  1.00 48.60  ? 43  GLN F CG    1 
ATOM   3752  C  CD    . GLN F  6  43  ? -39.914  -46.790 54.911  1.00 53.87  ? 43  GLN F CD    1 
ATOM   3753  O  OE1   . GLN F  6  43  ? -40.005  -45.768 55.622  1.00 55.00  ? 43  GLN F OE1   1 
ATOM   3754  N  NE2   . GLN F  6  43  ? -39.275  -47.865 55.322  1.00 60.23  ? 43  GLN F NE2   1 
ATOM   3755  N  N     . LEU F  6  44  ? -42.365  -47.759 50.883  1.00 51.76  ? 44  LEU F N     1 
ATOM   3756  C  CA    . LEU F  6  44  ? -43.382  -48.825 50.775  1.00 53.27  ? 44  LEU F CA    1 
ATOM   3757  C  C     . LEU F  6  44  ? -42.821  -50.081 51.405  1.00 58.50  ? 44  LEU F C     1 
ATOM   3758  O  O     . LEU F  6  44  ? -41.599  -50.204 51.535  1.00 60.68  ? 44  LEU F O     1 
ATOM   3759  C  CB    . LEU F  6  44  ? -43.647  -49.156 49.335  1.00 49.79  ? 44  LEU F CB    1 
ATOM   3760  C  CG    . LEU F  6  44  ? -44.760  -48.354 48.706  1.00 50.33  ? 44  LEU F CG    1 
ATOM   3761  C  CD1   . LEU F  6  44  ? -44.646  -46.853 48.824  1.00 49.90  ? 44  LEU F CD1   1 
ATOM   3762  C  CD2   . LEU F  6  44  ? -45.079  -48.753 47.254  1.00 53.21  ? 44  LEU F CD2   1 
ATOM   3763  N  N     . ALA F  6  45  ? -43.712  -50.962 51.853  1.00 61.92  ? 45  ALA F N     1 
ATOM   3764  C  CA    . ALA F  6  45  ? -43.302  -52.243 52.451  1.00 63.64  ? 45  ALA F CA    1 
ATOM   3765  C  C     . ALA F  6  45  ? -44.140  -53.378 51.881  1.00 64.69  ? 45  ALA F C     1 
ATOM   3766  O  O     . ALA F  6  45  ? -45.251  -53.116 51.387  1.00 62.61  ? 45  ALA F O     1 
ATOM   3767  C  CB    . ALA F  6  45  ? -43.420  -52.172 53.952  1.00 61.73  ? 45  ALA F CB    1 
ATOM   3768  N  N     . ASN F  6  46  ? -43.570  -54.582 51.859  1.00 62.88  ? 46  ASN F N     1 
ATOM   3769  C  CA    . ASN F  6  46  ? -44.157  -55.667 51.103  1.00 65.94  ? 46  ASN F CA    1 
ATOM   3770  C  C     . ASN F  6  46  ? -44.496  -55.271 49.691  1.00 68.37  ? 46  ASN F C     1 
ATOM   3771  O  O     . ASN F  6  46  ? -45.578  -55.535 49.177  1.00 70.77  ? 46  ASN F O     1 
ATOM   3772  C  CB    . ASN F  6  46  ? -45.418  -56.164 51.786  1.00 70.38  ? 46  ASN F CB    1 
ATOM   3773  C  CG    . ASN F  6  46  ? -45.132  -57.360 52.616  1.00 80.08  ? 46  ASN F CG    1 
ATOM   3774  O  OD1   . ASN F  6  46  ? -44.892  -58.454 52.073  1.00 87.28  ? 46  ASN F OD1   1 
ATOM   3775  N  ND2   . ASN F  6  46  ? -45.043  -57.160 53.939  1.00 84.78  ? 46  ASN F ND2   1 
ATOM   3776  N  N     . THR F  6  47  ? -43.548  -54.606 49.047  1.00 70.31  ? 47  THR F N     1 
ATOM   3777  C  CA    . THR F  6  47  ? -43.850  -53.919 47.793  1.00 65.56  ? 47  THR F CA    1 
ATOM   3778  C  C     . THR F  6  47  ? -43.762  -54.906 46.671  1.00 61.40  ? 47  THR F C     1 
ATOM   3779  O  O     . THR F  6  47  ? -42.887  -55.765 46.717  1.00 57.70  ? 47  THR F O     1 
ATOM   3780  C  CB    . THR F  6  47  ? -42.894  -52.753 47.542  1.00 67.02  ? 47  THR F CB    1 
ATOM   3781  O  OG1   . THR F  6  47  ? -42.741  -51.965 48.751  1.00 66.56  ? 47  THR F OG1   1 
ATOM   3782  C  CG2   . THR F  6  47  ? -43.404  -51.923 46.373  1.00 64.48  ? 47  THR F CG2   1 
ATOM   3783  N  N     . GLU F  6  48  ? -44.644  -54.767 45.683  1.00 59.90  ? 48  GLU F N     1 
ATOM   3784  C  CA    . GLU F  6  48  ? -44.555  -55.557 44.452  1.00 63.49  ? 48  GLU F CA    1 
ATOM   3785  C  C     . GLU F  6  48  ? -44.684  -54.701 43.202  1.00 61.91  ? 48  GLU F C     1 
ATOM   3786  O  O     . GLU F  6  48  ? -45.237  -53.618 43.219  1.00 55.98  ? 48  GLU F O     1 
ATOM   3787  C  CB    . GLU F  6  48  ? -45.508  -56.737 44.428  1.00 74.00  ? 48  GLU F CB    1 
ATOM   3788  C  CG    . GLU F  6  48  ? -46.837  -56.598 45.140  1.00 81.81  ? 48  GLU F CG    1 
ATOM   3789  C  CD    . GLU F  6  48  ? -47.739  -57.832 44.941  1.00 82.10  ? 48  GLU F CD    1 
ATOM   3790  O  OE1   . GLU F  6  48  ? -47.212  -58.987 45.013  1.00 76.36  ? 48  GLU F OE1   1 
ATOM   3791  O  OE2   . GLU F  6  48  ? -48.966  -57.591 44.775  1.00 75.23  ? 48  GLU F OE2   1 
ATOM   3792  N  N     . GLU F  6  49  ? -44.079  -55.163 42.112  1.00 61.39  ? 49  GLU F N     1 
ATOM   3793  C  CA    . GLU F  6  49  ? -43.892  -54.354 40.913  1.00 59.68  ? 49  GLU F CA    1 
ATOM   3794  C  C     . GLU F  6  49  ? -44.839  -54.816 39.875  1.00 57.00  ? 49  GLU F C     1 
ATOM   3795  O  O     . GLU F  6  49  ? -44.865  -55.986 39.576  1.00 58.86  ? 49  GLU F O     1 
ATOM   3796  C  CB    . GLU F  6  49  ? -42.491  -54.558 40.377  1.00 64.98  ? 49  GLU F CB    1 
ATOM   3797  C  CG    . GLU F  6  49  ? -42.169  -53.765 39.119  1.00 70.25  ? 49  GLU F CG    1 
ATOM   3798  C  CD    . GLU F  6  49  ? -40.692  -53.733 38.798  1.00 68.63  ? 49  GLU F CD    1 
ATOM   3799  O  OE1   . GLU F  6  49  ? -40.223  -54.714 38.145  1.00 73.35  ? 49  GLU F OE1   1 
ATOM   3800  O  OE2   . GLU F  6  49  ? -40.050  -52.754 39.226  1.00 59.38  ? 49  GLU F OE2   1 
ATOM   3801  N  N     . TYR F  6  50  ? -45.640  -53.900 39.368  1.00 59.78  ? 50  TYR F N     1 
ATOM   3802  C  CA    . TYR F  6  50  ? -46.589  -54.191 38.301  1.00 65.13  ? 50  TYR F CA    1 
ATOM   3803  C  C     . TYR F  6  50  ? -46.093  -53.405 37.098  1.00 71.95  ? 50  TYR F C     1 
ATOM   3804  O  O     . TYR F  6  50  ? -46.126  -52.168 37.077  1.00 70.58  ? 50  TYR F O     1 
ATOM   3805  C  CB    . TYR F  6  50  ? -48.030  -53.763 38.650  1.00 66.76  ? 50  TYR F CB    1 
ATOM   3806  C  CG    . TYR F  6  50  ? -48.702  -54.665 39.637  1.00 68.67  ? 50  TYR F CG    1 
ATOM   3807  C  CD1   . TYR F  6  50  ? -48.234  -54.745 40.945  1.00 71.58  ? 50  TYR F CD1   1 
ATOM   3808  C  CD2   . TYR F  6  50  ? -49.780  -55.456 39.272  1.00 73.12  ? 50  TYR F CD2   1 
ATOM   3809  C  CE1   . TYR F  6  50  ? -48.814  -55.583 41.874  1.00 79.50  ? 50  TYR F CE1   1 
ATOM   3810  C  CE2   . TYR F  6  50  ? -50.385  -56.287 40.189  1.00 79.17  ? 50  TYR F CE2   1 
ATOM   3811  C  CZ    . TYR F  6  50  ? -49.899  -56.353 41.492  1.00 83.99  ? 50  TYR F CZ    1 
ATOM   3812  O  OH    . TYR F  6  50  ? -50.450  -57.194 42.445  1.00 87.92  ? 50  TYR F OH    1 
ATOM   3813  N  N     . ILE F  6  51  ? -45.694  -54.139 36.069  1.00 80.69  ? 51  ILE F N     1 
ATOM   3814  C  CA    . ILE F  6  51  ? -45.283  -53.550 34.804  1.00 81.09  ? 51  ILE F CA    1 
ATOM   3815  C  C     . ILE F  6  51  ? -46.474  -53.686 33.877  1.00 89.65  ? 51  ILE F C     1 
ATOM   3816  O  O     . ILE F  6  51  ? -47.158  -54.707 33.856  1.00 92.88  ? 51  ILE F O     1 
ATOM   3817  C  CB    . ILE F  6  51  ? -44.054  -54.283 34.305  1.00 83.54  ? 51  ILE F CB    1 
ATOM   3818  C  CG1   . ILE F  6  51  ? -42.843  -53.366 34.363  1.00 89.66  ? 51  ILE F CG1   1 
ATOM   3819  C  CG2   . ILE F  6  51  ? -44.270  -54.945 32.951  1.00 88.96  ? 51  ILE F CG2   1 
ATOM   3820  C  CD1   . ILE F  6  51  ? -41.494  -54.061 34.216  1.00 93.85  ? 51  ILE F CD1   1 
ATOM   3821  N  N     . ASP F  6  52  ? -46.739  -52.645 33.103  1.00 107.80 ? 52  ASP F N     1 
ATOM   3822  C  CA    . ASP F  6  52  ? -47.897  -52.558 32.170  1.00 113.50 ? 52  ASP F CA    1 
ATOM   3823  C  C     . ASP F  6  52  ? -49.205  -53.170 32.724  1.00 103.99 ? 52  ASP F C     1 
ATOM   3824  O  O     . ASP F  6  52  ? -49.828  -54.018 32.092  1.00 114.04 ? 52  ASP F O     1 
ATOM   3825  C  CB    . ASP F  6  52  ? -47.534  -53.069 30.741  1.00 115.43 ? 52  ASP F CB    1 
ATOM   3826  C  CG    . ASP F  6  52  ? -47.312  -54.570 30.664  1.00 127.81 ? 52  ASP F CG    1 
ATOM   3827  O  OD1   . ASP F  6  52  ? -47.607  -55.319 31.625  1.00 140.18 ? 52  ASP F OD1   1 
ATOM   3828  O  OD2   . ASP F  6  52  ? -46.837  -55.013 29.594  1.00 141.83 ? 52  ASP F OD2   1 
ATOM   3829  N  N     . GLY F  6  53  ? -49.566  -52.818 33.944  1.00 88.78  ? 53  GLY F N     1 
ATOM   3830  C  CA    . GLY F  6  53  ? -50.851  -53.236 34.496  1.00 88.75  ? 53  GLY F CA    1 
ATOM   3831  C  C     . GLY F  6  53  ? -50.853  -54.559 35.248  1.00 88.39  ? 53  GLY F C     1 
ATOM   3832  O  O     . GLY F  6  53  ? -51.497  -54.634 36.302  1.00 83.04  ? 53  GLY F O     1 
ATOM   3833  N  N     . ALA F  6  54  ? -50.135  -55.581 34.768  1.00 86.22  ? 54  ALA F N     1 
ATOM   3834  C  CA    . ALA F  6  54  ? -50.130  -56.902 35.439  1.00 84.78  ? 54  ALA F CA    1 
ATOM   3835  C  C     . ALA F  6  54  ? -48.848  -57.241 36.192  1.00 77.20  ? 54  ALA F C     1 
ATOM   3836  O  O     . ALA F  6  54  ? -47.769  -56.790 35.795  1.00 81.55  ? 54  ALA F O     1 
ATOM   3837  C  CB    . ALA F  6  54  ? -50.430  -57.983 34.414  1.00 95.15  ? 54  ALA F CB    1 
ATOM   3838  N  N     . LEU F  6  55  ? -48.964  -58.019 37.267  1.00 72.04  ? 55  LEU F N     1 
ATOM   3839  C  CA    . LEU F  6  55  ? -47.864  -58.182 38.225  1.00 71.02  ? 55  LEU F CA    1 
ATOM   3840  C  C     . LEU F  6  55  ? -46.591  -58.734 37.646  1.00 64.52  ? 55  LEU F C     1 
ATOM   3841  O  O     . LEU F  6  55  ? -46.616  -59.754 36.989  1.00 66.03  ? 55  LEU F O     1 
ATOM   3842  C  CB    . LEU F  6  55  ? -48.254  -59.068 39.409  1.00 72.50  ? 55  LEU F CB    1 
ATOM   3843  C  CG    . LEU F  6  55  ? -47.080  -59.400 40.373  1.00 73.60  ? 55  LEU F CG    1 
ATOM   3844  C  CD1   . LEU F  6  55  ? -47.490  -59.398 41.841  1.00 73.36  ? 55  LEU F CD1   1 
ATOM   3845  C  CD2   . LEU F  6  55  ? -46.349  -60.702 40.021  1.00 75.91  ? 55  LEU F CD2   1 
ATOM   3846  N  N     . SER F  6  56  ? -45.487  -58.098 37.981  1.00 65.20  ? 56  SER F N     1 
ATOM   3847  C  CA    . SER F  6  56  ? -44.153  -58.435 37.492  1.00 73.76  ? 56  SER F CA    1 
ATOM   3848  C  C     . SER F  6  56  ? -43.382  -59.261 38.518  1.00 65.61  ? 56  SER F C     1 
ATOM   3849  O  O     . SER F  6  56  ? -42.774  -60.235 38.149  1.00 64.72  ? 56  SER F O     1 
ATOM   3850  C  CB    . SER F  6  56  ? -43.360  -57.131 37.166  1.00 84.28  ? 56  SER F CB    1 
ATOM   3851  O  OG    . SER F  6  56  ? -42.050  -57.322 36.627  1.00 86.67  ? 56  SER F OG    1 
ATOM   3852  N  N     . GLY F  6  57  ? -43.338  -58.830 39.766  1.00 61.55  ? 57  GLY F N     1 
ATOM   3853  C  CA    . GLY F  6  57  ? -42.586  -59.553 40.779  1.00 62.50  ? 57  GLY F CA    1 
ATOM   3854  C  C     . GLY F  6  57  ? -42.759  -58.989 42.190  1.00 67.87  ? 57  GLY F C     1 
ATOM   3855  O  O     . GLY F  6  57  ? -43.370  -57.932 42.365  1.00 59.72  ? 57  GLY F O     1 
ATOM   3856  N  N     . HIS F  6  58  ? -42.238  -59.700 43.195  1.00 70.14  ? 58  HIS F N     1 
ATOM   3857  C  CA    . HIS F  6  58  ? -42.303  -59.207 44.555  1.00 75.88  ? 58  HIS F CA    1 
ATOM   3858  C  C     . HIS F  6  58  ? -40.929  -58.693 44.910  1.00 68.26  ? 58  HIS F C     1 
ATOM   3859  O  O     . HIS F  6  58  ? -39.939  -59.370 44.697  1.00 69.54  ? 58  HIS F O     1 
ATOM   3860  C  CB    . HIS F  6  58  ? -42.767  -60.295 45.538  1.00 92.44  ? 58  HIS F CB    1 
ATOM   3861  C  CG    . HIS F  6  58  ? -42.961  -59.799 46.942  1.00 111.48 ? 58  HIS F CG    1 
ATOM   3862  N  ND1   . HIS F  6  58  ? -41.919  -59.593 47.834  1.00 110.99 ? 58  HIS F ND1   1 
ATOM   3863  C  CD2   . HIS F  6  58  ? -44.093  -59.431 47.593  1.00 123.34 ? 58  HIS F CD2   1 
ATOM   3864  C  CE1   . HIS F  6  58  ? -42.402  -59.121 48.972  1.00 121.13 ? 58  HIS F CE1   1 
ATOM   3865  N  NE2   . HIS F  6  58  ? -43.717  -59.000 48.848  1.00 129.83 ? 58  HIS F NE2   1 
ATOM   3866  N  N     . LEU F  6  59  ? -40.878  -57.512 45.501  1.00 66.03  ? 59  LEU F N     1 
ATOM   3867  C  CA    . LEU F  6  59  ? -39.625  -56.827 45.797  1.00 66.12  ? 59  LEU F CA    1 
ATOM   3868  C  C     . LEU F  6  59  ? -39.353  -56.843 47.293  1.00 61.90  ? 59  LEU F C     1 
ATOM   3869  O  O     . LEU F  6  59  ? -38.575  -57.698 47.741  1.00 59.25  ? 59  LEU F O     1 
ATOM   3870  C  CB    . LEU F  6  59  ? -39.620  -55.391 45.248  1.00 68.48  ? 59  LEU F CB    1 
ATOM   3871  C  CG    . LEU F  6  59  ? -39.646  -55.055 43.758  1.00 65.76  ? 59  LEU F CG    1 
ATOM   3872  C  CD1   . LEU F  6  59  ? -40.431  -56.112 43.011  1.00 68.06  ? 59  LEU F CD1   1 
ATOM   3873  C  CD2   . LEU F  6  59  ? -40.227  -53.699 43.405  1.00 59.22  ? 59  LEU F CD2   1 
ATOM   3874  N  N     . GLY F  6  60  ? -39.974  -55.928 48.038  1.00 56.87  ? 60  GLY F N     1 
ATOM   3875  C  CA    . GLY F  6  60  ? -39.556  -55.690 49.412  1.00 62.17  ? 60  GLY F CA    1 
ATOM   3876  C  C     . GLY F  6  60  ? -39.782  -54.275 49.924  1.00 63.68  ? 60  GLY F C     1 
ATOM   3877  O  O     . GLY F  6  60  ? -40.768  -53.648 49.582  1.00 61.40  ? 60  GLY F O     1 
ATOM   3878  N  N     . GLU F  6  61  ? -38.839  -53.768 50.721  1.00 66.25  ? 61  GLU F N     1 
ATOM   3879  C  CA    . GLU F  6  61  ? -38.918  -52.401 51.252  1.00 68.69  ? 61  GLU F CA    1 
ATOM   3880  C  C     . GLU F  6  61  ? -38.363  -51.451 50.206  1.00 60.18  ? 61  GLU F C     1 
ATOM   3881  O  O     . GLU F  6  61  ? -37.263  -51.580 49.779  1.00 58.51  ? 61  GLU F O     1 
ATOM   3882  C  CB    . GLU F  6  61  ? -38.135  -52.308 52.567  1.00 78.58  ? 61  GLU F CB    1 
ATOM   3883  C  CG    . GLU F  6  61  ? -38.252  -51.006 53.355  1.00 83.01  ? 61  GLU F CG    1 
ATOM   3884  C  CD    . GLU F  6  61  ? -37.298  -50.965 54.556  1.00 91.94  ? 61  GLU F CD    1 
ATOM   3885  O  OE1   . GLU F  6  61  ? -36.730  -52.027 54.954  1.00 100.57 ? 61  GLU F OE1   1 
ATOM   3886  O  OE2   . GLU F  6  61  ? -37.020  -49.859 55.079  1.00 88.75  ? 61  GLU F OE2   1 
ATOM   3887  N  N     . VAL F  6  62  ? -39.140  -50.483 49.776  1.00 56.86  ? 62  VAL F N     1 
ATOM   3888  C  CA    . VAL F  6  62  ? -38.765  -49.633 48.664  1.00 50.18  ? 62  VAL F CA    1 
ATOM   3889  C  C     . VAL F  6  62  ? -38.913  -48.133 48.902  1.00 49.49  ? 62  VAL F C     1 
ATOM   3890  O  O     . VAL F  6  62  ? -39.946  -47.638 49.393  1.00 47.18  ? 62  VAL F O     1 
ATOM   3891  C  CB    . VAL F  6  62  ? -39.696  -49.981 47.525  1.00 51.23  ? 62  VAL F CB    1 
ATOM   3892  C  CG1   . VAL F  6  62  ? -39.592  -48.937 46.403  1.00 55.33  ? 62  VAL F CG1   1 
ATOM   3893  C  CG2   . VAL F  6  62  ? -39.399  -51.376 46.988  1.00 49.33  ? 62  VAL F CG2   1 
ATOM   3894  N  N     . LEU F  6  63  ? -37.870  -47.393 48.575  1.00 49.15  ? 63  LEU F N     1 
ATOM   3895  C  CA    . LEU F  6  63  ? -37.977  -45.925 48.523  1.00 49.48  ? 63  LEU F CA    1 
ATOM   3896  C  C     . LEU F  6  63  ? -38.334  -45.519 47.122  1.00 50.18  ? 63  LEU F C     1 
ATOM   3897  O  O     . LEU F  6  63  ? -37.783  -46.060 46.151  1.00 52.78  ? 63  LEU F O     1 
ATOM   3898  C  CB    . LEU F  6  63  ? -36.618  -45.337 48.839  1.00 49.18  ? 63  LEU F CB    1 
ATOM   3899  C  CG    . LEU F  6  63  ? -36.504  -43.858 48.712  1.00 52.13  ? 63  LEU F CG    1 
ATOM   3900  C  CD1   . LEU F  6  63  ? -37.524  -43.168 49.615  1.00 58.20  ? 63  LEU F CD1   1 
ATOM   3901  C  CD2   . LEU F  6  63  ? -35.111  -43.414 49.102  1.00 53.02  ? 63  LEU F CD2   1 
ATOM   3902  N  N     . ILE F  6  64  ? -39.296  -44.615 46.989  1.00 47.87  ? 64  ILE F N     1 
ATOM   3903  C  CA    . ILE F  6  64  ? -39.584  -44.068 45.689  1.00 48.68  ? 64  ILE F CA    1 
ATOM   3904  C  C     . ILE F  6  64  ? -39.292  -42.594 45.744  1.00 48.52  ? 64  ILE F C     1 
ATOM   3905  O  O     . ILE F  6  64  ? -39.919  -41.831 46.471  1.00 50.09  ? 64  ILE F O     1 
ATOM   3906  C  CB    . ILE F  6  64  ? -41.048  -44.268 45.320  1.00 53.40  ? 64  ILE F CB    1 
ATOM   3907  C  CG1   . ILE F  6  64  ? -41.384  -45.745 45.303  1.00 52.94  ? 64  ILE F CG1   1 
ATOM   3908  C  CG2   . ILE F  6  64  ? -41.360  -43.737 43.912  1.00 57.02  ? 64  ILE F CG2   1 
ATOM   3909  C  CD1   . ILE F  6  64  ? -42.872  -46.048 45.200  1.00 52.82  ? 64  ILE F CD1   1 
ATOM   3910  N  N     . ARG F  6  65  ? -38.414  -42.152 44.870  1.00 49.65  ? 65  ARG F N     1 
ATOM   3911  C  CA    . ARG F  6  65  ? -38.092  -40.732 44.839  1.00 52.57  ? 65  ARG F CA    1 
ATOM   3912  C  C     . ARG F  6  65  ? -39.301  -40.021 44.221  1.00 53.64  ? 65  ARG F C     1 
ATOM   3913  O  O     . ARG F  6  65  ? -39.819  -40.429 43.165  1.00 53.48  ? 65  ARG F O     1 
ATOM   3914  C  CB    . ARG F  6  65  ? -36.814  -40.409 44.048  1.00 51.28  ? 65  ARG F CB    1 
ATOM   3915  C  CG    . ARG F  6  65  ? -35.994  -39.314 44.708  1.00 50.99  ? 65  ARG F CG    1 
ATOM   3916  C  CD    . ARG F  6  65  ? -34.792  -38.896 43.878  1.00 48.94  ? 65  ARG F CD    1 
ATOM   3917  N  NE    . ARG F  6  65  ? -35.082  -37.655 43.228  1.00 44.76  ? 65  ARG F NE    1 
ATOM   3918  C  CZ    . ARG F  6  65  ? -34.435  -36.525 43.412  1.00 44.70  ? 65  ARG F CZ    1 
ATOM   3919  N  NH1   . ARG F  6  65  ? -33.434  -36.425 44.248  1.00 43.53  ? 65  ARG F NH1   1 
ATOM   3920  N  NH2   . ARG F  6  65  ? -34.823  -35.443 42.742  1.00 46.96  ? 65  ARG F NH2   1 
ATOM   3921  N  N     . CYS F  6  66  ? -39.665  -38.934 44.885  1.00 53.13  ? 66  CYS F N     1 
ATOM   3922  C  CA    . CYS F  6  66  ? -40.908  -38.255 44.637  1.00 53.88  ? 66  CYS F CA    1 
ATOM   3923  C  C     . CYS F  6  66  ? -41.123  -37.798 43.203  1.00 51.95  ? 66  CYS F C     1 
ATOM   3924  O  O     . CYS F  6  66  ? -42.234  -37.872 42.696  1.00 55.33  ? 66  CYS F O     1 
ATOM   3925  C  CB    . CYS F  6  66  ? -40.952  -37.026 45.550  1.00 56.95  ? 66  CYS F CB    1 
ATOM   3926  S  SG    . CYS F  6  66  ? -39.568  -35.893 45.319  1.00 53.83  ? 66  CYS F SG    1 
ATOM   3927  N  N     . ASN F  6  67  ? -40.077  -37.266 42.579  1.00 49.19  ? 67  ASN F N     1 
ATOM   3928  C  CA    . ASN F  6  67  ? -40.181  -36.839 41.203  1.00 47.92  ? 67  ASN F CA    1 
ATOM   3929  C  C     . ASN F  6  67  ? -40.719  -37.899 40.239  1.00 42.31  ? 67  ASN F C     1 
ATOM   3930  O  O     . ASN F  6  67  ? -41.373  -37.547 39.268  1.00 40.31  ? 67  ASN F O     1 
ATOM   3931  C  CB    . ASN F  6  67  ? -38.838  -36.319 40.689  1.00 50.83  ? 67  ASN F CB    1 
ATOM   3932  C  CG    . ASN F  6  67  ? -37.811  -37.413 40.618  1.00 54.19  ? 67  ASN F CG    1 
ATOM   3933  O  OD1   . ASN F  6  67  ? -37.416  -37.923 41.676  1.00 59.68  ? 67  ASN F OD1   1 
ATOM   3934  N  ND2   . ASN F  6  67  ? -37.416  -37.808 39.408  1.00 50.30  ? 67  ASN F ND2   1 
ATOM   3935  N  N     . ASN F  6  68  ? -40.492  -39.160 40.538  1.00 40.99  ? 68  ASN F N     1 
ATOM   3936  C  CA    . ASN F  6  68  ? -40.954  -40.229 39.654  1.00 45.07  ? 68  ASN F CA    1 
ATOM   3937  C  C     . ASN F  6  68  ? -42.445  -40.573 39.646  1.00 44.41  ? 68  ASN F C     1 
ATOM   3938  O  O     . ASN F  6  68  ? -42.952  -41.145 38.707  1.00 42.71  ? 68  ASN F O     1 
ATOM   3939  C  CB    . ASN F  6  68  ? -40.192  -41.505 39.957  1.00 45.80  ? 68  ASN F CB    1 
ATOM   3940  C  CG    . ASN F  6  68  ? -38.707  -41.315 39.816  1.00 47.56  ? 68  ASN F CG    1 
ATOM   3941  O  OD1   . ASN F  6  68  ? -38.158  -41.320 38.716  1.00 50.22  ? 68  ASN F OD1   1 
ATOM   3942  N  ND2   . ASN F  6  68  ? -38.054  -41.090 40.932  1.00 50.74  ? 68  ASN F ND2   1 
ATOM   3943  N  N     . VAL F  6  69  ? -43.127  -40.204 40.701  1.00 48.37  ? 69  VAL F N     1 
ATOM   3944  C  CA    . VAL F  6  69  ? -44.522  -40.504 40.875  1.00 51.72  ? 69  VAL F CA    1 
ATOM   3945  C  C     . VAL F  6  69  ? -45.464  -39.689 40.038  1.00 55.58  ? 69  VAL F C     1 
ATOM   3946  O  O     . VAL F  6  69  ? -45.347  -38.438 40.040  1.00 60.73  ? 69  VAL F O     1 
ATOM   3947  C  CB    . VAL F  6  69  ? -44.943  -40.169 42.331  1.00 56.43  ? 69  VAL F CB    1 
ATOM   3948  C  CG1   . VAL F  6  69  ? -46.449  -40.124 42.622  1.00 58.90  ? 69  VAL F CG1   1 
ATOM   3949  C  CG2   . VAL F  6  69  ? -44.399  -41.324 43.128  1.00 60.34  ? 69  VAL F CG2   1 
ATOM   3950  N  N     . LEU F  6  70  ? -46.468  -40.384 39.488  1.00 51.93  ? 70  LEU F N     1 
ATOM   3951  C  CA    . LEU F  6  70  ? -47.522  -39.754 38.710  1.00 48.32  ? 70  LEU F CA    1 
ATOM   3952  C  C     . LEU F  6  70  ? -48.715  -39.600 39.618  1.00 52.06  ? 70  LEU F C     1 
ATOM   3953  O  O     . LEU F  6  70  ? -49.171  -38.461 39.835  1.00 59.59  ? 70  LEU F O     1 
ATOM   3954  C  CB    . LEU F  6  70  ? -47.897  -40.561 37.501  1.00 47.47  ? 70  LEU F CB    1 
ATOM   3955  C  CG    . LEU F  6  70  ? -49.268  -40.280 36.854  1.00 47.99  ? 70  LEU F CG    1 
ATOM   3956  C  CD1   . LEU F  6  70  ? -49.378  -38.859 36.406  1.00 46.85  ? 70  LEU F CD1   1 
ATOM   3957  C  CD2   . LEU F  6  70  ? -49.551  -41.146 35.640  1.00 49.57  ? 70  LEU F CD2   1 
ATOM   3958  N  N     . TYR F  6  71  ? -49.260  -40.697 40.123  1.00 52.92  ? 71  TYR F N     1 
ATOM   3959  C  CA    . TYR F  6  71  ? -50.347  -40.643 41.130  1.00 58.08  ? 71  TYR F CA    1 
ATOM   3960  C  C     . TYR F  6  71  ? -50.218  -41.759 42.153  1.00 58.30  ? 71  TYR F C     1 
ATOM   3961  O  O     . TYR F  6  71  ? -49.636  -42.804 41.854  1.00 58.86  ? 71  TYR F O     1 
ATOM   3962  C  CB    . TYR F  6  71  ? -51.797  -40.620 40.533  1.00 58.19  ? 71  TYR F CB    1 
ATOM   3963  C  CG    . TYR F  6  71  ? -52.200  -41.844 39.720  1.00 56.41  ? 71  TYR F CG    1 
ATOM   3964  C  CD1   . TYR F  6  71  ? -52.428  -43.077 40.337  1.00 56.27  ? 71  TYR F CD1   1 
ATOM   3965  C  CD2   . TYR F  6  71  ? -52.313  -41.791 38.339  1.00 54.94  ? 71  TYR F CD2   1 
ATOM   3966  C  CE1   . TYR F  6  71  ? -52.740  -44.219 39.591  1.00 56.23  ? 71  TYR F CE1   1 
ATOM   3967  C  CE2   . TYR F  6  71  ? -52.637  -42.918 37.594  1.00 56.20  ? 71  TYR F CE2   1 
ATOM   3968  C  CZ    . TYR F  6  71  ? -52.851  -44.127 38.235  1.00 55.93  ? 71  TYR F CZ    1 
ATOM   3969  O  OH    . TYR F  6  71  ? -53.202  -45.245 37.523  1.00 57.93  ? 71  TYR F OH    1 
ATOM   3970  N  N     . ILE F  6  72  ? -50.904  -41.590 43.275  1.00 58.52  ? 72  ILE F N     1 
ATOM   3971  C  CA    . ILE F  6  72  ? -50.934  -42.628 44.293  1.00 65.07  ? 72  ILE F CA    1 
ATOM   3972  C  C     . ILE F  6  72  ? -52.375  -42.786 44.699  1.00 67.89  ? 72  ILE F C     1 
ATOM   3973  O  O     . ILE F  6  72  ? -53.111  -41.794 44.682  1.00 70.90  ? 72  ILE F O     1 
ATOM   3974  C  CB    . ILE F  6  72  ? -50.098  -42.302 45.539  1.00 72.24  ? 72  ILE F CB    1 
ATOM   3975  C  CG1   . ILE F  6  72  ? -50.243  -43.385 46.622  1.00 74.34  ? 72  ILE F CG1   1 
ATOM   3976  C  CG2   . ILE F  6  72  ? -50.460  -40.931 46.105  1.00 76.46  ? 72  ILE F CG2   1 
ATOM   3977  C  CD1   . ILE F  6  72  ? -49.429  -43.167 47.869  1.00 76.02  ? 72  ILE F CD1   1 
ATOM   3978  N  N     . ARG F  6  73  ? -52.749  -44.015 45.068  1.00 68.93  ? 73  ARG F N     1 
ATOM   3979  C  CA    . ARG F  6  73  ? -54.142  -44.383 45.285  1.00 70.02  ? 73  ARG F CA    1 
ATOM   3980  C  C     . ARG F  6  73  ? -54.262  -45.492 46.320  1.00 71.68  ? 73  ARG F C     1 
ATOM   3981  O  O     . ARG F  6  73  ? -53.342  -46.265 46.469  1.00 71.62  ? 73  ARG F O     1 
ATOM   3982  C  CB    . ARG F  6  73  ? -54.638  -44.775 43.920  1.00 68.56  ? 73  ARG F CB    1 
ATOM   3983  C  CG    . ARG F  6  73  ? -55.590  -45.883 43.665  1.00 79.25  ? 73  ARG F CG    1 
ATOM   3984  C  CD    . ARG F  6  73  ? -55.471  -46.274 42.200  1.00 81.59  ? 73  ARG F CD    1 
ATOM   3985  N  NE    . ARG F  6  73  ? -55.539  -47.745 42.235  1.00 79.62  ? 73  ARG F NE    1 
ATOM   3986  C  CZ    . ARG F  6  73  ? -55.283  -48.481 41.183  1.00 79.79  ? 73  ARG F CZ    1 
ATOM   3987  N  NH1   . ARG F  6  73  ? -55.328  -49.783 41.292  1.00 82.74  ? 73  ARG F NH1   1 
ATOM   3988  N  NH2   . ARG F  6  73  ? -54.911  -47.921 40.048  1.00 86.17  ? 73  ARG F NH2   1 
ATOM   3989  N  N     . GLY F  6  74  ? -55.355  -45.526 47.085  1.00 72.70  ? 74  GLY F N     1 
ATOM   3990  C  CA    . GLY F  6  74  ? -55.619  -46.629 47.999  1.00 72.18  ? 74  GLY F CA    1 
ATOM   3991  C  C     . GLY F  6  74  ? -55.744  -48.020 47.378  1.00 75.33  ? 74  GLY F C     1 
ATOM   3992  O  O     . GLY F  6  74  ? -56.029  -48.182 46.172  1.00 69.89  ? 74  GLY F O     1 
ATOM   3993  N  N     . VAL F  6  75  ? -55.555  -49.008 48.253  1.00 83.53  ? 75  VAL F N     1 
ATOM   3994  C  CA    . VAL F  6  75  ? -55.572  -50.469 47.986  1.00 91.53  ? 75  VAL F CA    1 
ATOM   3995  C  C     . VAL F  6  75  ? -55.421  -50.860 46.541  1.00 91.86  ? 75  VAL F C     1 
ATOM   3996  O  O     . VAL F  6  75  ? -54.335  -50.798 46.029  1.00 87.32  ? 75  VAL F O     1 
ATOM   3997  C  CB    . VAL F  6  75  ? -56.807  -51.203 48.586  1.00 95.68  ? 75  VAL F CB    1 
ATOM   3998  C  CG1   . VAL F  6  75  ? -56.641  -51.399 50.101  1.00 95.68  ? 75  VAL F CG1   1 
ATOM   3999  C  CG2   . VAL F  6  75  ? -58.105  -50.499 48.151  1.00 97.26  ? 75  VAL F CG2   1 
ATOM   4000  O  OXT   . VAL F  6  75  ? -56.360  -51.244 45.851  1.00 118.11 ? 75  VAL F OXT   1 
ATOM   4001  N  N     . LYS G  7  3   ? -38.930  -12.806 46.309  1.00 119.37 ? 3   LYS G N     1 
ATOM   4002  C  CA    . LYS G  7  3   ? -37.868  -13.233 45.347  1.00 126.38 ? 3   LYS G CA    1 
ATOM   4003  C  C     . LYS G  7  3   ? -38.378  -13.478 43.927  1.00 126.15 ? 3   LYS G C     1 
ATOM   4004  O  O     . LYS G  7  3   ? -37.645  -13.233 42.974  1.00 125.64 ? 3   LYS G O     1 
ATOM   4005  C  CB    . LYS G  7  3   ? -37.125  -14.500 45.840  1.00 126.78 ? 3   LYS G CB    1 
ATOM   4006  C  CG    . LYS G  7  3   ? -35.897  -14.850 44.998  1.00 125.59 ? 3   LYS G CG    1 
ATOM   4007  C  CD    . LYS G  7  3   ? -34.514  -15.045 45.650  1.00 129.62 ? 3   LYS G CD    1 
ATOM   4008  C  CE    . LYS G  7  3   ? -33.407  -14.340 44.828  1.00 129.13 ? 3   LYS G CE    1 
ATOM   4009  N  NZ    . LYS G  7  3   ? -31.982  -14.596 45.202  1.00 128.24 ? 3   LYS G NZ    1 
ATOM   4010  N  N     . ALA G  7  4   ? -39.604  -13.974 43.788  1.00 117.28 ? 4   ALA G N     1 
ATOM   4011  C  CA    . ALA G  7  4   ? -40.096  -14.380 42.490  1.00 99.77  ? 4   ALA G CA    1 
ATOM   4012  C  C     . ALA G  7  4   ? -41.180  -13.490 41.983  1.00 92.10  ? 4   ALA G C     1 
ATOM   4013  O  O     . ALA G  7  4   ? -42.324  -13.630 42.445  1.00 78.67  ? 4   ALA G O     1 
ATOM   4014  C  CB    . ALA G  7  4   ? -40.634  -15.780 42.620  1.00 105.40 ? 4   ALA G CB    1 
ATOM   4015  N  N     . HIS G  7  5   ? -40.841  -12.702 40.967  1.00 91.21  ? 5   HIS G N     1 
ATOM   4016  C  CA    . HIS G  7  5   ? -41.752  -11.668 40.473  1.00 96.14  ? 5   HIS G CA    1 
ATOM   4017  C  C     . HIS G  7  5   ? -42.838  -12.195 39.554  1.00 89.99  ? 5   HIS G C     1 
ATOM   4018  O  O     . HIS G  7  5   ? -42.613  -13.172 38.858  1.00 102.77 ? 5   HIS G O     1 
ATOM   4019  C  CB    . HIS G  7  5   ? -40.955  -10.648 39.692  1.00 101.63 ? 5   HIS G CB    1 
ATOM   4020  C  CG    . HIS G  7  5   ? -39.585  -10.397 40.233  1.00 110.07 ? 5   HIS G CG    1 
ATOM   4021  N  ND1   . HIS G  7  5   ? -39.262  -9.575  41.295  1.00 120.58 ? 5   HIS G ND1   1 
ATOM   4022  C  CD2   . HIS G  7  5   ? -38.411  -10.876 39.770  1.00 119.17 ? 5   HIS G CD2   1 
ATOM   4023  C  CE1   . HIS G  7  5   ? -37.947  -9.568  41.464  1.00 121.16 ? 5   HIS G CE1   1 
ATOM   4024  N  NE2   . HIS G  7  5   ? -37.407  -10.339 40.540  1.00 118.80 ? 5   HIS G NE2   1 
ATOM   4025  N  N     . PRO G  7  6   ? -43.967  -11.508 39.447  1.00 82.40  ? 6   PRO G N     1 
ATOM   4026  C  CA    . PRO G  7  6   ? -45.023  -11.955 38.548  1.00 81.12  ? 6   PRO G CA    1 
ATOM   4027  C  C     . PRO G  7  6   ? -44.697  -11.615 37.100  1.00 80.91  ? 6   PRO G C     1 
ATOM   4028  O  O     . PRO G  7  6   ? -43.847  -10.744 36.857  1.00 92.96  ? 6   PRO G O     1 
ATOM   4029  C  CB    . PRO G  7  6   ? -46.238  -11.176 38.982  1.00 81.28  ? 6   PRO G CB    1 
ATOM   4030  C  CG    . PRO G  7  6   ? -45.609  -9.896  39.440  1.00 89.20  ? 6   PRO G CG    1 
ATOM   4031  C  CD    . PRO G  7  6   ? -44.210  -10.168 39.974  1.00 87.12  ? 6   PRO G CD    1 
ATOM   4032  N  N     . PRO G  7  7   ? -45.312  -12.334 36.155  1.00 75.22  ? 7   PRO G N     1 
ATOM   4033  C  CA    . PRO G  7  7   ? -45.034  -12.048 34.766  1.00 73.77  ? 7   PRO G CA    1 
ATOM   4034  C  C     . PRO G  7  7   ? -45.896  -10.898 34.317  1.00 72.60  ? 7   PRO G C     1 
ATOM   4035  O  O     . PRO G  7  7   ? -46.994  -10.693 34.864  1.00 74.36  ? 7   PRO G O     1 
ATOM   4036  C  CB    . PRO G  7  7   ? -45.423  -13.341 34.038  1.00 79.51  ? 7   PRO G CB    1 
ATOM   4037  C  CG    . PRO G  7  7   ? -46.379  -14.043 34.962  1.00 76.93  ? 7   PRO G CG    1 
ATOM   4038  C  CD    . PRO G  7  7   ? -46.036  -13.604 36.342  1.00 75.94  ? 7   PRO G CD    1 
ATOM   4039  N  N     . GLU G  7  8   ? -45.407  -10.187 33.312  1.00 74.11  ? 8   GLU G N     1 
ATOM   4040  C  CA    . GLU G  7  8   ? -46.067  -8.993  32.791  1.00 89.80  ? 8   GLU G CA    1 
ATOM   4041  C  C     . GLU G  7  8   ? -47.116  -9.291  31.722  1.00 87.98  ? 8   GLU G C     1 
ATOM   4042  O  O     . GLU G  7  8   ? -46.918  -8.973  30.531  1.00 89.49  ? 8   GLU G O     1 
ATOM   4043  C  CB    . GLU G  7  8   ? -45.028  -8.028  32.236  1.00 102.90 ? 8   GLU G CB    1 
ATOM   4044  C  CG    . GLU G  7  8   ? -43.868  -7.690  33.156  1.00 114.81 ? 8   GLU G CG    1 
ATOM   4045  C  CD    . GLU G  7  8   ? -43.730  -6.184  33.388  1.00 130.48 ? 8   GLU G CD    1 
ATOM   4046  O  OE1   . GLU G  7  8   ? -43.642  -5.371  32.437  1.00 135.71 ? 8   GLU G OE1   1 
ATOM   4047  O  OE2   . GLU G  7  8   ? -43.663  -5.803  34.569  1.00 143.20 ? 8   GLU G OE2   1 
ATOM   4048  N  N     . LEU G  7  9   ? -48.217  -9.901  32.141  1.00 81.79  ? 9   LEU G N     1 
ATOM   4049  C  CA    . LEU G  7  9   ? -49.256  -10.221 31.187  1.00 89.11  ? 9   LEU G CA    1 
ATOM   4050  C  C     . LEU G  7  9   ? -50.491  -9.386  31.448  1.00 101.80 ? 9   LEU G C     1 
ATOM   4051  O  O     . LEU G  7  9   ? -51.601  -9.844  31.157  1.00 110.19 ? 9   LEU G O     1 
ATOM   4052  C  CB    . LEU G  7  9   ? -49.625  -11.684 31.291  1.00 89.76  ? 9   LEU G CB    1 
ATOM   4053  C  CG    . LEU G  7  9   ? -48.536  -12.730 31.191  1.00 92.05  ? 9   LEU G CG    1 
ATOM   4054  C  CD1   . LEU G  7  9   ? -49.014  -13.892 32.065  1.00 92.74  ? 9   LEU G CD1   1 
ATOM   4055  C  CD2   . LEU G  7  9   ? -48.248  -13.128 29.750  1.00 90.67  ? 9   LEU G CD2   1 
ATOM   4056  N  N     . LYS G  7  10  ? -50.323  -8.183  32.000  1.00 102.35 ? 10  LYS G N     1 
ATOM   4057  C  CA    . LYS G  7  10  ? -51.425  -7.223  32.053  1.00 97.29  ? 10  LYS G CA    1 
ATOM   4058  C  C     . LYS G  7  10  ? -51.833  -6.865  30.621  1.00 88.94  ? 10  LYS G C     1 
ATOM   4059  O  O     . LYS G  7  10  ? -52.977  -7.037  30.246  1.00 83.39  ? 10  LYS G O     1 
ATOM   4060  C  CB    . LYS G  7  10  ? -51.019  -5.998  32.839  1.00 106.38 ? 10  LYS G CB    1 
ATOM   4061  C  CG    . LYS G  7  10  ? -50.853  -6.361  34.351  1.00 122.46 ? 10  LYS G CG    1 
ATOM   4062  C  CD    . LYS G  7  10  ? -50.082  -5.383  35.248  1.00 144.57 ? 10  LYS G CD    1 
ATOM   4063  C  CE    . LYS G  7  10  ? -49.011  -6.094  36.102  1.00 152.05 ? 10  LYS G CE    1 
ATOM   4064  N  NZ    . LYS G  7  10  ? -48.223  -5.154  36.944  1.00 152.06 ? 10  LYS G NZ    1 
ATOM   4065  N  N     . LYS G  7  11  ? -50.859  -6.481  29.804  1.00 86.47  ? 11  LYS G N     1 
ATOM   4066  C  CA    . LYS G  7  11  ? -50.985  -6.255  28.359  1.00 87.31  ? 11  LYS G CA    1 
ATOM   4067  C  C     . LYS G  7  11  ? -51.945  -7.228  27.622  1.00 87.75  ? 11  LYS G C     1 
ATOM   4068  O  O     . LYS G  7  11  ? -52.624  -6.821  26.678  1.00 95.91  ? 11  LYS G O     1 
ATOM   4069  C  CB    . LYS G  7  11  ? -49.605  -6.378  27.666  1.00 94.44  ? 11  LYS G CB    1 
ATOM   4070  C  CG    . LYS G  7  11  ? -48.517  -5.320  27.849  1.00 97.65  ? 11  LYS G CG    1 
ATOM   4071  C  CD    . LYS G  7  11  ? -47.642  -5.583  29.076  1.00 104.97 ? 11  LYS G CD    1 
ATOM   4072  C  CE    . LYS G  7  11  ? -46.166  -5.238  28.868  1.00 126.45 ? 11  LYS G CE    1 
ATOM   4073  N  NZ    . LYS G  7  11  ? -45.177  -6.096  29.599  1.00 139.37 ? 11  LYS G NZ    1 
ATOM   4074  N  N     . PHE G  7  12  ? -51.981  -8.506  28.003  1.00 82.44  ? 12  PHE G N     1 
ATOM   4075  C  CA    . PHE G  7  12  ? -52.770  -9.531  27.315  1.00 77.31  ? 12  PHE G CA    1 
ATOM   4076  C  C     . PHE G  7  12  ? -54.050  -9.882  28.066  1.00 76.82  ? 12  PHE G C     1 
ATOM   4077  O  O     . PHE G  7  12  ? -54.809  -10.741 27.640  1.00 74.77  ? 12  PHE G O     1 
ATOM   4078  C  CB    . PHE G  7  12  ? -51.960  -10.804 27.139  1.00 76.68  ? 12  PHE G CB    1 
ATOM   4079  C  CG    . PHE G  7  12  ? -50.701  -10.598 26.367  1.00 77.78  ? 12  PHE G CG    1 
ATOM   4080  C  CD1   . PHE G  7  12  ? -49.553  -10.150 27.018  1.00 83.49  ? 12  PHE G CD1   1 
ATOM   4081  C  CD2   . PHE G  7  12  ? -50.633  -10.883 25.020  1.00 76.05  ? 12  PHE G CD2   1 
ATOM   4082  C  CE1   . PHE G  7  12  ? -48.376  -9.937  26.314  1.00 79.59  ? 12  PHE G CE1   1 
ATOM   4083  C  CE2   . PHE G  7  12  ? -49.461  -10.677 24.314  1.00 75.58  ? 12  PHE G CE2   1 
ATOM   4084  C  CZ    . PHE G  7  12  ? -48.342  -10.185 24.960  1.00 76.38  ? 12  PHE G CZ    1 
ATOM   4085  N  N     . MET G  7  13  ? -54.320  -9.215  29.174  1.00 75.39  ? 13  MET G N     1 
ATOM   4086  C  CA    . MET G  7  13  ? -55.570  -9.480  29.846  1.00 73.98  ? 13  MET G CA    1 
ATOM   4087  C  C     . MET G  7  13  ? -56.798  -9.228  29.022  1.00 74.58  ? 13  MET G C     1 
ATOM   4088  O  O     . MET G  7  13  ? -56.897  -8.194  28.369  1.00 74.35  ? 13  MET G O     1 
ATOM   4089  C  CB    . MET G  7  13  ? -55.723  -8.638  31.083  1.00 76.92  ? 13  MET G CB    1 
ATOM   4090  C  CG    . MET G  7  13  ? -55.080  -9.252  32.291  1.00 76.15  ? 13  MET G CG    1 
ATOM   4091  S  SD    . MET G  7  13  ? -55.882  -10.818 32.825  1.00 84.05  ? 13  MET G SD    1 
ATOM   4092  C  CE    . MET G  7  13  ? -55.213  -10.573 34.466  1.00 81.36  ? 13  MET G CE    1 
ATOM   4093  N  N     . ASP G  7  14  ? -57.758  -10.131 29.154  1.00 83.79  ? 14  ASP G N     1 
ATOM   4094  C  CA    . ASP G  7  14  ? -59.039  -10.074 28.422  1.00 90.83  ? 14  ASP G CA    1 
ATOM   4095  C  C     . ASP G  7  14  ? -58.847  -10.010 26.902  1.00 87.30  ? 14  ASP G C     1 
ATOM   4096  O  O     . ASP G  7  14  ? -59.622  -9.392  26.206  1.00 82.55  ? 14  ASP G O     1 
ATOM   4097  C  CB    . ASP G  7  14  ? -59.913  -8.900  28.891  1.00 96.18  ? 14  ASP G CB    1 
ATOM   4098  C  CG    . ASP G  7  14  ? -60.247  -8.957  30.360  1.00 105.90 ? 14  ASP G CG    1 
ATOM   4099  O  OD1   . ASP G  7  14  ? -60.991  -9.887  30.723  1.00 112.00 ? 14  ASP G OD1   1 
ATOM   4100  O  OD2   . ASP G  7  14  ? -59.816  -8.083  31.161  1.00 110.98 ? 14  ASP G OD2   1 
ATOM   4101  N  N     . LYS G  7  15  ? -57.774  -10.600 26.398  1.00 87.05  ? 15  LYS G N     1 
ATOM   4102  C  CA    . LYS G  7  15  ? -57.515  -10.639 24.978  1.00 87.15  ? 15  LYS G CA    1 
ATOM   4103  C  C     . LYS G  7  15  ? -57.608  -12.090 24.547  1.00 89.53  ? 15  LYS G C     1 
ATOM   4104  O  O     . LYS G  7  15  ? -57.369  -13.010 25.323  1.00 92.76  ? 15  LYS G O     1 
ATOM   4105  C  CB    . LYS G  7  15  ? -56.133  -10.108 24.689  1.00 94.20  ? 15  LYS G CB    1 
ATOM   4106  C  CG    . LYS G  7  15  ? -55.921  -8.667  25.130  1.00 103.60 ? 15  LYS G CG    1 
ATOM   4107  C  CD    . LYS G  7  15  ? -56.497  -7.707  24.108  1.00 116.64 ? 15  LYS G CD    1 
ATOM   4108  C  CE    . LYS G  7  15  ? -56.198  -6.248  24.421  1.00 119.96 ? 15  LYS G CE    1 
ATOM   4109  N  NZ    . LYS G  7  15  ? -56.788  -5.807  25.700  1.00 122.18 ? 15  LYS G NZ    1 
ATOM   4110  N  N     . LYS G  7  16  ? -57.966  -12.302 23.293  1.00 89.40  ? 16  LYS G N     1 
ATOM   4111  C  CA    . LYS G  7  16  ? -57.985  -13.650 22.757  1.00 87.21  ? 16  LYS G CA    1 
ATOM   4112  C  C     . LYS G  7  16  ? -56.522  -13.965 22.422  1.00 83.50  ? 16  LYS G C     1 
ATOM   4113  O  O     . LYS G  7  16  ? -55.820  -13.191 21.753  1.00 79.13  ? 16  LYS G O     1 
ATOM   4114  C  CB    . LYS G  7  16  ? -58.885  -13.733 21.525  1.00 96.39  ? 16  LYS G CB    1 
ATOM   4115  C  CG    . LYS G  7  16  ? -58.978  -15.110 20.913  1.00 104.07 ? 16  LYS G CG    1 
ATOM   4116  C  CD    . LYS G  7  16  ? -60.357  -15.465 20.359  1.00 113.89 ? 16  LYS G CD    1 
ATOM   4117  C  CE    . LYS G  7  16  ? -60.359  -16.770 19.545  1.00 125.52 ? 16  LYS G CE    1 
ATOM   4118  N  NZ    . LYS G  7  16  ? -61.429  -17.747 19.945  1.00 132.94 ? 16  LYS G NZ    1 
ATOM   4119  N  N     . LEU G  7  17  ? -56.093  -15.127 22.886  1.00 75.92  ? 17  LEU G N     1 
ATOM   4120  C  CA    . LEU G  7  17  ? -54.756  -15.622 22.690  1.00 70.35  ? 17  LEU G CA    1 
ATOM   4121  C  C     . LEU G  7  17  ? -54.765  -16.977 21.997  1.00 71.75  ? 17  LEU G C     1 
ATOM   4122  O  O     . LEU G  7  17  ? -55.752  -17.721 22.025  1.00 68.36  ? 17  LEU G O     1 
ATOM   4123  C  CB    . LEU G  7  17  ? -54.110  -15.794 24.061  1.00 69.80  ? 17  LEU G CB    1 
ATOM   4124  C  CG    . LEU G  7  17  ? -54.019  -14.516 24.913  1.00 68.98  ? 17  LEU G CG    1 
ATOM   4125  C  CD1   . LEU G  7  17  ? -53.362  -14.845 26.249  1.00 67.24  ? 17  LEU G CD1   1 
ATOM   4126  C  CD2   . LEU G  7  17  ? -53.297  -13.379 24.209  1.00 65.26  ? 17  LEU G CD2   1 
ATOM   4127  N  N     . SER G  7  18  ? -53.630  -17.286 21.380  1.00 77.55  ? 18  SER G N     1 
ATOM   4128  C  CA    . SER G  7  18  ? -53.331  -18.617 20.881  1.00 78.63  ? 18  SER G CA    1 
ATOM   4129  C  C     . SER G  7  18  ? -52.049  -19.085 21.567  1.00 76.22  ? 18  SER G C     1 
ATOM   4130  O  O     . SER G  7  18  ? -51.016  -18.421 21.477  1.00 77.10  ? 18  SER G O     1 
ATOM   4131  C  CB    . SER G  7  18  ? -53.210  -18.589 19.370  1.00 83.61  ? 18  SER G CB    1 
ATOM   4132  O  OG    . SER G  7  18  ? -52.334  -19.606 18.939  1.00 102.39 ? 18  SER G OG    1 
ATOM   4133  N  N     . LEU G  7  19  ? -52.123  -20.233 22.243  1.00 75.21  ? 19  LEU G N     1 
ATOM   4134  C  CA    . LEU G  7  19  ? -51.080  -20.729 23.128  1.00 69.27  ? 19  LEU G CA    1 
ATOM   4135  C  C     . LEU G  7  19  ? -50.463  -22.033 22.640  1.00 72.49  ? 19  LEU G C     1 
ATOM   4136  O  O     . LEU G  7  19  ? -51.193  -22.977 22.368  1.00 66.15  ? 19  LEU G O     1 
ATOM   4137  C  CB    . LEU G  7  19  ? -51.652  -21.006 24.486  1.00 67.62  ? 19  LEU G CB    1 
ATOM   4138  C  CG    . LEU G  7  19  ? -52.555  -20.034 25.215  1.00 71.68  ? 19  LEU G CG    1 
ATOM   4139  C  CD1   . LEU G  7  19  ? -52.670  -20.351 26.696  1.00 77.38  ? 19  LEU G CD1   1 
ATOM   4140  C  CD2   . LEU G  7  19  ? -52.012  -18.654 25.132  1.00 77.28  ? 19  LEU G CD2   1 
ATOM   4141  N  N     . LYS G  7  20  ? -49.124  -22.060 22.500  1.00 77.02  ? 20  LYS G N     1 
ATOM   4142  C  CA    . LYS G  7  20  ? -48.345  -23.278 22.206  1.00 73.19  ? 20  LYS G CA    1 
ATOM   4143  C  C     . LYS G  7  20  ? -48.015  -23.934 23.516  1.00 59.28  ? 20  LYS G C     1 
ATOM   4144  O  O     . LYS G  7  20  ? -47.480  -23.331 24.413  1.00 58.47  ? 20  LYS G O     1 
ATOM   4145  C  CB    . LYS G  7  20  ? -47.058  -23.010 21.430  1.00 85.26  ? 20  LYS G CB    1 
ATOM   4146  C  CG    . LYS G  7  20  ? -46.413  -24.303 20.866  1.00 103.73 ? 20  LYS G CG    1 
ATOM   4147  C  CD    . LYS G  7  20  ? -45.048  -24.178 20.179  1.00 114.80 ? 20  LYS G CD    1 
ATOM   4148  C  CE    . LYS G  7  20  ? -45.058  -23.131 19.052  1.00 134.58 ? 20  LYS G CE    1 
ATOM   4149  N  NZ    . LYS G  7  20  ? -45.666  -23.533 17.743  1.00 138.08 ? 20  LYS G NZ    1 
ATOM   4150  N  N     . LEU G  7  21  ? -48.350  -25.182 23.619  1.00 52.96  ? 21  LEU G N     1 
ATOM   4151  C  CA    . LEU G  7  21  ? -48.278  -25.874 24.867  1.00 55.05  ? 21  LEU G CA    1 
ATOM   4152  C  C     . LEU G  7  21  ? -47.360  -27.071 24.742  1.00 55.26  ? 21  LEU G C     1 
ATOM   4153  O  O     . LEU G  7  21  ? -46.918  -27.472 23.673  1.00 59.61  ? 21  LEU G O     1 
ATOM   4154  C  CB    . LEU G  7  21  ? -49.683  -26.354 25.270  1.00 56.89  ? 21  LEU G CB    1 
ATOM   4155  C  CG    . LEU G  7  21  ? -50.801  -25.471 25.804  1.00 54.58  ? 21  LEU G CG    1 
ATOM   4156  C  CD1   . LEU G  7  21  ? -51.658  -26.268 26.788  1.00 57.46  ? 21  LEU G CD1   1 
ATOM   4157  C  CD2   . LEU G  7  21  ? -50.285  -24.253 26.497  1.00 52.35  ? 21  LEU G CD2   1 
ATOM   4158  N  N     . ASN G  7  22  ? -47.101  -27.656 25.883  1.00 57.02  ? 22  ASN G N     1 
ATOM   4159  C  CA    . ASN G  7  22  ? -46.165  -28.721 25.997  1.00 60.99  ? 22  ASN G CA    1 
ATOM   4160  C  C     . ASN G  7  22  ? -46.225  -29.817 24.999  1.00 61.27  ? 22  ASN G C     1 
ATOM   4161  O  O     . ASN G  7  22  ? -45.253  -29.965 24.246  1.00 83.06  ? 22  ASN G O     1 
ATOM   4162  C  CB    . ASN G  7  22  ? -46.172  -29.235 27.417  1.00 64.11  ? 22  ASN G CB    1 
ATOM   4163  C  CG    . ASN G  7  22  ? -45.492  -30.530 27.548  1.00 66.27  ? 22  ASN G CG    1 
ATOM   4164  O  OD1   . ASN G  7  22  ? -46.081  -31.608 27.465  1.00 65.23  ? 22  ASN G OD1   1 
ATOM   4165  N  ND2   . ASN G  7  22  ? -44.189  -30.423 27.707  1.00 74.38  ? 22  ASN G ND2   1 
ATOM   4166  N  N     . GLY G  7  23  ? -47.254  -30.612 24.953  1.00 54.46  ? 23  GLY G N     1 
ATOM   4167  C  CA    . GLY G  7  23  ? -47.118  -31.857 24.142  1.00 59.07  ? 23  GLY G CA    1 
ATOM   4168  C  C     . GLY G  7  23  ? -47.331  -31.758 22.623  1.00 62.51  ? 23  GLY G C     1 
ATOM   4169  O  O     . GLY G  7  23  ? -47.919  -32.628 21.984  1.00 59.15  ? 23  GLY G O     1 
ATOM   4170  N  N     . GLY G  7  24  ? -46.856  -30.679 22.016  1.00 69.72  ? 24  GLY G N     1 
ATOM   4171  C  CA    . GLY G  7  24  ? -47.303  -30.288 20.686  1.00 69.79  ? 24  GLY G CA    1 
ATOM   4172  C  C     . GLY G  7  24  ? -48.754  -29.870 20.605  1.00 66.30  ? 24  GLY G C     1 
ATOM   4173  O  O     . GLY G  7  24  ? -49.336  -29.817 19.535  1.00 73.49  ? 24  GLY G O     1 
ATOM   4174  N  N     . ARG G  7  25  ? -49.315  -29.502 21.745  1.00 68.26  ? 25  ARG G N     1 
ATOM   4175  C  CA    . ARG G  7  25  ? -50.724  -29.119 21.887  1.00 64.84  ? 25  ARG G CA    1 
ATOM   4176  C  C     . ARG G  7  25  ? -50.829  -27.620 21.780  1.00 65.15  ? 25  ARG G C     1 
ATOM   4177  O  O     . ARG G  7  25  ? -49.927  -26.887 22.152  1.00 73.45  ? 25  ARG G O     1 
ATOM   4178  C  CB    . ARG G  7  25  ? -51.275  -29.569 23.221  1.00 59.40  ? 25  ARG G CB    1 
ATOM   4179  C  CG    . ARG G  7  25  ? -51.155  -31.085 23.307  1.00 59.61  ? 25  ARG G CG    1 
ATOM   4180  C  CD    . ARG G  7  25  ? -51.548  -31.702 24.627  1.00 59.43  ? 25  ARG G CD    1 
ATOM   4181  N  NE    . ARG G  7  25  ? -50.508  -31.507 25.594  1.00 57.43  ? 25  ARG G NE    1 
ATOM   4182  C  CZ    . ARG G  7  25  ? -50.301  -32.294 26.640  1.00 61.43  ? 25  ARG G CZ    1 
ATOM   4183  N  NH1   . ARG G  7  25  ? -51.097  -33.340 26.947  1.00 68.80  ? 25  ARG G NH1   1 
ATOM   4184  N  NH2   . ARG G  7  25  ? -49.286  -31.990 27.446  1.00 59.26  ? 25  ARG G NH2   1 
ATOM   4185  N  N     . HIS G  7  26  ? -51.865  -27.195 21.099  1.00 66.25  ? 26  HIS G N     1 
ATOM   4186  C  CA    A HIS G  7  26  ? -52.140  -25.793 20.886  0.70 73.87  ? 26  HIS G CA    1 
ATOM   4187  C  CA    B HIS G  7  26  ? -52.146  -25.793 20.842  0.30 62.68  ? 26  HIS G CA    1 
ATOM   4188  C  C     . HIS G  7  26  ? -53.550  -25.552 21.365  1.00 66.54  ? 26  HIS G C     1 
ATOM   4189  O  O     . HIS G  7  26  ? -54.392  -26.405 21.220  1.00 65.68  ? 26  HIS G O     1 
ATOM   4190  C  CB    A HIS G  7  26  ? -51.951  -25.466 19.404  0.70 84.16  ? 26  HIS G CB    1 
ATOM   4191  C  CB    B HIS G  7  26  ? -52.003  -25.473 19.327  0.30 58.91  ? 26  HIS G CB    1 
ATOM   4192  C  CG    A HIS G  7  26  ? -52.203  -24.033 19.026  0.70 98.42  ? 26  HIS G CG    1 
ATOM   4193  C  CG    B HIS G  7  26  ? -50.709  -25.943 18.745  0.30 53.72  ? 26  HIS G CG    1 
ATOM   4194  N  ND1   A HIS G  7  26  ? -53.463  -23.559 18.719  0.70 99.61  ? 26  HIS G ND1   1 
ATOM   4195  N  ND1   B HIS G  7  26  ? -49.572  -25.167 18.712  0.30 50.85  ? 26  HIS G ND1   1 
ATOM   4196  C  CD2   A HIS G  7  26  ? -51.363  -22.981 18.881  0.70 104.61 ? 26  HIS G CD2   1 
ATOM   4197  C  CD2   B HIS G  7  26  ? -50.384  -27.112 18.153  0.30 52.51  ? 26  HIS G CD2   1 
ATOM   4198  C  CE1   A HIS G  7  26  ? -53.405  -22.275 18.433  0.70 98.64  ? 26  HIS G CE1   1 
ATOM   4199  C  CE1   B HIS G  7  26  ? -48.598  -25.845 18.138  0.30 51.47  ? 26  HIS G CE1   1 
ATOM   4200  N  NE2   A HIS G  7  26  ? -52.140  -21.900 18.531  0.70 108.39 ? 26  HIS G NE2   1 
ATOM   4201  N  NE2   B HIS G  7  26  ? -49.061  -27.036 17.808  0.30 52.10  ? 26  HIS G NE2   1 
ATOM   4202  N  N     . VAL G  7  27  ? -53.786  -24.369 21.914  1.00 62.87  ? 27  VAL G N     1 
ATOM   4203  C  CA    . VAL G  7  27  ? -55.076  -24.035 22.479  1.00 60.15  ? 27  VAL G CA    1 
ATOM   4204  C  C     . VAL G  7  27  ? -55.214  -22.555 22.300  1.00 66.85  ? 27  VAL G C     1 
ATOM   4205  O  O     . VAL G  7  27  ? -54.219  -21.827 22.183  1.00 76.07  ? 27  VAL G O     1 
ATOM   4206  C  CB    . VAL G  7  27  ? -55.057  -24.430 23.938  1.00 56.91  ? 27  VAL G CB    1 
ATOM   4207  C  CG1   . VAL G  7  27  ? -55.684  -23.421 24.855  1.00 58.18  ? 27  VAL G CG1   1 
ATOM   4208  C  CG2   . VAL G  7  27  ? -55.646  -25.821 24.145  1.00 55.13  ? 27  VAL G CG2   1 
ATOM   4209  N  N     . GLN G  7  28  ? -56.468  -22.110 22.282  1.00 72.60  ? 28  GLN G N     1 
ATOM   4210  C  CA    . GLN G  7  28  ? -56.753  -20.696 22.051  1.00 75.87  ? 28  GLN G CA    1 
ATOM   4211  C  C     . GLN G  7  28  ? -57.944  -20.179 22.883  1.00 69.53  ? 28  GLN G C     1 
ATOM   4212  O  O     . GLN G  7  28  ? -58.894  -20.942 23.103  1.00 66.09  ? 28  GLN G O     1 
ATOM   4213  C  CB    . GLN G  7  28  ? -56.783  -20.548 20.518  1.00 83.71  ? 28  GLN G CB    1 
ATOM   4214  C  CG    . GLN G  7  28  ? -57.842  -19.675 19.866  1.00 89.02  ? 28  GLN G CG    1 
ATOM   4215  C  CD    . GLN G  7  28  ? -57.658  -19.657 18.339  1.00 88.94  ? 28  GLN G CD    1 
ATOM   4216  O  OE1   . GLN G  7  28  ? -56.644  -20.139 17.821  1.00 83.32  ? 28  GLN G OE1   1 
ATOM   4217  N  NE2   . GLN G  7  28  ? -58.660  -19.162 17.606  1.00 91.69  ? 28  GLN G NE2   1 
ATOM   4218  N  N     . GLY G  7  29  ? -57.905  -18.910 23.286  1.00 63.60  ? 29  GLY G N     1 
ATOM   4219  C  CA    . GLY G  7  29  ? -58.944  -18.343 24.140  1.00 67.20  ? 29  GLY G CA    1 
ATOM   4220  C  C     . GLY G  7  29  ? -58.614  -17.036 24.849  1.00 71.38  ? 29  GLY G C     1 
ATOM   4221  O  O     . GLY G  7  29  ? -57.596  -16.408 24.581  1.00 69.69  ? 29  GLY G O     1 
ATOM   4222  N  N     . ILE G  7  30  ? -59.508  -16.593 25.730  1.00 77.14  ? 30  ILE G N     1 
ATOM   4223  C  CA    . ILE G  7  30  ? -59.426  -15.241 26.278  1.00 83.27  ? 30  ILE G CA    1 
ATOM   4224  C  C     . ILE G  7  30  ? -58.833  -15.295 27.679  1.00 77.94  ? 30  ILE G C     1 
ATOM   4225  O  O     . ILE G  7  30  ? -59.380  -15.952 28.569  1.00 70.81  ? 30  ILE G O     1 
ATOM   4226  C  CB    . ILE G  7  30  ? -60.788  -14.521 26.304  1.00 94.22  ? 30  ILE G CB    1 
ATOM   4227  C  CG1   . ILE G  7  30  ? -61.300  -14.307 24.871  1.00 102.19 ? 30  ILE G CG1   1 
ATOM   4228  C  CG2   . ILE G  7  30  ? -60.679  -13.186 27.040  1.00 100.06 ? 30  ILE G CG2   1 
ATOM   4229  C  CD1   . ILE G  7  30  ? -62.754  -14.700 24.693  1.00 109.38 ? 30  ILE G CD1   1 
ATOM   4230  N  N     . LEU G  7  31  ? -57.780  -14.505 27.882  1.00 71.00  ? 31  LEU G N     1 
ATOM   4231  C  CA    . LEU G  7  31  ? -56.981  -14.597 29.099  1.00 68.33  ? 31  LEU G CA    1 
ATOM   4232  C  C     . LEU G  7  31  ? -57.608  -13.852 30.268  1.00 68.48  ? 31  LEU G C     1 
ATOM   4233  O  O     . LEU G  7  31  ? -57.587  -12.620 30.284  1.00 63.57  ? 31  LEU G O     1 
ATOM   4234  C  CB    . LEU G  7  31  ? -55.564  -14.078 28.853  1.00 65.14  ? 31  LEU G CB    1 
ATOM   4235  C  CG    . LEU G  7  31  ? -54.679  -13.964 30.097  1.00 66.59  ? 31  LEU G CG    1 
ATOM   4236  C  CD1   . LEU G  7  31  ? -54.434  -15.320 30.719  1.00 65.64  ? 31  LEU G CD1   1 
ATOM   4237  C  CD2   . LEU G  7  31  ? -53.381  -13.288 29.763  1.00 66.82  ? 31  LEU G CD2   1 
ATOM   4238  N  N     . ARG G  7  32  ? -58.166  -14.594 31.220  1.00 71.21  ? 32  ARG G N     1 
ATOM   4239  C  CA    . ARG G  7  32  ? -58.828  -13.971 32.346  1.00 75.49  ? 32  ARG G CA    1 
ATOM   4240  C  C     . ARG G  7  32  ? -57.977  -13.804 33.560  1.00 71.61  ? 32  ARG G C     1 
ATOM   4241  O  O     . ARG G  7  32  ? -58.289  -12.995 34.434  1.00 69.53  ? 32  ARG G O     1 
ATOM   4242  C  CB    . ARG G  7  32  ? -60.190  -14.604 32.640  1.00 80.14  ? 32  ARG G CB    1 
ATOM   4243  C  CG    . ARG G  7  32  ? -61.274  -14.223 31.631  1.00 90.03  ? 32  ARG G CG    1 
ATOM   4244  C  CD    . ARG G  7  32  ? -61.656  -12.751 31.457  1.00 93.56  ? 32  ARG G CD    1 
ATOM   4245  N  NE    . ARG G  7  32  ? -62.251  -12.547 30.113  1.00 107.91 ? 32  ARG G NE    1 
ATOM   4246  C  CZ    . ARG G  7  32  ? -63.379  -13.100 29.634  1.00 119.28 ? 32  ARG G CZ    1 
ATOM   4247  N  NH1   . ARG G  7  32  ? -63.775  -12.935 28.363  1.00 112.80 ? 32  ARG G NH1   1 
ATOM   4248  N  NH2   . ARG G  7  32  ? -64.170  -13.788 30.448  1.00 132.14 ? 32  ARG G NH2   1 
ATOM   4249  N  N     . GLY G  7  33  ? -56.886  -14.541 33.613  1.00 73.65  ? 33  GLY G N     1 
ATOM   4250  C  CA    . GLY G  7  33  ? -55.965  -14.349 34.722  1.00 75.46  ? 33  GLY G CA    1 
ATOM   4251  C  C     . GLY G  7  33  ? -54.726  -15.177 34.786  1.00 68.89  ? 33  GLY G C     1 
ATOM   4252  O  O     . GLY G  7  33  ? -54.521  -16.028 33.937  1.00 75.10  ? 33  GLY G O     1 
ATOM   4253  N  N     . PHE G  7  34  ? -53.864  -14.831 35.731  1.00 65.20  ? 34  PHE G N     1 
ATOM   4254  C  CA    . PHE G  7  34  ? -52.548  -15.432 35.828  1.00 65.93  ? 34  PHE G CA    1 
ATOM   4255  C  C     . PHE G  7  34  ? -51.922  -15.348 37.199  1.00 66.38  ? 34  PHE G C     1 
ATOM   4256  O  O     . PHE G  7  34  ? -52.408  -14.618 38.049  1.00 81.67  ? 34  PHE G O     1 
ATOM   4257  C  CB    . PHE G  7  34  ? -51.630  -14.834 34.763  1.00 64.58  ? 34  PHE G CB    1 
ATOM   4258  C  CG    . PHE G  7  34  ? -51.360  -13.397 34.950  1.00 64.06  ? 34  PHE G CG    1 
ATOM   4259  C  CD1   . PHE G  7  34  ? -50.519  -12.969 35.943  1.00 65.97  ? 34  PHE G CD1   1 
ATOM   4260  C  CD2   . PHE G  7  34  ? -51.912  -12.478 34.102  1.00 69.08  ? 34  PHE G CD2   1 
ATOM   4261  C  CE1   . PHE G  7  34  ? -50.204  -11.640 36.078  1.00 74.50  ? 34  PHE G CE1   1 
ATOM   4262  C  CE2   . PHE G  7  34  ? -51.648  -11.128 34.266  1.00 74.54  ? 34  PHE G CE2   1 
ATOM   4263  C  CZ    . PHE G  7  34  ? -50.780  -10.701 35.246  1.00 76.22  ? 34  PHE G CZ    1 
ATOM   4264  N  N     . ASP G  7  35  ? -50.790  -16.001 37.381  1.00 63.65  ? 35  ASP G N     1 
ATOM   4265  C  CA    . ASP G  7  35  ? -50.053  -15.914 38.638  1.00 65.58  ? 35  ASP G CA    1 
ATOM   4266  C  C     . ASP G  7  35  ? -48.531  -15.924 38.463  1.00 64.54  ? 35  ASP G C     1 
ATOM   4267  O  O     . ASP G  7  35  ? -48.057  -15.873 37.338  1.00 64.98  ? 35  ASP G O     1 
ATOM   4268  C  CB    . ASP G  7  35  ? -50.592  -16.975 39.556  1.00 70.33  ? 35  ASP G CB    1 
ATOM   4269  C  CG    . ASP G  7  35  ? -50.173  -18.346 39.189  1.00 74.70  ? 35  ASP G CG    1 
ATOM   4270  O  OD1   . ASP G  7  35  ? -49.377  -18.510 38.230  1.00 82.67  ? 35  ASP G OD1   1 
ATOM   4271  O  OD2   . ASP G  7  35  ? -50.749  -19.266 39.833  1.00 82.24  ? 35  ASP G OD2   1 
ATOM   4272  N  N     . PRO G  7  36  ? -47.748  -15.943 39.542  1.00 64.31  ? 36  PRO G N     1 
ATOM   4273  C  CA    . PRO G  7  36  ? -46.326  -15.728 39.284  1.00 67.47  ? 36  PRO G CA    1 
ATOM   4274  C  C     . PRO G  7  36  ? -45.581  -16.935 38.667  1.00 66.88  ? 36  PRO G C     1 
ATOM   4275  O  O     . PRO G  7  36  ? -44.471  -16.776 38.141  1.00 66.99  ? 36  PRO G O     1 
ATOM   4276  C  CB    . PRO G  7  36  ? -45.748  -15.288 40.646  1.00 69.25  ? 36  PRO G CB    1 
ATOM   4277  C  CG    . PRO G  7  36  ? -46.747  -15.660 41.658  1.00 70.27  ? 36  PRO G CG    1 
ATOM   4278  C  CD    . PRO G  7  36  ? -48.065  -15.891 40.974  1.00 70.43  ? 36  PRO G CD    1 
ATOM   4279  N  N     . PHE G  7  37  ? -46.185  -18.119 38.743  1.00 63.24  ? 37  PHE G N     1 
ATOM   4280  C  CA    . PHE G  7  37  ? -45.729  -19.285 37.998  1.00 60.36  ? 37  PHE G CA    1 
ATOM   4281  C  C     . PHE G  7  37  ? -46.118  -19.201 36.537  1.00 59.28  ? 37  PHE G C     1 
ATOM   4282  O  O     . PHE G  7  37  ? -45.752  -20.070 35.781  1.00 62.42  ? 37  PHE G O     1 
ATOM   4283  C  CB    . PHE G  7  37  ? -46.345  -20.593 38.528  1.00 59.86  ? 37  PHE G CB    1 
ATOM   4284  C  CG    . PHE G  7  37  ? -45.831  -21.009 39.853  1.00 62.45  ? 37  PHE G CG    1 
ATOM   4285  C  CD1   . PHE G  7  37  ? -44.483  -20.961 40.132  1.00 66.37  ? 37  PHE G CD1   1 
ATOM   4286  C  CD2   . PHE G  7  37  ? -46.722  -21.342 40.844  1.00 62.52  ? 37  PHE G CD2   1 
ATOM   4287  C  CE1   . PHE G  7  37  ? -44.032  -21.341 41.361  1.00 71.02  ? 37  PHE G CE1   1 
ATOM   4288  C  CE2   . PHE G  7  37  ? -46.297  -21.702 42.080  1.00 64.28  ? 37  PHE G CE2   1 
ATOM   4289  C  CZ    . PHE G  7  37  ? -44.938  -21.746 42.329  1.00 70.95  ? 37  PHE G CZ    1 
ATOM   4290  N  N     . MET G  7  38  ? -46.859  -18.183 36.127  1.00 57.62  ? 38  MET G N     1 
ATOM   4291  C  CA    . MET G  7  38  ? -47.417  -18.098 34.796  1.00 52.67  ? 38  MET G CA    1 
ATOM   4292  C  C     . MET G  7  38  ? -48.473  -19.122 34.550  1.00 48.55  ? 38  MET G C     1 
ATOM   4293  O  O     . MET G  7  38  ? -48.722  -19.460 33.420  1.00 51.24  ? 38  MET G O     1 
ATOM   4294  C  CB    . MET G  7  38  ? -46.325  -18.194 33.741  1.00 52.66  ? 38  MET G CB    1 
ATOM   4295  C  CG    . MET G  7  38  ? -46.747  -17.654 32.401  1.00 55.21  ? 38  MET G CG    1 
ATOM   4296  S  SD    . MET G  7  38  ? -45.242  -17.361 31.501  1.00 59.55  ? 38  MET G SD    1 
ATOM   4297  C  CE    . MET G  7  38  ? -45.898  -17.914 29.932  1.00 62.34  ? 38  MET G CE    1 
ATOM   4298  N  N     . ASN G  7  39  ? -49.129  -19.575 35.596  1.00 49.14  ? 39  ASN G N     1 
ATOM   4299  C  CA    . ASN G  7  39  ? -50.353  -20.322 35.404  1.00 52.91  ? 39  ASN G CA    1 
ATOM   4300  C  C     . ASN G  7  39  ? -51.344  -19.377 34.832  1.00 53.46  ? 39  ASN G C     1 
ATOM   4301  O  O     . ASN G  7  39  ? -51.415  -18.256 35.283  1.00 50.80  ? 39  ASN G O     1 
ATOM   4302  C  CB    . ASN G  7  39  ? -50.951  -20.859 36.706  1.00 53.44  ? 39  ASN G CB    1 
ATOM   4303  C  CG    . ASN G  7  39  ? -50.093  -21.898 37.341  1.00 54.80  ? 39  ASN G CG    1 
ATOM   4304  O  OD1   . ASN G  7  39  ? -49.422  -22.668 36.679  1.00 61.47  ? 39  ASN G OD1   1 
ATOM   4305  N  ND2   . ASN G  7  39  ? -50.055  -21.891 38.618  1.00 57.03  ? 39  ASN G ND2   1 
ATOM   4306  N  N     . LEU G  7  40  ? -52.121  -19.859 33.883  1.00 57.68  ? 40  LEU G N     1 
ATOM   4307  C  CA    . LEU G  7  40  ? -53.119  -19.027 33.241  1.00 58.79  ? 40  LEU G CA    1 
ATOM   4308  C  C     . LEU G  7  40  ? -54.542  -19.530 33.462  1.00 62.60  ? 40  LEU G C     1 
ATOM   4309  O  O     . LEU G  7  40  ? -54.776  -20.739 33.696  1.00 60.23  ? 40  LEU G O     1 
ATOM   4310  C  CB    . LEU G  7  40  ? -52.841  -18.973 31.742  1.00 57.46  ? 40  LEU G CB    1 
ATOM   4311  C  CG    . LEU G  7  40  ? -51.464  -18.465 31.366  1.00 55.06  ? 40  LEU G CG    1 
ATOM   4312  C  CD1   . LEU G  7  40  ? -51.416  -18.218 29.855  1.00 56.47  ? 40  LEU G CD1   1 
ATOM   4313  C  CD2   . LEU G  7  40  ? -51.070  -17.209 32.115  1.00 56.48  ? 40  LEU G CD2   1 
ATOM   4314  N  N     . VAL G  7  41  ? -55.475  -18.568 33.427  1.00 66.40  ? 41  VAL G N     1 
ATOM   4315  C  CA    . VAL G  7  41  ? -56.904  -18.840 33.319  1.00 69.14  ? 41  VAL G CA    1 
ATOM   4316  C  C     . VAL G  7  41  ? -57.272  -18.416 31.918  1.00 69.66  ? 41  VAL G C     1 
ATOM   4317  O  O     . VAL G  7  41  ? -57.081  -17.264 31.554  1.00 61.78  ? 41  VAL G O     1 
ATOM   4318  C  CB    . VAL G  7  41  ? -57.756  -18.057 34.321  1.00 69.69  ? 41  VAL G CB    1 
ATOM   4319  C  CG1   . VAL G  7  41  ? -59.221  -18.342 34.051  1.00 76.38  ? 41  VAL G CG1   1 
ATOM   4320  C  CG2   . VAL G  7  41  ? -57.449  -18.441 35.758  1.00 69.05  ? 41  VAL G CG2   1 
ATOM   4321  N  N     . ILE G  7  42  ? -57.772  -19.369 31.140  1.00 72.51  ? 42  ILE G N     1 
ATOM   4322  C  CA    . ILE G  7  42  ? -58.338  -19.025 29.864  1.00 76.21  ? 42  ILE G CA    1 
ATOM   4323  C  C     . ILE G  7  42  ? -59.831  -19.242 29.891  1.00 77.12  ? 42  ILE G C     1 
ATOM   4324  O  O     . ILE G  7  42  ? -60.333  -20.150 30.524  1.00 74.88  ? 42  ILE G O     1 
ATOM   4325  C  CB    . ILE G  7  42  ? -57.684  -19.825 28.722  1.00 81.83  ? 42  ILE G CB    1 
ATOM   4326  C  CG1   . ILE G  7  42  ? -56.155  -19.714 28.753  1.00 80.04  ? 42  ILE G CG1   1 
ATOM   4327  C  CG2   . ILE G  7  42  ? -58.148  -19.327 27.352  1.00 90.25  ? 42  ILE G CG2   1 
ATOM   4328  C  CD1   . ILE G  7  42  ? -55.621  -18.294 28.815  1.00 75.81  ? 42  ILE G CD1   1 
ATOM   4329  N  N     . ASP G  7  43  ? -60.502  -18.401 29.117  1.00 85.75  ? 43  ASP G N     1 
ATOM   4330  C  CA    . ASP G  7  43  ? -61.954  -18.436 28.987  1.00 96.26  ? 43  ASP G CA    1 
ATOM   4331  C  C     . ASP G  7  43  ? -62.359  -18.705 27.532  1.00 89.04  ? 43  ASP G C     1 
ATOM   4332  O  O     . ASP G  7  43  ? -61.676  -18.260 26.596  1.00 74.02  ? 43  ASP G O     1 
ATOM   4333  C  CB    . ASP G  7  43  ? -62.523  -17.068 29.472  1.00 100.00 ? 43  ASP G CB    1 
ATOM   4334  C  CG    . ASP G  7  43  ? -64.025  -17.110 29.786  1.00 100.40 ? 43  ASP G CG    1 
ATOM   4335  O  OD1   . ASP G  7  43  ? -64.697  -18.159 29.581  1.00 100.78 ? 43  ASP G OD1   1 
ATOM   4336  O  OD2   . ASP G  7  43  ? -64.494  -16.128 30.399  1.00 97.49  ? 43  ASP G OD2   1 
ATOM   4337  N  N     . GLU G  7  44  ? -63.495  -19.381 27.376  1.00 87.28  ? 44  GLU G N     1 
ATOM   4338  C  CA    . GLU G  7  44  ? -64.053  -19.633 26.062  1.00 93.87  ? 44  GLU G CA    1 
ATOM   4339  C  C     . GLU G  7  44  ? -62.910  -20.207 25.252  1.00 91.37  ? 44  GLU G C     1 
ATOM   4340  O  O     . GLU G  7  44  ? -62.506  -19.685 24.207  1.00 94.12  ? 44  GLU G O     1 
ATOM   4341  C  CB    . GLU G  7  44  ? -64.615  -18.366 25.398  1.00 103.92 ? 44  GLU G CB    1 
ATOM   4342  C  CG    . GLU G  7  44  ? -65.707  -17.636 26.177  1.00 114.65 ? 44  GLU G CG    1 
ATOM   4343  C  CD    . GLU G  7  44  ? -66.015  -16.224 25.650  1.00 118.22 ? 44  GLU G CD    1 
ATOM   4344  O  OE1   . GLU G  7  44  ? -65.924  -16.022 24.421  1.00 116.65 ? 44  GLU G OE1   1 
ATOM   4345  O  OE2   . GLU G  7  44  ? -66.392  -15.345 26.457  1.00 112.71 ? 44  GLU G OE2   1 
ATOM   4346  N  N     . CYS G  7  45  ? -62.358  -21.281 25.792  1.00 93.50  ? 45  CYS G N     1 
ATOM   4347  C  CA    . CYS G  7  45  ? -61.122  -21.840 25.258  1.00 94.80  ? 45  CYS G CA    1 
ATOM   4348  C  C     . CYS G  7  45  ? -61.431  -22.980 24.289  1.00 94.98  ? 45  CYS G C     1 
ATOM   4349  O  O     . CYS G  7  45  ? -62.372  -23.766 24.479  1.00 100.21 ? 45  CYS G O     1 
ATOM   4350  C  CB    . CYS G  7  45  ? -60.226  -22.274 26.409  1.00 93.70  ? 45  CYS G CB    1 
ATOM   4351  S  SG    . CYS G  7  45  ? -58.949  -23.446 25.986  1.00 91.81  ? 45  CYS G SG    1 
ATOM   4352  N  N     . VAL G  7  46  ? -60.633  -23.064 23.236  1.00 88.80  ? 46  VAL G N     1 
ATOM   4353  C  CA    . VAL G  7  46  ? -60.902  -24.039 22.205  1.00 83.16  ? 46  VAL G CA    1 
ATOM   4354  C  C     . VAL G  7  46  ? -59.674  -24.893 21.935  1.00 82.72  ? 46  VAL G C     1 
ATOM   4355  O  O     . VAL G  7  46  ? -58.562  -24.368 21.765  1.00 84.90  ? 46  VAL G O     1 
ATOM   4356  C  CB    . VAL G  7  46  ? -61.581  -23.378 21.007  1.00 84.63  ? 46  VAL G CB    1 
ATOM   4357  C  CG1   . VAL G  7  46  ? -61.094  -21.958 20.761  1.00 83.47  ? 46  VAL G CG1   1 
ATOM   4358  C  CG2   . VAL G  7  46  ? -61.467  -24.256 19.771  1.00 93.13  ? 46  VAL G CG2   1 
ATOM   4359  N  N     . GLU G  7  47  ? -59.875  -26.211 21.846  1.00 77.56  ? 47  GLU G N     1 
ATOM   4360  C  CA    . GLU G  7  47  ? -58.827  -27.235 21.846  1.00 75.13  ? 47  GLU G CA    1 
ATOM   4361  C  C     . GLU G  7  47  ? -57.933  -27.302 20.638  1.00 77.73  ? 47  GLU G C     1 
ATOM   4362  O  O     . GLU G  7  47  ? -56.745  -27.532 20.822  1.00 102.63 ? 47  GLU G O     1 
ATOM   4363  C  CB    . GLU G  7  47  ? -59.383  -28.639 21.999  1.00 76.00  ? 47  GLU G CB    1 
ATOM   4364  C  CG    . GLU G  7  47  ? -58.317  -29.715 22.040  1.00 79.43  ? 47  GLU G CG    1 
ATOM   4365  C  CD    . GLU G  7  47  ? -58.525  -30.940 22.872  1.00 87.36  ? 47  GLU G CD    1 
ATOM   4366  O  OE1   . GLU G  7  47  ? -58.177  -32.082 22.419  1.00 87.72  ? 47  GLU G OE1   1 
ATOM   4367  O  OE2   . GLU G  7  47  ? -59.017  -30.672 23.987  1.00 89.64  ? 47  GLU G OE2   1 
ATOM   4368  N  N     . MET G  7  48  ? -58.393  -27.077 19.434  1.00 73.28  ? 48  MET G N     1 
ATOM   4369  C  CA    . MET G  7  48  ? -57.432  -27.028 18.300  1.00 76.69  ? 48  MET G CA    1 
ATOM   4370  C  C     . MET G  7  48  ? -56.644  -28.285 18.075  1.00 77.91  ? 48  MET G C     1 
ATOM   4371  O  O     . MET G  7  48  ? -55.456  -28.280 17.938  1.00 69.59  ? 48  MET G O     1 
ATOM   4372  C  CB    . MET G  7  48  ? -56.462  -25.859 18.417  1.00 72.82  ? 48  MET G CB    1 
ATOM   4373  C  CG    . MET G  7  48  ? -57.190  -24.547 18.626  1.00 76.69  ? 48  MET G CG    1 
ATOM   4374  S  SD    . MET G  7  48  ? -57.685  -24.247 16.927  1.00 90.10  ? 48  MET G SD    1 
ATOM   4375  C  CE    . MET G  7  48  ? -58.325  -22.649 17.184  1.00 93.62  ? 48  MET G CE    1 
ATOM   4376  N  N     . ALA G  7  49  ? -57.370  -29.385 18.086  1.00 95.62  ? 49  ALA G N     1 
ATOM   4377  C  CA    . ALA G  7  49  ? -56.757  -30.711 18.000  1.00 102.42 ? 49  ALA G CA    1 
ATOM   4378  C  C     . ALA G  7  49  ? -56.085  -30.881 16.650  1.00 95.85  ? 49  ALA G C     1 
ATOM   4379  O  O     . ALA G  7  49  ? -56.346  -30.132 15.718  1.00 87.49  ? 49  ALA G O     1 
ATOM   4380  C  CB    . ALA G  7  49  ? -57.795  -31.815 18.215  1.00 113.02 ? 49  ALA G CB    1 
ATOM   4381  N  N     . THR G  7  50  ? -55.210  -31.862 16.594  1.00 103.19 ? 50  THR G N     1 
ATOM   4382  C  CA    . THR G  7  50  ? -54.360  -32.114 15.459  1.00 120.81 ? 50  THR G CA    1 
ATOM   4383  C  C     . THR G  7  50  ? -55.154  -32.490 14.220  1.00 130.80 ? 50  THR G C     1 
ATOM   4384  O  O     . THR G  7  50  ? -54.788  -32.118 13.100  1.00 147.35 ? 50  THR G O     1 
ATOM   4385  C  CB    . THR G  7  50  ? -53.372  -33.259 15.748  1.00 127.00 ? 50  THR G CB    1 
ATOM   4386  O  OG1   . THR G  7  50  ? -53.443  -33.764 17.088  1.00 132.78 ? 50  THR G OG1   1 
ATOM   4387  C  CG2   . THR G  7  50  ? -51.942  -32.894 15.380  1.00 125.51 ? 50  THR G CG2   1 
ATOM   4388  N  N     . SER G  7  51  ? -56.248  -33.219 14.443  1.00 127.84 ? 51  SER G N     1 
ATOM   4389  C  CA    . SER G  7  51  ? -57.237  -33.493 13.410  1.00 121.47 ? 51  SER G CA    1 
ATOM   4390  C  C     . SER G  7  51  ? -57.657  -32.241 12.702  1.00 118.60 ? 51  SER G C     1 
ATOM   4391  O  O     . SER G  7  51  ? -58.190  -32.332 11.623  1.00 121.03 ? 51  SER G O     1 
ATOM   4392  C  CB    . SER G  7  51  ? -58.499  -34.186 13.971  1.00 117.26 ? 51  SER G CB    1 
ATOM   4393  O  OG    . SER G  7  51  ? -58.334  -34.801 15.243  1.00 112.79 ? 51  SER G OG    1 
ATOM   4394  N  N     . GLY G  7  52  ? -57.444  -31.086 13.312  1.00 125.66 ? 52  GLY G N     1 
ATOM   4395  C  CA    . GLY G  7  52  ? -57.848  -29.830 12.711  1.00 122.42 ? 52  GLY G CA    1 
ATOM   4396  C  C     . GLY G  7  52  ? -59.186  -29.405 13.276  1.00 118.18 ? 52  GLY G C     1 
ATOM   4397  O  O     . GLY G  7  52  ? -59.497  -28.189 13.227  1.00 100.79 ? 52  GLY G O     1 
ATOM   4398  N  N     . GLN G  7  53  ? -59.959  -30.415 13.725  1.00 116.35 ? 53  GLN G N     1 
ATOM   4399  C  CA    . GLN G  7  53  ? -61.105  -30.245 14.592  1.00 117.49 ? 53  GLN G CA    1 
ATOM   4400  C  C     . GLN G  7  53  ? -60.782  -29.408 15.817  1.00 112.59 ? 53  GLN G C     1 
ATOM   4401  O  O     . GLN G  7  53  ? -59.772  -29.648 16.457  1.00 119.31 ? 53  GLN G O     1 
ATOM   4402  C  CB    . GLN G  7  53  ? -61.634  -31.586 15.079  1.00 113.97 ? 53  GLN G CB    1 
ATOM   4403  C  CG    . GLN G  7  53  ? -62.761  -31.438 16.104  1.00 120.01 ? 53  GLN G CG    1 
ATOM   4404  C  CD    . GLN G  7  53  ? -63.256  -32.779 16.602  1.00 121.81 ? 53  GLN G CD    1 
ATOM   4405  O  OE1   . GLN G  7  53  ? -62.576  -33.793 16.503  1.00 130.57 ? 53  GLN G OE1   1 
ATOM   4406  N  NE2   . GLN G  7  53  ? -64.458  -32.774 17.142  1.00 116.29 ? 53  GLN G NE2   1 
ATOM   4407  N  N     . GLN G  7  54  ? -61.678  -28.478 16.124  1.00 103.42 ? 54  GLN G N     1 
ATOM   4408  C  CA    . GLN G  7  54  ? -61.618  -27.638 17.304  1.00 92.09  ? 54  GLN G CA    1 
ATOM   4409  C  C     . GLN G  7  54  ? -62.727  -28.013 18.285  1.00 93.08  ? 54  GLN G C     1 
ATOM   4410  O  O     . GLN G  7  54  ? -63.803  -28.435 17.869  1.00 104.22 ? 54  GLN G O     1 
ATOM   4411  C  CB    . GLN G  7  54  ? -61.782  -26.195 16.878  1.00 80.21  ? 54  GLN G CB    1 
ATOM   4412  C  CG    . GLN G  7  54  ? -60.916  -25.873 15.695  1.00 80.21  ? 54  GLN G CG    1 
ATOM   4413  C  CD    . GLN G  7  54  ? -61.042  -24.485 15.147  1.00 92.28  ? 54  GLN G CD    1 
ATOM   4414  O  OE1   . GLN G  7  54  ? -61.795  -23.640 15.636  1.00 98.63  ? 54  GLN G OE1   1 
ATOM   4415  N  NE2   . GLN G  7  54  ? -60.293  -24.235 14.078  1.00 96.84  ? 54  GLN G NE2   1 
ATOM   4416  N  N     . ASN G  7  55  ? -62.469  -27.875 19.583  1.00 86.74  ? 55  ASN G N     1 
ATOM   4417  C  CA    . ASN G  7  55  ? -63.415  -28.283 20.641  1.00 88.63  ? 55  ASN G CA    1 
ATOM   4418  C  C     . ASN G  7  55  ? -63.450  -27.210 21.704  1.00 95.22  ? 55  ASN G C     1 
ATOM   4419  O  O     . ASN G  7  55  ? -62.419  -26.587 21.981  1.00 113.11 ? 55  ASN G O     1 
ATOM   4420  C  CB    . ASN G  7  55  ? -62.947  -29.536 21.422  1.00 85.24  ? 55  ASN G CB    1 
ATOM   4421  C  CG    . ASN G  7  55  ? -62.827  -30.760 20.566  1.00 88.79  ? 55  ASN G CG    1 
ATOM   4422  O  OD1   . ASN G  7  55  ? -63.310  -30.844 19.427  1.00 103.18 ? 55  ASN G OD1   1 
ATOM   4423  N  ND2   . ASN G  7  55  ? -62.073  -31.710 21.063  1.00 91.14  ? 55  ASN G ND2   1 
ATOM   4424  N  N     . ASN G  7  56  ? -64.587  -27.076 22.383  1.00 90.00  ? 56  ASN G N     1 
ATOM   4425  C  CA    . ASN G  7  56  ? -64.760  -25.984 23.319  1.00 84.64  ? 56  ASN G CA    1 
ATOM   4426  C  C     . ASN G  7  56  ? -64.781  -26.529 24.702  1.00 84.67  ? 56  ASN G C     1 
ATOM   4427  O  O     . ASN G  7  56  ? -65.585  -27.397 25.002  1.00 80.16  ? 56  ASN G O     1 
ATOM   4428  C  CB    . ASN G  7  56  ? -66.034  -25.209 23.019  1.00 85.02  ? 56  ASN G CB    1 
ATOM   4429  C  CG    . ASN G  7  56  ? -66.011  -24.605 21.632  1.00 87.95  ? 56  ASN G CG    1 
ATOM   4430  O  OD1   . ASN G  7  56  ? -66.024  -25.331 20.636  1.00 85.09  ? 56  ASN G OD1   1 
ATOM   4431  N  ND2   . ASN G  7  56  ? -65.938  -23.295 21.550  1.00 101.47 ? 56  ASN G ND2   1 
ATOM   4432  N  N     . ILE G  7  57  ? -63.897  -25.988 25.541  1.00 92.35  ? 57  ILE G N     1 
ATOM   4433  C  CA    . ILE G  7  57  ? -63.739  -26.265 26.981  1.00 87.70  ? 57  ILE G CA    1 
ATOM   4434  C  C     . ILE G  7  57  ? -63.585  -24.829 27.375  1.00 85.24  ? 57  ILE G C     1 
ATOM   4435  O  O     . ILE G  7  57  ? -63.068  -23.985 26.622  1.00 116.48 ? 57  ILE G O     1 
ATOM   4436  C  CB    . ILE G  7  57  ? -62.464  -27.078 27.204  1.00 91.08  ? 57  ILE G CB    1 
ATOM   4437  C  CG1   . ILE G  7  57  ? -61.309  -26.380 26.462  1.00 93.08  ? 57  ILE G CG1   1 
ATOM   4438  C  CG2   . ILE G  7  57  ? -62.668  -28.459 26.598  1.00 92.30  ? 57  ILE G CG2   1 
ATOM   4439  C  CD1   . ILE G  7  57  ? -59.939  -26.992 26.715  1.00 98.41  ? 57  ILE G CD1   1 
ATOM   4440  N  N     . GLY G  7  58  ? -64.008  -24.490 28.557  1.00 74.91  ? 58  GLY G N     1 
ATOM   4441  C  CA    . GLY G  7  58  ? -64.044  -23.026 28.819  1.00 75.48  ? 58  GLY G CA    1 
ATOM   4442  C  C     . GLY G  7  58  ? -63.533  -22.832 30.222  1.00 80.30  ? 58  GLY G C     1 
ATOM   4443  O  O     . GLY G  7  58  ? -63.573  -23.781 31.031  1.00 88.20  ? 58  GLY G O     1 
ATOM   4444  N  N     . MET G  7  59  ? -62.963  -21.677 30.475  1.00 78.69  ? 59  MET G N     1 
ATOM   4445  C  CA    . MET G  7  59  ? -62.613  -21.478 31.827  1.00 80.25  ? 59  MET G CA    1 
ATOM   4446  C  C     . MET G  7  59  ? -61.637  -22.587 32.326  1.00 81.94  ? 59  MET G C     1 
ATOM   4447  O  O     . MET G  7  59  ? -61.844  -23.264 33.364  1.00 83.37  ? 59  MET G O     1 
ATOM   4448  C  CB    . MET G  7  59  ? -63.791  -21.221 32.742  1.00 84.01  ? 59  MET G CB    1 
ATOM   4449  C  CG    . MET G  7  59  ? -63.191  -20.529 33.975  1.00 85.61  ? 59  MET G CG    1 
ATOM   4450  S  SD    . MET G  7  59  ? -63.049  -18.760 34.044  1.00 82.16  ? 59  MET G SD    1 
ATOM   4451  C  CE    . MET G  7  59  ? -63.582  -18.297 32.410  1.00 80.64  ? 59  MET G CE    1 
ATOM   4452  N  N     . VAL G  7  60  ? -60.587  -22.813 31.552  1.00 79.29  ? 60  VAL G N     1 
ATOM   4453  C  CA    . VAL G  7  60  ? -59.592  -23.820 31.881  1.00 68.65  ? 60  VAL G CA    1 
ATOM   4454  C  C     . VAL G  7  60  ? -58.538  -23.131 32.711  1.00 64.64  ? 60  VAL G C     1 
ATOM   4455  O  O     . VAL G  7  60  ? -58.407  -21.903 32.769  1.00 57.74  ? 60  VAL G O     1 
ATOM   4456  C  CB    . VAL G  7  60  ? -58.989  -24.451 30.644  1.00 68.61  ? 60  VAL G CB    1 
ATOM   4457  C  CG1   . VAL G  7  60  ? -59.961  -25.457 30.059  1.00 71.65  ? 60  VAL G CG1   1 
ATOM   4458  C  CG2   . VAL G  7  60  ? -58.692  -23.443 29.581  1.00 70.84  ? 60  VAL G CG2   1 
ATOM   4459  N  N     . VAL G  7  61  ? -57.821  -23.977 33.435  1.00 66.38  ? 61  VAL G N     1 
ATOM   4460  C  CA    . VAL G  7  61  ? -56.540  -23.607 34.058  1.00 67.24  ? 61  VAL G CA    1 
ATOM   4461  C  C     . VAL G  7  61  ? -55.400  -24.250 33.291  1.00 66.86  ? 61  VAL G C     1 
ATOM   4462  O  O     . VAL G  7  61  ? -55.436  -25.481 33.062  1.00 63.69  ? 61  VAL G O     1 
ATOM   4463  C  CB    . VAL G  7  61  ? -56.449  -24.077 35.512  1.00 67.59  ? 61  VAL G CB    1 
ATOM   4464  C  CG1   . VAL G  7  61  ? -55.061  -23.917 36.072  1.00 69.40  ? 61  VAL G CG1   1 
