data_4PJW
# 
_entry.id   4PJW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4PJW         
WWPDB D_1000201543 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        '4PJU contains the same protein complex without MES.' 
_pdbx_database_related.db_id          4PJU 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  . 
_pdbx_database_status.entry_id                        4PJW 
_pdbx_database_status.recvd_initial_deposition_date   2014-05-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  . 
_pdbx_database_status.methods_development_category    . 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hara, K.'       1 
'Chen, Z.'       2 
'Tomchick, D.R.' 3 
'Yu, H.'         4 
# 
_citation.abstract                  . 
_citation.abstract_id_CAS           . 
_citation.book_id_ISBN              . 
_citation.book_publisher            ? 
_citation.book_publisher_city       . 
_citation.book_title                . 
_citation.coordinate_linkage        . 
_citation.country                   US 
_citation.database_id_Medline       . 
_citation.details                   . 
_citation.id                        primary 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              . 
_citation.journal_issue             . 
_citation.journal_volume            21 
_citation.language                  . 
_citation.page_first                864 
_citation.page_last                 870 
_citation.title                     
'Structure of cohesin subcomplex pinpoints direct shugoshin-Wapl antagonism in centromeric cohesion.' 
_citation.year                      2014 
_citation.database_id_CSD           . 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2880 
_citation.pdbx_database_id_PubMed   25173175 
_citation.unpublished_flag          . 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hara, K.'       1 
primary 'Zheng, G.'      2 
primary 'Qu, Q.'         3 
primary 'Liu, H.'        4 
primary 'Ouyang, Z.'     5 
primary 'Chen, Z.'       6 
primary 'Tomchick, D.R.' 7 
primary 'Yu, H.'         8 
# 
_cell.entry_id           4PJW 
_cell.length_a           78.733 
_cell.length_b           108.045 
_cell.length_c           180.835 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4PJW 
_symmetry.cell_setting                     . 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            . 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   . 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cohesin subunit SA-2'                             115439.008 1  ? ? 'UNP residues 80-1060' ? 
2 polymer     man 'Double-strand-break repair protein rad21 homolog' 16237.192  1  ? ? 'UNP residues 281-420' ? 
3 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'             195.237    1  ? ? ?                      ? 
4 water       nat water                                              18.015     14 ? ? ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'SCC3 homolog 2,Stromal antigen 2'                  
2 'hHR21,Nuclear matrix protein 1,NXP-1,SCC1 homolog' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;EN(MSE)(MSE)LFEVVK(MSE)GKSA(MSE)QSVVDDWIESYKHDRDIALLDLINFFIQCSGCKGVVTAE(MSE)FRH
(MSE)QNSEIIRK(MSE)TEEFDEDSGDYPLT(MSE)AGPQWKKFKSSFCEFIGVLVRQCQYSIIYDEY(MSE)(MSE)D
TVISLLTGLSDSQVRAFRHTSTLAA(MSE)KL(MSE)TALVNVALNLSIN(MSE)DNTQRQYEAERNK(MSE)IGKRANE
RLELLLQKRKELQENQDEIEN(MSE)(MSE)NAIFKGVFVHRYRDAIAEIRAICIEEIGIW(MSE)K(MSE)YSDAFLND
SYLKYVGWT(MSE)HDKQGEVRLKCLTALQGLYYNKELNSKLELFTSRFKDRIVS(MSE)TLDKEYDVAVQAIKLLTLVL
QSSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSRRDPEEDG(MSE)(MSE)KRRGRQGPNANLVKTLVFFFLE
SELHEHAAYLVDS(MSE)WDCATELLKDWEC(MSE)NSLLLEEPLSGEEALTDRQESALIEI(MSE)LCTIRQAAECHPP
VGRGTGKRVLTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRN
IVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFH
NAHDLSKWDLFACNYKLLKTGIENGD(MSE)PEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQ(MSE)RVFCQ
ICQHYLTNVNTTVKEQAFTILCDIL(MSE)IFSHQI(MSE)SGGRD(MSE)LEPLVYTPDSSLQSELLSFILDHVFIEQD
DDNNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVE(MSE)NTAADIFKQY(MSE)KYYNDYGDIIKET(MSE)SK
TRQIDKIQCAKTLILSLQQLFNE(MSE)IQENGYNFDRSSSTFSGIKELARRFALTFGLDQLKTREAIA(MSE)LHKDGI
EFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKF(MSE)TFQ(MSE)SLRREDVWLPL(MSE)SYRN
SLLAGGDDDT(MSE)SVI
;
;ENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFFIQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDY
PLTMAGPQWKKFKSSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSI
NMDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDAIAEIRAICIEEIGIWMKMY
SDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKELNSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQ
SSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAY
LVDSMWDCATELLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKRVLTAKEKKTQLDD
RTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHAL
CNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSKWDLFACNYKLLKTG
IENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQICQHYLTNVNTTVKEQAFTILCDILMIFS
HQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDNNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEM
NTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTF
GLDQLKTREAIAMLHKDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREDVWL
PLMSYRNSLLAGGDDDTMSVI
;
A ? 
2 'polypeptide(L)' no yes 
;VDPVEP(MSE)PT(MSE)TDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLD
LAPPTKKL(MSE)(MSE)WKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
;
;VDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKL
MMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASN n 
1 3   MSE n 
1 4   MSE n 
1 5   LEU n 
1 6   PHE n 
1 7   GLU n 
1 8   VAL n 
1 9   VAL n 
1 10  LYS n 
1 11  MSE n 
1 12  GLY n 
1 13  LYS n 
1 14  SER n 
1 15  ALA n 
1 16  MSE n 
1 17  GLN n 
1 18  SER n 
1 19  VAL n 
1 20  VAL n 
1 21  ASP n 
1 22  ASP n 
1 23  TRP n 
1 24  ILE n 
1 25  GLU n 
1 26  SER n 
1 27  TYR n 
1 28  LYS n 
1 29  HIS n 
1 30  ASP n 
1 31  ARG n 
1 32  ASP n 
1 33  ILE n 
1 34  ALA n 
1 35  LEU n 
1 36  LEU n 
1 37  ASP n 
1 38  LEU n 
1 39  ILE n 
1 40  ASN n 
1 41  PHE n 
1 42  PHE n 
1 43  ILE n 
1 44  GLN n 
1 45  CYS n 
1 46  SER n 
1 47  GLY n 
1 48  CYS n 
1 49  LYS n 
1 50  GLY n 
1 51  VAL n 
1 52  VAL n 
1 53  THR n 
1 54  ALA n 
1 55  GLU n 
1 56  MSE n 
1 57  PHE n 
1 58  ARG n 
1 59  HIS n 
1 60  MSE n 
1 61  GLN n 
1 62  ASN n 
1 63  SER n 
1 64  GLU n 
1 65  ILE n 
1 66  ILE n 
1 67  ARG n 
1 68  LYS n 
1 69  MSE n 
1 70  THR n 
1 71  GLU n 
1 72  GLU n 
1 73  PHE n 
1 74  ASP n 
1 75  GLU n 
1 76  ASP n 
1 77  SER n 
1 78  GLY n 
1 79  ASP n 
1 80  TYR n 
1 81  PRO n 
1 82  LEU n 
1 83  THR n 
1 84  MSE n 
1 85  ALA n 
1 86  GLY n 
1 87  PRO n 
1 88  GLN n 
1 89  TRP n 
1 90  LYS n 
1 91  LYS n 
1 92  PHE n 
1 93  LYS n 
1 94  SER n 
1 95  SER n 
1 96  PHE n 
1 97  CYS n 
1 98  GLU n 
1 99  PHE n 
1 100 ILE n 
1 101 GLY n 
1 102 VAL n 
1 103 LEU n 
1 104 VAL n 
1 105 ARG n 
1 106 GLN n 
1 107 CYS n 
1 108 GLN n 
1 109 TYR n 
1 110 SER n 
1 111 ILE n 
1 112 ILE n 
1 113 TYR n 
1 114 ASP n 
1 115 GLU n 
1 116 TYR n 
1 117 MSE n 
1 118 MSE n 
1 119 ASP n 
1 120 THR n 
1 121 VAL n 
1 122 ILE n 
1 123 SER n 
1 124 LEU n 
1 125 LEU n 
1 126 THR n 
1 127 GLY n 
1 128 LEU n 
1 129 SER n 
1 130 ASP n 
1 131 SER n 
1 132 GLN n 
1 133 VAL n 
1 134 ARG n 
1 135 ALA n 
1 136 PHE n 
1 137 ARG n 
1 138 HIS n 
1 139 THR n 
1 140 SER n 
1 141 THR n 
1 142 LEU n 
1 143 ALA n 
1 144 ALA n 
1 145 MSE n 
1 146 LYS n 
1 147 LEU n 
1 148 MSE n 
1 149 THR n 
1 150 ALA n 
1 151 LEU n 
1 152 VAL n 
1 153 ASN n 
1 154 VAL n 
1 155 ALA n 
1 156 LEU n 
1 157 ASN n 
1 158 LEU n 
1 159 SER n 
1 160 ILE n 
1 161 ASN n 
1 162 MSE n 
1 163 ASP n 
1 164 ASN n 
1 165 THR n 
1 166 GLN n 
1 167 ARG n 
1 168 GLN n 
1 169 TYR n 
1 170 GLU n 
1 171 ALA n 
1 172 GLU n 
1 173 ARG n 
1 174 ASN n 
1 175 LYS n 
1 176 MSE n 
1 177 ILE n 
1 178 GLY n 
1 179 LYS n 
1 180 ARG n 
1 181 ALA n 
1 182 ASN n 
1 183 GLU n 
1 184 ARG n 
1 185 LEU n 
1 186 GLU n 
1 187 LEU n 
1 188 LEU n 
1 189 LEU n 
1 190 GLN n 
1 191 LYS n 
1 192 ARG n 
1 193 LYS n 
1 194 GLU n 
1 195 LEU n 
1 196 GLN n 
1 197 GLU n 
1 198 ASN n 
1 199 GLN n 
1 200 ASP n 
1 201 GLU n 
1 202 ILE n 
1 203 GLU n 
1 204 ASN n 
1 205 MSE n 
1 206 MSE n 
1 207 ASN n 
1 208 ALA n 
1 209 ILE n 
1 210 PHE n 
1 211 LYS n 
1 212 GLY n 
1 213 VAL n 
1 214 PHE n 
1 215 VAL n 
1 216 HIS n 
1 217 ARG n 
1 218 TYR n 
1 219 ARG n 
1 220 ASP n 
1 221 ALA n 
1 222 ILE n 
1 223 ALA n 
1 224 GLU n 
1 225 ILE n 
1 226 ARG n 
1 227 ALA n 
1 228 ILE n 
1 229 CYS n 
1 230 ILE n 
1 231 GLU n 
1 232 GLU n 
1 233 ILE n 
1 234 GLY n 
1 235 ILE n 
1 236 TRP n 
1 237 MSE n 
1 238 LYS n 
1 239 MSE n 
1 240 TYR n 
1 241 SER n 
1 242 ASP n 
1 243 ALA n 
1 244 PHE n 
1 245 LEU n 
1 246 ASN n 
1 247 ASP n 
1 248 SER n 
1 249 TYR n 
1 250 LEU n 
1 251 LYS n 
1 252 TYR n 
1 253 VAL n 
1 254 GLY n 
1 255 TRP n 
1 256 THR n 
1 257 MSE n 
1 258 HIS n 
1 259 ASP n 
1 260 LYS n 
1 261 GLN n 
1 262 GLY n 
1 263 GLU n 
1 264 VAL n 
1 265 ARG n 
1 266 LEU n 
1 267 LYS n 
1 268 CYS n 
1 269 LEU n 
1 270 THR n 
1 271 ALA n 
1 272 LEU n 
1 273 GLN n 
1 274 GLY n 
1 275 LEU n 
1 276 TYR n 
1 277 TYR n 
1 278 ASN n 
1 279 LYS n 
1 280 GLU n 
1 281 LEU n 
1 282 ASN n 
1 283 SER n 
1 284 LYS n 
1 285 LEU n 
1 286 GLU n 
1 287 LEU n 
1 288 PHE n 
1 289 THR n 
1 290 SER n 
1 291 ARG n 
1 292 PHE n 
1 293 LYS n 
1 294 ASP n 
1 295 ARG n 
1 296 ILE n 
1 297 VAL n 
1 298 SER n 
1 299 MSE n 
1 300 THR n 
1 301 LEU n 
1 302 ASP n 
1 303 LYS n 
1 304 GLU n 
1 305 TYR n 
1 306 ASP n 
1 307 VAL n 
1 308 ALA n 
1 309 VAL n 
1 310 GLN n 
1 311 ALA n 
1 312 ILE n 
1 313 LYS n 
1 314 LEU n 
1 315 LEU n 
1 316 THR n 
1 317 LEU n 
1 318 VAL n 
1 319 LEU n 
1 320 GLN n 
1 321 SER n 
1 322 SER n 
1 323 GLU n 
1 324 GLU n 
1 325 VAL n 
1 326 LEU n 
1 327 THR n 
1 328 ALA n 
1 329 GLU n 
1 330 ASP n 
1 331 CYS n 
1 332 GLU n 
1 333 ASN n 
1 334 VAL n 
1 335 TYR n 
1 336 HIS n 
1 337 LEU n 
1 338 VAL n 
1 339 TYR n 
1 340 SER n 
1 341 ALA n 
1 342 HIS n 
1 343 ARG n 
1 344 PRO n 
1 345 VAL n 
1 346 ALA n 
1 347 VAL n 
1 348 ALA n 
1 349 ALA n 
1 350 GLY n 
1 351 GLU n 
1 352 PHE n 
1 353 LEU n 
1 354 TYR n 
1 355 LYS n 
1 356 LYS n 
1 357 LEU n 
1 358 PHE n 
1 359 SER n 
1 360 ARG n 
1 361 ARG n 
1 362 ASP n 
1 363 PRO n 
1 364 GLU n 
1 365 GLU n 
1 366 ASP n 
1 367 GLY n 
1 368 MSE n 
1 369 MSE n 
1 370 LYS n 
1 371 ARG n 
1 372 ARG n 
1 373 GLY n 
1 374 ARG n 
1 375 GLN n 
1 376 GLY n 
1 377 PRO n 
1 378 ASN n 
1 379 ALA n 
1 380 ASN n 
1 381 LEU n 
1 382 VAL n 
1 383 LYS n 
1 384 THR n 
1 385 LEU n 
1 386 VAL n 
1 387 PHE n 
1 388 PHE n 
1 389 PHE n 
1 390 LEU n 
1 391 GLU n 
1 392 SER n 
1 393 GLU n 
1 394 LEU n 
1 395 HIS n 
1 396 GLU n 
1 397 HIS n 
1 398 ALA n 
1 399 ALA n 
1 400 TYR n 
1 401 LEU n 
1 402 VAL n 
1 403 ASP n 
1 404 SER n 
1 405 MSE n 
1 406 TRP n 
1 407 ASP n 
1 408 CYS n 
1 409 ALA n 
1 410 THR n 
1 411 GLU n 
1 412 LEU n 
1 413 LEU n 
1 414 LYS n 
1 415 ASP n 
1 416 TRP n 
1 417 GLU n 
1 418 CYS n 
1 419 MSE n 
1 420 ASN n 
1 421 SER n 
1 422 LEU n 
1 423 LEU n 
1 424 LEU n 
1 425 GLU n 
1 426 GLU n 
1 427 PRO n 
1 428 LEU n 
1 429 SER n 
1 430 GLY n 
1 431 GLU n 
1 432 GLU n 
1 433 ALA n 
1 434 LEU n 
1 435 THR n 
1 436 ASP n 
1 437 ARG n 
1 438 GLN n 
1 439 GLU n 
1 440 SER n 
1 441 ALA n 
1 442 LEU n 
1 443 ILE n 
1 444 GLU n 
1 445 ILE n 
1 446 MSE n 
1 447 LEU n 
1 448 CYS n 
1 449 THR n 
1 450 ILE n 
1 451 ARG n 
1 452 GLN n 
1 453 ALA n 
1 454 ALA n 
1 455 GLU n 
1 456 CYS n 
1 457 HIS n 
1 458 PRO n 
1 459 PRO n 
1 460 VAL n 
1 461 GLY n 
1 462 ARG n 
1 463 GLY n 
1 464 THR n 
1 465 GLY n 
1 466 LYS n 
1 467 ARG n 
1 468 VAL n 
1 469 LEU n 
1 470 THR n 
1 471 ALA n 
1 472 LYS n 
1 473 GLU n 
1 474 LYS n 
1 475 LYS n 
1 476 THR n 
1 477 GLN n 
1 478 LEU n 
1 479 ASP n 
1 480 ASP n 
1 481 ARG n 
1 482 THR n 
1 483 LYS n 
1 484 ILE n 
1 485 THR n 
1 486 GLU n 
1 487 LEU n 
1 488 PHE n 
1 489 ALA n 
1 490 VAL n 
1 491 ALA n 
1 492 LEU n 
1 493 PRO n 
1 494 GLN n 
1 495 LEU n 
1 496 LEU n 
1 497 ALA n 
1 498 LYS n 
1 499 TYR n 
1 500 SER n 
1 501 VAL n 
1 502 ASP n 
1 503 ALA n 
1 504 GLU n 
1 505 LYS n 
1 506 VAL n 
1 507 THR n 
1 508 ASN n 
1 509 LEU n 
1 510 LEU n 
1 511 GLN n 
1 512 LEU n 
1 513 PRO n 
1 514 GLN n 
1 515 TYR n 
1 516 PHE n 
1 517 ASP n 
1 518 LEU n 
1 519 GLU n 
1 520 ILE n 
1 521 TYR n 
1 522 THR n 
1 523 THR n 
1 524 GLY n 
1 525 ARG n 
1 526 LEU n 
1 527 GLU n 
1 528 LYS n 
1 529 HIS n 
1 530 LEU n 
1 531 ASP n 
1 532 ALA n 
1 533 LEU n 
1 534 LEU n 
1 535 ARG n 
1 536 GLN n 
1 537 ILE n 
1 538 ARG n 
1 539 ASN n 
1 540 ILE n 
1 541 VAL n 
1 542 GLU n 
1 543 LYS n 
1 544 HIS n 
1 545 THR n 
1 546 ASP n 
1 547 THR n 
1 548 ASP n 
1 549 VAL n 
1 550 LEU n 
1 551 GLU n 
1 552 ALA n 
1 553 CYS n 
1 554 SER n 
1 555 LYS n 
1 556 THR n 
1 557 TYR n 
1 558 HIS n 
1 559 ALA n 
1 560 LEU n 
1 561 CYS n 
1 562 ASN n 
1 563 GLU n 
1 564 GLU n 
1 565 PHE n 
1 566 THR n 
1 567 ILE n 
1 568 PHE n 
1 569 ASN n 
1 570 ARG n 
1 571 VAL n 
1 572 ASP n 
1 573 ILE n 
1 574 SER n 
1 575 ARG n 
1 576 SER n 
1 577 GLN n 
1 578 LEU n 
1 579 ILE n 
1 580 ASP n 
1 581 GLU n 
1 582 LEU n 
1 583 ALA n 
1 584 ASP n 
1 585 LYS n 
1 586 PHE n 
1 587 ASN n 
1 588 ARG n 
1 589 LEU n 
1 590 LEU n 
1 591 GLU n 
1 592 ASP n 
1 593 PHE n 
1 594 LEU n 
1 595 GLN n 
1 596 GLU n 
1 597 GLY n 
1 598 GLU n 
1 599 GLU n 
1 600 PRO n 
1 601 ASP n 
1 602 GLU n 
1 603 ASP n 
1 604 ASP n 
1 605 ALA n 
1 606 TYR n 
1 607 GLN n 
1 608 VAL n 
1 609 LEU n 
1 610 SER n 
1 611 THR n 
1 612 LEU n 
1 613 LYS n 
1 614 ARG n 
1 615 ILE n 
1 616 THR n 
1 617 ALA n 
1 618 PHE n 
1 619 HIS n 
1 620 ASN n 
1 621 ALA n 
1 622 HIS n 
1 623 ASP n 
1 624 LEU n 
1 625 SER n 
1 626 LYS n 
1 627 TRP n 
1 628 ASP n 
1 629 LEU n 
1 630 PHE n 
1 631 ALA n 
1 632 CYS n 
1 633 ASN n 
1 634 TYR n 
1 635 LYS n 
1 636 LEU n 
1 637 LEU n 
1 638 LYS n 
1 639 THR n 
1 640 GLY n 
1 641 ILE n 
1 642 GLU n 
1 643 ASN n 
1 644 GLY n 
1 645 ASP n 
1 646 MSE n 
1 647 PRO n 
1 648 GLU n 
1 649 GLN n 
1 650 ILE n 
1 651 VAL n 
1 652 ILE n 
1 653 HIS n 
1 654 ALA n 
1 655 LEU n 
1 656 GLN n 
1 657 CYS n 
1 658 THR n 
1 659 HIS n 
1 660 TYR n 
1 661 VAL n 
1 662 ILE n 
1 663 LEU n 
1 664 TRP n 
1 665 GLN n 
1 666 LEU n 
1 667 ALA n 
1 668 LYS n 
1 669 ILE n 
1 670 THR n 
1 671 GLU n 
1 672 SER n 
1 673 SER n 
1 674 SER n 
1 675 THR n 
1 676 LYS n 
1 677 GLU n 
1 678 ASP n 
1 679 LEU n 
1 680 LEU n 
1 681 ARG n 
1 682 LEU n 
1 683 LYS n 
1 684 LYS n 
1 685 GLN n 
1 686 MSE n 
1 687 ARG n 
1 688 VAL n 
1 689 PHE n 
1 690 CYS n 
1 691 GLN n 
1 692 ILE n 
1 693 CYS n 
1 694 GLN n 
1 695 HIS n 
1 696 TYR n 
1 697 LEU n 
1 698 THR n 
1 699 ASN n 
1 700 VAL n 
1 701 ASN n 
1 702 THR n 
1 703 THR n 
1 704 VAL n 
1 705 LYS n 
1 706 GLU n 
1 707 GLN n 
1 708 ALA n 
1 709 PHE n 
1 710 THR n 
1 711 ILE n 
1 712 LEU n 
1 713 CYS n 
1 714 ASP n 
1 715 ILE n 
1 716 LEU n 
1 717 MSE n 
1 718 ILE n 
1 719 PHE n 
1 720 SER n 
1 721 HIS n 
1 722 GLN n 
1 723 ILE n 
1 724 MSE n 
1 725 SER n 
1 726 GLY n 
1 727 GLY n 
1 728 ARG n 
1 729 ASP n 
1 730 MSE n 
1 731 LEU n 
1 732 GLU n 
1 733 PRO n 
1 734 LEU n 
1 735 VAL n 
1 736 TYR n 
1 737 THR n 
1 738 PRO n 
1 739 ASP n 
1 740 SER n 
1 741 SER n 
1 742 LEU n 
1 743 GLN n 
1 744 SER n 
1 745 GLU n 
1 746 LEU n 
1 747 LEU n 
1 748 SER n 
1 749 PHE n 
1 750 ILE n 
1 751 LEU n 
1 752 ASP n 
1 753 HIS n 
1 754 VAL n 
1 755 PHE n 
1 756 ILE n 
1 757 GLU n 
1 758 GLN n 
1 759 ASP n 
1 760 ASP n 
1 761 ASP n 
1 762 ASN n 
1 763 ASN n 
1 764 SER n 
1 765 ALA n 
1 766 ASP n 
1 767 GLY n 
1 768 GLN n 
1 769 GLN n 
1 770 GLU n 
1 771 ASP n 
1 772 GLU n 
1 773 ALA n 
1 774 SER n 
1 775 LYS n 
1 776 ILE n 
1 777 GLU n 
1 778 ALA n 
1 779 LEU n 
1 780 HIS n 
1 781 LYS n 
1 782 ARG n 
1 783 ARG n 
1 784 ASN n 
1 785 LEU n 
1 786 LEU n 
1 787 ALA n 
1 788 ALA n 
1 789 PHE n 
1 790 CYS n 
1 791 LYS n 
1 792 LEU n 
1 793 ILE n 
1 794 VAL n 
1 795 TYR n 
1 796 THR n 
1 797 VAL n 
1 798 VAL n 
1 799 GLU n 
1 800 MSE n 
1 801 ASN n 
1 802 THR n 
1 803 ALA n 
1 804 ALA n 
1 805 ASP n 
1 806 ILE n 
1 807 PHE n 
1 808 LYS n 
1 809 GLN n 
1 810 TYR n 
1 811 MSE n 
1 812 LYS n 
1 813 TYR n 
1 814 TYR n 
1 815 ASN n 
1 816 ASP n 
1 817 TYR n 
1 818 GLY n 
1 819 ASP n 
1 820 ILE n 
1 821 ILE n 
1 822 LYS n 
1 823 GLU n 
1 824 THR n 
1 825 MSE n 
1 826 SER n 
1 827 LYS n 
1 828 THR n 
1 829 ARG n 
1 830 GLN n 
1 831 ILE n 
1 832 ASP n 
1 833 LYS n 
1 834 ILE n 
1 835 GLN n 
1 836 CYS n 
1 837 ALA n 
1 838 LYS n 
1 839 THR n 
1 840 LEU n 
1 841 ILE n 
1 842 LEU n 
1 843 SER n 
1 844 LEU n 
1 845 GLN n 
1 846 GLN n 
1 847 LEU n 
1 848 PHE n 
1 849 ASN n 
1 850 GLU n 
1 851 MSE n 
1 852 ILE n 
1 853 GLN n 
1 854 GLU n 
1 855 ASN n 
1 856 GLY n 
1 857 TYR n 
1 858 ASN n 
1 859 PHE n 
1 860 ASP n 
1 861 ARG n 
1 862 SER n 
1 863 SER n 
1 864 SER n 
1 865 THR n 
1 866 PHE n 
1 867 SER n 
1 868 GLY n 
1 869 ILE n 
1 870 LYS n 
1 871 GLU n 
1 872 LEU n 
1 873 ALA n 
1 874 ARG n 
1 875 ARG n 
1 876 PHE n 
1 877 ALA n 
1 878 LEU n 
1 879 THR n 
1 880 PHE n 
1 881 GLY n 
1 882 LEU n 
1 883 ASP n 
1 884 GLN n 
1 885 LEU n 
1 886 LYS n 
1 887 THR n 
1 888 ARG n 
1 889 GLU n 
1 890 ALA n 
1 891 ILE n 
1 892 ALA n 
1 893 MSE n 
1 894 LEU n 
1 895 HIS n 
1 896 LYS n 
1 897 ASP n 
1 898 GLY n 
1 899 ILE n 
1 900 GLU n 
1 901 PHE n 
1 902 ALA n 
1 903 PHE n 
1 904 LYS n 
1 905 GLU n 
1 906 PRO n 
1 907 ASN n 
1 908 PRO n 
1 909 GLN n 
1 910 GLY n 
1 911 GLU n 
1 912 SER n 
1 913 HIS n 
1 914 PRO n 
1 915 PRO n 
1 916 LEU n 
1 917 ASN n 
1 918 LEU n 
1 919 ALA n 
1 920 PHE n 
1 921 LEU n 
1 922 ASP n 
1 923 ILE n 
1 924 LEU n 
1 925 SER n 
1 926 GLU n 
1 927 PHE n 
1 928 SER n 
1 929 SER n 
1 930 LYS n 
1 931 LEU n 
1 932 LEU n 
1 933 ARG n 
1 934 GLN n 
1 935 ASP n 
1 936 LYS n 
1 937 ARG n 
1 938 THR n 
1 939 VAL n 
1 940 TYR n 
1 941 VAL n 
1 942 TYR n 
1 943 LEU n 
1 944 GLU n 
1 945 LYS n 
1 946 PHE n 
1 947 MSE n 
1 948 THR n 
1 949 PHE n 
1 950 GLN n 
1 951 MSE n 
1 952 SER n 
1 953 LEU n 
1 954 ARG n 
1 955 ARG n 
1 956 GLU n 
1 957 ASP n 
1 958 VAL n 
1 959 TRP n 
1 960 LEU n 
1 961 PRO n 
1 962 LEU n 
1 963 MSE n 
1 964 SER n 
1 965 TYR n 
1 966 ARG n 
1 967 ASN n 
1 968 SER n 
1 969 LEU n 
1 970 LEU n 
1 971 ALA n 
1 972 GLY n 
1 973 GLY n 
1 974 ASP n 
1 975 ASP n 
1 976 ASP n 
1 977 THR n 
1 978 MSE n 
1 979 SER n 
1 980 VAL n 
1 981 ILE n 
2 1   VAL n 
2 2   ASP n 
2 3   PRO n 
2 4   VAL n 
2 5   GLU n 
2 6   PRO n 
2 7   MSE n 
2 8   PRO n 
2 9   THR n 
2 10  MSE n 
2 11  THR n 
2 12  ASP n 
2 13  GLN n 
2 14  THR n 
2 15  THR n 
2 16  LEU n 
2 17  VAL n 
2 18  PRO n 
2 19  ASN n 
2 20  GLU n 
2 21  GLU n 
2 22  GLU n 
2 23  ALA n 
2 24  PHE n 
2 25  ALA n 
2 26  LEU n 
2 27  GLU n 
2 28  PRO n 
2 29  ILE n 
2 30  ASP n 
2 31  ILE n 
2 32  THR n 
2 33  VAL n 
2 34  LYS n 
2 35  GLU n 
2 36  THR n 
2 37  LYS n 
2 38  ALA n 
2 39  LYS n 
2 40  ARG n 
2 41  LYS n 
2 42  ARG n 
2 43  LYS n 
2 44  LEU n 
2 45  ILE n 
2 46  VAL n 
2 47  ASP n 
2 48  SER n 
2 49  VAL n 
2 50  LYS n 
2 51  GLU n 
2 52  LEU n 
2 53  ASP n 
2 54  SER n 
2 55  LYS n 
2 56  THR n 
2 57  ILE n 
2 58  ARG n 
2 59  ALA n 
2 60  GLN n 
2 61  LEU n 
2 62  SER n 
2 63  ASP n 
2 64  TYR n 
2 65  SER n 
2 66  ASP n 
2 67  ILE n 
2 68  VAL n 
2 69  THR n 
2 70  THR n 
2 71  LEU n 
2 72  ASP n 
2 73  LEU n 
2 74  ALA n 
2 75  PRO n 
2 76  PRO n 
2 77  THR n 
2 78  LYS n 
2 79  LYS n 
2 80  LEU n 
2 81  MSE n 
2 82  MSE n 
2 83  TRP n 
2 84  LYS n 
2 85  GLU n 
2 86  THR n 
2 87  GLY n 
2 88  GLY n 
2 89  VAL n 
2 90  GLU n 
2 91  LYS n 
2 92  LEU n 
2 93  PHE n 
2 94  SER n 
2 95  LEU n 
2 96  PRO n 
2 97  ALA n 
2 98  GLN n 
2 99  PRO n 
2 100 LEU n 
2 101 TRP n 
2 102 ASN n 
2 103 ASN n 
2 104 ARG n 
2 105 LEU n 
2 106 LEU n 
2 107 LYS n 
2 108 LEU n 
2 109 PHE n 
2 110 THR n 
2 111 ARG n 
2 112 CYS n 
2 113 LEU n 
2 114 THR n 
2 115 PRO n 
2 116 LEU n 
2 117 VAL n 
2 118 PRO n 
2 119 GLU n 
2 120 ASP n 
2 121 LEU n 
2 122 ARG n 
2 123 LYS n 
2 124 ARG n 
2 125 ARG n 
2 126 LYS n 
2 127 GLY n 
2 128 GLY n 
2 129 GLU n 
2 130 ALA n 
2 131 ASP n 
2 132 ASN n 
2 133 LEU n 
2 134 ASP n 
2 135 GLU n 
2 136 PHE n 
2 137 LEU n 
2 138 LYS n 
2 139 GLU n 
2 140 PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 981 Human ? 'STAG2, SA2'                  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? 'High Five' ? ? ? ? ? BACULOVIRUS ? ? ? 'pFastBac HT' ? ? 
2 1 sample 'Biological sequence' 1 140 Human ? 'RAD21, HR21, KIAA0078, NXP1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? 'High Five' ? ? ? ? ? BACULOVIRUS ? ? ? 'pFastBac HT' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP STAG2_HUMAN Q8N3U4 1 
;ENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFFIQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDY
PLTMAGPQWKKFKSSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSI
NMDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDAIAEIRAICIEEIGIWMKMY
SDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKELNSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQ
SSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAY
LVDSMWDCATELLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKRVLTAKEKKTQLDD
RTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHAL
CNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSKWDLFACNYKLLKTG
IENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQICQHYLTNVNTTVKEQAFTILCDILMIFS
HQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDNNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEM
NTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTF
GLDQLKTREAIAMLHKDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREDVWL
PLMSYRNSLLAGGDDDTMSVI
;
80  ? 
2 UNP RAD21_HUMAN O60216 2 
;VDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKL
MMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
;
281 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4PJW A 1 ? 981 ? Q8N3U4 80  ? 1060 ? 80  1060 
2 2 4PJW B 1 ? 140 ? O60216 281 ? 420  ? 281 420  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1' 147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S'  195.237 
MSE 'L-peptide linking' n SELENOMETHIONINE                       ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     . 
_exptl.absorpt_correction_T_max   . 
_exptl.absorpt_correction_T_min   . 
_exptl.absorpt_correction_type    . 
_exptl.absorpt_process_details    . 
_exptl.entry_id                   4PJW 
_exptl.crystals_number            1 
_exptl.details                    . 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             . 
# 
_exptl_crystal.colour                      . 
_exptl_crystal.density_diffrn              . 
_exptl_crystal.density_Matthews            2.97 
_exptl_crystal.density_method              . 
_exptl_crystal.density_percent_sol         58.53 
_exptl_crystal.description                 . 
_exptl_crystal.F_000                       . 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 . 
_exptl_crystal.size_max                    . 
_exptl_crystal.size_mid                    . 
_exptl_crystal.size_min                    . 
_exptl_crystal.size_rad                    . 
_exptl_crystal.colour_lustre               . 
_exptl_crystal.colour_modifier             . 
_exptl_crystal.colour_primary              . 
_exptl_crystal.density_meas                . 
_exptl_crystal.density_meas_esd            . 
_exptl_crystal.density_meas_gt             . 
_exptl_crystal.density_meas_lt             . 
_exptl_crystal.density_meas_temp           . 
_exptl_crystal.density_meas_temp_esd       . 
_exptl_crystal.density_meas_temp_gt        . 
_exptl_crystal.density_meas_temp_lt        . 
_exptl_crystal.pdbx_crystal_image_url      . 
_exptl_crystal.pdbx_crystal_image_format   . 
_exptl_crystal.pdbx_mosaicity              . 
_exptl_crystal.pdbx_mosaicity_esd          . 
# 
_exptl_crystal_grow.apparatus       . 
_exptl_crystal_grow.atmosphere      . 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         . 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      . 
_exptl_crystal_grow.pH              . 
_exptl_crystal_grow.pressure        . 
_exptl_crystal_grow.pressure_esd    . 
_exptl_crystal_grow.seeding         . 
_exptl_crystal_grow.seeding_ref     . 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    . 
_exptl_crystal_grow.temp_esd        . 
_exptl_crystal_grow.time            . 
_exptl_crystal_grow.pdbx_details    
'0.12 M Morpheus Divalents Mix, 0.1 M Morpheus Buffer System 1, and 27-30% (v/v) Morpheus EOD_P8K (Molecular Dimensions).' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.ambient_environment    . 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   . 
_diffrn.ambient_temp_esd       . 
_diffrn.crystal_id             1 
_diffrn.crystal_support        . 
_diffrn.crystal_treatment      . 
_diffrn.details                . 
_diffrn.id                     1 
_diffrn.ambient_pressure       . 
_diffrn.ambient_pressure_esd   . 
_diffrn.ambient_pressure_gt    . 
_diffrn.ambient_pressure_lt    . 
_diffrn.ambient_temp_gt        . 
_diffrn.ambient_temp_lt        . 
# 
_diffrn_detector.details                      . 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              . 
_diffrn_detector.dtime                        . 
_diffrn_detector.pdbx_frames_total            . 
_diffrn_detector.pdbx_collection_time_total   . 
_diffrn_detector.pdbx_collection_date         2013-10-19 
# 
_diffrn_radiation.collimation                      . 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      . 
_diffrn_radiation.inhomogeneity                    . 
_diffrn_radiation.monochromator                    'Rosenbaum-Rock high-resolution double-crystal monochromator' 
_diffrn_radiation.polarisn_norm                    . 
_diffrn_radiation.polarisn_ratio                   . 
_diffrn_radiation.probe                            . 
_diffrn_radiation.type                             . 
_diffrn_radiation.xray_symbol                      . 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             . 
_diffrn_radiation.pdbx_wavelength                  . 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    . 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     . 
_diffrn_source.details                     . 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       . 
_diffrn_source.size                        . 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      . 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     . 
_diffrn_source.take-off_angle              . 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             . 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            79.1 
_reflns.entry_id                         4PJW 
_reflns.data_reduction_details           . 
_reflns.data_reduction_method            . 
_reflns.d_resolution_high                2.85 
_reflns.d_resolution_low                 50 
_reflns.details                          . 
_reflns.limit_h_max                      . 
_reflns.limit_h_min                      . 
_reflns.limit_k_max                      . 
_reflns.limit_k_min                      . 
_reflns.limit_l_max                      . 
_reflns.limit_l_min                      . 
_reflns.number_all                       37638 
_reflns.number_obs                       37638 
_reflns.observed_criterion               . 
_reflns.observed_criterion_F_max         . 
_reflns.observed_criterion_F_min         . 
_reflns.observed_criterion_I_max         . 
_reflns.observed_criterion_I_min         . 
_reflns.observed_criterion_sigma_F       . 
_reflns.observed_criterion_sigma_I       . 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   . 
_reflns.Rmerge_F_all                     . 
_reflns.Rmerge_F_obs                     . 
_reflns.Friedel_coverage                 . 
_reflns.number_gt                        . 
_reflns.threshold_expression             . 
_reflns.pdbx_redundancy                  8.8 
_reflns.pdbx_Rmerge_I_obs                0.098 
_reflns.pdbx_Rmerge_I_all                . 
_reflns.pdbx_Rsym_value                  . 
_reflns.pdbx_netI_over_av_sigmaI         . 
_reflns.pdbx_netI_over_sigmaI            20.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   . 
_reflns.pdbx_res_netI_over_sigmaI_2      . 
_reflns.pdbx_chi_squared                 . 
_reflns.pdbx_scaling_rejects             . 
_reflns.pdbx_d_res_high_opt              . 
_reflns.pdbx_d_res_low_opt               . 
_reflns.pdbx_d_res_opt_method            . 
_reflns.phase_calculation_details        . 
_reflns.pdbx_Rrim_I_all                  . 
_reflns.pdbx_Rpim_I_all                  . 
_reflns.pdbx_d_opt                       . 
_reflns.pdbx_number_measured_all         . 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
# 
_reflns_shell.d_res_high                  2.85 
_reflns_shell.d_res_low                   2.90 
_reflns_shell.meanI_over_sigI_all         . 
_reflns_shell.meanI_over_sigI_obs         1.5 
_reflns_shell.number_measured_all         . 
_reflns_shell.number_measured_obs         . 
_reflns_shell.number_possible             . 
_reflns_shell.number_unique_all           . 
_reflns_shell.number_unique_obs           . 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        . 
_reflns_shell.Rmerge_F_all                . 
_reflns_shell.Rmerge_F_obs                . 
_reflns_shell.Rmerge_I_all                . 
_reflns_shell.Rmerge_I_obs                1.00 
_reflns_shell.meanI_over_sigI_gt          . 
_reflns_shell.meanI_over_uI_all           . 
_reflns_shell.meanI_over_uI_gt            . 
_reflns_shell.number_measured_gt          . 
_reflns_shell.number_unique_gt            . 
_reflns_shell.percent_possible_gt         . 
_reflns_shell.Rmerge_F_gt                 . 
_reflns_shell.Rmerge_I_gt                 . 
_reflns_shell.pdbx_redundancy             8.2 
_reflns_shell.pdbx_Rsym_value             . 
_reflns_shell.pdbx_chi_squared            . 
_reflns_shell.pdbx_netI_over_sigmaI_all   . 
_reflns_shell.pdbx_netI_over_sigmaI_obs   . 
_reflns_shell.pdbx_Rrim_I_all             . 
_reflns_shell.pdbx_Rpim_I_all             . 
_reflns_shell.pdbx_rejects                . 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.aniso_B[1][1]                            . 
_refine.aniso_B[1][2]                            . 
_refine.aniso_B[1][3]                            . 
_refine.aniso_B[2][2]                            . 
_refine.aniso_B[2][3]                            . 
_refine.aniso_B[3][3]                            . 
_refine.B_iso_max                                . 
_refine.B_iso_mean                               59.4 
_refine.B_iso_min                                . 
_refine.correlation_coeff_Fo_to_Fc               . 
_refine.correlation_coeff_Fo_to_Fc_free          . 
_refine.details                                  . 
_refine.diff_density_max                         . 
_refine.diff_density_max_esd                     . 
_refine.diff_density_min                         . 
_refine.diff_density_min_esd                     . 
_refine.diff_density_rms                         . 
_refine.diff_density_rms_esd                     . 
_refine.entry_id                                 4PJW 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 . 
_refine.ls_abs_structure_Flack                   . 
_refine.ls_abs_structure_Flack_esd               . 
_refine.ls_abs_structure_Rogers                  . 
_refine.ls_abs_structure_Rogers_esd              . 
_refine.ls_d_res_high                            2.850 
_refine.ls_d_res_low                             41.705 
_refine.ls_extinction_coef                       . 
_refine.ls_extinction_coef_esd                   . 
_refine.ls_extinction_expression                 . 
_refine.ls_extinction_method                     . 
_refine.ls_goodness_of_fit_all                   . 
_refine.ls_goodness_of_fit_all_esd               . 
_refine.ls_goodness_of_fit_obs                   . 
_refine.ls_goodness_of_fit_obs_esd               . 
_refine.ls_hydrogen_treatment                    . 
_refine.ls_matrix_type                           . 
_refine.ls_number_constraints                    . 
_refine.ls_number_parameters                     . 
_refine.ls_number_reflns_all                     . 
_refine.ls_number_reflns_obs                     36729 
_refine.ls_number_reflns_R_free                  1837 
_refine.ls_number_reflns_R_work                  . 
_refine.ls_number_restraints                     . 
_refine.ls_percent_reflns_obs                    99.87 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          . 
_refine.ls_R_factor_obs                          0.2104 
_refine.ls_R_factor_R_free                       0.2252 
_refine.ls_R_factor_R_free_error                 . 
_refine.ls_R_factor_R_free_error_details         . 
_refine.ls_R_factor_R_work                       0.2096 
_refine.ls_R_Fsqd_factor_obs                     . 
_refine.ls_R_I_factor_obs                        . 
_refine.ls_redundancy_reflns_all                 . 
_refine.ls_redundancy_reflns_obs                 . 
_refine.ls_restrained_S_all                      . 
_refine.ls_restrained_S_obs                      . 
_refine.ls_shift_over_esd_max                    . 
_refine.ls_shift_over_esd_mean                   . 
_refine.ls_structure_factor_coef                 . 
_refine.ls_weighting_details                     . 
_refine.ls_weighting_scheme                      . 
_refine.ls_wR_factor_all                         . 
_refine.ls_wR_factor_obs                         . 
_refine.ls_wR_factor_R_free                      . 
_refine.ls_wR_factor_R_work                      . 
_refine.occupancy_max                            . 
_refine.occupancy_min                            . 
_refine.overall_SU_B                             . 
_refine.overall_SU_ML                            0.33 
_refine.overall_SU_R_Cruickshank_DPI             . 
_refine.overall_SU_R_free                        . 
_refine.overall_FOM_free_R_set                   . 
_refine.overall_FOM_work_R_set                   . 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 . 
_refine.solvent_model_param_ksol                 . 
_refine.ls_R_factor_gt                           . 
_refine.ls_goodness_of_fit_gt                    . 
_refine.ls_goodness_of_fit_ref                   . 
_refine.ls_shift_over_su_max                     . 
_refine.ls_shift_over_su_max_lt                  . 
_refine.ls_shift_over_su_mean                    . 
_refine.ls_shift_over_su_mean_lt                 . 
_refine.pdbx_ls_sigma_I                          . 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_ls_sigma_Fsqd                       . 
_refine.pdbx_data_cutoff_high_absF               . 
_refine.pdbx_data_cutoff_high_rms_absF           . 
_refine.pdbx_data_cutoff_low_absF                . 
_refine.pdbx_isotropic_thermal_model             . 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4PJU 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     . 
_refine.pdbx_overall_ESU_R                       . 
_refine.pdbx_overall_ESU_R_Free                  . 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             . 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        . 
_refine.pdbx_density_correlation                 . 
_refine.pdbx_pd_number_of_powder_patterns        . 
_refine.pdbx_pd_number_of_points                 . 
_refine.pdbx_pd_meas_number_of_points            . 
_refine.pdbx_pd_proc_ls_prof_R_factor            . 
_refine.pdbx_pd_proc_ls_prof_wR_factor           . 
_refine.pdbx_pd_Marquardt_correlation_coeff      . 
_refine.pdbx_pd_Fsqrd_R_factor                   . 
_refine.pdbx_pd_ls_matrix_band_width             . 
_refine.pdbx_overall_phase_error                 25.44 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   . 
_refine.pdbx_overall_SU_R_free_Blow_DPI          . 
_refine.pdbx_overall_SU_R_Blow_DPI               . 
_refine.pdbx_TLS_residual_ADP_flag               . 
_refine.pdbx_diffrn_id                           1 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7974 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               8000 
_refine_hist.d_res_high                       2.850 
_refine_hist.d_res_low                        41.705 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' . 0.005  . 8130  . f_bond_d           . . 
'X-RAY DIFFRACTION' . 0.869  . 10952 . f_angle_d          . . 
'X-RAY DIFFRACTION' . 15.549 . 3063  . f_dihedral_angle_d . . 
'X-RAY DIFFRACTION' . 0.049  . 1250  . f_chiral_restr     . . 
'X-RAY DIFFRACTION' . 0.003  . 1374  . f_plane_restr      . . 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 2.8500 2.9270  . . 139 2638 100.00 . . . 0.3157 . 0.3151 . . . . . . . . 
'X-RAY DIFFRACTION' 2.9270 3.0131  . . 139 2636 100.00 . . . 0.2907 . 0.2679 . . . . . . . . 
'X-RAY DIFFRACTION' 3.0131 3.1104  . . 139 2644 100.00 . . . 0.3129 . 0.2571 . . . . . . . . 
'X-RAY DIFFRACTION' 3.1104 3.2215  . . 138 2629 100.00 . . . 0.2990 . 0.2578 . . . . . . . . 
'X-RAY DIFFRACTION' 3.2215 3.3504  . . 141 2676 100.00 . . . 0.2776 . 0.2361 . . . . . . . . 
'X-RAY DIFFRACTION' 3.3504 3.5028  . . 140 2651 100.00 . . . 0.2504 . 0.2240 . . . . . . . . 
'X-RAY DIFFRACTION' 3.5028 3.6874  . . 141 2668 100.00 . . . 0.2490 . 0.2010 . . . . . . . . 
'X-RAY DIFFRACTION' 3.6874 3.9183  . . 140 2680 100.00 . . . 0.2106 . 0.1889 . . . . . . . . 
'X-RAY DIFFRACTION' 3.9183 4.2205  . . 141 2672 100.00 . . . 0.2191 . 0.1788 . . . . . . . . 
'X-RAY DIFFRACTION' 4.2205 4.6448  . . 143 2714 100.00 . . . 0.1624 . 0.1708 . . . . . . . . 
'X-RAY DIFFRACTION' 4.6448 5.3157  . . 142 2709 100.00 . . . 0.2047 . 0.1834 . . . . . . . . 
'X-RAY DIFFRACTION' 5.3157 6.6928  . . 145 2738 100.00 . . . 0.2307 . 0.2452 . . . . . . . . 
'X-RAY DIFFRACTION' 6.6928 41.7095 . . 149 2837 99.00  . . . 0.2141 . 0.2097 . . . . . . . . 
# 
_struct.entry_id                     4PJW 
_struct.title                        
'crystal structure of human Stromal Antigen 2 (SA2) in complex with Sister Chromatid Cohesion protein 1 (Scc1), with bound MES' 
_struct.pdbx_descriptor              'human Stromal Antigen 2 (SA2), human Sister Chromatid Cohesion protein 1' 
_struct.pdbx_model_details           . 
_struct.pdbx_formula_weight          . 
_struct.pdbx_formula_weight_method   . 
_struct.pdbx_model_type_details      . 
_struct.pdbx_CASP_flag               . 
# 
_struct_keywords.entry_id        4PJW 
_struct_keywords.text            
'Sister chromatid cohesion, cohesin subunits, protein-protein interaction, HEAT repeat, CELL CYCLE' 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 MSE A 4   ? GLY A 12  ? MSE A 83   GLY A 91   1 ? 9  
HELX_P HELX_P2  AA2 ALA A 15  ? ASP A 30  ? ALA A 94   ASP A 109  1 ? 16 
HELX_P HELX_P3  AA3 ASP A 30  ? CYS A 45  ? ASP A 109  CYS A 124  1 ? 16 
HELX_P HELX_P4  AA4 THR A 53  ? MSE A 60  ? THR A 132  MSE A 139  1 ? 8  
HELX_P HELX_P5  AA5 GLN A 61  ? GLU A 72  ? GLN A 140  GLU A 151  1 ? 12 
HELX_P HELX_P6  AA6 GLY A 86  ? GLN A 106 ? GLY A 165  GLN A 185  1 ? 21 
HELX_P HELX_P7  AA7 SER A 110 ? ASP A 114 ? SER A 189  ASP A 193  5 ? 5  
HELX_P HELX_P8  AA8 TYR A 116 ? SER A 129 ? TYR A 195  SER A 208  1 ? 14 
HELX_P HELX_P9  AA9 VAL A 133 ? LYS A 175 ? VAL A 212  LYS A 254  1 ? 43 
HELX_P HELX_P10 AB1 ASN A 182 ? VAL A 213 ? ASN A 261  VAL A 292  1 ? 32 
HELX_P HELX_P11 AB2 VAL A 213 ? TYR A 218 ? VAL A 292  TYR A 297  1 ? 6  
HELX_P HELX_P12 AB3 ILE A 222 ? TYR A 240 ? ILE A 301  TYR A 319  1 ? 19 
HELX_P HELX_P13 AB4 TYR A 240 ? LEU A 245 ? TYR A 319  LEU A 324  1 ? 6  
HELX_P HELX_P14 AB5 ASN A 246 ? MSE A 257 ? ASN A 325  MSE A 336  1 ? 12 
HELX_P HELX_P15 AB6 GLN A 261 ? GLY A 274 ? GLN A 340  GLY A 353  1 ? 14 
HELX_P HELX_P16 AB7 ASN A 282 ? MSE A 299 ? ASN A 361  MSE A 378  1 ? 18 
HELX_P HELX_P17 AB8 THR A 300 ? ASP A 302 ? THR A 379  ASP A 381  5 ? 3  
HELX_P HELX_P18 AB9 GLU A 304 ? SER A 322 ? GLU A 383  SER A 401  1 ? 19 
HELX_P HELX_P19 AC1 THR A 327 ? LEU A 337 ? THR A 406  LEU A 416  1 ? 11 
HELX_P HELX_P20 AC2 VAL A 338 ? SER A 340 ? VAL A 417  SER A 419  5 ? 3  
HELX_P HELX_P21 AC3 HIS A 342 ? PHE A 358 ? HIS A 421  PHE A 437  1 ? 17 
HELX_P HELX_P22 AC4 ASN A 378 ? SER A 392 ? ASN A 457  SER A 471  1 ? 15 
HELX_P HELX_P23 AC5 ALA A 398 ? TRP A 406 ? ALA A 477  TRP A 485  1 ? 9  
HELX_P HELX_P24 AC6 ALA A 409 ? LYS A 414 ? ALA A 488  LYS A 493  1 ? 6  
HELX_P HELX_P25 AC7 ASP A 415 ? LEU A 423 ? ASP A 494  LEU A 502  1 ? 9  
HELX_P HELX_P26 AC8 THR A 435 ? GLU A 455 ? THR A 514  GLU A 534  1 ? 21 
HELX_P HELX_P27 AC9 THR A 470 ? SER A 500 ? THR A 549  SER A 579  1 ? 31 
HELX_P HELX_P28 AD1 ASP A 502 ? LEU A 510 ? ASP A 581  LEU A 589  1 ? 9  
HELX_P HELX_P29 AD2 GLN A 511 ? PHE A 516 ? GLN A 590  PHE A 595  5 ? 6  
HELX_P HELX_P30 AD3 ASP A 517 ? LEU A 518 ? ASP A 596  LEU A 597  5 ? 2  
HELX_P HELX_P31 AD4 GLU A 519 ? GLY A 524 ? GLU A 598  GLY A 603  1 ? 6  
HELX_P HELX_P32 AD5 LEU A 526 ? HIS A 544 ? LEU A 605  HIS A 623  1 ? 19 
HELX_P HELX_P33 AD6 ASP A 546 ? CYS A 561 ? ASP A 625  CYS A 640  1 ? 16 
HELX_P HELX_P34 AD7 ILE A 567 ? GLN A 595 ? ILE A 646  GLN A 674  1 ? 29 
HELX_P HELX_P35 AD8 ASP A 601 ? HIS A 622 ? ASP A 680  HIS A 701  1 ? 22 
HELX_P HELX_P36 AD9 LEU A 629 ? GLY A 644 ? LEU A 708  GLY A 723  1 ? 16 
HELX_P HELX_P37 AE1 PRO A 647 ? LYS A 668 ? PRO A 726  LYS A 747  1 ? 22 
HELX_P HELX_P38 AE2 LYS A 676 ? TYR A 696 ? LYS A 755  TYR A 775  1 ? 21 
HELX_P HELX_P39 AE3 LEU A 697 ? ASN A 699 ? LEU A 776  ASN A 778  5 ? 3  
HELX_P HELX_P40 AE4 ASN A 701 ? PHE A 719 ? ASN A 780  PHE A 798  1 ? 19 
HELX_P HELX_P41 AE5 SER A 720 ? MSE A 724 ? SER A 799  MSE A 803  5 ? 5  
HELX_P HELX_P42 AE6 ASP A 739 ? VAL A 754 ? ASP A 818  VAL A 833  1 ? 16 
HELX_P HELX_P43 AE7 LYS A 775 ? TYR A 795 ? LYS A 854  TYR A 874  1 ? 21 
HELX_P HELX_P44 AE8 GLU A 799 ? THR A 802 ? GLU A 878  THR A 881  5 ? 4  
HELX_P HELX_P45 AE9 ALA A 803 ? LYS A 808 ? ALA A 882  LYS A 887  1 ? 6  
HELX_P HELX_P46 AF1 TYR A 813 ? GLN A 830 ? TYR A 892  GLN A 909  1 ? 18 
HELX_P HELX_P47 AF2 ASP A 832 ? GLY A 856 ? ASP A 911  GLY A 935  1 ? 25 
HELX_P HELX_P48 AF3 SER A 863 ? LEU A 878 ? SER A 942  LEU A 957  1 ? 16 
HELX_P HELX_P49 AF4 ARG A 888 ? PHE A 903 ? ARG A 967  PHE A 982  1 ? 16 
HELX_P HELX_P50 AF5 ALA A 919 ? SER A 925 ? ALA A 998  SER A 1004 1 ? 7  
HELX_P HELX_P51 AF6 LEU A 932 ? GLU A 944 ? LEU A 1011 GLU A 1023 1 ? 13 
HELX_P HELX_P52 AF7 THR A 948 ? ARG A 954 ? THR A 1027 ARG A 1033 1 ? 7  
HELX_P HELX_P53 AF8 TRP A 959 ? SER A 968 ? TRP A 1038 SER A 1047 1 ? 10 
HELX_P HELX_P54 AF9 ASP B 53  ? ASP B 63  ? ASP B 333  ASP B 343  1 ? 11 
HELX_P HELX_P55 AG1 THR B 77  ? GLY B 87  ? THR B 357  GLY B 367  1 ? 11 
HELX_P HELX_P56 AG2 GLY B 88  ? PHE B 93  ? GLY B 368  PHE B 373  1 ? 6  
HELX_P HELX_P57 AG3 ASN B 102 ? ARG B 111 ? ASN B 382  ARG B 391  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? A MSE 4   C ? ? ? 1_555 A LEU 5   N ? ? A MSE 83   A LEU 84   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2  covale both ? A LYS 10  C ? ? ? 1_555 A MSE 11  N ? ? A LYS 89   A MSE 90   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale3  covale both ? A MSE 11  C ? ? ? 1_555 A GLY 12  N ? ? A MSE 90   A GLY 91   1_555 ? ? ? ? ? ? ? 1.324 ? 
covale4  covale both ? A ALA 15  C ? ? ? 1_555 A MSE 16  N ? ? A ALA 94   A MSE 95   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale5  covale both ? A MSE 16  C ? ? ? 1_555 A GLN 17  N ? ? A MSE 95   A GLN 96   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale6  covale both ? A GLU 55  C ? ? ? 1_555 A MSE 56  N ? ? A GLU 134  A MSE 135  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale7  covale both ? A MSE 56  C ? ? ? 1_555 A PHE 57  N ? ? A MSE 135  A PHE 136  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale8  covale both ? A HIS 59  C ? ? ? 1_555 A MSE 60  N ? ? A HIS 138  A MSE 139  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale9  covale both ? A MSE 60  C ? ? ? 1_555 A GLN 61  N ? ? A MSE 139  A GLN 140  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale10 covale both ? A LYS 68  C ? ? ? 1_555 A MSE 69  N ? ? A LYS 147  A MSE 148  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale11 covale both ? A MSE 69  C ? ? ? 1_555 A THR 70  N ? ? A MSE 148  A THR 149  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale12 covale both ? A THR 83  C ? ? ? 1_555 A MSE 84  N ? ? A THR 162  A MSE 163  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale13 covale both ? A MSE 84  C ? ? ? 1_555 A ALA 85  N ? ? A MSE 163  A ALA 164  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale14 covale both ? A TYR 116 C ? ? ? 1_555 A MSE 117 N ? ? A TYR 195  A MSE 196  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale15 covale both ? A MSE 117 C ? ? ? 1_555 A MSE 118 N ? ? A MSE 196  A MSE 197  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale16 covale both ? A MSE 118 C ? ? ? 1_555 A ASP 119 N ? ? A MSE 197  A ASP 198  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale17 covale both ? A ALA 144 C ? ? ? 1_555 A MSE 145 N ? ? A ALA 223  A MSE 224  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale18 covale both ? A MSE 145 C ? ? ? 1_555 A LYS 146 N ? ? A MSE 224  A LYS 225  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale19 covale both ? A LEU 147 C ? ? ? 1_555 A MSE 148 N ? ? A LEU 226  A MSE 227  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale20 covale both ? A MSE 148 C ? ? ? 1_555 A THR 149 N ? ? A MSE 227  A THR 228  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale21 covale both ? A ASN 161 C ? ? ? 1_555 A MSE 162 N ? ? A ASN 240  A MSE 241  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale22 covale both ? A MSE 162 C ? ? ? 1_555 A ASP 163 N ? ? A MSE 241  A ASP 242  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale23 covale both ? A ASN 204 C ? ? ? 1_555 A MSE 205 N ? ? A ASN 283  A MSE 284  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale24 covale both ? A MSE 205 C ? ? ? 1_555 A MSE 206 N ? ? A MSE 284  A MSE 285  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale25 covale both ? A MSE 206 C ? ? ? 1_555 A ASN 207 N ? ? A MSE 285  A ASN 286  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale26 covale both ? A TRP 236 C ? ? ? 1_555 A MSE 237 N ? ? A TRP 315  A MSE 316  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale27 covale both ? A MSE 237 C ? ? ? 1_555 A LYS 238 N ? ? A MSE 316  A LYS 317  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale28 covale both ? A LYS 238 C ? ? ? 1_555 A MSE 239 N ? ? A LYS 317  A MSE 318  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale29 covale both ? A MSE 239 C ? ? ? 1_555 A TYR 240 N ? ? A MSE 318  A TYR 319  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale30 covale both ? A THR 256 C ? ? ? 1_555 A MSE 257 N ? ? A THR 335  A MSE 336  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale31 covale both ? A MSE 257 C ? ? ? 1_555 A HIS 258 N ? ? A MSE 336  A HIS 337  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale32 covale both ? A SER 298 C ? ? ? 1_555 A MSE 299 N ? ? A SER 377  A MSE 378  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale33 covale both ? A MSE 299 C ? ? ? 1_555 A THR 300 N ? ? A MSE 378  A THR 379  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale34 covale both ? A SER 404 C ? ? ? 1_555 A MSE 405 N ? ? A SER 483  A MSE 484  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale35 covale both ? A MSE 405 C ? ? ? 1_555 A TRP 406 N ? ? A MSE 484  A TRP 485  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale36 covale both ? A CYS 418 C ? ? ? 1_555 A MSE 419 N ? ? A CYS 497  A MSE 498  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale37 covale both ? A MSE 419 C ? ? ? 1_555 A ASN 420 N ? ? A MSE 498  A ASN 499  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale38 covale both ? A ILE 445 C ? ? ? 1_555 A MSE 446 N ? ? A ILE 524  A MSE 525  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale39 covale both ? A MSE 446 C ? ? ? 1_555 A LEU 447 N ? ? A MSE 525  A LEU 526  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale40 covale both ? A ASP 645 C ? ? ? 1_555 A MSE 646 N ? ? A ASP 724  A MSE 725  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale41 covale both ? A MSE 646 C ? ? ? 1_555 A PRO 647 N ? ? A MSE 725  A PRO 726  1_555 ? ? ? ? ? ? ? 1.347 ? 
covale42 covale both ? A GLN 685 C ? ? ? 1_555 A MSE 686 N ? ? A GLN 764  A MSE 765  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale43 covale both ? A MSE 686 C ? ? ? 1_555 A ARG 687 N ? ? A MSE 765  A ARG 766  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale44 covale both ? A LEU 716 C ? ? ? 1_555 A MSE 717 N ? ? A LEU 795  A MSE 796  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale45 covale both ? A MSE 717 C ? ? ? 1_555 A ILE 718 N ? ? A MSE 796  A ILE 797  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale46 covale both ? A ILE 723 C ? ? ? 1_555 A MSE 724 N ? ? A ILE 802  A MSE 803  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale47 covale both ? A MSE 724 C ? ? ? 1_555 A SER 725 N ? ? A MSE 803  A SER 804  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale48 covale both ? A ASP 729 C ? ? ? 1_555 A MSE 730 N ? ? A ASP 808  A MSE 809  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale49 covale both ? A MSE 730 C ? ? ? 1_555 A LEU 731 N ? ? A MSE 809  A LEU 810  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale50 covale both ? A GLU 799 C ? ? ? 1_555 A MSE 800 N ? ? A GLU 878  A MSE 879  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale51 covale both ? A MSE 800 C ? ? ? 1_555 A ASN 801 N ? ? A MSE 879  A ASN 880  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale52 covale both ? A TYR 810 C ? ? ? 1_555 A MSE 811 N ? ? A TYR 889  A MSE 890  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale53 covale both ? A MSE 811 C ? ? ? 1_555 A LYS 812 N ? ? A MSE 890  A LYS 891  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale54 covale both ? A THR 824 C ? ? ? 1_555 A MSE 825 N ? ? A THR 903  A MSE 904  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale55 covale both ? A MSE 825 C ? ? ? 1_555 A SER 826 N ? ? A MSE 904  A SER 905  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale56 covale both ? A GLU 850 C ? ? ? 1_555 A MSE 851 N ? ? A GLU 929  A MSE 930  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale57 covale both ? A MSE 851 C ? ? ? 1_555 A ILE 852 N ? ? A MSE 930  A ILE 931  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale58 covale both ? A ALA 892 C ? ? ? 1_555 A MSE 893 N ? ? A ALA 971  A MSE 972  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale59 covale both ? A MSE 893 C ? ? ? 1_555 A LEU 894 N ? ? A MSE 972  A LEU 973  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale60 covale both ? A PHE 946 C ? ? ? 1_555 A MSE 947 N ? ? A PHE 1025 A MSE 1026 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale61 covale both ? A MSE 947 C ? ? ? 1_555 A THR 948 N ? ? A MSE 1026 A THR 1027 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale62 covale both ? A GLN 950 C ? ? ? 1_555 A MSE 951 N ? ? A GLN 1029 A MSE 1030 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale63 covale both ? A MSE 951 C ? ? ? 1_555 A SER 952 N ? ? A MSE 1030 A SER 1031 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale64 covale both ? A LEU 962 C ? ? ? 1_555 A MSE 963 N ? ? A LEU 1041 A MSE 1042 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale65 covale both ? A MSE 963 C ? ? ? 1_555 A SER 964 N ? ? A MSE 1042 A SER 1043 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale66 covale both ? B LEU 80  C ? ? ? 1_555 B MSE 81  N ? ? B LEU 360  B MSE 361  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale67 covale both ? B MSE 81  C ? ? ? 1_555 B MSE 82  N ? ? B MSE 361  B MSE 362  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale68 covale both ? B MSE 82  C ? ? ? 1_555 B TRP 83  N ? ? B MSE 362  B TRP 363  1_555 ? ? ? ? ? ? ? 1.331 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 277 A . ? TYR 356  A ASN 278 A ? ASN 357  A 1 -3.44 
2 GLU 280 A . ? GLU 359  A LEU 281 A ? LEU 360  A 1 11.41 
3 GLU 598 A . ? GLU 677  A GLU 599 A ? GLU 678  A 1 -9.07 
4 GLU 599 A . ? GLU 678  A PRO 600 A ? PRO 679  A 1 -0.91 
5 SER 674 A . ? SER 753  A THR 675 A ? THR 754  A 1 -1.62 
6 GLY 910 A . ? GLY 989  A GLU 911 A ? GLU 990  A 1 -1.48 
7 PRO 915 A . ? PRO 994  A LEU 916 A ? LEU 995  A 1 -3.97 
8 LEU 931 A . ? LEU 1010 A LEU 932 A ? LEU 1011 A 1 -7.19 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    MES 
_struct_site.pdbx_auth_seq_id     1101 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue MES A 1101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 VAL A 215 ? VAL A 294 . ? 1_555 ? 