ATOM   4465  C  CG2   . VAL G  7  61  ? -57.344  -23.229 36.373  1.00 70.23  ? 61  VAL G CG2   1 
ATOM   4466  N  N     . ILE G  7  62  ? -54.421  -23.426 32.909  1.00 64.91  ? 62  ILE G N     1 
ATOM   4467  C  CA    . ILE G  7  62  ? -53.172  -23.935 32.322  1.00 63.95  ? 62  ILE G CA    1 
ATOM   4468  C  C     . ILE G  7  62  ? -51.985  -23.759 33.259  1.00 60.52  ? 62  ILE G C     1 
ATOM   4469  O  O     . ILE G  7  62  ? -51.770  -22.652 33.768  1.00 58.08  ? 62  ILE G O     1 
ATOM   4470  C  CB    . ILE G  7  62  ? -52.840  -23.224 31.019  1.00 65.09  ? 62  ILE G CB    1 
ATOM   4471  C  CG1   . ILE G  7  62  ? -54.003  -23.428 30.061  1.00 67.53  ? 62  ILE G CG1   1 
ATOM   4472  C  CG2   . ILE G  7  62  ? -51.563  -23.815 30.447  1.00 68.67  ? 62  ILE G CG2   1 
ATOM   4473  C  CD1   . ILE G  7  62  ? -53.757  -22.700 28.765  1.00 68.61  ? 62  ILE G CD1   1 
ATOM   4474  N  N     . ARG G  7  63  ? -51.240  -24.843 33.471  1.00 55.63  ? 63  ARG G N     1 
ATOM   4475  C  CA    . ARG G  7  63  ? -50.056  -24.793 34.334  1.00 54.83  ? 63  ARG G CA    1 
ATOM   4476  C  C     . ARG G  7  63  ? -48.973  -24.028 33.612  1.00 52.52  ? 63  ARG G C     1 
ATOM   4477  O  O     . ARG G  7  63  ? -48.730  -24.230 32.436  1.00 49.10  ? 63  ARG G O     1 
ATOM   4478  C  CB    . ARG G  7  63  ? -49.536  -26.183 34.650  1.00 58.53  ? 63  ARG G CB    1 
ATOM   4479  C  CG    . ARG G  7  63  ? -48.637  -26.172 35.863  1.00 63.26  ? 63  ARG G CG    1 
ATOM   4480  C  CD    . ARG G  7  63  ? -48.069  -27.551 36.204  1.00 66.90  ? 63  ARG G CD    1 
ATOM   4481  N  NE    . ARG G  7  63  ? -46.889  -27.446 37.065  1.00 67.47  ? 63  ARG G NE    1 
ATOM   4482  C  CZ    . ARG G  7  63  ? -46.945  -27.585 38.386  1.00 65.84  ? 63  ARG G CZ    1 
ATOM   4483  N  NH1   . ARG G  7  63  ? -48.061  -27.910 39.048  1.00 65.28  ? 63  ARG G NH1   1 
ATOM   4484  N  NH2   . ARG G  7  63  ? -45.856  -27.353 39.116  1.00 66.59  ? 63  ARG G NH2   1 
ATOM   4485  N  N     . GLY G  7  64  ? -48.310  -23.123 34.300  1.00 54.44  ? 64  GLY G N     1 
ATOM   4486  C  CA    . GLY G  7  64  ? -47.337  -22.216 33.649  1.00 56.83  ? 64  GLY G CA    1 
ATOM   4487  C  C     . GLY G  7  64  ? -46.159  -22.913 33.020  1.00 56.88  ? 64  GLY G C     1 
ATOM   4488  O  O     . GLY G  7  64  ? -45.630  -22.541 32.024  1.00 54.37  ? 64  GLY G O     1 
ATOM   4489  N  N     . ASN G  7  65  ? -45.871  -24.025 33.663  1.00 62.11  ? 65  ASN G N     1 
ATOM   4490  C  CA    . ASN G  7  65  ? -44.788  -24.917 33.434  1.00 56.25  ? 65  ASN G CA    1 
ATOM   4491  C  C     . ASN G  7  65  ? -44.835  -25.363 31.997  1.00 53.63  ? 65  ASN G C     1 
ATOM   4492  O  O     . ASN G  7  65  ? -43.826  -25.584 31.378  1.00 52.01  ? 65  ASN G O     1 
ATOM   4493  C  CB    . ASN G  7  65  ? -45.086  -26.085 34.359  1.00 57.78  ? 65  ASN G CB    1 
ATOM   4494  C  CG    . ASN G  7  65  ? -43.955  -26.992 34.506  1.00 60.51  ? 65  ASN G CG    1 
ATOM   4495  O  OD1   . ASN G  7  65  ? -42.838  -26.693 34.092  1.00 69.55  ? 65  ASN G OD1   1 
ATOM   4496  N  ND2   . ASN G  7  65  ? -44.218  -28.132 35.068  1.00 62.88  ? 65  ASN G ND2   1 
ATOM   4497  N  N     . SER G  7  66  ? -46.026  -25.557 31.457  1.00 55.47  ? 66  SER G N     1 
ATOM   4498  C  CA    . SER G  7  66  ? -46.224  -26.221 30.186  1.00 55.95  ? 66  SER G CA    1 
ATOM   4499  C  C     . SER G  7  66  ? -46.598  -25.265 29.066  1.00 47.77  ? 66  SER G C     1 
ATOM   4500  O  O     . SER G  7  66  ? -47.087  -25.655 28.031  1.00 47.36  ? 66  SER G O     1 
ATOM   4501  C  CB    . SER G  7  66  ? -47.207  -27.394 30.457  1.00 59.36  ? 66  SER G CB    1 
ATOM   4502  O  OG    . SER G  7  66  ? -48.438  -26.831 30.321  1.00 61.26  ? 66  SER G OG    1 
ATOM   4503  N  N     . ILE G  7  67  ? -46.450  -23.985 29.298  1.00 45.96  ? 67  ILE G N     1 
ATOM   4504  C  CA    . ILE G  7  67  ? -46.722  -22.950 28.280  1.00 46.61  ? 67  ILE G CA    1 
ATOM   4505  C  C     . ILE G  7  67  ? -45.425  -22.569 27.616  1.00 44.04  ? 67  ILE G C     1 
ATOM   4506  O  O     . ILE G  7  67  ? -44.460  -22.247 28.294  1.00 41.85  ? 67  ILE G O     1 
ATOM   4507  C  CB    . ILE G  7  67  ? -47.322  -21.744 28.968  1.00 51.26  ? 67  ILE G CB    1 
ATOM   4508  C  CG1   . ILE G  7  67  ? -48.732  -22.128 29.413  1.00 57.19  ? 67  ILE G CG1   1 
ATOM   4509  C  CG2   . ILE G  7  67  ? -47.300  -20.519 28.071  1.00 54.46  ? 67  ILE G CG2   1 
ATOM   4510  C  CD1   . ILE G  7  67  ? -49.373  -21.087 30.275  1.00 66.72  ? 67  ILE G CD1   1 
ATOM   4511  N  N     . ILE G  7  68  ? -45.360  -22.595 26.302  1.00 46.04  ? 68  ILE G N     1 
ATOM   4512  C  CA    . ILE G  7  68  ? -44.093  -22.316 25.619  1.00 48.12  ? 68  ILE G CA    1 
ATOM   4513  C  C     . ILE G  7  68  ? -44.080  -20.920 25.121  1.00 53.56  ? 68  ILE G C     1 
ATOM   4514  O  O     . ILE G  7  68  ? -43.233  -20.114 25.502  1.00 62.47  ? 68  ILE G O     1 
ATOM   4515  C  CB    . ILE G  7  68  ? -43.855  -23.260 24.477  1.00 47.65  ? 68  ILE G CB    1 
ATOM   4516  C  CG1   . ILE G  7  68  ? -43.604  -24.667 25.056  1.00 52.27  ? 68  ILE G CG1   1 
ATOM   4517  C  CG2   . ILE G  7  68  ? -42.661  -22.828 23.664  1.00 47.73  ? 68  ILE G CG2   1 
ATOM   4518  C  CD1   . ILE G  7  68  ? -43.667  -25.782 24.008  1.00 57.63  ? 68  ILE G CD1   1 
ATOM   4519  N  N     . MET G  7  69  ? -45.096  -20.614 24.349  1.00 62.36  ? 69  MET G N     1 
ATOM   4520  C  CA    . MET G  7  69  ? -45.256  -19.285 23.795  1.00 71.03  ? 69  MET G CA    1 
ATOM   4521  C  C     . MET G  7  69  ? -46.753  -19.029 23.708  1.00 70.86  ? 69  MET G C     1 
ATOM   4522  O  O     . MET G  7  69  ? -47.521  -19.953 23.469  1.00 61.91  ? 69  MET G O     1 
ATOM   4523  C  CB    . MET G  7  69  ? -44.613  -19.294 22.419  1.00 76.40  ? 69  MET G CB    1 
ATOM   4524  C  CG    . MET G  7  69  ? -44.975  -18.115 21.553  1.00 82.89  ? 69  MET G CG    1 
ATOM   4525  S  SD    . MET G  7  69  ? -45.730  -18.555 19.996  1.00 87.30  ? 69  MET G SD    1 
ATOM   4526  C  CE    . MET G  7  69  ? -47.146  -19.568 20.426  1.00 88.80  ? 69  MET G CE    1 
ATOM   4527  N  N     . LEU G  7  70  ? -47.151  -17.772 23.898  1.00 71.31  ? 70  LEU G N     1 
ATOM   4528  C  CA    . LEU G  7  70  ? -48.504  -17.355 23.580  1.00 69.22  ? 70  LEU G CA    1 
ATOM   4529  C  C     . LEU G  7  70  ? -48.464  -16.210 22.578  1.00 75.32  ? 70  LEU G C     1 
ATOM   4530  O  O     . LEU G  7  70  ? -47.495  -15.427 22.534  1.00 70.28  ? 70  LEU G O     1 
ATOM   4531  C  CB    . LEU G  7  70  ? -49.241  -17.026 24.846  1.00 67.23  ? 70  LEU G CB    1 
ATOM   4532  C  CG    . LEU G  7  70  ? -48.748  -15.980 25.813  1.00 73.50  ? 70  LEU G CG    1 
ATOM   4533  C  CD1   . LEU G  7  70  ? -48.904  -14.568 25.255  1.00 79.53  ? 70  LEU G CD1   1 
ATOM   4534  C  CD2   . LEU G  7  70  ? -49.528  -16.053 27.127  1.00 75.38  ? 70  LEU G CD2   1 
ATOM   4535  N  N     . GLU G  7  71  ? -49.488  -16.166 21.718  1.00 82.91  ? 71  GLU G N     1 
ATOM   4536  C  CA    . GLU G  7  71  ? -49.617  -15.169 20.654  1.00 86.95  ? 71  GLU G CA    1 
ATOM   4537  C  C     . GLU G  7  71  ? -50.946  -14.484 20.811  1.00 82.85  ? 71  GLU G C     1 
ATOM   4538  O  O     . GLU G  7  71  ? -51.970  -15.143 20.943  1.00 80.16  ? 71  GLU G O     1 
ATOM   4539  C  CB    . GLU G  7  71  ? -49.602  -15.857 19.300  1.00 90.65  ? 71  GLU G CB    1 
ATOM   4540  C  CG    . GLU G  7  71  ? -49.884  -15.008 18.072  1.00 99.66  ? 71  GLU G CG    1 
ATOM   4541  C  CD    . GLU G  7  71  ? -50.366  -15.842 16.881  1.00 105.71 ? 71  GLU G CD    1 
ATOM   4542  O  OE1   . GLU G  7  71  ? -50.255  -17.080 16.942  1.00 110.72 ? 71  GLU G OE1   1 
ATOM   4543  O  OE2   . GLU G  7  71  ? -50.892  -15.285 15.894  1.00 96.90  ? 71  GLU G OE2   1 
ATOM   4544  N  N     . ALA G  7  72  ? -50.921  -13.158 20.775  1.00 85.56  ? 72  ALA G N     1 
ATOM   4545  C  CA    . ALA G  7  72  ? -52.148  -12.379 20.842  1.00 87.78  ? 72  ALA G CA    1 
ATOM   4546  C  C     . ALA G  7  72  ? -52.767  -12.340 19.471  1.00 85.75  ? 72  ALA G C     1 
ATOM   4547  O  O     . ALA G  7  72  ? -52.088  -11.984 18.513  1.00 77.30  ? 72  ALA G O     1 
ATOM   4548  C  CB    . ALA G  7  72  ? -51.865  -10.968 21.309  1.00 89.13  ? 72  ALA G CB    1 
ATOM   4549  N  N     . LEU G  7  73  ? -54.040  -12.722 19.401  1.00 93.76  ? 73  LEU G N     1 
ATOM   4550  C  CA    . LEU G  7  73  ? -54.834  -12.701 18.154  1.00 97.70  ? 73  LEU G CA    1 
ATOM   4551  C  C     . LEU G  7  73  ? -55.539  -11.356 17.899  1.00 109.29 ? 73  LEU G C     1 
ATOM   4552  O  O     . LEU G  7  73  ? -55.824  -11.021 16.751  1.00 109.71 ? 73  LEU G O     1 
ATOM   4553  C  CB    . LEU G  7  73  ? -55.871  -13.834 18.170  1.00 85.27  ? 73  LEU G CB    1 
ATOM   4554  C  CG    . LEU G  7  73  ? -55.250  -15.220 18.328  1.00 76.16  ? 73  LEU G CG    1 
ATOM   4555  C  CD1   . LEU G  7  73  ? -56.307  -16.280 18.487  1.00 70.92  ? 73  LEU G CD1   1 
ATOM   4556  C  CD2   . LEU G  7  73  ? -54.345  -15.513 17.143  1.00 78.89  ? 73  LEU G CD2   1 
ATOM   4557  N  N     . GLU G  7  74  ? -55.781  -10.610 18.982  1.00 110.35 ? 74  GLU G N     1 
ATOM   4558  C  CA    . GLU G  7  74  ? -56.479  -9.338  19.017  1.00 107.26 ? 74  GLU G CA    1 
ATOM   4559  C  C     . GLU G  7  74  ? -55.408  -8.342  19.373  1.00 102.13 ? 74  GLU G C     1 
ATOM   4560  O  O     . GLU G  7  74  ? -54.438  -8.730  19.980  1.00 96.64  ? 74  GLU G O     1 
ATOM   4561  C  CB    . GLU G  7  74  ? -57.458  -9.401  20.179  1.00 114.24 ? 74  GLU G CB    1 
ATOM   4562  C  CG    . GLU G  7  74  ? -58.417  -8.258  20.479  1.00 122.18 ? 74  GLU G CG    1 
ATOM   4563  C  CD    . GLU G  7  74  ? -59.495  -8.674  21.465  1.00 127.58 ? 74  GLU G CD    1 
ATOM   4564  O  OE1   . GLU G  7  74  ? -59.398  -9.792  22.021  1.00 113.47 ? 74  GLU G OE1   1 
ATOM   4565  O  OE2   . GLU G  7  74  ? -60.515  -7.938  21.573  1.00 142.03 ? 74  GLU G OE2   1 
ATOM   4566  N  N     . ARG G  7  75  ? -55.545  -7.074  19.018  1.00 109.62 ? 75  ARG G N     1 
ATOM   4567  C  CA    . ARG G  7  75  ? -54.527  -6.102  19.425  1.00 115.67 ? 75  ARG G CA    1 
ATOM   4568  C  C     . ARG G  7  75  ? -54.337  -6.004  20.910  1.00 113.25 ? 75  ARG G C     1 
ATOM   4569  O  O     . ARG G  7  75  ? -55.324  -6.037  21.585  1.00 107.27 ? 75  ARG G O     1 
ATOM   4570  C  CB    . ARG G  7  75  ? -54.734  -4.694  18.806  1.00 129.03 ? 75  ARG G CB    1 
ATOM   4571  C  CG    . ARG G  7  75  ? -53.608  -3.714  18.979  1.00 140.75 ? 75  ARG G CG    1 
ATOM   4572  C  CD    . ARG G  7  75  ? -52.241  -4.360  18.757  1.00 153.17 ? 75  ARG G CD    1 
ATOM   4573  N  NE    . ARG G  7  75  ? -51.463  -3.894  17.635  1.00 161.54 ? 75  ARG G NE    1 
ATOM   4574  C  CZ    . ARG G  7  75  ? -50.303  -4.432  17.258  1.00 160.01 ? 75  ARG G CZ    1 
ATOM   4575  N  NH1   . ARG G  7  75  ? -49.764  -5.468  17.907  1.00 152.68 ? 75  ARG G NH1   1 
ATOM   4576  N  NH2   . ARG G  7  75  ? -49.683  -3.931  16.194  1.00 162.97 ? 75  ARG G NH2   1 
ATOM   4577  N  N     . VAL G  7  76  ? -53.097  -5.930  21.392  1.00 118.84 ? 76  VAL G N     1 
ATOM   4578  C  CA    . VAL G  7  76  ? -52.814  -5.607  22.804  1.00 123.42 ? 76  VAL G CA    1 
ATOM   4579  C  C     . VAL G  7  76  ? -52.747  -4.124  23.164  1.00 130.83 ? 76  VAL G C     1 
ATOM   4580  O  O     . VAL G  7  76  ? -53.213  -3.638  24.199  1.00 120.45 ? 76  VAL G O     1 
ATOM   4581  C  CB    . VAL G  7  76  ? -51.551  -6.284  23.337  1.00 125.34 ? 76  VAL G CB    1 
ATOM   4582  C  CG1   . VAL G  7  76  ? -51.758  -7.782  23.347  1.00 128.41 ? 76  VAL G CG1   1 
ATOM   4583  C  CG2   . VAL G  7  76  ? -50.339  -5.898  22.519  1.00 128.23 ? 76  VAL G CG2   1 
ATOM   4584  O  OXT   . VAL G  7  76  ? -52.129  -3.367  22.423  1.00 138.32 ? 76  VAL G OXT   1 
ATOM   4585  N  N     . THR H  8  2   ? -31.573  0.788   26.058  1.00 122.54 ? 2   THR K N     1 
ATOM   4586  C  CA    . THR H  8  2   ? -30.963  1.654   24.997  1.00 117.76 ? 2   THR K CA    1 
ATOM   4587  C  C     . THR H  8  2   ? -31.956  2.104   23.907  1.00 124.41 ? 2   THR K C     1 
ATOM   4588  O  O     . THR H  8  2   ? -31.566  2.608   22.842  1.00 117.81 ? 2   THR K O     1 
ATOM   4589  C  CB    . THR H  8  2   ? -29.693  0.999   24.392  1.00 111.06 ? 2   THR K CB    1 
ATOM   4590  O  OG1   . THR H  8  2   ? -28.883  0.347   25.389  1.00 104.58 ? 2   THR K OG1   1 
ATOM   4591  C  CG2   . THR H  8  2   ? -28.829  2.052   23.748  1.00 112.59 ? 2   THR K CG2   1 
ATOM   4592  N  N     . GLN H  8  3   ? -33.250  2.030   24.236  1.00 132.47 ? 3   GLN K N     1 
ATOM   4593  C  CA    . GLN H  8  3   ? -34.341  2.175   23.265  1.00 129.00 ? 3   GLN K CA    1 
ATOM   4594  C  C     . GLN H  8  3   ? -34.378  3.546   22.578  1.00 135.91 ? 3   GLN K C     1 
ATOM   4595  O  O     . GLN H  8  3   ? -34.399  3.586   21.361  1.00 123.49 ? 3   GLN K O     1 
ATOM   4596  C  CB    . GLN H  8  3   ? -35.740  1.950   23.928  1.00 124.58 ? 3   GLN K CB    1 
ATOM   4597  C  CG    . GLN H  8  3   ? -36.114  0.563   24.406  1.00 123.58 ? 3   GLN K CG    1 
ATOM   4598  C  CD    . GLN H  8  3   ? -35.462  0.123   25.706  1.00 133.54 ? 3   GLN K CD    1 
ATOM   4599  O  OE1   . GLN H  8  3   ? -34.296  -0.274  25.711  1.00 135.19 ? 3   GLN K OE1   1 
ATOM   4600  N  NE2   . GLN H  8  3   ? -36.204  0.169   26.813  1.00 141.15 ? 3   GLN K NE2   1 
ATOM   4601  N  N     . PHE H  8  4   ? -34.324  4.647   23.338  1.00 147.02 ? 4   PHE K N     1 
ATOM   4602  C  CA    . PHE H  8  4   ? -34.840  5.950   22.893  1.00 139.52 ? 4   PHE K CA    1 
ATOM   4603  C  C     . PHE H  8  4   ? -33.739  7.019   22.701  1.00 130.21 ? 4   PHE K C     1 
ATOM   4604  O  O     . PHE H  8  4   ? -33.603  7.971   23.473  1.00 119.74 ? 4   PHE K O     1 
ATOM   4605  C  CB    . PHE H  8  4   ? -35.863  6.407   23.936  1.00 139.44 ? 4   PHE K CB    1 
ATOM   4606  C  CG    . PHE H  8  4   ? -37.114  5.568   24.007  1.00 143.82 ? 4   PHE K CG    1 
ATOM   4607  C  CD1   . PHE H  8  4   ? -37.973  5.468   22.897  1.00 144.61 ? 4   PHE K CD1   1 
ATOM   4608  C  CD2   . PHE H  8  4   ? -37.475  4.916   25.199  1.00 137.38 ? 4   PHE K CD2   1 
ATOM   4609  C  CE1   . PHE H  8  4   ? -39.157  4.731   22.970  1.00 145.23 ? 4   PHE K CE1   1 
ATOM   4610  C  CE2   . PHE H  8  4   ? -38.663  4.179   25.271  1.00 139.59 ? 4   PHE K CE2   1 
ATOM   4611  C  CZ    . PHE H  8  4   ? -39.504  4.082   24.158  1.00 142.83 ? 4   PHE K CZ    1 
ATOM   4612  N  N     . LEU H  8  5   ? -32.965  6.873   21.629  1.00 115.95 ? 5   LEU K N     1 
ATOM   4613  C  CA    . LEU H  8  5   ? -31.741  7.630   21.410  1.00 106.35 ? 5   LEU K CA    1 
ATOM   4614  C  C     . LEU H  8  5   ? -31.782  8.382   20.101  1.00 113.19 ? 5   LEU K C     1 
ATOM   4615  O  O     . LEU H  8  5   ? -32.683  8.162   19.292  1.00 117.65 ? 5   LEU K O     1 
ATOM   4616  C  CB    . LEU H  8  5   ? -30.575  6.648   21.326  1.00 107.01 ? 5   LEU K CB    1 
ATOM   4617  C  CG    . LEU H  8  5   ? -30.045  5.949   22.557  1.00 108.95 ? 5   LEU K CG    1 
ATOM   4618  C  CD1   . LEU H  8  5   ? -28.597  5.471   22.339  1.00 112.06 ? 5   LEU K CD1   1 
ATOM   4619  C  CD2   . LEU H  8  5   ? -30.194  6.817   23.790  1.00 112.14 ? 5   LEU K CD2   1 
ATOM   4620  N  N     . PRO H  8  6   ? -30.794  9.269   19.861  1.00 120.02 ? 6   PRO K N     1 
ATOM   4621  C  CA    . PRO H  8  6   ? -30.710  9.915   18.536  1.00 121.85 ? 6   PRO K CA    1 
ATOM   4622  C  C     . PRO H  8  6   ? -30.505  8.869   17.452  1.00 124.36 ? 6   PRO K C     1 
ATOM   4623  O  O     . PRO H  8  6   ? -29.671  7.991   17.662  1.00 132.95 ? 6   PRO K O     1 
ATOM   4624  C  CB    . PRO H  8  6   ? -29.466  10.805  18.671  1.00 120.07 ? 6   PRO K CB    1 
ATOM   4625  C  CG    . PRO H  8  6   ? -28.705  10.263  19.860  1.00 112.78 ? 6   PRO K CG    1 
ATOM   4626  C  CD    . PRO H  8  6   ? -29.811  9.863   20.792  1.00 114.68 ? 6   PRO K CD    1 
ATOM   4627  N  N     . PRO H  8  7   ? -31.253  8.932   16.338  1.00 131.31 ? 7   PRO K N     1 
ATOM   4628  C  CA    . PRO H  8  7   ? -31.089  7.892   15.304  1.00 136.19 ? 7   PRO K CA    1 
ATOM   4629  C  C     . PRO H  8  7   ? -29.656  7.738   14.789  1.00 133.55 ? 7   PRO K C     1 
ATOM   4630  O  O     . PRO H  8  7   ? -29.280  6.657   14.323  1.00 133.12 ? 7   PRO K O     1 
ATOM   4631  C  CB    . PRO H  8  7   ? -32.067  8.273   14.187  1.00 132.76 ? 7   PRO K CB    1 
ATOM   4632  C  CG    . PRO H  8  7   ? -32.566  9.627   14.545  1.00 138.09 ? 7   PRO K CG    1 
ATOM   4633  C  CD    . PRO H  8  7   ? -32.284  9.921   15.992  1.00 134.11 ? 7   PRO K CD    1 
ATOM   4634  N  N     . ASN H  8  8   ? -28.862  8.802   14.846  1.00 130.08 ? 8   ASN K N     1 
ATOM   4635  C  CA    . ASN H  8  8   ? -27.424  8.600   14.665  1.00 132.92 ? 8   ASN K CA    1 
ATOM   4636  C  C     . ASN H  8  8   ? -26.745  7.460   15.439  1.00 131.61 ? 8   ASN K C     1 
ATOM   4637  O  O     . ASN H  8  8   ? -26.008  6.728   14.808  1.00 129.70 ? 8   ASN K O     1 
ATOM   4638  C  CB    . ASN H  8  8   ? -26.599  9.868   14.818  1.00 137.32 ? 8   ASN K CB    1 
ATOM   4639  C  CG    . ASN H  8  8   ? -26.727  10.479  16.189  1.00 143.04 ? 8   ASN K CG    1 
ATOM   4640  O  OD1   . ASN H  8  8   ? -27.046  9.813   17.168  1.00 148.47 ? 8   ASN K OD1   1 
ATOM   4641  N  ND2   . ASN H  8  8   ? -26.433  11.754  16.272  1.00 156.23 ? 8   ASN K ND2   1 
ATOM   4642  N  N     . LEU H  8  9   ? -26.998  7.320   16.750  1.00 124.45 ? 9   LEU K N     1 
ATOM   4643  C  CA    . LEU H  8  9   ? -26.367  6.302   17.625  1.00 108.92 ? 9   LEU K CA    1 
ATOM   4644  C  C     . LEU H  8  9   ? -27.119  4.981   17.569  1.00 101.83 ? 9   LEU K C     1 
ATOM   4645  O  O     . LEU H  8  9   ? -26.513  3.913   17.440  1.00 93.64  ? 9   LEU K O     1 
ATOM   4646  C  CB    . LEU H  8  9   ? -26.364  6.716   19.106  1.00 105.61 ? 9   LEU K CB    1 
ATOM   4647  C  CG    . LEU H  8  9   ? -25.404  7.794   19.578  1.00 111.05 ? 9   LEU K CG    1 
ATOM   4648  C  CD1   . LEU H  8  9   ? -25.646  8.144   21.041  1.00 108.26 ? 9   LEU K CD1   1 
ATOM   4649  C  CD2   . LEU H  8  9   ? -23.957  7.359   19.362  1.00 115.10 ? 9   LEU K CD2   1 
ATOM   4650  N  N     . LEU H  8  10  ? -28.436  5.072   17.724  1.00 91.02  ? 10  LEU K N     1 
ATOM   4651  C  CA    . LEU H  8  10  ? -29.330  3.926   17.642  1.00 88.43  ? 10  LEU K CA    1 
ATOM   4652  C  C     . LEU H  8  10  ? -29.146  3.042   16.401  1.00 90.69  ? 10  LEU K C     1 
ATOM   4653  O  O     . LEU H  8  10  ? -29.547  1.864   16.399  1.00 98.75  ? 10  LEU K O     1 
ATOM   4654  C  CB    . LEU H  8  10  ? -30.756  4.439   17.740  1.00 88.15  ? 10  LEU K CB    1 
ATOM   4655  C  CG    . LEU H  8  10  ? -31.944  3.511   17.504  1.00 88.58  ? 10  LEU K CG    1 
ATOM   4656  C  CD1   . LEU H  8  10  ? -33.020  3.789   18.533  1.00 92.17  ? 10  LEU K CD1   1 
ATOM   4657  C  CD2   . LEU H  8  10  ? -32.492  3.654   16.083  1.00 88.46  ? 10  LEU K CD2   1 
ATOM   4658  N  N     . ALA H  8  11  ? -28.560  3.584   15.336  1.00 83.95  ? 11  ALA K N     1 
ATOM   4659  C  CA    . ALA H  8  11  ? -28.246  2.780   14.167  1.00 83.63  ? 11  ALA K CA    1 
ATOM   4660  C  C     . ALA H  8  11  ? -27.152  1.752   14.409  1.00 79.57  ? 11  ALA K C     1 
ATOM   4661  O  O     . ALA H  8  11  ? -26.995  0.824   13.589  1.00 80.05  ? 11  ALA K O     1 
ATOM   4662  C  CB    . ALA H  8  11  ? -27.877  3.663   12.997  1.00 88.89  ? 11  ALA K CB    1 
ATOM   4663  N  N     . LEU H  8  12  ? -26.412  1.908   15.500  1.00 76.60  ? 12  LEU K N     1 
ATOM   4664  C  CA    . LEU H  8  12  ? -25.453  0.878   15.946  1.00 89.69  ? 12  LEU K CA    1 
ATOM   4665  C  C     . LEU H  8  12  ? -26.047  -0.460  16.415  1.00 89.99  ? 12  LEU K C     1 
ATOM   4666  O  O     . LEU H  8  12  ? -25.471  -1.533  16.214  1.00 88.04  ? 12  LEU K O     1 
ATOM   4667  C  CB    . LEU H  8  12  ? -24.625  1.415   17.109  1.00 97.54  ? 12  LEU K CB    1 
ATOM   4668  C  CG    . LEU H  8  12  ? -23.723  2.645   16.902  1.00 100.76 ? 12  LEU K CG    1 
ATOM   4669  C  CD1   . LEU H  8  12  ? -23.353  3.234   18.264  1.00 94.29  ? 12  LEU K CD1   1 
ATOM   4670  C  CD2   . LEU H  8  12  ? -22.510  2.281   16.032  1.00 102.16 ? 12  LEU K CD2   1 
ATOM   4671  N  N     . PHE H  8  13  ? -27.237  -0.378  16.998  1.00 90.61  ? 13  PHE K N     1 
ATOM   4672  C  CA    . PHE H  8  13  ? -27.904  -1.515  17.602  1.00 86.60  ? 13  PHE K CA    1 
ATOM   4673  C  C     . PHE H  8  13  ? -28.740  -2.238  16.560  1.00 79.96  ? 13  PHE K C     1 
ATOM   4674  O  O     . PHE H  8  13  ? -29.872  -2.694  16.837  1.00 83.94  ? 13  PHE K O     1 
ATOM   4675  C  CB    . PHE H  8  13  ? -28.753  -1.052  18.780  1.00 84.09  ? 13  PHE K CB    1 
ATOM   4676  C  CG    . PHE H  8  13  ? -27.943  -0.556  19.925  1.00 89.22  ? 13  PHE K CG    1 
ATOM   4677  C  CD1   . PHE H  8  13  ? -27.266  0.641   19.860  1.00 92.07  ? 13  PHE K CD1   1 
ATOM   4678  C  CD2   . PHE H  8  13  ? -27.838  -1.300  21.081  1.00 102.26 ? 13  PHE K CD2   1 
ATOM   4679  C  CE1   . PHE H  8  13  ? -26.521  1.121   20.925  1.00 97.95  ? 13  PHE K CE1   1 
ATOM   4680  C  CE2   . PHE H  8  13  ? -27.074  -0.842  22.154  1.00 113.25 ? 13  PHE K CE2   1 
ATOM   4681  C  CZ    . PHE H  8  13  ? -26.404  0.373   22.076  1.00 106.54 ? 13  PHE K CZ    1 
ATOM   4682  N  N     . ALA H  8  14  ? -28.142  -2.407  15.386  1.00 69.37  ? 14  ALA K N     1 
ATOM   4683  C  CA    . ALA H  8  14  ? -28.886  -2.919  14.263  1.00 69.96  ? 14  ALA K CA    1 
ATOM   4684  C  C     . ALA H  8  14  ? -28.757  -4.417  14.297  1.00 69.96  ? 14  ALA K C     1 
ATOM   4685  O  O     . ALA H  8  14  ? -27.690  -4.938  14.615  1.00 80.21  ? 14  ALA K O     1 
ATOM   4686  C  CB    . ALA H  8  14  ? -28.295  -2.413  12.984  1.00 71.25  ? 14  ALA K CB    1 
ATOM   4687  N  N     . PRO H  8  15  ? -29.829  -5.147  14.004  1.00 68.35  ? 15  PRO K N     1 
ATOM   4688  C  CA    . PRO H  8  15  ? -29.656  -6.580  13.904  1.00 64.23  ? 15  PRO K CA    1 
ATOM   4689  C  C     . PRO H  8  15  ? -28.730  -6.948  12.805  1.00 61.69  ? 15  PRO K C     1 
ATOM   4690  O  O     . PRO H  8  15  ? -28.566  -6.236  11.824  1.00 56.00  ? 15  PRO K O     1 
ATOM   4691  C  CB    . PRO H  8  15  ? -31.038  -7.110  13.557  1.00 64.66  ? 15  PRO K CB    1 
ATOM   4692  C  CG    . PRO H  8  15  ? -31.699  -5.966  12.920  1.00 69.42  ? 15  PRO K CG    1 
ATOM   4693  C  CD    . PRO H  8  15  ? -31.216  -4.774  13.730  1.00 71.13  ? 15  PRO K CD    1 
ATOM   4694  N  N     . ARG H  8  16  ? -28.160  -8.120  13.005  1.00 67.20  ? 16  ARG K N     1 
ATOM   4695  C  CA    . ARG H  8  16  ? -27.429  -8.825  11.976  1.00 71.31  ? 16  ARG K CA    1 
ATOM   4696  C  C     . ARG H  8  16  ? -28.483  -9.443  11.067  1.00 68.80  ? 16  ARG K C     1 
ATOM   4697  O  O     . ARG H  8  16  ? -29.658  -9.405  11.415  1.00 73.42  ? 16  ARG K O     1 
ATOM   4698  C  CB    . ARG H  8  16  ? -26.623  -9.860  12.713  1.00 73.01  ? 16  ARG K CB    1 
ATOM   4699  C  CG    . ARG H  8  16  ? -25.567  -10.575 11.916  1.00 82.58  ? 16  ARG K CG    1 
ATOM   4700  C  CD    . ARG H  8  16  ? -24.905  -11.518 12.930  1.00 87.74  ? 16  ARG K CD    1 
ATOM   4701  N  NE    . ARG H  8  16  ? -23.923  -10.764 13.715  1.00 76.21  ? 16  ARG K NE    1 
ATOM   4702  C  CZ    . ARG H  8  16  ? -22.617  -10.962 13.630  1.00 70.35  ? 16  ARG K CZ    1 
ATOM   4703  N  NH1   . ARG H  8  16  ? -22.061  -11.902 12.880  1.00 73.68  ? 16  ARG K NH1   1 
ATOM   4704  N  NH2   . ARG H  8  16  ? -21.823  -10.232 14.349  1.00 71.93  ? 16  ARG K NH2   1 
ATOM   4705  N  N     . ASP H  8  17  ? -28.115  -9.954  9.896   1.00 66.86  ? 17  ASP K N     1 
ATOM   4706  C  CA    . ASP H  8  17  ? -29.130  -10.550 9.023   1.00 69.63  ? 17  ASP K CA    1 
ATOM   4707  C  C     . ASP H  8  17  ? -29.741  -11.767 9.672   1.00 64.98  ? 17  ASP K C     1 
ATOM   4708  O  O     . ASP H  8  17  ? -29.080  -12.383 10.506  1.00 62.90  ? 17  ASP K O     1 
ATOM   4709  C  CB    . ASP H  8  17  ? -28.581  -10.965 7.654   1.00 79.20  ? 17  ASP K CB    1 
ATOM   4710  C  CG    . ASP H  8  17  ? -28.371  -9.788  6.736   1.00 87.05  ? 17  ASP K CG    1 
ATOM   4711  O  OD1   . ASP H  8  17  ? -28.952  -8.700  6.975   1.00 87.09  ? 17  ASP K OD1   1 
ATOM   4712  O  OD2   . ASP H  8  17  ? -27.560  -9.955  5.797   1.00 103.79 ? 17  ASP K OD2   1 
ATOM   4713  N  N     . PRO H  8  18  ? -30.999  -12.103 9.318   1.00 64.31  ? 18  PRO K N     1 
ATOM   4714  C  CA    . PRO H  8  18  ? -31.623  -13.268 9.945   1.00 66.07  ? 18  PRO K CA    1 
ATOM   4715  C  C     . PRO H  8  18  ? -30.882  -14.565 9.573   1.00 63.34  ? 18  PRO K C     1 
ATOM   4716  O  O     . PRO H  8  18  ? -30.260  -14.622 8.513   1.00 54.79  ? 18  PRO K O     1 
ATOM   4717  C  CB    . PRO H  8  18  ? -33.060  -13.240 9.406   1.00 66.89  ? 18  PRO K CB    1 
ATOM   4718  C  CG    . PRO H  8  18  ? -32.935  -12.556 8.099   1.00 66.29  ? 18  PRO K CG    1 
ATOM   4719  C  CD    . PRO H  8  18  ? -31.891  -11.511 8.309   1.00 65.13  ? 18  PRO K CD    1 
ATOM   4720  N  N     . ILE H  8  19  ? -30.914  -15.549 10.480  1.00 63.92  ? 19  ILE K N     1 
ATOM   4721  C  CA    . ILE H  8  19  ? -30.023  -16.735 10.384  1.00 62.49  ? 19  ILE K CA    1 
ATOM   4722  C  C     . ILE H  8  19  ? -30.596  -17.805 9.450   1.00 57.73  ? 19  ILE K C     1 
ATOM   4723  O  O     . ILE H  8  19  ? -31.791  -18.049 9.513   1.00 60.55  ? 19  ILE K O     1 
ATOM   4724  C  CB    . ILE H  8  19  ? -29.660  -17.358 11.772  1.00 60.60  ? 19  ILE K CB    1 
ATOM   4725  C  CG1   . ILE H  8  19  ? -30.858  -18.039 12.442  1.00 56.36  ? 19  ILE K CG1   1 
ATOM   4726  C  CG2   . ILE H  8  19  ? -29.035  -16.270 12.631  1.00 66.68  ? 19  ILE K CG2   1 
ATOM   4727  C  CD1   . ILE H  8  19  ? -30.856  -18.131 13.935  1.00 51.66  ? 19  ILE K CD1   1 
ATOM   4728  N  N     . PRO H  8  20  ? -29.753  -18.490 8.674   1.00 52.03  ? 20  PRO K N     1 
ATOM   4729  C  CA    . PRO H  8  20  ? -30.193  -19.530 7.810   1.00 53.44  ? 20  PRO K CA    1 
ATOM   4730  C  C     . PRO H  8  20  ? -31.034  -20.496 8.596   1.00 57.81  ? 20  PRO K C     1 
ATOM   4731  O  O     . PRO H  8  20  ? -30.717  -20.778 9.740   1.00 61.87  ? 20  PRO K O     1 
ATOM   4732  C  CB    . PRO H  8  20  ? -28.925  -20.270 7.450   1.00 53.98  ? 20  PRO K CB    1 
ATOM   4733  C  CG    . PRO H  8  20  ? -27.850  -19.252 7.590   1.00 57.14  ? 20  PRO K CG    1 
ATOM   4734  C  CD    . PRO H  8  20  ? -28.304  -18.276 8.616   1.00 55.82  ? 20  PRO K CD    1 
ATOM   4735  N  N     . TYR H  8  21  ? -32.109  -21.001 7.997   1.00 58.34  ? 21  TYR K N     1 
ATOM   4736  C  CA    . TYR H  8  21  ? -32.794  -22.172 8.535   1.00 52.49  ? 21  TYR K CA    1 
ATOM   4737  C  C     . TYR H  8  21  ? -31.857  -23.359 8.537   1.00 56.69  ? 21  TYR K C     1 
ATOM   4738  O  O     . TYR H  8  21  ? -30.933  -23.482 7.714   1.00 59.47  ? 21  TYR K O     1 
ATOM   4739  C  CB    . TYR H  8  21  ? -33.968  -22.536 7.669   1.00 49.74  ? 21  TYR K CB    1 
ATOM   4740  C  CG    . TYR H  8  21  ? -34.579  -23.844 7.979   1.00 46.50  ? 21  TYR K CG    1 
ATOM   4741  C  CD1   . TYR H  8  21  ? -35.535  -23.963 8.952   1.00 47.87  ? 21  TYR K CD1   1 
ATOM   4742  C  CD2   . TYR H  8  21  ? -34.232  -24.957 7.256   1.00 48.92  ? 21  TYR K CD2   1 
ATOM   4743  C  CE1   . TYR H  8  21  ? -36.114  -25.194 9.253   1.00 50.01  ? 21  TYR K CE1   1 
ATOM   4744  C  CE2   . TYR H  8  21  ? -34.820  -26.190 7.533   1.00 53.28  ? 21  TYR K CE2   1 
ATOM   4745  C  CZ    . TYR H  8  21  ? -35.753  -26.299 8.541   1.00 50.32  ? 21  TYR K CZ    1 
ATOM   4746  O  OH    . TYR H  8  21  ? -36.262  -27.527 8.800   1.00 51.29  ? 21  TYR K OH    1 
ATOM   4747  N  N     . LEU H  8  22  ? -32.089  -24.198 9.534   1.00 59.10  ? 22  LEU K N     1 
ATOM   4748  C  CA    . LEU H  8  22  ? -31.501  -25.522 9.604   1.00 57.95  ? 22  LEU K CA    1 
ATOM   4749  C  C     . LEU H  8  22  ? -32.556  -26.359 10.282  1.00 58.98  ? 22  LEU K C     1 
ATOM   4750  O  O     . LEU H  8  22  ? -33.204  -25.899 11.223  1.00 66.69  ? 22  LEU K O     1 
ATOM   4751  C  CB    . LEU H  8  22  ? -30.278  -25.528 10.482  1.00 55.53  ? 22  LEU K CB    1 
ATOM   4752  C  CG    . LEU H  8  22  ? -29.054  -24.882 9.939   1.00 57.37  ? 22  LEU K CG    1 
ATOM   4753  C  CD1   . LEU H  8  22  ? -27.996  -24.891 11.049  1.00 61.57  ? 22  LEU K CD1   1 
ATOM   4754  C  CD2   . LEU H  8  22  ? -28.556  -25.657 8.713   1.00 57.67  ? 22  LEU K CD2   1 
ATOM   4755  N  N     . PRO H  8  23  ? -32.723  -27.592 9.842   1.00 56.83  ? 23  PRO K N     1 
ATOM   4756  C  CA    . PRO H  8  23  ? -33.694  -28.411 10.515  1.00 61.12  ? 23  PRO K CA    1 
ATOM   4757  C  C     . PRO H  8  23  ? -33.254  -28.720 11.938  1.00 65.48  ? 23  PRO K C     1 
ATOM   4758  O  O     . PRO H  8  23  ? -32.098  -28.526 12.266  1.00 70.03  ? 23  PRO K O     1 
ATOM   4759  C  CB    . PRO H  8  23  ? -33.756  -29.651 9.663   1.00 61.96  ? 23  PRO K CB    1 
ATOM   4760  C  CG    . PRO H  8  23  ? -32.421  -29.686 9.007   1.00 63.37  ? 23  PRO K CG    1 
ATOM   4761  C  CD    . PRO H  8  23  ? -31.902  -28.309 8.884   1.00 57.61  ? 23  PRO K CD    1 
ATOM   4762  N  N     . PRO H  8  24  ? -34.168  -29.162 12.799  1.00 63.93  ? 24  PRO K N     1 
ATOM   4763  C  CA    . PRO H  8  24  ? -33.821  -29.607 14.131  1.00 63.47  ? 24  PRO K CA    1 
ATOM   4764  C  C     . PRO H  8  24  ? -32.877  -30.810 14.207  1.00 62.65  ? 24  PRO K C     1 
ATOM   4765  O  O     . PRO H  8  24  ? -32.755  -31.526 13.218  1.00 65.36  ? 24  PRO K O     1 
ATOM   4766  C  CB    . PRO H  8  24  ? -35.159  -30.050 14.693  1.00 62.69  ? 24  PRO K CB    1 
ATOM   4767  C  CG    . PRO H  8  24  ? -36.113  -29.269 13.925  1.00 65.19  ? 24  PRO K CG    1 
ATOM   4768  C  CD    . PRO H  8  24  ? -35.588  -29.383 12.541  1.00 65.66  ? 24  PRO K CD    1 
ATOM   4769  N  N     . LEU H  8  25  ? -32.197  -31.007 15.338  1.00 59.90  ? 25  LEU K N     1 
ATOM   4770  C  CA    . LEU H  8  25  ? -31.275  -32.138 15.469  1.00 61.89  ? 25  LEU K CA    1 
ATOM   4771  C  C     . LEU H  8  25  ? -31.969  -33.350 16.022  1.00 63.73  ? 25  LEU K C     1 
ATOM   4772  O  O     . LEU H  8  25  ? -31.701  -34.417 15.559  1.00 61.66  ? 25  LEU K O     1 
ATOM   4773  C  CB    . LEU H  8  25  ? -30.097  -31.791 16.376  1.00 65.74  ? 25  LEU K CB    1 
ATOM   4774  C  CG    . LEU H  8  25  ? -28.955  -31.143 15.617  1.00 68.84  ? 25  LEU K CG    1 
ATOM   4775  C  CD1   . LEU H  8  25  ? -28.179  -30.201 16.514  1.00 69.94  ? 25  LEU K CD1   1 
ATOM   4776  C  CD2   . LEU H  8  25  ? -28.073  -32.228 15.049  1.00 75.75  ? 25  LEU K CD2   1 
ATOM   4777  N  N     . GLU H  8  26  ? -32.769  -33.169 17.069  1.00 72.53  ? 26  GLU K N     1 
ATOM   4778  C  CA    . GLU H  8  26  ? -33.496  -34.220 17.764  1.00 75.86  ? 26  GLU K CA    1 
ATOM   4779  C  C     . GLU H  8  26  ? -34.971  -34.074 17.387  1.00 69.13  ? 26  GLU K C     1 
ATOM   4780  O  O     . GLU H  8  26  ? -35.434  -32.976 17.145  1.00 69.05  ? 26  GLU K O     1 
ATOM   4781  C  CB    . GLU H  8  26  ? -33.317  -34.046 19.280  1.00 87.88  ? 26  GLU K CB    1 
ATOM   4782  C  CG    . GLU H  8  26  ? -31.886  -34.068 19.796  1.00 104.52 ? 26  GLU K CG    1 
ATOM   4783  C  CD    . GLU H  8  26  ? -31.756  -34.267 21.327  1.00 130.49 ? 26  GLU K CD    1 
ATOM   4784  O  OE1   . GLU H  8  26  ? -30.991  -35.185 21.734  1.00 144.29 ? 26  GLU K OE1   1 
ATOM   4785  O  OE2   . GLU H  8  26  ? -32.354  -33.525 22.163  1.00 138.90 ? 26  GLU K OE2   1 
ATOM   4786  N  N     . LYS H  8  27  ? -35.739  -35.151 17.390  1.00 69.71  ? 27  LYS K N     1 
ATOM   4787  C  CA    . LYS H  8  27  ? -37.201  -35.069 17.368  1.00 72.89  ? 27  LYS K CA    1 
ATOM   4788  C  C     . LYS H  8  27  ? -37.687  -34.366 18.619  1.00 74.14  ? 27  LYS K C     1 
ATOM   4789  O  O     . LYS H  8  27  ? -36.982  -34.175 19.606  1.00 75.42  ? 27  LYS K O     1 
ATOM   4790  C  CB    . LYS H  8  27  ? -37.871  -36.440 17.376  1.00 79.90  ? 27  LYS K CB    1 
ATOM   4791  C  CG    . LYS H  8  27  ? -37.584  -37.298 16.170  1.00 88.99  ? 27  LYS K CG    1 
ATOM   4792  C  CD    . LYS H  8  27  ? -38.020  -38.758 16.323  1.00 97.68  ? 27  LYS K CD    1 
ATOM   4793  C  CE    . LYS H  8  27  ? -36.904  -39.802 16.153  1.00 113.85 ? 27  LYS K CE    1 
ATOM   4794  N  NZ    . LYS H  8  27  ? -37.200  -40.810 15.078  1.00 129.29 ? 27  LYS K NZ    1 
ATOM   4795  N  N     . LEU H  8  28  ? -38.957  -34.013 18.579  1.00 74.68  ? 28  LEU K N     1 
ATOM   4796  C  CA    . LEU H  8  28  ? -39.603  -33.391 19.717  1.00 72.35  ? 28  LEU K CA    1 
ATOM   4797  C  C     . LEU H  8  28  ? -39.702  -34.482 20.766  1.00 69.55  ? 28  LEU K C     1 
ATOM   4798  O  O     . LEU H  8  28  ? -39.844  -35.641 20.434  1.00 68.14  ? 28  LEU K O     1 
ATOM   4799  C  CB    . LEU H  8  28  ? -40.959  -32.838 19.249  1.00 78.13  ? 28  LEU K CB    1 
ATOM   4800  C  CG    . LEU H  8  28  ? -41.387  -31.387 19.494  1.00 86.30  ? 28  LEU K CG    1 
ATOM   4801  C  CD1   . LEU H  8  28  ? -40.212  -30.438 19.353  1.00 90.08  ? 28  LEU K CD1   1 
ATOM   4802  C  CD2   . LEU H  8  28  ? -42.491  -30.933 18.536  1.00 89.94  ? 28  LEU K CD2   1 
ATOM   4803  N  N     . PRO H  8  29  ? -39.616  -34.132 22.049  1.00 76.61  ? 29  PRO K N     1 
ATOM   4804  C  CA    . PRO H  8  29  ? -39.562  -35.217 23.040  1.00 73.04  ? 29  PRO K CA    1 
ATOM   4805  C  C     . PRO H  8  29  ? -40.810  -36.111 23.052  1.00 72.71  ? 29  PRO K C     1 
ATOM   4806  O  O     . PRO H  8  29  ? -40.671  -37.322 23.126  1.00 69.71  ? 29  PRO K O     1 
ATOM   4807  C  CB    . PRO H  8  29  ? -39.338  -34.484 24.373  1.00 75.23  ? 29  PRO K CB    1 
ATOM   4808  C  CG    . PRO H  8  29  ? -39.794  -33.063 24.138  1.00 81.00  ? 29  PRO K CG    1 
ATOM   4809  C  CD    . PRO H  8  29  ? -39.972  -32.822 22.653  1.00 81.48  ? 29  PRO K CD    1 
ATOM   4810  N  N     . HIS H  8  30  ? -42.006  -35.534 22.946  1.00 78.80  ? 30  HIS K N     1 
ATOM   4811  C  CA    . HIS H  8  30  ? -43.251  -36.335 22.939  1.00 82.92  ? 30  HIS K CA    1 
ATOM   4812  C  C     . HIS H  8  30  ? -43.455  -37.215 21.708  1.00 80.65  ? 30  HIS K C     1 
ATOM   4813  O  O     . HIS H  8  30  ? -44.338  -38.073 21.749  1.00 85.19  ? 30  HIS K O     1 
ATOM   4814  C  CB    . HIS H  8  30  ? -44.515  -35.473 23.075  1.00 84.64  ? 30  HIS K CB    1 
ATOM   4815  C  CG    . HIS H  8  30  ? -44.811  -34.654 21.860  1.00 85.56  ? 30  HIS K CG    1 
ATOM   4816  N  ND1   . HIS H  8  30  ? -44.405  -33.339 21.742  1.00 85.90  ? 30  HIS K ND1   1 
ATOM   4817  C  CD2   . HIS H  8  30  ? -45.466  -34.965 20.715  1.00 81.08  ? 30  HIS K CD2   1 
ATOM   4818  C  CE1   . HIS H  8  30  ? -44.783  -32.881 20.558  1.00 83.00  ? 30  HIS K CE1   1 
ATOM   4819  N  NE2   . HIS H  8  30  ? -45.426  -33.844 19.920  1.00 81.43  ? 30  HIS K NE2   1 
ATOM   4820  N  N     . GLU H  8  31  ? -42.685  -37.005 20.643  1.00 73.69  ? 31  GLU K N     1 
ATOM   4821  C  CA    . GLU H  8  31  ? -42.826  -37.793 19.436  1.00 76.48  ? 31  GLU K CA    1 
ATOM   4822  C  C     . GLU H  8  31  ? -41.619  -38.675 19.155  1.00 81.55  ? 31  GLU K C     1 
ATOM   4823  O  O     . GLU H  8  31  ? -41.374  -39.045 18.001  1.00 80.17  ? 31  GLU K O     1 
ATOM   4824  C  CB    . GLU H  8  31  ? -43.189  -36.889 18.266  1.00 82.16  ? 31  GLU K CB    1 
ATOM   4825  C  CG    . GLU H  8  31  ? -42.030  -36.064 17.705  1.00 95.89  ? 31  GLU K CG    1 
ATOM   4826  C  CD    . GLU H  8  31  ? -42.395  -34.752 16.979  1.00 105.65 ? 31  GLU K CD    1 
ATOM   4827  O  OE1   . GLU H  8  31  ? -43.564  -34.301 17.090  1.00 112.10 ? 31  GLU K OE1   1 
ATOM   4828  O  OE2   . GLU H  8  31  ? -41.515  -34.184 16.254  1.00 100.70 ? 31  GLU K OE2   1 
ATOM   4829  N  N     . LYS H  8  32  ? -40.827  -38.993 20.179  1.00 89.72  ? 32  LYS K N     1 
ATOM   4830  C  CA    . LYS H  8  32  ? -39.576  -39.755 19.946  1.00 102.00 ? 32  LYS K CA    1 
ATOM   4831  C  C     . LYS H  8  32  ? -39.977  -41.181 20.247  1.00 109.16 ? 32  LYS K C     1 
ATOM   4832  O  O     . LYS H  8  32  ? -40.895  -41.378 21.036  1.00 110.80 ? 32  LYS K O     1 
ATOM   4833  C  CB    . LYS H  8  32  ? -38.314  -39.167 20.646  1.00 104.16 ? 32  LYS K CB    1 
ATOM   4834  C  CG    . LYS H  8  32  ? -38.119  -39.476 22.116  1.00 115.82 ? 32  LYS K CG    1 
ATOM   4835  C  CD    . LYS H  8  32  ? -36.726  -39.135 22.660  1.00 117.15 ? 32  LYS K CD    1 
ATOM   4836  C  CE    . LYS H  8  32  ? -36.473  -37.628 22.679  1.00 121.59 ? 32  LYS K CE    1 
ATOM   4837  N  NZ    . LYS H  8  32  ? -35.130  -37.233 23.188  1.00 126.47 ? 32  LYS K NZ    1 
ATOM   4838  N  N     . HIS H  8  33  ? -39.350  -42.155 19.586  1.00 128.59 ? 33  HIS K N     1 
ATOM   4839  C  CA    . HIS H  8  33  ? -39.705  -43.590 19.709  1.00 135.76 ? 33  HIS K CA    1 
ATOM   4840  C  C     . HIS H  8  33  ? -38.739  -44.287 20.693  1.00 121.63 ? 33  HIS K C     1 
ATOM   4841  O  O     . HIS H  8  33  ? -37.519  -44.373 20.452  1.00 121.82 ? 33  HIS K O     1 
ATOM   4842  C  CB    . HIS H  8  33  ? -39.742  -44.231 18.300  1.00 155.11 ? 33  HIS K CB    1 
ATOM   4843  C  CG    . HIS H  8  33  ? -38.379  -44.350 17.641  1.00 182.43 ? 33  HIS K CG    1 
ATOM   4844  N  ND1   . HIS H  8  33  ? -37.760  -43.267 17.051  1.00 189.23 ? 33  HIS K ND1   1 
ATOM   4845  C  CD2   . HIS H  8  33  ? -37.492  -45.372 17.505  1.00 189.60 ? 33  HIS K CD2   1 
ATOM   4846  C  CE1   . HIS H  8  33  ? -36.571  -43.605 16.583  1.00 185.60 ? 33  HIS K CE1   1 
ATOM   4847  N  NE2   . HIS H  8  33  ? -36.388  -44.885 16.830  1.00 181.94 ? 33  HIS K NE2   1 
ATOM   4848  N  N     . HIS H  8  34  ? -39.281  -44.751 21.815  1.00 109.05 ? 34  HIS K N     1 
ATOM   4849  C  CA    . HIS H  8  34  ? -38.472  -45.363 22.854  1.00 113.82 ? 34  HIS K CA    1 
ATOM   4850  C  C     . HIS H  8  34  ? -38.291  -46.864 22.624  1.00 119.51 ? 34  HIS K C     1 
ATOM   4851  O  O     . HIS H  8  34  ? -39.161  -47.649 22.991  1.00 117.52 ? 34  HIS K O     1 
ATOM   4852  C  CB    . HIS H  8  34  ? -39.043  -45.064 24.246  1.00 118.11 ? 34  HIS K CB    1 
ATOM   4853  C  CG    . HIS H  8  34  ? -38.554  -43.763 24.820  1.00 116.88 ? 34  HIS K CG    1 
ATOM   4854  N  ND1   . HIS H  8  34  ? -37.866  -43.637 26.018  1.00 112.35 ? 34  HIS K ND1   1 
ATOM   4855  C  CD2   . HIS H  8  34  ? -38.651  -42.516 24.309  1.00 110.45 ? 34  HIS K CD2   1 
ATOM   4856  C  CE1   . HIS H  8  34  ? -37.575  -42.362 26.214  1.00 114.35 ? 34  HIS K CE1   1 
ATOM   4857  N  NE2   . HIS H  8  34  ? -38.021  -41.667 25.184  1.00 110.89 ? 34  HIS K NE2   1 
ATOM   4858  N  N     . ASN H  8  35  ? -37.151  -47.235 22.031  1.00 124.34 ? 35  ASN K N     1 
ATOM   4859  C  CA    . ASN H  8  35  ? -36.789  -48.630 21.689  1.00 126.54 ? 35  ASN K CA    1 
ATOM   4860  C  C     . ASN H  8  35  ? -36.550  -49.590 22.860  1.00 122.89 ? 35  ASN K C     1 
ATOM   4861  O  O     . ASN H  8  35  ? -36.760  -50.785 22.710  1.00 128.62 ? 35  ASN K O     1 
ATOM   4862  C  CB    . ASN H  8  35  ? -35.576  -48.710 20.732  1.00 125.09 ? 35  ASN K CB    1 
ATOM   4863  C  CG    . ASN H  8  35  ? -35.922  -48.312 19.275  1.00 135.77 ? 35  ASN K CG    1 
ATOM   4864  O  OD1   . ASN H  8  35  ? -37.091  -48.104 18.957  1.00 144.66 ? 35  ASN K OD1   1 
ATOM   4865  N  ND2   . ASN H  8  35  ? -34.951  -48.281 18.356  1.00 146.59 ? 35  ASN K ND2   1 
ATOM   4866  N  N     . GLN H  8  36  ? -36.145  -49.099 24.025  1.00 116.80 ? 36  GLN K N     1 
ATOM   4867  C  CA    . GLN H  8  36  ? -36.076  -49.958 25.203  1.00 110.05 ? 36  GLN K CA    1 
ATOM   4868  C  C     . GLN H  8  36  ? -36.540  -49.153 26.396  1.00 100.89 ? 36  GLN K C     1 
ATOM   4869  O  O     . GLN H  8  36  ? -35.678  -48.705 27.138  1.00 102.76 ? 36  GLN K O     1 
ATOM   4870  C  CB    . GLN H  8  36  ? -34.649  -50.457 25.402  1.00 115.02 ? 36  GLN K CB    1 
ATOM   4871  C  CG    . GLN H  8  36  ? -34.061  -51.226 24.232  1.00 120.70 ? 36  GLN K CG    1 
ATOM   4872  C  CD    . GLN H  8  36  ? -32.583  -51.522 24.419  1.00 132.76 ? 36  GLN K CD    1 
ATOM   4873  O  OE1   . GLN H  8  36  ? -31.801  -51.550 23.442  1.00 129.18 ? 36  GLN K OE1   1 
ATOM   4874  N  NE2   . GLN H  8  36  ? -32.181  -51.739 25.687  1.00 131.70 ? 36  GLN K NE2   1 
ATOM   4875  N  N     . PRO H  8  37  ? -37.868  -48.949 26.580  1.00 92.36  ? 37  PRO K N     1 
ATOM   4876  C  CA    . PRO H  8  37  ? -38.328  -47.984 27.597  1.00 90.20  ? 37  PRO K CA    1 
ATOM   4877  C  C     . PRO H  8  37  ? -38.014  -48.412 29.040  1.00 78.94  ? 37  PRO K C     1 
ATOM   4878  O  O     . PRO H  8  37  ? -37.612  -49.569 29.250  1.00 67.14  ? 37  PRO K O     1 
ATOM   4879  C  CB    . PRO H  8  37  ? -39.839  -47.903 27.372  1.00 93.99  ? 37  PRO K CB    1 
ATOM   4880  C  CG    . PRO H  8  37  ? -40.181  -49.251 26.846  1.00 95.57  ? 37  PRO K CG    1 
ATOM   4881  C  CD    . PRO H  8  37  ? -38.995  -49.738 26.055  1.00 93.29  ? 37  PRO K CD    1 
ATOM   4882  N  N     . TYR H  8  38  ? -38.151  -47.472 29.976  1.00 73.64  ? 38  TYR K N     1 
ATOM   4883  C  CA    . TYR H  8  38  ? -37.657  -47.724 31.327  1.00 73.39  ? 38  TYR K CA    1 
ATOM   4884  C  C     . TYR H  8  38  ? -38.275  -48.991 31.809  1.00 79.36  ? 38  TYR K C     1 
ATOM   4885  O  O     . TYR H  8  38  ? -39.408  -49.266 31.485  1.00 88.98  ? 38  TYR K O     1 
ATOM   4886  C  CB    . TYR H  8  38  ? -38.049  -46.641 32.323  1.00 66.77  ? 38  TYR K CB    1 
ATOM   4887  C  CG    . TYR H  8  38  ? -37.177  -45.442 32.328  1.00 61.57  ? 38  TYR K CG    1 
ATOM   4888  C  CD1   . TYR H  8  38  ? -35.813  -45.539 32.362  1.00 56.02  ? 38  TYR K CD1   1 
ATOM   4889  C  CD2   . TYR H  8  38  ? -37.763  -44.173 32.265  1.00 63.56  ? 38  TYR K CD2   1 
ATOM   4890  C  CE1   . TYR H  8  38  ? -35.054  -44.388 32.297  1.00 59.74  ? 38  TYR K CE1   1 
ATOM   4891  C  CE2   . TYR H  8  38  ? -37.030  -43.012 32.201  1.00 64.44  ? 38  TYR K CE2   1 
ATOM   4892  C  CZ    . TYR H  8  38  ? -35.654  -43.105 32.253  1.00 64.50  ? 38  TYR K CZ    1 
ATOM   4893  O  OH    . TYR H  8  38  ? -35.030  -41.844 32.282  1.00 65.99  ? 38  TYR K OH    1 
ATOM   4894  N  N     . CYS H  8  39  ? -37.555  -49.771 32.581  1.00 87.14  ? 39  CYS K N     1 
ATOM   4895  C  CA    . CYS H  8  39  ? -38.126  -51.021 33.022  1.00 94.15  ? 39  CYS K CA    1 
ATOM   4896  C  C     . CYS H  8  39  ? -37.704  -51.359 34.429  1.00 89.56  ? 39  CYS K C     1 
ATOM   4897  O  O     . CYS H  8  39  ? -36.679  -50.910 34.937  1.00 93.74  ? 39  CYS K O     1 
ATOM   4898  C  CB    . CYS H  8  39  ? -37.765  -52.132 32.020  1.00 99.81  ? 39  CYS K CB    1 
ATOM   4899  S  SG    . CYS H  8  39  ? -36.081  -52.717 32.220  1.00 98.76  ? 39  CYS K SG    1 
ATOM   4900  N  N     . GLY H  8  40  ? -38.472  -52.272 34.985  1.00 82.71  ? 40  GLY K N     1 
ATOM   4901  C  CA    . GLY H  8  40  ? -38.395  -52.560 36.385  1.00 79.16  ? 40  GLY K CA    1 
ATOM   4902  C  C     . GLY H  8  40  ? -37.257  -53.478 36.788  1.00 74.17  ? 40  GLY K C     1 
ATOM   4903  O  O     . GLY H  8  40  ? -36.551  -54.016 35.916  1.00 71.21  ? 40  GLY K O     1 
ATOM   4904  N  N     . ILE H  8  41  ? -37.218  -53.673 38.112  1.00 64.24  ? 41  ILE K N     1 
ATOM   4905  C  CA    . ILE H  8  41  ? -36.167  -54.330 38.834  1.00 59.34  ? 41  ILE K CA    1 
ATOM   4906  C  C     . ILE H  8  41  ? -36.556  -55.667 39.376  1.00 60.10  ? 41  ILE K C     1 
ATOM   4907  O  O     . ILE H  8  41  ? -35.741  -56.333 40.043  1.00 71.60  ? 41  ILE K O     1 
ATOM   4908  C  CB    . ILE H  8  41  ? -35.743  -53.534 40.047  1.00 57.02  ? 41  ILE K CB    1 
ATOM   4909  C  CG1   . ILE H  8  41  ? -36.920  -53.062 40.850  1.00 57.30  ? 41  ILE K CG1   1 
ATOM   4910  C  CG2   . ILE H  8  41  ? -34.928  -52.347 39.611  1.00 61.25  ? 41  ILE K CG2   1 
ATOM   4911  C  CD1   . ILE H  8  41  ? -36.499  -52.804 42.274  1.00 61.84  ? 41  ILE K CD1   1 
ATOM   4912  N  N     . ALA H  8  42  ? -37.763  -56.107 39.081  1.00 58.47  ? 42  ALA K N     1 
ATOM   4913  C  CA    . ALA H  8  42  ? -38.200  -57.413 39.590  1.00 62.73  ? 42  ALA K CA    1 
ATOM   4914  C  C     . ALA H  8  42  ? -37.268  -58.593 39.186  1.00 61.50  ? 42  ALA K C     1 
ATOM   4915  O  O     . ALA H  8  42  ? -36.881  -59.401 40.049  1.00 62.77  ? 42  ALA K O     1 
ATOM   4916  C  CB    . ALA H  8  42  ? -39.638  -57.692 39.168  1.00 65.00  ? 42  ALA K CB    1 
ATOM   4917  N  N     . PRO H  8  43  ? -36.819  -58.639 37.921  1.00 56.74  ? 43  PRO K N     1 
ATOM   4918  C  CA    . PRO H  8  43  ? -35.961  -59.720 37.480  1.00 55.83  ? 43  PRO K CA    1 
ATOM   4919  C  C     . PRO H  8  43  ? -34.630  -59.829 38.204  1.00 59.65  ? 43  PRO K C     1 
ATOM   4920  O  O     . PRO H  8  43  ? -33.999  -60.895 38.188  1.00 62.64  ? 43  PRO K O     1 
ATOM   4921  C  CB    . PRO H  8  43  ? -35.699  -59.414 36.024  1.00 54.63  ? 43  PRO K CB    1 
ATOM   4922  C  CG    . PRO H  8  43  ? -36.817  -58.556 35.653  1.00 60.62  ? 43  PRO K CG    1 
ATOM   4923  C  CD    . PRO H  8  43  ? -37.057  -57.680 36.843  1.00 60.17  ? 43  PRO K CD    1 
ATOM   4924  N  N     . TYR H  8  44  ? -34.215  -58.750 38.853  1.00 59.63  ? 44  TYR K N     1 
ATOM   4925  C  CA    . TYR H  8  44  ? -32.871  -58.638 39.370  1.00 58.06  ? 44  TYR K CA    1 
ATOM   4926  C  C     . TYR H  8  44  ? -32.718  -59.090 40.811  1.00 60.87  ? 44  TYR K C     1 
ATOM   4927  O  O     . TYR H  8  44  ? -31.582  -59.023 41.288  1.00 57.39  ? 44  TYR K O     1 
ATOM   4928  C  CB    . TYR H  8  44  ? -32.387  -57.194 39.171  1.00 55.75  ? 44  TYR K CB    1 
ATOM   4929  C  CG    . TYR H  8  44  ? -32.218  -56.828 37.737  1.00 53.52  ? 44  TYR K CG    1 
ATOM   4930  C  CD1   . TYR H  8  44  ? -31.070  -57.145 37.061  1.00 51.20  ? 44  TYR K CD1   1 
ATOM   4931  C  CD2   . TYR H  8  44  ? -33.234  -56.218 37.029  1.00 59.51  ? 44  TYR K CD2   1 
ATOM   4932  C  CE1   . TYR H  8  44  ? -30.909  -56.842 35.729  1.00 54.85  ? 44  TYR K CE1   1 
ATOM   4933  C  CE2   . TYR H  8  44  ? -33.088  -55.862 35.682  1.00 63.68  ? 44  TYR K CE2   1 
ATOM   4934  C  CZ    . TYR H  8  44  ? -31.912  -56.181 35.043  1.00 61.23  ? 44  TYR K CZ    1 
ATOM   4935  O  OH    . TYR H  8  44  ? -31.767  -55.918 33.704  1.00 72.28  ? 44  TYR K OH    1 
ATOM   4936  N  N     . ILE H  8  45  ? -33.786  -59.492 41.520  1.00 66.03  ? 45  ILE K N     1 
ATOM   4937  C  CA    . ILE H  8  45  ? -33.654  -59.773 42.995  1.00 68.83  ? 45  ILE K CA    1 
ATOM   4938  C  C     . ILE H  8  45  ? -32.656  -60.896 43.275  1.00 62.27  ? 45  ILE K C     1 
ATOM   4939  O  O     . ILE H  8  45  ? -31.909  -60.896 44.227  1.00 51.91  ? 45  ILE K O     1 
ATOM   4940  C  CB    . ILE H  8  45  ? -34.963  -59.966 43.801  1.00 71.57  ? 45  ILE K CB    1 
ATOM   4941  C  CG1   . ILE H  8  45  ? -35.833  -61.010 43.086  1.00 89.49  ? 45  ILE K CG1   1 
ATOM   4942  C  CG2   . ILE H  8  45  ? -35.680  -58.643 44.000  1.00 71.88  ? 45  ILE K CG2   1 
ATOM   4943  C  CD1   . ILE H  8  45  ? -37.306  -61.166 43.473  1.00 99.80  ? 45  ILE K CD1   1 
ATOM   4944  N  N     . ARG H  8  46  ? -32.634  -61.855 42.368  1.00 63.18  ? 46  ARG K N     1 
ATOM   4945  C  CA    . ARG H  8  46  ? -31.710  -62.963 42.432  1.00 64.14  ? 46  ARG K CA    1 
ATOM   4946  C  C     . ARG H  8  46  ? -30.300  -62.503 42.538  1.00 61.94  ? 46  ARG K C     1 
ATOM   4947  O  O     . ARG H  8  46  ? -29.429  -63.289 42.900  1.00 65.68  ? 46  ARG K O     1 
ATOM   4948  C  CB    . ARG H  8  46  ? -31.903  -63.935 41.272  1.00 72.75  ? 46  ARG K CB    1 
ATOM   4949  C  CG    . ARG H  8  46  ? -31.986  -63.316 39.878  1.00 83.02  ? 46  ARG K CG    1 
ATOM   4950  C  CD    . ARG H  8  46  ? -31.565  -64.137 38.621  1.00 87.65  ? 46  ARG K CD    1 
ATOM   4951  N  NE    . ARG H  8  46  ? -30.313  -64.880 38.800  1.00 92.93  ? 46  ARG K NE    1 
ATOM   4952  C  CZ    . ARG H  8  46  ? -30.206  -66.206 38.964  1.00 106.87 ? 46  ARG K CZ    1 
ATOM   4953  N  NH1   . ARG H  8  46  ? -31.279  -67.019 39.036  1.00 114.28 ? 46  ARG K NH1   1 
ATOM   4954  N  NH2   . ARG H  8  46  ? -28.989  -66.740 39.109  1.00 98.75  ? 46  ARG K NH2   1 
ATOM   4955  N  N     . GLU H  8  47  ? -30.020  -61.254 42.204  1.00 61.97  ? 47  GLU K N     1 
ATOM   4956  C  CA    . GLU H  8  47  ? -28.634  -60.760 42.316  1.00 63.09  ? 47  GLU K CA    1 
ATOM   4957  C  C     . GLU H  8  47  ? -28.175  -60.482 43.707  1.00 59.93  ? 47  GLU K C     1 
ATOM   4958  O  O     . GLU H  8  47  ? -26.963  -60.487 43.982  1.00 62.82  ? 47  GLU K O     1 
ATOM   4959  C  CB    . GLU H  8  47  ? -28.340  -59.552 41.430  1.00 66.38  ? 47  GLU K CB    1 
ATOM   4960  C  CG    . GLU H  8  47  ? -28.374  -59.951 39.942  1.00 75.29  ? 47  GLU K CG    1 
ATOM   4961  C  CD    . GLU H  8  47  ? -27.192  -60.803 39.517  1.00 81.44  ? 47  GLU K CD    1 
ATOM   4962  O  OE1   . GLU H  8  47  ? -26.156  -60.639 40.193  1.00 80.49  ? 47  GLU K OE1   1 
ATOM   4963  O  OE2   . GLU H  8  47  ? -27.363  -61.662 38.607  1.00 83.88  ? 47  GLU K OE2   1 
ATOM   4964  N  N     . PHE H  8  48  ? -29.134  -60.240 44.585  1.00 58.18  ? 48  PHE K N     1 
ATOM   4965  C  CA    . PHE H  8  48  ? -28.756  -59.856 45.941  1.00 58.93  ? 48  PHE K CA    1 
ATOM   4966  C  C     . PHE H  8  48  ? -28.000  -60.955 46.680  1.00 57.96  ? 48  PHE K C     1 
ATOM   4967  O  O     . PHE H  8  48  ? -28.184  -62.143 46.405  1.00 59.83  ? 48  PHE K O     1 
ATOM   4968  C  CB    . PHE H  8  48  ? -29.975  -59.572 46.777  1.00 58.06  ? 48  PHE K CB    1 
ATOM   4969  C  CG    . PHE H  8  48  ? -30.605  -58.236 46.593  1.00 55.61  ? 48  PHE K CG    1 
ATOM   4970  C  CD1   . PHE H  8  48  ? -30.022  -57.108 47.157  1.00 56.69  ? 48  PHE K CD1   1 
ATOM   4971  C  CD2   . PHE H  8  48  ? -31.841  -58.129 45.925  1.00 54.06  ? 48  PHE K CD2   1 
ATOM   4972  C  CE1   . PHE H  8  48  ? -30.659  -55.872 47.060  1.00 59.24  ? 48  PHE K CE1   1 
ATOM   4973  C  CE2   . PHE H  8  48  ? -32.496  -56.920 45.846  1.00 55.38  ? 48  PHE K CE2   1 
ATOM   4974  C  CZ    . PHE H  8  48  ? -31.903  -55.787 46.415  1.00 60.81  ? 48  PHE K CZ    1 
ATOM   4975  N  N     . GLU H  8  49  ? -27.176  -60.531 47.614  1.00 57.66  ? 49  GLU K N     1 
ATOM   4976  C  CA    . GLU H  8  49  ? -26.325  -61.447 48.323  1.00 65.22  ? 49  GLU K CA    1 
ATOM   4977  C  C     . GLU H  8  49  ? -27.151  -62.240 49.286  1.00 68.66  ? 49  GLU K C     1 
ATOM   4978  O  O     . GLU H  8  49  ? -28.204  -61.781 49.710  1.00 79.83  ? 49  GLU K O     1 
ATOM   4979  C  CB    . GLU H  8  49  ? -25.270  -60.706 49.121  1.00 73.67  ? 49  GLU K CB    1 
ATOM   4980  C  CG    . GLU H  8  49  ? -25.861  -59.772 50.176  1.00 82.42  ? 49  GLU K CG    1 
ATOM   4981  C  CD    . GLU H  8  49  ? -24.805  -58.915 50.835  1.00 87.97  ? 49  GLU K CD    1 
ATOM   4982  O  OE1   . GLU H  8  49  ? -23.593  -59.265 50.718  1.00 80.11  ? 49  GLU K OE1   1 
ATOM   4983  O  OE2   . GLU H  8  49  ? -25.204  -57.890 51.445  1.00 96.51  ? 49  GLU K OE2   1 
ATOM   4984  N  N     . ASP H  8  50  ? -26.658  -63.401 49.681  1.00 74.30  ? 50  ASP K N     1 
ATOM   4985  C  CA    . ASP H  8  50  ? -27.276  -64.092 50.791  1.00 77.29  ? 50  ASP K CA    1 
ATOM   4986  C  C     . ASP H  8  50  ? -27.015  -63.278 52.037  1.00 74.80  ? 50  ASP K C     1 
ATOM   4987  O  O     . ASP H  8  50  ? -25.896  -62.830 52.288  1.00 80.89  ? 50  ASP K O     1 
ATOM   4988  C  CB    . ASP H  8  50  ? -26.700  -65.486 50.927  1.00 82.05  ? 50  ASP K CB    1 
ATOM   4989  C  CG    . ASP H  8  50  ? -27.487  -66.369 51.868  1.00 86.72  ? 50  ASP K CG    1 
ATOM   4990  O  OD1   . ASP H  8  50  ? -27.513  -66.038 53.078  1.00 85.91  ? 50  ASP K OD1   1 
ATOM   4991  O  OD2   . ASP H  8  50  ? -28.049  -67.381 51.367  1.00 81.49  ? 50  ASP K OD2   1 
ATOM   4992  N  N     . PRO H  8  51  ? -28.040  -63.096 52.842  1.00 74.87  ? 51  PRO K N     1 
ATOM   4993  C  CA    . PRO H  8  51  ? -27.827  -62.303 54.049  1.00 79.68  ? 51  PRO K CA    1 
ATOM   4994  C  C     . PRO H  8  51  ? -26.838  -62.896 55.051  1.00 85.27  ? 51  PRO K C     1 
ATOM   4995  O  O     . PRO H  8  51  ? -26.287  -62.140 55.849  1.00 98.51  ? 51  PRO K O     1 
ATOM   4996  C  CB    . PRO H  8  51  ? -29.203  -62.255 54.688  1.00 80.58  ? 51  PRO K CB    1 
ATOM   4997  C  CG    . PRO H  8  51  ? -29.930  -63.428 54.088  1.00 80.33  ? 51  PRO K CG    1 
ATOM   4998  C  CD    . PRO H  8  51  ? -29.428  -63.537 52.696  1.00 78.07  ? 51  PRO K CD    1 
ATOM   4999  N  N     . ARG H  8  52  ? -26.597  -64.206 55.037  1.00 78.67  ? 52  ARG K N     1 
ATOM   5000  C  CA    . ARG H  8  52  ? -25.570  -64.725 55.908  1.00 83.27  ? 52  ARG K CA    1 
ATOM   5001  C  C     . ARG H  8  52  ? -24.248  -64.209 55.427  1.00 87.66  ? 52  ARG K C     1 
ATOM   5002  O  O     . ARG H  8  52  ? -23.394  -63.899 56.240  1.00 100.79 ? 52  ARG K O     1 
ATOM   5003  C  CB    . ARG H  8  52  ? -25.535  -66.245 55.884  1.00 97.95  ? 52  ARG K CB    1 
ATOM   5004  C  CG    . ARG H  8  52  ? -26.790  -66.945 56.423  1.00 104.71 ? 52  ARG K CG    1 
ATOM   5005  C  CD    . ARG H  8  52  ? -26.958  -68.370 55.910  1.00 105.22 ? 52  ARG K CD    1 
ATOM   5006  N  NE    . ARG H  8  52  ? -27.995  -68.461 54.888  1.00 109.94 ? 52  ARG K NE    1 
ATOM   5007  C  CZ    . ARG H  8  52  ? -28.561  -69.581 54.465  1.00 117.18 ? 52  ARG K CZ    1 
ATOM   5008  N  NH1   . ARG H  8  52  ? -28.282  -70.771 55.012  1.00 134.62 ? 52  ARG K NH1   1 
ATOM   5009  N  NH2   . ARG H  8  52  ? -29.467  -69.511 53.498  1.00 111.49 ? 52  ARG K NH2   1 
ATOM   5010  N  N     . ASP H  8  53  ? -24.082  -64.093 54.107  1.00 90.03  ? 53  ASP K N     1 
ATOM   5011  C  CA    . ASP H  8  53  ? -22.824  -63.660 53.475  1.00 80.89  ? 53  ASP K CA    1 
ATOM   5012  C  C     . ASP H  8  53  ? -22.685  -62.156 53.478  1.00 72.58  ? 53  ASP K C     1 
ATOM   5013  O  O     . ASP H  8  53  ? -21.706  -61.656 52.966  1.00 78.16  ? 53  ASP K O     1 
ATOM   5014  C  CB    . ASP H  8  53  ? -22.658  -64.260 52.077  1.00 81.58  ? 53  ASP K CB    1 
ATOM   5015  C  CG    . ASP H  8  53  ? -22.754  -65.801 52.072  1.00 93.00  ? 53  ASP K CG    1 
ATOM   5016  O  OD1   . ASP H  8  53  ? -22.723  -66.403 53.182  1.00 102.99 ? 53  ASP K OD1   1 
ATOM   5017  O  OD2   . ASP H  8  53  ? -22.837  -66.434 50.977  1.00 95.45  ? 53  ASP K OD2   1 
ATOM   5018  N  N     . ALA H  8  54  ? -23.609  -61.433 54.093  1.00 68.45  ? 54  ALA K N     1 
ATOM   5019  C  CA    . ALA H  8  54  ? -23.509  -59.992 54.187  1.00 76.45  ? 54  ALA K CA    1 
ATOM   5020  C  C     . ALA H  8  54  ? -22.442  -59.655 55.210  1.00 82.17  ? 54  ALA K C     1 
ATOM   5021  O  O     . ALA H  8  54  ? -22.222  -60.440 56.109  1.00 82.77  ? 54  ALA K O     1 
ATOM   5022  C  CB    . ALA H  8  54  ? -24.832  -59.374 54.615  1.00 78.83  ? 54  ALA K CB    1 
ATOM   5023  N  N     . PRO H  8  55  ? -21.814  -58.481 55.107  1.00 89.54  ? 55  PRO K N     1 
ATOM   5024  C  CA    . PRO H  8  55  ? -20.884  -57.987 56.113  1.00 93.33  ? 55  PRO K CA    1 
ATOM   5025  C  C     . PRO H  8  55  ? -21.622  -57.424 57.321  1.00 90.28  ? 55  PRO K C     1 
ATOM   5026  O  O     . PRO H  8  55  ? -22.764  -57.048 57.171  1.00 91.82  ? 55  PRO K O     1 
ATOM   5027  C  CB    . PRO H  8  55  ? -20.166  -56.855 55.393  1.00 98.05  ? 55  PRO K CB    1 
ATOM   5028  C  CG    . PRO H  8  55  ? -21.197  -56.332 54.463  1.00 102.05 ? 55  PRO K CG    1 
ATOM   5029  C  CD    . PRO H  8  55  ? -21.929  -57.554 53.973  1.00 97.58  ? 55  PRO K CD    1 
ATOM   5030  N  N     . PRO H  8  56  ? -20.985  -57.354 58.503  1.00 95.81  ? 56  PRO K N     1 
ATOM   5031  C  CA    . PRO H  8  56  ? -21.696  -56.951 59.697  1.00 95.33  ? 56  PRO K CA    1 
ATOM   5032  C  C     . PRO H  8  56  ? -21.927  -55.454 59.745  1.00 102.30 ? 56  PRO K C     1 
ATOM   5033  O  O     . PRO H  8  56  ? -21.108  -54.715 59.188  1.00 106.49 ? 56  PRO K O     1 
ATOM   5034  C  CB    . PRO H  8  56  ? -20.713  -57.297 60.795  1.00 99.02  ? 56  PRO K CB    1 
ATOM   5035  C  CG    . PRO H  8  56  ? -19.371  -57.039 60.175  1.00 99.19  ? 56  PRO K CG    1 
ATOM   5036  C  CD    . PRO H  8  56  ? -19.563  -57.616 58.801  1.00 100.47 ? 56  PRO K CD    1 
ATOM   5037  N  N     . PRO H  8  57  ? -22.992  -55.010 60.439  1.00 110.84 ? 57  PRO K N     1 
ATOM   5038  C  CA    . PRO H  8  57  ? -23.182  -53.569 60.690  1.00 117.45 ? 57  PRO K CA    1 
ATOM   5039  C  C     . PRO H  8  57  ? -21.966  -52.930 61.372  1.00 122.32 ? 57  PRO K C     1 
ATOM   5040  O  O     . PRO H  8  57  ? -21.689  -53.305 62.492  1.00 117.06 ? 57  PRO K O     1 
ATOM   5041  C  CB    . PRO H  8  57  ? -24.465  -53.518 61.562  1.00 112.14 ? 57  PRO K CB    1 
ATOM   5042  C  CG    . PRO H  8  57  ? -24.664  -54.888 62.090  1.00 108.15 ? 57  PRO K CG    1 
ATOM   5043  C  CD    . PRO H  8  57  ? -24.050  -55.819 61.080  1.00 109.94 ? 57  PRO K CD    1 
ATOM   5044  N  N     . THR H  8  58  ? -21.172  -52.084 60.702  1.00 137.99 ? 58  THR K N     1 
ATOM   5045  C  CA    . THR H  8  58  ? -20.295  -51.108 61.389  1.00 138.81 ? 58  THR K CA    1 
ATOM   5046  C  C     . THR H  8  58  ? -21.322  -50.156 62.011  1.00 139.59 ? 58  THR K C     1 
ATOM   5047  O  O     . THR H  8  58  ? -22.298  -49.747 61.335  1.00 137.16 ? 58  THR K O     1 
ATOM   5048  C  CB    . THR H  8  58  ? -19.283  -50.406 60.402  1.00 136.58 ? 58  THR K CB    1 
ATOM   5049  O  OG1   . THR H  8  58  ? -19.955  -49.360 59.672  1.00 139.32 ? 58  THR K OG1   1 
ATOM   5050  C  CG2   . THR H  8  58  ? -18.628  -51.389 59.364  1.00 129.55 ? 58  THR K CG2   1 
ATOM   5051  N  N     . ARG H  8  59  ? -21.157  -49.896 63.310  1.00 141.33 ? 59  ARG K N     1 
ATOM   5052  C  CA    . ARG H  8  59  ? -22.250  -49.346 64.145  1.00 152.51 ? 59  ARG K CA    1 
ATOM   5053  C  C     . ARG H  8  59  ? -23.610  -49.718 63.500  1.00 156.15 ? 59  ARG K C     1 
ATOM   5054  O  O     . ARG H  8  59  ? -24.524  -50.274 64.101  1.00 153.89 ? 59  ARG K O     1 
ATOM   5055  C  CB    . ARG H  8  59  ? -22.095  -47.808 64.344  1.00 146.94 ? 59  ARG K CB    1 
ATOM   5056  C  CG    . ARG H  8  59  ? -23.433  -47.052 64.339  1.00 145.98 ? 59  ARG K CG    1 
ATOM   5057  C  CD    . ARG H  8  59  ? -23.392  -45.547 64.486  1.00 144.58 ? 59  ARG K CD    1 
ATOM   5058  N  NE    . ARG H  8  59  ? -22.409  -44.894 63.631  1.00 146.93 ? 59  ARG K NE    1 
ATOM   5059  C  CZ    . ARG H  8  59  ? -22.341  -43.576 63.431  1.00 149.39 ? 59  ARG K CZ    1 
ATOM   5060  N  NH1   . ARG H  8  59  ? -23.209  -42.734 63.995  1.00 145.82 ? 59  ARG K NH1   1 
ATOM   5061  N  NH2   . ARG H  8  59  ? -21.405  -43.087 62.621  1.00 151.19 ? 59  ARG K NH2   1 
ATOM   5062  N  N     . PRO I  9  2   ? -31.171  -9.017  45.980  1.00 119.44 ? 2   PRO L N     1 
ATOM   5063  C  CA    . PRO I  9  2   ? -32.020  -7.836  46.214  1.00 117.61 ? 2   PRO L CA    1 
ATOM   5064  C  C     . PRO I  9  2   ? -31.385  -6.503  45.799  1.00 106.72 ? 2   PRO L C     1 
ATOM   5065  O  O     . PRO I  9  2   ? -32.098  -5.567  45.452  1.00 106.28 ? 2   PRO L O     1 
ATOM   5066  C  CB    . PRO I  9  2   ? -32.327  -7.888  47.729  1.00 130.25 ? 2   PRO L CB    1 
ATOM   5067  C  CG    . PRO I  9  2   ? -31.765  -9.187  48.229  1.00 135.27 ? 2   PRO L CG    1 
ATOM   5068  C  CD    . PRO I  9  2   ? -30.675  -9.587  47.244  1.00 131.70 ? 2   PRO L CD    1 
ATOM   5069  N  N     . LYS I  9  3   ? -30.066  -6.402  45.847  1.00 98.39  ? 3   LYS L N     1 
ATOM   5070  C  CA    . LYS I  9  3   ? -29.360  -5.228  45.341  1.00 102.16 ? 3   LYS L CA    1 
ATOM   5071  C  C     . LYS I  9  3   ? -29.126  -5.225  43.836  1.00 99.83  ? 3   LYS L C     1 
ATOM   5072  O  O     . LYS I  9  3   ? -28.978  -6.276  43.227  1.00 125.21 ? 3   LYS L O     1 
ATOM   5073  C  CB    . LYS I  9  3   ? -28.065  -5.129  46.113  1.00 110.79 ? 3   LYS L CB    1 
ATOM   5074  C  CG    . LYS I  9  3   ? -27.046  -4.082  45.666  1.00 116.88 ? 3   LYS L CG    1 
ATOM   5075  C  CD    . LYS I  9  3   ? -25.663  -4.593  46.092  1.00 121.84 ? 3   LYS L CD    1 
ATOM   5076  C  CE    . LYS I  9  3   ? -25.668  -5.256  47.466  1.00 124.09 ? 3   LYS L CE    1 
ATOM   5077  N  NZ    . LYS I  9  3   ? -24.353  -5.126  48.121  1.00 129.49 ? 3   LYS L NZ    1 
ATOM   5078  N  N     . PHE I  9  4   ? -29.099  -4.058  43.209  1.00 93.28  ? 4   PHE L N     1 
ATOM   5079  C  CA    . PHE I  9  4   ? -28.838  -3.896  41.765  1.00 90.81  ? 4   PHE L CA    1 
ATOM   5080  C  C     . PHE I  9  4   ? -27.817  -2.794  41.539  1.00 84.38  ? 4   PHE L C     1 
ATOM   5081  O  O     . PHE I  9  4   ? -27.969  -1.740  42.134  1.00 85.47  ? 4   PHE L O     1 
ATOM   5082  C  CB    . PHE I  9  4   ? -30.138  -3.513  41.035  1.00 89.38  ? 4   PHE L CB    1 
ATOM   5083  C  CG    . PHE I  9  4   ? -29.978  -3.280  39.557  1.00 85.95  ? 4   PHE L CG    1 
ATOM   5084  C  CD1   . PHE I  9  4   ? -29.505  -2.083  39.046  1.00 79.17  ? 4   PHE L CD1   1 
ATOM   5085  C  CD2   . PHE I  9  4   ? -30.292  -4.285  38.678  1.00 92.26  ? 4   PHE L CD2   1 
ATOM   5086  C  CE1   . PHE I  9  4   ? -29.328  -1.895  37.694  1.00 78.38  ? 4   PHE L CE1   1 
ATOM   5087  C  CE2   . PHE I  9  4   ? -30.147  -4.096  37.314  1.00 96.72  ? 4   PHE L CE2   1 
ATOM   5088  C  CZ    . PHE I  9  4   ? -29.666  -2.895  36.811  1.00 86.84  ? 4   PHE L CZ    1 
ATOM   5089  N  N     . TYR I  9  5   ? -26.890  -2.986  40.603  1.00 82.28  ? 5   TYR L N     1 
ATOM   5090  C  CA    . TYR I  9  5   ? -25.911  -1.960  40.265  1.00 82.21  ? 5   TYR L CA    1 
ATOM   5091  C  C     . TYR I  9  5   ? -26.063  -1.448  38.839  1.00 86.41  ? 5   TYR L C     1 
ATOM   5092  O  O     . TYR I  9  5   ? -25.901  -2.240  37.902  1.00 93.35  ? 5   TYR L O     1 
ATOM   5093  C  CB    . TYR I  9  5   ? -24.506  -2.491  40.468  1.00 83.66  ? 5   TYR L CB    1 
ATOM   5094  C  CG    . TYR I  9  5   ? -23.411  -1.588  39.930  1.00 87.77  ? 5   TYR L CG    1 
ATOM   5095  C  CD1   . TYR I  9  5   ? -23.028  -0.466  40.639  1.00 92.54  ? 5   TYR L CD1   1 
ATOM   5096  C  CD2   . TYR I  9  5   ? -22.735  -1.883  38.757  1.00 89.19  ? 5   TYR L CD2   1 
ATOM   5097  C  CE1   . TYR I  9  5   ? -22.002  0.340   40.191  1.00 95.37  ? 5   TYR L CE1   1 
ATOM   5098  C  CE2   . TYR I  9  5   ? -21.714  -1.090  38.295  1.00 95.69  ? 5   TYR L CE2   1 
ATOM   5099  C  CZ    . TYR I  9  5   ? -21.356  0.032   39.008  1.00 101.60 ? 5   TYR L CZ    1 
ATOM   5100  O  OH    . TYR I  9  5   ? -20.335  0.850   38.546  1.00 116.36 ? 5   TYR L OH    1 
ATOM   5101  N  N     . CYS I  9  6   ? -26.380  -0.155  38.683  1.00 86.32  ? 6   CYS L N     1 
ATOM   5102  C  CA    . CYS I  9  6   ? -26.450  0.504   37.376  1.00 82.02  ? 6   CYS L CA    1 
ATOM   5103  C  C     . CYS I  9  6   ? -25.059  0.831   36.840  1.00 75.51  ? 6   CYS L C     1 
ATOM   5104  O  O     . CYS I  9  6   ? -24.395  1.725   37.320  1.00 76.07  ? 6   CYS L O     1 
ATOM   5105  C  CB    . CYS I  9  6   ? -27.292  1.781   37.380  1.00 81.35  ? 6   CYS L CB    1 
ATOM   5106  S  SG    . CYS I  9  6   ? -27.186  2.618   35.757  1.00 86.31  ? 6   CYS L SG    1 
ATOM   5107  N  N     . ASP I  9  7   ? -24.615  0.099   35.836  1.00 77.81  ? 7   ASP L N     1 
ATOM   5108  C  CA    . ASP I  9  7   ? -23.307  0.341   35.234  1.00 82.73  ? 7   ASP L CA    1 
ATOM   5109  C  C     . ASP I  9  7   ? -23.251  1.744   34.603  1.00 78.33  ? 7   ASP L C     1 
ATOM   5110  O  O     . ASP I  9  7   ? -22.195  2.360   34.587  1.00 73.80  ? 7   ASP L O     1 
ATOM   5111  C  CB    . ASP I  9  7   ? -22.932  -0.760  34.200  1.00 85.72  ? 7   ASP L CB    1 
ATOM   5112  C  CG    . ASP I  9  7   ? -22.888  -2.185  34.781  1.00 89.44  ? 7   ASP L CG    1 
ATOM   5113  O  OD1   . ASP I  9  7   ? -23.960  -2.715  35.184  1.00 81.31  ? 7   ASP L OD1   1 
ATOM   5114  O  OD2   . ASP I  9  7   ? -21.760  -2.747  34.858  1.00 93.39  ? 7   ASP L OD2   1 
ATOM   5115  N  N     . TYR I  9  8   ? -24.373  2.238   34.092  1.00 73.71  ? 8   TYR L N     1 
ATOM   5116  C  CA    . TYR I  9  8   ? -24.373  3.527   33.454  1.00 77.57  ? 8   TYR L CA    1 
ATOM   5117  C  C     . TYR I  9  8   ? -24.258  4.668   34.454  1.00 80.77  ? 8   TYR L C     1 
ATOM   5118  O  O     . TYR I  9  8   ? -23.441  5.593   34.254  1.00 85.63  ? 8   TYR L O     1 
ATOM   5119  C  CB    . TYR I  9  8   ? -25.635  3.693   32.611  1.00 83.30  ? 8   TYR L CB    1 
ATOM   5120  C  CG    . TYR I  9  8   ? -25.690  2.820   31.375  1.00 82.22  ? 8   TYR L CG    1 
ATOM   5121  C  CD1   . TYR I  9  8   ? -24.632  2.770   30.479  1.00 79.91  ? 8   TYR L CD1   1 
ATOM   5122  C  CD2   . TYR I  9  8   ? -26.821  2.067   31.089  1.00 84.59  ? 8   TYR L CD2   1 
ATOM   5123  C  CE1   . TYR I  9  8   ? -24.678  1.971   29.356  1.00 80.32  ? 8   TYR L CE1   1 
ATOM   5124  C  CE2   . TYR I  9  8   ? -26.884  1.295   29.952  1.00 85.87  ? 8   TYR L CE2   1 
ATOM   5125  C  CZ    . TYR I  9  8   ? -25.801  1.240   29.078  1.00 82.74  ? 8   TYR L CZ    1 
ATOM   5126  O  OH    . TYR I  9  8   ? -25.852  0.459   27.947  1.00 81.03  ? 8   TYR L OH    1 
ATOM   5127  N  N     . CYS I  9  9   ? -25.045  4.599   35.520  1.00 78.63  ? 9   CYS L N     1 
ATOM   5128  C  CA    . CYS I  9  9   ? -25.037  5.626   36.547  1.00 84.00  ? 9   CYS L CA    1 
ATOM   5129  C  C     . CYS I  9  9   ? -23.920  5.511   37.615  1.00 85.17  ? 9   CYS L C     1 
ATOM   5130  O  O     . CYS I  9  9   ? -23.636  6.495   38.307  1.00 102.30 ? 9   CYS L O     1 
ATOM   5131  C  CB    . CYS I  9  9   ? -26.368  5.606   37.261  1.00 85.53  ? 9   CYS L CB    1 
ATOM   5132  S  SG    . CYS I  9  9   ? -27.789  5.836   36.170  1.00 97.63  ? 9   CYS L SG    1 
ATOM   5133  N  N     . ASP I  9  10  ? -23.222  4.384   37.704  1.00 81.00  ? 10  ASP L N     1 
ATOM   5134  C  CA    . ASP I  9  10  ? -22.369  4.052   38.848  1.00 84.68  ? 10  ASP L CA    1 
ATOM   5135  C  C     . ASP I  9  10  ? -23.086  4.310   40.195  1.00 84.55  ? 10  ASP L C     1 
ATOM   5136  O  O     . ASP I  9  10  ? -22.594  5.002   41.081  1.00 89.01  ? 10  ASP L O     1 
ATOM   5137  C  CB    . ASP I  9  10  ? -21.001  4.736   38.755  1.00 88.75  ? 10  ASP L CB    1 
ATOM   5138  C  CG    . ASP I  9  10  ? -19.941  4.133   39.719  1.00 91.00  ? 10  ASP L CG    1 
ATOM   5139  O  OD1   . ASP I  9  10  ? -20.248  3.260   40.522  1.00 91.75  ? 10  ASP L OD1   1 
ATOM   5140  O  OD2   . ASP I  9  10  ? -18.774  4.540   39.787  1.00 93.92  ? 10  ASP L OD2   1 
ATOM   5141  N  N     . THR I  9  11  ? -24.284  3.760   40.315  1.00 85.26  ? 11  THR L N     1 
ATOM   5142  C  CA    . THR I  9  11  ? -25.109  3.863   41.506  1.00 87.22  ? 11  THR L CA    1 
ATOM   5143  C  C     . THR I  9  11  ? -25.811  2.535   41.779  1.00 87.28  ? 11  THR L C     1 
ATOM   5144  O  O     . THR I  9  11  ? -25.954  1.721   40.883  1.00 95.99  ? 11  THR L O     1 
ATOM   5145  C  CB    . THR I  9  11  ? -26.156  4.979   41.329  1.00 90.97  ? 11  THR L CB    1 
ATOM   5146  O  OG1   . THR I  9  11  ? -26.744  5.279   42.601  1.00 97.27  ? 11  THR L OG1   1 
ATOM   5147  C  CG2   . THR I  9  11  ? -27.281  4.605   40.349  1.00 91.35  ? 11  THR L CG2   1 
ATOM   5148  N  N     . TYR I  9  12  ? -26.305  2.349   42.991  1.00 88.66  ? 12  TYR L N     1 
ATOM   5149  C  CA    . TYR I  9  12  ? -26.974  1.124   43.419  1.00 86.98  ? 12  TYR L CA    1 
ATOM   5150  C  C     . TYR I  9  12  ? -28.459  1.329   43.672  1.00 86.51  ? 12  TYR L C     1 
ATOM   5151  O  O     . TYR I  9  12  ? -28.857  2.429   44.066  1.00 102.27 ? 12  TYR L O     1 
ATOM   5152  C  CB    . TYR I  9  12  ? -26.321  0.562   44.691  1.00 88.52  ? 12  TYR L CB    1 
ATOM   5153  C  CG    . TYR I  9  12  ? -24.927  0.016   44.455  1.00 91.46  ? 12  TYR L CG    1 
ATOM   5154  C  CD1   . TYR I  9  12  ? -24.720  -1.290  44.054  1.00 98.93  ? 12  TYR L CD1   1 
ATOM   5155  C  CD2   . TYR I  9  12  ? -23.809  0.814   44.625  1.00 101.37 ? 12  TYR L CD2   1 
ATOM   5156  C  CE1   . TYR I  9  12  ? -23.441  -1.790  43.847  1.00 105.29 ? 12  TYR L CE1   1 
ATOM   5157  C  CE2   . TYR I  9  12  ? -22.528  0.336   44.419  1.00 107.23 ? 12  TYR L CE2   1 
ATOM   5158  C  CZ    . TYR I  9  12  ? -22.349  -0.981  44.046  1.00 109.29 ? 12  TYR L CZ    1 
ATOM   5159  O  OH    . TYR I  9  12  ? -21.102  -1.496  43.812  1.00 107.21 ? 12  TYR L OH    1 
ATOM   5160  N  N     . LEU I  9  13  ? -29.273  0.297   43.462  1.00 83.65  ? 13  LEU L N     1 
ATOM   5161  C  CA    . LEU I  9  13  ? -30.660  0.240   43.965  1.00 90.95  ? 13  LEU L CA    1 
ATOM   5162  C  C     . LEU I  9  13  ? -30.662  -0.764  45.113  1.00 99.95  ? 13  LEU L C     1 
ATOM   5163  O  O     . LEU I  9  13  ? -30.678  -1.963  44.893  1.00 99.02  ? 13  LEU L O     1 
ATOM   5164  C  CB    . LEU I  9  13  ? -31.664  -0.191  42.909  1.00 87.40  ? 13  LEU L CB    1 
ATOM   5165  C  CG    . LEU I  9  13  ? -31.946  0.710   41.718  1.00 85.93  ? 13  LEU L CG    1 
ATOM   5166  C  CD1   . LEU I  9  13  ? -30.682  1.148   41.016  1.00 88.82  ? 13  LEU L CD1   1 
ATOM   5167  C  CD2   . LEU I  9  13  ? -32.853  0.015   40.710  1.00 90.89  ? 13  LEU L CD2   1 
ATOM   5168  N  N     . THR I  9  14  ? -30.559  -0.277  46.343  1.00 116.15 ? 14  THR L N     1 
ATOM   5169  C  CA    . THR I  9  14  ? -30.323  -1.143  47.507  1.00 119.03 ? 14  THR L CA    1 
ATOM   5170  C  C     . THR I  9  14  ? -31.370  -2.235  47.554  1.00 112.22 ? 14  THR L C     1 
ATOM   5171  O  O     . THR I  9  14  ? -31.040  -3.362  47.945  1.00 110.94 ? 14  THR L O     1 
ATOM   5172  C  CB    . THR I  9  14  ? -30.090  -0.317  48.806  1.00 122.87 ? 14  THR L CB    1 
ATOM   5173  O  OG1   . THR I  9  14  ? -31.166  0.617   48.911  1.00 140.65 ? 14  THR L OG1   1 
ATOM   5174  C  CG2   . THR I  9  14  ? -28.717  0.437   48.754  1.00 114.68 ? 14  THR L CG2   1 
ATOM   5175  N  N     . HIS I  9  15  ? -32.591  -1.936  47.110  1.00 107.28 ? 15  HIS L N     1 
ATOM   5176  C  CA    . HIS I  9  15  ? -33.581  -3.005  46.969  1.00 116.55 ? 15  HIS L CA    1 
ATOM   5177  C  C     . HIS I  9  15  ? -34.218  -2.993  45.593  1.00 119.01 ? 15  HIS L C     1 
ATOM   5178  O  O     . HIS I  9  15  ? -35.053  -2.120  45.278  1.00 136.48 ? 15  HIS L O     1 