2 AC1 6 TYR A 218 ? TYR A 297 . ? 1_555 ? 
3 AC1 6 ARG A 219 ? ARG A 298 . ? 1_555 ? 
4 AC1 6 TYR A 252 ? TYR A 331 . ? 1_555 ? 
5 AC1 6 TRP A 255 ? TRP A 334 . ? 1_555 ? 
6 AC1 6 ARG B 58  ? ARG B 338 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4PJW 
_atom_sites.fract_transf_matrix[1][1]   0.012701 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009255 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005530 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1     N  N    . MSE A 1 4   ? -46.700 -46.641 -21.417 1.00 126.19 ? 83   MSE A N    1 
HETATM 2     C  CA   . MSE A 1 4   ? -46.549 -45.544 -22.364 1.00 123.28 ? 83   MSE A CA   1 
HETATM 3     C  C    . MSE A 1 4   ? -46.677 -44.197 -21.652 1.00 112.45 ? 83   MSE A C    1 
HETATM 4     O  O    . MSE A 1 4   ? -46.812 -43.162 -22.300 1.00 108.45 ? 83   MSE A O    1 
HETATM 5     C  CB   . MSE A 1 4   ? -47.617 -45.649 -23.458 1.00 127.33 ? 83   MSE A CB   1 
HETATM 6     C  CG   . MSE A 1 4   ? -47.300 -44.877 -24.737 1.00 135.80 ? 83   MSE A CG   1 
HETATM 7     SE SE   . MSE A 1 4   ? -48.867 -44.615 -25.868 1.00 164.92 ? 83   MSE A SE   1 
HETATM 8     C  CE   . MSE A 1 4   ? -48.198 -43.159 -26.982 1.00 122.52 ? 83   MSE A CE   1 
HETATM 9     H  HA   . MSE A 1 4   ? -45.676 -45.602 -22.785 1.00 147.93 ? 83   MSE A HA   1 
HETATM 10    H  HB2  . MSE A 1 4   ? -47.724 -46.583 -23.697 1.00 152.79 ? 83   MSE A HB2  1 
HETATM 11    H  HB3  . MSE A 1 4   ? -48.454 -45.305 -23.107 1.00 152.79 ? 83   MSE A HB3  1 
HETATM 12    H  HG2  . MSE A 1 4   ? -46.951 -44.004 -24.501 1.00 162.96 ? 83   MSE A HG2  1 
HETATM 13    H  HG3  . MSE A 1 4   ? -46.640 -45.371 -25.249 1.00 162.96 ? 83   MSE A HG3  1 
HETATM 14    H  HE1  . MSE A 1 4   ? -48.885 -42.907 -27.618 1.00 147.03 ? 83   MSE A HE1  1 
HETATM 15    H  HE2  . MSE A 1 4   ? -47.977 -42.403 -26.415 1.00 147.03 ? 83   MSE A HE2  1 
HETATM 16    H  HE3  . MSE A 1 4   ? -47.406 -43.461 -27.454 1.00 147.03 ? 83   MSE A HE3  1 
ATOM   17    N  N    . LEU A 1 5   ? -46.618 -44.215 -20.321 1.00 59.39  ? 84   LEU A N    1 
ATOM   18    C  CA   . LEU A 1 5   ? -46.956 -43.041 -19.509 1.00 54.54  ? 84   LEU A CA   1 
ATOM   19    C  C    . LEU A 1 5   ? -46.323 -41.726 -19.966 1.00 55.01  ? 84   LEU A C    1 
ATOM   20    O  O    . LEU A 1 5   ? -47.040 -40.769 -20.239 1.00 52.91  ? 84   LEU A O    1 
ATOM   21    C  CB   . LEU A 1 5   ? -46.624 -43.285 -18.035 1.00 45.30  ? 84   LEU A CB   1 
ATOM   22    C  CG   . LEU A 1 5   ? -47.774 -43.884 -17.224 1.00 39.00  ? 84   LEU A CG   1 
ATOM   23    C  CD1  . LEU A 1 5   ? -47.849 -45.386 -17.425 1.00 53.12  ? 84   LEU A CD1  1 
ATOM   24    C  CD2  . LEU A 1 5   ? -47.639 -43.540 -15.752 1.00 33.24  ? 84   LEU A CD2  1 
ATOM   25    H  H    . LEU A 1 5   ? -46.384 -44.901 -19.859 1.00 71.26  ? 84   LEU A H    1 
ATOM   26    H  HA   . LEU A 1 5   ? -47.917 -42.918 -19.560 1.00 65.45  ? 84   LEU A HA   1 
ATOM   27    H  HB2  . LEU A 1 5   ? -45.874 -43.898 -17.983 1.00 54.36  ? 84   LEU A HB2  1 
ATOM   28    H  HB3  . LEU A 1 5   ? -46.384 -42.438 -17.627 1.00 54.36  ? 84   LEU A HB3  1 
ATOM   29    H  HG   . LEU A 1 5   ? -48.608 -43.503 -17.540 1.00 46.80  ? 84   LEU A HG   1 
ATOM   30    H  HD11 . LEU A 1 5   ? -48.585 -45.738 -16.900 1.00 63.75  ? 84   LEU A HD11 1 
ATOM   31    H  HD12 . LEU A 1 5   ? -47.995 -45.571 -18.366 1.00 63.75  ? 84   LEU A HD12 1 
ATOM   32    H  HD13 . LEU A 1 5   ? -47.014 -45.785 -17.134 1.00 63.75  ? 84   LEU A HD13 1 
ATOM   33    H  HD21 . LEU A 1 5   ? -48.381 -43.934 -15.267 1.00 39.89  ? 84   LEU A HD21 1 
ATOM   34    H  HD22 . LEU A 1 5   ? -46.800 -43.897 -15.420 1.00 39.89  ? 84   LEU A HD22 1 
ATOM   35    H  HD23 . LEU A 1 5   ? -47.652 -42.576 -15.651 1.00 39.89  ? 84   LEU A HD23 1 
ATOM   36    N  N    . PHE A 1 6   ? -44.994 -41.675 -20.044 1.00 54.90  ? 85   PHE A N    1 
ATOM   37    C  CA   . PHE A 1 6   ? -44.307 -40.435 -20.409 1.00 51.07  ? 85   PHE A CA   1 
ATOM   38    C  C    . PHE A 1 6   ? -44.895 -39.803 -21.665 1.00 56.36  ? 85   PHE A C    1 
ATOM   39    O  O    . PHE A 1 6   ? -45.185 -38.608 -21.701 1.00 56.74  ? 85   PHE A O    1 
ATOM   40    C  CB   . PHE A 1 6   ? -42.813 -40.667 -20.639 1.00 50.23  ? 85   PHE A CB   1 
ATOM   41    C  CG   . PHE A 1 6   ? -42.121 -39.493 -21.279 1.00 49.26  ? 85   PHE A CG   1 
ATOM   42    C  CD1  . PHE A 1 6   ? -42.074 -38.269 -20.632 1.00 46.26  ? 85   PHE A CD1  1 
ATOM   43    C  CD2  . PHE A 1 6   ? -41.534 -39.606 -22.529 1.00 55.68  ? 85   PHE A CD2  1 
ATOM   44    C  CE1  . PHE A 1 6   ? -41.450 -37.181 -21.215 1.00 49.52  ? 85   PHE A CE1  1 
ATOM   45    C  CE2  . PHE A 1 6   ? -40.907 -38.519 -23.117 1.00 48.81  ? 85   PHE A CE2  1 
ATOM   46    C  CZ   . PHE A 1 6   ? -40.866 -37.306 -22.459 1.00 43.57  ? 85   PHE A CZ   1 
ATOM   47    H  H    . PHE A 1 6   ? -44.470 -42.339 -19.892 1.00 65.88  ? 85   PHE A H    1 
ATOM   48    H  HA   . PHE A 1 6   ? -44.401 -39.798 -19.683 1.00 61.28  ? 85   PHE A HA   1 
ATOM   49    H  HB2  . PHE A 1 6   ? -42.386 -40.836 -19.785 1.00 60.28  ? 85   PHE A HB2  1 
ATOM   50    H  HB3  . PHE A 1 6   ? -42.701 -41.434 -21.223 1.00 60.28  ? 85   PHE A HB3  1 
ATOM   51    H  HD1  . PHE A 1 6   ? -42.467 -38.177 -19.794 1.00 55.51  ? 85   PHE A HD1  1 
ATOM   52    H  HD2  . PHE A 1 6   ? -41.560 -40.420 -22.977 1.00 66.82  ? 85   PHE A HD2  1 
ATOM   53    H  HE1  . PHE A 1 6   ? -41.423 -36.365 -20.769 1.00 59.42  ? 85   PHE A HE1  1 
ATOM   54    H  HE2  . PHE A 1 6   ? -40.514 -38.607 -23.955 1.00 58.57  ? 85   PHE A HE2  1 
ATOM   55    H  HZ   . PHE A 1 6   ? -40.444 -36.576 -22.852 1.00 52.29  ? 85   PHE A HZ   1 
ATOM   56    N  N    . GLU A 1 7   ? -45.077 -40.623 -22.690 1.00 94.66  ? 86   GLU A N    1 
ATOM   57    C  CA   . GLU A 1 7   ? -45.571 -40.144 -23.970 1.00 102.96 ? 86   GLU A CA   1 
ATOM   58    C  C    . GLU A 1 7   ? -47.043 -39.732 -23.894 1.00 101.97 ? 86   GLU A C    1 
ATOM   59    O  O    . GLU A 1 7   ? -47.452 -38.787 -24.563 1.00 103.96 ? 86   GLU A O    1 
ATOM   60    C  CB   . GLU A 1 7   ? -45.337 -41.209 -25.044 1.00 107.62 ? 86   GLU A CB   1 
ATOM   61    C  CG   . GLU A 1 7   ? -43.852 -41.414 -25.355 1.00 109.72 ? 86   GLU A CG   1 
ATOM   62    C  CD   . GLU A 1 7   ? -43.554 -42.726 -26.060 1.00 119.73 ? 86   GLU A CD   1 
ATOM   63    O  OE1  . GLU A 1 7   ? -44.429 -43.619 -26.078 1.00 122.19 ? 86   GLU A OE1  1 
ATOM   64    O  OE2  . GLU A 1 7   ? -42.433 -42.865 -26.595 1.00 121.51 ? 86   GLU A OE2  1 
ATOM   65    H  H    . GLU A 1 7   ? -44.920 -41.469 -22.669 1.00 113.60 ? 86   GLU A H    1 
ATOM   66    H  HA   . GLU A 1 7   ? -45.061 -39.358 -24.221 1.00 123.55 ? 86   GLU A HA   1 
ATOM   67    H  HB2  . GLU A 1 7   ? -45.699 -42.054 -24.735 1.00 129.15 ? 86   GLU A HB2  1 
ATOM   68    H  HB3  . GLU A 1 7   ? -45.780 -40.936 -25.862 1.00 129.15 ? 86   GLU A HB3  1 
ATOM   69    H  HG2  . GLU A 1 7   ? -43.550 -40.693 -25.929 1.00 131.66 ? 86   GLU A HG2  1 
ATOM   70    H  HG3  . GLU A 1 7   ? -43.353 -41.404 -24.523 1.00 131.66 ? 86   GLU A HG3  1 
ATOM   71    N  N    . VAL A 1 8   ? -47.833 -40.416 -23.069 1.00 67.01  ? 87   VAL A N    1 
ATOM   72    C  CA   . VAL A 1 8   ? -49.241 -40.051 -22.900 1.00 62.84  ? 87   VAL A CA   1 
ATOM   73    C  C    . VAL A 1 8   ? -49.386 -38.681 -22.244 1.00 60.67  ? 87   VAL A C    1 
ATOM   74    O  O    . VAL A 1 8   ? -50.324 -37.939 -22.541 1.00 59.86  ? 87   VAL A O    1 
ATOM   75    C  CB   . VAL A 1 8   ? -50.012 -41.075 -22.039 1.00 56.04  ? 87   VAL A CB   1 
ATOM   76    C  CG1  . VAL A 1 8   ? -51.450 -40.614 -21.815 1.00 51.11  ? 87   VAL A CG1  1 
ATOM   77    C  CG2  . VAL A 1 8   ? -50.014 -42.440 -22.697 1.00 62.37  ? 87   VAL A CG2  1 
ATOM   78    H  H    . VAL A 1 8   ? -47.582 -41.090 -22.598 1.00 80.41  ? 87   VAL A H    1 
ATOM   79    H  HA   . VAL A 1 8   ? -49.664 -40.013 -23.772 1.00 75.41  ? 87   VAL A HA   1 
ATOM   80    H  HB   . VAL A 1 8   ? -49.580 -41.155 -21.174 1.00 67.24  ? 87   VAL A HB   1 
ATOM   81    H  HG11 . VAL A 1 8   ? -51.912 -41.272 -21.273 1.00 61.33  ? 87   VAL A HG11 1 
ATOM   82    H  HG12 . VAL A 1 8   ? -51.440 -39.758 -21.359 1.00 61.33  ? 87   VAL A HG12 1 
ATOM   83    H  HG13 . VAL A 1 8   ? -51.890 -40.526 -22.675 1.00 61.33  ? 87   VAL A HG13 1 
ATOM   84    H  HG21 . VAL A 1 8   ? -50.504 -43.060 -22.135 1.00 74.85  ? 87   VAL A HG21 1 
ATOM   85    H  HG22 . VAL A 1 8   ? -50.442 -42.370 -23.565 1.00 74.85  ? 87   VAL A HG22 1 
ATOM   86    H  HG23 . VAL A 1 8   ? -49.098 -42.741 -22.802 1.00 74.85  ? 87   VAL A HG23 1 
ATOM   87    N  N    . VAL A 1 9   ? -48.466 -38.357 -21.340 1.00 77.49  ? 88   VAL A N    1 
ATOM   88    C  CA   . VAL A 1 9   ? -48.552 -37.121 -20.571 1.00 77.17  ? 88   VAL A CA   1 
ATOM   89    C  C    . VAL A 1 9   ? -48.098 -35.912 -21.395 1.00 77.05  ? 88   VAL A C    1 
ATOM   90    O  O    . VAL A 1 9   ? -48.553 -34.790 -21.159 1.00 79.53  ? 88   VAL A O    1 
ATOM   91    C  CB   . VAL A 1 9   ? -47.731 -37.221 -19.265 1.00 64.60  ? 88   VAL A CB   1 
ATOM   92    C  CG1  . VAL A 1 9   ? -47.827 -35.938 -18.449 1.00 62.49  ? 88   VAL A CG1  1 
ATOM   93    C  CG2  . VAL A 1 9   ? -48.220 -38.394 -18.430 1.00 58.19  ? 88   VAL A CG2  1 
ATOM   94    H  H    . VAL A 1 9   ? -47.779 -38.839 -21.153 1.00 92.98  ? 88   VAL A H    1 
ATOM   95    H  HA   . VAL A 1 9   ? -49.478 -36.975 -20.323 1.00 92.60  ? 88   VAL A HA   1 
ATOM   96    H  HB   . VAL A 1 9   ? -46.798 -37.373 -19.484 1.00 77.52  ? 88   VAL A HB   1 
ATOM   97    H  HG11 . VAL A 1 9   ? -47.302 -36.038 -17.640 1.00 74.99  ? 88   VAL A HG11 1 
ATOM   98    H  HG12 . VAL A 1 9   ? -47.484 -35.201 -18.978 1.00 74.99  ? 88   VAL A HG12 1 
ATOM   99    H  HG13 . VAL A 1 9   ? -48.757 -35.778 -18.222 1.00 74.99  ? 88   VAL A HG13 1 
ATOM   100   H  HG21 . VAL A 1 9   ? -47.695 -38.443 -17.616 1.00 69.83  ? 88   VAL A HG21 1 
ATOM   101   H  HG22 . VAL A 1 9   ? -49.156 -38.258 -18.213 1.00 69.83  ? 88   VAL A HG22 1 
ATOM   102   H  HG23 . VAL A 1 9   ? -48.115 -39.211 -18.942 1.00 69.83  ? 88   VAL A HG23 1 
ATOM   103   N  N    . LYS A 1 10  ? -47.214 -36.139 -22.364 1.00 85.44  ? 89   LYS A N    1 
ATOM   104   C  CA   . LYS A 1 10  ? -46.754 -35.058 -23.234 1.00 93.68  ? 89   LYS A CA   1 
ATOM   105   C  C    . LYS A 1 10  ? -47.656 -34.931 -24.460 1.00 100.50 ? 89   LYS A C    1 
ATOM   106   O  O    . LYS A 1 10  ? -48.003 -33.825 -24.881 1.00 100.29 ? 89   LYS A O    1 
ATOM   107   C  CB   . LYS A 1 10  ? -45.305 -35.293 -23.678 1.00 97.92  ? 89   LYS A CB   1 
ATOM   108   C  CG   . LYS A 1 10  ? -44.689 -34.104 -24.417 1.00 105.90 ? 89   LYS A CG   1 
ATOM   109   C  CD   . LYS A 1 10  ? -43.170 -34.210 -24.522 1.00 107.60 ? 89   LYS A CD   1 
ATOM   110   C  CE   . LYS A 1 10  ? -42.739 -35.425 -25.326 1.00 107.27 ? 89   LYS A CE   1 
ATOM   111   N  NZ   . LYS A 1 10  ? -41.264 -35.463 -25.534 1.00 105.34 ? 89   LYS A NZ   1 
ATOM   112   H  HA   . LYS A 1 10  ? -46.789 -34.221 -22.746 1.00 112.42 ? 89   LYS A HA   1 
ATOM   113   H  HB2  . LYS A 1 10  ? -44.763 -35.469 -22.893 1.00 117.50 ? 89   LYS A HB2  1 
ATOM   114   H  HB3  . LYS A 1 10  ? -45.281 -36.058 -24.274 1.00 117.50 ? 89   LYS A HB3  1 
ATOM   115   H  HG2  . LYS A 1 10  ? -45.051 -34.066 -25.316 1.00 127.09 ? 89   LYS A HG2  1 
ATOM   116   H  HG3  . LYS A 1 10  ? -44.901 -33.288 -23.938 1.00 127.09 ? 89   LYS A HG3  1 
ATOM   117   H  HD2  . LYS A 1 10  ? -42.826 -33.418 -24.963 1.00 129.12 ? 89   LYS A HD2  1 
ATOM   118   H  HD3  . LYS A 1 10  ? -42.794 -34.287 -23.632 1.00 129.12 ? 89   LYS A HD3  1 
ATOM   119   H  HE2  . LYS A 1 10  ? -42.998 -36.230 -24.850 1.00 128.72 ? 89   LYS A HE2  1 
ATOM   120   H  HE3  . LYS A 1 10  ? -43.167 -35.400 -26.196 1.00 128.72 ? 89   LYS A HE3  1 
ATOM   121   H  HZ1  . LYS A 1 10  ? -41.001 -34.736 -25.975 1.00 126.41 ? 89   LYS A HZ1  1 
ATOM   122   H  HZ2  . LYS A 1 10  ? -40.847 -35.492 -24.748 1.00 126.41 ? 89   LYS A HZ2  1 
ATOM   123   H  HZ3  . LYS A 1 10  ? -41.042 -36.183 -26.006 1.00 126.41 ? 89   LYS A HZ3  1 
HETATM 124   N  N    . MSE A 1 11  ? -48.046 -36.073 -25.016 1.00 134.32 ? 90   MSE A N    1 
HETATM 125   C  CA   . MSE A 1 11  ? -48.792 -36.111 -26.268 1.00 137.67 ? 90   MSE A CA   1 
HETATM 126   C  C    . MSE A 1 11  ? -50.305 -36.057 -26.058 1.00 141.29 ? 90   MSE A C    1 
HETATM 127   O  O    . MSE A 1 11  ? -51.002 -35.346 -26.781 1.00 146.58 ? 90   MSE A O    1 
HETATM 128   C  CB   . MSE A 1 11  ? -48.432 -37.374 -27.055 1.00 146.56 ? 90   MSE A CB   1 
HETATM 129   C  CG   . MSE A 1 11  ? -46.941 -37.532 -27.338 1.00 151.08 ? 90   MSE A CG   1 
HETATM 130   SE SE   . MSE A 1 11  ? -46.600 -38.033 -29.190 1.00 187.64 ? 90   MSE A SE   1 
HETATM 131   C  CE   . MSE A 1 11  ? -47.435 -39.797 -29.187 1.00 146.36 ? 90   MSE A CE   1 
HETATM 132   H  HA   . MSE A 1 11  ? -48.529 -35.348 -26.805 1.00 165.21 ? 90   MSE A HA   1 
HETATM 133   H  HB2  . MSE A 1 11  ? -48.720 -38.150 -26.548 1.00 175.87 ? 90   MSE A HB2  1 
HETATM 134   H  HB3  . MSE A 1 11  ? -48.894 -37.352 -27.908 1.00 175.87 ? 90   MSE A HB3  1 
HETATM 135   H  HG2  . MSE A 1 11  ? -46.579 -38.226 -26.766 1.00 181.30 ? 90   MSE A HG2  1 
HETATM 136   H  HG3  . MSE A 1 11  ? -46.493 -36.689 -27.166 1.00 181.30 ? 90   MSE A HG3  1 
HETATM 137   H  HE1  . MSE A 1 11  ? -47.345 -40.189 -30.070 1.00 175.63 ? 90   MSE A HE1  1 
HETATM 138   H  HE2  . MSE A 1 11  ? -46.990 -40.355 -28.530 1.00 175.63 ? 90   MSE A HE2  1 
HETATM 139   H  HE3  . MSE A 1 11  ? -48.373 -39.701 -28.961 1.00 175.63 ? 90   MSE A HE3  1 
ATOM   140   N  N    . GLY A 1 12  ? -50.797 -36.796 -25.076 1.00 87.55  ? 91   GLY A N    1 
ATOM   141   C  CA   . GLY A 1 12  ? -52.216 -36.842 -24.769 1.00 85.24  ? 91   GLY A CA   1 
ATOM   142   C  C    . GLY A 1 12  ? -53.033 -35.688 -25.292 1.00 83.20  ? 91   GLY A C    1 
ATOM   143   O  O    . GLY A 1 12  ? -53.252 -34.727 -24.577 1.00 84.31  ? 91   GLY A O    1 
ATOM   144   N  N    . SER A 1 14  ? -55.647 -35.612 -23.629 1.00 87.69  ? 93   SER A N    1 
ATOM   145   C  CA   . SER A 1 14  ? -56.443 -36.415 -22.706 1.00 85.48  ? 93   SER A CA   1 
ATOM   146   C  C    . SER A 1 14  ? -56.319 -35.940 -21.257 1.00 77.69  ? 93   SER A C    1 
ATOM   147   O  O    . SER A 1 14  ? -55.246 -35.513 -20.816 1.00 69.90  ? 93   SER A O    1 
ATOM   148   C  CB   . SER A 1 14  ? -56.088 -37.903 -22.825 1.00 83.70  ? 93   SER A CB   1 
ATOM   149   O  OG   . SER A 1 14  ? -54.695 -38.125 -22.690 1.00 80.61  ? 93   SER A OG   1 
ATOM   150   N  N    . ALA A 1 15  ? -57.435 -36.018 -20.533 1.00 72.51  ? 94   ALA A N    1 
ATOM   151   C  CA   . ALA A 1 15  ? -57.512 -35.567 -19.147 1.00 66.41  ? 94   ALA A CA   1 
ATOM   152   C  C    . ALA A 1 15  ? -56.485 -36.292 -18.291 1.00 65.88  ? 94   ALA A C    1 
ATOM   153   O  O    . ALA A 1 15  ? -56.092 -37.419 -18.595 1.00 59.18  ? 94   ALA A O    1 
ATOM   154   C  CB   . ALA A 1 15  ? -58.920 -35.792 -18.593 1.00 67.96  ? 94   ALA A CB   1 
ATOM   155   H  HA   . ALA A 1 15  ? -57.320 -34.616 -19.110 1.00 79.70  ? 94   ALA A HA   1 
ATOM   156   H  HB1  . ALA A 1 15  ? -59.554 -35.291 -19.129 1.00 81.56  ? 94   ALA A HB1  1 
ATOM   157   H  HB2  . ALA A 1 15  ? -59.127 -36.739 -18.634 1.00 81.56  ? 94   ALA A HB2  1 
ATOM   158   H  HB3  . ALA A 1 15  ? -58.950 -35.486 -17.673 1.00 81.56  ? 94   ALA A HB3  1 
HETATM 159   N  N    . MSE A 1 16  ? -56.048 -35.641 -17.220 1.00 72.36  ? 95   MSE A N    1 
HETATM 160   C  CA   . MSE A 1 16  ? -55.071 -36.245 -16.331 1.00 61.85  ? 95   MSE A CA   1 
HETATM 161   C  C    . MSE A 1 16  ? -55.736 -37.302 -15.458 1.00 60.36  ? 95   MSE A C    1 
HETATM 162   O  O    . MSE A 1 16  ? -55.189 -38.386 -15.265 1.00 63.22  ? 95   MSE A O    1 
HETATM 163   C  CB   . MSE A 1 16  ? -54.403 -35.182 -15.462 1.00 64.44  ? 95   MSE A CB   1 
HETATM 164   C  CG   . MSE A 1 16  ? -52.903 -35.371 -15.336 1.00 61.13  ? 95   MSE A CG   1 
HETATM 165   SE SE   . MSE A 1 16  ? -51.951 -35.079 -17.018 1.00 88.35  ? 95   MSE A SE   1 
HETATM 166   C  CE   . MSE A 1 16  ? -51.252 -36.871 -17.328 1.00 49.62  ? 95   MSE A CE   1 
HETATM 167   H  H    . MSE A 1 16  ? -56.302 -34.853 -16.988 1.00 86.83  ? 95   MSE A H    1 
HETATM 168   H  HA   . MSE A 1 16  ? -54.381 -36.668 -16.865 1.00 74.22  ? 95   MSE A HA   1 
HETATM 169   H  HB2  . MSE A 1 16  ? -54.563 -34.309 -15.855 1.00 77.32  ? 95   MSE A HB2  1 
HETATM 170   H  HB3  . MSE A 1 16  ? -54.785 -35.218 -14.571 1.00 77.32  ? 95   MSE A HB3  1 
HETATM 171   H  HG2  . MSE A 1 16  ? -52.560 -34.739 -14.685 1.00 73.36  ? 95   MSE A HG2  1 
HETATM 172   H  HG3  . MSE A 1 16  ? -52.723 -36.278 -15.044 1.00 73.36  ? 95   MSE A HG3  1 
HETATM 173   H  HE1  . MSE A 1 16  ? -50.744 -36.873 -18.154 1.00 59.54  ? 95   MSE A HE1  1 
HETATM 174   H  HE2  . MSE A 1 16  ? -50.679 -37.119 -16.586 1.00 59.54  ? 95   MSE A HE2  1 
HETATM 175   H  HE3  . MSE A 1 16  ? -51.994 -37.492 -17.395 1.00 59.54  ? 95   MSE A HE3  1 
ATOM   176   N  N    . GLN A 1 17  ? -56.923 -36.991 -14.944 1.00 60.70  ? 96   GLN A N    1 
ATOM   177   C  CA   . GLN A 1 17  ? -57.634 -37.919 -14.069 1.00 57.25  ? 96   GLN A CA   1 
ATOM   178   C  C    . GLN A 1 17  ? -57.984 -39.201 -14.809 1.00 54.15  ? 96   GLN A C    1 
ATOM   179   O  O    . GLN A 1 17  ? -58.165 -40.252 -14.194 1.00 51.32  ? 96   GLN A O    1 
ATOM   180   C  CB   . GLN A 1 17  ? -58.904 -37.280 -13.505 1.00 52.13  ? 96   GLN A CB   1 
ATOM   181   C  CG   . GLN A 1 17  ? -59.566 -38.129 -12.425 1.00 54.00  ? 96   GLN A CG   1 
ATOM   182   C  CD   . GLN A 1 17  ? -60.483 -37.332 -11.522 1.00 62.98  ? 96   GLN A CD   1 
ATOM   183   O  OE1  . GLN A 1 17  ? -60.030 -36.470 -10.766 1.00 69.76  ? 96   GLN A OE1  1 
ATOM   184   N  NE2  . GLN A 1 17  ? -61.783 -37.617 -11.591 1.00 61.61  ? 96   GLN A NE2  1 
ATOM   185   H  H    . GLN A 1 17  ? -57.338 -36.252 -15.086 1.00 72.84  ? 96   GLN A H    1 
ATOM   186   H  HA   . GLN A 1 17  ? -57.059 -38.151 -13.323 1.00 68.70  ? 96   GLN A HA   1 
ATOM   187   H  HB2  . GLN A 1 17  ? -58.678 -36.421 -13.114 1.00 62.55  ? 96   GLN A HB2  1 
ATOM   188   H  HB3  . GLN A 1 17  ? -59.543 -37.159 -14.225 1.00 62.55  ? 96   GLN A HB3  1 
ATOM   189   H  HG2  . GLN A 1 17  ? -60.094 -38.823 -12.850 1.00 64.80  ? 96   GLN A HG2  1 
ATOM   190   H  HG3  . GLN A 1 17  ? -58.876 -38.529 -11.873 1.00 64.80  ? 96   GLN A HG3  1 
ATOM   191   H  HE21 . GLN A 1 17  ? -62.061 -38.227 -12.130 1.00 73.93  ? 96   GLN A HE21 1 
ATOM   192   H  HE22 . GLN A 1 17  ? -62.343 -37.191 -11.097 1.00 73.93  ? 96   GLN A HE22 1 
ATOM   193   N  N    . SER A 1 18  ? -58.072 -39.110 -16.131 1.00 54.41  ? 97   SER A N    1 
ATOM   194   C  CA   . SER A 1 18  ? -58.367 -40.275 -16.954 1.00 57.06  ? 97   SER A CA   1 
ATOM   195   C  C    . SER A 1 18  ? -57.227 -41.290 -16.927 1.00 55.49  ? 97   SER A C    1 
ATOM   196   O  O    . SER A 1 18  ? -57.466 -42.485 -16.774 1.00 55.92  ? 97   SER A O    1 
ATOM   197   C  CB   . SER A 1 18  ? -58.673 -39.848 -18.389 1.00 65.24  ? 97   SER A CB   1 
ATOM   198   O  OG   . SER A 1 18  ? -59.928 -39.188 -18.445 1.00 74.34  ? 97   SER A OG   1 
ATOM   199   H  H    . SER A 1 18  ? -57.964 -38.382 -16.577 1.00 65.29  ? 97   SER A H    1 
ATOM   200   H  HA   . SER A 1 18  ? -59.158 -40.712 -16.602 1.00 68.47  ? 97   SER A HA   1 
ATOM   201   H  HB2  . SER A 1 18  ? -57.980 -39.241 -18.695 1.00 78.29  ? 97   SER A HB2  1 
ATOM   202   H  HB3  . SER A 1 18  ? -58.701 -40.635 -18.956 1.00 78.29  ? 97   SER A HB3  1 
ATOM   203   H  HG   . SER A 1 18  ? -60.094 -38.954 -19.235 1.00 89.20  ? 97   SER A HG   1 
ATOM   204   N  N    . VAL A 1 19  ? -55.992 -40.815 -17.057 1.00 43.45  ? 98   VAL A N    1 
ATOM   205   C  CA   . VAL A 1 19  ? -54.837 -41.714 -17.063 1.00 41.83  ? 98   VAL A CA   1 
ATOM   206   C  C    . VAL A 1 19  ? -54.434 -42.125 -15.646 1.00 35.36  ? 98   VAL A C    1 
ATOM   207   O  O    . VAL A 1 19  ? -53.894 -43.213 -15.446 1.00 31.96  ? 98   VAL A O    1 
ATOM   208   C  CB   . VAL A 1 19  ? -53.627 -41.123 -17.846 1.00 44.82  ? 98   VAL A CB   1 
ATOM   209   C  CG1  . VAL A 1 19  ? -53.301 -39.723 -17.394 1.00 45.25  ? 98   VAL A CG1  1 
ATOM   210   C  CG2  . VAL A 1 19  ? -52.388 -42.016 -17.725 1.00 45.83  ? 98   VAL A CG2  1 
ATOM   211   H  H    . VAL A 1 19  ? -55.794 -39.982 -17.142 1.00 52.14  ? 98   VAL A H    1 
ATOM   212   H  HA   . VAL A 1 19  ? -55.099 -42.526 -17.525 1.00 50.20  ? 98   VAL A HA   1 
ATOM   213   H  HB   . VAL A 1 19  ? -53.862 -41.078 -18.786 1.00 53.79  ? 98   VAL A HB   1 
ATOM   214   H  HG11 . VAL A 1 19  ? -52.545 -39.394 -17.905 1.00 54.30  ? 98   VAL A HG11 1 
ATOM   215   H  HG12 . VAL A 1 19  ? -54.074 -39.155 -17.543 1.00 54.30  ? 98   VAL A HG12 1 
ATOM   216   H  HG13 . VAL A 1 19  ? -53.080 -39.740 -16.449 1.00 54.30  ? 98   VAL A HG13 1 
ATOM   217   H  HG21 . VAL A 1 19  ? -51.660 -41.615 -18.224 1.00 55.00  ? 98   VAL A HG21 1 
ATOM   218   H  HG22 . VAL A 1 19  ? -52.145 -42.094 -16.789 1.00 55.00  ? 98   VAL A HG22 1 
ATOM   219   H  HG23 . VAL A 1 19  ? -52.595 -42.892 -18.087 1.00 55.00  ? 98   VAL A HG23 1 
ATOM   220   N  N    . VAL A 1 20  ? -54.716 -41.276 -14.662 1.00 27.81  ? 99   VAL A N    1 
ATOM   221   C  CA   . VAL A 1 20  ? -54.503 -41.664 -13.271 1.00 23.48  ? 99   VAL A CA   1 
ATOM   222   C  C    . VAL A 1 20  ? -55.439 -42.810 -12.924 1.00 26.48  ? 99   VAL A C    1 
ATOM   223   O  O    . VAL A 1 20  ? -55.023 -43.805 -12.338 1.00 30.44  ? 99   VAL A O    1 
ATOM   224   C  CB   . VAL A 1 20  ? -54.732 -40.499 -12.295 1.00 21.18  ? 99   VAL A CB   1 
ATOM   225   C  CG1  . VAL A 1 20  ? -54.770 -40.998 -10.853 1.00 18.06  ? 99   VAL A CG1  1 
ATOM   226   C  CG2  . VAL A 1 20  ? -53.626 -39.464 -12.456 1.00 29.07  ? 99   VAL A CG2  1 
ATOM   227   H  H    . VAL A 1 20  ? -55.028 -40.482 -14.769 1.00 33.37  ? 99   VAL A H    1 
ATOM   228   H  HA   . VAL A 1 20  ? -53.591 -41.975 -13.163 1.00 28.18  ? 99   VAL A HA   1 
ATOM   229   H  HB   . VAL A 1 20  ? -55.580 -40.073 -12.494 1.00 25.41  ? 99   VAL A HB   1 
ATOM   230   H  HG11 . VAL A 1 20  ? -54.914 -40.243 -10.262 1.00 21.67  ? 99   VAL A HG11 1 
ATOM   231   H  HG12 . VAL A 1 20  ? -55.494 -41.636 -10.760 1.00 21.67  ? 99   VAL A HG12 1 
ATOM   232   H  HG13 . VAL A 1 20  ? -53.924 -41.425 -10.645 1.00 21.67  ? 99   VAL A HG13 1 
ATOM   233   H  HG21 . VAL A 1 20  ? -53.783 -38.735 -11.835 1.00 34.88  ? 99   VAL A HG21 1 
ATOM   234   H  HG22 . VAL A 1 20  ? -52.772 -39.883 -12.267 1.00 34.88  ? 99   VAL A HG22 1 
ATOM   235   H  HG23 . VAL A 1 20  ? -53.637 -39.131 -13.367 1.00 34.88  ? 99   VAL A HG23 1 
ATOM   236   N  N    . ASP A 1 21  ? -56.706 -42.671 -13.296 1.00 44.10  ? 100  ASP A N    1 
ATOM   237   C  CA   . ASP A 1 21  ? -57.686 -43.716 -13.026 1.00 43.66  ? 100  ASP A CA   1 
ATOM   238   C  C    . ASP A 1 21  ? -57.335 -44.985 -13.792 1.00 39.72  ? 100  ASP A C    1 
ATOM   239   O  O    . ASP A 1 21  ? -57.502 -46.092 -13.280 1.00 42.00  ? 100  ASP A O    1 
ATOM   240   C  CB   . ASP A 1 21  ? -59.097 -43.246 -13.390 1.00 48.48  ? 100  ASP A CB   1 
ATOM   241   C  CG   . ASP A 1 21  ? -59.671 -42.270 -12.373 1.00 51.20  ? 100  ASP A CG   1 
ATOM   242   O  OD1  . ASP A 1 21  ? -59.277 -42.332 -11.185 1.00 47.73  ? 100  ASP A OD1  1 
ATOM   243   O  OD2  . ASP A 1 21  ? -60.531 -41.449 -12.762 1.00 50.30  ? 100  ASP A OD2  1 
ATOM   244   H  H    . ASP A 1 21  ? -57.023 -41.985 -13.705 1.00 52.92  ? 100  ASP A H    1 
ATOM   245   H  HA   . ASP A 1 21  ? -57.674 -43.923 -12.079 1.00 52.39  ? 100  ASP A HA   1 
ATOM   246   H  HB2  . ASP A 1 21  ? -59.070 -42.801 -14.251 1.00 58.18  ? 100  ASP A HB2  1 
ATOM   247   H  HB3  . ASP A 1 21  ? -59.685 -44.016 -13.433 1.00 58.18  ? 100  ASP A HB3  1 
ATOM   248   N  N    . ASP A 1 22  ? -56.831 -44.821 -15.012 1.00 30.24  ? 101  ASP A N    1 
ATOM   249   C  CA   . ASP A 1 22  ? -56.378 -45.966 -15.795 1.00 35.25  ? 101  ASP A CA   1 
ATOM   250   C  C    . ASP A 1 22  ? -55.199 -46.632 -15.096 1.00 34.02  ? 101  ASP A C    1 
ATOM   251   O  O    . ASP A 1 22  ? -55.083 -47.858 -15.100 1.00 36.53  ? 101  ASP A O    1 
ATOM   252   C  CB   . ASP A 1 22  ? -55.988 -45.555 -17.220 1.00 38.79  ? 101  ASP A CB   1 
ATOM   253   C  CG   . ASP A 1 22  ? -57.176 -45.083 -18.045 1.00 56.34  ? 101  ASP A CG   1 
ATOM   254   O  OD1  . ASP A 1 22  ? -58.320 -45.497 -17.750 1.00 62.12  ? 101  ASP A OD1  1 
ATOM   255   O  OD2  . ASP A 1 22  ? -56.962 -44.299 -18.995 1.00 58.68  ? 101  ASP A OD2  1 
ATOM   256   H  H    . ASP A 1 22  ? -56.742 -44.063 -15.407 1.00 36.29  ? 101  ASP A H    1 
ATOM   257   H  HA   . ASP A 1 22  ? -57.098 -46.613 -15.856 1.00 42.30  ? 101  ASP A HA   1 
ATOM   258   H  HB2  . ASP A 1 22  ? -55.347 -44.828 -17.175 1.00 46.54  ? 101  ASP A HB2  1 
ATOM   259   H  HB3  . ASP A 1 22  ? -55.593 -46.317 -17.672 1.00 46.54  ? 101  ASP A HB3  1 
ATOM   260   N  N    . TRP A 1 23  ? -54.334 -45.827 -14.482 1.00 32.14  ? 102  TRP A N    1 
ATOM   261   C  CA   . TRP A 1 23  ? -53.180 -46.371 -13.776 1.00 28.49  ? 102  TRP A CA   1 
ATOM   262   C  C    . TRP A 1 23  ? -53.610 -47.074 -12.491 1.00 31.28  ? 102  TRP A C    1 
ATOM   263   O  O    . TRP A 1 23  ? -53.108 -48.154 -12.173 1.00 32.62  ? 102  TRP A O    1 
ATOM   264   C  CB   . TRP A 1 23  ? -52.144 -45.292 -13.441 1.00 28.84  ? 102  TRP A CB   1 
ATOM   265   C  CG   . TRP A 1 23  ? -50.915 -45.894 -12.832 1.00 25.42  ? 102  TRP A CG   1 
ATOM   266   C  CD1  . TRP A 1 23  ? -49.823 -46.363 -13.496 1.00 28.94  ? 102  TRP A CD1  1 
ATOM   267   C  CD2  . TRP A 1 23  ? -50.664 -46.118 -11.438 1.00 25.84  ? 102  TRP A CD2  1 
ATOM   268   N  NE1  . TRP A 1 23  ? -48.905 -46.863 -12.606 1.00 29.48  ? 102  TRP A NE1  1 
ATOM   269   C  CE2  . TRP A 1 23  ? -49.399 -46.725 -11.335 1.00 24.61  ? 102  TRP A CE2  1 
ATOM   270   C  CE3  . TRP A 1 23  ? -51.387 -45.865 -10.268 1.00 22.12  ? 102  TRP A CE3  1 
ATOM   271   C  CZ2  . TRP A 1 23  ? -48.837 -47.078 -10.110 1.00 25.99  ? 102  TRP A CZ2  1 
ATOM   272   C  CZ3  . TRP A 1 23  ? -50.827 -46.219 -9.051  1.00 22.32  ? 102  TRP A CZ3  1 
ATOM   273   C  CH2  . TRP A 1 23  ? -49.568 -46.820 -8.983  1.00 21.75  ? 102  TRP A CH2  1 
ATOM   274   H  H    . TRP A 1 23  ? -54.393 -44.970 -14.461 1.00 38.57  ? 102  TRP A H    1 
ATOM   275   H  HA   . TRP A 1 23  ? -52.749 -47.029 -14.343 1.00 34.19  ? 102  TRP A HA   1 
ATOM   276   H  HB2  . TRP A 1 23  ? -51.887 -44.831 -14.255 1.00 34.61  ? 102  TRP A HB2  1 
ATOM   277   H  HB3  . TRP A 1 23  ? -52.526 -44.667 -12.805 1.00 34.61  ? 102  TRP A HB3  1 
ATOM   278   H  HD1  . TRP A 1 23  ? -49.716 -46.351 -14.420 1.00 34.73  ? 102  TRP A HD1  1 
ATOM   279   H  HE1  . TRP A 1 23  ? -48.144 -47.205 -12.812 1.00 35.38  ? 102  TRP A HE1  1 
ATOM   280   H  HE3  . TRP A 1 23  ? -52.229 -45.470 -10.306 1.00 26.54  ? 102  TRP A HE3  1 
ATOM   281   H  HZ2  . TRP A 1 23  ? -47.997 -47.474 -10.060 1.00 31.19  ? 102  TRP A HZ2  1 
ATOM   282   H  HZ3  . TRP A 1 23  ? -51.299 -46.056 -8.266  1.00 26.78  ? 102  TRP A HZ3  1 
ATOM   283   H  HH2  . TRP A 1 23  ? -49.215 -47.043 -8.151  1.00 26.10  ? 102  TRP A HH2  1 
ATOM   284   N  N    . ILE A 1 24  ? -54.526 -46.456 -11.745 1.00 34.30  ? 103  ILE A N    1 
ATOM   285   C  CA   . ILE A 1 24  ? -55.043 -47.064 -10.519 1.00 36.32  ? 103  ILE A CA   1 
ATOM   286   C  C    . ILE A 1 24  ? -55.720 -48.382 -10.867 1.00 43.44  ? 103  ILE A C    1 
ATOM   287   O  O    . ILE A 1 24  ? -55.626 -49.358 -10.120 1.00 45.14  ? 103  ILE A O    1 
ATOM   288   C  CB   . ILE A 1 24  ? -56.038 -46.139 -9.762  1.00 38.30  ? 103  ILE A CB   1 
ATOM   289   C  CG1  . ILE A 1 24  ? -55.292 -44.923 -9.203  1.00 44.24  ? 103  ILE A CG1  1 
ATOM   290   C  CG2  . ILE A 1 24  ? -56.729 -46.905 -8.621  1.00 38.13  ? 103  ILE A CG2  1 
ATOM   291   C  CD1  . ILE A 1 24  ? -56.149 -43.934 -8.422  1.00 48.22  ? 103  ILE A CD1  1 
ATOM   292   H  H    . ILE A 1 24  ? -54.864 -45.686 -11.927 1.00 41.16  ? 103  ILE A H    1 
ATOM   293   H  HA   . ILE A 1 24  ? -54.301 -47.256 -9.924  1.00 43.58  ? 103  ILE A HA   1 
ATOM   294   H  HB   . ILE A 1 24  ? -56.714 -45.832 -10.386 1.00 45.96  ? 103  ILE A HB   1 
ATOM   295   H  HG12 . ILE A 1 24  ? -54.594 -45.237 -8.607  1.00 53.09  ? 103  ILE A HG12 1 
ATOM   296   H  HG13 . ILE A 1 24  ? -54.893 -44.440 -9.943  1.00 53.09  ? 103  ILE A HG13 1 
ATOM   297   H  HG21 . ILE A 1 24  ? -57.343 -46.307 -8.166  1.00 45.76  ? 103  ILE A HG21 1 
ATOM   298   H  HG22 . ILE A 1 24  ? -57.215 -47.657 -8.995  1.00 45.76  ? 103  ILE A HG22 1 
ATOM   299   H  HG23 . ILE A 1 24  ? -56.055 -47.222 -8.000  1.00 45.76  ? 103  ILE A HG23 1 
ATOM   300   H  HD11 . ILE A 1 24  ? -55.587 -43.206 -8.113  1.00 57.87  ? 103  ILE A HD11 1 
ATOM   301   H  HD12 . ILE A 1 24  ? -56.845 -43.592 -9.004  1.00 57.87  ? 103  ILE A HD12 1 
ATOM   302   H  HD13 . ILE A 1 24  ? -56.545 -44.391 -7.664  1.00 57.87  ? 103  ILE A HD13 1 
ATOM   303   N  N    . GLU A 1 25  ? -56.396 -48.395 -12.011 1.00 50.99  ? 104  GLU A N    1 
ATOM   304   C  CA   . GLU A 1 25  ? -57.025 -49.600 -12.533 1.00 55.24  ? 104  GLU A CA   1 
ATOM   305   C  C    . GLU A 1 25  ? -56.016 -50.739 -12.613 1.00 49.63  ? 104  GLU A C    1 
ATOM   306   O  O    . GLU A 1 25  ? -56.237 -51.815 -12.058 1.00 51.85  ? 104  GLU A O    1 
ATOM   307   C  CB   . GLU A 1 25  ? -57.590 -49.322 -13.924 1.00 63.66  ? 104  GLU A CB   1 
ATOM   308   C  CG   . GLU A 1 25  ? -58.843 -50.094 -14.256 1.00 71.21  ? 104  GLU A CG   1 
ATOM   309   C  CD   . GLU A 1 25  ? -59.501 -49.579 -15.523 1.00 78.60  ? 104  GLU A CD   1 
ATOM   310   O  OE1  . GLU A 1 25  ? -59.095 -50.010 -16.625 1.00 79.96  ? 104  GLU A OE1  1 
ATOM   311   O  OE2  . GLU A 1 25  ? -60.417 -48.734 -15.417 1.00 77.21  ? 104  GLU A OE2  1 
ATOM   312   H  H    . GLU A 1 25  ? -56.506 -47.704 -12.511 1.00 61.19  ? 104  GLU A H    1 
ATOM   313   H  HA   . GLU A 1 25  ? -57.752 -49.868 -11.950 1.00 66.28  ? 104  GLU A HA   1 
ATOM   314   H  HB2  . GLU A 1 25  ? -57.801 -48.377 -13.989 1.00 76.39  ? 104  GLU A HB2  1 
ATOM   315   H  HB3  . GLU A 1 25  ? -56.918 -49.553 -14.584 1.00 76.39  ? 104  GLU A HB3  1 
ATOM   316   H  HG2  . GLU A 1 25  ? -58.616 -51.027 -14.390 1.00 85.45  ? 104  GLU A HG2  1 
ATOM   317   H  HG3  . GLU A 1 25  ? -59.477 -50.004 -13.528 1.00 85.45  ? 104  GLU A HG3  1 
ATOM   318   N  N    . SER A 1 26  ? -54.903 -50.486 -13.295 1.00 41.26  ? 105  SER A N    1 
ATOM   319   C  CA   . SER A 1 26  ? -53.866 -51.494 -13.493 1.00 42.23  ? 105  SER A CA   1 
ATOM   320   C  C    . SER A 1 26  ? -53.137 -51.864 -12.205 1.00 43.64  ? 105  SER A C    1 
ATOM   321   O  O    . SER A 1 26  ? -52.684 -52.996 -12.048 1.00 49.43  ? 105  SER A O    1 
ATOM   322   C  CB   . SER A 1 26  ? -52.850 -51.005 -14.525 1.00 43.54  ? 105  SER A CB   1 
ATOM   323   O  OG   . SER A 1 26  ? -52.429 -49.687 -14.233 1.00 44.72  ? 105  SER A OG   1 
ATOM   324   H  H    . SER A 1 26  ? -54.723 -49.728 -13.659 1.00 49.52  ? 105  SER A H    1 
ATOM   325   H  HA   . SER A 1 26  ? -54.277 -52.300 -13.842 1.00 50.67  ? 105  SER A HA   1 
ATOM   326   H  HB2  . SER A 1 26  ? -52.079 -51.593 -14.512 1.00 52.24  ? 105  SER A HB2  1 
ATOM   327   H  HB3  . SER A 1 26  ? -53.262 -51.017 -15.404 1.00 52.24  ? 105  SER A HB3  1 
ATOM   328   H  HG   . SER A 1 26  ? -52.070 -49.662 -13.474 1.00 53.67  ? 105  SER A HG   1 
ATOM   329   N  N    . TYR A 1 27  ? -53.003 -50.909 -11.292 1.00 38.41  ? 106  TYR A N    1 
ATOM   330   C  CA   . TYR A 1 27  ? -52.335 -51.172 -10.021 1.00 37.12  ? 106  TYR A CA   1 
ATOM   331   C  C    . TYR A 1 27  ? -53.118 -52.197 -9.200  1.00 43.98  ? 106  TYR A C    1 
ATOM   332   O  O    . TYR A 1 27  ? -52.542 -52.975 -8.439  1.00 45.55  ? 106  TYR A O    1 
ATOM   333   C  CB   . TYR A 1 27  ? -52.166 -49.877 -9.226  1.00 31.61  ? 106  TYR A CB   1 
ATOM   334   C  CG   . TYR A 1 27  ? -51.470 -50.066 -7.899  1.00 22.74  ? 106  TYR A CG   1 
ATOM   335   C  CD1  . TYR A 1 27  ? -50.095 -50.253 -7.836  1.00 23.03  ? 106  TYR A CD1  1 
ATOM   336   C  CD2  . TYR A 1 27  ? -52.183 -50.049 -6.710  1.00 21.79  ? 106  TYR A CD2  1 
ATOM   337   C  CE1  . TYR A 1 27  ? -49.454 -50.426 -6.628  1.00 21.59  ? 106  TYR A CE1  1 
ATOM   338   C  CE2  . TYR A 1 27  ? -51.551 -50.225 -5.497  1.00 24.92  ? 106  TYR A CE2  1 
ATOM   339   C  CZ   . TYR A 1 27  ? -50.186 -50.414 -5.462  1.00 24.26  ? 106  TYR A CZ   1 
ATOM   340   O  OH   . TYR A 1 27  ? -49.554 -50.580 -4.255  1.00 24.61  ? 106  TYR A OH   1 
ATOM   341   H  H    . TYR A 1 27  ? -53.289 -50.103 -11.382 1.00 46.09  ? 106  TYR A H    1 
ATOM   342   H  HA   . TYR A 1 27  ? -51.453 -51.536 -10.196 1.00 44.54  ? 106  TYR A HA   1 
ATOM   343   H  HB2  . TYR A 1 27  ? -51.640 -49.254 -9.751  1.00 37.93  ? 106  TYR A HB2  1 
ATOM   344   H  HB3  . TYR A 1 27  ? -53.042 -49.501 -9.050  1.00 37.93  ? 106  TYR A HB3  1 
ATOM   345   H  HD1  . TYR A 1 27  ? -49.599 -50.266 -8.622  1.00 27.64  ? 106  TYR A HD1  1 
ATOM   346   H  HD2  . TYR A 1 27  ? -53.105 -49.927 -6.732  1.00 26.15  ? 106  TYR A HD2  1 
ATOM   347   H  HE1  . TYR A 1 27  ? -48.533 -50.552 -6.601  1.00 25.91  ? 106  TYR A HE1  1 
ATOM   348   H  HE2  . TYR A 1 27  ? -52.042 -50.214 -4.707  1.00 29.90  ? 106  TYR A HE2  1 
ATOM   349   H  HH   . TYR A 1 27  ? -50.115 -50.552 -3.630  1.00 29.54  ? 106  TYR A HH   1 
ATOM   350   N  N    . LYS A 1 28  ? -54.437 -52.191 -9.352  1.00 50.29  ? 107  LYS A N    1 
ATOM   351   C  CA   . LYS A 1 28  ? -55.278 -53.176 -8.684  1.00 51.77  ? 107  LYS A CA   1 
ATOM   352   C  C    . LYS A 1 28  ? -55.106 -54.552 -9.321  1.00 54.63  ? 107  LYS A C    1 
ATOM   353   O  O    . LYS A 1 28  ? -55.012 -55.562 -8.623  1.00 54.03  ? 107  LYS A O    1 
ATOM   354   C  CB   . LYS A 1 28  ? -56.745 -52.746 -8.730  1.00 41.34  ? 107  LYS A CB   1 
ATOM   355   C  CG   . LYS A 1 28  ? -57.053 -51.551 -7.840  1.00 36.75  ? 107  LYS A CG   1 
ATOM   356   C  CD   . LYS A 1 28  ? -58.358 -50.874 -8.241  1.00 42.35  ? 107  LYS A CD   1 
ATOM   357   C  CE   . LYS A 1 28  ? -58.728 -49.724 -7.304  1.00 44.30  ? 107  LYS A CE   1 
ATOM   358   N  NZ   . LYS A 1 28  ? -59.914 -48.948 -7.788  1.00 42.23  ? 107  LYS A NZ   1 
ATOM   359   H  H    . LYS A 1 28  ? -54.870 -51.627 -9.837  1.00 60.35  ? 107  LYS A H    1 
ATOM   360   H  HA   . LYS A 1 28  ? -55.012 -53.240 -7.753  1.00 62.13  ? 107  LYS A HA   1 
ATOM   361   H  HB2  . LYS A 1 28  ? -56.973 -52.505 -9.641  1.00 49.61  ? 107  LYS A HB2  1 
ATOM   362   H  HB3  . LYS A 1 28  ? -57.298 -53.487 -8.436  1.00 49.61  ? 107  LYS A HB3  1 
ATOM   363   H  HG2  . LYS A 1 28  ? -57.136 -51.849 -6.921  1.00 44.10  ? 107  LYS A HG2  1 
ATOM   364   H  HG3  . LYS A 1 28  ? -56.338 -50.901 -7.918  1.00 44.10  ? 107  LYS A HG3  1 
ATOM   365   H  HD2  . LYS A 1 28  ? -58.267 -50.516 -9.138  1.00 50.82  ? 107  LYS A HD2  1 
ATOM   366   H  HD3  . LYS A 1 28  ? -59.075 -51.527 -8.215  1.00 50.82  ? 107  LYS A HD3  1 
ATOM   367   H  HE2  . LYS A 1 28  ? -58.941 -50.085 -6.429  1.00 53.17  ? 107  LYS A HE2  1 
ATOM   368   H  HE3  . LYS A 1 28  ? -57.976 -49.115 -7.239  1.00 53.17  ? 107  LYS A HE3  1 
ATOM   369   H  HZ1  . LYS A 1 28  ? -60.099 -48.289 -7.219  1.00 50.68  ? 107  LYS A HZ1  1 
ATOM   370   H  HZ2  . LYS A 1 28  ? -59.743 -48.599 -8.589  1.00 50.68  ? 107  LYS A HZ2  1 
ATOM   371   H  HZ3  . LYS A 1 28  ? -60.622 -49.483 -7.851  1.00 50.68  ? 107  LYS A HZ3  1 
ATOM   372   N  N    . HIS A 1 29  ? -55.056 -54.581 -10.647 1.00 67.79  ? 108  HIS A N    1 
ATOM   373   C  CA   . HIS A 1 29  ? -54.840 -55.819 -11.380 1.00 70.18  ? 108  HIS A CA   1 
ATOM   374   C  C    . HIS A 1 29  ? -53.502 -56.443 -10.986 1.00 68.54  ? 108  HIS A C    1 
ATOM   375   O  O    . HIS A 1 29  ? -53.449 -57.557 -10.468 1.00 76.35  ? 108  HIS A O    1 
ATOM   376   C  CB   . HIS A 1 29  ? -54.869 -55.531 -12.879 1.00 75.74  ? 108  HIS A CB   1 
ATOM   377   C  CG   . HIS A 1 29  ? -54.713 -56.749 -13.732 1.00 86.99  ? 108  HIS A CG   1 
ATOM   378   N  ND1  . HIS A 1 29  ? -53.499 -57.370 -13.920 1.00 93.07  ? 108  HIS A ND1  1 
ATOM   379   C  CD2  . HIS A 1 29  ? -55.615 -57.456 -14.453 1.00 92.41  ? 108  HIS A CD2  1 
ATOM   380   C  CE1  . HIS A 1 29  ? -53.658 -58.412 -14.718 1.00 98.42  ? 108  HIS A CE1  1 
ATOM   381   N  NE2  . HIS A 1 29  ? -54.933 -58.486 -15.055 1.00 98.16  ? 108  HIS A NE2  1 
ATOM   382   H  H    . HIS A 1 29  ? -55.145 -53.889 -11.150 1.00 81.35  ? 108  HIS A H    1 
ATOM   383   H  HA   . HIS A 1 29  ? -55.549 -56.448 -11.172 1.00 84.22  ? 108  HIS A HA   1 
ATOM   384   H  HB2  . HIS A 1 29  ? -55.719 -55.120 -13.102 1.00 90.89  ? 108  HIS A HB2  1 
ATOM   385   H  HB3  . HIS A 1 29  ? -54.144 -54.923 -13.095 1.00 90.89  ? 108  HIS A HB3  1 
ATOM   386   H  HD1  . HIS A 1 29  ? -52.753 -57.121 -13.571 1.00 111.68 ? 108  HIS A HD1  1 
ATOM   387   H  HD2  . HIS A 1 29  ? -56.525 -57.279 -14.526 1.00 110.89 ? 108  HIS A HD2  1 
ATOM   388   H  HE1  . HIS A 1 29  ? -52.988 -58.994 -14.994 1.00 118.10 ? 108  HIS A HE1  1 
ATOM   389   H  HE2  . HIS A 1 29  ? -55.280 -59.082 -15.568 1.00 117.79 ? 108  HIS A HE2  1 
ATOM   390   N  N    . ASP A 1 30  ? -52.425 -55.707 -11.237 1.00 69.74  ? 109  ASP A N    1 
ATOM   391   C  CA   . ASP A 1 30  ? -51.076 -56.156 -10.915 1.00 69.67  ? 109  ASP A CA   1 
ATOM   392   C  C    . ASP A 1 30  ? -50.261 -54.953 -10.445 1.00 63.48  ? 109  ASP A C    1 
ATOM   393   O  O    . ASP A 1 30  ? -49.836 -54.130 -11.258 1.00 63.13  ? 109  ASP A O    1 
ATOM   394   C  CB   . ASP A 1 30  ? -50.429 -56.799 -12.147 1.00 73.70  ? 109  ASP A CB   1 
ATOM   395   C  CG   . ASP A 1 30  ? -49.190 -57.615 -11.809 1.00 78.63  ? 109  ASP A CG   1 
ATOM   396   O  OD1  . ASP A 1 30  ? -48.529 -57.325 -10.787 1.00 81.62  ? 109  ASP A OD1  1 
ATOM   397   O  OD2  . ASP A 1 30  ? -48.877 -58.555 -12.575 1.00 73.98  ? 109  ASP A OD2  1 
ATOM   398   H  H    . ASP A 1 30  ? -52.450 -54.928 -11.601 1.00 83.69  ? 109  ASP A H    1 
ATOM   399   H  HA   . ASP A 1 30  ? -51.108 -56.810 -10.200 1.00 83.60  ? 109  ASP A HA   1 
ATOM   400   H  HB2  . ASP A 1 30  ? -51.072 -57.392 -12.567 1.00 88.45  ? 109  ASP A HB2  1 
ATOM   401   H  HB3  . ASP A 1 30  ? -50.168 -56.101 -12.767 1.00 88.45  ? 109  ASP A HB3  1 
ATOM   402   N  N    . ARG A 1 31  ? -50.080 -54.849 -9.129  1.00 55.96  ? 110  ARG A N    1 
ATOM   403   C  CA   . ARG A 1 31  ? -49.271 -53.796 -8.521  1.00 47.26  ? 110  ARG A CA   1 
ATOM   404   C  C    . ARG A 1 31  ? -47.936 -53.631 -9.226  1.00 51.39  ? 110  ARG A C    1 
ATOM   405   O  O    . ARG A 1 31  ? -47.516 -52.517 -9.540  1.00 56.61  ? 110  ARG A O    1 
ATOM   406   C  CB   . ARG A 1 31  ? -48.947 -54.148 -7.073  1.00 44.62  ? 110  ARG A CB   1 
ATOM   407   C  CG   . ARG A 1 31  ? -50.049 -53.978 -6.053  1.00 48.67  ? 110  ARG A CG   1 
ATOM   408   C  CD   . ARG A 1 31  ? -49.647 -54.762 -4.805  1.00 56.10  ? 110  ARG A CD   1 
ATOM   409   N  NE   . ARG A 1 31  ? -50.061 -54.157 -3.540  1.00 56.92  ? 110  ARG A NE   1 
ATOM   410   C  CZ   . ARG A 1 31  ? -49.542 -54.485 -2.358  1.00 58.64  ? 110  ARG A CZ   1 
ATOM   411   N  NH1  . ARG A 1 31  ? -48.588 -55.408 -2.276  1.00 58.05  ? 110  ARG A NH1  1 
ATOM   412   N  NH2  . ARG A 1 31  ? -49.970 -53.891 -1.251  1.00 54.11  ? 110  ARG A NH2  1 
ATOM   413   H  H    . ARG A 1 31  ? -50.424 -55.390 -8.556  1.00 67.15  ? 110  ARG A H    1 
ATOM   414   H  HA   . ARG A 1 31  ? -49.749 -52.953 -8.544  1.00 56.72  ? 110  ARG A HA   1 
ATOM   415   H  HB2  . ARG A 1 31  ? -48.675 -55.079 -7.044  1.00 53.54  ? 110  ARG A HB2  1 
ATOM   416   H  HB3  . ARG A 1 31  ? -48.207 -53.591 -6.787  1.00 53.54  ? 110  ARG A HB3  1 
ATOM   417   H  HG2  . ARG A 1 31  ? -50.144 -53.041 -5.820  1.00 58.40  ? 110  ARG A HG2  1 
ATOM   418   H  HG3  . ARG A 1 31  ? -50.880 -54.338 -6.399  1.00 58.40  ? 110  ARG A HG3  1 
ATOM   419   H  HD2  . ARG A 1 31  ? -50.047 -55.645 -4.852  1.00 67.32  ? 110  ARG A HD2  1 
ATOM   420   H  HD3  . ARG A 1 31  ? -48.680 -54.843 -4.789  1.00 67.32  ? 110  ARG A HD3  1 
ATOM   421   H  HE   . ARG A 1 31  ? -50.743 -53.633 -3.549  1.00 68.30  ? 110  ARG A HE   1 
ATOM   422   H  HH11 . ARG A 1 31  ? -48.304 -55.798 -2.988  1.00 69.66  ? 110  ARG A HH11 1 
ATOM   423   H  HH12 . ARG A 1 31  ? -48.255 -55.616 -1.511  1.00 69.66  ? 110  ARG A HH12 1 
ATOM   424   H  HH21 . ARG A 1 31  ? -50.586 -53.293 -1.294  1.00 64.93  ? 110  ARG A HH21 1 
ATOM   425   H  HH22 . ARG A 1 31  ? -49.632 -54.105 -0.490  1.00 64.93  ? 110  ARG A HH22 1 
ATOM   426   N  N    . ASP A 1 32  ? -47.263 -54.755 -9.451  1.00 50.71  ? 111  ASP A N    1 
ATOM   427   C  CA   . ASP A 1 32  ? -45.858 -54.745 -9.841  1.00 45.81  ? 111  ASP A CA   1 
ATOM   428   C  C    . ASP A 1 32  ? -45.597 -54.233 -11.252 1.00 49.87  ? 111  ASP A C    1 
ATOM   429   O  O    . ASP A 1 32  ? -44.643 -53.484 -11.462 1.00 52.32  ? 111  ASP A O    1 
ATOM   430   C  CB   . ASP A 1 32  ? -45.252 -56.139 -9.656  1.00 55.35  ? 111  ASP A CB   1 
ATOM   431   C  CG   . ASP A 1 32  ? -44.741 -56.374 -8.240  1.00 62.29  ? 111  ASP A CG   1 
ATOM   432   O  OD1  . ASP A 1 32  ? -44.557 -55.387 -7.493  1.00 56.58  ? 111  ASP A OD1  1 
ATOM   433   O  OD2  . ASP A 1 32  ? -44.511 -57.549 -7.875  1.00 63.27  ? 111  ASP A OD2  1 
ATOM   434   H  H    . ASP A 1 32  ? -47.601 -55.543 -9.385  1.00 60.86  ? 111  ASP A H    1 
ATOM   435   H  HA   . ASP A 1 32  ? -45.388 -54.151 -9.236  1.00 54.98  ? 111  ASP A HA   1 
ATOM   436   H  HB2  . ASP A 1 32  ? -45.929 -56.807 -9.846  1.00 66.42  ? 111  ASP A HB2  1 
ATOM   437   H  HB3  . ASP A 1 32  ? -44.504 -56.242 -10.266 1.00 66.42  ? 111  ASP A HB3  1 
ATOM   438   N  N    . ILE A 1 33  ? -46.422 -54.621 -12.219 1.00 46.19  ? 112  ILE A N    1 
ATOM   439   C  CA   . ILE A 1 33  ? -46.236 -54.107 -13.570 1.00 49.46  ? 112  ILE A CA   1 
ATOM   440   C  C    . ILE A 1 33  ? -46.551 -52.607 -13.590 1.00 49.65  ? 112  ILE A C    1 
ATOM   441   O  O    . ILE A 1 33  ? -45.907 -51.837 -14.303 1.00 49.80  ? 112  ILE A O    1 
ATOM   442   C  CB   . ILE A 1 33  ? -47.082 -54.869 -14.628 1.00 52.72  ? 112  ILE A CB   1 
ATOM   443   C  CG1  . ILE A 1 33  ? -48.563 -54.489 -14.546 1.00 62.97  ? 112  ILE A CG1  1 
ATOM   444   C  CG2  . ILE A 1 33  ? -46.896 -56.385 -14.491 1.00 56.14  ? 112  ILE A CG2  1 
ATOM   445   C  CD1  . ILE A 1 33  ? -48.971 -53.404 -15.533 1.00 67.27  ? 112  ILE A CD1  1 
ATOM   446   H  H    . ILE A 1 33  ? -47.080 -55.167 -12.123 1.00 55.43  ? 112  ILE A H    1 
ATOM   447   H  HA   . ILE A 1 33  ? -45.303 -54.212 -13.813 1.00 59.36  ? 112  ILE A HA   1 
ATOM   448   H  HB   . ILE A 1 33  ? -46.759 -54.611 -15.505 1.00 63.26  ? 112  ILE A HB   1 
ATOM   449   H  HG12 . ILE A 1 33  ? -49.098 -55.276 -14.731 1.00 75.57  ? 112  ILE A HG12 1 
ATOM   450   H  HG13 . ILE A 1 33  ? -48.753 -54.164 -13.652 1.00 75.57  ? 112  ILE A HG13 1 
ATOM   451   H  HG21 . ILE A 1 33  ? -47.435 -56.831 -15.162 1.00 67.37  ? 112  ILE A HG21 1 
ATOM   452   H  HG22 . ILE A 1 33  ? -45.959 -56.600 -14.621 1.00 67.37  ? 112  ILE A HG22 1 
ATOM   453   H  HG23 . ILE A 1 33  ? -47.179 -56.658 -13.604 1.00 67.37  ? 112  ILE A HG23 1 
ATOM   454   H  HD11 . ILE A 1 33  ? -49.916 -53.217 -15.423 1.00 80.72  ? 112  ILE A HD11 1 
ATOM   455   H  HD12 . ILE A 1 33  ? -48.452 -52.604 -15.354 1.00 80.72  ? 112  ILE A HD12 1 
ATOM   456   H  HD13 . ILE A 1 33  ? -48.798 -53.716 -16.434 1.00 80.72  ? 112  ILE A HD13 1 
ATOM   457   N  N    . ALA A 1 34  ? -47.522 -52.200 -12.778 1.00 38.75  ? 113  ALA A N    1 
ATOM   458   C  CA   . ALA A 1 34  ? -47.961 -50.808 -12.733 1.00 37.56  ? 113  ALA A CA   1 
ATOM   459   C  C    . ALA A 1 34  ? -46.937 -49.912 -12.048 1.00 30.13  ? 113  ALA A C    1 
ATOM   460   O  O    . ALA A 1 34  ? -46.673 -48.803 -12.512 1.00 26.85  ? 113  ALA A O    1 
ATOM   461   C  CB   . ALA A 1 34  ? -49.303 -50.701 -12.029 1.00 39.18  ? 113  ALA A CB   1 
ATOM   462   H  H    . ALA A 1 34  ? -47.947 -52.716 -12.237 1.00 46.51  ? 113  ALA A H    1 
ATOM   463   H  HA   . ALA A 1 34  ? -48.075 -50.487 -13.641 1.00 45.07  ? 113  ALA A HA   1 
ATOM   464   H  HB1  . ALA A 1 34  ? -49.576 -49.770 -12.011 1.00 47.02  ? 113  ALA A HB1  1 
ATOM   465   H  HB2  . ALA A 1 34  ? -49.957 -51.228 -12.515 1.00 47.02  ? 113  ALA A HB2  1 
ATOM   466   H  HB3  . ALA A 1 34  ? -49.213 -51.038 -11.124 1.00 47.02  ? 113  ALA A HB3  1 
ATOM   467   N  N    . LEU A 1 35  ? -46.366 -50.373 -10.940 1.00 32.89  ? 114  LEU A N    1 
ATOM   468   C  CA   . LEU A 1 35  ? -45.345 -49.577 -10.268 1.00 32.53  ? 114  LEU A CA   1 
ATOM   469   C  C    . LEU A 1 35  ? -44.140 -49.401 -11.184 1.00 33.12  ? 114  LEU A C    1 
ATOM   470   O  O    . LEU A 1 35  ? -43.557 -48.325 -11.241 1.00 28.10  ? 114  LEU A O    1 
ATOM   471   C  CB   . LEU A 1 35  ? -44.906 -50.198 -8.940  1.00 22.72  ? 114  LEU A CB   1 
ATOM   472   C  CG   . LEU A 1 35  ? -45.666 -49.795 -7.670  1.00 31.37  ? 114  LEU A CG   1 
ATOM   473   C  CD1  . LEU A 1 35  ? -44.897 -50.283 -6.455  1.00 38.17  ? 114  LEU A CD1  1 
ATOM   474   C  CD2  . LEU A 1 35  ? -45.910 -48.289 -7.555  1.00 31.28  ? 114  LEU A CD2  1 
ATOM   475   H  H    . LEU A 1 35  ? -46.546 -51.126 -10.564 1.00 39.47  ? 114  LEU A H    1 
ATOM   476   H  HA   . LEU A 1 35  ? -45.707 -48.698 -10.080 1.00 39.03  ? 114  LEU A HA   1 
ATOM   477   H  HB2  . LEU A 1 35  ? -44.983 -51.161 -9.021  1.00 27.26  ? 114  LEU A HB2  1 
ATOM   478   H  HB3  . LEU A 1 35  ? -43.975 -49.966 -8.796  1.00 27.26  ? 114  LEU A HB3  1 
ATOM   479   H  HG   . LEU A 1 35  ? -46.530 -50.236 -7.671  1.00 37.64  ? 114  LEU A HG   1 
ATOM   480   H  HD11 . LEU A 1 35  ? -45.379 -50.027 -5.653  1.00 45.81  ? 114  LEU A HD11 1 
ATOM   481   H  HD12 . LEU A 1 35  ? -44.817 -51.249 -6.499  1.00 45.81  ? 114  LEU A HD12 1 
ATOM   482   H  HD13 . LEU A 1 35  ? -44.016 -49.877 -6.455  1.00 45.81  ? 114  LEU A HD13 1 
ATOM   483   H  HD21 . LEU A 1 35  ? -46.392 -48.110 -6.733  1.00 37.53  ? 114  LEU A HD21 1 
ATOM   484   H  HD22 . LEU A 1 35  ? -45.055 -47.831 -7.544  1.00 37.53  ? 114  LEU A HD22 1 
ATOM   485   H  HD23 . LEU A 1 35  ? -46.434 -47.995 -8.317  1.00 37.53  ? 114  LEU A HD23 1 
ATOM   486   N  N    . LEU A 1 36  ? -43.781 -50.451 -11.916 1.00 37.41  ? 115  LEU A N    1 
ATOM   487   C  CA   . LEU A 1 36  ? -42.671 -50.360 -12.854 1.00 30.00  ? 115  LEU A CA   1 
ATOM   488   C  C    . LEU A 1 36  ? -42.979 -49.316 -13.915 1.00 28.42  ? 115  LEU A C    1 
ATOM   489   O  O    . LEU A 1 36  ? -42.108 -48.542 -14.309 1.00 39.93  ? 115  LEU A O    1 
ATOM   490   C  CB   . LEU A 1 36  ? -42.402 -51.709 -13.519 1.00 38.21  ? 115  LEU A CB   1 
ATOM   491   C  CG   . LEU A 1 36  ? -41.295 -51.699 -14.580 1.00 39.01  ? 115  LEU A CG   1 
ATOM   492   C  CD1  . LEU A 1 36  ? -39.984 -51.178 -13.997 1.00 32.42  ? 115  LEU A CD1  1 
ATOM   493   C  CD2  . LEU A 1 36  ? -41.104 -53.084 -15.187 1.00 40.93  ? 115  LEU A CD2  1 
ATOM   494   H  H    . LEU A 1 36  ? -44.162 -51.222 -11.888 1.00 44.89  ? 115  LEU A H    1 
ATOM   495   H  HA   . LEU A 1 36  ? -41.870 -50.088 -12.379 1.00 36.00  ? 115  LEU A HA   1 
ATOM   496   H  HB2  . LEU A 1 36  ? -42.145 -52.345 -12.834 1.00 45.85  ? 115  LEU A HB2  1 
ATOM   497   H  HB3  . LEU A 1 36  ? -43.218 -52.008 -13.951 1.00 45.85  ? 115  LEU A HB3  1 
ATOM   498   H  HG   . LEU A 1 36  ? -41.557 -51.099 -15.295 1.00 46.81  ? 115  LEU A HG   1 
ATOM   499   H  HD11 . LEU A 1 36  ? -39.306 -51.185 -14.691 1.00 38.90  ? 115  LEU A HD11 1 
ATOM   500   H  HD12 . LEU A 1 36  ? -40.120 -50.273 -13.675 1.00 38.90  ? 115  LEU A HD12 1 
ATOM   501   H  HD13 . LEU A 1 36  ? -39.714 -51.754 -13.264 1.00 38.90  ? 115  LEU A HD13 1 
ATOM   502   H  HD21 . LEU A 1 36  ? -40.399 -53.042 -15.852 1.00 49.12  ? 115  LEU A HD21 1 
ATOM   503   H  HD22 . LEU A 1 36  ? -40.860 -53.706 -14.484 1.00 49.12  ? 115  LEU A HD22 1 
ATOM   504   H  HD23 . LEU A 1 36  ? -41.935 -53.363 -15.603 1.00 49.12  ? 115  LEU A HD23 1 
ATOM   505   N  N    . ASP A 1 37  ? -44.227 -49.297 -14.374 1.00 40.09  ? 116  ASP A N    1 
ATOM   506   C  CA   . ASP A 1 37  ? -44.668 -48.292 -15.334 1.00 42.88  ? 116  ASP A CA   1 
ATOM   507   C  C    . ASP A 1 37  ? -44.553 -46.898 -14.724 1.00 38.71  ? 116  ASP A C    1 
ATOM   508   O  O    . ASP A 1 37  ? -44.333 -45.916 -15.432 1.00 44.49  ? 116  ASP A O    1 
ATOM   509   C  CB   . ASP A 1 37  ? -46.108 -48.559 -15.787 1.00 44.88  ? 116  ASP A CB   1 
ATOM   510   C  CG   . ASP A 1 37  ? -46.198 -49.646 -16.850 1.00 59.45  ? 116  ASP A CG   1 
ATOM   511   O  OD1  . ASP A 1 37  ? -45.437 -50.636 -16.769 1.00 63.18  ? 116  ASP A OD1  1 
ATOM   512   O  OD2  . ASP A 1 37  ? -47.033 -49.508 -17.772 1.00 62.52  ? 116  ASP A OD2  1 
ATOM   513   H  H    . ASP A 1 37  ? -44.838 -49.856 -14.144 1.00 48.10  ? 116  ASP A H    1 
ATOM   514   H  HA   . ASP A 1 37  ? -44.095 -48.327 -16.116 1.00 51.45  ? 116  ASP A HA   1 
ATOM   515   H  HB2  . ASP A 1 37  ? -46.633 -48.844 -15.022 1.00 53.86  ? 116  ASP A HB2  1 
ATOM   516   H  HB3  . ASP A 1 37  ? -46.480 -47.744 -16.159 1.00 53.86  ? 116  ASP A HB3  1 
ATOM   517   N  N    . LEU A 1 38  ? -44.691 -46.824 -13.404 1.00 31.31  ? 117  LEU A N    1 
ATOM   518   C  CA   . LEU A 1 38  ? -44.575 -45.558 -12.691 1.00 24.63  ? 117  LEU A CA   1 
ATOM   519   C  C    . LEU A 1 38  ? -43.111 -45.153 -12.520 1.00 30.64  ? 117  LEU A C    1 
ATOM   520   O  O    . LEU A 1 38  ? -42.770 -43.986 -12.715 1.00 32.85  ? 117  LEU A O    1 
ATOM   521   C  CB   . LEU A 1 38  ? -45.261 -45.652 -11.328 1.00 25.60  ? 117  LEU A CB   1 
ATOM   522   C  CG   . LEU A 1 38  ? -45.409 -44.372 -10.504 1.00 17.67  ? 117  LEU A CG   1 
ATOM   523   C  CD1  . LEU A 1 38  ? -46.194 -43.322 -11.252 1.00 24.03  ? 117  LEU A CD1  1 
ATOM   524   C  CD2  . LEU A 1 38  ? -46.101 -44.696 -9.191  1.00 17.44  ? 117  LEU A CD2  1 
ATOM   525   H  H    . LEU A 1 38  ? -44.855 -47.498 -12.895 1.00 37.57  ? 117  LEU A H    1 
ATOM   526   H  HA   . LEU A 1 38  ? -45.019 -44.865 -13.204 1.00 29.55  ? 117  LEU A HA   1 
ATOM   527   H  HB2  . LEU A 1 38  ? -46.156 -46.001 -11.469 1.00 30.72  ? 117  LEU A HB2  1 
ATOM   528   H  HB3  . LEU A 1 38  ? -44.760 -46.280 -10.785 1.00 30.72  ? 117  LEU A HB3  1 
ATOM   529   H  HG   . LEU A 1 38  ? -44.530 -44.014 -10.306 1.00 21.21  ? 117  LEU A HG   1 
ATOM   530   H  HD11 . LEU A 1 38  ? -46.266 -42.528 -10.699 1.00 28.84  ? 117  LEU A HD11 1 
ATOM   531   H  HD12 . LEU A 1 38  ? -45.730 -43.110 -12.077 1.00 28.84  ? 117  LEU A HD12 1 
ATOM   532   H  HD13 . LEU A 1 38  ? -47.078 -43.669 -11.449 1.00 28.84  ? 117  LEU A HD13 1 
ATOM   533   H  HD21 . LEU A 1 38  ? -46.191 -43.880 -8.674  1.00 20.93  ? 117  LEU A HD21 1 
ATOM   534   H  HD22 . LEU A 1 38  ? -46.977 -45.068 -9.380  1.00 20.93  ? 117  LEU A HD22 1 
ATOM   535   H  HD23 . LEU A 1 38  ? -45.565 -45.340 -8.703  1.00 20.93  ? 117  LEU A HD23 1 
ATOM   536   N  N    . ILE A 1 39  ? -42.259 -46.109 -12.141 1.00 28.66  ? 118  ILE A N    1 
ATOM   537   C  CA   . ILE A 1 39  ? -40.819 -45.863 -12.050 1.00 21.59  ? 118  ILE A CA   1 
ATOM   538   C  C    . ILE A 1 39  ? -40.331 -45.211 -13.337 1.00 29.00  ? 118  ILE A C    1 
ATOM   539   O  O    . ILE A 1 39  ? -39.760 -44.120 -13.319 1.00 32.15  ? 118  ILE A O    1 
ATOM   540   C  CB   . ILE A 1 39  ? -39.996 -47.169 -11.872 1.00 29.32  ? 118  ILE A CB   1 
ATOM   541   C  CG1  . ILE A 1 39  ? -40.376 -47.932 -10.601 1.00 30.83  ? 118  ILE A CG1  1 
ATOM   542   C  CG2  . ILE A 1 39  ? -38.496 -46.868 -11.830 1.00 35.70  ? 118  ILE A CG2  1 
ATOM   543   C  CD1  . ILE A 1 39  ? -40.337 -47.120 -9.338  1.00 32.00  ? 118  ILE A CD1  1 
ATOM   544   H  H    . ILE A 1 39  ? -42.491 -46.911 -11.932 1.00 34.39  ? 118  ILE A H    1 
ATOM   545   H  HA   . ILE A 1 39  ? -40.632 -45.269 -11.306 1.00 25.91  ? 118  ILE A HA   1 
ATOM   546   H  HB   . ILE A 1 39  ? -40.169 -47.743 -12.634 1.00 35.18  ? 118  ILE A HB   1 
ATOM   547   H  HG12 . ILE A 1 39  ? -41.279 -48.272 -10.703 1.00 36.99  ? 118  ILE A HG12 1 
ATOM   548   H  HG13 . ILE A 1 39  ? -39.760 -48.674 -10.490 1.00 36.99  ? 118  ILE A HG13 1 
ATOM   549   H  HG21 . ILE A 1 39  ? -38.011 -47.701 -11.718 1.00 42.84  ? 118  ILE A HG21 1 
ATOM   550   H  HG22 . ILE A 1 39  ? -38.237 -46.442 -12.662 1.00 42.84  ? 118  ILE A HG22 1 
ATOM   551   H  HG23 . ILE A 1 39  ? -38.314 -46.276 -11.084 1.00 42.84  ? 118  ILE A HG23 1 
ATOM   552   H  HD11 . ILE A 1 39  ? -40.592 -47.685 -8.592  1.00 38.39  ? 118  ILE A HD11 1 
ATOM   553   H  HD12 . ILE A 1 39  ? -39.437 -46.783 -9.207  1.00 38.39  ? 118  ILE A HD12 1 
ATOM   554   H  HD13 . ILE A 1 39  ? -40.959 -46.380 -9.420  1.00 38.39  ? 118  ILE A HD13 1 
ATOM   555   N  N    . ASN A 1 40  ? -40.562 -45.899 -14.452 1.00 29.72  ? 119  ASN A N    1 
ATOM   556   C  CA   . ASN A 1 40  ? -40.075 -45.459 -15.753 1.00 31.04  ? 119  ASN A CA   1 
ATOM   557   C  C    . ASN A 1 40  ? -40.563 -44.068 -16.134 1.00 31.07  ? 119  ASN A C    1 
ATOM   558   O  O    . ASN A 1 40  ? -39.816 -43.290 -16.732 1.00 32.04  ? 119  ASN A O    1 
ATOM   559   C  CB   . ASN A 1 40  ? -40.481 -46.462 -16.833 1.00 29.03  ? 119  ASN A CB   1 
ATOM   560   C  CG   . ASN A 1 40  ? -39.558 -47.663 -16.889 1.00 34.56  ? 119  ASN A CG   1 
ATOM   561   O  OD1  . ASN A 1 40  ? -38.531 -47.639 -17.566 1.00 41.35  ? 119  ASN A OD1  1 
ATOM   562   N  ND2  . ASN A 1 40  ? -39.925 -48.726 -16.182 1.00 43.90  ? 119  ASN A ND2  1 
ATOM   563   H  H    . ASN A 1 40  ? -41.006 -46.635 -14.480 1.00 35.67  ? 119  ASN A H    1 
ATOM   564   H  HA   . ASN A 1 40  ? -39.106 -45.432 -15.727 1.00 37.25  ? 119  ASN A HA   1 
ATOM   565   H  HB2  . ASN A 1 40  ? -41.378 -46.780 -16.648 1.00 34.84  ? 119  ASN A HB2  1 
ATOM   566   H  HB3  . ASN A 1 40  ? -40.456 -46.023 -17.698 1.00 34.84  ? 119  ASN A HB3  1 
ATOM   567   H  HD21 . ASN A 1 40  ? -39.434 -49.432 -16.182 1.00 52.68  ? 119  ASN A HD21 1 
ATOM   568   H  HD22 . ASN A 1 40  ? -40.653 -48.708 -15.725 1.00 52.68  ? 119  ASN A HD22 1 
ATOM   569   N  N    . PHE A 1 41  ? -41.813 -43.762 -15.795 1.00 33.03  ? 120  PHE A N    1 
ATOM   570   C  CA   . PHE A 1 41  ? -42.370 -42.442 -16.060 1.00 29.29  ? 120  PHE A CA   1 
ATOM   571   C  C    . PHE A 1 41  ? -41.477 -41.350 -15.479 1.00 30.75  ? 120  PHE A C    1 
ATOM   572   O  O    . PHE A 1 41  ? -41.092 -40.420 -16.184 1.00 32.31  ? 120  PHE A O    1 
ATOM   573   C  CB   . PHE A 1 41  ? -43.788 -42.326 -15.492 1.00 24.95  ? 120  PHE A CB   1 
ATOM   574   C  CG   . PHE A 1 41  ? -44.322 -40.924 -15.486 1.00 20.01  ? 120  PHE A CG   1 
ATOM   575   C  CD1  . PHE A 1 41  ? -44.766 -40.333 -16.656 1.00 23.13  ? 120  PHE A CD1  1 
ATOM   576   C  CD2  . PHE A 1 41  ? -44.373 -40.195 -14.313 1.00 26.03  ? 120  PHE A CD2  1 
ATOM   577   C  CE1  . PHE A 1 41  ? -45.252 -39.042 -16.655 1.00 28.56  ? 120  PHE A CE1  1 
ATOM   578   C  CE2  . PHE A 1 41  ? -44.858 -38.903 -14.306 1.00 30.17  ? 120  PHE A CE2  1 
ATOM   579   C  CZ   . PHE A 1 41  ? -45.302 -38.327 -15.478 1.00 27.47  ? 120  PHE A CZ   1 
ATOM   580   H  H    . PHE A 1 41  ? -42.359 -44.304 -15.410 1.00 39.64  ? 120  PHE A H    1 
ATOM   581   H  HA   . PHE A 1 41  ? -42.421 -42.308 -17.019 1.00 35.15  ? 120  PHE A HA   1 
ATOM   582   H  HB2  . PHE A 1 41  ? -44.385 -42.869 -16.029 1.00 29.94  ? 120  PHE A HB2  1 
ATOM   583   H  HB3  . PHE A 1 41  ? -43.785 -42.646 -14.576 1.00 29.94  ? 120  PHE A HB3  1 
ATOM   584   H  HD1  . PHE A 1 41  ? -44.736 -40.812 -17.453 1.00 27.75  ? 120  PHE A HD1  1 
ATOM   585   H  HD2  . PHE A 1 41  ? -44.076 -40.579 -13.520 1.00 31.24  ? 120  PHE A HD2  1 
ATOM   586   H  HE1  . PHE A 1 41  ? -45.550 -38.657 -17.447 1.00 34.27  ? 120  PHE A HE1  1 
ATOM   587   H  HE2  . PHE A 1 41  ? -44.890 -38.422 -13.510 1.00 36.20  ? 120  PHE A HE2  1 
ATOM   588   H  HZ   . PHE A 1 41  ? -45.629 -37.456 -15.475 1.00 32.97  ? 120  PHE A HZ   1 
ATOM   589   N  N    . PHE A 1 42  ? -41.137 -41.475 -14.199 1.00 36.71  ? 121  PHE A N    1 
ATOM   590   C  CA   . PHE A 1 42  ? -40.306 -40.482 -13.528 1.00 30.82  ? 121  PHE A CA   1 
ATOM   591   C  C    . PHE A 1 42  ? -38.922 -40.373 -14.156 1.00 39.23  ? 121  PHE A C    1 
ATOM   592   O  O    . PHE A 1 42  ? -38.381 -39.275 -14.292 1.00 42.60  ? 121  PHE A O    1 
ATOM   593   C  CB   . PHE A 1 42  ? -40.177 -40.813 -12.041 1.00 32.62  ? 121  PHE A CB   1 
ATOM   594   C  CG   . PHE A 1 42  ? -41.379 -40.427 -11.229 1.00 31.41  ? 121  PHE A CG   1 
ATOM   595   C  CD1  . PHE A 1 42  ? -41.933 -39.166 -11.356 1.00 29.79  ? 121  PHE A CD1  1 
ATOM   596   C  CD2  . PHE A 1 42  ? -41.960 -41.321 -10.347 1.00 33.74  ? 121  PHE A CD2  1 
ATOM   597   C  CE1  . PHE A 1 42  ? -43.035 -38.799 -10.621 1.00 29.31  ? 121  PHE A CE1  1 
ATOM   598   C  CE2  . PHE A 1 42  ? -43.071 -40.960 -9.607  1.00 31.79  ? 121  PHE A CE2  1 
ATOM   599   C  CZ   . PHE A 1 42  ? -43.608 -39.694 -9.744  1.00 25.00  ? 121  PHE A CZ   1 
ATOM   600   H  H    . PHE A 1 42  ? -41.377 -42.130 -13.696 1.00 44.05  ? 121  PHE A H    1 
ATOM   601   H  HA   . PHE A 1 42  ? -40.734 -39.615 -13.603 1.00 36.98  ? 121  PHE A HA   1 
ATOM   602   H  HB2  . PHE A 1 42  ? -40.048 -41.770 -11.943 1.00 39.14  ? 121  PHE A HB2  1 
ATOM   603   H  HB3  . PHE A 1 42  ? -39.411 -40.340 -11.680 1.00 39.14  ? 121  PHE A HB3  1 
ATOM   604   H  HD1  . PHE A 1 42  ? -41.552 -38.556 -11.945 1.00 35.75  ? 121  PHE A HD1  1 
ATOM   605   H  HD2  . PHE A 1 42  ? -41.601 -42.174 -10.252 1.00 40.49  ? 121  PHE A HD2  1 
ATOM   606   H  HE1  . PHE A 1 42  ? -43.395 -37.946 -10.716 1.00 35.18  ? 121  PHE A HE1  1 
ATOM   607   H  HE2  . PHE A 1 42  ? -43.455 -41.566 -9.015  1.00 38.14  ? 121  PHE A HE2  1 
ATOM   608   H  HZ   . PHE A 1 42  ? -44.354 -39.447 -9.246  1.00 30.00  ? 121  PHE A HZ   1 
ATOM   609   N  N    . ILE A 1 43  ? -38.347 -41.511 -14.530 1.00 36.19  ? 122  ILE A N    1 
ATOM   610   C  CA   . ILE A 1 43  ? -37.064 -41.513 -15.223 1.00 33.25  ? 122  ILE A CA   1 
ATOM   611   C  C    . ILE A 1 43  ? -37.183 -40.768 -16.545 1.00 36.63  ? 122  ILE A C    1 
ATOM   612   O  O    . ILE A 1 43  ? -36.469 -39.800 -16.794 1.00 44.95  ? 122  ILE A O    1 
ATOM   613   C  CB   . ILE A 1 43  ? -36.597 -42.946 -15.569 1.00 29.83  ? 122  ILE A CB   1 
ATOM   614   C  CG1  . ILE A 1 43  ? -36.264 -43.760 -14.312 1.00 27.04  ? 122  ILE A CG1  1 
ATOM   615   C  CG2  . ILE A 1 43  ? -35.402 -42.909 -16.516 1.00 28.19  ? 122  ILE A CG2  1 
ATOM   616   C  CD1  . ILE A 1 43  ? -35.149 -43.203 -13.480 1.00 29.70  ? 122  ILE A CD1  1 
ATOM   617   H  H    . ILE A 1 43  ? -38.677 -42.293 -14.396 1.00 43.42  ? 122  ILE A H    1 
ATOM   618   H  HA   . ILE A 1 43  ? -36.389 -41.082 -14.676 1.00 39.90  ? 122  ILE A HA   1 
ATOM   619   H  HB   . ILE A 1 43  ? -37.326 -43.392 -16.027 1.00 35.79  ? 122  ILE A HB   1 
ATOM   620   H  HG12 . ILE A 1 43  ? -37.055 -43.802 -13.752 1.00 32.45  ? 122  ILE A HG12 1 
ATOM   621   H  HG13 . ILE A 1 43  ? -36.009 -44.655 -14.583 1.00 32.45  ? 122  ILE A HG13 1 
ATOM   622   H  HG21 . ILE A 1 43  ? -35.130 -43.819 -16.716 1.00 33.83  ? 122  ILE A HG21 1 
ATOM   623   H  HG22 . ILE A 1 43  ? -35.660 -42.454 -17.333 1.00 33.83  ? 122  ILE A HG22 1 
ATOM   624   H  HG23 . ILE A 1 43  ? -34.674 -42.433 -16.087 1.00 33.83  ? 122  ILE A HG23 1 
ATOM   625   H  HD11 . ILE A 1 43  ? -35.011 -43.780 -12.713 1.00 35.64  ? 122  ILE A HD11 1 
ATOM   626   H  HD12 . ILE A 1 43  ? -34.343 -43.167 -14.018 1.00 35.64  ? 122  ILE A HD12 1 
ATOM   627   H  HD13 . ILE A 1 43  ? -35.391 -42.311 -13.185 1.00 35.64  ? 122  ILE A HD13 1 
ATOM   628   N  N    . GLN A 1 44  ? -38.076 -41.250 -17.401 1.00 31.66  ? 123  GLN A N    1 
ATOM   629   C  CA   . GLN A 1 44  ? -38.179 -40.747 -18.764 1.00 32.71  ? 123  GLN A CA   1 
ATOM   630   C  C    . GLN A 1 44  ? -38.597 -39.281 -18.821 1.00 39.16  ? 123  GLN A C    1 
ATOM   631   O  O    . GLN A 1 44  ? -38.326 -38.596 -19.808 1.00 44.97  ? 123  GLN A O    1 
ATOM   632   C  CB   . GLN A 1 44  ? -39.155 -41.601 -19.567 1.00 34.85  ? 123  GLN A CB   1 
ATOM   633   C  CG   . GLN A 1 44  ? -38.665 -43.016 -19.800 1.00 44.95  ? 123  GLN A CG   1 
ATOM   634   C  CD   . GLN A 1 44  ? -39.702 -43.891 -20.470 1.00 54.24  ? 123  GLN A CD   1 
ATOM   635   O  OE1  . GLN A 1 44  ? -40.814 -43.451 -20.762 1.00 52.74  ? 123  GLN A OE1  1 
ATOM   636   N  NE2  . GLN A 1 44  ? -39.342 -45.145 -20.713 1.00 58.51  ? 123  GLN A NE2  1 
ATOM   637   H  H    . GLN A 1 44  ? -38.638 -41.874 -17.215 1.00 38.00  ? 123  GLN A H    1 
ATOM   638   H  HA   . GLN A 1 44  ? -37.308 -40.820 -19.186 1.00 39.25  ? 123  GLN A HA   1 
ATOM   639   H  HB2  . GLN A 1 44  ? -39.996 -41.652 -19.087 1.00 41.82  ? 123  GLN A HB2  1 
ATOM   640   H  HB3  . GLN A 1 44  ? -39.294 -41.188 -20.434 1.00 41.82  ? 123  GLN A HB3  1 
ATOM   641   H  HG2  . GLN A 1 44  ? -37.881 -42.990 -20.371 1.00 53.95  ? 123  GLN A HG2  1 
ATOM   642   H  HG3  . GLN A 1 44  ? -38.441 -43.417 -18.946 1.00 53.95  ? 123  GLN A HG3  1 
ATOM   643   H  HE21 . GLN A 1 44  ? -38.557 -45.418 -20.491 1.00 70.21  ? 123  GLN A HE21 1 
ATOM   644   H  HE22 . GLN A 1 44  ? -39.894 -45.685 -21.092 1.00 70.21  ? 123  GLN A HE22 1 
ATOM   645   N  N    . CYS A 1 45  ? -39.268 -38.809 -17.774 1.00 40.61  ? 124  CYS A N    1 
ATOM   646   C  CA   . CYS A 1 45  ? -39.605 -37.394 -17.660 1.00 37.58  ? 124  CYS A CA   1 
ATOM   647   C  C    . CYS A 1 45  ? -38.351 -36.534 -17.499 1.00 40.20  ? 124  CYS A C    1 
ATOM   648   O  O    . CYS A 1 45  ? -38.386 -35.323 -17.715 1.00 42.08  ? 124  CYS A O    1 
ATOM   649   C  CB   . CYS A 1 45  ? -40.533 -37.165 -16.470 1.00 39.64  ? 124  CYS A CB   1 
ATOM   650   S  SG   . CYS A 1 45  ? -42.283 -37.572 -16.769 1.00 44.73  ? 124  CYS A SG   1 
ATOM   651   H  H    . CYS A 1 45  ? -39.539 -39.289 -17.114 1.00 48.73  ? 124  CYS A H    1 
ATOM   652   H  HA   . CYS A 1 45  ? -40.067 -37.110 -18.464 1.00 45.10  ? 124  CYS A HA   1 
ATOM   653   H  HB2  . CYS A 1 45  ? -40.227 -37.713 -15.730 1.00 47.57  ? 124  CYS A HB2  1 
ATOM   654   H  HB3  . CYS A 1 45  ? -40.489 -36.229 -16.220 1.00 47.57  ? 124  CYS A HB3  1 
ATOM   655   H  HG   . CYS A 1 45  ? -42.370 -38.733 -17.061 1.00 53.68  ? 124  CYS A HG   1 
ATOM   656   N  N    . SER A 1 46  ? -37.250 -37.171 -17.111 1.00 32.43  ? 125  SER A N    1 
ATOM   657   C  CA   . SER A 1 46  ? -35.978 -36.485 -16.915 1.00 28.23  ? 125  SER A CA   1 
ATOM   658   C  C    . SER A 1 46  ? -35.165 -36.424 -18.206 1.00 32.49  ? 125  SER A C    1 
ATOM   659   O  O    . SER A 1 46  ? -34.025 -35.974 -18.201 1.00 38.94  ? 125  SER A O    1 
ATOM   660   C  CB   . SER A 1 46  ? -35.167 -37.198 -15.833 1.00 34.27  ? 125  SER A CB   1 
ATOM   661   O  OG   . SER A 1 46  ? -35.964 -37.448 -14.685 1.00 38.21  ? 125  SER A OG   1 
ATOM   662   H  H    . SER A 1 46  ? -37.215 -38.016 -16.951 1.00 38.91  ? 125  SER A H    1 
ATOM   663   H  HA   . SER A 1 46  ? -36.147 -35.577 -16.620 1.00 33.87  ? 125  SER A HA   1 
ATOM   664   H  HB2  . SER A 1 46  ? -34.846 -38.043 -16.184 1.00 41.13  ? 125  SER A HB2  1 
ATOM   665   H  HB3  . SER A 1 46  ? -34.417 -36.637 -15.580 1.00 41.13  ? 125  SER A HB3  1 
ATOM   666   H  HG   . SER A 1 46  ? -36.618 -37.933 -14.890 1.00 45.86  ? 125  SER A HG   1 
ATOM   667   N  N    . GLY A 1 47  ? -35.751 -36.873 -19.311 1.00 30.41  ? 126  GLY A N    1 
ATOM   668   C  CA   . GLY A 1 47  ? -35.075 -36.850 -20.597 1.00 26.73  ? 126  GLY A CA   1 
ATOM   669   C  C    . GLY A 1 47  ? -34.336 -38.143 -20.890 1.00 28.08  ? 126  GLY A C    1 
ATOM   670   O  O    . GLY A 1 47  ? -33.883 -38.377 -22.011 1.00 34.37  ? 126  GLY A O    1 
ATOM   671   H  H    . GLY A 1 47  ? -36.547 -37.198 -19.339 1.00 36.49  ? 126  GLY A H    1 
ATOM   672   H  HA2  . GLY A 1 47  ? -35.725 -36.702 -21.301 1.00 32.08  ? 126  GLY A HA2  1 
ATOM   673   H  HA3  . GLY A 1 47  ? -34.435 -36.121 -20.612 1.00 32.08  ? 126  GLY A HA3  1 
ATOM   674   N  N    . CYS A 1 48  ? -34.219 -38.990 -19.876 1.00 34.72  ? 127  CYS A N    1 
ATOM   675   C  CA   . CYS A 1 48  ? -33.539 -40.268 -20.018 1.00 34.63  ? 127  CYS A CA   1 
ATOM   676   C  C    . CYS A 1 48  ? -34.243 -41.142 -21.046 1.00 40.91  ? 127  CYS A C    1 
ATOM   677   O  O    . CYS A 1 48  ? -35.468 -41.119 -21.151 1.00 45.51  ? 127  CYS A O    1 
ATOM   678   C  CB   . CYS A 1 48  ? -33.502 -40.976 -18.666 1.00 35.34  ? 127  CYS A CB   1 
ATOM   679   S  SG   . CYS A 1 48  ? -32.670 -42.569 -18.647 1.00 33.59  ? 127  CYS A SG   1 
ATOM   680   H  H    . CYS A 1 48  ? -34.529 -38.845 -19.087 1.00 41.67  ? 127  CYS A H    1 
ATOM   681   H  HA   . CYS A 1 48  ? -32.627 -40.119 -20.312 1.00 41.56  ? 127  CYS A HA   1 
ATOM   682   H  HB2  . CYS A 1 48  ? -33.046 -40.402 -18.031 1.00 42.41  ? 127  CYS A HB2  1 
ATOM   683   H  HB3  . CYS A 1 48  ? -34.415 -41.122 -18.372 1.00 42.41  ? 127  CYS A HB3  1 
ATOM   684   H  HG   . CYS A 1 48  ? -32.711 -43.018 -17.535 1.00 40.31  ? 127  CYS A HG   1 
ATOM   685   N  N    . LYS A 1 49  ? -33.460 -41.905 -21.805 1.00 50.33  ? 128  LYS A N    1 
ATOM   686   C  CA   . LYS A 1 49  ? -33.992 -42.781 -22.847 1.00 46.72  ? 128  LYS A CA   1 
ATOM   687   C  C    . LYS A 1 49  ? -33.798 -44.251 -22.493 1.00 43.56  ? 128  LYS A C    1 
ATOM   688   O  O    . LYS A 1 49  ? -34.112 -45.136 -23.288 1.00 48.75  ? 128  LYS A O    1 
ATOM   689   C  CB   . LYS A 1 49  ? -33.330 -42.469 -24.193 1.00 49.18  ? 128  LYS A CB   1 
ATOM   690   C  CG   . LYS A 1 49  ? -34.173 -41.573 -25.096 1.00 51.20  ? 128  LYS A CG   1 
ATOM   691   C  CD   . LYS A 1 49  ? -33.352 -40.947 -26.207 1.00 55.66  ? 128  LYS A CD   1 
ATOM   692   C  CE   . LYS A 1 49  ? -32.605 -39.720 -25.705 1.00 64.67  ? 128  LYS A CE   1 
ATOM   693   N  NZ   . LYS A 1 49  ? -33.513 -38.620 -25.258 1.00 60.52  ? 128  LYS A NZ   1 
ATOM   694   H  H    . LYS A 1 49  ? -32.604 -41.933 -21.734 1.00 60.40  ? 128  LYS A H    1 
ATOM   695   H  HA   . LYS A 1 49  ? -34.944 -42.619 -22.938 1.00 56.07  ? 128  LYS A HA   1 
ATOM   696   H  HB2  . LYS A 1 49  ? -32.487 -42.017 -24.030 1.00 59.02  ? 128  LYS A HB2  1 
ATOM   697   H  HB3  . LYS A 1 49  ? -33.172 -43.301 -24.665 1.00 59.02  ? 128  LYS A HB3  1 
ATOM   698   H  HG2  . LYS A 1 49  ? -34.876 -42.103 -25.502 1.00 61.44  ? 128  LYS A HG2  1 
ATOM   699   H  HG3  . LYS A 1 49  ? -34.557 -40.858 -24.565 1.00 61.44  ? 128  LYS A HG3  1 
ATOM   700   H  HD2  . LYS A 1 49  ? -32.702 -41.591 -26.529 1.00 66.79  ? 128  LYS A HD2  1 
ATOM   701   H  HD3  . LYS A 1 49  ? -33.941 -40.673 -26.927 1.00 66.79  ? 128  LYS A HD3  1 
ATOM   702   H  HE2  . LYS A 1 49  ? -32.052 -39.976 -24.950 1.00 77.61  ? 128  LYS A HE2  1 
ATOM   703   H  HE3  . LYS A 1 49  ? -32.048 -39.376 -26.421 1.00 77.61  ? 128  LYS A HE3  1 
ATOM   704   H  HZ1  . LYS A 1 49  ? -33.034 -37.926 -24.974 1.00 72.62  ? 128  LYS A HZ1  1 
ATOM   705   H  HZ2  . LYS A 1 49  ? -34.029 -38.357 -25.935 1.00 72.62  ? 128  LYS A HZ2  1 
ATOM   706   H  HZ3  . LYS A 1 49  ? -34.032 -38.904 -24.593 1.00 72.62  ? 128  LYS A HZ3  1 
ATOM   707   N  N    . GLY A 1 50  ? -33.275 -44.509 -21.300 1.00 35.16  ? 129  GLY A N    1 
ATOM   708   C  CA   . GLY A 1 50  ? -33.159 -45.869 -20.812 1.00 43.22  ? 129  GLY A CA   1 
ATOM   709   C  C    . GLY A 1 50  ? -34.518 -46.425 -20.429 1.00 48.09  ? 129  GLY A C    1 
ATOM   710   O  O    . GLY A 1 50  ? -35.517 -45.703 -20.437 1.00 49.63  ? 129  GLY A O    1 
ATOM   711   H  H    . GLY A 1 50  ? -32.981 -43.911 -20.755 1.00 42.19  ? 129  GLY A H    1 
ATOM   712   H  HA2  . GLY A 1 50  ? -32.773 -46.433 -21.500 1.00 51.86  ? 129  GLY A HA2  1 
ATOM   713   H  HA3  . GLY A 1 50  ? -32.582 -45.890 -20.032 1.00 51.86  ? 129  GLY A HA3  1 
ATOM   714   N  N    . VAL A 1 51  ? -34.549 -47.706 -20.074 1.00 52.84  ? 130  VAL A N    1 
ATOM   715   C  CA   . VAL A 1 51  ? -35.757 -48.344 -19.555 1.00 55.80  ? 130  VAL A CA   1 
ATOM   716   C  C    . VAL A 1 51  ? -35.393 -49.255 -18.392 1.00 53.12  ? 130  VAL A C    1 
ATOM   717   O  O    . VAL A 1 51  ? -34.454 -50.046 -18.481 1.00 53.15  ? 130  VAL A O    1 
ATOM   718   C  CB   . VAL A 1 51  ? -36.496 -49.169 -20.644 1.00 56.56  ? 130  VAL A CB   1 
ATOM   719   C  CG1  . VAL A 1 51  ? -37.552 -50.086 -20.025 1.00 61.65  ? 130  VAL A CG1  1 
ATOM   720   C  CG2  . VAL A 1 51  ? -37.154 -48.248 -21.657 1.00 59.46  ? 130  VAL A CG2  1 
ATOM   721   H  H    . VAL A 1 51  ? -33.874 -48.236 -20.125 1.00 63.41  ? 130  VAL A H    1 
ATOM   722   H  HA   . VAL A 1 51  ? -36.363 -47.661 -19.228 1.00 66.96  ? 130  VAL A HA   1 
ATOM   723   H  HB   . VAL A 1 51  ? -35.853 -49.723 -21.113 1.00 67.87  ? 130  VAL A HB   1 
ATOM   724   H  HG11 . VAL A 1 51  ? -37.992 -50.583 -20.732 1.00 73.98  ? 130  VAL A HG11 1 
ATOM   725   H  HG12 . VAL A 1 51  ? -37.117 -50.698 -19.410 1.00 73.98  ? 130  VAL A HG12 1 
ATOM   726   H  HG13 . VAL A 1 51  ? -38.200 -49.544 -19.548 1.00 73.98  ? 130  VAL A HG13 1 
ATOM   727   H  HG21 . VAL A 1 51  ? -37.607 -48.786 -22.325 1.00 71.35  ? 130  VAL A HG21 1 
ATOM   728   H  HG22 . VAL A 1 51  ? -37.793 -47.680 -21.199 1.00 71.35  ? 130  VAL A HG22 1 
ATOM   729   H  HG23 . VAL A 1 51  ? -36.470 -47.704 -22.079 1.00 71.35  ? 130  VAL A HG23 1 
ATOM   730   N  N    . VAL A 1 52  ? -36.142 -49.130 -17.302 1.00 39.98  ? 131  VAL A N    1 
ATOM   731   C  CA   . VAL A 1 52  ? -36.008 -50.042 -16.177 1.00 40.97  ? 131  VAL A CA   1 
ATOM   732   C  C    . VAL A 1 52  ? -36.883 -51.252 -16.471 1.00 44.79  ? 131  VAL A C    1 
ATOM   733   O  O    . VAL A 1 52  ? -38.073 -51.108 -16.753 1.00 45.57  ? 131  VAL A O    1 
ATOM   734   C  CB   . VAL A 1 52  ? -36.467 -49.412 -14.842 1.00 36.26  ? 131  VAL A CB   1 
ATOM   735   C  CG1  . VAL A 1 52  ? -35.934 -50.233 -13.675 1.00 28.72  ? 131  VAL A CG1  1 
ATOM   736   C  CG2  . VAL A 1 52  ? -36.023 -47.947 -14.725 1.00 30.81  ? 131  VAL A CG2  1 
ATOM   737   H  H    . VAL A 1 52  ? -36.738 -48.521 -17.190 1.00 47.97  ? 131  VAL A H    1 
ATOM   738   H  HA   . VAL A 1 52  ? -35.087 -50.331 -16.090 1.00 49.17  ? 131  VAL A HA   1 
ATOM   739   H  HB   . VAL A 1 52  ? -37.436 -49.433 -14.803 1.00 43.52  ? 131  VAL A HB   1 
ATOM   740   H  HG11 . VAL A 1 52  ? -36.229 -49.828 -12.845 1.00 34.46  ? 131  VAL A HG11 1 
ATOM   741   H  HG12 . VAL A 1 52  ? -36.278 -51.137 -13.743 1.00 34.46  ? 131  VAL A HG12 1 
ATOM   742   H  HG13 . VAL A 1 52  ? -34.965 -50.243 -13.714 1.00 34.46  ? 131  VAL A HG13 1 
ATOM   743   H  HG21 . VAL A 1 52  ? -36.330 -47.592 -13.876 1.00 36.97  ? 131  VAL A HG21 1 
ATOM   744   H  HG22 . VAL A 1 52  ? -35.055 -47.907 -14.770 1.00 36.97  ? 131  VAL A HG22 1 
ATOM   745   H  HG23 . VAL A 1 52  ? -36.410 -47.440 -15.456 1.00 36.97  ? 131  VAL A HG23 1 
ATOM   746   N  N    . THR A 1 53  ? -36.289 -52.440 -16.411 1.00 57.35  ? 132  THR A N    1 
ATOM   747   C  CA   . THR A 1 53  ? -36.992 -53.668 -16.760 1.00 59.43  ? 132  THR A CA   1 
ATOM   748   C  C    . THR A 1 53  ? -37.449 -54.403 -15.508 1.00 60.38  ? 132  THR A C    1 
ATOM   749   O  O    . THR A 1 53  ? -37.024 -54.079 -14.398 1.00 60.03  ? 132  THR A O    1 
ATOM   750   C  CB   . THR A 1 53  ? -36.102 -54.597 -17.601 1.00 64.45  ? 132  THR A CB   1 
ATOM   751   O  OG1  . THR A 1 53  ? -34.938 -54.962 -16.848 1.00 59.39  ? 132  THR A OG1  1 
ATOM   752   C  CG2  . THR A 1 53  ? -35.682 -53.904 -18.893 1.00 65.61  ? 132  THR A CG2  1 
ATOM   753   H  H    . THR A 1 53  ? -35.473 -52.561 -16.168 1.00 68.82  ? 132  THR A H    1 
ATOM   754   H  HA   . THR A 1 53  ? -37.778 -53.446 -17.284 1.00 71.32  ? 132  THR A HA   1 
ATOM   755   H  HB   . THR A 1 53  ? -36.599 -55.397 -17.831 1.00 77.34  ? 132  THR A HB   1 
ATOM   756   H  HG1  . THR A 1 53  ? -34.449 -55.470 -17.304 1.00 71.26  ? 132  THR A HG1  1 
ATOM   757   H  HG21 . THR A 1 53  ? -35.120 -54.495 -19.419 1.00 78.73  ? 132  THR A HG21 1 
ATOM   758   H  HG22 . THR A 1 53  ? -36.466 -53.669 -19.413 1.00 78.73  ? 132  THR A HG22 1 
ATOM   759   H  HG23 . THR A 1 53  ? -35.185 -53.096 -18.689 1.00 78.73  ? 132  THR A HG23 1 
ATOM   760   N  N    . ALA A 1 54  ? -38.322 -55.387 -15.697 1.00 50.26  ? 133  ALA A N    1 
ATOM   761   C  CA   . ALA A 1 54  ? -38.867 -56.162 -14.590 1.00 45.56  ? 133  ALA A CA   1 
ATOM   762   C  C    . ALA A 1 54  ? -37.757 -56.828 -13.786 1.00 47.70  ? 133  ALA A C    1 
ATOM   763   O  O    . ALA A 1 54  ? -37.844 -56.948 -12.563 1.00 50.51  ? 133  ALA A O    1 
ATOM   764   C  CB   . ALA A 1 54  ? -39.828 -57.211 -15.115 1.00 50.56  ? 133  ALA A CB   1 
ATOM   765   H  H    . ALA A 1 54  ? -38.617 -55.628 -16.468 1.00 60.31  ? 133  ALA A H    1 
ATOM   766   H  HA   . ALA A 1 54  ? -39.357 -55.571 -13.997 1.00 54.67  ? 133  ALA A HA   1 
ATOM   767   H  HB1  . ALA A 1 54  ? -40.182 -57.718 -14.367 1.00 60.67  ? 133  ALA A HB1  1 
ATOM   768   H  HB2  . ALA A 1 54  ? -40.551 -56.769 -15.587 1.00 60.67  ? 133  ALA A HB2  1 
ATOM   769   H  HB3  . ALA A 1 54  ? -39.351 -57.802 -15.719 1.00 60.67  ? 133  ALA A HB3  1 
ATOM   770   N  N    . GLU A 1 55  ? -36.711 -57.256 -14.483 1.00 60.39  ? 134  GLU A N    1 
ATOM   771   C  CA   . GLU A 1 55  ? -35.614 -57.973 -13.852 1.00 67.55  ? 134  GLU A CA   1 
ATOM   772   C  C    . GLU A 1 55  ? -34.832 -57.020 -12.958 1.00 61.14  ? 134  GLU A C    1 
ATOM   773   O  O    . GLU A 1 55  ? -34.419 -57.384 -11.859 1.00 54.24  ? 134  GLU A O    1 
ATOM   774   C  CB   . GLU A 1 55  ? -34.704 -58.602 -14.913 1.00 73.90  ? 134  GLU A CB   1 
ATOM   775   C  CG   . GLU A 1 55  ? -35.342 -59.764 -15.683 1.00 86.83  ? 134  GLU A CG   1 
ATOM   776   C  CD   . GLU A 1 55  ? -36.559 -59.351 -16.505 1.00 89.31  ? 134  GLU A CD   1 
ATOM   777   O  OE1  . GLU A 1 55  ? -36.545 -58.240 -17.081 1.00 78.17  ? 134  GLU A OE1  1 
ATOM   778   O  OE2  . GLU A 1 55  ? -37.529 -60.140 -16.569 1.00 92.03  ? 134  GLU A OE2  1 
ATOM   779   H  H    . GLU A 1 55  ? -36.614 -57.143 -15.330 1.00 72.47  ? 134  GLU A H    1 
ATOM   780   H  HA   . GLU A 1 55  ? -35.972 -58.684 -13.298 1.00 81.06  ? 134  GLU A HA   1 
ATOM   781   H  HB2  . GLU A 1 55  ? -34.460 -57.919 -15.558 1.00 88.68  ? 134  GLU A HB2  1 
ATOM   782   H  HB3  . GLU A 1 55  ? -33.906 -58.940 -14.478 1.00 88.68  ? 134  GLU A HB3  1 
ATOM   783   H  HG2  . GLU A 1 55  ? -34.685 -60.137 -16.291 1.00 104.20 ? 134  GLU A HG2  1 
ATOM   784   H  HG3  . GLU A 1 55  ? -35.627 -60.441 -15.050 1.00 104.20 ? 134  GLU A HG3  1 
HETATM 785   N  N    . MSE A 1 56  ? -34.645 -55.792 -13.431 1.00 74.34  ? 135  MSE A N    1 
HETATM 786   C  CA   . MSE A 1 56  ? -33.978 -54.767 -12.639 1.00 73.52  ? 135  MSE A CA   1 
HETATM 787   C  C    . MSE A 1 56  ? -34.815 -54.429 -11.413 1.00 63.86  ? 135  MSE A C    1 
HETATM 788   O  O    . MSE A 1 56  ? -34.300 -54.346 -10.297 1.00 58.23  ? 135  MSE A O    1 
HETATM 789   C  CB   . MSE A 1 56  ? -33.761 -53.501 -13.468 1.00 71.73  ? 135  MSE A CB   1 
HETATM 790   C  CG   . MSE A 1 56  ? -32.831 -53.672 -14.655 1.00 75.41  ? 135  MSE A CG   1 
HETATM 791   SE SE   . MSE A 1 56  ? -32.695 -52.040 -15.715 1.00 88.68  ? 135  MSE A SE   1 
HETATM 792   C  CE   . MSE A 1 56  ? -31.949 -50.841 -14.370 1.00 66.26  ? 135  MSE A CE   1 
HETATM 793   H  H    . MSE A 1 56  ? -34.895 -55.527 -14.210 1.00 89.21  ? 135  MSE A H    1 
HETATM 794   H  HA   . MSE A 1 56  ? -33.111 -55.096 -12.354 1.00 88.23  ? 135  MSE A HA   1 
HETATM 795   H  HB2  . MSE A 1 56  ? -34.619 -53.203 -13.809 1.00 86.07  ? 135  MSE A HB2  1 
HETATM 796   H  HB3  . MSE A 1 56  ? -33.382 -52.816 -12.895 1.00 86.07  ? 135  MSE A HB3  1 
HETATM 797   H  HG2  . MSE A 1 56  ? -31.944 -53.899 -14.335 1.00 90.49  ? 135  MSE A HG2  1 
HETATM 798   H  HG3  . MSE A 1 56  ? -33.170 -54.377 -15.228 1.00 90.49  ? 135  MSE A HG3  1 
HETATM 799   H  HE1  . MSE A 1 56  ? -31.823 -49.964 -14.765 1.00 79.51  ? 135  MSE A HE1  1 
HETATM 800   H  HE2  . MSE A 1 56  ? -32.565 -50.783 -13.623 1.00 79.51  ? 135  MSE A HE2  1 
HETATM 801   H  HE3  . MSE A 1 56  ? -31.097 -51.195 -14.070 1.00 79.51  ? 135  MSE A HE3  1 
ATOM   802   N  N    . PHE A 1 57  ? -36.109 -54.228 -11.640 1.00 53.93  ? 136  PHE A N    1 
ATOM   803   C  CA   . PHE A 1 57  ? -37.051 -53.881 -10.583 1.00 56.76  ? 136  PHE A CA   1 
ATOM   804   C  C    . PHE A 1 57  ? -36.982 -54.872 -9.426  1.00 61.20  ? 136  PHE A C    1 
ATOM   805   O  O    . PHE A 1 57  ? -36.816 -54.485 -8.268  1.00 60.65  ? 136  PHE A O    1 
ATOM   806   C  CB   . PHE A 1 57  ? -38.470 -53.860 -11.154 1.00 61.09  ? 136  PHE A CB   1 
ATOM   807   C  CG   . PHE A 1 57  ? -39.523 -53.454 -10.164 1.00 61.46  ? 136  PHE A CG   1 
ATOM   808   C  CD1  . PHE A 1 57  ? -40.036 -54.371 -9.262  1.00 66.10  ? 136  PHE A CD1  1 
ATOM   809   C  CD2  . PHE A 1 57  ? -40.013 -52.161 -10.149 1.00 56.34  ? 136  PHE A CD2  1 
ATOM   810   C  CE1  . PHE A 1 57  ? -41.004 -54.003 -8.354  1.00 65.07  ? 136  PHE A CE1  1 
ATOM   811   C  CE2  . PHE A 1 57  ? -40.985 -51.787 -9.245  1.00 55.99  ? 136  PHE A CE2  1 
ATOM   812   C  CZ   . PHE A 1 57  ? -41.483 -52.710 -8.347  1.00 61.42  ? 136  PHE A CZ   1 
ATOM   813   H  H    . PHE A 1 57  ? -36.473 -54.288 -12.417 1.00 64.72  ? 136  PHE A H    1 
ATOM   814   H  HA   . PHE A 1 57  ? -36.844 -52.997 -10.243 1.00 68.11  ? 136  PHE A HA   1 
ATOM   815   H  HB2  . PHE A 1 57  ? -38.500 -53.231 -11.892 1.00 73.31  ? 136  PHE A HB2  1 
ATOM   816   H  HB3  . PHE A 1 57  ? -38.691 -54.750 -11.472 1.00 73.31  ? 136  PHE A HB3  1 
ATOM   817   H  HD1  . PHE A 1 57  ? -39.716 -55.244 -9.263  1.00 79.32  ? 136  PHE A HD1  1 
ATOM   818   H  HD2  . PHE A 1 57  ? -39.681 -51.536 -10.752 1.00 67.61  ? 136  PHE A HD2  1 
ATOM   819   H  HE1  . PHE A 1 57  ? -41.339 -54.627 -7.751  1.00 78.09  ? 136  PHE A HE1  1 
ATOM   820   H  HE2  . PHE A 1 57  ? -41.305 -50.914 -9.241  1.00 67.19  ? 136  PHE A HE2  1 
ATOM   821   H  HZ   . PHE A 1 57  ? -42.137 -52.459 -7.736  1.00 73.71  ? 136  PHE A HZ   1 
ATOM   822   N  N    . ARG A 1 58  ? -37.109 -56.152 -9.754  1.00 63.05  ? 137  ARG A N    1 
ATOM   823   C  CA   . ARG A 1 58  ? -37.174 -57.208 -8.751  1.00 61.40  ? 137  ARG A CA   1 
ATOM   824   C  C    . ARG A 1 58  ? -35.881 -57.389 -7.963  1.00 60.34  ? 137  ARG A C    1 
ATOM   825   O  O    . ARG A 1 58  ? -35.908 -57.904 -6.844  1.00 58.14  ? 137  ARG A O    1 
ATOM   826   C  CB   . ARG A 1 58  ? -37.517 -58.541 -9.418  1.00 71.45  ? 137  ARG A CB   1 
ATOM   827   C  CG   . ARG A 1 58  ? -38.976 -58.939 -9.323  1.00 78.00  ? 137  ARG A CG   1 
ATOM   828   C  CD   . ARG A 1 58  ? -39.132 -60.445 -9.478  1.00 85.40  ? 137  ARG A CD   1 
ATOM   829   N  NE   . ARG A 1 58  ? -38.742 -60.910 -10.810 1.00 85.08  ? 137  ARG A NE   1 
ATOM   830   C  CZ   . ARG A 1 58  ? -39.575 -61.062 -11.838 1.00 88.74  ? 137  ARG A CZ   1 
ATOM   831   N  NH1  . ARG A 1 58  ? -40.870 -60.791 -11.714 1.00 93.91  ? 137  ARG A NH1  1 
ATOM   832   N  NH2  . ARG A 1 58  ? -39.110 -61.492 -13.003 1.00 85.01  ? 137  ARG A NH2  1 
ATOM   833   H  H    . ARG A 1 58  ? -37.161 -56.439 -10.563 1.00 75.66  ? 137  ARG A H    1 
ATOM   834   H  HA   . ARG A 1 58  ? -37.880 -56.999 -8.120  1.00 73.68  ? 137  ARG A HA   1 
ATOM   835   H  HB2  . ARG A 1 58  ? -37.289 -58.484 -10.359 1.00 85.74  ? 137  ARG A HB2  1 
ATOM   836   H  HB3  . ARG A 1 58  ? -36.994 -59.242 -8.998  1.00 85.74  ? 137  ARG A HB3  1 
ATOM   837   H  HG2  . ARG A 1 58  ? -39.325 -58.682 -8.455  1.00 93.60  ? 137  ARG A HG2  1 
ATOM   838   H  HG3  . ARG A 1 58  ? -39.476 -58.504 -10.031 1.00 93.60  ? 137  ARG A HG3  1 
ATOM   839   H  HD2  . ARG A 1 58  ? -38.568 -60.891 -8.826  1.00 102.47 ? 137  ARG A HD2  1 
ATOM   840   H  HD3  . ARG A 1 58  ? -40.061 -60.685 -9.335  1.00 102.47 ? 137  ARG A HD3  1 
ATOM   841   H  HE   . ARG A 1 58  ? -37.913 -61.099 -10.938 1.00 102.10 ? 137  ARG A HE   1 
ATOM   842   H  HH11 . ARG A 1 58  ? -41.182 -60.512 -10.963 1.00 112.69 ? 137  ARG A HH11 1 
ATOM   843   H  HH12 . ARG A 1 58  ? -41.397 -60.894 -12.386 1.00 112.69 ? 137  ARG A HH12 1 
ATOM   844   H  HH21 . ARG A 1 58  ? -38.273 -61.670 -13.092 1.00 102.01 ? 137  ARG A HH21 1 
ATOM   845   H  HH22 . ARG A 1 58  ? -39.644 -61.592 -13.669 1.00 102.01 ? 137  ARG A HH22 1 
ATOM   846   N  N    . HIS A 1 59  ? -34.756 -56.970 -8.541  1.00 59.52  ? 138  HIS A N    1 
ATOM   847   C  CA   . HIS A 1 59  ? -33.449 -57.380 -8.031  1.00 56.51  ? 138  HIS A CA   1 
ATOM   848   C  C    . HIS A 1 59  ? -32.500 -56.243 -7.651  1.00 56.62  ? 138  HIS A C    1 
ATOM   849   O  O    . HIS A 1 59  ? -31.865 -56.305 -6.601  1.00 60.00  ? 138  HIS A O    1 
ATOM   850   C  CB   . HIS A 1 59  ? -32.784 -58.316 -9.040  1.00 63.48  ? 138  HIS A CB   1 
ATOM   851   C  CG   . HIS A 1 59  ? -33.515 -59.611 -9.219  1.00 71.46  ? 138  HIS A CG   1 
ATOM   852   N  ND1  . HIS A 1 59  ? -33.667 -60.525 -8.198  1.00 72.93  ? 138  HIS A ND1  1 
ATOM   853   C  CD2  . HIS A 1 59  ? -34.141 -60.142 -10.295 1.00 74.13  ? 138  HIS A CD2  1 
ATOM   854   C  CE1  . HIS A 1 59  ? -34.354 -61.564 -8.638  1.00 75.04  ? 138  HIS A CE1  1 
ATOM   855   N  NE2  . HIS A 1 59  ? -34.654 -61.357 -9.907  1.00 76.36  ? 138  HIS A NE2  1 
ATOM   856   H  H    . HIS A 1 59  ? -34.722 -56.451 -9.226  1.00 71.42  ? 138  HIS A H    1 
ATOM   857   H  HA   . HIS A 1 59  ? -33.598 -57.898 -7.225  1.00 67.81  ? 138  HIS A HA   1 
ATOM   858   H  HB2  . HIS A 1 59  ? -32.747 -57.873 -9.902  1.00 76.18  ? 138  HIS A HB2  1 
ATOM   859   H  HB3  . HIS A 1 59  ? -31.886 -58.520 -8.734  1.00 76.18  ? 138  HIS A HB3  1 
ATOM   860   H  HD1  . HIS A 1 59  ? -33.362 -60.433 -7.399  1.00 87.51  ? 138  HIS A HD1  1 
ATOM   861   H  HD2  . HIS A 1 59  ? -34.211 -59.757 -11.138 1.00 88.96  ? 138  HIS A HD2  1 
ATOM   862   H  HE1  . HIS A 1 59  ? -34.586 -62.313 -8.139  1.00 90.05  ? 138  HIS A HE1  1 
ATOM   863   H  HE2  . HIS A 1 59  ? -35.097 -61.896 -10.410 1.00 91.64  ? 138  HIS A HE2  1 
HETATM 864   N  N    . MSE A 1 60  ? -32.396 -55.214 -8.484  1.00 76.07  ? 139  MSE A N    1 
HETATM 865   C  CA   . MSE A 1 60  ? -31.465 -54.122 -8.207  1.00 69.61  ? 139  MSE A CA   1 
HETATM 866   C  C    . MSE A 1 60  ? -32.046 -53.139 -7.202  1.00 69.15  ? 139  MSE A C    1 
HETATM 867   O  O    . MSE A 1 60  ? -33.251 -52.897 -7.186  1.00 74.59  ? 139  MSE A O    1 
HETATM 868   C  CB   . MSE A 1 60  ? -31.119 -53.363 -9.490  1.00 72.78  ? 139  MSE A CB   1 
HETATM 869   C  CG   . MSE A 1 60  ? -30.714 -54.254 -10.659 1.00 75.95  ? 139  MSE A CG   1 
HETATM 870   SE SE   . MSE A 1 60  ? -30.193 -53.268 -12.260 1.00 105.55 ? 139  MSE A SE   1 
HETATM 871   C  CE   . MSE A 1 60  ? -28.540 -52.488 -11.608 1.00 73.00  ? 139  MSE A CE   1 
HETATM 872   H  H    . MSE A 1 60  ? -32.847 -55.122 -9.211  1.00 91.28  ? 139  MSE A H    1 
HETATM 873   H  HA   . MSE A 1 60  ? -30.643 -54.492 -7.847  1.00 83.54  ? 139  MSE A HA   1 
HETATM 874   H  HB2  . MSE A 1 60  ? -31.894 -52.850 -9.766  1.00 87.34  ? 139  MSE A HB2  1 
HETATM 875   H  HB3  . MSE A 1 60  ? -30.379 -52.764 -9.306  1.00 87.34  ? 139  MSE A HB3  1 
HETATM 876   H  HG2  . MSE A 1 60  ? -29.959 -54.800 -10.389 1.00 91.14  ? 139  MSE A HG2  1 
HETATM 877   H  HG3  . MSE A 1 60  ? -31.464 -54.823 -10.893 1.00 91.14  ? 139  MSE A HG3  1 
HETATM 878   H  HE1  . MSE A 1 60  ? -28.147 -51.949 -12.312 1.00 87.60  ? 139  MSE A HE1  1 
HETATM 879   H  HE2  . MSE A 1 60  ? -28.736 -51.933 -10.837 1.00 87.60  ? 139  MSE A HE2  1 
HETATM 880   H  HE3  . MSE A 1 60  ? -27.933 -53.201 -11.357 1.00 87.60  ? 139  MSE A HE3  1 
ATOM   881   N  N    . GLN A 1 61  ? -31.182 -52.578 -6.362  1.00 55.45  ? 140  GLN A N    1 
ATOM   882   C  CA   . GLN A 1 61  ? -31.558 -51.448 -5.524  1.00 54.66  ? 140  GLN A CA   1 
ATOM   883   C  C    . GLN A 1 61  ? -31.523 -50.170 -6.362  1.00 56.89  ? 140  GLN A C    1 
ATOM   884   O  O    . GLN A 1 61  ? -30.963 -50.157 -7.456  1.00 49.55  ? 140  GLN A O    1 
ATOM   885   C  CB   . GLN A 1 61  ? -30.612 -51.313 -4.331  1.00 63.82  ? 140  GLN A CB   1 
ATOM   886   C  CG   . GLN A 1 61  ? -30.901 -52.261 -3.180  1.00 64.08  ? 140  GLN A CG   1 
ATOM   887   C  CD   . GLN A 1 61  ? -30.370 -51.728 -1.863  1.00 71.23  ? 140  GLN A CD   1 
ATOM   888   O  OE1  . GLN A 1 61  ? -29.174 -51.455 -1.725  1.00 70.59  ? 140  GLN A OE1  1 
ATOM   889   N  NE2  . GLN A 1 61  ? -31.260 -51.559 -0.891  1.00 71.76  ? 140  GLN A NE2  1 
ATOM   890   H  H    . GLN A 1 61  ? -30.368 -52.834 -6.260  1.00 66.54  ? 140  GLN A H    1 
ATOM   891   H  HA   . GLN A 1 61  ? -32.461 -51.575 -5.191  1.00 65.59  ? 140  GLN A HA   1 
ATOM   892   H  HB2  . GLN A 1 61  ? -29.707 -51.485 -4.633  1.00 76.58  ? 140  GLN A HB2  1 
ATOM   893   H  HB3  . GLN A 1 61  ? -30.674 -50.407 -3.988  1.00 76.58  ? 140  GLN A HB3  1 
ATOM   894   H  HG2  . GLN A 1 61  ? -31.860 -52.377 -3.096  1.00 76.89  ? 140  GLN A HG2  1 
ATOM   895   H  HG3  . GLN A 1 61  ? -30.474 -53.114 -3.356  1.00 76.89  ? 140  GLN A HG3  1 
ATOM   896   H  HE21 . GLN A 1 61  ? -32.088 -51.748 -1.029  1.00 86.12  ? 140  GLN A HE21 1 
ATOM   897   H  HE22 . GLN A 1 61  ? -31.009 -51.259 -0.125  1.00 86.12  ? 140  GLN A HE22 1 
ATOM   898   N  N    . ASN A 1 62  ? -32.109 -49.096 -5.839  1.00 59.38  ? 141  ASN A N    1 
ATOM   899   C  CA   . ASN A 1 62  ? -32.225 -47.842 -6.582  1.00 46.68  ? 141  ASN A CA   1 
ATOM   900   C  C    . ASN A 1 62  ? -30.870 -47.267 -6.986  1.00 51.16  ? 141  ASN A C    1 
ATOM   901   O  O    . ASN A 1 62  ? -30.693 -46.831 -8.123  1.00 51.61  ? 141  ASN A O    1 
ATOM   902   C  CB   . ASN A 1 62  ? -33.018 -46.807 -5.773  1.00 42.29  ? 141  ASN A CB   1 
ATOM   903   C  CG   . ASN A 1 62  ? -34.507 -47.125 -5.705  1.00 44.24  ? 141  ASN A CG   1 
ATOM   904   O  OD1  . ASN A 1 62  ? -35.031 -47.883 -6.520  1.00 44.21  ? 141  ASN A OD1  1 
ATOM   905   N  ND2  . ASN A 1 62  ? -35.198 -46.529 -4.736  1.00 50.85  ? 141  ASN A ND2  1 
ATOM   906   H  H    . ASN A 1 62  ? -32.451 -49.067 -5.050  1.00 71.25  ? 141  ASN A H    1 
ATOM   907   H  HA   . ASN A 1 62  ? -32.721 -48.015 -7.397  1.00 56.01  ? 141  ASN A HA   1 
ATOM   908   H  HB2  . ASN A 1 62  ? -32.674 -46.784 -4.866  1.00 50.74  ? 141  ASN A HB2  1 
ATOM   909   H  HB3  . ASN A 1 62  ? -32.915 -45.936 -6.188  1.00 50.74  ? 141  ASN A HB3  1 
ATOM   910   H  HD21 . ASN A 1 62  ? -36.041 -46.676 -4.656  1.00 61.02  ? 141  ASN A HD21 1 
ATOM   911   H  HD22 . ASN A 1 62  ? -34.801 -45.997 -4.189  1.00 61.02  ? 141  ASN A HD22 1 
ATOM   912   N  N    . SER A 1 63  ? -29.917 -47.272 -6.058  1.00 60.64  ? 142  SER A N    1 
ATOM   913   C  CA   . SER A 1 63  ? -28.575 -46.758 -6.335  1.00 57.94  ? 142  SER A CA   1 
ATOM   914   C  C    . SER A 1 63  ? -27.972 -47.426 -7.565  1.00 54.33  ? 142  SER A C    1 
ATOM   915   O  O    . SER A 1 63  ? -27.271 -46.791 -8.354  1.00 58.56  ? 142  SER A O    1 
ATOM   916   C  CB   . SER A 1 63  ? -27.653 -46.981 -5.136  1.00 56.39  ? 142  SER A CB   1 
ATOM   917   O  OG   . SER A 1 63  ? -27.550 -48.359 -4.822  1.00 64.28  ? 142  SER A OG   1 
ATOM   918   H  H    . SER A 1 63  ? -30.021 -47.568 -5.258  1.00 72.77  ? 142  SER A H    1 
ATOM   919   H  HA   . SER A 1 63  ? -28.628 -45.805 -6.504  1.00 69.53  ? 142  SER A HA   1 
ATOM   920   H  HB2  . SER A 1 63  ? -26.770 -46.640 -5.349  1.00 67.66  ? 142  SER A HB2  1 
ATOM   921   H  HB3  . SER A 1 63  ? -28.014 -46.509 -4.369  1.00 67.66  ? 142  SER A HB3  1 
ATOM   922   H  HG   . SER A 1 63  ? -27.041 -48.466 -4.162  1.00 77.13  ? 142  SER A HG   1 
ATOM   923   N  N    . GLU A 1 64  ? -28.258 -48.714 -7.724  1.00 57.81  ? 143  GLU A N    1 
ATOM   924   C  CA   . GLU A 1 64  ? -27.760 -49.481 -8.859  1.00 61.31  ? 143  GLU A CA   1 
ATOM   925   C  C    . GLU A 1 64  ? -28.592 -49.212 -10.108 1.00 56.02  ? 143  GLU A C    1 
ATOM   926   O  O    . GLU A 1 64  ? -28.058 -49.193 -11.217 1.00 55.03  ? 143  GLU A O    1 
ATOM   927   C  CB   . GLU A 1 64  ? -27.764 -50.976 -8.539  1.00 70.08  ? 143  GLU A CB   1 
ATOM   928   C  CG   . GLU A 1 64  ? -26.954 -51.343 -7.300  1.00 74.41  ? 143  GLU A CG   1 
ATOM   929   C  CD   . GLU A 1 64  ? -27.481 -52.575 -6.582  1.00 80.42  ? 143  GLU A CD   1 
ATOM   930   O  OE1  . GLU A 1 64  ? -28.238 -53.355 -7.200  1.00 79.09  ? 143  GLU A OE1  1 
ATOM   931   O  OE2  . GLU A 1 64  ? -27.131 -52.762 -5.397  1.00 82.33  ? 143  GLU A OE2  1 
ATOM   932   H  H    . GLU A 1 64  ? -28.744 -49.171 -7.181  1.00 69.38  ? 143  GLU A H    1 
ATOM   933   H  HA   . GLU A 1 64  ? -26.845 -49.215 -9.044  1.00 73.57  ? 143  GLU A HA   1 
ATOM   934   H  HB2  . GLU A 1 64  ? -28.679 -51.261 -8.390  1.00 84.10  ? 143  GLU A HB2  1 
ATOM   935   H  HB3  . GLU A 1 64  ? -27.388 -51.458 -9.292  1.00 84.10  ? 143  GLU A HB3  1 
ATOM   936   H  HG2  . GLU A 1 64  ? -26.038 -51.521 -7.565  1.00 89.30  ? 143  GLU A HG2  1 
ATOM   937   H  HG3  . GLU A 1 64  ? -26.979 -50.600 -6.677  1.00 89.30  ? 143  GLU A HG3  1 
ATOM   938   N  N    . ILE A 1 65  ? -29.897 -49.008 -9.933  1.00 51.16  ? 144  ILE A N    1 
ATOM   939   C  CA   . ILE A 1 65  ? -30.754 -48.655 -11.064 1.00 51.75  ? 144  ILE A CA   1 
ATOM   940   C  C    . ILE A 1 65  ? -30.309 -47.304 -11.612 1.00 45.12  ? 144  ILE A C    1 
ATOM   941   O  O    . ILE A 1 65  ? -30.027 -47.174 -12.800 1.00 46.16  ? 144  ILE A O    1 
ATOM   942   C  CB   . ILE A 1 65  ? -32.268 -48.608 -10.697 1.00 48.29  ? 144  ILE A CB   1 
ATOM   943   C  CG1  . ILE A 1 65  ? -32.763 -49.989 -10.255 1.00 48.27  ? 144  ILE A CG1  1 
ATOM   944   C  CG2  . ILE A 1 65  ? -33.100 -48.139 -11.900 1.00 48.14  ? 144  ILE A CG2  1 
ATOM   945   C  CD1  . ILE A 1 65  ? -34.213 -50.016 -9.789  1.00 49.03  ? 144  ILE A CD1  1 
ATOM   946   H  H    . ILE A 1 65  ? -30.307 -49.067 -9.180  1.00 61.39  ? 144  ILE A H    1 
ATOM   947   H  HA   . ILE A 1 65  ? -30.637 -49.315 -11.765 1.00 62.10  ? 144  ILE A HA   1 
ATOM   948   H  HB   . ILE A 1 65  ? -32.393 -47.983 -9.967  1.00 57.95  ? 144  ILE A HB   1 
ATOM   949   H  HG12 . ILE A 1 65  ? -32.682 -50.602 -11.002 1.00 57.92  ? 144  ILE A HG12 1 
ATOM   950   H  HG13 . ILE A 1 65  ? -32.211 -50.296 -9.518  1.00 57.92  ? 144  ILE A HG13 1 
ATOM   951   H  HG21 . ILE A 1 65  ? -34.036 -48.118 -11.647 1.00 57.77  ? 144  ILE A HG21 1 
ATOM   952   H  HG22 . ILE A 1 65  ? -32.807 -47.251 -12.159 1.00 57.77  ? 144  ILE A HG22 1 
ATOM   953   H  HG23 . ILE A 1 65  ? -32.969 -48.758 -12.635 1.00 57.77  ? 144  ILE A HG23 1 
ATOM   954   H  HD11 . ILE A 1 65  ? -34.444 -50.922 -9.529  1.00 58.84  ? 144  ILE A HD11 1 
ATOM   955   H  HD12 . ILE A 1 65  ? -34.312 -49.419 -9.032  1.00 58.84  ? 144  ILE A HD12 1 
ATOM   956   H  HD13 . ILE A 1 65  ? -34.784 -49.726 -10.518 1.00 58.84  ? 144  ILE A HD13 1 
ATOM   957   N  N    . ILE A 1 66  ? -30.205 -46.315 -10.731 1.00 31.31  ? 145  ILE A N    1 
ATOM   958   C  CA   . ILE A 1 66  ? -29.892 -44.954 -11.150 1.00 26.07  ? 145  ILE A CA   1 
ATOM   959   C  C    . ILE A 1 66  ? -28.555 -44.896 -11.894 1.00 28.93  ? 145  ILE A C    1 
ATOM   960   O  O    . ILE A 1 66  ? -28.416 -44.158 -12.868 1.00 30.68  ? 145  ILE A O    1 
ATOM   961   C  CB   . ILE A 1 66  ? -29.882 -43.979 -9.954  1.00 24.19  ? 145  ILE A CB   1 
ATOM   962   C  CG1  . ILE A 1 66  ? -31.269 -43.932 -9.298  1.00 27.73  ? 145  ILE A CG1  1 
ATOM   963   C  CG2  . ILE A 1 66  ? -29.497 -42.583 -10.421 1.00 23.68  ? 145  ILE A CG2  1 
ATOM   964   C  CD1  . ILE A 1 66  ? -31.333 -43.143 -8.001  1.00 23.07  ? 145  ILE A CD1  1 
ATOM   965   H  H    . ILE A 1 66  ? -30.312 -46.406 -9.883  1.00 37.57  ? 145  ILE A H    1 
ATOM   966   H  HA   . ILE A 1 66  ? -30.581 -44.655 -11.764 1.00 31.28  ? 145  ILE A HA   1 
ATOM   967   H  HB   . ILE A 1 66  ? -29.233 -44.285 -9.302  1.00 29.03  ? 145  ILE A HB   1 
ATOM   968   H  HG12 . ILE A 1 66  ? -31.892 -43.526 -9.920  1.00 33.27  ? 145  ILE A HG12 1 
ATOM   969   H  HG13 . ILE A 1 66  ? -31.549 -44.840 -9.102  1.00 33.27  ? 145  ILE A HG13 1 
ATOM   970   H  HG21 . ILE A 1 66  ? -29.495 -41.984 -9.658  1.00 28.42  ? 145  ILE A HG21 1 
ATOM   971   H  HG22 . ILE A 1 66  ? -28.612 -42.616 -10.818 1.00 28.42  ? 145  ILE A HG22 1 
ATOM   972   H  HG23 . ILE A 1 66  ? -30.143 -42.280 -11.078 1.00 28.42  ? 145  ILE A HG23 1 
ATOM   973   H  HD11 . ILE A 1 66  ? -32.242 -43.168 -7.662  1.00 27.68  ? 145  ILE A HD11 1 
ATOM   974   H  HD12 . ILE A 1 66  ? -30.728 -43.543 -7.358  1.00 27.68  ? 145  ILE A HD12 1 
ATOM   975   H  HD13 . ILE A 1 66  ? -31.071 -42.226 -8.177  1.00 27.68  ? 145  ILE A HD13 1 
ATOM   976   N  N    . ARG A 1 67  ? -27.585 -45.684 -11.440 1.00 51.37  ? 146  ARG A N    1 
ATOM   977   C  CA   . ARG A 1 67  ? -26.298 -45.784 -12.120 1.00 52.15  ? 146  ARG A CA   1 
ATOM   978   C  C    . ARG A 1 67  ? -26.467 -46.335 -13.535 1.00 55.29  ? 146  ARG A C    1 
ATOM   979   O  O    . ARG A 1 67  ? -25.959 -45.758 -14.497 1.00 53.82  ? 146  ARG A O    1 
ATOM   980   C  CB   . ARG A 1 67  ? -25.339 -46.668 -11.322 1.00 48.62  ? 146  ARG A CB   1 
ATOM   981   C  CG   . ARG A 1 67  ? -24.657 -45.948 -10.171 1.00 66.60  ? 146  ARG A CG   1 
ATOM   982   C  CD   . ARG A 1 67  ? -23.692 -46.868 -9.434  1.00 80.99  ? 146  ARG A CD   1 
ATOM   983   N  NE   . ARG A 1 67  ? -22.691 -46.122 -8.670  1.00 88.04  ? 146  ARG A NE   1 
ATOM   984   C  CZ   . ARG A 1 67  ? -22.834 -45.730 -7.405  1.00 86.48  ? 146  ARG A CZ   1 
ATOM   985   N  NH1  . ARG A 1 67  ? -23.944 -46.008 -6.729  1.00 80.54  ? 146  ARG A NH1  1 
ATOM   986   N  NH2  . ARG A 1 67  ? -21.857 -45.056 -6.809  1.00 83.20  ? 146  ARG A NH2  1 
ATOM   987   H  H    . ARG A 1 67  ? -27.648 -46.174 -10.736 1.00 61.64  ? 146  ARG A H    1 
ATOM   988   H  HA   . ARG A 1 67  ? -25.906 -44.899 -12.187 1.00 62.58  ? 146  ARG A HA   1 
ATOM   989   H  HB2  . ARG A 1 67  ? -25.837 -47.414 -10.952 1.00 58.34  ? 146  ARG A HB2  1 
ATOM   990   H  HB3  . ARG A 1 67  ? -24.648 -46.996 -11.918 1.00 58.34  ? 146  ARG A HB3  1 
ATOM   991   H  HG2  . ARG A 1 67  ? -24.154 -45.195 -10.518 1.00 79.92  ? 146  ARG A HG2  1 
ATOM   992   H  HG3  . ARG A 1 67  ? -25.328 -45.644 -9.541  1.00 79.92  ? 146  ARG A HG3  1 
ATOM   993   H  HD2  . ARG A 1 67  ? -24.192 -47.423 -8.815  1.00 97.19  ? 146  ARG A HD2  1 
ATOM   994   H  HD3  . ARG A 1 67  ? -23.227 -47.423 -10.080 1.00 97.19  ? 146  ARG A HD3  1 
ATOM   995   H  HE   . ARG A 1 67  ? -21.956 -45.921 -9.068  1.00 105.65 ? 146  ARG A HE   1 
ATOM   996   H  HH11 . ARG A 1 67  ? -24.581 -46.444 -7.109  1.00 96.64  ? 146  ARG A HH11 1 
ATOM   997   H  HH12 . ARG A 1 67  ? -24.026 -45.750 -5.913  1.00 96.64  ? 146  ARG A HH12 1 
ATOM   998   H  HH21 . ARG A 1 67  ? -21.136 -44.873 -7.240  1.00 99.84  ? 146  ARG A HH21 1 
ATOM   999   H  HH22 . ARG A 1 67  ? -21.947 -44.802 -5.992  1.00 99.84  ? 146  ARG A HH22 1 
ATOM   1000  N  N    . LYS A 1 68  ? -27.179 -47.454 -13.654 1.00 38.47  ? 147  LYS A N    1 
ATOM   1001  C  CA   . LYS A 1 68  ? -27.432 -48.085 -14.953 1.00 38.19  ? 147  LYS A CA   1 
ATOM   1002  C  C    . LYS A 1 68  ? -28.169 -47.141 -15.902 1.00 41.68  ? 147  LYS A C    1 
ATOM   1003  O  O    . LYS A 1 68  ? -27.979 -47.193 -17.118 1.00 47.28  ? 147  LYS A O    1 
ATOM   1004  C  CB   . LYS A 1 68  ? -28.239 -49.382 -14.772 1.00 45.05  ? 147  LYS A CB   1 
ATOM   1005  C  CG   . LYS A 1 68  ? -28.706 -50.059 -16.070 1.00 54.20  ? 147  LYS A CG   1 
ATOM   1006  C  CD   . LYS A 1 68  ? -27.557 -50.682 -16.850 1.00 54.62  ? 147  LYS A CD   1 
ATOM   1007  C  CE   . LYS A 1 68  ? -28.023 -51.212 -18.199 1.00 58.68  ? 147  LYS A CE   1 
ATOM   1008  N  NZ   . LYS A 1 68  ? -26.899 -51.381 -19.160 1.00 71.53  ? 147  LYS A NZ   1 
ATOM   1009  H  H    . LYS A 1 68  ? -27.532 -47.872 -12.991 1.00 46.17  ? 147  LYS A H    1 
ATOM   1010  H  HA   . LYS A 1 68  ? -26.583 -48.316 -15.361 1.00 45.83  ? 147  LYS A HA   1 
ATOM   1011  H  HB2  . LYS A 1 68  ? -27.688 -50.021 -14.293 1.00 54.06  ? 147  LYS A HB2  1 
ATOM   1012  H  HB3  . LYS A 1 68  ? -29.030 -49.180 -14.248 1.00 54.06  ? 147  LYS A HB3  1 
ATOM   1013  H  HG2  . LYS A 1 68  ? -29.337 -50.763 -15.850 1.00 65.04  ? 147  LYS A HG2  1 
ATOM   1014  H  HG3  . LYS A 1 68  ? -29.131 -49.397 -16.637 1.00 65.04  ? 147  LYS A HG3  1 
ATOM   1015  H  HD2  . LYS A 1 68  ? -26.875 -50.010 -17.007 1.00 65.54  ? 147  LYS A HD2  1 
ATOM   1016  H  HD3  . LYS A 1 68  ? -27.189 -51.422 -16.342 1.00 65.54  ? 147  LYS A HD3  1 
ATOM   1017  H  HE2  . LYS A 1 68  ? -28.443 -52.077 -18.072 1.00 70.42  ? 147  LYS A HE2  1 
ATOM   1018  H  HE3  . LYS A 1 68  ? -28.657 -50.588 -18.584 1.00 70.42  ? 147  LYS A HE3  1 
ATOM   1019  H  HZ1  . LYS A 1 68  ? -27.207 -51.692 -19.935 1.00 85.83  ? 147  LYS A HZ1  1 
ATOM   1020  H  HZ2  . LYS A 1 68  ? -26.499 -50.599 -19.300 1.00 85.83  ? 147  LYS A HZ2  1 
ATOM   1021  H  HZ3  . LYS A 1 68  ? -26.304 -51.957 -18.833 1.00 85.83  ? 147  LYS A HZ3  1 
HETATM 1022  N  N    . MSE A 1 69  ? -29.002 -46.272 -15.340 1.00 53.77  ? 148  MSE A N    1 
HETATM 1023  C  CA   . MSE A 1 69  ? -29.814 -45.368 -16.145 1.00 53.24  ? 148  MSE A CA   1 
HETATM 1024  C  C    . MSE A 1 69  ? -29.039 -44.105 -16.519 1.00 55.30  ? 148  MSE A C    1 
HETATM 1025  O  O    . MSE A 1 69  ? -29.367 -43.440 -17.503 1.00 54.85  ? 148  MSE A O    1 
HETATM 1026  C  CB   . MSE A 1 69  ? -31.112 -45.034 -15.409 1.00 47.44  ? 148  MSE A CB   1 
HETATM 1027  C  CG   . MSE A 1 69  ? -31.966 -46.274 -15.150 1.00 50.62  ? 148  MSE A CG   1 
HETATM 1028  SE SE   . MSE A 1 69  ? -32.571 -47.157 -16.779 1.00 74.50  ? 148  MSE A SE   1 
HETATM 1029  C  CE   . MSE A 1 69  ? -33.934 -45.874 -17.216 1.00 41.67  ? 148  MSE A CE   1 
HETATM 1030  H  H    . MSE A 1 69  ? -29.117 -46.186 -14.492 1.00 64.53  ? 148  MSE A H    1 
HETATM 1031  H  HA   . MSE A 1 69  ? -30.058 -45.827 -16.964 1.00 63.89  ? 148  MSE A HA   1 
HETATM 1032  H  HB2  . MSE A 1 69  ? -30.896 -44.633 -14.553 1.00 56.93  ? 148  MSE A HB2  1 
HETATM 1033  H  HB3  . MSE A 1 69  ? -31.632 -44.416 -15.946 1.00 56.93  ? 148  MSE A HB3  1 
HETATM 1034  H  HG2  . MSE A 1 69  ? -31.445 -46.914 -14.641 1.00 60.75  ? 148  MSE A HG2  1 
HETATM 1035  H  HG3  . MSE A 1 69  ? -32.752 -46.013 -14.645 1.00 60.75  ? 148  MSE A HG3  1 
HETATM 1036  H  HE1  . MSE A 1 69  ? -34.373 -46.147 -18.036 1.00 50.01  ? 148  MSE A HE1  1 
HETATM 1037  H  HE2  . MSE A 1 69  ? -34.578 -45.838 -16.491 1.00 50.01  ? 148  MSE A HE2  1 
HETATM 1038  H  HE3  . MSE A 1 69  ? -33.521 -45.004 -17.335 1.00 50.01  ? 148  MSE A HE3  1 
ATOM   1039  N  N    . THR A 1 70  ? -28.006 -43.783 -15.746 1.00 42.91  ? 149  THR A N    1 
ATOM   1040  C  CA   . THR A 1 70  ? -27.090 -42.715 -16.126 1.00 37.15  ? 149  THR A CA   1 
ATOM   1041  C  C    . THR A 1 70  ? -26.290 -43.177 -17.337 1.00 41.46  ? 149  THR A C    1 
ATOM   1042  O  O    . THR A 1 70  ? -26.039 -42.401 -18.259 1.00 40.07  ? 149  THR A O    1 
ATOM   1043  C  CB   . THR A 1 70  ? -26.104 -42.355 -15.000 1.00 32.54  ? 149  THR A CB   1 
ATOM   1044  O  OG1  . THR A 1 70  ? -26.822 -42.075 -13.792 1.00 31.38  ? 149  THR A OG1  1 
ATOM   1045  C  CG2  . THR A 1 70  ? -25.270 -41.138 -15.393 1.00 25.47  ? 149  THR A CG2  1 
ATOM   1046  H  H    . THR A 1 70  ? -27.814 -44.166 -15.000 1.00 51.49  ? 149  THR A H    1 
ATOM   1047  H  HA   . THR A 1 70  ? -27.593 -41.921 -16.367 1.00 44.58  ? 149  THR A HA   1 
ATOM   1048  H  HB   . THR A 1 70  ? -25.503 -43.101 -14.850 1.00 39.05  ? 149  THR A HB   1 
ATOM   1049  H  HG1  . THR A 1 70  ? -27.268 -42.748 -13.560 1.00 37.65  ? 149  THR A HG1  1 
ATOM   1050  H  HG21 . THR A 1 70  ? -24.651 -40.916 -14.680 1.00 30.57  ? 149  THR A HG21 1 
ATOM   1051  H  HG22 . THR A 1 70  ? -24.767 -41.328 -16.200 1.00 30.57  ? 149  THR A HG22 1 
ATOM   1052  H  HG23 . THR A 1 70  ? -25.850 -40.378 -15.555 1.00 30.57  ? 149  THR A HG23 1 
ATOM   1053  N  N    . GLU A 1 71  ? -25.888 -44.446 -17.323 1.00 51.60  ? 150  GLU A N    1 
ATOM   1054  C  CA   . GLU A 1 71  ? -25.146 -45.029 -18.437 1.00 54.63  ? 150  GLU A CA   1 
ATOM   1055  C  C    . GLU A 1 71  ? -25.996 -45.065 -19.693 1.00 55.00  ? 150  GLU A C    1 
ATOM   1056  O  O    . GLU A 1 71  ? -25.513 -44.786 -20.789 1.00 57.88  ? 150  GLU A O    1 
ATOM   1057  C  CB   . GLU A 1 71  ? -24.708 -46.459 -18.117 1.00 60.58  ? 150  GLU A CB   1 
ATOM   1058  C  CG   . GLU A 1 71  ? -23.780 -46.585 -16.922 1.00 73.43  ? 150  GLU A CG   1 
ATOM   1059  C  CD   . GLU A 1 71  ? -23.295 -48.010 -16.696 1.00 84.06  ? 150  GLU A CD   1 
ATOM   1060  O  OE1  . GLU A 1 71  ? -23.362 -48.827 -17.642 1.00 89.85  ? 150  GLU A OE1  1 
ATOM   1061  O  OE2  . GLU A 1 71  ? -22.852 -48.316 -15.566 1.00 84.57  ? 150  GLU A OE2  1 
ATOM   1062  H  H    . GLU A 1 71  ? -26.033 -44.993 -16.675 1.00 61.92  ? 150  GLU A H    1 
ATOM   1063  H  HA   . GLU A 1 71  ? -24.356 -44.496 -18.614 1.00 65.55  ? 150  GLU A HA   1 
ATOM   1064  H  HB2  . GLU A 1 71  ? -25.497 -46.991 -17.932 1.00 72.69  ? 150  GLU A HB2  1 
ATOM   1065  H  HB3  . GLU A 1 71  ? -24.244 -46.821 -18.888 1.00 72.69  ? 150  GLU A HB3  1 
ATOM   1066  H  HG2  . GLU A 1 71  ? -23.002 -46.023 -17.066 1.00 88.12  ? 150  GLU A HG2  1 
ATOM   1067  H  HG3  . GLU A 1 71  ? -24.252 -46.299 -16.125 1.00 88.12  ? 150  GLU A HG3  1 
ATOM   1068  N  N    . GLU A 1 72  ? -27.266 -45.414 -19.526 1.00 58.87  ? 151  GLU A N    1 
ATOM   1069  C  CA   . GLU A 1 72  ? -28.145 -45.673 -20.656 1.00 57.98  ? 151  GLU A CA   1 
ATOM   1070  C  C    . GLU A 1 72  ? -28.941 -44.445 -21.061 1.00 55.53  ? 151  GLU A C    1 
ATOM   1071  O  O    . GLU A 1 72  ? -29.835 -44.537 -21.900 1.00 61.96  ? 151  GLU A O    1 
ATOM   1072  C  CB   . GLU A 1 72  ? -29.115 -46.791 -20.296 1.00 62.11  ? 151  GLU A CB   1 
ATOM   1073  C  CG   . GLU A 1 72  ? -28.465 -48.145 -20.129 1.00 74.58  ? 151  GLU A CG   1 
ATOM   1074  C  CD   . GLU A 1 72  ? -28.474 -48.978 -21.399 1.00 90.37  ? 151  GLU A CD   1 
ATOM   1075  O  OE1  . GLU A 1 72  ? -28.620 -48.412 -22.504 1.00 88.68  ? 151  GLU A OE1  1 
ATOM   1076  O  OE2  . GLU A 1 72  ? -28.351 -50.213 -21.279 1.00 99.10  ? 151  GLU A OE2  1 
ATOM   1077  H  H    . GLU A 1 72  ? -27.645 -45.509 -18.760 1.00 70.65  ? 151  GLU A H    1 
ATOM   1078  H  HA   . GLU A 1 72  ? -27.615 -45.959 -21.417 1.00 69.58  ? 151  GLU A HA   1 
ATOM   1079  H  HB2  . GLU A 1 72  ? -29.551 -46.568 -19.458 1.00 74.53  ? 151  GLU A HB2  1 
ATOM   1080  H  HB3  . GLU A 1 72  ? -29.778 -46.867 -21.000 1.00 74.53  ? 151  GLU A HB3  1 
ATOM   1081  H  HG2  . GLU A 1 72  ? -27.541 -48.019 -19.862 1.00 89.50  ? 151  GLU A HG2  1 
ATOM   1082  H  HG3  . GLU A 1 72  ? -28.942 -48.640 -19.445 1.00 89.50  ? 151  GLU A HG3  1 
ATOM   1083  N  N    . PHE A 1 73  ? -28.623 -43.306 -20.453 1.00 41.60  ? 152  PHE A N    1 
ATOM   1084  C  CA   . PHE A 1 73  ? -29.341 -42.058 -20.708 1.00 40.58  ? 152  PHE A CA   1 
ATOM   1085  C  C    . PHE A 1 73  ? -29.451 -41.756 -22.205 1.00 48.17  ? 152  PHE A C    1 
ATOM   1086  O  O    . PHE A 1 73  ? -30.503 -41.323 -22.677 1.00 48.47  ? 152  PHE A O    1 
ATOM   1087  C  CB   . PHE A 1 73  ? -28.633 -40.902 -20.000 1.00 37.89  ? 152  PHE A CB   1 
ATOM   1088  C  CG   . PHE A 1 73  ? -29.531 -39.734 -19.679 1.00 34.19  ? 152  PHE A CG   1 
ATOM   1089  C  CD1  . PHE A 1 73  ? -29.916 -38.833 -20.664 1.00 38.75  ? 152  PHE A CD1  1 
ATOM   1090  C  CD2  . PHE A 1 73  ? -29.973 -39.527 -18.382 1.00 30.57  ? 152  PHE A CD2  1 
ATOM   1091  C  CE1  . PHE A 1 73  ? -30.737 -37.751 -20.355 1.00 35.11  ? 152  PHE A CE1  1 
ATOM   1092  C  CE2  . PHE A 1 73  ? -30.790 -38.451 -18.070 1.00 31.63  ? 152  PHE A CE2  1 
ATOM   1093  C  CZ   . PHE A 1 73  ? -31.173 -37.564 -19.058 1.00 26.26  ? 152  PHE A CZ   1 
ATOM   1094  H  H    . PHE A 1 73  ? -27.986 -43.227 -19.881 1.00 49.92  ? 152  PHE A H    1 
ATOM   1095  H  HA   . PHE A 1 73  ? -30.238 -42.129 -20.347 1.00 48.69  ? 152  PHE A HA   1 
ATOM   1096  H  HB2  . PHE A 1 73  ? -28.263 -41.228 -19.165 1.00 45.47  ? 152  PHE A HB2  1 
ATOM   1097  H  HB3  . PHE A 1 73  ? -27.919 -40.578 -20.570 1.00 45.47  ? 152  PHE A HB3  1 
ATOM   1098  H  HD1  . PHE A 1 73  ? -29.626 -38.955 -21.538 1.00 46.49  ? 152  PHE A HD1  1 
ATOM   1099  H  HD2  . PHE A 1 73  ? -29.720 -40.119 -17.711 1.00 36.68  ? 152  PHE A HD2  1 
ATOM   1100  H  HE1  . PHE A 1 73  ? -30.993 -37.156 -21.023 1.00 42.13  ? 152  PHE A HE1  1 
ATOM   1101  H  HE2  . PHE A 1 73  ? -31.082 -38.327 -17.196 1.00 37.96  ? 152  PHE A HE2  1 
ATOM   1102  H  HZ   . PHE A 1 73  ? -31.722 -36.842 -18.850 1.00 31.51  ? 152  PHE A HZ   1 
ATOM   1103  N  N    . ASP A 1 74  ? -28.360 -41.984 -22.937 1.00 45.89  ? 153  ASP A N    1 
ATOM   1104  C  CA   . ASP A 1 74  ? -28.344 -41.859 -24.398 1.00 49.01  ? 153  ASP A CA   1 
ATOM   1105  C  C    . ASP A 1 74  ? -28.792 -40.473 -24.875 1.00 47.17  ? 153  ASP A C    1 
ATOM   1106  O  O    . ASP A 1 74  ? -29.694 -40.351 -25.702 1.00 48.58  ? 153  ASP A O    1 
ATOM   1107  C  CB   . ASP A 1 74  ? -29.223 -42.950 -25.025 1.00 59.57  ? 153  ASP A CB   1 
ATOM   1108  C  CG   . ASP A 1 74  ? -28.924 -43.178 -26.502 1.00 70.42  ? 153  ASP A CG   1 
ATOM   1109  O  OD1  . ASP A 1 74  ? -27.879 -42.702 -26.994 1.00 71.40  ? 153  ASP A OD1  1 
ATOM   1110  O  OD2  . ASP A 1 74  ? -29.738 -43.850 -27.169 1.00 77.93  ? 153  ASP A OD2  1 
ATOM   1111  H  H    . ASP A 1 74  ? -27.601 -42.216 -22.605 1.00 55.06  ? 153  ASP A H    1 
ATOM   1112  H  HA   . ASP A 1 74  ? -27.436 -41.997 -24.710 1.00 58.81  ? 153  ASP A HA   1 
ATOM   1113  H  HB2  . ASP A 1 74  ? -29.070 -43.786 -24.557 1.00 71.48  ? 153  ASP A HB2  1 
ATOM   1114  H  HB3  . ASP A 1 74  ? -30.154 -42.691 -24.944 1.00 71.48  ? 153  ASP A HB3  1 
ATOM   1115  N  N    . GLU A 1 75  ? -28.141 -39.438 -24.352 1.00 48.49  ? 154  GLU A N    1 
ATOM   1116  C  CA   . GLU A 1 75  ? -28.466 -38.054 -24.676 1.00 49.69  ? 154  GLU A CA   1 
ATOM   1117  C  C    . GLU A 1 75  ? -27.728 -37.573 -25.920 1.00 54.00  ? 154  GLU A C    1 
ATOM   1118  O  O    . GLU A 1 75  ? -26.672 -38.101 -26.264 1.00 64.72  ? 154  GLU A O    1 
ATOM   1119  C  CB   . GLU A 1 75  ? -28.109 -37.141 -23.496 1.00 48.93  ? 154  GLU A CB   1 
ATOM   1120  C  CG   . GLU A 1 75  ? -26.596 -36.924 -23.247 1.00 45.81  ? 154  GLU A CG   1 
ATOM   1121  C  CD   . GLU A 1 75  ? -25.881 -38.136 -22.664 1.00 45.73  ? 154  GLU A CD   1 
ATOM   1122  O  OE1  . GLU A 1 75  ? -26.544 -39.151 -22.373 1.00 54.89  ? 154  GLU A OE1  1 
ATOM   1123  O  OE2  . GLU A 1 75  ? -24.649 -38.064 -22.483 1.00 47.75  ? 154  GLU A OE2  1 
ATOM   1124  H  H    . GLU A 1 75  ? -27.491 -39.516 -23.793 1.00 58.19  ? 154  GLU A H    1 
ATOM   1125  H  HA   . GLU A 1 75  ? -29.419 -37.979 -24.841 1.00 59.62  ? 154  GLU A HA   1 
ATOM   1126  H  HB2  . GLU A 1 75  ? -28.505 -36.270 -23.652 1.00 58.71  ? 154  GLU A HB2  1 
ATOM   1127  H  HB3  . GLU A 1 75  ? -28.483 -37.526 -22.688 1.00 58.71  ? 154  GLU A HB3  1 
ATOM   1128  H  HG2  . GLU A 1 75  ? -26.170 -36.707 -24.091 1.00 54.97  ? 154  GLU A HG2  1 
ATOM   1129  H  HG3  . GLU A 1 75  ? -26.486 -36.188 -22.625 1.00 54.97  ? 154  GLU A HG3  1 
ATOM   1130  N  N    . ASP A 1 76  ? -28.284 -36.561 -26.580 1.00 83.85  ? 155  ASP A N    1 
ATOM   1131  C  CA   . ASP A 1 76  ? -27.601 -35.885 -27.679 1.00 91.54  ? 155  ASP A CA   1 
ATOM   1132  C  C    . ASP A 1 76  ? -26.959 -34.610 -27.150 1.00 89.41  ? 155  ASP A C    1 
ATOM   1133  O  O    . ASP A 1 76  ? -25.782 -34.343 -27.398 1.00 90.48  ? 155  ASP A O    1 
ATOM   1134  C  CB   . ASP A 1 76  ? -28.582 -35.535 -28.802 1.00 101.47 ? 155  ASP A CB   1 
ATOM   1135  C  CG   . ASP A 1 76  ? -29.042 -36.753 -29.585 1.00 111.49 ? 155  ASP A CG   1 
ATOM   1136  O  OD1  . ASP A 1 76  ? -28.296 -37.755 -29.634 1.00 113.25 ? 155  ASP A OD1  1 
ATOM   1137  O  OD2  . ASP A 1 76  ? -30.150 -36.701 -30.162 1.00 112.80 ? 155  ASP A OD2  1 
ATOM   1138  H  H    . ASP A 1 76  ? -29.065 -36.244 -26.409 1.00 100.62 ? 155  ASP A H    1 
ATOM   1139  H  HA   . ASP A 1 76  ? -26.907 -36.460 -28.038 1.00 109.85 ? 155  ASP A HA   1 
ATOM   1140  H  HB2  . ASP A 1 76  ? -29.366 -35.113 -28.416 1.00 121.76 ? 155  ASP A HB2  1 
ATOM   1141  H  HB3  . ASP A 1 76  ? -28.149 -34.926 -29.421 1.00 121.76 ? 155  ASP A HB3  1 
ATOM   1142  N  N    . SER A 1 77  ? -27.753 -33.831 -26.418 1.00 58.43  ? 156  SER A N    1 
ATOM   1143  C  CA   . SER A 1 77  ? -27.298 -32.577 -25.825 1.00 52.91  ? 156  SER A CA   1 
ATOM   1144  C  C    . SER A 1 77  ? -27.383 -32.646 -24.300 1.00 46.28  ? 156  SER A C    1 
ATOM   1145  O  O    . SER A 1 77  ? -27.598 -33.720 -23.733 1.00 50.91  ? 156  SER A O    1 
ATOM   1146  C  CB   . SER A 1 77  ? -28.138 -31.411 -26.358 1.00 58.35  ? 156  SER A CB   1 
ATOM   1147  O  OG   . SER A 1 77  ? -29.523 -31.643 -26.165 1.00 56.61  ? 156  SER A OG   1 
ATOM   1148  H  H    . SER A 1 77  ? -28.576 -34.012 -26.248 1.00 70.11  ? 156  SER A H    1 
ATOM   1149  H  HA   . SER A 1 77  ? -26.373 -32.423 -26.072 1.00 63.49  ? 156  SER A HA   1 
ATOM   1150  H  HB2  . SER A 1 77  ? -27.887 -30.601 -25.886 1.00 70.03  ? 156  SER A HB2  1 
ATOM   1151  H  HB3  . SER A 1 77  ? -27.966 -31.307 -27.307 1.00 70.03  ? 156  SER A HB3  1 
ATOM   1152  H  HG   . SER A 1 77  ? -29.689 -31.734 -25.347 1.00 67.93  ? 156  SER A HG   1 
ATOM   1153  N  N    . GLY A 1 78  ? -27.192 -31.503 -23.644 1.00 38.24  ? 157  GLY A N    1 
ATOM   1154  C  CA   . GLY A 1 78  ? -27.367 -31.397 -22.205 1.00 38.48  ? 157  GLY A CA   1 
ATOM   1155  C  C    . GLY A 1 78  ? -28.777 -30.953 -21.853 1.00 44.15  ? 157  GLY A C    1 
ATOM   1156  O  O    . GLY A 1 78  ? -29.046 -30.501 -20.736 1.00 43.12  ? 157  GLY A O    1 
ATOM   1157  H  H    . GLY A 1 78  ? -26.957 -30.766 -24.019 1.00 45.88  ? 157  GLY A H    1 
ATOM   1158  H  HA2  . GLY A 1 78  ? -27.199 -32.258 -21.790 1.00 46.18  ? 157  GLY A HA2  1 
ATOM   1159  H  HA3  . GLY A 1 78  ? -26.739 -30.751 -21.845 1.00 46.18  ? 157  GLY A HA3  1 
ATOM   1160  N  N    . ASP A 1 79  ? -29.682 -31.079 -22.819 1.00 52.71  ? 158  ASP A N    1 
ATOM   1161  C  CA   . ASP A 1 79  ? -31.071 -30.696 -22.625 1.00 52.56  ? 158  ASP A CA   1 
ATOM   1162  C  C    . ASP A 1 79  ? -31.850 -31.780 -21.902 1.00 48.88  ? 158  ASP A C    1 
ATOM   1163  O  O    . ASP A 1 79  ? -31.566 -32.969 -22.044 1.00 49.39  ? 158  ASP A O    1 
ATOM   1164  C  CB   . ASP A 1 79  ? -31.735 -30.420 -23.973 1.00 57.42  ? 158  ASP A CB   1 
ATOM   1165  C  CG   . ASP A 1 79  ? -31.278 -29.115 -24.592 1.00 62.47  ? 158  ASP A CG   1 
ATOM   1166  O  OD1  . ASP A 1 79  ? -30.775 -28.243 -23.849 1.00 57.12  ? 158  ASP A OD1  1 
ATOM   1167  O  OD2  . ASP A 1 79  ? -31.436 -28.953 -25.822 1.00 70.57  ? 158  ASP A OD2  1 
ATOM   1168  H  H    . ASP A 1 79  ? -29.512 -31.388 -23.604 1.00 63.25  ? 158  ASP A H    1 
ATOM   1169  H  HA   . ASP A 1 79  ? -31.110 -29.885 -22.094 1.00 63.07  ? 158  ASP A HA   1 
ATOM   1170  H  HB2  . ASP A 1 79  ? -31.514 -31.137 -24.588 1.00 68.91  ? 158  ASP A HB2  1 
ATOM   1171  H  HB3  . ASP A 1 79  ? -32.696 -30.373 -23.850 1.00 68.91  ? 158  ASP A HB3  1 
ATOM   1172  N  N    . TYR A 1 80  ? -32.825 -31.354 -21.109 1.00 34.80  ? 159  TYR A N    1 
ATOM   1173  C  CA   . TYR A 1 80  ? -33.795 -32.271 -20.540 1.00 30.14  ? 159  TYR A CA   1 
ATOM   1174  C  C    . TYR A 1 80  ? -35.138 -31.548 -20.429 1.00 34.87  ? 159  TYR A C    1 
ATOM   1175  O  O    . TYR A 1 80  ? -35.171 -30.324 -20.306 1.00 35.69  ? 159  TYR A O    1 
ATOM   1176  C  CB   . TYR A 1 80  ? -33.318 -32.820 -19.189 1.00 27.95  ? 159  TYR A CB   1 
ATOM   1177  C  CG   . TYR A 1 80  ? -32.964 -31.771 -18.150 1.00 25.18  ? 159  TYR A CG   1 
ATOM   1178  C  CD1  . TYR A 1 80  ? -33.939 -31.204 -17.337 1.00 26.39  ? 159  TYR A CD1  1 
ATOM   1179  C  CD2  . TYR A 1 80  ? -31.650 -31.362 -17.969 1.00 25.56  ? 159  TYR A CD2  1 
ATOM   1180  C  CE1  . TYR A 1 80  ? -33.614 -30.254 -16.380 1.00 23.86  ? 159  TYR A CE1  1 
ATOM   1181  C  CE2  . TYR A 1 80  ? -31.317 -30.413 -17.017 1.00 21.10  ? 159  TYR A CE2  1 
ATOM   1182  C  CZ   . TYR A 1 80  ? -32.301 -29.861 -16.228 1.00 25.31  ? 159  TYR A CZ   1 
ATOM   1183  O  OH   . TYR A 1 80  ? -31.960 -28.921 -15.281 1.00 24.85  ? 159  TYR A OH   1 
ATOM   1184  H  H    . TYR A 1 80  ? -32.946 -30.532 -20.886 1.00 41.75  ? 159  TYR A H    1 
ATOM   1185  H  HA   . TYR A 1 80  ? -33.910 -33.022 -21.143 1.00 36.17  ? 159  TYR A HA   1 
ATOM   1186  H  HB2  . TYR A 1 80  ? -34.022 -33.373 -18.816 1.00 33.54  ? 159  TYR A HB2  1 
ATOM   1187  H  HB3  . TYR A 1 80  ? -32.526 -33.360 -19.339 1.00 33.54  ? 159  TYR A HB3  1 
ATOM   1188  H  HD1  . TYR A 1 80  ? -34.826 -31.466 -17.437 1.00 31.66  ? 159  TYR A HD1  1 
ATOM   1189  H  HD2  . TYR A 1 80  ? -30.981 -31.730 -18.500 1.00 30.68  ? 159  TYR A HD2  1 
ATOM   1190  H  HE1  . TYR A 1 80  ? -34.278 -29.881 -15.846 1.00 28.63  ? 159  TYR A HE1  1 
ATOM   1191  H  HE2  . TYR A 1 80  ? -30.432 -30.148 -16.912 1.00 25.32  ? 159  TYR A HE2  1 
ATOM   1192  H  HH   . TYR A 1 80  ? -31.132 -28.780 -15.301 1.00 29.82  ? 159  TYR A HH   1 
ATOM   1193  N  N    . PRO A 1 81  ? -36.247 -32.305 -20.490 1.00 36.75  ? 160  PRO A N    1 
ATOM   1194  C  CA   . PRO A 1 81  ? -37.609 -31.771 -20.616 1.00 30.55  ? 160  PRO A CA   1 
ATOM   1195  C  C    . PRO A 1 81  ? -37.959 -30.522 -19.797 1.00 34.83  ? 160  PRO A C    1 
ATOM   1196  O  O    . PRO A 1 81  ? -38.729 -29.699 -20.294 1.00 37.51  ? 160  PRO A O    1 
ATOM   1197  C  CB   . PRO A 1 81  ? -38.465 -32.947 -20.165 1.00 27.52  ? 160  PRO A CB   1 
ATOM   1198  C  CG   . PRO A 1 81  ? -37.704 -34.125 -20.644 1.00 29.81  ? 160  PRO A CG   1 
ATOM   1199  C  CD   . PRO A 1 81  ? -36.261 -33.780 -20.416 1.00 32.50  ? 160  PRO A CD   1 
ATOM   1200  H  HA   . PRO A 1 81  ? -37.801 -31.590 -21.550 1.00 36.66  ? 160  PRO A HA   1 
ATOM   1201  H  HB2  . PRO A 1 81  ? -38.541 -32.951 -19.198 1.00 33.02  ? 160  PRO A HB2  1 
ATOM   1202  H  HB3  . PRO A 1 81  ? -39.339 -32.903 -20.585 1.00 33.02  ? 160  PRO A HB3  1 
ATOM   1203  H  HG2  . PRO A 1 81  ? -37.955 -34.908 -20.129 1.00 35.78  ? 160  PRO A HG2  1 
ATOM   1204  H  HG3  . PRO A 1 81  ? -37.878 -34.265 -21.588 1.00 35.78  ? 160  PRO A HG3  1 
ATOM   1205  H  HD2  . PRO A 1 81  ? -35.977 -34.077 -19.537 1.00 39.00  ? 160  PRO A HD2  1 
ATOM   1206  H  HD3  . PRO A 1 81  ? -35.708 -34.159 -21.116 1.00 39.00  ? 160  PRO A HD3  1 
ATOM   1207  N  N    . LEU A 1 82  ? -37.425 -30.373 -18.588 1.00 33.70  ? 161  LEU A N    1 
ATOM   1208  C  CA   . LEU A 1 82  ? -37.800 -29.236 -17.740 1.00 31.64  ? 161  LEU A CA   1 
ATOM   1209  C  C    . LEU A 1 82  ? -37.007 -27.953 -18.020 1.00 34.55  ? 161  LEU A C    1 
ATOM   1210  O  O    . LEU A 1 82  ? -37.132 -26.974 -17.281 1.00 36.00  ? 161  LEU A O    1 