ATOM   5179  C  CB    . HIS I  9  15  ? -34.636  -2.969  48.067  1.00 120.87 ? 15  HIS L CB    1 
ATOM   5180  C  CG    . HIS I  9  15  ? -34.077  -3.041  49.456  1.00 119.79 ? 15  HIS L CG    1 
ATOM   5181  N  ND1   . HIS I  9  15  ? -33.279  -4.060  49.948  1.00 116.53 ? 15  HIS L ND1   1 
ATOM   5182  C  CD2   . HIS I  9  15  ? -34.233  -2.168  50.470  1.00 118.98 ? 15  HIS L CD2   1 
ATOM   5183  C  CE1   . HIS I  9  15  ? -32.967  -3.791  51.209  1.00 116.22 ? 15  HIS L CE1   1 
ATOM   5184  N  NE2   . HIS I  9  15  ? -33.537  -2.649  51.545  1.00 116.23 ? 15  HIS L NE2   1 
ATOM   5185  N  N     . ASP I  9  16  ? -33.828  -3.994  44.799  1.00 103.02 ? 16  ASP L N     1 
ATOM   5186  C  CA    . ASP I  9  16  ? -34.251  -4.137  43.420  1.00 91.96  ? 16  ASP L CA    1 
ATOM   5187  C  C     . ASP I  9  16  ? -35.653  -4.745  43.391  1.00 89.58  ? 16  ASP L C     1 
ATOM   5188  O  O     . ASP I  9  16  ? -36.041  -5.505  44.258  1.00 85.68  ? 16  ASP L O     1 
ATOM   5189  C  CB    . ASP I  9  16  ? -33.245  -4.992  42.667  1.00 91.70  ? 16  ASP L CB    1 
ATOM   5190  C  CG    . ASP I  9  16  ? -33.550  -5.139  41.175  1.00 101.36 ? 16  ASP L CG    1 
ATOM   5191  O  OD1   . ASP I  9  16  ? -34.596  -4.684  40.668  1.00 107.13 ? 16  ASP L OD1   1 
ATOM   5192  O  OD2   . ASP I  9  16  ? -32.734  -5.764  40.457  1.00 104.52 ? 16  ASP L OD2   1 
ATOM   5193  N  N     . SER I  9  17  ? -36.410  -4.339  42.380  1.00 90.20  ? 17  SER L N     1 
ATOM   5194  C  CA    . SER I  9  17  ? -37.679  -4.924  42.012  1.00 87.69  ? 17  SER L CA    1 
ATOM   5195  C  C     . SER I  9  17  ? -37.858  -4.674  40.531  1.00 88.89  ? 17  SER L C     1 
ATOM   5196  O  O     . SER I  9  17  ? -37.161  -3.879  39.965  1.00 85.76  ? 17  SER L O     1 
ATOM   5197  C  CB    . SER I  9  17  ? -38.755  -4.215  42.806  1.00 89.28  ? 17  SER L CB    1 
ATOM   5198  O  OG    . SER I  9  17  ? -40.089  -4.496  42.433  1.00 88.95  ? 17  SER L OG    1 
ATOM   5199  N  N     . PRO I  9  18  ? -38.823  -5.325  39.897  1.00 100.05 ? 18  PRO L N     1 
ATOM   5200  C  CA    . PRO I  9  18  ? -39.148  -4.899  38.543  1.00 100.96 ? 18  PRO L CA    1 
ATOM   5201  C  C     . PRO I  9  18  ? -39.559  -3.431  38.469  1.00 100.40 ? 18  PRO L C     1 
ATOM   5202  O  O     . PRO I  9  18  ? -39.032  -2.690  37.651  1.00 96.67  ? 18  PRO L O     1 
ATOM   5203  C  CB    . PRO I  9  18  ? -40.317  -5.822  38.159  1.00 104.62 ? 18  PRO L CB    1 
ATOM   5204  C  CG    . PRO I  9  18  ? -40.863  -6.386  39.450  1.00 106.15 ? 18  PRO L CG    1 
ATOM   5205  C  CD    . PRO I  9  18  ? -39.661  -6.459  40.342  1.00 107.46 ? 18  PRO L CD    1 
ATOM   5206  N  N     . SER I  9  19  ? -40.491  -3.042  39.339  1.00 103.61 ? 19  SER L N     1 
ATOM   5207  C  CA    . SER I  9  19  ? -41.020  -1.673  39.416  1.00 100.39 ? 19  SER L CA    1 
ATOM   5208  C  C     . SER I  9  19  ? -39.939  -0.628  39.627  1.00 91.52  ? 19  SER L C     1 
ATOM   5209  O  O     . SER I  9  19  ? -39.911  0.366   38.934  1.00 91.51  ? 19  SER L O     1 
ATOM   5210  C  CB    . SER I  9  19  ? -42.101  -1.542  40.497  1.00 104.14 ? 19  SER L CB    1 
ATOM   5211  O  OG    . SER I  9  19  ? -41.576  -1.826  41.778  1.00 109.90 ? 19  SER L OG    1 
ATOM   5212  N  N     . VAL I  9  20  ? -39.038  -0.897  40.555  1.00 85.86  ? 20  VAL L N     1 
ATOM   5213  C  CA    . VAL I  9  20  ? -38.019  0.061   40.929  1.00 85.53  ? 20  VAL L CA    1 
ATOM   5214  C  C     . VAL I  9  20  ? -37.022  0.240   39.814  1.00 81.91  ? 20  VAL L C     1 
ATOM   5215  O  O     . VAL I  9  20  ? -36.563  1.361   39.564  1.00 89.91  ? 20  VAL L O     1 
ATOM   5216  C  CB    . VAL I  9  20  ? -37.229  -0.402  42.172  1.00 89.95  ? 20  VAL L CB    1 
ATOM   5217  C  CG1   . VAL I  9  20  ? -36.024  0.493   42.461  1.00 88.74  ? 20  VAL L CG1   1 
ATOM   5218  C  CG2   . VAL I  9  20  ? -38.140  -0.496  43.399  1.00 91.77  ? 20  VAL L CG2   1 
ATOM   5219  N  N     . ARG I  9  21  ? -36.640  -0.858  39.182  1.00 80.78  ? 21  ARG L N     1 
ATOM   5220  C  CA    . ARG I  9  21  ? -35.627  -0.791  38.137  1.00 87.44  ? 21  ARG L CA    1 
ATOM   5221  C  C     . ARG I  9  21  ? -36.161  -0.068  36.904  1.00 85.72  ? 21  ARG L C     1 
ATOM   5222  O  O     . ARG I  9  21  ? -35.444  0.714   36.286  1.00 81.78  ? 21  ARG L O     1 
ATOM   5223  C  CB    . ARG I  9  21  ? -35.091  -2.174  37.784  1.00 94.67  ? 21  ARG L CB    1 
ATOM   5224  C  CG    . ARG I  9  21  ? -33.680  -2.183  37.197  1.00 102.29 ? 21  ARG L CG    1 
ATOM   5225  C  CD    . ARG I  9  21  ? -33.349  -3.273  36.151  1.00 108.13 ? 21  ARG L CD    1 
ATOM   5226  N  NE    . ARG I  9  21  ? -34.076  -4.559  36.165  1.00 110.12 ? 21  ARG L NE    1 
ATOM   5227  C  CZ    . ARG I  9  21  ? -33.930  -5.532  37.070  1.00 110.64 ? 21  ARG L CZ    1 
ATOM   5228  N  NH1   . ARG I  9  21  ? -33.113  -5.447  38.095  1.00 103.28 ? 21  ARG L NH1   1 
ATOM   5229  N  NH2   . ARG I  9  21  ? -34.649  -6.637  36.955  1.00 126.80 ? 21  ARG L NH2   1 
ATOM   5230  N  N     . LYS I  9  22  ? -37.420  -0.318  36.564  1.00 89.55  ? 22  LYS L N     1 
ATOM   5231  C  CA    . LYS I  9  22  ? -38.079  0.417   35.490  1.00 91.06  ? 22  LYS L CA    1 
ATOM   5232  C  C     . LYS I  9  22  ? -38.169  1.899   35.780  1.00 85.03  ? 22  LYS L C     1 
ATOM   5233  O  O     . LYS I  9  22  ? -37.868  2.713   34.892  1.00 102.85 ? 22  LYS L O     1 
ATOM   5234  C  CB    . LYS I  9  22  ? -39.451  -0.174  35.139  1.00 98.77  ? 22  LYS L CB    1 
ATOM   5235  C  CG    . LYS I  9  22  ? -39.332  -1.465  34.318  1.00 114.55 ? 22  LYS L CG    1 
ATOM   5236  C  CD    . LYS I  9  22  ? -40.447  -1.664  33.275  1.00 126.15 ? 22  LYS L CD    1 
ATOM   5237  C  CE    . LYS I  9  22  ? -41.814  -1.995  33.886  1.00 125.42 ? 22  LYS L CE    1 
ATOM   5238  N  NZ    . LYS I  9  22  ? -41.846  -3.254  34.696  1.00 118.20 ? 22  LYS L NZ    1 
ATOM   5239  N  N     . THR I  9  23  ? -38.593  2.254   36.983  1.00 80.74  ? 23  THR L N     1 
ATOM   5240  C  CA    . THR I  9  23  ? -38.623  3.651   37.396  1.00 81.69  ? 23  THR L CA    1 
ATOM   5241  C  C     . THR I  9  23  ? -37.232  4.269   37.195  1.00 87.40  ? 23  THR L C     1 
ATOM   5242  O  O     . THR I  9  23  ? -37.112  5.289   36.501  1.00 98.58  ? 23  THR L O     1 
ATOM   5243  C  CB    . THR I  9  23  ? -38.986  3.847   38.879  1.00 81.63  ? 23  THR L CB    1 
ATOM   5244  O  OG1   . THR I  9  23  ? -40.259  3.280   39.201  1.00 84.94  ? 23  THR L OG1   1 
ATOM   5245  C  CG2   . THR I  9  23  ? -39.056  5.319   39.192  1.00 82.68  ? 23  THR L CG2   1 
ATOM   5246  N  N     . HIS I  9  24  ? -36.194  3.680   37.795  1.00 84.24  ? 24  HIS L N     1 
ATOM   5247  C  CA    . HIS I  9  24  ? -34.828  4.186   37.622  1.00 79.43  ? 24  HIS L CA    1 
ATOM   5248  C  C     . HIS I  9  24  ? -34.466  4.356   36.148  1.00 85.72  ? 24  HIS L C     1 
ATOM   5249  O  O     . HIS I  9  24  ? -33.863  5.343   35.736  1.00 94.91  ? 24  HIS L O     1 
ATOM   5250  C  CB    . HIS I  9  24  ? -33.779  3.285   38.279  1.00 71.82  ? 24  HIS L CB    1 
ATOM   5251  C  CG    . HIS I  9  24  ? -32.366  3.641   37.904  1.00 64.94  ? 24  HIS L CG    1 
ATOM   5252  N  ND1   . HIS I  9  24  ? -31.425  4.022   38.828  1.00 63.25  ? 24  HIS L ND1   1 
ATOM   5253  C  CD2   . HIS I  9  24  ? -31.715  3.637   36.715  1.00 62.68  ? 24  HIS L CD2   1 
ATOM   5254  C  CE1   . HIS I  9  24  ? -30.257  4.218   38.239  1.00 58.82  ? 24  HIS L CE1   1 
ATOM   5255  N  NE2   . HIS I  9  24  ? -30.425  4.034   36.949  1.00 58.86  ? 24  HIS L NE2   1 
ATOM   5256  N  N     . CYS I  9  25  ? -34.760  3.339   35.355  1.00 92.45  ? 25  CYS L N     1 
ATOM   5257  C  CA    . CYS I  9  25  ? -34.274  3.305   33.980  1.00 100.35 ? 25  CYS L CA    1 
ATOM   5258  C  C     . CYS I  9  25  ? -34.991  4.287   33.067  1.00 97.75  ? 25  CYS L C     1 
ATOM   5259  O  O     . CYS I  9  25  ? -34.414  4.743   32.096  1.00 95.68  ? 25  CYS L O     1 
ATOM   5260  C  CB    . CYS I  9  25  ? -34.284  1.874   33.409  1.00 115.54 ? 25  CYS L CB    1 
ATOM   5261  S  SG    . CYS I  9  25  ? -32.773  0.937   33.898  1.00 106.72 ? 25  CYS L SG    1 
ATOM   5262  N  N     . SER I  9  26  ? -36.236  4.627   33.372  1.00 101.95 ? 26  SER L N     1 
ATOM   5263  C  CA    . SER I  9  26  ? -36.914  5.750   32.700  1.00 105.68 ? 26  SER L CA    1 
ATOM   5264  C  C     . SER I  9  26  ? -36.763  7.025   33.505  1.00 103.66 ? 26  SER L C     1 
ATOM   5265  O  O     . SER I  9  26  ? -37.732  7.700   33.821  1.00 118.83 ? 26  SER L O     1 
ATOM   5266  C  CB    . SER I  9  26  ? -38.367  5.421   32.402  1.00 110.42 ? 26  SER L CB    1 
ATOM   5267  O  OG    . SER I  9  26  ? -39.002  4.964   33.583  1.00 123.40 ? 26  SER L OG    1 
ATOM   5268  N  N     . GLY I  9  27  ? -35.532  7.351   33.858  1.00 102.01 ? 27  GLY L N     1 
ATOM   5269  C  CA    . GLY I  9  27  ? -35.198  8.451   34.758  1.00 106.03 ? 27  GLY L CA    1 
ATOM   5270  C  C     . GLY I  9  27  ? -34.394  9.447   33.952  1.00 116.17 ? 27  GLY L C     1 
ATOM   5271  O  O     . GLY I  9  27  ? -33.719  9.094   32.966  1.00 127.13 ? 27  GLY L O     1 
ATOM   5272  N  N     . ARG I  9  28  ? -34.423  10.694  34.406  1.00 118.02 ? 28  ARG L N     1 
ATOM   5273  C  CA    . ARG I  9  28  ? -33.759  11.770  33.691  1.00 113.17 ? 28  ARG L CA    1 
ATOM   5274  C  C     . ARG I  9  28  ? -32.261  11.517  33.690  1.00 99.92  ? 28  ARG L C     1 
ATOM   5275  O  O     . ARG I  9  28  ? -31.648  11.362  32.642  1.00 90.40  ? 28  ARG L O     1 
ATOM   5276  C  CB    . ARG I  9  28  ? -34.090  13.105  34.347  1.00 126.20 ? 28  ARG L CB    1 
ATOM   5277  C  CG    . ARG I  9  28  ? -33.708  14.350  33.572  1.00 132.37 ? 28  ARG L CG    1 
ATOM   5278  C  CD    . ARG I  9  28  ? -33.951  15.606  34.405  1.00 132.34 ? 28  ARG L CD    1 
ATOM   5279  N  NE    . ARG I  9  28  ? -33.203  15.602  35.677  1.00 133.99 ? 28  ARG L NE    1 
ATOM   5280  C  CZ    . ARG I  9  28  ? -31.871  15.706  35.826  1.00 132.88 ? 28  ARG L CZ    1 
ATOM   5281  N  NH1   . ARG I  9  28  ? -31.060  15.864  34.783  1.00 131.06 ? 28  ARG L NH1   1 
ATOM   5282  N  NH2   . ARG I  9  28  ? -31.319  15.677  37.047  1.00 131.15 ? 28  ARG L NH2   1 
ATOM   5283  N  N     . LYS I  9  29  ? -31.698  11.409  34.879  1.00 99.84  ? 29  LYS L N     1 
ATOM   5284  C  CA    . LYS I  9  29  ? -30.262  11.194  35.020  1.00 108.93 ? 29  LYS L CA    1 
ATOM   5285  C  C     . LYS I  9  29  ? -29.762  10.028  34.152  1.00 110.47 ? 29  LYS L C     1 
ATOM   5286  O  O     . LYS I  9  29  ? -28.718  10.115  33.511  1.00 106.79 ? 29  LYS L O     1 
ATOM   5287  C  CB    . LYS I  9  29  ? -29.916  10.888  36.478  1.00 123.35 ? 29  LYS L CB    1 
ATOM   5288  C  CG    . LYS I  9  29  ? -28.864  11.800  37.097  1.00 130.70 ? 29  LYS L CG    1 
ATOM   5289  C  CD    . LYS I  9  29  ? -28.617  11.464  38.595  1.00 140.76 ? 29  LYS L CD    1 
ATOM   5290  C  CE    . LYS I  9  29  ? -28.740  12.587  39.659  1.00 148.71 ? 29  LYS L CE    1 
ATOM   5291  N  NZ    . LYS I  9  29  ? -27.534  13.426  39.930  1.00 156.07 ? 29  LYS L NZ    1 
ATOM   5292  N  N     . HIS I  9  30  ? -30.505  8.914   34.184  1.00 107.74 ? 30  HIS L N     1 
ATOM   5293  C  CA    . HIS I  9  30  ? -30.115  7.635   33.574  1.00 97.84  ? 30  HIS L CA    1 
ATOM   5294  C  C     . HIS I  9  30  ? -29.979  7.849   32.081  1.00 89.39  ? 30  HIS L C     1 
ATOM   5295  O  O     . HIS I  9  30  ? -28.893  7.685   31.518  1.00 88.34  ? 30  HIS L O     1 
ATOM   5296  C  CB    . HIS I  9  30  ? -31.133  6.505   33.891  1.00 101.48 ? 30  HIS L CB    1 
ATOM   5297  C  CG    . HIS I  9  30  ? -30.740  5.129   33.402  1.00 99.24  ? 30  HIS L CG    1 
ATOM   5298  N  ND1   . HIS I  9  30  ? -29.569  4.505   33.774  1.00 92.50  ? 30  HIS L ND1   1 
ATOM   5299  C  CD2   . HIS I  9  30  ? -31.368  4.256   32.577  1.00 91.47  ? 30  HIS L CD2   1 
ATOM   5300  C  CE1   . HIS I  9  30  ? -29.467  3.338   33.170  1.00 84.88  ? 30  HIS L CE1   1 
ATOM   5301  N  NE2   . HIS I  9  30  ? -30.564  3.149   32.464  1.00 89.92  ? 30  HIS L NE2   1 
ATOM   5302  N  N     . LYS I  9  31  ? -31.070  8.269   31.462  1.00 86.44  ? 31  LYS L N     1 
ATOM   5303  C  CA    . LYS I  9  31  ? -31.121  8.362   30.001  1.00 96.38  ? 31  LYS L CA    1 
ATOM   5304  C  C     . LYS I  9  31  ? -29.984  9.204   29.428  1.00 103.41 ? 31  LYS L C     1 
ATOM   5305  O  O     . LYS I  9  31  ? -29.395  8.846   28.401  1.00 104.59 ? 31  LYS L O     1 
ATOM   5306  C  CB    . LYS I  9  31  ? -32.486  8.869   29.567  1.00 97.14  ? 31  LYS L CB    1 
ATOM   5307  C  CG    . LYS I  9  31  ? -33.547  7.815   29.861  1.00 104.36 ? 31  LYS L CG    1 
ATOM   5308  C  CD    . LYS I  9  31  ? -35.011  8.116   29.599  1.00 112.83 ? 31  LYS L CD    1 
ATOM   5309  C  CE    . LYS I  9  31  ? -35.159  8.046   28.088  1.00 127.08 ? 31  LYS L CE    1 
ATOM   5310  N  NZ    . LYS I  9  31  ? -36.155  9.005   27.555  1.00 132.64 ? 31  LYS L NZ    1 
ATOM   5311  N  N     . GLU I  9  32  ? -29.642  10.274  30.150  1.00 115.36 ? 32  GLU L N     1 
ATOM   5312  C  CA    . GLU I  9  32  ? -28.503  11.112  29.798  1.00 116.35 ? 32  GLU L CA    1 
ATOM   5313  C  C     . GLU I  9  32  ? -27.194  10.335  29.901  1.00 113.67 ? 32  GLU L C     1 
ATOM   5314  O  O     . GLU I  9  32  ? -26.339  10.434  28.998  1.00 130.39 ? 32  GLU L O     1 
ATOM   5315  C  CB    . GLU I  9  32  ? -28.404  12.427  30.584  1.00 114.61 ? 32  GLU L CB    1 
ATOM   5316  C  CG    . GLU I  9  32  ? -27.567  13.471  29.824  1.00 129.52 ? 32  GLU L CG    1 
ATOM   5317  C  CD    . GLU I  9  32  ? -27.164  14.700  30.643  1.00 135.85 ? 32  GLU L CD    1 
ATOM   5318  O  OE1   . GLU I  9  32  ? -27.726  14.865  31.749  1.00 135.17 ? 32  GLU L OE1   1 
ATOM   5319  O  OE2   . GLU I  9  32  ? -26.271  15.480  30.206  1.00 126.51 ? 32  GLU L OE2   1 
ATOM   5320  N  N     . ASN I  9  33  ? -27.014  9.608   30.998  1.00 103.67 ? 33  ASN L N     1 
ATOM   5321  C  CA    . ASN I  9  33  ? -25.794  8.821   31.168  1.00 101.17 ? 33  ASN L CA    1 
ATOM   5322  C  C     . ASN I  9  33  ? -25.598  7.799   30.055  1.00 95.96  ? 33  ASN L C     1 
ATOM   5323  O  O     . ASN I  9  33  ? -24.462  7.549   29.620  1.00 92.30  ? 33  ASN L O     1 
ATOM   5324  C  CB    . ASN I  9  33  ? -25.804  8.094   32.495  1.00 103.04 ? 33  ASN L CB    1 
ATOM   5325  C  CG    . ASN I  9  33  ? -25.628  9.028   33.637  1.00 103.46 ? 33  ASN L CG    1 
ATOM   5326  O  OD1   . ASN I  9  33  ? -26.478  9.082   34.545  1.00 104.95 ? 33  ASN L OD1   1 
ATOM   5327  N  ND2   . ASN I  9  33  ? -24.475  9.712   33.644  1.00 102.92 ? 33  ASN L ND2   1 
ATOM   5328  N  N     . VAL I  9  34  ? -26.717  7.250   29.592  1.00 85.99  ? 34  VAL L N     1 
ATOM   5329  C  CA    . VAL I  9  34  ? -26.688  6.283   28.515  1.00 87.44  ? 34  VAL L CA    1 
ATOM   5330  C  C     . VAL I  9  34  ? -26.228  6.974   27.227  1.00 94.82  ? 34  VAL L C     1 
ATOM   5331  O  O     . VAL I  9  34  ? -25.197  6.594   26.662  1.00 92.91  ? 34  VAL L O     1 
ATOM   5332  C  CB    . VAL I  9  34  ? -28.058  5.622   28.311  1.00 81.23  ? 34  VAL L CB    1 
ATOM   5333  C  CG1   . VAL I  9  34  ? -28.045  4.732   27.075  1.00 79.57  ? 34  VAL L CG1   1 
ATOM   5334  C  CG2   . VAL I  9  34  ? -28.445  4.807   29.530  1.00 81.11  ? 34  VAL L CG2   1 
ATOM   5335  N  N     . LYS I  9  35  ? -26.998  7.973   26.784  1.00 103.32 ? 35  LYS L N     1 
ATOM   5336  C  CA    . LYS I  9  35  ? -26.643  8.818   25.640  1.00 103.60 ? 35  LYS L CA    1 
ATOM   5337  C  C     . LYS I  9  35  ? -25.141  9.116   25.659  1.00 107.02 ? 35  LYS L C     1 
ATOM   5338  O  O     . LYS I  9  35  ? -24.469  8.917   24.646  1.00 104.91 ? 35  LYS L O     1 
ATOM   5339  C  CB    . LYS I  9  35  ? -27.477  10.106  25.670  1.00 114.08 ? 35  LYS L CB    1 
ATOM   5340  C  CG    . LYS I  9  35  ? -27.218  11.163  24.577  1.00 125.86 ? 35  LYS L CG    1 
ATOM   5341  C  CD    . LYS I  9  35  ? -28.256  12.312  24.547  1.00 130.47 ? 35  LYS L CD    1 
ATOM   5342  C  CE    . LYS I  9  35  ? -28.571  13.015  25.853  1.00 142.50 ? 35  LYS L CE    1 
ATOM   5343  N  NZ    . LYS I  9  35  ? -27.631  14.058  26.357  1.00 140.22 ? 35  LYS L NZ    1 
ATOM   5344  N  N     . ASP I  9  36  ? -24.633  9.568   26.813  1.00 113.68 ? 36  ASP L N     1 
ATOM   5345  C  CA    . ASP I  9  36  ? -23.207  9.918   27.009  1.00 118.94 ? 36  ASP L CA    1 
ATOM   5346  C  C     . ASP I  9  36  ? -22.283  8.752   26.759  1.00 111.58 ? 36  ASP L C     1 
ATOM   5347  O  O     . ASP I  9  36  ? -21.291  8.905   26.046  1.00 113.35 ? 36  ASP L O     1 
ATOM   5348  C  CB    . ASP I  9  36  ? -22.909  10.457  28.419  1.00 127.71 ? 36  ASP L CB    1 
ATOM   5349  C  CG    . ASP I  9  36  ? -23.391  11.893  28.635  1.00 137.28 ? 36  ASP L CG    1 
ATOM   5350  O  OD1   . ASP I  9  36  ? -24.260  12.373  27.855  1.00 141.36 ? 36  ASP L OD1   1 
ATOM   5351  O  OD2   . ASP I  9  36  ? -22.907  12.535  29.599  1.00 134.83 ? 36  ASP L OD2   1 
ATOM   5352  N  N     . TYR I  9  37  ? -22.640  7.604   27.323  1.00 110.07 ? 37  TYR L N     1 
ATOM   5353  C  CA    . TYR I  9  37  ? -21.809  6.399   27.200  1.00 108.33 ? 37  TYR L CA    1 
ATOM   5354  C  C     . TYR I  9  37  ? -21.502  6.010   25.738  1.00 104.27 ? 37  TYR L C     1 
ATOM   5355  O  O     . TYR I  9  37  ? -20.355  5.652   25.424  1.00 96.10  ? 37  TYR L O     1 
ATOM   5356  C  CB    . TYR I  9  37  ? -22.412  5.204   27.978  1.00 99.16  ? 37  TYR L CB    1 
ATOM   5357  C  CG    . TYR I  9  37  ? -21.470  4.042   28.026  1.00 97.31  ? 37  TYR L CG    1 
ATOM   5358  C  CD1   . TYR I  9  37  ? -20.367  4.062   28.873  1.00 101.76 ? 37  TYR L CD1   1 
ATOM   5359  C  CD2   . TYR I  9  37  ? -21.610  2.956   27.155  1.00 105.61 ? 37  TYR L CD2   1 
ATOM   5360  C  CE1   . TYR I  9  37  ? -19.438  3.026   28.880  1.00 105.72 ? 37  TYR L CE1   1 
ATOM   5361  C  CE2   . TYR I  9  37  ? -20.699  1.897   27.157  1.00 106.04 ? 37  TYR L CE2   1 
ATOM   5362  C  CZ    . TYR I  9  37  ? -19.610  1.949   28.017  1.00 107.90 ? 37  TYR L CZ    1 
ATOM   5363  O  OH    . TYR I  9  37  ? -18.684  0.942   28.006  1.00 108.50 ? 37  TYR L OH    1 
ATOM   5364  N  N     . TYR I  9  38  ? -22.519  6.091   24.873  1.00 98.76  ? 38  TYR L N     1 
ATOM   5365  C  CA    . TYR I  9  38  ? -22.400  5.678   23.463  1.00 97.29  ? 38  TYR L CA    1 
ATOM   5366  C  C     . TYR I  9  38  ? -21.921  6.792   22.536  1.00 106.03 ? 38  TYR L C     1 
ATOM   5367  O  O     . TYR I  9  38  ? -21.317  6.511   21.498  1.00 107.06 ? 38  TYR L O     1 
ATOM   5368  C  CB    . TYR I  9  38  ? -23.700  5.049   22.964  1.00 93.41  ? 38  TYR L CB    1 
ATOM   5369  C  CG    . TYR I  9  38  ? -23.977  3.754   23.686  1.00 97.30  ? 38  TYR L CG    1 
ATOM   5370  C  CD1   . TYR I  9  38  ? -23.153  2.631   23.524  1.00 92.80  ? 38  TYR L CD1   1 
ATOM   5371  C  CD2   . TYR I  9  38  ? -25.026  3.663   24.595  1.00 102.87 ? 38  TYR L CD2   1 
ATOM   5372  C  CE1   . TYR I  9  38  ? -23.370  1.466   24.231  1.00 92.80  ? 38  TYR L CE1   1 
ATOM   5373  C  CE2   . TYR I  9  38  ? -25.266  2.479   25.303  1.00 98.98  ? 38  TYR L CE2   1 
ATOM   5374  C  CZ    . TYR I  9  38  ? -24.436  1.396   25.126  1.00 95.25  ? 38  TYR L CZ    1 
ATOM   5375  O  OH    . TYR I  9  38  ? -24.703  0.239   25.809  1.00 96.58  ? 38  TYR L OH    1 
ATOM   5376  N  N     . GLN I  9  39  ? -22.159  8.042   22.942  1.00 108.71 ? 39  GLN L N     1 
ATOM   5377  C  CA    . GLN I  9  39  ? -21.439  9.156   22.331  1.00 108.58 ? 39  GLN L CA    1 
ATOM   5378  C  C     . GLN I  9  39  ? -19.918  8.977   22.611  1.00 97.82  ? 39  GLN L C     1 
ATOM   5379  O  O     . GLN I  9  39  ? -19.132  8.978   21.674  1.00 92.20  ? 39  GLN L O     1 
ATOM   5380  C  CB    . GLN I  9  39  ? -21.987  10.542  22.754  1.00 118.51 ? 39  GLN L CB    1 
ATOM   5381  C  CG    . GLN I  9  39  ? -20.921  11.668  22.684  1.00 127.46 ? 39  GLN L CG    1 
ATOM   5382  C  CD    . GLN I  9  39  ? -20.531  12.104  21.254  1.00 122.29 ? 39  GLN L CD    1 
ATOM   5383  O  OE1   . GLN I  9  39  ? -21.223  11.819  20.270  1.00 122.02 ? 39  GLN L OE1   1 
ATOM   5384  N  NE2   . GLN I  9  39  ? -19.390  12.774  21.136  1.00 104.76 ? 39  GLN L NE2   1 
ATOM   5385  N  N     . LYS I  9  40  ? -19.522  8.814   23.875  1.00 92.71  ? 40  LYS L N     1 
ATOM   5386  C  CA    . LYS I  9  40  ? -18.141  8.516   24.228  1.00 105.08 ? 40  LYS L CA    1 
ATOM   5387  C  C     . LYS I  9  40  ? -17.536  7.371   23.410  1.00 112.61 ? 40  LYS L C     1 
ATOM   5388  O  O     . LYS I  9  40  ? -16.338  7.355   23.128  1.00 113.07 ? 40  LYS L O     1 
ATOM   5389  C  CB    . LYS I  9  40  ? -17.976  8.180   25.720  1.00 117.71 ? 40  LYS L CB    1 
ATOM   5390  C  CG    . LYS I  9  40  ? -17.979  9.337   26.685  1.00 134.16 ? 40  LYS L CG    1 
ATOM   5391  C  CD    . LYS I  9  40  ? -17.051  10.486  26.315  1.00 145.06 ? 40  LYS L CD    1 
ATOM   5392  C  CE    . LYS I  9  40  ? -16.212  11.242  27.303  1.00 146.17 ? 40  LYS L CE    1 
ATOM   5393  N  NZ    . LYS I  9  40  ? -17.059  11.966  28.258  1.00 147.32 ? 40  LYS L NZ    1 
ATOM   5394  N  N     . TRP I  9  41  ? -18.372  6.402   23.061  1.00 116.06 ? 41  TRP L N     1 
ATOM   5395  C  CA    . TRP I  9  41  ? -17.951  5.298   22.221  1.00 108.14 ? 41  TRP L CA    1 
ATOM   5396  C  C     . TRP I  9  41  ? -17.709  5.738   20.777  1.00 108.13 ? 41  TRP L C     1 
ATOM   5397  O  O     . TRP I  9  41  ? -16.840  5.220   20.130  1.00 110.75 ? 41  TRP L O     1 
ATOM   5398  C  CB    . TRP I  9  41  ? -18.985  4.164   22.295  1.00 103.24 ? 41  TRP L CB    1 
ATOM   5399  C  CG    . TRP I  9  41  ? -18.377  2.951   21.696  1.00 100.60 ? 41  TRP L CG    1 
ATOM   5400  C  CD1   . TRP I  9  41  ? -17.372  2.176   22.214  1.00 96.22  ? 41  TRP L CD1   1 
ATOM   5401  C  CD2   . TRP I  9  41  ? -18.664  2.442   20.405  1.00 98.16  ? 41  TRP L CD2   1 
ATOM   5402  N  NE1   . TRP I  9  41  ? -17.034  1.205   21.319  1.00 94.43  ? 41  TRP L NE1   1 
ATOM   5403  C  CE2   . TRP I  9  41  ? -17.826  1.344   20.208  1.00 95.94  ? 41  TRP L CE2   1 
ATOM   5404  C  CE3   . TRP I  9  41  ? -19.555  2.816   19.391  1.00 98.79  ? 41  TRP L CE3   1 
ATOM   5405  C  CZ2   . TRP I  9  41  ? -17.840  0.628   19.025  1.00 100.14 ? 41  TRP L CZ2   1 
ATOM   5406  C  CZ3   . TRP I  9  41  ? -19.546  2.131   18.215  1.00 100.34 ? 41  TRP L CZ3   1 
ATOM   5407  C  CH2   . TRP I  9  41  ? -18.677  1.053   18.027  1.00 100.06 ? 41  TRP L CH2   1 
ATOM   5408  N  N     . MET I  9  42  ? -18.518  6.623   20.238  1.00 109.98 ? 42  MET L N     1 
ATOM   5409  C  CA    . MET I  9  42  ? -18.255  7.161   18.920  1.00 115.34 ? 42  MET L CA    1 
ATOM   5410  C  C     . MET I  9  42  ? -16.948  7.926   18.863  1.00 122.66 ? 42  MET L C     1 
ATOM   5411  O  O     . MET I  9  42  ? -16.295  7.933   17.829  1.00 131.97 ? 42  MET L O     1 
ATOM   5412  C  CB    . MET I  9  42  ? -19.368  8.117   18.534  1.00 125.39 ? 42  MET L CB    1 
ATOM   5413  C  CG    . MET I  9  42  ? -20.783  7.547   18.601  1.00 125.44 ? 42  MET L CG    1 
ATOM   5414  S  SD    . MET I  9  42  ? -21.610  7.125   17.046  1.00 136.40 ? 42  MET L SD    1 
ATOM   5415  C  CE    . MET I  9  42  ? -20.246  6.592   16.041  1.00 138.12 ? 42  MET L CE    1 
ATOM   5416  N  N     . GLU I  9  43  ? -16.580  8.586   19.951  1.00 122.53 ? 43  GLU L N     1 
ATOM   5417  C  CA    . GLU I  9  43  ? -15.268  9.187   20.107  1.00 119.26 ? 43  GLU L CA    1 
ATOM   5418  C  C     . GLU I  9  43  ? -14.176  8.143   19.889  1.00 118.69 ? 43  GLU L C     1 
ATOM   5419  O  O     . GLU I  9  43  ? -13.083  8.427   19.421  1.00 130.79 ? 43  GLU L O     1 
ATOM   5420  C  CB    . GLU I  9  43  ? -15.181  9.921   21.456  1.00 127.64 ? 43  GLU L CB    1 
ATOM   5421  C  CG    . GLU I  9  43  ? -16.229  11.058  21.628  1.00 136.46 ? 43  GLU L CG    1 
ATOM   5422  C  CD    . GLU I  9  43  ? -15.800  12.184  22.576  1.00 147.75 ? 43  GLU L CD    1 
ATOM   5423  O  OE1   . GLU I  9  43  ? -14.966  11.956  23.478  1.00 151.52 ? 43  GLU L OE1   1 
ATOM   5424  O  OE2   . GLU I  9  43  ? -16.338  13.304  22.473  1.00 143.35 ? 43  GLU L OE2   1 
ATOM   5425  N  N     . GLU I  9  44  ? -14.483  6.909   20.236  1.00 121.71 ? 44  GLU L N     1 
ATOM   5426  C  CA    . GLU I  9  44  ? -13.604  5.819   19.865  1.00 137.79 ? 44  GLU L CA    1 
ATOM   5427  C  C     . GLU I  9  44  ? -13.152  5.847   18.395  1.00 136.88 ? 44  GLU L C     1 
ATOM   5428  O  O     . GLU I  9  44  ? -12.021  5.531   18.059  1.00 132.81 ? 44  GLU L O     1 
ATOM   5429  C  CB    . GLU I  9  44  ? -14.213  4.465   20.322  1.00 155.78 ? 44  GLU L CB    1 
ATOM   5430  C  CG    . GLU I  9  44  ? -13.783  3.249   19.501  1.00 150.03 ? 44  GLU L CG    1 
ATOM   5431  C  CD    . GLU I  9  44  ? -14.554  3.052   18.192  1.00 141.33 ? 44  GLU L CD    1 
ATOM   5432  O  OE1   . GLU I  9  44  ? -15.147  4.042   17.720  1.00 152.03 ? 44  GLU L OE1   1 
ATOM   5433  O  OE2   . GLU I  9  44  ? -14.563  1.897   17.696  1.00 114.58 ? 44  GLU L OE2   1 
ATOM   5434  N  N     . GLN I  9  45  ? -14.106  6.167   17.533  1.00 146.46 ? 45  GLN L N     1 
ATOM   5435  C  CA    . GLN I  9  45  ? -13.842  6.237   16.091  1.00 150.75 ? 45  GLN L CA    1 
ATOM   5436  C  C     . GLN I  9  45  ? -12.724  7.275   15.818  1.00 152.55 ? 45  GLN L C     1 
ATOM   5437  O  O     . GLN I  9  45  ? -12.008  7.256   14.829  1.00 152.24 ? 45  GLN L O     1 
ATOM   5438  C  CB    . GLN I  9  45  ? -15.157  6.576   15.356  1.00 157.85 ? 45  GLN L CB    1 
ATOM   5439  C  CG    . GLN I  9  45  ? -16.248  5.486   15.430  1.00 161.05 ? 45  GLN L CG    1 
ATOM   5440  C  CD    . GLN I  9  45  ? -16.969  5.285   14.070  1.00 156.40 ? 45  GLN L CD    1 
ATOM   5441  O  OE1   . GLN I  9  45  ? -17.228  6.204   13.253  1.00 150.48 ? 45  GLN L OE1   1 
ATOM   5442  N  NE2   . GLN I  9  45  ? -17.416  4.056   13.871  1.00 149.61 ? 45  GLN L NE2   1 
ATOM   5443  N  N     . ALA I  9  46  ? -12.602  8.239   16.737  1.00 154.75 ? 46  ALA L N     1 
ATOM   5444  C  CA    . ALA I  9  46  ? -11.488  9.199   16.700  1.00 153.61 ? 46  ALA L CA    1 
ATOM   5445  C  C     . ALA I  9  46  ? -10.173  8.449   16.817  1.00 160.71 ? 46  ALA L C     1 
ATOM   5446  O  O     . ALA I  9  46  ? -9.239   8.803   16.127  1.00 178.57 ? 46  ALA L O     1 
ATOM   5447  C  CB    . ALA I  9  46  ? -11.598  10.296  17.767  1.00 149.41 ? 46  ALA L CB    1 
ATOM   5448  N  N     . GLN I  9  47  ? -10.132  7.424   17.648  1.00 172.02 ? 47  GLN L N     1 
ATOM   5449  C  CA    . GLN I  9  47  ? -8.924   6.616   17.800  1.00 172.54 ? 47  GLN L CA    1 
ATOM   5450  C  C     . GLN I  9  47  ? -8.601   5.908   16.478  1.00 168.10 ? 47  GLN L C     1 
ATOM   5451  O  O     . GLN I  9  47  ? -7.482   5.418   16.264  1.00 180.99 ? 47  GLN L O     1 
ATOM   5452  C  CB    . GLN I  9  47  ? -9.083   5.627   18.984  1.00 185.31 ? 47  GLN L CB    1 
ATOM   5453  C  CG    . GLN I  9  47  ? -9.228   6.272   20.365  1.00 191.62 ? 47  GLN L CG    1 
ATOM   5454  C  CD    . GLN I  9  47  ? -9.966   5.453   21.447  1.00 185.44 ? 47  GLN L CD    1 
ATOM   5455  O  OE1   . GLN I  9  47  ? -10.152  4.248   21.305  1.00 182.28 ? 47  GLN L OE1   1 
ATOM   5456  N  NE2   . GLN I  9  47  ? -10.496  6.138   22.465  1.00 177.41 ? 47  GLN L NE2   1 
ATOM   5457  N  N     . SER I  9  48  ? -9.596   5.793   15.600  1.00 155.67 ? 48  SER L N     1 
ATOM   5458  C  CA    . SER I  9  48  ? -9.354   5.331   14.237  1.00 147.57 ? 48  SER L CA    1 
ATOM   5459  C  C     . SER I  9  48  ? -8.341   6.185   13.489  1.00 169.52 ? 48  SER L C     1 
ATOM   5460  O  O     . SER I  9  48  ? -7.559   5.642   12.699  1.00 190.03 ? 48  SER L O     1 
ATOM   5461  C  CB    . SER I  9  48  ? -10.640  5.111   13.426  1.00 133.26 ? 48  SER L CB    1 
ATOM   5462  O  OG    . SER I  9  48  ? -10.549  5.468   12.043  1.00 114.83 ? 48  SER L OG    1 
ATOM   5463  N  N     . LEU I  9  49  ? -8.300   7.485   13.775  1.00 188.82 ? 49  LEU L N     1 
ATOM   5464  C  CA    . LEU I  9  49  ? -7.384   8.393   13.051  1.00 198.67 ? 49  LEU L CA    1 
ATOM   5465  C  C     . LEU I  9  49  ? -5.923   8.032   13.239  1.00 203.84 ? 49  LEU L C     1 
ATOM   5466  O  O     . LEU I  9  49  ? -5.069   8.277   12.367  1.00 224.35 ? 49  LEU L O     1 
ATOM   5467  C  CB    . LEU I  9  49  ? -7.620   9.862   13.399  1.00 195.87 ? 49  LEU L CB    1 
ATOM   5468  C  CG    . LEU I  9  49  ? -7.308   10.291  14.829  1.00 193.50 ? 49  LEU L CG    1 
ATOM   5469  C  CD1   . LEU I  9  49  ? -5.830   10.398  15.139  1.00 185.48 ? 49  LEU L CD1   1 
ATOM   5470  C  CD2   . LEU I  9  49  ? -8.065   11.592  15.181  1.00 185.89 ? 49  LEU L CD2   1 
ATOM   5471  N  N     . ILE I  9  50  ? -5.626   7.390   14.370  1.00 198.12 ? 50  ILE L N     1 
ATOM   5472  C  CA    . ILE I  9  50  ? -4.256   6.948   14.618  1.00 184.80 ? 50  ILE L CA    1 
ATOM   5473  C  C     . ILE I  9  50  ? -3.844   6.017   13.470  1.00 190.71 ? 50  ILE L C     1 
ATOM   5474  O  O     . ILE I  9  50  ? -2.695   6.030   12.998  1.00 187.60 ? 50  ILE L O     1 
ATOM   5475  C  CB    . ILE I  9  50  ? -4.117   6.159   15.934  1.00 168.74 ? 50  ILE L CB    1 
ATOM   5476  C  CG1   . ILE I  9  50  ? -4.641   6.936   17.110  1.00 159.20 ? 50  ILE L CG1   1 
ATOM   5477  C  CG2   . ILE I  9  50  ? -2.714   5.649   16.218  1.00 158.91 ? 50  ILE L CG2   1 
ATOM   5478  C  CD1   . ILE I  9  50  ? -4.586   8.427   17.117  1.00 146.92 ? 50  ILE L CD1   1 
ATOM   5479  N  N     . ASP I  9  51  ? -4.807   5.207   13.045  1.00 194.09 ? 51  ASP L N     1 
ATOM   5480  C  CA    . ASP I  9  51  ? -4.726   4.529   11.744  1.00 195.19 ? 51  ASP L CA    1 
ATOM   5481  C  C     . ASP I  9  51  ? -4.748   5.438   10.507  1.00 184.48 ? 51  ASP L C     1 
ATOM   5482  O  O     . ASP I  9  51  ? -4.038   5.134   9.551   1.00 170.47 ? 51  ASP L O     1 
ATOM   5483  C  CB    . ASP I  9  51  ? -5.871   3.516   11.644  1.00 198.06 ? 51  ASP L CB    1 
ATOM   5484  C  CG    . ASP I  9  51  ? -5.622   2.298   12.467  1.00 199.18 ? 51  ASP L CG    1 
ATOM   5485  O  OD1   . ASP I  9  51  ? -4.440   1.978   12.722  1.00 196.85 ? 51  ASP L OD1   1 
ATOM   5486  O  OD2   . ASP I  9  51  ? -6.618   1.647   12.814  1.00 202.73 ? 51  ASP L OD2   1 
ATOM   5487  N  N     . LYS I  9  52  ? -5.594   6.471   10.545  1.00 179.14 ? 52  LYS L N     1 
ATOM   5488  C  CA    . LYS I  9  52  ? -5.724   7.544   9.507   1.00 169.31 ? 52  LYS L CA    1 
ATOM   5489  C  C     . LYS I  9  52  ? -4.395   8.227   9.153   1.00 168.41 ? 52  LYS L C     1 
ATOM   5490  O  O     . LYS I  9  52  ? -4.075   8.442   7.977   1.00 146.17 ? 52  LYS L O     1 
ATOM   5491  C  CB    . LYS I  9  52  ? -6.765   8.605   9.922   1.00 164.91 ? 52  LYS L CB    1 
ATOM   5492  C  CG    . LYS I  9  52  ? -8.210   8.057   9.904   1.00 157.72 ? 52  LYS L CG    1 
ATOM   5493  C  CD    . LYS I  9  52  ? -9.252   8.584   10.904  1.00 153.05 ? 52  LYS L CD    1 
ATOM   5494  C  CE    . LYS I  9  52  ? -9.229   10.076  11.143  1.00 151.99 ? 52  LYS L CE    1 
ATOM   5495  N  NZ    . LYS I  9  52  ? -9.624   10.806  9.924   1.00 158.23 ? 52  LYS L NZ    1 
ATOM   5496  N  N     . THR I  9  53  ? -3.645   8.586   10.194  1.00 184.38 ? 53  THR L N     1 
ATOM   5497  C  CA    . THR I  9  53  ? -2.307   9.174   10.054  1.00 196.53 ? 53  THR L CA    1 
ATOM   5498  C  C     . THR I  9  53  ? -1.285   8.248   9.342   1.00 208.32 ? 53  THR L C     1 
ATOM   5499  O  O     . THR I  9  53  ? -0.456   8.763   8.582   1.00 225.41 ? 53  THR L O     1 
ATOM   5500  C  CB    . THR I  9  53  ? -1.791   9.766   11.407  1.00 189.69 ? 53  THR L CB    1 
ATOM   5501  O  OG1   . THR I  9  53  ? -1.057   10.977  11.173  1.00 188.60 ? 53  THR L OG1   1 
ATOM   5502  C  CG2   . THR I  9  53  ? -0.947   8.794   12.248  1.00 178.53 ? 53  THR L CG2   1 
ATOM   5503  N  N     . THR I  9  54  ? -1.342   6.931   9.582   1.00 197.99 ? 54  THR L N     1 
ATOM   5504  C  CA    . THR I  9  54  ? -0.533   5.923   8.831   1.00 176.55 ? 54  THR L CA    1 
ATOM   5505  C  C     . THR I  9  54  ? -1.227   5.475   7.530   1.00 162.37 ? 54  THR L C     1 
ATOM   5506  O  O     . THR I  9  54  ? -0.801   5.767   6.413   1.00 133.95 ? 54  THR L O     1 
ATOM   5507  C  CB    . THR I  9  54  ? -0.132   4.672   9.685   1.00 162.37 ? 54  THR L CB    1 
ATOM   5508  O  OG1   . THR I  9  54  ? -0.264   4.962   11.086  1.00 159.17 ? 54  THR L OG1   1 
ATOM   5509  C  CG2   . THR I  9  54  ? 1.314    4.210   9.366   1.00 149.44 ? 54  THR L CG2   1 
HETATM 5510  P  PG    . GTP J  10 1   ? -21.924  16.341  32.838  1.00 189.03 ? 1   GTP 1 PG    1 
HETATM 5511  O  O1G   . GTP J  10 1   ? -21.999  17.620  32.034  1.00 196.65 ? 1   GTP 1 O1G   1 
HETATM 5512  O  O2G   . GTP J  10 1   ? -20.534  16.263  33.437  1.00 161.60 ? 1   GTP 1 O2G   1 
HETATM 5513  O  O3G   . GTP J  10 1   ? -22.459  15.080  32.164  1.00 174.00 ? 1   GTP 1 O3G   1 
HETATM 5514  O  O3B   . GTP J  10 1   ? -22.980  16.612  34.044  1.00 187.99 ? 1   GTP 1 O3B   1 
HETATM 5515  P  PB    . GTP J  10 1   ? -24.444  17.323  33.929  1.00 193.93 ? 1   GTP 1 PB    1 
HETATM 5516  O  O1B   . GTP J  10 1   ? -25.118  16.950  32.622  1.00 196.52 ? 1   GTP 1 O1B   1 
HETATM 5517  O  O2B   . GTP J  10 1   ? -24.305  18.799  34.202  1.00 184.88 ? 1   GTP 1 O2B   1 
HETATM 5518  O  O3A   . GTP J  10 1   ? -25.295  16.665  35.146  1.00 172.60 ? 1   GTP 1 O3A   1 
HETATM 5519  P  PA    . GTP J  10 1   ? -25.095  17.099  36.675  1.00 148.84 ? 1   GTP 1 PA    1 
HETATM 5520  O  O1A   . GTP J  10 1   ? -23.710  17.712  36.635  1.00 142.05 ? 1   GTP 1 O1A   1 
HETATM 5521  O  O2A   . GTP J  10 1   ? -26.408  17.748  37.040  1.00 143.11 ? 1   GTP 1 O2A   1 
HETATM 5522  O  "O5'" . GTP J  10 1   ? -24.925  15.880  37.693  1.00 127.88 ? 1   GTP 1 "O5'" 1 
HETATM 5523  C  "C5'" . GTP J  10 1   ? -24.686  16.170  39.052  1.00 126.74 ? 1   GTP 1 "C5'" 1 
HETATM 5524  C  "C4'" . GTP J  10 1   ? -23.363  16.926  39.322  1.00 142.25 ? 1   GTP 1 "C4'" 1 
HETATM 5525  O  "O4'" . GTP J  10 1   ? -23.190  18.208  38.689  1.00 151.48 ? 1   GTP 1 "O4'" 1 
HETATM 5526  C  "C3'" . GTP J  10 1   ? -23.217  17.307  40.791  1.00 151.67 ? 1   GTP 1 "C3'" 1 
HETATM 5527  O  "O3'" . GTP J  10 1   ? -22.590  16.275  41.574  1.00 158.72 ? 1   GTP 1 "O3'" 1 
HETATM 5528  C  "C2'" . GTP J  10 1   ? -22.483  18.630  40.884  1.00 144.20 ? 1   GTP 1 "C2'" 1 
HETATM 5529  O  "O2'" . GTP J  10 1   ? -21.076  18.459  40.959  1.00 130.13 ? 1   GTP 1 "O2'" 1 
HETATM 5530  C  "C1'" . GTP J  10 1   ? -22.995  19.307  39.612  1.00 148.50 ? 1   GTP 1 "C1'" 1 
HETATM 5531  N  N9    . GTP J  10 1   ? -24.223  20.156  39.797  1.00 149.52 ? 1   GTP 1 N9    1 
HETATM 5532  C  C8    . GTP J  10 1   ? -25.315  20.232  38.989  1.00 144.45 ? 1   GTP 1 C8    1 
HETATM 5533  N  N7    . GTP J  10 1   ? -26.291  21.070  39.439  1.00 131.74 ? 1   GTP 1 N7    1 
HETATM 5534  C  C5    . GTP J  10 1   ? -25.814  21.565  40.597  1.00 134.95 ? 1   GTP 1 C5    1 
HETATM 5535  C  C6    . GTP J  10 1   ? -26.288  22.519  41.634  1.00 130.68 ? 1   GTP 1 C6    1 
HETATM 5536  O  O6    . GTP J  10 1   ? -27.384  23.117  41.577  1.00 132.37 ? 1   GTP 1 O6    1 
HETATM 5537  N  N1    . GTP J  10 1   ? -25.460  22.752  42.660  1.00 134.33 ? 1   GTP 1 N1    1 
HETATM 5538  C  C2    . GTP J  10 1   ? -24.253  22.187  42.816  1.00 135.33 ? 1   GTP 1 C2    1 
HETATM 5539  N  N2    . GTP J  10 1   ? -23.536  22.525  43.907  1.00 139.57 ? 1   GTP 1 N2    1 
HETATM 5540  N  N3    . GTP J  10 1   ? -23.734  21.311  41.931  1.00 129.56 ? 1   GTP 1 N3    1 
HETATM 5541  C  C4    . GTP J  10 1   ? -24.456  20.977  40.826  1.00 139.66 ? 1   GTP 1 C4    1 
ATOM   5542  P  P     . G   J  10 2   ? -23.785  15.675  42.220  1.00 142.21 ? 2   G   1 P     1 
ATOM   5543  O  OP1   . G   J  10 2   ? -22.961  14.446  42.339  1.00 130.81 ? 2   G   1 OP1   1 
ATOM   5544  O  OP2   . G   J  10 2   ? -25.243  15.591  41.853  1.00 117.76 ? 2   G   1 OP2   1 
ATOM   5545  O  "O5'" . G   J  10 2   ? -23.734  16.219  43.707  1.00 148.37 ? 2   G   1 "O5'" 1 
ATOM   5546  C  "C5'" . G   J  10 2   ? -22.534  16.281  44.502  1.00 155.30 ? 2   G   1 "C5'" 1 
ATOM   5547  C  "C4'" . G   J  10 2   ? -22.664  17.424  45.479  1.00 167.86 ? 2   G   1 "C4'" 1 
ATOM   5548  O  "O4'" . G   J  10 2   ? -22.939  18.659  44.757  1.00 177.11 ? 2   G   1 "O4'" 1 
ATOM   5549  C  "C3'" . G   J  10 2   ? -23.848  17.325  46.432  1.00 173.92 ? 2   G   1 "C3'" 1 
ATOM   5550  O  "O3'" . G   J  10 2   ? -23.667  16.398  47.489  1.00 171.67 ? 2   G   1 "O3'" 1 
ATOM   5551  C  "C2'" . G   J  10 2   ? -24.003  18.771  46.875  1.00 170.00 ? 2   G   1 "C2'" 1 
ATOM   5552  O  "O2'" . G   J  10 2   ? -23.081  19.158  47.871  1.00 158.52 ? 2   G   1 "O2'" 1 
ATOM   5553  C  "C1'" . G   J  10 2   ? -23.801  19.482  45.537  1.00 166.94 ? 2   G   1 "C1'" 1 
ATOM   5554  N  N9    . G   J  10 2   ? -25.049  19.723  44.815  1.00 145.64 ? 2   G   1 N9    1 
ATOM   5555  C  C8    . G   J  10 2   ? -25.471  19.176  43.627  1.00 140.61 ? 2   G   1 C8    1 
ATOM   5556  N  N7    . G   J  10 2   ? -26.637  19.623  43.244  1.00 132.46 ? 2   G   1 N7    1 
ATOM   5557  C  C5    . G   J  10 2   ? -27.007  20.517  44.239  1.00 136.40 ? 2   G   1 C5    1 
ATOM   5558  C  C6    . G   J  10 2   ? -28.175  21.321  44.373  1.00 141.65 ? 2   G   1 C6    1 
ATOM   5559  O  O6    . G   J  10 2   ? -29.163  21.385  43.629  1.00 129.95 ? 2   G   1 O6    1 
ATOM   5560  N  N1    . G   J  10 2   ? -28.131  22.095  45.530  1.00 154.88 ? 2   G   1 N1    1 
ATOM   5561  C  C2    . G   J  10 2   ? -27.110  22.084  46.451  1.00 152.81 ? 2   G   1 C2    1 
ATOM   5562  N  N2    . G   J  10 2   ? -27.255  22.894  47.512  1.00 152.11 ? 2   G   1 N2    1 
ATOM   5563  N  N3    . G   J  10 2   ? -26.020  21.341  46.337  1.00 141.20 ? 2   G   1 N3    1 
ATOM   5564  C  C4    . G   J  10 2   ? -26.035  20.590  45.216  1.00 138.25 ? 2   G   1 C4    1 
ATOM   5565  P  P     . A   J  10 3   ? -24.943  15.674  48.112  1.00 166.62 ? 3   A   1 P     1 
ATOM   5566  O  OP1   . A   J  10 3   ? -24.440  14.635  49.049  1.00 173.57 ? 3   A   1 OP1   1 
ATOM   5567  O  OP2   . A   J  10 3   ? -25.911  15.335  47.033  1.00 145.36 ? 3   A   1 OP2   1 
ATOM   5568  O  "O5'" . A   J  10 3   ? -25.577  16.816  49.010  1.00 163.21 ? 3   A   1 "O5'" 1 
ATOM   5569  C  "C5'" . A   J  10 3   ? -24.902  17.307  50.178  1.00 157.54 ? 3   A   1 "C5'" 1 
ATOM   5570  C  "C4'" . A   J  10 3   ? -25.769  18.359  50.810  1.00 162.66 ? 3   A   1 "C4'" 1 
ATOM   5571  O  "O4'" . A   J  10 3   ? -25.952  19.461  49.878  1.00 169.51 ? 3   A   1 "O4'" 1 
ATOM   5572  C  "C3'" . A   J  10 3   ? -27.199  17.926  51.130  1.00 166.48 ? 3   A   1 "C3'" 1 
ATOM   5573  O  "O3'" . A   J  10 3   ? -27.310  17.159  52.321  1.00 170.07 ? 3   A   1 "O3'" 1 
ATOM   5574  C  "C2'" . A   J  10 3   ? -27.886  19.277  51.236  1.00 164.15 ? 3   A   1 "C2'" 1 
ATOM   5575  O  "O2'" . A   J  10 3   ? -27.636  19.949  52.451  1.00 165.56 ? 3   A   1 "O2'" 1 
ATOM   5576  C  "C1'" . A   J  10 3   ? -27.250  19.999  50.049  1.00 165.88 ? 3   A   1 "C1'" 1 
ATOM   5577  N  N9    . A   J  10 3   ? -28.007  19.816  48.813  1.00 156.60 ? 3   A   1 N9    1 
ATOM   5578  C  C8    . A   J  10 3   ? -27.731  19.059  47.701  1.00 148.09 ? 3   A   1 C8    1 
ATOM   5579  N  N7    . A   J  10 3   ? -28.651  19.136  46.770  1.00 149.97 ? 3   A   1 N7    1 
ATOM   5580  C  C5    . A   J  10 3   ? -29.605  19.989  47.309  1.00 149.40 ? 3   A   1 C5    1 
ATOM   5581  C  C6    . A   J  10 3   ? -30.824  20.496  46.813  1.00 139.91 ? 3   A   1 C6    1 
ATOM   5582  N  N6    . A   J  10 3   ? -31.327  20.194  45.614  1.00 136.63 ? 3   A   1 N6    1 
ATOM   5583  N  N1    . A   J  10 3   ? -31.533  21.320  47.615  1.00 150.59 ? 3   A   1 N1    1 
ATOM   5584  C  C2    . A   J  10 3   ? -31.037  21.633  48.819  1.00 157.04 ? 3   A   1 C2    1 
ATOM   5585  N  N3    . A   J  10 3   ? -29.903  21.232  49.390  1.00 166.22 ? 3   A   1 N3    1 
ATOM   5586  C  C4    . A   J  10 3   ? -29.222  20.411  48.570  1.00 159.49 ? 3   A   1 C4    1 
ATOM   5587  P  P     . C   J  10 4   ? -28.386  15.985  52.442  1.00 163.01 ? 4   C   1 P     1 
ATOM   5588  O  OP1   . C   J  10 4   ? -28.000  15.190  53.645  1.00 140.66 ? 4   C   1 OP1   1 
ATOM   5589  O  OP2   . C   J  10 4   ? -28.547  15.355  51.097  1.00 153.57 ? 4   C   1 OP2   1 
ATOM   5590  O  "O5'" . C   J  10 4   ? -29.733  16.750  52.810  1.00 150.07 ? 4   C   1 "O5'" 1 
ATOM   5591  C  "C5'" . C   J  10 4   ? -29.899  17.435  54.059  1.00 139.14 ? 4   C   1 "C5'" 1 
ATOM   5592  C  "C4'" . C   J  10 4   ? -31.022  18.430  53.913  1.00 146.10 ? 4   C   1 "C4'" 1 
ATOM   5593  O  "O4'" . C   J  10 4   ? -30.842  19.204  52.689  1.00 158.99 ? 4   C   1 "O4'" 1 
ATOM   5594  C  "C3'" . C   J  10 4   ? -32.418  17.848  53.750  1.00 140.79 ? 4   C   1 "C3'" 1 
ATOM   5595  O  "O3'" . C   J  10 4   ? -33.007  17.452  54.975  1.00 127.49 ? 4   C   1 "O3'" 1 
ATOM   5596  C  "C2'" . C   J  10 4   ? -33.164  19.020  53.126  1.00 150.79 ? 4   C   1 "C2'" 1 
ATOM   5597  O  "O2'" . C   J  10 4   ? -33.603  20.011  54.031  1.00 146.06 ? 4   C   1 "O2'" 1 
ATOM   5598  C  "C1'" . C   J  10 4   ? -32.107  19.587  52.177  1.00 162.23 ? 4   C   1 "C1'" 1 
ATOM   5599  N  N1    . C   J  10 4   ? -32.248  19.112  50.790  1.00 161.67 ? 4   C   1 N1    1 
ATOM   5600  C  C2    . C   J  10 4   ? -33.353  19.555  50.043  1.00 160.28 ? 4   C   1 C2    1 
ATOM   5601  O  O2    . C   J  10 4   ? -34.176  20.325  50.566  1.00 163.69 ? 4   C   1 O2    1 
ATOM   5602  N  N3    . C   J  10 4   ? -33.501  19.130  48.769  1.00 145.08 ? 4   C   1 N3    1 
ATOM   5603  C  C4    . C   J  10 4   ? -32.614  18.287  48.240  1.00 143.76 ? 4   C   1 C4    1 
ATOM   5604  N  N4    . C   J  10 4   ? -32.807  17.910  46.978  1.00 141.24 ? 4   C   1 N4    1 
ATOM   5605  C  C5    . C   J  10 4   ? -31.474  17.830  48.969  1.00 145.25 ? 4   C   1 C5    1 
ATOM   5606  C  C6    . C   J  10 4   ? -31.336  18.256  50.232  1.00 147.74 ? 4   C   1 C6    1 
ATOM   5607  P  P     . U   J  10 5   ? -34.329  16.579  54.951  1.00 133.89 ? 5   U   1 P     1 
ATOM   5608  O  OP1   . U   J  10 5   ? -34.764  16.331  56.351  1.00 135.20 ? 5   U   1 OP1   1 
ATOM   5609  O  OP2   . U   J  10 5   ? -34.121  15.454  54.011  1.00 147.93 ? 5   U   1 OP2   1 
ATOM   5610  O  "O5'" . U   J  10 5   ? -35.393  17.522  54.251  1.00 120.48 ? 5   U   1 "O5'" 1 
ATOM   5611  C  "C5'" . U   J  10 5   ? -36.239  18.388  55.011  1.00 121.79 ? 5   U   1 "C5'" 1 
ATOM   5612  C  "C4'" . U   J  10 5   ? -37.340  18.848  54.105  1.00 123.91 ? 5   U   1 "C4'" 1 
ATOM   5613  O  "O4'" . U   J  10 5   ? -36.768  19.247  52.833  1.00 124.71 ? 5   U   1 "O4'" 1 
ATOM   5614  C  "C3'" . U   J  10 5   ? -38.304  17.750  53.695  1.00 125.03 ? 5   U   1 "C3'" 1 
ATOM   5615  O  "O3'" . U   J  10 5   ? -39.232  17.442  54.718  1.00 133.79 ? 5   U   1 "O3'" 1 
ATOM   5616  C  "C2'" . U   J  10 5   ? -38.930  18.342  52.438  1.00 123.21 ? 5   U   1 "C2'" 1 
ATOM   5617  O  "O2'" . U   J  10 5   ? -40.017  19.216  52.618  1.00 95.07  ? 5   U   1 "O2'" 1 
ATOM   5618  C  "C1'" . U   J  10 5   ? -37.715  19.021  51.807  1.00 128.91 ? 5   U   1 "C1'" 1 
ATOM   5619  N  N1    . U   J  10 5   ? -37.078  18.242  50.733  1.00 135.58 ? 5   U   1 N1    1 
ATOM   5620  C  C2    . U   J  10 5   ? -37.759  18.186  49.529  1.00 131.04 ? 5   U   1 C2    1 
ATOM   5621  O  O2    . U   J  10 5   ? -38.840  18.730  49.344  1.00 111.56 ? 5   U   1 O2    1 
ATOM   5622  N  N3    . U   J  10 5   ? -37.130  17.456  48.551  1.00 127.56 ? 5   U   1 N3    1 
ATOM   5623  C  C4    . U   J  10 5   ? -35.917  16.804  48.631  1.00 128.82 ? 5   U   1 C4    1 
ATOM   5624  O  O4    . U   J  10 5   ? -35.481  16.219  47.635  1.00 110.70 ? 5   U   1 O4    1 
ATOM   5625  C  C5    . U   J  10 5   ? -35.281  16.891  49.915  1.00 130.04 ? 5   U   1 C5    1 
ATOM   5626  C  C6    . U   J  10 5   ? -35.869  17.591  50.897  1.00 130.91 ? 5   U   1 C6    1 
ATOM   5627  P  P     . U   J  10 6   ? -39.633  15.925  54.971  1.00 143.25 ? 6   U   1 P     1 
ATOM   5628  O  OP1   . U   J  10 6   ? -40.328  15.846  56.278  1.00 151.48 ? 6   U   1 OP1   1 
ATOM   5629  O  OP2   . U   J  10 6   ? -38.429  15.094  54.744  1.00 133.58 ? 6   U   1 OP2   1 
ATOM   5630  O  "O5'" . U   J  10 6   ? -40.777  15.676  53.892  1.00 136.36 ? 6   U   1 "O5'" 1 
ATOM   5631  C  "C5'" . U   J  10 6   ? -41.997  16.436  53.938  1.00 133.31 ? 6   U   1 "C5'" 1 
ATOM   5632  C  "C4'" . U   J  10 6   ? -42.656  16.431  52.580  1.00 128.56 ? 6   U   1 "C4'" 1 
ATOM   5633  O  "O4'" . U   J  10 6   ? -41.739  16.950  51.582  1.00 129.36 ? 6   U   1 "O4'" 1 
ATOM   5634  C  "C3'" . U   J  10 6   ? -43.032  15.072  52.015  1.00 123.61 ? 6   U   1 "C3'" 1 
ATOM   5635  O  "O3'" . U   J  10 6   ? -44.196  14.578  52.653  1.00 133.28 ? 6   U   1 "O3'" 1 
ATOM   5636  C  "C2'" . U   J  10 6   ? -43.210  15.406  50.540  1.00 114.84 ? 6   U   1 "C2'" 1 
ATOM   5637  O  "O2'" . U   J  10 6   ? -44.454  15.956  50.177  1.00 98.63  ? 6   U   1 "O2'" 1 
ATOM   5638  C  "C1'" . U   J  10 6   ? -42.039  16.362  50.325  1.00 118.87 ? 6   U   1 "C1'" 1 
ATOM   5639  N  N1    . U   J  10 6   ? -40.825  15.715  49.800  1.00 119.95 ? 6   U   1 N1    1 
ATOM   5640  C  C2    . U   J  10 6   ? -40.795  15.449  48.444  1.00 123.13 ? 6   U   1 C2    1 
ATOM   5641  O  O2    . U   J  10 6   ? -41.725  15.703  47.691  1.00 121.71 ? 6   U   1 O2    1 
ATOM   5642  N  N3    . U   J  10 6   ? -39.638  14.852  48.004  1.00 119.39 ? 6   U   1 N3    1 
ATOM   5643  C  C4    . U   J  10 6   ? -38.527  14.505  48.746  1.00 119.67 ? 6   U   1 C4    1 
ATOM   5644  O  O4    . U   J  10 6   ? -37.565  13.955  48.192  1.00 116.85 ? 6   U   1 O4    1 
ATOM   5645  C  C5    . U   J  10 6   ? -38.638  14.807  50.140  1.00 117.75 ? 6   U   1 C5    1 
ATOM   5646  C  C6    . U   J  10 6   ? -39.758  15.375  50.609  1.00 118.57 ? 6   U   1 C6    1 
ATOM   5647  P  P     . A   J  10 7   ? -44.344  13.010  52.922  1.00 145.19 ? 7   A   1 P     1 
ATOM   5648  O  OP1   . A   J  10 7   ? -45.585  12.774  53.710  1.00 147.46 ? 7   A   1 OP1   1 
ATOM   5649  O  OP2   . A   J  10 7   ? -43.047  12.524  53.458  1.00 124.31 ? 7   A   1 OP2   1 
ATOM   5650  O  "O5'" . A   J  10 7   ? -44.724  12.454  51.478  1.00 142.61 ? 7   A   1 "O5'" 1 
ATOM   5651  C  "C5'" . A   J  10 7   ? -46.015  12.755  50.908  1.00 133.58 ? 7   A   1 "C5'" 1 
ATOM   5652  C  "C4'" . A   J  10 7   ? -46.004  12.510  49.421  1.00 125.06 ? 7   A   1 "C4'" 1 
ATOM   5653  O  "O4'" . A   J  10 7   ? -44.913  13.238  48.798  1.00 122.43 ? 7   A   1 "O4'" 1 
ATOM   5654  C  "C3'" . A   J  10 7   ? -45.772  11.070  48.979  1.00 120.58 ? 7   A   1 "C3'" 1 
ATOM   5655  O  "O3'" . A   J  10 7   ? -46.965  10.299  49.094  1.00 129.56 ? 7   A   1 "O3'" 1 
ATOM   5656  C  "C2'" . A   J  10 7   ? -45.312  11.271  47.539  1.00 115.36 ? 7   A   1 "C2'" 1 
ATOM   5657  O  "O2'" . A   J  10 7   ? -46.333  11.526  46.595  1.00 102.17 ? 7   A   1 "O2'" 1 
ATOM   5658  C  "C1'" . A   J  10 7   ? -44.421  12.498  47.694  1.00 114.30 ? 7   A   1 "C1'" 1 
ATOM   5659  N  N9    . A   J  10 7   ? -43.027  12.156  47.961  1.00 113.39 ? 7   A   1 N9    1 
ATOM   5660  C  C8    . A   J  10 7   ? -42.316  12.271  49.134  1.00 115.96 ? 7   A   1 C8    1 
ATOM   5661  N  N7    . A   J  10 7   ? -41.059  11.916  49.032  1.00 101.24 ? 7   A   1 N7    1 
ATOM   5662  C  C5    . A   J  10 7   ? -40.935  11.537  47.704  1.00 100.27 ? 7   A   1 C5    1 
ATOM   5663  C  C6    . A   J  10 7   ? -39.851  11.045  46.974  1.00 98.01  ? 7   A   1 C6    1 
ATOM   5664  N  N6    . A   J  10 7   ? -38.650  10.853  47.511  1.00 102.26 ? 7   A   1 N6    1 
ATOM   5665  N  N1    . A   J  10 7   ? -40.053  10.739  45.673  1.00 94.98  ? 7   A   1 N1    1 
ATOM   5666  C  C2    . A   J  10 7   ? -41.282  10.915  45.158  1.00 95.43  ? 7   A   1 C2    1 
ATOM   5667  N  N3    . A   J  10 7   ? -42.386  11.375  45.748  1.00 90.02  ? 7   A   1 N3    1 
ATOM   5668  C  C4    . A   J  10 7   ? -42.141  11.668  47.036  1.00 102.39 ? 7   A   1 C4    1 
ATOM   5669  P  P     . C   J  10 8   ? -46.896  8.769   49.567  1.00 132.83 ? 8   C   1 P     1 
ATOM   5670  O  OP1   . C   J  10 8   ? -48.284  8.269   49.782  1.00 127.83 ? 8   C   1 OP1   1 
ATOM   5671  O  OP2   . C   J  10 8   ? -45.888  8.672   50.667  1.00 130.09 ? 8   C   1 OP2   1 
ATOM   5672  O  "O5'" . C   J  10 8   ? -46.397  8.026   48.251  1.00 122.14 ? 8   C   1 "O5'" 1 
ATOM   5673  C  "C5'" . C   J  10 8   ? -47.194  8.016   47.051  1.00 119.09 ? 8   C   1 "C5'" 1 
ATOM   5674  C  "C4'" . C   J  10 8   ? -46.353  7.556   45.877  1.00 118.84 ? 8   C   1 "C4'" 1 
ATOM   5675  O  "O4'" . C   J  10 8   ? -45.192  8.415   45.708  1.00 117.53 ? 8   C   1 "O4'" 1 
ATOM   5676  C  "C3'" . C   J  10 8   ? -45.718  6.179   45.982  1.00 112.36 ? 8   C   1 "C3'" 1 
ATOM   5677  O  "O3'" . C   J  10 8   ? -46.657  5.139   45.771  1.00 115.55 ? 8   C   1 "O3'" 1 
ATOM   5678  C  "C2'" . C   J  10 8   ? -44.658  6.260   44.897  1.00 107.78 ? 8   C   1 "C2'" 1 
ATOM   5679  O  "O2'" . C   J  10 8   ? -45.109  6.211   43.557  1.00 107.61 ? 8   C   1 "O2'" 1 
ATOM   5680  C  "C1'" . C   J  10 8   ? -44.125  7.659   45.163  1.00 103.75 ? 8   C   1 "C1'" 1 
ATOM   5681  N  N1    . C   J  10 8   ? -42.994  7.664   46.100  1.00 100.20 ? 8   C   1 N1    1 
ATOM   5682  C  C2    . C   J  10 8   ? -41.737  7.295   45.600  1.00 102.21 ? 8   C   1 C2    1 
ATOM   5683  O  O2    . C   J  10 8   ? -41.629  6.975   44.404  1.00 93.78  ? 8   C   1 O2    1 
ATOM   5684  N  N3    . C   J  10 8   ? -40.662  7.332   46.418  1.00 91.83  ? 8   C   1 N3    1 
ATOM   5685  C  C4    . C   J  10 8   ? -40.796  7.725   47.683  1.00 86.65  ? 8   C   1 C4    1 
ATOM   5686  N  N4    . C   J  10 8   ? -39.695  7.769   48.436  1.00 81.13  ? 8   C   1 N4    1 
ATOM   5687  C  C5    . C   J  10 8   ? -42.063  8.104   48.222  1.00 90.54  ? 8   C   1 C5    1 
ATOM   5688  C  C6    . C   J  10 8   ? -43.126  8.062   47.403  1.00 93.83  ? 8   C   1 C6    1 
ATOM   5689  P  P     . C   J  10 9   ? -46.466  3.753   46.523  1.00 110.67 ? 9   C   1 P     1 
ATOM   5690  O  OP1   . C   J  10 9   ? -47.750  3.015   46.333  1.00 107.14 ? 9   C   1 OP1   1 
ATOM   5691  O  OP2   . C   J  10 9   ? -45.970  4.027   47.909  1.00 105.38 ? 9   C   1 OP2   1 
ATOM   5692  O  "O5'" . C   J  10 9   ? -45.259  3.100   45.708  1.00 105.52 ? 9   C   1 "O5'" 1 
ATOM   5693  C  "C5'" . C   J  10 9   ? -45.308  2.840   44.289  1.00 99.42  ? 9   C   1 "C5'" 1 
ATOM   5694  C  "C4'" . C   J  10 9   ? -43.984  2.279   43.795  1.00 100.37 ? 9   C   1 "C4'" 1 
ATOM   5695  O  "O4'" . C   J  10 9   ? -42.934  3.284   43.829  1.00 93.05  ? 9   C   1 "O4'" 1 
ATOM   5696  C  "C3'" . C   J  10 9   ? -43.390  1.125   44.589  1.00 104.47 ? 9   C   1 "C3'" 1 
ATOM   5697  O  "O3'" . C   J  10 9   ? -44.000  -0.100  44.226  1.00 105.91 ? 9   C   1 "O3'" 1 
ATOM   5698  C  "C2'" . C   J  10 9   ? -41.933  1.181   44.159  1.00 99.57  ? 9   C   1 "C2'" 1 
ATOM   5699  O  "O2'" . C   J  10 9   ? -41.661  0.717   42.856  1.00 109.51 ? 9   C   1 "O2'" 1 
ATOM   5700  C  "C1'" . C   J  10 9   ? -41.700  2.680   44.175  1.00 88.22  ? 9   C   1 "C1'" 1 
ATOM   5701  N  N1    . C   J  10 9   ? -41.273  3.166   45.499  1.00 85.92  ? 9   C   1 N1    1 
ATOM   5702  C  C2    . C   J  10 9   ? -39.900  3.356   45.727  1.00 91.98  ? 9   C   1 C2    1 
ATOM   5703  O  O2    . C   J  10 9   ? -39.081  3.047   44.844  1.00 93.62  ? 9   C   1 O2    1 
ATOM   5704  N  N3    . C   J  10 9   ? -39.494  3.877   46.903  1.00 86.11  ? 9   C   1 N3    1 
ATOM   5705  C  C4    . C   J  10 9   ? -40.387  4.222   47.828  1.00 92.13  ? 9   C   1 C4    1 
ATOM   5706  N  N4    . C   J  10 9   ? -39.919  4.721   48.972  1.00 102.10 ? 9   C   1 N4    1 
ATOM   5707  C  C5    . C   J  10 9   ? -41.787  4.029   47.634  1.00 86.17  ? 9   C   1 C5    1 
ATOM   5708  C  C6    . C   J  10 9   ? -42.182  3.511   46.463  1.00 82.40  ? 9   C   1 C6    1 
ATOM   5709  P  P     . U   J  10 10  ? -44.090  -1.282  45.302  1.00 103.07 ? 10  U   1 P     1 
ATOM   5710  O  OP1   . U   J  10 10  ? -44.433  -2.493  44.499  1.00 107.23 ? 10  U   1 OP1   1 
ATOM   5711  O  OP2   . U   J  10 10  ? -44.966  -0.880  46.437  1.00 93.36  ? 10  U   1 OP2   1 
ATOM   5712  O  "O5'" . U   J  10 10  ? -42.611  -1.325  45.897  1.00 87.53  ? 10  U   1 "O5'" 1 
ATOM   5713  C  "C5'" . U   J  10 10  ? -41.825  -2.421  45.438  1.00 91.16  ? 10  U   1 "C5'" 1 
ATOM   5714  C  "C4'" . U   J  10 10  ? -40.386  -2.310  45.825  1.00 86.98  ? 10  U   1 "C4'" 1 
ATOM   5715  O  "O4'" . U   J  10 10  ? -40.015  -0.952  46.089  1.00 79.80  ? 10  U   1 "O4'" 1 
ATOM   5716  C  "C3'" . U   J  10 10  ? -39.969  -3.015  47.098  1.00 85.39  ? 10  U   1 "C3'" 1 
ATOM   5717  O  "O3'" . U   J  10 10  ? -39.915  -4.416  46.880  1.00 92.59  ? 10  U   1 "O3'" 1 
ATOM   5718  C  "C2'" . U   J  10 10  ? -38.591  -2.409  47.295  1.00 86.60  ? 10  U   1 "C2'" 1 
ATOM   5719  O  "O2'" . U   J  10 10  ? -37.624  -3.000  46.447  1.00 81.43  ? 10  U   1 "O2'" 1 
ATOM   5720  C  "C1'" . U   J  10 10  ? -38.847  -0.962  46.879  1.00 86.83  ? 10  U   1 "C1'" 1 
ATOM   5721  N  N1    . U   J  10 10  ? -39.060  -0.028  47.991  1.00 99.13  ? 10  U   1 N1    1 
ATOM   5722  C  C2    . U   J  10 10  ? -37.936  0.536   48.568  1.00 98.29  ? 10  U   1 C2    1 
ATOM   5723  O  O2    . U   J  10 10  ? -36.799  0.232   48.241  1.00 91.13  ? 10  U   1 O2    1 
ATOM   5724  N  N3    . U   J  10 10  ? -38.196  1.445   49.566  1.00 104.62 ? 10  U   1 N3    1 
ATOM   5725  C  C4    . U   J  10 10  ? -39.439  1.859   50.017  1.00 109.43 ? 10  U   1 C4    1 
ATOM   5726  O  O4    . U   J  10 10  ? -39.510  2.692   50.926  1.00 111.00 ? 10  U   1 O4    1 
ATOM   5727  C  C5    . U   J  10 10  ? -40.552  1.245   49.352  1.00 110.37 ? 10  U   1 C5    1 
ATOM   5728  C  C6    . U   J  10 10  ? -40.331  0.349   48.383  1.00 107.78 ? 10  U   1 C6    1 
ATOM   5729  P  P     . G   J  10 11  ? -40.272  -5.391  48.053  1.00 99.36  ? 11  G   1 P     1 
ATOM   5730  O  OP1   . G   J  10 11  ? -40.279  -6.749  47.474  1.00 98.66  ? 11  G   1 OP1   1 
ATOM   5731  O  OP2   . G   J  10 11  ? -41.457  -4.864  48.755  1.00 101.21 ? 11  G   1 OP2   1 
ATOM   5732  O  "O5'" . G   J  10 11  ? -39.029  -5.233  49.022  1.00 103.06 ? 11  G   1 "O5'" 1 
ATOM   5733  C  "C5'" . G   J  10 11  ? -37.723  -5.617  48.579  1.00 109.40 ? 11  G   1 "C5'" 1 
ATOM   5734  C  "C4'" . G   J  10 11  ? -36.781  -5.450  49.735  1.00 111.20 ? 11  G   1 "C4'" 1 
ATOM   5735  O  "O4'" . G   J  10 11  ? -36.877  -4.061  50.164  1.00 113.79 ? 11  G   1 "O4'" 1 
ATOM   5736  C  "C3'" . G   J  10 11  ? -37.123  -6.315  50.947  1.00 109.06 ? 11  G   1 "C3'" 1 
ATOM   5737  O  "O3'" . G   J  10 11  ? -35.943  -6.707  51.645  1.00 109.05 ? 11  G   1 "O3'" 1 
ATOM   5738  C  "C2'" . G   J  10 11  ? -37.975  -5.371  51.785  1.00 112.91 ? 11  G   1 "C2'" 1 
ATOM   5739  O  "O2'" . G   J  10 11  ? -38.033  -5.813  53.122  1.00 110.86 ? 11  G   1 "O2'" 1 
ATOM   5740  C  "C1'" . G   J  10 11  ? -37.291  -4.025  51.507  1.00 114.93 ? 11  G   1 "C1'" 1 
ATOM   5741  N  N9    . G   J  10 11  ? -38.123  -2.839  51.696  1.00 115.24 ? 11  G   1 N9    1 
ATOM   5742  C  C8    . G   J  10 11  ? -39.447  -2.677  51.360  1.00 111.40 ? 11  G   1 C8    1 
ATOM   5743  N  N7    . G   J  10 11  ? -39.939  -1.531  51.746  1.00 112.90 ? 11  G   1 N7    1 
ATOM   5744  C  C5    . G   J  10 11  ? -38.878  -0.898  52.384  1.00 125.09 ? 11  G   1 C5    1 
ATOM   5745  C  C6    . G   J  10 11  ? -38.804  0.377   53.029  1.00 125.10 ? 11  G   1 C6    1 
ATOM   5746  O  O6    . G   J  10 11  ? -39.693  1.231   53.167  1.00 116.65 ? 11  G   1 O6    1 
ATOM   5747  N  N1    . G   J  10 11  ? -37.523  0.629   53.521  1.00 118.03 ? 11  G   1 N1    1 
ATOM   5748  C  C2    . G   J  10 11  ? -36.452  -0.227  53.415  1.00 107.21 ? 11  G   1 C2    1 
ATOM   5749  N  N2    . G   J  10 11  ? -35.300  0.194   53.959  1.00 101.65 ? 11  G   1 N2    1 
ATOM   5750  N  N3    . G   J  10 11  ? -36.514  -1.422  52.844  1.00 112.22 ? 11  G   1 N3    1 
ATOM   5751  C  C4    . G   J  10 11  ? -37.741  -1.681  52.334  1.00 120.24 ? 11  G   1 C4    1 
ATOM   5752  P  P     . G   J  10 12  ? -35.187  -8.092  51.296  1.00 114.05 ? 12  G   1 P     1 
ATOM   5753  O  OP1   . G   J  10 12  ? -33.711  -7.866  51.328  1.00 103.86 ? 12  G   1 OP1   1 
ATOM   5754  O  OP2   . G   J  10 12  ? -35.749  -8.609  50.027  1.00 119.52 ? 12  G   1 OP2   1 
ATOM   5755  O  "O5'" . G   J  10 12  ? -35.645  -9.016  52.511  1.00 97.14  ? 12  G   1 "O5'" 1 
ATOM   5756  C  "C5'" . G   J  10 12  ? -37.016  -9.054  52.945  1.00 88.45  ? 12  G   1 "C5'" 1 
ATOM   5757  C  "C4'" . G   J  10 12  ? -37.319  -10.364 53.637  1.00 86.14  ? 12  G   1 "C4'" 1 
ATOM   5758  O  "O4'" . G   J  10 12  ? -37.180  -11.467 52.694  1.00 86.14  ? 12  G   1 "O4'" 1 
ATOM   5759  C  "C3'" . G   J  10 12  ? -36.388  -10.746 54.779  1.00 84.17  ? 12  G   1 "C3'" 1 
ATOM   5760  O  "O3'" . G   J  10 12  ? -36.668  -10.087 56.000  1.00 78.89  ? 12  G   1 "O3'" 1 
ATOM   5761  C  "C2'" . G   J  10 12  ? -36.545  -12.263 54.834  1.00 78.84  ? 12  G   1 "C2'" 1 
ATOM   5762  O  "O2'" . G   J  10 12  ? -37.671  -12.736 55.525  1.00 76.09  ? 12  G   1 "O2'" 1 
ATOM   5763  C  "C1'" . G   J  10 12  ? -36.599  -12.597 53.343  1.00 77.64  ? 12  G   1 "C1'" 1 
ATOM   5764  N  N9    . G   J  10 12  ? -35.288  -12.887 52.765  1.00 66.75  ? 12  G   1 N9    1 
ATOM   5765  C  C8    . G   J  10 12  ? -34.599  -12.140 51.843  1.00 65.11  ? 12  G   1 C8    1 
ATOM   5766  N  N7    . G   J  10 12  ? -33.447  -12.664 51.520  1.00 63.12  ? 12  G   1 N7    1 
ATOM   5767  C  C5    . G   J  10 12  ? -33.358  -13.810 52.293  1.00 58.65  ? 12  G   1 C5    1 
ATOM   5768  C  C6    . G   J  10 12  ? -32.332  -14.785 52.376  1.00 55.98  ? 12  G   1 C6    1 
ATOM   5769  O  O6    . G   J  10 12  ? -31.265  -14.828 51.769  1.00 57.76  ? 12  G   1 O6    1 
ATOM   5770  N  N1    . G   J  10 12  ? -32.638  -15.781 53.293  1.00 53.29  ? 12  G   1 N1    1 
ATOM   5771  C  C2    . G   J  10 12  ? -33.783  -15.824 54.043  1.00 61.98  ? 12  G   1 C2    1 
ATOM   5772  N  N2    . G   J  10 12  ? -33.888  -16.854 54.886  1.00 69.63  ? 12  G   1 N2    1 
ATOM   5773  N  N3    . G   J  10 12  ? -34.756  -14.926 53.972  1.00 66.65  ? 12  G   1 N3    1 
ATOM   5774  C  C4    . G   J  10 12  ? -34.482  -13.957 53.075  1.00 64.15  ? 12  G   1 C4    1 
ATOM   5775  P  P     . C   J  10 13  ? -35.478  -9.763  57.033  1.00 89.77  ? 13  C   1 P     1 
ATOM   5776  O  OP1   . C   J  10 13  ? -36.087  -8.935  58.111  1.00 109.83 ? 13  C   1 OP1   1 
ATOM   5777  O  OP2   . C   J  10 13  ? -34.259  -9.307  56.304  1.00 83.34  ? 13  C   1 OP2   1 
ATOM   5778  O  "O5'" . C   J  10 13  ? -35.124  -11.170 57.682  1.00 89.16  ? 13  C   1 "O5'" 1 
ATOM   5779  C  "C5'" . C   J  10 13  ? -36.084  -11.931 58.436  1.00 88.70  ? 13  C   1 "C5'" 1 
ATOM   5780  C  "C4'" . C   J  10 13  ? -35.434  -13.235 58.826  1.00 90.70  ? 13  C   1 "C4'" 1 
ATOM   5781  O  "O4'" . C   J  10 13  ? -35.086  -13.963 57.619  1.00 85.62  ? 13  C   1 "O4'" 1 
ATOM   5782  C  "C3'" . C   J  10 13  ? -34.086  -13.117 59.527  1.00 93.18  ? 13  C   1 "C3'" 1 
ATOM   5783  O  "O3'" . C   J  10 13  ? -34.095  -12.761 60.904  1.00 99.33  ? 13  C   1 "O3'" 1 
ATOM   5784  C  "C2'" . C   J  10 13  ? -33.502  -14.502 59.300  1.00 86.26  ? 13  C   1 "C2'" 1 
ATOM   5785  O  "O2'" . C   J  10 13  ? -33.978  -15.505 60.175  1.00 86.72  ? 13  C   1 "O2'" 1 
ATOM   5786  C  "C1'" . C   J  10 13  ? -33.918  -14.727 57.849  1.00 78.14  ? 13  C   1 "C1'" 1 
ATOM   5787  N  N1    . C   J  10 13  ? -32.871  -14.324 56.909  1.00 67.46  ? 13  C   1 N1    1 
ATOM   5788  C  C2    . C   J  10 13  ? -31.733  -15.132 56.817  1.00 70.67  ? 13  C   1 C2    1 
ATOM   5789  O  O2    . C   J  10 13  ? -31.659  -16.150 57.523  1.00 76.57  ? 13  C   1 O2    1 
ATOM   5790  N  N3    . C   J  10 13  ? -30.741  -14.788 55.968  1.00 66.98  ? 13  C   1 N3    1 
ATOM   5791  C  C4    . C   J  10 13  ? -30.844  -13.675 55.244  1.00 71.75  ? 13  C   1 C4    1 
ATOM   5792  N  N4    . C   J  10 13  ? -29.858  -13.400 54.395  1.00 78.60  ? 13  C   1 N4    1 
ATOM   5793  C  C5    . C   J  10 13  ? -31.989  -12.828 55.318  1.00 69.46  ? 13  C   1 C5    1 
ATOM   5794  C  C6    . C   J  10 13  ? -32.963  -13.179 56.170  1.00 67.19  ? 13  C   1 C6    1 
ATOM   5795  P  P     . A   J  10 14  ? -32.805  -12.053 61.528  1.00 98.71  ? 14  A   1 P     1 
ATOM   5796  O  OP1   . A   J  10 14  ? -33.213  -11.624 62.882  1.00 102.48 ? 14  A   1 OP1   1 
ATOM   5797  O  OP2   . A   J  10 14  ? -32.261  -11.086 60.529  1.00 96.22  ? 14  A   1 OP2   1 
ATOM   5798  O  "O5'" . A   J  10 14  ? -31.726  -13.222 61.640  1.00 82.77  ? 14  A   1 "O5'" 1 
ATOM   5799  C  "C5'" . A   J  10 14  ? -31.905  -14.305 62.552  1.00 83.08  ? 14  A   1 "C5'" 1 
ATOM   5800  C  "C4'" . A   J  10 14  ? -30.783  -15.278 62.334  1.00 89.43  ? 14  A   1 "C4'" 1 
ATOM   5801  O  "O4'" . A   J  10 14  ? -30.667  -15.550 60.918  1.00 83.51  ? 14  A   1 "O4'" 1 
ATOM   5802  C  "C3'" . A   J  10 14  ? -29.384  -14.770 62.678  1.00 101.14 ? 14  A   1 "C3'" 1 
ATOM   5803  O  "O3'" . A   J  10 14  ? -29.056  -14.745 64.066  1.00 110.61 ? 14  A   1 "O3'" 1 
ATOM   5804  C  "C2'" . A   J  10 14  ? -28.503  -15.735 61.888  1.00 94.11  ? 14  A   1 "C2'" 1 
ATOM   5805  O  "O2'" . A   J  10 14  ? -28.242  -17.001 62.455  1.00 91.37  ? 14  A   1 "O2'" 1 
ATOM   5806  C  "C1'" . A   J  10 14  ? -29.324  -15.873 60.614  1.00 85.25  ? 14  A   1 "C1'" 1 
ATOM   5807  N  N9    . A   J  10 14  ? -28.848  -14.983 59.569  1.00 75.84  ? 14  A   1 N9    1 
ATOM   5808  C  C8    . A   J  10 14  ? -29.391  -13.828 59.061  1.00 79.05  ? 14  A   1 C8    1 
ATOM   5809  N  N7    . A   J  10 14  ? -28.694  -13.306 58.078  1.00 79.23  ? 14  A   1 N7    1 
ATOM   5810  C  C5    . A   J  10 14  ? -27.614  -14.165 57.943  1.00 76.36  ? 14  A   1 C5    1 
ATOM   5811  C  C6    . A   J  10 14  ? -26.505  -14.154 57.085  1.00 74.09  ? 14  A   1 C6    1 
ATOM   5812  N  N6    . A   J  10 14  ? -26.308  -13.215 56.159  1.00 79.34  ? 14  A   1 N6    1 
ATOM   5813  N  N1    . A   J  10 14  ? -25.600  -15.150 57.213  1.00 71.27  ? 14  A   1 N1    1 
ATOM   5814  C  C2    . A   J  10 14  ? -25.810  -16.095 58.144  1.00 75.59  ? 14  A   1 C2    1 
ATOM   5815  N  N3    . A   J  10 14  ? -26.821  -16.218 59.008  1.00 76.80  ? 14  A   1 N3    1 
ATOM   5816  C  C4    . A   J  10 14  ? -27.697  -15.206 58.854  1.00 78.50  ? 14  A   1 C4    1 
ATOM   5817  P  P     . G   J  10 15  ? -27.862  -13.825 64.607  1.00 110.38 ? 15  G   1 P     1 
ATOM   5818  O  OP1   . G   J  10 15  ? -27.918  -13.924 66.079  1.00 118.23 ? 15  G   1 OP1   1 
ATOM   5819  O  OP2   . G   J  10 15  ? -27.895  -12.499 63.932  1.00 93.78  ? 15  G   1 OP2   1 
ATOM   5820  O  "O5'" . G   J  10 15  ? -26.549  -14.594 64.133  1.00 98.62  ? 15  G   1 "O5'" 1 
ATOM   5821  C  "C5'" . G   J  10 15  ? -26.081  -15.787 64.792  1.00 99.43  ? 15  G   1 "C5'" 1 
ATOM   5822  C  "C4'" . G   J  10 15  ? -24.778  -16.193 64.152  1.00 106.66 ? 15  G   1 "C4'" 1 
ATOM   5823  O  "O4'" . G   J  10 15  ? -24.982  -16.363 62.721  1.00 109.93 ? 15  G   1 "O4'" 1 
ATOM   5824  C  "C3'" . G   J  10 15  ? -23.674  -15.147 64.211  1.00 114.74 ? 15  G   1 "C3'" 1 
ATOM   5825  O  "O3'" . G   J  10 15  ? -22.996  -15.073 65.459  1.00 122.38 ? 15  G   1 "O3'" 1 
ATOM   5826  C  "C2'" . G   J  10 15  ? -22.780  -15.568 63.050  1.00 107.78 ? 15  G   1 "C2'" 1 
ATOM   5827  O  "O2'" . G   J  10 15  ? -21.914  -16.652 63.311  1.00 102.19 ? 15  G   1 "O2'" 1 
ATOM   5828  C  "C1'" . G   J  10 15  ? -23.833  -15.928 62.009  1.00 94.69  ? 15  G   1 "C1'" 1 
ATOM   5829  N  N9    . G   J  10 15  ? -24.203  -14.795 61.173  1.00 80.79  ? 15  G   1 N9    1 
ATOM   5830  C  C8    . G   J  10 15  ? -25.292  -13.963 61.294  1.00 79.34  ? 15  G   1 C8    1 
ATOM   5831  N  N7    . G   J  10 15  ? -25.357  -13.057 60.357  1.00 74.10  ? 15  G   1 N7    1 
ATOM   5832  C  C5    . G   J  10 15  ? -24.211  -13.267 59.604  1.00 71.60  ? 15  G   1 C5    1 
ATOM   5833  C  C6    . G   J  10 15  ? -23.726  -12.578 58.464  1.00 68.94  ? 15  G   1 C6    1 
ATOM   5834  O  O6    . G   J  10 15  ? -24.232  -11.628 57.853  1.00 73.78  ? 15  G   1 O6    1 
ATOM   5835  N  N1    . G   J  10 15  ? -22.526  -13.118 58.023  1.00 67.99  ? 15  G   1 N1    1 
ATOM   5836  C  C2    . G   J  10 15  ? -21.861  -14.168 58.608  1.00 65.99  ? 15  G   1 C2    1 
ATOM   5837  N  N2    . G   J  10 15  ? -20.707  -14.520 58.021  1.00 62.49  ? 15  G   1 N2    1 
ATOM   5838  N  N3    . G   J  10 15  ? -22.313  -14.839 59.661  1.00 64.34  ? 15  G   1 N3    1 
ATOM   5839  C  C4    . G   J  10 15  ? -23.482  -14.332 60.104  1.00 72.26  ? 15  G   1 C4    1 
ATOM   5840  P  P     . U   J  10 16  ? -22.362  -13.684 65.939  1.00 122.60 ? 16  U   1 P     1 
ATOM   5841  O  OP1   . U   J  10 16  ? -21.837  -13.923 67.306  1.00 132.35 ? 16  U   1 OP1   1 
ATOM   5842  O  OP2   . U   J  10 16  ? -23.342  -12.596 65.667  1.00 116.92 ? 16  U   1 OP2   1 
ATOM   5843  O  "O5'" . U   J  10 16  ? -21.120  -13.455 64.970  1.00 100.80 ? 16  U   1 "O5'" 1 
ATOM   5844  C  "C5'" . U   J  10 16  ? -19.897  -14.185 65.129  1.00 100.32 ? 16  U   1 "C5'" 1 
ATOM   5845  C  "C4'" . U   J  10 16  ? -19.016  -13.945 63.929  1.00 104.66 ? 16  U   1 "C4'" 1 
ATOM   5846  O  "O4'" . U   J  10 16  ? -19.815  -14.080 62.726  1.00 95.14  ? 16  U   1 "O4'" 1 
ATOM   5847  C  "C3'" . U   J  10 16  ? -18.443  -12.540 63.797  1.00 122.50 ? 16  U   1 "C3'" 1 
ATOM   5848  O  "O3'" . U   J  10 16  ? -17.368  -12.201 64.681  1.00 142.67 ? 16  U   1 "O3'" 1 
ATOM   5849  C  "C2'" . U   J  10 16  ? -18.124  -12.473 62.305  1.00 106.63 ? 16  U   1 "C2'" 1 
ATOM   5850  O  "O2'" . U   J  10 16  ? -16.937  -13.075 61.847  1.00 112.30 ? 16  U   1 "O2'" 1 
ATOM   5851  C  "C1'" . U   J  10 16  ? -19.346  -13.183 61.738  1.00 94.15  ? 16  U   1 "C1'" 1 
ATOM   5852  N  N1    . U   J  10 16  ? -20.411  -12.230 61.386  1.00 92.91  ? 16  U   1 N1    1 
ATOM   5853  C  C2    . U   J  10 16  ? -20.190  -11.479 60.245  1.00 92.88  ? 16  U   1 C2    1 
ATOM   5854  O  O2    . U   J  10 16  ? -19.191  -11.598 59.554  1.00 85.14  ? 16  U   1 O2    1 
ATOM   5855  N  N3    . U   J  10 16  ? -21.202  -10.609 59.921  1.00 93.61  ? 16  U   1 N3    1 
ATOM   5856  C  C4    . U   J  10 16  ? -22.373  -10.374 60.612  1.00 101.74 ? 16  U   1 C4    1 
ATOM   5857  O  O4    . U   J  10 16  ? -23.183  -9.543  60.175  1.00 102.08 ? 16  U   1 O4    1 
ATOM   5858  C  C5    . U   J  10 16  ? -22.519  -11.169 61.800  1.00 101.00 ? 16  U   1 C5    1 
ATOM   5859  C  C6    . U   J  10 16  ? -21.560  -12.051 62.135  1.00 93.28  ? 16  U   1 C6    1 
ATOM   5860  P  P     . G   J  10 17  ? -17.209  -10.692 65.230  1.00 145.42 ? 17  G   1 P     1 
ATOM   5861  O  OP1   . G   J  10 17  ? -16.185  -10.739 66.298  1.00 156.29 ? 17  G   1 OP1   1 
ATOM   5862  O  OP2   . G   J  10 17  ? -18.559  -10.114 65.486  1.00 129.58 ? 17  G   1 OP2   1 
ATOM   5863  O  "O5'" . G   J  10 17  ? -16.573  -9.912  64.000  1.00 132.98 ? 17  G   1 "O5'" 1 
ATOM   5864  C  "C5'" . G   J  10 17  ? -15.297  -10.322 63.481  1.00 142.70 ? 17  G   1 "C5'" 1 
ATOM   5865  C  "C4'" . G   J  10 17  ? -14.985  -9.465  62.284  1.00 151.52 ? 17  G   1 "C4'" 1 
ATOM   5866  O  "O4'" . G   J  10 17  ? -16.054  -9.658  61.327  1.00 145.42 ? 17  G   1 "O4'" 1 
ATOM   5867  C  "C3'" . G   J  10 17  ? -14.951  -7.965  62.564  1.00 161.19 ? 17  G   1 "C3'" 1 
ATOM   5868  O  "O3'" . G   J  10 17  ? -13.644  -7.558  62.972  1.00 171.17 ? 17  G   1 "O3'" 1 
ATOM   5869  C  "C2'" . G   J  10 17  ? -15.445  -7.336  61.260  1.00 150.44 ? 17  G   1 "C2'" 1 
ATOM   5870  O  "O2'" . G   J  10 17  ? -14.445  -6.951  60.339  1.00 147.18 ? 17  G   1 "O2'" 1 
ATOM   5871  C  "C1'" . G   J  10 17  ? -16.356  -8.427  60.697  1.00 136.30 ? 17  G   1 "C1'" 1 
ATOM   5872  N  N9    . G   J  10 17  ? -17.788  -8.170  60.824  1.00 127.40 ? 17  G   1 N9    1 
ATOM   5873  C  C8    . G   J  10 17  ? -18.670  -8.612  61.785  1.00 122.95 ? 17  G   1 C8    1 
ATOM   5874  N  N7    . G   J  10 17  ? -19.899  -8.220  61.571  1.00 127.33 ? 17  G   1 N7    1 
ATOM   5875  C  C5    . G   J  10 17  ? -19.827  -7.479  60.396  1.00 122.09 ? 17  G   1 C5    1 
ATOM   5876  C  C6    . G   J  10 17  ? -20.843  -6.784  59.658  1.00 108.37 ? 17  G   1 C6    1 
ATOM   5877  O  O6    . G   J  10 17  ? -22.058  -6.689  59.887  1.00 99.71  ? 17  G   1 O6    1 
ATOM   5878  N  N1    . G   J  10 17  ? -20.313  -6.160  58.538  1.00 97.76  ? 17  G   1 N1    1 
ATOM   5879  C  C2    . G   J  10 17  ? -18.997  -6.186  58.162  1.00 97.16  ? 17  G   1 C2    1 
ATOM   5880  N  N2    . G   J  10 17  ? -18.697  -5.531  57.040  1.00 100.50 ? 17  G   1 N2    1 
ATOM   5881  N  N3    . G   J  10 17  ? -18.044  -6.807  58.835  1.00 101.07 ? 17  G   1 N3    1 
ATOM   5882  C  C4    . G   J  10 17  ? -18.527  -7.435  59.928  1.00 117.99 ? 17  G   1 C4    1 
ATOM   5883  P  P     . A   J  10 18  ? -13.421  -6.239  63.866  1.00 160.68 ? 18  A   1 P     1 
ATOM   5884  O  OP1   . A   J  10 18  ? -13.221  -5.075  62.951  1.00 146.54 ? 18  A   1 OP1   1 
ATOM   5885  O  OP2   . A   J  10 18  ? -12.433  -6.554  64.940  1.00 157.34 ? 18  A   1 OP2   1 
ATOM   5886  O  "O5'" . A   J  10 18  ? -14.821  -6.061  64.591  1.00 146.61 ? 18  A   1 "O5'" 1 
ATOM   5887  C  "C5'" . A   J  10 18  ? -14.880  -5.887  66.002  1.00 145.11 ? 18  A   1 "C5'" 1 
ATOM   5888  C  "C4'" . A   J  10 18  ? -16.273  -5.507  66.401  1.00 143.85 ? 18  A   1 "C4'" 1 
ATOM   5889  O  "O4'" . A   J  10 18  ? -16.747  -4.435  65.540  1.00 149.72 ? 18  A   1 "O4'" 1 
ATOM   5890  C  "C3'" . A   J  10 18  ? -17.280  -6.643  66.270  1.00 148.73 ? 18  A   1 "C3'" 1 
ATOM   5891  O  "O3'" . A   J  10 18  ? -18.326  -6.517  67.222  1.00 151.23 ? 18  A   1 "O3'" 1 
ATOM   5892  C  "C2'" . A   J  10 18  ? -17.824  -6.421  64.864  1.00 158.11 ? 18  A   1 "C2'" 1 