ATOM   1211  C  CB   . LEU A 1 82  ? -37.661 -29.591 -16.258 1.00 28.62  ? 161  LEU A CB   1 
ATOM   1212  C  CG   . LEU A 1 82  ? -38.564 -30.692 -15.706 1.00 28.56  ? 161  LEU A CG   1 
ATOM   1213  C  CD1  . LEU A 1 82  ? -38.191 -30.943 -14.263 1.00 36.38  ? 161  LEU A CD1  1 
ATOM   1214  C  CD2  . LEU A 1 82  ? -40.034 -30.317 -15.807 1.00 27.85  ? 161  LEU A CD2  1 
ATOM   1215  H  H    . LEU A 1 82  ? -36.851 -30.907 -18.236 1.00 40.44  ? 161  LEU A H    1 
ATOM   1216  H  HA   . LEU A 1 82  ? -38.735 -29.035 -17.901 1.00 37.96  ? 161  LEU A HA   1 
ATOM   1217  H  HB2  . LEU A 1 82  ? -36.745 -29.872 -16.102 1.00 34.35  ? 161  LEU A HB2  1 
ATOM   1218  H  HB3  . LEU A 1 82  ? -37.840 -28.791 -15.740 1.00 34.35  ? 161  LEU A HB3  1 
ATOM   1219  H  HG   . LEU A 1 82  ? -38.421 -31.510 -16.207 1.00 34.27  ? 161  LEU A HG   1 
ATOM   1220  H  HD11 . LEU A 1 82  ? -38.762 -31.641 -13.907 1.00 43.66  ? 161  LEU A HD11 1 
ATOM   1221  H  HD12 . LEU A 1 82  ? -37.263 -31.221 -14.221 1.00 43.66  ? 161  LEU A HD12 1 
ATOM   1222  H  HD13 . LEU A 1 82  ? -38.315 -30.124 -13.758 1.00 43.66  ? 161  LEU A HD13 1 
ATOM   1223  H  HD21 . LEU A 1 82  ? -40.569 -31.041 -15.446 1.00 33.42  ? 161  LEU A HD21 1 
ATOM   1224  H  HD22 . LEU A 1 82  ? -40.188 -29.506 -15.298 1.00 33.42  ? 161  LEU A HD22 1 
ATOM   1225  H  HD23 . LEU A 1 82  ? -40.258 -30.171 -16.739 1.00 33.42  ? 161  LEU A HD23 1 
ATOM   1226  N  N    . THR A 1 83  ? -36.210 -27.948 -19.084 1.00 43.29  ? 162  THR A N    1 
ATOM   1227  C  CA   . THR A 1 83  ? -35.372 -26.791 -19.401 1.00 46.79  ? 162  THR A CA   1 
ATOM   1228  C  C    . THR A 1 83  ? -35.511 -26.374 -20.860 1.00 52.20  ? 162  THR A C    1 
ATOM   1229  O  O    . THR A 1 83  ? -35.065 -25.294 -21.252 1.00 58.34  ? 162  THR A O    1 
ATOM   1230  C  CB   . THR A 1 83  ? -33.884 -27.053 -19.072 1.00 40.09  ? 162  THR A CB   1 
ATOM   1231  O  OG1  . THR A 1 83  ? -33.484 -28.327 -19.593 1.00 38.67  ? 162  THR A OG1  1 
ATOM   1232  C  CG2  . THR A 1 83  ? -33.669 -27.033 -17.570 1.00 38.24  ? 162  THR A CG2  1 
ATOM   1233  H  H    . THR A 1 83  ? -36.135 -28.600 -19.639 1.00 51.95  ? 162  THR A H    1 
ATOM   1234  H  HA   . THR A 1 83  ? -35.663 -26.044 -18.855 1.00 56.15  ? 162  THR A HA   1 
ATOM   1235  H  HB   . THR A 1 83  ? -33.338 -26.356 -19.469 1.00 48.11  ? 162  THR A HB   1 
ATOM   1236  H  HG1  . THR A 1 83  ? -33.950 -28.936 -19.252 1.00 46.41  ? 162  THR A HG1  1 
ATOM   1237  H  HG21 . THR A 1 83  ? -32.735 -27.198 -17.367 1.00 45.88  ? 162  THR A HG21 1 
ATOM   1238  H  HG22 . THR A 1 83  ? -33.922 -26.169 -17.211 1.00 45.88  ? 162  THR A HG22 1 
ATOM   1239  H  HG23 . THR A 1 83  ? -34.209 -27.720 -17.149 1.00 45.88  ? 162  THR A HG23 1 
HETATM 1240  N  N    . MSE A 1 84  ? -36.132 -27.226 -21.665 1.00 74.72  ? 163  MSE A N    1 
HETATM 1241  C  CA   . MSE A 1 84  ? -36.416 -26.862 -23.041 1.00 78.06  ? 163  MSE A CA   1 
HETATM 1242  C  C    . MSE A 1 84  ? -37.579 -25.881 -23.080 1.00 80.28  ? 163  MSE A C    1 
HETATM 1243  O  O    . MSE A 1 84  ? -38.538 -26.012 -22.317 1.00 86.79  ? 163  MSE A O    1 
HETATM 1244  C  CB   . MSE A 1 84  ? -36.741 -28.100 -23.863 1.00 71.60  ? 163  MSE A CB   1 
HETATM 1245  C  CG   . MSE A 1 84  ? -35.670 -29.166 -23.784 1.00 71.88  ? 163  MSE A CG   1 
HETATM 1246  SE SE   . MSE A 1 84  ? -35.715 -30.374 -25.308 1.00 123.67 ? 163  MSE A SE   1 
HETATM 1247  C  CE   . MSE A 1 84  ? -35.446 -32.068 -24.377 1.00 74.82  ? 163  MSE A CE   1 
HETATM 1248  H  H    . MSE A 1 84  ? -36.396 -28.013 -21.441 1.00 89.66  ? 163  MSE A H    1 
HETATM 1249  H  HA   . MSE A 1 84  ? -35.632 -26.441 -23.427 1.00 93.68  ? 163  MSE A HA   1 
HETATM 1250  H  HB2  . MSE A 1 84  ? -37.569 -28.485 -23.537 1.00 85.92  ? 163  MSE A HB2  1 
HETATM 1251  H  HB3  . MSE A 1 84  ? -36.838 -27.844 -24.793 1.00 85.92  ? 163  MSE A HB3  1 
HETATM 1252  H  HG2  . MSE A 1 84  ? -34.799 -28.740 -23.763 1.00 86.25  ? 163  MSE A HG2  1 
HETATM 1253  H  HG3  . MSE A 1 84  ? -35.803 -29.691 -22.980 1.00 86.25  ? 163  MSE A HG3  1 
HETATM 1254  H  HE1  . MSE A 1 84  ? -34.595 -32.040 -23.911 1.00 89.78  ? 163  MSE A HE1  1 
HETATM 1255  H  HE2  . MSE A 1 84  ? -36.167 -32.197 -23.741 1.00 89.78  ? 163  MSE A HE2  1 
HETATM 1256  H  HE3  . MSE A 1 84  ? -35.445 -32.788 -25.026 1.00 89.78  ? 163  MSE A HE3  1 
ATOM   1257  N  N    . ALA A 1 85  ? -37.485 -24.899 -23.971 1.00 60.94  ? 164  ALA A N    1 
ATOM   1258  C  CA   . ALA A 1 85  ? -38.492 -23.847 -24.069 1.00 62.80  ? 164  ALA A CA   1 
ATOM   1259  C  C    . ALA A 1 85  ? -39.549 -24.177 -25.127 1.00 62.26  ? 164  ALA A C    1 
ATOM   1260  O  O    . ALA A 1 85  ? -39.432 -25.163 -25.858 1.00 54.19  ? 164  ALA A O    1 
ATOM   1261  C  CB   . ALA A 1 85  ? -37.825 -22.501 -24.361 1.00 49.31  ? 164  ALA A CB   1 
ATOM   1262  H  H    . ALA A 1 85  ? -36.842 -24.819 -24.536 1.00 73.12  ? 164  ALA A H    1 
ATOM   1263  H  HA   . ALA A 1 85  ? -38.945 -23.772 -23.214 1.00 75.35  ? 164  ALA A HA   1 
ATOM   1264  H  HB1  . ALA A 1 85  ? -38.509 -21.816 -24.422 1.00 59.17  ? 164  ALA A HB1  1 
ATOM   1265  H  HB2  . ALA A 1 85  ? -37.209 -22.291 -23.641 1.00 59.17  ? 164  ALA A HB2  1 
ATOM   1266  H  HB3  . ALA A 1 85  ? -37.343 -22.563 -25.201 1.00 59.17  ? 164  ALA A HB3  1 
ATOM   1267  N  N    . GLY A 1 86  ? -40.582 -23.342 -25.188 1.00 54.45  ? 165  GLY A N    1 
ATOM   1268  C  CA   . GLY A 1 86  ? -41.693 -23.530 -26.106 1.00 62.81  ? 165  GLY A CA   1 
ATOM   1269  C  C    . GLY A 1 86  ? -42.949 -23.916 -25.347 1.00 72.47  ? 165  GLY A C    1 
ATOM   1270  O  O    . GLY A 1 86  ? -42.864 -24.351 -24.198 1.00 74.16  ? 165  GLY A O    1 
ATOM   1271  H  H    . GLY A 1 86  ? -40.662 -22.643 -24.694 1.00 65.34  ? 165  GLY A H    1 
ATOM   1272  H  HA2  . GLY A 1 86  ? -41.860 -22.708 -26.593 1.00 75.37  ? 165  GLY A HA2  1 
ATOM   1273  H  HA3  . GLY A 1 86  ? -41.481 -24.233 -26.740 1.00 75.37  ? 165  GLY A HA3  1 
ATOM   1274  N  N    . PRO A 1 87  ? -44.125 -23.752 -25.974 1.00 84.20  ? 166  PRO A N    1 
ATOM   1275  C  CA   . PRO A 1 87  ? -45.370 -24.074 -25.264 1.00 81.76  ? 166  PRO A CA   1 
ATOM   1276  C  C    . PRO A 1 87  ? -45.590 -25.573 -25.023 1.00 72.12  ? 166  PRO A C    1 
ATOM   1277  O  O    . PRO A 1 87  ? -46.173 -25.927 -23.997 1.00 74.71  ? 166  PRO A O    1 
ATOM   1278  C  CB   . PRO A 1 87  ? -46.459 -23.513 -26.191 1.00 84.11  ? 166  PRO A CB   1 
ATOM   1279  C  CG   . PRO A 1 87  ? -45.758 -22.513 -27.049 1.00 87.17  ? 166  PRO A CG   1 
ATOM   1280  C  CD   . PRO A 1 87  ? -44.389 -23.067 -27.250 1.00 85.88  ? 166  PRO A CD   1 
ATOM   1281  H  HA   . PRO A 1 87  ? -45.402 -23.607 -24.415 1.00 98.11  ? 166  PRO A HA   1 
ATOM   1282  H  HB2  . PRO A 1 87  ? -46.831 -24.228 -26.731 1.00 100.93 ? 166  PRO A HB2  1 
ATOM   1283  H  HB3  . PRO A 1 87  ? -47.151 -23.086 -25.662 1.00 100.93 ? 166  PRO A HB3  1 
ATOM   1284  H  HG2  . PRO A 1 87  ? -46.221 -22.427 -27.896 1.00 104.61 ? 166  PRO A HG2  1 
ATOM   1285  H  HG3  . PRO A 1 87  ? -45.719 -21.659 -26.590 1.00 104.61 ? 166  PRO A HG3  1 
ATOM   1286  H  HD2  . PRO A 1 87  ? -44.384 -23.701 -27.984 1.00 103.06 ? 166  PRO A HD2  1 
ATOM   1287  H  HD3  . PRO A 1 87  ? -43.750 -22.351 -27.390 1.00 103.06 ? 166  PRO A HD3  1 
ATOM   1288  N  N    . GLN A 1 88  ? -45.138 -26.432 -25.936 1.00 71.32  ? 167  GLN A N    1 
ATOM   1289  C  CA   . GLN A 1 88  ? -45.378 -27.872 -25.803 1.00 74.49  ? 167  GLN A CA   1 
ATOM   1290  C  C    . GLN A 1 88  ? -44.627 -28.459 -24.616 1.00 75.84  ? 167  GLN A C    1 
ATOM   1291  O  O    . GLN A 1 88  ? -45.007 -29.505 -24.088 1.00 81.49  ? 167  GLN A O    1 
ATOM   1292  C  CB   . GLN A 1 88  ? -44.995 -28.630 -27.080 1.00 76.48  ? 167  GLN A CB   1 
ATOM   1293  C  CG   . GLN A 1 88  ? -46.089 -28.628 -28.151 1.00 88.94  ? 167  GLN A CG   1 
ATOM   1294  C  CD   . GLN A 1 88  ? -46.074 -29.863 -29.046 1.00 101.51 ? 167  GLN A CD   1 
ATOM   1295  O  OE1  . GLN A 1 88  ? -45.646 -30.944 -28.639 1.00 103.57 ? 167  GLN A OE1  1 
ATOM   1296  N  NE2  . GLN A 1 88  ? -46.558 -29.702 -30.275 1.00 103.51 ? 167  GLN A NE2  1 
ATOM   1297  H  H    . GLN A 1 88  ? -44.691 -26.210 -26.637 1.00 85.58  ? 167  GLN A H    1 
ATOM   1298  H  HA   . GLN A 1 88  ? -46.325 -28.014 -25.650 1.00 89.39  ? 167  GLN A HA   1 
ATOM   1299  H  HB2  . GLN A 1 88  ? -44.205 -28.218 -27.463 1.00 91.77  ? 167  GLN A HB2  1 
ATOM   1300  H  HB3  . GLN A 1 88  ? -44.806 -29.553 -26.850 1.00 91.77  ? 167  GLN A HB3  1 
ATOM   1301  H  HG2  . GLN A 1 88  ? -46.954 -28.589 -27.715 1.00 106.73 ? 167  GLN A HG2  1 
ATOM   1302  H  HG3  . GLN A 1 88  ? -45.971 -27.850 -28.718 1.00 106.73 ? 167  GLN A HG3  1 
ATOM   1303  H  HE21 . GLN A 1 88  ? -46.856 -28.934 -30.522 1.00 124.21 ? 167  GLN A HE21 1 
ATOM   1304  H  HE22 . GLN A 1 88  ? -46.574 -30.366 -30.821 1.00 124.21 ? 167  GLN A HE22 1 
ATOM   1305  N  N    . TRP A 1 89  ? -43.552 -27.792 -24.210 1.00 57.32  ? 168  TRP A N    1 
ATOM   1306  C  CA   . TRP A 1 89  ? -42.788 -28.220 -23.047 1.00 48.94  ? 168  TRP A CA   1 
ATOM   1307  C  C    . TRP A 1 89  ? -43.303 -27.554 -21.778 1.00 46.62  ? 168  TRP A C    1 
ATOM   1308  O  O    . TRP A 1 89  ? -43.154 -28.097 -20.684 1.00 57.34  ? 168  TRP A O    1 
ATOM   1309  C  CB   . TRP A 1 89  ? -41.301 -27.927 -23.233 1.00 45.23  ? 168  TRP A CB   1 
ATOM   1310  C  CG   . TRP A 1 89  ? -40.615 -28.884 -24.164 1.00 49.77  ? 168  TRP A CG   1 
ATOM   1311  C  CD1  . TRP A 1 89  ? -40.010 -28.586 -25.352 1.00 54.14  ? 168  TRP A CD1  1 
ATOM   1312  C  CD2  . TRP A 1 89  ? -40.466 -30.299 -23.982 1.00 50.75  ? 168  TRP A CD2  1 
ATOM   1313  N  NE1  . TRP A 1 89  ? -39.493 -29.727 -25.919 1.00 50.50  ? 168  TRP A NE1  1 
ATOM   1314  C  CE2  . TRP A 1 89  ? -39.758 -30.790 -25.100 1.00 51.27  ? 168  TRP A CE2  1 
ATOM   1315  C  CE3  . TRP A 1 89  ? -40.860 -31.195 -22.984 1.00 51.20  ? 168  TRP A CE3  1 
ATOM   1316  C  CZ2  . TRP A 1 89  ? -39.435 -32.141 -25.243 1.00 51.43  ? 168  TRP A CZ2  1 
ATOM   1317  C  CZ3  . TRP A 1 89  ? -40.541 -32.536 -23.131 1.00 51.06  ? 168  TRP A CZ3  1 
ATOM   1318  C  CH2  . TRP A 1 89  ? -39.834 -32.995 -24.252 1.00 50.17  ? 168  TRP A CH2  1 
ATOM   1319  H  H    . TRP A 1 89  ? -43.244 -27.086 -24.593 1.00 68.79  ? 168  TRP A H    1 
ATOM   1320  H  HA   . TRP A 1 89  ? -42.890 -29.179 -22.942 1.00 58.73  ? 168  TRP A HA   1 
ATOM   1321  H  HB2  . TRP A 1 89  ? -41.200 -27.033 -23.598 1.00 54.28  ? 168  TRP A HB2  1 
ATOM   1322  H  HB3  . TRP A 1 89  ? -40.860 -27.982 -22.371 1.00 54.28  ? 168  TRP A HB3  1 
ATOM   1323  H  HD1  . TRP A 1 89  ? -39.955 -27.734 -25.723 1.00 64.96  ? 168  TRP A HD1  1 
ATOM   1324  H  HE1  . TRP A 1 89  ? -39.070 -29.766 -26.667 1.00 60.60  ? 168  TRP A HE1  1 
ATOM   1325  H  HE3  . TRP A 1 89  ? -41.327 -30.898 -22.237 1.00 61.44  ? 168  TRP A HE3  1 
ATOM   1326  H  HZ2  . TRP A 1 89  ? -38.970 -32.449 -25.987 1.00 61.72  ? 168  TRP A HZ2  1 
ATOM   1327  H  HZ3  . TRP A 1 89  ? -40.797 -33.141 -22.473 1.00 61.28  ? 168  TRP A HZ3  1 
ATOM   1328  H  HH2  . TRP A 1 89  ? -39.634 -33.900 -24.324 1.00 60.20  ? 168  TRP A HH2  1 
ATOM   1329  N  N    . LYS A 1 90  ? -43.904 -26.378 -21.918 1.00 45.15  ? 169  LYS A N    1 
ATOM   1330  C  CA   . LYS A 1 90  ? -44.539 -25.737 -20.778 1.00 50.39  ? 169  LYS A CA   1 
ATOM   1331  C  C    . LYS A 1 90  ? -45.785 -26.528 -20.414 1.00 52.21  ? 169  LYS A C    1 
ATOM   1332  O  O    . LYS A 1 90  ? -46.109 -26.690 -19.237 1.00 52.37  ? 169  LYS A O    1 
ATOM   1333  C  CB   . LYS A 1 90  ? -44.898 -24.285 -21.087 1.00 57.05  ? 169  LYS A CB   1 
ATOM   1334  C  CG   . LYS A 1 90  ? -45.417 -23.537 -19.875 1.00 63.15  ? 169  LYS A CG   1 
ATOM   1335  C  CD   . LYS A 1 90  ? -45.518 -22.044 -20.117 1.00 75.17  ? 169  LYS A CD   1 
ATOM   1336  C  CE   . LYS A 1 90  ? -45.523 -21.300 -18.790 1.00 79.93  ? 169  LYS A CE   1 
ATOM   1337  N  NZ   . LYS A 1 90  ? -45.673 -19.827 -18.938 1.00 76.16  ? 169  LYS A NZ   1 
ATOM   1338  H  H    . LYS A 1 90  ? -43.958 -25.937 -22.653 1.00 54.18  ? 169  LYS A H    1 
ATOM   1339  H  HA   . LYS A 1 90  ? -43.933 -25.750 -20.020 1.00 60.46  ? 169  LYS A HA   1 
ATOM   1340  H  HB2  . LYS A 1 90  ? -44.106 -23.825 -21.406 1.00 68.46  ? 169  LYS A HB2  1 
ATOM   1341  H  HB3  . LYS A 1 90  ? -45.589 -24.268 -21.768 1.00 68.46  ? 169  LYS A HB3  1 
ATOM   1342  H  HG2  . LYS A 1 90  ? -46.303 -23.867 -19.655 1.00 75.78  ? 169  LYS A HG2  1 
ATOM   1343  H  HG3  . LYS A 1 90  ? -44.813 -23.682 -19.131 1.00 75.78  ? 169  LYS A HG3  1 
ATOM   1344  H  HD2  . LYS A 1 90  ? -44.753 -21.746 -20.634 1.00 90.20  ? 169  LYS A HD2  1 
ATOM   1345  H  HD3  . LYS A 1 90  ? -46.344 -21.845 -20.585 1.00 90.20  ? 169  LYS A HD3  1 
ATOM   1346  H  HE2  . LYS A 1 90  ? -46.264 -21.622 -18.252 1.00 95.91  ? 169  LYS A HE2  1 
ATOM   1347  H  HE3  . LYS A 1 90  ? -44.685 -21.469 -18.332 1.00 95.91  ? 169  LYS A HE3  1 
ATOM   1348  H  HZ1  . LYS A 1 90  ? -45.670 -19.439 -18.136 1.00 91.39  ? 169  LYS A HZ1  1 
ATOM   1349  H  HZ2  . LYS A 1 90  ? -45.000 -19.500 -19.420 1.00 91.39  ? 169  LYS A HZ2  1 
ATOM   1350  H  HZ3  . LYS A 1 90  ? -46.440 -19.639 -19.347 1.00 91.39  ? 169  LYS A HZ3  1 
ATOM   1351  N  N    . LYS A 1 91  ? -46.483 -27.019 -21.433 1.00 58.60  ? 170  LYS A N    1 
ATOM   1352  C  CA   . LYS A 1 91  ? -47.651 -27.863 -21.220 1.00 55.90  ? 170  LYS A CA   1 
ATOM   1353  C  C    . LYS A 1 91  ? -47.254 -29.208 -20.630 1.00 57.15  ? 170  LYS A C    1 
ATOM   1354  O  O    . LYS A 1 91  ? -48.002 -29.789 -19.845 1.00 57.91  ? 170  LYS A O    1 
ATOM   1355  C  CB   . LYS A 1 91  ? -48.420 -28.069 -22.525 1.00 58.16  ? 170  LYS A CB   1 
ATOM   1356  C  CG   . LYS A 1 91  ? -49.368 -26.928 -22.849 1.00 81.04  ? 170  LYS A CG   1 
ATOM   1357  C  CD   . LYS A 1 91  ? -50.009 -27.087 -24.224 1.00 95.20  ? 170  LYS A CD   1 
ATOM   1358  C  CE   . LYS A 1 91  ? -50.678 -25.796 -24.693 1.00 89.21  ? 170  LYS A CE   1 
ATOM   1359  N  NZ   . LYS A 1 91  ? -51.468 -25.985 -25.944 1.00 87.71  ? 170  LYS A NZ   1 
ATOM   1360  H  H    . LYS A 1 91  ? -46.298 -26.877 -22.261 1.00 70.32  ? 170  LYS A H    1 
ATOM   1361  H  HA   . LYS A 1 91  ? -48.245 -27.424 -20.590 1.00 67.09  ? 170  LYS A HA   1 
ATOM   1362  H  HB2  . LYS A 1 91  ? -47.786 -28.146 -23.255 1.00 69.80  ? 170  LYS A HB2  1 
ATOM   1363  H  HB3  . LYS A 1 91  ? -48.944 -28.882 -22.456 1.00 69.80  ? 170  LYS A HB3  1 
ATOM   1364  H  HG2  . LYS A 1 91  ? -50.077 -26.905 -22.187 1.00 97.25  ? 170  LYS A HG2  1 
ATOM   1365  H  HG3  . LYS A 1 91  ? -48.876 -26.092 -22.841 1.00 97.25  ? 170  LYS A HG3  1 
ATOM   1366  H  HD2  . LYS A 1 91  ? -49.324 -27.326 -24.869 1.00 114.24 ? 170  LYS A HD2  1 
ATOM   1367  H  HD3  . LYS A 1 91  ? -50.685 -27.781 -24.182 1.00 114.24 ? 170  LYS A HD3  1 
ATOM   1368  H  HE2  . LYS A 1 91  ? -51.280 -25.482 -24.001 1.00 107.05 ? 170  LYS A HE2  1 
ATOM   1369  H  HE3  . LYS A 1 91  ? -49.994 -25.130 -24.867 1.00 107.05 ? 170  LYS A HE3  1 
ATOM   1370  H  HZ1  . LYS A 1 91  ? -51.842 -25.214 -26.186 1.00 105.26 ? 170  LYS A HZ1  1 
ATOM   1371  H  HZ2  . LYS A 1 91  ? -50.937 -26.267 -26.600 1.00 105.26 ? 170  LYS A HZ2  1 
ATOM   1372  H  HZ3  . LYS A 1 91  ? -52.109 -26.588 -25.811 1.00 105.26 ? 170  LYS A HZ3  1 
ATOM   1373  N  N    . PHE A 1 92  ? -46.080 -29.707 -21.004 1.00 50.38  ? 171  PHE A N    1 
ATOM   1374  C  CA   . PHE A 1 92  ? -45.603 -30.968 -20.451 1.00 46.92  ? 171  PHE A CA   1 
ATOM   1375  C  C    . PHE A 1 92  ? -45.403 -30.843 -18.948 1.00 44.17  ? 171  PHE A C    1 
ATOM   1376  O  O    . PHE A 1 92  ? -45.905 -31.656 -18.173 1.00 44.99  ? 171  PHE A O    1 
ATOM   1377  C  CB   . PHE A 1 92  ? -44.287 -31.402 -21.089 1.00 39.81  ? 171  PHE A CB   1 
ATOM   1378  C  CG   . PHE A 1 92  ? -43.574 -32.463 -20.306 1.00 44.73  ? 171  PHE A CG   1 
ATOM   1379  C  CD1  . PHE A 1 92  ? -44.020 -33.775 -20.328 1.00 48.47  ? 171  PHE A CD1  1 
ATOM   1380  C  CD2  . PHE A 1 92  ? -42.470 -32.147 -19.529 1.00 46.30  ? 171  PHE A CD2  1 
ATOM   1381  C  CE1  . PHE A 1 92  ? -43.373 -34.753 -19.596 1.00 49.19  ? 171  PHE A CE1  1 
ATOM   1382  C  CE2  . PHE A 1 92  ? -41.818 -33.120 -18.796 1.00 39.76  ? 171  PHE A CE2  1 
ATOM   1383  C  CZ   . PHE A 1 92  ? -42.268 -34.425 -18.831 1.00 45.15  ? 171  PHE A CZ   1 
ATOM   1384  H  H    . PHE A 1 92  ? -45.546 -29.339 -21.570 1.00 60.45  ? 171  PHE A H    1 
ATOM   1385  H  HA   . PHE A 1 92  ? -46.264 -31.659 -20.614 1.00 56.30  ? 171  PHE A HA   1 
ATOM   1386  H  HB2  . PHE A 1 92  ? -44.468 -31.755 -21.975 1.00 47.78  ? 171  PHE A HB2  1 
ATOM   1387  H  HB3  . PHE A 1 92  ? -43.700 -30.632 -21.154 1.00 47.78  ? 171  PHE A HB3  1 
ATOM   1388  H  HD1  . PHE A 1 92  ? -44.762 -34.000 -20.841 1.00 58.16  ? 171  PHE A HD1  1 
ATOM   1389  H  HD2  . PHE A 1 92  ? -42.163 -31.269 -19.503 1.00 55.56  ? 171  PHE A HD2  1 
ATOM   1390  H  HE1  . PHE A 1 92  ? -43.678 -35.632 -19.622 1.00 59.02  ? 171  PHE A HE1  1 
ATOM   1391  H  HE2  . PHE A 1 92  ? -41.075 -32.897 -18.282 1.00 47.72  ? 171  PHE A HE2  1 
ATOM   1392  H  HZ   . PHE A 1 92  ? -41.830 -35.082 -18.340 1.00 54.18  ? 171  PHE A HZ   1 
ATOM   1393  N  N    . LYS A 1 93  ? -44.662 -29.815 -18.549 1.00 29.06  ? 172  LYS A N    1 
ATOM   1394  C  CA   . LYS A 1 93  ? -44.331 -29.594 -17.148 1.00 29.97  ? 172  LYS A CA   1 
ATOM   1395  C  C    . LYS A 1 93  ? -45.581 -29.520 -16.280 1.00 35.29  ? 172  LYS A C    1 
ATOM   1396  O  O    . LYS A 1 93  ? -45.638 -30.118 -15.207 1.00 37.98  ? 172  LYS A O    1 
ATOM   1397  C  CB   . LYS A 1 93  ? -43.504 -28.313 -17.006 1.00 27.92  ? 172  LYS A CB   1 
ATOM   1398  C  CG   . LYS A 1 93  ? -43.290 -27.843 -15.574 1.00 22.25  ? 172  LYS A CG   1 
ATOM   1399  C  CD   . LYS A 1 93  ? -42.341 -26.664 -15.531 1.00 24.84  ? 172  LYS A CD   1 
ATOM   1400  C  CE   . LYS A 1 93  ? -42.474 -25.900 -14.233 1.00 30.82  ? 172  LYS A CE   1 
ATOM   1401  N  NZ   . LYS A 1 93  ? -41.687 -24.640 -14.286 1.00 36.51  ? 172  LYS A NZ   1 
ATOM   1402  H  H    . LYS A 1 93  ? -44.334 -29.224 -19.080 1.00 34.87  ? 172  LYS A H    1 
ATOM   1403  H  HA   . LYS A 1 93  ? -43.791 -30.335 -16.831 1.00 35.96  ? 172  LYS A HA   1 
ATOM   1404  H  HB2  . LYS A 1 93  ? -42.629 -28.466 -17.398 1.00 33.50  ? 172  LYS A HB2  1 
ATOM   1405  H  HB3  . LYS A 1 93  ? -43.954 -27.600 -17.484 1.00 33.50  ? 172  LYS A HB3  1 
ATOM   1406  H  HG2  . LYS A 1 93  ? -44.139 -27.566 -15.195 1.00 26.69  ? 172  LYS A HG2  1 
ATOM   1407  H  HG3  . LYS A 1 93  ? -42.906 -28.564 -15.051 1.00 26.69  ? 172  LYS A HG3  1 
ATOM   1408  H  HD2  . LYS A 1 93  ? -41.429 -26.984 -15.604 1.00 29.80  ? 172  LYS A HD2  1 
ATOM   1409  H  HD3  . LYS A 1 93  ? -42.546 -26.061 -16.262 1.00 29.80  ? 172  LYS A HD3  1 
ATOM   1410  H  HE2  . LYS A 1 93  ? -43.405 -25.674 -14.085 1.00 36.99  ? 172  LYS A HE2  1 
ATOM   1411  H  HE3  . LYS A 1 93  ? -42.136 -26.442 -13.503 1.00 36.99  ? 172  LYS A HE3  1 
ATOM   1412  H  HZ1  . LYS A 1 93  ? -41.771 -24.197 -13.519 1.00 43.81  ? 172  LYS A HZ1  1 
ATOM   1413  H  HZ2  . LYS A 1 93  ? -40.827 -24.824 -14.422 1.00 43.81  ? 172  LYS A HZ2  1 
ATOM   1414  H  HZ3  . LYS A 1 93  ? -41.981 -24.126 -14.951 1.00 43.81  ? 172  LYS A HZ3  1 
ATOM   1415  N  N    . SER A 1 94  ? -46.592 -28.801 -16.747 1.00 40.62  ? 173  SER A N    1 
ATOM   1416  C  CA   . SER A 1 94  ? -47.821 -28.677 -15.979 1.00 40.49  ? 173  SER A CA   1 
ATOM   1417  C  C    . SER A 1 94  ? -48.588 -30.001 -15.955 1.00 35.55  ? 173  SER A C    1 
ATOM   1418  O  O    . SER A 1 94  ? -49.217 -30.338 -14.955 1.00 33.73  ? 173  SER A O    1 
ATOM   1419  C  CB   . SER A 1 94  ? -48.696 -27.559 -16.537 1.00 40.51  ? 173  SER A CB   1 
ATOM   1420  O  OG   . SER A 1 94  ? -49.100 -27.850 -17.860 1.00 50.71  ? 173  SER A OG   1 
ATOM   1421  H  H    . SER A 1 94  ? -46.592 -28.379 -17.497 1.00 48.75  ? 173  SER A H    1 
ATOM   1422  H  HA   . SER A 1 94  ? -47.596 -28.448 -15.064 1.00 48.59  ? 173  SER A HA   1 
ATOM   1423  H  HB2  . SER A 1 94  ? -49.485 -27.467 -15.980 1.00 48.62  ? 173  SER A HB2  1 
ATOM   1424  H  HB3  . SER A 1 94  ? -48.190 -26.732 -16.536 1.00 48.62  ? 173  SER A HB3  1 
ATOM   1425  H  HG   . SER A 1 94  ? -49.580 -27.228 -18.156 1.00 60.86  ? 173  SER A HG   1 
ATOM   1426  N  N    . SER A 1 95  ? -48.527 -30.751 -17.052 1.00 29.88  ? 174  SER A N    1 
ATOM   1427  C  CA   . SER A 1 95  ? -49.136 -32.080 -17.106 1.00 27.61  ? 174  SER A CA   1 
ATOM   1428  C  C    . SER A 1 95  ? -48.418 -33.020 -16.147 1.00 27.17  ? 174  SER A C    1 
ATOM   1429  O  O    . SER A 1 95  ? -49.053 -33.782 -15.415 1.00 32.24  ? 174  SER A O    1 
ATOM   1430  C  CB   . SER A 1 95  ? -49.076 -32.649 -18.526 1.00 33.51  ? 174  SER A CB   1 
ATOM   1431  O  OG   . SER A 1 95  ? -49.908 -31.918 -19.410 1.00 32.61  ? 174  SER A OG   1 
ATOM   1432  H  H    . SER A 1 95  ? -48.137 -30.514 -17.781 1.00 35.86  ? 174  SER A H    1 
ATOM   1433  H  HA   . SER A 1 95  ? -50.067 -32.020 -16.839 1.00 33.14  ? 174  SER A HA   1 
ATOM   1434  H  HB2  . SER A 1 95  ? -48.161 -32.603 -18.845 1.00 40.21  ? 174  SER A HB2  1 
ATOM   1435  H  HB3  . SER A 1 95  ? -49.373 -33.572 -18.508 1.00 40.21  ? 174  SER A HB3  1 
ATOM   1436  H  HG   . SER A 1 95  ? -49.662 -31.115 -19.437 1.00 39.13  ? 174  SER A HG   1 
ATOM   1437  N  N    . PHE A 1 96  ? -47.089 -32.950 -16.160 1.00 30.08  ? 175  PHE A N    1 
ATOM   1438  C  CA   . PHE A 1 96  ? -46.249 -33.711 -15.243 1.00 22.38  ? 175  PHE A CA   1 
ATOM   1439  C  C    . PHE A 1 96  ? -46.637 -33.456 -13.791 1.00 24.47  ? 175  PHE A C    1 
ATOM   1440  O  O    . PHE A 1 96  ? -46.746 -34.392 -13.001 1.00 25.70  ? 175  PHE A O    1 
ATOM   1441  C  CB   . PHE A 1 96  ? -44.783 -33.335 -15.468 1.00 24.25  ? 175  PHE A CB   1 
ATOM   1442  C  CG   . PHE A 1 96  ? -43.846 -33.853 -14.413 1.00 20.63  ? 175  PHE A CG   1 
ATOM   1443  C  CD1  . PHE A 1 96  ? -43.325 -35.133 -14.496 1.00 20.11  ? 175  PHE A CD1  1 
ATOM   1444  C  CD2  . PHE A 1 96  ? -43.478 -33.052 -13.347 1.00 19.81  ? 175  PHE A CD2  1 
ATOM   1445  C  CE1  . PHE A 1 96  ? -42.461 -35.607 -13.531 1.00 16.60  ? 175  PHE A CE1  1 
ATOM   1446  C  CE2  . PHE A 1 96  ? -42.615 -33.522 -12.379 1.00 24.50  ? 175  PHE A CE2  1 
ATOM   1447  C  CZ   . PHE A 1 96  ? -42.106 -34.801 -12.473 1.00 23.51  ? 175  PHE A CZ   1 
ATOM   1448  H  H    . PHE A 1 96  ? -46.642 -32.457 -16.705 1.00 36.09  ? 175  PHE A H    1 
ATOM   1449  H  HA   . PHE A 1 96  ? -46.352 -34.659 -15.424 1.00 26.85  ? 175  PHE A HA   1 
ATOM   1450  H  HB2  . PHE A 1 96  ? -44.496 -33.696 -16.321 1.00 29.10  ? 175  PHE A HB2  1 
ATOM   1451  H  HB3  . PHE A 1 96  ? -44.708 -32.368 -15.480 1.00 29.10  ? 175  PHE A HB3  1 
ATOM   1452  H  HD1  . PHE A 1 96  ? -43.562 -35.681 -15.209 1.00 24.13  ? 175  PHE A HD1  1 
ATOM   1453  H  HD2  . PHE A 1 96  ? -43.819 -32.190 -13.279 1.00 23.78  ? 175  PHE A HD2  1 
ATOM   1454  H  HE1  . PHE A 1 96  ? -42.119 -36.470 -13.595 1.00 19.91  ? 175  PHE A HE1  1 
ATOM   1455  H  HE2  . PHE A 1 96  ? -42.376 -32.977 -11.665 1.00 29.40  ? 175  PHE A HE2  1 
ATOM   1456  H  HZ   . PHE A 1 96  ? -41.523 -35.119 -11.821 1.00 28.22  ? 175  PHE A HZ   1 
ATOM   1457  N  N    . CYS A 1 97  ? -46.851 -32.190 -13.445 1.00 35.56  ? 176  CYS A N    1 
ATOM   1458  C  CA   . CYS A 1 97  ? -47.211 -31.823 -12.077 1.00 30.98  ? 176  CYS A CA   1 
ATOM   1459  C  C    . CYS A 1 97  ? -48.659 -32.169 -11.728 1.00 34.52  ? 176  CYS A C    1 
ATOM   1460  O  O    . CYS A 1 97  ? -48.948 -32.586 -10.606 1.00 37.80  ? 176  CYS A O    1 
ATOM   1461  C  CB   . CYS A 1 97  ? -46.974 -30.330 -11.851 1.00 31.10  ? 176  CYS A CB   1 
ATOM   1462  S  SG   . CYS A 1 97  ? -45.232 -29.843 -11.875 1.00 39.34  ? 176  CYS A SG   1 
ATOM   1463  H  H    . CYS A 1 97  ? -46.794 -31.523 -13.984 1.00 42.67  ? 176  CYS A H    1 
ATOM   1464  H  HA   . CYS A 1 97  ? -46.636 -32.308 -11.465 1.00 37.17  ? 176  CYS A HA   1 
ATOM   1465  H  HB2  . CYS A 1 97  ? -47.429 -29.834 -12.550 1.00 37.32  ? 176  CYS A HB2  1 
ATOM   1466  H  HB3  . CYS A 1 97  ? -47.338 -30.085 -10.986 1.00 37.32  ? 176  CYS A HB3  1 
ATOM   1467  H  HG   . CYS A 1 97  ? -44.764 -30.121 -12.945 1.00 47.20  ? 176  CYS A HG   1 
ATOM   1468  N  N    . GLU A 1 98  ? -49.567 -31.978 -12.681 1.00 43.29  ? 177  GLU A N    1 
ATOM   1469  C  CA   . GLU A 1 98  ? -50.984 -32.266 -12.470 1.00 34.73  ? 177  GLU A CA   1 
ATOM   1470  C  C    . GLU A 1 98  ? -51.194 -33.748 -12.177 1.00 31.23  ? 177  GLU A C    1 
ATOM   1471  O  O    . GLU A 1 98  ? -51.978 -34.119 -11.308 1.00 41.58  ? 177  GLU A O    1 
ATOM   1472  C  CB   . GLU A 1 98  ? -51.781 -31.858 -13.713 1.00 41.90  ? 177  GLU A CB   1 
ATOM   1473  C  CG   . GLU A 1 98  ? -53.277 -32.180 -13.672 1.00 54.41  ? 177  GLU A CG   1 
ATOM   1474  C  CD   . GLU A 1 98  ? -54.059 -31.283 -12.726 1.00 64.21  ? 177  GLU A CD   1 
ATOM   1475  O  OE1  . GLU A 1 98  ? -53.475 -30.312 -12.194 1.00 63.97  ? 177  GLU A OE1  1 
ATOM   1476  O  OE2  . GLU A 1 98  ? -55.262 -31.552 -12.515 1.00 64.11  ? 177  GLU A OE2  1 
ATOM   1477  H  H    . GLU A 1 98  ? -49.386 -31.680 -13.467 1.00 51.95  ? 177  GLU A H    1 
ATOM   1478  H  HA   . GLU A 1 98  ? -51.310 -31.753 -11.714 1.00 41.67  ? 177  GLU A HA   1 
ATOM   1479  H  HB2  . GLU A 1 98  ? -51.692 -30.900 -13.833 1.00 50.28  ? 177  GLU A HB2  1 
ATOM   1480  H  HB3  . GLU A 1 98  ? -51.406 -32.317 -14.481 1.00 50.28  ? 177  GLU A HB3  1 
ATOM   1481  H  HG2  . GLU A 1 98  ? -53.647 -32.069 -14.562 1.00 65.29  ? 177  GLU A HG2  1 
ATOM   1482  H  HG3  . GLU A 1 98  ? -53.393 -33.097 -13.378 1.00 65.29  ? 177  GLU A HG3  1 
ATOM   1483  N  N    . PHE A 1 99  ? -50.478 -34.585 -12.915 1.00 18.18  ? 178  PHE A N    1 
ATOM   1484  C  CA   . PHE A 1 99  ? -50.576 -36.035 -12.785 1.00 24.05  ? 178  PHE A CA   1 
ATOM   1485  C  C    . PHE A 1 99  ? -50.149 -36.546 -11.407 1.00 24.76  ? 178  PHE A C    1 
ATOM   1486  O  O    . PHE A 1 99  ? -50.801 -37.420 -10.835 1.00 26.70  ? 178  PHE A O    1 
ATOM   1487  C  CB   . PHE A 1 99  ? -49.714 -36.694 -13.859 1.00 20.32  ? 178  PHE A CB   1 
ATOM   1488  C  CG   . PHE A 1 99  ? -49.609 -38.188 -13.727 1.00 19.70  ? 178  PHE A CG   1 
ATOM   1489  C  CD1  . PHE A 1 99  ? -50.572 -39.017 -14.277 1.00 25.21  ? 178  PHE A CD1  1 
ATOM   1490  C  CD2  . PHE A 1 99  ? -48.539 -38.763 -13.058 1.00 21.58  ? 178  PHE A CD2  1 
ATOM   1491  C  CE1  . PHE A 1 99  ? -50.471 -40.394 -14.158 1.00 31.57  ? 178  PHE A CE1  1 
ATOM   1492  C  CE2  . PHE A 1 99  ? -48.432 -40.138 -12.939 1.00 25.32  ? 178  PHE A CE2  1 
ATOM   1493  C  CZ   . PHE A 1 99  ? -49.396 -40.953 -13.489 1.00 26.20  ? 178  PHE A CZ   1 
ATOM   1494  H  H    . PHE A 1 99  ? -49.914 -34.332 -13.514 1.00 21.82  ? 178  PHE A H    1 
ATOM   1495  H  HA   . PHE A 1 99  ? -51.496 -36.304 -12.932 1.00 28.85  ? 178  PHE A HA   1 
ATOM   1496  H  HB2  . PHE A 1 99  ? -50.097 -36.500 -14.729 1.00 24.38  ? 178  PHE A HB2  1 
ATOM   1497  H  HB3  . PHE A 1 99  ? -48.817 -36.328 -13.807 1.00 24.38  ? 178  PHE A HB3  1 
ATOM   1498  H  HD1  . PHE A 1 99  ? -51.295 -38.646 -14.729 1.00 30.25  ? 178  PHE A HD1  1 
ATOM   1499  H  HD2  . PHE A 1 99  ? -47.883 -38.218 -12.686 1.00 25.90  ? 178  PHE A HD2  1 
ATOM   1500  H  HE1  . PHE A 1 99  ? -51.123 -40.942 -14.531 1.00 37.89  ? 178  PHE A HE1  1 
ATOM   1501  H  HE2  . PHE A 1 99  ? -47.710 -40.512 -12.487 1.00 30.38  ? 178  PHE A HE2  1 
ATOM   1502  H  HZ   . PHE A 1 99  ? -49.327 -41.876 -13.407 1.00 31.43  ? 178  PHE A HZ   1 
ATOM   1503  N  N    . ILE A 1 100 ? -49.041 -36.027 -10.888 1.00 24.84  ? 179  ILE A N    1 
ATOM   1504  C  CA   . ILE A 1 100 ? -48.570 -36.431 -9.570  1.00 15.38  ? 179  ILE A CA   1 
ATOM   1505  C  C    . ILE A 1 100 ? -49.593 -36.032 -8.510  1.00 19.86  ? 179  ILE A C    1 
ATOM   1506  O  O    . ILE A 1 100 ? -49.978 -36.845 -7.667  1.00 21.20  ? 179  ILE A O    1 
ATOM   1507  C  CB   . ILE A 1 100 ? -47.195 -35.810 -9.260  1.00 14.16  ? 179  ILE A CB   1 
ATOM   1508  C  CG1  . ILE A 1 100 ? -46.121 -36.456 -10.135 1.00 16.03  ? 179  ILE A CG1  1 
ATOM   1509  C  CG2  . ILE A 1 100 ? -46.808 -35.992 -7.788  1.00 17.34  ? 179  ILE A CG2  1 
ATOM   1510  C  CD1  . ILE A 1 100 ? -44.883 -35.616 -10.273 1.00 17.05  ? 179  ILE A CD1  1 
ATOM   1511  H  H    . ILE A 1 100 ? -48.547 -35.441 -11.278 1.00 29.81  ? 179  ILE A H    1 
ATOM   1512  H  HA   . ILE A 1 100 ? -48.475 -37.396 -9.550  1.00 18.46  ? 179  ILE A HA   1 
ATOM   1513  H  HB   . ILE A 1 100 ? -47.229 -34.861 -9.458  1.00 16.99  ? 179  ILE A HB   1 
ATOM   1514  H  HG12 . ILE A 1 100 ? -45.863 -37.305 -9.741  1.00 19.23  ? 179  ILE A HG12 1 
ATOM   1515  H  HG13 . ILE A 1 100 ? -46.484 -36.601 -11.023 1.00 19.23  ? 179  ILE A HG13 1 
ATOM   1516  H  HG21 . ILE A 1 100 ? -45.939 -35.588 -7.638  1.00 20.81  ? 179  ILE A HG21 1 
ATOM   1517  H  HG22 . ILE A 1 100 ? -47.475 -35.560 -7.231  1.00 20.81  ? 179  ILE A HG22 1 
ATOM   1518  H  HG23 . ILE A 1 100 ? -46.772 -36.940 -7.586  1.00 20.81  ? 179  ILE A HG23 1 
ATOM   1519  H  HD11 . ILE A 1 100 ? -44.247 -36.083 -10.838 1.00 20.46  ? 179  ILE A HD11 1 
ATOM   1520  H  HD12 . ILE A 1 100 ? -45.122 -34.767 -10.676 1.00 20.46  ? 179  ILE A HD12 1 
ATOM   1521  H  HD13 . ILE A 1 100 ? -44.501 -35.470 -9.394  1.00 20.46  ? 179  ILE A HD13 1 
ATOM   1522  N  N    . GLY A 1 101 ? -50.046 -34.785 -8.563  1.00 25.25  ? 180  GLY A N    1 
ATOM   1523  C  CA   . GLY A 1 101 ? -51.012 -34.300 -7.597  1.00 25.54  ? 180  GLY A CA   1 
ATOM   1524  C  C    . GLY A 1 101 ? -52.307 -35.091 -7.650  1.00 20.73  ? 180  GLY A C    1 
ATOM   1525  O  O    . GLY A 1 101 ? -52.882 -35.444 -6.620  1.00 20.69  ? 180  GLY A O    1 
ATOM   1526  H  H    . GLY A 1 101 ? -49.807 -34.203 -9.150  1.00 30.30  ? 180  GLY A H    1 
ATOM   1527  H  HA2  . GLY A 1 101 ? -50.642 -34.371 -6.703  1.00 30.65  ? 180  GLY A HA2  1 
ATOM   1528  H  HA3  . GLY A 1 101 ? -51.211 -33.367 -7.776  1.00 30.65  ? 180  GLY A HA3  1 
ATOM   1529  N  N    . VAL A 1 102 ? -52.755 -35.395 -8.863  1.00 23.15  ? 181  VAL A N    1 
ATOM   1530  C  CA   . VAL A 1 102 ? -54.034 -36.070 -9.057  1.00 24.47  ? 181  VAL A CA   1 
ATOM   1531  C  C    . VAL A 1 102 ? -53.911 -37.554 -8.722  1.00 21.08  ? 181  VAL A C    1 
ATOM   1532  O  O    . VAL A 1 102 ? -54.883 -38.186 -8.318  1.00 27.21  ? 181  VAL A O    1 
ATOM   1533  C  CB   . VAL A 1 102 ? -54.573 -35.848 -10.501 1.00 24.12  ? 181  VAL A CB   1 
ATOM   1534  C  CG1  . VAL A 1 102 ? -55.696 -36.832 -10.852 1.00 26.06  ? 181  VAL A CG1  1 
ATOM   1535  C  CG2  . VAL A 1 102 ? -55.064 -34.406 -10.659 1.00 23.47  ? 181  VAL A CG2  1 
ATOM   1536  H  H    . VAL A 1 102 ? -52.336 -35.220 -9.593  1.00 27.78  ? 181  VAL A H    1 
ATOM   1537  H  HA   . VAL A 1 102 ? -54.680 -35.686 -8.444  1.00 29.36  ? 181  VAL A HA   1 
ATOM   1538  H  HB   . VAL A 1 102 ? -53.849 -35.986 -11.130 1.00 28.94  ? 181  VAL A HB   1 
ATOM   1539  H  HG11 . VAL A 1 102 ? -55.998 -36.656 -11.757 1.00 31.27  ? 181  VAL A HG11 1 
ATOM   1540  H  HG12 . VAL A 1 102 ? -55.353 -37.737 -10.788 1.00 31.27  ? 181  VAL A HG12 1 
ATOM   1541  H  HG13 . VAL A 1 102 ? -56.429 -36.711 -10.228 1.00 31.27  ? 181  VAL A HG13 1 
ATOM   1542  H  HG21 . VAL A 1 102 ? -55.396 -34.284 -11.562 1.00 28.17  ? 181  VAL A HG21 1 
ATOM   1543  H  HG22 . VAL A 1 102 ? -55.774 -34.243 -10.020 1.00 28.17  ? 181  VAL A HG22 1 
ATOM   1544  H  HG23 . VAL A 1 102 ? -54.324 -33.802 -10.494 1.00 28.17  ? 181  VAL A HG23 1 
ATOM   1545  N  N    . LEU A 1 103 ? -52.712 -38.106 -8.865  1.00 23.96  ? 182  LEU A N    1 
ATOM   1546  C  CA   . LEU A 1 103 ? -52.487 -39.508 -8.522  1.00 24.26  ? 182  LEU A CA   1 
ATOM   1547  C  C    . LEU A 1 103 ? -52.622 -39.719 -7.015  1.00 27.44  ? 182  LEU A C    1 
ATOM   1548  O  O    . LEU A 1 103 ? -53.302 -40.643 -6.560  1.00 23.45  ? 182  LEU A O    1 
ATOM   1549  C  CB   . LEU A 1 103 ? -51.110 -39.976 -9.005  1.00 22.12  ? 182  LEU A CB   1 
ATOM   1550  C  CG   . LEU A 1 103 ? -50.690 -41.396 -8.615  1.00 17.18  ? 182  LEU A CG   1 
ATOM   1551  C  CD1  . LEU A 1 103 ? -51.758 -42.409 -8.992  1.00 32.09  ? 182  LEU A CD1  1 
ATOM   1552  C  CD2  . LEU A 1 103 ? -49.375 -41.748 -9.286  1.00 15.51  ? 182  LEU A CD2  1 
ATOM   1553  H  H    . LEU A 1 103 ? -52.015 -37.695 -9.156  1.00 28.75  ? 182  LEU A H    1 
ATOM   1554  H  HA   . LEU A 1 103 ? -53.159 -40.052 -8.961  1.00 29.11  ? 182  LEU A HA   1 
ATOM   1555  H  HB2  . LEU A 1 103 ? -51.097 -39.929 -9.974  1.00 26.54  ? 182  LEU A HB2  1 
ATOM   1556  H  HB3  . LEU A 1 103 ? -50.441 -39.371 -8.646  1.00 26.54  ? 182  LEU A HB3  1 
ATOM   1557  H  HG   . LEU A 1 103 ? -50.561 -41.438 -7.655  1.00 20.62  ? 182  LEU A HG   1 
ATOM   1558  H  HD11 . LEU A 1 103 ? -51.459 -43.294 -8.731  1.00 38.51  ? 182  LEU A HD11 1 
ATOM   1559  H  HD12 . LEU A 1 103 ? -52.581 -42.187 -8.528  1.00 38.51  ? 182  LEU A HD12 1 
ATOM   1560  H  HD13 . LEU A 1 103 ? -51.900 -42.376 -9.951  1.00 38.51  ? 182  LEU A HD13 1 
ATOM   1561  H  HD21 . LEU A 1 103 ? -49.122 -42.649 -9.030  1.00 18.61  ? 182  LEU A HD21 1 
ATOM   1562  H  HD22 . LEU A 1 103 ? -49.487 -41.696 -10.248 1.00 18.61  ? 182  LEU A HD22 1 
ATOM   1563  H  HD23 . LEU A 1 103 ? -48.696 -41.119 -8.997  1.00 18.61  ? 182  LEU A HD23 1 
ATOM   1564  N  N    . VAL A 1 104 ? -51.988 -38.844 -6.243  1.00 19.93  ? 183  VAL A N    1 
ATOM   1565  C  CA   . VAL A 1 104 ? -52.008 -38.967 -4.791  1.00 13.66  ? 183  VAL A CA   1 
ATOM   1566  C  C    . VAL A 1 104 ? -53.398 -38.723 -4.246  1.00 13.99  ? 183  VAL A C    1 
ATOM   1567  O  O    . VAL A 1 104 ? -53.878 -39.488 -3.415  1.00 24.03  ? 183  VAL A O    1 
ATOM   1568  C  CB   . VAL A 1 104 ? -51.021 -37.979 -4.131  1.00 13.09  ? 183  VAL A CB   1 
ATOM   1569  C  CG1  . VAL A 1 104 ? -51.168 -37.956 -2.601  1.00 14.64  ? 183  VAL A CG1  1 
ATOM   1570  C  CG2  . VAL A 1 104 ? -49.616 -38.347 -4.498  1.00 12.66  ? 183  VAL A CG2  1 
ATOM   1571  H  H    . VAL A 1 104 ? -51.540 -38.171 -6.534  1.00 23.92  ? 183  VAL A H    1 
ATOM   1572  H  HA   . VAL A 1 104 ? -51.742 -39.867 -4.546  1.00 16.39  ? 183  VAL A HA   1 
ATOM   1573  H  HB   . VAL A 1 104 ? -51.195 -37.085 -4.464  1.00 15.71  ? 183  VAL A HB   1 
ATOM   1574  H  HG11 . VAL A 1 104 ? -50.530 -37.324 -2.232  1.00 17.57  ? 183  VAL A HG11 1 
ATOM   1575  H  HG12 . VAL A 1 104 ? -52.071 -37.685 -2.375  1.00 17.57  ? 183  VAL A HG12 1 
ATOM   1576  H  HG13 . VAL A 1 104 ? -50.992 -38.844 -2.254  1.00 17.57  ? 183  VAL A HG13 1 
ATOM   1577  H  HG21 . VAL A 1 104 ? -49.006 -37.721 -4.078  1.00 15.19  ? 183  VAL A HG21 1 
ATOM   1578  H  HG22 . VAL A 1 104 ? -49.434 -39.247 -4.185  1.00 15.19  ? 183  VAL A HG22 1 
ATOM   1579  H  HG23 . VAL A 1 104 ? -49.521 -38.306 -5.462  1.00 15.19  ? 183  VAL A HG23 1 
ATOM   1580  N  N    . ARG A 1 105 ? -54.040 -37.657 -4.714  1.00 34.06  ? 184  ARG A N    1 
ATOM   1581  C  CA   . ARG A 1 105 ? -55.366 -37.296 -4.233  1.00 26.07  ? 184  ARG A CA   1 
ATOM   1582  C  C    . ARG A 1 105 ? -56.362 -38.417 -4.502  1.00 26.12  ? 184  ARG A C    1 
ATOM   1583  O  O    . ARG A 1 105 ? -57.258 -38.652 -3.696  1.00 31.56  ? 184  ARG A O    1 
ATOM   1584  C  CB   . ARG A 1 105 ? -55.826 -35.978 -4.868  1.00 32.47  ? 184  ARG A CB   1 
ATOM   1585  C  CG   . ARG A 1 105 ? -55.155 -34.746 -4.245  1.00 38.97  ? 184  ARG A CG   1 
ATOM   1586  C  CD   . ARG A 1 105 ? -55.345 -33.475 -5.077  1.00 43.91  ? 184  ARG A CD   1 
ATOM   1587  N  NE   . ARG A 1 105 ? -54.701 -32.306 -4.468  1.00 51.35  ? 184  ARG A NE   1 
ATOM   1588  C  CZ   . ARG A 1 105 ? -53.412 -31.986 -4.609  1.00 46.70  ? 184  ARG A CZ   1 
ATOM   1589  N  NH1  . ARG A 1 105 ? -52.601 -32.741 -5.340  1.00 39.32  ? 184  ARG A NH1  1 
ATOM   1590  N  NH2  . ARG A 1 105 ? -52.925 -30.900 -4.018  1.00 37.27  ? 184  ARG A NH2  1 
ATOM   1591  H  H    . ARG A 1 105 ? -53.726 -37.125 -5.312  1.00 40.87  ? 184  ARG A H    1 
ATOM   1592  H  HA   . ARG A 1 105 ? -55.324 -37.162 -3.273  1.00 31.29  ? 184  ARG A HA   1 
ATOM   1593  H  HB2  . ARG A 1 105 ? -55.609 -35.991 -5.813  1.00 38.97  ? 184  ARG A HB2  1 
ATOM   1594  H  HB3  . ARG A 1 105 ? -56.784 -35.888 -4.749  1.00 38.97  ? 184  ARG A HB3  1 
ATOM   1595  H  HG2  . ARG A 1 105 ? -55.536 -34.589 -3.368  1.00 46.77  ? 184  ARG A HG2  1 
ATOM   1596  H  HG3  . ARG A 1 105 ? -54.202 -34.912 -4.167  1.00 46.77  ? 184  ARG A HG3  1 
ATOM   1597  H  HD2  . ARG A 1 105 ? -54.957 -33.609 -5.955  1.00 52.69  ? 184  ARG A HD2  1 
ATOM   1598  H  HD3  . ARG A 1 105 ? -56.294 -33.288 -5.157  1.00 52.69  ? 184  ARG A HD3  1 
ATOM   1599  H  HE   . ARG A 1 105 ? -55.189 -31.789 -3.984  1.00 61.62  ? 184  ARG A HE   1 
ATOM   1600  H  HH11 . ARG A 1 105 ? -52.905 -33.445 -5.729  1.00 47.19  ? 184  ARG A HH11 1 
ATOM   1601  H  HH12 . ARG A 1 105 ? -51.773 -32.526 -5.425  1.00 47.19  ? 184  ARG A HH12 1 
ATOM   1602  H  HH21 . ARG A 1 105 ? -53.439 -30.402 -3.541  1.00 44.73  ? 184  ARG A HH21 1 
ATOM   1603  H  HH22 . ARG A 1 105 ? -52.094 -30.697 -4.109  1.00 44.73  ? 184  ARG A HH22 1 
ATOM   1604  N  N    . GLN A 1 106 ? -56.190 -39.122 -5.618  1.00 17.57  ? 185  GLN A N    1 
ATOM   1605  C  CA   . GLN A 1 106 ? -57.085 -40.224 -5.976  1.00 18.54  ? 185  GLN A CA   1 
ATOM   1606  C  C    . GLN A 1 106 ? -56.759 -41.528 -5.238  1.00 23.18  ? 185  GLN A C    1 
ATOM   1607  O  O    . GLN A 1 106 ? -57.459 -42.524 -5.408  1.00 27.76  ? 185  GLN A O    1 
ATOM   1608  C  CB   . GLN A 1 106 ? -57.057 -40.476 -7.490  1.00 17.29  ? 185  GLN A CB   1 
ATOM   1609  C  CG   . GLN A 1 106 ? -57.681 -39.372 -8.334  1.00 22.55  ? 185  GLN A CG   1 
ATOM   1610  C  CD   . GLN A 1 106 ? -59.195 -39.409 -8.301  1.00 30.21  ? 185  GLN A CD   1 
ATOM   1611  O  OE1  . GLN A 1 106 ? -59.836 -38.567 -7.671  1.00 25.04  ? 185  GLN A OE1  1 
ATOM   1612  N  NE2  . GLN A 1 106 ? -59.776 -40.391 -8.984  1.00 29.27  ? 185  GLN A NE2  1 
ATOM   1613  H  H    . GLN A 1 106 ? -55.560 -38.983 -6.187  1.00 21.08  ? 185  GLN A H    1 
ATOM   1614  H  HA   . GLN A 1 106 ? -57.991 -39.973 -5.738  1.00 22.25  ? 185  GLN A HA   1 
ATOM   1615  H  HB2  . GLN A 1 106 ? -56.134 -40.573 -7.770  1.00 20.75  ? 185  GLN A HB2  1 
ATOM   1616  H  HB3  . GLN A 1 106 ? -57.541 -41.296 -7.676  1.00 20.75  ? 185  GLN A HB3  1 
ATOM   1617  H  HG2  . GLN A 1 106 ? -57.393 -38.511 -7.993  1.00 27.06  ? 185  GLN A HG2  1 
ATOM   1618  H  HG3  . GLN A 1 106 ? -57.397 -39.478 -9.255  1.00 27.06  ? 185  GLN A HG3  1 
ATOM   1619  H  HE21 . GLN A 1 106 ? -59.294 -40.961 -9.412  1.00 35.12  ? 185  GLN A HE21 1 
ATOM   1620  H  HE22 . GLN A 1 106 ? -60.633 -40.456 -8.997  1.00 35.12  ? 185  GLN A HE22 1 
ATOM   1621  N  N    . CYS A 1 107 ? -55.703 -41.523 -4.429  1.00 29.46  ? 186  CYS A N    1 
ATOM   1622  C  CA   . CYS A 1 107 ? -55.264 -42.723 -3.713  1.00 21.69  ? 186  CYS A CA   1 
ATOM   1623  C  C    . CYS A 1 107 ? -55.383 -42.563 -2.200  1.00 22.57  ? 186  CYS A C    1 
ATOM   1624  O  O    . CYS A 1 107 ? -55.144 -43.509 -1.449  1.00 30.29  ? 186  CYS A O    1 
ATOM   1625  C  CB   . CYS A 1 107 ? -53.806 -43.033 -4.065  1.00 22.93  ? 186  CYS A CB   1 
ATOM   1626  S  SG   . CYS A 1 107 ? -53.528 -43.665 -5.751  1.00 24.34  ? 186  CYS A SG   1 
ATOM   1627  H  H    . CYS A 1 107 ? -55.217 -40.830 -4.275  1.00 35.36  ? 186  CYS A H    1 
ATOM   1628  H  HA   . CYS A 1 107 ? -55.811 -43.476 -3.985  1.00 26.02  ? 186  CYS A HA   1 
ATOM   1629  H  HB2  . CYS A 1 107 ? -53.287 -42.219 -3.969  1.00 27.51  ? 186  CYS A HB2  1 
ATOM   1630  H  HB3  . CYS A 1 107 ? -53.476 -43.702 -3.445  1.00 27.51  ? 186  CYS A HB3  1 
ATOM   1631  H  HG   . CYS A 1 107 ? -53.908 -42.847 -6.543  1.00 29.20  ? 186  CYS A HG   1 
ATOM   1632  N  N    . GLN A 1 108 ? -55.778 -41.372 -1.764  1.00 16.78  ? 187  GLN A N    1 
ATOM   1633  C  CA   . GLN A 1 108 ? -55.626 -40.964 -0.371  1.00 18.08  ? 187  GLN A CA   1 
ATOM   1634  C  C    . GLN A 1 108 ? -56.474 -41.735 0.633   1.00 19.11  ? 187  GLN A C    1 
ATOM   1635  O  O    . GLN A 1 108 ? -56.302 -41.566 1.844   1.00 18.59  ? 187  GLN A O    1 
ATOM   1636  C  CB   . GLN A 1 108 ? -55.940 -39.477 -0.237  1.00 22.28  ? 187  GLN A CB   1 
ATOM   1637  C  CG   . GLN A 1 108 ? -57.382 -39.123 -0.519  1.00 15.59  ? 187  GLN A CG   1 
ATOM   1638  C  CD   . GLN A 1 108 ? -57.614 -37.636 -0.479  1.00 16.95  ? 187  GLN A CD   1 
ATOM   1639  O  OE1  . GLN A 1 108 ? -57.568 -37.020 0.585   1.00 17.47  ? 187  GLN A OE1  1 
ATOM   1640  N  NE2  . GLN A 1 108 ? -57.851 -37.041 -1.642  1.00 25.46  ? 187  GLN A NE2  1 
ATOM   1641  H  H    . GLN A 1 108 ? -56.142 -40.773 -2.262  1.00 20.14  ? 187  GLN A H    1 
ATOM   1642  H  HA   . GLN A 1 108 ? -54.698 -41.088 -0.118  1.00 21.70  ? 187  GLN A HA   1 
ATOM   1643  H  HB2  . GLN A 1 108 ? -55.739 -39.196 0.669   1.00 26.74  ? 187  GLN A HB2  1 
ATOM   1644  H  HB3  . GLN A 1 108 ? -55.387 -38.985 -0.864  1.00 26.74  ? 187  GLN A HB3  1 
ATOM   1645  H  HG2  . GLN A 1 108 ? -57.622 -39.443 -1.403  1.00 18.71  ? 187  GLN A HG2  1 
ATOM   1646  H  HG3  . GLN A 1 108 ? -57.949 -39.536 0.151   1.00 18.71  ? 187  GLN A HG3  1 
ATOM   1647  H  HE21 . GLN A 1 108 ? -57.867 -37.504 -2.367  1.00 30.56  ? 187  GLN A HE21 1 
ATOM   1648  H  HE22 . GLN A 1 108 ? -57.990 -36.192 -1.671  1.00 30.56  ? 187  GLN A HE22 1 
ATOM   1649  N  N    . TYR A 1 109 ? -57.390 -42.564 0.139   1.00 17.02  ? 188  TYR A N    1 
ATOM   1650  C  CA   . TYR A 1 109 ? -58.350 -43.238 1.009   1.00 17.87  ? 188  TYR A CA   1 
ATOM   1651  C  C    . TYR A 1 109 ? -58.087 -44.735 1.144   1.00 19.31  ? 188  TYR A C    1 
ATOM   1652  O  O    . TYR A 1 109 ? -58.512 -45.355 2.119   1.00 19.99  ? 188  TYR A O    1 
ATOM   1653  C  CB   . TYR A 1 109 ? -59.775 -42.988 0.510   1.00 18.38  ? 188  TYR A CB   1 
ATOM   1654  C  CG   . TYR A 1 109 ? -60.197 -41.530 0.567   1.00 17.93  ? 188  TYR A CG   1 
ATOM   1655  C  CD1  . TYR A 1 109 ? -60.121 -40.810 1.749   1.00 17.72  ? 188  TYR A CD1  1 
ATOM   1656  C  CD2  . TYR A 1 109 ? -60.669 -40.874 -0.565  1.00 18.99  ? 188  TYR A CD2  1 
ATOM   1657  C  CE1  . TYR A 1 109 ? -60.503 -39.484 1.809   1.00 17.49  ? 188  TYR A CE1  1 
ATOM   1658  C  CE2  . TYR A 1 109 ? -61.054 -39.542 -0.515  1.00 17.70  ? 188  TYR A CE2  1 
ATOM   1659  C  CZ   . TYR A 1 109 ? -60.966 -38.852 0.675   1.00 17.48  ? 188  TYR A CZ   1 
ATOM   1660  O  OH   . TYR A 1 109 ? -61.347 -37.529 0.738   1.00 17.44  ? 188  TYR A OH   1 
ATOM   1661  H  H    . TYR A 1 109 ? -57.476 -42.752 -0.696  1.00 20.43  ? 188  TYR A H    1 
ATOM   1662  H  HA   . TYR A 1 109 ? -58.282 -42.852 1.896   1.00 21.45  ? 188  TYR A HA   1 
ATOM   1663  H  HB2  . TYR A 1 109 ? -59.838 -43.279 -0.414  1.00 22.06  ? 188  TYR A HB2  1 
ATOM   1664  H  HB3  . TYR A 1 109 ? -60.392 -43.497 1.058   1.00 22.06  ? 188  TYR A HB3  1 
ATOM   1665  H  HD1  . TYR A 1 109 ? -59.808 -41.230 2.518   1.00 21.26  ? 188  TYR A HD1  1 
ATOM   1666  H  HD2  . TYR A 1 109 ? -60.728 -41.337 -1.369  1.00 22.79  ? 188  TYR A HD2  1 
ATOM   1667  H  HE1  . TYR A 1 109 ? -60.445 -39.017 2.612   1.00 20.99  ? 188  TYR A HE1  1 
ATOM   1668  H  HE2  . TYR A 1 109 ? -61.368 -39.117 -1.280  1.00 21.24  ? 188  TYR A HE2  1 
ATOM   1669  H  HH   . TYR A 1 109 ? -61.607 -37.268 -0.017  1.00 20.92  ? 188  TYR A HH   1 
ATOM   1670  N  N    . SER A 1 110 ? -57.383 -45.309 0.175   1.00 22.94  ? 189  SER A N    1 
ATOM   1671  C  CA   . SER A 1 110 ? -57.078 -46.733 0.197   1.00 25.61  ? 189  SER A CA   1 
ATOM   1672  C  C    . SER A 1 110 ? -55.604 -46.993 -0.134  1.00 26.38  ? 189  SER A C    1 
ATOM   1673  O  O    . SER A 1 110 ? -54.779 -47.165 0.769   1.00 19.96  ? 189  SER A O    1 
ATOM   1674  C  CB   . SER A 1 110 ? -57.989 -47.483 -0.780  1.00 24.60  ? 189  SER A CB   1 
ATOM   1675  O  OG   . SER A 1 110 ? -57.846 -46.978 -2.098  1.00 35.08  ? 189  SER A OG   1 
ATOM   1676  H  H    . SER A 1 110 ? -57.070 -44.893 -0.509  1.00 27.52  ? 189  SER A H    1 
ATOM   1677  H  HA   . SER A 1 110 ? -57.249 -47.077 1.088   1.00 30.73  ? 189  SER A HA   1 
ATOM   1678  H  HB2  . SER A 1 110 ? -57.749 -48.423 -0.776  1.00 29.52  ? 189  SER A HB2  1 
ATOM   1679  H  HB3  . SER A 1 110 ? -58.911 -47.375 -0.499  1.00 29.52  ? 189  SER A HB3  1 
ATOM   1680  H  HG   . SER A 1 110 ? -58.051 -46.164 -2.117  1.00 42.10  ? 189  SER A HG   1 
ATOM   1681  N  N    . ILE A 1 111 ? -55.285 -47.006 -1.428  1.00 20.97  ? 190  ILE A N    1 
ATOM   1682  C  CA   . ILE A 1 111 ? -53.957 -47.392 -1.914  1.00 24.52  ? 190  ILE A CA   1 
ATOM   1683  C  C    . ILE A 1 111 ? -52.814 -46.729 -1.160  1.00 18.14  ? 190  ILE A C    1 
ATOM   1684  O  O    . ILE A 1 111 ? -51.818 -47.375 -0.854  1.00 26.88  ? 190  ILE A O    1 
ATOM   1685  C  CB   . ILE A 1 111 ? -53.793 -47.074 -3.423  1.00 23.67  ? 190  ILE A CB   1 
ATOM   1686  C  CG1  . ILE A 1 111 ? -54.583 -48.077 -4.262  1.00 22.40  ? 190  ILE A CG1  1 
ATOM   1687  C  CG2  . ILE A 1 111 ? -52.312 -47.115 -3.856  1.00 18.47  ? 190  ILE A CG2  1 
ATOM   1688  C  CD1  . ILE A 1 111 ? -54.758 -47.666 -5.715  1.00 26.06  ? 190  ILE A CD1  1 
ATOM   1689  H  H    . ILE A 1 111 ? -55.831 -46.790 -2.057  1.00 25.17  ? 190  ILE A H    1 
ATOM   1690  H  HA   . ILE A 1 111 ? -53.859 -48.351 -1.805  1.00 29.42  ? 190  ILE A HA   1 
ATOM   1691  H  HB   . ILE A 1 111 ? -54.142 -46.185 -3.593  1.00 28.41  ? 190  ILE A HB   1 
ATOM   1692  H  HG12 . ILE A 1 111 ? -54.118 -48.929 -4.250  1.00 26.88  ? 190  ILE A HG12 1 
ATOM   1693  H  HG13 . ILE A 1 111 ? -55.467 -48.180 -3.876  1.00 26.88  ? 190  ILE A HG13 1 
ATOM   1694  H  HG21 . ILE A 1 111 ? -52.254 -46.911 -4.803  1.00 22.16  ? 190  ILE A HG21 1 
ATOM   1695  H  HG22 . ILE A 1 111 ? -51.816 -46.456 -3.345  1.00 22.16  ? 190  ILE A HG22 1 
ATOM   1696  H  HG23 . ILE A 1 111 ? -51.957 -48.001 -3.686  1.00 22.16  ? 190  ILE A HG23 1 
ATOM   1697  H  HD11 . ILE A 1 111 ? -55.266 -48.351 -6.177  1.00 31.27  ? 190  ILE A HD11 1 
ATOM   1698  H  HD12 . ILE A 1 111 ? -55.233 -46.821 -5.749  1.00 31.27  ? 190  ILE A HD12 1 
ATOM   1699  H  HD13 . ILE A 1 111 ? -53.883 -47.571 -6.123  1.00 31.27  ? 190  ILE A HD13 1 
ATOM   1700  N  N    . ILE A 1 112 ? -52.964 -45.447 -0.854  1.00 25.36  ? 191  ILE A N    1 
ATOM   1701  C  CA   . ILE A 1 112 ? -51.868 -44.668 -0.289  1.00 23.34  ? 191  ILE A CA   1 
ATOM   1702  C  C    . ILE A 1 112 ? -51.319 -45.268 1.012   1.00 21.21  ? 191  ILE A C    1 
ATOM   1703  O  O    . ILE A 1 112 ? -50.173 -45.013 1.375   1.00 28.78  ? 191  ILE A O    1 
ATOM   1704  C  CB   . ILE A 1 112 ? -52.291 -43.192 -0.060  1.00 24.52  ? 191  ILE A CB   1 
ATOM   1705  C  CG1  . ILE A 1 112 ? -51.069 -42.270 -0.120  1.00 24.22  ? 191  ILE A CG1  1 
ATOM   1706  C  CG2  . ILE A 1 112 ? -53.093 -43.050 1.242   1.00 32.36  ? 191  ILE A CG2  1 
ATOM   1707  C  CD1  . ILE A 1 112 ? -51.392 -40.814 0.152   1.00 32.83  ? 191  ILE A CD1  1 
ATOM   1708  H  H    . ILE A 1 112 ? -53.692 -45.002 -0.963  1.00 30.44  ? 191  ILE A H    1 
ATOM   1709  H  HA   . ILE A 1 112 ? -51.140 -44.662 -0.930  1.00 28.01  ? 191  ILE A HA   1 
ATOM   1710  H  HB   . ILE A 1 112 ? -52.878 -42.942 -0.790  1.00 29.42  ? 191  ILE A HB   1 
ATOM   1711  H  HG12 . ILE A 1 112 ? -50.424 -42.561 0.545   1.00 29.07  ? 191  ILE A HG12 1 
ATOM   1712  H  HG13 . ILE A 1 112 ? -50.677 -42.327 -1.005  1.00 29.07  ? 191  ILE A HG13 1 
ATOM   1713  H  HG21 . ILE A 1 112 ? -53.343 -42.120 1.358   1.00 38.83  ? 191  ILE A HG21 1 
ATOM   1714  H  HG22 . ILE A 1 112 ? -53.889 -43.602 1.184   1.00 38.83  ? 191  ILE A HG22 1 
ATOM   1715  H  HG23 . ILE A 1 112 ? -52.542 -43.340 1.985   1.00 38.83  ? 191  ILE A HG23 1 
ATOM   1716  H  HD11 . ILE A 1 112 ? -50.575 -40.294 0.098   1.00 39.39  ? 191  ILE A HD11 1 
ATOM   1717  H  HD12 . ILE A 1 112 ? -52.028 -40.503 -0.511  1.00 39.39  ? 191  ILE A HD12 1 
ATOM   1718  H  HD13 . ILE A 1 112 ? -51.776 -40.737 1.040   1.00 39.39  ? 191  ILE A HD13 1 
ATOM   1719  N  N    . TYR A 1 113 ? -52.127 -46.080 1.693   1.00 20.95  ? 192  TYR A N    1 
ATOM   1720  C  CA   . TYR A 1 113 ? -51.748 -46.656 2.986   1.00 24.01  ? 192  TYR A CA   1 
ATOM   1721  C  C    . TYR A 1 113 ? -51.322 -48.128 2.886   1.00 27.06  ? 192  TYR A C    1 
ATOM   1722  O  O    . TYR A 1 113 ? -51.217 -48.810 3.907   1.00 25.66  ? 192  TYR A O    1 
ATOM   1723  C  CB   . TYR A 1 113 ? -52.916 -46.539 3.979   1.00 19.19  ? 192  TYR A CB   1 
ATOM   1724  C  CG   . TYR A 1 113 ? -53.349 -45.119 4.279   1.00 18.33  ? 192  TYR A CG   1 
ATOM   1725  C  CD1  . TYR A 1 113 ? -52.502 -44.235 4.929   1.00 17.83  ? 192  TYR A CD1  1 
ATOM   1726  C  CD2  . TYR A 1 113 ? -54.613 -44.668 3.922   1.00 21.19  ? 192  TYR A CD2  1 
ATOM   1727  C  CE1  . TYR A 1 113 ? -52.895 -42.939 5.205   1.00 17.23  ? 192  TYR A CE1  1 
ATOM   1728  C  CE2  . TYR A 1 113 ? -55.018 -43.379 4.200   1.00 17.77  ? 192  TYR A CE2  1 
ATOM   1729  C  CZ   . TYR A 1 113 ? -54.153 -42.517 4.838   1.00 17.14  ? 192  TYR A CZ   1 
ATOM   1730  O  OH   . TYR A 1 113 ? -54.546 -41.228 5.109   1.00 21.14  ? 192  TYR A OH   1 
ATOM   1731  H  H    . TYR A 1 113 ? -52.909 -46.317 1.425   1.00 25.14  ? 192  TYR A H    1 
ATOM   1732  H  HA   . TYR A 1 113 ? -51.000 -46.153 3.346   1.00 28.81  ? 192  TYR A HA   1 
ATOM   1733  H  HB2  . TYR A 1 113 ? -53.682 -47.009 3.613   1.00 23.03  ? 192  TYR A HB2  1 
ATOM   1734  H  HB3  . TYR A 1 113 ? -52.652 -46.949 4.818   1.00 23.03  ? 192  TYR A HB3  1 
ATOM   1735  H  HD1  . TYR A 1 113 ? -51.650 -44.516 5.177   1.00 21.40  ? 192  TYR A HD1  1 
ATOM   1736  H  HD2  . TYR A 1 113 ? -55.198 -45.247 3.489   1.00 25.43  ? 192  TYR A HD2  1 
ATOM   1737  H  HE1  . TYR A 1 113 ? -52.314 -42.356 5.638   1.00 20.68  ? 192  TYR A HE1  1 
ATOM   1738  H  HE2  . TYR A 1 113 ? -55.865 -43.090 3.949   1.00 21.33  ? 192  TYR A HE2  1 
ATOM   1739  H  HH   . TYR A 1 113 ? -55.330 -41.102 4.835   1.00 25.37  ? 192  TYR A HH   1 
ATOM   1740  N  N    . ASP A 1 114 ? -51.060 -48.611 1.671   1.00 25.03  ? 193  ASP A N    1 
ATOM   1741  C  CA   . ASP A 1 114 ? -50.863 -50.046 1.452   1.00 21.15  ? 193  ASP A CA   1 
ATOM   1742  C  C    . ASP A 1 114 ? -49.434 -50.538 1.696   1.00 31.43  ? 193  ASP A C    1 
ATOM   1743  O  O    . ASP A 1 114 ? -49.130 -51.699 1.422   1.00 41.71  ? 193  ASP A O    1 
ATOM   1744  C  CB   . ASP A 1 114 ? -51.323 -50.450 0.042   1.00 27.45  ? 193  ASP A CB   1 
ATOM   1745  C  CG   . ASP A 1 114 ? -50.400 -49.940 -1.068  1.00 31.51  ? 193  ASP A CG   1 
ATOM   1746  O  OD1  . ASP A 1 114 ? -49.318 -49.383 -0.787  1.00 30.84  ? 193  ASP A OD1  1 
ATOM   1747  O  OD2  . ASP A 1 114 ? -50.773 -50.098 -2.248  1.00 33.42  ? 193  ASP A OD2  1 
ATOM   1748  H  H    . ASP A 1 114 ? -50.992 -48.132 0.960   1.00 30.04  ? 193  ASP A H    1 
ATOM   1749  H  HA   . ASP A 1 114 ? -51.431 -50.520 2.078   1.00 25.38  ? 193  ASP A HA   1 
ATOM   1750  H  HB2  . ASP A 1 114 ? -51.349 -51.418 -0.014  1.00 32.94  ? 193  ASP A HB2  1 
ATOM   1751  H  HB3  . ASP A 1 114 ? -52.208 -50.086 -0.116  1.00 32.94  ? 193  ASP A HB3  1 
ATOM   1752  N  N    . GLU A 1 115 ? -48.568 -49.649 2.180   1.00 35.65  ? 194  GLU A N    1 
ATOM   1753  C  CA   . GLU A 1 115 ? -47.191 -49.990 2.556   1.00 39.59  ? 194  GLU A CA   1 
ATOM   1754  C  C    . GLU A 1 115 ? -46.259 -50.250 1.368   1.00 39.94  ? 194  GLU A C    1 
ATOM   1755  O  O    . GLU A 1 115 ? -45.085 -50.567 1.568   1.00 46.20  ? 194  GLU A O    1 
ATOM   1756  C  CB   . GLU A 1 115 ? -47.154 -51.218 3.478   1.00 48.86  ? 194  GLU A CB   1 
ATOM   1757  C  CG   . GLU A 1 115 ? -48.095 -51.173 4.669   1.00 54.37  ? 194  GLU A CG   1 
ATOM   1758  C  CD   . GLU A 1 115 ? -47.521 -50.380 5.823   1.00 58.35  ? 194  GLU A CD   1 
ATOM   1759  O  OE1  . GLU A 1 115 ? -46.684 -49.485 5.570   1.00 57.37  ? 194  GLU A OE1  1 
ATOM   1760  O  OE2  . GLU A 1 115 ? -47.898 -50.658 6.982   1.00 62.04  ? 194  GLU A OE2  1 
ATOM   1761  H  H    . GLU A 1 115 ? -48.758 -48.819 2.304   1.00 42.78  ? 194  GLU A H    1 
ATOM   1762  H  HA   . GLU A 1 115 ? -46.820 -49.244 3.054   1.00 47.51  ? 194  GLU A HA   1 
ATOM   1763  H  HB2  . GLU A 1 115 ? -47.385 -52.001 2.955   1.00 58.63  ? 194  GLU A HB2  1 
ATOM   1764  H  HB3  . GLU A 1 115 ? -46.253 -51.314 3.824   1.00 58.63  ? 194  GLU A HB3  1 
ATOM   1765  H  HG2  . GLU A 1 115 ? -48.928 -50.756 4.400   1.00 65.24  ? 194  GLU A HG2  1 
ATOM   1766  H  HG3  . GLU A 1 115 ? -48.259 -52.078 4.977   1.00 65.24  ? 194  GLU A HG3  1 
ATOM   1767  N  N    . TYR A 1 116 ? -46.768 -50.114 0.146   1.00 36.35  ? 195  TYR A N    1 
ATOM   1768  C  CA   . TYR A 1 116 ? -46.024 -50.515 -1.046  1.00 30.41  ? 195  TYR A CA   1 
ATOM   1769  C  C    . TYR A 1 116 ? -45.807 -49.370 -2.033  1.00 32.53  ? 195  TYR A C    1 
ATOM   1770  O  O    . TYR A 1 116 ? -44.678 -49.051 -2.401  1.00 34.79  ? 195  TYR A O    1 
ATOM   1771  C  CB   . TYR A 1 116 ? -46.784 -51.636 -1.751  1.00 36.23  ? 195  TYR A CB   1 
ATOM   1772  C  CG   . TYR A 1 116 ? -45.949 -52.440 -2.714  1.00 39.23  ? 195  TYR A CG   1 
ATOM   1773  C  CD1  . TYR A 1 116 ? -44.876 -53.192 -2.265  1.00 40.09  ? 195  TYR A CD1  1 
ATOM   1774  C  CD2  . TYR A 1 116 ? -46.246 -52.464 -4.069  1.00 43.87  ? 195  TYR A CD2  1 
ATOM   1775  C  CE1  . TYR A 1 116 ? -44.110 -53.934 -3.137  1.00 40.22  ? 195  TYR A CE1  1 
ATOM   1776  C  CE2  . TYR A 1 116 ? -45.488 -53.208 -4.951  1.00 48.59  ? 195  TYR A CE2  1 
ATOM   1777  C  CZ   . TYR A 1 116 ? -44.419 -53.941 -4.479  1.00 49.49  ? 195  TYR A CZ   1 
ATOM   1778  O  OH   . TYR A 1 116 ? -43.657 -54.683 -5.352  1.00 54.69  ? 195  TYR A OH   1 
ATOM   1779  H  H    . TYR A 1 116 ? -47.547 -49.789 -0.020  1.00 43.62  ? 195  TYR A H    1 
ATOM   1780  H  HA   . TYR A 1 116 ? -45.156 -50.856 -0.780  1.00 36.49  ? 195  TYR A HA   1 
ATOM   1781  H  HB2  . TYR A 1 116 ? -47.130 -52.246 -1.081  1.00 43.48  ? 195  TYR A HB2  1 
ATOM   1782  H  HB3  . TYR A 1 116 ? -47.519 -51.247 -2.251  1.00 43.48  ? 195  TYR A HB3  1 
ATOM   1783  H  HD1  . TYR A 1 116 ? -44.663 -53.189 -1.359  1.00 48.11  ? 195  TYR A HD1  1 
ATOM   1784  H  HD2  . TYR A 1 116 ? -46.966 -51.969 -4.389  1.00 52.64  ? 195  TYR A HD2  1 
ATOM   1785  H  HE1  . TYR A 1 116 ? -43.390 -54.431 -2.820  1.00 48.26  ? 195  TYR A HE1  1 
ATOM   1786  H  HE2  . TYR A 1 116 ? -45.695 -53.211 -5.857  1.00 58.31  ? 195  TYR A HE2  1 
ATOM   1787  H  HH   . TYR A 1 116 ? -43.951 -54.599 -6.134  1.00 65.62  ? 195  TYR A HH   1 
HETATM 1788  N  N    . MSE A 1 117 ? -46.906 -48.766 -2.465  1.00 57.40  ? 196  MSE A N    1 
HETATM 1789  C  CA   . MSE A 1 117 ? -46.885 -47.791 -3.550  1.00 50.58  ? 196  MSE A CA   1 
HETATM 1790  C  C    . MSE A 1 117 ? -46.034 -46.559 -3.234  1.00 50.00  ? 196  MSE A C    1 
HETATM 1791  O  O    . MSE A 1 117 ? -45.180 -46.174 -4.030  1.00 48.55  ? 196  MSE A O    1 
HETATM 1792  C  CB   . MSE A 1 117 ? -48.320 -47.366 -3.889  1.00 49.66  ? 196  MSE A CB   1 
HETATM 1793  C  CG   . MSE A 1 117 ? -48.470 -46.604 -5.204  1.00 44.99  ? 196  MSE A CG   1 
HETATM 1794  SE SE   . MSE A 1 117 ? -48.522 -44.678 -4.983  1.00 83.63  ? 196  MSE A SE   1 
HETATM 1795  C  CE   . MSE A 1 117 ? -50.414 -44.384 -5.369  1.00 49.11  ? 196  MSE A CE   1 
HETATM 1796  H  H    . MSE A 1 117 ? -47.691 -48.906 -2.141  1.00 68.88  ? 196  MSE A H    1 
HETATM 1797  H  HA   . MSE A 1 117 ? -46.517 -48.220 -4.338  1.00 60.69  ? 196  MSE A HA   1 
HETATM 1798  H  HB2  . MSE A 1 117 ? -48.872 -48.161 -3.946  1.00 59.60  ? 196  MSE A HB2  1 
HETATM 1799  H  HB3  . MSE A 1 117 ? -48.648 -46.792 -3.179  1.00 59.60  ? 196  MSE A HB3  1 
HETATM 1800  H  HG2  . MSE A 1 117 ? -47.717 -46.817 -5.777  1.00 53.99  ? 196  MSE A HG2  1 
HETATM 1801  H  HG3  . MSE A 1 117 ? -49.297 -46.876 -5.631  1.00 53.99  ? 196  MSE A HG3  1 
HETATM 1802  H  HE1  . MSE A 1 117 ? -50.606 -43.436 -5.298  1.00 58.93  ? 196  MSE A HE1  1 
HETATM 1803  H  HE2  . MSE A 1 117 ? -50.603 -44.694 -6.269  1.00 58.93  ? 196  MSE A HE2  1 
HETATM 1804  H  HE3  . MSE A 1 117 ? -50.947 -44.880 -4.729  1.00 58.93  ? 196  MSE A HE3  1 
HETATM 1805  N  N    . MSE A 1 118 ? -46.257 -45.946 -2.078  1.00 40.72  ? 197  MSE A N    1 
HETATM 1806  C  CA   . MSE A 1 118 ? -45.614 -44.670 -1.774  1.00 30.73  ? 197  MSE A CA   1 
HETATM 1807  C  C    . MSE A 1 118 ? -44.148 -44.787 -1.364  1.00 35.06  ? 197  MSE A C    1 
HETATM 1808  O  O    . MSE A 1 118 ? -43.347 -43.904 -1.669  1.00 43.71  ? 197  MSE A O    1 
HETATM 1809  C  CB   . MSE A 1 118 ? -46.385 -43.932 -0.684  1.00 36.70  ? 197  MSE A CB   1 
HETATM 1810  C  CG   . MSE A 1 118 ? -47.724 -43.392 -1.154  1.00 49.91  ? 197  MSE A CG   1 
HETATM 1811  SE SE   . MSE A 1 118 ? -47.573 -42.000 -2.512  1.00 68.20  ? 197  MSE A SE   1 
HETATM 1812  C  CE   . MSE A 1 118 ? -46.644 -40.673 -1.428  1.00 41.29  ? 197  MSE A CE   1 
HETATM 1813  H  H    . MSE A 1 118 ? -46.771 -46.244 -1.456  1.00 48.86  ? 197  MSE A H    1 
HETATM 1814  H  HA   . MSE A 1 118 ? -45.656 -44.120 -2.571  1.00 36.88  ? 197  MSE A HA   1 
HETATM 1815  H  HB2  . MSE A 1 118 ? -46.551 -44.542 0.051   1.00 44.03  ? 197  MSE A HB2  1 
HETATM 1816  H  HB3  . MSE A 1 118 ? -45.852 -43.182 -0.376  1.00 44.03  ? 197  MSE A HB3  1 
HETATM 1817  H  HG2  . MSE A 1 118 ? -48.240 -44.121 -1.532  1.00 59.89  ? 197  MSE A HG2  1 
HETATM 1818  H  HG3  . MSE A 1 118 ? -48.194 -43.015 -0.393  1.00 59.89  ? 197  MSE A HG3  1 
HETATM 1819  H  HE1  . MSE A 1 118 ? -46.482 -39.883 -1.967  1.00 49.55  ? 197  MSE A HE1  1 
HETATM 1820  H  HE2  . MSE A 1 118 ? -47.198 -40.445 -0.665  1.00 49.55  ? 197  MSE A HE2  1 
HETATM 1821  H  HE3  . MSE A 1 118 ? -45.801 -41.046 -1.126  1.00 49.55  ? 197  MSE A HE3  1 
ATOM   1822  N  N    . ASP A 1 119 ? -43.801 -45.855 -0.653  1.00 39.36  ? 198  ASP A N    1 
ATOM   1823  C  CA   . ASP A 1 119 ? -42.417 -46.063 -0.221  1.00 38.85  ? 198  ASP A CA   1 
ATOM   1824  C  C    . ASP A 1 119 ? -41.514 -46.267 -1.431  1.00 33.86  ? 198  ASP A C    1 
ATOM   1825  O  O    . ASP A 1 119 ? -40.390 -45.771 -1.470  1.00 37.67  ? 198  ASP A O    1 
ATOM   1826  C  CB   . ASP A 1 119 ? -42.317 -47.267 0.717   1.00 50.89  ? 198  ASP A CB   1 
ATOM   1827  C  CG   . ASP A 1 119 ? -43.147 -47.094 1.979   1.00 73.15  ? 198  ASP A CG   1 
ATOM   1828  O  OD1  . ASP A 1 119 ? -43.978 -46.155 2.025   1.00 72.77  ? 198  ASP A OD1  1 
ATOM   1829  O  OD2  . ASP A 1 119 ? -42.969 -47.898 2.921   1.00 79.49  ? 198  ASP A OD2  1 
ATOM   1830  H  H    . ASP A 1 119 ? -44.344 -46.474 -0.407  1.00 47.23  ? 198  ASP A H    1 
ATOM   1831  H  HA   . ASP A 1 119 ? -42.110 -45.278 0.259   1.00 46.62  ? 198  ASP A HA   1 
ATOM   1832  H  HB2  . ASP A 1 119 ? -42.637 -48.057 0.253   1.00 61.06  ? 198  ASP A HB2  1 
ATOM   1833  H  HB3  . ASP A 1 119 ? -41.391 -47.388 0.980   1.00 61.06  ? 198  ASP A HB3  1 
ATOM   1834  N  N    . THR A 1 120 ? -42.021 -46.998 -2.414  1.00 20.46  ? 199  THR A N    1 
ATOM   1835  C  CA   . THR A 1 120 ? -41.335 -47.170 -3.684  1.00 20.46  ? 199  THR A CA   1 
ATOM   1836  C  C    . THR A 1 120 ? -41.069 -45.822 -4.348  1.00 29.57  ? 199  THR A C    1 
ATOM   1837  O  O    . THR A 1 120 ? -39.929 -45.485 -4.657  1.00 37.52  ? 199  THR A O    1 
ATOM   1838  C  CB   . THR A 1 120 ? -42.181 -48.023 -4.641  1.00 33.65  ? 199  THR A CB   1 
ATOM   1839  O  OG1  . THR A 1 120 ? -42.228 -49.371 -4.161  1.00 32.81  ? 199  THR A OG1  1 
ATOM   1840  C  CG2  . THR A 1 120 ? -41.603 -48.007 -6.061  1.00 32.68  ? 199  THR A CG2  1 
ATOM   1841  H  H    . THR A 1 120 ? -42.774 -47.412 -2.368  1.00 24.56  ? 199  THR A H    1 
ATOM   1842  H  HA   . THR A 1 120 ? -40.486 -47.616 -3.538  1.00 24.55  ? 199  THR A HA   1 
ATOM   1843  H  HB   . THR A 1 120 ? -43.082 -47.665 -4.676  1.00 40.38  ? 199  THR A HB   1 
ATOM   1844  H  HG1  . THR A 1 120 ? -42.572 -49.391 -3.395  1.00 39.37  ? 199  THR A HG1  1 
ATOM   1845  H  HG21 . THR A 1 120 ? -42.152 -48.551 -6.648  1.00 39.22  ? 199  THR A HG21 1 
ATOM   1846  H  HG22 . THR A 1 120 ? -41.584 -47.099 -6.400  1.00 39.22  ? 199  THR A HG22 1 
ATOM   1847  H  HG23 . THR A 1 120 ? -40.700 -48.361 -6.055  1.00 39.22  ? 199  THR A HG23 1 
ATOM   1848  N  N    . VAL A 1 121 ? -42.136 -45.069 -4.591  1.00 29.65  ? 200  VAL A N    1 
ATOM   1849  C  CA   . VAL A 1 121 ? -42.033 -43.782 -5.265  1.00 20.30  ? 200  VAL A CA   1 
ATOM   1850  C  C    . VAL A 1 121 ? -41.129 -42.825 -4.490  1.00 21.98  ? 200  VAL A C    1 
ATOM   1851  O  O    . VAL A 1 121 ? -40.290 -42.145 -5.078  1.00 28.96  ? 200  VAL A O    1 
ATOM   1852  C  CB   . VAL A 1 121 ? -43.434 -43.155 -5.477  1.00 22.69  ? 200  VAL A CB   1 
ATOM   1853  C  CG1  . VAL A 1 121 ? -43.338 -41.717 -5.979  1.00 18.92  ? 200  VAL A CG1  1 
ATOM   1854  C  CG2  . VAL A 1 121 ? -44.232 -43.989 -6.463  1.00 28.99  ? 200  VAL A CG2  1 
ATOM   1855  H  H    . VAL A 1 121 ? -42.939 -45.284 -4.371  1.00 35.59  ? 200  VAL A H    1 
ATOM   1856  H  HA   . VAL A 1 121 ? -41.636 -43.921 -6.140  1.00 24.36  ? 200  VAL A HA   1 
ATOM   1857  H  HB   . VAL A 1 121 ? -43.910 -43.149 -4.632  1.00 27.22  ? 200  VAL A HB   1 
ATOM   1858  H  HG11 . VAL A 1 121 ? -44.234 -41.364 -6.098  1.00 22.70  ? 200  VAL A HG11 1 
ATOM   1859  H  HG12 . VAL A 1 121 ? -42.857 -41.186 -5.326  1.00 22.70  ? 200  VAL A HG12 1 
ATOM   1860  H  HG13 . VAL A 1 121 ? -42.865 -41.709 -6.826  1.00 22.70  ? 200  VAL A HG13 1 
ATOM   1861  H  HG21 . VAL A 1 121 ? -45.105 -43.584 -6.584  1.00 34.79  ? 200  VAL A HG21 1 
ATOM   1862  H  HG22 . VAL A 1 121 ? -43.759 -44.016 -7.309  1.00 34.79  ? 200  VAL A HG22 1 
ATOM   1863  H  HG23 . VAL A 1 121 ? -44.330 -44.887 -6.109  1.00 34.79  ? 200  VAL A HG23 1 
ATOM   1864  N  N    . ILE A 1 122 ? -41.292 -42.777 -3.173  1.00 17.89  ? 201  ILE A N    1 
ATOM   1865  C  CA   . ILE A 1 122 ? -40.515 -41.851 -2.353  1.00 17.10  ? 201  ILE A CA   1 
ATOM   1866  C  C    . ILE A 1 122 ? -39.042 -42.245 -2.328  1.00 22.98  ? 201  ILE A C    1 
ATOM   1867  O  O    . ILE A 1 122 ? -38.167 -41.383 -2.384  1.00 29.83  ? 201  ILE A O    1 
ATOM   1868  C  CB   . ILE A 1 122 ? -41.088 -41.751 -0.920  1.00 15.21  ? 201  ILE A CB   1 
ATOM   1869  C  CG1  . ILE A 1 122 ? -42.395 -40.948 -0.957  1.00 18.17  ? 201  ILE A CG1  1 
ATOM   1870  C  CG2  . ILE A 1 122 ? -40.090 -41.094 0.027   1.00 16.24  ? 201  ILE A CG2  1 
ATOM   1871  C  CD1  . ILE A 1 122 ? -43.060 -40.712 0.391   1.00 23.52  ? 201  ILE A CD1  1 
ATOM   1872  H  H    . ILE A 1 122 ? -41.843 -43.266 -2.730  1.00 21.47  ? 201  ILE A H    1 
ATOM   1873  H  HA   . ILE A 1 122 ? -40.572 -40.968 -2.750  1.00 20.51  ? 201  ILE A HA   1 
ATOM   1874  H  HB   . ILE A 1 122 ? -41.281 -42.646 -0.598  1.00 18.25  ? 201  ILE A HB   1 
ATOM   1875  H  HG12 . ILE A 1 122 ? -42.209 -40.078 -1.345  1.00 21.80  ? 201  ILE A HG12 1 
ATOM   1876  H  HG13 . ILE A 1 122 ? -43.031 -41.422 -1.516  1.00 21.80  ? 201  ILE A HG13 1 
ATOM   1877  H  HG21 . ILE A 1 122 ? -40.481 -41.048 0.914   1.00 19.49  ? 201  ILE A HG21 1 
ATOM   1878  H  HG22 . ILE A 1 122 ? -39.280 -41.626 0.050   1.00 19.49  ? 201  ILE A HG22 1 
ATOM   1879  H  HG23 . ILE A 1 122 ? -39.891 -40.201 -0.294  1.00 19.49  ? 201  ILE A HG23 1 
ATOM   1880  H  HD11 . ILE A 1 122 ? -43.872 -40.199 0.257   1.00 28.22  ? 201  ILE A HD11 1 
ATOM   1881  H  HD12 . ILE A 1 122 ? -43.272 -41.569 0.792   1.00 28.22  ? 201  ILE A HD12 1 
ATOM   1882  H  HD13 . ILE A 1 122 ? -42.449 -40.222 0.963   1.00 28.22  ? 201  ILE A HD13 1 
ATOM   1883  N  N    . SER A 1 123 ? -38.770 -43.544 -2.248  1.00 24.78  ? 202  SER A N    1 
ATOM   1884  C  CA   . SER A 1 123 ? -37.397 -44.032 -2.263  1.00 21.84  ? 202  SER A CA   1 
ATOM   1885  C  C    . SER A 1 123 ? -36.691 -43.621 -3.547  1.00 28.46  ? 202  SER A C    1 
ATOM   1886  O  O    . SER A 1 123 ? -35.544 -43.167 -3.519  1.00 27.28  ? 202  SER A O    1 
ATOM   1887  C  CB   . SER A 1 123 ? -37.370 -45.551 -2.126  1.00 23.51  ? 202  SER A CB   1 
ATOM   1888  O  OG   . SER A 1 123 ? -37.919 -45.950 -0.885  1.00 41.33  ? 202  SER A OG   1 
ATOM   1889  H  H    . SER A 1 123 ? -39.363 -44.163 -2.184  1.00 29.73  ? 202  SER A H    1 
ATOM   1890  H  HA   . SER A 1 123 ? -36.914 -43.650 -1.514  1.00 26.20  ? 202  SER A HA   1 
ATOM   1891  H  HB2  . SER A 1 123 ? -37.892 -45.943 -2.843  1.00 28.21  ? 202  SER A HB2  1 
ATOM   1892  H  HB3  . SER A 1 123 ? -36.451 -45.857 -2.178  1.00 28.21  ? 202  SER A HB3  1 
ATOM   1893  H  HG   . SER A 1 123 ? -38.716 -45.690 -0.827  1.00 49.59  ? 202  SER A HG   1 
ATOM   1894  N  N    . LEU A 1 124 ? -37.380 -43.778 -4.672  1.00 27.16  ? 203  LEU A N    1 
ATOM   1895  C  CA   . LEU A 1 124 ? -36.784 -43.478 -5.964  1.00 24.14  ? 203  LEU A CA   1 
ATOM   1896  C  C    . LEU A 1 124 ? -36.518 -41.984 -6.095  1.00 28.98  ? 203  LEU A C    1 
ATOM   1897  O  O    . LEU A 1 124 ? -35.420 -41.571 -6.473  1.00 30.27  ? 203  LEU A O    1 
ATOM   1898  C  CB   . LEU A 1 124 ? -37.690 -43.952 -7.097  1.00 17.89  ? 203  LEU A CB   1 
ATOM   1899  C  CG   . LEU A 1 124 ? -37.082 -43.800 -8.491  1.00 23.62  ? 203  LEU A CG   1 
ATOM   1900  C  CD1  . LEU A 1 124 ? -35.993 -44.835 -8.715  1.00 28.55  ? 203  LEU A CD1  1 
ATOM   1901  C  CD2  . LEU A 1 124 ? -38.149 -43.911 -9.554  1.00 30.11  ? 203  LEU A CD2  1 
ATOM   1902  H  H    . LEU A 1 124 ? -38.193 -44.055 -4.712  1.00 32.59  ? 203  LEU A H    1 
ATOM   1903  H  HA   . LEU A 1 124 ? -35.937 -43.944 -6.039  1.00 28.97  ? 203  LEU A HA   1 
ATOM   1904  H  HB2  . LEU A 1 124 ? -37.890 -44.892 -6.963  1.00 21.47  ? 203  LEU A HB2  1 
ATOM   1905  H  HB3  . LEU A 1 124 ? -38.511 -43.436 -7.075  1.00 21.47  ? 203  LEU A HB3  1 
ATOM   1906  H  HG   . LEU A 1 124 ? -36.678 -42.921 -8.564  1.00 28.34  ? 203  LEU A HG   1 
ATOM   1907  H  HD11 . LEU A 1 124 ? -35.625 -44.718 -9.605  1.00 34.27  ? 203  LEU A HD11 1 
ATOM   1908  H  HD12 . LEU A 1 124 ? -35.299 -44.711 -8.050  1.00 34.27  ? 203  LEU A HD12 1 
ATOM   1909  H  HD13 . LEU A 1 124 ? -36.379 -45.721 -8.631  1.00 34.27  ? 203  LEU A HD13 1 
ATOM   1910  H  HD21 . LEU A 1 124 ? -37.737 -43.811 -10.427 1.00 36.13  ? 203  LEU A HD21 1 
ATOM   1911  H  HD22 . LEU A 1 124 ? -38.573 -44.781 -9.486  1.00 36.13  ? 203  LEU A HD22 1 
ATOM   1912  H  HD23 . LEU A 1 124 ? -38.806 -43.211 -9.416  1.00 36.13  ? 203  LEU A HD23 1 
ATOM   1913  N  N    . LEU A 1 125 ? -37.525 -41.178 -5.775  1.00 29.11  ? 204  LEU A N    1 
ATOM   1914  C  CA   . LEU A 1 125 ? -37.398 -39.731 -5.866  1.00 24.38  ? 204  LEU A CA   1 
ATOM   1915  C  C    . LEU A 1 125 ? -36.303 -39.230 -4.926  1.00 18.41  ? 204  LEU A C    1 
ATOM   1916  O  O    . LEU A 1 125 ? -35.592 -38.280 -5.253  1.00 27.60  ? 204  LEU A O    1 
ATOM   1917  C  CB   . LEU A 1 125 ? -38.733 -39.042 -5.548  1.00 24.92  ? 204  LEU A CB   1 
ATOM   1918  C  CG   . LEU A 1 125 ? -39.912 -39.256 -6.508  1.00 25.87  ? 204  LEU A CG   1 
ATOM   1919  C  CD1  . LEU A 1 125 ? -40.959 -38.174 -6.292  1.00 35.40  ? 204  LEU A CD1  1 
ATOM   1920  C  CD2  . LEU A 1 125 ? -39.474 -39.288 -7.965  1.00 23.09  ? 204  LEU A CD2  1 
ATOM   1921  H  H    . LEU A 1 125 ? -38.295 -41.447 -5.503  1.00 34.93  ? 204  LEU A H    1 
ATOM   1922  H  HA   . LEU A 1 125 ? -37.147 -39.493 -6.772  1.00 29.26  ? 204  LEU A HA   1 
ATOM   1923  H  HB2  . LEU A 1 125 ? -39.024 -39.347 -4.674  1.00 29.91  ? 204  LEU A HB2  1 
ATOM   1924  H  HB3  . LEU A 1 125 ? -38.572 -38.086 -5.511  1.00 29.91  ? 204  LEU A HB3  1 
ATOM   1925  H  HG   . LEU A 1 125 ? -40.325 -40.110 -6.306  1.00 31.05  ? 204  LEU A HG   1 
ATOM   1926  H  HD11 . LEU A 1 125 ? -41.696 -38.322 -6.904  1.00 42.48  ? 204  LEU A HD11 1 
ATOM   1927  H  HD12 . LEU A 1 125 ? -41.275 -38.220 -5.376  1.00 42.48  ? 204  LEU A HD12 1 
ATOM   1928  H  HD13 . LEU A 1 125 ? -40.556 -37.308 -6.461  1.00 42.48  ? 204  LEU A HD13 1 
ATOM   1929  H  HD21 . LEU A 1 125 ? -40.254 -39.425 -8.526  1.00 27.71  ? 204  LEU A HD21 1 
ATOM   1930  H  HD22 . LEU A 1 125 ? -39.052 -38.443 -8.186  1.00 27.71  ? 204  LEU A HD22 1 
ATOM   1931  H  HD23 . LEU A 1 125 ? -38.845 -40.015 -8.090  1.00 27.71  ? 204  LEU A HD23 1 
ATOM   1932  N  N    . THR A 1 126 ? -36.154 -39.876 -3.772  1.00 13.69  ? 205  THR A N    1 
ATOM   1933  C  CA   . THR A 1 126 ? -35.124 -39.481 -2.811  1.00 20.53  ? 205  THR A CA   1 
ATOM   1934  C  C    . THR A 1 126 ? -33.733 -39.794 -3.351  1.00 15.20  ? 205  THR A C    1 
ATOM   1935  O  O    . THR A 1 126 ? -32.790 -39.055 -3.098  1.00 21.67  ? 205  THR A O    1 
ATOM   1936  C  CB   . THR A 1 126 ? -35.303 -40.181 -1.446  1.00 17.85  ? 205  THR A CB   1 
ATOM   1937  O  OG1  . THR A 1 126 ? -36.631 -39.954 -0.956  1.00 17.38  ? 205  THR A OG1  1 
ATOM   1938  C  CG2  . THR A 1 126 ? -34.312 -39.638 -0.432  1.00 14.39  ? 205  THR A CG2  1 
ATOM   1939  H  H    . THR A 1 126 ? -36.635 -40.544 -3.521  1.00 16.43  ? 205  THR A H    1 
ATOM   1940  H  HA   . THR A 1 126 ? -35.180 -38.524 -2.665  1.00 24.64  ? 205  THR A HA   1 
ATOM   1941  H  HB   . THR A 1 126 ? -35.151 -41.134 -1.546  1.00 21.42  ? 205  THR A HB   1 
ATOM   1942  H  HG1  . THR A 1 126 ? -37.193 -40.263 -1.498  1.00 20.85  ? 205  THR A HG1  1 
ATOM   1943  H  HG21 . THR A 1 126 ? -34.432 -40.083 0.421   1.00 17.27  ? 205  THR A HG21 1 
ATOM   1944  H  HG22 . THR A 1 126 ? -33.405 -39.789 -0.741  1.00 17.27  ? 205  THR A HG22 1 
ATOM   1945  H  HG23 . THR A 1 126 ? -34.449 -38.685 -0.312  1.00 17.27  ? 205  THR A HG23 1 
ATOM   1946  N  N    . GLY A 1 127 ? -33.611 -40.889 -4.096  1.00 15.75  ? 206  GLY A N    1 
ATOM   1947  C  CA   . GLY A 1 127 ? -32.340 -41.280 -4.682  1.00 15.09  ? 206  GLY A CA   1 
ATOM   1948  C  C    . GLY A 1 127 ? -31.990 -40.427 -5.885  1.00 21.10  ? 206  GLY A C    1 
ATOM   1949  O  O    . GLY A 1 127 ? -30.851 -39.988 -6.038  1.00 26.64  ? 206  GLY A O    1 
ATOM   1950  H  H    . GLY A 1 127 ? -34.258 -41.426 -4.277  1.00 18.90  ? 206  GLY A H    1 
ATOM   1951  H  HA2  . GLY A 1 127 ? -31.636 -41.189 -4.021  1.00 18.11  ? 206  GLY A HA2  1 
ATOM   1952  H  HA3  . GLY A 1 127 ? -32.383 -42.208 -4.962  1.00 18.11  ? 206  GLY A HA3  1 
ATOM   1953  N  N    . LEU A 1 128 ? -32.975 -40.187 -6.742  1.00 27.15  ? 207  LEU A N    1 
ATOM   1954  C  CA   . LEU A 1 128 ? -32.774 -39.369 -7.932  1.00 20.73  ? 207  LEU A CA   1 
ATOM   1955  C  C    . LEU A 1 128 ? -32.447 -37.930 -7.545  1.00 24.43  ? 207  LEU A C    1 
ATOM   1956  O  O    . LEU A 1 128 ? -31.662 -37.257 -8.215  1.00 28.55  ? 207  LEU A O    1 
ATOM   1957  C  CB   . LEU A 1 128 ? -34.024 -39.402 -8.815  1.00 21.08  ? 207  LEU A CB   1 
ATOM   1958  C  CG   . LEU A 1 128 ? -34.276 -40.700 -9.585  1.00 23.29  ? 207  LEU A CG   1 
ATOM   1959  C  CD1  . LEU A 1 128 ? -35.687 -40.721 -10.167 1.00 25.26  ? 207  LEU A CD1  1 
ATOM   1960  C  CD2  . LEU A 1 128 ? -33.240 -40.877 -10.686 1.00 28.65  ? 207  LEU A CD2  1 
ATOM   1961  H  H    . LEU A 1 128 ? -33.776 -40.489 -6.657  1.00 32.58  ? 207  LEU A H    1 
ATOM   1962  H  HA   . LEU A 1 128 ? -32.030 -39.723 -8.443  1.00 24.87  ? 207  LEU A HA   1 
ATOM   1963  H  HB2  . LEU A 1 128 ? -34.798 -39.246 -8.252  1.00 25.29  ? 207  LEU A HB2  1 
ATOM   1964  H  HB3  . LEU A 1 128 ? -33.954 -38.688 -9.468  1.00 25.29  ? 207  LEU A HB3  1 
ATOM   1965  H  HG   . LEU A 1 128 ? -34.194 -41.449 -8.975  1.00 27.95  ? 207  LEU A HG   1 
ATOM   1966  H  HD11 . LEU A 1 128 ? -35.817 -41.553 -10.648 1.00 30.32  ? 207  LEU A HD11 1 
ATOM   1967  H  HD12 . LEU A 1 128 ? -36.328 -40.653 -9.442  1.00 30.32  ? 207  LEU A HD12 1 
ATOM   1968  H  HD13 . LEU A 1 128 ? -35.790 -39.969 -10.771 1.00 30.32  ? 207  LEU A HD13 1 
ATOM   1969  H  HD21 . LEU A 1 128 ? -33.420 -41.704 -11.159 1.00 34.38  ? 207  LEU A HD21 1 
ATOM   1970  H  HD22 . LEU A 1 128 ? -33.298 -40.126 -11.297 1.00 34.38  ? 207  LEU A HD22 1 
ATOM   1971  H  HD23 . LEU A 1 128 ? -32.357 -40.909 -10.285 1.00 34.38  ? 207  LEU A HD23 1 
ATOM   1972  N  N    . SER A 1 129 ? -33.048 -37.460 -6.458  1.00 26.48  ? 208  SER A N    1 
ATOM   1973  C  CA   . SER A 1 129 ? -32.789 -36.107 -5.982  1.00 24.34  ? 208  SER A CA   1 
ATOM   1974  C  C    . SER A 1 129 ? -31.384 -35.996 -5.394  1.00 24.82  ? 208  SER A C    1 
ATOM   1975  O  O    . SER A 1 129 ? -30.909 -34.899 -5.105  1.00 26.92  ? 208  SER A O    1 
ATOM   1976  C  CB   . SER A 1 129 ? -33.826 -35.692 -4.936  1.00 22.33  ? 208  SER A CB   1 
ATOM   1977  O  OG   . SER A 1 129 ? -33.565 -36.307 -3.686  1.00 23.68  ? 208  SER A OG   1 
ATOM   1978  H  H    . SER A 1 129 ? -33.608 -37.903 -5.979  1.00 31.77  ? 208  SER A H    1 
ATOM   1979  H  HA   . SER A 1 129 ? -32.852 -35.491 -6.729  1.00 29.20  ? 208  SER A HA   1 
ATOM   1980  H  HB2  . SER A 1 129 ? -33.794 -34.729 -4.826  1.00 26.79  ? 208  SER A HB2  1 
ATOM   1981  H  HB3  . SER A 1 129 ? -34.706 -35.961 -5.242  1.00 26.79  ? 208  SER A HB3  1 
ATOM   1982  H  HG   . SER A 1 129 ? -33.590 -37.143 -3.766  1.00 28.41  ? 208  SER A HG   1 
ATOM   1983  N  N    . ASP A 1 130 ? -30.723 -37.134 -5.215  1.00 27.72  ? 209  ASP A N    1 
ATOM   1984  C  CA   . ASP A 1 130 ? -29.362 -37.145 -4.700  1.00 25.75  ? 209  ASP A CA   1 
ATOM   1985  C  C    . ASP A 1 130 ? -28.332 -37.280 -5.826  1.00 25.48  ? 209  ASP A C    1 
ATOM   1986  O  O    . ASP A 1 130 ? -27.141 -37.062 -5.613  1.00 26.11  ? 209  ASP A O    1 
ATOM   1987  C  CB   . ASP A 1 130 ? -29.194 -38.278 -3.690  1.00 30.66  ? 209  ASP A CB   1 
ATOM   1988  C  CG   . ASP A 1 130 ? -27.903 -38.167 -2.902  1.00 42.13  ? 209  ASP A CG   1 
ATOM   1989  O  OD1  . ASP A 1 130 ? -27.634 -37.069 -2.367  1.00 45.22  ? 209  ASP A OD1  1 
ATOM   1990  O  OD2  . ASP A 1 130 ? -27.156 -39.169 -2.823  1.00 42.88  ? 209  ASP A OD2  1 
ATOM   1991  H  H    . ASP A 1 130 ? -31.042 -37.915 -5.385  1.00 33.26  ? 209  ASP A H    1 
ATOM   1992  H  HA   . ASP A 1 130 ? -29.194 -36.308 -4.241  1.00 30.90  ? 209  ASP A HA   1 
ATOM   1993  H  HB2  . ASP A 1 130 ? -29.933 -38.255 -3.062  1.00 36.79  ? 209  ASP A HB2  1 
ATOM   1994  H  HB3  . ASP A 1 130 ? -29.185 -39.125 -4.163  1.00 36.79  ? 209  ASP A HB3  1 
ATOM   1995  N  N    . SER A 1 131 ? -28.798 -37.624 -7.024  1.00 17.76  ? 210  SER A N    1 
ATOM   1996  C  CA   . SER A 1 131 ? -27.912 -37.840 -8.163  1.00 16.45  ? 210  SER A CA   1 
ATOM   1997  C  C    . SER A 1 131 ? -27.154 -36.574 -8.529  1.00 14.41  ? 210  SER A C    1 
ATOM   1998  O  O    . SER A 1 131 ? -27.640 -35.468 -8.310  1.00 27.10  ? 210  SER A O    1 
ATOM   1999  C  CB   . SER A 1 131 ? -28.718 -38.303 -9.378  1.00 20.44  ? 210  SER A CB   1 
ATOM   2000  O  OG   . SER A 1 131 ? -27.875 -38.523 -10.499 1.00 18.86  ? 210  SER A OG   1 
ATOM   2001  H  H    . SER A 1 131 ? -29.631 -37.740 -7.204  1.00 21.32  ? 210  SER A H    1 
ATOM   2002  H  HA   . SER A 1 131 ? -27.266 -38.530 -7.942  1.00 19.74  ? 210  SER A HA   1 
ATOM   2003  H  HB2  . SER A 1 131 ? -29.171 -39.132 -9.157  1.00 24.53  ? 210  SER A HB2  1 
ATOM   2004  H  HB3  . SER A 1 131 ? -29.369 -37.620 -9.602  1.00 24.53  ? 210  SER A HB3  1 
ATOM   2005  H  HG   . SER A 1 131 ? -27.306 -39.114 -10.319 1.00 22.63  ? 210  SER A HG   1 
ATOM   2006  N  N    . GLN A 1 132 ? -25.963 -36.740 -9.091  1.00 29.46  ? 211  GLN A N    1 
ATOM   2007  C  CA   . GLN A 1 132 ? -25.214 -35.612 -9.628  1.00 32.81  ? 211  GLN A CA   1 
ATOM   2008  C  C    . GLN A 1 132 ? -25.704 -35.280 -11.034 1.00 37.66  ? 211  GLN A C    1 
ATOM   2009  O  O    . GLN A 1 132 ? -25.482 -34.178 -11.537 1.00 39.55  ? 211  GLN A O    1 
ATOM   2010  C  CB   . GLN A 1 132 ? -23.723 -35.920 -9.647  1.00 34.82  ? 211  GLN A CB   1 
ATOM   2011  C  CG   . GLN A 1 132 ? -23.086 -35.950 -8.270  1.00 46.35  ? 211  GLN A CG   1 
ATOM   2012  C  CD   . GLN A 1 132 ? -21.597 -36.205 -8.343  1.00 50.79  ? 211  GLN A CD   1 
ATOM   2013  O  OE1  . GLN A 1 132 ? -21.090 -36.666 -9.366  1.00 49.23  ? 211  GLN A OE1  1 
ATOM   2014  N  NE2  . GLN A 1 132 ? -20.884 -35.898 -7.266  1.00 54.43  ? 211  GLN A NE2  1 
ATOM   2015  H  H    . GLN A 1 132 ? -25.565 -37.498 -9.174  1.00 35.35  ? 211  GLN A H    1 
ATOM   2016  H  HA   . GLN A 1 132 ? -25.358 -34.836 -9.064  1.00 39.37  ? 211  GLN A HA   1 
ATOM   2017  H  HB2  . GLN A 1 132 ? -23.588 -36.789 -10.055 1.00 41.79  ? 211  GLN A HB2  1 
ATOM   2018  H  HB3  . GLN A 1 132 ? -23.270 -35.238 -10.168 1.00 41.79  ? 211  GLN A HB3  1 
ATOM   2019  H  HG2  . GLN A 1 132 ? -23.226 -35.094 -7.836  1.00 55.62  ? 211  GLN A HG2  1 
ATOM   2020  H  HG3  . GLN A 1 132 ? -23.490 -36.660 -7.748  1.00 55.62  ? 211  GLN A HG3  1 
ATOM   2021  H  HE21 . GLN A 1 132 ? -21.273 -35.571 -6.572  1.00 65.32  ? 211  GLN A HE21 1 
ATOM   2022  H  HE22 . GLN A 1 132 ? -20.034 -36.026 -7.262  1.00 65.32  ? 211  GLN A HE22 1 
ATOM   2023  N  N    . VAL A 1 133 ? -26.369 -36.240 -11.668 1.00 25.74  ? 212  VAL A N    1 
ATOM   2024  C  CA   . VAL A 1 133 ? -27.009 -36.000 -12.955 1.00 24.19  ? 212  VAL A CA   1 
ATOM   2025  C  C    . VAL A 1 133 ? -28.134 -34.997 -12.755 1.00 22.88  ? 212  VAL A C    1 
ATOM   2026  O  O    . VAL A 1 133 ? -29.133 -35.303 -12.110 1.00 27.40  ? 212  VAL A O    1 
ATOM   2027  C  CB   . VAL A 1 133 ? -27.592 -37.289 -13.549 1.00 21.84  ? 212  VAL A CB   1 
ATOM   2028  C  CG1  . VAL A 1 133 ? -28.118 -37.028 -14.950 1.00 27.94  ? 212  VAL A CG1  1 
ATOM   2029  C  CG2  . VAL A 1 133 ? -26.541 -38.392 -13.576 1.00 30.46  ? 212  VAL A CG2  1 
ATOM   2030  H  H    . VAL A 1 133 ? -26.465 -37.042 -11.372 1.00 30.89  ? 212  VAL A H    1 
ATOM   2031  H  HA   . VAL A 1 133 ? -26.365 -35.630 -13.579 1.00 29.03  ? 212  VAL A HA   1 
ATOM   2032  H  HB   . VAL A 1 133 ? -28.332 -37.588 -12.997 1.00 26.21  ? 212  VAL A HB   1 
ATOM   2033  H  HG11 . VAL A 1 133 ? -28.483 -37.852 -15.309 1.00 33.53  ? 212  VAL A HG11 1 
ATOM   2034  H  HG12 . VAL A 1 133 ? -28.812 -36.351 -14.906 1.00 33.53  ? 212  VAL A HG12 1 
ATOM   2035  H  HG13 . VAL A 1 133 ? -27.388 -36.718 -15.509 1.00 33.53  ? 212  VAL A HG13 1 
ATOM   2036  H  HG21 . VAL A 1 133 ? -26.935 -39.193 -13.955 1.00 36.55  ? 212  VAL A HG21 1 
ATOM   2037  H  HG22 . VAL A 1 133 ? -25.793 -38.101 -14.121 1.00 36.55  ? 212  VAL A HG22 1 
ATOM   2038  H  HG23 . VAL A 1 133 ? -26.243 -38.566 -12.670 1.00 36.55  ? 212  VAL A HG23 1 
ATOM   2039  N  N    . ARG A 1 134 ? -27.977 -33.807 -13.326 1.00 25.72  ? 213  ARG A N    1 
ATOM   2040  C  CA   . ARG A 1 134 ? -28.883 -32.702 -13.038 1.00 30.97  ? 213  ARG A CA   1 
ATOM   2041  C  C    . ARG A 1 134 ? -30.306 -32.999 -13.485 1.00 27.34  ? 213  ARG A C    1 
ATOM   2042  O  O    . ARG A 1 134 ? -31.262 -32.654 -12.794 1.00 29.14  ? 213  ARG A O    1 
ATOM   2043  C  CB   . ARG A 1 134 ? -28.399 -31.415 -13.703 1.00 32.01  ? 213  ARG A CB   1 
ATOM   2044  C  CG   . ARG A 1 134 ? -29.256 -30.203 -13.356 1.00 28.14  ? 213  ARG A CG   1 
ATOM   2045  C  CD   . ARG A 1 134 ? -28.681 -28.937 -13.934 1.00 26.36  ? 213  ARG A CD   1 
ATOM   2046  N  NE   . ARG A 1 134 ? -27.351 -28.663 -13.404 1.00 32.15  ? 213  ARG A NE   1 
ATOM   2047  C  CZ   . ARG A 1 134 ? -26.458 -27.873 -13.991 1.00 29.28  ? 213  ARG A CZ   1 
ATOM   2048  N  NH1  . ARG A 1 134 ? -26.742 -27.280 -15.145 1.00 30.59  ? 213  ARG A NH1  1 
ATOM   2049  N  NH2  . ARG A 1 134 ? -25.271 -27.688 -13.432 1.00 24.09  ? 213  ARG A NH2  1 
ATOM   2050  H  H    . ARG A 1 134 ? -27.352 -33.614 -13.884 1.00 30.86  ? 213  ARG A H    1 
ATOM   2051  H  HA   . ARG A 1 134 ? -28.898 -32.553 -12.080 1.00 37.17  ? 213  ARG A HA   1 
ATOM   2052  H  HB2  . ARG A 1 134 ? -27.492 -31.232 -13.412 1.00 38.42  ? 213  ARG A HB2  1 
ATOM   2053  H  HB3  . ARG A 1 134 ? -28.421 -31.530 -14.665 1.00 38.42  ? 213  ARG A HB3  1 
ATOM   2054  H  HG2  . ARG A 1 134 ? -30.147 -30.327 -13.719 1.00 33.77  ? 213  ARG A HG2  1 
ATOM   2055  H  HG3  . ARG A 1 134 ? -29.297 -30.106 -12.391 1.00 33.77  ? 213  ARG A HG3  1 
ATOM   2056  H  HD2  . ARG A 1 134 ? -28.612 -29.027 -14.897 1.00 31.63  ? 213  ARG A HD2  1 
ATOM   2057  H  HD3  . ARG A 1 134 ? -29.258 -28.191 -13.707 1.00 31.63  ? 213  ARG A HD3  1 
ATOM   2058  H  HE   . ARG A 1 134 ? -27.130 -29.038 -12.662 1.00 38.58  ? 213  ARG A HE   1 
ATOM   2059  H  HH11 . ARG A 1 134 ? -27.510 -27.399 -15.512 1.00 36.71  ? 213  ARG A HH11 1 
ATOM   2060  H  HH12 . ARG A 1 134 ? -26.159 -26.772 -15.522 1.00 36.71  ? 213  ARG A HH12 1 
ATOM   2061  H  HH21 . ARG A 1 134 ? -25.083 -28.072 -12.686 1.00 28.91  ? 213  ARG A HH21 1 
ATOM   2062  H  HH22 . ARG A 1 134 ? -24.691 -27.179 -13.811 1.00 28.91  ? 213  ARG A HH22 1 
ATOM   2063  N  N    . ALA A 1 135 ? -30.443 -33.644 -14.638 1.00 19.93  ? 214  ALA A N    1 
ATOM   2064  C  CA   . ALA A 1 135 ? -31.761 -33.943 -15.186 1.00 22.75  ? 214  ALA A CA   1 
ATOM   2065  C  C    . ALA A 1 135 ? -32.559 -34.823 -14.220 1.00 28.35  ? 214  ALA A C    1 
ATOM   2066  O  O    . ALA A 1 135 ? -33.783 -34.709 -14.129 1.00 31.04  ? 214  ALA A O    1 
ATOM   2067  C  CB   . ALA A 1 135 ? -31.633 -34.610 -16.540 1.00 16.53  ? 214  ALA A CB   1 
ATOM   2068  H  H    . ALA A 1 135 ? -29.788 -33.919 -15.122 1.00 23.92  ? 214  ALA A H    1 
ATOM   2069  H  HA   . ALA A 1 135 ? -32.249 -33.113 -15.306 1.00 27.30  ? 214  ALA A HA   1 
ATOM   2070  H  HB1  . ALA A 1 135 ? -32.520 -34.799 -16.884 1.00 19.84  ? 214  ALA A HB1  1 
ATOM   2071  H  HB2  . ALA A 1 135 ? -31.165 -34.011 -17.143 1.00 19.84  ? 214  ALA A HB2  1 
ATOM   2072  H  HB3  . ALA A 1 135 ? -31.134 -35.435 -16.439 1.00 19.84  ? 214  ALA A HB3  1 
ATOM   2073  N  N    . PHE A 1 136 ? -31.858 -35.690 -13.492 1.00 19.33  ? 215  PHE A N    1 
ATOM   2074  C  CA   . PHE A 1 136 ? -32.485 -36.500 -12.452 1.00 19.61  ? 215  PHE A CA   1 
ATOM   2075  C  C    . PHE A 1 136 ? -32.748 -35.664 -11.202 1.00 21.53  ? 215  PHE A C    1 
ATOM   2076  O  O    . PHE A 1 136 ? -33.850 -35.693 -10.649 1.00 26.34  ? 215  PHE A O    1 
ATOM   2077  C  CB   . PHE A 1 136 ? -31.607 -37.699 -12.078 1.00 22.05  ? 215  PHE A CB   1 
ATOM   2078  C  CG   . PHE A 1 136 ? -31.578 -38.799 -13.111 1.00 19.56  ? 215  PHE A CG   1 
ATOM   2079  C  CD1  . PHE A 1 136 ? -32.599 -38.944 -14.040 1.00 24.68  ? 215  PHE A CD1  1 
ATOM   2080  C  CD2  . PHE A 1 136 ? -30.525 -39.704 -13.136 1.00 20.26  ? 215  PHE A CD2  1 
ATOM   2081  C  CE1  . PHE A 1 136 ? -32.561 -39.966 -14.980 1.00 35.73  ? 215  PHE A CE1  1 
ATOM   2082  C  CE2  . PHE A 1 136 ? -30.482 -40.720 -14.071 1.00 21.21  ? 215  PHE A CE2  1 
ATOM   2083  C  CZ   . PHE A 1 136 ? -31.499 -40.853 -14.993 1.00 28.86  ? 215  PHE A CZ   1 
ATOM   2084  H  H    . PHE A 1 136 ? -31.014 -35.828 -13.582 1.00 23.20  ? 215  PHE A H    1 
ATOM   2085  H  HA   . PHE A 1 136 ? -33.335 -36.836 -12.778 1.00 23.53  ? 215  PHE A HA   1 
ATOM   2086  H  HB2  . PHE A 1 136 ? -30.696 -37.390 -11.952 1.00 26.46  ? 215  PHE A HB2  1 
ATOM   2087  H  HB3  . PHE A 1 136 ? -31.939 -38.081 -11.251 1.00 26.46  ? 215  PHE A HB3  1 
ATOM   2088  H  HD1  . PHE A 1 136 ? -33.314 -38.349 -14.035 1.00 29.62  ? 215  PHE A HD1  1 
ATOM   2089  H  HD2  . PHE A 1 136 ? -29.835 -39.620 -12.519 1.00 24.31  ? 215  PHE A HD2  1 
ATOM   2090  H  HE1  . PHE A 1 136 ? -33.248 -40.052 -15.601 1.00 42.88  ? 215  PHE A HE1  1 
ATOM   2091  H  HE2  . PHE A 1 136 ? -29.769 -41.317 -14.077 1.00 25.46  ? 215  PHE A HE2  1 
ATOM   2092  H  HZ   . PHE A 1 136 ? -31.472 -41.538 -15.621 1.00 34.63  ? 215  PHE A HZ   1 
ATOM   2093  N  N    . ARG A 1 137 ? -31.742 -34.918 -10.756 1.00 20.16  ? 216  ARG A N    1 
ATOM   2094  C  CA   . ARG A 1 137 ? -31.877 -34.139 -9.531  1.00 20.84  ? 216  ARG A CA   1 
ATOM   2095  C  C    . ARG A 1 137 ? -32.957 -33.074 -9.676  1.00 22.45  ? 216  ARG A C    1 
ATOM   2096  O  O    . ARG A 1 137 ? -33.710 -32.806 -8.744  1.00 25.79  ? 216  ARG A O    1 
ATOM   2097  C  CB   . ARG A 1 137 ? -30.548 -33.487 -9.150  1.00 16.07  ? 216  ARG A CB   1 
ATOM   2098  C  CG   . ARG A 1 137 ? -30.555 -32.938 -7.739  1.00 17.59  ? 216  ARG A CG   1 
ATOM   2099  C  CD   . ARG A 1 137 ? -29.159 -32.716 -7.182  1.00 18.63  ? 216  ARG A CD   1 
ATOM   2100  N  NE   . ARG A 1 137 ? -28.559 -31.476 -7.662  1.00 14.46  ? 216  ARG A NE   1 
ATOM   2101  C  CZ   . ARG A 1 137 ? -27.851 -31.355 -8.780  1.00 21.12  ? 216  ARG A CZ   1 
ATOM   2102  N  NH1  . ARG A 1 137 ? -27.629 -32.403 -9.564  1.00 27.20  ? 216  ARG A NH1  1 
ATOM   2103  N  NH2  . ARG A 1 137 ? -27.360 -30.169 -9.109  1.00 21.43  ? 216  ARG A NH2  1 
ATOM   2104  H  H    . ARG A 1 137 ? -30.977 -34.845 -11.142 1.00 24.19  ? 216  ARG A H    1 
ATOM   2105  H  HA   . ARG A 1 137 ? -32.137 -34.732 -8.809  1.00 25.01  ? 216  ARG A HA   1 
ATOM   2106  H  HB2  . ARG A 1 137 ? -29.841 -34.149 -9.211  1.00 19.28  ? 216  ARG A HB2  1 
ATOM   2107  H  HB3  . ARG A 1 137 ? -30.369 -32.752 -9.758  1.00 19.28  ? 216  ARG A HB3  1 
ATOM   2108  H  HG2  . ARG A 1 137 ? -31.019 -32.086 -7.735  1.00 21.11  ? 216  ARG A HG2  1 
ATOM   2109  H  HG3  . ARG A 1 137 ? -31.013 -33.567 -7.159  1.00 21.11  ? 216  ARG A HG3  1 
ATOM   2110  H  HD2  . ARG A 1 137 ? -29.207 -32.672 -6.214  1.00 22.35  ? 216  ARG A HD2  1 
ATOM   2111  H  HD3  . ARG A 1 137 ? -28.588 -33.451 -7.453  1.00 22.35  ? 216  ARG A HD3  1 
ATOM   2112  H  HE   . ARG A 1 137 ? -28.673 -30.769 -7.185  1.00 17.35  ? 216  ARG A HE   1 
ATOM   2113  H  HH11 . ARG A 1 137 ? -27.947 -33.174 -9.352  1.00 32.64  ? 216  ARG A HH11 1 
ATOM   2114  H  HH12 . ARG A 1 137 ? -27.168 -32.311 -10.284 1.00 32.64  ? 216  ARG A HH12 1 
ATOM   2115  H  HH21 . ARG A 1 137 ? -27.502 -29.489 -8.602  1.00 25.71  ? 216  ARG A HH21 1 
ATOM   2116  H  HH22 . ARG A 1 137 ? -26.899 -30.080 -9.829  1.00 25.71  ? 216  ARG A HH22 1 
ATOM   2117  N  N    . HIS A 1 138 ? -33.033 -32.475 -10.857 1.00 26.53  ? 217  HIS A N    1 
ATOM   2118  C  CA   . HIS A 1 138 ? -34.004 -31.424 -11.125 1.00 27.74  ? 217  HIS A CA   1 
ATOM   2119  C  C    . HIS A 1 138 ? -35.418 -32.000 -11.210 1.00 26.79  ? 217  HIS A C    1 
ATOM   2120  O  O    . HIS A 1 138 ? -36.312 -31.588 -10.470 1.00 25.86  ? 217  HIS A O    1 
ATOM   2121  C  CB   . HIS A 1 138 ? -33.626 -30.707 -12.423 1.00 31.93  ? 217  HIS A CB   1 
ATOM   2122  C  CG   . HIS A 1 138 ? -34.498 -29.537 -12.759 1.00 31.06  ? 217  HIS A CG   1 
ATOM   2123  N  ND1  . HIS A 1 138 ? -34.122 -28.579 -13.676 1.00 25.37  ? 217  HIS A ND1  1 
ATOM   2124  C  CD2  . HIS A 1 138 ? -35.725 -29.167 -12.314 1.00 32.72  ? 217  HIS A CD2  1 
ATOM   2125  C  CE1  . HIS A 1 138 ? -35.074 -27.670 -13.778 1.00 34.21  ? 217  HIS A CE1  1 
ATOM   2126  N  NE2  . HIS A 1 138 ? -36.059 -28.005 -12.963 1.00 32.15  ? 217  HIS A NE2  1 
ATOM   2127  H  H    . HIS A 1 138 ? -32.527 -32.662 -11.526 1.00 31.84  ? 217  HIS A H    1 
ATOM   2128  H  HA   . HIS A 1 138 ? -33.983 -30.777 -10.403 1.00 33.29  ? 217  HIS A HA   1 
ATOM   2129  H  HB2  . HIS A 1 138 ? -32.715 -30.382 -12.344 1.00 38.32  ? 217  HIS A HB2  1 
ATOM   2130  H  HB3  . HIS A 1 138 ? -33.686 -31.339 -13.156 1.00 38.32  ? 217  HIS A HB3  1 
ATOM   2131  H  HD1  . HIS A 1 138 ? -33.381 -28.573 -14.112 1.00 30.44  ? 217  HIS A HD1  1 
ATOM   2132  H  HD2  . HIS A 1 138 ? -36.242 -29.617 -11.686 1.00 39.27  ? 217  HIS A HD2  1 
ATOM   2133  H  HE1  . HIS A 1 138 ? -35.056 -26.923 -14.331 1.00 41.05  ? 217  HIS A HE1  1 
ATOM   2134  H  HE2  . HIS A 1 138 ? -36.790 -27.565 -12.855 1.00 38.58  ? 217  HIS A HE2  1 
ATOM   2135  N  N    . THR A 1 139 ? -35.612 -32.958 -12.111 1.00 17.91  ? 218  THR A N    1 
ATOM   2136  C  CA   . THR A 1 139 ? -36.923 -33.564 -12.318 1.00 15.79  ? 218  THR A CA   1 
ATOM   2137  C  C    . THR A 1 139 ? -37.488 -34.223 -11.056 1.00 19.69  ? 218  THR A C    1 
ATOM   2138  O  O    . THR A 1 139 ? -38.646 -34.005 -10.705 1.00 19.30  ? 218  THR A O    1 
ATOM   2139  C  CB   . THR A 1 139 ? -36.871 -34.609 -13.446 1.00 15.17  ? 218  THR A CB   1 
ATOM   2140  O  OG1  . THR A 1 139 ? -36.433 -33.985 -14.659 1.00 23.58  ? 218  THR A OG1  1 
ATOM   2141  C  CG2  . THR A 1 139 ? -38.241 -35.232 -13.671 1.00 17.78  ? 218  THR A CG2  1 
ATOM   2142  H  H    . THR A 1 139 ? -34.995 -33.276 -12.619 1.00 21.49  ? 218  THR A H    1 
ATOM   2143  H  HA   . THR A 1 139 ? -37.544 -32.870 -12.589 1.00 18.95  ? 218  THR A HA   1 
ATOM   2144  H  HB   . THR A 1 139 ? -36.250 -35.313 -13.204 1.00 18.20  ? 218  THR A HB   1 
ATOM   2145  H  HG1  . THR A 1 139 ? -35.667 -33.656 -14.552 1.00 28.29  ? 218  THR A HG1  1 
ATOM   2146  H  HG21 . THR A 1 139 ? -38.193 -35.888 -14.384 1.00 21.33  ? 218  THR A HG21 1 
ATOM   2147  H  HG22 . THR A 1 139 ? -38.544 -35.670 -12.860 1.00 21.33  ? 218  THR A HG22 1 
ATOM   2148  H  HG23 . THR A 1 139 ? -38.881 -34.546 -13.917 1.00 21.33  ? 218  THR A HG23 1 
ATOM   2149  N  N    . SER A 1 140 ? -36.672 -35.023 -10.378 1.00 16.51  ? 219  SER A N    1 
ATOM   2150  C  CA   . SER A 1 140 ? -37.131 -35.760 -9.206  1.00 14.59  ? 219  SER A CA   1 
ATOM   2151  C  C    . SER A 1 140 ? -37.493 -34.819 -8.060  1.00 18.84  ? 219  SER A C    1 
ATOM   2152  O  O    . SER A 1 140 ? -38.402 -35.102 -7.278  1.00 22.29  ? 219  SER A O    1 
ATOM   2153  C  CB   . SER A 1 140 ? -36.061 -36.751 -8.740  1.00 22.10  ? 219  SER A CB   1 
ATOM   2154  O  OG   . SER A 1 140 ? -34.944 -36.080 -8.180  1.00 25.43  ? 219  SER A OG   1 
ATOM   2155  H  H    . SER A 1 140 ? -35.847 -35.158 -10.577 1.00 19.81  ? 219  SER A H    1 
ATOM   2156  H  HA   . SER A 1 140 ? -37.925 -36.265 -9.441  1.00 17.51  ? 219  SER A HA   1 
ATOM   2157  H  HB2  . SER A 1 140 ? -36.445 -37.335 -8.069  1.00 26.52  ? 219  SER A HB2  1 
ATOM   2158  H  HB3  . SER A 1 140 ? -35.764 -37.273 -9.502  1.00 26.52  ? 219  SER A HB3  1 
ATOM   2159  H  HG   . SER A 1 140 ? -34.599 -35.570 -8.752  1.00 30.51  ? 219  SER A HG   1 
ATOM   2160  N  N    . THR A 1 141 ? -36.778 -33.702 -7.960  1.00 13.30  ? 220  THR A N    1 
ATOM   2161  C  CA   . THR A 1 141 ? -37.056 -32.714 -6.924  1.00 10.35  ? 220  THR A CA   1 
ATOM   2162  C  C    . THR A 1 141 ? -38.416 -32.068 -7.159  1.00 15.61  ? 220  THR A C    1 
ATOM   2163  O  O    . THR A 1 141 ? -39.214 -31.935 -6.235  1.00 19.70  ? 220  THR A O    1 
ATOM   2164  C  CB   . THR A 1 141 ? -35.982 -31.614 -6.876  1.00 11.22  ? 220  THR A CB   1 
ATOM   2165  O  OG1  . THR A 1 141 ? -34.706 -32.209 -6.624  1.00 17.80  ? 220  THR A OG1  1 
ATOM   2166  C  CG2  . THR A 1 141 ? -36.288 -30.605 -5.770  1.00 12.66  ? 220  THR A CG2  1 
ATOM   2167  H  H    . THR A 1 141 ? -36.127 -33.494 -8.481  1.00 15.96  ? 220  THR A H    1 
ATOM   2168  H  HA   . THR A 1 141 ? -37.075 -33.155 -6.060  1.00 12.42  ? 220  THR A HA   1 
ATOM   2169  H  HB   . THR A 1 141 ? -35.960 -31.145 -7.725  1.00 13.46  ? 220  THR A HB   1 
ATOM   2170  H  HG1  . THR A 1 141 ? -34.518 -32.754 -7.234  1.00 21.36  ? 220  THR A HG1  1 
ATOM   2171  H  HG21 . THR A 1 141 ? -35.605 -29.918 -5.751  1.00 15.20  ? 220  THR A HG21 1 
ATOM   2172  H  HG22 . THR A 1 141 ? -37.150 -30.189 -5.931  1.00 15.20  ? 220  THR A HG22 1 
ATOM   2173  H  HG23 . THR A 1 141 ? -36.310 -31.053 -4.910  1.00 15.20  ? 220  THR A HG23 1 
ATOM   2174  N  N    . LEU A 1 142 ? -38.677 -31.668 -8.399  1.00 27.30  ? 221  LEU A N    1 
ATOM   2175  C  CA   . LEU A 1 142 ? -39.981 -31.126 -8.760  1.00 21.77  ? 221  LEU A CA   1 
ATOM   2176  C  C    . LEU A 1 142 ? -41.082 -32.134 -8.433  1.00 21.02  ? 221  LEU A C    1 
ATOM   2177  O  O    . LEU A 1 142 ? -42.095 -31.786 -7.826  1.00 26.23  ? 221  LEU A O    1 
ATOM   2178  C  CB   . LEU A 1 142 ? -40.020 -30.786 -10.248 1.00 17.45  ? 221  LEU A CB   1 
ATOM   2179  C  CG   . LEU A 1 142 ? -41.292 -30.080 -10.731 1.00 19.94  ? 221  LEU A CG   1 
ATOM   2180  C  CD1  . LEU A 1 142 ? -41.477 -28.721 -10.047 1.00 20.45  ? 221  LEU A CD1  1 
ATOM   2181  C  CD2  . LEU A 1 142 ? -41.290 -29.926 -12.251 1.00 22.38  ? 221  LEU A CD2  1 
ATOM   2182  H  H    . LEU A 1 142 ? -38.115 -31.699 -9.049  1.00 32.76  ? 221  LEU A H    1 
ATOM   2183  H  HA   . LEU A 1 142 ? -40.146 -30.315 -8.255  1.00 26.12  ? 221  LEU A HA   1 
ATOM   2184  H  HB2  . LEU A 1 142 ? -39.271 -30.204 -10.450 1.00 20.95  ? 221  LEU A HB2  1 
ATOM   2185  H  HB3  . LEU A 1 142 ? -39.936 -31.609 -10.754 1.00 20.95  ? 221  LEU A HB3  1 
ATOM   2186  H  HG   . LEU A 1 142 ? -42.055 -30.630 -10.496 1.00 23.93  ? 221  LEU A HG   1 
ATOM   2187  H  HD11 . LEU A 1 142 ? -42.290 -28.309 -10.379 1.00 24.54  ? 221  LEU A HD11 1 
ATOM   2188  H  HD12 . LEU A 1 142 ? -41.543 -28.857 -9.089  1.00 24.54  ? 221  LEU A HD12 1 
ATOM   2189  H  HD13 . LEU A 1 142 ? -40.714 -28.158 -10.250 1.00 24.54  ? 221  LEU A HD13 1 
ATOM   2190  H  HD21 . LEU A 1 142 ? -42.106 -29.477 -12.523 1.00 26.86  ? 221  LEU A HD21 1 
ATOM   2191  H  HD22 . LEU A 1 142 ? -40.519 -29.400 -12.514 1.00 26.86  ? 221  LEU A HD22 1 
ATOM   2192  H  HD23 . LEU A 1 142 ? -41.245 -30.806 -12.657 1.00 26.86  ? 221  LEU A HD23 1 
ATOM   2193  N  N    . ALA A 1 143 ? -40.872 -33.383 -8.840  1.00 17.83  ? 222  ALA A N    1 
ATOM   2194  C  CA   . ALA A 1 143 ? -41.803 -34.469 -8.544  1.00 12.37  ? 222  ALA A CA   1 
ATOM   2195  C  C    . ALA A 1 143 ? -42.074 -34.586 -7.046  1.00 12.23  ? 222  ALA A C    1 
ATOM   2196  O  O    . ALA A 1 143 ? -43.227 -34.657 -6.618  1.00 20.05  ? 222  ALA A O    1 
ATOM   2197  C  CB   . ALA A 1 143 ? -41.256 -35.784 -9.062  1.00 11.69  ? 222  ALA A CB   1 
ATOM   2198  H  H    . ALA A 1 143 ? -40.187 -33.631 -9.297  1.00 21.40  ? 222  ALA A H    1 
ATOM   2199  H  HA   . ALA A 1 143 ? -42.647 -34.295 -8.991  1.00 14.84  ? 222  ALA A HA   1 
ATOM   2200  H  HB1  . ALA A 1 143 ? -41.887 -36.491 -8.856  1.00 14.02  ? 222  ALA A HB1  1 
ATOM   2201  H  HB2  . ALA A 1 143 ? -41.134 -35.719 -10.022 1.00 14.02  ? 222  ALA A HB2  1 
ATOM   2202  H  HB3  . ALA A 1 143 ? -40.406 -35.963 -8.631  1.00 14.02  ? 222  ALA A HB3  1 
ATOM   2203  N  N    . ALA A 1 144 ? -41.007 -34.618 -6.256  1.00 13.38  ? 223  ALA A N    1 
ATOM   2204  C  CA   . ALA A 1 144 ? -41.130 -34.819 -4.816  1.00 14.82  ? 223  ALA A CA   1 
ATOM   2205  C  C    . ALA A 1 144 ? -41.775 -33.614 -4.157  1.00 15.56  ? 223  ALA A C    1 
ATOM   2206  O  O    . ALA A 1 144 ? -42.411 -33.738 -3.114  1.00 23.60  ? 223  ALA A O    1 
ATOM   2207  C  CB   . ALA A 1 144 ? -39.773 -35.084 -4.196  1.00 19.91  ? 223  ALA A CB   1 
ATOM   2208  H  H    . ALA A 1 144 ? -40.197 -34.526 -6.529  1.00 16.05  ? 223  ALA A H    1 
ATOM   2209  H  HA   . ALA A 1 144 ? -41.693 -35.591 -4.650  1.00 17.79  ? 223  ALA A HA   1 
ATOM   2210  H  HB1  . ALA A 1 144 ? -39.882 -35.214 -3.241  1.00 23.89  ? 223  ALA A HB1  1 
ATOM   2211  H  HB2  . ALA A 1 144 ? -39.393 -35.882 -4.598  1.00 23.89  ? 223  ALA A HB2  1 
ATOM   2212  H  HB3  . ALA A 1 144 ? -39.196 -34.323 -4.363  1.00 23.89  ? 223  ALA A HB3  1 
HETATM 2213  N  N    . MSE A 1 145 ? -41.593 -32.443 -4.749  1.00 27.80  ? 224  MSE A N    1 
HETATM 2214  C  CA   . MSE A 1 145 ? -42.203 -31.241 -4.203  1.00 25.52  ? 224  MSE A CA   1 
HETATM 2215  C  C    . MSE A 1 145 ? -43.710 -31.229 -4.447  1.00 27.44  ? 224  MSE A C    1 
HETATM 2216  O  O    . MSE A 1 145 ? -44.481 -30.881 -3.555  1.00 30.70  ? 224  MSE A O    1 
HETATM 2217  C  CB   . MSE A 1 145 ? -41.563 -29.987 -4.796  1.00 30.53  ? 224  MSE A CB   1 
HETATM 2218  C  CG   . MSE A 1 145 ? -40.168 -29.644 -4.284  1.00 27.33  ? 224  MSE A CG   1 
HETATM 2219  SE SE   . MSE A 1 145 ? -40.039 -29.533 -2.356  1.00 53.05  ? 224  MSE A SE   1 
HETATM 2220  C  CE   . MSE A 1 145 ? -39.607 -31.402 -2.008  1.00 29.12  ? 224  MSE A CE   1 
HETATM 2221  H  H    . MSE A 1 145 ? -41.127 -32.317 -5.461  1.00 33.36  ? 224  MSE A H    1 
HETATM 2222  H  HA   . MSE A 1 145 ? -42.046 -31.224 -3.246  1.00 30.63  ? 224  MSE A HA   1 
HETATM 2223  H  HB2  . MSE A 1 145 ? -41.498 -30.103 -5.757  1.00 36.64  ? 224  MSE A HB2  1 
HETATM 2224  H  HB3  . MSE A 1 145 ? -42.137 -29.230 -4.602  1.00 36.64  ? 224  MSE A HB3  1 
HETATM 2225  H  HG2  . MSE A 1 145 ? -39.549 -30.328 -4.583  1.00 32.79  ? 224  MSE A HG2  1 
HETATM 2226  H  HG3  . MSE A 1 145 ? -39.906 -28.784 -4.647  1.00 32.79  ? 224  MSE A HG3  1 
HETATM 2227  H  HE1  . MSE A 1 145 ? -40.328 -31.959 -2.340  1.00 34.94  ? 224  MSE A HE1  1 
HETATM 2228  H  HE2  . MSE A 1 145 ? -38.780 -31.624 -2.463  1.00 34.94  ? 224  MSE A HE2  1 
HETATM 2229  H  HE3  . MSE A 1 145 ? -39.504 -31.529 -1.052  1.00 34.94  ? 224  MSE A HE3  1 
ATOM   2230  N  N    . LYS A 1 146 ? -44.121 -31.589 -5.660  1.00 13.26  ? 225  LYS A N    1 
ATOM   2231  C  CA   . LYS A 1 146 ? -45.533 -31.750 -5.979  1.00 11.05  ? 225  LYS A CA   1 
ATOM   2232  C  C    . LYS A 1 146 ? -46.126 -32.880 -5.145  1.00 15.52  ? 225  LYS A C    1 
ATOM   2233  O  O    . LYS A 1 146 ? -47.252 -32.787 -4.654  1.00 23.93  ? 225  LYS A O    1 
ATOM   2234  C  CB   . LYS A 1 146 ? -45.708 -32.087 -7.459  1.00 11.42  ? 225  LYS A CB   1 
ATOM   2235  C  CG   . LYS A 1 146 ? -45.534 -30.934 -8.446  1.00 14.87  ? 225  LYS A CG   1 
ATOM   2236  C  CD   . LYS A 1 146 ? -45.499 -29.571 -7.787  1.00 21.37  ? 225  LYS A CD   1 
ATOM   2237  C  CE   . LYS A 1 146 ? -45.399 -28.465 -8.819  1.00 21.05  ? 225  LYS A CE   1 
ATOM   2238  N  NZ   . LYS A 1 146 ? -45.362 -27.136 -8.154  1.00 23.36  ? 225  LYS A NZ   1 
ATOM   2239  H  H    . LYS A 1 146 ? -43.595 -31.748 -6.321  1.00 15.92  ? 225  LYS A H    1 
ATOM   2240  H  HA   . LYS A 1 146 ? -46.012 -30.930 -5.784  1.00 13.27  ? 225  LYS A HA   1 
ATOM   2241  H  HB2  . LYS A 1 146 ? -45.058 -32.768 -7.695  1.00 13.71  ? 225  LYS A HB2  1 
ATOM   2242  H  HB3  . LYS A 1 146 ? -46.603 -32.441 -7.586  1.00 13.71  ? 225  LYS A HB3  1 
ATOM   2243  H  HG2  . LYS A 1 146 ? -44.698 -31.054 -8.923  1.00 17.85  ? 225  LYS A HG2  1 
ATOM   2244  H  HG3  . LYS A 1 146 ? -46.275 -30.943 -9.071  1.00 17.85  ? 225  LYS A HG3  1 
ATOM   2245  H  HD2  . LYS A 1 146 ? -46.314 -29.440 -7.278  1.00 25.64  ? 225  LYS A HD2  1 
ATOM   2246  H  HD3  . LYS A 1 146 ? -44.726 -29.516 -7.205  1.00 25.64  ? 225  LYS A HD3  1 
ATOM   2247  H  HE2  . LYS A 1 146 ? -44.583 -28.574 -9.333  1.00 25.26  ? 225  LYS A HE2  1 
ATOM   2248  H  HE3  . LYS A 1 146 ? -46.173 -28.495 -9.403  1.00 25.26  ? 225  LYS A HE3  1 
ATOM   2249  H  HZ1  . LYS A 1 146 ? -46.103 -27.015 -7.676  1.00 28.03  ? 225  LYS A HZ1  1 
ATOM   2250  H  HZ2  . LYS A 1 146 ? -44.657 -27.087 -7.613  1.00 28.03  ? 225  LYS A HZ2  1 
ATOM   2251  H  HZ3  . LYS A 1 146 ? -45.303 -26.492 -8.765  1.00 28.03  ? 225  LYS A HZ3  1 
ATOM   2252  N  N    . LEU A 1 147 ? -45.362 -33.954 -4.997  1.00 20.74  ? 226  LEU A N    1 
ATOM   2253  C  CA   . LEU A 1 147 ? -45.811 -35.100 -4.229  1.00 16.76  ? 226  LEU A CA   1 
ATOM   2254  C  C    . LEU A 1 147 ? -46.118 -34.689 -2.797  1.00 12.01  ? 226  LEU A C    1 
ATOM   2255  O  O    . LEU A 1 147 ? -47.136 -35.083 -2.235  1.00 17.33  ? 226  LEU A O    1 
ATOM   2256  C  CB   . LEU A 1 147 ? -44.740 -36.191 -4.243  1.00 20.19  ? 226  LEU A CB   1 
ATOM   2257  C  CG   . LEU A 1 147 ? -45.105 -37.502 -3.551  1.00 17.94  ? 226  LEU A CG   1 
ATOM   2258  C  CD1  . LEU A 1 147 ? -46.396 -38.007 -4.139  1.00 15.79  ? 226  LEU A CD1  1 
ATOM   2259  C  CD2  . LEU A 1 147 ? -43.999 -38.530 -3.715  1.00 21.32  ? 226  LEU A CD2  1 
ATOM   2260  H  H    . LEU A 1 147 ? -44.576 -34.042 -5.335  1.00 24.88  ? 226  LEU A H    1 
ATOM   2261  H  HA   . LEU A 1 147 ? -46.620 -35.458 -4.626  1.00 20.11  ? 226  LEU A HA   1 
ATOM   2262  H  HB2  . LEU A 1 147 ? -44.532 -36.402 -5.167  1.00 24.22  ? 226  LEU A HB2  1 
ATOM   2263  H  HB3  . LEU A 1 147 ? -43.947 -35.845 -3.806  1.00 24.22  ? 226  LEU A HB3  1 
ATOM   2264  H  HG   . LEU A 1 147 ? -45.239 -37.341 -2.604  1.00 21.53  ? 226  LEU A HG   1 
ATOM   2265  H  HD11 . LEU A 1 147 ? -46.635 -38.840 -3.704  1.00 18.95  ? 226  LEU A HD11 1 
ATOM   2266  H  HD12 . LEU A 1 147 ? -47.089 -37.345 -3.992  1.00 18.95  ? 226  LEU A HD12 1 
ATOM   2267  H  HD13 . LEU A 1 147 ? -46.273 -38.153 -5.090  1.00 18.95  ? 226  LEU A HD13 1 
ATOM   2268  H  HD21 . LEU A 1 147 ? -44.261 -39.349 -3.265  1.00 25.58  ? 226  LEU A HD21 1 
ATOM   2269  H  HD22 . LEU A 1 147 ? -43.864 -38.700 -4.660  1.00 25.58  ? 226  LEU A HD22 1 
ATOM   2270  H  HD23 . LEU A 1 147 ? -43.184 -38.182 -3.321  1.00 25.58  ? 226  LEU A HD23 1 
HETATM 2271  N  N    . MSE A 1 148 ? -45.236 -33.884 -2.216  1.00 25.48  ? 227  MSE A N    1 
HETATM 2272  C  CA   . MSE A 1 148 ? -45.413 -33.414 -0.849  1.00 22.62  ? 227  MSE A CA   1 
HETATM 2273  C  C    . MSE A 1 148 ? -46.685 -32.581 -0.723  1.00 22.77  ? 227  MSE A C    1 
HETATM 2274  O  O    . MSE A 1 148 ? -47.446 -32.748 0.227   1.00 27.31  ? 227  MSE A O    1 
HETATM 2275  C  CB   . MSE A 1 148 ? -44.204 -32.582 -0.427  1.00 31.12  ? 227  MSE A CB   1 
HETATM 2276  C  CG   . MSE A 1 148 ? -44.313 -31.906 0.930   1.00 32.66  ? 227  MSE A CG   1 
HETATM 2277  SE SE   . MSE A 1 148 ? -43.679 -32.938 2.439   1.00 50.04  ? 227  MSE A SE   1 
HETATM 2278  C  CE   . MSE A 1 148 ? -43.496 -31.445 3.687   1.00 27.94  ? 227  MSE A CE   1 
HETATM 2279  H  H    . MSE A 1 148 ? -44.521 -33.594 -2.596  1.00 30.57  ? 227  MSE A H    1 
HETATM 2280  H  HA   . MSE A 1 148 ? -45.475 -34.179 -0.256  1.00 27.15  ? 227  MSE A HA   1 
HETATM 2281  H  HB2  . MSE A 1 148 ? -43.427 -33.162 -0.401  1.00 37.35  ? 227  MSE A HB2  1 
HETATM 2282  H  HB3  . MSE A 1 148 ? -44.065 -31.885 -1.087  1.00 37.35  ? 227  MSE A HB3  1 
HETATM 2283  H  HG2  . MSE A 1 148 ? -43.799 -31.084 0.904   1.00 39.19  ? 227  MSE A HG2  1 
HETATM 2284  H  HG3  . MSE A 1 148 ? -45.246 -31.698 1.093   1.00 39.19  ? 227  MSE A HG3  1 
HETATM 2285  H  HE1  . MSE A 1 148 ? -43.174 -31.783 4.537   1.00 33.52  ? 227  MSE A HE1  1 
HETATM 2286  H  HE2  . MSE A 1 148 ? -42.864 -30.806 3.323   1.00 33.52  ? 227  MSE A HE2  1 
HETATM 2287  H  HE3  . MSE A 1 148 ? -44.362 -31.024 3.804   1.00 33.52  ? 227  MSE A HE3  1 
ATOM   2288  N  N    . THR A 1 149 ? -46.904 -31.673 -1.671  1.00 15.69  ? 228  THR A N    1 
ATOM   2289  C  CA   . THR A 1 149 ? -48.061 -30.776 -1.628  1.00 15.06  ? 228  THR A CA   1 
ATOM   2290  C  C    . THR A 1 149 ? -49.364 -31.568 -1.703  1.00 13.20  ? 228  THR A C    1 
ATOM   2291  O  O    . THR A 1 149 ? -50.343 -31.230 -1.038  1.00 14.68  ? 228  THR A O    1 
ATOM   2292  C  CB   . THR A 1 149 ? -48.030 -29.736 -2.768  1.00 11.19  ? 228  THR A CB   1 
ATOM   2293  O  OG1  . THR A 1 149 ? -46.852 -28.934 -2.653  1.00 16.47  ? 228  THR A OG1  1 
ATOM   2294  C  CG2  . THR A 1 149 ? -49.258 -28.819 -2.714  1.00 11.73  ? 228  THR A CG2  1 
ATOM   2295  H  H    . THR A 1 149 ? -46.395 -31.554 -2.355  1.00 18.83  ? 228  THR A H    1 
ATOM   2296  H  HA   . THR A 1 149 ? -48.053 -30.295 -0.786  1.00 18.07  ? 228  THR A HA   1 
ATOM   2297  H  HB   . THR A 1 149 ? -48.027 -30.194 -3.623  1.00 13.43  ? 228  THR A HB   1 
ATOM   2298  H  HG1  . THR A 1 149 ? -46.829 -28.366 -3.271  1.00 19.77  ? 228  THR A HG1  1 
ATOM   2299  H  HG21 . THR A 1 149 ? -49.221 -28.173 -3.437  1.00 14.07  ? 228  THR A HG21 1 
ATOM   2300  H  HG22 . THR A 1 149 ? -50.068 -29.345 -2.802  1.00 14.07  ? 228  THR A HG22 1 
ATOM   2301  H  HG23 . THR A 1 149 ? -49.280 -28.345 -1.868  1.00 14.07  ? 228  THR A HG23 1 
ATOM   2302  N  N    . ALA A 1 150 ? -49.365 -32.623 -2.510  1.00 13.83  ? 229  ALA A N    1 
ATOM   2303  C  CA   . ALA A 1 150 ? -50.505 -33.524 -2.583  1.00 15.40  ? 229  ALA A CA   1 
ATOM   2304  C  C    . ALA A 1 150 ? -50.771 -34.139 -1.215  1.00 17.91  ? 229  ALA A C    1 
ATOM   2305  O  O    . ALA A 1 150 ? -51.924 -34.347 -0.828  1.00 22.39  ? 229  ALA A O    1 
ATOM   2306  C  CB   . ALA A 1 150 ? -50.255 -34.616 -3.606  1.00 14.51  ? 229  ALA A CB   1 
ATOM   2307  H  H    . ALA A 1 150 ? -48.713 -32.838 -3.028  1.00 16.60  ? 229  ALA A H    1 
ATOM   2308  H  HA   . ALA A 1 150 ? -51.293 -33.026 -2.854  1.00 18.48  ? 229  ALA A HA   1 
ATOM   2309  H  HB1  . ALA A 1 150 ? -51.027 -35.203 -3.637  1.00 17.41  ? 229  ALA A HB1  1 
ATOM   2310  H  HB2  . ALA A 1 150 ? -50.115 -34.208 -4.475  1.00 17.41  ? 229  ALA A HB2  1 
ATOM   2311  H  HB3  . ALA A 1 150 ? -49.467 -35.119 -3.345  1.00 17.41  ? 229  ALA A HB3  1 
ATOM   2312  N  N    . LEU A 1 151 ? -49.698 -34.435 -0.488  1.00 11.75  ? 230  LEU A N    1 
ATOM   2313  C  CA   . LEU A 1 151 ? -49.813 -35.050 0.829   1.00 12.09  ? 230  LEU A CA   1 
ATOM   2314  C  C    . LEU A 1 151 ? -50.284 -34.061 1.897   1.00 12.35  ? 230  LEU A C    1 
ATOM   2315  O  O    . LEU A 1 151 ? -50.903 -34.466 2.881   1.00 12.84  ? 230  LEU A O    1 
ATOM   2316  C  CB   . LEU A 1 151 ? -48.485 -35.699 1.238   1.00 12.02  ? 230  LEU A CB   1 
ATOM   2317  C  CG   . LEU A 1 151 ? -48.067 -36.969 0.488   1.00 12.08  ? 230  LEU A CG   1 
ATOM   2318  C  CD1  . LEU A 1 151 ? -46.704 -37.466 0.980   1.00 12.16  ? 230  LEU A CD1  1 
ATOM   2319  C  CD2  . LEU A 1 151 ? -49.121 -38.047 0.656   1.00 12.63  ? 230  LEU A CD2  1 
ATOM   2320  H  H    . LEU A 1 151 ? -48.888 -34.289 -0.737  1.00 14.11  ? 230  LEU A H    1 
ATOM   2321  H  HA   . LEU A 1 151 ? -50.476 -35.757 0.778   1.00 14.51  ? 230  LEU A HA   1 
ATOM   2322  H  HB2  . LEU A 1 151 ? -47.779 -35.047 1.109   1.00 14.42  ? 230  LEU A HB2  1 
ATOM   2323  H  HB3  . LEU A 1 151 ? -48.539 -35.929 2.179   1.00 14.42  ? 230  LEU A HB3  1 
ATOM   2324  H  HG   . LEU A 1 151 ? -47.991 -36.768 -0.457  1.00 14.49  ? 230  LEU A HG   1 
ATOM   2325  H  HD11 . LEU A 1 151 ? -46.465 -38.269 0.490   1.00 14.59  ? 230  LEU A HD11 1 
ATOM   2326  H  HD12 . LEU A 1 151 ? -46.041 -36.775 0.826   1.00 14.59  ? 230  LEU A HD12 1 
ATOM   2327  H  HD13 . LEU A 1 151 ? -46.763 -37.663 1.928   1.00 14.59  ? 230  LEU A HD13 1 
ATOM   2328  H  HD21 . LEU A 1 151 ? -48.839 -38.841 0.175   1.00 15.16  ? 230  LEU A HD21 1 
ATOM   2329  H  HD22 . LEU A 1 151 ? -49.219 -38.249 1.600   1.00 15.16  ? 230  LEU A HD22 1 
ATOM   2330  H  HD23 . LEU A 1 151 ? -49.963 -37.725 0.297   1.00 15.16  ? 230  LEU A HD23 1 
ATOM   2331  N  N    . VAL A 1 152 ? -50.008 -32.772 1.710   1.00 13.90  ? 231  VAL A N    1 
ATOM   2332  C  CA   . VAL A 1 152 ? -50.494 -31.758 2.645   1.00 14.43  ? 231  VAL A CA   1 
ATOM   2333  C  C    . VAL A 1 152 ? -52.010 -31.686 2.532   1.00 18.75  ? 231  VAL A C    1 
ATOM   2334  O  O    . VAL A 1 152 ? -52.706 -31.448 3.517   1.00 24.42  ? 231  VAL A O    1 
ATOM   2335  C  CB   . VAL A 1 152 ? -49.859 -30.358 2.397   1.00 20.13  ? 231  VAL A CB   1 
ATOM   2336  C  CG1  . VAL A 1 152 ? -50.394 -29.334 3.391   1.00 19.71  ? 231  VAL A CG1  1 
ATOM   2337  C  CG2  . VAL A 1 152 ? -48.326 -30.422 2.500   1.00 16.06  ? 231  VAL A CG2  1 
ATOM   2338  H  H    . VAL A 1 152 ? -49.545 -32.460 1.055   1.00 16.68  ? 231  VAL A H    1 
ATOM   2339  H  HA   . VAL A 1 152 ? -50.273 -32.030 3.549   1.00 17.32  ? 231  VAL A HA   1 
ATOM   2340  H  HB   . VAL A 1 152 ? -50.088 -30.059 1.503   1.00 24.15  ? 231  VAL A HB   1 
ATOM   2341  H  HG11 . VAL A 1 152 ? -49.981 -28.475 3.212   1.00 23.65  ? 231  VAL A HG11 1 
ATOM   2342  H  HG12 . VAL A 1 152 ? -51.356 -29.267 3.287   1.00 23.65  ? 231  VAL A HG12 1 
ATOM   2343  H  HG13 . VAL A 1 152 ? -50.178 -29.625 4.291   1.00 23.65  ? 231  VAL A HG13 1 
ATOM   2344  H  HG21 . VAL A 1 152 ? -47.962 -29.537 2.341   1.00 19.27  ? 231  VAL A HG21 1 
ATOM   2345  H  HG22 . VAL A 1 152 ? -48.083 -30.725 3.389   1.00 19.27  ? 231  VAL A HG22 1 
ATOM   2346  H  HG23 . VAL A 1 152 ? -47.991 -31.042 1.835   1.00 19.27  ? 231  VAL A HG23 1 
ATOM   2347  N  N    . ASN A 1 153 ? -52.526 -31.919 1.331   1.00 31.21  ? 232  ASN A N    1 
ATOM   2348  C  CA   . ASN A 1 153 ? -53.963 -31.948 1.127   1.00 26.85  ? 232  ASN A CA   1 
ATOM   2349  C  C    . ASN A 1 153 ? -54.588 -33.136 1.847   1.00 27.99  ? 232  ASN A C    1 
ATOM   2350  O  O    . ASN A 1 153 ? -55.603 -32.996 2.528   1.00 35.77  ? 232  ASN A O    1 
ATOM   2351  C  CB   . ASN A 1 153 ? -54.284 -32.029 -0.358  1.00 27.12  ? 232  ASN A CB   1 
ATOM   2352  C  CG   . ASN A 1 153 ? -55.659 -31.495 -0.679  1.00 41.43  ? 232  ASN A CG   1 
ATOM   2353  O  OD1  . ASN A 1 153 ? -55.954 -30.322 -0.451  1.00 45.18  ? 232  ASN A OD1  1 
ATOM   2354  N  ND2  . ASN A 1 153 ? -56.512 -32.356 -1.214  1.00 53.77  ? 232  ASN A ND2  1 
ATOM   2355  H  H    . ASN A 1 153 ? -52.064 -32.063 0.620   1.00 37.45  ? 232  ASN A H    1 
ATOM   2356  H  HA   . ASN A 1 153 ? -54.355 -31.135 1.481   1.00 32.22  ? 232  ASN A HA   1 
ATOM   2357  H  HB2  . ASN A 1 153 ? -53.635 -31.505 -0.852  1.00 32.55  ? 232  ASN A HB2  1 
ATOM   2358  H  HB3  . ASN A 1 153 ? -54.247 -32.956 -0.641  1.00 32.55  ? 232  ASN A HB3  1 
ATOM   2359  H  HD21 . ASN A 1 153 ? -57.309 -32.103 -1.416  1.00 64.52  ? 232  ASN A HD21 1 
ATOM   2360  H  HD22 . ASN A 1 153 ? -56.269 -33.168 -1.360  1.00 64.52  ? 232  ASN A HD22 1 
ATOM   2361  N  N    . VAL A 1 154 ? -53.970 -34.304 1.691   1.00 14.92  ? 233  VAL A N    1 
ATOM   2362  C  CA   . VAL A 1 154 ? -54.423 -35.527 2.354   1.00 13.93  ? 233  VAL A CA   1 
ATOM   2363  C  C    . VAL A 1 154 ? -54.439 -35.350 3.864   1.00 14.37  ? 233  VAL A C    1 
ATOM   2364  O  O    . VAL A 1 154 ? -55.414 -35.709 4.529   1.00 21.60  ? 233  VAL A O    1 
ATOM   2365  C  CB   . VAL A 1 154 ? -53.520 -36.728 1.998   1.00 13.72  ? 233  VAL A CB   1 
ATOM   2366  C  CG1  . VAL A 1 154 ? -53.903 -37.971 2.804   1.00 14.36  ? 233  VAL A CG1  1 
ATOM   2367  C  CG2  . VAL A 1 154 ? -53.601 -37.017 0.508   1.00 19.92  ? 233  VAL A CG2  1 
ATOM   2368  H  H    . VAL A 1 154 ? -53.275 -34.417 1.197   1.00 17.90  ? 233  VAL A H    1 
ATOM   2369  H  HA   . VAL A 1 154 ? -55.326 -35.731 2.064   1.00 16.72  ? 233  VAL A HA   1 
ATOM   2370  H  HB   . VAL A 1 154 ? -52.601 -36.505 2.210   1.00 16.47  ? 233  VAL A HB   1 
ATOM   2371  H  HG11 . VAL A 1 154 ? -53.316 -38.702 2.554   1.00 17.23  ? 233  VAL A HG11 1 
ATOM   2372  H  HG12 . VAL A 1 154 ? -53.805 -37.776 3.749   1.00 17.23  ? 233  VAL A HG12 1 
ATOM   2373  H  HG13 . VAL A 1 154 ? -54.824 -38.203 2.608   1.00 17.23  ? 233  VAL A HG13 1 
ATOM   2374  H  HG21 . VAL A 1 154 ? -53.029 -37.773 0.302   1.00 23.91  ? 233  VAL A HG21 1 
ATOM   2375  H  HG22 . VAL A 1 154 ? -54.520 -37.224 0.276   1.00 23.91  ? 233  VAL A HG22 1 
ATOM   2376  H  HG23 . VAL A 1 154 ? -53.304 -36.234 0.019   1.00 23.91  ? 233  VAL A HG23 1 
ATOM   2377  N  N    . ALA A 1 155 ? -53.358 -34.799 4.402   1.00 14.14  ? 234  ALA A N    1 
ATOM   2378  C  CA   . ALA A 1 155 ? -53.268 -34.541 5.832   1.00 14.72  ? 234  ALA A CA   1 
ATOM   2379  C  C    . ALA A 1 155 ? -54.398 -33.618 6.273   1.00 15.27  ? 234  ALA A C    1 
ATOM   2380  O  O    . ALA A 1 155 ? -55.056 -33.864 7.284   1.00 27.80  ? 234  ALA A O    1 
ATOM   2381  C  CB   . ALA A 1 155 ? -51.922 -33.931 6.173   1.00 14.48  ? 234  ALA A CB   1 
ATOM   2382  H  H    . ALA A 1 155 ? -52.659 -34.565 3.958   1.00 16.97  ? 234  ALA A H    1 
ATOM   2383  H  HA   . ALA A 1 155 ? -53.354 -35.378 6.314   1.00 17.67  ? 234  ALA A HA   1 
ATOM   2384  H  HB1  . ALA A 1 155 ? -51.883 -33.767 7.128   1.00 17.37  ? 234  ALA A HB1  1 
ATOM   2385  H  HB2  . ALA A 1 155 ? -51.221 -34.550 5.914   1.00 17.37  ? 234  ALA A HB2  1 
ATOM   2386  H  HB3  . ALA A 1 155 ? -51.822 -33.096 5.689   1.00 17.37  ? 234  ALA A HB3  1 
ATOM   2387  N  N    . LEU A 1 156 ? -54.629 -32.562 5.500   1.00 15.00  ? 235  LEU A N    1 
ATOM   2388  C  CA   . LEU A 1 156 ? -55.663 -31.590 5.825   1.00 15.68  ? 235  LEU A CA   1 
ATOM   2389  C  C    . LEU A 1 156 ? -57.047 -32.232 5.845   1.00 19.89  ? 235  LEU A C    1 
ATOM   2390  O  O    . LEU A 1 156 ? -57.825 -32.010 6.774   1.00 18.71  ? 235  LEU A O    1 
ATOM   2391  C  CB   . LEU A 1 156 ? -55.629 -30.444 4.817   1.00 15.38  ? 235  LEU A CB   1 
ATOM   2392  C  CG   . LEU A 1 156 ? -56.555 -29.251 5.043   1.00 16.17  ? 235  LEU A CG   1 
ATOM   2393  C  CD1  . LEU A 1 156 ? -56.503 -28.777 6.480   1.00 16.92  ? 235  LEU A CD1  1 
ATOM   2394  C  CD2  . LEU A 1 156 ? -56.134 -28.138 4.102   1.00 15.94  ? 235  LEU A CD2  1 
ATOM   2395  H  H    . LEU A 1 156 ? -54.197 -32.386 4.777   1.00 18.01  ? 235  LEU A H    1 
ATOM   2396  H  HA   . LEU A 1 156 ? -55.488 -31.223 6.706   1.00 18.81  ? 235  LEU A HA   1 
ATOM   2397  H  HB2  . LEU A 1 156 ? -54.724 -30.096 4.794   1.00 18.46  ? 235  LEU A HB2  1 
ATOM   2398  H  HB3  . LEU A 1 156 ? -55.850 -30.809 3.946   1.00 18.46  ? 235  LEU A HB3  1 
ATOM   2399  H  HG   . LEU A 1 156 ? -57.468 -29.504 4.834   1.00 19.41  ? 235  LEU A HG   1 
ATOM   2400  H  HD11 . LEU A 1 156 ? -57.102 -28.021 6.584   1.00 20.31  ? 235  LEU A HD11 1 
ATOM   2401  H  HD12 . LEU A 1 156 ? -56.781 -29.502 7.061   1.00 20.31  ? 235  LEU A HD12 1 
ATOM   2402  H  HD13 . LEU A 1 156 ? -55.595 -28.512 6.691   1.00 20.31  ? 235  LEU A HD13 1 
ATOM   2403  H  HD21 . LEU A 1 156 ? -56.716 -27.373 4.237   1.00 19.13  ? 235  LEU A HD21 1 
ATOM   2404  H  HD22 . LEU A 1 156 ? -55.215 -27.892 4.295   1.00 19.13  ? 235  LEU A HD22 1 
ATOM   2405  H  HD23 . LEU A 1 156 ? -56.207 -28.453 3.188   1.00 19.13  ? 235  LEU A HD23 1 
ATOM   2406  N  N    . ASN A 1 157 ? -57.350 -33.023 4.817   1.00 20.55  ? 236  ASN A N    1 
ATOM   2407  C  CA   . ASN A 1 157 ? -58.604 -33.761 4.768   1.00 16.43  ? 236  ASN A CA   1 
ATOM   2408  C  C    . ASN A 1 157 ? -58.733 -34.655 5.990   1.00 21.26  ? 236  ASN A C    1 
ATOM   2409  O  O    . ASN A 1 157 ? -59.791 -34.719 6.613   1.00 29.25  ? 236  ASN A O    1 
ATOM   2410  C  CB   . ASN A 1 157 ? -58.681 -34.634 3.516   1.00 19.30  ? 236  ASN A CB   1 
ATOM   2411  C  CG   . ASN A 1 157 ? -58.859 -33.836 2.247   1.00 18.93  ? 236  ASN A CG   1 
ATOM   2412  O  OD1  . ASN A 1 157 ? -59.346 -32.705 2.268   1.00 18.72  ? 236  ASN A OD1  1 
ATOM   2413  N  ND2  . ASN A 1 157 ? -58.478 -34.433 1.121   1.00 19.50  ? 236  ASN A ND2  1 
ATOM   2414  H  H    . ASN A 1 157 ? -56.843 -33.148 4.134   1.00 24.66  ? 236  ASN A H    1 
ATOM   2415  H  HA   . ASN A 1 157 ? -59.349 -33.139 4.758   1.00 19.72  ? 236  ASN A HA   1 
ATOM   2416  H  HB2  . ASN A 1 157 ? -57.859 -35.143 3.436   1.00 23.16  ? 236  ASN A HB2  1 
ATOM   2417  H  HB3  . ASN A 1 157 ? -59.436 -35.237 3.598   1.00 23.16  ? 236  ASN A HB3  1 
ATOM   2418  H  HD21 . ASN A 1 157 ? -58.557 -34.023 0.369   1.00 23.40  ? 236  ASN A HD21 1 
ATOM   2419  H  HD22 . ASN A 1 157 ? -58.152 -35.228 1.145   1.00 23.40  ? 236  ASN A HD22 1 
ATOM   2420  N  N    . LEU A 1 158 ? -57.651 -35.358 6.318   1.00 17.18  ? 237  LEU A N    1 
ATOM   2421  C  CA   . LEU A 1 158 ? -57.640 -36.264 7.464   1.00 17.31  ? 237  LEU A CA   1 
ATOM   2422  C  C    . LEU A 1 158 ? -57.976 -35.516 8.743   1.00 18.11  ? 237  LEU A C    1 
ATOM   2423  O  O    . LEU A 1 158 ? -58.791 -35.967 9.545   1.00 21.84  ? 237  LEU A O    1 
ATOM   2424  C  CB   . LEU A 1 158 ? -56.272 -36.926 7.614   1.00 16.97  ? 237  LEU A CB   1 
ATOM   2425  C  CG   . LEU A 1 158 ? -56.122 -38.379 7.162   1.00 16.99  ? 237  LEU A CG   1 