ATOM   5893  O  "O2'" . A   J  10 18  ? -19.055  -7.071  64.625  1.00 162.91 ? 18  A   1 "O2'" 1 
ATOM   5894  C  "C1'" . A   J  10 18  ? -17.853  -4.890  64.789  1.00 156.72 ? 18  A   1 "C1'" 1 
ATOM   5895  N  N9    . A   J  10 18  ? -17.761  -4.337  63.434  1.00 154.86 ? 18  A   1 N9    1 
ATOM   5896  C  C8    . A   J  10 18  ? -16.644  -4.038  62.689  1.00 141.90 ? 18  A   1 C8    1 
ATOM   5897  N  N7    . A   J  10 18  ? -16.917  -3.599  61.483  1.00 135.57 ? 18  A   1 N7    1 
ATOM   5898  C  C5    . A   J  10 18  ? -18.306  -3.580  61.440  1.00 145.37 ? 18  A   1 C5    1 
ATOM   5899  C  C6    . A   J  10 18  ? -19.222  -3.204  60.438  1.00 142.59 ? 18  A   1 C6    1 
ATOM   5900  N  N6    . A   J  10 18  ? -18.864  -2.744  59.240  1.00 134.92 ? 18  A   1 N6    1 
ATOM   5901  N  N1    . A   J  10 18  ? -20.542  -3.335  60.708  1.00 152.10 ? 18  A   1 N1    1 
ATOM   5902  C  C2    . A   J  10 18  ? -20.913  -3.795  61.912  1.00 149.64 ? 18  A   1 C2    1 
ATOM   5903  N  N3    . A   J  10 18  ? -20.146  -4.172  62.937  1.00 151.75 ? 18  A   1 N3    1 
ATOM   5904  C  C4    . A   J  10 18  ? -18.839  -4.040  62.633  1.00 155.18 ? 18  A   1 C4    1 
ATOM   5905  P  P     . G   J  10 19  ? -18.031  -6.690  68.759  1.00 159.34 ? 19  G   1 P     1 
ATOM   5906  O  OP1   . G   J  10 19  ? -17.024  -7.768  68.951  1.00 149.27 ? 19  G   1 OP1   1 
ATOM   5907  O  OP2   . G   J  10 19  ? -19.341  -6.773  69.458  1.00 155.72 ? 19  G   1 OP2   1 
ATOM   5908  O  "O5'" . G   J  10 19  ? -17.306  -5.305  69.091  1.00 177.36 ? 19  G   1 "O5'" 1 
ATOM   5909  C  "C5'" . G   J  10 19  ? -17.362  -4.679  70.382  1.00 191.35 ? 19  G   1 "C5'" 1 
ATOM   5910  C  "C4'" . G   J  10 19  ? -15.985  -4.511  70.988  1.00 193.57 ? 19  G   1 "C4'" 1 
ATOM   5911  O  "O4'" . G   J  10 19  ? -14.926  -4.984  70.116  1.00 195.37 ? 19  G   1 "O4'" 1 
ATOM   5912  C  "C3'" . G   J  10 19  ? -15.564  -3.075  71.251  1.00 190.96 ? 19  G   1 "C3'" 1 
ATOM   5913  O  "O3'" . G   J  10 19  ? -16.230  -2.611  72.418  1.00 182.62 ? 19  G   1 "O3'" 1 
ATOM   5914  C  "C2'" . G   J  10 19  ? -14.043  -3.179  71.390  1.00 188.04 ? 19  G   1 "C2'" 1 
ATOM   5915  O  "O2'" . G   J  10 19  ? -13.616  -3.235  72.738  1.00 183.66 ? 19  G   1 "O2'" 1 
ATOM   5916  C  "C1'" . G   J  10 19  ? -13.701  -4.428  70.565  1.00 186.83 ? 19  G   1 "C1'" 1 
ATOM   5917  N  N9    . G   J  10 19  ? -12.821  -4.194  69.418  1.00 182.32 ? 19  G   1 N9    1 
ATOM   5918  C  C8    . G   J  10 19  ? -11.550  -4.693  69.261  1.00 168.25 ? 19  G   1 C8    1 
ATOM   5919  N  N7    . G   J  10 19  ? -10.993  -4.337  68.134  1.00 173.67 ? 19  G   1 N7    1 
ATOM   5920  C  C5    . G   J  10 19  ? -11.946  -3.542  67.511  1.00 176.25 ? 19  G   1 C5    1 
ATOM   5921  C  C6    . G   J  10 19  ? -11.910  -2.859  66.254  1.00 166.85 ? 19  G   1 C6    1 
ATOM   5922  O  O6    . G   J  10 19  ? -10.995  -2.819  65.417  1.00 152.47 ? 19  G   1 O6    1 
ATOM   5923  N  N1    . G   J  10 19  ? -13.104  -2.189  66.000  1.00 165.25 ? 19  G   1 N1    1 
ATOM   5924  C  C2    . G   J  10 19  ? -14.187  -2.159  66.848  1.00 169.83 ? 19  G   1 C2    1 
ATOM   5925  N  N2    . G   J  10 19  ? -15.255  -1.468  66.419  1.00 164.26 ? 19  G   1 N2    1 
ATOM   5926  N  N3    . G   J  10 19  ? -14.231  -2.780  68.022  1.00 183.03 ? 19  G   1 N3    1 
ATOM   5927  C  C4    . G   J  10 19  ? -13.084  -3.445  68.289  1.00 185.54 ? 19  G   1 C4    1 
ATOM   5928  P  P     . G   J  10 20  ? -16.124  -1.092  72.797  1.00 182.10 ? 20  G   1 P     1 
ATOM   5929  O  OP1   . G   J  10 20  ? -17.113  -0.373  71.955  1.00 191.27 ? 20  G   1 OP1   1 
ATOM   5930  O  OP2   . G   J  10 20  ? -14.697  -0.693  72.733  1.00 170.13 ? 20  G   1 OP2   1 
ATOM   5931  O  "O5'" . G   J  10 20  ? -16.593  -1.109  74.319  1.00 163.13 ? 20  G   1 "O5'" 1 
ATOM   5932  C  "C5'" . G   J  10 20  ? -16.249  -2.150  75.256  1.00 146.94 ? 20  G   1 "C5'" 1 
ATOM   5933  C  "C4'" . G   J  10 20  ? -17.386  -2.376  76.228  1.00 138.30 ? 20  G   1 "C4'" 1 
ATOM   5934  O  "O4'" . G   J  10 20  ? -17.804  -1.119  76.837  1.00 130.05 ? 20  G   1 "O4'" 1 
ATOM   5935  C  "C3'" . G   J  10 20  ? -18.670  -2.914  75.612  1.00 143.86 ? 20  G   1 "C3'" 1 
ATOM   5936  O  "O3'" . G   J  10 20  ? -18.717  -4.316  75.404  1.00 152.06 ? 20  G   1 "O3'" 1 
ATOM   5937  C  "C2'" . G   J  10 20  ? -19.714  -2.500  76.639  1.00 133.59 ? 20  G   1 "C2'" 1 
ATOM   5938  O  "O2'" . G   J  10 20  ? -19.790  -3.349  77.763  1.00 129.54 ? 20  G   1 "O2'" 1 
ATOM   5939  C  "C1'" . G   J  10 20  ? -19.210  -1.108  76.996  1.00 124.02 ? 20  G   1 "C1'" 1 
ATOM   5940  N  N9    . G   J  10 20  ? -19.773  -0.059  76.157  1.00 112.61 ? 20  G   1 N9    1 
ATOM   5941  C  C8    . G   J  10 20  ? -19.164  0.627   75.134  1.00 115.86 ? 20  G   1 C8    1 
ATOM   5942  N  N7    . G   J  10 20  ? -19.928  1.540   74.602  1.00 112.47 ? 20  G   1 N7    1 
ATOM   5943  C  C5    . G   J  10 20  ? -21.098  1.478   75.342  1.00 100.86 ? 20  G   1 C5    1 
ATOM   5944  C  C6    . G   J  10 20  ? -22.275  2.245   75.247  1.00 101.64 ? 20  G   1 C6    1 
ATOM   5945  O  O6    . G   J  10 20  ? -22.521  3.186   74.480  1.00 108.96 ? 20  G   1 O6    1 
ATOM   5946  N  N1    . G   J  10 20  ? -23.227  1.829   76.172  1.00 98.69  ? 20  G   1 N1    1 
ATOM   5947  C  C2    . G   J  10 20  ? -23.069  0.807   77.075  1.00 98.75  ? 20  G   1 C2    1 
ATOM   5948  N  N2    . G   J  10 20  ? -24.104  0.562   77.897  1.00 88.96  ? 20  G   1 N2    1 
ATOM   5949  N  N3    . G   J  10 20  ? -21.965  0.087   77.175  1.00 99.99  ? 20  G   1 N3    1 
ATOM   5950  C  C4    . G   J  10 20  ? -21.031  0.471   76.280  1.00 100.76 ? 20  G   1 C4    1 
ATOM   5951  P  P     . U   J  10 21  ? -19.700  -4.897  74.297  1.00 144.20 ? 21  U   1 P     1 
ATOM   5952  O  OP1   . U   J  10 21  ? -19.497  -6.373  74.305  1.00 137.48 ? 21  U   1 OP1   1 
ATOM   5953  O  OP2   . U   J  10 21  ? -19.530  -4.054  73.054  1.00 115.40 ? 21  U   1 OP2   1 
ATOM   5954  O  "O5'" . U   J  10 21  ? -21.141  -4.729  74.942  1.00 130.01 ? 21  U   1 "O5'" 1 
ATOM   5955  C  "C5'" . U   J  10 21  ? -21.586  -5.510  76.064  1.00 118.00 ? 21  U   1 "C5'" 1 
ATOM   5956  C  "C4'" . U   J  10 21  ? -22.971  -5.037  76.433  1.00 122.10 ? 21  U   1 "C4'" 1 
ATOM   5957  O  "O4'" . U   J  10 21  ? -22.958  -3.603  76.684  1.00 117.42 ? 21  U   1 "O4'" 1 
ATOM   5958  C  "C3'" . U   J  10 21  ? -24.019  -5.173  75.337  1.00 127.94 ? 21  U   1 "C3'" 1 
ATOM   5959  O  "O3'" . U   J  10 21  ? -24.548  -6.480  75.185  1.00 130.21 ? 21  U   1 "O3'" 1 
ATOM   5960  C  "C2'" . U   J  10 21  ? -25.069  -4.157  75.767  1.00 121.65 ? 21  U   1 "C2'" 1 
ATOM   5961  O  "O2'" . U   J  10 21  ? -25.919  -4.634  76.791  1.00 132.21 ? 21  U   1 "O2'" 1 
ATOM   5962  C  "C1'" . U   J  10 21  ? -24.176  -3.019  76.250  1.00 115.82 ? 21  U   1 "C1'" 1 
ATOM   5963  N  N1    . U   J  10 21  ? -23.902  -2.029  75.198  1.00 118.06 ? 21  U   1 N1    1 
ATOM   5964  C  C2    . U   J  10 21  ? -24.889  -1.096  74.942  1.00 118.45 ? 21  U   1 C2    1 
ATOM   5965  O  O2    . U   J  10 21  ? -25.943  -1.058  75.555  1.00 115.84 ? 21  U   1 O2    1 
ATOM   5966  N  N3    . U   J  10 21  ? -24.584  -0.188  73.958  1.00 124.19 ? 21  U   1 N3    1 
ATOM   5967  C  C4    . U   J  10 21  ? -23.429  -0.134  73.198  1.00 129.11 ? 21  U   1 C4    1 
ATOM   5968  O  O4    . U   J  10 21  ? -23.310  0.739   72.336  1.00 134.45 ? 21  U   1 O4    1 
ATOM   5969  C  C5    . U   J  10 21  ? -22.464  -1.145  73.510  1.00 124.10 ? 21  U   1 C5    1 
ATOM   5970  C  C6    . U   J  10 21  ? -22.726  -2.033  74.476  1.00 122.80 ? 21  U   1 C6    1 
ATOM   5971  P  P     . G   J  10 22  ? -25.060  -6.946  73.743  1.00 138.27 ? 22  G   1 P     1 
ATOM   5972  O  OP1   . G   J  10 22  ? -25.510  -8.351  73.896  1.00 146.28 ? 22  G   1 OP1   1 
ATOM   5973  O  OP2   . G   J  10 22  ? -23.996  -6.601  72.765  1.00 135.32 ? 22  G   1 OP2   1 
ATOM   5974  O  "O5'" . G   J  10 22  ? -26.334  -6.028  73.435  1.00 111.85 ? 22  G   1 "O5'" 1 
ATOM   5975  C  "C5'" . G   J  10 22  ? -27.591  -6.359  74.045  1.00 109.09 ? 22  G   1 "C5'" 1 
ATOM   5976  C  "C4'" . G   J  10 22  ? -28.616  -5.281  73.834  1.00 112.66 ? 22  G   1 "C4'" 1 
ATOM   5977  O  "O4'" . G   J  10 22  ? -28.071  -3.979  74.166  1.00 123.77 ? 22  G   1 "O4'" 1 
ATOM   5978  C  "C3'" . G   J  10 22  ? -29.073  -5.054  72.408  1.00 120.00 ? 22  G   1 "C3'" 1 
ATOM   5979  O  "O3'" . G   J  10 22  ? -29.930  -6.035  71.847  1.00 127.32 ? 22  G   1 "O3'" 1 
ATOM   5980  C  "C2'" . G   J  10 22  ? -29.748  -3.693  72.532  1.00 121.58 ? 22  G   1 "C2'" 1 
ATOM   5981  O  "O2'" . G   J  10 22  ? -31.029  -3.667  73.136  1.00 109.11 ? 22  G   1 "O2'" 1 
ATOM   5982  C  "C1'" . G   J  10 22  ? -28.708  -2.976  73.386  1.00 117.82 ? 22  G   1 "C1'" 1 
ATOM   5983  N  N9    . G   J  10 22  ? -27.694  -2.289  72.595  1.00 104.87 ? 22  G   1 N9    1 
ATOM   5984  C  C8    . G   J  10 22  ? -26.383  -2.649  72.391  1.00 102.01 ? 22  G   1 C8    1 
ATOM   5985  N  N7    . G   J  10 22  ? -25.725  -1.799  71.652  1.00 94.68  ? 22  G   1 N7    1 
ATOM   5986  C  C5    . G   J  10 22  ? -26.661  -0.826  71.339  1.00 84.80  ? 22  G   1 C5    1 
ATOM   5987  C  C6    . G   J  10 22  ? -26.516  0.367   70.605  1.00 85.95  ? 22  G   1 C6    1 
ATOM   5988  O  O6    . G   J  10 22  ? -25.501  0.820   70.060  1.00 97.84  ? 22  G   1 O6    1 
ATOM   5989  N  N1    . G   J  10 22  ? -27.709  1.078   70.557  1.00 83.87  ? 22  G   1 N1    1 
ATOM   5990  C  C2    . G   J  10 22  ? -28.889  0.703   71.156  1.00 83.18  ? 22  G   1 C2    1 
ATOM   5991  N  N2    . G   J  10 22  ? -29.930  1.538   70.986  1.00 74.92  ? 22  G   1 N2    1 
ATOM   5992  N  N3    . G   J  10 22  ? -29.024  -0.394  71.885  1.00 81.55  ? 22  G   1 N3    1 
ATOM   5993  C  C4    . G   J  10 22  ? -27.880  -1.110  71.921  1.00 88.86  ? 22  G   1 C4    1 
ATOM   5994  P  P     . C   J  10 23  ? -29.850  -6.320  70.283  1.00 112.15 ? 23  C   1 P     1 
ATOM   5995  O  OP1   . C   J  10 23  ? -30.448  -7.642  70.050  1.00 112.95 ? 23  C   1 OP1   1 
ATOM   5996  O  OP2   . C   J  10 23  ? -28.456  -6.057  69.816  1.00 111.25 ? 23  C   1 OP2   1 
ATOM   5997  O  "O5'" . C   J  10 23  ? -30.834  -5.242  69.653  1.00 90.99  ? 23  C   1 "O5'" 1 
ATOM   5998  C  "C5'" . C   J  10 23  ? -32.166  -5.009  70.119  1.00 87.76  ? 23  C   1 "C5'" 1 
ATOM   5999  C  "C4'" . C   J  10 23  ? -32.613  -3.638  69.666  1.00 95.67  ? 23  C   1 "C4'" 1 
ATOM   6000  O  "O4'" . C   J  10 23  ? -31.667  -2.633  70.114  1.00 98.01  ? 23  C   1 "O4'" 1 
ATOM   6001  C  "C3'" . C   J  10 23  ? -32.623  -3.389  68.163  1.00 105.60 ? 23  C   1 "C3'" 1 
ATOM   6002  O  "O3'" . C   J  10 23  ? -33.685  -3.970  67.414  1.00 114.91 ? 23  C   1 "O3'" 1 
ATOM   6003  C  "C2'" . C   J  10 23  ? -32.640  -1.866  68.101  1.00 97.52  ? 23  C   1 "C2'" 1 
ATOM   6004  O  "O2'" . C   J  10 23  ? -33.866  -1.228  68.397  1.00 88.75  ? 23  C   1 "O2'" 1 
ATOM   6005  C  "C1'" . C   J  10 23  ? -31.608  -1.563  69.173  1.00 91.61  ? 23  C   1 "C1'" 1 
ATOM   6006  N  N1    . C   J  10 23  ? -30.240  -1.414  68.639  1.00 85.20  ? 23  C   1 N1    1 
ATOM   6007  C  C2    . C   J  10 23  ? -29.925  -0.226  67.966  1.00 84.00  ? 23  C   1 C2    1 
ATOM   6008  O  O2    . C   J  10 23  ? -30.811  0.627   67.793  1.00 81.89  ? 23  C   1 O2    1 
ATOM   6009  N  N3    . C   J  10 23  ? -28.656  -0.022  67.541  1.00 80.44  ? 23  C   1 N3    1 
ATOM   6010  C  C4    . C   J  10 23  ? -27.720  -0.950  67.755  1.00 87.82  ? 23  C   1 C4    1 
ATOM   6011  N  N4    . C   J  10 23  ? -26.480  -0.702  67.308  1.00 97.40  ? 23  C   1 N4    1 
ATOM   6012  C  C5    . C   J  10 23  ? -28.006  -2.157  68.458  1.00 84.03  ? 23  C   1 C5    1 
ATOM   6013  C  C6    . C   J  10 23  ? -29.270  -2.354  68.863  1.00 84.14  ? 23  C   1 C6    1 
ATOM   6014  P  P     . A   J  10 24  ? -33.437  -4.428  65.901  1.00 110.50 ? 24  A   1 P     1 
ATOM   6015  O  OP1   . A   J  10 24  ? -34.723  -5.090  65.527  1.00 113.76 ? 24  A   1 OP1   1 
ATOM   6016  O  OP2   . A   J  10 24  ? -32.069  -5.064  65.783  1.00 90.23  ? 24  A   1 OP2   1 
ATOM   6017  O  "O5'" . A   J  10 24  ? -33.295  -3.072  65.080  1.00 90.93  ? 24  A   1 "O5'" 1 
ATOM   6018  C  "C5'" . A   J  10 24  ? -34.452  -2.254  64.850  1.00 88.85  ? 24  A   1 "C5'" 1 
ATOM   6019  C  "C4'" . A   J  10 24  ? -34.017  -0.984  64.157  1.00 89.85  ? 24  A   1 "C4'" 1 
ATOM   6020  O  "O4'" . A   J  10 24  ? -32.904  -0.407  64.877  1.00 83.46  ? 24  A   1 "O4'" 1 
ATOM   6021  C  "C3'" . A   J  10 24  ? -33.412  -1.140  62.767  1.00 96.80  ? 24  A   1 "C3'" 1 
ATOM   6022  O  "O3'" . A   J  10 24  ? -34.384  -1.401  61.754  1.00 110.21 ? 24  A   1 "O3'" 1 
ATOM   6023  C  "C2'" . A   J  10 24  ? -32.665  0.177   62.602  1.00 84.33  ? 24  A   1 "C2'" 1 
ATOM   6024  O  "O2'" . A   J  10 24  ? -33.470  1.291   62.295  1.00 74.22  ? 24  A   1 "O2'" 1 
ATOM   6025  C  "C1'" . A   J  10 24  ? -32.079  0.317   63.990  1.00 77.67  ? 24  A   1 "C1'" 1 
ATOM   6026  N  N9    . A   J  10 24  ? -30.728  -0.208  64.106  1.00 76.69  ? 24  A   1 N9    1 
ATOM   6027  C  C8    . A   J  10 24  ? -30.222  -1.295  64.778  1.00 75.01  ? 24  A   1 C8    1 
ATOM   6028  N  N7    . A   J  10 24  ? -28.910  -1.363  64.761  1.00 76.60  ? 24  A   1 N7    1 
ATOM   6029  C  C5    . A   J  10 24  ? -28.527  -0.212  64.083  1.00 85.06  ? 24  A   1 C5    1 
ATOM   6030  C  C6    . A   J  10 24  ? -27.267  0.313   63.733  1.00 92.32  ? 24  A   1 C6    1 
ATOM   6031  N  N6    . A   J  10 24  ? -26.110  -0.278  64.032  1.00 105.32 ? 24  A   1 N6    1 
ATOM   6032  N  N1    . A   J  10 24  ? -27.236  1.498   63.078  1.00 92.15  ? 24  A   1 N1    1 
ATOM   6033  C  C2    . A   J  10 24  ? -28.402  2.092   62.767  1.00 93.27  ? 24  A   1 C2    1 
ATOM   6034  N  N3    . A   J  10 24  ? -29.648  1.686   63.021  1.00 85.61  ? 24  A   1 N3    1 
ATOM   6035  C  C4    . A   J  10 24  ? -29.639  0.516   63.688  1.00 84.20  ? 24  A   1 C4    1 
ATOM   6036  P  P     . C   J  10 25  ? -34.064  -2.456  60.589  1.00 103.54 ? 25  C   1 P     1 
ATOM   6037  O  OP1   . C   J  10 25  ? -35.419  -2.743  59.993  1.00 100.64 ? 25  C   1 OP1   1 
ATOM   6038  O  OP2   . C   J  10 25  ? -33.215  -3.551  61.150  1.00 91.26  ? 25  C   1 OP2   1 
ATOM   6039  O  "O5'" . C   J  10 25  ? -33.079  -1.640  59.629  1.00 86.83  ? 25  C   1 "O5'" 1 
ATOM   6040  C  "C5'" . C   J  10 25  ? -33.573  -0.547  58.813  1.00 87.11  ? 25  C   1 "C5'" 1 
ATOM   6041  C  "C4'" . C   J  10 25  ? -32.431  0.352   58.427  1.00 88.47  ? 25  C   1 "C4'" 1 
ATOM   6042  O  "O4'" . C   J  10 25  ? -31.579  0.532   59.585  1.00 90.04  ? 25  C   1 "O4'" 1 
ATOM   6043  C  "C3'" . C   J  10 25  ? -31.462  -0.236  57.417  1.00 105.27 ? 25  C   1 "C3'" 1 
ATOM   6044  O  "O3'" . C   J  10 25  ? -31.857  -0.254  56.042  1.00 108.15 ? 25  C   1 "O3'" 1 
ATOM   6045  C  "C2'" . C   J  10 25  ? -30.195  0.586   57.661  1.00 101.17 ? 25  C   1 "C2'" 1 
ATOM   6046  O  "O2'" . C   J  10 25  ? -30.101  1.825   56.999  1.00 91.10  ? 25  C   1 "O2'" 1 
ATOM   6047  C  "C1'" . C   J  10 25  ? -30.250  0.759   59.174  1.00 89.27  ? 25  C   1 "C1'" 1 
ATOM   6048  N  N1    . C   J  10 25  ? -29.354  -0.173  59.871  1.00 86.02  ? 25  C   1 N1    1 
ATOM   6049  C  C2    . C   J  10 25  ? -27.977  0.121   59.825  1.00 96.90  ? 25  C   1 C2    1 
ATOM   6050  O  O2    . C   J  10 25  ? -27.592  1.128   59.204  1.00 95.76  ? 25  C   1 O2    1 
ATOM   6051  N  N3    . C   J  10 25  ? -27.105  -0.671  60.494  1.00 97.58  ? 25  C   1 N3    1 
ATOM   6052  C  C4    . C   J  10 25  ? -27.553  -1.735  61.165  1.00 93.61  ? 25  C   1 C4    1 
ATOM   6053  N  N4    . C   J  10 25  ? -26.642  -2.462  61.824  1.00 96.02  ? 25  C   1 N4    1 
ATOM   6054  C  C5    . C   J  10 25  ? -28.946  -2.082  61.198  1.00 87.13  ? 25  C   1 C5    1 
ATOM   6055  C  C6    . C   J  10 25  ? -29.802  -1.287  60.531  1.00 78.33  ? 25  C   1 C6    1 
ATOM   6056  P  P     . A   J  10 26  ? -31.388  -1.478  55.105  1.00 101.39 ? 26  A   1 P     1 
ATOM   6057  O  OP1   . A   J  10 26  ? -32.122  -1.329  53.844  1.00 103.01 ? 26  A   1 OP1   1 
ATOM   6058  O  OP2   . A   J  10 26  ? -31.531  -2.731  55.870  1.00 112.04 ? 26  A   1 OP2   1 
ATOM   6059  O  "O5'" . A   J  10 26  ? -29.800  -1.305  54.941  1.00 99.49  ? 26  A   1 "O5'" 1 
ATOM   6060  C  "C5'" . A   J  10 26  ? -29.428  -0.382  53.928  1.00 110.92 ? 26  A   1 "C5'" 1 
ATOM   6061  C  "C4'" . A   J  10 26  ? -27.979  -0.010  53.941  1.00 123.19 ? 26  A   1 "C4'" 1 
ATOM   6062  O  "O4'" . A   J  10 26  ? -27.537  0.300   55.283  1.00 123.40 ? 26  A   1 "O4'" 1 
ATOM   6063  C  "C3'" . A   J  10 26  ? -26.983  -1.058  53.463  1.00 130.13 ? 26  A   1 "C3'" 1 
ATOM   6064  O  "O3'" . A   J  10 26  ? -27.002  -1.087  52.046  1.00 128.23 ? 26  A   1 "O3'" 1 
ATOM   6065  C  "C2'" . A   J  10 26  ? -25.683  -0.473  54.004  1.00 132.29 ? 26  A   1 "C2'" 1 
ATOM   6066  O  "O2'" . A   J  10 26  ? -25.115  0.575   53.245  1.00 131.81 ? 26  A   1 "O2'" 1 
ATOM   6067  C  "C1'" . A   J  10 26  ? -26.146  0.050   55.364  1.00 128.02 ? 26  A   1 "C1'" 1 
ATOM   6068  N  N9    . A   J  10 26  ? -25.932  -0.927  56.424  1.00 123.76 ? 26  A   1 N9    1 
ATOM   6069  C  C8    . A   J  10 26  ? -26.855  -1.684  57.105  1.00 124.68 ? 26  A   1 C8    1 
ATOM   6070  N  N7    . A   J  10 26  ? -26.325  -2.469  58.012  1.00 125.80 ? 26  A   1 N7    1 
ATOM   6071  C  C5    . A   J  10 26  ? -24.964  -2.211  57.924  1.00 116.10 ? 26  A   1 C5    1 
ATOM   6072  C  C6    . A   J  10 26  ? -23.856  -2.727  58.616  1.00 114.06 ? 26  A   1 C6    1 
ATOM   6073  N  N6    . A   J  10 26  ? -23.946  -3.644  59.581  1.00 112.58 ? 26  A   1 N6    1 
ATOM   6074  N  N1    . A   J  10 26  ? -22.632  -2.265  58.276  1.00 116.48 ? 26  A   1 N1    1 
ATOM   6075  C  C2    . A   J  10 26  ? -22.540  -1.337  57.310  1.00 116.54 ? 26  A   1 C2    1 
ATOM   6076  N  N3    . A   J  10 26  ? -23.507  -0.788  56.575  1.00 109.43 ? 26  A   1 N3    1 
ATOM   6077  C  C4    . A   J  10 26  ? -24.707  -1.271  56.941  1.00 116.67 ? 26  A   1 C4    1 
ATOM   6078  P  P     . C   J  10 27  ? -26.480  -2.360  51.270  1.00 123.08 ? 27  C   1 P     1 
ATOM   6079  O  OP1   . C   J  10 27  ? -26.586  -2.062  49.813  1.00 128.82 ? 27  C   1 OP1   1 
ATOM   6080  O  OP2   . C   J  10 27  ? -27.081  -3.562  51.902  1.00 129.94 ? 27  C   1 OP2   1 
ATOM   6081  O  "O5'" . C   J  10 27  ? -24.946  -2.444  51.647  1.00 108.38 ? 27  C   1 "O5'" 1 
ATOM   6082  C  "C5'" . C   J  10 27  ? -23.973  -1.705  50.894  1.00 105.19 ? 27  C   1 "C5'" 1 
ATOM   6083  C  "C4'" . C   J  10 27  ? -22.635  -1.895  51.554  1.00 105.68 ? 27  C   1 "C4'" 1 
ATOM   6084  O  "O4'" . C   J  10 27  ? -22.800  -1.819  52.993  1.00 105.22 ? 27  C   1 "O4'" 1 
ATOM   6085  C  "C3'" . C   J  10 27  ? -22.045  -3.284  51.407  1.00 112.79 ? 27  C   1 "C3'" 1 
ATOM   6086  O  "O3'" . C   J  10 27  ? -21.517  -3.609  50.128  1.00 120.06 ? 27  C   1 "O3'" 1 
ATOM   6087  C  "C2'" . C   J  10 27  ? -21.029  -3.321  52.542  1.00 106.86 ? 27  C   1 "C2'" 1 
ATOM   6088  O  "O2'" . C   J  10 27  ? -19.782  -2.740  52.253  1.00 101.53 ? 27  C   1 "O2'" 1 
ATOM   6089  C  "C1'" . C   J  10 27  ? -21.781  -2.557  53.624  1.00 102.75 ? 27  C   1 "C1'" 1 
ATOM   6090  N  N1    . C   J  10 27  ? -22.369  -3.446  54.632  1.00 106.96 ? 27  C   1 N1    1 
ATOM   6091  C  C2    . C   J  10 27  ? -21.481  -4.032  55.539  1.00 118.91 ? 27  C   1 C2    1 
ATOM   6092  O  O2    . C   J  10 27  ? -20.270  -3.761  55.459  1.00 118.16 ? 27  C   1 O2    1 
ATOM   6093  N  N3    . C   J  10 27  ? -21.965  -4.839  56.507  1.00 116.72 ? 27  C   1 N3    1 
ATOM   6094  C  C4    . C   J  10 27  ? -23.272  -5.081  56.593  1.00 114.12 ? 27  C   1 C4    1 
ATOM   6095  N  N4    . C   J  10 27  ? -23.688  -5.877  57.586  1.00 110.23 ? 27  C   1 N4    1 
ATOM   6096  C  C5    . C   J  10 27  ? -24.202  -4.511  55.671  1.00 108.53 ? 27  C   1 C5    1 
ATOM   6097  C  C6    . C   J  10 27  ? -23.711  -3.706  54.714  1.00 104.21 ? 27  C   1 C6    1 
ATOM   6098  P  P     . A   J  10 28  ? -21.564  -5.148  49.637  1.00 116.14 ? 28  A   1 P     1 
ATOM   6099  O  OP1   . A   J  10 28  ? -21.193  -5.161  48.199  1.00 131.34 ? 28  A   1 OP1   1 
ATOM   6100  O  OP2   . A   J  10 28  ? -22.837  -5.774  50.089  1.00 107.91 ? 28  A   1 OP2   1 
ATOM   6101  O  "O5'" . A   J  10 28  ? -20.439  -5.848  50.510  1.00 96.11  ? 28  A   1 "O5'" 1 
ATOM   6102  C  "C5'" . A   J  10 28  ? -19.050  -5.694  50.169  1.00 90.82  ? 28  A   1 "C5'" 1 
ATOM   6103  C  "C4'" . A   J  10 28  ? -18.242  -6.497  51.147  1.00 96.47  ? 28  A   1 "C4'" 1 
ATOM   6104  O  "O4'" . A   J  10 28  ? -18.637  -6.120  52.491  1.00 110.12 ? 28  A   1 "O4'" 1 
ATOM   6105  C  "C3'" . A   J  10 28  ? -18.542  -7.989  51.174  1.00 108.35 ? 28  A   1 "C3'" 1 
ATOM   6106  O  "O3'" . A   J  10 28  ? -18.069  -8.690  50.026  1.00 119.64 ? 28  A   1 "O3'" 1 
ATOM   6107  C  "C2'" . A   J  10 28  ? -17.968  -8.384  52.530  1.00 109.22 ? 28  A   1 "C2'" 1 
ATOM   6108  O  "O2'" . A   J  10 28  ? -16.568  -8.572  52.610  1.00 109.08 ? 28  A   1 "O2'" 1 
ATOM   6109  C  "C1'" . A   J  10 28  ? -18.433  -7.203  53.377  1.00 107.24 ? 28  A   1 "C1'" 1 
ATOM   6110  N  N9    . A   J  10 28  ? -19.676  -7.431  54.110  1.00 99.81  ? 28  A   1 N9    1 
ATOM   6111  C  C8    . A   J  10 28  ? -20.960  -7.004  53.877  1.00 97.46  ? 28  A   1 C8    1 
ATOM   6112  N  N7    . A   J  10 28  ? -21.827  -7.432  54.763  1.00 98.06  ? 28  A   1 N7    1 
ATOM   6113  C  C5    . A   J  10 28  ? -21.064  -8.197  55.635  1.00 97.67  ? 28  A   1 C5    1 
ATOM   6114  C  C6    . A   J  10 28  ? -21.386  -8.932  56.797  1.00 97.88  ? 28  A   1 C6    1 
ATOM   6115  N  N6    . A   J  10 28  ? -22.613  -9.017  57.323  1.00 103.03 ? 28  A   1 N6    1 
ATOM   6116  N  N1    . A   J  10 28  ? -20.386  -9.600  57.406  1.00 89.50  ? 28  A   1 N1    1 
ATOM   6117  C  C2    . A   J  10 28  ? -19.151  -9.525  56.894  1.00 95.74  ? 28  A   1 C2    1 
ATOM   6118  N  N3    . A   J  10 28  ? -18.724  -8.869  55.818  1.00 91.87  ? 28  A   1 N3    1 
ATOM   6119  C  C4    . A   J  10 28  ? -19.738  -8.207  55.239  1.00 93.23  ? 28  A   1 C4    1 
ATOM   6120  P  P     . C   J  10 29  ? -19.000  -9.808  49.330  1.00 115.99 ? 29  C   1 P     1 
ATOM   6121  O  OP1   . C   J  10 29  ? -18.659  -9.851  47.881  1.00 117.89 ? 29  C   1 OP1   1 
ATOM   6122  O  OP2   . C   J  10 29  ? -20.404  -9.545  49.700  1.00 122.04 ? 29  C   1 OP2   1 
ATOM   6123  O  "O5'" . C   J  10 29  ? -18.634  -11.124 50.145  1.00 87.51  ? 29  C   1 "O5'" 1 
ATOM   6124  C  "C5'" . C   J  10 29  ? -17.267  -11.514 50.306  1.00 90.88  ? 29  C   1 "C5'" 1 
ATOM   6125  C  "C4'" . C   J  10 29  ? -17.120  -12.251 51.609  1.00 94.27  ? 29  C   1 "C4'" 1 
ATOM   6126  O  "O4'" . C   J  10 29  ? -17.633  -11.434 52.683  1.00 89.93  ? 29  C   1 "O4'" 1 
ATOM   6127  C  "C3'" . C   J  10 29  ? -17.961  -13.502 51.774  1.00 103.49 ? 29  C   1 "C3'" 1 
ATOM   6128  O  "O3'" . C   J  10 29  ? -17.572  -14.627 51.005  1.00 114.90 ? 29  C   1 "O3'" 1 
ATOM   6129  C  "C2'" . C   J  10 29  ? -17.897  -13.708 53.279  1.00 96.80  ? 29  C   1 "C2'" 1 
ATOM   6130  O  "O2'" . C   J  10 29  ? -16.738  -14.286 53.847  1.00 95.87  ? 29  C   1 "O2'" 1 
ATOM   6131  C  "C1'" . C   J  10 29  ? -18.077  -12.263 53.733  1.00 90.79  ? 29  C   1 "C1'" 1 
ATOM   6132  N  N1    . C   J  10 29  ? -19.475  -11.929 54.026  1.00 86.91  ? 29  C   1 N1    1 
ATOM   6133  C  C2    . C   J  10 29  ? -20.015  -12.470 55.203  1.00 84.24  ? 29  C   1 C2    1 
ATOM   6134  O  O2    . C   J  10 29  ? -19.293  -13.174 55.936  1.00 64.30  ? 29  C   1 O2    1 
ATOM   6135  N  N3    . C   J  10 29  ? -21.302  -12.188 55.523  1.00 82.44  ? 29  C   1 N3    1 
ATOM   6136  C  C4    . C   J  10 29  ? -22.040  -11.406 54.731  1.00 83.01  ? 29  C   1 C4    1 
ATOM   6137  N  N4    . C   J  10 29  ? -23.294  -11.152 55.118  1.00 80.13  ? 29  C   1 N4    1 
ATOM   6138  C  C5    . C   J  10 29  ? -21.518  -10.848 53.522  1.00 80.68  ? 29  C   1 C5    1 
ATOM   6139  C  C6    . C   J  10 29  ? -20.245  -11.146 53.204  1.00 81.75  ? 29  C   1 C6    1 
ATOM   6140  P  P     . U   J  10 30  ? -18.707  -15.592 50.450  1.00 116.05 ? 30  U   1 P     1 
ATOM   6141  O  OP1   . U   J  10 30  ? -18.043  -16.478 49.472  1.00 131.38 ? 30  U   1 OP1   1 
ATOM   6142  O  OP2   . U   J  10 30  ? -19.885  -14.773 50.038  1.00 103.65 ? 30  U   1 OP2   1 
ATOM   6143  O  "O5'" . U   J  10 30  ? -19.100  -16.445 51.733  1.00 102.84 ? 30  U   1 "O5'" 1 
ATOM   6144  C  "C5'" . U   J  10 30  ? -18.090  -17.113 52.507  1.00 99.88  ? 30  U   1 "C5'" 1 
ATOM   6145  C  "C4'" . U   J  10 30  ? -18.739  -17.692 53.735  1.00 101.05 ? 30  U   1 "C4'" 1 
ATOM   6146  O  "O4'" . U   J  10 30  ? -19.247  -16.617 54.553  1.00 94.41  ? 30  U   1 "O4'" 1 
ATOM   6147  C  "C3'" . U   J  10 30  ? -20.001  -18.495 53.473  1.00 113.10 ? 30  U   1 "C3'" 1 
ATOM   6148  O  "O3'" . U   J  10 30  ? -19.765  -19.762 52.870  1.00 127.22 ? 30  U   1 "O3'" 1 
ATOM   6149  C  "C2'" . U   J  10 30  ? -20.684  -18.466 54.838  1.00 101.18 ? 30  U   1 "C2'" 1 
ATOM   6150  O  "O2'" . U   J  10 30  ? -20.213  -19.293 55.887  1.00 98.64  ? 30  U   1 "O2'" 1 
ATOM   6151  C  "C1'" . U   J  10 30  ? -20.445  -17.016 55.200  1.00 88.31  ? 30  U   1 "C1'" 1 
ATOM   6152  N  N1    . U   J  10 30  ? -21.552  -16.164 54.750  1.00 78.73  ? 30  U   1 N1    1 
ATOM   6153  C  C2    . U   J  10 30  ? -22.654  -16.104 55.580  1.00 77.96  ? 30  U   1 C2    1 
ATOM   6154  O  O2    . U   J  10 30  ? -22.747  -16.756 56.607  1.00 78.44  ? 30  U   1 O2    1 
ATOM   6155  N  N3    . U   J  10 30  ? -23.624  -15.216 55.186  1.00 76.37  ? 30  U   1 N3    1 
ATOM   6156  C  C4    . U   J  10 30  ? -23.636  -14.433 54.049  1.00 80.50  ? 30  U   1 C4    1 
ATOM   6157  O  O4    . U   J  10 30  ? -24.636  -13.758 53.781  1.00 82.03  ? 30  U   1 O4    1 
ATOM   6158  C  C5    . U   J  10 30  ? -22.470  -14.570 53.231  1.00 81.41  ? 30  U   1 C5    1 
ATOM   6159  C  C6    . U   J  10 30  ? -21.487  -15.402 53.606  1.00 77.38  ? 30  U   1 C6    1 
ATOM   6160  P  P     . G   J  10 31  ? -20.923  -20.446 52.012  1.00 128.40 ? 31  G   1 P     1 
ATOM   6161  O  OP1   . G   J  10 31  ? -20.233  -21.474 51.197  1.00 133.13 ? 31  G   1 OP1   1 
ATOM   6162  O  OP2   . G   J  10 31  ? -21.848  -19.381 51.433  1.00 96.30  ? 31  G   1 OP2   1 
ATOM   6163  O  "O5'" . G   J  10 31  ? -21.700  -21.261 53.134  1.00 106.86 ? 31  G   1 "O5'" 1 
ATOM   6164  C  "C5'" . G   J  10 31  ? -23.121  -21.309 53.092  1.00 96.77  ? 31  G   1 "C5'" 1 
ATOM   6165  C  "C4'" . G   J  10 31  ? -23.649  -21.484 54.488  1.00 90.76  ? 31  G   1 "C4'" 1 
ATOM   6166  O  "O4'" . G   J  10 31  ? -23.457  -20.230 55.182  1.00 88.68  ? 31  G   1 "O4'" 1 
ATOM   6167  C  "C3'" . G   J  10 31  ? -25.150  -21.737 54.552  1.00 90.68  ? 31  G   1 "C3'" 1 
ATOM   6168  O  "O3'" . G   J  10 31  ? -25.365  -23.131 54.424  1.00 89.84  ? 31  G   1 "O3'" 1 
ATOM   6169  C  "C2'" . G   J  10 31  ? -25.572  -21.043 55.834  1.00 77.70  ? 31  G   1 "C2'" 1 
ATOM   6170  O  "O2'" . G   J  10 31  ? -25.287  -21.893 56.924  1.00 78.32  ? 31  G   1 "O2'" 1 
ATOM   6171  C  "C1'" . G   J  10 31  ? -24.689  -19.806 55.743  1.00 77.73  ? 31  G   1 "C1'" 1 
ATOM   6172  N  N9    . G   J  10 31  ? -25.210  -18.723 54.918  1.00 72.37  ? 31  G   1 N9    1 
ATOM   6173  C  C8    . G   J  10 31  ? -24.642  -18.127 53.815  1.00 71.16  ? 31  G   1 C8    1 
ATOM   6174  N  N7    . G   J  10 31  ? -25.362  -17.149 53.330  1.00 69.80  ? 31  G   1 N7    1 
ATOM   6175  C  C5    . G   J  10 31  ? -26.457  -17.076 54.183  1.00 71.30  ? 31  G   1 C5    1 
ATOM   6176  C  C6    . G   J  10 31  ? -27.580  -16.193 54.177  1.00 72.65  ? 31  G   1 C6    1 
ATOM   6177  O  O6    . G   J  10 31  ? -27.811  -15.231 53.424  1.00 67.98  ? 31  G   1 O6    1 
ATOM   6178  N  N1    . G   J  10 31  ? -28.455  -16.483 55.222  1.00 70.50  ? 31  G   1 N1    1 
ATOM   6179  C  C2    . G   J  10 31  ? -28.278  -17.484 56.153  1.00 74.82  ? 31  G   1 C2    1 
ATOM   6180  N  N2    . G   J  10 31  ? -29.227  -17.593 57.099  1.00 75.38  ? 31  G   1 N2    1 
ATOM   6181  N  N3    . G   J  10 31  ? -27.243  -18.314 56.164  1.00 67.90  ? 31  G   1 N3    1 
ATOM   6182  C  C4    . G   J  10 31  ? -26.379  -18.051 55.163  1.00 69.39  ? 31  G   1 C4    1 
ATOM   6183  P  P     . C   J  10 32  ? -26.280  -23.652 53.235  1.00 88.27  ? 122 C   1 P     1 
ATOM   6184  O  OP1   . C   J  10 32  ? -25.985  -25.116 53.128  1.00 89.52  ? 122 C   1 OP1   1 
ATOM   6185  O  OP2   . C   J  10 32  ? -26.215  -22.692 52.063  1.00 61.03  ? 122 C   1 OP2   1 
ATOM   6186  O  "O5'" . C   J  10 32  ? -27.741  -23.447 53.825  1.00 78.74  ? 122 C   1 "O5'" 1 
ATOM   6187  C  "C5'" . C   J  10 32  ? -28.098  -23.892 55.139  1.00 72.11  ? 122 C   1 "C5'" 1 
ATOM   6188  C  "C4'" . C   J  10 32  ? -29.291  -23.097 55.615  1.00 69.30  ? 122 C   1 "C4'" 1 
ATOM   6189  O  "O4'" . C   J  10 32  ? -28.996  -21.685 55.747  1.00 61.80  ? 122 C   1 "O4'" 1 
ATOM   6190  C  "C3'" . C   J  10 32  ? -30.481  -23.076 54.676  1.00 67.61  ? 122 C   1 "C3'" 1 
ATOM   6191  O  "O3'" . C   J  10 32  ? -31.107  -24.347 54.704  1.00 69.71  ? 122 C   1 "O3'" 1 
ATOM   6192  C  "C2'" . C   J  10 32  ? -31.293  -21.918 55.242  1.00 62.59  ? 122 C   1 "C2'" 1 
ATOM   6193  O  "O2'" . C   J  10 32  ? -32.008  -22.171 56.427  1.00 66.60  ? 122 C   1 "O2'" 1 
ATOM   6194  C  "C1'" . C   J  10 32  ? -30.182  -20.937 55.563  1.00 58.13  ? 122 C   1 "C1'" 1 
ATOM   6195  N  N1    . C   J  10 32  ? -29.975  -19.970 54.479  1.00 57.62  ? 122 C   1 N1    1 
ATOM   6196  C  C2    . C   J  10 32  ? -30.923  -18.954 54.302  1.00 57.75  ? 122 C   1 C2    1 
ATOM   6197  O  O2    . C   J  10 32  ? -31.922  -18.933 55.028  1.00 61.88  ? 122 C   1 O2    1 
ATOM   6198  N  N3    . C   J  10 32  ? -30.712  -18.005 53.366  1.00 53.55  ? 122 C   1 N3    1 
ATOM   6199  C  C4    . C   J  10 32  ? -29.650  -18.091 52.566  1.00 56.52  ? 122 C   1 C4    1 
ATOM   6200  N  N4    . C   J  10 32  ? -29.509  -17.162 51.622  1.00 64.74  ? 122 C   1 N4    1 
ATOM   6201  C  C5    . C   J  10 32  ? -28.678  -19.125 52.706  1.00 54.64  ? 122 C   1 C5    1 
ATOM   6202  C  C6    . C   J  10 32  ? -28.865  -20.023 53.681  1.00 56.08  ? 122 C   1 C6    1 
ATOM   6203  P  P     . A   J  10 33  ? -31.990  -24.785 53.482  1.00 68.65  ? 123 A   1 P     1 
ATOM   6204  O  OP1   . A   J  10 33  ? -32.613  -26.098 53.859  1.00 79.11  ? 123 A   1 OP1   1 
ATOM   6205  O  OP2   . A   J  10 33  ? -31.240  -24.567 52.225  1.00 60.20  ? 123 A   1 OP2   1 
ATOM   6206  O  "O5'" . A   J  10 33  ? -33.093  -23.650 53.409  1.00 63.17  ? 123 A   1 "O5'" 1 
ATOM   6207  C  "C5'" . A   J  10 33  ? -34.133  -23.618 54.388  1.00 65.34  ? 123 A   1 "C5'" 1 
ATOM   6208  C  "C4'" . A   J  10 33  ? -35.111  -22.531 54.044  1.00 61.19  ? 123 A   1 "C4'" 1 
ATOM   6209  O  "O4'" . A   J  10 33  ? -34.444  -21.248 54.092  1.00 59.57  ? 123 A   1 "O4'" 1 
ATOM   6210  C  "C3'" . A   J  10 33  ? -35.618  -22.607 52.616  1.00 63.69  ? 123 A   1 "C3'" 1 
ATOM   6211  O  "O3'" . A   J  10 33  ? -36.496  -23.715 52.497  1.00 62.87  ? 123 A   1 "O3'" 1 
ATOM   6212  C  "C2'" . A   J  10 33  ? -36.120  -21.181 52.434  1.00 64.02  ? 123 A   1 "C2'" 1 
ATOM   6213  O  "O2'" . A   J  10 33  ? -37.346  -20.941 53.083  1.00 66.56  ? 123 A   1 "O2'" 1 
ATOM   6214  C  "C1'" . A   J  10 33  ? -35.010  -20.400 53.124  1.00 60.92  ? 123 A   1 "C1'" 1 
ATOM   6215  N  N9    . A   J  10 33  ? -33.948  -20.003 52.212  1.00 61.61  ? 123 A   1 N9    1 
ATOM   6216  C  C8    . A   J  10 33  ? -32.777  -20.649 51.901  1.00 62.47  ? 123 A   1 C8    1 
ATOM   6217  N  N7    . A   J  10 33  ? -32.040  -20.019 51.017  1.00 59.54  ? 123 A   1 N7    1 
ATOM   6218  C  C5    . A   J  10 33  ? -32.772  -18.878 50.737  1.00 61.76  ? 123 A   1 C5    1 
ATOM   6219  C  C6    . A   J  10 33  ? -32.523  -17.799 49.891  1.00 65.89  ? 123 A   1 C6    1 
ATOM   6220  N  N6    . A   J  10 33  ? -31.433  -17.705 49.133  1.00 73.91  ? 123 A   1 N6    1 
ATOM   6221  N  N1    . A   J  10 33  ? -33.442  -16.812 49.843  1.00 76.56  ? 123 A   1 N1    1 
ATOM   6222  C  C2    . A   J  10 33  ? -34.551  -16.930 50.600  1.00 85.25  ? 123 A   1 C2    1 
ATOM   6223  N  N3    . A   J  10 33  ? -34.909  -17.914 51.424  1.00 70.25  ? 123 A   1 N3    1 
ATOM   6224  C  C4    . A   J  10 33  ? -33.958  -18.863 51.451  1.00 64.32  ? 123 A   1 C4    1 
ATOM   6225  P  P     . U   J  10 34  ? -37.380  -23.886 51.169  1.00 69.15  ? 124 U   1 P     1 
ATOM   6226  O  OP1   . U   J  10 34  ? -37.262  -22.744 50.252  1.00 63.06  ? 124 U   1 OP1   1 
ATOM   6227  O  OP2   . U   J  10 34  ? -38.686  -24.441 51.542  1.00 81.33  ? 124 U   1 OP2   1 
ATOM   6228  O  "O5'" . U   J  10 34  ? -36.632  -24.984 50.307  1.00 73.15  ? 124 U   1 "O5'" 1 
ATOM   6229  C  "C5'" . U   J  10 34  ? -35.308  -25.424 50.593  1.00 65.07  ? 124 U   1 "C5'" 1 
ATOM   6230  C  "C4'" . U   J  10 34  ? -34.508  -25.453 49.330  1.00 55.84  ? 124 U   1 "C4'" 1 
ATOM   6231  O  "O4'" . U   J  10 34  ? -34.797  -24.269 48.572  1.00 51.98  ? 124 U   1 "O4'" 1 
ATOM   6232  C  "C3'" . U   J  10 34  ? -33.024  -25.401 49.627  1.00 55.99  ? 124 U   1 "C3'" 1 
ATOM   6233  O  "O3'" . U   J  10 34  ? -32.388  -26.191 48.650  1.00 50.82  ? 124 U   1 "O3'" 1 
ATOM   6234  C  "C2'" . U   J  10 34  ? -32.695  -23.932 49.455  1.00 58.76  ? 124 U   1 "C2'" 1 
ATOM   6235  O  "O2'" . U   J  10 34  ? -31.319  -23.699 49.140  1.00 73.73  ? 124 U   1 "O2'" 1 
ATOM   6236  C  "C1'" . U   J  10 34  ? -33.589  -23.622 48.269  1.00 57.42  ? 124 U   1 "C1'" 1 
ATOM   6237  N  N1    . U   J  10 34  ? -33.842  -22.196 48.071  1.00 62.17  ? 124 U   1 N1    1 
ATOM   6238  C  C2    . U   J  10 34  ? -32.860  -21.430 47.472  1.00 66.36  ? 124 U   1 C2    1 
ATOM   6239  O  O2    . U   J  10 34  ? -31.766  -21.870 47.166  1.00 72.95  ? 124 U   1 O2    1 
ATOM   6240  N  N3    . U   J  10 34  ? -33.186  -20.106 47.308  1.00 71.21  ? 124 U   1 N3    1 
ATOM   6241  C  C4    . U   J  10 34  ? -34.351  -19.472 47.700  1.00 74.22  ? 124 U   1 C4    1 
ATOM   6242  O  O4    . U   J  10 34  ? -34.504  -18.267 47.468  1.00 86.80  ? 124 U   1 O4    1 
ATOM   6243  C  C5    . U   J  10 34  ? -35.295  -20.326 48.349  1.00 70.23  ? 124 U   1 C5    1 
ATOM   6244  C  C6    . U   J  10 34  ? -35.008  -21.622 48.518  1.00 68.58  ? 124 U   1 C6    1 
ATOM   6245  P  P     . A   J  10 35  ? -32.167  -27.733 48.907  1.00 51.57  ? 125 A   1 P     1 
ATOM   6246  O  OP1   . A   J  10 35  ? -32.686  -28.150 50.236  1.00 47.92  ? 125 A   1 OP1   1 
ATOM   6247  O  OP2   . A   J  10 35  ? -30.786  -28.055 48.479  1.00 58.54  ? 125 A   1 OP2   1 
ATOM   6248  O  "O5'" . A   J  10 35  ? -33.134  -28.394 47.834  1.00 57.53  ? 125 A   1 "O5'" 1 
ATOM   6249  C  "C5'" . A   J  10 35  ? -32.883  -28.161 46.439  1.00 58.34  ? 125 A   1 "C5'" 1 
ATOM   6250  C  "C4'" . A   J  10 35  ? -33.816  -29.022 45.641  1.00 52.99  ? 125 A   1 "C4'" 1 
ATOM   6251  O  "O4'" . A   J  10 35  ? -33.503  -30.399 45.922  1.00 48.52  ? 125 A   1 "O4'" 1 
ATOM   6252  C  "C3'" . A   J  10 35  ? -35.291  -28.915 46.001  1.00 49.87  ? 125 A   1 "C3'" 1 
ATOM   6253  O  "O3'" . A   J  10 35  ? -35.780  -27.746 45.372  1.00 51.01  ? 125 A   1 "O3'" 1 
ATOM   6254  C  "C2'" . A   J  10 35  ? -35.803  -30.200 45.399  1.00 51.02  ? 125 A   1 "C2'" 1 
ATOM   6255  O  "O2'" . A   J  10 35  ? -35.874  -30.157 43.985  1.00 46.72  ? 125 A   1 "O2'" 1 
ATOM   6256  C  "C1'" . A   J  10 35  ? -34.689  -31.142 45.854  1.00 53.23  ? 125 A   1 "C1'" 1 
ATOM   6257  N  N9    . A   J  10 35  ? -34.870  -31.740 47.162  1.00 56.56  ? 125 A   1 N9    1 
ATOM   6258  C  C8    . A   J  10 35  ? -34.409  -31.338 48.388  1.00 64.36  ? 125 A   1 C8    1 
ATOM   6259  N  N7    . A   J  10 35  ? -34.715  -32.161 49.364  1.00 63.00  ? 125 A   1 N7    1 
ATOM   6260  C  C5    . A   J  10 35  ? -35.390  -33.186 48.726  1.00 54.49  ? 125 A   1 C5    1 
ATOM   6261  C  C6    . A   J  10 35  ? -36.033  -34.312 49.216  1.00 54.57  ? 125 A   1 C6    1 
ATOM   6262  N  N6    . A   J  10 35  ? -36.066  -34.618 50.504  1.00 56.56  ? 125 A   1 N6    1 
ATOM   6263  N  N1    . A   J  10 35  ? -36.656  -35.119 48.336  1.00 59.37  ? 125 A   1 N1    1 
ATOM   6264  C  C2    . A   J  10 35  ? -36.667  -34.762 47.044  1.00 64.25  ? 125 A   1 C2    1 
ATOM   6265  N  N3    . A   J  10 35  ? -36.127  -33.696 46.461  1.00 59.13  ? 125 A   1 N3    1 
ATOM   6266  C  C4    . A   J  10 35  ? -35.493  -32.942 47.372  1.00 57.12  ? 125 A   1 C4    1 
ATOM   6267  P  P     . A   J  10 36  ? -37.251  -27.197 45.718  1.00 48.99  ? 126 A   1 P     1 
ATOM   6268  O  OP1   . A   J  10 36  ? -37.278  -25.711 45.622  1.00 51.03  ? 126 A   1 OP1   1 
ATOM   6269  O  OP2   . A   J  10 36  ? -37.742  -27.849 46.933  1.00 44.05  ? 126 A   1 OP2   1 
ATOM   6270  O  "O5'" . A   J  10 36  ? -37.964  -27.571 44.361  1.00 52.16  ? 126 A   1 "O5'" 1 
ATOM   6271  C  "C5'" . A   J  10 36  ? -38.860  -28.666 44.420  1.00 53.86  ? 126 A   1 "C5'" 1 
ATOM   6272  C  "C4'" . A   J  10 36  ? -39.974  -28.340 43.503  1.00 51.69  ? 126 A   1 "C4'" 1 
ATOM   6273  O  "O4'" . A   J  10 36  ? -41.029  -29.229 43.926  1.00 54.49  ? 126 A   1 "O4'" 1 
ATOM   6274  C  "C3'" . A   J  10 36  ? -40.526  -26.937 43.658  1.00 49.09  ? 126 A   1 "C3'" 1 
ATOM   6275  O  "O3'" . A   J  10 36  ? -41.296  -26.737 42.486  1.00 47.81  ? 126 A   1 "O3'" 1 
ATOM   6276  C  "C2'" . A   J  10 36  ? -41.397  -27.116 44.889  1.00 51.73  ? 126 A   1 "C2'" 1 
ATOM   6277  O  "O2'" . A   J  10 36  ? -42.474  -26.194 44.912  1.00 61.28  ? 126 A   1 "O2'" 1 
ATOM   6278  C  "C1'" . A   J  10 36  ? -42.001  -28.490 44.622  1.00 54.10  ? 126 A   1 "C1'" 1 
ATOM   6279  N  N9    . A   J  10 36  ? -42.446  -29.311 45.744  1.00 53.02  ? 126 A   1 N9    1 
ATOM   6280  C  C8    . A   J  10 36  ? -41.992  -29.360 47.034  1.00 58.54  ? 126 A   1 C8    1 
ATOM   6281  N  N7    . A   J  10 36  ? -42.626  -30.232 47.783  1.00 58.44  ? 126 A   1 N7    1 
ATOM   6282  C  C5    . A   J  10 36  ? -43.516  -30.831 46.908  1.00 52.06  ? 126 A   1 C5    1 
ATOM   6283  C  C6    . A   J  10 36  ? -44.471  -31.832 47.082  1.00 52.13  ? 126 A   1 C6    1 
ATOM   6284  N  N6    . A   J  10 36  ? -44.682  -32.454 48.238  1.00 54.52  ? 126 A   1 N6    1 
ATOM   6285  N  N1    . A   J  10 36  ? -45.223  -32.176 46.019  1.00 54.54  ? 126 A   1 N1    1 
ATOM   6286  C  C2    . A   J  10 36  ? -44.985  -31.584 44.850  1.00 56.00  ? 126 A   1 C2    1 
ATOM   6287  N  N3    . A   J  10 36  ? -44.148  -30.594 44.572  1.00 57.48  ? 126 A   1 N3    1 
ATOM   6288  C  C4    . A   J  10 36  ? -43.423  -30.270 45.654  1.00 52.49  ? 126 A   1 C4    1 
ATOM   6289  P  P     . U   J  10 37  ? -41.269  -25.337 41.734  1.00 51.02  ? 127 U   1 P     1 
ATOM   6290  O  OP1   . U   J  10 37  ? -39.882  -25.060 41.310  1.00 50.77  ? 127 U   1 OP1   1 
ATOM   6291  O  OP2   . U   J  10 37  ? -42.014  -24.348 42.563  1.00 48.43  ? 127 U   1 OP2   1 
ATOM   6292  O  "O5'" . U   J  10 37  ? -42.116  -25.625 40.421  1.00 51.93  ? 127 U   1 "O5'" 1 
ATOM   6293  C  "C5'" . U   J  10 37  ? -41.809  -26.693 39.514  1.00 50.74  ? 127 U   1 "C5'" 1 
ATOM   6294  C  "C4'" . U   J  10 37  ? -42.050  -26.258 38.092  1.00 50.61  ? 127 U   1 "C4'" 1 
ATOM   6295  O  "O4'" . U   J  10 37  ? -43.475  -26.108 37.870  1.00 53.38  ? 127 U   1 "O4'" 1 
ATOM   6296  C  "C3'" . U   J  10 37  ? -41.457  -24.918 37.694  1.00 48.53  ? 127 U   1 "C3'" 1 
ATOM   6297  O  "O3'" . U   J  10 37  ? -41.275  -24.913 36.288  1.00 46.22  ? 127 U   1 "O3'" 1 
ATOM   6298  C  "C2'" . U   J  10 37  ? -42.556  -23.959 38.105  1.00 51.22  ? 127 U   1 "C2'" 1 
ATOM   6299  O  "O2'" . U   J  10 37  ? -42.541  -22.715 37.452  1.00 61.14  ? 127 U   1 "O2'" 1 
ATOM   6300  C  "C1'" . U   J  10 37  ? -43.779  -24.738 37.663  1.00 52.62  ? 127 U   1 "C1'" 1 
ATOM   6301  N  N1    . U   J  10 37  ? -45.001  -24.430 38.410  1.00 55.88  ? 127 U   1 N1    1 
ATOM   6302  C  C2    . U   J  10 37  ? -46.089  -23.998 37.684  1.00 61.01  ? 127 U   1 C2    1 
ATOM   6303  O  O2    . U   J  10 37  ? -46.055  -23.818 36.487  1.00 68.20  ? 127 U   1 O2    1 
ATOM   6304  N  N3    . U   J  10 37  ? -47.242  -23.833 38.402  1.00 63.99  ? 127 U   1 N3    1 
ATOM   6305  C  C4    . U   J  10 37  ? -47.445  -24.151 39.723  1.00 65.47  ? 127 U   1 C4    1 
ATOM   6306  O  O4    . U   J  10 37  ? -48.572  -24.026 40.210  1.00 62.96  ? 127 U   1 O4    1 
ATOM   6307  C  C5    . U   J  10 37  ? -46.277  -24.635 40.402  1.00 63.18  ? 127 U   1 C5    1 
ATOM   6308  C  C6    . U   J  10 37  ? -45.122  -24.740 39.742  1.00 58.22  ? 127 U   1 C6    1 
ATOM   6309  P  P     . U   J  10 38  ? -39.914  -25.490 35.659  1.00 48.77  ? 128 U   1 P     1 
ATOM   6310  O  OP1   . U   J  10 38  ? -40.164  -25.883 34.239  1.00 55.80  ? 128 U   1 OP1   1 
ATOM   6311  O  OP2   . U   J  10 38  ? -39.331  -26.477 36.594  1.00 44.12  ? 128 U   1 OP2   1 
ATOM   6312  O  "O5'" . U   J  10 38  ? -39.056  -24.168 35.408  1.00 49.84  ? 128 U   1 "O5'" 1 
ATOM   6313  C  "C5'" . U   J  10 38  ? -38.742  -23.318 36.505  1.00 52.99  ? 128 U   1 "C5'" 1 
ATOM   6314  C  "C4'" . U   J  10 38  ? -38.189  -22.056 35.938  1.00 54.52  ? 128 U   1 "C4'" 1 
ATOM   6315  O  "O4'" . U   J  10 38  ? -39.268  -21.326 35.323  1.00 57.21  ? 128 U   1 "O4'" 1 
ATOM   6316  C  "C3'" . U   J  10 38  ? -37.598  -21.056 36.928  1.00 57.78  ? 128 U   1 "C3'" 1 
ATOM   6317  O  "O3'" . U   J  10 38  ? -36.213  -21.332 36.928  1.00 54.99  ? 128 U   1 "O3'" 1 
ATOM   6318  C  "C2'" . U   J  10 38  ? -37.836  -19.682 36.280  1.00 59.98  ? 128 U   1 "C2'" 1 
ATOM   6319  O  "O2'" . U   J  10 38  ? -36.637  -19.072 35.816  1.00 61.00  ? 128 U   1 "O2'" 1 
ATOM   6320  C  "C1'" . U   J  10 38  ? -38.794  -20.018 35.127  1.00 59.20  ? 128 U   1 "C1'" 1 
ATOM   6321  N  N1    . U   J  10 38  ? -39.960  -19.161 34.966  1.00 55.62  ? 128 U   1 N1    1 
ATOM   6322  C  C2    . U   J  10 38  ? -40.266  -18.773 33.692  1.00 60.59  ? 128 U   1 C2    1 
ATOM   6323  O  O2    . U   J  10 38  ? -39.580  -19.067 32.728  1.00 70.20  ? 128 U   1 O2    1 
ATOM   6324  N  N3    . U   J  10 38  ? -41.354  -17.945 33.595  1.00 62.54  ? 128 U   1 N3    1 
ATOM   6325  C  C4    . U   J  10 38  ? -42.206  -17.565 34.604  1.00 59.52  ? 128 U   1 C4    1 
ATOM   6326  O  O4    . U   J  10 38  ? -43.154  -16.832 34.351  1.00 57.13  ? 128 U   1 O4    1 
ATOM   6327  C  C5    . U   J  10 38  ? -41.870  -18.089 35.883  1.00 64.00  ? 128 U   1 C5    1 
ATOM   6328  C  C6    . U   J  10 38  ? -40.785  -18.859 36.013  1.00 63.16  ? 128 U   1 C6    1 
ATOM   6329  P  P     . U   J  10 39  ? -35.418  -21.519 38.265  1.00 60.60  ? 129 U   1 P     1 
ATOM   6330  O  OP1   . U   J  10 39  ? -36.179  -22.379 39.250  1.00 52.90  ? 129 U   1 OP1   1 
ATOM   6331  O  OP2   . U   J  10 39  ? -34.839  -20.168 38.576  1.00 64.84  ? 129 U   1 OP2   1 
ATOM   6332  O  "O5'" . U   J  10 39  ? -34.256  -22.492 37.786  1.00 58.04  ? 129 U   1 "O5'" 1 
ATOM   6333  C  "C5'" . U   J  10 39  ? -34.504  -23.708 37.060  1.00 54.67  ? 129 U   1 "C5'" 1 
ATOM   6334  C  "C4'" . U   J  10 39  ? -33.340  -24.006 36.151  1.00 48.80  ? 129 U   1 "C4'" 1 
ATOM   6335  O  "O4'" . U   J  10 39  ? -33.212  -22.895 35.220  1.00 45.68  ? 129 U   1 "O4'" 1 
ATOM   6336  C  "C3'" . U   J  10 39  ? -31.999  -24.105 36.871  1.00 46.90  ? 129 U   1 "C3'" 1 
ATOM   6337  O  "O3'" . U   J  10 39  ? -31.139  -25.056 36.267  1.00 44.69  ? 129 U   1 "O3'" 1 
ATOM   6338  C  "C2'" . U   J  10 39  ? -31.444  -22.703 36.689  1.00 45.07  ? 129 U   1 "C2'" 1 
ATOM   6339  O  "O2'" . U   J  10 39  ? -30.049  -22.629 36.814  1.00 49.41  ? 129 U   1 "O2'" 1 
ATOM   6340  C  "C1'" . U   J  10 39  ? -31.896  -22.430 35.267  1.00 43.45  ? 129 U   1 "C1'" 1 
ATOM   6341  N  N1    . U   J  10 39  ? -31.892  -21.027 34.889  1.00 38.82  ? 129 U   1 N1    1 
ATOM   6342  C  C2    . U   J  10 39  ? -31.137  -20.671 33.793  1.00 40.68  ? 129 U   1 C2    1 
ATOM   6343  O  O2    . U   J  10 39  ? -30.520  -21.477 33.120  1.00 43.19  ? 129 U   1 O2    1 
ATOM   6344  N  N3    . U   J  10 39  ? -31.097  -19.329 33.532  1.00 40.77  ? 129 U   1 N3    1 
ATOM   6345  C  C4    . U   J  10 39  ? -31.755  -18.335 34.214  1.00 40.83  ? 129 U   1 C4    1 
ATOM   6346  O  O4    . U   J  10 39  ? -31.609  -17.161 33.866  1.00 41.90  ? 129 U   1 O4    1 
ATOM   6347  C  C5    . U   J  10 39  ? -32.551  -18.799 35.309  1.00 40.56  ? 129 U   1 C5    1 
ATOM   6348  C  C6    . U   J  10 39  ? -32.601  -20.100 35.593  1.00 38.40  ? 129 U   1 C6    1 
ATOM   6349  P  P     . G   J  10 40  ? -31.170  -26.538 36.790  1.00 46.49  ? 130 G   1 P     1 
ATOM   6350  O  OP1   . G   J  10 40  ? -30.326  -27.376 35.892  1.00 47.52  ? 130 G   1 OP1   1 
ATOM   6351  O  OP2   . G   J  10 40  ? -32.592  -26.908 37.053  1.00 52.32  ? 130 G   1 OP2   1 
ATOM   6352  O  "O5'" . G   J  10 40  ? -30.574  -26.441 38.252  1.00 48.07  ? 130 G   1 "O5'" 1 
ATOM   6353  C  "C5'" . G   J  10 40  ? -29.160  -26.601 38.369  1.00 53.75  ? 130 G   1 "C5'" 1 
ATOM   6354  C  "C4'" . G   J  10 40  ? -28.709  -26.441 39.790  1.00 54.34  ? 130 G   1 "C4'" 1 
ATOM   6355  O  "O4'" . G   J  10 40  ? -28.086  -25.144 39.898  1.00 60.99  ? 130 G   1 "O4'" 1 
ATOM   6356  C  "C3'" . G   J  10 40  ? -29.750  -26.376 40.894  1.00 54.52  ? 130 G   1 "C3'" 1 
ATOM   6357  O  "O3'" . G   J  10 40  ? -30.271  -27.648 41.231  1.00 50.50  ? 130 G   1 "O3'" 1 
ATOM   6358  C  "C2'" . G   J  10 40  ? -28.906  -25.792 42.013  1.00 59.97  ? 130 G   1 "C2'" 1 
ATOM   6359  O  "O2'" . G   J  10 40  ? -28.120  -26.837 42.565  1.00 63.81  ? 130 G   1 "O2'" 1 
ATOM   6360  C  "C1'" . G   J  10 40  ? -27.992  -24.817 41.259  1.00 67.08  ? 130 G   1 "C1'" 1 
ATOM   6361  N  N9    . G   J  10 40  ? -28.233  -23.385 41.406  1.00 76.41  ? 130 G   1 N9    1 
ATOM   6362  C  C8    . G   J  10 40  ? -27.316  -22.435 41.787  1.00 79.30  ? 130 G   1 C8    1 
ATOM   6363  N  N7    . G   J  10 40  ? -27.832  -21.242 41.888  1.00 86.28  ? 130 G   1 N7    1 
ATOM   6364  C  C5    . G   J  10 40  ? -29.166  -21.411 41.542  1.00 87.00  ? 130 G   1 C5    1 
ATOM   6365  C  C6    . G   J  10 40  ? -30.234  -20.477 41.501  1.00 91.93  ? 130 G   1 C6    1 
ATOM   6366  O  O6    . G   J  10 40  ? -30.206  -19.270 41.746  1.00 107.25 ? 130 G   1 O6    1 
ATOM   6367  N  N1    . G   J  10 40  ? -31.427  -21.070 41.104  1.00 88.04  ? 130 G   1 N1    1 
ATOM   6368  C  C2    . G   J  10 40  ? -31.590  -22.407 40.846  1.00 85.47  ? 130 G   1 C2    1 
ATOM   6369  N  N2    . G   J  10 40  ? -32.835  -22.807 40.533  1.00 80.16  ? 130 G   1 N2    1 
ATOM   6370  N  N3    . G   J  10 40  ? -30.606  -23.292 40.899  1.00 87.14  ? 130 G   1 N3    1 
ATOM   6371  C  C4    . G   J  10 40  ? -29.425  -22.724 41.223  1.00 82.21  ? 130 G   1 C4    1 
ATOM   6372  P  P     . U   J  10 41  ? -31.245  -27.832 42.497  1.00 51.60  ? 131 U   1 P     1 
ATOM   6373  O  OP1   . U   J  10 41  ? -32.525  -27.070 42.228  1.00 48.82  ? 131 U   1 OP1   1 
ATOM   6374  O  OP2   . U   J  10 41  ? -30.460  -27.661 43.754  1.00 52.97  ? 131 U   1 OP2   1 
ATOM   6375  O  "O5'" . U   J  10 41  ? -31.634  -29.375 42.472  1.00 46.39  ? 131 U   1 "O5'" 1 
ATOM   6376  C  "C5'" . U   J  10 41  ? -32.336  -29.764 41.283  1.00 49.90  ? 131 U   1 "C5'" 1 
ATOM   6377  C  "C4'" . U   J  10 41  ? -32.351  -31.256 41.104  1.00 47.34  ? 131 U   1 "C4'" 1 
ATOM   6378  O  "O4'" . U   J  10 41  ? -31.027  -31.807 41.248  1.00 43.42  ? 131 U   1 "O4'" 1 
ATOM   6379  C  "C3'" . U   J  10 41  ? -33.220  -31.987 42.116  1.00 45.81  ? 131 U   1 "C3'" 1 
ATOM   6380  O  "O3'" . U   J  10 41  ? -33.749  -33.102 41.396  1.00 45.84  ? 131 U   1 "O3'" 1 
ATOM   6381  C  "C2'" . U   J  10 41  ? -32.211  -32.290 43.206  1.00 43.13  ? 131 U   1 "C2'" 1 
ATOM   6382  O  "O2'" . U   J  10 41  ? -32.729  -33.278 44.085  1.00 38.20  ? 131 U   1 "O2'" 1 
ATOM   6383  C  "C1'" . U   J  10 41  ? -31.029  -32.690 42.323  1.00 44.15  ? 131 U   1 "C1'" 1 
ATOM   6384  N  N1    . U   J  10 41  ? -29.724  -32.611 42.968  1.00 45.11  ? 131 U   1 N1    1 
ATOM   6385  C  C2    . U   J  10 41  ? -29.041  -33.789 43.174  1.00 44.35  ? 131 U   1 C2    1 
ATOM   6386  O  O2    . U   J  10 41  ? -29.452  -34.870 42.798  1.00 48.32  ? 131 U   1 O2    1 
ATOM   6387  N  N3    . U   J  10 41  ? -27.885  -33.662 43.890  1.00 41.54  ? 131 U   1 N3    1 
ATOM   6388  C  C4    . U   J  10 41  ? -27.372  -32.515 44.420  1.00 42.88  ? 131 U   1 C4    1 
ATOM   6389  O  O4    . U   J  10 41  ? -26.316  -32.566 45.026  1.00 48.45  ? 131 U   1 O4    1 
ATOM   6390  C  C5    . U   J  10 41  ? -28.083  -31.326 44.080  1.00 45.64  ? 131 U   1 C5    1 
ATOM   6391  C  C6    . U   J  10 41  ? -29.219  -31.411 43.393  1.00 44.32  ? 131 U   1 C6    1 
ATOM   6392  P  P     . G   J  10 42  ? -35.252  -33.045 41.004  1.00 42.59  ? 132 G   1 P     1 
ATOM   6393  O  OP1   . G   J  10 42  ? -35.452  -31.812 40.167  1.00 46.34  ? 132 G   1 OP1   1 
ATOM   6394  O  OP2   . G   J  10 42  ? -35.950  -33.222 42.308  1.00 47.67  ? 132 G   1 OP2   1 
ATOM   6395  O  "O5'" . G   J  10 42  ? -35.528  -34.329 40.113  1.00 44.82  ? 132 G   1 "O5'" 1 
ATOM   6396  C  "C5'" . G   J  10 42  ? -34.694  -34.665 38.983  1.00 46.52  ? 132 G   1 "C5'" 1 
ATOM   6397  C  "C4'" . G   J  10 42  ? -35.132  -34.140 37.633  1.00 45.54  ? 132 G   1 "C4'" 1 
ATOM   6398  O  "O4'" . G   J  10 42  ? -33.921  -34.150 36.839  1.00 48.03  ? 132 G   1 "O4'" 1 
ATOM   6399  C  "C3'" . G   J  10 42  ? -36.110  -34.977 36.812  1.00 45.62  ? 132 G   1 "C3'" 1 
ATOM   6400  O  "O3'" . G   J  10 42  ? -37.459  -34.570 36.838  1.00 44.35  ? 132 G   1 "O3'" 1 
ATOM   6401  C  "C2'" . G   J  10 42  ? -35.717  -34.644 35.382  1.00 45.78  ? 132 G   1 "C2'" 1 
ATOM   6402  O  "O2'" . G   J  10 42  ? -36.197  -33.430 34.875  1.00 43.14  ? 132 G   1 "O2'" 1 
ATOM   6403  C  "C1'" . G   J  10 42  ? -34.205  -34.564 35.518  1.00 49.49  ? 132 G   1 "C1'" 1 
ATOM   6404  N  N9    . G   J  10 42  ? -33.578  -35.860 35.288  1.00 52.75  ? 132 G   1 N9    1 
ATOM   6405  C  C8    . G   J  10 42  ? -32.965  -36.715 36.173  1.00 50.89  ? 132 G   1 C8    1 
ATOM   6406  N  N7    . G   J  10 42  ? -32.516  -37.800 35.601  1.00 53.01  ? 132 G   1 N7    1 
ATOM   6407  C  C5    . G   J  10 42  ? -32.804  -37.621 34.254  1.00 56.24  ? 132 G   1 C5    1 
ATOM   6408  C  C6    . G   J  10 42  ? -32.565  -38.464 33.144  1.00 63.01  ? 132 G   1 C6    1 
ATOM   6409  O  O6    . G   J  10 42  ? -31.994  -39.555 33.126  1.00 78.06  ? 132 G   1 O6    1 
ATOM   6410  N  N1    . G   J  10 42  ? -33.101  -37.942 31.972  1.00 61.74  ? 132 G   1 N1    1 
ATOM   6411  C  C2    . G   J  10 42  ? -33.812  -36.771 31.890  1.00 63.39  ? 132 G   1 C2    1 
ATOM   6412  N  N2    . G   J  10 42  ? -34.322  -36.450 30.693  1.00 68.21  ? 132 G   1 N2    1 
ATOM   6413  N  N3    . G   J  10 42  ? -34.015  -35.963 32.913  1.00 57.88  ? 132 G   1 N3    1 
ATOM   6414  C  C4    . G   J  10 42  ? -33.487  -36.446 34.053  1.00 53.68  ? 132 G   1 C4    1 
ATOM   6415  P  P     . G   J  10 43  ? -38.610  -35.565 36.389  1.00 45.38  ? 133 G   1 P     1 
ATOM   6416  O  OP1   . G   J  10 43  ? -39.848  -34.737 36.474  1.00 52.82  ? 133 G   1 OP1   1 
ATOM   6417  O  OP2   . G   J  10 43  ? -38.471  -36.774 37.214  1.00 40.69  ? 133 G   1 OP2   1 
ATOM   6418  O  "O5'" . G   J  10 43  ? -38.411  -35.784 34.827  1.00 44.92  ? 133 G   1 "O5'" 1 
ATOM   6419  C  "C5'" . G   J  10 43  ? -38.958  -34.836 33.881  1.00 48.42  ? 133 G   1 "C5'" 1 
ATOM   6420  C  "C4'" . G   J  10 43  ? -38.466  -35.168 32.492  1.00 53.06  ? 133 G   1 "C4'" 1 
ATOM   6421  O  "O4'" . G   J  10 43  ? -39.110  -36.380 32.037  1.00 56.97  ? 133 G   1 "O4'" 1 
ATOM   6422  C  "C3'" . G   J  10 43  ? -38.712  -34.143 31.406  1.00 57.18  ? 133 G   1 "C3'" 1 
ATOM   6423  O  "O3'" . G   J  10 43  ? -37.559  -34.187 30.577  1.00 66.35  ? 133 G   1 "O3'" 1 
ATOM   6424  C  "C2'" . G   J  10 43  ? -39.932  -34.664 30.662  1.00 56.19  ? 133 G   1 "C2'" 1 
ATOM   6425  O  "O2'" . G   J  10 43  ? -39.817  -34.457 29.276  1.00 66.26  ? 133 G   1 "O2'" 1 
ATOM   6426  C  "C1'" . G   J  10 43  ? -39.797  -36.166 30.816  1.00 53.94  ? 133 G   1 "C1'" 1 
ATOM   6427  N  N9    . G   J  10 43  ? -41.089  -36.846 30.911  1.00 58.69  ? 133 G   1 N9    1 
ATOM   6428  C  C8    . G   J  10 43  ? -41.397  -38.000 30.236  1.00 67.05  ? 133 G   1 C8    1 
ATOM   6429  N  N7    . G   J  10 43  ? -42.569  -38.484 30.552  1.00 65.76  ? 133 G   1 N7    1 
ATOM   6430  C  C5    . G   J  10 43  ? -43.025  -37.648 31.556  1.00 61.62  ? 133 G   1 C5    1 
ATOM   6431  C  C6    . G   J  10 43  ? -44.249  -37.666 32.267  1.00 69.54  ? 133 G   1 C6    1 
ATOM   6432  O  O6    . G   J  10 43  ? -45.190  -38.464 32.155  1.00 84.57  ? 133 G   1 O6    1 
ATOM   6433  N  N1    . G   J  10 43  ? -44.341  -36.603 33.162  1.00 64.77  ? 133 G   1 N1    1 
ATOM   6434  C  C2    . G   J  10 43  ? -43.376  -35.644 33.342  1.00 59.69  ? 133 G   1 C2    1 
ATOM   6435  N  N2    . G   J  10 43  ? -43.649  -34.689 34.246  1.00 56.20  ? 133 G   1 N2    1 
ATOM   6436  N  N3    . G   J  10 43  ? -42.237  -35.608 32.664  1.00 61.53  ? 133 G   1 N3    1 
ATOM   6437  C  C4    . G   J  10 43  ? -42.132  -36.625 31.786  1.00 58.36  ? 133 G   1 C4    1 
ATOM   6438  P  P     . U   J  10 44  ? -36.493  -33.002 30.659  1.00 70.03  ? 134 U   1 P     1 
ATOM   6439  O  OP1   . U   J  10 44  ? -35.706  -33.196 31.900  1.00 66.32  ? 134 U   1 OP1   1 
ATOM   6440  O  OP2   . U   J  10 44  ? -37.180  -31.686 30.465  1.00 69.53  ? 134 U   1 OP2   1 
ATOM   6441  O  "O5'" . U   J  10 44  ? -35.596  -33.331 29.389  1.00 77.57  ? 134 U   1 "O5'" 1 
ATOM   6442  C  "C5'" . U   J  10 44  ? -35.707  -32.638 28.139  1.00 89.21  ? 134 U   1 "C5'" 1 
ATOM   6443  C  "C4'" . U   J  10 44  ? -34.749  -33.223 27.129  1.00 93.61  ? 134 U   1 "C4'" 1 
ATOM   6444  O  "O4'" . U   J  10 44  ? -33.449  -32.566 27.235  1.00 100.20 ? 134 U   1 "O4'" 1 
ATOM   6445  C  "C3'" . U   J  10 44  ? -34.491  -34.713 27.303  1.00 91.50  ? 134 U   1 "C3'" 1 
ATOM   6446  O  "O3'" . U   J  10 44  ? -35.452  -35.480 26.598  1.00 81.65  ? 134 U   1 "O3'" 1 
ATOM   6447  C  "C2'" . U   J  10 44  ? -33.061  -34.862 26.795  1.00 99.24  ? 134 U   1 "C2'" 1 
ATOM   6448  O  "O2'" . U   J  10 44  ? -33.012  -35.048 25.393  1.00 96.08  ? 134 U   1 "O2'" 1 
ATOM   6449  C  "C1'" . U   J  10 44  ? -32.421  -33.541 27.251  1.00 102.72 ? 134 U   1 "C1'" 1 
ATOM   6450  N  N1    . U   J  10 44  ? -31.762  -33.532 28.577  1.00 100.49 ? 134 U   1 N1    1 
ATOM   6451  C  C2    . U   J  10 44  ? -30.409  -33.872 28.663  1.00 104.18 ? 134 U   1 C2    1 
ATOM   6452  O  O2    . U   J  10 44  ? -29.742  -34.211 27.692  1.00 96.84  ? 134 U   1 O2    1 
ATOM   6453  N  N3    . U   J  10 44  ? -29.881  -33.824 29.935  1.00 103.11 ? 134 U   1 N3    1 
ATOM   6454  C  C4    . U   J  10 44  ? -30.551  -33.519 31.113  1.00 101.83 ? 134 U   1 C4    1 
ATOM   6455  O  O4    . U   J  10 44  ? -29.944  -33.528 32.190  1.00 88.67  ? 134 U   1 O4    1 
ATOM   6456  C  C5    . U   J  10 44  ? -31.934  -33.174 30.936  1.00 97.72  ? 134 U   1 C5    1 
ATOM   6457  C  C6    . U   J  10 44  ? -32.472  -33.170 29.707  1.00 93.35  ? 134 U   1 C6    1 
ATOM   6458  P  P     . A   J  10 45  ? -36.049  -36.819 27.240  1.00 79.23  ? 135 A   1 P     1 
ATOM   6459  O  OP1   . A   J  10 45  ? -36.433  -37.801 26.157  1.00 73.91  ? 135 A   1 OP1   1 
ATOM   6460  O  OP2   . A   J  10 45  ? -37.037  -36.417 28.298  1.00 87.28  ? 135 A   1 OP2   1 
ATOM   6461  O  "O5'" . A   J  10 45  ? -34.765  -37.448 27.935  1.00 70.16  ? 135 A   1 "O5'" 1 
ATOM   6462  C  "C5'" . A   J  10 45  ? -34.119  -38.645 27.487  1.00 62.17  ? 135 A   1 "C5'" 1 
ATOM   6463  C  "C4'" . A   J  10 45  ? -32.962  -38.961 28.402  1.00 53.89  ? 135 A   1 "C4'" 1 
ATOM   6464  O  "O4'" . A   J  10 45  ? -33.461  -39.677 29.554  1.00 45.84  ? 135 A   1 "O4'" 1 
ATOM   6465  C  "C3'" . A   J  10 45  ? -31.868  -39.826 27.790  1.00 52.08  ? 135 A   1 "C3'" 1 
ATOM   6466  O  "O3'" . A   J  10 45  ? -30.797  -39.057 27.262  1.00 60.82  ? 135 A   1 "O3'" 1 
ATOM   6467  C  "C2'" . A   J  10 45  ? -31.402  -40.626 28.979  1.00 48.72  ? 135 A   1 "C2'" 1 
ATOM   6468  O  "O2'" . A   J  10 45  ? -30.561  -39.883 29.824  1.00 51.37  ? 135 A   1 "O2'" 1 
ATOM   6469  C  "C1'" . A   J  10 45  ? -32.722  -40.853 29.690  1.00 49.46  ? 135 A   1 "C1'" 1 
ATOM   6470  N  N9    . A   J  10 45  ? -33.508  -41.963 29.166  1.00 53.92  ? 135 A   1 N9    1 
ATOM   6471  C  C8    . A   J  10 45  ? -34.866  -42.018 28.989  1.00 58.19  ? 135 A   1 C8    1 
ATOM   6472  N  N7    . A   J  10 45  ? -35.313  -43.211 28.674  1.00 58.03  ? 135 A   1 N7    1 
ATOM   6473  C  C5    . A   J  10 45  ? -34.171  -43.988 28.629  1.00 58.98  ? 135 A   1 C5    1 
ATOM   6474  C  C6    . A   J  10 45  ? -33.966  -45.334 28.312  1.00 71.35  ? 135 A   1 C6    1 
ATOM   6475  N  N6    . A   J  10 45  ? -34.941  -46.164 27.948  1.00 81.43  ? 135 A   1 N6    1 
ATOM   6476  N  N1    . A   J  10 45  ? -32.702  -45.807 28.361  1.00 78.85  ? 135 A   1 N1    1 
ATOM   6477  C  C2    . A   J  10 45  ? -31.717  -44.968 28.706  1.00 73.58  ? 135 A   1 C2    1 
ATOM   6478  N  N3    . A   J  10 45  ? -31.787  -43.681 29.034  1.00 67.22  ? 135 A   1 N3    1 
ATOM   6479  C  C4    . A   J  10 45  ? -33.055  -43.242 28.954  1.00 59.54  ? 135 A   1 C4    1 
ATOM   6480  P  P     . G   J  10 46  ? -30.233  -39.330 25.770  1.00 63.00  ? 136 G   1 P     1 
ATOM   6481  O  OP1   . G   J  10 46  ? -29.332  -38.195 25.394  1.00 61.00  ? 136 G   1 OP1   1 
ATOM   6482  O  OP2   . G   J  10 46  ? -31.370  -39.735 24.894  1.00 58.87  ? 136 G   1 OP2   1 
ATOM   6483  O  "O5'" . G   J  10 46  ? -29.223  -40.548 25.939  1.00 58.80  ? 136 G   1 "O5'" 1 
ATOM   6484  C  "C5'" . G   J  10 46  ? -28.183  -40.704 24.972  1.00 66.08  ? 136 G   1 "C5'" 1 
ATOM   6485  C  "C4'" . G   J  10 46  ? -27.710  -42.134 24.941  1.00 71.26  ? 136 G   1 "C4'" 1 
ATOM   6486  O  "O4'" . G   J  10 46  ? -26.814  -42.319 26.060  1.00 77.86  ? 136 G   1 "O4'" 1 
ATOM   6487  C  "C3'" . G   J  10 46  ? -28.817  -43.170 25.077  1.00 76.07  ? 136 G   1 "C3'" 1 
ATOM   6488  O  "O3'" . G   J  10 46  ? -29.191  -44.110 24.071  1.00 86.50  ? 136 G   1 "O3'" 1 
ATOM   6489  C  "C2'" . G   J  10 46  ? -28.748  -43.614 26.538  1.00 75.37  ? 136 G   1 "C2'" 1 
ATOM   6490  O  "O2'" . G   J  10 46  ? -28.984  -44.954 26.897  1.00 65.33  ? 136 G   1 "O2'" 1 
ATOM   6491  C  "C1'" . G   J  10 46  ? -27.283  -43.371 26.879  1.00 78.97  ? 136 G   1 "C1'" 1 
ATOM   6492  N  N9    . G   J  10 46  ? -27.103  -42.997 28.282  1.00 83.24  ? 136 G   1 N9    1 
ATOM   6493  C  C8    . G   J  10 46  ? -27.883  -42.142 29.023  1.00 80.82  ? 136 G   1 C8    1 
ATOM   6494  N  N7    . G   J  10 46  ? -27.469  -42.009 30.251  1.00 78.75  ? 136 G   1 N7    1 
ATOM   6495  C  C5    . G   J  10 46  ? -26.337  -42.806 30.319  1.00 73.01  ? 136 G   1 C5    1 
ATOM   6496  C  C6    . G   J  10 46  ? -25.467  -43.051 31.397  1.00 75.54  ? 136 G   1 C6    1 
ATOM   6497  O  O6    . G   J  10 46  ? -25.530  -42.603 32.546  1.00 75.73  ? 136 G   1 O6    1 
ATOM   6498  N  N1    . G   J  10 46  ? -24.445  -43.919 31.039  1.00 77.83  ? 136 G   1 N1    1 
ATOM   6499  C  C2    . G   J  10 46  ? -24.273  -44.455 29.788  1.00 83.28  ? 136 G   1 C2    1 
ATOM   6500  N  N2    . G   J  10 46  ? -23.223  -45.261 29.626  1.00 96.64  ? 136 G   1 N2    1 
ATOM   6501  N  N3    . G   J  10 46  ? -25.072  -44.222 28.766  1.00 78.85  ? 136 G   1 N3    1 
ATOM   6502  C  C4    . G   J  10 46  ? -26.088  -43.408 29.108  1.00 76.81  ? 136 G   1 C4    1 
ATOM   6503  P  P     . U   J  10 47  ? -28.209  -44.947 23.196  1.00 83.28  ? 137 U   1 P     1 
ATOM   6504  O  OP1   . U   J  10 47  ? -26.844  -44.837 23.749  1.00 86.83  ? 137 U   1 OP1   1 
ATOM   6505  O  OP2   . U   J  10 47  ? -28.551  -44.672 21.829  1.00 81.62  ? 137 U   1 OP2   1 
ATOM   6506  O  "O5'" . U   J  10 47  ? -28.581  -46.365 23.793  1.00 95.13  ? 137 U   1 "O5'" 1 
ATOM   6507  C  "C5'" . U   J  10 47  ? -29.216  -47.397 23.052  1.00 104.23 ? 137 U   1 "C5'" 1 
ATOM   6508  C  "C4'" . U   J  10 47  ? -30.698  -47.635 23.335  1.00 97.57  ? 137 U   1 "C4'" 1 
ATOM   6509  O  "O4'" . U   J  10 47  ? -31.236  -46.804 24.387  1.00 80.30  ? 137 U   1 "O4'" 1 
ATOM   6510  C  "C3'" . U   J  10 47  ? -31.620  -47.406 22.139  1.00 105.20 ? 137 U   1 "C3'" 1 
ATOM   6511  O  "O3'" . U   J  10 47  ? -32.223  -48.602 21.670  1.00 117.49 ? 137 U   1 "O3'" 1 
ATOM   6512  C  "C2'" . U   J  10 47  ? -32.544  -46.285 22.588  1.00 94.47  ? 137 U   1 "C2'" 1 
ATOM   6513  O  "O2'" . U   J  10 47  ? -33.816  -46.225 21.972  1.00 95.28  ? 137 U   1 "O2'" 1 
ATOM   6514  C  "C1'" . U   J  10 47  ? -32.586  -46.536 24.089  1.00 85.48  ? 137 U   1 "C1'" 1 
ATOM   6515  N  N1    . U   J  10 47  ? -33.022  -45.255 24.663  1.00 87.35  ? 137 U   1 N1    1 
ATOM   6516  C  C2    . U   J  10 47  ? -34.388  -45.053 24.704  1.00 85.50  ? 137 U   1 C2    1 
ATOM   6517  O  O2    . U   J  10 47  ? -35.189  -45.926 24.433  1.00 86.25  ? 137 U   1 O2    1 
ATOM   6518  N  N3    . U   J  10 47  ? -34.778  -43.807 25.127  1.00 81.19  ? 137 U   1 N3    1 
ATOM   6519  C  C4    . U   J  10 47  ? -33.968  -42.737 25.418  1.00 79.34  ? 137 U   1 C4    1 
ATOM   6520  O  O4    . U   J  10 47  ? -34.475  -41.665 25.751  1.00 82.42  ? 137 U   1 O4    1 
ATOM   6521  C  C5    . U   J  10 47  ? -32.570  -43.007 25.297  1.00 79.62  ? 137 U   1 C5    1 
ATOM   6522  C  C6    . U   J  10 47  ? -32.156  -44.223 24.932  1.00 80.88  ? 137 U   1 C6    1 
ATOM   6523  P  P     . G   J  10 48  ? -31.581  -49.368 20.407  1.00 117.54 ? 138 G   1 P     1 
ATOM   6524  O  OP1   . G   J  10 48  ? -32.392  -50.617 20.359  1.00 125.61 ? 138 G   1 OP1   1 
ATOM   6525  O  OP2   . G   J  10 48  ? -30.101  -49.486 20.542  1.00 106.05 ? 138 G   1 OP2   1 
ATOM   6526  O  "O5'" . G   J  10 48  ? -31.641  -48.332 19.181  1.00 122.29 ? 138 G   1 "O5'" 1 
ATOM   6527  C  "C5'" . G   J  10 48  ? -30.991  -47.036 19.078  1.00 142.68 ? 138 G   1 "C5'" 1 
ATOM   6528  C  "C4'" . G   J  10 48  ? -30.324  -46.728 17.742  1.00 164.67 ? 138 G   1 "C4'" 1 
ATOM   6529  O  "O4'" . G   J  10 48  ? -29.138  -45.874 17.903  1.00 168.29 ? 138 G   1 "O4'" 1 
ATOM   6530  C  "C3'" . G   J  10 48  ? -29.890  -47.916 16.885  1.00 171.90 ? 138 G   1 "C3'" 1 
ATOM   6531  O  "O3'" . G   J  10 48  ? -30.887  -48.223 15.912  1.00 163.06 ? 138 G   1 "O3'" 1 
ATOM   6532  C  "C2'" . G   J  10 48  ? -28.610  -47.415 16.206  1.00 170.11 ? 138 G   1 "C2'" 1 
ATOM   6533  O  "O2'" . G   J  10 48  ? -28.757  -46.671 15.017  1.00 172.88 ? 138 G   1 "O2'" 1 
ATOM   6534  C  "C1'" . G   J  10 48  ? -28.027  -46.459 17.251  1.00 162.71 ? 138 G   1 "C1'" 1 
ATOM   6535  N  N9    . G   J  10 48  ? -27.165  -47.124 18.230  1.00 170.34 ? 138 G   1 N9    1 
ATOM   6536  C  C8    . G   J  10 48  ? -27.504  -47.588 19.481  1.00 162.36 ? 138 G   1 C8    1 
ATOM   6537  N  N7    . G   J  10 48  ? -26.515  -48.171 20.101  1.00 153.11 ? 138 G   1 N7    1 
ATOM   6538  C  C5    . G   J  10 48  ? -25.465  -48.117 19.194  1.00 176.85 ? 138 G   1 C5    1 
ATOM   6539  C  C6    . G   J  10 48  ? -24.128  -48.590 19.302  1.00 175.96 ? 138 G   1 C6    1 
ATOM   6540  O  O6    . G   J  10 48  ? -23.596  -49.180 20.251  1.00 170.72 ? 138 G   1 O6    1 
ATOM   6541  N  N1    . G   J  10 48  ? -23.390  -48.311 18.151  1.00 176.54 ? 138 G   1 N1    1 
ATOM   6542  C  C2    . G   J  10 48  ? -23.870  -47.653 17.039  1.00 164.59 ? 138 G   1 C2    1 
ATOM   6543  N  N2    . G   J  10 48  ? -23.006  -47.464 16.029  1.00 137.82 ? 138 G   1 N2    1 
ATOM   6544  N  N3    . G   J  10 48  ? -25.113  -47.207 16.929  1.00 179.71 ? 138 G   1 N3    1 
ATOM   6545  C  C4    . G   J  10 48  ? -25.850  -47.473 18.033  1.00 181.80 ? 138 G   1 C4    1 
ATOM   6546  O  "O5'" . A   K  11 1   ? -29.897  5.156   55.413  1.00 198.06 ? 1   A   X "O5'" 1 
ATOM   6547  C  "C5'" . A   K  11 1   ? -28.837  4.214   55.157  1.00 176.08 ? 1   A   X "C5'" 1 
ATOM   6548  C  "C4'" . A   K  11 1   ? -29.225  3.343   53.989  1.00 165.24 ? 1   A   X "C4'" 1 
ATOM   6549  O  "O4'" . A   K  11 1   ? -30.528  2.736   54.211  1.00 161.69 ? 1   A   X "O4'" 1 
ATOM   6550  C  "C3'" . A   K  11 1   ? -29.420  4.059   52.657  1.00 157.22 ? 1   A   X "C3'" 1 
ATOM   6551  O  "O3'" . A   K  11 1   ? -28.180  4.364   52.037  1.00 142.47 ? 1   A   X "O3'" 1 
ATOM   6552  C  "C2'" . A   K  11 1   ? -30.238  3.042   51.876  1.00 153.81 ? 1   A   X "C2'" 1 
ATOM   6553  O  "O2'" . A   K  11 1   ? -29.390  2.035   51.367  1.00 169.05 ? 1   A   X "O2'" 1 
ATOM   6554  C  "C1'" . A   K  11 1   ? -31.145  2.478   52.965  1.00 141.48 ? 1   A   X "C1'" 1 
ATOM   6555  N  N9    . A   K  11 1   ? -32.486  3.046   52.976  1.00 124.13 ? 1   A   X N9    1 
ATOM   6556  C  C8    . A   K  11 1   ? -33.046  4.019   53.765  1.00 123.85 ? 1   A   X C8    1 
ATOM   6557  N  N7    . A   K  11 1   ? -34.306  4.258   53.490  1.00 128.50 ? 1   A   X N7    1 
ATOM   6558  C  C5    . A   K  11 1   ? -34.595  3.385   52.448  1.00 121.26 ? 1   A   X C5    1 
ATOM   6559  C  C6    . A   K  11 1   ? -35.765  3.148   51.689  1.00 108.69 ? 1   A   X C6    1 
ATOM   6560  N  N6    . A   K  11 1   ? -36.926  3.772   51.882  1.00 111.35 ? 1   A   X N6    1 
ATOM   6561  N  N1    . A   K  11 1   ? -35.707  2.216   50.715  1.00 113.07 ? 1   A   X N1    1 
ATOM   6562  C  C2    . A   K  11 1   ? -34.544  1.581   50.509  1.00 130.16 ? 1   A   X C2    1 
ATOM   6563  N  N3    . A   K  11 1   ? -33.381  1.716   51.149  1.00 123.85 ? 1   A   X N3    1 
ATOM   6564  C  C4    . A   K  11 1   ? -33.479  2.636   52.123  1.00 122.12 ? 1   A   X C4    1 
ATOM   6565  P  P     . G   K  11 2   ? -28.044  5.711   51.188  1.00 137.71 ? 2   G   X P     1 
ATOM   6566  O  OP1   . G   K  11 2   ? -26.596  5.914   50.953  1.00 124.06 ? 2   G   X OP1   1 
ATOM   6567  O  OP2   . G   K  11 2   ? -28.914  6.772   51.780  1.00 131.62 ? 2   G   X OP2   1 
ATOM   6568  O  "O5'" . G   K  11 2   ? -28.781  5.371   49.816  1.00 136.63 ? 2   G   X "O5'" 1 
ATOM   6569  C  "C5'" . G   K  11 2   ? -28.266  4.387   48.888  1.00 122.90 ? 2   G   X "C5'" 1 
ATOM   6570  C  "C4'" . G   K  11 2   ? -29.367  3.914   47.968  1.00 110.16 ? 2   G   X "C4'" 1 
ATOM   6571  O  "O4'" . G   K  11 2   ? -30.566  3.599   48.721  1.00 105.17 ? 2   G   X "O4'" 1 
ATOM   6572  C  "C3'" . G   K  11 2   ? -29.955  4.967   47.056  1.00 106.44 ? 2   G   X "C3'" 1 
ATOM   6573  O  "O3'" . G   K  11 2   ? -29.083  5.299   45.995  1.00 107.30 ? 2   G   X "O3'" 1 
ATOM   6574  C  "C2'" . G   K  11 2   ? -31.222  4.279   46.579  1.00 98.42  ? 2   G   X "C2'" 1 
ATOM   6575  O  "O2'" . G   K  11 2   ? -31.107  3.301   45.583  1.00 112.86 ? 2   G   X "O2'" 1 
ATOM   6576  C  "C1'" . G   K  11 2   ? -31.658  3.551   47.835  1.00 96.90  ? 2   G   X "C1'" 1 
ATOM   6577  N  N9    . G   K  11 2   ? -32.798  4.206   48.443  1.00 93.44  ? 2   G   X N9    1 
ATOM   6578  C  C8    . G   K  11 2   ? -32.825  5.071   49.510  1.00 98.27  ? 2   G   X C8    1 
ATOM   6579  N  N7    . G   K  11 2   ? -34.033  5.461   49.818  1.00 103.07 ? 2   G   X N7    1 
ATOM   6580  C  C5    . G   K  11 2   ? -34.850  4.818   48.896  1.00 93.68  ? 2   G   X C5    1 
ATOM   6581  C  C6    . G   K  11 2   ? -36.263  4.849   48.726  1.00 90.81  ? 2   G   X C6    1 
ATOM   6582  O  O6    . G   K  11 2   ? -37.115  5.482   49.358  1.00 102.36 ? 2   G   X O6    1 
ATOM   6583  N  N1    . G   K  11 2   ? -36.665  4.053   47.665  1.00 85.20  ? 2   G   X N1    1 
ATOM   6584  C  C2    . G   K  11 2   ? -35.838  3.311   46.870  1.00 85.10  ? 2   G   X C2    1 
ATOM   6585  N  N2    . G   K  11 2   ? -36.452  2.604   45.911  1.00 83.05  ? 2   G   X N2    1 
ATOM   6586  N  N3    . G   K  11 2   ? -34.522  3.259   47.018  1.00 87.10  ? 2   G   X N3    1 
ATOM   6587  C  C4    . G   K  11 2   ? -34.100  4.042   48.037  1.00 92.97  ? 2   G   X C4    1 
ATOM   6588  P  P     . G   K  11 3   ? -29.229  6.719   45.300  1.00 100.58 ? 3   G   X P     1 
ATOM   6589  O  OP1   . G   K  11 3   ? -27.866  7.080   44.790  1.00 83.94  ? 3   G   X OP1   1 
ATOM   6590  O  OP2   . G   K  11 3   ? -29.911  7.623   46.265  1.00 101.75 ? 3   G   X OP2   1 
ATOM   6591  O  "O5'" . G   K  11 3   ? -30.463  6.534   44.301  1.00 88.68  ? 3   G   X "O5'" 1 
ATOM   6592  C  "C5'" . G   K  11 3   ? -30.338  5.856   43.032  1.00 86.48  ? 3   G   X "C5'" 1 
ATOM   6593  C  "C4'" . G   K  11 3   ? -31.697  5.371   42.580  1.00 84.13  ? 3   G   X "C4'" 1 
ATOM   6594  O  "O4'" . G   K  11 3   ? -32.402  4.912   43.751  1.00 87.16  ? 3   G   X "O4'" 1 
ATOM   6595  C  "C3'" . G   K  11 3   ? -32.653  6.407   42.008  1.00 84.84  ? 3   G   X "C3'" 1 
ATOM   6596  O  "O3'" . G   K  11 3   ? -32.498  6.643   40.622  1.00 85.00  ? 3   G   X "O3'" 1 
ATOM   6597  C  "C2'" . G   K  11 3   ? -34.010  5.764   42.237  1.00 85.05  ? 3   G   X "C2'" 1 
ATOM   6598  O  "O2'" . G   K  11 3   ? -34.485  4.809   41.304  1.00 85.07  ? 3   G   X "O2'" 1 
ATOM   6599  C  "C1'" . G   K  11 3   ? -33.787  5.134   43.604  1.00 84.39  ? 3   G   X "C1'" 1 
ATOM   6600  N  N9    . G   K  11 3   ? -34.230  5.933   44.737  1.00 84.33  ? 3   G   X N9    1 
ATOM   6601  C  C8    . G   K  11 3   ? -33.483  6.402   45.790  1.00 91.38  ? 3   G   X C8    1 
ATOM   6602  N  N7    . G   K  11 3   ? -34.194  7.028   46.687  1.00 98.66  ? 3   G   X N7    1 
ATOM   6603  C  C5    . G   K  11 3   ? -35.488  6.970   46.195  1.00 92.67  ? 3   G   X C5    1 
ATOM   6604  C  C6    . G   K  11 3   ? -36.697  7.489   46.726  1.00 91.79  ? 3   G   X C6    1 
ATOM   6605  O  O6    . G   K  11 3   ? -36.875  8.103   47.781  1.00 90.29  ? 3   G   X O6    1 
ATOM   6606  N  N1    . G   K  11 3   ? -37.778  7.197   45.907  1.00 88.11  ? 3   G   X N1    1 