ATOM   2426  C  CD1  . LEU A 1 158 ? -54.678 -38.820 7.390   1.00 22.53  ? 237  LEU A CD1  1 
ATOM   2427  C  CD2  . LEU A 1 158 ? -57.098 -39.320 7.879   1.00 18.01  ? 237  LEU A CD2  1 
ATOM   2428  H  H    . LEU A 1 158 ? -56.906 -35.328 5.890   1.00 20.62  ? 237  LEU A H    1 
ATOM   2429  H  HA   . LEU A 1 158 ? -58.304 -36.959 7.332   1.00 20.77  ? 237  LEU A HA   1 
ATOM   2430  H  HB2  . LEU A 1 158 ? -55.631 -36.405 7.105   1.00 20.36  ? 237  LEU A HB2  1 
ATOM   2431  H  HB3  . LEU A 1 158 ? -56.028 -36.897 8.553   1.00 20.36  ? 237  LEU A HB3  1 
ATOM   2432  H  HG   . LEU A 1 158 ? -56.302 -38.431 6.210   1.00 20.39  ? 237  LEU A HG   1 
ATOM   2433  H  HD11 . LEU A 1 158 ? -54.581 -39.741 7.103   1.00 27.03  ? 237  LEU A HD11 1 
ATOM   2434  H  HD12 . LEU A 1 158 ? -54.089 -38.248 6.873   1.00 27.03  ? 237  LEU A HD12 1 
ATOM   2435  H  HD13 . LEU A 1 158 ? -54.471 -38.743 8.334   1.00 27.03  ? 237  LEU A HD13 1 
ATOM   2436  H  HD21 . LEU A 1 158 ? -56.960 -40.224 7.556   1.00 21.61  ? 237  LEU A HD21 1 
ATOM   2437  H  HD22 . LEU A 1 158 ? -56.930 -39.280 8.834   1.00 21.61  ? 237  LEU A HD22 1 
ATOM   2438  H  HD23 . LEU A 1 158 ? -58.006 -39.035 7.691   1.00 21.61  ? 237  LEU A HD23 1 
ATOM   2439  N  N    . SER A 1 159 ? -57.348 -34.360 8.916   1.00 17.90  ? 238  SER A N    1 
ATOM   2440  C  CA   . SER A 1 159 ? -57.573 -33.532 10.088  1.00 18.79  ? 238  SER A CA   1 
ATOM   2441  C  C    . SER A 1 159 ? -59.048 -33.154 10.199  1.00 19.53  ? 238  SER A C    1 
ATOM   2442  O  O    . SER A 1 159 ? -59.648 -33.247 11.271  1.00 20.58  ? 238  SER A O    1 
ATOM   2443  C  CB   . SER A 1 159 ? -56.705 -32.279 9.996   1.00 18.45  ? 238  SER A CB   1 
ATOM   2444  O  OG   . SER A 1 159 ? -57.042 -31.346 11.002  1.00 20.46  ? 238  SER A OG   1 
ATOM   2445  H  H    . SER A 1 159 ? -56.780 -34.031 8.361   1.00 21.48  ? 238  SER A H    1 
ATOM   2446  H  HA   . SER A 1 159 ? -57.320 -34.023 10.885  1.00 22.54  ? 238  SER A HA   1 
ATOM   2447  H  HB2  . SER A 1 159 ? -55.775 -32.532 10.102  1.00 22.14  ? 238  SER A HB2  1 
ATOM   2448  H  HB3  . SER A 1 159 ? -56.838 -31.867 9.128   1.00 22.14  ? 238  SER A HB3  1 
ATOM   2449  H  HG   . SER A 1 159 ? -56.556 -30.665 10.937  1.00 24.56  ? 238  SER A HG   1 
ATOM   2450  N  N    . ILE A 1 160 ? -59.626 -32.739 9.077   1.00 19.11  ? 239  ILE A N    1 
ATOM   2451  C  CA   . ILE A 1 160 ? -61.036 -32.382 9.022   1.00 19.87  ? 239  ILE A CA   1 
ATOM   2452  C  C    . ILE A 1 160 ? -61.903 -33.591 9.363   1.00 20.43  ? 239  ILE A C    1 
ATOM   2453  O  O    . ILE A 1 160 ? -62.832 -33.498 10.162  1.00 21.48  ? 239  ILE A O    1 
ATOM   2454  C  CB   . ILE A 1 160 ? -61.402 -31.823 7.627   1.00 19.40  ? 239  ILE A CB   1 
ATOM   2455  C  CG1  . ILE A 1 160 ? -60.972 -30.359 7.528   1.00 19.40  ? 239  ILE A CG1  1 
ATOM   2456  C  CG2  . ILE A 1 160 ? -62.905 -31.936 7.338   1.00 20.17  ? 239  ILE A CG2  1 
ATOM   2457  C  CD1  . ILE A 1 160 ? -60.868 -29.845 6.108   1.00 18.82  ? 239  ILE A CD1  1 
ATOM   2458  H  H    . ILE A 1 160 ? -59.216 -32.655 8.326   1.00 22.93  ? 239  ILE A H    1 
ATOM   2459  H  HA   . ILE A 1 160 ? -61.214 -31.691 9.678   1.00 23.84  ? 239  ILE A HA   1 
ATOM   2460  H  HB   . ILE A 1 160 ? -60.920 -32.332 6.956   1.00 23.28  ? 239  ILE A HB   1 
ATOM   2461  H  HG12 . ILE A 1 160 ? -61.623 -29.811 7.994   1.00 23.28  ? 239  ILE A HG12 1 
ATOM   2462  H  HG13 . ILE A 1 160 ? -60.102 -30.261 7.944   1.00 23.28  ? 239  ILE A HG13 1 
ATOM   2463  H  HG21 . ILE A 1 160 ? -63.084 -31.575 6.456   1.00 24.21  ? 239  ILE A HG21 1 
ATOM   2464  H  HG22 . ILE A 1 160 ? -63.163 -32.871 7.371   1.00 24.21  ? 239  ILE A HG22 1 
ATOM   2465  H  HG23 . ILE A 1 160 ? -63.394 -31.434 8.008   1.00 24.21  ? 239  ILE A HG23 1 
ATOM   2466  H  HD11 . ILE A 1 160 ? -60.592 -28.915 6.129   1.00 22.59  ? 239  ILE A HD11 1 
ATOM   2467  H  HD12 . ILE A 1 160 ? -60.211 -30.374 5.628   1.00 22.59  ? 239  ILE A HD12 1 
ATOM   2468  H  HD13 . ILE A 1 160 ? -61.734 -29.924 5.679   1.00 22.59  ? 239  ILE A HD13 1 
ATOM   2469  N  N    . ASN A 1 161 ? -61.585 -34.731 8.764   1.00 23.44  ? 240  ASN A N    1 
ATOM   2470  C  CA   . ASN A 1 161 ? -62.314 -35.958 9.037   1.00 20.61  ? 240  ASN A CA   1 
ATOM   2471  C  C    . ASN A 1 161 ? -62.186 -36.338 10.510  1.00 30.95  ? 240  ASN A C    1 
ATOM   2472  O  O    . ASN A 1 161 ? -63.162 -36.734 11.137  1.00 37.17  ? 240  ASN A O    1 
ATOM   2473  C  CB   . ASN A 1 161 ? -61.797 -37.093 8.143   1.00 26.05  ? 240  ASN A CB   1 
ATOM   2474  C  CG   . ASN A 1 161 ? -62.786 -38.245 8.017   1.00 25.00  ? 240  ASN A CG   1 
ATOM   2475  O  OD1  . ASN A 1 161 ? -63.999 -38.053 8.091   1.00 26.78  ? 240  ASN A OD1  1 
ATOM   2476  N  ND2  . ASN A 1 161 ? -62.265 -39.451 7.814   1.00 38.01  ? 240  ASN A ND2  1 
ATOM   2477  H  H    . ASN A 1 161 ? -60.947 -34.820 8.194   1.00 28.13  ? 240  ASN A H    1 
ATOM   2478  H  HA   . ASN A 1 161 ? -63.254 -35.821 8.840   1.00 24.73  ? 240  ASN A HA   1 
ATOM   2479  H  HB2  . ASN A 1 161 ? -61.629 -36.743 7.254   1.00 31.26  ? 240  ASN A HB2  1 
ATOM   2480  H  HB3  . ASN A 1 161 ? -60.976 -37.443 8.522   1.00 31.26  ? 240  ASN A HB3  1 
ATOM   2481  H  HD21 . ASN A 1 161 ? -62.780 -40.135 7.736   1.00 45.62  ? 240  ASN A HD21 1 
ATOM   2482  H  HD22 . ASN A 1 161 ? -61.412 -39.548 7.762   1.00 45.62  ? 240  ASN A HD22 1 
HETATM 2483  N  N    . MSE A 1 162 ? -60.980 -36.201 11.058  1.00 48.34  ? 241  MSE A N    1 
HETATM 2484  C  CA   . MSE A 1 162 ? -60.722 -36.523 12.462  1.00 46.31  ? 241  MSE A CA   1 
HETATM 2485  C  C    . MSE A 1 162 ? -61.545 -35.648 13.407  1.00 46.87  ? 241  MSE A C    1 
HETATM 2486  O  O    . MSE A 1 162 ? -61.998 -36.110 14.456  1.00 44.80  ? 241  MSE A O    1 
HETATM 2487  C  CB   . MSE A 1 162 ? -59.231 -36.365 12.791  1.00 44.38  ? 241  MSE A CB   1 
HETATM 2488  C  CG   . MSE A 1 162 ? -58.340 -37.503 12.281  1.00 53.07  ? 241  MSE A CG   1 
HETATM 2489  SE SE   . MSE A 1 162 ? -56.407 -37.197 12.519  1.00 78.34  ? 241  MSE A SE   1 
HETATM 2490  C  CE   . MSE A 1 162 ? -56.340 -37.344 14.466  1.00 71.25  ? 241  MSE A CE   1 
HETATM 2491  H  H    . MSE A 1 162 ? -60.287 -35.921 10.633  1.00 58.00  ? 241  MSE A H    1 
HETATM 2492  H  HA   . MSE A 1 162 ? -60.960 -37.451 12.615  1.00 55.57  ? 241  MSE A HA   1 
HETATM 2493  H  HB2  . MSE A 1 162 ? -58.912 -35.541 12.391  1.00 53.26  ? 241  MSE A HB2  1 
HETATM 2494  H  HB3  . MSE A 1 162 ? -59.129 -36.321 13.754  1.00 53.26  ? 241  MSE A HB3  1 
HETATM 2495  H  HG2  . MSE A 1 162 ? -58.570 -38.315 12.759  1.00 63.68  ? 241  MSE A HG2  1 
HETATM 2496  H  HG3  . MSE A 1 162 ? -58.504 -37.625 11.333  1.00 63.68  ? 241  MSE A HG3  1 
HETATM 2497  H  HE1  . MSE A 1 162 ? -55.426 -37.214 14.761  1.00 85.50  ? 241  MSE A HE1  1 
HETATM 2498  H  HE2  . MSE A 1 162 ? -56.913 -36.664 14.853  1.00 85.50  ? 241  MSE A HE2  1 
HETATM 2499  H  HE3  . MSE A 1 162 ? -56.650 -38.226 14.726  1.00 85.50  ? 241  MSE A HE3  1 
ATOM   2500  N  N    . ASP A 1 163 ? -61.739 -34.388 13.034  1.00 32.58  ? 242  ASP A N    1 
ATOM   2501  C  CA   . ASP A 1 163 ? -62.497 -33.466 13.869  1.00 27.35  ? 242  ASP A CA   1 
ATOM   2502  C  C    . ASP A 1 163 ? -63.990 -33.785 13.833  1.00 33.82  ? 242  ASP A C    1 
ATOM   2503  O  O    . ASP A 1 163 ? -64.654 -33.769 14.866  1.00 44.79  ? 242  ASP A O    1 
ATOM   2504  C  CB   . ASP A 1 163 ? -62.257 -32.010 13.447  1.00 36.20  ? 242  ASP A CB   1 
ATOM   2505  C  CG   . ASP A 1 163 ? -60.881 -31.497 13.850  1.00 48.19  ? 242  ASP A CG   1 
ATOM   2506  O  OD1  . ASP A 1 163 ? -60.261 -32.083 14.762  1.00 54.02  ? 242  ASP A OD1  1 
ATOM   2507  O  OD2  . ASP A 1 163 ? -60.427 -30.491 13.263  1.00 55.99  ? 242  ASP A OD2  1 
ATOM   2508  H  H    . ASP A 1 163 ? -61.442 -34.043 12.305  1.00 39.10  ? 242  ASP A H    1 
ATOM   2509  H  HA   . ASP A 1 163 ? -62.198 -33.560 14.787  1.00 32.82  ? 242  ASP A HA   1 
ATOM   2510  H  HB2  . ASP A 1 163 ? -62.330 -31.946 12.482  1.00 43.44  ? 242  ASP A HB2  1 
ATOM   2511  H  HB3  . ASP A 1 163 ? -62.923 -31.445 13.869  1.00 43.44  ? 242  ASP A HB3  1 
ATOM   2512  N  N    . ASN A 1 164 ? -64.520 -34.053 12.643  1.00 25.08  ? 243  ASN A N    1 
ATOM   2513  C  CA   . ASN A 1 164 ? -65.919 -34.436 12.502  1.00 24.98  ? 243  ASN A CA   1 
ATOM   2514  C  C    . ASN A 1 164 ? -66.239 -35.712 13.264  1.00 25.74  ? 243  ASN A C    1 
ATOM   2515  O  O    . ASN A 1 164 ? -67.243 -35.788 13.976  1.00 29.75  ? 243  ASN A O    1 
ATOM   2516  C  CB   . ASN A 1 164 ? -66.281 -34.627 11.031  1.00 24.18  ? 243  ASN A CB   1 
ATOM   2517  C  CG   . ASN A 1 164 ? -66.283 -33.330 10.261  1.00 23.82  ? 243  ASN A CG   1 
ATOM   2518  O  OD1  . ASN A 1 164 ? -66.575 -32.275 10.816  1.00 24.56  ? 243  ASN A OD1  1 
ATOM   2519  N  ND2  . ASN A 1 164 ? -65.958 -33.397 8.973   1.00 29.78  ? 243  ASN A ND2  1 
ATOM   2520  H  H    . ASN A 1 164 ? -64.088 -34.019 11.900  1.00 30.10  ? 243  ASN A H    1 
ATOM   2521  H  HA   . ASN A 1 164 ? -66.477 -33.726 12.858  1.00 29.98  ? 243  ASN A HA   1 
ATOM   2522  H  HB2  . ASN A 1 164 ? -65.632 -35.219 10.620  1.00 29.01  ? 243  ASN A HB2  1 
ATOM   2523  H  HB3  . ASN A 1 164 ? -67.169 -35.014 10.971  1.00 29.01  ? 243  ASN A HB3  1 
ATOM   2524  H  HD21 . ASN A 1 164 ? -65.946 -32.682 8.495   1.00 35.74  ? 243  ASN A HD21 1 
ATOM   2525  H  HD22 . ASN A 1 164 ? -65.760 -34.155 8.619   1.00 35.74  ? 243  ASN A HD22 1 
ATOM   2526  N  N    . THR A 1 165 ? -65.387 -36.717 13.113  1.00 25.11  ? 244  THR A N    1 
ATOM   2527  C  CA   . THR A 1 165 ? -65.617 -37.990 13.770  1.00 25.91  ? 244  THR A CA   1 
ATOM   2528  C  C    . THR A 1 165 ? -65.477 -37.847 15.289  1.00 27.16  ? 244  THR A C    1 
ATOM   2529  O  O    . THR A 1 165 ? -66.096 -38.586 16.050  1.00 35.94  ? 244  THR A O    1 
ATOM   2530  C  CB   . THR A 1 165 ? -64.659 -39.062 13.227  1.00 25.10  ? 244  THR A CB   1 
ATOM   2531  O  OG1  . THR A 1 165 ? -65.012 -40.346 13.754  1.00 32.96  ? 244  THR A OG1  1 
ATOM   2532  C  CG2  . THR A 1 165 ? -63.242 -38.745 13.605  1.00 24.59  ? 244  THR A CG2  1 
ATOM   2533  H  H    . THR A 1 165 ? -64.672 -36.686 12.637  1.00 30.13  ? 244  THR A H    1 
ATOM   2534  H  HA   . THR A 1 165 ? -66.524 -38.279 13.582  1.00 31.10  ? 244  THR A HA   1 
ATOM   2535  H  HB   . THR A 1 165 ? -64.719 -39.086 12.259  1.00 30.12  ? 244  THR A HB   1 
ATOM   2536  H  HG1  . THR A 1 165 ? -64.488 -40.932 13.458  1.00 39.55  ? 244  THR A HG1  1 
ATOM   2537  H  HG21 . THR A 1 165 ? -62.646 -39.426 13.258  1.00 29.51  ? 244  THR A HG21 1 
ATOM   2538  H  HG22 . THR A 1 165 ? -62.986 -37.885 13.237  1.00 29.51  ? 244  THR A HG22 1 
ATOM   2539  H  HG23 . THR A 1 165 ? -63.156 -38.712 14.571  1.00 29.51  ? 244  THR A HG23 1 
ATOM   2540  N  N    . GLN A 1 166 ? -64.668 -36.887 15.722  1.00 27.02  ? 245  GLN A N    1 
ATOM   2541  C  CA   . GLN A 1 166 ? -64.507 -36.601 17.143  1.00 28.37  ? 245  GLN A CA   1 
ATOM   2542  C  C    . GLN A 1 166 ? -65.783 -35.978 17.701  1.00 30.73  ? 245  GLN A C    1 
ATOM   2543  O  O    . GLN A 1 166 ? -66.242 -36.342 18.782  1.00 35.45  ? 245  GLN A O    1 
ATOM   2544  C  CB   . GLN A 1 166 ? -63.314 -35.662 17.353  1.00 29.52  ? 245  GLN A CB   1 
ATOM   2545  C  CG   . GLN A 1 166 ? -63.097 -35.187 18.781  1.00 30.73  ? 245  GLN A CG   1 
ATOM   2546  C  CD   . GLN A 1 166 ? -62.623 -36.289 19.701  1.00 42.36  ? 245  GLN A CD   1 
ATOM   2547  O  OE1  . GLN A 1 166 ? -62.028 -37.271 19.259  1.00 41.11  ? 245  GLN A OE1  1 
ATOM   2548  N  NE2  . GLN A 1 166 ? -62.881 -36.130 20.994  1.00 54.49  ? 245  GLN A NE2  1 
ATOM   2549  H  H    . GLN A 1 166 ? -64.197 -36.382 15.209  1.00 32.42  ? 245  GLN A H    1 
ATOM   2550  H  HA   . GLN A 1 166 ? -64.335 -37.427 17.621  1.00 34.04  ? 245  GLN A HA   1 
ATOM   2551  H  HB2  . GLN A 1 166 ? -62.507 -36.124 17.075  1.00 35.42  ? 245  GLN A HB2  1 
ATOM   2552  H  HB3  . GLN A 1 166 ? -63.442 -34.875 16.801  1.00 35.42  ? 245  GLN A HB3  1 
ATOM   2553  H  HG2  . GLN A 1 166 ? -62.427 -34.486 18.782  1.00 36.88  ? 245  GLN A HG2  1 
ATOM   2554  H  HG3  . GLN A 1 166 ? -63.935 -34.845 19.130  1.00 36.88  ? 245  GLN A HG3  1 
ATOM   2555  H  HE21 . GLN A 1 166 ? -63.297 -35.429 21.266  1.00 65.39  ? 245  GLN A HE21 1 
ATOM   2556  H  HE22 . GLN A 1 166 ? -62.632 -36.729 21.559  1.00 65.39  ? 245  GLN A HE22 1 
ATOM   2557  N  N    . ARG A 1 167 ? -66.352 -35.034 16.960  1.00 31.86  ? 246  ARG A N    1 
ATOM   2558  C  CA   . ARG A 1 167 ? -67.591 -34.395 17.374  1.00 32.46  ? 246  ARG A CA   1 
ATOM   2559  C  C    . ARG A 1 167 ? -68.705 -35.429 17.404  1.00 40.92  ? 246  ARG A C    1 
ATOM   2560  O  O    . ARG A 1 167 ? -69.615 -35.365 18.235  1.00 45.41  ? 246  ARG A O    1 
ATOM   2561  C  CB   . ARG A 1 167 ? -67.956 -33.250 16.431  1.00 30.88  ? 246  ARG A CB   1 
ATOM   2562  C  CG   . ARG A 1 167 ? -67.375 -31.910 16.841  1.00 38.99  ? 246  ARG A CG   1 
ATOM   2563  C  CD   . ARG A 1 167 ? -67.783 -30.813 15.873  1.00 35.34  ? 246  ARG A CD   1 
ATOM   2564  N  NE   . ARG A 1 167 ? -67.321 -31.082 14.513  1.00 36.00  ? 246  ARG A NE   1 
ATOM   2565  C  CZ   . ARG A 1 167 ? -66.123 -30.750 14.040  1.00 35.71  ? 246  ARG A CZ   1 
ATOM   2566  N  NH1  . ARG A 1 167 ? -65.232 -30.144 14.817  1.00 41.25  ? 246  ARG A NH1  1 
ATOM   2567  N  NH2  . ARG A 1 167 ? -65.801 -31.044 12.789  1.00 31.79  ? 246  ARG A NH2  1 
ATOM   2568  H  H    . ARG A 1 167 ? -66.039 -34.746 16.212  1.00 38.23  ? 246  ARG A H    1 
ATOM   2569  H  HA   . ARG A 1 167 ? -67.484 -34.034 18.268  1.00 38.95  ? 246  ARG A HA   1 
ATOM   2570  H  HB2  . ARG A 1 167 ? -67.624 -33.458 15.543  1.00 37.06  ? 246  ARG A HB2  1 
ATOM   2571  H  HB3  . ARG A 1 167 ? -68.922 -33.160 16.408  1.00 37.06  ? 246  ARG A HB3  1 
ATOM   2572  H  HG2  . ARG A 1 167 ? -67.702 -31.675 17.723  1.00 46.79  ? 246  ARG A HG2  1 
ATOM   2573  H  HG3  . ARG A 1 167 ? -66.407 -31.968 16.845  1.00 46.79  ? 246  ARG A HG3  1 
ATOM   2574  H  HD2  . ARG A 1 167 ? -68.751 -30.747 15.856  1.00 42.41  ? 246  ARG A HD2  1 
ATOM   2575  H  HD3  . ARG A 1 167 ? -67.396 -29.972 16.163  1.00 42.41  ? 246  ARG A HD3  1 
ATOM   2576  H  HE   . ARG A 1 167 ? -67.863 -31.484 13.979  1.00 43.20  ? 246  ARG A HE   1 
ATOM   2577  H  HH11 . ARG A 1 167 ? -65.432 -29.952 15.631  1.00 49.50  ? 246  ARG A HH11 1 
ATOM   2578  H  HH12 . ARG A 1 167 ? -64.459 -29.936 14.504  1.00 49.50  ? 246  ARG A HH12 1 
ATOM   2579  H  HH21 . ARG A 1 167 ? -66.370 -31.439 12.279  1.00 38.15  ? 246  ARG A HH21 1 
ATOM   2580  H  HH22 . ARG A 1 167 ? -65.025 -30.833 12.483  1.00 38.15  ? 246  ARG A HH22 1 
ATOM   2581  N  N    . GLN A 1 168 ? -68.618 -36.397 16.501  1.00 49.48  ? 247  GLN A N    1 
ATOM   2582  C  CA   . GLN A 1 168 ? -69.600 -37.469 16.442  1.00 45.03  ? 247  GLN A CA   1 
ATOM   2583  C  C    . GLN A 1 168 ? -69.458 -38.357 17.675  1.00 48.07  ? 247  GLN A C    1 
ATOM   2584  O  O    . GLN A 1 168 ? -70.452 -38.782 18.258  1.00 53.15  ? 247  GLN A O    1 
ATOM   2585  C  CB   . GLN A 1 168 ? -69.410 -38.278 15.153  1.00 40.68  ? 247  GLN A CB   1 
ATOM   2586  C  CG   . GLN A 1 168 ? -70.693 -38.762 14.475  1.00 51.29  ? 247  GLN A CG   1 
ATOM   2587  C  CD   . GLN A 1 168 ? -71.788 -37.703 14.392  1.00 59.14  ? 247  GLN A CD   1 
ATOM   2588  O  OE1  . GLN A 1 168 ? -72.783 -37.770 15.116  1.00 56.96  ? 247  GLN A OE1  1 
ATOM   2589  N  NE2  . GLN A 1 168 ? -71.615 -36.732 13.500  1.00 61.84  ? 247  GLN A NE2  1 
ATOM   2590  H  H    . GLN A 1 168 ? -67.997 -36.456 15.908  1.00 59.38  ? 247  GLN A H    1 
ATOM   2591  H  HA   . GLN A 1 168 ? -70.492 -37.089 16.437  1.00 54.03  ? 247  GLN A HA   1 
ATOM   2592  H  HB2  . GLN A 1 168 ? -68.934 -37.726 14.512  1.00 48.82  ? 247  GLN A HB2  1 
ATOM   2593  H  HB3  . GLN A 1 168 ? -68.878 -39.062 15.360  1.00 48.82  ? 247  GLN A HB3  1 
ATOM   2594  H  HG2  . GLN A 1 168 ? -70.481 -39.041 13.570  1.00 61.55  ? 247  GLN A HG2  1 
ATOM   2595  H  HG3  . GLN A 1 168 ? -71.046 -39.514 14.976  1.00 61.55  ? 247  GLN A HG3  1 
ATOM   2596  H  HE21 . GLN A 1 168 ? -70.912 -36.722 13.005  1.00 74.21  ? 247  GLN A HE21 1 
ATOM   2597  H  HE22 . GLN A 1 168 ? -72.207 -36.113 13.418  1.00 74.21  ? 247  GLN A HE22 1 
ATOM   2598  N  N    . TYR A 1 169 ? -68.221 -38.615 18.082  1.00 48.87  ? 248  TYR A N    1 
ATOM   2599  C  CA   . TYR A 1 169 ? -67.959 -39.422 19.263  1.00 47.48  ? 248  TYR A CA   1 
ATOM   2600  C  C    . TYR A 1 169 ? -68.518 -38.775 20.522  1.00 55.76  ? 248  TYR A C    1 
ATOM   2601  O  O    . TYR A 1 169 ? -69.221 -39.417 21.301  1.00 66.24  ? 248  TYR A O    1 
ATOM   2602  C  CB   . TYR A 1 169 ? -66.460 -39.619 19.421  1.00 49.93  ? 248  TYR A CB   1 
ATOM   2603  C  CG   . TYR A 1 169 ? -66.063 -40.267 20.716  1.00 52.19  ? 248  TYR A CG   1 
ATOM   2604  C  CD1  . TYR A 1 169 ? -65.782 -39.505 21.840  1.00 54.51  ? 248  TYR A CD1  1 
ATOM   2605  C  CD2  . TYR A 1 169 ? -65.961 -41.643 20.813  1.00 51.63  ? 248  TYR A CD2  1 
ATOM   2606  C  CE1  . TYR A 1 169 ? -65.416 -40.097 23.023  1.00 61.14  ? 248  TYR A CE1  1 
ATOM   2607  C  CE2  . TYR A 1 169 ? -65.591 -42.245 21.987  1.00 52.39  ? 248  TYR A CE2  1 
ATOM   2608  C  CZ   . TYR A 1 169 ? -65.321 -41.469 23.092  1.00 61.08  ? 248  TYR A CZ   1 
ATOM   2609  O  OH   . TYR A 1 169 ? -64.956 -42.071 24.272  1.00 71.83  ? 248  TYR A OH   1 
ATOM   2610  H  H    . TYR A 1 169 ? -67.511 -38.332 17.688  1.00 58.64  ? 248  TYR A H    1 
ATOM   2611  H  HA   . TYR A 1 169 ? -68.373 -40.292 19.157  1.00 56.97  ? 248  TYR A HA   1 
ATOM   2612  H  HB2  . TYR A 1 169 ? -66.142 -40.182 18.698  1.00 59.92  ? 248  TYR A HB2  1 
ATOM   2613  H  HB3  . TYR A 1 169 ? -66.025 -38.753 19.378  1.00 59.92  ? 248  TYR A HB3  1 
ATOM   2614  H  HD1  . TYR A 1 169 ? -65.847 -38.578 21.792  1.00 65.41  ? 248  TYR A HD1  1 
ATOM   2615  H  HD2  . TYR A 1 169 ? -66.142 -42.169 20.067  1.00 61.96  ? 248  TYR A HD2  1 
ATOM   2616  H  HE1  . TYR A 1 169 ? -65.232 -39.575 23.771  1.00 73.37  ? 248  TYR A HE1  1 
ATOM   2617  H  HE2  . TYR A 1 169 ? -65.528 -43.171 22.039  1.00 62.87  ? 248  TYR A HE2  1 
ATOM   2618  H  HH   . TYR A 1 169 ? -64.937 -42.905 24.175  1.00 86.19  ? 248  TYR A HH   1 
ATOM   2619  N  N    . GLU A 1 170 ? -68.194 -37.503 20.722  1.00 66.21  ? 249  GLU A N    1 
ATOM   2620  C  CA   . GLU A 1 170 ? -68.595 -36.798 21.933  1.00 66.56  ? 249  GLU A CA   1 
ATOM   2621  C  C    . GLU A 1 170 ? -70.109 -36.677 22.052  1.00 72.22  ? 249  GLU A C    1 
ATOM   2622  O  O    . GLU A 1 170 ? -70.662 -36.830 23.140  1.00 79.16  ? 249  GLU A O    1 
ATOM   2623  C  CB   . GLU A 1 170 ? -67.962 -35.410 21.976  1.00 66.04  ? 249  GLU A CB   1 
ATOM   2624  C  CG   . GLU A 1 170 ? -66.493 -35.422 22.356  1.00 75.39  ? 249  GLU A CG   1 
ATOM   2625  C  CD   . GLU A 1 170 ? -65.838 -34.063 22.193  1.00 82.39  ? 249  GLU A CD   1 
ATOM   2626  O  OE1  . GLU A 1 170 ? -66.515 -33.131 21.705  1.00 84.53  ? 249  GLU A OE1  1 
ATOM   2627  O  OE2  . GLU A 1 170 ? -64.647 -33.926 22.549  1.00 82.61  ? 249  GLU A OE2  1 
ATOM   2628  H  H    . GLU A 1 170 ? -67.740 -37.024 20.170  1.00 79.45  ? 249  GLU A H    1 
ATOM   2629  H  HA   . GLU A 1 170 ? -68.276 -37.294 22.703  1.00 79.87  ? 249  GLU A HA   1 
ATOM   2630  H  HB2  . GLU A 1 170 ? -68.038 -35.004 21.099  1.00 79.25  ? 249  GLU A HB2  1 
ATOM   2631  H  HB3  . GLU A 1 170 ? -68.433 -34.871 22.631  1.00 79.25  ? 249  GLU A HB3  1 
ATOM   2632  H  HG2  . GLU A 1 170 ? -66.408 -35.687 23.285  1.00 90.47  ? 249  GLU A HG2  1 
ATOM   2633  H  HG3  . GLU A 1 170 ? -66.024 -36.052 21.786  1.00 90.47  ? 249  GLU A HG3  1 
ATOM   2634  N  N    . ALA A 1 171 ? -70.773 -36.403 20.933  1.00 51.50  ? 250  ALA A N    1 
ATOM   2635  C  CA   . ALA A 1 171 ? -72.230 -36.317 20.906  1.00 53.36  ? 250  ALA A CA   1 
ATOM   2636  C  C    . ALA A 1 171 ? -72.862 -37.626 21.373  1.00 56.79  ? 250  ALA A C    1 
ATOM   2637  O  O    . ALA A 1 171 ? -73.980 -37.639 21.888  1.00 63.89  ? 250  ALA A O    1 
ATOM   2638  C  CB   . ALA A 1 171 ? -72.710 -35.969 19.508  1.00 51.57  ? 250  ALA A CB   1 
ATOM   2639  H  H    . ALA A 1 171 ? -70.401 -36.262 20.170  1.00 61.80  ? 250  ALA A H    1 
ATOM   2640  H  HA   . ALA A 1 171 ? -72.518 -35.612 21.508  1.00 64.04  ? 250  ALA A HA   1 
ATOM   2641  H  HB1  . ALA A 1 171 ? -73.679 -35.917 19.511  1.00 61.89  ? 250  ALA A HB1  1 
ATOM   2642  H  HB2  . ALA A 1 171 ? -72.333 -35.114 19.249  1.00 61.89  ? 250  ALA A HB2  1 
ATOM   2643  H  HB3  . ALA A 1 171 ? -72.418 -36.660 18.893  1.00 61.89  ? 250  ALA A HB3  1 
ATOM   2644  N  N    . GLU A 1 172 ? -72.138 -38.725 21.188  1.00 62.17  ? 251  GLU A N    1 
ATOM   2645  C  CA   . GLU A 1 172 ? -72.612 -40.039 21.601  1.00 64.60  ? 251  GLU A CA   1 
ATOM   2646  C  C    . GLU A 1 172 ? -72.207 -40.376 23.032  1.00 78.58  ? 251  GLU A C    1 
ATOM   2647  O  O    . GLU A 1 172 ? -72.929 -41.093 23.725  1.00 89.86  ? 251  GLU A O    1 
ATOM   2648  C  CB   . GLU A 1 172 ? -72.086 -41.113 20.653  1.00 61.12  ? 251  GLU A CB   1 
ATOM   2649  C  CG   . GLU A 1 172 ? -72.960 -41.323 19.427  1.00 66.22  ? 251  GLU A CG   1 
ATOM   2650  C  CD   . GLU A 1 172 ? -73.891 -42.517 19.562  1.00 75.51  ? 251  GLU A CD   1 
ATOM   2651  O  OE1  . GLU A 1 172 ? -73.435 -43.589 20.017  1.00 77.55  ? 251  GLU A OE1  1 
ATOM   2652  O  OE2  . GLU A 1 172 ? -75.082 -42.385 19.209  1.00 82.34  ? 251  GLU A OE2  1 
ATOM   2653  H  H    . GLU A 1 172 ? -71.360 -38.734 20.821  1.00 74.60  ? 251  GLU A H    1 
ATOM   2654  H  HA   . GLU A 1 172 ? -73.581 -40.051 21.556  1.00 77.52  ? 251  GLU A HA   1 
ATOM   2655  H  HB2  . GLU A 1 172 ? -71.202 -40.855 20.347  1.00 73.35  ? 251  GLU A HB2  1 
ATOM   2656  H  HB3  . GLU A 1 172 ? -72.035 -41.956 21.130  1.00 73.35  ? 251  GLU A HB3  1 
ATOM   2657  H  HG2  . GLU A 1 172 ? -73.505 -40.533 19.288  1.00 79.47  ? 251  GLU A HG2  1 
ATOM   2658  H  HG3  . GLU A 1 172 ? -72.391 -41.473 18.656  1.00 79.47  ? 251  GLU A HG3  1 
ATOM   2659  N  N    . ARG A 1 173 ? -71.054 -39.877 23.473  1.00 95.67  ? 252  ARG A N    1 
ATOM   2660  C  CA   . ARG A 1 173 ? -70.644 -40.058 24.863  1.00 94.88  ? 252  ARG A CA   1 
ATOM   2661  C  C    . ARG A 1 173 ? -71.690 -39.416 25.768  1.00 100.29 ? 252  ARG A C    1 
ATOM   2662  O  O    . ARG A 1 173 ? -71.916 -39.873 26.888  1.00 106.27 ? 252  ARG A O    1 
ATOM   2663  C  CB   . ARG A 1 173 ? -69.267 -39.442 25.131  1.00 95.79  ? 252  ARG A CB   1 
ATOM   2664  C  CG   . ARG A 1 173 ? -68.370 -40.294 26.036  1.00 99.72  ? 252  ARG A CG   1 
ATOM   2665  C  CD   . ARG A 1 173 ? -67.286 -39.462 26.712  1.00 103.56 ? 252  ARG A CD   1 
ATOM   2666  N  NE   . ARG A 1 173 ? -67.825 -38.620 27.781  1.00 114.64 ? 252  ARG A NE   1 
ATOM   2667  C  CZ   . ARG A 1 173 ? -67.623 -38.806 29.087  1.00 116.47 ? 252  ARG A CZ   1 
ATOM   2668  N  NH1  . ARG A 1 173 ? -66.874 -39.806 29.539  1.00 111.01 ? 252  ARG A NH1  1 
ATOM   2669  N  NH2  . ARG A 1 173 ? -68.175 -37.972 29.958  1.00 116.04 ? 252  ARG A NH2  1 
ATOM   2670  H  H    . ARG A 1 173 ? -70.497 -39.433 22.992  1.00 114.80 ? 252  ARG A H    1 
ATOM   2671  H  HA   . ARG A 1 173 ? -70.601 -41.005 25.066  1.00 113.85 ? 252  ARG A HA   1 
ATOM   2672  H  HB2  . ARG A 1 173 ? -68.808 -39.325 24.285  1.00 114.94 ? 252  ARG A HB2  1 
ATOM   2673  H  HB3  . ARG A 1 173 ? -69.389 -38.581 25.561  1.00 114.94 ? 252  ARG A HB3  1 
ATOM   2674  H  HG2  . ARG A 1 173 ? -68.913 -40.703 26.728  1.00 119.66 ? 252  ARG A HG2  1 
ATOM   2675  H  HG3  . ARG A 1 173 ? -67.938 -40.979 25.502  1.00 119.66 ? 252  ARG A HG3  1 
ATOM   2676  H  HD2  . ARG A 1 173 ? -66.624 -40.056 27.099  1.00 124.27 ? 252  ARG A HD2  1 
ATOM   2677  H  HD3  . ARG A 1 173 ? -66.871 -38.884 26.052  1.00 124.27 ? 252  ARG A HD3  1 
ATOM   2678  H  HE   . ARG A 1 173 ? -68.313 -37.951 27.549  1.00 137.57 ? 252  ARG A HE   1 
ATOM   2679  H  HH11 . ARG A 1 173 ? -66.511 -40.356 28.986  1.00 133.21 ? 252  ARG A HH11 1 
ATOM   2680  H  HH12 . ARG A 1 173 ? -66.755 -39.907 30.385  1.00 133.21 ? 252  ARG A HH12 1 
ATOM   2681  H  HH21 . ARG A 1 173 ? -68.660 -37.318 29.680  1.00 139.24 ? 252  ARG A HH21 1 
ATOM   2682  H  HH22 . ARG A 1 173 ? -68.045 -38.083 30.801  1.00 139.24 ? 252  ARG A HH22 1 
ATOM   2683  N  N    . ASN A 1 174 ? -72.325 -38.357 25.269  1.00 76.17  ? 253  ASN A N    1 
ATOM   2684  C  CA   . ASN A 1 174 ? -73.455 -37.738 25.953  1.00 77.43  ? 253  ASN A CA   1 
ATOM   2685  C  C    . ASN A 1 174 ? -74.626 -38.699 26.060  1.00 76.13  ? 253  ASN A C    1 
ATOM   2686  O  O    . ASN A 1 174 ? -75.066 -39.037 27.158  1.00 79.32  ? 253  ASN A O    1 
ATOM   2687  C  CB   . ASN A 1 174 ? -73.919 -36.486 25.207  1.00 79.47  ? 253  ASN A CB   1 
ATOM   2688  C  CG   . ASN A 1 174 ? -72.917 -35.356 25.283  1.00 83.64  ? 253  ASN A CG   1 
ATOM   2689  O  OD1  . ASN A 1 174 ? -71.982 -35.394 26.084  1.00 80.91  ? 253  ASN A OD1  1 
ATOM   2690  N  ND2  . ASN A 1 174 ? -73.113 -34.333 24.453  1.00 83.49  ? 253  ASN A ND2  1 
ATOM   2691  H  H    . ASN A 1 174 ? -72.117 -37.976 24.527  1.00 91.40  ? 253  ASN A H    1 
ATOM   2692  H  HA   . ASN A 1 174 ? -73.187 -37.479 26.849  1.00 92.92  ? 253  ASN A HA   1 
ATOM   2693  N  N    . LYS A 1 175 ? -75.115 -39.147 24.907  1.00 90.44  ? 254  LYS A N    1 
ATOM   2694  C  CA   . LYS A 1 175 ? -76.290 -40.014 24.836  1.00 95.80  ? 254  LYS A CA   1 
ATOM   2695  C  C    . LYS A 1 175 ? -76.092 -41.380 25.503  1.00 99.36  ? 254  LYS A C    1 
ATOM   2696  O  O    . LYS A 1 175 ? -76.954 -42.253 25.397  1.00 105.35 ? 254  LYS A O    1 
ATOM   2697  C  CB   . LYS A 1 175 ? -76.730 -40.210 23.378  1.00 90.53  ? 254  LYS A CB   1 
ATOM   2698  C  CG   . LYS A 1 175 ? -76.972 -38.923 22.598  1.00 89.67  ? 254  LYS A CG   1 
ATOM   2699  C  CD   . LYS A 1 175 ? -77.817 -37.935 23.385  1.00 94.35  ? 254  LYS A CD   1 
ATOM   2700  C  CE   . LYS A 1 175 ? -78.206 -36.730 22.536  1.00 95.24  ? 254  LYS A CE   1 
ATOM   2701  N  NZ   . LYS A 1 175 ? -79.149 -37.099 21.441  1.00 87.96  ? 254  LYS A NZ   1 
ATOM   2702  N  N    . ALA A 1 181 ? -76.357 -47.768 21.829  1.00 96.87  ? 260  ALA A N    1 
ATOM   2703  C  CA   . ALA A 1 181 ? -75.511 -46.599 22.050  1.00 93.17  ? 260  ALA A CA   1 
ATOM   2704  C  C    . ALA A 1 181 ? -74.038 -46.959 22.275  1.00 86.25  ? 260  ALA A C    1 
ATOM   2705  O  O    . ALA A 1 181 ? -73.162 -46.433 21.592  1.00 81.29  ? 260  ALA A O    1 
ATOM   2706  C  CB   . ALA A 1 181 ? -76.048 -45.755 23.204  1.00 87.69  ? 260  ALA A CB   1 
ATOM   2707  N  N    . ASN A 1 182 ? -73.764 -47.852 23.223  1.00 107.63 ? 261  ASN A N    1 
ATOM   2708  C  CA   . ASN A 1 182 ? -72.388 -48.285 23.486  1.00 113.48 ? 261  ASN A CA   1 
ATOM   2709  C  C    . ASN A 1 182 ? -71.765 -49.019 22.295  1.00 113.20 ? 261  ASN A C    1 
ATOM   2710  O  O    . ASN A 1 182 ? -70.545 -49.179 22.228  1.00 111.86 ? 261  ASN A O    1 
ATOM   2711  C  CB   . ASN A 1 182 ? -72.322 -49.190 24.724  1.00 115.16 ? 261  ASN A CB   1 
ATOM   2712  C  CG   . ASN A 1 182 ? -72.303 -48.410 26.033  1.00 123.11 ? 261  ASN A CG   1 
ATOM   2713  O  OD1  . ASN A 1 182 ? -71.565 -47.434 26.187  1.00 121.44 ? 261  ASN A OD1  1 
ATOM   2714  N  ND2  . ASN A 1 182 ? -73.120 -48.847 26.989  1.00 124.04 ? 261  ASN A ND2  1 
ATOM   2715  H  HA   . ASN A 1 182 ? -71.846 -47.501 23.665  1.00 136.18 ? 261  ASN A HA   1 
ATOM   2716  N  N    . GLU A 1 183 ? -72.600 -49.468 21.362  1.00 104.99 ? 262  GLU A N    1 
ATOM   2717  C  CA   . GLU A 1 183 ? -72.121 -50.213 20.199  1.00 100.74 ? 262  GLU A CA   1 
ATOM   2718  C  C    . GLU A 1 183 ? -71.579 -49.274 19.123  1.00 96.89  ? 262  GLU A C    1 
ATOM   2719  O  O    . GLU A 1 183 ? -70.544 -49.554 18.518  1.00 98.87  ? 262  GLU A O    1 
ATOM   2720  C  CB   . GLU A 1 183 ? -73.231 -51.104 19.633  1.00 107.30 ? 262  GLU A CB   1 
ATOM   2721  C  CG   . GLU A 1 183 ? -73.804 -52.073 20.660  1.00 116.64 ? 262  GLU A CG   1 
ATOM   2722  C  CD   . GLU A 1 183 ? -74.166 -53.424 20.066  1.00 116.23 ? 262  GLU A CD   1 
ATOM   2723  O  OE1  . GLU A 1 183 ? -74.811 -53.453 18.996  1.00 116.64 ? 262  GLU A OE1  1 
ATOM   2724  O  OE2  . GLU A 1 183 ? -73.802 -54.456 20.673  1.00 106.12 ? 262  GLU A OE2  1 
ATOM   2725  H  H    . GLU A 1 183 ? -73.453 -49.354 21.378  1.00 125.99 ? 262  GLU A H    1 
ATOM   2726  H  HA   . GLU A 1 183 ? -71.394 -50.791 20.479  1.00 120.89 ? 262  GLU A HA   1 
ATOM   2727  H  HB2  . GLU A 1 183 ? -73.955 -50.542 19.316  1.00 128.75 ? 262  GLU A HB2  1 
ATOM   2728  H  HB3  . GLU A 1 183 ? -72.872 -51.626 18.898  1.00 128.75 ? 262  GLU A HB3  1 
ATOM   2729  H  HG2  . GLU A 1 183 ? -73.146 -52.219 21.357  1.00 139.96 ? 262  GLU A HG2  1 
ATOM   2730  H  HG3  . GLU A 1 183 ? -74.610 -51.689 21.041  1.00 139.96 ? 262  GLU A HG3  1 
ATOM   2731  N  N    . ARG A 1 184 ? -72.269 -48.161 18.888  1.00 58.84  ? 263  ARG A N    1 
ATOM   2732  C  CA   . ARG A 1 184 ? -71.788 -47.163 17.936  1.00 56.02  ? 263  ARG A CA   1 
ATOM   2733  C  C    . ARG A 1 184 ? -70.557 -46.454 18.493  1.00 58.59  ? 263  ARG A C    1 
ATOM   2734  O  O    . ARG A 1 184 ? -69.677 -46.030 17.740  1.00 55.01  ? 263  ARG A O    1 
ATOM   2735  C  CB   . ARG A 1 184 ? -72.872 -46.133 17.603  1.00 53.47  ? 263  ARG A CB   1 
ATOM   2736  C  CG   . ARG A 1 184 ? -72.384 -45.029 16.663  1.00 46.14  ? 263  ARG A CG   1 
ATOM   2737  C  CD   . ARG A 1 184 ? -73.509 -44.128 16.191  1.00 45.42  ? 263  ARG A CD   1 
ATOM   2738  N  NE   . ARG A 1 184 ? -73.112 -43.316 15.038  1.00 48.54  ? 263  ARG A NE   1 
ATOM   2739  C  CZ   . ARG A 1 184 ? -72.953 -41.991 15.035  1.00 50.54  ? 263  ARG A CZ   1 
ATOM   2740  N  NH1  . ARG A 1 184 ? -73.158 -41.262 16.128  1.00 50.26  ? 263  ARG A NH1  1 
ATOM   2741  N  NH2  . ARG A 1 184 ? -72.593 -41.381 13.913  1.00 45.34  ? 263  ARG A NH2  1 
ATOM   2742  H  H    . ARG A 1 184 ? -73.016 -47.960 19.265  1.00 70.61  ? 263  ARG A H    1 
ATOM   2743  H  HA   . ARG A 1 184 ? -71.532 -47.608 17.113  1.00 67.23  ? 263  ARG A HA   1 
ATOM   2744  H  HB2  . ARG A 1 184 ? -73.615 -46.585 17.173  1.00 64.16  ? 263  ARG A HB2  1 
ATOM   2745  H  HB3  . ARG A 1 184 ? -73.172 -45.714 18.425  1.00 64.16  ? 263  ARG A HB3  1 
ATOM   2746  H  HG2  . ARG A 1 184 ? -71.735 -44.480 17.130  1.00 55.37  ? 263  ARG A HG2  1 
ATOM   2747  H  HG3  . ARG A 1 184 ? -71.976 -45.435 15.883  1.00 55.37  ? 263  ARG A HG3  1 
ATOM   2748  H  HD2  . ARG A 1 184 ? -74.267 -44.675 15.930  1.00 54.51  ? 263  ARG A HD2  1 
ATOM   2749  H  HD3  . ARG A 1 184 ? -73.762 -43.529 16.911  1.00 54.51  ? 263  ARG A HD3  1 
ATOM   2750  H  HE   . ARG A 1 184 ? -72.969 -43.729 14.297  1.00 58.24  ? 263  ARG A HE   1 
ATOM   2751  H  HH11 . ARG A 1 184 ? -73.394 -41.644 16.862  1.00 60.32  ? 263  ARG A HH11 1 
ATOM   2752  H  HH12 . ARG A 1 184 ? -73.051 -40.409 16.103  1.00 60.32  ? 263  ARG A HH12 1 
ATOM   2753  H  HH21 . ARG A 1 184 ? -72.458 -41.840 13.198  1.00 54.41  ? 263  ARG A HH21 1 
ATOM   2754  H  HH22 . ARG A 1 184 ? -72.489 -40.527 13.901  1.00 54.41  ? 263  ARG A HH22 1 
ATOM   2755  N  N    . LEU A 1 185 ? -70.505 -46.328 19.816  1.00 71.76  ? 264  LEU A N    1 
ATOM   2756  C  CA   . LEU A 1 185 ? -69.394 -45.660 20.483  1.00 59.94  ? 264  LEU A CA   1 
ATOM   2757  C  C    . LEU A 1 185 ? -68.100 -46.415 20.219  1.00 56.61  ? 264  LEU A C    1 
ATOM   2758  O  O    . LEU A 1 185 ? -67.054 -45.811 19.990  1.00 56.71  ? 264  LEU A O    1 
ATOM   2759  C  CB   . LEU A 1 185 ? -69.646 -45.582 21.988  1.00 58.54  ? 264  LEU A CB   1 
ATOM   2760  C  CG   . LEU A 1 185 ? -68.975 -44.400 22.688  1.00 63.87  ? 264  LEU A CG   1 
ATOM   2761  C  CD1  . LEU A 1 185 ? -69.752 -43.119 22.412  1.00 67.54  ? 264  LEU A CD1  1 
ATOM   2762  C  CD2  . LEU A 1 185 ? -68.844 -44.647 24.184  1.00 71.41  ? 264  LEU A CD2  1 
ATOM   2763  H  H    . LEU A 1 185 ? -71.107 -46.624 20.354  1.00 86.11  ? 264  LEU A H    1 
ATOM   2764  H  HA   . LEU A 1 185 ? -69.302 -44.759 20.137  1.00 71.92  ? 264  LEU A HA   1 
ATOM   2765  H  HB2  . LEU A 1 185 ? -70.602 -45.508 22.138  1.00 70.25  ? 264  LEU A HB2  1 
ATOM   2766  H  HB3  . LEU A 1 185 ? -69.313 -46.394 22.400  1.00 70.25  ? 264  LEU A HB3  1 
ATOM   2767  H  HG   . LEU A 1 185 ? -68.082 -44.288 22.326  1.00 76.65  ? 264  LEU A HG   1 
ATOM   2768  H  HD11 . LEU A 1 185 ? -69.313 -42.381 22.863  1.00 81.05  ? 264  LEU A HD11 1 
ATOM   2769  H  HD12 . LEU A 1 185 ? -69.768 -42.960 21.455  1.00 81.05  ? 264  LEU A HD12 1 
ATOM   2770  H  HD13 . LEU A 1 185 ? -70.657 -43.221 22.747  1.00 81.05  ? 264  LEU A HD13 1 
ATOM   2771  H  HD21 . LEU A 1 185 ? -68.415 -43.879 24.594  1.00 85.69  ? 264  LEU A HD21 1 
ATOM   2772  H  HD22 . LEU A 1 185 ? -69.728 -44.774 24.562  1.00 85.69  ? 264  LEU A HD22 1 
ATOM   2773  H  HD23 . LEU A 1 185 ? -68.305 -45.441 24.326  1.00 85.69  ? 264  LEU A HD23 1 
ATOM   2774  N  N    . GLU A 1 186 ? -68.184 -47.741 20.254  1.00 76.18  ? 265  GLU A N    1 
ATOM   2775  C  CA   . GLU A 1 186 ? -67.035 -48.598 19.984  1.00 82.58  ? 265  GLU A CA   1 
ATOM   2776  C  C    . GLU A 1 186 ? -66.531 -48.427 18.554  1.00 71.76  ? 265  GLU A C    1 
ATOM   2777  O  O    . GLU A 1 186 ? -65.329 -48.487 18.303  1.00 76.62  ? 265  GLU A O    1 
ATOM   2778  C  CB   . GLU A 1 186 ? -67.406 -50.061 20.234  1.00 91.82  ? 265  GLU A CB   1 
ATOM   2779  C  CG   . GLU A 1 186 ? -67.207 -50.520 21.679  1.00 98.35  ? 265  GLU A CG   1 
ATOM   2780  C  CD   . GLU A 1 186 ? -65.783 -50.956 21.996  1.00 104.04 ? 265  GLU A CD   1 
ATOM   2781  O  OE1  . GLU A 1 186 ? -64.965 -51.104 21.061  1.00 102.44 ? 265  GLU A OE1  1 
ATOM   2782  O  OE2  . GLU A 1 186 ? -65.483 -51.151 23.194  1.00 108.08 ? 265  GLU A OE2  1 
ATOM   2783  H  H    . GLU A 1 186 ? -68.905 -48.173 20.434  1.00 91.41  ? 265  GLU A H    1 
ATOM   2784  H  HA   . GLU A 1 186 ? -66.314 -48.362 20.589  1.00 99.09  ? 265  GLU A HA   1 
ATOM   2785  H  HB2  . GLU A 1 186 ? -68.341 -50.188 20.010  1.00 110.18 ? 265  GLU A HB2  1 
ATOM   2786  H  HB3  . GLU A 1 186 ? -66.855 -50.623 19.667  1.00 110.18 ? 265  GLU A HB3  1 
ATOM   2787  H  HG2  . GLU A 1 186 ? -67.432 -49.787 22.274  1.00 118.02 ? 265  GLU A HG2  1 
ATOM   2788  H  HG3  . GLU A 1 186 ? -67.793 -51.274 21.851  1.00 118.02 ? 265  GLU A HG3  1 
ATOM   2789  N  N    . LEU A 1 187 ? -67.453 -48.211 17.622  1.00 42.86  ? 266  LEU A N    1 
ATOM   2790  C  CA   . LEU A 1 187 ? -67.099 -48.037 16.220  1.00 42.52  ? 266  LEU A CA   1 
ATOM   2791  C  C    . LEU A 1 187 ? -66.453 -46.682 15.983  1.00 40.52  ? 266  LEU A C    1 
ATOM   2792  O  O    . LEU A 1 187 ? -65.504 -46.575 15.209  1.00 40.21  ? 266  LEU A O    1 
ATOM   2793  C  CB   . LEU A 1 187 ? -68.339 -48.171 15.337  1.00 49.92  ? 266  LEU A CB   1 
ATOM   2794  C  CG   . LEU A 1 187 ? -69.022 -49.540 15.362  1.00 50.07  ? 266  LEU A CG   1 
ATOM   2795  C  CD1  . LEU A 1 187 ? -70.336 -49.502 14.578  1.00 53.41  ? 266  LEU A CD1  1 
ATOM   2796  C  CD2  . LEU A 1 187 ? -68.091 -50.625 14.826  1.00 37.79  ? 266  LEU A CD2  1 
ATOM   2797  H  H    . LEU A 1 187 ? -68.297 -48.162 17.779  1.00 51.43  ? 266  LEU A H    1 
ATOM   2798  H  HA   . LEU A 1 187 ? -66.466 -48.725 15.962  1.00 51.03  ? 266  LEU A HA   1 
ATOM   2799  H  HB2  . LEU A 1 187 ? -68.992 -47.515 15.625  1.00 59.90  ? 266  LEU A HB2  1 
ATOM   2800  H  HB3  . LEU A 1 187 ? -68.082 -47.991 14.419  1.00 59.90  ? 266  LEU A HB3  1 
ATOM   2801  H  HG   . LEU A 1 187 ? -69.235 -49.763 16.281  1.00 60.08  ? 266  LEU A HG   1 
ATOM   2802  H  HD11 . LEU A 1 187 ? -70.747 -50.380 14.609  1.00 64.09  ? 266  LEU A HD11 1 
ATOM   2803  H  HD12 . LEU A 1 187 ? -70.925 -48.845 14.981  1.00 64.09  ? 266  LEU A HD12 1 
ATOM   2804  H  HD13 . LEU A 1 187 ? -70.147 -49.257 13.658  1.00 64.09  ? 266  LEU A HD13 1 
ATOM   2805  H  HD21 . LEU A 1 187 ? -68.552 -51.478 14.854  1.00 45.35  ? 266  LEU A HD21 1 
ATOM   2806  H  HD22 . LEU A 1 187 ? -67.849 -50.410 13.911  1.00 45.35  ? 266  LEU A HD22 1 
ATOM   2807  H  HD23 . LEU A 1 187 ? -67.296 -50.660 15.380  1.00 45.35  ? 266  LEU A HD23 1 
ATOM   2808  N  N    . LEU A 1 188 ? -66.974 -45.648 16.639  1.00 42.23  ? 267  LEU A N    1 
ATOM   2809  C  CA   . LEU A 1 188 ? -66.406 -44.307 16.523  1.00 35.83  ? 267  LEU A CA   1 
ATOM   2810  C  C    . LEU A 1 188 ? -65.029 -44.239 17.180  1.00 40.96  ? 267  LEU A C    1 
ATOM   2811  O  O    . LEU A 1 188 ? -64.135 -43.537 16.704  1.00 48.75  ? 267  LEU A O    1 
ATOM   2812  C  CB   . LEU A 1 188 ? -67.334 -43.267 17.148  1.00 35.61  ? 267  LEU A CB   1 
ATOM   2813  C  CG   . LEU A 1 188 ? -68.656 -43.013 16.421  1.00 39.34  ? 267  LEU A CG   1 
ATOM   2814  C  CD1  . LEU A 1 188 ? -69.486 -41.983 17.170  1.00 41.22  ? 267  LEU A CD1  1 
ATOM   2815  C  CD2  . LEU A 1 188 ? -68.421 -42.547 14.990  1.00 42.53  ? 267  LEU A CD2  1 
ATOM   2816  H  H    . LEU A 1 188 ? -67.657 -45.696 17.159  1.00 50.67  ? 267  LEU A H    1 
ATOM   2817  H  HA   . LEU A 1 188 ? -66.301 -44.089 15.583  1.00 42.99  ? 267  LEU A HA   1 
ATOM   2818  H  HB2  . LEU A 1 188 ? -67.552 -43.557 18.048  1.00 42.73  ? 267  LEU A HB2  1 
ATOM   2819  H  HB3  . LEU A 1 188 ? -66.861 -42.422 17.189  1.00 42.73  ? 267  LEU A HB3  1 
ATOM   2820  H  HG   . LEU A 1 188 ? -69.163 -43.839 16.387  1.00 47.20  ? 267  LEU A HG   1 
ATOM   2821  H  HD11 . LEU A 1 188 ? -70.317 -41.838 16.691  1.00 49.46  ? 267  LEU A HD11 1 
ATOM   2822  H  HD12 . LEU A 1 188 ? -69.672 -42.316 18.062  1.00 49.46  ? 267  LEU A HD12 1 
ATOM   2823  H  HD13 . LEU A 1 188 ? -68.986 -41.153 17.224  1.00 49.46  ? 267  LEU A HD13 1 
ATOM   2824  H  HD21 . LEU A 1 188 ? -69.279 -42.396 14.563  1.00 51.03  ? 267  LEU A HD21 1 
ATOM   2825  H  HD22 . LEU A 1 188 ? -67.910 -41.722 15.007  1.00 51.03  ? 267  LEU A HD22 1 
ATOM   2826  H  HD23 . LEU A 1 188 ? -67.929 -43.232 14.512  1.00 51.03  ? 267  LEU A HD23 1 
ATOM   2827  N  N    . LEU A 1 189 ? -64.859 -44.969 18.276  1.00 45.54  ? 268  LEU A N    1 
ATOM   2828  C  CA   . LEU A 1 189 ? -63.558 -45.061 18.917  1.00 42.11  ? 268  LEU A CA   1 
ATOM   2829  C  C    . LEU A 1 189 ? -62.611 -45.787 17.977  1.00 37.64  ? 268  LEU A C    1 
ATOM   2830  O  O    . LEU A 1 189 ? -61.465 -45.379 17.790  1.00 41.42  ? 268  LEU A O    1 
ATOM   2831  C  CB   . LEU A 1 189 ? -63.668 -45.812 20.241  1.00 47.23  ? 268  LEU A CB   1 
ATOM   2832  C  CG   . LEU A 1 189 ? -62.553 -45.536 21.246  1.00 48.37  ? 268  LEU A CG   1 
ATOM   2833  C  CD1  . LEU A 1 189 ? -62.661 -44.120 21.795  1.00 55.57  ? 268  LEU A CD1  1 
ATOM   2834  C  CD2  . LEU A 1 189 ? -62.582 -46.552 22.379  1.00 60.83  ? 268  LEU A CD2  1 
ATOM   2835  H  H    . LEU A 1 189 ? -65.480 -45.419 18.666  1.00 54.64  ? 268  LEU A H    1 
ATOM   2836  H  HA   . LEU A 1 189 ? -63.211 -44.172 19.089  1.00 50.53  ? 268  LEU A HA   1 
ATOM   2837  H  HB2  . LEU A 1 189 ? -64.507 -45.569 20.663  1.00 56.68  ? 268  LEU A HB2  1 
ATOM   2838  H  HB3  . LEU A 1 189 ? -63.664 -46.764 20.055  1.00 56.68  ? 268  LEU A HB3  1 
ATOM   2839  H  HG   . LEU A 1 189 ? -61.697 -45.617 20.796  1.00 58.05  ? 268  LEU A HG   1 
ATOM   2840  H  HD11 . LEU A 1 189 ? -61.942 -43.973 22.430  1.00 66.68  ? 268  LEU A HD11 1 
ATOM   2841  H  HD12 . LEU A 1 189 ? -62.589 -43.491 21.061  1.00 66.68  ? 268  LEU A HD12 1 
ATOM   2842  H  HD13 . LEU A 1 189 ? -63.518 -44.018 22.237  1.00 66.68  ? 268  LEU A HD13 1 
ATOM   2843  H  HD21 . LEU A 1 189 ? -61.864 -46.352 23.000  1.00 72.99  ? 268  LEU A HD21 1 
ATOM   2844  H  HD22 . LEU A 1 189 ? -63.438 -46.494 22.832  1.00 72.99  ? 268  LEU A HD22 1 
ATOM   2845  H  HD23 . LEU A 1 189 ? -62.462 -47.440 22.010  1.00 72.99  ? 268  LEU A HD23 1 
ATOM   2846  N  N    . GLN A 1 190 ? -63.106 -46.861 17.371  1.00 36.10  ? 269  GLN A N    1 
ATOM   2847  C  CA   . GLN A 1 190 ? -62.322 -47.620 16.412  1.00 38.59  ? 269  GLN A CA   1 
ATOM   2848  C  C    . GLN A 1 190 ? -61.985 -46.764 15.193  1.00 42.31  ? 269  GLN A C    1 
ATOM   2849  O  O    . GLN A 1 190 ? -60.861 -46.806 14.696  1.00 40.82  ? 269  GLN A O    1 
ATOM   2850  C  CB   . GLN A 1 190 ? -63.080 -48.878 15.980  1.00 34.14  ? 269  GLN A CB   1 
ATOM   2851  C  CG   . GLN A 1 190 ? -62.294 -49.801 15.066  1.00 42.11  ? 269  GLN A CG   1 
ATOM   2852  C  CD   . GLN A 1 190 ? -60.949 -50.189 15.648  1.00 53.75  ? 269  GLN A CD   1 
ATOM   2853  O  OE1  . GLN A 1 190 ? -60.809 -50.359 16.861  1.00 62.09  ? 269  GLN A OE1  1 
ATOM   2854  N  NE2  . GLN A 1 190 ? -59.947 -50.320 14.786  1.00 48.80  ? 269  GLN A NE2  1 
ATOM   2855  H  H    . GLN A 1 190 ? -63.897 -47.170 17.501  1.00 43.32  ? 269  GLN A H    1 
ATOM   2856  H  HA   . GLN A 1 190 ? -61.490 -47.896 16.827  1.00 46.31  ? 269  GLN A HA   1 
ATOM   2857  H  HB2  . GLN A 1 190 ? -63.320 -49.383 16.773  1.00 40.97  ? 269  GLN A HB2  1 
ATOM   2858  H  HB3  . GLN A 1 190 ? -63.884 -48.609 15.508  1.00 40.97  ? 269  GLN A HB3  1 
ATOM   2859  H  HG2  . GLN A 1 190 ? -62.804 -50.613 14.920  1.00 50.53  ? 269  GLN A HG2  1 
ATOM   2860  H  HG3  . GLN A 1 190 ? -62.137 -49.351 14.221  1.00 50.53  ? 269  GLN A HG3  1 
ATOM   2861  H  HE21 . GLN A 1 190 ? -60.081 -50.186 13.948  1.00 58.56  ? 269  GLN A HE21 1 
ATOM   2862  H  HE22 . GLN A 1 190 ? -59.164 -50.539 15.067  1.00 58.56  ? 269  GLN A HE22 1 
ATOM   2863  N  N    . LYS A 1 191 ? -62.955 -45.988 14.713  1.00 41.01  ? 270  LYS A N    1 
ATOM   2864  C  CA   . LYS A 1 191 ? -62.733 -45.128 13.552  1.00 28.73  ? 270  LYS A CA   1 
ATOM   2865  C  C    . LYS A 1 191 ? -61.695 -44.068 13.879  1.00 37.31  ? 270  LYS A C    1 
ATOM   2866  O  O    . LYS A 1 191 ? -60.826 -43.760 13.066  1.00 38.61  ? 270  LYS A O    1 
ATOM   2867  C  CB   . LYS A 1 191 ? -64.023 -44.432 13.109  1.00 26.95  ? 270  LYS A CB   1 
ATOM   2868  C  CG   . LYS A 1 191 ? -63.915 -43.842 11.710  1.00 26.05  ? 270  LYS A CG   1 
ATOM   2869  C  CD   . LYS A 1 191 ? -65.076 -42.946 11.333  1.00 25.78  ? 270  LYS A CD   1 
ATOM   2870  C  CE   . LYS A 1 191 ? -65.047 -42.678 9.832   1.00 35.23  ? 270  LYS A CE   1 
ATOM   2871  N  NZ   . LYS A 1 191 ? -65.452 -41.294 9.450   1.00 32.39  ? 270  LYS A NZ   1 
ATOM   2872  H  H    . LYS A 1 191 ? -63.749 -45.940 15.041  1.00 49.21  ? 270  LYS A H    1 
ATOM   2873  H  HA   . LYS A 1 191 ? -62.404 -45.664 12.813  1.00 34.47  ? 270  LYS A HA   1 
ATOM   2874  H  HB2  . LYS A 1 191 ? -64.747 -45.077 13.108  1.00 32.33  ? 270  LYS A HB2  1 
ATOM   2875  H  HB3  . LYS A 1 191 ? -64.221 -43.710 13.725  1.00 32.33  ? 270  LYS A HB3  1 
ATOM   2876  H  HG2  . LYS A 1 191 ? -63.103 -43.314 11.656  1.00 31.27  ? 270  LYS A HG2  1 
ATOM   2877  H  HG3  . LYS A 1 191 ? -63.878 -44.568 11.067  1.00 31.27  ? 270  LYS A HG3  1 
ATOM   2878  H  HD2  . LYS A 1 191 ? -65.913 -43.385 11.553  1.00 30.94  ? 270  LYS A HD2  1 
ATOM   2879  H  HD3  . LYS A 1 191 ? -65.001 -42.100 11.801  1.00 30.94  ? 270  LYS A HD3  1 
ATOM   2880  H  HE2  . LYS A 1 191 ? -64.145 -42.822 9.508   1.00 42.27  ? 270  LYS A HE2  1 
ATOM   2881  H  HE3  . LYS A 1 191 ? -65.655 -43.295 9.394   1.00 42.27  ? 270  LYS A HE3  1 
ATOM   2882  H  HZ1  . LYS A 1 191 ? -65.415 -41.200 8.565   1.00 38.86  ? 270  LYS A HZ1  1 
ATOM   2883  H  HZ2  . LYS A 1 191 ? -66.284 -41.134 9.723   1.00 38.86  ? 270  LYS A HZ2  1 
ATOM   2884  H  HZ3  . LYS A 1 191 ? -64.905 -40.702 9.827   1.00 38.86  ? 270  LYS A HZ3  1 
ATOM   2885  N  N    . ARG A 1 192 ? -61.806 -43.510 15.078  1.00 43.51  ? 271  ARG A N    1 
ATOM   2886  C  CA   . ARG A 1 192 ? -60.912 -42.459 15.543  1.00 38.95  ? 271  ARG A CA   1 
ATOM   2887  C  C    . ARG A 1 192 ? -59.496 -42.996 15.711  1.00 37.61  ? 271  ARG A C    1 
ATOM   2888  O  O    . ARG A 1 192 ? -58.517 -42.278 15.520  1.00 36.88  ? 271  ARG A O    1 
ATOM   2889  C  CB   . ARG A 1 192 ? -61.461 -41.909 16.857  1.00 43.56  ? 271  ARG A CB   1 
ATOM   2890  C  CG   . ARG A 1 192 ? -60.557 -40.988 17.647  1.00 46.69  ? 271  ARG A CG   1 
ATOM   2891  C  CD   . ARG A 1 192 ? -61.438 -40.159 18.571  1.00 55.61  ? 271  ARG A CD   1 
ATOM   2892  N  NE   . ARG A 1 192 ? -60.740 -39.568 19.709  1.00 58.97  ? 271  ARG A NE   1 
ATOM   2893  C  CZ   . ARG A 1 192 ? -60.427 -40.227 20.823  1.00 66.34  ? 271  ARG A CZ   1 
ATOM   2894  N  NH1  . ARG A 1 192 ? -60.715 -41.519 20.948  1.00 62.06  ? 271  ARG A NH1  1 
ATOM   2895  N  NH2  . ARG A 1 192 ? -59.807 -39.595 21.811  1.00 74.08  ? 271  ARG A NH2  1 
ATOM   2896  H  H    . ARG A 1 192 ? -62.406 -43.729 15.654  1.00 52.21  ? 271  ARG A H    1 
ATOM   2897  H  HA   . ARG A 1 192 ? -60.893 -41.740 14.893  1.00 46.74  ? 271  ARG A HA   1 
ATOM   2898  H  HB2  . ARG A 1 192 ? -62.272 -41.414 16.661  1.00 52.27  ? 271  ARG A HB2  1 
ATOM   2899  H  HB3  . ARG A 1 192 ? -61.677 -42.660 17.432  1.00 52.27  ? 271  ARG A HB3  1 
ATOM   2900  H  HG2  . ARG A 1 192 ? -59.939 -41.509 18.184  1.00 56.03  ? 271  ARG A HG2  1 
ATOM   2901  H  HG3  . ARG A 1 192 ? -60.081 -40.394 17.047  1.00 56.03  ? 271  ARG A HG3  1 
ATOM   2902  H  HD2  . ARG A 1 192 ? -61.829 -39.435 18.057  1.00 66.74  ? 271  ARG A HD2  1 
ATOM   2903  H  HD3  . ARG A 1 192 ? -62.142 -40.728 18.920  1.00 66.74  ? 271  ARG A HD3  1 
ATOM   2904  H  HE   . ARG A 1 192 ? -60.516 -38.740 19.657  1.00 70.77  ? 271  ARG A HE   1 
ATOM   2905  H  HH11 . ARG A 1 192 ? -61.120 -41.932 20.312  1.00 74.47  ? 271  ARG A HH11 1 
ATOM   2906  H  HH12 . ARG A 1 192 ? -60.504 -41.938 21.668  1.00 74.47  ? 271  ARG A HH12 1 
ATOM   2907  H  HH21 . ARG A 1 192 ? -59.612 -38.761 21.733  1.00 88.89  ? 271  ARG A HH21 1 
ATOM   2908  H  HH22 . ARG A 1 192 ? -59.593 -40.021 22.527  1.00 88.89  ? 271  ARG A HH22 1 
ATOM   2909  N  N    . LYS A 1 193 ? -59.400 -44.274 16.055  1.00 47.67  ? 272  LYS A N    1 
ATOM   2910  C  CA   . LYS A 1 193 ? -58.120 -44.946 16.205  1.00 50.91  ? 272  LYS A CA   1 
ATOM   2911  C  C    . LYS A 1 193 ? -57.475 -45.156 14.836  1.00 44.03  ? 272  LYS A C    1 
ATOM   2912  O  O    . LYS A 1 193 ? -56.278 -44.920 14.655  1.00 40.85  ? 272  LYS A O    1 
ATOM   2913  C  CB   . LYS A 1 193 ? -58.350 -46.289 16.893  1.00 60.44  ? 272  LYS A CB   1 
ATOM   2914  C  CG   . LYS A 1 193 ? -57.115 -46.939 17.482  1.00 57.60  ? 272  LYS A CG   1 
ATOM   2915  C  CD   . LYS A 1 193 ? -57.466 -48.261 18.176  1.00 67.10  ? 272  LYS A CD   1 
ATOM   2916  C  CE   . LYS A 1 193 ? -58.374 -48.079 19.407  1.00 75.89  ? 272  LYS A CE   1 
ATOM   2917  N  NZ   . LYS A 1 193 ? -58.991 -49.359 19.864  1.00 74.32  ? 272  LYS A NZ   1 
ATOM   2918  H  H    . LYS A 1 193 ? -60.077 -44.782 16.209  1.00 57.20  ? 272  LYS A H    1 
ATOM   2919  H  HA   . LYS A 1 193 ? -57.527 -44.409 16.753  1.00 61.09  ? 272  LYS A HA   1 
ATOM   2920  H  HB2  . LYS A 1 193 ? -58.983 -46.159 17.616  1.00 72.52  ? 272  LYS A HB2  1 
ATOM   2921  H  HB3  . LYS A 1 193 ? -58.722 -46.906 16.244  1.00 72.52  ? 272  LYS A HB3  1 
ATOM   2922  H  HG2  . LYS A 1 193 ? -56.480 -47.126 16.773  1.00 69.12  ? 272  LYS A HG2  1 
ATOM   2923  H  HG3  . LYS A 1 193 ? -56.721 -46.345 18.140  1.00 69.12  ? 272  LYS A HG3  1 
ATOM   2924  H  HD2  . LYS A 1 193 ? -57.931 -48.833 17.545  1.00 80.52  ? 272  LYS A HD2  1 
ATOM   2925  H  HD3  . LYS A 1 193 ? -56.647 -48.690 18.469  1.00 80.52  ? 272  LYS A HD3  1 
ATOM   2926  H  HE2  . LYS A 1 193 ? -57.846 -47.723 20.139  1.00 91.06  ? 272  LYS A HE2  1 
ATOM   2927  H  HE3  . LYS A 1 193 ? -59.089 -47.463 19.184  1.00 91.06  ? 272  LYS A HE3  1 
ATOM   2928  H  HZ1  . LYS A 1 193 ? -59.506 -49.211 20.575  1.00 89.18  ? 272  LYS A HZ1  1 
ATOM   2929  H  HZ2  . LYS A 1 193 ? -59.490 -49.705 19.213  1.00 89.18  ? 272  LYS A HZ2  1 
ATOM   2930  H  HZ3  . LYS A 1 193 ? -58.356 -49.942 20.083  1.00 89.18  ? 272  LYS A HZ3  1 
ATOM   2931  N  N    . GLU A 1 194 ? -58.282 -45.593 13.873  1.00 40.03  ? 273  GLU A N    1 
ATOM   2932  C  CA   . GLU A 1 194 ? -57.800 -45.866 12.523  1.00 41.45  ? 273  GLU A CA   1 
ATOM   2933  C  C    . GLU A 1 194 ? -57.311 -44.602 11.820  1.00 42.89  ? 273  GLU A C    1 
ATOM   2934  O  O    . GLU A 1 194 ? -56.337 -44.646 11.072  1.00 46.56  ? 273  GLU A O    1 
ATOM   2935  C  CB   . GLU A 1 194 ? -58.899 -46.530 11.684  1.00 40.90  ? 273  GLU A CB   1 
ATOM   2936  C  CG   . GLU A 1 194 ? -59.182 -47.982 12.064  1.00 46.63  ? 273  GLU A CG   1 
ATOM   2937  C  CD   . GLU A 1 194 ? -60.142 -48.673 11.110  1.00 59.84  ? 273  GLU A CD   1 
ATOM   2938  O  OE1  . GLU A 1 194 ? -60.618 -48.014 10.160  1.00 65.92  ? 273  GLU A OE1  1 
ATOM   2939  O  OE2  . GLU A 1 194 ? -60.425 -49.875 11.316  1.00 65.01  ? 273  GLU A OE2  1 
ATOM   2940  H  H    . GLU A 1 194 ? -59.122 -45.741 13.979  1.00 48.03  ? 273  GLU A H    1 
ATOM   2941  H  HA   . GLU A 1 194 ? -57.054 -46.483 12.576  1.00 49.74  ? 273  GLU A HA   1 
ATOM   2942  H  HB2  . GLU A 1 194 ? -59.722 -46.029 11.797  1.00 49.09  ? 273  GLU A HB2  1 
ATOM   2943  H  HB3  . GLU A 1 194 ? -58.631 -46.515 10.752  1.00 49.09  ? 273  GLU A HB3  1 
ATOM   2944  H  HG2  . GLU A 1 194 ? -58.348 -48.477 12.058  1.00 55.96  ? 273  GLU A HG2  1 
ATOM   2945  H  HG3  . GLU A 1 194 ? -59.574 -48.004 12.951  1.00 55.96  ? 273  GLU A HG3  1 
ATOM   2946  N  N    . LEU A 1 195 ? -57.993 -43.482 12.050  1.00 26.99  ? 274  LEU A N    1 
ATOM   2947  C  CA   . LEU A 1 195 ? -57.611 -42.218 11.421  1.00 23.37  ? 274  LEU A CA   1 
ATOM   2948  C  C    . LEU A 1 195 ? -56.318 -41.666 12.005  1.00 23.03  ? 274  LEU A C    1 
ATOM   2949  O  O    . LEU A 1 195 ? -55.548 -41.009 11.308  1.00 24.90  ? 274  LEU A O    1 
ATOM   2950  C  CB   . LEU A 1 195 ? -58.711 -41.169 11.578  1.00 21.76  ? 274  LEU A CB   1 
ATOM   2951  C  CG   . LEU A 1 195 ? -60.045 -41.410 10.867  1.00 21.79  ? 274  LEU A CG   1 
ATOM   2952  C  CD1  . LEU A 1 195 ? -60.995 -40.276 11.203  1.00 22.03  ? 274  LEU A CD1  1 
ATOM   2953  C  CD2  . LEU A 1 195 ? -59.884 -41.556 9.359   1.00 20.77  ? 274  LEU A CD2  1 
ATOM   2954  H  H    . LEU A 1 195 ? -58.680 -43.426 12.564  1.00 32.38  ? 274  LEU A H    1 
ATOM   2955  H  HA   . LEU A 1 195 ? -57.472 -42.367 10.473  1.00 28.04  ? 274  LEU A HA   1 
ATOM   2956  H  HB2  . LEU A 1 195 ? -58.908 -41.083 12.524  1.00 26.11  ? 274  LEU A HB2  1 
ATOM   2957  H  HB3  . LEU A 1 195 ? -58.366 -40.324 11.249  1.00 26.11  ? 274  LEU A HB3  1 
ATOM   2958  H  HG   . LEU A 1 195 ? -60.435 -42.232 11.204  1.00 26.15  ? 274  LEU A HG   1 
ATOM   2959  H  HD11 . LEU A 1 195 ? -61.840 -40.428 10.753  1.00 26.43  ? 274  LEU A HD11 1 
ATOM   2960  H  HD12 . LEU A 1 195 ? -61.130 -40.252 12.164  1.00 26.43  ? 274  LEU A HD12 1 
ATOM   2961  H  HD13 . LEU A 1 195 ? -60.606 -39.439 10.903  1.00 26.43  ? 274  LEU A HD13 1 
ATOM   2962  H  HD21 . LEU A 1 195 ? -60.756 -41.707 8.962   1.00 24.93  ? 274  LEU A HD21 1 
ATOM   2963  H  HD22 . LEU A 1 195 ? -59.493 -40.743 9.003   1.00 24.93  ? 274  LEU A HD22 1 
ATOM   2964  H  HD23 . LEU A 1 195 ? -59.302 -42.311 9.176   1.00 24.93  ? 274  LEU A HD23 1 
ATOM   2965  N  N    . GLN A 1 196 ? -56.085 -41.919 13.288  1.00 31.50  ? 275  GLN A N    1 
ATOM   2966  C  CA   . GLN A 1 196 ? -54.878 -41.435 13.945  1.00 30.04  ? 275  GLN A CA   1 
ATOM   2967  C  C    . GLN A 1 196 ? -53.672 -42.190 13.399  1.00 28.73  ? 275  GLN A C    1 
ATOM   2968  O  O    . GLN A 1 196 ? -52.603 -41.611 13.190  1.00 21.94  ? 275  GLN A O    1 
ATOM   2969  C  CB   . GLN A 1 196 ? -54.991 -41.599 15.461  1.00 28.08  ? 275  GLN A CB   1 
ATOM   2970  C  CG   . GLN A 1 196 ? -53.808 -41.056 16.233  1.00 29.85  ? 275  GLN A CG   1 
ATOM   2971  C  CD   . GLN A 1 196 ? -53.513 -39.610 15.892  1.00 36.12  ? 275  GLN A CD   1 
ATOM   2972  O  OE1  . GLN A 1 196 ? -54.204 -38.697 16.347  1.00 35.84  ? 275  GLN A OE1  1 
ATOM   2973  N  NE2  . GLN A 1 196 ? -52.488 -39.394 15.073  1.00 35.85  ? 275  GLN A NE2  1 
ATOM   2974  H  H    . GLN A 1 196 ? -56.610 -42.369 13.800  1.00 37.79  ? 275  GLN A H    1 
ATOM   2975  H  HA   . GLN A 1 196 ? -54.762 -40.492 13.748  1.00 36.04  ? 275  GLN A HA   1 
ATOM   2976  H  HB2  . GLN A 1 196 ? -55.783 -41.131 15.767  1.00 33.70  ? 275  GLN A HB2  1 
ATOM   2977  H  HB3  . GLN A 1 196 ? -55.069 -42.544 15.667  1.00 33.70  ? 275  GLN A HB3  1 
ATOM   2978  H  HG2  . GLN A 1 196 ? -53.998 -41.109 17.183  1.00 35.82  ? 275  GLN A HG2  1 
ATOM   2979  H  HG3  . GLN A 1 196 ? -53.022 -41.582 16.021  1.00 35.82  ? 275  GLN A HG3  1 
ATOM   2980  H  HE21 . GLN A 1 196 ? -52.035 -40.058 14.768  1.00 43.02  ? 275  GLN A HE21 1 
ATOM   2981  H  HE22 . GLN A 1 196 ? -52.279 -38.591 14.848  1.00 43.02  ? 275  GLN A HE22 1 
ATOM   2982  N  N    . GLU A 1 197 ? -53.859 -43.484 13.153  1.00 39.27  ? 276  GLU A N    1 
ATOM   2983  C  CA   . GLU A 1 197 ? -52.850 -44.288 12.475  1.00 38.26  ? 276  GLU A CA   1 
ATOM   2984  C  C    . GLU A 1 197 ? -52.566 -43.680 11.113  1.00 34.22  ? 276  GLU A C    1 
ATOM   2985  O  O    . GLU A 1 197 ? -51.414 -43.471 10.738  1.00 38.90  ? 276  GLU A O    1 
ATOM   2986  C  CB   . GLU A 1 197 ? -53.329 -45.730 12.308  1.00 41.05  ? 276  GLU A CB   1 
ATOM   2987  C  CG   . GLU A 1 197 ? -53.324 -46.538 13.599  1.00 50.72  ? 276  GLU A CG   1 
ATOM   2988  C  CD   . GLU A 1 197 ? -54.053 -47.867 13.469  1.00 64.00  ? 276  GLU A CD   1 
ATOM   2989  O  OE1  . GLU A 1 197 ? -54.712 -48.100 12.430  1.00 61.74  ? 276  GLU A OE1  1 
ATOM   2990  O  OE2  . GLU A 1 197 ? -53.966 -48.681 14.414  1.00 68.68  ? 276  GLU A OE2  1 
ATOM   2991  H  H    . GLU A 1 197 ? -54.566 -43.922 13.370  1.00 47.12  ? 276  GLU A H    1 
ATOM   2992  H  HA   . GLU A 1 197 ? -52.029 -44.290 12.993  1.00 45.91  ? 276  GLU A HA   1 
ATOM   2993  H  HB2  . GLU A 1 197 ? -54.238 -45.719 11.969  1.00 49.26  ? 276  GLU A HB2  1 
ATOM   2994  H  HB3  . GLU A 1 197 ? -52.748 -46.180 11.675  1.00 49.26  ? 276  GLU A HB3  1 
ATOM   2995  H  HG2  . GLU A 1 197 ? -52.407 -46.723 13.852  1.00 60.86  ? 276  GLU A HG2  1 
ATOM   2996  H  HG3  . GLU A 1 197 ? -53.762 -46.023 14.295  1.00 60.86  ? 276  GLU A HG3  1 
ATOM   2997  N  N    . ASN A 1 198 ? -53.628 -43.391 10.377  1.00 34.21  ? 277  ASN A N    1 
ATOM   2998  C  CA   . ASN A 1 198 ? -53.500 -42.745 9.080   1.00 32.81  ? 277  ASN A CA   1 
ATOM   2999  C  C    . ASN A 1 198 ? -52.729 -41.427 9.135   1.00 31.30  ? 277  ASN A C    1 
ATOM   3000  O  O    . ASN A 1 198 ? -51.983 -41.107 8.214   1.00 27.67  ? 277  ASN A O    1 
ATOM   3001  C  CB   . ASN A 1 198 ? -54.885 -42.511 8.477   1.00 31.99  ? 277  ASN A CB   1 
ATOM   3002  C  CG   . ASN A 1 198 ? -55.464 -43.760 7.853   1.00 29.47  ? 277  ASN A CG   1 
ATOM   3003  O  OD1  . ASN A 1 198 ? -54.851 -44.825 7.867   1.00 39.02  ? 277  ASN A OD1  1 
ATOM   3004  N  ND2  . ASN A 1 198 ? -56.656 -43.636 7.305   1.00 28.85  ? 277  ASN A ND2  1 
ATOM   3005  H  H    . ASN A 1 198 ? -54.439 -43.559 10.607  1.00 41.05  ? 277  ASN A H    1 
ATOM   3006  H  HA   . ASN A 1 198 ? -53.018 -43.341 8.486   1.00 39.37  ? 277  ASN A HA   1 
ATOM   3007  H  HB2  . ASN A 1 198 ? -55.490 -42.217 9.176   1.00 38.39  ? 277  ASN A HB2  1 
ATOM   3008  H  HB3  . ASN A 1 198 ? -54.820 -41.833 7.786   1.00 38.39  ? 277  ASN A HB3  1 
ATOM   3009  H  HD21 . ASN A 1 198 ? -57.033 -44.315 6.936   1.00 34.62  ? 277  ASN A HD21 1 
ATOM   3010  H  HD22 . ASN A 1 198 ? -57.058 -42.875 7.318   1.00 34.62  ? 277  ASN A HD22 1 
ATOM   3011  N  N    . GLN A 1 199 ? -52.904 -40.667 10.211  1.00 27.49  ? 278  GLN A N    1 
ATOM   3012  C  CA   . GLN A 1 199 ? -52.225 -39.386 10.340  1.00 19.84  ? 278  GLN A CA   1 
ATOM   3013  C  C    . GLN A 1 199 ? -50.733 -39.620 10.556  1.00 32.43  ? 278  GLN A C    1 
ATOM   3014  O  O    . GLN A 1 199 ? -49.893 -38.939 9.965   1.00 38.35  ? 278  GLN A O    1 
ATOM   3015  C  CB   . GLN A 1 199 ? -52.811 -38.576 11.496  1.00 30.44  ? 278  GLN A CB   1 
ATOM   3016  C  CG   . GLN A 1 199 ? -52.266 -37.152 11.590  1.00 42.37  ? 278  GLN A CG   1 
ATOM   3017  C  CD   . GLN A 1 199 ? -52.636 -36.448 12.889  1.00 56.89  ? 278  GLN A CD   1 
ATOM   3018  O  OE1  . GLN A 1 199 ? -53.171 -37.059 13.815  1.00 60.16  ? 278  GLN A OE1  1 
ATOM   3019  N  NE2  . GLN A 1 199 ? -52.342 -35.155 12.963  1.00 67.83  ? 278  GLN A NE2  1 
ATOM   3020  H  H    . GLN A 1 199 ? -53.408 -40.870 10.878  1.00 32.99  ? 278  GLN A H    1 
ATOM   3021  H  HA   . GLN A 1 199 ? -52.340 -38.878 9.522   1.00 23.81  ? 278  GLN A HA   1 
ATOM   3022  H  HB2  . GLN A 1 199 ? -53.773 -38.518 11.381  1.00 36.53  ? 278  GLN A HB2  1 
ATOM   3023  H  HB3  . GLN A 1 199 ? -52.607 -39.027 12.330  1.00 36.53  ? 278  GLN A HB3  1 
ATOM   3024  H  HG2  . GLN A 1 199 ? -51.298 -37.182 11.533  1.00 50.85  ? 278  GLN A HG2  1 
ATOM   3025  H  HG3  . GLN A 1 199 ? -52.624 -36.630 10.856  1.00 50.85  ? 278  GLN A HG3  1 
ATOM   3026  H  HE21 . GLN A 1 199 ? -51.963 -34.762 12.299  1.00 81.40  ? 278  GLN A HE21 1 
ATOM   3027  H  HE22 . GLN A 1 199 ? -52.530 -34.711 13.675  1.00 81.40  ? 278  GLN A HE22 1 
ATOM   3028  N  N    . ASP A 1 200 ? -50.412 -40.599 11.396  1.00 30.71  ? 279  ASP A N    1 
ATOM   3029  C  CA   . ASP A 1 200 ? -49.026 -40.951 11.684  1.00 21.68  ? 279  ASP A CA   1 
ATOM   3030  C  C    . ASP A 1 200 ? -48.319 -41.396 10.403  1.00 20.88  ? 279  ASP A C    1 
ATOM   3031  O  O    . ASP A 1 200 ? -47.196 -40.975 10.119  1.00 26.65  ? 279  ASP A O    1 
ATOM   3032  C  CB   . ASP A 1 200 ? -48.960 -42.073 12.729  1.00 31.38  ? 279  ASP A CB   1 
ATOM   3033  C  CG   . ASP A 1 200 ? -49.496 -41.651 14.088  1.00 39.13  ? 279  ASP A CG   1 
ATOM   3034  O  OD1  . ASP A 1 200 ? -49.469 -40.442 14.402  1.00 41.79  ? 279  ASP A OD1  1 
ATOM   3035  O  OD2  . ASP A 1 200 ? -49.942 -42.539 14.846  1.00 35.99  ? 279  ASP A OD2  1 
ATOM   3036  H  H    . ASP A 1 200 ? -50.986 -41.080 11.817  1.00 36.85  ? 279  ASP A H    1 
ATOM   3037  H  HA   . ASP A 1 200 ? -48.562 -40.175 12.037  1.00 26.02  ? 279  ASP A HA   1 
ATOM   3038  H  HB2  . ASP A 1 200 ? -49.489 -42.824 12.418  1.00 37.66  ? 279  ASP A HB2  1 
ATOM   3039  H  HB3  . ASP A 1 200 ? -48.036 -42.344 12.843  1.00 37.66  ? 279  ASP A HB3  1 
ATOM   3040  N  N    . GLU A 1 201 ? -48.990 -42.243 9.628   1.00 20.44  ? 280  GLU A N    1 
ATOM   3041  C  CA   . GLU A 1 201 ? -48.424 -42.745 8.382   1.00 20.35  ? 280  GLU A CA   1 
ATOM   3042  C  C    . GLU A 1 201 ? -48.133 -41.598 7.423   1.00 23.38  ? 280  GLU A C    1 
ATOM   3043  O  O    . GLU A 1 201 ? -47.075 -41.561 6.799   1.00 31.12  ? 280  GLU A O    1 
ATOM   3044  C  CB   . GLU A 1 201 ? -49.370 -43.746 7.713   1.00 21.69  ? 280  GLU A CB   1 
ATOM   3045  C  CG   . GLU A 1 201 ? -48.776 -44.440 6.489   1.00 32.08  ? 280  GLU A CG   1 
ATOM   3046  C  CD   . GLU A 1 201 ? -47.985 -45.686 6.850   1.00 56.15  ? 280  GLU A CD   1 
ATOM   3047  O  OE1  . GLU A 1 201 ? -48.615 -46.748 7.070   1.00 65.03  ? 280  GLU A OE1  1 
ATOM   3048  O  OE2  . GLU A 1 201 ? -46.736 -45.604 6.916   1.00 58.93  ? 280  GLU A OE2  1 
ATOM   3049  H  H    . GLU A 1 201 ? -49.777 -42.542 9.802   1.00 24.53  ? 280  GLU A H    1 
ATOM   3050  H  HA   . GLU A 1 201 ? -47.589 -43.199 8.573   1.00 24.42  ? 280  GLU A HA   1 
ATOM   3051  H  HB2  . GLU A 1 201 ? -49.604 -44.432 8.357   1.00 26.02  ? 280  GLU A HB2  1 
ATOM   3052  H  HB3  . GLU A 1 201 ? -50.170 -43.277 7.428   1.00 26.02  ? 280  GLU A HB3  1 
ATOM   3053  H  HG2  . GLU A 1 201 ? -49.495 -44.702 5.893   1.00 38.49  ? 280  GLU A HG2  1 
ATOM   3054  H  HG3  . GLU A 1 201 ? -48.177 -43.825 6.036   1.00 38.49  ? 280  GLU A HG3  1 
ATOM   3055  N  N    . ILE A 1 202 ? -49.068 -40.663 7.302   1.00 24.40  ? 281  ILE A N    1 
ATOM   3056  C  CA   . ILE A 1 202 ? -48.901 -39.564 6.363   1.00 18.11  ? 281  ILE A CA   1 
ATOM   3057  C  C    . ILE A 1 202 ? -47.770 -38.652 6.825   1.00 18.15  ? 281  ILE A C    1 
ATOM   3058  O  O    . ILE A 1 202 ? -46.928 -38.278 6.018   1.00 23.14  ? 281  ILE A O    1 
ATOM   3059  C  CB   . ILE A 1 202 ? -50.222 -38.774 6.143   1.00 20.45  ? 281  ILE A CB   1 
ATOM   3060  C  CG1  . ILE A 1 202 ? -51.238 -39.635 5.386   1.00 22.05  ? 281  ILE A CG1  1 
ATOM   3061  C  CG2  . ILE A 1 202 ? -49.976 -37.480 5.373   1.00 17.62  ? 281  ILE A CG2  1 
ATOM   3062  C  CD1  . ILE A 1 202 ? -50.808 -40.067 3.970   1.00 21.60  ? 281  ILE A CD1  1 
ATOM   3063  H  H    . ILE A 1 202 ? -49.803 -40.642 7.748   1.00 29.28  ? 281  ILE A H    1 
ATOM   3064  H  HA   . ILE A 1 202 ? -48.641 -39.934 5.505   1.00 21.74  ? 281  ILE A HA   1 
ATOM   3065  H  HB   . ILE A 1 202 ? -50.594 -38.549 7.011   1.00 24.54  ? 281  ILE A HB   1 
ATOM   3066  H  HG12 . ILE A 1 202 ? -51.401 -40.441 5.900   1.00 26.46  ? 281  ILE A HG12 1 
ATOM   3067  H  HG13 . ILE A 1 202 ? -52.063 -39.133 5.299   1.00 26.46  ? 281  ILE A HG13 1 
ATOM   3068  H  HG21 . ILE A 1 202 ? -50.820 -37.017 5.257   1.00 21.14  ? 281  ILE A HG21 1 
ATOM   3069  H  HG22 . ILE A 1 202 ? -49.360 -36.925 5.878   1.00 21.14  ? 281  ILE A HG22 1 
ATOM   3070  H  HG23 . ILE A 1 202 ? -49.594 -37.696 4.508   1.00 21.14  ? 281  ILE A HG23 1 
ATOM   3071  H  HD11 . ILE A 1 202 ? -51.513 -40.604 3.577   1.00 25.92  ? 281  ILE A HD11 1 
ATOM   3072  H  HD12 . ILE A 1 202 ? -50.655 -39.275 3.432   1.00 25.92  ? 281  ILE A HD12 1 
ATOM   3073  H  HD13 . ILE A 1 202 ? -49.992 -40.587 4.034   1.00 25.92  ? 281  ILE A HD13 1 
ATOM   3074  N  N    . GLU A 1 203 ? -47.728 -38.327 8.117   1.00 18.62  ? 282  GLU A N    1 
ATOM   3075  C  CA   . GLU A 1 203 ? -46.648 -37.490 8.657   1.00 22.90  ? 282  GLU A CA   1 
ATOM   3076  C  C    . GLU A 1 203 ? -45.260 -38.110 8.448   1.00 25.68  ? 282  GLU A C    1 
ATOM   3077  O  O    . GLU A 1 203 ? -44.283 -37.391 8.239   1.00 32.21  ? 282  GLU A O    1 
ATOM   3078  C  CB   . GLU A 1 203 ? -46.867 -37.174 10.140  1.00 21.61  ? 282  GLU A CB   1 
ATOM   3079  C  CG   . GLU A 1 203 ? -47.383 -35.758 10.373  1.00 48.38  ? 282  GLU A CG   1 
ATOM   3080  C  CD   . GLU A 1 203 ? -48.252 -35.627 11.620  1.00 60.09  ? 282  GLU A CD   1 
ATOM   3081  O  OE1  . GLU A 1 203 ? -47.905 -36.234 12.658  1.00 59.34  ? 282  GLU A OE1  1 
ATOM   3082  O  OE2  . GLU A 1 203 ? -49.279 -34.908 11.557  1.00 53.16  ? 282  GLU A OE2  1 
ATOM   3083  H  H    . GLU A 1 203 ? -48.308 -38.575 8.701   1.00 22.34  ? 282  GLU A H    1 
ATOM   3084  H  HA   . GLU A 1 203 ? -46.656 -36.645 8.181   1.00 27.48  ? 282  GLU A HA   1 
ATOM   3085  H  HB2  . GLU A 1 203 ? -47.518 -37.794 10.502  1.00 25.93  ? 282  GLU A HB2  1 
ATOM   3086  H  HB3  . GLU A 1 203 ? -46.023 -37.266 10.610  1.00 25.93  ? 282  GLU A HB3  1 
ATOM   3087  H  HG2  . GLU A 1 203 ? -46.626 -35.160 10.474  1.00 58.06  ? 282  GLU A HG2  1 
ATOM   3088  H  HG3  . GLU A 1 203 ? -47.917 -35.489 9.609   1.00 58.06  ? 282  GLU A HG3  1 
ATOM   3089  N  N    . ASN A 1 204 ? -45.178 -39.437 8.495   1.00 19.92  ? 283  ASN A N    1 
ATOM   3090  C  CA   . ASN A 1 204 ? -43.932 -40.135 8.185   1.00 29.74  ? 283  ASN A CA   1 
ATOM   3091  C  C    . ASN A 1 204 ? -43.502 -39.826 6.762   1.00 29.24  ? 283  ASN A C    1 
ATOM   3092  O  O    . ASN A 1 204 ? -42.375 -39.390 6.515   1.00 33.93  ? 283  ASN A O    1 
ATOM   3093  C  CB   . ASN A 1 204 ? -44.084 -41.653 8.350   1.00 29.86  ? 283  ASN A CB   1 
ATOM   3094  C  CG   . ASN A 1 204 ? -44.148 -42.084 9.802   1.00 38.94  ? 283  ASN A CG   1 
ATOM   3095  O  OD1  . ASN A 1 204 ? -43.721 -41.351 10.697  1.00 37.03  ? 283  ASN A OD1  1 
ATOM   3096  N  ND2  . ASN A 1 204 ? -44.673 -43.284 10.046  1.00 44.31  ? 283  ASN A ND2  1 
ATOM   3097  H  H    . ASN A 1 204 ? -45.830 -39.958 8.704   1.00 23.90  ? 283  ASN A H    1 
ATOM   3098  H  HA   . ASN A 1 204 ? -43.235 -39.831 8.788   1.00 35.69  ? 283  ASN A HA   1 
ATOM   3099  H  HB2  . ASN A 1 204 ? -44.904 -41.937 7.916   1.00 35.83  ? 283  ASN A HB2  1 
ATOM   3100  H  HB3  . ASN A 1 204 ? -43.322 -42.093 7.940   1.00 35.83  ? 283  ASN A HB3  1 
ATOM   3101  H  HD21 . ASN A 1 204 ? -44.731 -43.572 10.854  1.00 53.18  ? 283  ASN A HD21 1 
ATOM   3102  H  HD22 . ASN A 1 204 ? -44.954 -43.770 9.394   1.00 53.18  ? 283  ASN A HD22 1 
HETATM 3103  N  N    . MSE A 1 205 ? -44.415 -40.058 5.828   1.00 28.41  ? 284  MSE A N    1 
HETATM 3104  C  CA   . MSE A 1 205 ? -44.146 -39.829 4.418   1.00 26.65  ? 284  MSE A CA   1 
HETATM 3105  C  C    . MSE A 1 205 ? -43.739 -38.384 4.119   1.00 30.60  ? 284  MSE A C    1 
HETATM 3106  O  O    . MSE A 1 205 ? -42.848 -38.152 3.306   1.00 27.97  ? 284  MSE A O    1 
HETATM 3107  C  CB   . MSE A 1 205 ? -45.367 -40.215 3.589   1.00 29.59  ? 284  MSE A CB   1 
HETATM 3108  C  CG   . MSE A 1 205 ? -45.591 -41.713 3.489   1.00 36.50  ? 284  MSE A CG   1 
HETATM 3109  SE SE   . MSE A 1 205 ? -47.376 -42.164 2.839   1.00 59.66  ? 284  MSE A SE   1 
HETATM 3110  C  CE   . MSE A 1 205 ? -47.813 -40.501 1.968   1.00 35.25  ? 284  MSE A CE   1 
HETATM 3111  H  H    . MSE A 1 205 ? -45.207 -40.352 5.988   1.00 34.09  ? 284  MSE A H    1 
HETATM 3112  H  HA   . MSE A 1 205 ? -43.418 -40.411 4.149   1.00 31.98  ? 284  MSE A HA   1 
HETATM 3113  H  HB2  . MSE A 1 205 ? -46.157 -39.823 3.994   1.00 35.51  ? 284  MSE A HB2  1 
HETATM 3114  H  HB3  . MSE A 1 205 ? -45.255 -39.871 2.689   1.00 35.51  ? 284  MSE A HB3  1 
HETATM 3115  H  HG2  . MSE A 1 205 ? -44.943 -42.090 2.874   1.00 43.80  ? 284  MSE A HG2  1 
HETATM 3116  H  HG3  . MSE A 1 205 ? -45.483 -42.109 4.369   1.00 43.80  ? 284  MSE A HG3  1 
HETATM 3117  H  HE1  . MSE A 1 205 ? -48.701 -40.570 1.583   1.00 42.30  ? 284  MSE A HE1  1 
HETATM 3118  H  HE2  . MSE A 1 205 ? -47.792 -39.786 2.623   1.00 42.30  ? 284  MSE A HE2  1 
HETATM 3119  H  HE3  . MSE A 1 205 ? -47.162 -40.330 1.270   1.00 42.30  ? 284  MSE A HE3  1 
HETATM 3120  N  N    . MSE A 1 206 ? -44.378 -37.414 4.765   1.00 32.96  ? 285  MSE A N    1 
HETATM 3121  C  CA   . MSE A 1 206 ? -43.992 -36.026 4.551   1.00 30.54  ? 285  MSE A CA   1 
HETATM 3122  C  C    . MSE A 1 206 ? -42.601 -35.806 5.113   1.00 31.77  ? 285  MSE A C    1 
HETATM 3123  O  O    . MSE A 1 206 ? -41.787 -35.103 4.519   1.00 34.60  ? 285  MSE A O    1 
HETATM 3124  C  CB   . MSE A 1 206 ? -44.940 -35.046 5.239   1.00 41.87  ? 285  MSE A CB   1 
HETATM 3125  C  CG   . MSE A 1 206 ? -46.359 -35.504 5.385   1.00 48.71  ? 285  MSE A CG   1 
HETATM 3126  SE SE   . MSE A 1 206 ? -47.559 -34.007 5.704   1.00 54.58  ? 285  MSE A SE   1 
HETATM 3127  C  CE   . MSE A 1 206 ? -47.729 -33.433 3.860   1.00 35.60  ? 285  MSE A CE   1 
HETATM 3128  H  H    . MSE A 1 206 ? -45.025 -37.529 5.320   1.00 39.55  ? 285  MSE A H    1 
HETATM 3129  H  HA   . MSE A 1 206 ? -43.990 -35.834 3.600   1.00 36.65  ? 285  MSE A HA   1 
HETATM 3130  H  HB2  . MSE A 1 206 ? -44.601 -34.867 6.130   1.00 50.24  ? 285  MSE A HB2  1 
HETATM 3131  H  HB3  . MSE A 1 206 ? -44.953 -34.222 4.728   1.00 50.24  ? 285  MSE A HB3  1 
HETATM 3132  H  HG2  . MSE A 1 206 ? -46.637 -35.949 4.569   1.00 58.45  ? 285  MSE A HG2  1 
HETATM 3133  H  HG3  . MSE A 1 206 ? -46.424 -36.112 6.138   1.00 58.45  ? 285  MSE A HG3  1 
HETATM 3134  H  HE1  . MSE A 1 206 ? -46.851 -33.198 3.521   1.00 42.72  ? 285  MSE A HE1  1 
HETATM 3135  H  HE2  . MSE A 1 206 ? -48.101 -34.160 3.337   1.00 42.72  ? 285  MSE A HE2  1 
HETATM 3136  H  HE3  . MSE A 1 206 ? -48.317 -32.663 3.822   1.00 42.72  ? 285  MSE A HE3  1 
ATOM   3137  N  N    . ASN A 1 207 ? -42.332 -36.409 6.267   1.00 28.31  ? 286  ASN A N    1 
ATOM   3138  C  CA   . ASN A 1 207 ? -41.076 -36.173 6.964   1.00 26.14  ? 286  ASN A CA   1 
ATOM   3139  C  C    . ASN A 1 207 ? -39.907 -36.824 6.231   1.00 26.40  ? 286  ASN A C    1 
ATOM   3140  O  O    . ASN A 1 207 ? -38.783 -36.328 6.274   1.00 29.20  ? 286  ASN A O    1 
ATOM   3141  C  CB   . ASN A 1 207 ? -41.156 -36.666 8.408   1.00 25.51  ? 286  ASN A CB   1 
ATOM   3142  C  CG   . ASN A 1 207 ? -40.143 -35.987 9.304   1.00 42.75  ? 286  ASN A CG   1 
ATOM   3143  O  OD1  . ASN A 1 207 ? -39.039 -36.495 9.516   1.00 46.16  ? 286  ASN A OD1  1 
ATOM   3144  N  ND2  . ASN A 1 207 ? -40.509 -34.820 9.826   1.00 48.06  ? 286  ASN A ND2  1 
ATOM   3145  H  H    . ASN A 1 207 ? -42.861 -36.957 6.666   1.00 33.97  ? 286  ASN A H    1 
ATOM   3146  H  HA   . ASN A 1 207 ? -40.910 -35.218 6.989   1.00 31.37  ? 286  ASN A HA   1 
ATOM   3147  H  HB2  . ASN A 1 207 ? -42.041 -36.479 8.759   1.00 30.62  ? 286  ASN A HB2  1 
ATOM   3148  H  HB3  . ASN A 1 207 ? -40.984 -37.620 8.428   1.00 30.62  ? 286  ASN A HB3  1 
ATOM   3149  H  HD21 . ASN A 1 207 ? -39.971 -34.392 10.342  1.00 57.68  ? 286  ASN A HD21 1 
ATOM   3150  H  HD22 . ASN A 1 207 ? -41.285 -34.494 9.647   1.00 57.68  ? 286  ASN A HD22 1 
ATOM   3151  N  N    . ALA A 1 208 ? -40.190 -37.923 5.540   1.00 15.78  ? 287  ALA A N    1 
ATOM   3152  C  CA   . ALA A 1 208 ? -39.213 -38.556 4.666   1.00 14.58  ? 287  ALA A CA   1 
ATOM   3153  C  C    . ALA A 1 208 ? -38.842 -37.592 3.545   1.00 16.64  ? 287  ALA A C    1 
ATOM   3154  O  O    . ALA A 1 208 ? -37.668 -37.291 3.342   1.00 24.90  ? 287  ALA A O    1 
ATOM   3155  C  CB   . ALA A 1 208 ? -39.785 -39.849 4.089   1.00 14.78  ? 287  ALA A CB   1 
ATOM   3156  H  H    . ALA A 1 208 ? -40.950 -38.324 5.562   1.00 18.94  ? 287  ALA A H    1 
ATOM   3157  H  HA   . ALA A 1 208 ? -38.413 -38.769 5.171   1.00 17.49  ? 287  ALA A HA   1 
ATOM   3158  H  HB1  . ALA A 1 208 ? -39.122 -40.257 3.510   1.00 17.74  ? 287  ALA A HB1  1 
ATOM   3159  H  HB2  . ALA A 1 208 ? -40.002 -40.451 4.818   1.00 17.74  ? 287  ALA A HB2  1 
ATOM   3160  H  HB3  . ALA A 1 208 ? -40.585 -39.642 3.581   1.00 17.74  ? 287  ALA A HB3  1 
ATOM   3161  N  N    . ILE A 1 209 ? -39.852 -37.107 2.827   1.00 17.23  ? 288  ILE A N    1 
ATOM   3162  C  CA   . ILE A 1 209 ? -39.637 -36.219 1.689   1.00 12.35  ? 288  ILE A CA   1 
ATOM   3163  C  C    . ILE A 1 209 ? -38.988 -34.916 2.120   1.00 12.60  ? 288  ILE A C    1 
ATOM   3164  O  O    . ILE A 1 209 ? -38.129 -34.395 1.417   1.00 21.31  ? 288  ILE A O    1 
ATOM   3165  C  CB   . ILE A 1 209 ? -40.959 -35.919 0.949   1.00 13.52  ? 288  ILE A CB   1 
ATOM   3166  C  CG1  . ILE A 1 209 ? -41.433 -37.182 0.228   1.00 18.97  ? 288  ILE A CG1  1 
ATOM   3167  C  CG2  . ILE A 1 209 ? -40.784 -34.778 -0.066  1.00 17.58  ? 288  ILE A CG2  1 
ATOM   3168  C  CD1  . ILE A 1 209 ? -42.798 -37.064 -0.419  1.00 18.84  ? 288  ILE A CD1  1 
ATOM   3169  H  H    . ILE A 1 209 ? -40.680 -37.280 2.981   1.00 20.68  ? 288  ILE A H    1 
ATOM   3170  H  HA   . ILE A 1 209 ? -39.039 -36.655 1.063   1.00 14.83  ? 288  ILE A HA   1 
ATOM   3171  H  HB   . ILE A 1 209 ? -41.630 -35.659 1.599   1.00 16.22  ? 288  ILE A HB   1 
ATOM   3172  H  HG12 . ILE A 1 209 ? -40.795 -37.398 -0.470  1.00 22.76  ? 288  ILE A HG12 1 
ATOM   3173  H  HG13 . ILE A 1 209 ? -41.474 -37.908 0.870   1.00 22.76  ? 288  ILE A HG13 1 
ATOM   3174  H  HG21 . ILE A 1 209 ? -41.631 -34.619 -0.510  1.00 21.09  ? 288  ILE A HG21 1 
ATOM   3175  H  HG22 . ILE A 1 209 ? -40.501 -33.978 0.405   1.00 21.09  ? 288  ILE A HG22 1 
ATOM   3176  H  HG23 . ILE A 1 209 ? -40.112 -35.035 -0.717  1.00 21.09  ? 288  ILE A HG23 1 
ATOM   3177  H  HD11 . ILE A 1 209 ? -43.016 -37.905 -0.849  1.00 22.61  ? 288  ILE A HD11 1 
ATOM   3178  H  HD12 . ILE A 1 209 ? -43.455 -36.862 0.266   1.00 22.61  ? 288  ILE A HD12 1 
ATOM   3179  H  HD13 . ILE A 1 209 ? -42.775 -36.351 -1.076  1.00 22.61  ? 288  ILE A HD13 1 
ATOM   3180  N  N    . PHE A 1 210 ? -39.381 -34.397 3.277   1.00 16.65  ? 289  PHE A N    1 
ATOM   3181  C  CA   . PHE A 1 210 ? -38.888 -33.099 3.723   1.00 20.78  ? 289  PHE A CA   1 
ATOM   3182  C  C    . PHE A 1 210 ? -37.408 -33.165 4.091   1.00 24.30  ? 289  PHE A C    1 
ATOM   3183  O  O    . PHE A 1 210 ? -36.619 -32.323 3.659   1.00 23.69  ? 289  PHE A O    1 
ATOM   3184  C  CB   . PHE A 1 210 ? -39.704 -32.587 4.911   1.00 21.69  ? 289  PHE A CB   1 
ATOM   3185  C  CG   . PHE A 1 210 ? -39.401 -31.157 5.292   1.00 16.90  ? 289  PHE A CG   1 
ATOM   3186  C  CD1  . PHE A 1 210 ? -39.907 -30.103 4.550   1.00 21.39  ? 289  PHE A CD1  1 
ATOM   3187  C  CD2  . PHE A 1 210 ? -38.619 -30.869 6.397   1.00 20.05  ? 289  PHE A CD2  1 
ATOM   3188  C  CE1  . PHE A 1 210 ? -39.638 -28.790 4.906   1.00 22.49  ? 289  PHE A CE1  1 
ATOM   3189  C  CE2  . PHE A 1 210 ? -38.354 -29.556 6.758   1.00 23.42  ? 289  PHE A CE2  1 
ATOM   3190  C  CZ   . PHE A 1 210 ? -38.856 -28.519 6.008   1.00 19.38  ? 289  PHE A CZ   1 
ATOM   3191  H  H    . PHE A 1 210 ? -39.931 -34.774 3.820   1.00 19.98  ? 289  PHE A H    1 
ATOM   3192  H  HA   . PHE A 1 210 ? -38.985 -32.461 2.998   1.00 24.94  ? 289  PHE A HA   1 
ATOM   3193  H  HB2  . PHE A 1 210 ? -40.647 -32.641 4.688   1.00 26.03  ? 289  PHE A HB2  1 
ATOM   3194  H  HB3  . PHE A 1 210 ? -39.517 -33.146 5.682   1.00 26.03  ? 289  PHE A HB3  1 
ATOM   3195  H  HD1  . PHE A 1 210 ? -40.435 -30.278 3.805   1.00 25.67  ? 289  PHE A HD1  1 
ATOM   3196  H  HD2  . PHE A 1 210 ? -38.276 -31.565 6.910   1.00 24.06  ? 289  PHE A HD2  1 
ATOM   3197  H  HE1  . PHE A 1 210 ? -39.982 -28.091 4.397   1.00 26.99  ? 289  PHE A HE1  1 
ATOM   3198  H  HE2  . PHE A 1 210 ? -37.824 -29.377 7.501   1.00 28.11  ? 289  PHE A HE2  1 
ATOM   3199  H  HZ   . PHE A 1 210 ? -38.674 -27.639 6.247   1.00 23.26  ? 289  PHE A HZ   1 
ATOM   3200  N  N    . LYS A 1 211 ? -37.032 -34.168 4.879   1.00 31.00  ? 290  LYS A N    1 
ATOM   3201  C  CA   . LYS A 1 211 ? -35.653 -34.293 5.346   1.00 31.93  ? 290  LYS A CA   1 
ATOM   3202  C  C    . LYS A 1 211 ? -34.767 -34.970 4.313   1.00 31.66  ? 290  LYS A C    1 
ATOM   3203  O  O    . LYS A 1 211 ? -33.566 -34.714 4.252   1.00 41.23  ? 290  LYS A O    1 
ATOM   3204  C  CB   . LYS A 1 211 ? -35.605 -35.055 6.671   1.00 31.07  ? 290  LYS A CB   1 
ATOM   3205  C  CG   . LYS A 1 211 ? -35.992 -34.184 7.856   1.00 39.87  ? 290  LYS A CG   1 
ATOM   3206  C  CD   . LYS A 1 211 ? -36.119 -34.974 9.150   1.00 50.98  ? 290  LYS A CD   1 
ATOM   3207  C  CE   . LYS A 1 211 ? -36.766 -34.127 10.243  1.00 56.48  ? 290  LYS A CE   1 
ATOM   3208  N  NZ   . LYS A 1 211 ? -37.421 -34.941 11.309  1.00 60.27  ? 290  LYS A NZ   1 
ATOM   3209  H  H    . LYS A 1 211 ? -37.556 -34.790 5.158   1.00 37.19  ? 290  LYS A H    1 
ATOM   3210  H  HA   . LYS A 1 211 ? -35.297 -33.405 5.503   1.00 38.31  ? 290  LYS A HA   1 
ATOM   3211  H  HB2  . LYS A 1 211 ? -36.224 -35.800 6.631   1.00 37.28  ? 290  LYS A HB2  1 
ATOM   3212  H  HB3  . LYS A 1 211 ? -34.703 -35.379 6.818   1.00 37.28  ? 290  LYS A HB3  1 
ATOM   3213  H  HG2  . LYS A 1 211 ? -35.312 -33.505 7.985   1.00 47.85  ? 290  LYS A HG2  1 
ATOM   3214  H  HG3  . LYS A 1 211 ? -36.848 -33.766 7.674   1.00 47.85  ? 290  LYS A HG3  1 
ATOM   3215  H  HD2  . LYS A 1 211 ? -36.676 -35.754 8.998   1.00 61.18  ? 290  LYS A HD2  1 
ATOM   3216  H  HD3  . LYS A 1 211 ? -35.237 -35.242 9.452   1.00 61.18  ? 290  LYS A HD3  1 
ATOM   3217  H  HE2  . LYS A 1 211 ? -36.084 -33.580 10.662  1.00 67.77  ? 290  LYS A HE2  1 
ATOM   3218  H  HE3  . LYS A 1 211 ? -37.444 -33.561 9.842   1.00 67.77  ? 290  LYS A HE3  1 
ATOM   3219  H  HZ1  . LYS A 1 211 ? -37.782 -34.405 11.921  1.00 72.32  ? 290  LYS A HZ1  1 
ATOM   3220  H  HZ2  . LYS A 1 211 ? -38.060 -35.448 10.955  1.00 72.32  ? 290  LYS A HZ2  1 
ATOM   3221  H  HZ3  . LYS A 1 211 ? -36.820 -35.466 11.703  1.00 72.32  ? 290  LYS A HZ3  1 
ATOM   3222  N  N    . GLY A 1 212 ? -35.366 -35.828 3.496   1.00 22.21  ? 291  GLY A N    1 
ATOM   3223  C  CA   . GLY A 1 212 ? -34.638 -36.528 2.455   1.00 15.98  ? 291  GLY A CA   1 
ATOM   3224  C  C    . GLY A 1 212 ? -34.408 -35.704 1.198   1.00 20.37  ? 291  GLY A C    1 
ATOM   3225  O  O    . GLY A 1 212 ? -33.384 -35.872 0.531   1.00 28.85  ? 291  GLY A O    1 
ATOM   3226  H  H    . GLY A 1 212 ? -36.203 -36.021 3.527   1.00 26.65  ? 291  GLY A H    1 
ATOM   3227  H  HA2  . GLY A 1 212 ? -33.773 -36.800 2.800   1.00 19.17  ? 291  GLY A HA2  1 
ATOM   3228  H  HA3  . GLY A 1 212 ? -35.129 -37.327 2.207   1.00 19.17  ? 291  GLY A HA3  1 
ATOM   3229  N  N    . VAL A 1 213 ? -35.355 -34.827 0.868   1.00 17.26  ? 292  VAL A N    1 
ATOM   3230  C  CA   . VAL A 1 213 ? -35.251 -34.008 -0.334  1.00 11.57  ? 292  VAL A CA   1 
ATOM   3231  C  C    . VAL A 1 213 ? -35.143 -32.516 0.001   1.00 12.06  ? 292  VAL A C    1 
ATOM   3232  O  O    . VAL A 1 213 ? -34.092 -31.916 -0.214  1.00 11.49  ? 292  VAL A O    1 
ATOM   3233  C  CB   . VAL A 1 213 ? -36.437 -34.263 -1.295  1.00 11.10  ? 292  VAL A CB   1 
ATOM   3234  C  CG1  . VAL A 1 213 ? -36.347 -33.355 -2.512  1.00 13.91  ? 292  VAL A CG1  1 
ATOM   3235  C  CG2  . VAL A 1 213 ? -36.483 -35.737 -1.726  1.00 11.43  ? 292  VAL A CG2  1 
ATOM   3236  H  H    . VAL A 1 213 ? -36.069 -34.689 1.327   1.00 20.71  ? 292  VAL A H    1 
ATOM   3237  H  HA   . VAL A 1 213 ? -34.440 -34.258 -0.804  1.00 13.88  ? 292  VAL A HA   1 
ATOM   3238  H  HB   . VAL A 1 213 ? -37.266 -34.061 -0.833  1.00 13.32  ? 292  VAL A HB   1 
ATOM   3239  H  HG11 . VAL A 1 213 ? -37.100 -33.535 -3.097  1.00 16.70  ? 292  VAL A HG11 1 
ATOM   3240  H  HG12 . VAL A 1 213 ? -36.370 -32.431 -2.218  1.00 16.70  ? 292  VAL A HG12 1 
ATOM   3241  H  HG13 . VAL A 1 213 ? -35.516 -33.534 -2.979  1.00 16.70  ? 292  VAL A HG13 1 
ATOM   3242  H  HG21 . VAL A 1 213 ? -37.234 -35.867 -2.326  1.00 13.72  ? 292  VAL A HG21 1 
ATOM   3243  H  HG22 . VAL A 1 213 ? -35.655 -35.959 -2.179  1.00 13.72  ? 292  VAL A HG22 1 
ATOM   3244  H  HG23 . VAL A 1 213 ? -36.589 -36.293 -0.938  1.00 13.72  ? 292  VAL A HG23 1 
ATOM   3245  N  N    . PHE A 1 214 ? -36.212 -31.921 0.523   1.00 16.53  ? 293  PHE A N    1 
ATOM   3246  C  CA   . PHE A 1 214 ? -36.283 -30.461 0.652   1.00 17.10  ? 293  PHE A CA   1 
ATOM   3247  C  C    . PHE A 1 214 ? -35.087 -29.845 1.376   1.00 13.05  ? 293  PHE A C    1 
ATOM   3248  O  O    . PHE A 1 214 ? -34.550 -28.816 0.959   1.00 24.90  ? 293  PHE A O    1 
ATOM   3249  C  CB   . PHE A 1 214 ? -37.558 -30.024 1.380   1.00 15.93  ? 293  PHE A CB   1 
ATOM   3250  C  CG   . PHE A 1 214 ? -37.643 -28.541 1.579   1.00 11.43  ? 293  PHE A CG   1 
ATOM   3251  C  CD1  . PHE A 1 214 ? -38.101 -27.720 0.565   1.00 12.14  ? 293  PHE A CD1  1 
ATOM   3252  C  CD2  . PHE A 1 214 ? -37.238 -27.962 2.771   1.00 12.10  ? 293  PHE A CD2  1 
ATOM   3253  C  CE1  . PHE A 1 214 ? -38.168 -26.349 0.739   1.00 17.88  ? 293  PHE A CE1  1 
ATOM   3254  C  CE2  . PHE A 1 214 ? -37.293 -26.589 2.946   1.00 13.09  ? 293  PHE A CE2  1 
ATOM   3255  C  CZ   . PHE A 1 214 ? -37.756 -25.783 1.928   1.00 14.04  ? 293  PHE A CZ   1 
ATOM   3256  H  H    . PHE A 1 214 ? -36.910 -32.334 0.809   1.00 19.84  ? 293  PHE A H    1 
ATOM   3257  H  HA   . PHE A 1 214 ? -36.312 -30.077 -0.239  1.00 20.52  ? 293  PHE A HA   1 
ATOM   3258  H  HB2  . PHE A 1 214 ? -38.329 -30.300 0.858   1.00 19.12  ? 293  PHE A HB2  1 
ATOM   3259  H  HB3  . PHE A 1 214 ? -37.582 -30.445 2.253   1.00 19.12  ? 293  PHE A HB3  1 
ATOM   3260  H  HD1  . PHE A 1 214 ? -38.374 -28.095 -0.241  1.00 14.57  ? 293  PHE A HD1  1 
ATOM   3261  H  HD2  . PHE A 1 214 ? -36.918 -28.501 3.458   1.00 14.52  ? 293  PHE A HD2  1 
ATOM   3262  H  HE1  . PHE A 1 214 ? -38.481 -25.808 0.050   1.00 21.46  ? 293  PHE A HE1  1 
ATOM   3263  H  HE2  . PHE A 1 214 ? -37.022 -26.212 3.752   1.00 15.70  ? 293  PHE A HE2  1 
ATOM   3264  H  HZ   . PHE A 1 214 ? -37.805 -24.862 2.047   1.00 16.85  ? 293  PHE A HZ   1 
ATOM   3265  N  N    . VAL A 1 215 ? -34.685 -30.474 2.468   1.00 19.47  ? 294  VAL A N    1 
ATOM   3266  C  CA   . VAL A 1 215 ? -33.671 -29.907 3.343   1.00 31.12  ? 294  VAL A CA   1 
ATOM   3267  C  C    . VAL A 1 215 ? -32.306 -29.803 2.655   1.00 31.37  ? 294  VAL A C    1 
ATOM   3268  O  O    . VAL A 1 215 ? -31.488 -28.958 3.020   1.00 40.72  ? 294  VAL A O    1 
ATOM   3269  C  CB   . VAL A 1 215 ? -33.610 -30.707 4.668   1.00 29.18  ? 294  VAL A CB   1 
ATOM   3270  C  CG1  . VAL A 1 215 ? -32.194 -30.879 5.176   1.00 33.74  ? 294  VAL A CG1  1 
ATOM   3271  C  CG2  . VAL A 1 215 ? -34.467 -30.021 5.720   1.00 32.46  ? 294  VAL A CG2  1 
ATOM   3272  H  H    . VAL A 1 215 ? -34.985 -31.237 2.728   1.00 23.37  ? 294  VAL A H    1 
ATOM   3273  H  HA   . VAL A 1 215 ? -33.943 -29.004 3.570   1.00 37.35  ? 294  VAL A HA   1 
ATOM   3274  H  HB   . VAL A 1 215 ? -33.979 -31.591 4.517   1.00 35.02  ? 294  VAL A HB   1 
ATOM   3275  H  HG11 . VAL A 1 215 ? -32.215 -31.384 6.004   1.00 40.48  ? 294  VAL A HG11 1 
ATOM   3276  H  HG12 . VAL A 1 215 ? -31.675 -31.356 4.509   1.00 40.48  ? 294  VAL A HG12 1 
ATOM   3277  H  HG13 . VAL A 1 215 ? -31.807 -30.003 5.332   1.00 40.48  ? 294  VAL A HG13 1 
ATOM   3278  H  HG21 . VAL A 1 215 ? -34.421 -30.529 6.545   1.00 38.95  ? 294  VAL A HG21 1 
ATOM   3279  H  HG22 . VAL A 1 215 ? -34.129 -29.123 5.865   1.00 38.95  ? 294  VAL A HG22 1 
ATOM   3280  H  HG23 . VAL A 1 215 ? -35.383 -29.983 5.405   1.00 38.95  ? 294  VAL A HG23 1 
ATOM   3281  N  N    . HIS A 1 216 ? -32.082 -30.636 1.642   1.00 27.24  ? 295  HIS A N    1 
ATOM   3282  C  CA   . HIS A 1 216 ? -30.824 -30.627 0.900   1.00 29.20  ? 295  HIS A CA   1 
ATOM   3283  C  C    . HIS A 1 216 ? -30.973 -29.858 -0.392  1.00 29.56  ? 295  HIS A C    1 
ATOM   3284  O  O    . HIS A 1 216 ? -30.015 -29.277 -0.888  1.00 42.47  ? 295  HIS A O    1 
ATOM   3285  C  CB   . HIS A 1 216 ? -30.395 -32.048 0.548   1.00 30.03  ? 295  HIS A CB   1 
ATOM   3286  C  CG   . HIS A 1 216 ? -30.303 -32.959 1.728   1.00 32.97  ? 295  HIS A CG   1 
ATOM   3287  N  ND1  . HIS A 1 216 ? -29.319 -32.840 2.686   1.00 36.71  ? 295  HIS A ND1  1 
ATOM   3288  C  CD2  . HIS A 1 216 ? -31.065 -34.015 2.097   1.00 33.67  ? 295  HIS A CD2  1 
ATOM   3289  C  CE1  . HIS A 1 216 ? -29.487 -33.777 3.602   1.00 48.19  ? 295  HIS A CE1  1 
ATOM   3290  N  NE2  . HIS A 1 216 ? -30.537 -34.504 3.270   1.00 44.58  ? 295  HIS A NE2  1 
ATOM   3291  H  H    . HIS A 1 216 ? -32.647 -31.221 1.362   1.00 32.68  ? 295  HIS A H    1 
ATOM   3292  H  HA   . HIS A 1 216 ? -30.129 -30.212 1.434   1.00 35.04  ? 295  HIS A HA   1 
ATOM   3293  H  HB2  . HIS A 1 216 ? -31.040 -32.426 -0.069  1.00 36.04  ? 295  HIS A HB2  1 
ATOM   3294  H  HB3  . HIS A 1 216 ? -29.520 -32.016 0.130   1.00 36.04  ? 295  HIS A HB3  1 
ATOM   3295  H  HD1  . HIS A 1 216 ? -28.699 -32.244 2.692   1.00 44.05  ? 295  HIS A HD1  1 
ATOM   3296  H  HD2  . HIS A 1 216 ? -31.809 -34.344 1.647   1.00 40.40  ? 295  HIS A HD2  1 
ATOM   3297  H  HE1  . HIS A 1 216 ? -28.953 -33.905 4.352   1.00 57.82  ? 295  HIS A HE1  1 
ATOM   3298  H  HE2  . HIS A 1 216 ? -30.841 -35.175 3.714   1.00 53.49  ? 295  HIS A HE2  1 
ATOM   3299  N  N    . ARG A 1 217 ? -32.184 -29.854 -0.930  1.00 26.77  ? 296  ARG A N    1 
ATOM   3300  C  CA   . ARG A 1 217 ? -32.398 -29.461 -2.313  1.00 19.45  ? 296  ARG A CA   1 
ATOM   3301  C  C    . ARG A 1 217 ? -32.859 -28.016 -2.466  1.00 15.58  ? 296  ARG A C    1 
ATOM   3302  O  O    . ARG A 1 217 ? -32.822 -27.458 -3.561  1.00 22.33  ? 296  ARG A O    1 
ATOM   3303  C  CB   . ARG A 1 217 ? -33.431 -30.403 -2.921  1.00 12.27  ? 296  ARG A CB   1 
ATOM   3304  C  CG   . ARG A 1 217 ? -33.275 -30.699 -4.390  1.00 31.09  ? 296  ARG A CG   1 
ATOM   3305  C  CD   . ARG A 1 217 ? -31.872 -31.127 -4.749  1.00 23.87  ? 296  ARG A CD   1 
ATOM   3306  N  NE   . ARG A 1 217 ? -31.287 -31.955 -3.703  1.00 23.80  ? 296  ARG A NE   1 
ATOM   3307  C  CZ   . ARG A 1 217 ? -29.994 -31.987 -3.401  1.00 19.86  ? 296  ARG A CZ   1 
ATOM   3308  N  NH1  . ARG A 1 217 ? -29.128 -31.233 -4.066  1.00 16.13  ? 296  ARG A NH1  1 
ATOM   3309  N  NH2  . ARG A 1 217 ? -29.569 -32.780 -2.428  1.00 30.42  ? 296  ARG A NH2  1 
ATOM   3310  H  H    . ARG A 1 217 ? -32.902 -30.077 -0.512  1.00 32.12  ? 296  ARG A H    1 
ATOM   3311  H  HA   . ARG A 1 217 ? -31.569 -29.565 -2.804  1.00 23.35  ? 296  ARG A HA   1 
ATOM   3312  H  HB2  . ARG A 1 217 ? -33.385 -31.250 -2.450  1.00 14.72  ? 296  ARG A HB2  1 
ATOM   3313  H  HB3  . ARG A 1 217 ? -34.310 -30.013 -2.797  1.00 14.72  ? 296  ARG A HB3  1 
ATOM   3314  H  HG2  . ARG A 1 217 ? -33.880 -31.417 -4.634  1.00 37.31  ? 296  ARG A HG2  1 
ATOM   3315  H  HG3  . ARG A 1 217 ? -33.485 -29.900 -4.897  1.00 37.31  ? 296  ARG A HG3  1 
ATOM   3316  H  HD2  . ARG A 1 217 ? -31.895 -31.643 -5.570  1.00 28.64  ? 296  ARG A HD2  1 
ATOM   3317  H  HD3  . ARG A 1 217 ? -31.316 -30.340 -4.862  1.00 28.64  ? 296  ARG A HD3  1 
ATOM   3318  H  HE   . ARG A 1 217 ? -31.816 -32.459 -3.249  1.00 28.56  ? 296  ARG A HE   1 
ATOM   3319  H  HH11 . ARG A 1 217 ? -29.403 -30.718 -4.698  1.00 19.36  ? 296  ARG A HH11 1 
ATOM   3320  H  HH12 . ARG A 1 217 ? -28.293 -31.259 -3.865  1.00 19.36  ? 296  ARG A HH12 1 
ATOM   3321  H  HH21 . ARG A 1 217 ? -30.129 -33.269 -1.997  1.00 36.50  ? 296  ARG A HH21 1 
ATOM   3322  H  HH22 . ARG A 1 217 ? -28.733 -32.805 -2.228  1.00 36.50  ? 296  ARG A HH22 1 
ATOM   3323  N  N    . TYR A 1 218 ? -33.306 -27.410 -1.373  1.00 12.81  ? 297  TYR A N    1 
ATOM   3324  C  CA   . TYR A 1 218 ? -33.625 -25.991 -1.386  1.00 16.37  ? 297  TYR A CA   1 
ATOM   3325  C  C    . TYR A 1 218 ? -32.328 -25.203 -1.412  1.00 19.40  ? 297  TYR A C    1 
ATOM   3326  O  O    . TYR A 1 218 ? -32.319 -23.990 -1.626  1.00 20.70  ? 297  TYR A O    1 
ATOM   3327  C  CB   . TYR A 1 218 ? -34.430 -25.621 -0.144  1.00 17.83  ? 297  TYR A CB   1 
ATOM   3328  C  CG   . TYR A 1 218 ? -33.575 -25.165 1.014   1.00 17.28  ? 297  TYR A CG   1 
ATOM   3329  C  CD1  . TYR A 1 218 ? -32.998 -26.085 1.884   1.00 26.80  ? 297  TYR A CD1  1 
ATOM   3330  C  CD2  . TYR A 1 218 ? -33.344 -23.813 1.239   1.00 22.58  ? 297  TYR A CD2  1 
ATOM   3331  C  CE1  . TYR A 1 218 ? -32.210 -25.669 2.944   1.00 20.80  ? 297  TYR A CE1  1 
ATOM   3332  C  CE2  . TYR A 1 218 ? -32.556 -23.389 2.291   1.00 31.20  ? 297  TYR A CE2  1 
ATOM   3333  C  CZ   . TYR A 1 218 ? -31.996 -24.319 3.143   1.00 24.49  ? 297  TYR A CZ   1 
ATOM   3334  O  OH   . TYR A 1 218 ? -31.215 -23.897 4.192   1.00 28.71  ? 297  TYR A OH   1 
ATOM   3335  H  H    . TYR A 1 218 ? -33.432 -27.797 -0.616  1.00 15.37  ? 297  TYR A H    1 
ATOM   3336  H  HA   . TYR A 1 218 ? -34.144 -25.774 -2.176  1.00 19.65  ? 297  TYR A HA   1 
ATOM   3337  H  HB2  . TYR A 1 218 ? -35.037 -24.899 -0.367  1.00 21.39  ? 297  TYR A HB2  1 
ATOM   3338  H  HB3  . TYR A 1 218 ? -34.934 -26.398 0.146   1.00 21.39  ? 297  TYR A HB3  1 
ATOM   3339  H  HD1  . TYR A 1 218 ? -33.141 -26.994 1.750   1.00 32.16  ? 297  TYR A HD1  1 
ATOM   3340  H  HD2  . TYR A 1 218 ? -33.720 -23.184 0.667   1.00 27.09  ? 297  TYR A HD2  1 
ATOM   3341  H  HE1  . TYR A 1 218 ? -31.829 -26.293 3.518   1.00 24.96  ? 297  TYR A HE1  1 
ATOM   3342  H  HE2  . TYR A 1 218 ? -32.411 -22.481 2.430   1.00 37.44  ? 297  TYR A HE2  1 
ATOM   3343  H  HH   . TYR A 1 218 ? -30.935 -24.560 4.626   1.00 34.46  ? 297  TYR A HH   1 
ATOM   3344  N  N    . ARG A 1 219 ? -31.233 -25.923 -1.200  1.00 29.60  ? 298  ARG A N    1 
ATOM   3345  C  CA   . ARG A 1 219 ? -29.920 -25.339 -1.031  1.00 19.57  ? 298  ARG A CA   1 
ATOM   3346  C  C    . ARG A 1 219 ? -29.032 -25.724 -2.208  1.00 17.46  ? 298  ARG A C    1 
ATOM   3347  O  O    . ARG A 1 219 ? -27.810 -25.594 -2.155  1.00 19.87  ? 298  ARG A O    1 
ATOM   3348  C  CB   . ARG A 1 219 ? -29.331 -25.894 0.252   1.00 18.02  ? 298  ARG A CB   1 
ATOM   3349  C  CG   . ARG A 1 219 ? -28.610 -24.892 1.101   1.00 32.24  ? 298  ARG A CG   1 
ATOM   3350  C  CD   . ARG A 1 219 ? -28.372 -25.456 2.487   1.00 31.12  ? 298  ARG A CD   1 
ATOM   3351  N  NE   . ARG A 1 219 ? -28.118 -26.897 2.467   1.00 28.80  ? 298  ARG A NE   1 
ATOM   3352  C  CZ   . ARG A 1 219 ? -27.244 -27.525 3.251   1.00 38.75  ? 298  ARG A CZ   1 
ATOM   3353  N  NH1  . ARG A 1 219 ? -26.517 -26.856 4.143   1.00 36.98  ? 298  ARG A NH1  1 
ATOM   3354  N  NH2  . ARG A 1 219 ? -27.095 -28.840 3.145   1.00 43.06  ? 298  ARG A NH2  1 
ATOM   3355  H  H    . ARG A 1 219 ? -31.231 -26.781 -1.149  1.00 35.52  ? 298  ARG A H    1 
ATOM   3356  H  HA   . ARG A 1 219 ? -29.980 -24.372 -0.971  1.00 23.49  ? 298  ARG A HA   1 
ATOM   3357  H  HB2  . ARG A 1 219 ? -30.051 -26.266 0.786   1.00 21.62  ? 298  ARG A HB2  1 
ATOM   3358  H  HB3  . ARG A 1 219 ? -28.699 -26.594 0.025   1.00 21.62  ? 298  ARG A HB3  1 
ATOM   3359  H  HG2  . ARG A 1 219 ? -27.751 -24.686 0.700   1.00 38.69  ? 298  ARG A HG2  1 
ATOM   3360  H  HG3  . ARG A 1 219 ? -29.149 -24.089 1.183   1.00 38.69  ? 298  ARG A HG3  1 
ATOM   3361  H  HD2  . ARG A 1 219 ? -27.599 -25.020 2.879   1.00 37.34  ? 298  ARG A HD2  1 
ATOM   3362  H  HD3  . ARG A 1 219 ? -29.157 -25.296 3.034   1.00 37.34  ? 298  ARG A HD3  1 
ATOM   3363  H  HE   . ARG A 1 219 ? -28.566 -27.373 1.908   1.00 34.56  ? 298  ARG A HE   1 
ATOM   3364  H  HH11 . ARG A 1 219 ? -26.606 -26.004 4.219   1.00 44.37  ? 298  ARG A HH11 1 
ATOM   3365  H  HH12 . ARG A 1 219 ? -25.956 -27.275 4.643   1.00 44.37  ? 298  ARG A HH12 1 
ATOM   3366  H  HH21 . ARG A 1 219 ? -27.562 -29.280 2.572   1.00 51.67  ? 298  ARG A HH21 1 
ATOM   3367  H  HH22 . ARG A 1 219 ? -26.533 -29.251 3.649   1.00 51.67  ? 298  ARG A HH22 1 
ATOM   3368  N  N    . ASP A 1 220 ? -29.657 -26.212 -3.272  1.00 21.95  ? 299  ASP A N    1 
ATOM   3369  C  CA   . ASP A 1 220 ? -28.918 -26.758 -4.400  1.00 24.17  ? 299  ASP A CA   1 
ATOM   3370  C  C    . ASP A 1 220 ? -28.041 -25.713 -5.072  1.00 22.96  ? 299  ASP A C    1 
ATOM   3371  O  O    . ASP A 1 220 ? -28.338 -24.520 -5.034  1.00 29.57  ? 299  ASP A O    1 
ATOM   3372  C  CB   . ASP A 1 220 ? -29.874 -27.355 -5.431  1.00 23.40  ? 299  ASP A CB   1 
ATOM   3373  C  CG   . ASP A 1 220 ? -29.189 -28.352 -6.344  1.00 23.92  ? 299  ASP A CG   1 
ATOM   3374  O  OD1  . ASP A 1 220 ? -28.653 -27.935 -7.395  1.00 26.98  ? 299  ASP A OD1  1 
ATOM   3375  O  OD2  . ASP A 1 220 ? -29.187 -29.554 -6.000  1.00 30.15  ? 299  ASP A OD2  1 
ATOM   3376  H  H    . ASP A 1 220 ? -30.512 -26.238 -3.365  1.00 26.34  ? 299  ASP A H    1 
ATOM   3377  H  HA   . ASP A 1 220 ? -28.342 -27.470 -4.081  1.00 29.00  ? 299  ASP A HA   1 
ATOM   3378  H  HB2  . ASP A 1 220 ? -30.593 -27.814 -4.969  1.00 28.08  ? 299  ASP A HB2  1 
ATOM   3379  H  HB3  . ASP A 1 220 ? -30.233 -26.641 -5.981  1.00 28.08  ? 299  ASP A HB3  1 
ATOM   3380  N  N    . ALA A 1 221 ? -26.958 -26.169 -5.693  1.00 15.21  ? 300  ALA A N    1 
ATOM   3381  C  CA   . ALA A 1 221 ? -26.051 -25.268 -6.397  1.00 22.21  ? 300  ALA A CA   1 
ATOM   3382  C  C    . ALA A 1 221 ? -26.780 -24.624 -7.570  1.00 22.71  ? 300  ALA A C    1 
ATOM   3383  O  O    . ALA A 1 221 ? -26.461 -23.503 -7.969  1.00 22.01  ? 300  ALA A O    1 
ATOM   3384  C  CB   . ALA A 1 221 ? -24.816 -26.021 -6.881  1.00 13.28  ? 300  ALA A CB   1 
ATOM   3385  H  H    . ALA A 1 221 ? -26.726 -26.996 -5.722  1.00 18.26  ? 300  ALA A H    1 
ATOM   3386  H  HA   . ALA A 1 221 ? -25.764 -24.566 -5.793  1.00 26.65  ? 300  ALA A HA   1 
ATOM   3387  H  HB1  . ALA A 1 221 ? -24.231 -25.401 -7.344  1.00 15.93  ? 300  ALA A HB1  1 
ATOM   3388  H  HB2  . ALA A 1 221 ? -24.357 -26.400 -6.114  1.00 15.93  ? 300  ALA A HB2  1 
ATOM   3389  H  HB3  . ALA A 1 221 ? -25.093 -26.728 -7.484  1.00 15.93  ? 300  ALA A HB3  1 
ATOM   3390  N  N    . ILE A 1 222 ? -27.765 -25.337 -8.111  1.00 17.18  ? 301  ILE A N    1 
ATOM   3391  C  CA   . ILE A 1 222 ? -28.565 -24.829 -9.223  1.00 18.58  ? 301  ILE A CA   1 
ATOM   3392  C  C    . ILE A 1 222 ? -29.738 -23.993 -8.725  1.00 22.36  ? 301  ILE A C    1 
ATOM   3393  O  O    . ILE A 1 222 ? -30.560 -24.456 -7.933  1.00 24.97  ? 301  ILE A O    1 
ATOM   3394  C  CB   . ILE A 1 222 ? -29.089 -25.970 -10.113 1.00 13.20  ? 301  ILE A CB   1 
ATOM   3395  C  CG1  . ILE A 1 222 ? -27.941 -26.899 -10.511 1.00 23.32  ? 301  ILE A CG1  1 
ATOM   3396  C  CG2  . ILE A 1 222 ? -29.786 -25.413 -11.354 1.00 21.06  ? 301  ILE A CG2  1 
ATOM   3397  C  CD1  . ILE A 1 222 ? -26.708 -26.185 -11.035 1.00 27.26  ? 301  ILE A CD1  1 
ATOM   3398  H  H    . ILE A 1 222 ? -27.992 -26.124 -7.849  1.00 20.62  ? 301  ILE A H    1 
ATOM   3399  H  HA   . ILE A 1 222 ? -28.006 -24.257 -9.773  1.00 22.30  ? 301  ILE A HA   1 
ATOM   3400  H  HB   . ILE A 1 222 ? -29.735 -26.483 -9.603  1.00 15.84  ? 301  ILE A HB   1 
ATOM   3401  H  HG12 . ILE A 1 222 ? -27.674 -27.414 -9.733  1.00 27.99  ? 301  ILE A HG12 1 
ATOM   3402  H  HG13 . ILE A 1 222 ? -28.253 -27.498 -11.207 1.00 27.99  ? 301  ILE A HG13 1 
ATOM   3403  H  HG21 . ILE A 1 222 ? -30.105 -26.153 -11.895 1.00 25.28  ? 301  ILE A HG21 1 
ATOM   3404  H  HG22 . ILE A 1 222 ? -30.533 -24.861 -11.075 1.00 25.28  ? 301  ILE A HG22 1 
ATOM   3405  H  HG23 . ILE A 1 222 ? -29.152 -24.882 -11.861 1.00 25.28  ? 301  ILE A HG23 1 
ATOM   3406  H  HD11 . ILE A 1 222 ? -26.035 -26.845 -11.262 1.00 32.71  ? 301  ILE A HD11 1 
ATOM   3407  H  HD12 . ILE A 1 222 ? -26.951 -25.675 -11.824 1.00 32.71  ? 301  ILE A HD12 1 
ATOM   3408  H  HD13 . ILE A 1 222 ? -26.371 -25.591 -10.347 1.00 32.71  ? 301  ILE A HD13 1 
ATOM   3409  N  N    . ALA A 1 223 ? -29.808 -22.759 -9.215  1.00 16.60  ? 302  ALA A N    1 
ATOM   3410  C  CA   . ALA A 1 223 ? -30.801 -21.794 -8.759  1.00 14.48  ? 302  ALA A CA   1 
ATOM   3411  C  C    . ALA A 1 223 ? -32.234 -22.232 -9.071  1.00 14.40  ? 302  ALA A C    1 
ATOM   3412  O  O    . ALA A 1 223 ? -33.141 -22.038 -8.259  1.00 13.88  ? 302  ALA A O    1 
ATOM   3413  C  CB   . ALA A 1 223 ? -30.522 -20.430 -9.371  1.00 16.10  ? 302  ALA A CB   1 
ATOM   3414  H  H    . ALA A 1 223 ? -29.283 -22.453 -9.823  1.00 19.93  ? 302  ALA A H    1 
ATOM   3415  H  HA   . ALA A 1 223 ? -30.725 -21.705 -7.796  1.00 17.38  ? 302  ALA A HA   1 
ATOM   3416  H  HB1  . ALA A 1 223 ? -31.191 -19.801 -9.057  1.00 19.32  ? 302  ALA A HB1  1 
ATOM   3417  H  HB2  . ALA A 1 223 ? -29.638 -20.137 -9.098  1.00 19.32  ? 302  ALA A HB2  1 
ATOM   3418  H  HB3  . ALA A 1 223 ? -30.563 -20.503 -10.337 1.00 19.32  ? 302  ALA A HB3  1 
ATOM   3419  N  N    . GLU A 1 224 ? -32.436 -22.826 -10.243 1.00 36.52  ? 303  GLU A N    1 
ATOM   3420  C  CA   . GLU A 1 224 ? -33.771 -23.242 -10.659 1.00 29.09  ? 303  GLU A CA   1 
ATOM   3421  C  C    . GLU A 1 224 ? -34.341 -24.264 -9.684  1.00 31.23  ? 303  GLU A C    1 
ATOM   3422  O  O    . GLU A 1 224 ? -35.549 -24.320 -9.470  1.00 41.68  ? 303  GLU A O    1 
ATOM   3423  C  CB   . GLU A 1 224 ? -33.743 -23.829 -12.071 1.00 29.76  ? 303  GLU A CB   1 
ATOM   3424  C  CG   . GLU A 1 224 ? -35.095 -23.799 -12.775 1.00 46.76  ? 303  GLU A CG   1 
ATOM   3425  C  CD   . GLU A 1 224 ? -35.014 -24.213 -14.236 1.00 60.58  ? 303  GLU A CD   1 
ATOM   3426  O  OE1  . GLU A 1 224 ? -33.939 -24.692 -14.663 1.00 63.35  ? 303  GLU A OE1  1 
ATOM   3427  O  OE2  . GLU A 1 224 ? -36.028 -24.057 -14.955 1.00 62.57  ? 303  GLU A OE2  1 
ATOM   3428  H  H    . GLU A 1 224 ? -31.817 -23.000 -10.814 1.00 43.82  ? 303  GLU A H    1 
ATOM   3429  H  HA   . GLU A 1 224 ? -34.357 -22.469 -10.664 1.00 34.91  ? 303  GLU A HA   1 
ATOM   3430  H  HB2  . GLU A 1 224 ? -33.117 -23.320 -12.609 1.00 35.71  ? 303  GLU A HB2  1 
ATOM   3431  H  HB3  . GLU A 1 224 ? -33.456 -24.754 -12.019 1.00 35.71  ? 303  GLU A HB3  1 
ATOM   3432  H  HG2  . GLU A 1 224 ? -35.699 -24.410 -12.324 1.00 56.11  ? 303  GLU A HG2  1 
ATOM   3433  H  HG3  . GLU A 1 224 ? -35.449 -22.897 -12.739 1.00 56.11  ? 303  GLU A HG3  1 
ATOM   3434  N  N    . ILE A 1 225 ? -33.463 -25.057 -9.081  1.00 17.26  ? 304  ILE A N    1 
ATOM   3435  C  CA   . ILE A 1 225 ? -33.884 -26.079 -8.131  1.00 10.90  ? 304  ILE A CA   1 
ATOM   3436  C  C    . ILE A 1 225 ? -34.185 -25.454 -6.772  1.00 10.85  ? 304  ILE A C    1 
ATOM   3437  O  O    . ILE A 1 225 ? -35.069 -25.923 -6.060  1.00 12.75  ? 304  ILE A O    1 
ATOM   3438  C  CB   . ILE A 1 225 ? -32.823 -27.206 -8.007  1.00 10.85  ? 304  ILE A CB   1 
ATOM   3439  C  CG1  . ILE A 1 225 ? -32.686 -27.923 -9.355  1.00 11.04  ? 304  ILE A CG1  1 
ATOM   3440  C  CG2  . ILE A 1 225 ? -33.182 -28.199 -6.887  1.00 10.59  ? 304  ILE A CG2  1 
ATOM   3441  C  CD1  . ILE A 1 225 ? -31.766 -29.124 -9.345  1.00 14.10  ? 304  ILE A CD1  1 
ATOM   3442  H  H    . ILE A 1 225 ? -32.613 -25.024 -9.206  1.00 20.71  ? 304  ILE A H    1 
ATOM   3443  H  HA   . ILE A 1 225 ? -34.703 -26.483 -8.455  1.00 13.08  ? 304  ILE A HA   1 
ATOM   3444  H  HB   . ILE A 1 225 ? -31.970 -26.799 -7.790  1.00 13.02  ? 304  ILE A HB   1 
ATOM   3445  H  HG12 . ILE A 1 225 ? -33.564 -28.228 -9.633  1.00 13.24  ? 304  ILE A HG12 1 
ATOM   3446  H  HG13 . ILE A 1 225 ? -32.340 -27.293 -10.006 1.00 13.24  ? 304  ILE A HG13 1 
ATOM   3447  H  HG21 . ILE A 1 225 ? -32.497 -28.885 -6.843  1.00 12.71  ? 304  ILE A HG21 1 
ATOM   3448  H  HG22 . ILE A 1 225 ? -33.227 -27.722 -6.044  1.00 12.71  ? 304  ILE A HG22 1 
ATOM   3449  H  HG23 . ILE A 1 225 ? -34.041 -28.602 -7.086  1.00 12.71  ? 304  ILE A HG23 1 
ATOM   3450  H  HD11 . ILE A 1 225 ? -31.742 -29.510 -10.234 1.00 16.92  ? 304  ILE A HD11 1 
ATOM   3451  H  HD12 . ILE A 1 225 ? -30.877 -28.837 -9.084  1.00 16.92  ? 304  ILE A HD12 1 
ATOM   3452  H  HD13 . ILE A 1 225 ? -32.104 -29.775 -8.710  1.00 16.92  ? 304  ILE A HD13 1 
ATOM   3453  N  N    . ARG A 1 226 ? -33.475 -24.387 -6.414  1.00 18.11  ? 305  ARG A N    1 
ATOM   3454  C  CA   . ARG A 1 226 ? -33.741 -23.720 -5.141  1.00 18.18  ? 305  ARG A CA   1 
ATOM   3455  C  C    . ARG A 1 226 ? -35.097 -23.039 -5.216  1.00 19.49  ? 305  ARG A C    1 
ATOM   3456  O  O    . ARG A 1 226 ? -35.850 -23.024 -4.246  1.00 19.51  ? 305  ARG A O    1 
ATOM   3457  C  CB   . ARG A 1 226 ? -32.650 -22.701 -4.792  1.00 19.02  ? 305  ARG A CB   1 
ATOM   3458  C  CG   . ARG A 1 226 ? -31.274 -23.325 -4.627  1.00 25.51  ? 305  ARG A CG   1 
ATOM   3459  C  CD   . ARG A 1 226 ? -30.386 -22.542 -3.664  1.00 25.20  ? 305  ARG A CD   1 
ATOM   3460  N  NE   . ARG A 1 226 ? -29.999 -21.234 -4.182  1.00 24.45  ? 305  ARG A NE   1 
ATOM   3461  C  CZ   . ARG A 1 226 ? -29.159 -21.039 -5.193  1.00 23.23  ? 305  ARG A CZ   1 
ATOM   3462  N  NH1  . ARG A 1 226 ? -28.615 -22.068 -5.833  1.00 19.77  ? 305  ARG A NH1  1 
ATOM   3463  N  NH2  . ARG A 1 226 ? -28.878 -19.802 -5.575  1.00 20.65  ? 305  ARG A NH2  1 
ATOM   3464  H  H    . ARG A 1 226 ? -32.844 -24.035 -6.880  1.00 21.74  ? 305  ARG A H    1 
ATOM   3465  H  HA   . ARG A 1 226 ? -33.774 -24.383 -4.434  1.00 21.82  ? 305  ARG A HA   1 
ATOM   3466  H  HB2  . ARG A 1 226 ? -32.595 -22.043 -5.502  1.00 22.82  ? 305  ARG A HB2  1 
ATOM   3467  H  HB3  . ARG A 1 226 ? -32.882 -22.267 -3.956  1.00 22.82  ? 305  ARG A HB3  1 
ATOM   3468  H  HG2  . ARG A 1 226 ? -31.374 -24.225 -4.279  1.00 30.61  ? 305  ARG A HG2  1 
ATOM   3469  H  HG3  . ARG A 1 226 ? -30.832 -23.350 -5.490  1.00 30.61  ? 305  ARG A HG3  1 
ATOM   3470  H  HD2  . ARG A 1 226 ? -30.867 -22.404 -2.833  1.00 30.24  ? 305  ARG A HD2  1 
ATOM   3471  H  HD3  . ARG A 1 226 ? -29.576 -23.050 -3.498  1.00 30.24  ? 305  ARG A HD3  1 
ATOM   3472  H  HE   . ARG A 1 226 ? -30.339 -20.539 -3.806  1.00 29.34  ? 305  ARG A HE   1 
ATOM   3473  H  HH11 . ARG A 1 226 ? -28.795 -22.872 -5.588  1.00 23.73  ? 305  ARG A HH11 1 
ATOM   3474  H  HH12 . ARG A 1 226 ? -28.075 -21.929 -6.489  1.00 23.73  ? 305  ARG A HH12 1 
ATOM   3475  H  HH21 . ARG A 1 226 ? -29.232 -19.135 -5.165  1.00 24.78  ? 305  ARG A HH21 1 
ATOM   3476  H  HH22 . ARG A 1 226 ? -28.340 -19.667 -6.232  1.00 24.78  ? 305  ARG A HH22 1 
ATOM   3477  N  N    . ALA A 1 227 ? -35.409 -22.500 -6.388  1.00 22.36  ? 306  ALA A N    1 
ATOM   3478  C  CA   . ALA A 1 227 ? -36.670 -21.807 -6.602  1.00 25.47  ? 306  ALA A CA   1 
ATOM   3479  C  C    . ALA A 1 227 ? -37.856 -22.769 -6.513  1.00 27.15  ? 306  ALA A C    1 
ATOM   3480  O  O    . ALA A 1 227 ? -38.910 -22.419 -5.981  1.00 33.33  ? 306  ALA A O    1 
ATOM   3481  C  CB   . ALA A 1 227 ? -36.657 -21.106 -7.944  1.00 27.10  ? 306  ALA A CB   1 
ATOM   3482  H  H    . ALA A 1 227 ? -34.902 -22.523 -7.082  1.00 26.84  ? 306  ALA A H    1 
ATOM   3483  H  HA   . ALA A 1 227 ? -36.780 -21.133 -5.913  1.00 30.56  ? 306  ALA A HA   1 
ATOM   3484  H  HB1  . ALA A 1 227 ? -37.503 -20.650 -8.070  1.00 32.52  ? 306  ALA A HB1  1 
ATOM   3485  H  HB2  . ALA A 1 227 ? -35.929 -20.464 -7.958  1.00 32.52  ? 306  ALA A HB2  1 
ATOM   3486  H  HB3  . ALA A 1 227 ? -36.529 -21.766 -8.644  1.00 32.52  ? 306  ALA A HB3  1 
ATOM   3487  N  N    . ILE A 1 228 ? -37.682 -23.975 -7.044  1.00 23.96  ? 307  ILE A N    1 
ATOM   3488  C  CA   . ILE A 1 228 ? -38.721 -24.997 -6.983  1.00 21.04  ? 307  ILE A CA   1 
ATOM   3489  C  C    . ILE A 1 228 ? -39.098 -25.286 -5.530  1.00 21.75  ? 307  ILE A C    1 
ATOM   3490  O  O    . ILE A 1 228 ? -40.275 -25.316 -5.172  1.00 30.21  ? 307  ILE A O    1 
ATOM   3491  C  CB   . ILE A 1 228 ? -38.256 -26.303 -7.671  1.00 16.63  ? 307  ILE A CB   1 
ATOM   3492  C  CG1  . ILE A 1 228 ? -38.378 -26.173 -9.193  1.00 16.57  ? 307  ILE A CG1  1 
ATOM   3493  C  CG2  . ILE A 1 228 ? -39.075 -27.503 -7.183  1.00 24.32  ? 307  ILE A CG2  1 
ATOM   3494  C  CD1  . ILE A 1 228 ? -37.856 -27.375 -9.976  1.00 17.08  ? 307  ILE A CD1  1 
ATOM   3495  H  H    . ILE A 1 228 ? -36.966 -24.229 -7.447  1.00 28.75  ? 307  ILE A H    1 
ATOM   3496  H  HA   . ILE A 1 228 ? -39.512 -24.677 -7.444  1.00 25.24  ? 307  ILE A HA   1 
ATOM   3497  H  HB   . ILE A 1 228 ? -37.324 -26.454 -7.448  1.00 19.96  ? 307  ILE A HB   1 
ATOM   3498  H  HG12 . ILE A 1 228 ? -39.314 -26.057 -9.421  1.00 19.89  ? 307  ILE A HG12 1 
ATOM   3499  H  HG13 . ILE A 1 228 ? -37.874 -25.395 -9.479  1.00 19.89  ? 307  ILE A HG13 1 
ATOM   3500  H  HG21 . ILE A 1 228 ? -38.759 -28.303 -7.632  1.00 29.19  ? 307  ILE A HG21 1 
ATOM   3501  H  HG22 . ILE A 1 228 ? -38.960 -27.594 -6.224  1.00 29.19  ? 307  ILE A HG22 1 
ATOM   3502  H  HG23 . ILE A 1 228 ? -40.010 -27.353 -7.392  1.00 29.19  ? 307  ILE A HG23 1 
ATOM   3503  H  HD11 . ILE A 1 228 ? -37.971 -27.207 -10.925 1.00 20.50  ? 307  ILE A HD11 1 
ATOM   3504  H  HD12 . ILE A 1 228 ? -36.915 -27.499 -9.774  1.00 20.50  ? 307  ILE A HD12 1 
ATOM   3505  H  HD13 . ILE A 1 228 ? -38.358 -28.163 -9.715  1.00 20.50  ? 307  ILE A HD13 1 
ATOM   3506  N  N    . CYS A 1 229 ? -38.085 -25.478 -4.697  1.00 18.32  ? 308  CYS A N    1 
ATOM   3507  C  CA   . CYS A 1 229 ? -38.298 -25.819 -3.299  1.00 16.76  ? 308  CYS A CA   1 
ATOM   3508  C  C    . CYS A 1 229 ? -39.010 -24.708 -2.521  1.00 15.94  ? 308  CYS A C    1 
ATOM   3509  O  O    . CYS A 1 229 ? -39.873 -24.981 -1.687  1.00 21.34  ? 308  CYS A O    1 
ATOM   3510  C  CB   . CYS A 1 229 ? -36.957 -26.174 -2.643  1.00 19.31  ? 308  CYS A CB   1 
ATOM   3511  S  SG   . CYS A 1 229 ? -36.291 -27.771 -3.176  1.00 25.73  ? 308  CYS A SG   1 
ATOM   3512  H  H    . CYS A 1 229 ? -37.257 -25.417 -4.919  1.00 21.98  ? 308  CYS A H    1 
ATOM   3513  H  HA   . CYS A 1 229 ? -38.861 -26.609 -3.257  1.00 20.11  ? 308  CYS A HA   1 
ATOM   3514  H  HB2  . CYS A 1 229 ? -36.307 -25.491 -2.869  1.00 23.17  ? 308  CYS A HB2  1 
ATOM   3515  H  HB3  . CYS A 1 229 ? -37.078 -26.208 -1.681  1.00 23.17  ? 308  CYS A HB3  1 
ATOM   3516  H  HG   . CYS A 1 229 ? -36.121 -27.747 -4.363  1.00 30.88  ? 308  CYS A HG   1 
ATOM   3517  N  N    . ILE A 1 230 ? -38.651 -23.457 -2.791  1.00 18.96  ? 309  ILE A N    1 
ATOM   3518  C  CA   . ILE A 1 230 ? -39.205 -22.327 -2.046  1.00 25.02  ? 309  ILE A CA   1 
ATOM   3519  C  C    . ILE A 1 230 ? -40.637 -22.005 -2.488  1.00 23.80  ? 309  ILE A C    1 
ATOM   3520  O  O    . ILE A 1 230 ? -41.453 -21.538 -1.693  1.00 21.43  ? 309  ILE A O    1 
ATOM   3521  C  CB   . ILE A 1 230 ? -38.304 -21.072 -2.181  1.00 14.56  ? 309  ILE A CB   1 
ATOM   3522  C  CG1  . ILE A 1 230 ? -37.117 -21.139 -1.216  1.00 20.50  ? 309  ILE A CG1  1 
ATOM   3523  C  CG2  . ILE A 1 230 ? -39.066 -19.777 -1.912  1.00 32.98  ? 309  ILE A CG2  1 
ATOM   3524  C  CD1  . ILE A 1 230 ? -37.467 -21.329 0.259   1.00 26.50  ? 309  ILE A CD1  1 
ATOM   3525  H  H    . ILE A 1 230 ? -38.087 -23.234 -3.402  1.00 22.76  ? 309  ILE A H    1 
ATOM   3526  H  HA   . ILE A 1 230 ? -39.236 -22.564 -1.106  1.00 30.02  ? 309  ILE A HA   1 
ATOM   3527  H  HB   . ILE A 1 230 ? -37.959 -21.041 -3.087  1.00 17.47  ? 309  ILE A HB   1 
ATOM   3528  H  HG12 . ILE A 1 230 ? -36.551 -21.882 -1.478  1.00 24.61  ? 309  ILE A HG12 1 
ATOM   3529  H  HG13 . ILE A 1 230 ? -36.616 -20.311 -1.290  1.00 24.61  ? 309  ILE A HG13 1 
ATOM   3530  H  HG21 . ILE A 1 230 ? -38.459 -19.027 -2.009  1.00 39.57  ? 309  ILE A HG21 1 
ATOM   3531  H  HG22 . ILE A 1 230 ? -39.792 -19.700 -2.551  1.00 39.57  ? 309  ILE A HG22 1 
ATOM   3532  H  HG23 . ILE A 1 230 ? -39.420 -19.802 -1.009  1.00 39.57  ? 309  ILE A HG23 1 
ATOM   3533  H  HD11 . ILE A 1 230 ? -36.647 -21.357 0.777   1.00 31.80  ? 309  ILE A HD11 1 
ATOM   3534  H  HD12 . ILE A 1 230 ? -38.017 -20.586 0.551   1.00 31.80  ? 309  ILE A HD12 1 
ATOM   3535  H  HD13 . ILE A 1 230 ? -37.952 -22.162 0.363   1.00 31.80  ? 309  ILE A HD13 1 
ATOM   3536  N  N    . GLU A 1 231 ? -40.941 -22.264 -3.754  1.00 23.42  ? 310  GLU A N    1 
ATOM   3537  C  CA   . GLU A 1 231 ? -42.291 -22.078 -4.253  1.00 25.83  ? 310  GLU A CA   1 
ATOM   3538  C  C    . GLU A 1 231 ? -43.286 -22.953 -3.485  1.00 32.76  ? 310  GLU A C    1 
ATOM   3539  O  O    . GLU A 1 231 ? -44.336 -22.475 -3.052  1.00 35.69  ? 310  GLU A O    1 
ATOM   3540  C  CB   . GLU A 1 231 ? -42.344 -22.404 -5.741  1.00 28.86  ? 310  GLU A CB   1 
ATOM   3541  C  CG   . GLU A 1 231 ? -43.674 -22.107 -6.386  1.00 35.18  ? 310  GLU A CG   1 
ATOM   3542  C  CD   . GLU A 1 231 ? -43.572 -22.011 -7.894  1.00 46.97  ? 310  GLU A CD   1 
ATOM   3543  O  OE1  . GLU A 1 231 ? -42.748 -22.742 -8.484  1.00 49.05  ? 310  GLU A OE1  1 
ATOM   3544  O  OE2  . GLU A 1 231 ? -44.316 -21.202 -8.491  1.00 54.52  ? 310  GLU A OE2  1 
ATOM   3545  H  H    . GLU A 1 231 ? -40.382 -22.548 -4.342  1.00 28.11  ? 310  GLU A H    1 
ATOM   3546  H  HA   . GLU A 1 231 ? -42.550 -21.150 -4.137  1.00 30.99  ? 310  GLU A HA   1 
ATOM   3547  H  HB2  . GLU A 1 231 ? -41.669 -21.880 -6.199  1.00 34.63  ? 310  GLU A HB2  1 
ATOM   3548  H  HB3  . GLU A 1 231 ? -42.162 -23.350 -5.859  1.00 34.63  ? 310  GLU A HB3  1 
ATOM   3549  H  HG2  . GLU A 1 231 ? -44.298 -22.819 -6.171  1.00 42.22  ? 310  GLU A HG2  1 
ATOM   3550  H  HG3  . GLU A 1 231 ? -44.007 -21.260 -6.052  1.00 42.22  ? 310  GLU A HG3  1 
ATOM   3551  N  N    . GLU A 1 232 ? -42.945 -24.226 -3.302  1.00 28.62  ? 311  GLU A N    1 
ATOM   3552  C  CA   . GLU A 1 232 ? -43.859 -25.176 -2.675  1.00 31.65  ? 311  GLU A CA   1 
ATOM   3553  C  C    . GLU A 1 232 ? -43.920 -25.044 -1.156  1.00 32.99  ? 311  GLU A C    1 
ATOM   3554  O  O    . GLU A 1 232 ? -44.975 -25.280 -0.569  1.00 35.33  ? 311  GLU A O    1 
ATOM   3555  C  CB   . GLU A 1 232 ? -43.509 -26.611 -3.075  1.00 31.17  ? 311  GLU A CB   1 
ATOM   3556  C  CG   . GLU A 1 232 ? -43.635 -26.874 -4.569  1.00 35.58  ? 311  GLU A CG   1 
ATOM   3557  C  CD   . GLU A 1 232 ? -45.061 -26.732 -5.075  1.00 40.92  ? 311  GLU A CD   1 
ATOM   3558  O  OE1  . GLU A 1 232 ? -45.974 -27.340 -4.468  1.00 37.38  ? 311  GLU A OE1  1 
ATOM   3559  O  OE2  . GLU A 1 232 ? -45.264 -26.036 -6.099  1.00 50.65  ? 311  GLU A OE2  1 
ATOM   3560  H  H    . GLU A 1 232 ? -42.189 -24.565 -3.532  1.00 34.35  ? 311  GLU A H    1 
ATOM   3561  H  HA   . GLU A 1 232 ? -44.751 -24.998 -3.011  1.00 37.98  ? 311  GLU A HA   1 
ATOM   3562  H  HB2  . GLU A 1 232 ? -42.592 -26.793 -2.817  1.00 37.41  ? 311  GLU A HB2  1 
ATOM   3563  H  HB3  . GLU A 1 232 ? -44.107 -27.220 -2.614  1.00 37.41  ? 311  GLU A HB3  1 
ATOM   3564  H  HG2  . GLU A 1 232 ? -43.082 -26.238 -5.050  1.00 42.70  ? 311  GLU A HG2  1 
ATOM   3565  H  HG3  . GLU A 1 232 ? -43.340 -27.779 -4.757  1.00 42.70  ? 311  GLU A HG3  1 
ATOM   3566  N  N    . ILE A 1 233 ? -42.823 -24.675 -0.500  1.00 23.67  ? 312  ILE A N    1 
ATOM   3567  C  CA   . ILE A 1 233 ? -42.922 -24.446 0.935   1.00 23.00  ? 312  ILE A CA   1 
ATOM   3568  C  C    . ILE A 1 233 ? -43.839 -23.252 1.164   1.00 21.95  ? 312  ILE A C    1 
ATOM   3569  O  O    . ILE A 1 233 ? -44.522 -23.184 2.177   1.00 23.71  ? 312  ILE A O    1 
ATOM   3570  C  CB   . ILE A 1 233 ? -41.562 -24.249 1.648   1.00 21.41  ? 312  ILE A CB   1 
ATOM   3571  C  CG1  . ILE A 1 233 ? -41.761 -24.362 3.161   1.00 25.03  ? 312  ILE A CG1  1 
ATOM   3572  C  CG2  . ILE A 1 233 ? -40.957 -22.908 1.305   1.00 24.24  ? 312  ILE A CG2  1 
ATOM   3573  C  CD1  . ILE A 1 233 ? -40.486 -24.493 3.944   1.00 26.99  ? 312  ILE A CD1  1 
ATOM   3574  H  H    . ILE A 1 233 ? -42.045 -24.555 -0.845  1.00 28.40  ? 312  ILE A H    1 
ATOM   3575  H  HA   . ILE A 1 233 ? -43.347 -25.219 1.338   1.00 27.60  ? 312  ILE A HA   1 
ATOM   3576  H  HB   . ILE A 1 233 ? -40.955 -24.948 1.359   1.00 25.69  ? 312  ILE A HB   1 
ATOM   3577  H  HG12 . ILE A 1 233 ? -42.219 -23.567 3.475   1.00 30.04  ? 312  ILE A HG12 1 
ATOM   3578  H  HG13 . ILE A 1 233 ? -42.302 -25.146 3.346   1.00 30.04  ? 312  ILE A HG13 1 
ATOM   3579  H  HG21 . ILE A 1 233 ? -40.109 -22.818 1.766   1.00 29.09  ? 312  ILE A HG21 1 
ATOM   3580  H  HG22 . ILE A 1 233 ? -40.819 -22.860 0.346   1.00 29.09  ? 312  ILE A HG22 1 
ATOM   3581  H  HG23 . ILE A 1 233 ? -41.565 -22.207 1.588   1.00 29.09  ? 312  ILE A HG23 1 
ATOM   3582  H  HD11 . ILE A 1 233 ? -40.701 -24.559 4.887   1.00 32.39  ? 312  ILE A HD11 1 
ATOM   3583  H  HD12 . ILE A 1 233 ? -40.019 -25.292 3.654   1.00 32.39  ? 312  ILE A HD12 1 
ATOM   3584  H  HD13 . ILE A 1 233 ? -39.936 -23.711 3.783   1.00 32.39  ? 312  ILE A HD13 1 
ATOM   3585  N  N    . GLY A 1 234 ? -43.872 -22.322 0.214   1.00 19.05  ? 313  GLY A N    1 
ATOM   3586  C  CA   . GLY A 1 234 ? -44.824 -21.229 0.280   1.00 21.01  ? 313  GLY A CA   1 
ATOM   3587  C  C    . GLY A 1 234 ? -46.239 -21.773 0.212   1.00 22.20  ? 313  GLY A C    1 
ATOM   3588  O  O    . GLY A 1 234 ? -47.117 -21.361 0.966   1.00 25.25  ? 313  GLY A O    1 
ATOM   3589  H  H    . GLY A 1 234 ? -43.355 -22.304 -0.474  1.00 22.86  ? 313  GLY A H    1 
ATOM   3590  H  HA2  . GLY A 1 234 ? -44.713 -20.743 1.112   1.00 25.21  ? 313  GLY A HA2  1 
ATOM   3591  H  HA3  . GLY A 1 234 ? -44.683 -20.621 -0.462  1.00 25.21  ? 313  GLY A HA3  1 
ATOM   3592  N  N    . ILE A 1 235 ? -46.450 -22.722 -0.693  1.00 13.28  ? 314  ILE A N    1 
ATOM   3593  C  CA   . ILE A 1 235 ? -47.768 -23.304 -0.913  1.00 13.34  ? 314  ILE A CA   1 
ATOM   3594  C  C    . ILE A 1 235 ? -48.282 -24.099 0.295   1.00 20.05  ? 314  ILE A C    1 
ATOM   3595  O  O    . ILE A 1 235 ? -49.467 -24.033 0.609   1.00 28.88  ? 314  ILE A O    1 
ATOM   3596  C  CB   . ILE A 1 235 ? -47.765 -24.181 -2.191  1.00 13.17  ? 314  ILE A CB   1 
ATOM   3597  C  CG1  . ILE A 1 235 ? -47.712 -23.283 -3.428  1.00 14.62  ? 314  ILE A CG1  1 
ATOM   3598  C  CG2  . ILE A 1 235 ? -49.005 -25.073 -2.269  1.00 12.82  ? 314  ILE A CG2  1 
ATOM   3599  C  CD1  . ILE A 1 235 ? -47.361 -24.006 -4.710  1.00 14.65  ? 314  ILE A CD1  1 
ATOM   3600  H  H    . ILE A 1 235 ? -45.837 -23.049 -1.200  1.00 15.93  ? 314  ILE A H    1 
ATOM   3601  H  HA   . ILE A 1 235 ? -48.395 -22.580 -1.066  1.00 16.00  ? 314  ILE A HA   1 
ATOM   3602  H  HB   . ILE A 1 235 ? -46.976 -24.745 -2.180  1.00 15.80  ? 314  ILE A HB   1 
ATOM   3603  H  HG12 . ILE A 1 235 ? -48.582 -22.872 -3.550  1.00 17.54  ? 314  ILE A HG12 1 
ATOM   3604  H  HG13 . ILE A 1 235 ? -47.043 -22.596 -3.284  1.00 17.54  ? 314  ILE A HG13 1 
ATOM   3605  H  HG21 . ILE A 1 235 ? -48.962 -25.602 -3.081  1.00 15.38  ? 314  ILE A HG21 1 
ATOM   3606  H  HG22 . ILE A 1 235 ? -49.023 -25.656 -1.494  1.00 15.38  ? 314  ILE A HG22 1 
ATOM   3607  H  HG23 . ILE A 1 235 ? -49.796 -24.512 -2.280  1.00 15.38  ? 314  ILE A HG23 1 
ATOM   3608  H  HD11 . ILE A 1 235 ? -47.350 -23.367 -5.439  1.00 17.58  ? 314  ILE A HD11 1 
ATOM   3609  H  HD12 . ILE A 1 235 ? -46.487 -24.414 -4.613  1.00 17.58  ? 314  ILE A HD12 1 
ATOM   3610  H  HD13 . ILE A 1 235 ? -48.028 -24.690 -4.879  1.00 17.58  ? 314  ILE A HD13 1 
ATOM   3611  N  N    . TRP A 1 236 ? -47.407 -24.838 0.972   1.00 22.15  ? 315  TRP A N    1 
ATOM   3612  C  CA   . TRP A 1 236 ? -47.825 -25.652 2.118   1.00 19.41  ? 315  TRP A CA   1 
ATOM   3613  C  C    . TRP A 1 236 ? -48.327 -24.780 3.263   1.00 18.50  ? 315  TRP A C    1 
ATOM   3614  O  O    . TRP A 1 236 ? -49.286 -25.129 3.950   1.00 21.30  ? 315  TRP A O    1 
ATOM   3615  C  CB   . TRP A 1 236 ? -46.672 -26.533 2.621   1.00 12.62  ? 315  TRP A CB   1 
ATOM   3616  C  CG   . TRP A 1 236 ? -46.000 -27.321 1.538   1.00 11.89  ? 315  TRP A CG   1 
ATOM   3617  C  CD1  . TRP A 1 236 ? -46.567 -27.781 0.386   1.00 12.76  ? 315  TRP A CD1  1 
ATOM   3618  C  CD2  . TRP A 1 236 ? -44.624 -27.723 1.495   1.00 13.18  ? 315  TRP A CD2  1 
ATOM   3619  N  NE1  . TRP A 1 236 ? -45.635 -28.451 -0.369  1.00 11.50  ? 315  TRP A NE1  1 
ATOM   3620  C  CE2  . TRP A 1 236 ? -44.431 -28.425 0.287   1.00 14.94  ? 315  TRP A CE2  1 
ATOM   3621  C  CE3  . TRP A 1 236 ? -43.537 -27.560 2.361   1.00 16.46  ? 315  TRP A CE3  1 
ATOM   3622  C  CZ2  . TRP A 1 236 ? -43.194 -28.951 -0.086  1.00 14.33  ? 315  TRP A CZ2  1 
ATOM   3623  C  CZ3  . TRP A 1 236 ? -42.306 -28.092 1.993   1.00 19.94  ? 315  TRP A CZ3  1 
ATOM   3624  C  CH2  . TRP A 1 236 ? -42.148 -28.786 0.784   1.00 10.93  ? 315  TRP A CH2  1 
ATOM   3625  H  H    . TRP A 1 236 ? -46.568 -24.887 0.791   1.00 26.58  ? 315  TRP A H    1 
ATOM   3626  H  HA   . TRP A 1 236 ? -48.550 -26.234 1.844   1.00 23.29  ? 315  TRP A HA   1 
ATOM   3627  H  HB2  . TRP A 1 236 ? -46.002 -25.965 3.034   1.00 15.14  ? 315  TRP A HB2  1 
ATOM   3628  H  HB3  . TRP A 1 236 ? -47.020 -27.160 3.273   1.00 15.14  ? 315  TRP A HB3  1 
ATOM   3629  H  HD1  . TRP A 1 236 ? -47.458 -27.661 0.147   1.00 15.31  ? 315  TRP A HD1  1 
ATOM   3630  H  HE1  . TRP A 1 236 ? -45.779 -28.816 -1.134  1.00 13.80  ? 315  TRP A HE1  1 
ATOM   3631  H  HE3  . TRP A 1 236 ? -43.634 -27.096 3.161   1.00 19.75  ? 315  TRP A HE3  1 
ATOM   3632  H  HZ2  . TRP A 1 236 ? -43.090 -29.422 -0.881  1.00 17.20  ? 315  TRP A HZ2  1 
ATOM   3633  H  HZ3  . TRP A 1 236 ? -41.576 -27.988 2.559   1.00 23.92  ? 315  TRP A HZ3  1 
ATOM   3634  H  HH2  . TRP A 1 236 ? -41.314 -29.134 0.565   1.00 13.12  ? 315  TRP A HH2  1 
HETATM 3635  N  N    . MSE A 1 237 ? -47.671 -23.645 3.464   1.00 20.51  ? 316  MSE A N    1 
HETATM 3636  C  CA   . MSE A 1 237 ? -47.992 -22.756 4.576   1.00 22.54  ? 316  MSE A CA   1 
HETATM 3637  C  C    . MSE A 1 237 ? -49.283 -21.970 4.339   1.00 24.86  ? 316  MSE A C    1 
HETATM 3638  O  O    . MSE A 1 237 ? -49.996 -21.612 5.277   1.00 34.84  ? 316  MSE A O    1 
HETATM 3639  C  CB   . MSE A 1 237 ? -46.825 -21.807 4.797   1.00 28.62  ? 316  MSE A CB   1 
HETATM 3640  C  CG   . MSE A 1 237 ? -45.515 -22.541 4.995   1.00 31.10  ? 316  MSE A CG   1 