ATOM   6607  C  C2    . G   K  11 3   ? -37.714  6.502   44.727  1.00 86.23  ? 3   G   X C2    1 
ATOM   6608  N  N2    . G   K  11 3   ? -38.872  6.324   44.086  1.00 79.63  ? 3   G   X N2    1 
ATOM   6609  N  N3    . G   K  11 3   ? -36.594  6.018   44.215  1.00 87.09  ? 3   G   X N3    1 
ATOM   6610  C  C4    . G   K  11 3   ? -35.527  6.288   44.996  1.00 86.98  ? 3   G   X C4    1 
ATOM   6611  P  P     . U   K  11 4   ? -32.192  8.122   40.128  1.00 93.13  ? 4   U   X P     1 
ATOM   6612  O  OP1   . U   K  11 4   ? -31.694  8.115   38.695  1.00 90.98  ? 4   U   X OP1   1 
ATOM   6613  O  OP2   . U   K  11 4   ? -31.244  8.683   41.132  1.00 90.80  ? 4   U   X OP2   1 
ATOM   6614  O  "O5'" . U   K  11 4   ? -33.679  8.681   40.109  1.00 75.74  ? 4   U   X "O5'" 1 
ATOM   6615  C  "C5'" . U   K  11 4   ? -34.442  8.229   38.988  1.00 82.10  ? 4   U   X "C5'" 1 
ATOM   6616  C  "C4'" . U   K  11 4   ? -35.894  8.177   39.330  1.00 84.24  ? 4   U   X "C4'" 1 
ATOM   6617  O  "O4'" . U   K  11 4   ? -36.015  7.801   40.712  1.00 86.82  ? 4   U   X "O4'" 1 
ATOM   6618  C  "C3'" . U   K  11 4   ? -36.585  9.523   39.335  1.00 91.25  ? 4   U   X "C3'" 1 
ATOM   6619  O  "O3'" . U   K  11 4   ? -36.762  9.965   38.000  1.00 96.86  ? 4   U   X "O3'" 1 
ATOM   6620  C  "C2'" . U   K  11 4   ? -37.831  9.230   40.160  1.00 88.89  ? 4   U   X "C2'" 1 
ATOM   6621  O  "O2'" . U   K  11 4   ? -38.928  8.691   39.447  1.00 77.57  ? 4   U   X "O2'" 1 
ATOM   6622  C  "C1'" . U   K  11 4   ? -37.226  8.326   41.237  1.00 90.01  ? 4   U   X "C1'" 1 
ATOM   6623  N  N1    . U   K  11 4   ? -36.906  8.981   42.513  1.00 92.57  ? 4   U   X N1    1 
ATOM   6624  C  C2    . U   K  11 4   ? -37.958  9.401   43.307  1.00 89.83  ? 4   U   X C2    1 
ATOM   6625  O  O2    . U   K  11 4   ? -39.127  9.289   42.968  1.00 80.73  ? 4   U   X O2    1 
ATOM   6626  N  N3    . U   K  11 4   ? -37.583  9.973   44.502  1.00 90.21  ? 4   U   X N3    1 
ATOM   6627  C  C4    . U   K  11 4   ? -36.292  10.166  44.971  1.00 95.29  ? 4   U   X C4    1 
ATOM   6628  O  O4    . U   K  11 4   ? -36.105  10.707  46.062  1.00 95.22  ? 4   U   X O4    1 
ATOM   6629  C  C5    . U   K  11 4   ? -35.265  9.702   44.090  1.00 98.96  ? 4   U   X C5    1 
ATOM   6630  C  C6    . U   K  11 4   ? -35.596  9.137   42.924  1.00 96.85  ? 4   U   X C6    1 
ATOM   6631  P  P     . A   K  11 5   ? -36.307  11.447  37.625  1.00 91.40  ? 5   A   X P     1 
ATOM   6632  O  OP1   . A   K  11 5   ? -36.375  11.579  36.130  1.00 88.45  ? 5   A   X OP1   1 
ATOM   6633  O  OP2   . A   K  11 5   ? -34.976  11.666  38.288  1.00 78.80  ? 5   A   X OP2   1 
ATOM   6634  O  "O5'" . A   K  11 5   ? -37.593  12.231  38.149  1.00 90.91  ? 5   A   X "O5'" 1 
ATOM   6635  C  "C5'" . A   K  11 5   ? -38.887  11.967  37.547  1.00 103.61 ? 5   A   X "C5'" 1 
ATOM   6636  C  "C4'" . A   K  11 5   ? -40.023  12.468  38.420  1.00 110.37 ? 5   A   X "C4'" 1 
ATOM   6637  O  "O4'" . A   K  11 5   ? -40.054  11.740  39.676  1.00 105.04 ? 5   A   X "O4'" 1 
ATOM   6638  C  "C3'" . A   K  11 5   ? -39.956  13.927  38.871  1.00 117.83 ? 5   A   X "C3'" 1 
ATOM   6639  O  "O3'" . A   K  11 5   ? -40.417  14.865  37.908  1.00 129.33 ? 5   A   X "O3'" 1 
ATOM   6640  C  "C2'" . A   K  11 5   ? -40.865  13.918  40.087  1.00 104.57 ? 5   A   X "C2'" 1 
ATOM   6641  O  "O2'" . A   K  11 5   ? -42.222  13.860  39.721  1.00 105.00 ? 5   A   X "O2'" 1 
ATOM   6642  C  "C1'" . A   K  11 5   ? -40.418  12.615  40.725  1.00 97.04  ? 5   A   X "C1'" 1 
ATOM   6643  N  N9    . A   K  11 5   ? -39.251  12.808  41.570  1.00 92.67  ? 5   A   X N9    1 
ATOM   6644  C  C8    . A   K  11 5   ? -37.903  12.655  41.339  1.00 95.73  ? 5   A   X C8    1 
ATOM   6645  N  N7    . A   K  11 5   ? -37.158  12.862  42.399  1.00 98.97  ? 5   A   X N7    1 
ATOM   6646  C  C5    . A   K  11 5   ? -38.077  13.185  43.390  1.00 101.41 ? 5   A   X C5    1 
ATOM   6647  C  C6    . A   K  11 5   ? -37.931  13.532  44.745  1.00 100.11 ? 5   A   X C6    1 
ATOM   6648  N  N6    . A   K  11 5   ? -36.756  13.610  45.376  1.00 103.67 ? 5   A   X N6    1 
ATOM   6649  N  N1    . A   K  11 5   ? -39.057  13.781  45.448  1.00 99.60  ? 5   A   X N1    1 
ATOM   6650  C  C2    . A   K  11 5   ? -40.240  13.729  44.820  1.00 97.25  ? 5   A   X C2    1 
ATOM   6651  N  N3    . A   K  11 5   ? -40.505  13.428  43.552  1.00 92.68  ? 5   A   X N3    1 
ATOM   6652  C  C4    . A   K  11 5   ? -39.369  13.158  42.889  1.00 95.16  ? 5   A   X C4    1 
ATOM   6653  P  P     . A   K  11 6   ? -39.619  16.236  37.679  1.00 121.58 ? 6   A   X P     1 
ATOM   6654  O  OP1   . A   K  11 6   ? -39.692  16.499  36.226  1.00 106.38 ? 6   A   X OP1   1 
ATOM   6655  O  OP2   . A   K  11 6   ? -38.282  16.175  38.371  1.00 107.33 ? 6   A   X OP2   1 
ATOM   6656  O  "O5'" . A   K  11 6   ? -40.491  17.279  38.510  1.00 128.89 ? 6   A   X "O5'" 1 
ATOM   6657  C  "C5'" . A   K  11 6   ? -41.924  17.206  38.665  1.00 129.24 ? 6   A   X "C5'" 1 
ATOM   6658  C  "C4'" . A   K  11 6   ? -42.330  17.851  39.974  1.00 130.99 ? 6   A   X "C4'" 1 
ATOM   6659  O  "O4'" . A   K  11 6   ? -42.158  16.907  41.073  1.00 127.07 ? 6   A   X "O4'" 1 
ATOM   6660  C  "C3'" . A   K  11 6   ? -41.531  19.073  40.430  1.00 132.29 ? 6   A   X "C3'" 1 
ATOM   6661  O  "O3'" . A   K  11 6   ? -41.768  20.327  39.797  1.00 134.15 ? 6   A   X "O3'" 1 
ATOM   6662  C  "C2'" . A   K  11 6   ? -41.885  19.093  41.908  1.00 129.89 ? 6   A   X "C2'" 1 
ATOM   6663  O  "O2'" . A   K  11 6   ? -43.148  19.705  42.100  1.00 123.98 ? 6   A   X "O2'" 1 
ATOM   6664  C  "C1'" . A   K  11 6   ? -41.755  17.604  42.236  1.00 122.30 ? 6   A   X "C1'" 1 
ATOM   6665  N  N9    . A   K  11 6   ? -40.372  17.239  42.550  1.00 116.59 ? 6   A   X N9    1 
ATOM   6666  C  C8    . A   K  11 6   ? -39.349  16.837  41.725  1.00 119.82 ? 6   A   X C8    1 
ATOM   6667  N  N7    . A   K  11 6   ? -38.209  16.647  42.346  1.00 117.23 ? 6   A   X N7    1 
ATOM   6668  C  C5    . A   K  11 6   ? -38.495  16.964  43.665  1.00 109.89 ? 6   A   X C5    1 
ATOM   6669  C  C6    . A   K  11 6   ? -37.710  16.961  44.829  1.00 105.94 ? 6   A   X C6    1 
ATOM   6670  N  N6    . A   K  11 6   ? -36.426  16.597  44.864  1.00 104.39 ? 6   A   X N6    1 
ATOM   6671  N  N1    . A   K  11 6   ? -38.302  17.346  45.980  1.00 111.74 ? 6   A   X N1    1 
ATOM   6672  C  C2    . A   K  11 6   ? -39.592  17.711  45.957  1.00 114.52 ? 6   A   X C2    1 
ATOM   6673  N  N3    . A   K  11 6   ? -40.437  17.741  44.930  1.00 110.46 ? 6   A   X N3    1 
ATOM   6674  C  C4    . A   K  11 6   ? -39.819  17.352  43.801  1.00 112.88 ? 6   A   X C4    1 
ATOM   6675  P  P     . G   K  11 7   ? -40.645  21.476  39.863  1.00 139.95 ? 7   G   X P     1 
ATOM   6676  O  OP1   . G   K  11 7   ? -41.144  22.586  39.024  1.00 132.62 ? 7   G   X OP1   1 
ATOM   6677  O  OP2   . G   K  11 7   ? -39.301  20.888  39.612  1.00 119.69 ? 7   G   X OP2   1 
ATOM   6678  O  "O5'" . G   K  11 7   ? -40.587  21.892  41.399  1.00 132.23 ? 7   G   X "O5'" 1 
ATOM   6679  C  "C5'" . G   K  11 7   ? -41.487  22.862  41.966  1.00 134.39 ? 7   G   X "C5'" 1 
ATOM   6680  C  "C4'" . G   K  11 7   ? -41.210  22.999  43.442  1.00 142.43 ? 7   G   X "C4'" 1 
ATOM   6681  O  "O4'" . G   K  11 7   ? -40.842  21.705  43.997  1.00 150.78 ? 7   G   X "O4'" 1 
ATOM   6682  C  "C3'" . G   K  11 7   ? -40.013  23.858  43.809  1.00 151.03 ? 7   G   X "C3'" 1 
ATOM   6683  O  "O3'" . G   K  11 7   ? -40.222  25.258  43.683  1.00 150.27 ? 7   G   X "O3'" 1 
ATOM   6684  C  "C2'" . G   K  11 7   ? -39.725  23.381  45.231  1.00 151.49 ? 7   G   X "C2'" 1 
ATOM   6685  O  "O2'" . G   K  11 7   ? -40.538  23.911  46.257  1.00 154.44 ? 7   G   X "O2'" 1 
ATOM   6686  C  "C1'" . G   K  11 7   ? -39.929  21.877  45.074  1.00 145.93 ? 7   G   X "C1'" 1 
ATOM   6687  N  N9    . G   K  11 7   ? -38.675  21.195  44.764  1.00 137.28 ? 7   G   X N9    1 
ATOM   6688  C  C8    . G   K  11 7   ? -38.260  20.713  43.545  1.00 134.22 ? 7   G   X C8    1 
ATOM   6689  N  N7    . G   K  11 7   ? -37.069  20.179  43.583  1.00 136.04 ? 7   G   X N7    1 
ATOM   6690  C  C5    . G   K  11 7   ? -36.668  20.326  44.904  1.00 134.79 ? 7   G   X C5    1 
ATOM   6691  C  C6    . G   K  11 7   ? -35.467  19.930  45.553  1.00 134.99 ? 7   G   X C6    1 
ATOM   6692  O  O6    . G   K  11 7   ? -34.481  19.356  45.075  1.00 128.72 ? 7   G   X O6    1 
ATOM   6693  N  N1    . G   K  11 7   ? -35.481  20.265  46.903  1.00 143.01 ? 7   G   X N1    1 
ATOM   6694  C  C2    . G   K  11 7   ? -36.504  20.919  47.546  1.00 143.99 ? 7   G   X C2    1 
ATOM   6695  N  N2    . G   K  11 7   ? -36.321  21.160  48.857  1.00 148.12 ? 7   G   X N2    1 
ATOM   6696  N  N3    . G   K  11 7   ? -37.635  21.282  46.957  1.00 135.41 ? 7   G   X N3    1 
ATOM   6697  C  C4    . G   K  11 7   ? -37.646  20.959  45.644  1.00 134.93 ? 7   G   X C4    1 
ATOM   6698  P  P     . U   K  11 8   ? -38.960  26.245  43.777  1.00 150.37 ? 8   U   X P     1 
ATOM   6699  O  OP1   . U   K  11 8   ? -39.475  27.624  43.649  1.00 163.70 ? 8   U   X OP1   1 
ATOM   6700  O  OP2   . U   K  11 8   ? -37.939  25.785  42.816  1.00 141.85 ? 8   U   X OP2   1 
ATOM   6701  O  "O5'" . U   K  11 8   ? -38.348  25.989  45.228  1.00 140.30 ? 8   U   X "O5'" 1 
ATOM   6702  C  "C5'" . U   K  11 8   ? -38.774  26.710  46.397  1.00 142.81 ? 8   U   X "C5'" 1 
ATOM   6703  C  "C4'" . U   K  11 8   ? -37.761  26.539  47.501  1.00 155.04 ? 8   U   X "C4'" 1 
ATOM   6704  O  "O4'" . U   K  11 8   ? -37.468  25.128  47.692  1.00 162.62 ? 8   U   X "O4'" 1 
ATOM   6705  C  "C3'" . U   K  11 8   ? -36.390  27.149  47.233  1.00 166.97 ? 8   U   X "C3'" 1 
ATOM   6706  O  "O3'" . U   K  11 8   ? -36.291  28.555  47.390  1.00 166.58 ? 8   U   X "O3'" 1 
ATOM   6707  C  "C2'" . U   K  11 8   ? -35.510  26.372  48.205  1.00 166.15 ? 8   U   X "C2'" 1 
ATOM   6708  O  "O2'" . U   K  11 8   ? -35.492  26.790  49.553  1.00 149.66 ? 8   U   X "O2'" 1 
ATOM   6709  C  "C1'" . U   K  11 8   ? -36.099  24.971  48.047  1.00 173.30 ? 8   U   X "C1'" 1 
ATOM   6710  N  N1    . U   K  11 8   ? -35.391  24.178  47.022  1.00 184.23 ? 8   U   X N1    1 
ATOM   6711  C  C2    . U   K  11 8   ? -34.173  23.624  47.384  1.00 182.43 ? 8   U   X C2    1 
ATOM   6712  O  O2    . U   K  11 8   ? -33.678  23.761  48.493  1.00 180.90 ? 8   U   X O2    1 
ATOM   6713  N  N3    . U   K  11 8   ? -33.564  22.883  46.403  1.00 171.34 ? 8   U   X N3    1 
ATOM   6714  C  C4    . U   K  11 8   ? -34.008  22.664  45.116  1.00 168.76 ? 8   U   X C4    1 
ATOM   6715  O  O4    . U   K  11 8   ? -33.340  21.955  44.360  1.00 164.40 ? 8   U   X O4    1 
ATOM   6716  C  C5    . U   K  11 8   ? -35.266  23.274  44.813  1.00 167.18 ? 8   U   X C5    1 
ATOM   6717  C  C6    . U   K  11 8   ? -35.895  23.996  45.749  1.00 174.23 ? 8   U   X C6    1 
ATOM   6718  P  P     . C   K  11 9   ? -35.218  29.382  46.537  1.00 154.43 ? 9   C   X P     1 
ATOM   6719  O  OP1   . C   K  11 9   ? -35.329  30.781  46.989  1.00 171.81 ? 9   C   X OP1   1 
ATOM   6720  O  OP2   . C   K  11 9   ? -35.378  29.060  45.090  1.00 131.03 ? 9   C   X OP2   1 
ATOM   6721  O  "O5'" . C   K  11 9   ? -33.816  28.911  47.121  1.00 138.75 ? 9   C   X "O5'" 1 
ATOM   6722  C  "C5'" . C   K  11 9   ? -33.101  29.707  48.075  1.00 138.79 ? 9   C   X "C5'" 1 
ATOM   6723  C  "C4'" . C   K  11 9   ? -32.020  28.879  48.712  1.00 149.47 ? 9   C   X "C4'" 1 
ATOM   6724  O  "O4'" . C   K  11 9   ? -32.372  27.471  48.644  1.00 156.91 ? 9   C   X "O4'" 1 
ATOM   6725  C  "C3'" . C   K  11 9   ? -30.657  28.924  48.038  1.00 156.62 ? 9   C   X "C3'" 1 
ATOM   6726  O  "O3'" . C   K  11 9   ? -29.885  30.096  48.273  1.00 159.86 ? 9   C   X "O3'" 1 
ATOM   6727  C  "C2'" . C   K  11 9   ? -30.011  27.677  48.628  1.00 161.11 ? 9   C   X "C2'" 1 
ATOM   6728  O  "O2'" . C   K  11 9   ? -29.449  27.818  49.918  1.00 143.06 ? 9   C   X "O2'" 1 
ATOM   6729  C  "C1'" . C   K  11 9   ? -31.185  26.693  48.565  1.00 166.81 ? 9   C   X "C1'" 1 
ATOM   6730  N  N1    . C   K  11 9   ? -31.197  25.873  47.331  1.00 172.33 ? 9   C   X N1    1 
ATOM   6731  C  C2    . C   K  11 9   ? -30.209  24.890  47.178  1.00 170.02 ? 9   C   X C2    1 
ATOM   6732  O  O2    . C   K  11 9   ? -29.372  24.729  48.080  1.00 168.53 ? 9   C   X O2    1 
ATOM   6733  N  N3    . C   K  11 9   ? -30.189  24.141  46.051  1.00 160.22 ? 9   C   X N3    1 
ATOM   6734  C  C4    . C   K  11 9   ? -31.099  24.347  45.096  1.00 158.05 ? 9   C   X C4    1 
ATOM   6735  N  N4    . C   K  11 9   ? -31.047  23.574  44.011  1.00 156.57 ? 9   C   X N4    1 
ATOM   6736  C  C5    . C   K  11 9   ? -32.112  25.342  45.221  1.00 154.78 ? 9   C   X C5    1 
ATOM   6737  C  C6    . C   K  11 9   ? -32.119  26.079  46.340  1.00 165.74 ? 9   C   X C6    1 
ATOM   6738  P  P     . C   K  11 10  ? -28.756  30.537  47.223  1.00 162.53 ? 10  C   X P     1 
ATOM   6739  O  OP1   . C   K  11 10  ? -28.101  31.774  47.701  1.00 167.35 ? 10  C   X OP1   1 
ATOM   6740  O  OP2   . C   K  11 10  ? -29.373  30.531  45.871  1.00 151.86 ? 10  C   X OP2   1 
ATOM   6741  O  "O5'" . C   K  11 10  ? -27.619  29.446  47.452  1.00 153.60 ? 10  C   X "O5'" 1 
ATOM   6742  C  "C5'" . C   K  11 10  ? -26.732  29.396  48.588  1.00 144.47 ? 10  C   X "C5'" 1 
ATOM   6743  C  "C4'" . C   K  11 10  ? -25.718  28.297  48.370  1.00 149.51 ? 10  C   X "C4'" 1 
ATOM   6744  O  "O4'" . C   K  11 10  ? -26.415  27.038  48.150  1.00 162.41 ? 10  C   X "O4'" 1 
ATOM   6745  C  "C3'" . C   K  11 10  ? -24.829  28.456  47.141  1.00 150.82 ? 10  C   X "C3'" 1 
ATOM   6746  O  "O3'" . C   K  11 10  ? -23.677  29.239  47.410  1.00 153.81 ? 10  C   X "O3'" 1 
ATOM   6747  C  "C2'" . C   K  11 10  ? -24.442  27.016  46.824  1.00 154.08 ? 10  C   X "C2'" 1 
ATOM   6748  O  "O2'" . C   K  11 10  ? -23.327  26.554  47.559  1.00 147.39 ? 10  C   X "O2'" 1 
ATOM   6749  C  "C1'" . C   K  11 10  ? -25.735  26.271  47.163  1.00 159.06 ? 10  C   X "C1'" 1 
ATOM   6750  N  N1    . C   K  11 10  ? -26.616  26.046  45.991  1.00 154.35 ? 10  C   X N1    1 
ATOM   6751  C  C2    . C   K  11 10  ? -26.276  25.038  45.082  1.00 145.78 ? 10  C   X C2    1 
ATOM   6752  O  O2    . C   K  11 10  ? -25.247  24.373  45.273  1.00 139.37 ? 10  C   X O2    1 
ATOM   6753  N  N3    . C   K  11 10  ? -27.057  24.838  43.994  1.00 144.56 ? 10  C   X N3    1 
ATOM   6754  C  C4    . C   K  11 10  ? -28.145  25.587  43.803  1.00 138.61 ? 10  C   X C4    1 
ATOM   6755  N  N4    . C   K  11 10  ? -28.875  25.358  42.711  1.00 133.81 ? 10  C   X N4    1 
ATOM   6756  C  C5    . C   K  11 10  ? -28.517  26.617  44.712  1.00 137.32 ? 10  C   X C5    1 
ATOM   6757  C  C6    . C   K  11 10  ? -27.732  26.810  45.781  1.00 150.30 ? 10  C   X C6    1 
ATOM   6758  N  N     . SER L  1  2   ? -38.853  -10.601 -34.370 1.00 116.54 ? 2   SER a N     1 
ATOM   6759  C  CA    . SER L  1  2   ? -38.659  -11.740 -33.428 1.00 119.07 ? 2   SER a CA    1 
ATOM   6760  C  C     . SER L  1  2   ? -37.804  -11.377 -32.213 1.00 126.06 ? 2   SER a C     1 
ATOM   6761  O  O     . SER L  1  2   ? -36.593  -11.645 -32.164 1.00 146.10 ? 2   SER a O     1 
ATOM   6762  C  CB    . SER L  1  2   ? -38.037  -12.962 -34.113 1.00 116.25 ? 2   SER a CB    1 
ATOM   6763  O  OG    . SER L  1  2   ? -38.792  -13.413 -35.212 1.00 113.16 ? 2   SER a OG    1 
ATOM   6764  N  N     . ILE L  1  3   ? -38.432  -10.751 -31.227 1.00 121.61 ? 3   ILE a N     1 
ATOM   6765  C  CA    . ILE L  1  3   ? -37.943  -10.844 -29.835 1.00 116.35 ? 3   ILE a CA    1 
ATOM   6766  C  C     . ILE L  1  3   ? -39.070  -10.400 -28.887 1.00 111.62 ? 3   ILE a C     1 
ATOM   6767  O  O     . ILE L  1  3   ? -39.686  -9.341  -29.062 1.00 125.24 ? 3   ILE a O     1 
ATOM   6768  C  CB    . ILE L  1  3   ? -36.636  -10.079 -29.515 1.00 117.49 ? 3   ILE a CB    1 
ATOM   6769  C  CG1   . ILE L  1  3   ? -36.007  -10.622 -28.231 1.00 110.02 ? 3   ILE a CG1   1 
ATOM   6770  C  CG2   . ILE L  1  3   ? -36.912  -8.585  -29.379 1.00 124.67 ? 3   ILE a CG2   1 
ATOM   6771  C  CD1   . ILE L  1  3   ? -35.894  -12.114 -28.073 1.00 100.69 ? 3   ILE a CD1   1 
ATOM   6772  N  N     . GLY L  1  4   ? -39.445  -11.263 -27.970 1.00 104.52 ? 4   GLY a N     1 
ATOM   6773  C  CA    . GLY L  1  4   ? -40.758  -11.144 -27.364 1.00 99.30  ? 4   GLY a CA    1 
ATOM   6774  C  C     . GLY L  1  4   ? -40.782  -10.131 -26.257 1.00 90.48  ? 4   GLY a C     1 
ATOM   6775  O  O     . GLY L  1  4   ? -39.773  -9.843  -25.626 1.00 94.26  ? 4   GLY a O     1 
ATOM   6776  N  N     . VAL L  1  5   ? -41.967  -9.593  -26.029 1.00 80.80  ? 5   VAL a N     1 
ATOM   6777  C  CA    . VAL L  1  5   ? -42.164  -8.645  -24.933 1.00 76.00  ? 5   VAL a CA    1 
ATOM   6778  C  C     . VAL L  1  5   ? -41.679  -9.183  -23.587 1.00 77.17  ? 5   VAL a C     1 
ATOM   6779  O  O     . VAL L  1  5   ? -41.118  -8.418  -22.831 1.00 80.40  ? 5   VAL a O     1 
ATOM   6780  C  CB    . VAL L  1  5   ? -43.637  -8.260  -24.761 1.00 77.14  ? 5   VAL a CB    1 
ATOM   6781  C  CG1   . VAL L  1  5   ? -43.793  -7.197  -23.679 1.00 73.27  ? 5   VAL a CG1   1 
ATOM   6782  C  CG2   . VAL L  1  5   ? -44.292  -7.891  -26.101 1.00 83.14  ? 5   VAL a CG2   1 
ATOM   6783  N  N     . PRO L  1  6   ? -41.911  -10.470 -23.263 1.00 80.19  ? 6   PRO a N     1 
ATOM   6784  C  CA    . PRO L  1  6   ? -41.557  -10.915 -21.915 1.00 77.70  ? 6   PRO a CA    1 
ATOM   6785  C  C     . PRO L  1  6   ? -40.080  -11.006 -21.718 1.00 70.40  ? 6   PRO a C     1 
ATOM   6786  O  O     . PRO L  1  6   ? -39.622  -10.739 -20.614 1.00 67.40  ? 6   PRO a O     1 
ATOM   6787  C  CB    . PRO L  1  6   ? -42.211  -12.294 -21.782 1.00 84.58  ? 6   PRO a CB    1 
ATOM   6788  C  CG    . PRO L  1  6   ? -43.298  -12.281 -22.804 1.00 88.11  ? 6   PRO a CG    1 
ATOM   6789  C  CD    . PRO L  1  6   ? -42.677  -11.520 -23.951 1.00 87.70  ? 6   PRO a CD    1 
ATOM   6790  N  N     . ILE L  1  7   ? -39.348  -11.381 -22.757 1.00 67.47  ? 7   ILE a N     1 
ATOM   6791  C  CA    . ILE L  1  7   ? -37.875  -11.382 -22.651 1.00 69.97  ? 7   ILE a CA    1 
ATOM   6792  C  C     . ILE L  1  7   ? -37.305  -9.972  -22.499 1.00 71.91  ? 7   ILE a C     1 
ATOM   6793  O  O     . ILE L  1  7   ? -36.376  -9.755  -21.732 1.00 68.31  ? 7   ILE a O     1 
ATOM   6794  C  CB    . ILE L  1  7   ? -37.254  -12.075 -23.864 1.00 70.99  ? 7   ILE a CB    1 
ATOM   6795  C  CG1   . ILE L  1  7   ? -37.622  -13.555 -23.836 1.00 76.90  ? 7   ILE a CG1   1 
ATOM   6796  C  CG2   . ILE L  1  7   ? -35.752  -11.906 -23.954 1.00 67.48  ? 7   ILE a CG2   1 
ATOM   6797  C  CD1   . ILE L  1  7   ? -37.010  -14.325 -22.691 1.00 77.80  ? 7   ILE a CD1   1 
ATOM   6798  N  N     . LYS L  1  8   ? -37.852  -9.011  -23.240 1.00 75.28  ? 8   LYS a N     1 
ATOM   6799  C  CA    . LYS L  1  8   ? -37.457  -7.620  -23.083 1.00 74.28  ? 8   LYS a CA    1 
ATOM   6800  C  C     . LYS L  1  8   ? -37.556  -7.302  -21.620 1.00 69.93  ? 8   LYS a C     1 
ATOM   6801  O  O     . LYS L  1  8   ? -36.574  -6.823  -21.048 1.00 71.18  ? 8   LYS a O     1 
ATOM   6802  C  CB    . LYS L  1  8   ? -38.335  -6.637  -23.869 1.00 79.01  ? 8   LYS a CB    1 
ATOM   6803  C  CG    . LYS L  1  8   ? -38.099  -6.627  -25.368 1.00 82.68  ? 8   LYS a CG    1 
ATOM   6804  C  CD    . LYS L  1  8   ? -39.033  -5.642  -26.080 1.00 85.27  ? 8   LYS a CD    1 
ATOM   6805  C  CE    . LYS L  1  8   ? -38.619  -5.515  -27.537 1.00 87.60  ? 8   LYS a CE    1 
ATOM   6806  N  NZ    . LYS L  1  8   ? -39.672  -4.860  -28.355 1.00 85.07  ? 8   LYS a NZ    1 
ATOM   6807  N  N     . VAL L  1  9   ? -38.723  -7.574  -21.039 1.00 64.63  ? 9   VAL a N     1 
ATOM   6808  C  CA    . VAL L  1  9   ? -38.967  -7.265  -19.631 1.00 64.73  ? 9   VAL a CA    1 
ATOM   6809  C  C     . VAL L  1  9   ? -37.910  -7.878  -18.725 1.00 64.48  ? 9   VAL a C     1 
ATOM   6810  O  O     . VAL L  1  9   ? -37.541  -7.287  -17.721 1.00 57.96  ? 9   VAL a O     1 
ATOM   6811  C  CB    . VAL L  1  9   ? -40.353  -7.733  -19.158 1.00 69.17  ? 9   VAL a CB    1 
ATOM   6812  C  CG1   . VAL L  1  9   ? -40.577  -7.490  -17.672 1.00 72.49  ? 9   VAL a CG1   1 
ATOM   6813  C  CG2   . VAL L  1  9   ? -41.442  -6.978  -19.894 1.00 69.69  ? 9   VAL a CG2   1 
ATOM   6814  N  N     . LEU L  1  10  ? -37.466  -9.100  -19.049 1.00 65.60  ? 10  LEU a N     1 
ATOM   6815  C  CA    . LEU L  1  10  ? -36.374  -9.735  -18.311 1.00 61.46  ? 10  LEU a CA    1 
ATOM   6816  C  C     . LEU L  1  10  ? -35.133  -8.873  -18.376 1.00 60.72  ? 10  LEU a C     1 
ATOM   6817  O  O     . LEU L  1  10  ? -34.504  -8.637  -17.376 1.00 54.17  ? 10  LEU a O     1 
ATOM   6818  C  CB    . LEU L  1  10  ? -36.074  -11.128 -18.849 1.00 63.26  ? 10  LEU a CB    1 
ATOM   6819  C  CG    . LEU L  1  10  ? -34.860  -11.844 -18.232 1.00 67.09  ? 10  LEU a CG    1 
ATOM   6820  C  CD1   . LEU L  1  10  ? -34.899  -11.909 -16.728 1.00 66.06  ? 10  LEU a CD1   1 
ATOM   6821  C  CD2   . LEU L  1  10  ? -34.803  -13.263 -18.797 1.00 72.84  ? 10  LEU a CD2   1 
ATOM   6822  N  N     . HIS L  1  11  ? -34.761  -8.442  -19.581 1.00 65.92  ? 11  HIS a N     1 
ATOM   6823  C  CA    . HIS L  1  11  ? -33.556  -7.632  -19.762 1.00 67.09  ? 11  HIS a CA    1 
ATOM   6824  C  C     . HIS L  1  11  ? -33.654  -6.308  -19.044 1.00 62.69  ? 11  HIS a C     1 
ATOM   6825  O  O     . HIS L  1  11  ? -32.654  -5.757  -18.633 1.00 61.49  ? 11  HIS a O     1 
ATOM   6826  C  CB    . HIS L  1  11  ? -33.282  -7.394  -21.241 1.00 73.40  ? 11  HIS a CB    1 
ATOM   6827  C  CG    . HIS L  1  11  ? -32.641  -8.560  -21.920 1.00 75.96  ? 11  HIS a CG    1 
ATOM   6828  N  ND1   . HIS L  1  11  ? -33.341  -9.585  -22.510 1.00 74.97  ? 11  HIS a ND1   1 
ATOM   6829  C  CD2   . HIS L  1  11  ? -31.341  -8.800  -22.186 1.00 85.20  ? 11  HIS a CD2   1 
ATOM   6830  C  CE1   . HIS L  1  11  ? -32.496  -10.425 -23.078 1.00 74.55  ? 11  HIS a CE1   1 
ATOM   6831  N  NE2   . HIS L  1  11  ? -31.277  -9.976  -22.892 1.00 83.12  ? 11  HIS a NE2   1 
ATOM   6832  N  N     . GLU L  1  12  ? -34.857  -5.788  -18.928 1.00 65.38  ? 12  GLU a N     1 
ATOM   6833  C  CA    . GLU L  1  12  ? -35.071  -4.530  -18.239 1.00 74.65  ? 12  GLU a CA    1 
ATOM   6834  C  C     . GLU L  1  12  ? -34.858  -4.665  -16.750 1.00 69.55  ? 12  GLU a C     1 
ATOM   6835  O  O     . GLU L  1  12  ? -34.567  -3.677  -16.072 1.00 71.96  ? 12  GLU a O     1 
ATOM   6836  C  CB    . GLU L  1  12  ? -36.492  -4.006  -18.492 1.00 88.64  ? 12  GLU a CB    1 
ATOM   6837  C  CG    . GLU L  1  12  ? -36.629  -2.508  -18.771 1.00 97.13  ? 12  GLU a CG    1 
ATOM   6838  C  CD    . GLU L  1  12  ? -35.869  -2.081  -20.026 1.00 106.65 ? 12  GLU a CD    1 
ATOM   6839  O  OE1   . GLU L  1  12  ? -36.133  -2.688  -21.089 1.00 112.08 ? 12  GLU a OE1   1 
ATOM   6840  O  OE2   . GLU L  1  12  ? -35.002  -1.171  -19.952 1.00 108.23 ? 12  GLU a OE2   1 
ATOM   6841  N  N     . ALA L  1  13  ? -34.941  -5.885  -16.245 1.00 68.47  ? 13  ALA a N     1 
ATOM   6842  C  CA    . ALA L  1  13  ? -34.594  -6.144  -14.860 1.00 69.24  ? 13  ALA a CA    1 
ATOM   6843  C  C     . ALA L  1  13  ? -33.118  -6.443  -14.646 1.00 62.78  ? 13  ALA a C     1 
ATOM   6844  O  O     . ALA L  1  13  ? -32.730  -6.628  -13.500 1.00 59.52  ? 13  ALA a O     1 
ATOM   6845  C  CB    . ALA L  1  13  ? -35.401  -7.314  -14.338 1.00 73.82  ? 13  ALA a CB    1 
ATOM   6846  N  N     . GLU L  1  14  ? -32.310  -6.459  -15.699 1.00 61.40  ? 14  GLU a N     1 
ATOM   6847  C  CA    . GLU L  1  14  ? -30.864  -6.483  -15.536 1.00 67.26  ? 14  GLU a CA    1 
ATOM   6848  C  C     . GLU L  1  14  ? -30.455  -5.325  -14.650 1.00 65.67  ? 14  GLU a C     1 
ATOM   6849  O  O     . GLU L  1  14  ? -30.898  -4.186  -14.836 1.00 67.92  ? 14  GLU a O     1 
ATOM   6850  C  CB    . GLU L  1  14  ? -30.081  -6.371  -16.847 1.00 71.99  ? 14  GLU a CB    1 
ATOM   6851  C  CG    . GLU L  1  14  ? -30.158  -7.581  -17.760 1.00 77.24  ? 14  GLU a CG    1 
ATOM   6852  C  CD    . GLU L  1  14  ? -29.608  -7.328  -19.171 1.00 88.00  ? 14  GLU a CD    1 
ATOM   6853  O  OE1   . GLU L  1  14  ? -29.412  -6.158  -19.585 1.00 99.50  ? 14  GLU a OE1   1 
ATOM   6854  O  OE2   . GLU L  1  14  ? -29.426  -8.302  -19.939 1.00 93.25  ? 14  GLU a OE2   1 
ATOM   6855  N  N     . GLY L  1  15  ? -29.608  -5.642  -13.685 1.00 66.17  ? 15  GLY a N     1 
ATOM   6856  C  CA    . GLY L  1  15  ? -29.145  -4.678  -12.713 1.00 65.86  ? 15  GLY a CA    1 
ATOM   6857  C  C     . GLY L  1  15  ? -29.881  -4.664  -11.406 1.00 62.64  ? 15  GLY a C     1 
ATOM   6858  O  O     . GLY L  1  15  ? -29.354  -4.112  -10.451 1.00 65.28  ? 15  GLY a O     1 
ATOM   6859  N  N     . HIS L  1  16  ? -31.026  -5.314  -11.330 1.00 63.79  ? 16  HIS a N     1 
ATOM   6860  C  CA    . HIS L  1  16  ? -31.794  -5.268  -10.105 1.00 69.97  ? 16  HIS a CA    1 
ATOM   6861  C  C     . HIS L  1  16  ? -31.892  -6.617  -9.434  1.00 71.78  ? 16  HIS a C     1 
ATOM   6862  O  O     . HIS L  1  16  ? -31.329  -7.632  -9.903  1.00 62.40  ? 16  HIS a O     1 
ATOM   6863  C  CB    . HIS L  1  16  ? -33.175  -4.705  -10.386 1.00 74.84  ? 16  HIS a CB    1 
ATOM   6864  C  CG    . HIS L  1  16  ? -33.126  -3.417  -11.133 1.00 81.08  ? 16  HIS a CG    1 
ATOM   6865  N  ND1   . HIS L  1  16  ? -33.032  -2.168  -10.550 1.00 86.18  ? 16  HIS a ND1   1 
ATOM   6866  C  CD2   . HIS L  1  16  ? -33.094  -3.215  -12.464 1.00 84.39  ? 16  HIS a CD2   1 
ATOM   6867  C  CE1   . HIS L  1  16  ? -32.979  -1.252  -11.507 1.00 92.16  ? 16  HIS a CE1   1 
ATOM   6868  N  NE2   . HIS L  1  16  ? -33.016  -1.867  -12.675 1.00 89.54  ? 16  HIS a NE2   1 
ATOM   6869  N  N     . ILE L  1  17  ? -32.635  -6.617  -8.322  1.00 76.38  ? 17  ILE a N     1 
ATOM   6870  C  CA    . ILE L  1  17  ? -32.850  -7.865  -7.593  1.00 81.17  ? 17  ILE a CA    1 
ATOM   6871  C  C     . ILE L  1  17  ? -33.955  -8.721  -8.210  1.00 73.14  ? 17  ILE a C     1 
ATOM   6872  O  O     . ILE L  1  17  ? -35.087  -8.263  -8.394  1.00 75.53  ? 17  ILE a O     1 
ATOM   6873  C  CB    . ILE L  1  17  ? -33.088  -7.601  -6.098  1.00 87.30  ? 17  ILE a CB    1 
ATOM   6874  C  CG1   . ILE L  1  17  ? -31.896  -6.844  -5.491  1.00 91.65  ? 17  ILE a CG1   1 
ATOM   6875  C  CG2   . ILE L  1  17  ? -33.300  -8.899  -5.319  1.00 88.84  ? 17  ILE a CG2   1 
ATOM   6876  C  CD1   . ILE L  1  17  ? -30.560  -7.572  -5.518  1.00 92.37  ? 17  ILE a CD1   1 
ATOM   6877  N  N     . VAL L  1  18  ? -33.609  -9.971  -8.505  1.00 68.07  ? 18  VAL a N     1 
ATOM   6878  C  CA    . VAL L  1  18  ? -34.576  -10.944 -8.982  1.00 66.80  ? 18  VAL a CA    1 
ATOM   6879  C  C     . VAL L  1  18  ? -34.499  -12.197 -8.146  1.00 65.82  ? 18  VAL a C     1 
ATOM   6880  O  O     . VAL L  1  18  ? -33.442  -12.615 -7.700  1.00 72.77  ? 18  VAL a O     1 
ATOM   6881  C  CB    . VAL L  1  18  ? -34.377  -11.307 -10.462 1.00 64.36  ? 18  VAL a CB    1 
ATOM   6882  C  CG1   . VAL L  1  18  ? -34.394  -10.040 -11.294 1.00 65.13  ? 18  VAL a CG1   1 
ATOM   6883  C  CG2   . VAL L  1  18  ? -33.093  -12.104 -10.689 1.00 63.50  ? 18  VAL a CG2   1 
ATOM   6884  N  N     . THR L  1  19  ? -35.642  -12.823 -7.971  1.00 65.88  ? 19  THR a N     1 
ATOM   6885  C  CA    . THR L  1  19  ? -35.675  -14.194 -7.516  1.00 65.70  ? 19  THR a CA    1 
ATOM   6886  C  C     . THR L  1  19  ? -35.915  -15.069 -8.735  1.00 58.43  ? 19  THR a C     1 
ATOM   6887  O  O     . THR L  1  19  ? -36.607  -14.707 -9.662  1.00 58.62  ? 19  THR a O     1 
ATOM   6888  C  CB    . THR L  1  19  ? -36.784  -14.331 -6.490  1.00 72.42  ? 19  THR a CB    1 
ATOM   6889  O  OG1   . THR L  1  19  ? -36.750  -13.162 -5.635  1.00 82.92  ? 19  THR a OG1   1 
ATOM   6890  C  CG2   . THR L  1  19  ? -36.620  -15.616 -5.708  1.00 72.81  ? 19  THR a CG2   1 
ATOM   6891  N  N     . CYS L  1  20  ? -35.384  -16.263 -8.701  1.00 53.78  ? 20  CYS a N     1 
ATOM   6892  C  CA    . CYS L  1  20  ? -35.481  -17.183 -9.804  1.00 52.61  ? 20  CYS a CA    1 
ATOM   6893  C  C     . CYS L  1  20  ? -35.620  -18.621 -9.257  1.00 50.50  ? 20  CYS a C     1 
ATOM   6894  O  O     . CYS L  1  20  ? -34.744  -19.117 -8.531  1.00 56.02  ? 20  CYS a O     1 
ATOM   6895  C  CB    . CYS L  1  20  ? -34.232  -16.989 -10.614 1.00 53.64  ? 20  CYS a CB    1 
ATOM   6896  S  SG    . CYS L  1  20  ? -33.825  -18.422 -11.647 1.00 72.20  ? 20  CYS a SG    1 
ATOM   6897  N  N     . GLU L  1  21  ? -36.704  -19.301 -9.556  1.00 46.56  ? 21  GLU a N     1 
ATOM   6898  C  CA    . GLU L  1  21  ? -36.810  -20.692 -9.214  1.00 53.13  ? 21  GLU a CA    1 
ATOM   6899  C  C     . GLU L  1  21  ? -36.348  -21.594 -10.379 1.00 52.96  ? 21  GLU a C     1 
ATOM   6900  O  O     . GLU L  1  21  ? -36.836  -21.494 -11.468 1.00 53.46  ? 21  GLU a O     1 
ATOM   6901  C  CB    . GLU L  1  21  ? -38.230  -21.065 -8.800  1.00 57.87  ? 21  GLU a CB    1 
ATOM   6902  C  CG    . GLU L  1  21  ? -38.414  -22.580 -8.567  1.00 61.28  ? 21  GLU a CG    1 
ATOM   6903  C  CD    . GLU L  1  21  ? -39.424  -22.942 -7.486  1.00 67.85  ? 21  GLU a CD    1 
ATOM   6904  O  OE1   . GLU L  1  21  ? -40.218  -22.068 -7.046  1.00 74.07  ? 21  GLU a OE1   1 
ATOM   6905  O  OE2   . GLU L  1  21  ? -39.409  -24.114 -7.013  1.00 74.23  ? 21  GLU a OE2   1 
ATOM   6906  N  N     . THR L  1  22  ? -35.470  -22.539 -10.106 1.00 53.71  ? 22  THR a N     1 
ATOM   6907  C  CA    . THR L  1  22  ? -34.992  -23.461 -11.065 1.00 54.43  ? 22  THR a CA    1 
ATOM   6908  C  C     . THR L  1  22  ? -35.877  -24.710 -11.081 1.00 54.60  ? 22  THR a C     1 
ATOM   6909  O  O     . THR L  1  22  ? -36.644  -24.941 -10.162 1.00 56.61  ? 22  THR a O     1 
ATOM   6910  C  CB    . THR L  1  22  ? -33.574  -23.724 -10.649 1.00 56.65  ? 22  THR a CB    1 
ATOM   6911  O  OG1   . THR L  1  22  ? -32.914  -24.378 -11.708 1.00 62.86  ? 22  THR a OG1   1 
ATOM   6912  C  CG2   . THR L  1  22  ? -33.559  -24.674 -9.482  1.00 61.81  ? 22  THR a CG2   1 
ATOM   6913  N  N     . ASN L  1  23  ? -35.803  -25.504 -12.145 1.00 60.34  ? 23  ASN a N     1 
ATOM   6914  C  CA    . ASN L  1  23  ? -36.525  -26.782 -12.289 1.00 67.26  ? 23  ASN a CA    1 
ATOM   6915  C  C     . ASN L  1  23  ? -36.324  -27.748 -11.168 1.00 65.52  ? 23  ASN a C     1 
ATOM   6916  O  O     . ASN L  1  23  ? -37.222  -28.458 -10.835 1.00 61.99  ? 23  ASN a O     1 
ATOM   6917  C  CB    . ASN L  1  23  ? -36.015  -27.549 -13.496 1.00 82.59  ? 23  ASN a CB    1 
ATOM   6918  C  CG    . ASN L  1  23  ? -36.634  -27.059 -14.759 1.00 109.31 ? 23  ASN a CG    1 
ATOM   6919  O  OD1   . ASN L  1  23  ? -37.609  -26.267 -14.765 1.00 125.72 ? 23  ASN a OD1   1 
ATOM   6920  N  ND2   . ASN L  1  23  ? -36.073  -27.540 -15.872 1.00 128.90 ? 23  ASN a ND2   1 
ATOM   6921  N  N     . THR L  1  24  ? -35.112  -27.779 -10.628 1.00 64.71  ? 24  THR a N     1 
ATOM   6922  C  CA    . THR L  1  24  ? -34.762  -28.593 -9.510  1.00 59.42  ? 24  THR a CA    1 
ATOM   6923  C  C     . THR L  1  24  ? -35.441  -28.144 -8.217  1.00 62.64  ? 24  THR a C     1 
ATOM   6924  O  O     . THR L  1  24  ? -35.515  -28.923 -7.263  1.00 70.08  ? 24  THR a O     1 
ATOM   6925  C  CB    . THR L  1  24  ? -33.276  -28.505 -9.220  1.00 64.19  ? 24  THR a CB    1 
ATOM   6926  O  OG1   . THR L  1  24  ? -32.536  -27.867 -10.269 1.00 67.28  ? 24  THR a OG1   1 
ATOM   6927  C  CG2   . THR L  1  24  ? -32.683  -29.873 -9.003  1.00 76.12  ? 24  THR a CG2   1 
ATOM   6928  N  N     . GLY L  1  25  ? -35.985  -26.937 -8.140  1.00 61.43  ? 25  GLY a N     1 
ATOM   6929  C  CA    . GLY L  1  25  ? -36.732  -26.477 -6.970  1.00 59.87  ? 25  GLY a CA    1 
ATOM   6930  C  C     . GLY L  1  25  ? -35.917  -25.558 -6.084  1.00 57.04  ? 25  GLY a C     1 
ATOM   6931  O  O     . GLY L  1  25  ? -36.453  -25.002 -5.111  1.00 60.30  ? 25  GLY a O     1 
ATOM   6932  N  N     . GLU L  1  26  ? -34.644  -25.376 -6.390  1.00 54.25  ? 26  GLU a N     1 
ATOM   6933  C  CA    . GLU L  1  26  ? -33.869  -24.368 -5.691  1.00 60.26  ? 26  GLU a CA    1 
ATOM   6934  C  C     . GLU L  1  26  ? -34.376  -22.989 -6.078  1.00 56.97  ? 26  GLU a C     1 
ATOM   6935  O  O     . GLU L  1  26  ? -35.131  -22.848 -7.028  1.00 59.46  ? 26  GLU a O     1 
ATOM   6936  C  CB    . GLU L  1  26  ? -32.390  -24.439 -6.051  1.00 68.85  ? 26  GLU a CB    1 
ATOM   6937  C  CG    . GLU L  1  26  ? -31.655  -25.680 -5.550  1.00 80.30  ? 26  GLU a CG    1 
ATOM   6938  C  CD    . GLU L  1  26  ? -31.640  -26.812 -6.569  1.00 91.51  ? 26  GLU a CD    1 
ATOM   6939  O  OE1   . GLU L  1  26  ? -31.305  -26.505 -7.758  1.00 100.89 ? 26  GLU a OE1   1 
ATOM   6940  O  OE2   . GLU L  1  26  ? -31.935  -27.961 -6.137  1.00 86.74  ? 26  GLU a OE2   1 
ATOM   6941  N  N     . VAL L  1  27  ? -34.014  -21.983 -5.306  1.00 51.69  ? 27  VAL a N     1 
ATOM   6942  C  CA    . VAL L  1  27  ? -34.460  -20.648 -5.555  1.00 50.18  ? 27  VAL a CA    1 
ATOM   6943  C  C     . VAL L  1  27  ? -33.279  -19.757 -5.295  1.00 53.36  ? 27  VAL a C     1 
ATOM   6944  O  O     . VAL L  1  27  ? -32.711  -19.774 -4.212  1.00 55.29  ? 27  VAL a O     1 
ATOM   6945  C  CB    . VAL L  1  27  ? -35.567  -20.264 -4.574  1.00 48.91  ? 27  VAL a CB    1 
ATOM   6946  C  CG1   . VAL L  1  27  ? -36.105  -18.880 -4.859  1.00 50.36  ? 27  VAL a CG1   1 
ATOM   6947  C  CG2   . VAL L  1  27  ? -36.683  -21.254 -4.626  1.00 47.58  ? 27  VAL a CG2   1 
ATOM   6948  N  N     . TYR L  1  28  ? -32.987  -18.899 -6.258  1.00 56.19  ? 28  TYR a N     1 
ATOM   6949  C  CA    . TYR L  1  28  ? -31.806  -18.028 -6.234  1.00 56.64  ? 28  TYR a CA    1 
ATOM   6950  C  C     . TYR L  1  28  ? -32.275  -16.594 -6.189  1.00 58.14  ? 28  TYR a C     1 
ATOM   6951  O  O     . TYR L  1  28  ? -32.996  -16.148 -7.065  1.00 66.84  ? 28  TYR a O     1 
ATOM   6952  C  CB    . TYR L  1  28  ? -30.959  -18.295 -7.478  1.00 54.52  ? 28  TYR a CB    1 
ATOM   6953  C  CG    . TYR L  1  28  ? -30.447  -19.724 -7.550  1.00 53.86  ? 28  TYR a CG    1 
ATOM   6954  C  CD1   . TYR L  1  28  ? -31.274  -20.739 -7.914  1.00 59.11  ? 28  TYR a CD1   1 
ATOM   6955  C  CD2   . TYR L  1  28  ? -29.177  -20.060 -7.213  1.00 50.92  ? 28  TYR a CD2   1 
ATOM   6956  C  CE1   . TYR L  1  28  ? -30.829  -22.051 -7.987  1.00 63.57  ? 28  TYR a CE1   1 
ATOM   6957  C  CE2   . TYR L  1  28  ? -28.726  -21.339 -7.299  1.00 53.45  ? 28  TYR a CE2   1 
ATOM   6958  C  CZ    . TYR L  1  28  ? -29.541  -22.369 -7.692  1.00 59.03  ? 28  TYR a CZ    1 
ATOM   6959  O  OH    . TYR L  1  28  ? -29.131  -23.717 -7.705  1.00 60.84  ? 28  TYR a OH    1 
ATOM   6960  N  N     . ARG L  1  29  ? -31.926  -15.876 -5.139  1.00 60.45  ? 29  ARG a N     1 
ATOM   6961  C  CA    . ARG L  1  29  ? -32.274  -14.473 -5.025  1.00 61.49  ? 29  ARG a CA    1 
ATOM   6962  C  C     . ARG L  1  29  ? -31.004  -13.665 -5.055  1.00 66.91  ? 29  ARG a C     1 
ATOM   6963  O  O     . ARG L  1  29  ? -30.100  -13.909 -4.241  1.00 79.09  ? 29  ARG a O     1 
ATOM   6964  C  CB    . ARG L  1  29  ? -32.969  -14.212 -3.716  1.00 62.47  ? 29  ARG a CB    1 
ATOM   6965  C  CG    . ARG L  1  29  ? -33.828  -12.990 -3.795  1.00 65.19  ? 29  ARG a CG    1 
ATOM   6966  C  CD    . ARG L  1  29  ? -33.723  -12.136 -2.551  1.00 70.19  ? 29  ARG a CD    1 
ATOM   6967  N  NE    . ARG L  1  29  ? -34.901  -11.273 -2.527  1.00 67.74  ? 29  ARG a NE    1 
ATOM   6968  C  CZ    . ARG L  1  29  ? -34.930  -10.033 -2.077  1.00 67.36  ? 29  ARG a CZ    1 
ATOM   6969  N  NH1   . ARG L  1  29  ? -33.855  -9.437  -1.557  1.00 72.90  ? 29  ARG a NH1   1 
ATOM   6970  N  NH2   . ARG L  1  29  ? -36.086  -9.394  -2.113  1.00 68.88  ? 29  ARG a NH2   1 
ATOM   6971  N  N     . GLY L  1  30  ? -30.965  -12.654 -5.911  1.00 70.62  ? 30  GLY a N     1 
ATOM   6972  C  CA    . GLY L  1  30  ? -29.785  -11.781 -6.035  1.00 76.51  ? 30  GLY a CA    1 
ATOM   6973  C  C     . GLY L  1  30  ? -29.845  -10.674 -7.087  1.00 71.73  ? 30  GLY a C     1 
ATOM   6974  O  O     . GLY L  1  30  ? -30.887  -10.476 -7.677  1.00 59.81  ? 30  GLY a O     1 
ATOM   6975  N  N     . LYS L  1  31  ? -28.695  -10.043 -7.355  1.00 75.55  ? 31  LYS a N     1 
ATOM   6976  C  CA    . LYS L  1  31  ? -28.603  -9.064  -8.408  1.00 77.56  ? 31  LYS a CA    1 
ATOM   6977  C  C     . LYS L  1  31  ? -28.433  -9.798  -9.708  1.00 77.20  ? 31  LYS a C     1 
ATOM   6978  O  O     . LYS L  1  31  ? -27.513  -10.578 -9.882  1.00 66.22  ? 31  LYS a O     1 
ATOM   6979  C  CB    . LYS L  1  31  ? -27.504  -8.005  -8.241  1.00 85.74  ? 31  LYS a CB    1 
ATOM   6980  C  CG    . LYS L  1  31  ? -27.897  -6.714  -8.994  1.00 91.66  ? 31  LYS a CG    1 
ATOM   6981  C  CD    . LYS L  1  31  ? -26.781  -5.763  -9.464  1.00 93.27  ? 31  LYS a CD    1 
ATOM   6982  C  CE    . LYS L  1  31  ? -26.080  -5.059  -8.312  1.00 92.46  ? 31  LYS a CE    1 
ATOM   6983  N  NZ    . LYS L  1  31  ? -24.600  -5.022  -8.458  1.00 94.92  ? 31  LYS a NZ    1 
ATOM   6984  N  N     . LEU L  1  32  ? -29.363  -9.518  -10.629 1.00 83.78  ? 32  LEU a N     1 
ATOM   6985  C  CA    . LEU L  1  32  ? -29.289  -10.008 -12.025 1.00 74.49  ? 32  LEU a CA    1 
ATOM   6986  C  C     . LEU L  1  32  ? -28.303  -9.120  -12.735 1.00 70.75  ? 32  LEU a C     1 
ATOM   6987  O  O     . LEU L  1  32  ? -28.558  -7.915  -12.891 1.00 79.02  ? 32  LEU a O     1 
ATOM   6988  C  CB    . LEU L  1  32  ? -30.643  -9.894  -12.713 1.00 68.71  ? 32  LEU a CB    1 
ATOM   6989  C  CG    . LEU L  1  32  ? -30.637  -10.233 -14.179 1.00 69.22  ? 32  LEU a CG    1 
ATOM   6990  C  CD1   . LEU L  1  32  ? -30.206  -11.665 -14.440 1.00 67.57  ? 32  LEU a CD1   1 
ATOM   6991  C  CD2   . LEU L  1  32  ? -32.025  -9.940  -14.729 1.00 70.53  ? 32  LEU a CD2   1 
ATOM   6992  N  N     . ILE L  1  33  ? -27.185  -9.687  -13.128 1.00 64.62  ? 33  ILE a N     1 
ATOM   6993  C  CA    . ILE L  1  33  ? -26.204  -8.907  -13.830 1.00 68.00  ? 33  ILE a CA    1 
ATOM   6994  C  C     . ILE L  1  33  ? -26.703  -8.784  -15.256 1.00 76.87  ? 33  ILE a C     1 
ATOM   6995  O  O     . ILE L  1  33  ? -26.977  -7.698  -15.730 1.00 78.41  ? 33  ILE a O     1 
ATOM   6996  C  CB    . ILE L  1  33  ? -24.817  -9.581  -13.767 1.00 65.77  ? 33  ILE a CB    1 
ATOM   6997  C  CG1   . ILE L  1  33  ? -24.362  -9.727  -12.314 1.00 68.75  ? 33  ILE a CG1   1 
ATOM   6998  C  CG2   . ILE L  1  33  ? -23.790  -8.808  -14.567 1.00 62.11  ? 33  ILE a CG2   1 
ATOM   6999  C  CD1   . ILE L  1  33  ? -24.489  -8.464  -11.458 1.00 70.38  ? 33  ILE a CD1   1 
ATOM   7000  N  N     . GLU L  1  34  ? -26.783  -9.917  -15.944 1.00 85.90  ? 34  GLU a N     1 
ATOM   7001  C  CA    . GLU L  1  34  ? -26.934  -10.003 -17.390 1.00 90.69  ? 34  GLU a CA    1 
ATOM   7002  C  C     . GLU L  1  34  ? -27.819  -11.209 -17.655 1.00 86.28  ? 34  GLU a C     1 
ATOM   7003  O  O     . GLU L  1  34  ? -27.592  -12.307 -17.130 1.00 105.68 ? 34  GLU a O     1 
ATOM   7004  C  CB    . GLU L  1  34  ? -25.552  -10.149 -18.070 1.00 105.27 ? 34  GLU a CB    1 
ATOM   7005  C  CG    . GLU L  1  34  ? -25.540  -10.647 -19.517 1.00 121.92 ? 34  GLU a CG    1 
ATOM   7006  C  CD    . GLU L  1  34  ? -25.273  -9.569  -20.574 1.00 129.64 ? 34  GLU a CD    1 
ATOM   7007  O  OE1   . GLU L  1  34  ? -24.153  -9.016  -20.547 1.00 119.93 ? 34  GLU a OE1   1 
ATOM   7008  O  OE2   . GLU L  1  34  ? -26.161  -9.334  -21.447 1.00 133.14 ? 34  GLU a OE2   1 
ATOM   7009  N  N     . ALA L  1  35  ? -28.832  -11.014 -18.486 1.00 80.14  ? 35  ALA a N     1 
ATOM   7010  C  CA    . ALA L  1  35  ? -29.683  -12.099 -19.002 1.00 72.35  ? 35  ALA a CA    1 
ATOM   7011  C  C     . ALA L  1  35  ? -29.492  -12.159 -20.491 1.00 69.67  ? 35  ALA a C     1 
ATOM   7012  O  O     . ALA L  1  35  ? -29.302  -11.136 -21.143 1.00 74.28  ? 35  ALA a O     1 
ATOM   7013  C  CB    . ALA L  1  35  ? -31.138  -11.836 -18.673 1.00 70.92  ? 35  ALA a CB    1 
ATOM   7014  N  N     . GLU L  1  36  ? -29.493  -13.358 -21.034 1.00 72.02  ? 36  GLU a N     1 
ATOM   7015  C  CA    . GLU L  1  36  ? -29.464  -13.566 -22.489 1.00 78.97  ? 36  GLU a CA    1 
ATOM   7016  C  C     . GLU L  1  36  ? -30.873  -13.856 -22.998 1.00 83.10  ? 36  GLU a C     1 
ATOM   7017  O  O     . GLU L  1  36  ? -31.792  -13.981 -22.195 1.00 98.36  ? 36  GLU a O     1 
ATOM   7018  C  CB    . GLU L  1  36  ? -28.526  -14.716 -22.834 1.00 76.08  ? 36  GLU a CB    1 
ATOM   7019  C  CG    . GLU L  1  36  ? -27.100  -14.370 -22.482 1.00 77.83  ? 36  GLU a CG    1 
ATOM   7020  C  CD    . GLU L  1  36  ? -26.258  -15.578 -22.086 1.00 85.45  ? 36  GLU a CD    1 
ATOM   7021  O  OE1   . GLU L  1  36  ? -26.197  -16.536 -22.907 1.00 83.79  ? 36  GLU a OE1   1 
ATOM   7022  O  OE2   . GLU L  1  36  ? -25.641  -15.516 -20.976 1.00 88.68  ? 36  GLU a OE2   1 
ATOM   7023  N  N     . ASP L  1  37  ? -31.068  -13.962 -24.304 1.00 84.88  ? 37  ASP a N     1 
ATOM   7024  C  CA    . ASP L  1  37  ? -32.421  -14.178 -24.831 1.00 83.13  ? 37  ASP a CA    1 
ATOM   7025  C  C     . ASP L  1  37  ? -32.979  -15.550 -24.515 1.00 74.18  ? 37  ASP a C     1 
ATOM   7026  O  O     . ASP L  1  37  ? -34.209  -15.683 -24.383 1.00 63.95  ? 37  ASP a O     1 
ATOM   7027  C  CB    . ASP L  1  37  ? -32.440  -13.945 -26.344 1.00 88.70  ? 37  ASP a CB    1 
ATOM   7028  C  CG    . ASP L  1  37  ? -32.207  -12.484 -26.728 1.00 91.63  ? 37  ASP a CG    1 
ATOM   7029  O  OD1   . ASP L  1  37  ? -32.555  -11.566 -25.939 1.00 83.63  ? 37  ASP a OD1   1 
ATOM   7030  O  OD2   . ASP L  1  37  ? -31.755  -12.313 -27.883 1.00 85.79  ? 37  ASP a OD2   1 
ATOM   7031  N  N     . ASN L  1  38  ? -32.083  -16.541 -24.412 1.00 68.39  ? 38  ASN a N     1 
ATOM   7032  C  CA    . ASN L  1  38  ? -32.484  -17.870 -23.947 1.00 62.23  ? 38  ASN a CA    1 
ATOM   7033  C  C     . ASN L  1  38  ? -32.905  -17.937 -22.467 1.00 55.05  ? 38  ASN a C     1 
ATOM   7034  O  O     . ASN L  1  38  ? -33.537  -18.923 -22.071 1.00 52.17  ? 38  ASN a O     1 
ATOM   7035  C  CB    . ASN L  1  38  ? -31.461  -18.915 -24.269 1.00 61.14  ? 38  ASN a CB    1 
ATOM   7036  C  CG    . ASN L  1  38  ? -30.113  -18.482 -23.876 1.00 68.25  ? 38  ASN a CG    1 
ATOM   7037  O  OD1   . ASN L  1  38  ? -29.902  -17.922 -22.777 1.00 73.32  ? 38  ASN a OD1   1 
ATOM   7038  N  ND2   . ASN L  1  38  ? -29.175  -18.728 -24.763 1.00 76.20  ? 38  ASN a ND2   1 
ATOM   7039  N  N     . MET L  1  39  ? -32.667  -16.867 -21.731 1.00 47.69  ? 39  MET a N     1 
ATOM   7040  C  CA    . MET L  1  39  ? -33.001  -16.772 -20.346 1.00 50.77  ? 39  MET a CA    1 
ATOM   7041  C  C     . MET L  1  39  ? -31.858  -17.390 -19.544 1.00 52.68  ? 39  MET a C     1 
ATOM   7042  O  O     . MET L  1  39  ? -32.041  -17.643 -18.347 1.00 51.91  ? 39  MET a O     1 
ATOM   7043  C  CB    . MET L  1  39  ? -34.335  -17.394 -19.909 1.00 54.53  ? 39  MET a CB    1 
ATOM   7044  C  CG    . MET L  1  39  ? -35.599  -16.828 -20.517 1.00 58.98  ? 39  MET a CG    1 
ATOM   7045  S  SD    . MET L  1  39  ? -37.231  -17.417 -19.997 1.00 60.06  ? 39  MET a SD    1 
ATOM   7046  C  CE    . MET L  1  39  ? -37.028  -17.501 -18.255 1.00 59.82  ? 39  MET a CE    1 
ATOM   7047  N  N     . ASN L  1  40  ? -30.676  -17.583 -20.142 1.00 50.25  ? 40  ASN a N     1 
ATOM   7048  C  CA    . ASN L  1  40  ? -29.505  -17.804 -19.323 1.00 49.95  ? 40  ASN a CA    1 
ATOM   7049  C  C     . ASN L  1  40  ? -29.336  -16.574 -18.460 1.00 51.36  ? 40  ASN a C     1 
ATOM   7050  O  O     . ASN L  1  40  ? -29.461  -15.457 -18.971 1.00 53.73  ? 40  ASN a O     1 
ATOM   7051  C  CB    . ASN L  1  40  ? -28.263  -18.063 -20.151 1.00 48.79  ? 40  ASN a CB    1 
ATOM   7052  C  CG    . ASN L  1  40  ? -28.214  -19.469 -20.771 1.00 51.98  ? 40  ASN a CG    1 
ATOM   7053  O  OD1   . ASN L  1  40  ? -28.999  -20.346 -20.441 1.00 52.93  ? 40  ASN a OD1   1 
ATOM   7054  N  ND2   . ASN L  1  40  ? -27.304  -19.693 -21.696 1.00 51.58  ? 40  ASN a ND2   1 
ATOM   7055  N  N     . CYS L  1  41  ? -29.119  -16.748 -17.169 1.00 54.21  ? 41  CYS a N     1 
ATOM   7056  C  CA    . CYS L  1  41  ? -28.935  -15.590 -16.287 1.00 62.11  ? 41  CYS a CA    1 
ATOM   7057  C  C     . CYS L  1  41  ? -27.675  -15.686 -15.445 1.00 67.78  ? 41  CYS a C     1 
ATOM   7058  O  O     . CYS L  1  41  ? -27.361  -16.750 -14.901 1.00 67.24  ? 41  CYS a O     1 
ATOM   7059  C  CB    . CYS L  1  41  ? -30.098  -15.415 -15.333 1.00 66.22  ? 41  CYS a CB    1 
ATOM   7060  S  SG    . CYS L  1  41  ? -31.637  -15.114 -16.192 1.00 71.94  ? 41  CYS a SG    1 
ATOM   7061  N  N     . GLN L  1  42  ? -26.901  -14.602 -15.451 1.00 74.48  ? 42  GLN a N     1 
ATOM   7062  C  CA    . GLN L  1  42  ? -25.774  -14.467 -14.552 1.00 78.78  ? 42  GLN a CA    1 
ATOM   7063  C  C     . GLN L  1  42  ? -26.270  -13.628 -13.385 1.00 74.35  ? 42  GLN a C     1 
ATOM   7064  O  O     . GLN L  1  42  ? -26.920  -12.606 -13.598 1.00 67.95  ? 42  GLN a O     1 
ATOM   7065  C  CB    . GLN L  1  42  ? -24.560  -13.824 -15.255 1.00 87.53  ? 42  GLN a CB    1 
ATOM   7066  C  CG    . GLN L  1  42  ? -23.308  -13.948 -14.395 1.00 95.60  ? 42  GLN a CG    1 
ATOM   7067  C  CD    . GLN L  1  42  ? -22.436  -12.725 -14.433 1.00 103.44 ? 42  GLN a CD    1 
ATOM   7068  O  OE1   . GLN L  1  42  ? -22.116  -12.207 -13.371 1.00 107.54 ? 42  GLN a OE1   1 
ATOM   7069  N  NE2   . GLN L  1  42  ? -22.052  -12.260 -15.626 1.00 109.36 ? 42  GLN a NE2   1 
ATOM   7070  N  N     . MET L  1  43  ? -25.939  -14.051 -12.167 1.00 73.98  ? 43  MET a N     1 
ATOM   7071  C  CA    . MET L  1  43  ? -26.349  -13.320 -10.973 1.00 72.58  ? 43  MET a CA    1 
ATOM   7072  C  C     . MET L  1  43  ? -25.222  -13.218 -9.968  1.00 73.45  ? 43  MET a C     1 
ATOM   7073  O  O     . MET L  1  43  ? -24.302  -14.049 -10.024 1.00 73.71  ? 43  MET a O     1 
ATOM   7074  C  CB    . MET L  1  43  ? -27.562  -13.991 -10.342 1.00 71.07  ? 43  MET a CB    1 
ATOM   7075  C  CG    . MET L  1  43  ? -28.804  -14.105 -11.204 1.00 72.94  ? 43  MET a CG    1 
ATOM   7076  S  SD    . MET L  1  43  ? -30.146  -15.109 -10.534 1.00 72.06  ? 43  MET a SD    1 
ATOM   7077  C  CE    . MET L  1  43  ? -30.713  -14.108 -9.154  1.00 70.44  ? 43  MET a CE    1 
ATOM   7078  N  N     . SER L  1  44  ? -25.296  -12.197 -9.099  1.00 76.40  ? 44  SER a N     1 
ATOM   7079  C  CA    . SER L  1  44  ? -24.298  -11.928 -8.036  1.00 80.27  ? 44  SER a CA    1 
ATOM   7080  C  C     . SER L  1  44  ? -24.931  -11.824 -6.672  1.00 82.63  ? 44  SER a C     1 
ATOM   7081  O  O     . SER L  1  44  ? -26.083  -11.386 -6.564  1.00 91.98  ? 44  SER a O     1 
ATOM   7082  C  CB    . SER L  1  44  ? -23.589  -10.613 -8.275  1.00 83.30  ? 44  SER a CB    1 
ATOM   7083  O  OG    . SER L  1  44  ? -22.725  -10.719 -9.392  1.00 93.11  ? 44  SER a OG    1 
ATOM   7084  N  N     . ASN L  1  45  ? -24.205  -12.227 -5.635  1.00 79.80  ? 45  ASN a N     1 
ATOM   7085  C  CA    . ASN L  1  45  ? -24.681  -12.054 -4.260  1.00 87.66  ? 45  ASN a CA    1 
ATOM   7086  C  C     . ASN L  1  45  ? -26.005  -12.725 -4.029  1.00 81.82  ? 45  ASN a C     1 
ATOM   7087  O  O     . ASN L  1  45  ? -27.019  -12.092 -3.715  1.00 75.00  ? 45  ASN a O     1 
ATOM   7088  C  CB    . ASN L  1  45  ? -24.864  -10.589 -3.895  1.00 102.88 ? 45  ASN a CB    1 
ATOM   7089  C  CG    . ASN L  1  45  ? -23.599  -9.801  -4.085  1.00 122.45 ? 45  ASN a CG    1 
ATOM   7090  O  OD1   . ASN L  1  45  ? -22.537  -10.175 -3.566  1.00 141.17 ? 45  ASN a OD1   1 
ATOM   7091  N  ND2   . ASN L  1  45  ? -23.696  -8.709  -4.850  1.00 135.00 ? 45  ASN a ND2   1 
ATOM   7092  N  N     . ILE L  1  46  ? -25.946  -14.040 -4.146  1.00 79.95  ? 46  ILE a N     1 
ATOM   7093  C  CA    . ILE L  1  46  ? -27.144  -14.845 -4.201  1.00 76.22  ? 46  ILE a CA    1 
ATOM   7094  C  C     . ILE L  1  46  ? -27.401  -15.448 -2.837  1.00 78.41  ? 46  ILE a C     1 
ATOM   7095  O  O     . ILE L  1  46  ? -26.459  -15.834 -2.128  1.00 88.05  ? 46  ILE a O     1 
ATOM   7096  C  CB    . ILE L  1  46  ? -26.932  -16.028 -5.133  1.00 74.64  ? 46  ILE a CB    1 
ATOM   7097  C  CG1   . ILE L  1  46  ? -26.512  -15.529 -6.479  1.00 77.73  ? 46  ILE a CG1   1 
ATOM   7098  C  CG2   . ILE L  1  46  ? -28.151  -16.892 -5.229  1.00 74.48  ? 46  ILE a CG2   1 
ATOM   7099  C  CD1   . ILE L  1  46  ? -27.582  -14.706 -7.143  1.00 80.13  ? 46  ILE a CD1   1 
ATOM   7100  N  N     . THR L  1  47  ? -28.680  -15.554 -2.495  1.00 68.43  ? 47  THR a N     1 
ATOM   7101  C  CA    . THR L  1  47  ? -29.124  -16.405 -1.433  1.00 62.51  ? 47  THR a CA    1 
ATOM   7102  C  C     . THR L  1  47  ? -29.840  -17.557 -2.112  1.00 60.00  ? 47  THR a C     1 
ATOM   7103  O  O     . THR L  1  47  ? -31.065  -17.474 -2.386  1.00 56.34  ? 47  THR a O     1 
ATOM   7104  C  CB    . THR L  1  47  ? -30.060  -15.659 -0.473  1.00 68.94  ? 47  THR a CB    1 
ATOM   7105  O  OG1   . THR L  1  47  ? -29.647  -14.297 -0.333  1.00 74.78  ? 47  THR a OG1   1 
ATOM   7106  C  CG2   . THR L  1  47  ? -30.057  -16.357 0.899   1.00 76.56  ? 47  THR a CG2   1 
ATOM   7107  N  N     . VAL L  1  48  ? -29.084  -18.627 -2.389  1.00 57.09  ? 48  VAL a N     1 
ATOM   7108  C  CA    . VAL L  1  48  ? -29.714  -19.875 -2.789  1.00 61.35  ? 48  VAL a CA    1 
ATOM   7109  C  C     . VAL L  1  48  ? -30.552  -20.443 -1.624  1.00 57.81  ? 48  VAL a C     1 
ATOM   7110  O  O     . VAL L  1  48  ? -30.205  -20.218 -0.478  1.00 57.94  ? 48  VAL a O     1 
ATOM   7111  C  CB    . VAL L  1  48  ? -28.716  -20.919 -3.266  1.00 66.00  ? 48  VAL a CB    1 
ATOM   7112  C  CG1   . VAL L  1  48  ? -27.853  -21.407 -2.120  1.00 74.06  ? 48  VAL a CG1   1 
ATOM   7113  C  CG2   . VAL L  1  48  ? -29.417  -22.133 -3.875  1.00 68.60  ? 48  VAL a CG2   1 
ATOM   7114  N  N     . THR L  1  49  ? -31.668  -21.104 -1.915  1.00 54.20  ? 49  THR a N     1 
ATOM   7115  C  CA    . THR L  1  49  ? -32.500  -21.761 -0.922  1.00 52.25  ? 49  THR a CA    1 
ATOM   7116  C  C     . THR L  1  49  ? -32.801  -23.145 -1.434  1.00 55.42  ? 49  THR a C     1 
ATOM   7117  O  O     . THR L  1  49  ? -33.629  -23.322 -2.332  1.00 65.35  ? 49  THR a O     1 
ATOM   7118  C  CB    . THR L  1  49  ? -33.804  -20.998 -0.665  1.00 50.54  ? 49  THR a CB    1 
ATOM   7119  O  OG1   . THR L  1  49  ? -33.530  -19.606 -0.414  1.00 52.89  ? 49  THR a OG1   1 
ATOM   7120  C  CG2   . THR L  1  49  ? -34.614  -21.619 0.484   1.00 47.98  ? 49  THR a CG2   1 
ATOM   7121  N  N     . TYR L  1  50  ? -32.116  -24.136 -0.895  1.00 58.94  ? 50  TYR a N     1 
ATOM   7122  C  CA    . TYR L  1  50  ? -32.188  -25.511 -1.397  1.00 60.11  ? 50  TYR a CA    1 
ATOM   7123  C  C     . TYR L  1  50  ? -33.598  -26.033 -1.190  1.00 56.34  ? 50  TYR a C     1 
ATOM   7124  O  O     . TYR L  1  50  ? -34.404  -25.422 -0.456  1.00 48.97  ? 50  TYR a O     1 
ATOM   7125  C  CB    . TYR L  1  50  ? -31.109  -26.402 -0.730  1.00 63.94  ? 50  TYR a CB    1 
ATOM   7126  C  CG    . TYR L  1  50  ? -29.686  -25.940 -1.061  1.00 69.92  ? 50  TYR a CG    1 
ATOM   7127  C  CD1   . TYR L  1  50  ? -29.220  -26.036 -2.370  1.00 84.24  ? 50  TYR a CD1   1 
ATOM   7128  C  CD2   . TYR L  1  50  ? -28.831  -25.355 -0.135  1.00 65.82  ? 50  TYR a CD2   1 
ATOM   7129  C  CE1   . TYR L  1  50  ? -27.950  -25.568 -2.729  1.00 87.60  ? 50  TYR a CE1   1 
ATOM   7130  C  CE2   . TYR L  1  50  ? -27.582  -24.884 -0.491  1.00 68.46  ? 50  TYR a CE2   1 
ATOM   7131  C  CZ    . TYR L  1  50  ? -27.127  -24.980 -1.786  1.00 75.22  ? 50  TYR a CZ    1 
ATOM   7132  O  OH    . TYR L  1  50  ? -25.923  -24.498 -2.264  1.00 69.84  ? 50  TYR a OH    1 
ATOM   7133  N  N     . ARG L  1  51  ? -33.848  -27.180 -1.817  1.00 54.67  ? 51  ARG a N     1 
ATOM   7134  C  CA    . ARG L  1  51  ? -35.168  -27.863 -1.651  1.00 55.76  ? 51  ARG a CA    1 
ATOM   7135  C  C     . ARG L  1  51  ? -35.661  -28.037 -0.197  1.00 54.88  ? 51  ARG a C     1 
ATOM   7136  O  O     . ARG L  1  51  ? -36.822  -27.791 0.114   1.00 46.77  ? 51  ARG a O     1 
ATOM   7137  C  CB    . ARG L  1  51  ? -35.264  -29.203 -2.420  1.00 57.24  ? 51  ARG a CB    1 
ATOM   7138  C  CG    . ARG L  1  51  ? -35.004  -29.112 -3.923  1.00 60.50  ? 51  ARG a CG    1 
ATOM   7139  C  CD    . ARG L  1  51  ? -34.965  -30.483 -4.601  1.00 62.72  ? 51  ARG a CD    1 
ATOM   7140  N  NE    . ARG L  1  51  ? -36.100  -31.338 -4.531  1.00 63.95  ? 51  ARG a NE    1 
ATOM   7141  C  CZ    . ARG L  1  51  ? -37.215  -31.200 -5.221  1.00 74.49  ? 51  ARG a CZ    1 
ATOM   7142  N  NH1   . ARG L  1  51  ? -37.380  -30.232 -6.112  1.00 82.29  ? 51  ARG a NH1   1 
ATOM   7143  N  NH2   . ARG L  1  51  ? -38.190  -32.090 -5.051  1.00 77.52  ? 51  ARG a NH2   1 
ATOM   7144  N  N     . ASP L  1  52  ? -34.737  -28.424 0.685   1.00 63.09  ? 52  ASP a N     1 
ATOM   7145  C  CA    . ASP L  1  52  ? -35.000  -28.656 2.138   1.00 64.07  ? 52  ASP a CA    1 
ATOM   7146  C  C     . ASP L  1  52  ? -35.328  -27.450 3.016   1.00 57.10  ? 52  ASP a C     1 
ATOM   7147  O  O     . ASP L  1  52  ? -36.049  -27.598 4.003   1.00 58.37  ? 52  ASP a O     1 
ATOM   7148  C  CB    . ASP L  1  52  ? -33.912  -29.523 2.817   1.00 66.68  ? 52  ASP a CB    1 
ATOM   7149  C  CG    . ASP L  1  52  ? -32.562  -28.893 2.774   1.00 72.82  ? 52  ASP a CG    1 
ATOM   7150  O  OD1   . ASP L  1  52  ? -32.487  -27.645 2.839   1.00 76.30  ? 52  ASP a OD1   1 
ATOM   7151  O  OD2   . ASP L  1  52  ? -31.592  -29.668 2.599   1.00 81.68  ? 52  ASP a OD2   1 
ATOM   7152  N  N     . GLY L  1  53  ? -34.865  -26.271 2.620   1.00 54.51  ? 53  GLY a N     1 
ATOM   7153  C  CA    . GLY L  1  53  ? -35.114  -25.031 3.373   1.00 53.78  ? 53  GLY a CA    1 
ATOM   7154  C  C     . GLY L  1  53  ? -33.843  -24.292 3.763   1.00 55.54  ? 53  GLY a C     1 
ATOM   7155  O  O     . GLY L  1  53  ? -33.850  -23.073 3.994   1.00 49.67  ? 53  GLY a O     1 
ATOM   7156  N  N     . ARG L  1  54  ? -32.757  -25.058 3.846   1.00 60.25  ? 54  ARG a N     1 
ATOM   7157  C  CA    . ARG L  1  54  ? -31.421  -24.510 4.027   1.00 64.14  ? 54  ARG a CA    1 
ATOM   7158  C  C     . ARG L  1  54  ? -31.043  -23.527 2.959   1.00 61.33  ? 54  ARG a C     1 
ATOM   7159  O  O     . ARG L  1  54  ? -31.436  -23.686 1.831   1.00 58.84  ? 54  ARG a O     1 
ATOM   7160  C  CB    . ARG L  1  54  ? -30.358  -25.595 3.959   1.00 68.12  ? 54  ARG a CB    1 
ATOM   7161  C  CG    . ARG L  1  54  ? -30.429  -26.636 5.048   1.00 76.74  ? 54  ARG a CG    1 
ATOM   7162  C  CD    . ARG L  1  54  ? -29.075  -27.318 5.121   1.00 87.28  ? 54  ARG a CD    1 
ATOM   7163  N  NE    . ARG L  1  54  ? -29.226  -28.707 4.776   1.00 91.84  ? 54  ARG a NE    1 
ATOM   7164  C  CZ    . ARG L  1  54  ? -29.564  -29.656 5.653   1.00 106.94 ? 54  ARG a CZ    1 
ATOM   7165  N  NH1   . ARG L  1  54  ? -29.747  -29.431 6.959   1.00 98.31  ? 54  ARG a NH1   1 
ATOM   7166  N  NH2   . ARG L  1  54  ? -29.667  -30.895 5.187   1.00 127.69 ? 54  ARG a NH2   1 
ATOM   7167  N  N     . VAL L  1  55  ? -30.301  -22.515 3.380   1.00 65.58  ? 55  VAL a N     1 
ATOM   7168  C  CA    . VAL L  1  55  ? -29.851  -21.467 2.500   1.00 67.40  ? 55  VAL a CA    1 
ATOM   7169  C  C     . VAL L  1  55  ? -28.339  -21.425 2.494   1.00 66.31  ? 55  VAL a C     1 
ATOM   7170  O  O     . VAL L  1  55  ? -27.670  -21.955 3.370   1.00 72.01  ? 55  VAL a O     1 
ATOM   7171  C  CB    . VAL L  1  55  ? -30.474  -20.091 2.853   1.00 69.92  ? 55  VAL a CB    1 
ATOM   7172  C  CG1   . VAL L  1  55  ? -31.956  -20.224 3.214   1.00 70.68  ? 55  VAL a CG1   1 
ATOM   7173  C  CG2   . VAL L  1  55  ? -29.731  -19.415 3.995   1.00 74.26  ? 55  VAL a CG2   1 
ATOM   7174  N  N     . ALA L  1  56  ? -27.820  -20.684 1.535   1.00 66.20  ? 56  ALA a N     1 
ATOM   7175  C  CA    . ALA L  1  56  ? -26.388  -20.519 1.376   1.00 67.95  ? 56  ALA a CA    1 
ATOM   7176  C  C     . ALA L  1  56  ? -26.149  -19.210 0.660   1.00 69.30  ? 56  ALA a C     1 
ATOM   7177  O  O     . ALA L  1  56  ? -27.097  -18.570 0.224   1.00 75.55  ? 56  ALA a O     1 
ATOM   7178  C  CB    . ALA L  1  56  ? -25.802  -21.692 0.601   1.00 67.66  ? 56  ALA a CB    1 
ATOM   7179  N  N     . GLN L  1  57  ? -24.900  -18.769 0.646   1.00 71.53  ? 57  GLN a N     1 
ATOM   7180  C  CA    . GLN L  1  57  ? -24.508  -17.525 0.010   1.00 72.37  ? 57  GLN a CA    1 
ATOM   7181  C  C     . GLN L  1  57  ? -23.631  -17.848 -1.135  1.00 71.43  ? 57  GLN a C     1 
ATOM   7182  O  O     . GLN L  1  57  ? -22.710  -18.657 -0.960  1.00 81.21  ? 57  GLN a O     1 
ATOM   7183  C  CB    . GLN L  1  57  ? -23.731  -16.676 0.995   1.00 77.54  ? 57  GLN a CB    1 
ATOM   7184  C  CG    . GLN L  1  57  ? -24.607  -16.112 2.110   1.00 80.62  ? 57  GLN a CG    1 
ATOM   7185  C  CD    . GLN L  1  57  ? -25.730  -15.265 1.561   1.00 82.65  ? 57  GLN a CD    1 
ATOM   7186  O  OE1   . GLN L  1  57  ? -26.872  -15.347 2.026   1.00 89.48  ? 57  GLN a OE1   1 
ATOM   7187  N  NE2   . GLN L  1  57  ? -25.421  -14.443 0.539   1.00 87.55  ? 57  GLN a NE2   1 
ATOM   7188  N  N     . LEU L  1  58  ? -23.884  -17.254 -2.291  1.00 68.57  ? 58  LEU a N     1 
ATOM   7189  C  CA    . LEU L  1  58  ? -23.014  -17.548 -3.426  1.00 78.27  ? 58  LEU a CA    1 
ATOM   7190  C  C     . LEU L  1  58  ? -22.607  -16.258 -4.096  1.00 86.17  ? 58  LEU a C     1 
ATOM   7191  O  O     . LEU L  1  58  ? -23.383  -15.298 -4.175  1.00 94.38  ? 58  LEU a O     1 
ATOM   7192  C  CB    . LEU L  1  58  ? -23.649  -18.521 -4.411  1.00 78.16  ? 58  LEU a CB    1 
ATOM   7193  C  CG    . LEU L  1  58  ? -24.215  -19.844 -3.874  1.00 78.43  ? 58  LEU a CG    1 
ATOM   7194  C  CD1   . LEU L  1  58  ? -24.985  -20.632 -4.936  1.00 73.83  ? 58  LEU a CD1   1 
ATOM   7195  C  CD2   . LEU L  1  58  ? -23.145  -20.716 -3.238  1.00 75.51  ? 58  LEU a CD2   1 
ATOM   7196  N  N     . GLU L  1  59  ? -21.368  -16.250 -4.582  1.00 93.63  ? 59  GLU a N     1 
ATOM   7197  C  CA    . GLU L  1  59  ? -20.757  -15.039 -5.110  1.00 95.82  ? 59  GLU a CA    1 
ATOM   7198  C  C     . GLU L  1  59  ? -21.277  -14.749 -6.525  1.00 86.69  ? 59  GLU a C     1 
ATOM   7199  O  O     . GLU L  1  59  ? -21.904  -13.704 -6.781  1.00 77.94  ? 59  GLU a O     1 
ATOM   7200  C  CB    . GLU L  1  59  ? -19.228  -15.199 -5.122  1.00 111.69 ? 59  GLU a CB    1 
ATOM   7201  C  CG    . GLU L  1  59  ? -18.527  -15.453 -3.760  1.00 119.56 ? 59  GLU a CG    1 
ATOM   7202  C  CD    . GLU L  1  59  ? -17.233  -14.658 -3.657  1.00 126.04 ? 59  GLU a CD    1 
ATOM   7203  O  OE1   . GLU L  1  59  ? -16.580  -14.551 -4.733  1.00 123.25 ? 59  GLU a OE1   1 
ATOM   7204  O  OE2   . GLU L  1  59  ? -16.967  -14.110 -2.548  1.00 144.34 ? 59  GLU a OE2   1 
ATOM   7205  N  N     . GLN L  1  60  ? -20.981  -15.690 -7.416  1.00 75.59  ? 60  GLN a N     1 
ATOM   7206  C  CA    . GLN L  1  60  ? -21.288  -15.552 -8.800  1.00 76.06  ? 60  GLN a CA    1 
ATOM   7207  C  C     . GLN L  1  60  ? -21.869  -16.852 -9.276  1.00 78.68  ? 60  GLN a C     1 
ATOM   7208  O  O     . GLN L  1  60  ? -21.285  -17.946 -9.085  1.00 80.30  ? 60  GLN a O     1 
ATOM   7209  C  CB    . GLN L  1  60  ? -20.011  -15.304 -9.564  1.00 86.42  ? 60  GLN a CB    1 
ATOM   7210  C  CG    . GLN L  1  60  ? -19.348  -13.981 -9.238  1.00 100.20 ? 60  GLN a CG    1 
ATOM   7211  C  CD    . GLN L  1  60  ? -20.061  -12.812 -9.901  1.00 105.92 ? 60  GLN a CD    1 
ATOM   7212  O  OE1   . GLN L  1  60  ? -21.268  -12.849 -10.147 1.00 103.01 ? 60  GLN a OE1   1 
ATOM   7213  N  NE2   . GLN L  1  60  ? -19.314  -11.733 -10.133 1.00 110.79 ? 60  GLN a NE2   1 
ATOM   7214  N  N     . VAL L  1  61  ? -23.013  -16.729 -9.938  1.00 75.16  ? 61  VAL a N     1 
ATOM   7215  C  CA    . VAL L  1  61  ? -23.683  -17.895 -10.512 1.00 69.93  ? 61  VAL a CA    1 
ATOM   7216  C  C     . VAL L  1  61  ? -24.111  -17.556 -11.906 1.00 62.45  ? 61  VAL a C     1 
ATOM   7217  O  O     . VAL L  1  61  ? -24.309  -16.382 -12.249 1.00 57.74  ? 61  VAL a O     1 
ATOM   7218  C  CB    . VAL L  1  61  ? -24.979  -18.306 -9.766  1.00 73.85  ? 61  VAL a CB    1 
ATOM   7219  C  CG1   . VAL L  1  61  ? -24.717  -18.739 -8.338  1.00 77.63  ? 61  VAL a CG1   1 
ATOM   7220  C  CG2   . VAL L  1  61  ? -26.000  -17.181 -9.705  1.00 73.75  ? 61  VAL a CG2   1 
ATOM   7221  N  N     . TYR L  1  62  ? -24.318  -18.627 -12.654 1.00 60.55  ? 62  TYR a N     1 
ATOM   7222  C  CA    . TYR L  1  62  ? -24.915  -18.565 -13.959 1.00 63.20  ? 62  TYR a CA    1 
ATOM   7223  C  C     . TYR L  1  62  ? -25.888  -19.725 -14.121 1.00 63.71  ? 62  TYR a C     1 
ATOM   7224  O  O     . TYR L  1  62  ? -25.528  -20.883 -13.841 1.00 68.26  ? 62  TYR a O     1 
ATOM   7225  C  CB    . TYR L  1  62  ? -23.793  -18.663 -14.966 1.00 66.02  ? 62  TYR a CB    1 
ATOM   7226  C  CG    . TYR L  1  62  ? -24.178  -18.427 -16.409 1.00 71.01  ? 62  TYR a CG    1 
ATOM   7227  C  CD1   . TYR L  1  62  ? -24.129  -17.151 -16.978 1.00 71.21  ? 62  TYR a CD1   1 
ATOM   7228  C  CD2   . TYR L  1  62  ? -24.491  -19.508 -17.227 1.00 70.09  ? 62  TYR a CD2   1 
ATOM   7229  C  CE1   . TYR L  1  62  ? -24.454  -16.952 -18.305 1.00 74.69  ? 62  TYR a CE1   1 
ATOM   7230  C  CE2   . TYR L  1  62  ? -24.774  -19.317 -18.554 1.00 69.83  ? 62  TYR a CE2   1 
ATOM   7231  C  CZ    . TYR L  1  62  ? -24.775  -18.053 -19.082 1.00 71.40  ? 62  TYR a CZ    1 
ATOM   7232  O  OH    . TYR L  1  62  ? -25.032  -17.958 -20.425 1.00 70.47  ? 62  TYR a OH    1 
ATOM   7233  N  N     . ILE L  1  63  ? -27.090  -19.426 -14.619 1.00 60.50  ? 63  ILE a N     1 
ATOM   7234  C  CA    . ILE L  1  63  ? -28.184  -20.410 -14.665 1.00 57.17  ? 63  ILE a CA    1 
ATOM   7235  C  C     . ILE L  1  63  ? -28.635  -20.596 -16.108 1.00 55.27  ? 63  ILE a C     1 
ATOM   7236  O  O     . ILE L  1  63  ? -28.935  -19.602 -16.802 1.00 57.49  ? 63  ILE a O     1 
ATOM   7237  C  CB    . ILE L  1  63  ? -29.394  -19.943 -13.841 1.00 53.61  ? 63  ILE a CB    1 
ATOM   7238  C  CG1   . ILE L  1  63  ? -28.908  -19.300 -12.555 1.00 58.30  ? 63  ILE a CG1   1 
ATOM   7239  C  CG2   . ILE L  1  63  ? -30.267  -21.112 -13.516 1.00 53.42  ? 63  ILE a CG2   1 
ATOM   7240  C  CD1   . ILE L  1  63  ? -29.962  -18.980 -11.527 1.00 60.02  ? 63  ILE a CD1   1 
ATOM   7241  N  N     . ARG L  1  64  ? -28.715  -21.851 -16.544 1.00 50.11  ? 64  ARG a N     1 
ATOM   7242  C  CA    . ARG L  1  64  ? -29.264  -22.154 -17.853 1.00 52.71  ? 64  ARG a CA    1 
ATOM   7243  C  C     . ARG L  1  64  ? -30.747  -21.762 -17.948 1.00 55.63  ? 64  ARG a C     1 
ATOM   7244  O  O     . ARG L  1  64  ? -31.569  -22.116 -17.082 1.00 53.02  ? 64  ARG a O     1 
ATOM   7245  C  CB    . ARG L  1  64  ? -29.098  -23.644 -18.194 1.00 55.26  ? 64  ARG a CB    1 
ATOM   7246  C  CG    . ARG L  1  64  ? -29.497  -24.039 -19.612 1.00 55.91  ? 64  ARG a CG    1 
ATOM   7247  C  CD    . ARG L  1  64  ? -28.788  -25.296 -20.075 1.00 57.58  ? 64  ARG a CD    1 
ATOM   7248  N  NE    . ARG L  1  64  ? -29.417  -25.943 -21.233 1.00 61.93  ? 64  ARG a NE    1 
ATOM   7249  C  CZ    . ARG L  1  64  ? -29.023  -25.883 -22.502 1.00 62.67  ? 64  ARG a CZ    1 
ATOM   7250  N  NH1   . ARG L  1  64  ? -27.991  -25.143 -22.858 1.00 64.34  ? 64  ARG a NH1   1 
ATOM   7251  N  NH2   . ARG L  1  64  ? -29.688  -26.550 -23.442 1.00 63.98  ? 64  ARG a NH2   1 
ATOM   7252  N  N     . GLY L  1  65  ? -31.101  -21.097 -19.041 1.00 54.29  ? 65  GLY a N     1 
ATOM   7253  C  CA    . GLY L  1  65  ? -32.471  -20.664 -19.235 1.00 58.01  ? 65  GLY a CA    1 
ATOM   7254  C  C     . GLY L  1  65  ? -33.458  -21.841 -19.272 1.00 58.72  ? 65  GLY a C     1 
ATOM   7255  O  O     . GLY L  1  65  ? -34.572  -21.749 -18.703 1.00 55.67  ? 65  GLY a O     1 
ATOM   7256  N  N     . SER L  1  66  ? -33.037  -22.912 -19.949 1.00 53.83  ? 66  SER a N     1 
ATOM   7257  C  CA    . SER L  1  66  ? -33.878  -24.056 -20.159 1.00 57.62  ? 66  SER a CA    1 
ATOM   7258  C  C     . SER L  1  66  ? -34.244  -24.675 -18.833 1.00 58.83  ? 66  SER a C     1 
ATOM   7259  O  O     . SER L  1  66  ? -35.175  -25.479 -18.796 1.00 61.75  ? 66  SER a O     1 
ATOM   7260  C  CB    . SER L  1  66  ? -33.228  -25.059 -21.143 1.00 61.53  ? 66  SER a CB    1 
ATOM   7261  O  OG    . SER L  1  66  ? -32.280  -25.917 -20.567 1.00 60.07  ? 66  SER a OG    1 
ATOM   7262  N  N     . LYS L  1  67  ? -33.545  -24.310 -17.766 1.00 57.80  ? 67  LYS a N     1 
ATOM   7263  C  CA    . LYS L  1  67  ? -33.801  -24.902 -16.474 1.00 59.03  ? 67  LYS a CA    1 
ATOM   7264  C  C     . LYS L  1  67  ? -34.468  -23.948 -15.503 1.00 59.41  ? 67  LYS a C     1 
ATOM   7265  O  O     . LYS L  1  67  ? -34.409  -24.134 -14.301 1.00 69.35  ? 67  LYS a O     1 
ATOM   7266  C  CB    . LYS L  1  67  ? -32.467  -25.396 -15.888 1.00 58.28  ? 67  LYS a CB    1 
ATOM   7267  C  CG    . LYS L  1  67  ? -31.593  -26.204 -16.830 1.00 53.38  ? 67  LYS a CG    1 
ATOM   7268  C  CD    . LYS L  1  67  ? -32.061  -27.618 -16.851 1.00 53.39  ? 67  LYS a CD    1 
ATOM   7269  C  CE    . LYS L  1  67  ? -31.331  -28.354 -17.937 1.00 55.77  ? 67  LYS a CE    1 
ATOM   7270  N  NZ    . LYS L  1  67  ? -31.720  -29.812 -18.053 1.00 61.57  ? 67  LYS a NZ    1 
ATOM   7271  N  N     . ILE L  1  68  ? -35.118  -22.921 -15.986 1.00 59.80  ? 68  ILE a N     1 
ATOM   7272  C  CA    . ILE L  1  68  ? -35.829  -21.998 -15.119 1.00 57.81  ? 68  ILE a CA    1 
ATOM   7273  C  C     . ILE L  1  68  ? -37.350  -22.179 -15.193 1.00 57.00  ? 68  ILE a C     1 
ATOM   7274  O  O     . ILE L  1  68  ? -37.937  -22.248 -16.257 1.00 57.26  ? 68  ILE a O     1 
ATOM   7275  C  CB    . ILE L  1  68  ? -35.471  -20.555 -15.496 1.00 58.59  ? 68  ILE a CB    1 
ATOM   7276  C  CG1   . ILE L  1  68  ? -33.994  -20.339 -15.245 1.00 57.99  ? 68  ILE a CG1   1 
ATOM   7277  C  CG2   . ILE L  1  68  ? -36.298  -19.567 -14.687 1.00 60.28  ? 68  ILE a CG2   1 
ATOM   7278  C  CD1   . ILE L  1  68  ? -33.548  -18.931 -15.568 1.00 62.43  ? 68  ILE a CD1   1 
ATOM   7279  N  N     . ARG L  1  69  ? -37.986  -22.219 -14.036 1.00 60.69  ? 69  ARG a N     1 
ATOM   7280  C  CA    . ARG L  1  69  ? -39.421  -22.252 -13.962 1.00 59.97  ? 69  ARG a CA    1 
ATOM   7281  C  C     . ARG L  1  69  ? -39.920  -20.874 -14.182 1.00 54.42  ? 69  ARG a C     1 
ATOM   7282  O  O     . ARG L  1  69  ? -40.760  -20.689 -15.059 1.00 61.59  ? 69  ARG a O     1 
ATOM   7283  C  CB    . ARG L  1  69  ? -39.917  -22.800 -12.638 1.00 64.86  ? 69  ARG a CB    1 
ATOM   7284  C  CG    . ARG L  1  69  ? -39.851  -24.315 -12.579 1.00 76.16  ? 69  ARG a CG    1 
ATOM   7285  C  CD    . ARG L  1  69  ? -41.166  -24.870 -11.976 1.00 90.50  ? 69  ARG a CD    1 
ATOM   7286  N  NE    . ARG L  1  69  ? -41.023  -26.257 -11.503 1.00 90.15  ? 69  ARG a NE    1 
ATOM   7287  C  CZ    . ARG L  1  69  ? -40.283  -26.640 -10.450 1.00 80.77  ? 69  ARG a CZ    1 
ATOM   7288  N  NH1   . ARG L  1  69  ? -39.563  -25.798 -9.701  1.00 74.11  ? 69  ARG a NH1   1 
ATOM   7289  N  NH2   . ARG L  1  69  ? -40.283  -27.910 -10.126 1.00 81.94  ? 69  ARG a NH2   1 
ATOM   7290  N  N     . PHE L  1  70  ? -39.496  -19.951 -13.334 1.00 46.39  ? 70  PHE a N     1 
ATOM   7291  C  CA    . PHE L  1  70  ? -39.993  -18.601 -13.378 1.00 46.35  ? 70  PHE a CA    1 
ATOM   7292  C  C     . PHE L  1  70  ? -39.107  -17.674 -12.628 1.00 45.75  ? 70  PHE a C     1 
ATOM   7293  O  O     . PHE L  1  70  ? -38.380  -18.112 -11.814 1.00 44.58  ? 70  PHE a O     1 
ATOM   7294  C  CB    . PHE L  1  70  ? -41.392  -18.466 -12.767 1.00 45.43  ? 70  PHE a CB    1 
ATOM   7295  C  CG    . PHE L  1  70  ? -41.427  -18.713 -11.301 1.00 44.25  ? 70  PHE a CG    1 
ATOM   7296  C  CD1   . PHE L  1  70  ? -41.604  -19.988 -10.820 1.00 45.12  ? 70  PHE a CD1   1 
ATOM   7297  C  CD2   . PHE L  1  70  ? -41.345  -17.673 -10.411 1.00 45.04  ? 70  PHE a CD2   1 
ATOM   7298  C  CE1   . PHE L  1  70  ? -41.661  -20.246 -9.457  1.00 47.16  ? 70  PHE a CE1   1 
ATOM   7299  C  CE2   . PHE L  1  70  ? -41.435  -17.908 -9.042  1.00 48.50  ? 70  PHE a CE2   1 
ATOM   7300  C  CZ    . PHE L  1  70  ? -41.563  -19.203 -8.554  1.00 48.83  ? 70  PHE a CZ    1 
ATOM   7301  N  N     . LEU L  1  71  ? -39.249  -16.386 -12.887 1.00 50.41  ? 71  LEU a N     1 
ATOM   7302  C  CA    . LEU L  1  71  ? -38.507  -15.348 -12.225 1.00 53.24  ? 71  LEU a CA    1 
ATOM   7303  C  C     . LEU L  1  71  ? -39.477  -14.395 -11.590 1.00 56.55  ? 71  LEU a C     1 
ATOM   7304  O  O     . LEU L  1  71  ? -40.606  -14.219 -12.085 1.00 61.89  ? 71  LEU a O     1 
ATOM   7305  C  CB    . LEU L  1  71  ? -37.620  -14.565 -13.175 1.00 54.48  ? 71  LEU a CB    1 
ATOM   7306  C  CG    . LEU L  1  71  ? -36.578  -15.470 -13.821 1.00 61.61  ? 71  LEU a CG    1 
ATOM   7307  C  CD1   . LEU L  1  71  ? -36.795  -15.572 -15.315 1.00 69.88  ? 71  LEU a CD1   1 
ATOM   7308  C  CD2   . LEU L  1  71  ? -35.139  -15.018 -13.595 1.00 68.43  ? 71  LEU a CD2   1 
ATOM   7309  N  N     . ILE L  1  72  ? -39.005  -13.757 -10.526 1.00 56.36  ? 72  ILE a N     1 
ATOM   7310  C  CA    . ILE L  1  72  ? -39.733  -12.682 -9.922  1.00 60.26  ? 72  ILE a CA    1 
ATOM   7311  C  C     . ILE L  1  72  ? -38.954  -11.396 -10.161 1.00 65.54  ? 72  ILE a C     1 
ATOM   7312  O  O     . ILE L  1  72  ? -37.894  -11.177 -9.585  1.00 67.41  ? 72  ILE a O     1 
ATOM   7313  C  CB    . ILE L  1  72  ? -39.946  -12.875 -8.431  1.00 60.16  ? 72  ILE a CB    1 
ATOM   7314  C  CG1   . ILE L  1  72  ? -40.664  -14.187 -8.147  1.00 63.13  ? 72  ILE a CG1   1 
ATOM   7315  C  CG2   . ILE L  1  72  ? -40.832  -11.745 -7.947  1.00 61.25  ? 72  ILE a CG2   1 
ATOM   7316  C  CD1   . ILE L  1  72  ? -40.770  -14.506 -6.664  1.00 64.66  ? 72  ILE a CD1   1 
ATOM   7317  N  N     . LEU L  1  73  ? -39.535  -10.500 -10.955 1.00 68.41  ? 73  LEU a N     1 
ATOM   7318  C  CA    . LEU L  1  73  ? -38.904  -9.231  -11.225 1.00 65.36  ? 73  LEU a CA    1 
ATOM   7319  C  C     . LEU L  1  73  ? -39.467  -8.132  -10.353 1.00 67.83  ? 73  LEU a C     1 
ATOM   7320  O  O     . LEU L  1  73  ? -40.509  -8.304  -9.673  1.00 79.06  ? 73  LEU a O     1 
ATOM   7321  C  CB    . LEU L  1  73  ? -39.074  -8.921  -12.691 1.00 66.43  ? 73  LEU a CB    1 
ATOM   7322  C  CG    . LEU L  1  73  ? -38.724  -10.062 -13.653 1.00 70.85  ? 73  LEU a CG    1 
ATOM   7323  C  CD1   . LEU L  1  73  ? -38.825  -9.737  -15.136 1.00 72.48  ? 73  LEU a CD1   1 
ATOM   7324  C  CD2   . LEU L  1  73  ? -37.351  -10.633 -13.394 1.00 73.35  ? 73  LEU a CD2   1 
ATOM   7325  N  N     . PRO L  1  74  ? -38.765  -6.991  -10.344 1.00 65.89  ? 74  PRO a N     1 
ATOM   7326  C  CA    . PRO L  1  74  ? -39.186  -5.802  -9.579  1.00 62.42  ? 74  PRO a CA    1 
ATOM   7327  C  C     . PRO L  1  74  ? -40.488  -5.233  -10.047 1.00 59.40  ? 74  PRO a C     1 
ATOM   7328  O  O     . PRO L  1  74  ? -40.624  -5.055  -11.252 1.00 59.72  ? 74  PRO a O     1 
ATOM   7329  C  CB    . PRO L  1  74  ? -38.070  -4.794  -9.830  1.00 61.40  ? 74  PRO a CB    1 
ATOM   7330  C  CG    . PRO L  1  74  ? -36.884  -5.594  -10.218 1.00 64.89  ? 74  PRO a CG    1 
ATOM   7331  C  CD    . PRO L  1  74  ? -37.347  -6.922  -10.747 1.00 66.03  ? 74  PRO a CD    1 
ATOM   7332  N  N     . ASP L  1  75  ? -41.408  -4.915  -9.137  1.00 65.91  ? 75  ASP a N     1 
ATOM   7333  C  CA    . ASP L  1  75  ? -42.758  -4.459  -9.557  1.00 76.11  ? 75  ASP a CA    1 
ATOM   7334  C  C     . ASP L  1  75  ? -42.758  -3.221  -10.449 1.00 82.22  ? 75  ASP a C     1 
ATOM   7335  O  O     . ASP L  1  75  ? -43.564  -3.158  -11.380 1.00 84.67  ? 75  ASP a O     1 
ATOM   7336  C  CB    . ASP L  1  75  ? -43.737  -4.173  -8.435  1.00 75.47  ? 75  ASP a CB    1 
ATOM   7337  C  CG    . ASP L  1  75  ? -43.953  -5.338  -7.571  1.00 82.33  ? 75  ASP a CG    1 
ATOM   7338  O  OD1   . ASP L  1  75  ? -43.773  -6.498  -8.020  1.00 89.16  ? 75  ASP a OD1   1 
ATOM   7339  O  OD2   . ASP L  1  75  ? -44.220  -5.081  -6.366  1.00 96.84  ? 75  ASP a OD2   1 
ATOM   7340  N  N     . MET L  1  76  ? -41.795  -2.332  -10.240 1.00 84.66  ? 76  MET a N     1 
ATOM   7341  C  CA    . MET L  1  76  ? -41.633  -1.177  -11.120 1.00 95.63  ? 76  MET a CA    1 
ATOM   7342  C  C     . MET L  1  76  ? -41.617  -1.491  -12.632 1.00 88.53  ? 76  MET a C     1 
ATOM   7343  O  O     . MET L  1  76  ? -42.149  -0.701  -13.416 1.00 92.79  ? 76  MET a O     1 
ATOM   7344  C  CB    . MET L  1  76  ? -40.370  -0.364  -10.748 1.00 100.34 ? 76  MET a CB    1 
ATOM   7345  C  CG    . MET L  1  76  ? -40.232  1.013   -11.413 1.00 101.02 ? 76  MET a CG    1 
ATOM   7346  S  SD    . MET L  1  76  ? -41.722  2.085   -11.432 1.00 98.69  ? 76  MET a SD    1 
ATOM   7347  C  CE    . MET L  1  76  ? -41.355  3.358   -12.630 1.00 106.10 ? 76  MET a CE    1 
ATOM   7348  N  N     . LEU L  1  77  ? -41.076  -2.647  -13.008 1.00 77.91  ? 77  LEU a N     1 
ATOM   7349  C  CA    . LEU L  1  77  ? -41.011  -3.053  -14.390 1.00 73.04  ? 77  LEU a CA    1 
ATOM   7350  C  C     . LEU L  1  77  ? -42.364  -3.105  -15.044 1.00 77.13  ? 77  LEU a C     1 
ATOM   7351  O  O     . LEU L  1  77  ? -42.451  -2.889  -16.251 1.00 78.88  ? 77  LEU a O     1 
ATOM   7352  C  CB    . LEU L  1  77  ? -40.354  -4.403  -14.579 1.00 72.43  ? 77  LEU a CB    1 
ATOM   7353  C  CG    . LEU L  1  77  ? -38.835  -4.703  -14.677 1.00 74.45  ? 77  LEU a CG    1 
ATOM   7354  C  CD1   . LEU L  1  77  ? -37.851  -3.621  -15.109 1.00 76.82  ? 77  LEU a CD1   1 
ATOM   7355  C  CD2   . LEU L  1  77  ? -38.516  -5.022  -13.247 1.00 74.26  ? 77  LEU a CD2   1 
ATOM   7356  N  N     . LYS L  1  78  ? -43.435  -3.259  -14.267 1.00 86.18  ? 78  LYS a N     1 
ATOM   7357  C  CA    . LYS L  1  78  ? -44.806  -3.156  -14.828 1.00 91.18  ? 78  LYS a CA    1 
ATOM   7358  C  C     . LYS L  1  78  ? -45.128  -1.833  -15.502 1.00 88.16  ? 78  LYS a C     1 
ATOM   7359  O  O     . LYS L  1  78  ? -46.065  -1.764  -16.291 1.00 96.00  ? 78  LYS a O     1 
ATOM   7360  C  CB    . LYS L  1  78  ? -45.904  -3.487  -13.811 1.00 88.43  ? 78  LYS a CB    1 
ATOM   7361  C  CG    . LYS L  1  78  ? -46.273  -2.400  -12.834 1.00 90.91  ? 78  LYS a CG    1 
ATOM   7362  C  CD    . LYS L  1  78  ? -46.797  -2.992  -11.533 1.00 96.41  ? 78  LYS a CD    1 
ATOM   7363  C  CE    . LYS L  1  78  ? -48.079  -2.337  -11.047 1.00 103.43 ? 78  LYS a CE    1 
ATOM   7364  N  NZ    . LYS L  1  78  ? -48.970  -3.349  -10.393 1.00 102.36 ? 78  LYS a NZ    1 
ATOM   7365  N  N     . ASN L  1  79  ? -44.356  -0.806  -15.172 1.00 81.48  ? 79  ASN a N     1 
ATOM   7366  C  CA    . ASN L  1  79  ? -44.521  0.480   -15.752 1.00 83.00  ? 79  ASN a CA    1 
ATOM   7367  C  C     . ASN L  1  79  ? -43.541  0.748   -16.867 1.00 93.41  ? 79  ASN a C     1 
ATOM   7368  O  O     . ASN L  1  79  ? -43.446  1.887   -17.339 1.00 110.24 ? 79  ASN a O     1 
ATOM   7369  C  CB    . ASN L  1  79  ? -44.346  1.534   -14.671 1.00 84.87  ? 79  ASN a CB    1 
ATOM   7370  C  CG    . ASN L  1  79  ? -45.311  1.363   -13.527 1.00 87.36  ? 79  ASN a CG    1 
ATOM   7371  O  OD1   . ASN L  1  79  ? -44.881  1.166   -12.378 1.00 97.86  ? 79  ASN a OD1   1 
ATOM   7372  N  ND2   . ASN L  1  79  ? -46.618  1.394   -13.815 1.00 83.77  ? 79  ASN a ND2   1 
ATOM   7373  N  N     . ALA L  1  80  ? -42.853  -0.271  -17.364 1.00 99.30  ? 80  ALA a N     1 
ATOM   7374  C  CA    . ALA L  1  80  ? -41.957  -0.073  -18.515 1.00 97.62  ? 80  ALA a CA    1 
ATOM   7375  C  C     . ALA L  1  80  ? -42.771  0.027   -19.823 1.00 94.66  ? 80  ALA a C     1 
ATOM   7376  O  O     . ALA L  1  80  ? -43.959  -0.361  -19.880 1.00 87.48  ? 80  ALA a O     1 
ATOM   7377  C  CB    . ALA L  1  80  ? -40.948  -1.193  -18.574 1.00 100.99 ? 80  ALA a CB    1 
ATOM   7378  N  N     . PRO L  1  81  ? -42.162  0.617   -20.860 1.00 91.72  ? 81  PRO a N     1 
ATOM   7379  C  CA    . PRO L  1  81  ? -42.960  1.045   -22.009 1.00 92.70  ? 81  PRO a CA    1 
ATOM   7380  C  C     . PRO L  1  81  ? -43.564  -0.078  -22.859 1.00 92.27  ? 81  PRO a C     1 
ATOM   7381  O  O     . PRO L  1  81  ? -44.623  0.122   -23.495 1.00 96.65  ? 81  PRO a O     1 
ATOM   7382  C  CB    . PRO L  1  81  ? -41.970  1.897   -22.812 1.00 99.33  ? 81  PRO a CB    1 
ATOM   7383  C  CG    . PRO L  1  81  ? -40.635  1.362   -22.448 1.00 98.42  ? 81  PRO a CG    1 
ATOM   7384  C  CD    . PRO L  1  81  ? -40.762  1.048   -20.985 1.00 95.44  ? 81  PRO a CD    1 
ATOM   7385  N  N     . MET L  1  82  ? -42.830  -1.189  -22.904 1.00 87.27  ? 82  MET a N     1 
ATOM   7386  C  CA    . MET L  1  82  ? -43.222  -2.445  -23.533 1.00 81.65  ? 82  MET a CA    1 
ATOM   7387  C  C     . MET L  1  82  ? -44.528  -3.056  -23.091 1.00 81.36  ? 82  MET a C     1 
ATOM   7388  O  O     . MET L  1  82  ? -45.222  -3.606  -23.947 1.00 83.20  ? 82  MET a O     1 
ATOM   7389  C  CB    . MET L  1  82  ? -42.174  -3.494  -23.306 1.00 77.66  ? 82  MET a CB    1 
ATOM   7390  C  CG    . MET L  1  82  ? -41.504  -3.435  -21.957 1.00 83.17  ? 82  MET a CG    1 
ATOM   7391  S  SD    . MET L  1  82  ? -39.734  -3.532  -22.024 1.00 93.36  ? 82  MET a SD    1 
ATOM   7392  C  CE    . MET L  1  82  ? -39.068  -1.977  -22.615 1.00 101.76 ? 82  MET a CE    1 
ATOM   7393  N  N     . LEU L  1  83  ? -44.841  -2.928  -21.804 1.00 82.44  ? 83  LEU a N     1 
ATOM   7394  C  CA    . LEU L  1  83  ? -46.125  -3.338  -21.248 1.00 89.08  ? 83  LEU a CA    1 
ATOM   7395  C  C     . LEU L  1  83  ? -47.000  -2.072  -21.341 1.00 108.49 ? 83  LEU a C     1 
ATOM   7396  O  O     . LEU L  1  83  ? -46.635  -1.026  -20.792 1.00 118.47 ? 83  LEU a O     1 
ATOM   7397  C  CB    . LEU L  1  83  ? -45.943  -3.739  -19.799 1.00 87.58  ? 83  LEU a CB    1 
ATOM   7398  C  CG    . LEU L  1  83  ? -44.858  -4.801  -19.526 1.00 90.46  ? 83  LEU a CG    1 
ATOM   7399  C  CD1   . LEU L  1  83  ? -44.586  -4.979  -18.026 1.00 87.41  ? 83  LEU a CD1   1 
ATOM   7400  C  CD2   . LEU L  1  83  ? -45.204  -6.130  -20.196 1.00 87.78  ? 83  LEU a CD2   1 
ATOM   7401  N  N     . LYS L  1  84  ? -48.114  -2.088  -22.075 1.00 121.43 ? 84  LYS a N     1 
ATOM   7402  C  CA    . LYS L  1  84  ? -48.807  -0.827  -22.447 1.00 113.01 ? 84  LYS a CA    1 
ATOM   7403  C  C     . LYS L  1  84  ? -50.290  -0.979  -22.858 1.00 108.87 ? 84  LYS a C     1 
ATOM   7404  O  O     . LYS L  1  84  ? -50.647  -1.701  -23.796 1.00 104.27 ? 84  LYS a O     1 
ATOM   7405  C  CB    . LYS L  1  84  ? -47.993  -0.142  -23.544 1.00 108.21 ? 84  LYS a CB    1 
ATOM   7406  C  CG    . LYS L  1  84  ? -47.946  -0.968  -24.822 1.00 115.83 ? 84  LYS a CG    1 
ATOM   7407  C  CD    . LYS L  1  84  ? -46.743  -0.570  -25.642 1.00 131.65 ? 84  LYS a CD    1 
ATOM   7408  C  CE    . LYS L  1  84  ? -46.759  -1.204  -27.018 1.00 147.07 ? 84  LYS a CE    1 
ATOM   7409  N  NZ    . LYS L  1  84  ? -45.956  -0.349  -27.944 1.00 151.97 ? 84  LYS a NZ    1 
ATOM   7410  N  N     . SER M  2  6   ? -53.238  -14.129 -33.472 1.00 134.74 ? 6   SER b N     1 
ATOM   7411  C  CA    . SER M  2  6   ? -53.047  -14.626 -32.057 1.00 128.38 ? 6   SER b CA    1 
ATOM   7412  C  C     . SER M  2  6   ? -54.194  -14.276 -31.102 1.00 127.49 ? 6   SER b C     1 
ATOM   7413  O  O     . SER M  2  6   ? -54.109  -14.569 -29.906 1.00 109.17 ? 6   SER b O     1 
ATOM   7414  C  CB    . SER M  2  6   ? -51.748  -14.079 -31.459 1.00 118.78 ? 6   SER b CB    1 
ATOM   7415  O  OG    . SER M  2  6   ? -51.522  -14.709 -30.222 1.00 114.47 ? 6   SER b OG    1 
ATOM   7416  N  N     . SER M  2  7   ? -55.275  -13.686 -31.627 1.00 139.63 ? 7   SER b N     1 
ATOM   7417  C  CA    . SER M  2  7   ? -56.236  -12.911 -30.801 1.00 139.82 ? 7   SER b CA    1 
ATOM   7418  C  C     . SER M  2  7   ? -56.819  -13.700 -29.655 1.00 129.77 ? 7   SER b C     1 
ATOM   7419  O  O     . SER M  2  7   ? -57.382  -13.149 -28.746 1.00 117.25 ? 7   SER b O     1 
ATOM   7420  C  CB    . SER M  2  7   ? -57.336  -12.221 -31.636 1.00 139.80 ? 7   SER b CB    1 
ATOM   7421  O  OG    . SER M  2  7   ? -58.081  -13.185 -32.361 1.00 143.00 ? 7   SER b OG    1 
ATOM   7422  N  N     . LYS M  2  8   ? -56.748  -15.030 -29.786 1.00 121.03 ? 8   LYS b N     1 
ATOM   7423  C  CA    . LYS M  2  8   ? -57.206  -15.934 -28.725 1.00 114.02 ? 8   LYS b CA    1 
ATOM   7424  C  C     . LYS M  2  8   ? -56.511  -15.651 -27.414 1.00 111.35 ? 8   LYS b C     1 
ATOM   7425  O  O     . LYS M  2  8   ? -57.155  -15.692 -26.374 1.00 119.89 ? 8   LYS b O     1 
ATOM   7426  C  CB    . LYS M  2  8   ? -57.031  -17.403 -29.110 1.00 107.58 ? 8   LYS b CB    1 
ATOM   7427  C  CG    . LYS M  2  8   ? -58.106  -17.915 -30.069 1.00 113.55 ? 8   LYS b CG    1 
ATOM   7428  C  CD    . LYS M  2  8   ? -59.561  -17.691 -29.617 1.00 109.58 ? 8   LYS b CD    1 
ATOM   7429  C  CE    . LYS M  2  8   ? -60.512  -18.581 -30.367 1.00 110.43 ? 8   LYS b CE    1 
ATOM   7430  N  NZ    . LYS M  2  8   ? -60.373  -18.562 -31.839 1.00 114.67 ? 8   LYS b NZ    1 
ATOM   7431  N  N     . MET M  2  9   ? -55.193  -15.568 -27.466 1.00 101.29 ? 9   MET b N     1 
ATOM   7432  C  CA    . MET M  2  9   ? -54.376  -15.167 -26.341 1.00 87.99  ? 9   MET b CA    1 
ATOM   7433  C  C     . MET M  2  9   ? -54.564  -13.712 -25.984 1.00 80.53  ? 9   MET b C     1 
ATOM   7434  O  O     . MET M  2  9   ? -54.594  -13.341 -24.834 1.00 87.33  ? 9   MET b O     1 
ATOM   7435  C  CB    . MET M  2  9   ? -52.926  -15.438 -26.671 1.00 93.36  ? 9   MET b CB    1 
ATOM   7436  C  CG    . MET M  2  9   ? -52.528  -16.859 -26.369 1.00 97.75  ? 9   MET b CG    1 
ATOM   7437  S  SD    . MET M  2  9   ? -52.543  -17.034 -24.598 1.00 110.41 ? 9   MET b SD    1 
ATOM   7438  C  CE    . MET M  2  9   ? -54.263  -17.387 -24.307 1.00 106.50 ? 9   MET b CE    1 
ATOM   7439  N  N     . LEU M  2  10  ? -54.665  -12.893 -27.012 1.00 77.78  ? 10  LEU b N     1 
ATOM   7440  C  CA    . LEU M  2  10  ? -54.743  -11.452 -26.874 1.00 81.25  ? 10  LEU b CA    1 
ATOM   7441  C  C     . LEU M  2  10  ? -55.986  -10.944 -26.165 1.00 84.99  ? 10  LEU b C     1 
ATOM   7442  O  O     . LEU M  2  10  ? -55.956  -9.902  -25.535 1.00 83.21  ? 10  LEU b O     1 
ATOM   7443  C  CB    . LEU M  2  10  ? -54.584  -10.782 -28.229 1.00 83.15  ? 10  LEU b CB    1 
ATOM   7444  C  CG    . LEU M  2  10  ? -53.190  -10.217 -28.433 1.00 83.21  ? 10  LEU b CG    1 
ATOM   7445  C  CD1   . LEU M  2  10  ? -52.912  -10.019 -29.907 1.00 85.49  ? 10  LEU b CD1   1 
ATOM   7446  C  CD2   . LEU M  2  10  ? -53.069  -8.911  -27.681 1.00 82.69  ? 10  LEU b CD2   1 
ATOM   7447  N  N     . GLN M  2  11  ? -57.091  -11.655 -26.299 1.00 85.08  ? 11  GLN b N     1 
ATOM   7448  C  CA    . GLN M  2  11  ? -58.344  -11.142 -25.798 1.00 85.46  ? 11  GLN b CA    1 
ATOM   7449  C  C     . GLN M  2  11  ? -58.213  -10.905 -24.324 1.00 87.00  ? 11  GLN b C     1 
ATOM   7450  O  O     . GLN M  2  11  ? -58.774  -9.964  -23.797 1.00 112.36 ? 11  GLN b O     1 
ATOM   7451  C  CB    . GLN M  2  11  ? -59.488  -12.124 -26.025 1.00 97.66  ? 11  GLN b CB    1 
ATOM   7452  C  CG    . GLN M  2  11  ? -59.242  -13.184 -27.075 1.00 109.33 ? 11  GLN b CG    1 
ATOM   7453  C  CD    . GLN M  2  11  ? -60.454  -14.071 -27.276 1.00 116.36 ? 11  GLN b CD    1 
ATOM   7454  O  OE1   . GLN M  2  11  ? -60.865  -14.795 -26.374 1.00 114.52 ? 11  GLN b OE1   1 
ATOM   7455  N  NE2   . GLN M  2  11  ? -61.038  -14.013 -28.464 1.00 121.78 ? 11  GLN b NE2   1 
ATOM   7456  N  N     . HIS M  2  12  ? -57.497  -11.789 -23.652 1.00 84.17  ? 12  HIS b N     1 
ATOM   7457  C  CA    . HIS M  2  12  ? -57.433  -11.778 -22.205 1.00 82.04  ? 12  HIS b CA    1 
ATOM   7458  C  C     . HIS M  2  12  ? -56.358  -10.924 -21.573 1.00 74.20  ? 12  HIS b C     1 
ATOM   7459  O  O     . HIS M  2  12  ? -56.306  -10.845 -20.360 1.00 77.93  ? 12  HIS b O     1 
ATOM   7460  C  CB    . HIS M  2  12  ? -57.278  -13.192 -21.695 1.00 82.58  ? 12  HIS b CB    1 
ATOM   7461  C  CG    . HIS M  2  12  ? -58.145  -14.177 -22.398 1.00 91.57  ? 12  HIS b CG    1 
ATOM   7462  N  ND1   . HIS M  2  12  ? -59.489  -14.302 -22.133 1.00 94.35  ? 12  HIS b ND1   1 
ATOM   7463  C  CD2   . HIS M  2  12  ? -57.861  -15.090 -23.352 1.00 94.63  ? 12  HIS b CD2   1 
ATOM   7464  C  CE1   . HIS M  2  12  ? -59.996  -15.250 -22.896 1.00 97.07  ? 12  HIS b CE1   1 
ATOM   7465  N  NE2   . HIS M  2  12  ? -59.029  -15.743 -23.646 1.00 101.48 ? 12  HIS b NE2   1 
ATOM   7466  N  N     . ILE M  2  13  ? -55.507  -10.276 -22.358 1.00 65.01  ? 13  ILE b N     1 
ATOM   7467  C  CA    . ILE M  2  13  ? -54.423  -9.513  -21.762 1.00 60.69  ? 13  ILE b CA    1 
ATOM   7468  C  C     . ILE M  2  13  ? -55.076  -8.471  -20.884 1.00 62.03  ? 13  ILE b C     1 
ATOM   7469  O  O     . ILE M  2  13  ? -56.043  -7.850  -21.262 1.00 64.80  ? 13  ILE b O     1 
ATOM   7470  C  CB    . ILE M  2  13  ? -53.473  -8.896  -22.810 1.00 60.19  ? 13  ILE b CB    1 
ATOM   7471  C  CG1   . ILE M  2  13  ? -52.529  -9.969  -23.338 1.00 60.75  ? 13  ILE b CG1   1 
ATOM   7472  C  CG2   . ILE M  2  13  ? -52.671  -7.746  -22.227 1.00 56.57  ? 13  ILE b CG2   1 
ATOM   7473  C  CD1   . ILE M  2  13  ? -51.296  -9.460  -24.041 1.00 63.29  ? 13  ILE b CD1   1 
ATOM   7474  N  N     . ASP M  2  14  ? -54.525  -8.320  -19.695 1.00 70.69  ? 14  ASP b N     1 
ATOM   7475  C  CA    . ASP M  2  14  ? -55.037  -7.425  -18.680 1.00 74.19  ? 14  ASP b CA    1 
ATOM   7476  C  C     . ASP M  2  14  ? -56.152  -8.026  -17.826 1.00 72.40  ? 14  ASP b C     1 
ATOM   7477  O  O     . ASP M  2  14  ? -56.606  -7.374  -16.903 1.00 72.68  ? 14  ASP b O     1 
ATOM   7478  C  CB    . ASP M  2  14  ? -55.464  -6.094  -19.290 1.00 80.45  ? 14  ASP b CB    1 
ATOM   7479  C  CG    . ASP M  2  14  ? -54.339  -5.075  -19.314 1.00 86.23  ? 14  ASP b CG    1 
ATOM   7480  O  OD1   . ASP M  2  14  ? -53.461  -5.140  -18.438 1.00 90.03  ? 14  ASP b OD1   1 
ATOM   7481  O  OD2   . ASP M  2  14  ? -54.330  -4.206  -20.204 1.00 86.09  ? 14  ASP b OD2   1 
ATOM   7482  N  N     . TYR M  2  15  ? -56.569  -9.265  -18.089 1.00 67.14  ? 15  TYR b N     1 
ATOM   7483  C  CA    . TYR M  2  15  ? -57.405  -9.969  -17.125 1.00 71.40  ? 15  TYR b CA    1 
ATOM   7484  C  C     . TYR M  2  15  ? -56.607  -10.646 -16.002 1.00 70.22  ? 15  TYR b C     1 
ATOM   7485  O  O     . TYR M  2  15  ? -55.386  -10.733 -16.010 1.00 73.51  ? 15  TYR b O     1 
ATOM   7486  C  CB    . TYR M  2  15  ? -58.252  -11.023 -17.796 1.00 74.35  ? 15  TYR b CB    1 
ATOM   7487  C  CG    . TYR M  2  15  ? -59.371  -10.477 -18.608 1.00 80.59  ? 15  TYR b CG    1 
ATOM   7488  C  CD1   . TYR M  2  15  ? -59.108  -9.664  -19.726 1.00 85.40  ? 15  TYR b CD1   1 
ATOM   7489  C  CD2   . TYR M  2  15  ? -60.682  -10.723 -18.262 1.00 81.04  ? 15  TYR b CD2   1 
ATOM   7490  C  CE1   . TYR M  2  15  ? -60.110  -9.088  -20.489 1.00 85.58  ? 15  TYR b CE1   1 
ATOM   7491  C  CE2   . TYR M  2  15  ? -61.686  -10.153 -19.017 1.00 87.42  ? 15  TYR b CE2   1 
ATOM   7492  C  CZ    . TYR M  2  15  ? -61.393  -9.349  -20.121 1.00 85.71  ? 15  TYR b CZ    1 
ATOM   7493  O  OH    . TYR M  2  15  ? -62.363  -8.769  -20.889 1.00 89.79  ? 15  TYR b OH    1 
ATOM   7494  N  N     . ARG M  2  16  ? -57.316  -11.080 -14.983 1.00 66.51  ? 16  ARG b N     1 
ATOM   7495  C  CA    . ARG M  2  16  ? -56.719  -11.852 -13.925 1.00 71.66  ? 16  ARG b CA    1 
ATOM   7496  C  C     . ARG M  2  16  ? -56.850  -13.289 -14.394 1.00 69.86  ? 16  ARG b C     1 
ATOM   7497  O  O     . ARG M  2  16  ? -57.975  -13.748 -14.579 1.00 67.80  ? 16  ARG b O     1 
ATOM   7498  C  CB    . ARG M  2  16  ? -57.507  -11.685 -12.614 1.00 80.62  ? 16  ARG b CB    1 
ATOM   7499  C  CG    . ARG M  2  16  ? -57.091  -10.602 -11.612 1.00 83.31  ? 16  ARG b CG    1 
ATOM   7500  C  CD    . ARG M  2  16  ? -55.650  -10.582 -11.180 1.00 83.24  ? 16  ARG b CD    1 
ATOM   7501  N  NE    . ARG M  2  16  ? -55.432  -11.376 -9.983  1.00 89.76  ? 16  ARG b NE    1 
ATOM   7502  C  CZ    . ARG M  2  16  ? -54.288  -11.347 -9.289  1.00 99.44  ? 16  ARG b CZ    1 
ATOM   7503  N  NH1   . ARG M  2  16  ? -53.281  -10.520 -9.623  1.00 89.63  ? 16  ARG b NH1   1 
ATOM   7504  N  NH2   . ARG M  2  16  ? -54.156  -12.147 -8.221  1.00 107.21 ? 16  ARG b NH2   1 
ATOM   7505  N  N     . MET M  2  17  ? -55.737  -14.013 -14.543 1.00 70.62  ? 17  MET b N     1 
ATOM   7506  C  CA    . MET M  2  17  ? -55.754  -15.349 -15.162 1.00 68.48  ? 17  MET b CA    1 
ATOM   7507  C  C     . MET M  2  17  ? -55.082  -16.446 -14.390 1.00 62.71  ? 17  MET b C     1 
ATOM   7508  O  O     . MET M  2  17  ? -54.028  -16.245 -13.820 1.00 64.04  ? 17  MET b O     1 
ATOM   7509  C  CB    . MET M  2  17  ? -55.110  -15.263 -16.516 1.00 71.01  ? 17  MET b CB    1 
ATOM   7510  C  CG    . MET M  2  17  ? -55.936  -14.317 -17.353 1.00 72.34  ? 17  MET b CG    1 
ATOM   7511  S  SD    . MET M  2  17  ? -56.156  -14.908 -19.016 1.00 92.33  ? 17  MET b SD    1 
ATOM   7512  C  CE    . MET M  2  17  ? -57.034  -16.422 -18.757 1.00 84.75  ? 17  MET b CE    1 
ATOM   7513  N  N     . ARG M  2  18  ? -55.740  -17.594 -14.304 1.00 60.54  ? 18  ARG b N     1 
ATOM   7514  C  CA    . ARG M  2  18  ? -55.277  -18.677 -13.455 1.00 58.53  ? 18  ARG b CA    1 
ATOM   7515  C  C     . ARG M  2  18  ? -54.533  -19.677 -14.325 1.00 56.82  ? 18  ARG b C     1 
ATOM   7516  O  O     . ARG M  2  18  ? -55.135  -20.426 -15.078 1.00 55.01  ? 18  ARG b O     1 
ATOM   7517  C  CB    . ARG M  2  18  ? -56.437  -19.296 -12.719 1.00 56.81  ? 18  ARG b CB    1 
ATOM   7518  C  CG    . ARG M  2  18  ? -56.144  -20.638 -12.093 1.00 63.01  ? 18  ARG b CG    1 
ATOM   7519  C  CD    . ARG M  2  18  ? -57.385  -21.497 -11.849 1.00 69.61  ? 18  ARG b CD    1 
ATOM   7520  N  NE    . ARG M  2  18  ? -58.126  -20.779 -10.805 1.00 74.72  ? 18  ARG b NE    1 
ATOM   7521  C  CZ    . ARG M  2  18  ? -58.353  -21.249 -9.595  1.00 72.59  ? 18  ARG b CZ    1 
ATOM   7522  N  NH1   . ARG M  2  18  ? -58.026  -22.511 -9.291  1.00 78.71  ? 18  ARG b NH1   1 
ATOM   7523  N  NH2   . ARG M  2  18  ? -58.905  -20.431 -8.705  1.00 66.93  ? 18  ARG b NH2   1 
ATOM   7524  N  N     . CYS M  2  19  ? -53.227  -19.755 -14.096 1.00 59.34  ? 19  CYS b N     1 
ATOM   7525  C  CA    . CYS M  2  19  ? -52.329  -20.645 -14.816 1.00 57.65  ? 19  CYS b CA    1 
ATOM   7526  C  C     . CYS M  2  19  ? -51.978  -21.886 -14.012 1.00 52.63  ? 19  CYS b C     1 
ATOM   7527  O  O     . CYS M  2  19  ? -51.612  -21.744 -12.871 1.00 50.06  ? 19  CYS b O     1 
ATOM   7528  C  CB    . CYS M  2  19  ? -51.077  -19.864 -15.080 1.00 58.97  ? 19  CYS b CB    1 
ATOM   7529  S  SG    . CYS M  2  19  ? -51.512  -18.249 -15.746 1.00 68.93  ? 19  CYS b SG    1 
ATOM   7530  N  N     . ILE M  2  20  ? -52.107  -23.077 -14.590 1.00 51.56  ? 20  ILE b N     1 
ATOM   7531  C  CA    . ILE M  2  20  ? -51.718  -24.332 -13.964 1.00 49.89  ? 20  ILE b CA    1 
ATOM   7532  C  C     . ILE M  2  20  ? -50.337  -24.670 -14.525 1.00 53.66  ? 20  ILE b C     1 
ATOM   7533  O  O     . ILE M  2  20  ? -50.149  -24.626 -15.746 1.00 55.78  ? 20  ILE b O     1 
ATOM   7534  C  CB    . ILE M  2  20  ? -52.657  -25.457 -14.295 1.00 52.61  ? 20  ILE b CB    1 
ATOM   7535  C  CG1   . ILE M  2  20  ? -54.015  -25.247 -13.601 1.00 59.54  ? 20  ILE b CG1   1 
ATOM   7536  C  CG2   . ILE M  2  20  ? -52.083  -26.800 -13.916 1.00 54.47  ? 20  ILE b CG2   1 
ATOM   7537  C  CD1   . ILE M  2  20  ? -55.031  -24.458 -14.441 1.00 66.83  ? 20  ILE b CD1   1 
ATOM   7538  N  N     . LEU M  2  21  ? -49.364  -24.900 -13.620 1.00 53.05  ? 21  LEU b N     1 
ATOM   7539  C  CA    . LEU M  2  21  ? -48.001  -25.180 -13.959 1.00 52.14  ? 21  LEU b CA    1 
ATOM   7540  C  C     . LEU M  2  21  ? -47.771  -26.673 -13.956 1.00 52.76  ? 21  LEU b C     1 
ATOM   7541  O  O     . LEU M  2  21  ? -48.638  -27.420 -13.510 1.00 55.12  ? 21  LEU b O     1 
ATOM   7542  C  CB    . LEU M  2  21  ? -47.114  -24.513 -12.967 1.00 59.89  ? 21  LEU b CB    1 
ATOM   7543  C  CG    . LEU M  2  21  ? -46.718  -23.072 -13.313 1.00 72.34  ? 21  LEU b CG    1 
ATOM   7544  C  CD1   . LEU M  2  21  ? -47.926  -22.226 -13.624 1.00 75.85  ? 21  LEU b CD1   1 
ATOM   7545  C  CD2   . LEU M  2  21  ? -45.905  -22.460 -12.162 1.00 76.90  ? 21  LEU b CD2   1 
ATOM   7546  N  N     . GLN M  2  22  ? -46.624  -27.143 -14.441 1.00 52.24  ? 22  GLN b N     1 
ATOM   7547  C  CA    . GLN M  2  22  ? -46.485  -28.570 -14.619 1.00 55.89  ? 22  GLN b CA    1 
ATOM   7548  C  C     . GLN M  2  22  ? -46.388  -29.326 -13.308 1.00 62.42  ? 22  GLN b C     1 
ATOM   7549  O  O     . GLN M  2  22  ? -46.780  -30.508 -13.273 1.00 78.42  ? 22  GLN b O     1 
ATOM   7550  C  CB    . GLN M  2  22  ? -45.323  -28.913 -15.518 1.00 58.34  ? 22  GLN b CB    1 
ATOM   7551  C  CG    . GLN M  2  22  ? -45.546  -28.459 -16.929 1.00 64.41  ? 22  GLN b CG    1 
ATOM   7552  C  CD    . GLN M  2  22  ? -44.883  -29.320 -17.967 1.00 76.27  ? 22  GLN b CD    1 
ATOM   7553  O  OE1   . GLN M  2  22  ? -43.752  -29.794 -17.794 1.00 94.84  ? 22  GLN b OE1   1 
ATOM   7554  N  NE2   . GLN M  2  22  ? -45.486  -29.371 -19.127 1.00 82.75  ? 22  GLN b NE2   1 
ATOM   7555  N  N     . ASP M  2  23  ? -45.910  -28.669 -12.251 1.00 58.87  ? 23  ASP b N     1 
ATOM   7556  C  CA    . ASP M  2  23  ? -45.899  -29.243 -10.908 1.00 59.00  ? 23  ASP b CA    1 
ATOM   7557  C  C     . ASP M  2  23  ? -47.137  -29.077 -10.062 1.00 59.67  ? 23  ASP b C     1 
ATOM   7558  O  O     . ASP M  2  23  ? -47.210  -29.590 -8.941  1.00 67.13  ? 23  ASP b O     1 
ATOM   7559  C  CB    . ASP M  2  23  ? -44.692  -28.787 -10.109 1.00 61.97  ? 23  ASP b CB    1 
ATOM   7560  C  CG    . ASP M  2  23  ? -44.738  -27.350 -9.703  1.00 62.83  ? 23  ASP b CG    1 
ATOM   7561  O  OD1   . ASP M  2  23  ? -44.903  -26.532 -10.629 1.00 68.38  ? 23  ASP b OD1   1 
ATOM   7562  O  OD2   . ASP M  2  23  ? -44.403  -27.050 -8.524  1.00 73.97  ? 23  ASP b OD2   1 
ATOM   7563  N  N     . GLY M  2  24  ? -48.142  -28.442 -10.628 1.00 58.11  ? 24  GLY b N     1 
ATOM   7564  C  CA    . GLY M  2  24  ? -49.443  -28.412 -10.026 1.00 57.92  ? 24  GLY b CA    1 
ATOM   7565  C  C     . GLY M  2  24  ? -49.704  -27.166 -9.243  1.00 54.89  ? 24  GLY b C     1 
ATOM   7566  O  O     . GLY M  2  24  ? -50.834  -26.976 -8.771  1.00 59.40  ? 24  GLY b O     1 
ATOM   7567  N  N     . ARG M  2  25  ? -48.703  -26.316 -9.147  1.00 51.52  ? 25  ARG b N     1 
ATOM   7568  C  CA    . ARG M  2  25  ? -48.971  -24.970 -8.709  1.00 55.50  ? 25  ARG b CA    1 
ATOM   7569  C  C     . ARG M  2  25  ? -49.996  -24.249 -9.591  1.00 56.12  ? 25  ARG b C     1 
ATOM   7570  O  O     . ARG M  2  25  ? -50.145  -24.525 -10.770 1.00 59.47  ? 25  ARG b O     1 
ATOM   7571  C  CB    . ARG M  2  25  ? -47.688  -24.171 -8.748  1.00 56.71  ? 25  ARG b CB    1 
ATOM   7572  C  CG    . ARG M  2  25  ? -46.784  -24.616 -7.635  1.00 56.15  ? 25  ARG b CG    1 
ATOM   7573  C  CD    . ARG M  2  25  ? -45.589  -23.736 -7.442  1.00 60.15  ? 25  ARG b CD    1 
ATOM   7574  N  NE    . ARG M  2  25  ? -44.427  -24.312 -8.073  1.00 61.80  ? 25  ARG b NE    1 
ATOM   7575  C  CZ    . ARG M  2  25  ? -43.212  -23.835 -7.875  1.00 65.31  ? 25  ARG b CZ    1 
ATOM   7576  N  NH1   . ARG M  2  25  ? -42.994  -22.785 -7.081  1.00 61.82  ? 25  ARG b NH1   1 
ATOM   7577  N  NH2   . ARG M  2  25  ? -42.210  -24.390 -8.553  1.00 71.00  ? 25  ARG b NH2   1 
ATOM   7578  N  N     . ILE M  2  26  ? -50.652  -23.270 -9.000  1.00 52.50  ? 26  ILE b N     1 
ATOM   7579  C  CA    . ILE M  2  26  ? -51.478  -22.363 -9.727  1.00 51.29  ? 26  ILE b CA    1 
ATOM   7580  C  C     . ILE M  2  26  ? -50.825  -21.017 -9.560  1.00 50.46  ? 26  ILE b C     1 
ATOM   7581  O  O     . ILE M  2  26  ? -50.491  -20.587 -8.457  1.00 57.01  ? 26  ILE b O     1 
ATOM   7582  C  CB    . ILE M  2  26  ? -52.823  -22.253 -9.031  1.00 56.82  ? 26  ILE b CB    1 
ATOM   7583  C  CG1   . ILE M  2  26  ? -53.473  -23.604 -8.839  1.00 59.95  ? 26  ILE b CG1   1 
ATOM   7584  C  CG2   . ILE M  2  26  ? -53.717  -21.283 -9.765  1.00 59.99  ? 26  ILE b CG2   1 
ATOM   7585  C  CD1   . ILE M  2  26  ? -54.306  -24.029 -10.014 1.00 67.61  ? 26  ILE b CD1   1 
ATOM   7586  N  N     . PHE M  2  27  ? -50.690  -20.280 -10.632 1.00 50.68  ? 27  PHE b N     1 
ATOM   7587  C  CA    . PHE M  2  27  ? -50.355  -18.858 -10.546 1.00 52.96  ? 27  PHE b CA    1 
ATOM   7588  C  C     . PHE M  2  27  ? -51.621  -18.129 -10.961 1.00 51.62  ? 27  PHE b C     1 
ATOM   7589  O  O     . PHE M  2  27  ? -52.129  -18.329 -12.041 1.00 48.49  ? 27  PHE b O     1 
ATOM   7590  C  CB    . PHE M  2  27  ? -49.254  -18.500 -11.540 1.00 55.34  ? 27  PHE b CB    1 
ATOM   7591  C  CG    . PHE M  2  27  ? -47.858  -18.816 -11.092 1.00 59.67  ? 27  PHE b CG    1 
ATOM   7592  C  CD1   . PHE M  2  27  ? -47.595  -19.543 -9.925  1.00 61.21  ? 27  PHE b CD1   1 
ATOM   7593  C  CD2   . PHE M  2  27  ? -46.775  -18.389 -11.896 1.00 61.39  ? 27  PHE b CD2   1 
ATOM   7594  C  CE1   . PHE M  2  27  ? -46.283  -19.749 -9.531  1.00 64.25  ? 27  PHE b CE1   1 
ATOM   7595  C  CE2   . PHE M  2  27  ? -45.470  -18.635 -11.513 1.00 60.56  ? 27  PHE b CE2   1 
ATOM   7596  C  CZ    . PHE M  2  27  ? -45.210  -19.275 -10.312 1.00 61.19  ? 27  PHE b CZ    1 
ATOM   7597  N  N     . ILE M  2  28  ? -52.125  -17.272 -10.094 1.00 52.27  ? 28  ILE b N     1 
ATOM   7598  C  CA    . ILE M  2  28  ? -53.094  -16.261 -10.497 1.00 50.78  ? 28  ILE b CA    1 
ATOM   7599  C  C     . ILE M  2  28  ? -52.461  -14.870 -10.531 1.00 51.95  ? 28  ILE b C     1 
ATOM   7600  O  O     . ILE M  2  28  ? -51.788  -14.435 -9.591  1.00 47.46  ? 28  ILE b O     1 
ATOM   7601  C  CB    . ILE M  2  28  ? -54.275  -16.242 -9.546  1.00 49.05  ? 28  ILE b CB    1 
ATOM   7602  C  CG1   . ILE M  2  28  ? -54.780  -17.667 -9.367  1.00 48.34  ? 28  ILE b CG1   1 
ATOM   7603  C  CG2   . ILE M  2  28  ? -55.339  -15.437 -10.221 1.00 52.88  ? 28  ILE b CG2   1 
ATOM   7604  C  CD1   . ILE M  2  28  ? -55.992  -17.803 -8.483  1.00 49.08  ? 28  ILE b CD1   1 
ATOM   7605  N  N     . GLY M  2  29  ? -52.715  -14.176 -11.623 1.00 56.88  ? 29  GLY b N     1 
ATOM   7606  C  CA    . GLY M  2  29  ? -51.994  -12.943 -11.891 1.00 64.45  ? 29  GLY b CA    1 
ATOM   7607  C  C     . GLY M  2  29  ? -52.590  -12.138 -13.024 1.00 68.16  ? 29  GLY b C     1 
ATOM   7608  O  O     . GLY M  2  29  ? -53.287  -12.649 -13.898 1.00 73.59  ? 29  GLY b O     1 
ATOM   7609  N  N     . THR M  2  30  ? -52.280  -10.854 -13.039 1.00 70.31  ? 30  THR b N     1 
ATOM   7610  C  CA    . THR M  2  30  ? -52.778  -9.987  -14.088 1.00 70.42  ? 30  THR b CA    1 
ATOM   7611  C  C     . THR M  2  30  ? -51.894  -10.196 -15.314 1.00 64.22  ? 30  THR b C     1 
ATOM   7612  O  O     . THR M  2  30  ? -50.688  -10.064 -15.264 1.00 62.71  ? 30  THR b O     1 
ATOM   7613  C  CB    . THR M  2  30  ? -52.874  -8.535  -13.613 1.00 74.68  ? 30  THR b CB    1 
ATOM   7614  O  OG1   . THR M  2  30  ? -53.669  -8.488  -12.415 1.00 78.66  ? 30  THR b OG1   1 
ATOM   7615  C  CG2   . THR M  2  30  ? -53.512  -7.697  -14.703 1.00 82.83  ? 30  THR b CG2   1 
ATOM   7616  N  N     . PHE M  2  31  ? -52.539  -10.516 -16.413 1.00 59.65  ? 31  PHE b N     1 
ATOM   7617  C  CA    . PHE M  2  31  ? -51.879  -11.107 -17.549 1.00 59.71  ? 31  PHE b CA    1 
ATOM   7618  C  C     . PHE M  2  31  ? -51.379  -9.972  -18.426 1.00 60.27  ? 31  PHE b C     1 
ATOM   7619  O  O     . PHE M  2  31  ? -52.124  -9.413  -19.196 1.00 63.72  ? 31  PHE b O     1 
ATOM   7620  C  CB    . PHE M  2  31  ? -52.862  -12.065 -18.263 1.00 59.50  ? 31  PHE b CB    1 
ATOM   7621  C  CG    . PHE M  2  31  ? -52.379  -12.620 -19.583 1.00 57.68  ? 31  PHE b CG    1 
ATOM   7622  C  CD1   . PHE M  2  31  ? -51.029  -12.921 -19.813 1.00 57.78  ? 31  PHE b CD1   1 
ATOM   7623  C  CD2   . PHE M  2  31  ? -53.292  -12.918 -20.578 1.00 58.76  ? 31  PHE b CD2   1 
ATOM   7624  C  CE1   . PHE M  2  31  ? -50.607  -13.420 -21.029 1.00 60.26  ? 31  PHE b CE1   1 
ATOM   7625  C  CE2   . PHE M  2  31  ? -52.890  -13.391 -21.812 1.00 60.37  ? 31  PHE b CE2   1 
ATOM   7626  C  CZ    . PHE M  2  31  ? -51.548  -13.667 -22.033 1.00 61.59  ? 31  PHE b CZ    1 
ATOM   7627  N  N     . LYS M  2  32  ? -50.133  -9.596  -18.296 1.00 63.68  ? 32  LYS b N     1 
ATOM   7628  C  CA    . LYS M  2  32  ? -49.645  -8.425  -18.986 1.00 71.74  ? 32  LYS b CA    1 
ATOM   7629  C  C     . LYS M  2  32  ? -49.037  -8.702  -20.332 1.00 69.26  ? 32  LYS b C     1 
ATOM   7630  O  O     . LYS M  2  32  ? -49.046  -7.810  -21.159 1.00 78.55  ? 32  LYS b O     1 
ATOM   7631  C  CB    . LYS M  2  32  ? -48.628  -7.674  -18.113 1.00 86.08  ? 32  LYS b CB    1 
ATOM   7632  C  CG    . LYS M  2  32  ? -49.199  -7.124  -16.788 1.00 98.24  ? 32  LYS b CG    1 
ATOM   7633  C  CD    . LYS M  2  32  ? -50.353  -6.132  -16.932 1.00 98.37  ? 32  LYS b CD    1 
ATOM   7634  C  CE    . LYS M  2  32  ? -49.908  -4.913  -17.720 1.00 106.43 ? 32  LYS b CE    1 
ATOM   7635  N  NZ    . LYS M  2  32  ? -50.952  -3.882  -17.618 1.00 113.22 ? 32  LYS b NZ    1 
ATOM   7636  N  N     . ALA M  2  33  ? -48.436  -9.860  -20.554 1.00 66.65  ? 33  ALA b N     1 
ATOM   7637  C  CA    . ALA M  2  33  ? -47.729  -10.097 -21.819 1.00 66.69  ? 33  ALA b CA    1 
ATOM   7638  C  C     . ALA M  2  33  ? -47.357  -11.539 -22.075 1.00 67.78  ? 33  ALA b C     1 
ATOM   7639  O  O     . ALA M  2  33  ? -47.194  -12.338 -21.141 1.00 82.93  ? 33  ALA b O     1 
ATOM   7640  C  CB    . ALA M  2  33  ? -46.492  -9.221  -21.959 1.00 64.92  ? 33  ALA b CB    1 
ATOM   7641  N  N     . PHE M  2  34  ? -47.221  -11.859 -23.356 1.00 63.25  ? 34  PHE b N     1 
ATOM   7642  C  CA    . PHE M  2  34  ? -46.814  -13.193 -23.791 1.00 58.18  ? 34  PHE b CA    1 
ATOM   7643  C  C     . PHE M  2  34  ? -45.979  -13.209 -25.048 1.00 50.39  ? 34  PHE b C     1 
ATOM   7644  O  O     . PHE M  2  34  ? -45.666  -12.134 -25.550 1.00 52.88  ? 34  PHE b O     1 
ATOM   7645  C  CB    . PHE M  2  34  ? -48.046  -14.056 -23.932 1.00 57.09  ? 34  PHE b CB    1 
ATOM   7646  C  CG    . PHE M  2  34  ? -48.852  -13.733 -25.105 1.00 57.85  ? 34  PHE b CG    1 
ATOM   7647  C  CD1   . PHE M  2  34  ? -48.574  -14.283 -26.324 1.00 59.60  ? 34  PHE b CD1   1 
ATOM   7648  C  CD2   . PHE M  2  34  ? -49.920  -12.885 -24.967 1.00 59.75  ? 34  PHE b CD2   1 
ATOM   7649  C  CE1   . PHE M  2  34  ? -49.369  -13.972 -27.402 1.00 64.59  ? 34  PHE b CE1   1 
ATOM   7650  C  CE2   . PHE M  2  34  ? -50.737  -12.585 -26.046 1.00 60.38  ? 34  PHE b CE2   1 
ATOM   7651  C  CZ    . PHE M  2  34  ? -50.459  -13.120 -27.269 1.00 60.42  ? 34  PHE b CZ    1 
ATOM   7652  N  N     . ASP M  2  35  ? -45.600  -14.389 -25.481 1.00 45.86  ? 35  ASP b N     1 
ATOM   7653  C  CA    . ASP M  2  35  ? -44.803  -14.544 -26.650 1.00 53.68  ? 35  ASP b CA    1 
ATOM   7654  C  C     . ASP M  2  35  ? -44.966  -15.903 -27.312 1.00 56.85  ? 35  ASP b C     1 
ATOM   7655  O  O     . ASP M  2  35  ? -45.788  -16.673 -26.874 1.00 66.12  ? 35  ASP b O     1 
ATOM   7656  C  CB    . ASP M  2  35  ? -43.320  -14.258 -26.359 1.00 59.16  ? 35  ASP b CB    1 
ATOM   7657  C  CG    . ASP M  2  35  ? -42.675  -15.218 -25.395 1.00 66.43  ? 35  ASP b CG    1 
ATOM   7658  O  OD1   . ASP M  2  35  ? -43.158  -16.391 -25.285 1.00 76.53  ? 35  ASP b OD1   1 
ATOM   7659  O  OD2   . ASP M  2  35  ? -41.651  -14.800 -24.756 1.00 68.78  ? 35  ASP b OD2   1 
ATOM   7660  N  N     . LYS M  2  36  ? -44.199  -16.216 -28.359 1.00 57.84  ? 36  LYS b N     1 
ATOM   7661  C  CA    . LYS M  2  36  ? -44.422  -17.433 -29.122 1.00 53.62  ? 36  LYS b CA    1 
ATOM   7662  C  C     . LYS M  2  36  ? -44.173  -18.663 -28.306 1.00 55.50  ? 36  LYS b C     1 
ATOM   7663  O  O     . LYS M  2  36  ? -44.625  -19.746 -28.689 1.00 53.92  ? 36  LYS b O     1 
ATOM   7664  C  CB    . LYS M  2  36  ? -43.539  -17.454 -30.351 1.00 58.48  ? 36  LYS b CB    1 
ATOM   7665  C  CG    . LYS M  2  36  ? -42.046  -17.492 -30.056 1.00 65.30  ? 36  LYS b CG    1 
ATOM   7666  C  CD    . LYS M  2  36  ? -41.200  -17.342 -31.297 1.00 72.98  ? 36  LYS b CD    1 
ATOM   7667  C  CE    . LYS M  2  36  ? -39.784  -16.883 -30.974 1.00 82.72  ? 36  LYS b CE    1 
ATOM   7668  N  NZ    . LYS M  2  36  ? -38.858  -17.246 -32.089 1.00 90.36  ? 36  LYS b NZ    1 
ATOM   7669  N  N     . HIS M  2  37  ? -43.441  -18.520 -27.199 1.00 53.99  ? 37  HIS b N     1 
ATOM   7670  C  CA    . HIS M  2  37  ? -43.278  -19.667 -26.310 1.00 56.91  ? 37  HIS b CA    1 
ATOM   7671  C  C     . HIS M  2  37  ? -44.407  -19.869 -25.306 1.00 60.60  ? 37  HIS b C     1 
ATOM   7672  O  O     . HIS M  2  37  ? -44.547  -20.904 -24.700 1.00 63.39  ? 37  HIS b O     1 
ATOM   7673  C  CB    . HIS M  2  37  ? -41.961  -19.512 -25.586 1.00 57.62  ? 37  HIS b CB    1 
ATOM   7674  C  CG    . HIS M  2  37  ? -40.805  -19.365 -26.515 1.00 54.36  ? 37  HIS b CG    1 
ATOM   7675  N  ND1   . HIS M  2  37  ? -40.407  -20.385 -27.351 1.00 55.57  ? 37  HIS b ND1   1 
ATOM   7676  C  CD2   . HIS M  2  37  ? -39.997  -18.318 -26.773 1.00 49.69  ? 37  HIS b CD2   1 
ATOM   7677  C  CE1   . HIS M  2  37  ? -39.375  -19.975 -28.064 1.00 53.32  ? 37  HIS b CE1   1 
ATOM   7678  N  NE2   . HIS M  2  37  ? -39.092  -18.734 -27.710 1.00 50.15  ? 37  HIS b NE2   1 
ATOM   7679  N  N     . MET M  2  38  ? -45.209  -18.839 -25.125 1.00 66.39  ? 38  MET b N     1 
ATOM   7680  C  CA    . MET M  2  38  ? -46.167  -18.707 -24.055 1.00 67.17  ? 38  MET b CA    1 
ATOM   7681  C  C     . MET M  2  38  ? -45.464  -18.461 -22.751 1.00 59.80  ? 38  MET b C     1 
ATOM   7682  O  O     . MET M  2  38  ? -46.026  -18.757 -21.726 1.00 63.78  ? 38  MET b O     1 
ATOM   7683  C  CB    . MET M  2  38  ? -47.156  -19.858 -24.015 1.00 76.27  ? 38  MET b CB    1 
ATOM   7684  C  CG    . MET M  2  38  ? -48.088  -19.783 -25.200 1.00 91.72  ? 38  MET b CG    1 
ATOM   7685  S  SD    . MET M  2  38  ? -49.725  -19.246 -24.610 1.00 125.02 ? 38  MET b SD    1 
ATOM   7686  C  CE    . MET M  2  38  ? -50.662  -20.810 -24.484 1.00 110.40 ? 38  MET b CE    1 
ATOM   7687  N  N     . ASN M  2  39  ? -44.276  -17.885 -22.779 1.00 51.44  ? 39  ASN b N     1 
ATOM   7688  C  CA    . ASN M  2  39  ? -43.770  -17.241 -21.602 1.00 51.30  ? 39  ASN b CA    1 
ATOM   7689  C  C     . ASN M  2  39  ? -44.818  -16.254 -21.203 1.00 51.17  ? 39  ASN b C     1 
ATOM   7690  O  O     . ASN M  2  39  ? -45.419  -15.622 -22.053 1.00 56.56  ? 39  ASN b O     1 
ATOM   7691  C  CB    . ASN M  2  39  ? -42.474  -16.452 -21.867 1.00 54.21  ? 39  ASN b CB    1 
ATOM   7692  C  CG    . ASN M  2  39  ? -41.260  -17.341 -22.167 1.00 55.00  ? 39  ASN b CG    1 
ATOM   7693  O  OD1   . ASN M  2  39  ? -41.057  -18.347 -21.502 1.00 57.52  ? 39  ASN b OD1   1 
ATOM   7694  N  ND2   . ASN M  2  39  ? -40.449  -16.966 -23.156 1.00 51.67  ? 39  ASN b ND2   1 
ATOM   7695  N  N     . LEU M  2  40  ? -45.033  -16.057 -19.922 1.00 53.81  ? 40  LEU b N     1 
ATOM   7696  C  CA    . LEU M  2  40  ? -46.016  -15.067 -19.455 1.00 53.99  ? 40  LEU b CA    1 
ATOM   7697  C  C     . LEU M  2  40  ? -45.386  -13.970 -18.644 1.00 51.14  ? 40  LEU b C     1 
ATOM   7698  O  O     . LEU M  2  40  ? -44.321  -14.156 -18.031 1.00 56.64  ? 40  LEU b O     1 
ATOM   7699  C  CB    . LEU M  2  40  ? -47.098  -15.776 -18.636 1.00 56.39  ? 40  LEU b CB    1 
ATOM   7700  C  CG    . LEU M  2  40  ? -47.834  -16.960 -19.315 1.00 55.50  ? 40  LEU b CG    1 
ATOM   7701  C  CD1   . LEU M  2  40  ? -48.906  -17.534 -18.384 1.00 54.24  ? 40  LEU b CD1   1 
ATOM   7702  C  CD2   . LEU M  2  40  ? -48.435  -16.446 -20.595 1.00 54.98  ? 40  LEU b CD2   1 
ATOM   7703  N  N     . ILE M  2  41  ? -46.090  -12.860 -18.565 1.00 48.36  ? 41  ILE b N     1 
ATOM   7704  C  CA    . ILE M  2  41  ? -45.810  -11.838 -17.571 1.00 49.65  ? 41  ILE b CA    1 
ATOM   7705  C  C     . ILE M  2  41  ? -47.071  -11.676 -16.753 1.00 52.82  ? 41  ILE b C     1 
ATOM   7706  O  O     . ILE M  2  41  ? -48.108  -11.337 -17.296 1.00 55.64  ? 41  ILE b O     1 
ATOM   7707  C  CB    . ILE M  2  41  ? -45.419  -10.508 -18.200 1.00 46.53  ? 41  ILE b CB    1 
ATOM   7708  C  CG1   . ILE M  2  41  ? -44.137  -10.610 -18.995 1.00 47.56  ? 41  ILE b CG1   1 
ATOM   7709  C  CG2   . ILE M  2  41  ? -45.187  -9.485  -17.135 1.00 48.03  ? 41  ILE b CG2   1 
ATOM   7710  C  CD1   . ILE M  2  41  ? -42.871  -10.831 -18.223 1.00 48.43  ? 41  ILE b CD1   1 
ATOM   7711  N  N     . LEU M  2  42  ? -46.977  -11.891 -15.453 1.00 57.89  ? 42  LEU b N     1 
ATOM   7712  C  CA    . LEU M  2  42  ? -48.119  -11.791 -14.568 1.00 62.66  ? 42  LEU b CA    1 
ATOM   7713  C  C     . LEU M  2  42  ? -47.818  -10.740 -13.534 1.00 67.88  ? 42  LEU b C     1 
ATOM   7714  O  O     . LEU M  2  42  ? -46.749  -10.779 -12.910 1.00 77.53  ? 42  LEU b O     1 
ATOM   7715  C  CB    . LEU M  2  42  ? -48.382  -13.143 -13.920 1.00 63.40  ? 42  LEU b CB    1 
ATOM   7716  C  CG    . LEU M  2  42  ? -48.727  -14.230 -14.924 1.00 66.80  ? 42  LEU b CG    1 
ATOM   7717  C  CD1   . LEU M  2  42  ? -49.028  -15.542 -14.234 1.00 75.38  ? 42  LEU b CD1   1 
ATOM   7718  C  CD2   . LEU M  2  42  ? -49.936  -13.869 -15.726 1.00 70.16  ? 42  LEU b CD2   1 
ATOM   7719  N  N     . CYS M  2  43  ? -48.778  -9.877  -13.272 1.00 69.95  ? 43  CYS b N     1 
ATOM   7720  C  CA    . CYS M  2  43  ? -48.624  -8.834  -12.269 1.00 77.35  ? 43  CYS b CA    1 
ATOM   7721  C  C     . CYS M  2  43  ? -49.303  -9.217  -11.014 1.00 77.36  ? 43  CYS b C     1 
ATOM   7722  O  O     . CYS M  2  43  ? -50.312  -9.932  -11.028 1.00 83.72  ? 43  CYS b O     1 
ATOM   7723  C  CB    . CYS M  2  43  ? -49.294  -7.564  -12.726 1.00 85.90  ? 43  CYS b CB    1 
ATOM   7724  S  SG    . CYS M  2  43  ? -48.087  -6.531  -13.507 1.00 120.63 ? 43  CYS b SG    1 
ATOM   7725  N  N     . ASP M  2  44  ? -48.793  -8.707  -9.907  1.00 83.30  ? 44  ASP b N     1 
ATOM   7726  C  CA    . ASP M  2  44  ? -49.447  -8.967  -8.615  1.00 90.56  ? 44  ASP b CA    1 
ATOM   7727  C  C     . ASP M  2  44  ? -49.810  -10.461 -8.509  1.00 85.03  ? 44  ASP b C     1 
ATOM   7728  O  O     . ASP M  2  44  ? -50.917  -10.823 -8.095  1.00 89.57  ? 44  ASP b O     1 
ATOM   7729  C  CB    . ASP M  2  44  ? -50.712  -8.108  -8.468  1.00 96.05  ? 44  ASP b CB    1 
ATOM   7730  C  CG    . ASP M  2  44  ? -50.482  -6.674  -8.882  1.00 105.45 ? 44  ASP b CG    1 
ATOM   7731  O  OD1   . ASP M  2  44  ? -49.765  -5.974  -8.139  1.00 98.41  ? 44  ASP b OD1   1 
ATOM   7732  O  OD2   . ASP M  2  44  ? -51.015  -6.287  -9.958  1.00 121.14 ? 44  ASP b OD2   1 
ATOM   7733  N  N     . CYS M  2  45  ? -48.872  -11.311 -8.922  1.00 74.21  ? 45  CYS b N     1 
ATOM   7734  C  CA    . CYS M  2  45  ? -49.134  -12.718 -9.117  1.00 67.06  ? 45  CYS b CA    1 
ATOM   7735  C  C     . CYS M  2  45  ? -49.036  -13.395 -7.792  1.00 62.78  ? 45  CYS b C     1 
ATOM   7736  O  O     . CYS M  2  45  ? -48.143  -13.143 -6.992  1.00 59.60  ? 45  CYS b O     1 
ATOM   7737  C  CB    . CYS M  2  45  ? -48.107  -13.287 -10.073 1.00 73.07  ? 45  CYS b CB    1 
ATOM   7738  S  SG    . CYS M  2  45  ? -48.282  -15.043 -10.334 1.00 83.23  ? 45  CYS b SG    1 
ATOM   7739  N  N     . ASP M  2  46  ? -50.008  -14.240 -7.543  1.00 66.72  ? 46  ASP b N     1 
ATOM   7740  C  CA    . ASP M  2  46  ? -50.094  -14.997 -6.292  1.00 71.24  ? 46  ASP b CA    1 
ATOM   7741  C  C     . ASP M  2  46  ? -49.982  -16.463 -6.702  1.00 67.57  ? 46  ASP b C     1 
ATOM   7742  O  O     . ASP M  2  46  ? -50.532  -16.877 -7.728  1.00 70.92  ? 46  ASP b O     1 
ATOM   7743  C  CB    . ASP M  2  46  ? -51.431  -14.710 -5.563  1.00 77.31  ? 46  ASP b CB    1 
ATOM   7744  C  CG    . ASP M  2  46  ? -51.501  -13.276 -4.979  1.00 84.74  ? 46  ASP b CG    1 
ATOM   7745  O  OD1   . ASP M  2  46  ? -50.821  -12.355 -5.478  1.00 93.42  ? 46  ASP b OD1   1 
ATOM   7746  O  OD2   . ASP M  2  46  ? -52.266  -13.009 -4.044  1.00 84.98  ? 46  ASP b OD2   1 
ATOM   7747  N  N     . GLU M  2  47  ? -49.298  -17.260 -5.896  1.00 64.01  ? 47  GLU b N     1 
ATOM   7748  C  CA    . GLU M  2  47  ? -49.136  -18.689 -6.156  1.00 58.18  ? 47  GLU b CA    1 
ATOM   7749  C  C     . GLU M  2  47  ? -49.975  -19.426 -5.170  1.00 52.49  ? 47  GLU b C     1 
ATOM   7750  O  O     . GLU M  2  47  ? -49.893  -19.125 -4.012  1.00 51.14  ? 47  GLU b O     1 
ATOM   7751  C  CB    . GLU M  2  47  ? -47.692  -19.093 -5.991  1.00 57.80  ? 47  GLU b CB    1 
ATOM   7752  C  CG    . GLU M  2  47  ? -47.485  -20.549 -5.693  1.00 61.86  ? 47  GLU b CG    1 
ATOM   7753  C  CD    . GLU M  2  47  ? -46.031  -20.816 -5.423  1.00 67.86  ? 47  GLU b CD    1 
ATOM   7754  O  OE1   . GLU M  2  47  ? -45.266  -19.875 -5.671  1.00 83.58  ? 47  GLU b OE1   1 
ATOM   7755  O  OE2   . GLU M  2  47  ? -45.598  -21.892 -4.975  1.00 65.27  ? 47  GLU b OE2   1 
ATOM   7756  N  N     . PHE M  2  48  ? -50.698  -20.428 -5.626  1.00 50.68  ? 48  PHE b N     1 
ATOM   7757  C  CA    . PHE M  2  48  ? -51.451  -21.283 -4.736  1.00 53.90  ? 48  PHE b CA    1 
ATOM   7758  C  C     . PHE M  2  48  ? -51.011  -22.716 -4.928  1.00 52.87  ? 48  PHE b C     1 
ATOM   7759  O  O     . PHE M  2  48  ? -50.558  -23.066 -6.035  1.00 49.41  ? 48  PHE b O     1 
ATOM   7760  C  CB    . PHE M  2  48  ? -52.963  -21.157 -5.010  1.00 58.95  ? 48  PHE b CB    1 
ATOM   7761  C  CG    . PHE M  2  48  ? -53.497  -19.770 -4.863  1.00 60.89  ? 48  PHE b CG    1 
ATOM   7762  C  CD1   . PHE M  2  48  ? -53.243  -18.822 -5.823  1.00 64.53  ? 48  PHE b CD1   1 
ATOM   7763  C  CD2   . PHE M  2  48  ? -54.153  -19.390 -3.722  1.00 61.47  ? 48  PHE b CD2   1 
ATOM   7764  C  CE1   . PHE M  2  48  ? -53.652  -17.507 -5.652  1.00 67.91  ? 48  PHE b CE1   1 
ATOM   7765  C  CE2   . PHE M  2  48  ? -54.532  -18.081 -3.525  1.00 65.33  ? 48  PHE b CE2   1 
ATOM   7766  C  CZ    . PHE M  2  48  ? -54.312  -17.136 -4.504  1.00 67.47  ? 48  PHE b CZ    1 
ATOM   7767  N  N     . ARG M  2  49  ? -51.190  -23.536 -3.890  1.00 53.32  ? 49  ARG b N     1 
ATOM   7768  C  CA    . ARG M  2  49  ? -50.935  -24.957 -4.036  1.00 60.03  ? 49  ARG b CA    1 
ATOM   7769  C  C     . ARG M  2  49  ? -51.696  -25.831 -3.098  1.00 64.02  ? 49  ARG b C     1 
ATOM   7770  O  O     . ARG M  2  49  ? -52.019  -25.384 -2.039  1.00 60.68  ? 49  ARG b O     1 
ATOM   7771  C  CB    . ARG M  2  49  ? -49.461  -25.193 -3.801  1.00 62.49  ? 49  ARG b CB    1 
ATOM   7772  C  CG    . ARG M  2  49  ? -48.957  -24.705 -2.475  1.00 63.50  ? 49  ARG b CG    1 
ATOM   7773  C  CD    . ARG M  2  49  ? -47.551  -25.188 -2.217  1.00 61.57  ? 49  ARG b CD    1 
ATOM   7774  N  NE    . ARG M  2  49  ? -46.602  -24.399 -2.962  1.00 60.23  ? 49  ARG b NE    1 
ATOM   7775  C  CZ    . ARG M  2  49  ? -45.318  -24.684 -3.018  1.00 65.17  ? 49  ARG b CZ    1 
ATOM   7776  N  NH1   . ARG M  2  49  ? -44.836  -25.722 -2.347  1.00 77.25  ? 49  ARG b NH1   1 
ATOM   7777  N  NH2   . ARG M  2  49  ? -44.495  -23.954 -3.749  1.00 65.52  ? 49  ARG b NH2   1 
ATOM   7778  N  N     . LYS M  2  50  ? -51.991  -27.066 -3.483  1.00 78.83  ? 50  LYS b N     1 
ATOM   7779  C  CA    . LYS M  2  50  ? -52.827  -27.944 -2.665  1.00 89.98  ? 50  LYS b CA    1 
ATOM   7780  C  C     . LYS M  2  50  ? -51.872  -28.861 -1.964  1.00 105.16 ? 50  LYS b C     1 
ATOM   7781  O  O     . LYS M  2  50  ? -51.010  -29.475 -2.602  1.00 117.37 ? 50  LYS b O     1 
ATOM   7782  C  CB    . LYS M  2  50  ? -53.807  -28.743 -3.512  1.00 101.63 ? 50  LYS b CB    1 
ATOM   7783  C  CG    . LYS M  2  50  ? -54.657  -27.910 -4.479  1.00 119.06 ? 50  LYS b CG    1 
ATOM   7784  C  CD    . LYS M  2  50  ? -55.318  -26.668 -3.887  1.00 132.60 ? 50  LYS b CD    1 
ATOM   7785  C  CE    . LYS M  2  50  ? -56.243  -27.012 -2.720  1.00 145.98 ? 50  LYS b CE    1 
ATOM   7786  N  NZ    . LYS M  2  50  ? -57.526  -27.612 -3.166  1.00 151.52 ? 50  LYS b NZ    1 
ATOM   7787  N  N     . ILE M  2  51  ? -52.011  -28.966 -0.647  1.00 119.29 ? 51  ILE b N     1 
ATOM   7788  C  CA    . ILE M  2  51  ? -51.146  -29.833 0.154   1.00 122.25 ? 51  ILE b CA    1 
ATOM   7789  C  C     . ILE M  2  51  ? -51.990  -30.978 0.673   1.00 128.50 ? 51  ILE b C     1 
ATOM   7790  O  O     . ILE M  2  51  ? -52.879  -30.767 1.512   1.00 125.63 ? 51  ILE b O     1 
ATOM   7791  C  CB    . ILE M  2  51  ? -50.487  -29.084 1.324   1.00 123.34 ? 51  ILE b CB    1 
ATOM   7792  C  CG1   . ILE M  2  51  ? -49.700  -27.882 0.790   1.00 131.92 ? 51  ILE b CG1   1 
ATOM   7793  C  CG2   . ILE M  2  51  ? -49.577  -30.021 2.109   1.00 123.14 ? 51  ILE b CG2   1 
ATOM   7794  C  CD1   . ILE M  2  51  ? -48.710  -28.187 -0.331  1.00 137.34 ? 51  ILE b CD1   1 
ATOM   7795  N  N     . LYS M  2  52  ? -51.689  -32.197 0.229   1.00 137.92 ? 52  LYS b N     1 
ATOM   7796  C  CA    . LYS M  2  52  ? -52.616  -33.302 0.541   1.00 151.05 ? 52  LYS b CA    1 
ATOM   7797  C  C     . LYS M  2  52  ? -52.734  -33.416 2.083   1.00 170.57 ? 52  LYS b C     1 
ATOM   7798  O  O     . LYS M  2  52  ? -51.783  -33.069 2.822   1.00 167.35 ? 52  LYS b O     1 
ATOM   7799  C  CB    . LYS M  2  52  ? -52.395  -34.640 -0.185  1.00 152.14 ? 52  LYS b CB    1 
ATOM   7800  C  CG    . LYS M  2  52  ? -51.150  -35.405 0.242   1.00 151.93 ? 52  LYS b CG    1 
ATOM   7801  C  CD    . LYS M  2  52  ? -50.630  -36.559 -0.622  1.00 150.36 ? 52  LYS b CD    1 
ATOM   7802  C  CE    . LYS M  2  52  ? -49.791  -36.105 -1.806  1.00 143.35 ? 52  LYS b CE    1 
ATOM   7803  N  NZ    . LYS M  2  52  ? -48.335  -36.251 -1.557  1.00 133.54 ? 52  LYS b NZ    1 
ATOM   7804  N  N     . PRO M  2  53  ? -53.937  -33.770 2.587   1.00 185.65 ? 53  PRO b N     1 
ATOM   7805  C  CA    . PRO M  2  53  ? -54.285  -33.347 3.956   1.00 187.08 ? 53  PRO b CA    1 
ATOM   7806  C  C     . PRO M  2  53  ? -53.769  -34.269 5.058   1.00 189.33 ? 53  PRO b C     1 
ATOM   7807  O  O     . PRO M  2  53  ? -54.256  -35.389 5.203   1.00 192.79 ? 53  PRO b O     1 
ATOM   7808  C  CB    . PRO M  2  53  ? -55.818  -33.351 3.961   1.00 181.18 ? 53  PRO b CB    1 
ATOM   7809  C  CG    . PRO M  2  53  ? -56.212  -34.242 2.826   1.00 177.80 ? 53  PRO b CG    1 
ATOM   7810  C  CD    . PRO M  2  53  ? -55.035  -34.524 1.959   1.00 178.91 ? 53  PRO b CD    1 
ATOM   7811  N  N     . GLU M  2  60  ? -57.789  -30.767 2.043   1.00 120.70 ? 60  GLU b N     1 
ATOM   7812  C  CA    . GLU M  2  60  ? -56.441  -30.185 2.022   1.00 130.15 ? 60  GLU b CA    1 
ATOM   7813  C  C     . GLU M  2  60  ? -56.218  -28.739 2.511   1.00 133.63 ? 60  GLU b C     1 
ATOM   7814  O  O     . GLU M  2  60  ? -57.133  -27.916 2.732   1.00 132.06 ? 60  GLU b O     1 
ATOM   7815  C  CB    . GLU M  2  60  ? -55.779  -30.278 0.620   1.00 136.29 ? 60  GLU b CB    1 
ATOM   7816  C  CG    . GLU M  2  60  ? -56.026  -31.511 -0.236  1.00 135.51 ? 60  GLU b CG    1 
ATOM   7817  C  CD    . GLU M  2  60  ? -57.294  -31.392 -1.047  1.00 137.05 ? 60  GLU b CD    1 
ATOM   7818  O  OE1   . GLU M  2  60  ? -58.072  -30.424 -0.939  1.00 142.90 ? 60  GLU b OE1   1 
ATOM   7819  O  OE2   . GLU M  2  60  ? -57.587  -32.354 -1.765  1.00 150.52 ? 60  GLU b OE2   1 
ATOM   7820  N  N     . ARG M  2  61  ? -54.928  -28.430 2.614   1.00 137.10 ? 61  ARG b N     1 
ATOM   7821  C  CA    . ARG M  2  61  ? -54.483  -27.051 2.762   1.00 138.28 ? 61  ARG b CA    1 
ATOM   7822  C  C     . ARG M  2  61  ? -54.390  -26.461 1.345   1.00 125.26 ? 61  ARG b C     1 
ATOM   7823  O  O     . ARG M  2  61  ? -53.806  -27.065 0.459   1.00 123.56 ? 61  ARG b O     1 
ATOM   7824  C  CB    . ARG M  2  61  ? -53.128  -26.950 3.483   1.00 141.44 ? 61  ARG b CB    1 
ATOM   7825  C  CG    . ARG M  2  61  ? -53.067  -27.110 5.002   1.00 142.57 ? 61  ARG b CG    1 
ATOM   7826  C  CD    . ARG M  2  61  ? -51.809  -27.879 5.458   1.00 152.16 ? 61  ARG b CD    1 
ATOM   7827  N  NE    . ARG M  2  61  ? -51.984  -29.357 5.594   1.00 154.98 ? 61  ARG b NE    1 
ATOM   7828  C  CZ    . ARG M  2  61  ? -50.986  -30.261 5.665   1.00 143.89 ? 61  ARG b CZ    1 
ATOM   7829  N  NH1   . ARG M  2  61  ? -49.700  -29.881 5.667   1.00 149.13 ? 61  ARG b NH1   1 
ATOM   7830  N  NH2   . ARG M  2  61  ? -51.254  -31.567 5.756   1.00 120.22 ? 61  ARG b NH2   1 
ATOM   7831  N  N     . GLU M  2  62  ? -54.949  -25.274 1.161   1.00 111.87 ? 62  GLU b N     1 
ATOM   7832  C  CA    . GLU M  2  62  ? -54.514  -24.331 0.141   1.00 100.07 ? 62  GLU b CA    1 
ATOM   7833  C  C     . GLU M  2  62  ? -53.442  -23.424 0.790   1.00 83.97  ? 62  GLU b C     1 
ATOM   7834  O  O     . GLU M  2  62  ? -53.643  -22.936 1.896   1.00 87.47  ? 62  GLU b O     1 
ATOM   7835  C  CB    . GLU M  2  62  ? -55.747  -23.576 -0.385  1.00 105.77 ? 62  GLU b CB    1 
ATOM   7836  C  CG    . GLU M  2  62  ? -55.513  -22.681 -1.594  1.00 116.13 ? 62  GLU b CG    1 
ATOM   7837  C  CD    . GLU M  2  62  ? -56.593  -22.728 -2.686  1.00 131.21 ? 62  GLU b CD    1 
ATOM   7838  O  OE1   . GLU M  2  62  ? -57.056  -23.826 -3.047  1.00 126.83 ? 62  GLU b OE1   1 
ATOM   7839  O  OE2   . GLU M  2  62  ? -56.984  -21.672 -3.249  1.00 145.84 ? 62  GLU b OE2   1 
ATOM   7840  N  N     . GLU M  2  63  ? -52.316  -23.213 0.130   1.00 74.83  ? 63  GLU b N     1 
ATOM   7841  C  CA    . GLU M  2  63  ? -51.231  -22.337 0.608   1.00 74.91  ? 63  GLU b CA    1 
ATOM   7842  C  C     . GLU M  2  63  ? -50.880  -21.233 -0.386  1.00 66.01  ? 63  GLU b C     1 
ATOM   7843  O  O     . GLU M  2  63  ? -50.294  -21.465 -1.436  1.00 55.25  ? 63  GLU b O     1 
ATOM   7844  C  CB    . GLU M  2  63  ? -49.940  -23.113 0.810   1.00 87.35  ? 63  GLU b CB    1 
ATOM   7845  C  CG    . GLU M  2  63  ? -49.890  -24.064 1.992   1.00 100.67 ? 63  GLU b CG    1 
ATOM   7846  C  CD    . GLU M  2  63  ? -48.471  -24.218 2.551   1.00 107.42 ? 63  GLU b CD    1 
ATOM   7847  O  OE1   . GLU M  2  63  ? -47.900  -25.332 2.494   1.00 112.23 ? 63  GLU b OE1   1 
ATOM   7848  O  OE2   . GLU M  2  63  ? -47.947  -23.204 3.052   1.00 103.13 ? 63  GLU b OE2   1 
ATOM   7849  N  N     . LYS M  2  64  ? -51.293  -20.013 -0.068  1.00 64.88  ? 64  LYS b N     1 
ATOM   7850  C  CA    . LYS M  2  64  ? -50.970  -18.865 -0.898  1.00 63.67  ? 64  LYS b CA    1 
ATOM   7851  C  C     . LYS M  2  64  ? -49.580  -18.409 -0.579  1.00 64.28  ? 64  LYS b C     1 
ATOM   7852  O  O     . LYS M  2  64  ? -49.048  -18.667 0.477   1.00 73.16  ? 64  LYS b O     1 
ATOM   7853  C  CB    . LYS M  2  64  ? -51.956  -17.726 -0.712  1.00 72.27  ? 64  LYS b CB    1 
ATOM   7854  C  CG    . LYS M  2  64  ? -51.630  -16.501 -1.550  1.00 85.11  ? 64  LYS b CG    1 
ATOM   7855  C  CD    . LYS M  2  64  ? -52.791  -15.528 -1.727  1.00 92.33  ? 64  LYS b CD    1 
ATOM   7856  C  CE    . LYS M  2  64  ? -52.833  -14.562 -0.564  1.00 98.70  ? 64  LYS b CE    1 
ATOM   7857  N  NZ    . LYS M  2  64  ? -54.032  -13.752 -0.839  1.00 109.09 ? 64  LYS b NZ    1 
ATOM   7858  N  N     . ARG M  2  65  ? -48.952  -17.757 -1.530  1.00 63.86  ? 65  ARG b N     1 
ATOM   7859  C  CA    . ARG M  2  65  ? -47.665  -17.184 -1.338  1.00 59.96  ? 65  ARG b CA    1 
ATOM   7860  C  C     . ARG M  2  65  ? -47.567  -16.117 -2.402  1.00 63.00  ? 65  ARG b C     1 
ATOM   7861  O  O     . ARG M  2  65  ? -47.751  -16.395 -3.567  1.00 64.42  ? 65  ARG b O     1 
ATOM   7862  C  CB    . ARG M  2  65  ? -46.695  -18.279 -1.617  1.00 59.68  ? 65  ARG b CB    1 
ATOM   7863  C  CG    . ARG M  2  65  ? -45.292  -17.750 -1.644  1.00 65.61  ? 65  ARG b CG    1 
ATOM   7864  C  CD    . ARG M  2  65  ? -44.281  -18.878 -1.395  1.00 66.22  ? 65  ARG b CD    1 
ATOM   7865  N  NE    . ARG M  2  65  ? -44.106  -19.730 -2.550  1.00 61.96  ? 65  ARG b NE    1 
ATOM   7866  C  CZ    . ARG M  2  65  ? -42.953  -20.283 -2.860  1.00 65.96  ? 65  ARG b CZ    1 
ATOM   7867  N  NH1   . ARG M  2  65  ? -41.919  -20.259 -2.036  1.00 73.03  ? 65  ARG b NH1   1 
ATOM   7868  N  NH2   . ARG M  2  65  ? -42.822  -20.931 -4.003  1.00 72.56  ? 65  ARG b NH2   1 
ATOM   7869  N  N     . VAL M  2  66  ? -47.265  -14.882 -2.019  1.00 71.09  ? 66  VAL b N     1 
ATOM   7870  C  CA    . VAL M  2  66  ? -47.245  -13.785 -2.983  1.00 70.01  ? 66  VAL b CA    1 
ATOM   7871  C  C     . VAL M  2  66  ? -45.916  -13.654 -3.676  1.00 69.29  ? 66  VAL b C     1 
ATOM   7872  O  O     . VAL M  2  66  ? -44.880  -13.676 -3.035  1.00 73.25  ? 66  VAL b O     1 
ATOM   7873  C  CB    . VAL M  2  66  ? -47.562  -12.451 -2.328  1.00 71.85  ? 66  VAL b CB    1 
ATOM   7874  C  CG1   . VAL M  2  66  ? -47.501  -11.332 -3.374  1.00 78.73  ? 66  VAL b CG1   1 
ATOM   7875  C  CG2   . VAL M  2  66  ? -48.964  -12.547 -1.726  1.00 76.16  ? 66  VAL b CG2   1 
ATOM   7876  N  N     . LEU M  2  67  ? -45.964  -13.501 -4.989  1.00 69.30  ? 67  LEU b N     1 
ATOM   7877  C  CA    . LEU M  2  67  ? -44.748  -13.384 -5.797  1.00 68.48  ? 67  LEU b CA    1 
ATOM   7878  C  C     . LEU M  2  67  ? -44.585  -12.020 -6.411  1.00 71.28  ? 67  LEU b C     1 
ATOM   7879  O  O     . LEU M  2  67  ? -43.473  -11.602 -6.617  1.00 76.97  ? 67  LEU b O     1 
ATOM   7880  C  CB    . LEU M  2  67  ? -44.761  -14.414 -6.911  1.00 65.08  ? 67  LEU b CB    1 
ATOM   7881  C  CG    . LEU M  2  67  ? -45.107  -15.863 -6.528  1.00 64.16  ? 67  LEU b CG    1 
ATOM   7882  C  CD1   . LEU M  2  67  ? -45.165  -16.823 -7.715  1.00 62.57  ? 67  LEU b CD1   1 
ATOM   7883  C  CD2   . LEU M  2  67  ? -44.165  -16.397 -5.470  1.00 64.33  ? 67  LEU b CD2   1 
ATOM   7884  N  N     . GLY M  2  68  ? -45.666  -11.313 -6.719  1.00 72.39  ? 68  GLY b N     1 
ATOM   7885  C  CA    . GLY M  2  68  ? -45.539  -9.991  -7.335  1.00 73.44  ? 68  GLY b CA    1 
ATOM   7886  C  C     . GLY M  2  68  ? -45.415  -10.057 -8.848  1.00 72.80  ? 68  GLY b C     1 
ATOM   7887  O  O     . GLY M  2  68  ? -46.271  -10.703 -9.472  1.00 67.96  ? 68  GLY b O     1 
ATOM   7888  N  N     . LEU M  2  69  ? -44.390  -9.422  -9.428  1.00 70.91  ? 69  LEU b N     1 
ATOM   7889  C  CA    . LEU M  2  69  ? -44.249  -9.456  -10.880 1.00 69.09  ? 69  LEU b CA    1 
ATOM   7890  C  C     . LEU M  2  69  ? -43.424  -10.632 -11.348 1.00 64.93  ? 69  LEU b C     1 
ATOM   7891  O  O     . LEU M  2  69  ? -42.218  -10.666 -11.119 1.00 62.70  ? 69  LEU b O     1 
ATOM   7892  C  CB    . LEU M  2  69  ? -43.616  -8.192  -11.428 1.00 73.52  ? 69  LEU b CB    1 
ATOM   7893  C  CG    . LEU M  2  69  ? -43.504  -8.258  -12.957 1.00 77.05  ? 69  LEU b CG    1 
ATOM   7894  C  CD1   . LEU M  2  69  ? -44.836  -7.971  -13.636 1.00 79.24  ? 69  LEU b CD1   1 
ATOM   7895  C  CD2   . LEU M  2  69  ? -42.499  -7.265  -13.490 1.00 77.12  ? 69  LEU b CD2   1 
ATOM   7896  N  N     . VAL M  2  70  ? -44.068  -11.533 -12.089 1.00 60.91  ? 70  VAL b N     1 
ATOM   7897  C  CA    . VAL M  2  70  ? -43.517  -12.845 -12.414 1.00 58.87  ? 70  VAL b CA    1 
ATOM   7898  C  C     . VAL M  2  70  ? -43.363  -13.058 -13.902 1.00 54.00  ? 70  VAL b C     1 
ATOM   7899  O  O     . VAL M  2  70  ? -44.207  -12.610 -14.688 1.00 59.97  ? 70  VAL b O     1 
ATOM   7900  C  CB    . VAL M  2  70  ? -44.499  -13.909 -11.947 1.00 64.62  ? 70  VAL b CB    1 
ATOM   7901  C  CG1   . VAL M  2  70  ? -43.949  -15.286 -12.270 1.00 73.55  ? 70  VAL b CG1   1 
ATOM   7902  C  CG2   . VAL M  2  70  ? -44.711  -13.811 -10.448 1.00 68.86  ? 70  VAL b CG2   1 
ATOM   7903  N  N     . LEU M  2  71  ? -42.305  -13.739 -14.280 1.00 49.15  ? 71  LEU b N     1 
ATOM   7904  C  CA    . LEU M  2  71  ? -42.066  -14.082 -15.670 1.00 48.77  ? 71  LEU b CA    1 
ATOM   7905  C  C     . LEU M  2  71  ? -42.011  -15.559 -15.688 1.00 48.44  ? 71  LEU b C     1 
ATOM   7906  O  O     . LEU M  2  71  ? -41.072  -16.162 -15.178 1.00 51.98  ? 71  LEU b O     1 
ATOM   7907  C  CB    . LEU M  2  71  ? -40.708  -13.549 -16.142 1.00 51.23  ? 71  LEU b CB    1 
ATOM   7908  C  CG    . LEU M  2  71  ? -40.359  -13.660 -17.614 1.00 54.01  ? 71  LEU b CG    1 
ATOM   7909  C  CD1   . LEU M  2  71  ? -38.889  -13.340 -17.814 1.00 54.03  ? 71  LEU b CD1   1 
ATOM   7910  C  CD2   . LEU M  2  71  ? -40.579  -15.045 -18.201 1.00 59.69  ? 71  LEU b CD2   1 
ATOM   7911  N  N     . LEU M  2  72  ? -43.000  -16.160 -16.291 1.00 50.52  ? 72  LEU b N     1 
ATOM   7912  C  CA    . LEU M  2  72  ? -43.119  -17.621 -16.296 1.00 55.82  ? 72  LEU b CA    1 
ATOM   7913  C  C     . LEU M  2  72  ? -42.539  -18.183 -17.587 1.00 53.82  ? 72  LEU b C     1 
ATOM   7914  O  O     . LEU M  2  72  ? -42.995  -17.802 -18.639 1.00 55.57  ? 72  LEU b O     1 
ATOM   7915  C  CB    . LEU M  2  72  ? -44.615  -18.003 -16.177 1.00 57.57  ? 72  LEU b CB    1 
ATOM   7916  C  CG    . LEU M  2  72  ? -44.924  -19.495 -16.212 1.00 60.00  ? 72  LEU b CG    1 
ATOM   7917  C  CD1   . LEU M  2  72  ? -44.287  -20.212 -15.009 1.00 63.65  ? 72  LEU b CD1   1 
ATOM   7918  C  CD2   . LEU M  2  72  ? -46.425  -19.642 -16.227 1.00 59.68  ? 72  LEU b CD2   1 
ATOM   7919  N  N     . ARG M  2  73  ? -41.620  -19.136 -17.518 1.00 53.98  ? 73  ARG b N     1 
ATOM   7920  C  CA    . ARG M  2  73  ? -41.130  -19.780 -18.724 1.00 53.63  ? 73  ARG b CA    1 
ATOM   7921  C  C     . ARG M  2  73  ? -42.200  -20.713 -19.324 1.00 52.99  ? 73  ARG b C     1 
ATOM   7922  O  O     . ARG M  2  73  ? -42.782  -21.537 -18.610 1.00 53.84  ? 73  ARG b O     1 
ATOM   7923  C  CB    . ARG M  2  73  ? -39.831  -20.533 -18.497 1.00 56.38  ? 73  ARG b CB    1 
ATOM   7924  C  CG    . ARG M  2  73  ? -39.080  -20.851 -19.787 1.00 60.43  ? 73  ARG b CG    1 
ATOM   7925  C  CD    . ARG M  2  73  ? -37.854  -21.702 -19.551 1.00 63.49  ? 73  ARG b CD    1 
ATOM   7926  N  NE    . ARG M  2  73  ? -37.313  -22.293 -20.766 1.00 68.85  ? 73  ARG b NE    1 
ATOM   7927  C  CZ    . ARG M  2  73  ? -36.492  -21.656 -21.609 1.00 80.53  ? 73  ARG b CZ    1 
ATOM   7928  N  NH1   . ARG M  2  73  ? -36.133  -20.365 -21.430 1.00 76.20  ? 73  ARG b NH1   1 
ATOM   7929  N  NH2   . ARG M  2  73  ? -36.016  -22.329 -22.667 1.00 84.67  ? 73  ARG b NH2   1 
ATOM   7930  N  N     . GLY M  2  74  ? -42.464  -20.544 -20.624 1.00 50.07  ? 74  GLY b N     1 
ATOM   7931  C  CA    . GLY M  2  74  ? -43.497  -21.242 -21.360 1.00 47.39  ? 74  GLY b CA    1 
ATOM   7932  C  C     . GLY M  2  74  ? -43.528  -22.720 -21.135 1.00 49.08  ? 74  GLY b C     1 
ATOM   7933  O  O     . GLY M  2  74  ? -44.585  -23.279 -20.967 1.00 51.57  ? 74  GLY b O     1 
ATOM   7934  N  N     . GLU M  2  75  ? -42.371  -23.358 -21.115 1.00 54.26  ? 75  GLU b N     1 
ATOM   7935  C  CA    . GLU M  2  75  ? -42.278  -24.799 -20.966 1.00 60.14  ? 75  GLU b CA    1 
ATOM   7936  C  C     . GLU M  2  75  ? -43.050  -25.272 -19.751 1.00 59.56  ? 75  GLU b C     1 
ATOM   7937  O  O     . GLU M  2  75  ? -43.616  -26.356 -19.784 1.00 65.14  ? 75  GLU b O     1 
ATOM   7938  C  CB    . GLU M  2  75  ? -40.807  -25.204 -20.792 1.00 72.92  ? 75  GLU b CB    1 
ATOM   7939  C  CG    . GLU M  2  75  ? -39.946  -25.495 -22.014 1.00 78.55  ? 75  GLU b CG    1 
ATOM   7940  C  CD    . GLU M  2  75  ? -38.461  -25.742 -21.643 1.00 92.62  ? 75  GLU b CD    1 
ATOM   7941  O  OE1   . GLU M  2  75  ? -37.852  -25.123 -20.718 1.00 93.68  ? 75  GLU b OE1   1 
ATOM   7942  O  OE2   . GLU M  2  75  ? -37.862  -26.646 -22.274 1.00 95.77  ? 75  GLU b OE2   1 
ATOM   7943  N  N     . ASN M  2  76  ? -43.065  -24.500 -18.669 1.00 56.25  ? 76  ASN b N     1 
ATOM   7944  C  CA    . ASN M  2  76  ? -43.693  -24.953 -17.443 1.00 61.17  ? 76  ASN b CA    1 
ATOM   7945  C  C     . ASN M  2  76  ? -45.177  -24.679 -17.360 1.00 58.48  ? 76  ASN b C     1 
ATOM   7946  O  O     . ASN M  2  76  ? -45.839  -25.040 -16.384 1.00 71.39  ? 76  ASN b O     1 
ATOM   7947  C  CB    . ASN M  2  76  ? -42.976  -24.353 -16.233 1.00 72.46  ? 76  ASN b CB    1 
ATOM   7948  C  CG    . ASN M  2  76  ? -41.480  -24.644 -16.247 1.00 86.99  ? 76  ASN b CG    1 
ATOM   7949  O  OD1   . ASN M  2  76  ? -40.687  -23.816 -16.708 1.00 94.98  ? 76  ASN b OD1   1 
ATOM   7950  N  ND2   . ASN M  2  76  ? -41.088  -25.819 -15.775 1.00 89.49  ? 76  ASN b ND2   1 
ATOM   7951  N  N     . LEU M  2  77  ? -45.722  -24.020 -18.364 1.00 53.34  ? 77  LEU b N     1 
ATOM   7952  C  CA    . LEU M  2  77  ? -47.131  -23.765 -18.421 1.00 50.29  ? 77  LEU b CA    1 
ATOM   7953  C  C     . LEU M  2  77  ? -47.870  -24.947 -18.966 1.00 45.05  ? 77  LEU b C     1 
ATOM   7954  O  O     . LEU M  2  77  ? -47.434  -25.562 -19.921 1.00 41.87  ? 77  LEU b O     1 
ATOM   7955  C  CB    . LEU M  2  77  ? -47.378  -22.584 -19.365 1.00 54.36  ? 77  LEU b CB    1 
ATOM   7956  C  CG    . LEU M  2  77  ? -48.820  -22.027 -19.394 1.00 59.13  ? 77  LEU b CG    1 
ATOM   7957  C  CD1   . LEU M  2  77  ? -49.437  -21.812 -18.001 1.00 61.90  ? 77  LEU b CD1   1 
ATOM   7958  C  CD2   . LEU M  2  77  ? -48.840  -20.719 -20.180 1.00 56.48  ? 77  LEU b CD2   1 
ATOM   7959  N  N     . VAL M  2  78  ? -49.029  -25.214 -18.393 1.00 44.42  ? 78  VAL b N     1 
ATOM   7960  C  CA    . VAL M  2  78  ? -49.946  -26.211 -18.941 1.00 45.65  ? 78  VAL b CA    1 
ATOM   7961  C  C     . VAL M  2  78  ? -51.161  -25.579 -19.564 1.00 48.46  ? 78  VAL b C     1 
ATOM   7962  O  O     . VAL M  2  78  ? -51.408  -25.780 -20.762 1.00 51.86  ? 78  VAL b O     1 
ATOM   7963  C  CB    . VAL M  2  78  ? -50.469  -27.184 -17.884 1.00 41.52  ? 78  VAL b CB    1 
ATOM   7964  C  CG1   . VAL M  2  78  ? -51.364  -28.214 -18.518 1.00 38.99  ? 78  VAL b CG1   1 
ATOM   7965  C  CG2   . VAL M  2  78  ? -49.297  -27.852 -17.245 1.00 42.07  ? 78  VAL b CG2   1 
ATOM   7966  N  N     . SER M  2  79  ? -51.919  -24.886 -18.715 1.00 47.81  ? 79  SER b N     1 
ATOM   7967  C  CA    . SER M  2  79  ? -53.170  -24.323 -19.109 1.00 48.35  ? 79  SER b CA    1 
ATOM   7968  C  C     . SER M  2  79  ? -53.447  -22.999 -18.403 1.00 52.94  ? 79  SER b C     1 
ATOM   7969  O  O     . SER M  2  79  ? -52.911  -22.765 -17.346 1.00 56.70  ? 79  SER b O     1 
ATOM   7970  C  CB    . SER M  2  79  ? -54.268  -25.330 -18.825 1.00 46.67  ? 79  SER b CB    1 
ATOM   7971  O  OG    . SER M  2  79  ? -54.499  -25.497 -17.435 1.00 45.91  ? 79  SER b OG    1 
ATOM   7972  N  N     . MET M  2  80  ? -54.230  -22.125 -19.027 1.00 54.74  ? 80  MET b N     1 
ATOM   7973  C  CA    . MET M  2  80  ? -54.765  -20.946 -18.398 1.00 56.28  ? 80  MET b CA    1 
ATOM   7974  C  C     . MET M  2  80  ? -56.272  -20.875 -18.698 1.00 58.47  ? 80  MET b C     1 
ATOM   7975  O  O     . MET M  2  80  ? -56.689  -21.040 -19.837 1.00 59.80  ? 80  MET b O     1 
ATOM   7976  C  CB    . MET M  2  80  ? -54.028  -19.660 -18.805 1.00 57.53  ? 80  MET b CB    1 
ATOM   7977  C  CG    . MET M  2  80  ? -52.899  -19.773 -19.845 1.00 65.48  ? 80  MET b CG    1 
ATOM   7978  S  SD    . MET M  2  80  ? -52.240  -18.220 -20.523 1.00 71.03  ? 80  MET b SD    1 
ATOM   7979  C  CE    . MET M  2  80  ? -52.419  -16.959 -19.259 1.00 69.93  ? 80  MET b CE    1 
ATOM   7980  N  N     . THR M  2  81  ? -57.031  -20.467 -17.686 1.00 58.98  ? 81  THR b N     1 
ATOM   7981  C  CA    . THR M  2  81  ? -58.369  -19.951 -17.814 1.00 56.24  ? 81  THR b CA    1 
ATOM   7982  C  C     . THR M  2  81  ? -58.450  -18.607 -17.124 1.00 58.50  ? 81  THR b C     1 
ATOM   7983  O  O     . THR M  2  81  ? -57.571  -18.249 -16.348 1.00 61.44  ? 81  THR b O     1 
ATOM   7984  C  CB    . THR M  2  81  ? -59.346  -20.864 -17.126 1.00 58.01  ? 81  THR b CB    1 
ATOM   7985  O  OG1   . THR M  2  81  ? -60.698  -20.444 -17.371 1.00 65.83  ? 81  THR b OG1   1 
ATOM   7986  C  CG2   . THR M  2  81  ? -59.150  -20.880 -15.601 1.00 60.92  ? 81  THR b CG2   1 
ATOM   7987  N  N     . VAL M  2  82  ? -59.545  -17.893 -17.368 1.00 66.41  ? 82  VAL b N     1 
ATOM   7988  C  CA    . VAL M  2  82  ? -59.778  -16.567 -16.807 1.00 67.44  ? 82  VAL b CA    1 
ATOM   7989  C  C     . VAL M  2  82  ? -60.337  -16.658 -15.420 1.00 63.62  ? 82  VAL b C     1 
ATOM   7990  O  O     . VAL M  2  82  ? -61.277  -17.389 -15.211 1.00 61.92  ? 82  VAL b O     1 
ATOM   7991  C  CB    . VAL M  2  82  ? -60.752  -15.775 -17.651 1.00 73.69  ? 82  VAL b CB    1 
ATOM   7992  C  CG1   . VAL M  2  82  ? -61.125  -14.475 -16.950 1.00 78.91  ? 82  VAL b CG1   1 
ATOM   7993  C  CG2   . VAL M  2  82  ? -60.102  -15.432 -19.001 1.00 82.00  ? 82  VAL b CG2   1 
ATOM   7994  N  N     . GLU M  2  83  ? -59.729  -15.911 -14.509 1.00 62.39  ? 83  GLU b N     1 
ATOM   7995  C  CA    . GLU M  2  83  ? -60.084  -15.953 -13.113 1.00 66.75  ? 83  GLU b CA    1 
ATOM   7996  C  C     . GLU M  2  83  ? -61.069  -14.859 -12.846 1.00 71.76  ? 83  GLU b C     1 
ATOM   7997  O  O     . GLU M  2  83  ? -62.062  -15.080 -12.140 1.00 77.43  ? 83  GLU b O     1 
ATOM   7998  C  CB    . GLU M  2  83  ? -58.849  -15.766 -12.238 1.00 67.35  ? 83  GLU b CB    1 
ATOM   7999  C  CG    . GLU M  2  83  ? -59.107  -15.700 -10.735 1.00 66.54  ? 83  GLU b CG    1 
ATOM   8000  C  CD    . GLU M  2  83  ? -59.430  -17.043 -10.139 1.00 73.01  ? 83  GLU b CD    1 
ATOM   8001  O  OE1   . GLU M  2  83  ? -59.533  -18.068 -10.882 1.00 88.01  ? 83  GLU b OE1   1 
ATOM   8002  O  OE2   . GLU M  2  83  ? -59.537  -17.076 -8.900  1.00 75.14  ? 83  GLU b OE2   1 
ATOM   8003  N  N     . GLY M  2  84  ? -60.761  -13.673 -13.366 1.00 79.49  ? 84  GLY b N     1 
ATOM   8004  C  CA    . GLY M  2  84  ? -61.552  -12.458 -13.120 1.00 87.71  ? 84  GLY b CA    1 
ATOM   8005  C  C     . GLY M  2  84  ? -61.254  -11.347 -14.126 1.00 95.13  ? 84  GLY b C     1 
ATOM   8006  O  O     . GLY M  2  84  ? -60.362  -11.497 -14.970 1.00 84.17  ? 84  GLY b O     1 
ATOM   8007  N  N     . PRO M  2  85  ? -61.994  -10.218 -14.048 1.00 102.01 ? 85  PRO b N     1 
ATOM   8008  C  CA    . PRO M  2  85  ? -61.830  -9.132  -15.041 1.00 94.06  ? 85  PRO b CA    1 
ATOM   8009  C  C     . PRO M  2  85  ? -60.698  -8.253  -14.582 1.00 92.52  ? 85  PRO b C     1 
ATOM   8010  O  O     . PRO M  2  85  ? -60.270  -8.411  -13.426 1.00 101.57 ? 85  PRO b O     1 
ATOM   8011  C  CB    . PRO M  2  85  ? -63.161  -8.399  -15.012 1.00 92.56  ? 85  PRO b CB    1 
ATOM   8012  C  CG    . PRO M  2  85  ? -63.900  -8.919  -13.800 1.00 100.05 ? 85  PRO b CG    1 
ATOM   8013  C  CD    . PRO M  2  85  ? -63.051  -9.916  -13.063 1.00 101.19 ? 85  PRO b CD    1 
ATOM   8014  N  N     . PRO M  2  86  ? -60.147  -7.403  -15.467 1.00 89.33  ? 86  PRO b N     1 
ATOM   8015  C  CA    . PRO M  2  86  ? -59.033  -6.506  -15.107 1.00 91.29  ? 86  PRO b CA    1 
ATOM   8016  C  C     . PRO M  2  86  ? -59.406  -5.650  -13.907 1.00 105.24 ? 86  PRO b C     1 
ATOM   8017  O  O     . PRO M  2  86  ? -60.555  -5.202  -13.825 1.00 116.11 ? 86  PRO b O     1 
ATOM   8018  C  CB    . PRO M  2  86  ? -58.839  -5.612  -16.298 1.00 87.23  ? 86  PRO b CB    1 
ATOM   8019  C  CG    . PRO M  2  86  ? -59.736  -6.129  -17.358 1.00 90.35  ? 86  PRO b CG    1 
ATOM   8020  C  CD    . PRO M  2  86  ? -60.558  -7.276  -16.864 1.00 89.61  ? 86  PRO b CD    1 
ATOM   8021  N  N     . PRO M  2  87  ? -58.504  -5.515  -12.920 1.00 115.84 ? 87  PRO b N     1 
ATOM   8022  C  CA    . PRO M  2  87  ? -58.787  -4.639  -11.786 1.00 120.61 ? 87  PRO b CA    1 
ATOM   8023  C  C     . PRO M  2  87  ? -59.024  -3.188  -12.200 1.00 125.37 ? 87  PRO b C     1 
ATOM   8024  O  O     . PRO M  2  87  ? -58.615  -2.784  -13.299 1.00 116.58 ? 87  PRO b O     1 
ATOM   8025  C  CB    . PRO M  2  87  ? -57.521  -4.767  -10.959 1.00 123.45 ? 87  PRO b CB    1 
ATOM   8026  C  CG    . PRO M  2  87  ? -57.174  -6.206  -11.121 1.00 120.30 ? 87  PRO b CG    1 
ATOM   8027  C  CD    . PRO M  2  87  ? -57.378  -6.413  -12.603 1.00 120.02 ? 87  PRO b CD    1 
ATOM   8028  N  N     . LYS M  2  88  ? -59.648  -2.419  -11.312 1.00 131.06 ? 88  LYS b N     1 
ATOM   8029  C  CA    . LYS M  2  88  ? -60.134  -1.082  -11.628 1.00 138.24 ? 88  LYS b CA    1 
ATOM   8030  C  C     . LYS M  2  88  ? -59.246  -0.003  -10.975 1.00 150.43 ? 88  LYS b C     1 
ATOM   8031  O  O     . LYS M  2  88  ? -58.420  -0.262  -10.087 1.00 145.67 ? 88  LYS b O     1 
ATOM   8032  C  CB    . LYS M  2  88  ? -61.608  -0.924  -11.246 1.00 133.97 ? 88  LYS b CB    1 
ATOM   8033  C  CG    . LYS M  2  88  ? -62.413  -2.199  -11.037 1.00 130.64 ? 88  LYS b CG    1 
ATOM   8034  C  CD    . LYS M  2  88  ? -63.904  -2.009  -11.199 1.00 125.78 ? 88  LYS b CD    1 
ATOM   8035  C  CE    . LYS M  2  88  ? -64.619  -3.338  -11.085 1.00 121.83 ? 88  LYS b CE    1 
ATOM   8036  N  NZ    . LYS M  2  88  ? -66.094  -3.183  -11.219 1.00 115.60 ? 88  LYS b NZ    1 
ATOM   8037  N  N     . ASP M  2  89  ? -59.453  1.207   -11.510 1.00 164.61 ? 89  ASP b N     1 
ATOM   8038  C  CA    . ASP M  2  89  ? -58.599  2.404   -11.503 1.00 161.46 ? 89  ASP b CA    1 
ATOM   8039  C  C     . ASP M  2  89  ? -58.264  2.707   -12.951 1.00 155.65 ? 89  ASP b C     1 
ATOM   8040  O  O     . ASP M  2  89  ? -57.230  2.272   -13.447 1.00 156.40 ? 89  ASP b O     1 
ATOM   8041  C  CB    . ASP M  2  89  ? -57.329  2.293   -10.649 1.00 158.73 ? 89  ASP b CB    1 
ATOM   8042  C  CG    . ASP M  2  89  ? -57.625  2.390   -9.163  1.00 163.59 ? 89  ASP b CG    1 
ATOM   8043  O  OD1   . ASP M  2  89  ? -58.810  2.424   -8.755  1.00 166.73 ? 89  ASP b OD1   1 
ATOM   8044  O  OD2   . ASP M  2  89  ? -56.658  2.412   -8.384  1.00 169.30 ? 89  ASP b OD2   1 
ATOM   8045  N  N     . GLY N  3  3   ? -54.221  -41.097 -48.845 1.00 116.25 ? -3  GLY c N     1 
ATOM   8046  C  CA    . GLY N  3  3   ? -53.324  -42.194 -49.320 1.00 120.39 ? -3  GLY c CA    1 
ATOM   8047  C  C     . GLY N  3  3   ? -51.978  -42.325 -48.607 1.00 134.58 ? -3  GLY c C     1 
ATOM   8048  O  O     . GLY N  3  3   ? -51.348  -43.393 -48.628 1.00 140.34 ? -3  GLY c O     1 
ATOM   8049  N  N     . SER N  3  4   ? -51.506  -41.246 -47.978 1.00 139.04 ? -2  SER c N     1 
ATOM   8050  C  CA    . SER N  3  4   ? -50.237  -41.244 -47.226 1.00 132.09 ? -2  SER c CA    1 
ATOM   8051  C  C     . SER N  3  4   ? -50.173  -40.147 -46.150 1.00 129.58 ? -2  SER c C     1 
ATOM   8052  O  O     . SER N  3  4   ? -51.215  -39.722 -45.645 1.00 134.86 ? -2  SER c O     1 
ATOM   8053  C  CB    . SER N  3  4   ? -49.074  -41.151 -48.220 1.00 128.66 ? -2  SER c CB    1 
ATOM   8054  O  OG    . SER N  3  4   ? -49.152  -39.916 -48.901 1.00 115.69 ? -2  SER c OG    1 
ATOM   8055  N  N     . GLY N  3  5   ? -48.973  -39.719 -45.759 1.00 116.99 ? -1  GLY c N     1 
ATOM   8056  C  CA    . GLY N  3  5   ? -48.813  -38.694 -44.762 1.00 105.18 ? -1  GLY c CA    1 
ATOM   8057  C  C     . GLY N  3  5   ? -48.985  -37.301 -45.295 1.00 98.90  ? -1  GLY c C     1 
ATOM   8058  O  O     . GLY N  3  5   ? -48.472  -36.993 -46.352 1.00 88.51  ? -1  GLY c O     1 
ATOM   8059  N  N     . SER N  3  6   ? -49.701  -36.460 -44.555 1.00 104.11 ? 0   SER c N     1 
ATOM   8060  C  CA    . SER N  3  6   ? -49.760  -35.016 -44.841 1.00 107.72 ? 0   SER c CA    1 
ATOM   8061  C  C     . SER N  3  6   ? -48.416  -34.355 -44.592 1.00 106.75 ? 0   SER c C     1 
ATOM   8062  O  O     . SER N  3  6   ? -47.526  -34.956 -43.981 1.00 101.38 ? 0   SER c O     1 
ATOM   8063  C  CB    . SER N  3  6   ? -50.822  -34.328 -43.981 1.00 108.71 ? 0   SER c CB    1 
ATOM   8064  O  OG    . SER N  3  6   ? -52.113  -34.857 -44.251 1.00 106.51 ? 0   SER c OG    1 
ATOM   8065  N  N     . VAL N  3  7   ? -48.289  -33.122 -45.071 1.00 112.17 ? 1   VAL c N     1 
ATOM   8066  C  CA    . VAL N  3  7   ? -47.069  -32.346 -44.819 1.00 121.59 ? 1   VAL c CA    1 
ATOM   8067  C  C     . VAL N  3  7   ? -47.029  -31.988 -43.337 1.00 114.01 ? 1   VAL c C     1 
ATOM   8068  O  O     . VAL N  3  7   ? -46.101  -32.379 -42.612 1.00 116.48 ? 1   VAL c O     1 
ATOM   8069  C  CB    . VAL N  3  7   ? -46.970  -31.089 -45.715 1.00 131.71 ? 1   VAL c CB    1 
ATOM   8070  C  CG1   . VAL N  3  7   ? -45.786  -30.203 -45.317 1.00 128.48 ? 1   VAL c CG1   1 
ATOM   8071  C  CG2   . VAL N  3  7   ? -46.882  -31.508 -47.185 1.00 140.47 ? 1   VAL c CG2   1 
ATOM   8072  N  N     . LYS N  3  8   ? -48.078  -31.275 -42.920 1.00 102.00 ? 2   LYS c N     1 
ATOM   8073  C  CA    . LYS N  3  8   ? -48.372  -31.029 -41.504 1.00 91.34  ? 2   LYS c CA    1 
ATOM   8074  C  C     . LYS N  3  8   ? -49.797  -31.394 -41.193 1.00 79.88  ? 2   LYS c C     1 
ATOM   8075  O  O     . LYS N  3  8   ? -50.705  -31.331 -42.037 1.00 91.96  ? 2   LYS c O     1 
ATOM   8076  C  CB    . LYS N  3  8   ? -48.082  -29.591 -41.135 1.00 103.59 ? 2   LYS c CB    1 
ATOM   8077  C  CG    . LYS N  3  8   ? -46.607  -29.329 -40.778 1.00 112.37 ? 2   LYS c CG    1 
ATOM   8078  C  CD    . LYS N  3  8   ? -46.058  -28.016 -41.361 1.00 119.44 ? 2   LYS c CD    1 
ATOM   8079  C  CE    . LYS N  3  8   ? -46.888  -26.759 -41.056 1.00 113.35 ? 2   LYS c CE    1 
ATOM   8080  N  NZ    . LYS N  3  8   ? -46.725  -26.329 -39.641 1.00 117.62 ? 2   LYS c NZ    1 
ATOM   8081  N  N     . LEU N  3  9   ? -49.972  -31.912 -40.001 1.00 69.51  ? 3   LEU c N     1 
ATOM   8082  C  CA    . LEU N  3  9   ? -51.240  -32.489 -39.605 1.00 66.37  ? 3   LEU c CA    1 
ATOM   8083  C  C     . LEU N  3  9   ? -51.938  -31.667 -38.515 1.00 66.36  ? 3   LEU c C     1 
ATOM   8084  O  O     . LEU N  3  9   ? -53.076  -31.915 -38.219 1.00 63.24  ? 3   LEU c O     1 
ATOM   8085  C  CB    . LEU N  3  9   ? -50.952  -33.893 -39.153 1.00 60.37  ? 3   LEU c CB    1 
ATOM   8086  C  CG    . LEU N  3  9   ? -52.114  -34.857 -39.193 1.00 61.37  ? 3   LEU c CG    1 
ATOM   8087  C  CD1   . LEU N  3  9   ? -52.820  -34.913 -40.517 1.00 63.04  ? 3   LEU c CD1   1 
ATOM   8088  C  CD2   . LEU N  3  9   ? -51.629  -36.270 -38.893 1.00 68.66  ? 3   LEU c CD2   1 
ATOM   8089  N  N     . VAL N  3  10  ? -51.272  -30.724 -37.865 1.00 64.04  ? 4   VAL c N     1 
ATOM   8090  C  CA    . VAL N  3  10  ? -51.977  -29.687 -37.147 1.00 63.05  ? 4   VAL c CA    1 
ATOM   8091  C  C     . VAL N  3  10  ? -52.871  -28.915 -38.049 1.00 65.80  ? 4   VAL c C     1 
ATOM   8092  O  O     . VAL N  3  10  ? -53.903  -28.446 -37.607 1.00 70.89  ? 4   VAL c O     1 
ATOM   8093  C  CB    . VAL N  3  10  ? -51.094  -28.617 -36.497 1.00 68.63  ? 4   VAL c CB    1 
ATOM   8094  C  CG1   . VAL N  3  10  ? -51.017  -28.844 -34.987 1.00 75.06  ? 4   VAL c CG1   1 
ATOM   8095  C  CG2   . VAL N  3  10  ? -49.699  -28.548 -37.106 1.00 68.74  ? 4   VAL c CG2   1 
ATOM   8096  N  N     . ARG N  3  11  ? -52.469  -28.754 -39.297 1.00 71.21  ? 5   ARG c N     1 
ATOM   8097  C  CA    . ARG N  3  11  ? -53.335  -28.121 -40.277 1.00 76.86  ? 5   ARG c CA    1 
ATOM   8098  C  C     . ARG N  3  11  ? -54.764  -28.639 -40.137 1.00 68.62  ? 5   ARG c C     1 
ATOM   8099  O  O     . ARG N  3  11  ? -55.701  -27.840 -40.124 1.00 72.34  ? 5   ARG c O     1 
ATOM   8100  C  CB    . ARG N  3  11  ? -52.760  -28.262 -41.700 1.00 88.36  ? 5   ARG c CB    1 
ATOM   8101  C  CG    . ARG N  3  11  ? -51.452  -27.525 -42.019 1.00 87.50  ? 5   ARG c CG    1 
ATOM   8102  C  CD    . ARG N  3  11  ? -51.623  -26.032 -42.260 1.00 89.87  ? 5   ARG c CD    1 
ATOM   8103  N  NE    . ARG N  3  11  ? -50.369  -25.317 -41.967 1.00 100.56 ? 5   ARG c NE    1 
ATOM   8104  C  CZ    . ARG N  3  11  ? -50.235  -24.052 -41.530 1.00 100.31 ? 5   ARG c CZ    1 
ATOM   8105  N  NH1   . ARG N  3  11  ? -51.284  -23.266 -41.273 1.00 100.81 ? 5   ARG c NH1   1 
ATOM   8106  N  NH2   . ARG N  3  11  ? -49.015  -23.522 -41.344 1.00 99.75  ? 5   ARG c NH2   1 
ATOM   8107  N  N     . PHE N  3  12  ? -54.902  -29.950 -39.965 1.00 59.18  ? 6   PHE c N     1 
ATOM   8108  C  CA    . PHE N  3  12  ? -56.201  -30.583 -39.641 1.00 56.29  ? 6   PHE c CA    1 
ATOM   8109  C  C     . PHE N  3  12  ? -56.836  -30.144 -38.332 1.00 51.31  ? 6   PHE c C     1 
ATOM   8110  O  O     . PHE N  3  12  ? -57.975  -29.769 -38.258 1.00 48.73  ? 6   PHE c O     1 
ATOM   8111  C  CB    . PHE N  3  12  ? -55.992  -32.087 -39.647 1.00 58.68  ? 6   PHE c CB    1 
ATOM   8112  C  CG    . PHE N  3  12  ? -57.062  -32.882 -39.033 1.00 59.38  ? 6   PHE c CG    1 
ATOM   8113  C  CD1   . PHE N  3  12  ? -57.021  -33.196 -37.704 1.00 65.44  ? 6   PHE c CD1   1 
ATOM   8114  C  CD2   . PHE N  3  12  ? -58.040  -33.404 -39.788 1.00 62.09  ? 6   PHE c CD2   1 
ATOM   8115  C  CE1   . PHE N  3  12  ? -58.019  -33.960 -37.116 1.00 69.26  ? 6   PHE c CE1   1 
ATOM   8116  C  CE2   . PHE N  3  12  ? -59.023  -34.215 -39.221 1.00 68.35  ? 6   PHE c CE2   1 
ATOM   8117  C  CZ    . PHE N  3  12  ? -59.032  -34.482 -37.883 1.00 67.47  ? 6   PHE c CZ    1 
ATOM   8118  N  N     . LEU N  3  13  ? -56.079  -30.153 -37.259 1.00 52.77  ? 7   LEU c N     1 
ATOM   8119  C  CA    . LEU N  3  13  ? -56.595  -29.709 -35.975 1.00 51.16  ? 7   LEU c CA    1 
ATOM   8120  C  C     . LEU N  3  13  ? -57.068  -28.296 -36.017 1.00 47.99  ? 7   LEU c C     1 
ATOM   8121  O  O     . LEU N  3  13  ? -58.043  -28.016 -35.337 1.00 50.95  ? 7   LEU c O     1 
ATOM   8122  C  CB    . LEU N  3  13  ? -55.555  -29.846 -34.856 1.00 53.33  ? 7   LEU c CB    1 
ATOM   8123  C  CG    . LEU N  3  13  ? -55.196  -31.281 -34.443 1.00 56.35  ? 7   LEU c CG    1 
ATOM   8124  C  CD1   . LEU N  3  13  ? -54.138  -31.256 -33.355 1.00 60.88  ? 7   LEU c CD1   1 
ATOM   8125  C  CD2   . LEU N  3  13  ? -56.428  -31.988 -33.906 1.00 58.11  ? 7   LEU c CD2   1 
ATOM   8126  N  N     . MET N  3  14  ? -56.459  -27.454 -36.846 1.00 48.15  ? 8   MET c N     1 
ATOM   8127  C  CA    . MET N  3  14  ? -56.809  -26.016 -36.964 1.00 49.92  ? 8   MET c CA    1 
ATOM   8128  C  C     . MET N  3  14  ? -58.145  -25.837 -37.658 1.00 50.31  ? 8   MET c C     1 
ATOM   8129  O  O     . MET N  3  14  ? -58.855  -24.857 -37.408 1.00 49.61  ? 8   MET c O     1 
ATOM   8130  C  CB    . MET N  3  14  ? -55.722  -25.221 -37.719 1.00 51.68  ? 8   MET c CB    1 
ATOM   8131  C  CG    . MET N  3  14  ? -54.347  -25.186 -37.011 1.00 52.57  ? 8   MET c CG    1 
ATOM   8132  S  SD    . MET N  3  14  ? -52.997  -24.159 -37.633 1.00 42.72  ? 8   MET c SD    1 
ATOM   8133  C  CE    . MET N  3  14  ? -52.565  -25.162 -39.004 1.00 47.68  ? 8   MET c CE    1 
ATOM   8134  N  N     . LYS N  3  15  ? -58.559  -26.840 -38.428 1.00 51.33  ? 9   LYS c N     1 
ATOM   8135  C  CA    . LYS N  3  15  ? -59.911  -26.861 -38.962 1.00 56.19  ? 9   LYS c CA    1 
ATOM   8136  C  C     . LYS N  3  15  ? -61.024  -27.219 -38.001 1.00 59.34  ? 9   LYS c C     1 
ATOM   8137  O  O     . LYS N  3  15  ? -62.183  -27.065 -38.326 1.00 74.75  ? 9   LYS c O     1 
ATOM   8138  C  CB    . LYS N  3  15  ? -60.012  -27.843 -40.118 1.00 57.09  ? 9   LYS c CB    1 
ATOM   8139  C  CG    . LYS N  3  15  ? -59.062  -27.534 -41.265 1.00 59.46  ? 9   LYS c CG    1 
ATOM   8140  C  CD    . LYS N  3  15  ? -59.234  -28.610 -42.304 1.00 61.15  ? 9   LYS c CD    1 
ATOM   8141  C  CE    . LYS N  3  15  ? -58.171  -28.501 -43.359 1.00 68.60  ? 9   LYS c CE    1 
ATOM   8142  N  NZ    . LYS N  3  15  ? -58.585  -29.439 -44.451 1.00 76.13  ? 9   LYS c NZ    1 
ATOM   8143  N  N     . LEU N  3  16  ? -60.728  -27.730 -36.828 1.00 61.76  ? 10  LEU c N     1 
ATOM   8144  C  CA    . LEU N  3  16  ? -61.771  -28.219 -35.948 1.00 64.51  ? 10  LEU c CA    1 
ATOM   8145  C  C     . LEU N  3  16  ? -62.466  -27.157 -35.093 1.00 64.73  ? 10  LEU c C     1 
ATOM   8146  O  O     . LEU N  3  16  ? -62.831  -27.457 -33.939 1.00 67.70  ? 10  LEU c O     1 
ATOM   8147  C  CB    . LEU N  3  16  ? -61.216  -29.322 -35.054 1.00 66.08  ? 10  LEU c CB    1 
ATOM   8148  C  CG    . LEU N  3  16  ? -60.614  -30.491 -35.808 1.00 66.40  ? 10  LEU c CG    1 
ATOM   8149  C  CD1   . LEU N  3  16  ? -60.211  -31.504 -34.748 1.00 71.64  ? 10  LEU c CD1   1 
ATOM   8150  C  CD2   . LEU N  3  16  ? -61.597  -31.088 -36.785 1.00 65.32  ? 10  LEU c CD2   1 
ATOM   8151  N  N     . SER N  3  17  ? -62.703  -25.954 -35.612 1.00 58.46  ? 11  SER c N     1 
ATOM   8152  C  CA    . SER N  3  17  ? -63.281  -24.949 -34.745 1.00 61.65  ? 11  SER c CA    1 
ATOM   8153  C  C     . SER N  3  17  ? -64.731  -25.238 -34.687 1.00 59.22  ? 11  SER c C     1 
ATOM   8154  O  O     . SER N  3  17  ? -65.299  -25.768 -35.607 1.00 59.96  ? 11  SER c O     1 
ATOM   8155  C  CB    . SER N  3  17  ? -63.042  -23.559 -35.265 1.00 69.99  ? 11  SER c CB    1 
ATOM   8156  O  OG    . SER N  3  17  ? -61.908  -23.598 -36.129 1.00 78.24  ? 11  SER c OG    1 
ATOM   8157  N  N     . HIS N  3  18  ? -65.283  -24.986 -33.514 1.00 64.85  ? 12  HIS c N     1 
ATOM   8158  C  CA    . HIS N  3  18  ? -66.657  -25.330 -33.120 1.00 66.64  ? 12  HIS c CA    1 
ATOM   8159  C  C     . HIS N  3  18  ? -66.922  -26.784 -32.948 1.00 65.49  ? 12  HIS c C     1 
ATOM   8160  O  O     . HIS N  3  18  ? -68.036  -27.089 -32.568 1.00 74.70  ? 12  HIS c O     1 
ATOM   8161  C  CB    . HIS N  3  18  ? -67.670  -24.794 -34.097 1.00 70.17  ? 12  HIS c CB    1 
ATOM   8162  C  CG    . HIS N  3  18  ? -67.398  -23.383 -34.461 1.00 69.46  ? 12  HIS c CG    1 
ATOM   8163  N  ND1   . HIS N  3  18  ? -67.497  -22.378 -33.524 1.00 65.10  ? 12  HIS c ND1   1 
ATOM   8164  C  CD2   . HIS N  3  18  ? -66.960  -22.833 -35.620 1.00 66.39  ? 12  HIS c CD2   1 
ATOM   8165  C  CE1   . HIS N  3  18  ? -67.107  -21.255 -34.098 1.00 68.60  ? 12  HIS c CE1   1 
ATOM   8166  N  NE2   . HIS N  3  18  ? -66.797  -21.499 -35.366 1.00 68.85  ? 12  HIS c NE2   1 
ATOM   8167  N  N     . GLU N  3  19  ? -65.935  -27.653 -33.139 1.00 60.36  ? 13  GLU c N     1 
ATOM   8168  C  CA    . GLU N  3  19  ? -66.112  -29.041 -32.779 1.00 62.22  ? 13  GLU c CA    1 
ATOM   8169  C  C     . GLU N  3  19  ? -65.899  -29.312 -31.305 1.00 57.35  ? 13  GLU c C     1 
ATOM   8170  O  O     . GLU N  3  19  ? -65.086  -28.643 -30.640 1.00 62.41  ? 13  GLU c O     1 
ATOM   8171  C  CB    . GLU N  3  19  ? -65.140  -29.875 -33.590 1.00 72.38  ? 13  GLU c CB    1 
ATOM   8172  C  CG    . GLU N  3  19  ? -65.517  -29.959 -35.063 1.00 75.48  ? 13  GLU c CG    1 
ATOM   8173  C  CD    . GLU N  3  19  ? -66.805  -30.763 -35.282 1.00 77.51  ? 13  GLU c CD    1 
ATOM   8174  O  OE1   . GLU N  3  19  ? -67.288  -30.844 -36.438 1.00 78.46  ? 13  GLU c OE1   1 
ATOM   8175  O  OE2   . GLU N  3  19  ? -67.320  -31.356 -34.286 1.00 78.50  ? 13  GLU c OE2   1 
ATOM   8176  N  N     . THR N  3  20  ? -66.616  -30.291 -30.785 1.00 52.45  ? 14  THR c N     1 
ATOM   8177  C  CA    . THR N  3  20  ? -66.536  -30.537 -29.347 1.00 51.18  ? 14  THR c CA    1 
ATOM   8178  C  C     . THR N  3  20  ? -65.751  -31.800 -29.134 1.00 49.45  ? 14  THR c C     1 
ATOM   8179  O  O     . THR N  3  20  ? -66.113  -32.838 -29.648 1.00 52.86  ? 14  THR c O     1 
ATOM   8180  C  CB    . THR N  3  20  ? -67.928  -30.670 -28.740 1.00 51.07  ? 14  THR c CB    1 
ATOM   8181  O  OG1   . THR N  3  20  ? -68.457  -29.350 -28.672 1.00 56.50  ? 14  THR c OG1   1 
ATOM   8182  C  CG2   . THR N  3  20  ? -67.885  -31.240 -27.355 1.00 54.39  ? 14  THR c CG2   1 
ATOM   8183  N  N     . VAL N  3  21  ? -64.697  -31.721 -28.340 1.00 45.10  ? 15  VAL c N     1 
ATOM   8184  C  CA    . VAL N  3  21  ? -63.749  -32.801 -28.232 1.00 42.54  ? 15  VAL c CA    1 
ATOM   8185  C  C     . VAL N  3  21  ? -63.448  -33.105 -26.813 1.00 43.11  ? 15  VAL c C     1 
ATOM   8186  O  O     . VAL N  3  21  ? -63.844  -32.378 -25.923 1.00 48.73  ? 15  VAL c O     1 
ATOM   8187  C  CB    . VAL N  3  21  ? -62.444  -32.403 -28.943 1.00 43.50  ? 15  VAL c CB    1 
ATOM   8188  C  CG1   . VAL N  3  21  ? -62.676  -32.159 -30.445 1.00 44.42  ? 15  VAL c CG1   1 
ATOM   8189  C  CG2   . VAL N  3  21  ? -61.767  -31.176 -28.333 1.00 41.20  ? 15  VAL c CG2   1 
ATOM   8190  N  N     . THR N  3  22  ? -62.645  -34.122 -26.615 1.00 46.21  ? 16  THR c N     1 
ATOM   8191  C  CA    . THR N  3  22  ? -62.061  -34.404 -25.331 1.00 50.75  ? 16  THR c CA    1 
ATOM   8192  C  C     . THR N  3  22  ? -60.573  -34.596 -25.540 1.00 51.56  ? 16  THR c C     1 
ATOM   8193  O  O     . THR N  3  22  ? -60.171  -35.425 -26.354 1.00 49.49  ? 16  THR c O     1 
ATOM   8194  C  CB    . THR N  3  22  ? -62.616  -35.703 -24.756 1.00 55.33  ? 16  THR c CB    1 
ATOM   8195  O  OG1   . THR N  3  22  ? -64.026  -35.553 -24.592 1.00 62.54  ? 16  THR c OG1   1 
ATOM   8196  C  CG2   . THR N  3  22  ? -61.973  -35.984 -23.383 1.00 53.92  ? 16  THR c CG2   1 
ATOM   8197  N  N     . ILE N  3  23  ? -59.789  -33.900 -24.727 1.00 49.71  ? 17  ILE c N     1 
ATOM   8198  C  CA    . ILE N  3  23  ? -58.361  -33.885 -24.795 1.00 47.11  ? 17  ILE c CA    1 
ATOM   8199  C  C     . ILE N  3  23  ? -57.821  -34.512 -23.543 1.00 47.03  ? 17  ILE c C     1 
ATOM   8200  O  O     . ILE N  3  23  ? -58.184  -34.186 -22.428 1.00 50.49  ? 17  ILE c O     1 
ATOM   8201  C  CB    . ILE N  3  23  ? -57.909  -32.433 -24.830 1.00 51.39  ? 17  ILE c CB    1 
ATOM   8202  C  CG1   . ILE N  3  23  ? -58.449  -31.762 -26.097 1.00 55.42  ? 17  ILE c CG1   1 
ATOM   8203  C  CG2   . ILE N  3  23  ? -56.412  -32.357 -24.939 1.00 57.49  ? 17  ILE c CG2   1 
ATOM   8204  C  CD1   . ILE N  3  23  ? -58.002  -30.327 -26.368 1.00 54.44  ? 17  ILE c CD1   1 
ATOM   8205  N  N     . GLU N  3  24  ? -56.864  -35.388 -23.701 1.00 51.00  ? 18  GLU c N     1 
ATOM   8206  C  CA    . GLU N  3  24  ? -56.091  -35.900 -22.573 1.00 50.27  ? 18  GLU c CA    1 
ATOM   8207  C  C     . GLU N  3  24  ? -54.748  -35.292 -22.559 1.00 42.14  ? 18  GLU c C     1 
ATOM   8208  O  O     . GLU N  3  24  ? -54.074  -35.257 -23.562 1.00 40.60  ? 18  GLU c O     1 
ATOM   8209  C  CB    . GLU N  3  24  ? -55.910  -37.400 -22.739 1.00 55.98  ? 18  GLU c CB    1 
ATOM   8210  C  CG    . GLU N  3  24  ? -57.288  -38.034 -22.861 1.00 63.44  ? 18  GLU c CG    1 
ATOM   8211  C  CD    . GLU N  3  24  ? -57.467  -39.249 -21.996 1.00 72.49  ? 18  GLU c CD    1 
ATOM   8212  O  OE1   . GLU N  3  24  ? -56.459  -39.581 -21.289 1.00 83.61  ? 18  GLU c OE1   1 
ATOM   8213  O  OE2   . GLU N  3  24  ? -58.636  -39.735 -21.983 1.00 73.86  ? 18  GLU c OE2   1 
ATOM   8214  N  N     . LEU N  3  25  ? -54.364  -34.891 -21.388 1.00 41.38  ? 19  LEU c N     1 
ATOM   8215  C  CA    . LEU N  3  25  ? -53.073  -34.289 -21.190 1.00 45.55  ? 19  LEU c CA    1 
ATOM   8216  C  C     . LEU N  3  25  ? -52.050  -35.287 -20.656 1.00 48.39  ? 19  LEU c C     1 
ATOM   8217  O  O     . LEU N  3  25  ? -52.396  -36.287 -20.060 1.00 46.99  ? 19  LEU c O     1 
ATOM   8218  C  CB    . LEU N  3  25  ? -53.153  -33.066 -20.242 1.00 44.71  ? 19  LEU c CB    1 
ATOM   8219  C  CG    . LEU N  3  25  ? -53.991  -31.867 -20.654 1.00 42.73  ? 19  LEU c CG    1 
ATOM   8220  C  CD1   . LEU N  3  25  ? -53.864  -30.447 -20.163 1.00 41.36  ? 19  LEU c CD1   1 
ATOM   8221  C  CD2   . LEU N  3  25  ? -54.061  -31.808 -22.156 1.00 45.57  ? 19  LEU c CD2   1 
ATOM   8222  N  N     . LYS N  3  26  ? -50.779  -34.936 -20.851 1.00 54.01  ? 20  LYS c N     1 
ATOM   8223  C  CA    . LYS N  3  26  ? -49.669  -35.765 -20.469 1.00 54.69  ? 20  LYS c CA    1 
ATOM   8224  C  C     . LYS N  3  26  ? -49.652  -35.935 -18.996 1.00 52.22  ? 20  LYS c C     1 
ATOM   8225  O  O     . LYS N  3  26  ? -49.074  -36.896 -18.541 1.00 54.50  ? 20  LYS c O     1 
ATOM   8226  C  CB    . LYS N  3  26  ? -48.372  -35.204 -21.018 1.00 61.60  ? 20  LYS c CB    1 
ATOM   8227  C  CG    . LYS N  3  26  ? -48.264  -35.212 -22.574 1.00 64.39  ? 20  LYS c CG    1 
ATOM   8228  C  CD    . LYS N  3  26  ? -46.839  -35.473 -23.082 1.00 66.70  ? 20  LYS c CD    1 
ATOM   8229  C  CE    . LYS N  3  26  ? -46.415  -34.691 -24.306 1.00 66.91  ? 20  LYS c CE    1 
ATOM   8230  N  NZ    . LYS N  3  26  ? -47.212  -35.108 -25.483 1.00 67.26  ? 20  LYS c NZ    1 
ATOM   8231  N  N     . ASN N  3  27  ? -50.335  -35.067 -18.254 1.00 52.30  ? 21  ASN c N     1 
ATOM   8232  C  CA    . ASN N  3  27  ? -50.517  -35.217 -16.782 1.00 49.56  ? 21  ASN c CA    1 
ATOM   8233  C  C     . ASN N  3  27  ? -51.856  -35.776 -16.307 1.00 47.25  ? 21  ASN c C     1 
ATOM   8234  O  O     . ASN N  3  27  ? -52.273  -35.548 -15.189 1.00 45.56  ? 21  ASN c O     1 
ATOM   8235  C  CB    . ASN N  3  27  ? -50.260  -33.876 -16.107 1.00 47.15  ? 21  ASN c CB    1 
ATOM   8236  C  CG    . ASN N  3  27  ? -51.365  -32.900 -16.401 1.00 49.49  ? 21  ASN c CG    1 
ATOM   8237  O  OD1   . ASN N  3  27  ? -52.416  -33.286 -16.909 1.00 56.29  ? 21  ASN c OD1   1 
ATOM   8238  N  ND2   . ASN N  3  27  ? -51.188  -31.646 -16.034 1.00 50.70  ? 21  ASN c ND2   1 
ATOM   8239  N  N     . GLY N  3  28  ? -52.566  -36.487 -17.155 1.00 52.51  ? 22  GLY c N     1 
ATOM   8240  C  CA    . GLY N  3  28  ? -53.801  -37.156 -16.721 1.00 57.38  ? 22  GLY c CA    1 
ATOM   8241  C  C     . GLY N  3  28  ? -55.064  -36.312 -16.696 1.00 58.41  ? 22  GLY c C     1 
ATOM   8242  O  O     . GLY N  3  28  ? -56.169  -36.861 -16.598 1.00 66.21  ? 22  GLY c O     1 
ATOM   8243  N  N     . THR N  3  29  ? -54.919  -34.988 -16.641 1.00 54.40  ? 23  THR c N     1 
ATOM   8244  C  CA    . THR N  3  29  ? -56.034  -34.065 -16.755 1.00 51.14  ? 23  THR c CA    1 
ATOM   8245  C  C     . THR N  3  29  ? -56.791  -34.355 -18.044 1.00 52.46  ? 23  THR c C     1 
ATOM   8246  O  O     . THR N  3  29  ? -56.202  -34.664 -19.083 1.00 54.29  ? 23  THR c O     1 
ATOM   8247  C  CB    . THR N  3  29  ? -55.552  -32.616 -16.864 1.00 51.45  ? 23  THR c CB    1 
ATOM   8248  O  OG1   . THR N  3  29  ? -54.696  -32.265 -15.766 1.00 46.53  ? 23  THR c OG1   1 
ATOM   8249  C  CG2   . THR N  3  29  ? -56.746  -31.748 -16.908 1.00 55.49  ? 23  THR c CG2   1 
ATOM   8250  N  N     . GLN N  3  30  ? -58.111  -34.310 -17.958 1.00 56.24  ? 24  GLN c N     1 
ATOM   8251  C  CA    . GLN N  3  30  ? -59.000  -34.524 -19.115 1.00 57.00  ? 24  GLN c CA    1 
ATOM   8252  C  C     . GLN N  3  30  ? -59.780  -33.253 -19.270 1.00 51.44  ? 24  GLN c C     1 
ATOM   8253  O  O     . GLN N  3  30  ? -60.316  -32.744 -18.313 1.00 48.51  ? 24  GLN c O     1 
ATOM   8254  C  CB    . GLN N  3  30  ? -60.003  -35.662 -18.910 1.00 60.62  ? 24  GLN c CB    1 
ATOM   8255  C  CG    . GLN N  3  30  ? -59.384  -37.015 -19.117 1.00 67.08  ? 24  GLN c CG    1 
ATOM   8256  C  CD    . GLN N  3  30  ? -60.422  -38.093 -19.195 1.00 75.53  ? 24  GLN c CD    1 
ATOM   8257  O  OE1   . GLN N  3  30  ? -61.297  -38.084 -20.033 1.00 83.05  ? 24  GLN c OE1   1 
ATOM   8258  N  NE2   . GLN N  3  30  ? -60.292  -39.076 -18.337 1.00 90.89  ? 24  GLN c NE2   1 
ATOM   8259  N  N     . VAL N  3  31  ? -59.893  -32.802 -20.507 1.00 49.49  ? 25  VAL c N     1 
ATOM   8260  C  CA    . VAL N  3  31  ? -60.602  -31.577 -20.833 1.00 46.40  ? 25  VAL c CA    1 
ATOM   8261  C  C     . VAL N  3  31  ? -61.629  -31.911 -21.872 1.00 48.86  ? 25  VAL c C     1 
ATOM   8262  O  O     . VAL N  3  31  ? -61.339  -32.581 -22.884 1.00 49.09  ? 25  VAL c O     1 
ATOM   8263  C  CB    . VAL N  3  31  ? -59.638  -30.593 -21.422 1.00 46.27  ? 25  VAL c CB    1 
ATOM   8264  C  CG1   . VAL N  3  31  ? -60.395  -29.469 -22.107 1.00 47.50  ? 25  VAL c CG1   1 
ATOM   8265  C  CG2   . VAL N  3  31  ? -58.737  -30.103 -20.303 1.00 46.01  ? 25  VAL c CG2   1 
ATOM   8266  N  N     . HIS N  3  32  ? -62.866  -31.555 -21.570 1.00 49.72  ? 26  HIS c N     1 
ATOM   8267  C  CA    . HIS N  3  32  ? -63.908  -31.797 -22.557 1.00 53.33  ? 26  HIS c CA    1 
ATOM   8268  C  C     . HIS N  3  32  ? -64.383  -30.416 -22.850 1.00 55.74  ? 26  HIS c C     1 
ATOM   8269  O  O     . HIS N  3  32  ? -64.601  -29.647 -21.904 1.00 61.35  ? 26  HIS c O     1 
ATOM   8270  C  CB    . HIS N  3  32  ? -65.029  -32.654 -22.042 1.00 54.35  ? 26  HIS c CB    1 
ATOM   8271  C  CG    . HIS N  3  32  ? -66.214  -32.680 -22.943 1.00 59.37  ? 26  HIS c CG    1 
ATOM   8272  N  ND1   . HIS N  3  32  ? -66.502  -33.749 -23.756 1.00 63.26  ? 26  HIS c ND1   1 
ATOM   8273  C  CD2   . HIS N  3  32  ? -67.205  -31.782 -23.140 1.00 61.06  ? 26  HIS c CD2   1 
ATOM   8274  C  CE1   . HIS N  3  32  ? -67.586  -33.499 -24.469 1.00 61.92  ? 26  HIS c CE1   1 
ATOM   8275  N  NE2   . HIS N  3  32  ? -68.031  -32.311 -24.103 1.00 64.00  ? 26  HIS c NE2   1 
ATOM   8276  N  N     . GLY N  3  33  ? -64.552  -30.111 -24.132 1.00 51.93  ? 27  GLY c N     1 
ATOM   8277  C  CA    . GLY N  3  33  ? -64.838  -28.744 -24.474 1.00 55.78  ? 27  GLY c CA    1 
ATOM   8278  C  C     . GLY N  3  33  ? -65.087  -28.541 -25.936 1.00 57.84  ? 27  GLY c C     1 
ATOM   8279  O  O     . GLY N  3  33  ? -64.914  -29.464 -26.734 1.00 50.32  ? 27  GLY c O     1 
ATOM   8280  N  N     . THR N  3  34  ? -65.341  -27.277 -26.279 1.00 60.25  ? 28  THR c N     1 
ATOM   8281  C  CA    . THR N  3  34  ? -65.510  -26.949 -27.679 1.00 59.91  ? 28  THR c CA    1 
ATOM   8282  C  C     . THR N  3  34  ? -64.428  -26.037 -28.191 1.00 53.17  ? 28  THR c C     1 
ATOM   8283  O  O     . THR N  3  34  ? -64.175  -25.003 -27.615 1.00 52.81  ? 28  THR c O     1 
ATOM   8284  C  CB    . THR N  3  34  ? -66.836  -26.255 -27.819 1.00 65.32  ? 28  THR c CB    1 
ATOM   8285  O  OG1   . THR N  3  34  ? -67.850  -27.103 -27.238 1.00 63.26  ? 28  THR c OG1   1 
ATOM   8286  C  CG2   . THR N  3  34  ? -67.071  -25.952 -29.301 1.00 67.07  ? 28  THR c CG2   1 
ATOM   8287  N  N     . ILE N  3  35  ? -63.803  -26.467 -29.270 1.00 48.18  ? 29  ILE c N     1 
ATOM   8288  C  CA    . ILE N  3  35  ? -62.585  -25.851 -29.717 1.00 48.89  ? 29  ILE c CA    1 
ATOM   8289  C  C     . ILE N  3  35  ? -62.934  -24.546 -30.368 1.00 54.93  ? 29  ILE c C     1 
ATOM   8290  O  O     . ILE N  3  35  ? -63.712  -24.531 -31.300 1.00 62.94  ? 29  ILE c O     1 
ATOM   8291  C  CB    . ILE N  3  35  ? -61.897  -26.640 -30.805 1.00 47.39  ? 29  ILE c CB    1 
ATOM   8292  C  CG1   . ILE N  3  35  ? -61.281  -27.897 -30.221 1.00 48.40  ? 29  ILE c CG1   1 
ATOM   8293  C  CG2   . ILE N  3  35  ? -60.794  -25.825 -31.461 1.00 48.52  ? 29  ILE c CG2   1 
ATOM   8294  C  CD1   . ILE N  3  35  ? -60.863  -28.943 -31.262 1.00 47.92  ? 29  ILE c CD1   1 
ATOM   8295  N  N     . THR N  3  36  ? -62.361  -23.452 -29.883 1.00 59.42  ? 30  THR c N     1 
ATOM   8296  C  CA    . THR N  3  36  ? -62.495  -22.138 -30.495 1.00 56.67  ? 30  THR c CA    1 
ATOM   8297  C  C     . THR N  3  36  ? -61.355  -21.868 -31.416 1.00 56.68  ? 30  THR c C     1 
ATOM   8298  O  O     . THR N  3  36  ? -61.534  -21.267 -32.472 1.00 74.67  ? 30  THR c O     1 
ATOM   8299  C  CB    . THR N  3  36  ? -62.485  -21.048 -29.436 1.00 58.04  ? 30  THR c CB    1 
ATOM   8300  O  OG1   . THR N  3  36  ? -61.252  -21.047 -28.749 1.00 56.36  ? 30  THR c OG1   1 
ATOM   8301  C  CG2   . THR N  3  36  ? -63.539  -21.251 -28.377 1.00 57.35  ? 30  THR c CG2   1 
ATOM   8302  N  N     . GLY N  3  37  ? -60.176  -22.323 -31.055 1.00 55.55  ? 31  GLY c N     1 
ATOM   8303  C  CA    . GLY N  3  37  ? -59.078  -22.334 -32.010 1.00 56.62  ? 31  GLY c CA    1 
ATOM   8304  C  C     . GLY N  3  37  ? -57.906  -23.214 -31.623 1.00 56.73  ? 31  GLY c C     1 
ATOM   8305  O  O     . GLY N  3  37  ? -57.693  -23.511 -30.443 1.00 60.15  ? 31  GLY c O     1 
ATOM   8306  N  N     . VAL N  3  38  ? -57.231  -23.740 -32.639 1.00 53.95  ? 32  VAL c N     1 
ATOM   8307  C  CA    . VAL N  3  38  ? -55.990  -24.453 -32.499 1.00 52.54  ? 32  VAL c CA    1 
ATOM   8308  C  C     . VAL N  3  38  ? -55.031  -23.696 -33.372 1.00 56.49  ? 32  VAL c C     1 
ATOM   8309  O  O     . VAL N  3  38  ? -55.417  -23.199 -34.424 1.00 64.86  ? 32  VAL c O     1 
ATOM   8310  C  CB    . VAL N  3  38  ? -56.108  -25.869 -33.002 1.00 50.40  ? 32  VAL c CB    1 
ATOM   8311  C  CG1   . VAL N  3  38  ? -54.774  -26.570 -32.940 1.00 54.94  ? 32  VAL c CG1   1 
ATOM   8312  C  CG2   . VAL N  3  38  ? -57.034  -26.619 -32.105 1.00 50.42  ? 32  VAL c CG2   1 
ATOM   8313  N  N     . ASP N  3  39  ? -53.789  -23.615 -32.922 1.00 62.71  ? 33  ASP c N     1 
ATOM   8314  C  CA    . ASP N  3  39  ? -52.723  -22.884 -33.602 1.00 67.84  ? 33  ASP c CA    1 
ATOM   8315  C  C     . ASP N  3  39  ? -51.655  -23.852 -34.086 1.00 70.25  ? 33  ASP c C     1 
ATOM   8316  O  O     . ASP N  3  39  ? -51.802  -25.063 -33.914 1.00 72.88  ? 33  ASP c O     1 
ATOM   8317  C  CB    . ASP N  3  39  ? -52.172  -21.776 -32.711 1.00 72.73  ? 33  ASP c CB    1 
ATOM   8318  C  CG    . ASP N  3  39  ? -51.164  -22.218 -31.704 1.00 78.68  ? 33  ASP c CG    1 
ATOM   8319  O  OD1   . ASP N  3  39  ? -50.668  -23.376 -31.738 1.00 87.64  ? 33  ASP c OD1   1 
ATOM   8320  O  OD2   . ASP N  3  39  ? -50.868  -21.332 -30.854 1.00 76.81  ? 33  ASP c OD2   1 
ATOM   8321  N  N     . VAL N  3  40  ? -50.589  -23.346 -34.685 1.00 71.27  ? 34  VAL c N     1 
ATOM   8322  C  CA    . VAL N  3  40  ? -49.640  -24.267 -35.343 1.00 76.32  ? 34  VAL c CA    1 
ATOM   8323  C  C     . VAL N  3  40  ? -48.771  -25.046 -34.358 1.00 71.71  ? 34  VAL c C     1 
ATOM   8324  O  O     . VAL N  3  40  ? -48.266  -26.108 -34.679 1.00 72.49  ? 34  VAL c O     1 
ATOM   8325  C  CB    . VAL N  3  40  ? -48.740  -23.544 -36.364 1.00 83.29  ? 34  VAL c CB    1 
ATOM   8326  C  CG1   . VAL N  3  40  ? -49.580  -22.820 -37.415 1.00 90.72  ? 34  VAL c CG1   1 
ATOM   8327  C  CG2   . VAL N  3  40  ? -47.847  -22.509 -35.680 1.00 84.13  ? 34  VAL c CG2   1 
ATOM   8328  N  N     . SER N  3  41  ? -48.621  -24.531 -33.144 1.00 67.65  ? 35  SER c N     1 
ATOM   8329  C  CA    . SER N  3  41  ? -47.871  -25.226 -32.103 1.00 65.75  ? 35  SER c CA    1 
ATOM   8330  C  C     . SER N  3  41  ? -48.798  -26.141 -31.329 1.00 61.69  ? 35  SER c C     1 
ATOM   8331  O  O     . SER N  3  41  ? -48.492  -26.533 -30.217 1.00 67.18  ? 35  SER c O     1 
ATOM   8332  C  CB    . SER N  3  41  ? -47.292  -24.227 -31.102 1.00 65.72  ? 35  SER c CB    1 
ATOM   8333  O  OG    . SER N  3  41  ? -46.598  -23.234 -31.812 1.00 67.49  ? 35  SER c OG    1 
ATOM   8334  N  N     . MET N  3  42  ? -49.958  -26.432 -31.879 1.00 57.57  ? 36  MET c N     1 
ATOM   8335  C  CA    . MET N  3  42  ? -50.968  -27.249 -31.243 1.00 51.95  ? 36  MET c CA    1 
ATOM   8336  C  C     . MET N  3  42  ? -51.497  -26.605 -29.987 1.00 48.32  ? 36  MET c C     1 
ATOM   8337  O  O     . MET N  3  42  ? -52.241  -27.267 -29.283 1.00 46.84  ? 36  MET c O     1 
ATOM   8338  C  CB    . MET N  3  42  ? -50.470  -28.686 -30.982 1.00 47.84  ? 36  MET c CB    1 
ATOM   8339  C  CG    . MET N  3  42  ? -51.575  -29.731 -30.921 1.00 42.38  ? 36  MET c CG    1 
ATOM   8340  S  SD    . MET N  3  42  ? -50.910  -31.334 -31.445 1.00 38.72  ? 36  MET c SD    1 
ATOM   8341  C  CE    . MET N  3  42  ? -51.505  -31.955 -29.940 1.00 39.07  ? 36  MET c CE    1 
ATOM   8342  N  N     . ASN N  3  43  ? -51.198  -25.339 -29.738 1.00 45.12  ? 37  ASN c N     1 
ATOM   8343  C  CA    . ASN N  3  43  ? -51.876  -24.733 -28.626 1.00 48.40  ? 37  ASN c CA    1 
ATOM   8344  C  C     . ASN N  3  43  ? -53.365  -24.600 -28.902 1.00 48.42  ? 37  ASN c C     1 
ATOM   8345  O  O     . ASN N  3  43  ? -53.808  -24.327 -30.017 1.00 51.94  ? 37  ASN c O     1 
ATOM   8346  C  CB    . ASN N  3  43  ? -51.354  -23.363 -28.310 1.00 50.95  ? 37  ASN c CB    1 
ATOM   8347  C  CG    . ASN N  3  43  ? -49.939  -23.374 -27.916 1.00 50.96  ? 37  ASN c CG    1 
ATOM   8348  O  OD1   . ASN N  3  43  ? -49.466  -24.324 -27.336 1.00 66.15  ? 37  ASN c OD1   1 
ATOM   8349  N  ND2   . ASN N  3  43  ? -49.257  -22.306 -28.174 1.00 51.69  ? 37  ASN c ND2   1 
ATOM   8350  N  N     . THR N  3  44  ? -54.159  -24.814 -27.873 1.00 46.82  ? 38  THR c N     1 
ATOM   8351  C  CA    . THR N  3  44  ? -55.539  -25.092 -28.116 1.00 48.00  ? 38  THR c CA    1 
ATOM   8352  C  C     . THR N  3  44  ? -56.406  -24.317 -27.174 1.00 50.88  ? 38  THR c C     1 
ATOM   8353  O  O     . THR N  3  44  ? -56.151  -24.282 -25.972 1.00 54.61  ? 38  THR c O     1 
ATOM   8354  C  CB    . THR N  3  44  ? -55.798  -26.587 -28.004 1.00 48.62  ? 38  THR c CB    1 
ATOM   8355  O  OG1   . THR N  3  44  ? -55.046  -27.266 -29.003 1.00 43.50  ? 38  THR c OG1   1 
ATOM   8356  C  CG2   . THR N  3  44  ? -57.270  -26.888 -28.307 1.00 52.46  ? 38  THR c CG2   1 
ATOM   8357  N  N     . HIS N  3  45  ? -57.481  -23.746 -27.720 1.00 53.15  ? 39  HIS c N     1 
ATOM   8358  C  CA    . HIS N  3  45  ? -58.403  -22.903 -26.956 1.00 52.13  ? 39  HIS c CA    1 
ATOM   8359  C  C     . HIS N  3  45  ? -59.782  -23.479 -27.034 1.00 49.68  ? 39  HIS c C     1 
ATOM   8360  O  O     . HIS N  3  45  ? -60.146  -24.087 -28.046 1.00 50.48  ? 39  HIS c O     1 
ATOM   8361  C  CB    . HIS N  3  45  ? -58.362  -21.547 -27.538 1.00 55.00  ? 39  HIS c CB    1 
ATOM   8362  C  CG    . HIS N  3  45  ? -56.978  -21.002 -27.638 1.00 60.16  ? 39  HIS c CG    1 
ATOM   8363  N  ND1   . HIS N  3  45  ? -56.363  -20.326 -26.609 1.00 59.27  ? 39  HIS c ND1   1 
ATOM   8364  C  CD2   . HIS N  3  45  ? -56.076  -21.077 -28.645 1.00 65.44  ? 39  HIS c CD2   1 
ATOM   8365  C  CE1   . HIS N  3  45  ? -55.143  -19.991 -26.981 1.00 65.99  ? 39  HIS c CE1   1 
ATOM   8366  N  NE2   . HIS N  3  45  ? -54.938  -20.450 -28.206 1.00 70.33  ? 39  HIS c NE2   1 
ATOM   8367  N  N     . LEU N  3  46  ? -60.462  -23.493 -25.898 1.00 49.58  ? 40  LEU c N     1 
ATOM   8368  C  CA    . LEU N  3  46  ? -61.700  -24.230 -25.785 1.00 51.75  ? 40  LEU c CA    1 
ATOM   8369  C  C     . LEU N  3  46  ? -62.668  -23.338 -25.032 1.00 54.25  ? 40  LEU c C     1 
ATOM   8370  O  O     . LEU N  3  46  ? -62.231  -22.339 -24.399 1.00 56.59  ? 40  LEU c O     1 
ATOM   8371  C  CB    . LEU N  3  46  ? -61.491  -25.505 -25.021 1.00 52.42  ? 40  LEU c CB    1 
ATOM   8372  C  CG    . LEU N  3  46  ? -60.560  -26.522 -25.661 1.00 52.82  ? 40  LEU c CG    1 
ATOM   8373  C  CD1   . LEU N  3  46  ? -59.743  -27.212 -24.598 1.00 57.96  ? 40  LEU c CD1   1 
ATOM   8374  C  CD2   . LEU N  3  46  ? -61.354  -27.513 -26.394 1.00 52.18  ? 40  LEU c CD2   1 
ATOM   8375  N  N     . LYS N  3  47  ? -63.955  -23.656 -25.196 1.00 53.31  ? 41  LYS c N     1 
ATOM   8376  C  CA    . LYS N  3  47  ? -64.945  -22.742 -24.745 1.00 57.22  ? 41  LYS c CA    1 
ATOM   8377  C  C     . LYS N  3  47  ? -66.018  -23.219 -23.863 1.00 59.68  ? 41  LYS c C     1 
ATOM   8378  O  O     . LYS N  3  47  ? -66.580  -22.398 -23.113 1.00 79.89  ? 41  LYS c O     1 
ATOM   8379  C  CB    . LYS N  3  47  ? -65.536  -22.078 -25.967 1.00 63.95  ? 41  LYS c CB    1 
ATOM   8380  C  CG    . LYS N  3  47  ? -66.745  -21.206 -25.880 1.00 72.15  ? 41  LYS c CG    1 
ATOM   8381  C  CD    . LYS N  3  47  ? -67.091  -20.720 -27.330 1.00 85.67  ? 41  LYS c CD    1 
ATOM   8382  C  CE    . LYS N  3  47  ? -68.259  -21.378 -28.030 1.00 85.77  ? 41  LYS c CE    1 
ATOM   8383  N  NZ    . LYS N  3  47  ? -69.085  -22.278 -27.208 1.00 85.33  ? 41  LYS c NZ    1 
ATOM   8384  N  N     . ALA N  3  48  ? -66.329  -24.492 -23.799 1.00 56.55  ? 42  ALA c N     1 
ATOM   8385  C  CA    . ALA N  3  48  ? -67.365  -24.810 -22.779 1.00 57.30  ? 42  ALA c CA    1 
ATOM   8386  C  C     . ALA N  3  48  ? -66.952  -25.984 -21.974 1.00 57.04  ? 42  ALA c C     1 
ATOM   8387  O  O     . ALA N  3  48  ? -67.231  -27.096 -22.386 1.00 57.72  ? 42  ALA c O     1 
ATOM   8388  C  CB    . ALA N  3  48  ? -68.642  -25.099 -23.517 1.00 61.93  ? 42  ALA c CB    1 
ATOM   8389  N  N     . VAL N  3  49  ? -66.099  -25.731 -20.987 1.00 58.05  ? 43  VAL c N     1 
ATOM   8390  C  CA    . VAL N  3  49  ? -65.074  -26.730 -20.644 1.00 59.67  ? 43  VAL c CA    1 
ATOM   8391  C  C     . VAL N  3  49  ? -65.368  -27.415 -19.348 1.00 62.85  ? 43  VAL c C     1 
ATOM   8392  O  O     . VAL N  3  49  ? -65.860  -26.779 -18.423 1.00 77.08  ? 43  VAL c O     1 
ATOM   8393  C  CB    . VAL N  3  49  ? -63.721  -26.084 -20.483 1.00 62.92  ? 43  VAL c CB    1 
ATOM   8394  C  CG1   . VAL N  3  49  ? -62.731  -27.066 -19.915 1.00 67.91  ? 43  VAL c CG1   1 
ATOM   8395  C  CG2   . VAL N  3  49  ? -63.253  -25.584 -21.829 1.00 69.70  ? 43  VAL c CG2   1 
ATOM   8396  N  N     . LYS N  3  50  ? -65.152  -28.716 -19.310 1.00 60.78  ? 44  LYS c N     1 
ATOM   8397  C  CA    . LYS N  3  50  ? -65.245  -29.485 -18.096 1.00 61.75  ? 44  LYS c CA    1 
ATOM   8398  C  C     . LYS N  3  50  ? -63.858  -30.134 -17.951 1.00 65.45  ? 44  LYS c C     1 
ATOM   8399  O  O     . LYS N  3  50  ? -63.514  -31.120 -18.624 1.00 65.70  ? 44  LYS c O     1 
ATOM   8400  C  CB    . LYS N  3  50  ? -66.365  -30.498 -18.208 1.00 65.87  ? 44  LYS c CB    1 
ATOM   8401  C  CG    . LYS N  3  50  ? -66.318  -31.637 -17.198 1.00 76.01  ? 44  LYS c CG    1 
ATOM   8402  C  CD    . LYS N  3  50  ? -67.653  -31.952 -16.547 1.00 87.86  ? 44  LYS c CD    1 
ATOM   8403  C  CE    . LYS N  3  50  ? -68.707  -32.416 -17.545 1.00 102.68 ? 44  LYS c CE    1 
ATOM   8404  N  NZ    . LYS N  3  50  ? -68.348  -33.695 -18.223 1.00 104.59 ? 44  LYS c NZ    1 
ATOM   8405  N  N     . MET N  3  51  ? -63.069  -29.560 -17.048 1.00 62.02  ? 45  MET c N     1 
ATOM   8406  C  CA    . MET N  3  51  ? -61.714  -30.003 -16.745 1.00 58.90  ? 45  MET c CA    1 
ATOM   8407  C  C     . MET N  3  51  ? -61.715  -30.917 -15.528 1.00 58.70  ? 45  MET c C     1 
ATOM   8408  O  O     . MET N  3  51  ? -62.299  -30.599 -14.500 1.00 59.15  ? 45  MET c O     1 
ATOM   8409  C  CB    . MET N  3  51  ? -60.823  -28.802 -16.411 1.00 56.05  ? 45  MET c CB    1 
ATOM   8410  C  CG    . MET N  3  51  ? -59.311  -29.046 -16.476 1.00 49.97  ? 45  MET c CG    1 
ATOM   8411  S  SD    . MET N  3  51  ? -58.498  -27.462 -16.576 1.00 41.00  ? 45  MET c SD    1 
ATOM   8412  C  CE    . MET N  3  51  ? -58.421  -27.447 -14.804 1.00 41.63  ? 45  MET c CE    1 
ATOM   8413  N  N     . THR N  3  52  ? -61.014  -32.034 -15.638 1.00 57.97  ? 46  THR c N     1 
ATOM   8414  C  CA    . THR N  3  52  ? -61.053  -33.041 -14.593 1.00 56.20  ? 46  THR c CA    1 
ATOM   8415  C  C     . THR N  3  52  ? -59.636  -33.448 -14.314 1.00 55.49  ? 46  THR c C     1 
ATOM   8416  O  O     . THR N  3  52  ? -59.095  -34.365 -14.955 1.00 67.77  ? 46  THR c O     1 
ATOM   8417  C  CB    . THR N  3  52  ? -61.882  -34.249 -15.092 1.00 57.31  ? 46  THR c CB    1 
ATOM   8418  O  OG1   . THR N  3  52  ? -62.978  -33.820 -15.913 1.00 53.53  ? 46  THR c OG1   1 
ATOM   8419  C  CG2   . THR N  3  52  ? -62.371  -35.058 -13.927 1.00 59.01  ? 46  THR c CG2   1 
ATOM   8420  N  N     . LEU N  3  53  ? -59.018  -32.760 -13.389 1.00 51.52  ? 47  LEU c N     1 
ATOM   8421  C  CA    . LEU N  3  53  ? -57.660  -33.064 -13.081 1.00 53.19  ? 47  LEU c CA    1 
ATOM   8422  C  C     . LEU N  3  53  ? -57.595  -34.479 -12.497 1.00 58.34  ? 47  LEU c C     1 
ATOM   8423  O  O     . LEU N  3  53  ? -58.584  -34.974 -12.011 1.00 62.91  ? 47  LEU c O     1 
ATOM   8424  C  CB    . LEU N  3  53  ? -57.132  -32.071 -12.071 1.00 52.48  ? 47  LEU c CB    1 
ATOM   8425  C  CG    . LEU N  3  53  ? -57.006  -30.673 -12.647 1.00 53.34  ? 47  LEU c CG    1 
ATOM   8426  C  CD1   . LEU N  3  53  ? -56.870  -29.735 -11.464 1.00 54.57  ? 47  LEU c CD1   1 
ATOM   8427  C  CD2   . LEU N  3  53  ? -55.777  -30.446 -13.507 1.00 63.91  ? 47  LEU c CD2   1 
ATOM   8428  N  N     . LYS N  3  54  ? -56.433  -35.130 -12.524 1.00 65.30  ? 48  LYS c N     1 
ATOM   8429  C  CA    . LYS N  3  54  ? -56.335  -36.523 -12.118 1.00 64.67  ? 48  LYS c CA    1 
ATOM   8430  C  C     . LYS N  3  54  ? -56.793  -36.688 -10.696 1.00 61.97  ? 48  LYS c C     1 
ATOM   8431  O  O     . LYS N  3  54  ? -56.338  -35.963 -9.801  1.00 56.36  ? 48  LYS c O     1 
ATOM   8432  C  CB    . LYS N  3  54  ? -54.897  -37.082 -12.274 1.00 74.80  ? 48  LYS c CB    1 
ATOM   8433  C  CG    . LYS N  3  54  ? -54.784  -38.612 -12.269 1.00 82.12  ? 48  LYS c CG    1 
ATOM   8434  C  CD    . LYS N  3  54  ? -55.597  -39.245 -13.399 1.00 89.94  ? 48  LYS c CD    1 
ATOM   8435  C  CE    . LYS N  3  54  ? -55.855  -40.739 -13.276 1.00 87.90  ? 48  LYS c CE    1 
ATOM   8436  N  NZ    . LYS N  3  54  ? -54.980  -41.387 -14.270 1.00 94.16  ? 48  LYS c NZ    1 
ATOM   8437  N  N     . ASN N  3  55  ? -57.721  -37.627 -10.505 1.00 64.19  ? 49  ASN c N     1 
ATOM   8438  C  CA    . ASN N  3  55  ? -58.332  -37.895 -9.201  1.00 66.72  ? 49  ASN c CA    1 
ATOM   8439  C  C     . ASN N  3  55  ? -58.847  -36.632 -8.505  1.00 69.82  ? 49  ASN c C     1 
ATOM   8440  O  O     . ASN N  3  55  ? -58.475  -36.302 -7.377  1.00 79.07  ? 49  ASN c O     1 
ATOM   8441  C  CB    . ASN N  3  55  ? -57.321  -38.555 -8.267  1.00 69.82  ? 49  ASN c CB    1 
ATOM   8442  C  CG    . ASN N  3  55  ? -56.550  -39.667 -8.896  1.00 72.52  ? 49  ASN c CG    1 
ATOM   8443  O  OD1   . ASN N  3  55  ? -55.358  -39.847 -8.576  1.00 72.96  ? 49  ASN c OD1   1 
ATOM   8444  N  ND2   . ASN N  3  55  ? -57.198  -40.412 -9.791  1.00 74.34  ? 49  ASN c ND2   1 
ATOM   8445  N  N     . ARG N  3  56  ? -59.566  -35.820 -9.246  1.00 71.49  ? 50  ARG c N     1 
ATOM   8446  C  CA    . ARG N  3  56  ? -60.251  -34.679 -8.663  1.00 74.95  ? 50  ARG c CA    1 
ATOM   8447  C  C     . ARG N  3  56  ? -61.622  -34.588 -9.323  1.00 77.03  ? 50  ARG c C     1 
ATOM   8448  O  O     . ARG N  3  56  ? -61.850  -35.188 -10.400 1.00 67.35  ? 50  ARG c O     1 
ATOM   8449  C  CB    . ARG N  3  56  ? -59.501  -33.372 -8.836  1.00 71.25  ? 50  ARG c CB    1 
ATOM   8450  C  CG    . ARG N  3  56  ? -58.147  -33.344 -8.226  1.00 76.19  ? 50  ARG c CG    1 
ATOM   8451  C  CD    . ARG N  3  56  ? -57.790  -31.880 -8.012  1.00 89.62  ? 50  ARG c CD    1 
ATOM   8452  N  NE    . ARG N  3  56  ? -57.636  -31.669 -6.581  1.00 100.27 ? 50  ARG c NE    1 
ATOM   8453  C  CZ    . ARG N  3  56  ? -56.491  -31.873 -5.920  1.00 116.68 ? 50  ARG c CZ    1 
ATOM   8454  N  NH1   . ARG N  3  56  ? -55.356  -32.258 -6.535  1.00 121.59 ? 50  ARG c NH1   1 
ATOM   8455  N  NH2   . ARG N  3  56  ? -56.453  -31.651 -4.604  1.00 122.78 ? 50  ARG c NH2   1 
ATOM   8456  N  N     . GLU N  3  57  ? -62.496  -33.827 -8.659  1.00 75.01  ? 51  GLU c N     1 
ATOM   8457  C  CA    . GLU N  3  57  ? -63.859  -33.717 -9.112  1.00 75.98  ? 51  GLU c CA    1 
ATOM   8458  C  C     . GLU N  3  57  ? -63.791  -32.734 -10.258 1.00 64.76  ? 51  GLU c C     1 
ATOM   8459  O  O     . GLU N  3  57  ? -62.929  -31.858 -10.300 1.00 69.27  ? 51  GLU c O     1 
ATOM   8460  C  CB    . GLU N  3  57  ? -64.812  -33.332 -7.973  1.00 92.93  ? 51  GLU c CB    1 
ATOM   8461  C  CG    . GLU N  3  57  ? -64.895  -31.830 -7.648  1.00 110.36 ? 51  GLU c CG    1 
ATOM   8462  C  CD    . GLU N  3  57  ? -66.015  -31.483 -6.639  1.00 119.11 ? 51  GLU c CD    1 
ATOM   8463  O  OE1   . GLU N  3  57  ? -66.834  -32.369 -6.294  1.00 125.87 ? 51  GLU c OE1   1 
ATOM   8464  O  OE2   . GLU N  3  57  ? -66.118  -30.319 -6.174  1.00 111.37 ? 51  GLU c OE2   1 
ATOM   8465  N  N     . PRO N  3  58  ? -64.675  -32.898 -11.236 1.00 56.90  ? 52  PRO c N     1 
ATOM   8466  C  CA    . PRO N  3  58  ? -64.721  -31.991 -12.369 1.00 54.37  ? 52  PRO c CA    1 
ATOM   8467  C  C     . PRO N  3  58  ? -64.994  -30.579 -11.988 1.00 53.91  ? 52  PRO c C     1 
ATOM   8468  O  O     . PRO N  3  58  ? -65.445  -30.342 -10.885 1.00 56.79  ? 52  PRO c O     1 
ATOM   8469  C  CB    . PRO N  3  58  ? -65.925  -32.487 -13.152 1.00 53.84  ? 52  PRO c CB    1 
ATOM   8470  C  CG    . PRO N  3  58  ? -65.842  -33.957 -12.975 1.00 55.82  ? 52  PRO c CG    1 
ATOM   8471  C  CD    . PRO N  3  58  ? -65.461  -34.109 -11.520 1.00 57.65  ? 52  PRO c CD    1 
ATOM   8472  N  N     . VAL N  3  59  ? -64.693  -29.674 -12.905 1.00 53.57  ? 53  VAL c N     1 
ATOM   8473  C  CA    . VAL N  3  59  ? -64.785  -28.259 -12.689 1.00 55.38  ? 53  VAL c CA    1 
ATOM   8474  C  C     . VAL N  3  59  ? -65.188  -27.696 -14.008 1.00 61.00  ? 53  VAL c C     1 
ATOM   8475  O  O     . VAL N  3  59  ? -64.546  -28.021 -15.016 1.00 72.87  ? 53  VAL c O     1 
ATOM   8476  C  CB    . VAL N  3  59  ? -63.403  -27.750 -12.386 1.00 55.53  ? 53  VAL c CB    1 
ATOM   8477  C  CG1   . VAL N  3  59  ? -63.277  -26.248 -12.311 1.00 56.13  ? 53  VAL c CG1   1 
ATOM   8478  C  CG2   . VAL N  3  59  ? -62.959  -28.368 -11.064 1.00 64.34  ? 53  VAL c CG2   1 
ATOM   8479  N  N     . GLN N  3  60  ? -66.187  -26.810 -14.012 1.00 63.44  ? 54  GLN c N     1 
ATOM   8480  C  CA    . GLN N  3  60  ? -66.643  -26.197 -15.267 1.00 65.24  ? 54  GLN c CA    1 
ATOM   8481  C  C     . GLN N  3  60  ? -66.050  -24.825 -15.501 1.00 61.69  ? 54  GLN c C     1 
ATOM   8482  O  O     . GLN N  3  60  ? -65.843  -24.103 -14.555 1.00 61.28  ? 54  GLN c O     1 
ATOM   8483  C  CB    . GLN N  3  60  ? -68.135  -26.259 -15.428 1.00 66.27  ? 54  GLN c CB    1 
ATOM   8484  C  CG    . GLN N  3  60  ? -68.510  -27.727 -15.296 1.00 78.72  ? 54  GLN c CG    1 
ATOM   8485  C  CD    . GLN N  3  60  ? -69.766  -28.137 -16.020 1.00 92.74  ? 54  GLN c CD    1 
ATOM   8486  O  OE1   . GLN N  3  60  ? -69.859  -29.231 -16.541 1.00 82.11  ? 54  GLN c OE1   1 
ATOM   8487  N  NE2   . GLN N  3  60  ? -70.810  -27.313 -15.892 1.00 112.56 ? 54  GLN c NE2   1 
ATOM   8488  N  N     . LEU N  3  61  ? -65.693  -24.534 -16.743 1.00 56.92  ? 55  LEU c N     1 
ATOM   8489  C  CA    . LEU N  3  61  ? -65.017  -23.323 -17.061 1.00 59.15  ? 55  LEU c CA    1 
ATOM   8490  C  C     . LEU N  3  61  ? -65.510  -22.753 -18.379 1.00 60.60  ? 55  LEU c C     1 
ATOM   8491  O  O     . LEU N  3  61  ? -65.717  -23.496 -19.329 1.00 65.50  ? 55  LEU c O     1 
ATOM   8492  C  CB    . LEU N  3  61  ? -63.504  -23.542 -17.173 1.00 59.98  ? 55  LEU c CB    1 
ATOM   8493  C  CG    . LEU N  3  61  ? -62.749  -24.262 -16.099 1.00 59.68  ? 55  LEU c CG    1 
ATOM   8494  C  CD1   . LEU N  3  61  ? -61.333  -24.387 -16.574 1.00 64.38  ? 55  LEU c CD1   1 
ATOM   8495  C  CD2   . LEU N  3  61  ? -62.745  -23.497 -14.806 1.00 62.30  ? 55  LEU c CD2   1 
ATOM   8496  N  N     . GLU N  3  62  ? -65.511  -21.428 -18.460 1.00 59.37  ? 56  GLU c N     1 
ATOM   8497  C  CA    . GLU N  3  62  ? -66.002  -20.724 -19.601 1.00 64.61  ? 56  GLU c CA    1 
ATOM   8498  C  C     . GLU N  3  62  ? -65.005  -20.824 -20.726 1.00 60.33  ? 56  GLU c C     1 
ATOM   8499  O  O     . GLU N  3  62  ? -65.292  -20.620 -21.886 1.00 61.93  ? 56  GLU c O     1 
ATOM   8500  C  CB    . GLU N  3  62  ? -66.294  -19.261 -19.195 1.00 77.59  ? 56  GLU c CB    1 
ATOM   8501  C  CG    . GLU N  3  62  ? -67.649  -18.750 -19.797 1.00 92.94  ? 56  GLU c CG    1 
ATOM   8502  C  CD    . GLU N  3  62  ? -68.821  -19.395 -19.032 1.00 100.89 ? 56  GLU c CD    1 
ATOM   8503  O  OE1   . GLU N  3  62  ? -69.415  -20.407 -19.536 1.00 100.32 ? 56  GLU c OE1   1 
ATOM   8504  O  OE2   . GLU N  3  62  ? -69.092  -18.906 -17.893 1.00 103.53 ? 56  GLU c OE2   1 
ATOM   8505  N  N     . THR N  3  63  ? -63.772  -21.089 -20.389 1.00 62.81  ? 57  THR c N     1 
ATOM   8506  C  CA    . THR N  3  63  ? -62.694  -20.848 -21.313 1.00 64.48  ? 57  THR c CA    1 
ATOM   8507  C  C     . THR N  3  63  ? -61.444  -21.572 -20.783 1.00 62.98  ? 57  THR c C     1 
ATOM   8508  O  O     . THR N  3  63  ? -61.226  -21.660 -19.588 1.00 59.64  ? 57  THR c O     1 
ATOM   8509  C  CB    . THR N  3  63  ? -62.442  -19.334 -21.417 1.00 61.13  ? 57  THR c CB    1 
ATOM   8510  O  OG1   . THR N  3  63  ? -61.263  -19.166 -22.204 1.00 72.64  ? 57  THR c OG1   1 
ATOM   8511  C  CG2   . THR N  3  63  ? -62.233  -18.705 -20.040 1.00 58.72  ? 57  THR c CG2   1 
ATOM   8512  N  N     . LEU N  3  64  ? -60.666  -22.145 -21.692 1.00 64.78  ? 58  LEU c N     1 
ATOM   8513  C  CA    . LEU N  3  64  ? -59.411  -22.758 -21.307 1.00 61.60  ? 58  LEU c CA    1 
ATOM   8514  C  C     . LEU N  3  64  ? -58.496  -22.805 -22.492 1.00 62.82  ? 58  LEU c C     1 
ATOM   8515  O  O     . LEU N  3  64  ? -58.938  -23.209 -23.575 1.00 70.84  ? 58  LEU c O     1 
ATOM   8516  C  CB    . LEU N  3  64  ? -59.681  -24.198 -20.869 1.00 56.63  ? 58  LEU c CB    1 
ATOM   8517  C  CG    . LEU N  3  64  ? -58.427  -24.941 -20.417 1.00 47.08  ? 58  LEU c CG    1 
ATOM   8518  C  CD1   . LEU N  3  64  ? -57.999  -24.422 -19.056 1.00 42.79  ? 58  LEU c CD1   1 
ATOM   8519  C  CD2   . LEU N  3  64  ? -58.707  -26.428 -20.461 1.00 45.80  ? 58  LEU c CD2   1 
ATOM   8520  N  N     . SER N  3  65  ? -57.239  -22.449 -22.259 1.00 59.25  ? 59  SER c N     1 
ATOM   8521  C  CA    . SER N  3  65  ? -56.194  -22.600 -23.260 1.00 59.17  ? 59  SER c CA    1 
ATOM   8522  C  C     . SER N  3  65  ? -55.103  -23.546 -22.756 1.00 59.36  ? 59  SER c C     1 
ATOM   8523  O  O     . SER N  3  65  ? -54.751  -23.521 -21.589 1.00 66.93  ? 59  SER c O     1 
ATOM   8524  C  CB    . SER N  3  65  ? -55.606  -21.251 -23.555 1.00 63.81  ? 59  SER c CB    1 
ATOM   8525  O  OG    . SER N  3  65  ? -56.641  -20.278 -23.710 1.00 79.26  ? 59  SER c OG    1 
ATOM   8526  N  N     . ILE N  3  66  ? -54.553  -24.382 -23.623 1.00 53.06  ? 60  ILE c N     1 
ATOM   8527  C  CA    . ILE N  3  66  ? -53.663  -25.460 -23.266 1.00 46.56  ? 60  ILE c CA    1 
ATOM   8528  C  C     . ILE N  3  66  ? -52.450  -25.328 -24.159 1.00 45.44  ? 60  ILE c C     1 
ATOM   8529  O  O     . ILE N  3  66  ? -52.578  -25.347 -25.375 1.00 48.83  ? 60  ILE c O     1 
ATOM   8530  C  CB    . ILE N  3  66  ? -54.321  -26.799 -23.590 1.00 46.83  ? 60  ILE c CB    1 
ATOM   8531  C  CG1   . ILE N  3  66  ? -55.645  -26.941 -22.822 1.00 48.57  ? 60  ILE c CG1   1 
ATOM   8532  C  CG2   . ILE N  3  66  ? -53.400  -27.928 -23.203 1.00 48.12  ? 60  ILE c CG2   1 
ATOM   8533  C  CD1   . ILE N  3  66  ? -56.448  -28.205 -23.125 1.00 47.44  ? 60  ILE c CD1   1 
ATOM   8534  N  N     . ARG N  3  67  ? -51.264  -25.262 -23.576 1.00 45.99  ? 61  ARG c N     1 
ATOM   8535  C  CA    . ARG N  3  67  ? -50.017  -25.215 -24.341 1.00 43.80  ? 61  ARG c CA    1 
ATOM   8536  C  C     . ARG N  3  67  ? -49.791  -26.599 -24.921 1.00 40.94  ? 61  ARG c C     1 
ATOM   8537  O  O     . ARG N  3  67  ? -49.782  -27.586 -24.236 1.00 38.69  ? 61  ARG c O     1 
ATOM   8538  C  CB    . ARG N  3  67  ? -48.828  -24.806 -23.500 1.00 43.89  ? 61  ARG c CB    1 
ATOM   8539  C  CG    . ARG N  3  67  ? -47.562  -24.414 -24.259 1.00 44.70  ? 61  ARG c CG    1 
ATOM   8540  C  CD    . ARG N  3  67  ? -46.422  -24.194 -23.223 1.00 47.11  ? 61  ARG c CD    1 
ATOM   8541  N  NE    . ARG N  3  67  ? -45.189  -23.575 -23.691 1.00 44.66  ? 61  ARG c NE    1 
ATOM   8542  C  CZ    . ARG N  3  67  ? -44.234  -24.225 -24.332 1.00 46.05  ? 61  ARG c CZ    1 
ATOM   8543  N  NH1   . ARG N  3  67  ? -43.206  -23.562 -24.808 1.00 49.32  ? 61  ARG c NH1   1 
ATOM   8544  N  NH2   . ARG N  3  67  ? -44.291  -25.510 -24.561 1.00 48.61  ? 61  ARG c NH2   1 
ATOM   8545  N  N     . GLY N  3  68  ? -49.615  -26.644 -26.221 1.00 42.48  ? 62  GLY c N     1 
ATOM   8546  C  CA    . GLY N  3  68  ? -49.846  -27.845 -27.026 1.00 44.09  ? 62  GLY c CA    1 
ATOM   8547  C  C     . GLY N  3  68  ? -48.963  -29.048 -26.719 1.00 42.94  ? 62  GLY c C     1 
ATOM   8548  O  O     . GLY N  3  68  ? -49.383  -30.175 -26.906 1.00 39.54  ? 62  GLY c O     1 
ATOM   8549  N  N     . ASN N  3  69  ? -47.732  -28.773 -26.301 1.00 40.99  ? 63  ASN c N     1 
ATOM   8550  C  CA    . ASN N  3  69  ? -46.872  -29.812 -25.906 1.00 42.05  ? 63  ASN c CA    1 
ATOM   8551  C  C     . ASN N  3  69  ? -47.489  -30.713 -24.824 1.00 43.58  ? 63  ASN c C     1 
ATOM   8552  O  O     . ASN N  3  69  ? -47.159  -31.894 -24.739 1.00 44.90  ? 63  ASN c O     1 
ATOM   8553  C  CB    . ASN N  3  69  ? -45.618  -29.184 -25.370 1.00 44.45  ? 63  ASN c CB    1 
ATOM   8554  C  CG    . ASN N  3  69  ? -45.861  -28.534 -24.052 1.00 47.35  ? 63  ASN c CG    1 
ATOM   8555  O  OD1   . ASN N  3  69  ? -46.304  -27.411 -23.964 1.00 50.51  ? 63  ASN c OD1   1 
ATOM   8556  N  ND2   . ASN N  3  69  ? -45.608  -29.277 -22.989 1.00 57.10  ? 63  ASN c ND2   1 
ATOM   8557  N  N     . ASN N  3  70  ? -48.367  -30.162 -23.993 1.00 42.89  ? 64  ASN c N     1 
ATOM   8558  C  CA    . ASN N  3  70  ? -49.061  -30.914 -22.959 1.00 43.50  ? 64  ASN c CA    1 
ATOM   8559  C  C     . ASN N  3  70  ? -50.133  -31.903 -23.424 1.00 42.70  ? 64  ASN c C     1 
ATOM   8560  O  O     . ASN N  3  70  ? -50.622  -32.710 -22.629 1.00 43.83  ? 64  ASN c O     1 
ATOM   8561  C  CB    . ASN N  3  70  ? -49.709  -29.968 -21.979 1.00 44.47  ? 64  ASN c CB    1 
ATOM   8562  C  CG    . ASN N  3  70  ? -48.698  -29.295 -21.108 1.00 47.30  ? 64  ASN c CG    1 
ATOM   8563  O  OD1   . ASN N  3  70  ? -48.156  -29.970 -20.260 1.00 58.83  ? 64  ASN c OD1   1 
ATOM   8564  N  ND2   . ASN N  3  70  ? -48.433  -28.015 -21.282 1.00 46.85  ? 64  ASN c ND2   1 
ATOM   8565  N  N     . ILE N  3  71  ? -50.496  -31.851 -24.688 1.00 40.30  ? 65  ILE c N     1 
ATOM   8566  C  CA    . ILE N  3  71  ? -51.551  -32.704 -25.153 1.00 42.90  ? 65  ILE c CA    1 
ATOM   8567  C  C     . ILE N  3  71  ? -51.069  -34.063 -25.516 1.00 42.62  ? 65  ILE c C     1 
ATOM   8568  O  O     . ILE N  3  71  ? -50.065  -34.212 -26.147 1.00 48.86  ? 65  ILE c O     1 
ATOM   8569  C  CB    . ILE N  3  71  ? -52.176  -32.108 -26.391 1.00 44.53  ? 65  ILE c CB    1 
ATOM   8570  C  CG1   . ILE N  3  71  ? -52.922  -30.825 -25.986 1.00 43.95  ? 65  ILE c CG1   1 
ATOM   8571  C  CG2   . ILE N  3  71  ? -53.058  -33.158 -27.086 1.00 43.93  ? 65  ILE c CG2   1 
ATOM   8572  C  CD1   . ILE N  3  71  ? -53.404  -30.052 -27.203 1.00 49.20  ? 65  ILE c CD1   1 
ATOM   8573  N  N     . ARG N  3  72  ? -51.790  -35.087 -25.150 1.00 44.24  ? 66  ARG c N     1 
ATOM   8574  C  CA    . ARG N  3  72  ? -51.377  -36.470 -25.456 1.00 46.16  ? 66  ARG c CA    1 
ATOM   8575  C  C     . ARG N  3  72  ? -52.281  -36.802 -26.576 1.00 45.44  ? 66  ARG c C     1 
ATOM   8576  O  O     . ARG N  3  72  ? -51.779  -37.189 -27.620 1.00 49.67  ? 66  ARG c O     1 
ATOM   8577  C  CB    . ARG N  3  72  ? -51.514  -37.386 -24.236 1.00 47.89  ? 66  ARG c CB    1 
ATOM   8578  C  CG    . ARG N  3  72  ? -51.431  -38.858 -24.454 1.00 49.09  ? 66  ARG c CG    1 
ATOM   8579  C  CD    . ARG N  3  72  ? -50.031  -39.371 -24.576 1.00 55.75  ? 66  ARG c CD    1 
ATOM   8580  N  NE    . ARG N  3  72  ? -48.899  -38.919 -23.719 1.00 56.26  ? 66  ARG c NE    1 
ATOM   8581  C  CZ    . ARG N  3  72  ? -48.820  -39.023 -22.407 1.00 52.93  ? 66  ARG c CZ    1 
ATOM   8582  N  NH1   . ARG N  3  72  ? -47.729  -38.656 -21.824 1.00 54.14  ? 66  ARG c NH1   1 
ATOM   8583  N  NH2   . ARG N  3  72  ? -49.842  -39.360 -21.667 1.00 52.70  ? 66  ARG c NH2   1 
ATOM   8584  N  N     . TYR N  3  73  ? -53.588  -36.652 -26.384 1.00 47.95  ? 67  TYR c N     1 
ATOM   8585  C  CA    . TYR N  3  73  ? -54.478  -36.743 -27.526 1.00 51.91  ? 67  TYR c CA    1 
ATOM   8586  C  C     . TYR N  3  73  ? -55.829  -36.081 -27.520 1.00 46.85  ? 67  TYR c C     1 
ATOM   8587  O  O     . TYR N  3  73  ? -56.277  -35.763 -26.471 1.00 47.55  ? 67  TYR c O     1 
ATOM   8588  C  CB    . TYR N  3  73  ? -54.681  -38.178 -27.945 1.00 59.52  ? 67  TYR c CB    1 
ATOM   8589  C  CG    . TYR N  3  73  ? -54.993  -39.161 -26.878 1.00 65.84  ? 67  TYR c CG    1 
ATOM   8590  C  CD1   . TYR N  3  73  ? -56.262  -39.205 -26.380 1.00 68.87  ? 67  TYR c CD1   1 
ATOM   8591  C  CD2   . TYR N  3  73  ? -54.061  -40.158 -26.498 1.00 66.69  ? 67  TYR c CD2   1 
ATOM   8592  C  CE1   . TYR N  3  73  ? -56.586  -40.158 -25.448 1.00 75.02  ? 67  TYR c CE1   1 
ATOM   8593  C  CE2   . TYR N  3  73  ? -54.381  -41.110 -25.575 1.00 66.66  ? 67  TYR c CE2   1 
ATOM   8594  C  CZ    . TYR N  3  73  ? -55.650  -41.094 -25.038 1.00 73.29  ? 67  TYR c CZ    1 
ATOM   8595  O  OH    . TYR N  3  73  ? -56.115  -41.966 -24.082 1.00 84.04  ? 67  TYR c OH    1 
ATOM   8596  N  N     . PHE N  3  74  ? -56.350  -35.812 -28.722 1.00 42.97  ? 68  PHE c N     1 
ATOM   8597  C  CA    . PHE N  3  74  ? -57.674  -35.337 -28.994 1.00 41.78  ? 68  PHE c CA    1 
ATOM   8598  C  C     . PHE N  3  74  ? -58.534  -36.541 -29.302 1.00 43.75  ? 68  PHE c C     1 
ATOM   8599  O  O     . PHE N  3  74  ? -58.191  -37.344 -30.173 1.00 41.20  ? 68  PHE c O     1 
ATOM   8600  C  CB    . PHE N  3  74  ? -57.765  -34.517 -30.247 1.00 41.68  ? 68  PHE c CB    1 
ATOM   8601  C  CG    . PHE N  3  74  ? -57.220  -33.150 -30.115 1.00 46.02  ? 68  PHE c CG    1 
ATOM   8602  C  CD1   . PHE N  3  74  ? -55.857  -32.926 -30.000 1.00 46.04  ? 68  PHE c CD1   1 
ATOM   8603  C  CD2   . PHE N  3  74  ? -58.072  -32.045 -30.206 1.00 48.77  ? 68  PHE c CD2   1 
ATOM   8604  C  CE1   . PHE N  3  74  ? -55.375  -31.631 -29.889 1.00 46.86  ? 68  PHE c CE1   1 
ATOM   8605  C  CE2   . PHE N  3  74  ? -57.597  -30.746 -30.048 1.00 48.50  ? 68  PHE c CE2   1 
ATOM   8606  C  CZ    . PHE N  3  74  ? -56.245  -30.542 -29.871 1.00 47.95  ? 68  PHE c CZ    1 
ATOM   8607  N  N     . ILE N  3  75  ? -59.686  -36.650 -28.628 1.00 47.31  ? 69  ILE c N     1 
ATOM   8608  C  CA    . ILE N  3  75  ? -60.692  -37.635 -28.970 1.00 47.94  ? 69  ILE c CA    1 
ATOM   8609  C  C     . ILE N  3  75  ? -61.760  -36.894 -29.742 1.00 50.88  ? 69  ILE c C     1 
ATOM   8610  O  O     . ILE N  3  75  ? -62.416  -36.040 -29.209 1.00 53.27  ? 69  ILE c O     1 
ATOM   8611  C  CB    . ILE N  3  75  ? -61.272  -38.275 -27.743 1.00 45.97  ? 69  ILE c CB    1 
ATOM   8612  C  CG1   . ILE N  3  75  ? -60.203  -39.151 -27.131 1.00 48.82  ? 69  ILE c CG1   1 
ATOM   8613  C  CG2   . ILE N  3  75  ? -62.361  -39.222 -28.178 1.00 46.61  ? 69  ILE c CG2   1 
ATOM   8614  C  CD1   . ILE N  3  75  ? -60.578  -39.744 -25.806 1.00 54.55  ? 69  ILE c CD1   1 
ATOM   8615  N  N     . LEU N  3  76  ? -62.003  -37.335 -30.960 1.00 50.82  ? 70  LEU c N     1 
ATOM   8616  C  CA    . LEU N  3  76  ? -62.813  -36.606 -31.867 1.00 51.32  ? 70  LEU c CA    1 
ATOM   8617  C  C     . LEU N  3  76  ? -64.217  -37.160 -31.889 1.00 51.76  ? 70  LEU c C     1 
ATOM   8618  O  O     . LEU N  3  76  ? -64.425  -38.324 -31.597 1.00 58.00  ? 70  LEU c O     1 
ATOM   8619  C  CB    . LEU N  3  76  ? -62.197  -36.702 -33.265 1.00 55.16  ? 70  LEU c CB    1 
ATOM   8620  C  CG    . LEU N  3  76  ? -60.736  -36.217 -33.261 1.00 58.02  ? 70  LEU c CG    1 
ATOM   8621  C  CD1   . LEU N  3  76  ? -60.026  -36.431 -34.583 1.00 58.41  ? 70  LEU c CD1   1 
ATOM   8622  C  CD2   . LEU N  3  76  ? -60.654  -34.775 -32.793 1.00 57.60  ? 70  LEU c CD2   1 
ATOM   8623  N  N     . PRO N  3  77  ? -65.188  -36.342 -32.297 1.00 51.33  ? 71  PRO c N     1 
ATOM   8624  C  CA    . PRO N  3  77  ? -66.534  -36.728 -32.524 1.00 50.46  ? 71  PRO c CA    1 
ATOM   8625  C  C     . PRO N  3  77  ? -66.619  -37.948 -33.407 1.00 52.22  ? 71  PRO c C     1 
ATOM   8626  O  O     . PRO N  3  77  ? -65.980  -37.946 -34.444 1.00 49.59  ? 71  PRO c O     1 
ATOM   8627  C  CB    . PRO N  3  77  ? -67.100  -35.540 -33.283 1.00 50.99  ? 71  PRO c CB    1 
ATOM   8628  C  CG    . PRO N  3  77  ? -66.351  -34.371 -32.760 1.00 51.95  ? 71  PRO c CG    1 
ATOM   8629  C  CD    . PRO N  3  77  ? -64.995  -34.905 -32.567 1.00 53.74  ? 71  PRO c CD    1 
ATOM   8630  N  N     . ASP N  3  78  ? -67.500  -38.881 -33.040 1.00 54.65  ? 72  ASP c N     1 
ATOM   8631  C  CA    . ASP N  3  78  ? -67.728  -40.103 -33.783 1.00 55.81  ? 72  ASP c CA    1 
ATOM   8632  C  C     . ASP N  3  78  ? -68.053  -39.874 -35.248 1.00 57.08  ? 72  ASP c C     1 
ATOM   8633  O  O     . ASP N  3  78  ? -67.642  -40.626 -36.097 1.00 57.78  ? 72  ASP c O     1 
ATOM   8634  C  CB    . ASP N  3  78  ? -68.878  -40.918 -33.134 1.00 61.13  ? 72  ASP c CB    1 
ATOM   8635  C  CG    . ASP N  3  78  ? -68.435  -41.659 -31.876 1.00 68.01  ? 72  ASP c CG    1 
ATOM   8636  O  OD1   . ASP N  3  78  ? -67.398  -41.265 -31.298 1.00 78.97  ? 72  ASP c OD1   1 
ATOM   8637  O  OD2   . ASP N  3  78  ? -69.102  -42.619 -31.438 1.00 69.16  ? 72  ASP c OD2   1 
ATOM   8638  N  N     . SER N  3  79  ? -68.785  -38.813 -35.524 1.00 62.98  ? 73  SER c N     1 
ATOM   8639  C  CA    . SER N  3  79  ? -69.276  -38.468 -36.839 1.00 67.48  ? 73  SER c CA    1 
ATOM   8640  C  C     . SER N  3  79  ? -68.332  -37.603 -37.666 1.00 64.96  ? 73  SER c C     1 
ATOM   8641  O  O     . SER N  3  79  ? -68.619  -37.288 -38.807 1.00 65.74  ? 73  SER c O     1 
ATOM   8642  C  CB    . SER N  3  79  ? -70.559  -37.666 -36.582 1.00 74.21  ? 73  SER c CB    1 
ATOM   8643  O  OG    . SER N  3  79  ? -70.289  -36.311 -36.178 1.00 84.24  ? 73  SER c OG    1 
ATOM   8644  N  N     . LEU N  3  80  ? -67.261  -37.096 -37.068 1.00 66.43  ? 74  LEU c N     1 
ATOM   8645  C  CA    . LEU N  3  80  ? -66.421  -36.059 -37.698 1.00 65.86  ? 74  LEU c CA    1 
ATOM   8646  C  C     . LEU N  3  80  ? -65.943  -36.552 -39.056 1.00 64.61  ? 74  LEU c C     1 
ATOM   8647  O  O     . LEU N  3  80  ? -65.368  -37.637 -39.111 1.00 75.98  ? 74  LEU c O     1 
ATOM   8648  C  CB    . LEU N  3  80  ? -65.183  -35.808 -36.846 1.00 64.38  ? 74  LEU c CB    1 
ATOM   8649  C  CG    . LEU N  3  80  ? -64.197  -34.766 -37.321 1.00 66.71  ? 74  LEU c CG    1 
ATOM   8650  C  CD1   . LEU N  3  80  ? -64.799  -33.381 -37.183 1.00 67.09  ? 74  LEU c CD1   1 
ATOM   8651  C  CD2   . LEU N  3  80  ? -62.940  -34.857 -36.470 1.00 72.07  ? 74  LEU c CD2   1 
ATOM   8652  N  N     . PRO N  3  81  ? -66.206  -35.835 -40.151 1.00 57.63  ? 75  PRO c N     1 
ATOM   8653  C  CA    . PRO N  3  81  ? -65.962  -36.322 -41.514 1.00 61.41  ? 75  PRO c CA    1 
ATOM   8654  C  C     . PRO N  3  81  ? -64.509  -36.333 -41.976 1.00 65.00  ? 75  PRO c C     1 
ATOM   8655  O  O     . PRO N  3  81  ? -64.026  -35.313 -42.474 1.00 62.08  ? 75  PRO c O     1 
ATOM   8656  C  CB    . PRO N  3  81  ? -66.757  -35.335 -42.330 1.00 59.56  ? 75  PRO c CB    1 
ATOM   8657  C  CG    . PRO N  3  81  ? -66.584  -34.067 -41.591 1.00 58.04  ? 75  PRO c CG    1 
ATOM   8658  C  CD    . PRO N  3  81  ? -66.709  -34.472 -40.162 1.00 58.14  ? 75  PRO c CD    1 
ATOM   8659  N  N     . LEU N  3  82  ? -63.777  -37.420 -41.712 1.00 67.17  ? 76  LEU c N     1 
ATOM   8660  C  CA    . LEU N  3  82  ? -62.296  -37.308 -41.708 1.00 65.38  ? 76  LEU c CA    1 
ATOM   8661  C  C     . LEU N  3  82  ? -61.786  -37.046 -43.095 1.00 65.29  ? 76  LEU c C     1 
ATOM   8662  O  O     . LEU N  3  82  ? -60.983  -36.141 -43.303 1.00 63.56  ? 76  LEU c O     1 
ATOM   8663  C  CB    . LEU N  3  82  ? -61.607  -38.547 -41.146 1.00 61.92  ? 76  LEU c CB    1 
ATOM   8664  C  CG    . LEU N  3  82  ? -61.777  -38.744 -39.634 1.00 61.62  ? 76  LEU c CG    1 
ATOM   8665  C  CD1   . LEU N  3  82  ? -61.247  -40.133 -39.261 1.00 61.97  ? 76  LEU c CD1   1 
ATOM   8666  C  CD2   . LEU N  3  82  ? -61.141  -37.623 -38.815 1.00 57.83  ? 76  LEU c CD2   1 
ATOM   8667  N  N     . ASP N  3  83  ? -62.328  -37.801 -44.034 1.00 66.35  ? 77  ASP c N     1 
ATOM   8668  C  CA    . ASP N  3  83  ? -61.798  -37.794 -45.361 1.00 69.80  ? 77  ASP c CA    1 
ATOM   8669  C  C     . ASP N  3  83  ? -61.937  -36.411 -45.927 1.00 71.91  ? 77  ASP c C     1 
ATOM   8670  O  O     . ASP N  3  83  ? -60.992  -35.903 -46.546 1.00 71.52  ? 77  ASP c O     1 
ATOM   8671  C  CB    . ASP N  3  83  ? -62.510  -38.846 -46.220 1.00 79.34  ? 77  ASP c CB    1 
ATOM   8672  C  CG    . ASP N  3  83  ? -62.267  -40.279 -45.706 1.00 88.44  ? 77  ASP c CG    1 
ATOM   8673  O  OD1   . ASP N  3  83  ? -61.069  -40.579 -45.407 1.00 107.28 ? 77  ASP c OD1   1 
ATOM   8674  O  OD2   . ASP N  3  83  ? -63.234  -41.085 -45.652 1.00 81.29  ? 77  ASP c OD2   1 
ATOM   8675  N  N     . THR N  3  84  ? -63.114  -35.819 -45.723 1.00 75.50  ? 78  THR c N     1 
ATOM   8676  C  CA    . THR N  3  84  ? -63.372  -34.425 -46.104 1.00 77.68  ? 78  THR c CA    1 
ATOM   8677  C  C     . THR N  3  84  ? -62.310  -33.496 -45.560 1.00 84.17  ? 78  THR c C     1 
ATOM   8678  O  O     . THR N  3  84  ? -61.700  -32.747 -46.330 1.00 96.06  ? 78  THR c O     1 
ATOM   8679  C  CB    . THR N  3  84  ? -64.697  -33.990 -45.504 1.00 78.76  ? 78  THR c CB    1 
ATOM   8680  O  OG1   . THR N  3  84  ? -65.728  -34.795 -46.094 1.00 86.31  ? 78  THR c OG1   1 
ATOM   8681  C  CG2   . THR N  3  84  ? -64.974  -32.481 -45.618 1.00 81.94  ? 78  THR c CG2   1 
ATOM   8682  N  N     . LEU N  3  85  ? -62.057  -33.616 -44.257 1.00 78.56  ? 79  LEU c N     1 
ATOM   8683  C  CA    . LEU N  3  85  ? -61.155  -32.722 -43.563 1.00 70.64  ? 79  LEU c CA    1 
ATOM   8684  C  C     . LEU N  3  85  ? -59.690  -32.943 -43.850 1.00 69.62  ? 79  LEU c C     1 
ATOM   8685  O  O     . LEU N  3  85  ? -58.861  -32.084 -43.566 1.00 76.94  ? 79  LEU c O     1 
ATOM   8686  C  CB    . LEU N  3  85  ? -61.387  -32.850 -42.076 1.00 67.14  ? 79  LEU c CB    1 
ATOM   8687  C  CG    . LEU N  3  85  ? -62.594  -32.066 -41.582 1.00 65.14  ? 79  LEU c CG    1 
ATOM   8688  C  CD1   . LEU N  3  85  ? -63.243  -32.704 -40.371 1.00 65.92  ? 79  LEU c CD1   1 
ATOM   8689  C  CD2   . LEU N  3  85  ? -62.108  -30.688 -41.211 1.00 64.58  ? 79  LEU c CD2   1 
ATOM   8690  N  N     . LEU N  3  86  ? -59.354  -34.112 -44.351 1.00 71.16  ? 80  LEU c N     1 
ATOM   8691  C  CA    . LEU N  3  86  ? -57.958  -34.469 -44.571 1.00 79.36  ? 80  LEU c CA    1 
ATOM   8692  C  C     . LEU N  3  86  ? -57.479  -34.159 -45.975 1.00 91.47  ? 80  LEU c C     1 
ATOM   8693  O  O     . LEU N  3  86  ? -56.298  -34.370 -46.269 1.00 104.79 ? 80  LEU c O     1 
ATOM   8694  C  CB    . LEU N  3  86  ? -57.715  -35.964 -44.242 1.00 73.01  ? 80  LEU c CB    1 
ATOM   8695  C  CG    . LEU N  3  86  ? -57.665  -36.236 -42.728 1.00 71.55  ? 80  LEU c CG    1 
ATOM   8696  C  CD1   . LEU N  3  86  ? -57.812  -37.716 -42.436 1.00 72.26  ? 80  LEU c CD1   1 
ATOM   8697  C  CD2   . LEU N  3  86  ? -56.409  -35.694 -42.057 1.00 69.80  ? 80  LEU c CD2   1 
ATOM   8698  N  N     . VAL N  3  87  ? -58.359  -33.708 -46.853 1.00 102.13 ? 81  VAL c N     1 
ATOM   8699  C  CA    . VAL N  3  87  ? -58.015  -33.732 -48.259 1.00 119.50 ? 81  VAL c CA    1 
ATOM   8700  C  C     . VAL N  3  87  ? -57.279  -32.482 -48.691 1.00 129.50 ? 81  VAL c C     1 
ATOM   8701  O  O     . VAL N  3  87  ? -56.245  -32.557 -49.384 1.00 149.78 ? 81  VAL c O     1 
ATOM   8702  C  CB    . VAL N  3  87  ? -59.238  -34.003 -49.136 1.00 120.86 ? 81  VAL c CB    1 
ATOM   8703  C  CG1   . VAL N  3  87  ? -60.139  -32.771 -49.289 1.00 126.28 ? 81  VAL c CG1   1 
ATOM   8704  C  CG2   . VAL N  3  87  ? -58.834  -34.627 -50.465 1.00 118.46 ? 81  VAL c CG2   1 
ATOM   8705  N  N     . ASP N  3  88  ? -57.827  -31.344 -48.281 1.00 126.91 ? 82  ASP c N     1 
ATOM   8706  C  CA    . ASP N  3  88  ? -57.210  -30.071 -48.573 1.00 135.91 ? 82  ASP c CA    1 
ATOM   8707  C  C     . ASP N  3  88  ? -55.902  -30.079 -47.767 1.00 136.02 ? 82  ASP c C     1 
ATOM   8708  O  O     . ASP N  3  88  ? -54.847  -29.716 -48.281 1.00 129.87 ? 82  ASP c O     1 
ATOM   8709  C  CB    . ASP N  3  88  ? -58.192  -28.951 -48.188 1.00 143.95 ? 82  ASP c CB    1 
ATOM   8710  C  CG    . ASP N  3  88  ? -57.604  -27.551 -48.312 1.00 150.82 ? 82  ASP c CG    1 
ATOM   8711  O  OD1   . ASP N  3  88  ? -56.972  -27.267 -49.367 1.00 153.44 ? 82  ASP c OD1   1 
ATOM   8712  O  OD2   . ASP N  3  88  ? -57.829  -26.745 -47.365 1.00 135.09 ? 82  ASP c OD2   1 
ATOM   8713  N  N     . VAL N  3  89  ? -56.004  -30.600 -46.541 1.00 143.15 ? 83  VAL c N     1 
ATOM   8714  C  CA    . VAL N  3  89  ? -54.991  -30.549 -45.483 1.00 139.03 ? 83  VAL c CA    1 
ATOM   8715  C  C     . VAL N  3  89  ? -54.270  -29.196 -45.441 1.00 133.61 ? 83  VAL c C     1 
ATOM   8716  O  O     . VAL N  3  89  ? -54.920  -28.148 -45.301 1.00 102.46 ? 83  VAL c O     1 
ATOM   8717  C  CB    . VAL N  3  89  ? -54.041  -31.789 -45.478 1.00 137.65 ? 83  VAL c CB    1 
ATOM   8718  C  CG1   . VAL N  3  89  ? -53.069  -31.819 -46.674 1.00 131.95 ? 83  VAL c CG1   1 
ATOM   8719  C  CG2   . VAL N  3  89  ? -53.370  -31.939 -44.104 1.00 129.31 ? 83  VAL c CG2   1 
ATOM   8720  N  N     . PRO O  4  13  ? -35.807  -25.080 -51.735 1.00 133.88 ? 13  PRO d N     1 
ATOM   8721  C  CA    . PRO O  4  13  ? -35.799  -26.541 -51.753 1.00 132.86 ? 13  PRO d CA    1 
ATOM   8722  C  C     . PRO O  4  13  ? -37.172  -27.109 -51.422 1.00 135.02 ? 13  PRO d C     1 
ATOM   8723  O  O     . PRO O  4  13  ? -37.299  -28.126 -50.741 1.00 149.29 ? 13  PRO d O     1 
ATOM   8724  C  CB    . PRO O  4  13  ? -34.799  -26.883 -50.654 1.00 137.97 ? 13  PRO d CB    1 
ATOM   8725  C  CG    . PRO O  4  13  ? -33.836  -25.743 -50.666 1.00 136.41 ? 13  PRO d CG    1 
ATOM   8726  C  CD    . PRO O  4  13  ? -34.546  -24.533 -51.209 1.00 132.31 ? 13  PRO d CD    1 
ATOM   8727  N  N     . GLU O  4  14  ? -38.207  -26.473 -51.944 1.00 138.32 ? 14  GLU d N     1 
ATOM   8728  C  CA    . GLU O  4  14  ? -39.567  -26.888 -51.654 1.00 141.77 ? 14  GLU d CA    1 
ATOM   8729  C  C     . GLU O  4  14  ? -39.743  -28.325 -52.139 1.00 151.07 ? 14  GLU d C     1 
ATOM   8730  O  O     . GLU O  4  14  ? -40.486  -29.140 -51.563 1.00 146.70 ? 14  GLU d O     1 
ATOM   8731  C  CB    . GLU O  4  14  ? -40.549  -25.926 -52.313 1.00 133.01 ? 14  GLU d CB    1 
ATOM   8732  C  CG    . GLU O  4  14  ? -40.230  -24.460 -52.038 1.00 134.59 ? 14  GLU d CG    1 
ATOM   8733  C  CD    . GLU O  4  14  ? -40.509  -24.056 -50.598 1.00 139.72 ? 14  GLU d CD    1 
ATOM   8734  O  OE1   . GLU O  4  14  ? -41.220  -24.804 -49.896 1.00 143.73 ? 14  GLU d OE1   1 
ATOM   8735  O  OE2   . GLU O  4  14  ? -40.019  -22.995 -50.162 1.00 125.37 ? 14  GLU d OE2   1 
ATOM   8736  N  N     . GLU O  4  15  ? -39.079  -28.632 -53.236 1.00 164.72 ? 15  GLU d N     1 
ATOM   8737  C  CA    . GLU O  4  15  ? -39.103  -29.986 -53.736 1.00 166.89 ? 15  GLU d CA    1 
ATOM   8738  C  C     . GLU O  4  15  ? -38.002  -30.854 -53.114 1.00 156.63 ? 15  GLU d C     1 
ATOM   8739  O  O     . GLU O  4  15  ? -37.903  -32.039 -53.405 1.00 152.47 ? 15  GLU d O     1 
ATOM   8740  C  CB    . GLU O  4  15  ? -39.096  -29.988 -55.264 1.00 175.23 ? 15  GLU d CB    1 
ATOM   8741  C  CG    . GLU O  4  15  ? -40.079  -28.997 -55.895 1.00 173.76 ? 15  GLU d CG    1 
ATOM   8742  C  CD    . GLU O  4  15  ? -41.282  -28.657 -55.013 1.00 171.33 ? 15  GLU d CD    1 
ATOM   8743  O  OE1   . GLU O  4  15  ? -41.235  -27.643 -54.287 1.00 162.18 ? 15  GLU d OE1   1 
ATOM   8744  O  OE2   . GLU O  4  15  ? -42.291  -29.388 -55.058 1.00 165.51 ? 15  GLU d OE2   1 
ATOM   8745  N  N     . LEU O  4  16  ? -37.160  -30.244 -52.284 1.00 153.73 ? 16  LEU d N     1 
ATOM   8746  C  CA    . LEU O  4  16  ? -36.339  -30.944 -51.293 1.00 156.22 ? 16  LEU d CA    1 
ATOM   8747  C  C     . LEU O  4  16  ? -37.304  -31.554 -50.261 1.00 172.82 ? 16  LEU d C     1 
ATOM   8748  O  O     . LEU O  4  16  ? -37.096  -32.636 -49.696 1.00 197.26 ? 16  LEU d O     1 
ATOM   8749  C  CB    . LEU O  4  16  ? -35.333  -29.975 -50.657 1.00 142.95 ? 16  LEU d CB    1 
ATOM   8750  C  CG    . LEU O  4  16  ? -34.196  -30.411 -49.732 1.00 126.44 ? 16  LEU d CG    1 
ATOM   8751  C  CD1   . LEU O  4  16  ? -33.363  -31.523 -50.340 1.00 112.43 ? 16  LEU d CD1   1 
ATOM   8752  C  CD2   . LEU O  4  16  ? -33.325  -29.220 -49.373 1.00 111.29 ? 16  LEU d CD2   1 
ATOM   8753  N  N     . GLN O  4  17  ? -38.345  -30.784 -49.996 1.00 178.33 ? 17  GLN d N     1 
ATOM   8754  C  CA    . GLN O  4  17  ? -39.561  -31.207 -49.298 1.00 174.74 ? 17  GLN d CA    1 
ATOM   8755  C  C     . GLN O  4  17  ? -40.340  -32.282 -50.080 1.00 177.88 ? 17  GLN d C     1 
ATOM   8756  O  O     . GLN O  4  17  ? -40.939  -33.209 -49.511 1.00 188.44 ? 17  GLN d O     1 
ATOM   8757  C  CB    . GLN O  4  17  ? -40.437  -29.989 -48.996 1.00 175.61 ? 17  GLN d CB    1 
ATOM   8758  C  CG    . GLN O  4  17  ? -39.712  -28.636 -49.017 1.00 175.05 ? 17  GLN d CG    1 
ATOM   8759  C  CD    . GLN O  4  17  ? -38.359  -28.641 -48.308 1.00 170.44 ? 17  GLN d CD    1 
ATOM   8760  O  OE1   . GLN O  4  17  ? -37.584  -29.585 -48.425 1.00 169.79 ? 17  GLN d OE1   1 
ATOM   8761  N  NE2   . GLN O  4  17  ? -38.065  -27.569 -47.594 1.00 177.98 ? 17  GLN d NE2   1 
ATOM   8762  N  N     . LYS O  4  18  ? -40.346  -32.154 -51.397 1.00 175.72 ? 18  LYS d N     1 
ATOM   8763  C  CA    . LYS O  4  18  ? -40.832  -33.259 -52.228 1.00 170.30 ? 18  LYS d CA    1 
ATOM   8764  C  C     . LYS O  4  18  ? -39.972  -34.521 -52.001 1.00 165.11 ? 18  LYS d C     1 
ATOM   8765  O  O     . LYS O  4  18  ? -40.445  -35.652 -52.075 1.00 163.84 ? 18  LYS d O     1 
ATOM   8766  C  CB    . LYS O  4  18  ? -40.844  -32.871 -53.702 1.00 169.82 ? 18  LYS d CB    1 
ATOM   8767  C  CG    . LYS O  4  18  ? -41.932  -31.874 -54.060 1.00 174.97 ? 18  LYS d CG    1 
ATOM   8768  C  CD    . LYS O  4  18  ? -43.317  -32.500 -54.007 1.00 171.64 ? 18  LYS d CD    1 
ATOM   8769  C  CE    . LYS O  4  18  ? -44.401  -31.452 -54.218 1.00 160.24 ? 18  LYS d CE    1 
ATOM   8770  N  NZ    . LYS O  4  18  ? -45.703  -32.056 -54.610 1.00 153.07 ? 18  LYS d NZ    1 
ATOM   8771  N  N     . ARG O  4  19  ? -38.687  -34.306 -51.788 1.00 154.73 ? 19  ARG d N     1 
ATOM   8772  C  CA    . ARG O  4  19  ? -37.744  -35.342 -51.377 1.00 142.80 ? 19  ARG d CA    1 
ATOM   8773  C  C     . ARG O  4  19  ? -38.059  -35.958 -50.013 1.00 133.98 ? 19  ARG d C     1 
ATOM   8774  O  O     . ARG O  4  19  ? -37.789  -37.128 -49.796 1.00 138.75 ? 19  ARG d O     1 
ATOM   8775  C  CB    . ARG O  4  19  ? -36.317  -34.806 -51.390 1.00 155.58 ? 19  ARG d CB    1 
ATOM   8776  C  CG    . ARG O  4  19  ? -35.833  -34.386 -52.764 1.00 162.13 ? 19  ARG d CG    1 
ATOM   8777  C  CD    . ARG O  4  19  ? -34.360  -34.030 -52.730 1.00 164.03 ? 19  ARG d CD    1 
ATOM   8778  N  NE    . ARG O  4  19  ? -33.565  -35.088 -52.119 1.00 169.34 ? 19  ARG d NE    1 
ATOM   8779  C  CZ    . ARG O  4  19  ? -33.262  -35.149 -50.828 1.00 166.74 ? 19  ARG d CZ    1 
ATOM   8780  N  NH1   . ARG O  4  19  ? -33.688  -34.212 -49.996 1.00 165.38 ? 19  ARG d NH1   1 
ATOM   8781  N  NH2   . ARG O  4  19  ? -32.528  -36.150 -50.369 1.00 166.02 ? 19  ARG d NH2   1 
ATOM   8782  N  N     . GLU O  4  20  ? -38.555  -35.156 -49.076 1.00 139.25 ? 20  GLU d N     1 
ATOM   8783  C  CA    . GLU O  4  20  ? -39.106  -35.686 -47.814 1.00 144.01 ? 20  GLU d CA    1 
ATOM   8784  C  C     . GLU O  4  20  ? -40.304  -36.597 -48.091 1.00 143.69 ? 20  GLU d C     1 
ATOM   8785  O  O     . GLU O  4  20  ? -40.526  -37.623 -47.417 1.00 139.57 ? 20  GLU d O     1 
ATOM   8786  C  CB    . GLU O  4  20  ? -39.511  -34.559 -46.841 1.00 147.58 ? 20  GLU d CB    1 
ATOM   8787  C  CG    . GLU O  4  20  ? -40.958  -34.066 -46.948 1.00 136.21 ? 20  GLU d CG    1 
ATOM   8788  C  CD    . GLU O  4  20  ? -41.839  -34.426 -45.760 1.00 127.19 ? 20  GLU d CD    1 
ATOM   8789  O  OE1   . GLU O  4  20  ? -42.947  -34.938 -45.988 1.00 128.77 ? 20  GLU d OE1   1 
ATOM   8790  O  OE2   . GLU O  4  20  ? -41.445  -34.183 -44.604 1.00 110.95 ? 20  GLU d OE2   1 
ATOM   8791  N  N     . GLU O  4  21  ? -41.093  -36.197 -49.078 1.00 140.85 ? 21  GLU d N     1 
ATOM   8792  C  CA    . GLU O  4  21  ? -42.183  -37.050 -49.538 1.00 141.90 ? 21  GLU d CA    1 
ATOM   8793  C  C     . GLU O  4  21  ? -41.622  -38.378 -50.059 1.00 140.65 ? 21  GLU d C     1 
ATOM   8794  O  O     . GLU O  4  21  ? -42.161  -39.438 -49.779 1.00 137.56 ? 21  GLU d O     1 
ATOM   8795  C  CB    . GLU O  4  21  ? -43.038  -36.317 -50.589 1.00 148.60 ? 21  GLU d CB    1 
ATOM   8796  C  CG    . GLU O  4  21  ? -42.904  -36.774 -52.037 1.00 157.66 ? 21  GLU d CG    1 
ATOM   8797  C  CD    . GLU O  4  21  ? -43.663  -38.053 -52.310 1.00 170.62 ? 21  GLU d CD    1 
ATOM   8798  O  OE1   . GLU O  4  21  ? -44.053  -38.723 -51.333 1.00 166.54 ? 21  GLU d OE1   1 
ATOM   8799  O  OE2   . GLU O  4  21  ? -43.873  -38.384 -53.496 1.00 184.63 ? 21  GLU d OE2   1 
ATOM   8800  N  N     . GLU O  4  22  ? -40.509  -38.313 -50.775 1.00 144.71 ? 22  GLU d N     1 
ATOM   8801  C  CA    . GLU O  4  22  ? -39.808  -39.516 -51.240 1.00 143.79 ? 22  GLU d CA    1 
ATOM   8802  C  C     . GLU O  4  22  ? -39.353  -40.371 -50.064 1.00 127.96 ? 22  GLU d C     1 
ATOM   8803  O  O     . GLU O  4  22  ? -39.375  -41.590 -50.117 1.00 117.25 ? 22  GLU d O     1 
ATOM   8804  C  CB    . GLU O  4  22  ? -38.585  -39.130 -52.076 1.00 153.82 ? 22  GLU d CB    1 
ATOM   8805  C  CG    . GLU O  4  22  ? -37.577  -40.254 -52.294 1.00 155.94 ? 22  GLU d CG    1 
ATOM   8806  C  CD    . GLU O  4  22  ? -36.147  -39.833 -51.998 1.00 158.92 ? 22  GLU d CD    1 
ATOM   8807  O  OE1   . GLU O  4  22  ? -35.862  -39.463 -50.841 1.00 160.34 ? 22  GLU d OE1   1 
ATOM   8808  O  OE2   . GLU O  4  22  ? -35.306  -39.874 -52.922 1.00 154.44 ? 22  GLU d OE2   1 
ATOM   8809  N  N     . GLU O  4  23  ? -38.916  -39.702 -49.014 1.00 117.70 ? 23  GLU d N     1 
ATOM   8810  C  CA    . GLU O  4  23  ? -38.493  -40.331 -47.776 1.00 114.10 ? 23  GLU d CA    1 
ATOM   8811  C  C     . GLU O  4  23  ? -39.592  -41.121 -47.097 1.00 107.61 ? 23  GLU d C     1 
ATOM   8812  O  O     . GLU O  4  23  ? -39.310  -42.154 -46.508 1.00 109.71 ? 23  GLU d O     1 
ATOM   8813  C  CB    . GLU O  4  23  ? -37.962  -39.287 -46.802 1.00 126.58 ? 23  GLU d CB    1 
ATOM   8814  C  CG    . GLU O  4  23  ? -36.824  -39.788 -45.927 1.00 140.30 ? 23  GLU d CG    1 
ATOM   8815  C  CD    . GLU O  4  23  ? -36.170  -38.682 -45.122 1.00 144.41 ? 23  GLU d CD    1 
ATOM   8816  O  OE1   . GLU O  4  23  ? -36.905  -37.857 -44.533 1.00 143.97 ? 23  GLU d OE1   1 
ATOM   8817  O  OE2   . GLU O  4  23  ? -34.922  -38.647 -45.076 1.00 137.09 ? 23  GLU d OE2   1 
ATOM   8818  N  N     . PHE O  4  24  ? -40.832  -40.638 -47.126 1.00 100.93 ? 24  PHE d N     1 
ATOM   8819  C  CA    . PHE O  4  24  ? -41.917  -41.450 -46.531 1.00 96.41  ? 24  PHE d CA    1 
ATOM   8820  C  C     . PHE O  4  24  ? -42.111  -42.854 -47.145 1.00 99.79  ? 24  PHE d C     1 
ATOM   8821  O  O     . PHE O  4  24  ? -42.379  -43.809 -46.438 1.00 96.91  ? 24  PHE d O     1 
ATOM   8822  C  CB    . PHE O  4  24  ? -43.239  -40.688 -46.500 1.00 92.83  ? 24  PHE d CB    1 
ATOM   8823  C  CG    . PHE O  4  24  ? -43.317  -39.656 -45.417 1.00 98.31  ? 24  PHE d CG    1 
ATOM   8824  C  CD1   . PHE O  4  24  ? -42.428  -39.667 -44.363 1.00 97.17  ? 24  PHE d CD1   1 
ATOM   8825  C  CD2   . PHE O  4  24  ? -44.276  -38.673 -45.456 1.00 103.13 ? 24  PHE d CD2   1 
ATOM   8826  C  CE1   . PHE O  4  24  ? -42.493  -38.715 -43.371 1.00 92.74  ? 24  PHE d CE1   1 
ATOM   8827  C  CE2   . PHE O  4  24  ? -44.350  -37.719 -44.464 1.00 101.56 ? 24  PHE d CE2   1 
ATOM   8828  C  CZ    . PHE O  4  24  ? -43.456  -37.740 -43.422 1.00 95.79  ? 24  PHE d CZ    1 
ATOM   8829  N  N     . ASN O  4  25  ? -41.978  -42.967 -48.458 1.00 98.85  ? 25  ASN d N     1 
ATOM   8830  C  CA    . ASN O  4  25  ? -42.065  -44.211 -49.187 1.00 99.59  ? 25  ASN d CA    1 
ATOM   8831  C  C     . ASN O  4  25  ? -40.991  -45.259 -48.888 1.00 99.78  ? 25  ASN d C     1 
ATOM   8832  O  O     . ASN O  4  25  ? -41.270  -46.455 -48.933 1.00 98.68  ? 25  ASN d O     1 
ATOM   8833  C  CB    . ASN O  4  25  ? -42.203  -43.927 -50.674 1.00 106.66 ? 25  ASN d CB    1 
ATOM   8834  C  CG    . ASN O  4  25  ? -43.643  -43.678 -51.042 1.00 117.26 ? 25  ASN d CG    1 
ATOM   8835  O  OD1   . ASN O  4  25  ? -44.506  -44.477 -50.665 1.00 130.16 ? 25  ASN d OD1   1 
ATOM   8836  N  ND2   . ASN O  4  25  ? -43.931  -42.557 -51.698 1.00 126.48 ? 25  ASN d ND2   1 
ATOM   8837  N  N     . THR O  4  26  ? -39.756  -44.828 -48.635 1.00 100.42 ? 26  THR d N     1 
ATOM   8838  C  CA    . THR O  4  26  ? -38.619  -45.758 -48.467 1.00 103.03 ? 26  THR d CA    1 
ATOM   8839  C  C     . THR O  4  26  ? -38.110  -45.824 -47.033 1.00 99.29  ? 26  THR d C     1 
ATOM   8840  O  O     . THR O  4  26  ? -37.832  -46.936 -46.553 1.00 94.83  ? 26  THR d O     1 
ATOM   8841  C  CB    . THR O  4  26  ? -37.434  -45.380 -49.366 1.00 112.91 ? 26  THR d CB    1 
ATOM   8842  O  OG1   . THR O  4  26  ? -37.075  -44.007 -49.124 1.00 127.46 ? 26  THR d OG1   1 
ATOM   8843  C  CG2   . THR O  4  26  ? -37.788  -45.541 -50.861 1.00 122.23 ? 26  THR d CG2   1 
ATOM   8844  N  N     . GLY O  4  27  ? -38.029  -44.663 -46.367 1.00 91.00  ? 27  GLY d N     1 
ATOM   8845  C  CA    . GLY O  4  27  ? -37.501  -44.536 -45.019 1.00 84.07  ? 27  GLY d CA    1 
ATOM   8846  C  C     . GLY O  4  27  ? -38.299  -45.327 -44.017 1.00 79.69  ? 27  GLY d C     1 
ATOM   8847  O  O     . GLY O  4  27  ? -39.142  -46.139 -44.375 1.00 83.25  ? 27  GLY d O     1 
ATOM   8848  N  N     . PRO O  4  28  ? -38.058  -45.094 -42.725 1.00 78.75  ? 28  PRO d N     1 
ATOM   8849  C  CA    . PRO O  4  28  ? -38.719  -45.946 -41.737 1.00 74.24  ? 28  PRO d CA    1 
ATOM   8850  C  C     . PRO O  4  28  ? -40.201  -45.610 -41.545 1.00 69.14  ? 28  PRO d C     1 
ATOM   8851  O  O     . PRO O  4  28  ? -40.987  -46.478 -41.230 1.00 64.99  ? 28  PRO d O     1 
ATOM   8852  C  CB    . PRO O  4  28  ? -37.884  -45.737 -40.467 1.00 76.82  ? 28  PRO d CB    1 
ATOM   8853  C  CG    . PRO O  4  28  ? -36.773  -44.811 -40.836 1.00 79.50  ? 28  PRO d CG    1 
ATOM   8854  C  CD    . PRO O  4  28  ? -37.249  -44.061 -42.055 1.00 81.18  ? 28  PRO d CD    1 
ATOM   8855  N  N     . LEU O  4  29  ? -40.606  -44.372 -41.792 1.00 64.25  ? 29  LEU d N     1 
ATOM   8856  C  CA    . LEU O  4  29  ? -42.030  -44.058 -41.729 1.00 63.59  ? 29  LEU d CA    1 
ATOM   8857  C  C     . LEU O  4  29  ? -42.834  -44.712 -42.865 1.00 61.67  ? 29  LEU d C     1 
ATOM   8858  O  O     . LEU O  4  29  ? -44.026  -44.504 -42.956 1.00 62.71  ? 29  LEU d O     1 
ATOM   8859  C  CB    . LEU O  4  29  ? -42.289  -42.525 -41.662 1.00 64.27  ? 29  LEU d CB    1 
ATOM   8860  C  CG    . LEU O  4  29  ? -42.280  -41.917 -40.254 1.00 66.07  ? 29  LEU d CG    1 
ATOM   8861  C  CD1   . LEU O  4  29  ? -40.940  -42.090 -39.551 1.00 71.04  ? 29  LEU d CD1   1 
ATOM   8862  C  CD2   . LEU O  4  29  ? -42.601  -40.435 -40.282 1.00 68.13  ? 29  LEU d CD2   1 
ATOM   8863  N  N     . SER O  4  30  ? -42.214  -45.475 -43.745 1.00 62.44  ? 30  SER d N     1 
ATOM   8864  C  CA    . SER O  4  30  ? -42.950  -46.366 -44.607 1.00 67.73  ? 30  SER d CA    1 
ATOM   8865  C  C     . SER O  4  30  ? -43.898  -47.305 -43.847 1.00 64.66  ? 30  SER d C     1 
ATOM   8866  O  O     . SER O  4  30  ? -44.895  -47.744 -44.410 1.00 61.52  ? 30  SER d O     1 
ATOM   8867  C  CB    . SER O  4  30  ? -41.999  -47.205 -45.470 1.00 77.10  ? 30  SER d CB    1 
ATOM   8868  O  OG    . SER O  4  30  ? -41.290  -48.170 -44.682 1.00 89.94  ? 30  SER d OG    1 
ATOM   8869  N  N     . VAL O  4  31  ? -43.570  -47.619 -42.594 1.00 61.80  ? 31  VAL d N     1 
ATOM   8870  C  CA    . VAL O  4  31  ? -44.442  -48.428 -41.756 1.00 60.12  ? 31  VAL d CA    1 
ATOM   8871  C  C     . VAL O  4  31  ? -45.850  -47.855 -41.663 1.00 58.24  ? 31  VAL d C     1 
ATOM   8872  O  O     . VAL O  4  31  ? -46.844  -48.578 -41.710 1.00 59.32  ? 31  VAL d O     1 
ATOM   8873  C  CB    . VAL O  4  31  ? -43.917  -48.532 -40.336 1.00 60.57  ? 31  VAL d CB    1 
ATOM   8874  C  CG1   . VAL O  4  31  ? -44.805  -49.463 -39.525 1.00 65.37  ? 31  VAL d CG1   1 
ATOM   8875  C  CG2   . VAL O  4  31  ? -42.550  -49.171 -40.295 1.00 59.64  ? 31  VAL d CG2   1 
ATOM   8876  N  N     . LEU O  4  32  ? -45.918  -46.537 -41.608 1.00 58.92  ? 32  LEU d N     1 
ATOM   8877  C  CA    . LEU O  4  32  ? -47.170  -45.790 -41.587 1.00 60.06  ? 32  LEU d CA    1 
ATOM   8878  C  C     . LEU O  4  32  ? -47.745  -45.675 -42.985 1.00 63.97  ? 32  LEU d C     1 
ATOM   8879  O  O     . LEU O  4  32  ? -48.914  -46.019 -43.199 1.00 63.29  ? 32  LEU d O     1 
ATOM   8880  C  CB    . LEU O  4  32  ? -46.948  -44.419 -40.935 1.00 57.46  ? 32  LEU d CB    1 
ATOM   8881  C  CG    . LEU O  4  32  ? -46.870  -44.385 -39.382 1.00 61.99  ? 32  LEU d CG    1 
ATOM   8882  C  CD1   . LEU O  4  32  ? -46.419  -45.778 -38.892 1.00 63.45  ? 32  LEU d CD1   1 
ATOM   8883  C  CD2   . LEU O  4  32  ? -46.247  -43.311 -38.460 1.00 64.50  ? 32  LEU d CD2   1 
ATOM   8884  N  N     . THR O  4  33  ? -46.917  -45.273 -43.952 1.00 67.16  ? 33  THR d N     1 
ATOM   8885  C  CA    . THR O  4  33  ? -47.388  -45.046 -45.316 1.00 68.31  ? 33  THR d CA    1 
ATOM   8886  C  C     . THR O  4  33  ? -48.107  -46.262 -45.855 1.00 65.41  ? 33  THR d C     1 
ATOM   8887  O  O     . THR O  4  33  ? -49.152  -46.158 -46.494 1.00 67.58  ? 33  THR d O     1 
ATOM   8888  C  CB    . THR O  4  33  ? -46.281  -44.747 -46.335 1.00 72.74  ? 33  THR d CB    1 
ATOM   8889  O  OG1   . THR O  4  33  ? -45.172  -44.106 -45.718 1.00 78.26  ? 33  THR d OG1   1 
ATOM   8890  C  CG2   . THR O  4  33  ? -46.710  -43.755 -47.398 1.00 78.64  ? 33  THR d CG2   1 
ATOM   8891  N  N     . GLN O  4  34  ? -47.527  -47.398 -45.571 1.00 64.04  ? 34  GLN d N     1 
ATOM   8892  C  CA    . GLN O  4  34  ? -48.101  -48.621 -45.995 1.00 70.21  ? 34  GLN d CA    1 
ATOM   8893  C  C     . GLN O  4  34  ? -49.321  -48.961 -45.199 1.00 66.40  ? 34  GLN d C     1 
ATOM   8894  O  O     . GLN O  4  34  ? -50.266  -49.585 -45.729 1.00 74.61  ? 34  GLN d O     1 
ATOM   8895  C  CB    . GLN O  4  34  ? -47.016  -49.716 -45.927 1.00 84.13  ? 34  GLN d CB    1 
ATOM   8896  C  CG    . GLN O  4  34  ? -46.016  -49.748 -47.090 1.00 88.63  ? 34  GLN d CG    1 
ATOM   8897  C  CD    . GLN O  4  34  ? -46.730  -50.148 -48.389 1.00 88.41  ? 34  GLN d CD    1 
ATOM   8898  O  OE1   . GLN O  4  34  ? -47.333  -51.222 -48.451 1.00 85.57  ? 34  GLN d OE1   1 
ATOM   8899  N  NE2   . GLN O  4  34  ? -46.681  -49.289 -49.409 1.00 90.69  ? 34  GLN d NE2   1 
ATOM   8900  N  N     . SER O  4  35  ? -49.269  -48.687 -43.902 1.00 67.38  ? 35  SER d N     1 
ATOM   8901  C  CA    . SER O  4  35  ? -50.407  -49.004 -42.995 1.00 70.32  ? 35  SER d CA    1 
ATOM   8902  C  C     . SER O  4  35  ? -51.654  -48.201 -43.376 1.00 66.91  ? 35  SER d C     1 
ATOM   8903  O  O     . SER O  4  35  ? -52.757  -48.735 -43.412 1.00 70.39  ? 35  SER d O     1 
ATOM   8904  C  CB    . SER O  4  35  ? -50.072  -48.713 -41.524 1.00 69.68  ? 35  SER d CB    1 
ATOM   8905  O  OG    . SER O  4  35  ? -49.188  -49.681 -41.007 1.00 70.31  ? 35  SER d OG    1 
ATOM   8906  N  N     . VAL O  4  36  ? -51.438  -46.948 -43.724 1.00 59.14  ? 36  VAL d N     1 
ATOM   8907  C  CA    . VAL O  4  36  ? -52.482  -46.120 -44.270 1.00 56.28  ? 36  VAL d CA    1 
ATOM   8908  C  C     . VAL O  4  36  ? -52.961  -46.665 -45.574 1.00 59.25  ? 36  VAL d C     1 
ATOM   8909  O  O     . VAL O  4  36  ? -54.154  -46.782 -45.779 1.00 71.58  ? 36  VAL d O     1 
ATOM   8910  C  CB    . VAL O  4  36  ? -51.984  -44.698 -44.536 1.00 55.49  ? 36  VAL d CB    1 
ATOM   8911  C  CG1   . VAL O  4  36  ? -52.981  -43.889 -45.306 1.00 54.44  ? 36  VAL d CG1   1 
ATOM   8912  C  CG2   . VAL O  4  36  ? -51.678  -43.986 -43.221 1.00 56.49  ? 36  VAL d CG2   1 
ATOM   8913  N  N     . LYS O  4  37  ? -52.038  -46.953 -46.462 1.00 68.48  ? 37  LYS d N     1 
ATOM   8914  C  CA    . LYS O  4  37  ? -52.380  -47.448 -47.793 1.00 81.35  ? 37  LYS d CA    1 
ATOM   8915  C  C     . LYS O  4  37  ? -53.275  -48.689 -47.735 1.00 74.58  ? 37  LYS d C     1 
ATOM   8916  O  O     . LYS O  4  37  ? -54.350  -48.714 -48.333 1.00 69.65  ? 37  LYS d O     1 
ATOM   8917  C  CB    . LYS O  4  37  ? -51.113  -47.716 -48.658 1.00 95.73  ? 37  LYS d CB    1 
ATOM   8918  C  CG    . LYS O  4  37  ? -51.136  -47.256 -50.125 1.00 111.56 ? 37  LYS d CG    1 
ATOM   8919  C  CD    . LYS O  4  37  ? -50.625  -45.814 -50.375 1.00 125.39 ? 37  LYS d CD    1 
ATOM   8920  C  CE    . LYS O  4  37  ? -49.797  -45.607 -51.645 1.00 130.29 ? 37  LYS d CE    1 
ATOM   8921  N  NZ    . LYS O  4  37  ? -48.460  -46.277 -51.569 1.00 131.62 ? 37  LYS d NZ    1 
ATOM   8922  N  N     . ASN O  4  38  ? -52.832  -49.680 -46.981 1.00 71.60  ? 38  ASN d N     1 
ATOM   8923  C  CA    . ASN O  4  38  ? -53.539  -50.942 -46.946 1.00 79.97  ? 38  ASN d CA    1 
ATOM   8924  C  C     . ASN O  4  38  ? -54.504  -51.084 -45.804 1.00 78.83  ? 38  ASN d C     1 
ATOM   8925  O  O     . ASN O  4  38  ? -55.027  -52.184 -45.613 1.00 81.95  ? 38  ASN d O     1 
ATOM   8926  C  CB    . ASN O  4  38  ? -52.573  -52.135 -46.923 1.00 88.99  ? 38  ASN d CB    1 
ATOM   8927  C  CG    . ASN O  4  38  ? -51.585  -52.094 -48.055 1.00 95.04  ? 38  ASN d CG    1 
ATOM   8928  O  OD1   . ASN O  4  38  ? -51.670  -51.225 -48.914 1.00 90.16  ? 38  ASN d OD1   1 
ATOM   8929  N  ND2   . ASN O  4  38  ? -50.566  -52.956 -48.001 1.00 110.04 ? 38  ASN d ND2   1 
ATOM   8930  N  N     . ASN O  4  39  ? -54.765  -50.019 -45.054 1.00 77.88  ? 39  ASN d N     1 
ATOM   8931  C  CA    . ASN O  4  39  ? -55.793  -50.044 -44.009 1.00 74.79  ? 39  ASN d CA    1 
ATOM   8932  C  C     . ASN O  4  39  ? -55.500  -51.068 -42.922 1.00 67.75  ? 39  ASN d C     1 
ATOM   8933  O  O     . ASN O  4  39  ? -56.378  -51.811 -42.497 1.00 71.91  ? 39  ASN d O     1 
ATOM   8934  C  CB    . ASN O  4  39  ? -57.216  -50.300 -44.608 1.00 79.64  ? 39  ASN d CB    1 
ATOM   8935  C  CG    . ASN O  4  39  ? -58.295  -49.785 -43.697 1.00 89.59  ? 39  ASN d CG    1 
ATOM   8936  O  OD1   . ASN O  4  39  ? -58.034  -49.022 -42.780 1.00 94.42  ? 39  ASN d OD1   1 
ATOM   8937  N  ND2   . ASN O  4  39  ? -59.518  -50.226 -43.908 1.00 103.94 ? 39  ASN d ND2   1 
ATOM   8938  N  N     . THR O  4  40  ? -54.238  -51.272 -42.612 1.00 65.15  ? 40  THR d N     1 
ATOM   8939  C  CA    . THR O  4  40  ? -53.846  -52.372 -41.730 1.00 65.75  ? 40  THR d CA    1 
ATOM   8940  C  C     . THR O  4  40  ? -53.987  -51.822 -40.327 1.00 58.49  ? 40  THR d C     1 
ATOM   8941  O  O     . THR O  4  40  ? -53.739  -50.638 -40.087 1.00 49.30  ? 40  THR d O     1 
ATOM   8942  C  CB    . THR O  4  40  ? -52.387  -52.892 -41.991 1.00 71.04  ? 40  THR d CB    1 
ATOM   8943  O  OG1   . THR O  4  40  ? -51.383  -51.972 -41.492 1.00 83.39  ? 40  THR d OG1   1 
ATOM   8944  C  CG2   . THR O  4  40  ? -52.143  -53.189 -43.483 1.00 68.41  ? 40  THR d CG2   1 
ATOM   8945  N  N     . GLN O  4  41  ? -54.253  -52.750 -39.415 1.00 60.21  ? 41  GLN d N     1 
ATOM   8946  C  CA    . GLN O  4  41  ? -54.227  -52.457 -37.997 1.00 64.55  ? 41  GLN d CA    1 
ATOM   8947  C  C     . GLN O  4  41  ? -52.797  -52.214 -37.577 1.00 63.15  ? 41  GLN d C     1 
ATOM   8948  O  O     . GLN O  4  41  ? -51.861  -52.438 -38.336 1.00 65.57  ? 41  GLN d O     1 
ATOM   8949  C  CB    . GLN O  4  41  ? -54.737  -53.614 -37.153 1.00 67.76  ? 41  GLN d CB    1 
ATOM   8950  C  CG    . GLN O  4  41  ? -56.165  -53.462 -36.696 1.00 73.27  ? 41  GLN d CG    1 
ATOM   8951  C  CD    . GLN O  4  41  ? -56.604  -54.563 -35.754 1.00 75.36  ? 41  GLN d CD    1 
ATOM   8952  O  OE1   . GLN O  4  41  ? -55.935  -55.542 -35.559 1.00 77.66  ? 41  GLN d OE1   1 
ATOM   8953  N  NE2   . GLN O  4  41  ? -57.688  -54.329 -35.072 1.00 84.95  ? 41  GLN d NE2   1 
ATOM   8954  N  N     . VAL O  4  42  ? -52.648  -51.671 -36.381 1.00 58.05  ? 42  VAL d N     1 
ATOM   8955  C  CA    . VAL O  4  42  ? -51.374  -51.123 -35.981 1.00 56.47  ? 42  VAL d CA    1 
ATOM   8956  C  C     . VAL O  4  42  ? -51.456  -51.022 -34.474 1.00 54.64  ? 42  VAL d C     1 
ATOM   8957  O  O     . VAL O  4  42  ? -52.489  -50.658 -33.924 1.00 58.94  ? 42  VAL d O     1 
ATOM   8958  C  CB    . VAL O  4  42  ? -51.112  -49.784 -36.740 1.00 57.76  ? 42  VAL d CB    1 
ATOM   8959  C  CG1   . VAL O  4  42  ? -51.332  -48.546 -35.900 1.00 58.20  ? 42  VAL d CG1   1 
ATOM   8960  C  CG2   . VAL O  4  42  ? -49.697  -49.726 -37.187 1.00 62.95  ? 42  VAL d CG2   1 
ATOM   8961  N  N     . LEU O  4  43  ? -50.381  -51.323 -33.781 1.00 53.66  ? 43  LEU d N     1 
ATOM   8962  C  CA    . LEU O  4  43  ? -50.398  -51.407 -32.320 1.00 51.31  ? 43  LEU d CA    1 
ATOM   8963  C  C     . LEU O  4  43  ? -49.349  -50.443 -31.811 1.00 50.51  ? 43  LEU d C     1 
ATOM   8964  O  O     . LEU O  4  43  ? -48.185  -50.616 -32.145 1.00 59.76  ? 43  LEU d O     1 
ATOM   8965  C  CB    . LEU O  4  43  ? -50.045  -52.798 -31.865 1.00 51.88  ? 43  LEU d CB    1 
ATOM   8966  C  CG    . LEU O  4  43  ? -49.907  -52.905 -30.360 1.00 59.83  ? 43  LEU d CG    1 
ATOM   8967  C  CD1   . LEU O  4  43  ? -51.281  -52.802 -29.752 1.00 66.98  ? 43  LEU d CD1   1 
ATOM   8968  C  CD2   . LEU O  4  43  ? -49.390  -54.275 -30.023 1.00 66.21  ? 43  LEU d CD2   1 
ATOM   8969  N  N     . ILE O  4  44  ? -49.730  -49.433 -31.048 1.00 46.21  ? 44  ILE d N     1 
ATOM   8970  C  CA    . ILE O  4  44  ? -48.817  -48.394 -30.673 1.00 45.52  ? 44  ILE d CA    1 
ATOM   8971  C  C     . ILE O  4  44  ? -48.594  -48.402 -29.188 1.00 44.95  ? 44  ILE d C     1 
ATOM   8972  O  O     . ILE O  4  44  ? -49.545  -48.401 -28.442 1.00 54.94  ? 44  ILE d O     1 
ATOM   8973  C  CB    . ILE O  4  44  ? -49.360  -47.023 -31.021 1.00 48.65  ? 44  ILE d CB    1 
ATOM   8974  C  CG1   . ILE O  4  44  ? -49.794  -46.981 -32.481 1.00 48.96  ? 44  ILE d CG1   1 
ATOM   8975  C  CG2   . ILE O  4  44  ? -48.255  -46.003 -30.755 1.00 54.44  ? 44  ILE d CG2   1 
ATOM   8976  C  CD1   . ILE O  4  44  ? -50.489  -45.706 -32.894 1.00 49.11  ? 44  ILE d CD1   1 
ATOM   8977  N  N     . ASN O  4  45  ? -47.358  -48.375 -28.738 1.00 42.41  ? 45  ASN d N     1 
ATOM   8978  C  CA    . ASN O  4  45  ? -47.077  -48.335 -27.336 1.00 43.69  ? 45  ASN d CA    1 
ATOM   8979  C  C     . ASN O  4  45  ? -46.765  -46.887 -27.159 1.00 47.20  ? 45  ASN d C     1 
ATOM   8980  O  O     . ASN O  4  45  ? -45.926  -46.283 -27.802 1.00 48.94  ? 45  ASN d O     1 
ATOM   8981  C  CB    . ASN O  4  45  ? -45.858  -49.119 -26.965 1.00 49.22  ? 45  ASN d CB    1 
ATOM   8982  C  CG    . ASN O  4  45  ? -45.652  -49.280 -25.478 1.00 51.72  ? 45  ASN d CG    1 
ATOM   8983  O  OD1   . ASN O  4  45  ? -46.543  -49.155 -24.677 1.00 56.66  ? 45  ASN d OD1   1 
ATOM   8984  N  ND2   . ASN O  4  45  ? -44.414  -49.589 -25.116 1.00 59.48  ? 45  ASN d ND2   1 
ATOM   8985  N  N     . CYS O  4  46  ? -47.461  -46.317 -26.201 1.00 52.11  ? 46  CYS d N     1 
ATOM   8986  C  CA    . CYS O  4  46  ? -47.647  -44.902 -26.071 1.00 50.23  ? 46  CYS d CA    1 
ATOM   8987  C  C     . CYS O  4  46  ? -46.995  -44.489 -24.757 1.00 42.81  ? 46  CYS d C     1 
ATOM   8988  O  O     . CYS O  4  46  ? -46.966  -45.238 -23.802 1.00 40.71  ? 46  CYS d O     1 
ATOM   8989  C  CB    . CYS O  4  46  ? -49.176  -44.734 -26.166 1.00 55.70  ? 46  CYS d CB    1 
ATOM   8990  S  SG    . CYS O  4  46  ? -49.659  -43.013 -26.382 1.00 72.55  ? 46  CYS d SG    1 
ATOM   8991  N  N     . ARG O  4  47  ? -46.530  -43.274 -24.655 1.00 41.92  ? 47  ARG d N     1 
ATOM   8992  C  CA    . ARG O  4  47  ? -45.892  -42.813 -23.407 1.00 47.05  ? 47  ARG d CA    1 
ATOM   8993  C  C     . ARG O  4  47  ? -46.799  -42.544 -22.199 1.00 48.99  ? 47  ARG d C     1 
ATOM   8994  O  O     . ARG O  4  47  ? -46.311  -42.208 -21.141 1.00 52.26  ? 47  ARG d O     1 
ATOM   8995  C  CB    . ARG O  4  47  ? -45.091  -41.513 -23.658 1.00 48.70  ? 47  ARG d CB    1 
ATOM   8996  C  CG    . ARG O  4  47  ? -43.892  -41.681 -24.576 1.00 47.42  ? 47  ARG d CG    1 
ATOM   8997  C  CD    . ARG O  4  47  ? -42.694  -42.192 -23.794 1.00 44.04  ? 47  ARG d CD    1 
ATOM   8998  N  NE    . ARG O  4  47  ? -41.997  -41.178 -23.008 1.00 43.19  ? 47  ARG d NE    1 
ATOM   8999  C  CZ    . ARG O  4  47  ? -41.127  -40.284 -23.479 1.00 43.51  ? 47  ARG d CZ    1 
ATOM   9000  N  NH1   . ARG O  4  47  ? -40.836  -40.237 -24.789 1.00 42.35  ? 47  ARG d NH1   1 
ATOM   9001  N  NH2   . ARG O  4  47  ? -40.529  -39.445 -22.617 1.00 42.91  ? 47  ARG d NH2   1 
ATOM   9002  N  N     . ASN O  4  48  ? -48.120  -42.650 -22.306 1.00 49.75  ? 48  ASN d N     1 
ATOM   9003  C  CA    . ASN O  4  48  ? -48.972  -42.807 -21.096 1.00 45.79  ? 48  ASN d CA    1 
ATOM   9004  C  C     . ASN O  4  48  ? -48.971  -44.245 -20.673 1.00 42.30  ? 48  ASN d C     1 
ATOM   9005  O  O     . ASN O  4  48  ? -49.742  -44.628 -19.834 1.00 41.18  ? 48  ASN d O     1 
ATOM   9006  C  CB    . ASN O  4  48  ? -50.438  -42.431 -21.349 1.00 45.80  ? 48  ASN d CB    1 
ATOM   9007  C  CG    . ASN O  4  48  ? -51.000  -43.034 -22.624 1.00 42.85  ? 48  ASN d CG    1 
ATOM   9008  O  OD1   . ASN O  4  48  ? -50.414  -44.012 -23.106 1.00 44.51  ? 48  ASN d OD1   1 
ATOM   9009  N  ND2   . ASN O  4  48  ? -52.109  -42.502 -23.136 1.00 39.15  ? 48  ASN d ND2   1 
ATOM   9010  N  N     . ASN O  4  49  ? -48.164  -45.039 -21.329 1.00 42.21  ? 49  ASN d N     1 
ATOM   9011  C  CA    . ASN O  4  49  ? -48.087  -46.414 -21.032 1.00 48.49  ? 49  ASN d CA    1 
ATOM   9012  C  C     . ASN O  4  49  ? -49.349  -47.158 -21.271 1.00 45.63  ? 49  ASN d C     1 
ATOM   9013  O  O     . ASN O  4  49  ? -49.617  -48.154 -20.602 1.00 49.91  ? 49  ASN d O     1 
ATOM   9014  C  CB    . ASN O  4  49  ? -47.606  -46.702 -19.586 1.00 52.50  ? 49  ASN d CB    1 
ATOM   9015  C  CG    . ASN O  4  49  ? -46.974  -48.079 -19.473 1.00 54.98  ? 49  ASN d CG    1 
ATOM   9016  O  OD1   . ASN O  4  49  ? -46.701  -48.770 -20.456 1.00 57.44  ? 49  ASN d OD1   1 
ATOM   9017  N  ND2   . ASN O  4  49  ? -46.743  -48.475 -18.274 1.00 60.18  ? 49  ASN d ND2   1 
ATOM   9018  N  N     . LYS O  4  50  ? -50.082  -46.713 -22.247 1.00 43.25  ? 50  LYS d N     1 
ATOM   9019  C  CA    . LYS O  4  50  ? -51.189  -47.497 -22.714 1.00 47.81  ? 50  LYS d CA    1 
ATOM   9020  C  C     . LYS O  4  50  ? -50.831  -47.959 -24.109 1.00 48.22  ? 50  LYS d C     1 
ATOM   9021  O  O     . LYS O  4  50  ? -49.915  -47.446 -24.721 1.00 48.23  ? 50  LYS d O     1 
ATOM   9022  C  CB    . LYS O  4  50  ? -52.423  -46.623 -22.716 1.00 51.22  ? 50  LYS d CB    1 
ATOM   9023  C  CG    . LYS O  4  50  ? -52.641  -46.005 -21.356 1.00 56.02  ? 50  LYS d CG    1 
ATOM   9024  C  CD    . LYS O  4  50  ? -54.047  -45.434 -21.275 1.00 63.72  ? 50  LYS d CD    1 
ATOM   9025  C  CE    . LYS O  4  50  ? -54.366  -45.048 -19.842 1.00 72.61  ? 50  LYS d CE    1 
ATOM   9026  N  NZ    . LYS O  4  50  ? -55.634  -44.268 -19.904 1.00 78.00  ? 50  LYS d NZ    1 
ATOM   9027  N  N     . LYS O  4  51  ? -51.605  -48.876 -24.642 1.00 49.28  ? 51  LYS d N     1 
ATOM   9028  C  CA    . LYS O  4  51  ? -51.340  -49.401 -25.967 1.00 50.91  ? 51  LYS d CA    1 
ATOM   9029  C  C     . LYS O  4  51  ? -52.616  -49.150 -26.774 1.00 51.41  ? 51  LYS d C     1 
ATOM   9030  O  O     . LYS O  4  51  ? -53.727  -49.385 -26.313 1.00 53.54  ? 51  LYS d O     1 
ATOM   9031  C  CB    . LYS O  4  51  ? -50.999  -50.883 -25.956 1.00 51.50  ? 51  LYS d CB    1 
ATOM   9032  C  CG    . LYS O  4  51  ? -50.510  -51.439 -24.628 1.00 52.87  ? 51  LYS d CG    1 
ATOM   9033  C  CD    . LYS O  4  51  ? -49.023  -51.248 -24.466 1.00 53.64  ? 51  LYS d CD    1 
ATOM   9034  C  CE    . LYS O  4  51  ? -48.530  -51.582 -23.047 1.00 52.80  ? 51  LYS d CE    1 
ATOM   9035  N  NZ    . LYS O  4  51  ? -48.213  -50.306 -22.347 1.00 49.73  ? 51  LYS d NZ    1 
ATOM   9036  N  N     . LEU O  4  52  ? -52.437  -48.645 -27.982 1.00 51.23  ? 52  LEU d N     1 
ATOM   9037  C  CA    . LEU O  4  52  ? -53.522  -48.277 -28.855 1.00 49.79  ? 52  LEU d CA    1 
ATOM   9038  C  C     . LEU O  4  52  ? -53.468  -49.206 -30.017 1.00 48.89  ? 52  LEU d C     1 
ATOM   9039  O  O     . LEU O  4  52  ? -52.448  -49.222 -30.701 1.00 56.34  ? 52  LEU d O     1 
ATOM   9040  C  CB    . LEU O  4  52  ? -53.342  -46.862 -29.379 1.00 46.93  ? 52  LEU d CB    1 
ATOM   9041  C  CG    . LEU O  4  52  ? -53.243  -45.851 -28.268 1.00 48.54  ? 52  LEU d CG    1 
ATOM   9042  C  CD1   . LEU O  4  52  ? -52.906  -44.450 -28.741 1.00 53.53  ? 52  LEU d CD1   1 
ATOM   9043  C  CD2   . LEU O  4  52  ? -54.540  -45.777 -27.524 1.00 50.29  ? 52  LEU d CD2   1 
ATOM   9044  N  N     . LEU O  4  53  ? -54.546  -49.928 -30.263 1.00 45.23  ? 53  LEU d N     1 
ATOM   9045  C  CA    . LEU O  4  53  ? -54.592  -50.773 -31.407 1.00 45.81  ? 53  LEU d CA    1 
ATOM   9046  C  C     . LEU O  4  53  ? -55.668  -50.244 -32.311 1.00 48.18  ? 53  LEU d C     1 
ATOM   9047  O  O     . LEU O  4  53  ? -56.833  -50.219 -31.948 1.00 51.95  ? 53  LEU d O     1 
ATOM   9048  C  CB    . LEU O  4  53  ? -54.899  -52.156 -30.955 1.00 46.70  ? 53  LEU d CB    1 
ATOM   9049  C  CG    . LEU O  4  53  ? -55.295  -53.130 -32.055 1.00 52.20  ? 53  LEU d CG    1 
ATOM   9050  C  CD1   . LEU O  4  53  ? -54.500  -52.985 -33.343 1.00 55.48  ? 53  LEU d CD1   1 
ATOM   9051  C  CD2   . LEU O  4  53  ? -55.062  -54.533 -31.478 1.00 53.79  ? 53  LEU d CD2   1 
ATOM   9052  N  N     . GLY O  4  54  ? -55.287  -49.812 -33.511 1.00 49.28  ? 54  GLY d N     1 
ATOM   9053  C  CA    . GLY O  4  54  ? -56.236  -49.209 -34.451 1.00 49.31  ? 54  GLY d CA    1 
ATOM   9054  C  C     . GLY O  4  54  ? -55.762  -49.036 -35.867 1.00 44.49  ? 54  GLY d C     1 
ATOM   9055  O  O     . GLY O  4  54  ? -54.795  -49.664 -36.245 1.00 47.02  ? 54  GLY d O     1 
ATOM   9056  N  N     . ARG O  4  55  ? -56.508  -48.277 -36.638 1.00 41.68  ? 55  ARG d N     1 
ATOM   9057  C  CA    . ARG O  4  55  ? -56.154  -47.993 -37.981 1.00 43.66  ? 55  ARG d CA    1 
ATOM   9058  C  C     . ARG O  4  55  ? -55.667  -46.580 -38.155 1.00 46.46  ? 55  ARG d C     1 
ATOM   9059  O  O     . ARG O  4  55  ? -56.136  -45.673 -37.466 1.00 47.74  ? 55  ARG d O     1 
ATOM   9060  C  CB    . ARG O  4  55  ? -57.360  -48.125 -38.854 1.00 47.94  ? 55  ARG d CB    1 
ATOM   9061  C  CG    . ARG O  4  55  ? -57.925  -49.518 -38.751 1.00 54.62  ? 55  ARG d CG    1 
ATOM   9062  C  CD    . ARG O  4  55  ? -58.842  -49.882 -39.914 1.00 59.17  ? 55  ARG d CD    1 
ATOM   9063  N  NE    . ARG O  4  55  ? -59.443  -51.138 -39.490 1.00 61.86  ? 55  ARG d NE    1 
ATOM   9064  C  CZ    . ARG O  4  55  ? -58.842  -52.316 -39.603 1.00 71.87  ? 55  ARG d CZ    1 
ATOM   9065  N  NH1   . ARG O  4  55  ? -57.627  -52.441 -40.129 1.00 86.74  ? 55  ARG d NH1   1 
ATOM   9066  N  NH2   . ARG O  4  55  ? -59.453  -53.404 -39.187 1.00 74.64  ? 55  ARG d NH2   1 
ATOM   9067  N  N     . VAL O  4  56  ? -54.811  -46.368 -39.157 1.00 46.09  ? 56  VAL d N     1 
ATOM   9068  C  CA    . VAL O  4  56  ? -54.159  -45.096 -39.331 1.00 46.97  ? 56  VAL d CA    1 
ATOM   9069  C  C     . VAL O  4  56  ? -54.771  -44.440 -40.530 1.00 49.12  ? 56  VAL d C     1 
ATOM   9070  O  O     . VAL O  4  56  ? -54.605  -44.929 -41.616 1.00 47.78  ? 56  VAL d O     1 
ATOM   9071  C  CB    . VAL O  4  56  ? -52.660  -45.264 -39.569 1.00 48.56  ? 56  VAL d CB    1 
ATOM   9072  C  CG1   . VAL O  4  56  ? -51.963  -43.934 -39.358 1.00 51.16  ? 56  VAL d CG1   1 
ATOM   9073  C  CG2   . VAL O  4  56  ? -52.049  -46.314 -38.656 1.00 49.07  ? 56  VAL d CG2   1 
ATOM   9074  N  N     . LYS O  4  57  ? -55.433  -43.312 -40.339 1.00 55.66  ? 57  LYS d N     1 
ATOM   9075  C  CA    . LYS O  4  57  ? -56.004  -42.572 -41.457 1.00 62.63  ? 57  LYS d CA    1 
ATOM   9076  C  C     . LYS O  4  57  ? -55.024  -41.607 -42.021 1.00 61.86  ? 57  LYS d C     1 
ATOM   9077  O  O     . LYS O  4  57  ? -55.099  -41.346 -43.199 1.00 62.56  ? 57  LYS d O     1 
ATOM   9078  C  CB    . LYS O  4  57  ? -57.278  -41.828 -41.097 1.00 68.12  ? 57  LYS d CB    1 
ATOM   9079  C  CG    . LYS O  4  57  ? -58.445  -42.792 -40.883 1.00 76.47  ? 57  LYS d CG    1 
ATOM   9080  C  CD    . LYS O  4  57  ? -59.041  -43.367 -42.157 1.00 87.62  ? 57  LYS d CD    1 
ATOM   9081  C  CE    . LYS O  4  57  ? -59.743  -42.259 -42.945 1.00 101.91 ? 57  LYS d CE    1 
ATOM   9082  N  NZ    . LYS O  4  57  ? -60.755  -42.733 -43.935 1.00 109.55 ? 57  LYS d NZ    1 
ATOM   9083  N  N     . ALA O  4  58  ? -54.146  -41.065 -41.199 1.00 64.38  ? 58  ALA d N     1 
ATOM   9084  C  CA    . ALA O  4  58  ? -53.122  -40.168 -41.724 1.00 67.23  ? 58  ALA d CA    1 
ATOM   9085  C  C     . ALA O  4  58  ? -52.014  -40.007 -40.709 1.00 70.60  ? 58  ALA d C     1 
ATOM   9086  O  O     . ALA O  4  58  ? -52.180  -40.336 -39.545 1.00 69.30  ? 58  ALA d O     1 
ATOM   9087  C  CB    . ALA O  4  58  ? -53.691  -38.811 -42.074 1.00 61.65  ? 58  ALA d CB    1 
ATOM   9088  N  N     . PHE O  4  59  ? -50.862  -39.534 -41.177 1.00 70.43  ? 59  PHE d N     1 
ATOM   9089  C  CA    . PHE O  4  59  ? -49.767  -39.220 -40.275 1.00 66.27  ? 59  PHE d CA    1 
ATOM   9090  C  C     . PHE O  4  59  ? -48.842  -38.149 -40.804 1.00 60.90  ? 59  PHE d C     1 
ATOM   9091  O  O     . PHE O  4  59  ? -48.973  -37.777 -41.935 1.00 69.64  ? 59  PHE d O     1 
ATOM   9092  C  CB    . PHE O  4  59  ? -48.983  -40.473 -40.035 1.00 65.59  ? 59  PHE d CB    1 
ATOM   9093  C  CG    . PHE O  4  59  ? -48.120  -40.846 -41.185 1.00 67.85  ? 59  PHE d CG    1 
ATOM   9094  C  CD1   . PHE O  4  59  ? -46.828  -40.379 -41.310 1.00 64.97  ? 59  PHE d CD1   1 
ATOM   9095  C  CD2   . PHE O  4  59  ? -48.622  -41.715 -42.117 1.00 76.77  ? 59  PHE d CD2   1 
ATOM   9096  C  CE1   . PHE O  4  59  ? -46.047  -40.754 -42.359 1.00 74.08  ? 59  PHE d CE1   1 
ATOM   9097  C  CE2   . PHE O  4  59  ? -47.833  -42.135 -43.166 1.00 86.16  ? 59  PHE d CE2   1 
ATOM   9098  C  CZ    . PHE O  4  59  ? -46.544  -41.655 -43.292 1.00 85.35  ? 59  PHE d CZ    1 
ATOM   9099  N  N     . ASP O  4  60  ? -47.875  -37.727 -40.019 1.00 53.81  ? 60  ASP d N     1 
ATOM   9100  C  CA    . ASP O  4  60  ? -46.918  -36.750 -40.466 1.00 53.13  ? 60  ASP d CA    1 
ATOM   9101  C  C     . ASP O  4  60  ? -45.557  -37.015 -39.881 1.00 57.57  ? 60  ASP d C     1 
ATOM   9102  O  O     . ASP O  4  60  ? -45.374  -38.014 -39.190 1.00 54.47  ? 60  ASP d O     1 
ATOM   9103  C  CB    . ASP O  4  60  ? -47.463  -35.344 -40.252 1.00 53.07  ? 60  ASP d CB    1 
ATOM   9104  C  CG    . ASP O  4  60  ? -47.348  -34.814 -38.824 1.00 54.23  ? 60  ASP d CG    1 
ATOM   9105  O  OD1   . ASP O  4  60  ? -46.706  -35.479 -37.979 1.00 56.35  ? 60  ASP d OD1   1 
ATOM   9106  O  OD2   . ASP O  4  60  ? -47.757  -33.684 -38.472 1.00 50.92  ? 60  ASP d OD2   1 
ATOM   9107  N  N     . ARG O  4  61  ? -44.620  -36.115 -40.166 1.00 64.18  ? 61  ARG d N     1 
ATOM   9108  C  CA    . ARG O  4  61  ? -43.236  -36.302 -39.726 1.00 64.56  ? 61  ARG d CA    1 
ATOM   9109  C  C     . ARG O  4  61  ? -43.048  -36.643 -38.259 1.00 67.89  ? 61  ARG d C     1 
ATOM   9110  O  O     . ARG O  4  61  ? -42.217  -37.513 -37.906 1.00 82.10  ? 61  ARG d O     1 
ATOM   9111  C  CB    . ARG O  4  61  ? -42.351  -35.120 -39.985 1.00 69.06  ? 61  ARG d CB    1 
ATOM   9112  C  CG    . ARG O  4  61  ? -43.067  -33.819 -39.987 1.00 78.99  ? 61  ARG d CG    1 
ATOM   9113  C  CD    . ARG O  4  61  ? -42.152  -32.666 -40.369 1.00 93.13  ? 61  ARG d CD    1 
ATOM   9114  N  NE    . ARG O  4  61  ? -42.601  -32.213 -41.696 1.00 106.62 ? 61  ARG d NE    1 
ATOM   9115  C  CZ    . ARG O  4  61  ? -41.981  -31.278 -42.399 1.00 105.54 ? 61  ARG d CZ    1 
ATOM   9116  N  NH1   . ARG O  4  61  ? -40.911  -30.660 -41.912 1.00 106.28 ? 61  ARG d NH1   1 
ATOM   9117  N  NH2   . ARG O  4  61  ? -42.492  -30.919 -43.566 1.00 111.28 ? 61  ARG d NH2   1 
ATOM   9118  N  N     . HIS O  4  62  ? -43.899  -36.079 -37.404 1.00 57.29  ? 62  HIS d N     1 
ATOM   9119  C  CA    . HIS O  4  62  ? -43.782  -36.336 -35.985 1.00 55.45  ? 62  HIS d CA    1 
ATOM   9120  C  C     . HIS O  4  62  ? -44.294  -37.714 -35.522 1.00 57.64  ? 62  HIS d C     1 
ATOM   9121  O  O     . HIS O  4  62  ? -44.073  -38.101 -34.387 1.00 51.33  ? 62  HIS d O     1 
ATOM   9122  C  CB    . HIS O  4  62  ? -44.461  -35.270 -35.205 1.00 50.35  ? 62  HIS d CB    1 
ATOM   9123  C  CG    . HIS O  4  62  ? -44.165  -33.925 -35.717 1.00 48.87  ? 62  HIS d CG    1 
ATOM   9124  N  ND1   . HIS O  4  62  ? -43.345  -33.053 -35.052 1.00 51.80  ? 62  HIS d ND1   1 
ATOM   9125  C  CD2   . HIS O  4  62  ? -44.616  -33.258 -36.788 1.00 50.99  ? 62  HIS d CD2   1 
ATOM   9126  C  CE1   . HIS O  4  62  ? -43.274  -31.911 -35.708 1.00 52.83  ? 62  HIS d CE1   1 
ATOM   9127  N  NE2   . HIS O  4  62  ? -44.048  -32.007 -36.769 1.00 52.48  ? 62  HIS d NE2   1 
ATOM   9128  N  N     . CYS O  4  63  ? -44.978  -38.429 -36.404 1.00 59.69  ? 63  CYS d N     1 
ATOM   9129  C  CA    . CYS O  4  63  ? -45.810  -39.564 -36.026 1.00 59.55  ? 63  CYS d CA    1 
ATOM   9130  C  C     . CYS O  4  63  ? -47.074  -39.060 -35.329 1.00 50.92  ? 63  CYS d C     1 
ATOM   9131  O  O     . CYS O  4  63  ? -47.677  -39.802 -34.608 1.00 50.36  ? 63  CYS d O     1 
ATOM   9132  C  CB    . CYS O  4  63  ? -45.094  -40.655 -35.219 1.00 64.01  ? 63  CYS d CB    1 
ATOM   9133  S  SG    . CYS O  4  63  ? -43.510  -41.272 -35.872 1.00 76.54  ? 63  CYS d SG    1 
ATOM   9134  N  N     . ASN O  4  64  ? -47.472  -37.812 -35.527 1.00 42.56  ? 64  ASN d N     1 
ATOM   9135  C  CA    . ASN O  4  64  ? -48.825  -37.470 -35.300 1.00 40.18  ? 64  ASN d CA    1 
ATOM   9136  C  C     . ASN O  4  64  ? -49.589  -38.425 -36.155 1.00 38.08  ? 64  ASN d C     1 
ATOM   9137  O  O     . ASN O  4  64  ? -49.317  -38.594 -37.314 1.00 33.40  ? 64  ASN d O     1 
ATOM   9138  C  CB    . ASN O  4  64  ? -49.163  -36.065 -35.782 1.00 41.27  ? 64  ASN d CB    1 
ATOM   9139  C  CG    . ASN O  4  64  ? -48.604  -34.995 -34.872 1.00 44.86  ? 64  ASN d CG    1 
ATOM   9140  O  OD1   . ASN O  4  64  ? -48.392  -35.204 -33.692 1.00 46.73  ? 64  ASN d OD1   1 
ATOM   9141  N  ND2   . ASN O  4  64  ? -48.394  -33.814 -35.412 1.00 46.93  ? 64  ASN d ND2   1 
ATOM   9142  N  N     . MET O  4  65  ? -50.613  -39.007 -35.574 1.00 39.50  ? 65  MET d N     1 
ATOM   9143  C  CA    . MET O  4  65  ? -51.476  -39.839 -36.346 1.00 41.35  ? 65  MET d CA    1 
ATOM   9144  C  C     . MET O  4  65  ? -52.917  -39.380 -36.107 1.00 44.70  ? 65  MET d C     1 
ATOM   9145  O  O     . MET O  4  65  ? -53.263  -38.906 -35.028 1.00 43.65  ? 65  MET d O     1 
ATOM   9146  C  CB    . MET O  4  65  ? -51.194  -41.302 -35.983 1.00 40.13  ? 65  MET d CB    1 
ATOM   9147  C  CG    . MET O  4  65  ? -49.868  -41.852 -36.512 1.00 37.90  ? 65  MET d CG    1 
ATOM   9148  S  SD    . MET O  4  65  ? -49.268  -43.187 -35.457 1.00 38.11  ? 65  MET d SD    1 
ATOM   9149  C  CE    . MET O  4  65  ? -50.374  -44.351 -36.232 1.00 39.79  ? 65  MET d CE    1 
ATOM   9150  N  N     . VAL O  4  66  ? -53.747  -39.558 -37.132 1.00 47.02  ? 66  VAL d N     1 
ATOM   9151  C  CA    . VAL O  4  66  ? -55.175  -39.641 -36.920 1.00 49.73  ? 66  VAL d CA    1 
ATOM   9152  C  C     . VAL O  4  66  ? -55.539  -41.119 -36.939 1.00 52.73  ? 66  VAL d C     1 
ATOM   9153  O  O     . VAL O  4  66  ? -55.203  -41.833 -37.879 1.00 53.51  ? 66  VAL d O     1 
ATOM   9154  C  CB    . VAL O  4  66  ? -55.929  -38.917 -38.010 1.00 49.72  ? 66  VAL d CB    1 
ATOM   9155  C  CG1   . VAL O  4  66  ? -57.372  -39.369 -38.046 1.00 51.40  ? 66  VAL d CG1   1 
ATOM   9156  C  CG2   . VAL O  4  66  ? -55.903  -37.435 -37.719 1.00 50.32  ? 66  VAL d CG2   1 
ATOM   9157  N  N     . LEU O  4  67  ? -56.289  -41.573 -35.943 1.00 53.42  ? 67  LEU d N     1 
ATOM   9158  C  CA    . LEU O  4  67  ? -56.632  -42.986 -35.868 1.00 53.75  ? 67  LEU d CA    1 
ATOM   9159  C  C     . LEU O  4  67  ? -58.120  -43.214 -35.902 1.00 53.53  ? 67  LEU d C     1 
ATOM   9160  O  O     . LEU O  4  67  ? -58.873  -42.369 -35.458 1.00 54.61  ? 67  LEU d O     1 
ATOM   9161  C  CB    . LEU O  4  67  ? -56.022  -43.557 -34.590 1.00 53.97  ? 67  LEU d CB    1 
ATOM   9162  C  CG    . LEU O  4  67  ? -54.494  -43.386 -34.438 1.00 49.77  ? 67  LEU d CG    1 
ATOM   9163  C  CD1   . LEU O  4  67  ? -54.010  -43.823 -33.084 1.00 47.95  ? 67  LEU d CD1   1 
ATOM   9164  C  CD2   . LEU O  4  67  ? -53.844  -44.266 -35.466 1.00 52.60  ? 67  LEU d CD2   1 
ATOM   9165  N  N     . GLU O  4  68  ? -58.512  -44.377 -36.392 1.00 54.44  ? 68  GLU d N     1 
ATOM   9166  C  CA    . GLU O  4  68  ? -59.870  -44.842 -36.328 1.00 56.89  ? 68  GLU d CA    1 
ATOM   9167  C  C     . GLU O  4  68  ? -59.960  -46.212 -35.655 1.00 52.48  ? 68  GLU d C     1 
ATOM   9168  O  O     . GLU O  4  68  ? -59.095  -47.036 -35.702 1.00 45.50  ? 68  GLU d O     1 
ATOM   9169  C  CB    . GLU O  4  68  ? -60.386  -45.019 -37.722 1.00 65.63  ? 68  GLU d CB    1 
ATOM   9170  C  CG    . GLU O  4  68  ? -60.998  -43.777 -38.369 1.00 78.83  ? 68  GLU d CG    1 
ATOM   9171  C  CD    . GLU O  4  68  ? -62.088  -44.142 -39.389 1.00 91.80  ? 68  GLU d CD    1 
ATOM   9172  O  OE1   . GLU O  4  68  ? -61.798  -44.174 -40.598 1.00 96.12  ? 68  GLU d OE1   1 
ATOM   9173  O  OE2   . GLU O  4  68  ? -63.198  -44.546 -38.949 1.00 102.78 ? 68  GLU d OE2   1 
ATOM   9174  N  N     . ASN O  4  69  ? -61.063  -46.416 -34.982 1.00 55.85  ? 69  ASN d N     1 
ATOM   9175  C  CA    . ASN O  4  69  ? -61.381  -47.702 -34.403 1.00 62.35  ? 69  ASN d CA    1 
ATOM   9176  C  C     . ASN O  4  69  ? -60.271  -48.194 -33.542 1.00 53.34  ? 69  ASN d C     1 
ATOM   9177  O  O     . ASN O  4  69  ? -59.831  -49.326 -33.648 1.00 53.17  ? 69  ASN d O     1 
ATOM   9178  C  CB    . ASN O  4  69  ? -61.694  -48.759 -35.472 1.00 71.42  ? 69  ASN d CB    1 
ATOM   9179  C  CG    . ASN O  4  69  ? -62.657  -48.262 -36.510 1.00 78.39  ? 69  ASN d CG    1 
ATOM   9180  O  OD1   . ASN O  4  69  ? -63.725  -47.647 -36.186 1.00 93.91  ? 69  ASN d OD1   1 
ATOM   9181  N  ND2   . ASN O  4  69  ? -62.291  -48.514 -37.765 1.00 78.76  ? 69  ASN d ND2   1 
ATOM   9182  N  N     . VAL O  4  70  ? -59.927  -47.320 -32.632 1.00 48.23  ? 70  VAL d N     1 
ATOM   9183  C  CA    . VAL O  4  70  ? -58.869  -47.609 -31.726 1.00 49.08  ? 70  VAL d CA    1 
ATOM   9184  C  C     . VAL O  4  70  ? -59.435  -48.367 -30.544 1.00 49.74  ? 70  VAL d C     1 
ATOM   9185  O  O     . VAL O  4  70  ? -60.557  -48.147 -30.132 1.00 50.75  ? 70  VAL d O     1 
ATOM   9186  C  CB    . VAL O  4  70  ? -58.206  -46.314 -31.257 1.00 50.09  ? 70  VAL d CB    1 
ATOM   9187  C  CG1   . VAL O  4  70  ? -57.005  -46.635 -30.393 1.00 52.87  ? 70  VAL d CG1   1 
ATOM   9188  C  CG2   . VAL O  4  70  ? -57.789  -45.474 -32.463 1.00 47.78  ? 70  VAL d CG2   1 
ATOM   9189  N  N     . LYS O  4  71  ? -58.624  -49.247 -29.984 1.00 51.93  ? 71  LYS d N     1 
ATOM   9190  C  CA    . LYS O  4  71  ? -58.890  -49.846 -28.688 1.00 53.60  ? 71  LYS d CA    1 
ATOM   9191  C  C     . LYS O  4  71  ? -57.703  -49.543 -27.811 1.00 50.20  ? 71  LYS d C     1 
ATOM   9192  O  O     . LYS O  4  71  ? -56.582  -49.936 -28.105 1.00 57.01  ? 71  LYS d O     1 
ATOM   9193  C  CB    . LYS O  4  71  ? -59.027  -51.332 -28.874 1.00 58.71  ? 71  LYS d CB    1 
ATOM   9194  C  CG    . LYS O  4  71  ? -59.185  -52.138 -27.600 1.00 63.04  ? 71  LYS d CG    1 
ATOM   9195  C  CD    . LYS O  4  71  ? -59.387  -53.601 -27.987 1.00 69.41  ? 71  LYS d CD    1 
ATOM   9196  C  CE    . LYS O  4  71  ? -59.581  -54.481 -26.774 1.00 77.11  ? 71  LYS d CE    1 
ATOM   9197  N  NZ    . LYS O  4  71  ? -60.607  -55.531 -27.019 1.00 83.99  ? 71  LYS d NZ    1 
ATOM   9198  N  N     . GLU O  4  72  ? -57.935  -48.795 -26.759 1.00 46.61  ? 72  GLU d N     1 
ATOM   9199  C  CA    . GLU O  4  72  ? -56.878  -48.336 -25.876 1.00 47.31  ? 72  GLU d CA    1 
ATOM   9200  C  C     . GLU O  4  72  ? -56.870  -49.401 -24.850 1.00 47.39  ? 72  GLU d C     1 
ATOM   9201  O  O     . GLU O  4  72  ? -57.930  -49.798 -24.416 1.00 50.43  ? 72  GLU d O     1 
ATOM   9202  C  CB    . GLU O  4  72  ? -57.267  -46.999 -25.273 1.00 49.16  ? 72  GLU d CB    1 
ATOM   9203  C  CG    . GLU O  4  72  ? -56.273  -46.461 -24.313 1.00 53.96  ? 72  GLU d CG    1 
ATOM   9204  C  CD    . GLU O  4  72  ? -56.685  -45.128 -23.753 1.00 59.06  ? 72  GLU d CD    1 
ATOM   9205  O  OE1   . GLU O  4  72  ? -57.840  -44.967 -23.310 1.00 71.62  ? 72  GLU d OE1   1 
ATOM   9206  O  OE2   . GLU O  4  72  ? -55.790  -44.266 -23.684 1.00 65.78  ? 72  GLU d OE2   1 
ATOM   9207  N  N     . MET O  4  73  ? -55.701  -49.879 -24.464 1.00 49.02  ? 73  MET d N     1 
ATOM   9208  C  CA    . MET O  4  73  ? -55.603  -51.035 -23.551 1.00 49.76  ? 73  MET d CA    1 
ATOM   9209  C  C     . MET O  4  73  ? -54.511  -50.742 -22.550 1.00 50.52  ? 73  MET d C     1 
ATOM   9210  O  O     . MET O  4  73  ? -53.459  -50.278 -22.931 1.00 50.60  ? 73  MET d O     1 
ATOM   9211  C  CB    . MET O  4  73  ? -55.236  -52.351 -24.261 1.00 47.84  ? 73  MET d CB    1 
ATOM   9212  C  CG    . MET O  4  73  ? -56.168  -52.754 -25.383 1.00 49.42  ? 73  MET d CG    1 
ATOM   9213  S  SD    . MET O  4  73  ? -55.754  -54.242 -26.341 1.00 47.71  ? 73  MET d SD    1 
ATOM   9214  C  CE    . MET O  4  73  ? -54.608  -53.426 -27.446 1.00 50.39  ? 73  MET d CE    1 
ATOM   9215  N  N     . TRP O  4  74  ? -54.783  -50.939 -21.273 1.00 54.47  ? 74  TRP d N     1 
ATOM   9216  C  CA    . TRP O  4  74  ? -53.800  -50.654 -20.256 1.00 57.20  ? 74  TRP d CA    1 
ATOM   9217  C  C     . TRP O  4  74  ? -54.025  -51.524 -19.059 1.00 60.74  ? 74  TRP d C     1 
ATOM   9218  O  O     . TRP O  4  74  ? -54.552  -52.598 -19.235 1.00 66.53  ? 74  TRP d O     1 
ATOM   9219  C  CB    . TRP O  4  74  ? -53.841  -49.169 -19.911 1.00 61.15  ? 74  TRP d CB    1 
ATOM   9220  C  CG    . TRP O  4  74  ? -55.090  -48.693 -19.231 1.00 63.11  ? 74  TRP d CG    1 
ATOM   9221  C  CD1   . TRP O  4  74  ? -55.259  -48.423 -17.918 1.00 64.72  ? 74  TRP d CD1   1 
ATOM   9222  C  CD2   . TRP O  4  74  ? -56.311  -48.385 -19.853 1.00 66.87  ? 74  TRP d CD2   1 
ATOM   9223  N  NE1   . TRP O  4  74  ? -56.506  -47.975 -17.668 1.00 63.86  ? 74  TRP d NE1   1 
ATOM   9224  C  CE2   . TRP O  4  74  ? -57.186  -47.953 -18.848 1.00 67.91  ? 74  TRP d CE2   1 
ATOM   9225  C  CE3   . TRP O  4  74  ? -56.759  -48.435 -21.163 1.00 71.96  ? 74  TRP d CE3   1 
ATOM   9226  C  CZ2   . TRP O  4  74  ? -58.496  -47.577 -19.104 1.00 73.37  ? 74  TRP d CZ2   1 
ATOM   9227  C  CZ3   . TRP O  4  74  ? -58.059  -48.036 -21.418 1.00 79.42  ? 74  TRP d CZ3   1 
ATOM   9228  C  CH2   . TRP O  4  74  ? -58.915  -47.616 -20.396 1.00 75.79  ? 74  TRP d CH2   1 
ATOM   9229  N  N     . THR O  4  75  ? -53.536  -51.138 -17.882 1.00 64.64  ? 75  THR d N     1 
ATOM   9230  C  CA    . THR O  4  75  ? -53.410  -52.045 -16.756 1.00 66.13  ? 75  THR d CA    1 
ATOM   9231  C  C     . THR O  4  75  ? -53.342  -51.328 -15.417 1.00 67.49  ? 75  THR d C     1 
ATOM   9232  O  O     . THR O  4  75  ? -52.431  -50.544 -15.195 1.00 70.60  ? 75  THR d O     1 
ATOM   9233  C  CB    . THR O  4  75  ? -52.176  -52.926 -17.019 1.00 67.44  ? 75  THR d CB    1 
ATOM   9234  O  OG1   . THR O  4  75  ? -52.496  -54.262 -16.662 1.00 65.89  ? 75  THR d OG1   1 
ATOM   9235  C  CG2   . THR O  4  75  ? -50.854  -52.480 -16.318 1.00 68.22  ? 75  THR d CG2   1 
ATOM   9236  N  N     . GLU O  4  76  ? -54.286  -51.602 -14.527 1.00 76.98  ? 76  GLU d N     1 
ATOM   9237  C  CA    . GLU O  4  76  ? -54.431  -50.896 -13.244 1.00 90.94  ? 76  GLU d CA    1 
ATOM   9238  C  C     . GLU O  4  76  ? -54.315  -51.835 -12.019 1.00 105.63 ? 76  GLU d C     1 
ATOM   9239  O  O     . GLU O  4  76  ? -54.215  -53.062 -12.197 1.00 102.54 ? 76  GLU d O     1 
ATOM   9240  C  CB    . GLU O  4  76  ? -55.795  -50.218 -13.180 1.00 92.53  ? 76  GLU d CB    1 
ATOM   9241  C  CG    . GLU O  4  76  ? -56.049  -49.223 -14.299 1.00 95.37  ? 76  GLU d CG    1 
ATOM   9242  C  CD    . GLU O  4  76  ? -56.925  -48.042 -13.889 1.00 105.21 ? 76  GLU d CD    1 
ATOM   9243  O  OE1   . GLU O  4  76  ? -57.335  -47.942 -12.707 1.00 108.01 ? 76  GLU d OE1   1 
ATOM   9244  O  OE2   . GLU O  4  76  ? -57.185  -47.150 -14.730 1.00 110.63 ? 76  GLU d OE2   1 
ATOM   9245  N  N     . VAL O  4  77  ? -54.320  -51.238 -10.812 1.00 116.70 ? 77  VAL d N     1 
ATOM   9246  C  CA    . VAL O  4  77  ? -54.557  -51.967 -9.549  1.00 123.01 ? 77  VAL d CA    1 
ATOM   9247  C  C     . VAL O  4  77  ? -55.907  -51.647 -8.887  1.00 113.66 ? 77  VAL d C     1 
ATOM   9248  O  O     . VAL O  4  77  ? -56.913  -52.348 -9.140  1.00 102.37 ? 77  VAL d O     1 
ATOM   9249  C  CB    . VAL O  4  77  ? -53.406  -51.807 -8.532  1.00 130.33 ? 77  VAL d CB    1 
ATOM   9250  C  CG1   . VAL O  4  77  ? -53.457  -52.906 -7.450  1.00 134.32 ? 77  VAL d CG1   1 
ATOM   9251  C  CG2   . VAL O  4  77  ? -52.056  -51.798 -9.258  1.00 130.15 ? 77  VAL d CG2   1 
ATOM   9252  N  N     . LYS O  4  88  ? -52.804  -59.007 -8.450  1.00 150.34 ? 88  LYS d N     1 
ATOM   9253  C  CA    . LYS O  4  88  ? -53.819  -57.932 -8.476  1.00 153.89 ? 88  LYS d CA    1 
ATOM   9254  C  C     . LYS O  4  88  ? -53.778  -56.950 -9.681  1.00 156.02 ? 88  LYS d C     1 
ATOM   9255  O  O     . LYS O  4  88  ? -54.533  -55.967 -9.639  1.00 151.39 ? 88  LYS d O     1 
ATOM   9256  C  CB    . LYS O  4  88  ? -53.649  -57.151 -7.151  1.00 154.20 ? 88  LYS d CB    1 
ATOM   9257  C  CG    . LYS O  4  88  ? -54.693  -57.437 -6.074  1.00 157.77 ? 88  LYS d CG    1 
ATOM   9258  C  CD    . LYS O  4  88  ? -54.263  -57.075 -4.660  1.00 161.42 ? 88  LYS d CD    1 
ATOM   9259  C  CE    . LYS O  4  88  ? -53.628  -55.703 -4.459  1.00 163.53 ? 88  LYS d CE    1 
ATOM   9260  N  NZ    . LYS O  4  88  ? -54.653  -54.657 -4.224  1.00 162.53 ? 88  LYS d NZ    1 
ATOM   9261  N  N     . PRO O  4  89  ? -52.909  -57.158 -10.721 1.00 153.18 ? 89  PRO d N     1 
ATOM   9262  C  CA    . PRO O  4  89  ? -52.997  -56.240 -11.888 1.00 129.57 ? 89  PRO d CA    1 
ATOM   9263  C  C     . PRO O  4  89  ? -54.201  -56.581 -12.765 1.00 114.16 ? 89  PRO d C     1 
ATOM   9264  O  O     . PRO O  4  89  ? -54.263  -57.684 -13.308 1.00 105.41 ? 89  PRO d O     1 
ATOM   9265  C  CB    . PRO O  4  89  ? -51.670  -56.438 -12.645 1.00 125.12 ? 89  PRO d CB    1 
ATOM   9266  C  CG    . PRO O  4  89  ? -51.204  -57.786 -12.255 1.00 137.58 ? 89  PRO d CG    1 
ATOM   9267  C  CD    . PRO O  4  89  ? -51.741  -58.062 -10.860 1.00 149.67 ? 89  PRO d CD    1 
ATOM   9268  N  N     . VAL O  4  90  ? -55.135  -55.631 -12.883 1.00 100.80 ? 90  VAL d N     1 
ATOM   9269  C  CA    . VAL O  4  90  ? -56.343  -55.761 -13.717 1.00 86.75  ? 90  VAL d CA    1 
ATOM   9270  C  C     . VAL O  4  90  ? -56.140  -55.155 -15.121 1.00 81.68  ? 90  VAL d C     1 
ATOM   9271  O  O     . VAL O  4  90  ? -55.586  -54.064 -15.251 1.00 79.52  ? 90  VAL d O     1 
ATOM   9272  C  CB    . VAL O  4  90  ? -57.610  -55.204 -13.008 1.00 80.83  ? 90  VAL d CB    1 
ATOM   9273  C  CG1   . VAL O  4  90  ? -57.416  -53.788 -12.484 1.00 81.77  ? 90  VAL d CG1   1 
ATOM   9274  C  CG2   . VAL O  4  90  ? -58.903  -55.321 -13.846 1.00 77.47  ? 90  VAL d CG2   1 
ATOM   9275  N  N     . ASN O  4  91  ? -56.616  -55.847 -16.157 1.00 76.02  ? 91  ASN d N     1 
ATOM   9276  C  CA    . ASN O  4  91  ? -56.653  -55.291 -17.511 1.00 75.30  ? 91  ASN d CA    1 
ATOM   9277  C  C     . ASN O  4  91  ? -57.789  -54.333 -17.733 1.00 72.34  ? 91  ASN d C     1 
ATOM   9278  O  O     . ASN O  4  91  ? -58.850  -54.518 -17.170 1.00 78.87  ? 91  ASN d O     1 
ATOM   9279  C  CB    . ASN O  4  91  ? -56.833  -56.346 -18.577 1.00 74.80  ? 91  ASN d CB    1 
ATOM   9280  C  CG    . ASN O  4  91  ? -55.744  -57.351 -18.533 1.00 78.61  ? 91  ASN d CG    1 
ATOM   9281  O  OD1   . ASN O  4  91  ? -54.614  -57.050 -18.155 1.00 80.94  ? 91  ASN d OD1   1 
ATOM   9282  N  ND2   . ASN O  4  91  ? -56.073  -58.561 -18.929 1.00 82.66  ? 91  ASN d ND2   1 
ATOM   9283  N  N     . LYS O  4  92  ? -57.568  -53.363 -18.599 1.00 69.76  ? 92  LYS d N     1 
ATOM   9284  C  CA    . LYS O  4  92  ? -58.569  -52.415 -18.954 1.00 72.53  ? 92  LYS d CA    1 
ATOM   9285  C  C     . LYS O  4  92  ? -58.490  -52.082 -20.425 1.00 68.99  ? 92  LYS d C     1 
ATOM   9286  O  O     . LYS O  4  92  ? -57.456  -52.247 -21.053 1.00 74.28  ? 92  LYS d O     1 
ATOM   9287  C  CB    . LYS O  4  92  ? -58.393  -51.175 -18.107 1.00 74.65  ? 92  LYS d CB    1 
ATOM   9288  C  CG    . LYS O  4  92  ? -58.840  -51.413 -16.678 1.00 79.81  ? 92  LYS d CG    1 
ATOM   9289  C  CD    . LYS O  4  92  ? -59.545  -50.214 -16.087 1.00 88.95  ? 92  LYS d CD    1 
ATOM   9290  C  CE    . LYS O  4  92  ? -59.855  -50.459 -14.624 1.00 95.21  ? 92  LYS d CE    1 
ATOM   9291  N  NZ    . LYS O  4  92  ? -60.420  -49.200 -14.050 1.00 102.84 ? 92  LYS d NZ    1 
ATOM   9292  N  N     . ASP O  4  93  ? -59.623  -51.657 -20.954 1.00 63.91  ? 93  ASP d N     1 
ATOM   9293  C  CA    . ASP O  4  93  ? -59.712  -51.294 -22.318 1.00 66.75  ? 93  ASP d CA    1 
ATOM   9294  C  C     . ASP O  4  93  ? -60.908  -50.381 -22.600 1.00 64.44  ? 93  ASP d C     1 
ATOM   9295  O  O     . ASP O  4  93  ? -61.893  -50.359 -21.870 1.00 65.46  ? 93  ASP d O     1 
ATOM   9296  C  CB    . ASP O  4  93  ? -59.738  -52.523 -23.228 1.00 74.86  ? 93  ASP d CB    1 
ATOM   9297  C  CG    . ASP O  4  93  ? -61.048  -53.321 -23.147 1.00 83.71  ? 93  ASP d CG    1 
ATOM   9298  O  OD1   . ASP O  4  93  ? -62.138  -52.914 -23.621 1.00 98.23  ? 93  ASP d OD1   1 
ATOM   9299  O  OD2   . ASP O  4  93  ? -60.979  -54.460 -22.661 1.00 99.38  ? 93  ASP d OD2   1 
ATOM   9300  N  N     . ARG O  4  94  ? -60.788  -49.623 -23.690 1.00 60.46  ? 94  ARG d N     1 
ATOM   9301  C  CA    . ARG O  4  94  ? -61.837  -48.763 -24.129 1.00 56.50  ? 94  ARG d CA    1 
ATOM   9302  C  C     . ARG O  4  94  ? -61.750  -48.588 -25.609 1.00 55.94  ? 94  ARG d C     1 
ATOM   9303  O  O     . ARG O  4  94  ? -60.639  -48.475 -26.130 1.00 65.25  ? 94  ARG d O     1 
ATOM   9304  C  CB    . ARG O  4  94  ? -61.715  -47.440 -23.369 1.00 55.80  ? 94  ARG d CB    1 
ATOM   9305  C  CG    . ARG O  4  94  ? -61.189  -46.213 -24.040 1.00 55.78  ? 94  ARG d CG    1 
ATOM   9306  C  CD    . ARG O  4  94  ? -61.369  -45.036 -23.074 1.00 58.03  ? 94  ARG d CD    1 
ATOM   9307  N  NE    . ARG O  4  94  ? -60.299  -44.070 -23.214 1.00 62.43  ? 94  ARG d NE    1 
ATOM   9308  C  CZ    . ARG O  4  94  ? -60.358  -42.767 -22.995 1.00 66.17  ? 94  ARG d CZ    1 
ATOM   9309  N  NH1   . ARG O  4  94  ? -61.488  -42.150 -22.729 1.00 70.48  ? 94  ARG d NH1   1 
ATOM   9310  N  NH2   . ARG O  4  94  ? -59.251  -42.044 -23.138 1.00 70.40  ? 94  ARG d NH2   1 
ATOM   9311  N  N     . TYR O  4  95  ? -62.896  -48.503 -26.259 1.00 50.79  ? 95  TYR d N     1 
ATOM   9312  C  CA    . TYR O  4  95  ? -62.944  -48.162 -27.630 1.00 50.87  ? 95  TYR d CA    1 
ATOM   9313  C  C     . TYR O  4  95  ? -63.001  -46.647 -27.796 1.00 52.74  ? 95  TYR d C     1 
ATOM   9314  O  O     . TYR O  4  95  ? -63.712  -45.964 -27.091 1.00 57.48  ? 95  TYR d O     1 
ATOM   9315  C  CB    . TYR O  4  95  ? -64.101  -48.827 -28.303 1.00 49.29  ? 95  TYR d CB    1 
ATOM   9316  C  CG    . TYR O  4  95  ? -64.101  -50.321 -28.218 1.00 55.37  ? 95  TYR d CG    1 
ATOM   9317  C  CD1   . TYR O  4  95  ? -63.270  -51.098 -29.021 1.00 61.87  ? 95  TYR d CD1   1 
ATOM   9318  C  CD2   . TYR O  4  95  ? -64.994  -50.992 -27.409 1.00 58.49  ? 95  TYR d CD2   1 
ATOM   9319  C  CE1   . TYR O  4  95  ? -63.313  -52.496 -28.985 1.00 64.60  ? 95  TYR d CE1   1 
ATOM   9320  C  CE2   . TYR O  4  95  ? -65.027  -52.377 -27.325 1.00 60.03  ? 95  TYR d CE2   1 
ATOM   9321  C  CZ    . TYR O  4  95  ? -64.186  -53.124 -28.120 1.00 63.93  ? 95  TYR d CZ    1 
ATOM   9322  O  OH    . TYR O  4  95  ? -64.162  -54.494 -28.057 1.00 69.16  ? 95  TYR d OH    1 
ATOM   9323  N  N     . ILE O  4  96  ? -62.270  -46.117 -28.774 1.00 52.34  ? 96  ILE d N     1 
ATOM   9324  C  CA    . ILE O  4  96  ? -62.255  -44.718 -29.172 1.00 51.20  ? 96  ILE d CA    1 
ATOM   9325  C  C     . ILE O  4  96  ? -62.370  -44.786 -30.672 1.00 51.12  ? 96  ILE d C     1 
ATOM   9326  O  O     . ILE O  4  96  ? -61.591  -45.487 -31.299 1.00 54.95  ? 96  ILE d O     1 
ATOM   9327  C  CB    . ILE O  4  96  ? -60.892  -44.094 -28.839 1.00 51.73  ? 96  ILE d CB    1 
ATOM   9328  C  CG1   . ILE O  4  96  ? -60.635  -44.247 -27.360 1.00 54.65  ? 96  ILE d CG1   1 
ATOM   9329  C  CG2   . ILE O  4  96  ? -60.851  -42.643 -29.292 1.00 53.40  ? 96  ILE d CG2   1 
ATOM   9330  C  CD1   . ILE O  4  96  ? -59.580  -43.339 -26.726 1.00 55.69  ? 96  ILE d CD1   1 
ATOM   9331  N  N     . SER O  4  97  ? -63.325  -44.106 -31.276 1.00 55.16  ? 97  SER d N     1 
ATOM   9332  C  CA    . SER O  4  97  ? -63.561  -44.394 -32.695 1.00 58.17  ? 97  SER d CA    1 
ATOM   9333  C  C     . SER O  4  97  ? -62.787  -43.426 -33.571 1.00 50.70  ? 97  SER d C     1 
ATOM   9334  O  O     . SER O  4  97  ? -62.441  -43.821 -34.689 1.00 43.77  ? 97  SER d O     1 
ATOM   9335  C  CB    . SER O  4  97  ? -65.046  -44.492 -33.077 1.00 62.76  ? 97  SER d CB    1 
ATOM   9336  O  OG    . SER O  4  97  ? -65.631  -43.229 -32.821 1.00 70.15  ? 97  SER d OG    1 
ATOM   9337  N  N     . LYS O  4  98  ? -62.544  -42.209 -33.090 1.00 46.66  ? 98  LYS d N     1 
ATOM   9338  C  CA    . LYS O  4  98  ? -61.678  -41.324 -33.870 1.00 48.92  ? 98  LYS d CA    1 
ATOM   9339  C  C     . LYS O  4  98  ? -60.801  -40.478 -32.990 1.00 50.33  ? 98  LYS d C     1 
ATOM   9340  O  O     . LYS O  4  98  ? -61.303  -39.675 -32.225 1.00 50.88  ? 98  LYS d O     1 
ATOM   9341  C  CB    . LYS O  4  98  ? -62.451  -40.395 -34.794 1.00 48.77  ? 98  LYS d CB    1 
ATOM   9342  C  CG    . LYS O  4  98  ? -63.319  -41.154 -35.782 1.00 48.37  ? 98  LYS d CG    1 
ATOM   9343  C  CD    . LYS O  4  98  ? -63.999  -40.239 -36.772 1.00 49.18  ? 98  LYS d CD    1 
ATOM   9344  C  CE    . LYS O  4  98  ? -64.831  -41.084 -37.724 1.00 53.44  ? 98  LYS d CE    1 
ATOM   9345  N  NZ    . LYS O  4  98  ? -65.854  -40.190 -38.348 1.00 58.59  ? 98  LYS d NZ    1 
ATOM   9346  N  N     . MET O  4  99  ? -59.481  -40.610 -33.128 1.00 51.06  ? 99  MET d N     1 
ATOM   9347  C  CA    . MET O  4  99  ? -58.584  -39.748 -32.340 1.00 48.75  ? 99  MET d CA    1 
ATOM   9348  C  C     . MET O  4  99  ? -57.483  -39.144 -33.163 1.00 48.71  ? 99  MET d C     1 
ATOM   9349  O  O     . MET O  4  99  ? -57.298  -39.491 -34.332 1.00 49.68  ? 99  MET d O     1 
ATOM   9350  C  CB    . MET O  4  99  ? -57.980  -40.472 -31.144 1.00 45.21  ? 99  MET d CB    1 
ATOM   9351  C  CG    . MET O  4  99  ? -57.100  -41.659 -31.399 1.00 42.98  ? 99  MET d CG    1 
ATOM   9352  S  SD    . MET O  4  99  ? -56.699  -42.731 -30.025 1.00 37.51  ? 99  MET d SD    1 
ATOM   9353  C  CE    . MET O  4  99  ? -56.368  -41.660 -28.661 1.00 38.68  ? 99  MET d CE    1 
ATOM   9354  N  N     . PHE O  4  100 ? -56.847  -38.153 -32.557 1.00 47.41  ? 100 PHE d N     1 
ATOM   9355  C  CA    . PHE O  4  100 ? -55.629  -37.593 -33.066 1.00 47.63  ? 100 PHE d CA    1 
ATOM   9356  C  C     . PHE O  4  100 ? -54.641  -37.776 -31.992 1.00 48.04  ? 100 PHE d C     1 
ATOM   9357  O  O     . PHE O  4  100 ? -54.829  -37.232 -30.928 1.00 50.22  ? 100 PHE d O     1 
ATOM   9358  C  CB    . PHE O  4  100 ? -55.782  -36.112 -33.264 1.00 50.85  ? 100 PHE d CB    1 
ATOM   9359  C  CG    . PHE O  4  100 ? -54.528  -35.465 -33.758 1.00 55.44  ? 100 PHE d CG    1 
ATOM   9360  C  CD1   . PHE O  4  100 ? -53.491  -35.184 -32.892 1.00 58.95  ? 100 PHE d CD1   1 
ATOM   9361  C  CD2   . PHE O  4  100 ? -54.419  -35.100 -35.078 1.00 57.08  ? 100 PHE d CD2   1 
ATOM   9362  C  CE1   . PHE O  4  100 ? -52.354  -34.551 -33.303 1.00 60.11  ? 100 PHE d CE1   1 
ATOM   9363  C  CE2   . PHE O  4  100 ? -53.281  -34.480 -35.505 1.00 61.23  ? 100 PHE d CE2   1 
ATOM   9364  C  CZ    . PHE O  4  100 ? -52.255  -34.188 -34.621 1.00 62.06  ? 100 PHE d CZ    1 
ATOM   9365  N  N     . LEU O  4  101 ? -53.575  -38.498 -32.277 1.00 53.17  ? 101 LEU d N     1 
ATOM   9366  C  CA    . LEU O  4  101 ? -52.499  -38.729 -31.290 1.00 49.42  ? 101 LEU d CA    1 
ATOM   9367  C  C     . LEU O  4  101 ? -51.335  -37.868 -31.618 1.00 45.81  ? 101 LEU d C     1 
ATOM   9368  O  O     . LEU O  4  101 ? -50.905  -37.815 -32.747 1.00 44.47  ? 101 LEU d O     1 
ATOM   9369  C  CB    . LEU O  4  101 ? -52.041  -40.173 -31.367 1.00 50.16  ? 101 LEU d CB    1 
ATOM   9370  C  CG    . LEU O  4  101 ? -50.764  -40.520 -30.647 1.00 50.72  ? 101 LEU d CG    1 
ATOM   9371  C  CD1   . LEU O  4  101 ? -50.903  -40.059 -29.208 1.00 57.08  ? 101 LEU d CD1   1 
ATOM   9372  C  CD2   . LEU O  4  101 ? -50.536  -42.031 -30.686 1.00 52.06  ? 101 LEU d CD2   1 
ATOM   9373  N  N     . ARG O  4  102 ? -50.857  -37.178 -30.620 1.00 45.65  ? 102 ARG d N     1 
ATOM   9374  C  CA    . ARG O  4  102 ? -49.640  -36.363 -30.743 1.00 47.90  ? 102 ARG d CA    1 
ATOM   9375  C  C     . ARG O  4  102 ? -48.391  -37.219 -30.803 1.00 46.70  ? 102 ARG d C     1 
ATOM   9376  O  O     . ARG O  4  102 ? -48.169  -38.042 -29.920 1.00 49.15  ? 102 ARG d O     1 
ATOM   9377  C  CB    . ARG O  4  102 ? -49.467  -35.377 -29.566 1.00 47.74  ? 102 ARG d CB    1 
ATOM   9378  C  CG    . ARG O  4  102 ? -48.528  -34.251 -29.898 1.00 48.37  ? 102 ARG d CG    1 
ATOM   9379  C  CD    . ARG O  4  102 ? -48.423  -33.260 -28.787 1.00 49.67  ? 102 ARG d CD    1 
ATOM   9380  N  NE    . ARG O  4  102 ? -47.114  -32.613 -28.689 1.00 50.95  ? 102 ARG d NE    1 
ATOM   9381  C  CZ    . ARG O  4  102 ? -46.796  -31.471 -29.264 1.00 54.32  ? 102 ARG d CZ    1 
ATOM   9382  N  NH1   . ARG O  4  102 ? -45.579  -31.017 -29.062 1.00 60.57  ? 102 ARG d NH1   1 
ATOM   9383  N  NH2   . ARG O  4  102 ? -47.655  -30.810 -30.038 1.00 58.47  ? 102 ARG d NH2   1 
ATOM   9384  N  N     . GLY O  4  103 ? -47.602  -36.998 -31.842 1.00 45.17  ? 103 GLY d N     1 
ATOM   9385  C  CA    . GLY O  4  103 ? -46.494  -37.847 -32.185 1.00 48.52  ? 103 GLY d CA    1 
ATOM   9386  C  C     . GLY O  4  103 ? -45.450  -38.086 -31.110 1.00 48.24  ? 103 GLY d C     1 
ATOM   9387  O  O     . GLY O  4  103 ? -44.906  -39.215 -30.984 1.00 47.55  ? 103 GLY d O     1 
ATOM   9388  N  N     . ASP O  4  104 ? -45.159  -37.034 -30.356 1.00 45.82  ? 104 ASP d N     1 
ATOM   9389  C  CA    . ASP O  4  104 ? -44.146  -37.156 -29.319 1.00 48.15  ? 104 ASP d CA    1 
ATOM   9390  C  C     . ASP O  4  104 ? -44.358  -38.322 -28.362 1.00 46.88  ? 104 ASP d C     1 
ATOM   9391  O  O     . ASP O  4  104 ? -43.440  -38.952 -27.855 1.00 47.32  ? 104 ASP d O     1 
ATOM   9392  C  CB    . ASP O  4  104 ? -43.924  -35.829 -28.595 1.00 51.17  ? 104 ASP d CB    1 
ATOM   9393  C  CG    . ASP O  4  104 ? -45.134  -35.248 -27.999 1.00 56.73  ? 104 ASP d CG    1 
ATOM   9394  O  OD1   . ASP O  4  104 ? -46.207  -35.895 -28.131 1.00 68.63  ? 104 ASP d OD1   1 
ATOM   9395  O  OD2   . ASP O  4  104 ? -45.011  -34.114 -27.433 1.00 59.21  ? 104 ASP d OD2   1 
ATOM   9396  N  N     . SER O  4  105 ? -45.610  -38.655 -28.182 1.00 49.32  ? 105 SER d N     1 
ATOM   9397  C  CA    . SER O  4  105 ? -45.990  -39.663 -27.223 1.00 50.31  ? 105 SER d CA    1 
ATOM   9398  C  C     . SER O  4  105 ? -45.907  -41.033 -27.784 1.00 46.33  ? 105 SER d C     1 
ATOM   9399  O  O     . SER O  4  105 ? -46.288  -41.969 -27.080 1.00 47.09  ? 105 SER d O     1 
ATOM   9400  C  CB    . SER O  4  105 ? -47.423  -39.361 -26.748 1.00 58.20  ? 105 SER d CB    1 
ATOM   9401  O  OG    . SER O  4  105 ? -47.557  -38.017 -26.219 1.00 61.85  ? 105 SER d OG    1 
ATOM   9402  N  N     . VAL O  4  106 ? -45.497  -41.187 -29.036 1.00 44.94  ? 106 VAL d N     1 
ATOM   9403  C  CA    . VAL O  4  106 ? -45.232  -42.528 -29.546 1.00 46.68  ? 106 VAL d CA    1 
ATOM   9404  C  C     . VAL O  4  106 ? -43.850  -43.053 -29.100 1.00 50.27  ? 106 VAL d C     1 
ATOM   9405  O  O     . VAL O  4  106 ? -42.864  -42.354 -29.186 1.00 49.72  ? 106 VAL d O     1 
ATOM   9406  C  CB    . VAL O  4  106 ? -45.203  -42.549 -31.045 1.00 45.16  ? 106 VAL d CB    1 
ATOM   9407  C  CG1   . VAL O  4  106 ? -44.826  -43.940 -31.546 1.00 46.26  ? 106 VAL d CG1   1 
ATOM   9408  C  CG2   . VAL O  4  106 ? -46.555  -42.167 -31.590 1.00 46.53  ? 106 VAL d CG2   1 
ATOM   9409  N  N     . ILE O  4  107 ? -43.811  -44.298 -28.637 1.00 52.24  ? 107 ILE d N     1 
ATOM   9410  C  CA    . ILE O  4  107 ? -42.603  -45.044 -28.412 1.00 51.56  ? 107 ILE d CA    1 
ATOM   9411  C  C     . ILE O  4  107 ? -42.310  -45.904 -29.635 1.00 54.68  ? 107 ILE d C     1 
ATOM   9412  O  O     . ILE O  4  107 ? -41.233  -45.829 -30.240 1.00 53.55  ? 107 ILE d O     1 
ATOM   9413  C  CB    . ILE O  4  107 ? -42.753  -45.987 -27.219 1.00 53.40  ? 107 ILE d CB    1 
ATOM   9414  C  CG1   . ILE O  4  107 ? -43.024  -45.157 -25.978 1.00 55.83  ? 107 ILE d CG1   1 
ATOM   9415  C  CG2   . ILE O  4  107 ? -41.489  -46.807 -27.041 1.00 55.59  ? 107 ILE d CG2   1 
ATOM   9416  C  CD1   . ILE O  4  107 ? -43.446  -45.995 -24.784 1.00 59.86  ? 107 ILE d CD1   1 
ATOM   9417  N  N     . VAL O  4  108 ? -43.260  -46.785 -29.945 1.00 56.62  ? 108 VAL d N     1 
ATOM   9418  C  CA    . VAL O  4  108 ? -43.116  -47.836 -30.926 1.00 56.17  ? 108 VAL d CA    1 
ATOM   9419  C  C     . VAL O  4  108 ? -44.449  -48.081 -31.644 1.00 55.15  ? 108 VAL d C     1 
ATOM   9420  O  O     . VAL O  4  108 ? -45.493  -48.213 -31.038 1.00 55.53  ? 108 VAL d O     1 
ATOM   9421  C  CB    . VAL O  4  108 ? -42.692  -49.063 -30.137 1.00 59.54  ? 108 VAL d CB    1 
ATOM   9422  C  CG1   . VAL O  4  108 ? -43.237  -50.360 -30.701 1.00 66.25  ? 108 VAL d CG1   1 
ATOM   9423  C  CG2   . VAL O  4  108 ? -41.197  -49.140 -30.175 1.00 63.04  ? 108 VAL d CG2   1 
ATOM   9424  N  N     . VAL O  4  109 ? -44.409  -48.235 -32.948 1.00 53.04  ? 109 VAL d N     1 
ATOM   9425  C  CA    . VAL O  4  109 ? -45.559  -48.686 -33.671 1.00 52.73  ? 109 VAL d CA    1 
ATOM   9426  C  C     . VAL O  4  109 ? -45.297  -50.067 -34.225 1.00 52.72  ? 109 VAL d C     1 
ATOM   9427  O  O     . VAL O  4  109 ? -44.226  -50.314 -34.761 1.00 56.96  ? 109 VAL d O     1 
ATOM   9428  C  CB    . VAL O  4  109 ? -45.769  -47.723 -34.816 1.00 54.67  ? 109 VAL d CB    1 
ATOM   9429  C  CG1   . VAL O  4  109 ? -47.037  -48.095 -35.581 1.00 58.50  ? 109 VAL d CG1   1 
ATOM   9430  C  CG2   . VAL O  4  109 ? -45.865  -46.319 -34.229 1.00 56.10  ? 109 VAL d CG2   1 
ATOM   9431  N  N     . LEU O  4  110 ? -46.288  -50.924 -34.224 1.00 52.33  ? 110 LEU d N     1 
ATOM   9432  C  CA    . LEU O  4  110 ? -46.127  -52.235 -34.809 1.00 55.98  ? 110 LEU d CA    1 
ATOM   9433  C  C     . LEU O  4  110 ? -47.241  -52.611 -35.791 1.00 59.37  ? 110 LEU d C     1 
ATOM   9434  O  O     . LEU O  4  110 ? -48.418  -52.737 -35.404 1.00 70.45  ? 110 LEU d O     1 
ATOM   9435  C  CB    . LEU O  4  110 ? -46.075  -53.239 -33.687 1.00 55.13  ? 110 LEU d CB    1 
ATOM   9436  C  CG    . LEU O  4  110 ? -46.423  -54.671 -34.147 1.00 60.24  ? 110 LEU d CG    1 
ATOM   9437  C  CD1   . LEU O  4  110 ? -45.313  -55.402 -34.912 1.00 64.77  ? 110 LEU d CD1   1 
ATOM   9438  C  CD2   . LEU O  4  110 ? -46.762  -55.477 -32.902 1.00 62.59  ? 110 LEU d CD2   1 
ATOM   9439  N  N     . ARG O  4  111 ? -46.879  -52.851 -37.037 1.00 58.05  ? 111 ARG d N     1 
ATOM   9440  C  CA    . ARG O  4  111 ? -47.838  -53.315 -38.023 1.00 63.15  ? 111 ARG d CA    1 
ATOM   9441  C  C     . ARG O  4  111 ? -48.319  -54.716 -37.712 1.00 65.90  ? 111 ARG d C     1 
ATOM   9442  O  O     . ARG O  4  111 ? -47.550  -55.577 -37.281 1.00 72.88  ? 111 ARG d O     1 
ATOM   9443  C  CB    . ARG O  4  111 ? -47.227  -53.294 -39.416 1.00 65.19  ? 111 ARG d CB    1 
ATOM   9444  C  CG    . ARG O  4  111 ? -47.409  -51.987 -40.167 1.00 66.75  ? 111 ARG d CG    1 
ATOM   9445  C  CD    . ARG O  4  111 ? -46.874  -52.106 -41.596 1.00 76.79  ? 111 ARG d CD    1 
ATOM   9446  N  NE    . ARG O  4  111 ? -47.560  -53.060 -42.491 1.00 80.25  ? 111 ARG d NE    1 
ATOM   9447  C  CZ    . ARG O  4  111 ? -48.155  -52.799 -43.651 1.00 82.71  ? 111 ARG d CZ    1 
ATOM   9448  N  NH1   . ARG O  4  111 ? -48.287  -51.587 -44.103 1.00 77.40  ? 111 ARG d NH1   1 
ATOM   9449  N  NH2   . ARG O  4  111 ? -48.691  -53.788 -44.344 1.00 92.99  ? 111 ARG d NH2   1 
ATOM   9450  N  N     . ASN O  4  112 ? -49.575  -54.964 -38.043 1.00 68.12  ? 112 ASN d N     1 
ATOM   9451  C  CA    . ASN O  4  112 ? -50.219  -56.254 -37.740 1.00 68.42  ? 112 ASN d CA    1 
ATOM   9452  C  C     . ASN O  4  112 ? -49.560  -57.430 -38.423 1.00 62.62  ? 112 ASN d C     1 
ATOM   9453  O  O     . ASN O  4  112 ? -49.617  -57.531 -39.625 1.00 57.71  ? 112 ASN d O     1 
ATOM   9454  C  CB    . ASN O  4  112 ? -51.705  -56.238 -38.173 1.00 73.73  ? 112 ASN d CB    1 
ATOM   9455  C  CG    . ASN O  4  112 ? -52.445  -57.541 -37.889 1.00 68.07  ? 112 ASN d CG    1 
ATOM   9456  O  OD1   . ASN O  4  112 ? -51.978  -58.404 -37.161 1.00 61.19  ? 112 ASN d OD1   1 
ATOM   9457  N  ND2   . ASN O  4  112 ? -53.642  -57.641 -38.451 1.00 70.42  ? 112 ASN d ND2   1 
ATOM   9458  N  N     . PRO O  4  113 ? -49.014  -58.335 -37.643 1.00 64.43  ? 113 PRO d N     1 
ATOM   9459  C  CA    . PRO O  4  113 ? -48.467  -59.510 -38.267 1.00 70.78  ? 113 PRO d CA    1 
ATOM   9460  C  C     . PRO O  4  113 ? -49.595  -60.520 -38.543 1.00 81.62  ? 113 PRO d C     1 
ATOM   9461  O  O     . PRO O  4  113 ? -50.381  -60.880 -37.668 1.00 95.34  ? 113 PRO d O     1 
ATO