HETATM 3641  SE SE   . MSE A 1 237 ? -43.987 -21.329 5.129   1.00 49.25  ? 316  MSE A SE   1 
HETATM 3642  C  CE   . MSE A 1 237 ? -44.246 -20.997 7.006   1.00 38.91  ? 316  MSE A CE   1 
HETATM 3643  H  H    . MSE A 1 237 ? -47.029 -23.363 2.967   1.00 24.61  ? 316  MSE A H    1 
HETATM 3644  H  HA   . MSE A 1 237 ? -48.097 -23.289 5.380   1.00 27.04  ? 316  MSE A HA   1 
HETATM 3645  H  HB2  . MSE A 1 237 ? -46.734 -21.231 4.023   1.00 34.34  ? 316  MSE A HB2  1 
HETATM 3646  H  HB3  . MSE A 1 237 ? -46.995 -21.275 5.590   1.00 34.34  ? 316  MSE A HB3  1 
HETATM 3647  H  HG2  . MSE A 1 237 ? -45.561 -23.056 5.816   1.00 37.32  ? 316  MSE A HG2  1 
HETATM 3648  H  HG3  . MSE A 1 237 ? -45.365 -23.131 4.240   1.00 37.32  ? 316  MSE A HG3  1 
HETATM 3649  H  HE1  . MSE A 1 237 ? -43.562 -20.383 7.316   1.00 46.69  ? 316  MSE A HE1  1 
HETATM 3650  H  HE2  . MSE A 1 237 ? -45.125 -20.608 7.139   1.00 46.69  ? 316  MSE A HE2  1 
HETATM 3651  H  HE3  . MSE A 1 237 ? -44.180 -21.837 7.487   1.00 46.69  ? 316  MSE A HE3  1 
ATOM   3652  N  N    . LYS A 1 238 ? -49.582 -21.719 3.073   1.00 24.14  ? 317  LYS A N    1 
ATOM   3653  C  CA   . LYS A 1 238 ? -50.791 -21.008 2.690   1.00 25.00  ? 317  LYS A CA   1 
ATOM   3654  C  C    . LYS A 1 238 ? -51.977 -21.967 2.655   1.00 27.62  ? 317  LYS A C    1 
ATOM   3655  O  O    . LYS A 1 238 ? -53.133 -21.559 2.782   1.00 32.46  ? 317  LYS A O    1 
ATOM   3656  C  CB   . LYS A 1 238 ? -50.566 -20.348 1.326   1.00 23.32  ? 317  LYS A CB   1 
ATOM   3657  C  CG   . LYS A 1 238 ? -51.806 -20.103 0.479   1.00 26.24  ? 317  LYS A CG   1 
ATOM   3658  C  CD   . LYS A 1 238 ? -51.619 -18.856 -0.365  1.00 34.00  ? 317  LYS A CD   1 
ATOM   3659  C  CE   . LYS A 1 238 ? -52.368 -18.917 -1.680  1.00 37.98  ? 317  LYS A CE   1 
ATOM   3660  N  NZ   . LYS A 1 238 ? -52.187 -17.648 -2.440  1.00 53.26  ? 317  LYS A NZ   1 
ATOM   3661  H  H    . LYS A 1 238 ? -49.092 -21.954 2.407   1.00 28.97  ? 317  LYS A H    1 
ATOM   3662  H  HA   . LYS A 1 238 ? -50.977 -20.313 3.340   1.00 30.00  ? 317  LYS A HA   1 
ATOM   3663  H  HB2  . LYS A 1 238 ? -50.143 -19.487 1.472   1.00 27.99  ? 317  LYS A HB2  1 
ATOM   3664  H  HB3  . LYS A 1 238 ? -49.972 -20.914 0.809   1.00 27.99  ? 317  LYS A HB3  1 
ATOM   3665  H  HG2  . LYS A 1 238 ? -51.950 -20.857 -0.113  1.00 31.49  ? 317  LYS A HG2  1 
ATOM   3666  H  HG3  . LYS A 1 238 ? -52.574 -19.972 1.057   1.00 31.49  ? 317  LYS A HG3  1 
ATOM   3667  H  HD2  . LYS A 1 238 ? -51.945 -18.088 0.130   1.00 40.80  ? 317  LYS A HD2  1 
ATOM   3668  H  HD3  . LYS A 1 238 ? -50.675 -18.748 -0.562  1.00 40.80  ? 317  LYS A HD3  1 
ATOM   3669  H  HE2  . LYS A 1 238 ? -52.022 -19.648 -2.215  1.00 45.57  ? 317  LYS A HE2  1 
ATOM   3670  H  HE3  . LYS A 1 238 ? -53.314 -19.041 -1.507  1.00 45.57  ? 317  LYS A HE3  1 
ATOM   3671  H  HZ1  . LYS A 1 238 ? -52.630 -17.690 -3.211  1.00 63.91  ? 317  LYS A HZ1  1 
ATOM   3672  H  HZ2  . LYS A 1 238 ? -52.498 -16.962 -1.966  1.00 63.91  ? 317  LYS A HZ2  1 
ATOM   3673  H  HZ3  . LYS A 1 238 ? -51.324 -17.515 -2.609  1.00 63.91  ? 317  LYS A HZ3  1 
HETATM 3674  N  N    . MSE A 1 239 ? -51.669 -23.252 2.530   1.00 35.38  ? 318  MSE A N    1 
HETATM 3675  C  CA   . MSE A 1 239 ? -52.668 -24.281 2.294   1.00 24.13  ? 318  MSE A CA   1 
HETATM 3676  C  C    . MSE A 1 239 ? -53.126 -24.941 3.596   1.00 36.12  ? 318  MSE A C    1 
HETATM 3677  O  O    . MSE A 1 239 ? -54.324 -25.105 3.836   1.00 46.38  ? 318  MSE A O    1 
HETATM 3678  C  CB   . MSE A 1 239 ? -52.070 -25.314 1.346   1.00 23.14  ? 318  MSE A CB   1 
HETATM 3679  C  CG   . MSE A 1 239 ? -52.835 -26.598 1.188   1.00 31.47  ? 318  MSE A CG   1 
HETATM 3680  SE SE   . MSE A 1 239 ? -51.947 -27.633 -0.196  1.00 67.79  ? 318  MSE A SE   1 
HETATM 3681  C  CE   . MSE A 1 239 ? -53.391 -28.872 -0.604  1.00 36.69  ? 318  MSE A CE   1 
HETATM 3682  H  H    . MSE A 1 239 ? -50.867 -23.558 2.580   1.00 42.46  ? 318  MSE A H    1 
HETATM 3683  H  HA   . MSE A 1 239 ? -53.436 -23.882 1.856   1.00 28.96  ? 318  MSE A HA   1 
HETATM 3684  H  HB2  . MSE A 1 239 ? -51.997 -24.912 0.467   1.00 27.77  ? 318  MSE A HB2  1 
HETATM 3685  H  HB3  . MSE A 1 239 ? -51.185 -25.544 1.668   1.00 27.77  ? 318  MSE A HB3  1 
HETATM 3686  H  HG2  . MSE A 1 239 ? -52.819 -27.099 2.018   1.00 37.76  ? 318  MSE A HG2  1 
HETATM 3687  H  HG3  . MSE A 1 239 ? -53.745 -26.411 0.909   1.00 37.76  ? 318  MSE A HG3  1 
HETATM 3688  H  HE1  . MSE A 1 239 ? -53.098 -29.479 -1.301  1.00 44.02  ? 318  MSE A HE1  1 
HETATM 3689  H  HE2  . MSE A 1 239 ? -53.614 -29.371 0.198   1.00 44.02  ? 318  MSE A HE2  1 
HETATM 3690  H  HE3  . MSE A 1 239 ? -54.163 -28.368 -0.905  1.00 44.02  ? 318  MSE A HE3  1 
ATOM   3691  N  N    . TYR A 1 240 ? -52.161 -25.308 4.433   1.00 21.15  ? 319  TYR A N    1 
ATOM   3692  C  CA   . TYR A 1 240 ? -52.423 -25.925 5.729   1.00 17.44  ? 319  TYR A CA   1 
ATOM   3693  C  C    . TYR A 1 240 ? -51.645 -25.118 6.763   1.00 16.80  ? 319  TYR A C    1 
ATOM   3694  O  O    . TYR A 1 240 ? -50.689 -25.608 7.362   1.00 20.62  ? 319  TYR A O    1 
ATOM   3695  C  CB   . TYR A 1 240 ? -51.973 -27.395 5.709   1.00 17.24  ? 319  TYR A CB   1 
ATOM   3696  C  CG   . TYR A 1 240 ? -52.426 -28.249 6.889   1.00 18.11  ? 319  TYR A CG   1 
ATOM   3697  C  CD1  . TYR A 1 240 ? -52.962 -27.675 8.033   1.00 25.02  ? 319  TYR A CD1  1 
ATOM   3698  C  CD2  . TYR A 1 240 ? -52.311 -29.637 6.850   1.00 19.87  ? 319  TYR A CD2  1 
ATOM   3699  C  CE1  . TYR A 1 240 ? -53.367 -28.452 9.102   1.00 22.59  ? 319  TYR A CE1  1 
ATOM   3700  C  CE2  . TYR A 1 240 ? -52.713 -30.423 7.917   1.00 20.42  ? 319  TYR A CE2  1 
ATOM   3701  C  CZ   . TYR A 1 240 ? -53.239 -29.826 9.040   1.00 22.86  ? 319  TYR A CZ   1 
ATOM   3702  O  OH   . TYR A 1 240 ? -53.647 -30.595 10.109  1.00 20.89  ? 319  TYR A OH   1 
ATOM   3703  H  H    . TYR A 1 240 ? -51.323 -25.206 4.268   1.00 25.38  ? 319  TYR A H    1 
ATOM   3704  H  HA   . TYR A 1 240 ? -53.370 -25.882 5.935   1.00 20.93  ? 319  TYR A HA   1 
ATOM   3705  H  HB2  . TYR A 1 240 ? -52.319 -27.809 4.903   1.00 20.69  ? 319  TYR A HB2  1 
ATOM   3706  H  HB3  . TYR A 1 240 ? -51.004 -27.417 5.692   1.00 20.69  ? 319  TYR A HB3  1 
ATOM   3707  H  HD1  . TYR A 1 240 ? -53.048 -26.750 8.082   1.00 30.02  ? 319  TYR A HD1  1 
ATOM   3708  H  HD2  . TYR A 1 240 ? -51.953 -30.044 6.094   1.00 23.84  ? 319  TYR A HD2  1 
ATOM   3709  H  HE1  . TYR A 1 240 ? -53.723 -28.051 9.861   1.00 27.10  ? 319  TYR A HE1  1 
ATOM   3710  H  HE2  . TYR A 1 240 ? -52.629 -31.348 7.875   1.00 24.50  ? 319  TYR A HE2  1 
ATOM   3711  H  HH   . TYR A 1 240 ? -53.515 -31.408 9.945   1.00 25.07  ? 319  TYR A HH   1 
ATOM   3712  N  N    . SER A 1 241 ? -52.057 -23.869 6.958   1.00 21.79  ? 320  SER A N    1 
ATOM   3713  C  CA   . SER A 1 241 ? -51.312 -22.933 7.795   1.00 26.70  ? 320  SER A CA   1 
ATOM   3714  C  C    . SER A 1 241 ? -51.218 -23.381 9.256   1.00 30.91  ? 320  SER A C    1 
ATOM   3715  O  O    . SER A 1 241 ? -50.205 -23.146 9.913   1.00 30.42  ? 320  SER A O    1 
ATOM   3716  C  CB   . SER A 1 241 ? -51.942 -21.540 7.716   1.00 31.06  ? 320  SER A CB   1 
ATOM   3717  O  OG   . SER A 1 241 ? -53.126 -21.466 8.492   1.00 39.71  ? 320  SER A OG   1 
ATOM   3718  H  H    . SER A 1 241 ? -52.771 -23.536 6.613   1.00 26.15  ? 320  SER A H    1 
ATOM   3719  H  HA   . SER A 1 241 ? -50.408 -22.865 7.452   1.00 32.04  ? 320  SER A HA   1 
ATOM   3720  H  HB2  . SER A 1 241 ? -51.306 -20.888 8.050   1.00 37.27  ? 320  SER A HB2  1 
ATOM   3721  H  HB3  . SER A 1 241 ? -52.160 -21.345 6.791   1.00 37.27  ? 320  SER A HB3  1 
ATOM   3722  H  HG   . SER A 1 241 ? -53.458 -20.697 8.438   1.00 47.66  ? 320  SER A HG   1 
ATOM   3723  N  N    . ASP A 1 242 ? -52.267 -24.031 9.759   1.00 44.94  ? 321  ASP A N    1 
ATOM   3724  C  CA   . ASP A 1 242 ? -52.290 -24.500 11.148  1.00 37.86  ? 321  ASP A CA   1 
ATOM   3725  C  C    . ASP A 1 242 ? -51.123 -25.431 11.468  1.00 39.01  ? 321  ASP A C    1 
ATOM   3726  O  O    . ASP A 1 242 ? -50.700 -25.538 12.620  1.00 40.93  ? 321  ASP A O    1 
ATOM   3727  C  CB   . ASP A 1 242 ? -53.596 -25.237 11.440  1.00 38.31  ? 321  ASP A CB   1 
ATOM   3728  C  CG   . ASP A 1 242 ? -54.796 -24.310 11.503  1.00 47.48  ? 321  ASP A CG   1 
ATOM   3729  O  OD1  . ASP A 1 242 ? -54.637 -23.130 11.881  1.00 47.06  ? 321  ASP A OD1  1 
ATOM   3730  O  OD2  . ASP A 1 242 ? -55.913 -24.768 11.185  1.00 54.58  ? 321  ASP A OD2  1 
ATOM   3731  H  H    . ASP A 1 242 ? -52.981 -24.214 9.316   1.00 53.92  ? 321  ASP A H    1 
ATOM   3732  H  HA   . ASP A 1 242 ? -52.236 -23.734 11.741  1.00 45.44  ? 321  ASP A HA   1 
ATOM   3733  H  HB2  . ASP A 1 242 ? -53.756 -25.887 10.738  1.00 45.97  ? 321  ASP A HB2  1 
ATOM   3734  H  HB3  . ASP A 1 242 ? -53.520 -25.686 12.297  1.00 45.97  ? 321  ASP A HB3  1 
ATOM   3735  N  N    . ALA A 1 243 ? -50.609 -26.094 10.437  1.00 24.89  ? 322  ALA A N    1 
ATOM   3736  C  CA   . ALA A 1 243 ? -49.606 -27.141 10.601  1.00 23.47  ? 322  ALA A CA   1 
ATOM   3737  C  C    . ALA A 1 243 ? -48.221 -26.737 10.091  1.00 22.24  ? 322  ALA A C    1 
ATOM   3738  O  O    . ALA A 1 243 ? -47.212 -27.269 10.558  1.00 16.50  ? 322  ALA A O    1 
ATOM   3739  C  CB   . ALA A 1 243 ? -50.070 -28.410 9.894   1.00 26.44  ? 322  ALA A CB   1 
ATOM   3740  H  H    . ALA A 1 243 ? -50.830 -25.954 9.618   1.00 29.87  ? 322  ALA A H    1 
ATOM   3741  H  HA   . ALA A 1 243 ? -49.522 -27.345 11.546  1.00 28.16  ? 322  ALA A HA   1 
ATOM   3742  H  HB1  . ALA A 1 243 ? -49.397 -29.099 10.008  1.00 31.73  ? 322  ALA A HB1  1 
ATOM   3743  H  HB2  . ALA A 1 243 ? -50.910 -28.699 10.284  1.00 31.73  ? 322  ALA A HB2  1 
ATOM   3744  H  HB3  . ALA A 1 243 ? -50.191 -28.219 8.951   1.00 31.73  ? 322  ALA A HB3  1 
ATOM   3745  N  N    . PHE A 1 244 ? -48.176 -25.799 9.145   1.00 23.49  ? 323  PHE A N    1 
ATOM   3746  C  CA   . PHE A 1 244 ? -46.922 -25.431 8.488   1.00 19.34  ? 323  PHE A CA   1 
ATOM   3747  C  C    . PHE A 1 244 ? -46.504 -23.972 8.670   1.00 22.82  ? 323  PHE A C    1 
ATOM   3748  O  O    . PHE A 1 244 ? -45.349 -23.645 8.436   1.00 26.33  ? 323  PHE A O    1 
ATOM   3749  C  CB   . PHE A 1 244 ? -46.996 -25.757 6.994   1.00 16.11  ? 323  PHE A CB   1 
ATOM   3750  C  CG   . PHE A 1 244 ? -46.836 -27.221 6.687   1.00 18.50  ? 323  PHE A CG   1 
ATOM   3751  C  CD1  . PHE A 1 244 ? -45.578 -27.775 6.537   1.00 19.48  ? 323  PHE A CD1  1 
ATOM   3752  C  CD2  . PHE A 1 244 ? -47.941 -28.044 6.559   1.00 20.43  ? 323  PHE A CD2  1 
ATOM   3753  C  CE1  . PHE A 1 244 ? -45.425 -29.119 6.256   1.00 16.27  ? 323  PHE A CE1  1 
ATOM   3754  C  CE2  . PHE A 1 244 ? -47.790 -29.390 6.276   1.00 16.27  ? 323  PHE A CE2  1 
ATOM   3755  C  CZ   . PHE A 1 244 ? -46.530 -29.928 6.134   1.00 15.21  ? 323  PHE A CZ   1 
ATOM   3756  H  H    . PHE A 1 244 ? -48.860 -25.359 8.865   1.00 28.19  ? 323  PHE A H    1 
ATOM   3757  H  HA   . PHE A 1 244 ? -46.215 -25.978 8.865   1.00 23.21  ? 323  PHE A HA   1 
ATOM   3758  H  HB2  . PHE A 1 244 ? -47.860 -25.476 6.655   1.00 19.33  ? 323  PHE A HB2  1 
ATOM   3759  H  HB3  . PHE A 1 244 ? -46.289 -25.278 6.533   1.00 19.33  ? 323  PHE A HB3  1 
ATOM   3760  H  HD1  . PHE A 1 244 ? -44.826 -27.235 6.622   1.00 23.38  ? 323  PHE A HD1  1 
ATOM   3761  H  HD2  . PHE A 1 244 ? -48.794 -27.688 6.658   1.00 24.51  ? 323  PHE A HD2  1 
ATOM   3762  H  HE1  . PHE A 1 244 ? -44.573 -29.479 6.158   1.00 19.52  ? 323  PHE A HE1  1 
ATOM   3763  H  HE2  . PHE A 1 244 ? -48.540 -29.934 6.193   1.00 19.52  ? 323  PHE A HE2  1 
ATOM   3764  H  HZ   . PHE A 1 244 ? -46.427 -30.832 5.942   1.00 18.25  ? 323  PHE A HZ   1 
ATOM   3765  N  N    . LEU A 1 245 ? -47.420 -23.104 9.091   1.00 29.40  ? 324  LEU A N    1 
ATOM   3766  C  CA   . LEU A 1 245 ? -47.107 -21.679 9.230   1.00 26.65  ? 324  LEU A CA   1 
ATOM   3767  C  C    . LEU A 1 245 ? -46.563 -21.377 10.622  1.00 31.24  ? 324  LEU A C    1 
ATOM   3768  O  O    . LEU A 1 245 ? -47.224 -20.759 11.456  1.00 40.58  ? 324  LEU A O    1 
ATOM   3769  C  CB   . LEU A 1 245 ? -48.335 -20.813 8.912   1.00 32.25  ? 324  LEU A CB   1 
ATOM   3770  C  CG   . LEU A 1 245 ? -48.218 -19.285 9.017   1.00 30.40  ? 324  LEU A CG   1 
ATOM   3771  C  CD1  . LEU A 1 245 ? -46.845 -18.769 8.630   1.00 22.49  ? 324  LEU A CD1  1 
ATOM   3772  C  CD2  . LEU A 1 245 ? -49.280 -18.643 8.139   1.00 36.81  ? 324  LEU A CD2  1 
ATOM   3773  H  H    . LEU A 1 245 ? -48.227 -23.310 9.302   1.00 35.28  ? 324  LEU A H    1 
ATOM   3774  H  HA   . LEU A 1 245 ? -46.415 -21.451 8.590   1.00 31.99  ? 324  LEU A HA   1 
ATOM   3775  H  HB2  . LEU A 1 245 ? -48.605 -21.010 8.001   1.00 38.70  ? 324  LEU A HB2  1 
ATOM   3776  H  HB3  . LEU A 1 245 ? -49.047 -21.080 9.514   1.00 38.70  ? 324  LEU A HB3  1 
ATOM   3777  H  HG   . LEU A 1 245 ? -48.389 -19.020 9.934   1.00 36.48  ? 324  LEU A HG   1 
ATOM   3778  H  HD11 . LEU A 1 245 ? -46.835 -17.803 8.717   1.00 26.99  ? 324  LEU A HD11 1 
ATOM   3779  H  HD12 . LEU A 1 245 ? -46.183 -19.161 9.221   1.00 26.99  ? 324  LEU A HD12 1 
ATOM   3780  H  HD13 . LEU A 1 245 ? -46.660 -19.021 7.712   1.00 26.99  ? 324  LEU A HD13 1 
ATOM   3781  H  HD21 . LEU A 1 245 ? -49.205 -17.678 8.207   1.00 44.17  ? 324  LEU A HD21 1 
ATOM   3782  H  HD22 . LEU A 1 245 ? -49.142 -18.922 7.220   1.00 44.17  ? 324  LEU A HD22 1 
ATOM   3783  H  HD23 . LEU A 1 245 ? -50.156 -18.929 8.443   1.00 44.17  ? 324  LEU A HD23 1 
ATOM   3784  N  N    . ASN A 1 246 ? -45.348 -21.851 10.857  1.00 30.83  ? 325  ASN A N    1 
ATOM   3785  C  CA   . ASN A 1 246 ? -44.604 -21.561 12.071  1.00 37.44  ? 325  ASN A CA   1 
ATOM   3786  C  C    . ASN A 1 246 ? -43.144 -21.329 11.691  1.00 38.56  ? 325  ASN A C    1 
ATOM   3787  O  O    . ASN A 1 246 ? -42.775 -21.494 10.529  1.00 37.23  ? 325  ASN A O    1 
ATOM   3788  C  CB   . ASN A 1 246 ? -44.739 -22.720 13.053  1.00 38.01  ? 325  ASN A CB   1 
ATOM   3789  C  CG   . ASN A 1 246 ? -44.751 -24.064 12.359  1.00 38.99  ? 325  ASN A CG   1 
ATOM   3790  O  OD1  . ASN A 1 246 ? -45.813 -24.608 12.048  1.00 43.91  ? 325  ASN A OD1  1 
ATOM   3791  N  ND2  . ASN A 1 246 ? -43.569 -24.604 12.101  1.00 40.00  ? 325  ASN A ND2  1 
ATOM   3792  H  H    . ASN A 1 246 ? -44.921 -22.359 10.309  1.00 36.99  ? 325  ASN A H    1 
ATOM   3793  H  HA   . ASN A 1 246 ? -44.952 -20.757 12.487  1.00 44.93  ? 325  ASN A HA   1 
ATOM   3794  H  HB2  . ASN A 1 246 ? -43.988 -22.705 13.666  1.00 45.61  ? 325  ASN A HB2  1 
ATOM   3795  H  HB3  . ASN A 1 246 ? -45.571 -22.626 13.542  1.00 45.61  ? 325  ASN A HB3  1 
ATOM   3796  H  HD21 . ASN A 1 246 ? -43.522 -25.367 11.708  1.00 48.00  ? 325  ASN A HD21 1 
ATOM   3797  H  HD22 . ASN A 1 246 ? -42.850 -24.191 12.327  1.00 48.00  ? 325  ASN A HD22 1 
ATOM   3798  N  N    . ASP A 1 247 ? -42.316 -20.938 12.655  1.00 39.26  ? 326  ASP A N    1 
ATOM   3799  C  CA   . ASP A 1 247 ? -40.925 -20.606 12.364  1.00 35.24  ? 326  ASP A CA   1 
ATOM   3800  C  C    . ASP A 1 247 ? -40.164 -21.782 11.760  1.00 39.02  ? 326  ASP A C    1 
ATOM   3801  O  O    . ASP A 1 247 ? -39.260 -21.588 10.943  1.00 43.64  ? 326  ASP A O    1 
ATOM   3802  C  CB   . ASP A 1 247 ? -40.197 -20.127 13.622  1.00 40.96  ? 326  ASP A CB   1 
ATOM   3803  C  CG   . ASP A 1 247 ? -38.788 -19.634 13.322  1.00 55.94  ? 326  ASP A CG   1 
ATOM   3804  O  OD1  . ASP A 1 247 ? -38.599 -18.960 12.283  1.00 52.64  ? 326  ASP A OD1  1 
ATOM   3805  O  OD2  . ASP A 1 247 ? -37.869 -19.925 14.120  1.00 61.92  ? 326  ASP A OD2  1 
ATOM   3806  H  H    . ASP A 1 247 ? -42.533 -20.858 13.483  1.00 47.11  ? 326  ASP A H    1 
ATOM   3807  H  HA   . ASP A 1 247 ? -40.908 -19.882 11.719  1.00 42.28  ? 326  ASP A HA   1 
ATOM   3808  H  HB2  . ASP A 1 247 ? -40.695 -19.395 14.017  1.00 49.15  ? 326  ASP A HB2  1 
ATOM   3809  H  HB3  . ASP A 1 247 ? -40.131 -20.863 14.250  1.00 49.15  ? 326  ASP A HB3  1 
ATOM   3810  N  N    . SER A 1 248 ? -40.531 -22.996 12.158  1.00 24.03  ? 327  SER A N    1 
ATOM   3811  C  CA   . SER A 1 248 ? -39.787 -24.185 11.743  1.00 22.01  ? 327  SER A CA   1 
ATOM   3812  C  C    . SER A 1 248 ? -39.832 -24.417 10.230  1.00 14.70  ? 327  SER A C    1 
ATOM   3813  O  O    . SER A 1 248 ? -39.041 -25.193 9.695   1.00 22.99  ? 327  SER A O    1 
ATOM   3814  C  CB   . SER A 1 248 ? -40.289 -25.423 12.486  1.00 20.25  ? 327  SER A CB   1 
ATOM   3815  O  OG   . SER A 1 248 ? -41.064 -26.249 11.638  1.00 29.73  ? 327  SER A OG   1 
ATOM   3816  H  H    . SER A 1 248 ? -41.204 -23.161 12.668  1.00 28.83  ? 327  SER A H    1 
ATOM   3817  H  HA   . SER A 1 248 ? -38.856 -24.060 11.987  1.00 26.41  ? 327  SER A HA   1 
ATOM   3818  H  HB2  . SER A 1 248 ? -39.526 -25.929 12.807  1.00 24.30  ? 327  SER A HB2  1 
ATOM   3819  H  HB3  . SER A 1 248 ? -40.836 -25.140 13.236  1.00 24.30  ? 327  SER A HB3  1 
ATOM   3820  H  HG   . SER A 1 248 ? -41.730 -25.824 11.353  1.00 35.68  ? 327  SER A HG   1 
ATOM   3821  N  N    . TYR A 1 249 ? -40.771 -23.759 9.555   1.00 22.97  ? 328  TYR A N    1 
ATOM   3822  C  CA   . TYR A 1 249 ? -40.843 -23.771 8.096   1.00 20.74  ? 328  TYR A CA   1 
ATOM   3823  C  C    . TYR A 1 249 ? -40.575 -22.378 7.516   1.00 23.19  ? 328  TYR A C    1 
ATOM   3824  O  O    . TYR A 1 249 ? -40.069 -22.257 6.401   1.00 26.80  ? 328  TYR A O    1 
ATOM   3825  C  CB   . TYR A 1 249 ? -42.209 -24.283 7.632   1.00 18.18  ? 328  TYR A CB   1 
ATOM   3826  C  CG   . TYR A 1 249 ? -42.441 -25.760 7.894   1.00 19.18  ? 328  TYR A CG   1 
ATOM   3827  C  CD1  . TYR A 1 249 ? -42.082 -26.712 6.948   1.00 21.08  ? 328  TYR A CD1  1 
ATOM   3828  C  CD2  . TYR A 1 249 ? -43.020 -26.203 9.078   1.00 21.46  ? 328  TYR A CD2  1 
ATOM   3829  C  CE1  . TYR A 1 249 ? -42.293 -28.065 7.171   1.00 16.61  ? 328  TYR A CE1  1 
ATOM   3830  C  CE2  . TYR A 1 249 ? -43.229 -27.557 9.313   1.00 26.67  ? 328  TYR A CE2  1 
ATOM   3831  C  CZ   . TYR A 1 249 ? -42.861 -28.480 8.354   1.00 23.84  ? 328  TYR A CZ   1 
ATOM   3832  O  OH   . TYR A 1 249 ? -43.058 -29.824 8.575   1.00 33.92  ? 328  TYR A OH   1 
ATOM   3833  H  H    . TYR A 1 249 ? -41.388 -23.289 9.926   1.00 27.57  ? 328  TYR A H    1 
ATOM   3834  H  HA   . TYR A 1 249 ? -40.165 -24.373 7.752   1.00 24.88  ? 328  TYR A HA   1 
ATOM   3835  H  HB2  . TYR A 1 249 ? -42.902 -23.789 8.098   1.00 21.81  ? 328  TYR A HB2  1 
ATOM   3836  H  HB3  . TYR A 1 249 ? -42.289 -24.137 6.677   1.00 21.81  ? 328  TYR A HB3  1 
ATOM   3837  H  HD1  . TYR A 1 249 ? -41.696 -26.437 6.148   1.00 25.29  ? 328  TYR A HD1  1 
ATOM   3838  H  HD2  . TYR A 1 249 ? -43.267 -25.583 9.727   1.00 25.75  ? 328  TYR A HD2  1 
ATOM   3839  H  HE1  . TYR A 1 249 ? -42.042 -28.689 6.529   1.00 19.93  ? 328  TYR A HE1  1 
ATOM   3840  H  HE2  . TYR A 1 249 ? -43.614 -27.840 10.110  1.00 32.00  ? 328  TYR A HE2  1 
ATOM   3841  H  HH   . TYR A 1 249 ? -42.790 -30.266 7.913   1.00 40.70  ? 328  TYR A HH   1 
ATOM   3842  N  N    . LEU A 1 250 ? -40.915 -21.331 8.268   1.00 27.42  ? 329  LEU A N    1 
ATOM   3843  C  CA   . LEU A 1 250 ? -40.662 -19.955 7.833   1.00 28.77  ? 329  LEU A CA   1 
ATOM   3844  C  C    . LEU A 1 250 ? -39.163 -19.643 7.710   1.00 32.14  ? 329  LEU A C    1 
ATOM   3845  O  O    . LEU A 1 250 ? -38.769 -18.837 6.862   1.00 37.70  ? 329  LEU A O    1 
ATOM   3846  C  CB   . LEU A 1 250 ? -41.314 -18.934 8.785   1.00 31.96  ? 329  LEU A CB   1 
ATOM   3847  C  CG   . LEU A 1 250 ? -42.769 -18.484 8.559   1.00 26.18  ? 329  LEU A CG   1 
ATOM   3848  C  CD1  . LEU A 1 250 ? -43.174 -17.404 9.518   1.00 30.32  ? 329  LEU A CD1  1 
ATOM   3849  C  CD2  . LEU A 1 250 ? -42.969 -17.968 7.143   1.00 25.59  ? 329  LEU A CD2  1 
ATOM   3850  H  H    . LEU A 1 250 ? -41.296 -21.390 9.038   1.00 32.90  ? 329  LEU A H    1 
ATOM   3851  H  HA   . LEU A 1 250 ? -41.058 -19.832 6.956   1.00 34.53  ? 329  LEU A HA   1 
ATOM   3852  H  HB2  . LEU A 1 250 ? -41.279 -19.307 9.679   1.00 38.35  ? 329  LEU A HB2  1 
ATOM   3853  H  HB3  . LEU A 1 250 ? -40.772 -18.129 8.763   1.00 38.35  ? 329  LEU A HB3  1 
ATOM   3854  H  HG   . LEU A 1 250 ? -43.360 -19.242 8.690   1.00 31.41  ? 329  LEU A HG   1 
ATOM   3855  H  HD11 . LEU A 1 250 ? -44.094 -17.152 9.340   1.00 36.39  ? 329  LEU A HD11 1 
ATOM   3856  H  HD12 . LEU A 1 250 ? -43.093 -17.740 10.425  1.00 36.39  ? 329  LEU A HD12 1 
ATOM   3857  H  HD13 . LEU A 1 250 ? -42.592 -16.638 9.395   1.00 36.39  ? 329  LEU A HD13 1 
ATOM   3858  H  HD21 . LEU A 1 250 ? -43.893 -17.694 7.035   1.00 30.71  ? 329  LEU A HD21 1 
ATOM   3859  H  HD22 . LEU A 1 250 ? -42.380 -17.211 6.997   1.00 30.71  ? 329  LEU A HD22 1 
ATOM   3860  H  HD23 . LEU A 1 250 ? -42.759 -18.678 6.516   1.00 30.71  ? 329  LEU A HD23 1 
ATOM   3861  N  N    . LYS A 1 251 ? -38.333 -20.277 8.541   1.00 20.91  ? 330  LYS A N    1 
ATOM   3862  C  CA   . LYS A 1 251 ? -36.901 -19.947 8.592   1.00 18.30  ? 330  LYS A CA   1 
ATOM   3863  C  C    . LYS A 1 251 ? -36.200 -20.170 7.253   1.00 17.92  ? 330  LYS A C    1 
ATOM   3864  O  O    . LYS A 1 251 ? -35.313 -19.406 6.876   1.00 25.47  ? 330  LYS A O    1 
ATOM   3865  C  CB   . LYS A 1 251 ? -36.181 -20.720 9.711   1.00 13.77  ? 330  LYS A CB   1 
ATOM   3866  C  CG   . LYS A 1 251 ? -36.208 -22.243 9.607   1.00 17.17  ? 330  LYS A CG   1 
ATOM   3867  C  CD   . LYS A 1 251 ? -35.901 -22.859 10.976  1.00 24.55  ? 330  LYS A CD   1 
ATOM   3868  C  CE   . LYS A 1 251 ? -34.976 -24.073 10.919  1.00 28.11  ? 330  LYS A CE   1 
ATOM   3869  N  NZ   . LYS A 1 251 ? -35.661 -25.325 10.513  1.00 26.74  ? 330  LYS A NZ   1 
ATOM   3870  H  H    . LYS A 1 251 ? -38.570 -20.900 9.084   1.00 25.10  ? 330  LYS A H    1 
ATOM   3871  H  HA   . LYS A 1 251 ? -36.819 -19.003 8.801   1.00 21.96  ? 330  LYS A HA   1 
ATOM   3872  H  HB2  . LYS A 1 251 ? -35.249 -20.449 9.717   1.00 16.53  ? 330  LYS A HB2  1 
ATOM   3873  H  HB3  . LYS A 1 251 ? -36.591 -20.482 10.557  1.00 16.53  ? 330  LYS A HB3  1 
ATOM   3874  H  HG2  . LYS A 1 251 ? -37.090 -22.535 9.327   1.00 20.61  ? 330  LYS A HG2  1 
ATOM   3875  H  HG3  . LYS A 1 251 ? -35.534 -22.539 8.975   1.00 20.61  ? 330  LYS A HG3  1 
ATOM   3876  H  HD2  . LYS A 1 251 ? -35.473 -22.187 11.530  1.00 29.47  ? 330  LYS A HD2  1 
ATOM   3877  H  HD3  . LYS A 1 251 ? -36.734 -23.140 11.386  1.00 29.47  ? 330  LYS A HD3  1 
ATOM   3878  H  HE2  . LYS A 1 251 ? -34.270 -23.899 10.277  1.00 33.73  ? 330  LYS A HE2  1 
ATOM   3879  H  HE3  . LYS A 1 251 ? -34.593 -24.216 11.798  1.00 33.73  ? 330  LYS A HE3  1 
ATOM   3880  H  HZ1  . LYS A 1 251 ? -35.078 -25.998 10.496  1.00 32.09  ? 330  LYS A HZ1  1 
ATOM   3881  H  HZ2  . LYS A 1 251 ? -36.309 -25.518 11.090  1.00 32.09  ? 330  LYS A HZ2  1 
ATOM   3882  H  HZ3  . LYS A 1 251 ? -36.015 -25.228 9.702   1.00 32.09  ? 330  LYS A HZ3  1 
ATOM   3883  N  N    . TYR A 1 252 ? -36.602 -21.216 6.541   1.00 15.77  ? 331  TYR A N    1 
ATOM   3884  C  CA   . TYR A 1 252 ? -36.050 -21.507 5.223   1.00 16.44  ? 331  TYR A CA   1 
ATOM   3885  C  C    . TYR A 1 252 ? -36.277 -20.361 4.240   1.00 21.34  ? 331  TYR A C    1 
ATOM   3886  O  O    . TYR A 1 252 ? -35.373 -19.973 3.502   1.00 31.11  ? 331  TYR A O    1 
ATOM   3887  C  CB   . TYR A 1 252 ? -36.648 -22.803 4.683   1.00 11.71  ? 331  TYR A CB   1 
ATOM   3888  C  CG   . TYR A 1 252 ? -36.261 -23.988 5.525   1.00 18.20  ? 331  TYR A CG   1 
ATOM   3889  C  CD1  . TYR A 1 252 ? -35.047 -24.638 5.332   1.00 22.86  ? 331  TYR A CD1  1 
ATOM   3890  C  CD2  . TYR A 1 252 ? -37.091 -24.442 6.530   1.00 24.59  ? 331  TYR A CD2  1 
ATOM   3891  C  CE1  . TYR A 1 252 ? -34.684 -25.722 6.113   1.00 22.39  ? 331  TYR A CE1  1 
ATOM   3892  C  CE2  . TYR A 1 252 ? -36.740 -25.520 7.313   1.00 25.94  ? 331  TYR A CE2  1 
ATOM   3893  C  CZ   . TYR A 1 252 ? -35.536 -26.156 7.109   1.00 23.03  ? 331  TYR A CZ   1 
ATOM   3894  O  OH   . TYR A 1 252 ? -35.211 -27.234 7.909   1.00 28.73  ? 331  TYR A OH   1 
ATOM   3895  H  H    . TYR A 1 252 ? -37.199 -21.778 6.802   1.00 18.92  ? 331  TYR A H    1 
ATOM   3896  H  HA   . TYR A 1 252 ? -35.092 -21.637 5.309   1.00 19.72  ? 331  TYR A HA   1 
ATOM   3897  H  HB2  . TYR A 1 252 ? -37.616 -22.733 4.685   1.00 14.06  ? 331  TYR A HB2  1 
ATOM   3898  H  HB3  . TYR A 1 252 ? -36.324 -22.953 3.781   1.00 14.06  ? 331  TYR A HB3  1 
ATOM   3899  H  HD1  . TYR A 1 252 ? -34.472 -24.344 4.663   1.00 27.43  ? 331  TYR A HD1  1 
ATOM   3900  H  HD2  . TYR A 1 252 ? -37.905 -24.017 6.677   1.00 29.50  ? 331  TYR A HD2  1 
ATOM   3901  H  HE1  . TYR A 1 252 ? -33.870 -26.150 5.972   1.00 26.87  ? 331  TYR A HE1  1 
ATOM   3902  H  HE2  . TYR A 1 252 ? -37.314 -25.815 7.984   1.00 31.13  ? 331  TYR A HE2  1 
ATOM   3903  H  HH   . TYR A 1 252 ? -34.461 -27.540 7.687   1.00 34.47  ? 331  TYR A HH   1 
ATOM   3904  N  N    . VAL A 1 253 ? -37.488 -19.822 4.234   1.00 35.04  ? 332  VAL A N    1 
ATOM   3905  C  CA   . VAL A 1 253 ? -37.813 -18.686 3.380   1.00 33.19  ? 332  VAL A CA   1 
ATOM   3906  C  C    . VAL A 1 253 ? -37.083 -17.436 3.876   1.00 33.22  ? 332  VAL A C    1 
ATOM   3907  O  O    . VAL A 1 253 ? -36.735 -16.553 3.093   1.00 27.83  ? 332  VAL A O    1 
ATOM   3908  C  CB   . VAL A 1 253 ? -39.346 -18.450 3.326   1.00 25.93  ? 332  VAL A CB   1 
ATOM   3909  C  CG1  . VAL A 1 253 ? -39.692 -17.083 2.716   1.00 28.44  ? 332  VAL A CG1  1 
ATOM   3910  C  CG2  . VAL A 1 253 ? -40.023 -19.573 2.542   1.00 26.38  ? 332  VAL A CG2  1 
ATOM   3911  H  H    . VAL A 1 253 ? -38.144 -20.096 4.717   1.00 42.05  ? 332  VAL A H    1 
ATOM   3912  H  HA   . VAL A 1 253 ? -37.507 -18.872 2.478   1.00 39.83  ? 332  VAL A HA   1 
ATOM   3913  H  HB   . VAL A 1 253 ? -39.697 -18.468 4.230   1.00 31.12  ? 332  VAL A HB   1 
ATOM   3914  H  HG11 . VAL A 1 253 ? -40.657 -16.979 2.702   1.00 34.13  ? 332  VAL A HG11 1 
ATOM   3915  H  HG12 . VAL A 1 253 ? -39.292 -16.385 3.258   1.00 34.13  ? 332  VAL A HG12 1 
ATOM   3916  H  HG13 . VAL A 1 253 ? -39.342 -17.043 1.812   1.00 34.13  ? 332  VAL A HG13 1 
ATOM   3917  H  HG21 . VAL A 1 253 ? -40.979 -19.409 2.518   1.00 31.65  ? 332  VAL A HG21 1 
ATOM   3918  H  HG22 . VAL A 1 253 ? -39.668 -19.586 1.639   1.00 31.65  ? 332  VAL A HG22 1 
ATOM   3919  H  HG23 . VAL A 1 253 ? -39.843 -20.418 2.982   1.00 31.65  ? 332  VAL A HG23 1 
ATOM   3920  N  N    . GLY A 1 254 ? -36.846 -17.374 5.182   1.00 28.60  ? 333  GLY A N    1 
ATOM   3921  C  CA   . GLY A 1 254 ? -36.104 -16.275 5.775   1.00 32.73  ? 333  GLY A CA   1 
ATOM   3922  C  C    . GLY A 1 254 ? -34.665 -16.235 5.293   1.00 35.02  ? 333  GLY A C    1 
ATOM   3923  O  O    . GLY A 1 254 ? -34.145 -15.185 4.907   1.00 30.35  ? 333  GLY A O    1 
ATOM   3924  H  H    . GLY A 1 254 ? -37.109 -17.964 5.750   1.00 34.32  ? 333  GLY A H    1 
ATOM   3925  H  HA2  . GLY A 1 254 ? -36.530 -15.434 5.544   1.00 39.27  ? 333  GLY A HA2  1 
ATOM   3926  H  HA3  . GLY A 1 254 ? -36.104 -16.366 6.740   1.00 39.27  ? 333  GLY A HA3  1 
ATOM   3927  N  N    . TRP A 1 255 ? -34.015 -17.392 5.311   1.00 29.49  ? 334  TRP A N    1 
ATOM   3928  C  CA   . TRP A 1 255 ? -32.643 -17.495 4.844   1.00 18.02  ? 334  TRP A CA   1 
ATOM   3929  C  C    . TRP A 1 255 ? -32.572 -17.233 3.353   1.00 20.79  ? 334  TRP A C    1 
ATOM   3930  O  O    . TRP A 1 255 ? -31.739 -16.460 2.882   1.00 34.72  ? 334  TRP A O    1 
ATOM   3931  C  CB   . TRP A 1 255 ? -32.092 -18.884 5.148   1.00 16.81  ? 334  TRP A CB   1 
ATOM   3932  C  CG   . TRP A 1 255 ? -32.109 -19.201 6.595   1.00 20.39  ? 334  TRP A CG   1 
ATOM   3933  C  CD1  . TRP A 1 255 ? -32.086 -18.312 7.632   1.00 26.49  ? 334  TRP A CD1  1 
ATOM   3934  C  CD2  . TRP A 1 255 ? -32.165 -20.501 7.181   1.00 22.01  ? 334  TRP A CD2  1 
ATOM   3935  N  NE1  . TRP A 1 255 ? -32.120 -18.982 8.830   1.00 29.07  ? 334  TRP A NE1  1 
ATOM   3936  C  CE2  . TRP A 1 255 ? -32.161 -20.331 8.580   1.00 24.04  ? 334  TRP A CE2  1 
ATOM   3937  C  CE3  . TRP A 1 255 ? -32.220 -21.797 6.659   1.00 23.06  ? 334  TRP A CE3  1 
ATOM   3938  C  CZ2  . TRP A 1 255 ? -32.227 -21.404 9.463   1.00 22.41  ? 334  TRP A CZ2  1 
ATOM   3939  C  CZ3  . TRP A 1 255 ? -32.274 -22.861 7.534   1.00 21.72  ? 334  TRP A CZ3  1 
ATOM   3940  C  CH2  . TRP A 1 255 ? -32.279 -22.661 8.921   1.00 22.82  ? 334  TRP A CH2  1 
ATOM   3941  H  H    . TRP A 1 255 ? -34.349 -18.134 5.591   1.00 35.38  ? 334  TRP A H    1 
ATOM   3942  H  HA   . TRP A 1 255 ? -32.094 -16.838 5.300   1.00 21.62  ? 334  TRP A HA   1 
ATOM   3943  H  HB2  . TRP A 1 255 ? -32.633 -19.546 4.689   1.00 20.17  ? 334  TRP A HB2  1 
ATOM   3944  H  HB3  . TRP A 1 255 ? -31.173 -18.934 4.840   1.00 20.17  ? 334  TRP A HB3  1 
ATOM   3945  H  HD1  . TRP A 1 255 ? -32.043 -17.388 7.540   1.00 31.79  ? 334  TRP A HD1  1 
ATOM   3946  H  HE1  . TRP A 1 255 ? -32.109 -18.617 9.609   1.00 34.88  ? 334  TRP A HE1  1 
ATOM   3947  H  HE3  . TRP A 1 255 ? -32.222 -21.938 5.740   1.00 27.67  ? 334  TRP A HE3  1 
ATOM   3948  H  HZ2  . TRP A 1 255 ? -32.225 -21.274 10.384  1.00 26.89  ? 334  TRP A HZ2  1 
ATOM   3949  H  HZ3  . TRP A 1 255 ? -32.307 -23.728 7.197   1.00 26.06  ? 334  TRP A HZ3  1 
ATOM   3950  H  HH2  . TRP A 1 255 ? -32.310 -23.398 9.487   1.00 27.39  ? 334  TRP A HH2  1 
ATOM   3951  N  N    . THR A 1 256 ? -33.459 -17.884 2.612   1.00 14.62  ? 335  THR A N    1 
ATOM   3952  C  CA   . THR A 1 256 ? -33.407 -17.862 1.157   1.00 18.15  ? 335  THR A CA   1 
ATOM   3953  C  C    . THR A 1 256 ? -33.720 -16.469 0.578   1.00 13.17  ? 335  THR A C    1 
ATOM   3954  O  O    . THR A 1 256 ? -33.453 -16.203 -0.592  1.00 13.45  ? 335  THR A O    1 
ATOM   3955  C  CB   . THR A 1 256 ? -34.347 -18.935 0.563   1.00 20.07  ? 335  THR A CB   1 
ATOM   3956  O  OG1  . THR A 1 256 ? -34.142 -20.182 1.242   1.00 23.21  ? 335  THR A OG1  1 
ATOM   3957  C  CG2  . THR A 1 256 ? -34.078 -19.123 -0.914  1.00 10.50  ? 335  THR A CG2  1 
ATOM   3958  H  H    . THR A 1 256 ? -34.107 -18.350 2.932   1.00 17.54  ? 335  THR A H    1 
ATOM   3959  H  HA   . THR A 1 256 ? -32.505 -18.089 0.883   1.00 21.78  ? 335  THR A HA   1 
ATOM   3960  H  HB   . THR A 1 256 ? -35.269 -18.655 0.674   1.00 24.08  ? 335  THR A HB   1 
ATOM   3961  H  HG1  . THR A 1 256 ? -34.306 -20.094 2.061   1.00 27.85  ? 335  THR A HG1  1 
ATOM   3962  H  HG21 . THR A 1 256 ? -34.673 -19.798 -1.276  1.00 12.59  ? 335  THR A HG21 1 
ATOM   3963  H  HG22 . THR A 1 256 ? -34.223 -18.289 -1.386  1.00 12.59  ? 335  THR A HG22 1 
ATOM   3964  H  HG23 . THR A 1 256 ? -33.160 -19.406 -1.050  1.00 12.59  ? 335  THR A HG23 1 
HETATM 3965  N  N    . MSE A 1 257 ? -34.252 -15.572 1.403   1.00 28.83  ? 336  MSE A N    1 
HETATM 3966  C  CA   . MSE A 1 257 ? -34.425 -14.175 1.000   1.00 29.36  ? 336  MSE A CA   1 
HETATM 3967  C  C    . MSE A 1 257 ? -33.074 -13.539 0.705   1.00 37.72  ? 336  MSE A C    1 
HETATM 3968  O  O    . MSE A 1 257 ? -32.995 -12.515 0.023   1.00 39.85  ? 336  MSE A O    1 
HETATM 3969  C  CB   . MSE A 1 257 ? -35.094 -13.368 2.112   1.00 29.34  ? 336  MSE A CB   1 
HETATM 3970  C  CG   . MSE A 1 257 ? -36.623 -13.350 2.091   1.00 35.48  ? 336  MSE A CG   1 
HETATM 3971  SE SE   . MSE A 1 257 ? -37.381 -12.306 3.560   1.00 76.15  ? 336  MSE A SE   1 
HETATM 3972  C  CE   . MSE A 1 257 ? -35.755 -11.797 4.481   1.00 36.08  ? 336  MSE A CE   1 
HETATM 3973  H  H    . MSE A 1 257 ? -34.522 -15.744 2.201   1.00 34.60  ? 336  MSE A H    1 
HETATM 3974  H  HA   . MSE A 1 257 ? -34.984 -14.133 0.208   1.00 35.23  ? 336  MSE A HA   1 
HETATM 3975  H  HB2  . MSE A 1 257 ? -34.819 -13.738 2.965   1.00 35.21  ? 336  MSE A HB2  1 
HETATM 3976  H  HB3  . MSE A 1 257 ? -34.792 -12.449 2.046   1.00 35.21  ? 336  MSE A HB3  1 
HETATM 3977  H  HG2  . MSE A 1 257 ? -36.924 -12.958 1.257   1.00 42.57  ? 336  MSE A HG2  1 
HETATM 3978  H  HG3  . MSE A 1 257 ? -36.951 -14.260 2.168   1.00 42.57  ? 336  MSE A HG3  1 
HETATM 3979  H  HE1  . MSE A 1 257 ? -35.986 -11.259 5.254   1.00 43.30  ? 336  MSE A HE1  1 
HETATM 3980  H  HE2  . MSE A 1 257 ? -35.288 -12.599 4.763   1.00 43.30  ? 336  MSE A HE2  1 
HETATM 3981  H  HE3  . MSE A 1 257 ? -35.196 -11.285 3.876   1.00 43.30  ? 336  MSE A HE3  1 
ATOM   3982  N  N    . HIS A 1 258 ? -32.019 -14.139 1.250   1.00 18.68  ? 337  HIS A N    1 
ATOM   3983  C  CA   . HIS A 1 258 ? -30.666 -13.627 1.089   1.00 10.53  ? 337  HIS A CA   1 
ATOM   3984  C  C    . HIS A 1 258 ? -29.924 -14.340 -0.040  1.00 10.28  ? 337  HIS A C    1 
ATOM   3985  O  O    . HIS A 1 258 ? -28.720 -14.158 -0.218  1.00 12.95  ? 337  HIS A O    1 
ATOM   3986  C  CB   . HIS A 1 258 ? -29.903 -13.778 2.397   1.00 11.04  ? 337  HIS A CB   1 
ATOM   3987  C  CG   . HIS A 1 258 ? -30.518 -13.033 3.538   1.00 11.41  ? 337  HIS A CG   1 
ATOM   3988  N  ND1  . HIS A 1 258 ? -31.618 -13.500 4.227   1.00 15.97  ? 337  HIS A ND1  1 
ATOM   3989  C  CD2  . HIS A 1 258 ? -30.195 -11.847 4.107   1.00 13.82  ? 337  HIS A CD2  1 
ATOM   3990  C  CE1  . HIS A 1 258 ? -31.936 -12.641 5.178   1.00 17.06  ? 337  HIS A CE1  1 
ATOM   3991  N  NE2  . HIS A 1 258 ? -31.088 -11.629 5.128   1.00 13.40  ? 337  HIS A NE2  1 
ATOM   3992  H  H    . HIS A 1 258 ? -32.064 -14.855 1.725   1.00 22.42  ? 337  HIS A H    1 
ATOM   3993  H  HA   . HIS A 1 258 ? -30.708 -12.683 0.872   1.00 12.63  ? 337  HIS A HA   1 
ATOM   3994  H  HB2  . HIS A 1 258 ? -29.875 -14.717 2.637   1.00 13.25  ? 337  HIS A HB2  1 
ATOM   3995  H  HB3  . HIS A 1 258 ? -29.002 -13.442 2.275   1.00 13.25  ? 337  HIS A HB3  1 
ATOM   3996  H  HD1  . HIS A 1 258 ? -32.026 -14.240 4.069   1.00 19.17  ? 337  HIS A HD1  1 
ATOM   3997  H  HD2  . HIS A 1 258 ? -29.493 -11.290 3.860   1.00 16.59  ? 337  HIS A HD2  1 
ATOM   3998  H  HE1  . HIS A 1 258 ? -32.640 -12.731 5.779   1.00 20.47  ? 337  HIS A HE1  1 
ATOM   3999  H  HE2  . HIS A 1 258 ? -31.097 -10.943 5.646   1.00 16.07  ? 337  HIS A HE2  1 
ATOM   4000  N  N    . ASP A 1 259 ? -30.648 -15.140 -0.814  1.00 10.43  ? 338  ASP A N    1 
ATOM   4001  C  CA   . ASP A 1 259 ? -30.045 -15.886 -1.910  1.00 11.87  ? 338  ASP A CA   1 
ATOM   4002  C  C    . ASP A 1 259 ? -29.409 -14.930 -2.912  1.00 13.91  ? 338  ASP A C    1 
ATOM   4003  O  O    . ASP A 1 259 ? -29.812 -13.776 -3.021  1.00 20.35  ? 338  ASP A O    1 
ATOM   4004  C  CB   . ASP A 1 259 ? -31.095 -16.742 -2.616  1.00 11.32  ? 338  ASP A CB   1 
ATOM   4005  C  CG   . ASP A 1 259 ? -30.475 -17.833 -3.473  1.00 17.50  ? 338  ASP A CG   1 
ATOM   4006  O  OD1  . ASP A 1 259 ? -30.153 -18.915 -2.922  1.00 13.97  ? 338  ASP A OD1  1 
ATOM   4007  O  OD2  . ASP A 1 259 ? -30.310 -17.604 -4.695  1.00 10.78  ? 338  ASP A OD2  1 
ATOM   4008  H  H    . ASP A 1 259 ? -31.494 -15.268 -0.725  1.00 12.52  ? 338  ASP A H    1 
ATOM   4009  H  HA   . ASP A 1 259 ? -29.354 -16.471 -1.562  1.00 14.25  ? 338  ASP A HA   1 
ATOM   4010  H  HB2  . ASP A 1 259 ? -31.658 -17.166 -1.950  1.00 13.58  ? 338  ASP A HB2  1 
ATOM   4011  H  HB3  . ASP A 1 259 ? -31.631 -16.175 -3.192  1.00 13.58  ? 338  ASP A HB3  1 
ATOM   4012  N  N    . LYS A 1 260 ? -28.428 -15.421 -3.657  1.00 12.61  ? 339  LYS A N    1 
ATOM   4013  C  CA   . LYS A 1 260 ? -27.666 -14.578 -4.569  1.00 11.95  ? 339  LYS A CA   1 
ATOM   4014  C  C    . LYS A 1 260 ? -28.326 -14.409 -5.940  1.00 11.12  ? 339  LYS A C    1 
ATOM   4015  O  O    . LYS A 1 260 ? -27.868 -13.599 -6.749  1.00 20.71  ? 339  LYS A O    1 
ATOM   4016  C  CB   . LYS A 1 260 ? -26.258 -15.153 -4.736  1.00 14.37  ? 339  LYS A CB   1 
ATOM   4017  C  CG   . LYS A 1 260 ? -25.143 -14.351 -4.057  1.00 11.48  ? 339  LYS A CG   1 
ATOM   4018  C  CD   . LYS A 1 260 ? -25.450 -13.938 -2.603  1.00 11.22  ? 339  LYS A CD   1 
ATOM   4019  C  CE   . LYS A 1 260 ? -24.402 -12.959 -2.082  1.00 11.71  ? 339  LYS A CE   1 
ATOM   4020  N  NZ   . LYS A 1 260 ? -24.876 -12.107 -0.951  1.00 13.42  ? 339  LYS A NZ   1 
ATOM   4021  H  H    . LYS A 1 260 ? -28.182 -16.245 -3.654  1.00 15.14  ? 339  LYS A H    1 
ATOM   4022  H  HA   . LYS A 1 260 ? -27.579 -13.696 -4.174  1.00 14.34  ? 339  LYS A HA   1 
ATOM   4023  H  HB2  . LYS A 1 260 ? -26.244 -16.048 -4.361  1.00 17.24  ? 339  LYS A HB2  1 
ATOM   4024  H  HB3  . LYS A 1 260 ? -26.053 -15.195 -5.683  1.00 17.24  ? 339  LYS A HB3  1 
ATOM   4025  H  HG2  . LYS A 1 260 ? -24.336 -14.889 -4.046  1.00 13.77  ? 339  LYS A HG2  1 
ATOM   4026  H  HG3  . LYS A 1 260 ? -24.989 -13.540 -4.567  1.00 13.77  ? 339  LYS A HG3  1 
ATOM   4027  H  HD2  . LYS A 1 260 ? -26.318 -13.505 -2.567  1.00 13.46  ? 339  LYS A HD2  1 
ATOM   4028  H  HD3  . LYS A 1 260 ? -25.442 -14.725 -2.036  1.00 13.46  ? 339  LYS A HD3  1 
ATOM   4029  H  HE2  . LYS A 1 260 ? -23.632 -13.461 -1.773  1.00 14.05  ? 339  LYS A HE2  1 
ATOM   4030  H  HE3  . LYS A 1 260 ? -24.140 -12.369 -2.806  1.00 14.05  ? 339  LYS A HE3  1 
ATOM   4031  H  HZ1  . LYS A 1 260 ? -24.225 -11.559 -0.690  1.00 16.10  ? 339  LYS A HZ1  1 
ATOM   4032  H  HZ2  . LYS A 1 260 ? -25.577 -11.623 -1.207  1.00 16.10  ? 339  LYS A HZ2  1 
ATOM   4033  H  HZ3  . LYS A 1 260 ? -25.114 -12.620 -0.264  1.00 16.10  ? 339  LYS A HZ3  1 
ATOM   4034  N  N    . GLN A 1 261 ? -29.388 -15.170 -6.202  1.00 22.57  ? 340  GLN A N    1 
ATOM   4035  C  CA   . GLN A 1 261 ? -30.115 -15.087 -7.476  1.00 19.88  ? 340  GLN A CA   1 
ATOM   4036  C  C    . GLN A 1 261 ? -31.480 -14.420 -7.320  1.00 22.38  ? 340  GLN A C    1 
ATOM   4037  O  O    . GLN A 1 261 ? -32.184 -14.644 -6.335  1.00 28.96  ? 340  GLN A O    1 
ATOM   4038  C  CB   . GLN A 1 261 ? -30.318 -16.478 -8.070  1.00 20.72  ? 340  GLN A CB   1 
ATOM   4039  C  CG   . GLN A 1 261 ? -29.041 -17.203 -8.430  1.00 23.08  ? 340  GLN A CG   1 
ATOM   4040  C  CD   . GLN A 1 261 ? -28.281 -16.514 -9.535  1.00 22.54  ? 340  GLN A CD   1 
ATOM   4041  O  OE1  . GLN A 1 261 ? -28.720 -16.495 -10.684 1.00 32.41  ? 340  GLN A OE1  1 
ATOM   4042  N  NE2  . GLN A 1 261 ? -27.135 -15.936 -9.195  1.00 29.66  ? 340  GLN A NE2  1 
ATOM   4043  H  H    . GLN A 1 261 ? -29.713 -15.748 -5.655  1.00 27.09  ? 340  GLN A H    1 
ATOM   4044  H  HA   . GLN A 1 261 ? -29.593 -14.564 -8.105  1.00 23.85  ? 340  GLN A HA   1 
ATOM   4045  H  HB2  . GLN A 1 261 ? -30.794 -17.024 -7.423  1.00 24.86  ? 340  GLN A HB2  1 
ATOM   4046  H  HB3  . GLN A 1 261 ? -30.847 -16.396 -8.878  1.00 24.86  ? 340  GLN A HB3  1 
ATOM   4047  H  HG2  . GLN A 1 261 ? -28.468 -17.242 -7.649  1.00 27.70  ? 340  GLN A HG2  1 
ATOM   4048  H  HG3  . GLN A 1 261 ? -29.259 -18.100 -8.728  1.00 27.70  ? 340  GLN A HG3  1 
ATOM   4049  H  HE21 . GLN A 1 261 ? -26.862 -15.967 -8.380  1.00 35.59  ? 340  GLN A HE21 1 
ATOM   4050  H  HE22 . GLN A 1 261 ? -26.665 -15.530 -9.790  1.00 35.59  ? 340  GLN A HE22 1 
ATOM   4051  N  N    . GLY A 1 262 ? -31.851 -13.610 -8.306  1.00 30.55  ? 341  GLY A N    1 
ATOM   4052  C  CA   . GLY A 1 262 ? -33.112 -12.893 -8.272  1.00 30.95  ? 341  GLY A CA   1 
ATOM   4053  C  C    . GLY A 1 262 ? -34.316 -13.814 -8.291  1.00 27.74  ? 341  GLY A C    1 
ATOM   4054  O  O    . GLY A 1 262 ? -35.278 -13.593 -7.559  1.00 28.37  ? 341  GLY A O    1 
ATOM   4055  H  H    . GLY A 1 262 ? -31.383 -13.460 -9.011  1.00 36.66  ? 341  GLY A H    1 
ATOM   4056  H  HA2  . GLY A 1 262 ? -33.153 -12.353 -7.467  1.00 37.14  ? 341  GLY A HA2  1 
ATOM   4057  H  HA3  . GLY A 1 262 ? -33.166 -12.303 -9.040  1.00 37.14  ? 341  GLY A HA3  1 
ATOM   4058  N  N    . GLU A 1 263 ? -34.267 -14.849 -9.126  1.00 33.14  ? 342  GLU A N    1 
ATOM   4059  C  CA   . GLU A 1 263 ? -35.396 -15.765 -9.267  1.00 25.87  ? 342  GLU A CA   1 
ATOM   4060  C  C    . GLU A 1 263 ? -35.696 -16.514 -7.980  1.00 26.89  ? 342  GLU A C    1 
ATOM   4061  O  O    . GLU A 1 263 ? -36.846 -16.861 -7.713  1.00 37.11  ? 342  GLU A O    1 
ATOM   4062  C  CB   . GLU A 1 263 ? -35.157 -16.770 -10.401 1.00 28.49  ? 342  GLU A CB   1 
ATOM   4063  C  CG   . GLU A 1 263 ? -35.283 -16.189 -11.808 1.00 51.66  ? 342  GLU A CG   1 
ATOM   4064  C  CD   . GLU A 1 263 ? -36.560 -15.378 -11.999 1.00 66.97  ? 342  GLU A CD   1 
ATOM   4065  O  OE1  . GLU A 1 263 ? -37.617 -15.794 -11.472 1.00 70.22  ? 342  GLU A OE1  1 
ATOM   4066  O  OE2  . GLU A 1 263 ? -36.504 -14.322 -12.670 1.00 67.91  ? 342  GLU A OE2  1 
ATOM   4067  H  H    . GLU A 1 263 ? -33.591 -15.044 -9.621  1.00 39.77  ? 342  GLU A H    1 
ATOM   4068  H  HA   . GLU A 1 263 ? -36.184 -15.249 -9.496  1.00 31.05  ? 342  GLU A HA   1 
ATOM   4069  H  HB2  . GLU A 1 263 ? -34.261 -17.130 -10.311 1.00 34.18  ? 342  GLU A HB2  1 
ATOM   4070  H  HB3  . GLU A 1 263 ? -35.805 -17.487 -10.321 1.00 34.18  ? 342  GLU A HB3  1 
ATOM   4071  H  HG2  . GLU A 1 263 ? -34.528 -15.603 -11.976 1.00 61.99  ? 342  GLU A HG2  1 
ATOM   4072  H  HG3  . GLU A 1 263 ? -35.290 -16.915 -12.450 1.00 61.99  ? 342  GLU A HG3  1 
ATOM   4073  N  N    . VAL A 1 264 ? -34.669 -16.768 -7.181  1.00 13.91  ? 343  VAL A N    1 
ATOM   4074  C  CA   . VAL A 1 264 ? -34.889 -17.394 -5.890  1.00 11.48  ? 343  VAL A CA   1 
ATOM   4075  C  C    . VAL A 1 264 ? -35.538 -16.371 -4.959  1.00 13.70  ? 343  VAL A C    1 
ATOM   4076  O  O    . VAL A 1 264 ? -36.580 -16.641 -4.366  1.00 28.35  ? 343  VAL A O    1 
ATOM   4077  C  CB   . VAL A 1 264 ? -33.579 -17.953 -5.285  1.00 16.68  ? 343  VAL A CB   1 
ATOM   4078  C  CG1  . VAL A 1 264 ? -33.845 -18.556 -3.931  1.00 9.06   ? 343  VAL A CG1  1 
ATOM   4079  C  CG2  . VAL A 1 264 ? -32.962 -19.000 -6.212  1.00 16.71  ? 343  VAL A CG2  1 
ATOM   4080  H  H    . VAL A 1 264 ? -33.847 -16.590 -7.360  1.00 16.69  ? 343  VAL A H    1 
ATOM   4081  H  HA   . VAL A 1 264 ? -35.507 -18.134 -6.000  1.00 13.77  ? 343  VAL A HA   1 
ATOM   4082  H  HB   . VAL A 1 264 ? -32.942 -17.230 -5.176  1.00 20.01  ? 343  VAL A HB   1 
ATOM   4083  H  HG11 . VAL A 1 264 ? -33.013 -18.900 -3.570  1.00 10.88  ? 343  VAL A HG11 1 
ATOM   4084  H  HG12 . VAL A 1 264 ? -34.202 -17.870 -3.346  1.00 10.88  ? 343  VAL A HG12 1 
ATOM   4085  H  HG13 . VAL A 1 264 ? -34.487 -19.277 -4.028  1.00 10.88  ? 343  VAL A HG13 1 
ATOM   4086  H  HG21 . VAL A 1 264 ? -32.144 -19.333 -5.811  1.00 20.06  ? 343  VAL A HG21 1 
ATOM   4087  H  HG22 . VAL A 1 264 ? -33.593 -19.727 -6.331  1.00 20.06  ? 343  VAL A HG22 1 
ATOM   4088  H  HG23 . VAL A 1 264 ? -32.767 -18.587 -7.068  1.00 20.06  ? 343  VAL A HG23 1 
ATOM   4089  N  N    . ARG A 1 265 ? -34.942 -15.186 -4.864  1.00 18.37  ? 344  ARG A N    1 
ATOM   4090  C  CA   . ARG A 1 265 ? -35.436 -14.140 -3.966  1.00 13.61  ? 344  ARG A CA   1 
ATOM   4091  C  C    . ARG A 1 265 ? -36.883 -13.751 -4.275  1.00 13.99  ? 344  ARG A C    1 
ATOM   4092  O  O    . ARG A 1 265 ? -37.659 -13.449 -3.370  1.00 18.52  ? 344  ARG A O    1 
ATOM   4093  C  CB   . ARG A 1 265 ? -34.535 -12.899 -4.032  1.00 18.20  ? 344  ARG A CB   1 
ATOM   4094  C  CG   . ARG A 1 265 ? -33.145 -13.103 -3.411  1.00 11.11  ? 344  ARG A CG   1 
ATOM   4095  C  CD   . ARG A 1 265 ? -32.425 -11.790 -3.138  1.00 17.43  ? 344  ARG A CD   1 
ATOM   4096  N  NE   . ARG A 1 265 ? -32.367 -10.939 -4.321  1.00 22.07  ? 344  ARG A NE   1 
ATOM   4097  C  CZ   . ARG A 1 265 ? -31.479 -11.064 -5.301  1.00 25.93  ? 344  ARG A CZ   1 
ATOM   4098  N  NH1  . ARG A 1 265 ? -30.556 -12.019 -5.264  1.00 24.42  ? 344  ARG A NH1  1 
ATOM   4099  N  NH2  . ARG A 1 265 ? -31.531 -10.231 -6.330  1.00 24.92  ? 344  ARG A NH2  1 
ATOM   4100  H  H    . ARG A 1 265 ? -34.244 -14.959 -5.312  1.00 22.05  ? 344  ARG A H    1 
ATOM   4101  H  HA   . ARG A 1 265 ? -35.409 -14.475 -3.056  1.00 16.34  ? 344  ARG A HA   1 
ATOM   4102  H  HB2  . ARG A 1 265 ? -34.411 -12.652 -4.962  1.00 21.84  ? 344  ARG A HB2  1 
ATOM   4103  H  HB3  . ARG A 1 265 ? -34.968 -12.173 -3.555  1.00 21.84  ? 344  ARG A HB3  1 
ATOM   4104  H  HG2  . ARG A 1 265 ? -33.241 -13.574 -2.568  1.00 13.33  ? 344  ARG A HG2  1 
ATOM   4105  H  HG3  . ARG A 1 265 ? -32.599 -13.623 -4.022  1.00 13.33  ? 344  ARG A HG3  1 
ATOM   4106  H  HD2  . ARG A 1 265 ? -32.898 -11.307 -2.442  1.00 20.91  ? 344  ARG A HD2  1 
ATOM   4107  H  HD3  . ARG A 1 265 ? -31.516 -11.978 -2.856  1.00 20.91  ? 344  ARG A HD3  1 
ATOM   4108  H  HE   . ARG A 1 265 ? -32.951 -10.311 -4.389  1.00 26.48  ? 344  ARG A HE   1 
ATOM   4109  H  HH11 . ARG A 1 265 ? -30.524 -12.561 -4.597  1.00 29.30  ? 344  ARG A HH11 1 
ATOM   4110  H  HH12 . ARG A 1 265 ? -29.987 -12.092 -5.904  1.00 29.30  ? 344  ARG A HH12 1 
ATOM   4111  H  HH21 . ARG A 1 265 ? -32.130 -9.614  -6.354  1.00 29.90  ? 344  ARG A HH21 1 
ATOM   4112  H  HH22 . ARG A 1 265 ? -30.962 -10.303 -6.971  1.00 29.90  ? 344  ARG A HH22 1 
ATOM   4113  N  N    . LEU A 1 266 ? -37.240 -13.765 -5.555  1.00 15.73  ? 345  LEU A N    1 
ATOM   4114  C  CA   . LEU A 1 266 ? -38.607 -13.471 -5.974  1.00 14.61  ? 345  LEU A CA   1 
ATOM   4115  C  C    . LEU A 1 266 ? -39.599 -14.438 -5.336  1.00 23.18  ? 345  LEU A C    1 
ATOM   4116  O  O    . LEU A 1 266 ? -40.641 -14.024 -4.815  1.00 28.53  ? 345  LEU A O    1 
ATOM   4117  C  CB   . LEU A 1 266 ? -38.728 -13.557 -7.498  1.00 13.90  ? 345  LEU A CB   1 
ATOM   4118  C  CG   . LEU A 1 266 ? -39.974 -12.962 -8.161  1.00 19.27  ? 345  LEU A CG   1 
ATOM   4119  C  CD1  . LEU A 1 266 ? -40.167 -11.503 -7.803  1.00 26.29  ? 345  LEU A CD1  1 
ATOM   4120  C  CD2  . LEU A 1 266 ? -39.829 -13.104 -9.659  1.00 22.95  ? 345  LEU A CD2  1 
ATOM   4121  H  H    . LEU A 1 266 ? -36.706 -13.944 -6.205  1.00 18.88  ? 345  LEU A H    1 
ATOM   4122  H  HA   . LEU A 1 266 ? -38.840 -12.570 -5.700  1.00 17.53  ? 345  LEU A HA   1 
ATOM   4123  H  HB2  . LEU A 1 266 ? -37.961 -13.105 -7.883  1.00 16.68  ? 345  LEU A HB2  1 
ATOM   4124  H  HB3  . LEU A 1 266 ? -38.699 -14.495 -7.745  1.00 16.68  ? 345  LEU A HB3  1 
ATOM   4125  H  HG   . LEU A 1 266 ? -40.760 -13.456 -7.879  1.00 23.12  ? 345  LEU A HG   1 
ATOM   4126  H  HD11 . LEU A 1 266 ? -40.965 -11.173 -8.245  1.00 31.55  ? 345  LEU A HD11 1 
ATOM   4127  H  HD12 . LEU A 1 266 ? -40.265 -11.425 -6.841  1.00 31.55  ? 345  LEU A HD12 1 
ATOM   4128  H  HD13 . LEU A 1 266 ? -39.392 -11.000 -8.099  1.00 31.55  ? 345  LEU A HD13 1 
ATOM   4129  H  HD21 . LEU A 1 266 ? -40.614 -12.729 -10.088 1.00 27.54  ? 345  LEU A HD21 1 
ATOM   4130  H  HD22 . LEU A 1 266 ? -39.035 -12.627 -9.945  1.00 27.54  ? 345  LEU A HD22 1 
ATOM   4131  H  HD23 . LEU A 1 266 ? -39.748 -14.045 -9.880  1.00 27.54  ? 345  LEU A HD23 1 
ATOM   4132  N  N    . LYS A 1 267 ? -39.272 -15.728 -5.370  1.00 25.80  ? 346  LYS A N    1 
ATOM   4133  C  CA   . LYS A 1 267 ? -40.156 -16.750 -4.828  1.00 19.81  ? 346  LYS A CA   1 
ATOM   4134  C  C    . LYS A 1 267 ? -40.366 -16.616 -3.319  1.00 23.99  ? 346  LYS A C    1 
ATOM   4135  O  O    . LYS A 1 267 ? -41.432 -16.954 -2.810  1.00 33.59  ? 346  LYS A O    1 
ATOM   4136  C  CB   . LYS A 1 267 ? -39.627 -18.154 -5.143  1.00 17.08  ? 346  LYS A CB   1 
ATOM   4137  C  CG   . LYS A 1 267 ? -39.682 -18.608 -6.615  1.00 15.54  ? 346  LYS A CG   1 
ATOM   4138  C  CD   . LYS A 1 267 ? -40.749 -17.924 -7.471  1.00 24.35  ? 346  LYS A CD   1 
ATOM   4139  C  CE   . LYS A 1 267 ? -41.341 -18.890 -8.491  1.00 32.24  ? 346  LYS A CE   1 
ATOM   4140  N  NZ   . LYS A 1 267 ? -40.344 -19.779 -9.160  1.00 35.07  ? 346  LYS A NZ   1 
ATOM   4141  H  H    . LYS A 1 267 ? -38.541 -16.035 -5.704  1.00 30.96  ? 346  LYS A H    1 
ATOM   4142  H  HA   . LYS A 1 267 ? -41.024 -16.663 -5.252  1.00 23.77  ? 346  LYS A HA   1 
ATOM   4143  H  HB2  . LYS A 1 267 ? -38.698 -18.195 -4.866  1.00 20.50  ? 346  LYS A HB2  1 
ATOM   4144  H  HB3  . LYS A 1 267 ? -40.143 -18.793 -4.628  1.00 20.50  ? 346  LYS A HB3  1 
ATOM   4145  H  HG2  . LYS A 1 267 ? -38.821 -18.429 -7.024  1.00 18.65  ? 346  LYS A HG2  1 
ATOM   4146  H  HG3  . LYS A 1 267 ? -39.858 -19.561 -6.636  1.00 18.65  ? 346  LYS A HG3  1 
ATOM   4147  H  HD2  . LYS A 1 267 ? -41.465 -17.607 -6.899  1.00 29.22  ? 346  LYS A HD2  1 
ATOM   4148  H  HD3  . LYS A 1 267 ? -40.348 -17.182 -7.951  1.00 29.22  ? 346  LYS A HD3  1 
ATOM   4149  H  HE2  . LYS A 1 267 ? -41.986 -19.458 -8.041  1.00 38.69  ? 346  LYS A HE2  1 
ATOM   4150  H  HE3  . LYS A 1 267 ? -41.787 -18.376 -9.183  1.00 38.69  ? 346  LYS A HE3  1 
ATOM   4151  H  HZ1  . LYS A 1 267 ? -40.754 -20.315 -9.739  1.00 42.08  ? 346  LYS A HZ1  1 
ATOM   4152  H  HZ2  . LYS A 1 267 ? -39.743 -19.288 -9.595  1.00 42.08  ? 346  LYS A HZ2  1 
ATOM   4153  H  HZ3  . LYS A 1 267 ? -39.925 -20.277 -8.552  1.00 42.08  ? 346  LYS A HZ3  1 
ATOM   4154  N  N    . CYS A 1 268 ? -39.358 -16.137 -2.601  1.00 17.91  ? 347  CYS A N    1 
ATOM   4155  C  CA   . CYS A 1 268 ? -39.498 -15.963 -1.161  1.00 22.42  ? 347  CYS A CA   1 
ATOM   4156  C  C    . CYS A 1 268 ? -40.542 -14.890 -0.890  1.00 26.02  ? 347  CYS A C    1 
ATOM   4157  O  O    . CYS A 1 268 ? -41.318 -14.996 0.057   1.00 34.48  ? 347  CYS A O    1 
ATOM   4158  C  CB   . CYS A 1 268 ? -38.163 -15.578 -0.518  1.00 24.40  ? 347  CYS A CB   1 
ATOM   4159  S  SG   . CYS A 1 268 ? -36.835 -16.750 -0.847  1.00 38.57  ? 347  CYS A SG   1 
ATOM   4160  H  H    . CYS A 1 268 ? -38.592 -15.907 -2.917  1.00 21.49  ? 347  CYS A H    1 
ATOM   4161  H  HA   . CYS A 1 268 ? -39.802 -16.795 -0.763  1.00 26.90  ? 347  CYS A HA   1 
ATOM   4162  H  HB2  . CYS A 1 268 ? -37.889 -14.714 -0.862  1.00 29.28  ? 347  CYS A HB2  1 
ATOM   4163  H  HB3  . CYS A 1 268 ? -38.283 -15.527 0.443   1.00 29.28  ? 347  CYS A HB3  1 
ATOM   4164  H  HG   . CYS A 1 268 ? -36.660 -16.819 -2.032  1.00 46.29  ? 347  CYS A HG   1 
ATOM   4165  N  N    . LEU A 1 269 ? -40.566 -13.862 -1.734  1.00 15.66  ? 348  LEU A N    1 
ATOM   4166  C  CA   . LEU A 1 269 ? -41.484 -12.743 -1.540  1.00 14.30  ? 348  LEU A CA   1 
ATOM   4167  C  C    . LEU A 1 269 ? -42.899 -13.089 -2.010  1.00 16.82  ? 348  LEU A C    1 
ATOM   4168  O  O    . LEU A 1 269 ? -43.887 -12.673 -1.403  1.00 19.09  ? 348  LEU A O    1 
ATOM   4169  C  CB   . LEU A 1 269 ? -40.966 -11.488 -2.244  1.00 10.22  ? 348  LEU A CB   1 
ATOM   4170  C  CG   . LEU A 1 269 ? -39.653 -10.929 -1.677  1.00 13.63  ? 348  LEU A CG   1 
ATOM   4171  C  CD1  . LEU A 1 269 ? -39.194 -9.710  -2.465  1.00 10.17  ? 348  LEU A CD1  1 
ATOM   4172  C  CD2  . LEU A 1 269 ? -39.763 -10.574 -0.193  1.00 13.68  ? 348  LEU A CD2  1 
ATOM   4173  H  H    . LEU A 1 269 ? -40.061 -13.788 -2.426  1.00 18.79  ? 348  LEU A H    1 
ATOM   4174  H  HA   . LEU A 1 269 ? -41.533 -12.547 -0.591  1.00 17.16  ? 348  LEU A HA   1 
ATOM   4175  H  HB2  . LEU A 1 269 ? -40.816 -11.698 -3.179  1.00 12.27  ? 348  LEU A HB2  1 
ATOM   4176  H  HB3  . LEU A 1 269 ? -41.637 -10.792 -2.170  1.00 12.27  ? 348  LEU A HB3  1 
ATOM   4177  H  HG   . LEU A 1 269 ? -38.966 -11.609 -1.764  1.00 16.35  ? 348  LEU A HG   1 
ATOM   4178  H  HD11 . LEU A 1 269 ? -38.365 -9.382  -2.084  1.00 12.20  ? 348  LEU A HD11 1 
ATOM   4179  H  HD12 . LEU A 1 269 ? -39.053 -9.967  -3.390  1.00 12.20  ? 348  LEU A HD12 1 
ATOM   4180  H  HD13 . LEU A 1 269 ? -39.877 -9.024  -2.412  1.00 12.20  ? 348  LEU A HD13 1 
ATOM   4181  H  HD21 . LEU A 1 269 ? -38.910 -10.227 0.113   1.00 16.41  ? 348  LEU A HD21 1 
ATOM   4182  H  HD22 . LEU A 1 269 ? -40.453 -9.902  -0.080  1.00 16.41  ? 348  LEU A HD22 1 
ATOM   4183  H  HD23 . LEU A 1 269 ? -39.993 -11.373 0.306   1.00 16.41  ? 348  LEU A HD23 1 
ATOM   4184  N  N    . THR A 1 270 ? -42.993 -13.861 -3.086  1.00 19.26  ? 349  THR A N    1 
ATOM   4185  C  CA   . THR A 1 270 ? -44.283 -14.351 -3.548  1.00 19.62  ? 349  THR A CA   1 
ATOM   4186  C  C    . THR A 1 270 ? -44.895 -15.263 -2.496  1.00 24.41  ? 349  THR A C    1 
ATOM   4187  O  O    . THR A 1 270 ? -46.097 -15.205 -2.241  1.00 32.45  ? 349  THR A O    1 
ATOM   4188  C  CB   . THR A 1 270 ? -44.141 -15.123 -4.864  1.00 20.22  ? 349  THR A CB   1 
ATOM   4189  O  OG1  . THR A 1 270 ? -43.923 -14.196 -5.932  1.00 22.67  ? 349  THR A OG1  1 
ATOM   4190  C  CG2  . THR A 1 270 ? -45.392 -15.942 -5.170  1.00 27.54  ? 349  THR A CG2  1 
ATOM   4191  H  H    . THR A 1 270 ? -42.325 -14.115 -3.565  1.00 23.11  ? 349  THR A H    1 
ATOM   4192  H  HA   . THR A 1 270 ? -44.882 -13.602 -3.693  1.00 23.55  ? 349  THR A HA   1 
ATOM   4193  H  HB   . THR A 1 270 ? -43.385 -15.728 -4.803  1.00 24.27  ? 349  THR A HB   1 
ATOM   4194  H  HG1  . THR A 1 270 ? -43.843 -14.608 -6.659  1.00 27.21  ? 349  THR A HG1  1 
ATOM   4195  H  HG21 . THR A 1 270 ? -45.279 -16.421 -6.006  1.00 33.05  ? 349  THR A HG21 1 
ATOM   4196  H  HG22 . THR A 1 270 ? -45.551 -16.583 -4.459  1.00 33.05  ? 349  THR A HG22 1 
ATOM   4197  H  HG23 . THR A 1 270 ? -46.162 -15.356 -5.244  1.00 33.05  ? 349  THR A HG23 1 
ATOM   4198  N  N    . ALA A 1 271 ? -44.063 -16.103 -1.886  1.00 18.86  ? 350  ALA A N    1 
ATOM   4199  C  CA   . ALA A 1 271 ? -44.536 -17.031 -0.865  1.00 15.59  ? 350  ALA A CA   1 
ATOM   4200  C  C    . ALA A 1 271 ? -45.134 -16.294 0.325   1.00 18.83  ? 350  ALA A C    1 
ATOM   4201  O  O    . ALA A 1 271 ? -46.212 -16.649 0.806   1.00 26.96  ? 350  ALA A O    1 
ATOM   4202  C  CB   . ALA A 1 271 ? -43.417 -17.925 -0.404  1.00 13.42  ? 350  ALA A CB   1 
ATOM   4203  H  H    . ALA A 1 271 ? -43.219 -16.154 -2.046  1.00 22.63  ? 350  ALA A H    1 
ATOM   4204  H  HA   . ALA A 1 271 ? -45.228 -17.593 -1.247  1.00 18.71  ? 350  ALA A HA   1 
ATOM   4205  H  HB1  . ALA A 1 271 ? -43.757 -18.531 0.273   1.00 16.11  ? 350  ALA A HB1  1 
ATOM   4206  H  HB2  . ALA A 1 271 ? -43.083 -18.429 -1.162  1.00 16.11  ? 350  ALA A HB2  1 
ATOM   4207  H  HB3  . ALA A 1 271 ? -42.708 -17.377 -0.032  1.00 16.11  ? 350  ALA A HB3  1 
ATOM   4208  N  N    . LEU A 1 272 ? -44.428 -15.277 0.806   1.00 20.69  ? 351  LEU A N    1 
ATOM   4209  C  CA   . LEU A 1 272 ? -44.892 -14.509 1.957   1.00 28.05  ? 351  LEU A CA   1 
ATOM   4210  C  C    . LEU A 1 272 ? -46.148 -13.708 1.633   1.00 31.29  ? 351  LEU A C    1 
ATOM   4211  O  O    . LEU A 1 272 ? -47.040 -13.582 2.467   1.00 37.39  ? 351  LEU A O    1 
ATOM   4212  C  CB   . LEU A 1 272 ? -43.793 -13.572 2.454   1.00 25.74  ? 351  LEU A CB   1 
ATOM   4213  C  CG   . LEU A 1 272 ? -42.540 -14.242 3.024   1.00 30.96  ? 351  LEU A CG   1 
ATOM   4214  C  CD1  . LEU A 1 272 ? -41.489 -13.199 3.377   1.00 35.11  ? 351  LEU A CD1  1 
ATOM   4215  C  CD2  . LEU A 1 272 ? -42.892 -15.073 4.241   1.00 30.37  ? 351  LEU A CD2  1 
ATOM   4216  H  H    . LEU A 1 272 ? -43.676 -15.011 0.485   1.00 24.82  ? 351  LEU A H    1 
ATOM   4217  H  HA   . LEU A 1 272 ? -45.108 -15.123 2.676   1.00 33.66  ? 351  LEU A HA   1 
ATOM   4218  H  HB2  . LEU A 1 272 ? -43.509 -13.015 1.713   1.00 30.89  ? 351  LEU A HB2  1 
ATOM   4219  H  HB3  . LEU A 1 272 ? -44.164 -13.012 3.154   1.00 30.89  ? 351  LEU A HB3  1 
ATOM   4220  H  HG   . LEU A 1 272 ? -42.164 -14.834 2.354   1.00 37.15  ? 351  LEU A HG   1 
ATOM   4221  H  HD11 . LEU A 1 272 ? -40.707 -13.648 3.735   1.00 42.14  ? 351  LEU A HD11 1 
ATOM   4222  H  HD12 . LEU A 1 272 ? -41.251 -12.708 2.575   1.00 42.14  ? 351  LEU A HD12 1 
ATOM   4223  H  HD13 . LEU A 1 272 ? -41.856 -12.593 4.039   1.00 42.14  ? 351  LEU A HD13 1 
ATOM   4224  H  HD21 . LEU A 1 272 ? -42.085 -15.487 4.584   1.00 36.45  ? 351  LEU A HD21 1 
ATOM   4225  H  HD22 . LEU A 1 272 ? -43.281 -14.495 4.916   1.00 36.45  ? 351  LEU A HD22 1 
ATOM   4226  H  HD23 . LEU A 1 272 ? -43.530 -15.756 3.982   1.00 36.45  ? 351  LEU A HD23 1 
ATOM   4227  N  N    . GLN A 1 273 ? -46.214 -13.160 0.424   1.00 21.32  ? 352  GLN A N    1 
ATOM   4228  C  CA   . GLN A 1 273 ? -47.403 -12.430 -0.014  1.00 18.64  ? 352  GLN A CA   1 
ATOM   4229  C  C    . GLN A 1 273 ? -48.654 -13.302 0.074   1.00 22.45  ? 352  GLN A C    1 
ATOM   4230  O  O    . GLN A 1 273 ? -49.711 -12.842 0.506   1.00 25.84  ? 352  GLN A O    1 
ATOM   4231  C  CB   . GLN A 1 273 ? -47.224 -11.923 -1.443  1.00 15.11  ? 352  GLN A CB   1 
ATOM   4232  C  CG   . GLN A 1 273 ? -46.365 -10.680 -1.559  1.00 13.24  ? 352  GLN A CG   1 
ATOM   4233  C  CD   . GLN A 1 273 ? -46.108 -10.292 -2.998  1.00 18.92  ? 352  GLN A CD   1 
ATOM   4234  O  OE1  . GLN A 1 273 ? -46.620 -10.926 -3.922  1.00 19.41  ? 352  GLN A OE1  1 
ATOM   4235  N  NE2  . GLN A 1 273 ? -45.318 -9.240  -3.199  1.00 26.16  ? 352  GLN A NE2  1 
ATOM   4236  H  H    . GLN A 1 273 ? -45.586 -13.196 -0.162  1.00 25.58  ? 352  GLN A H    1 
ATOM   4237  H  HA   . GLN A 1 273 ? -47.532 -11.661 0.564   1.00 22.37  ? 352  GLN A HA   1 
ATOM   4238  H  HB2  . GLN A 1 273 ? -46.806 -12.621 -1.971  1.00 18.13  ? 352  GLN A HB2  1 
ATOM   4239  H  HB3  . GLN A 1 273 ? -48.097 -11.714 -1.811  1.00 18.13  ? 352  GLN A HB3  1 
ATOM   4240  H  HG2  . GLN A 1 273 ? -46.817 -9.940  -1.123  1.00 15.89  ? 352  GLN A HG2  1 
ATOM   4241  H  HG3  . GLN A 1 273 ? -45.509 -10.844 -1.134  1.00 15.89  ? 352  GLN A HG3  1 
ATOM   4242  H  HE21 . GLN A 1 273 ? -44.983 -8.820  -2.529  1.00 31.40  ? 352  GLN A HE21 1 
ATOM   4243  H  HE22 . GLN A 1 273 ? -45.143 -8.982  -4.001  1.00 31.40  ? 352  GLN A HE22 1 
ATOM   4244  N  N    . GLY A 1 274 ? -48.523 -14.563 -0.328  1.00 20.87  ? 353  GLY A N    1 
ATOM   4245  C  CA   . GLY A 1 274 ? -49.608 -15.524 -0.223  1.00 16.16  ? 353  GLY A CA   1 
ATOM   4246  C  C    . GLY A 1 274 ? -50.110 -15.706 1.198   1.00 21.31  ? 353  GLY A C    1 
ATOM   4247  O  O    . GLY A 1 274 ? -51.216 -16.199 1.412   1.00 24.27  ? 353  GLY A O    1 
ATOM   4248  H  H    . GLY A 1 274 ? -47.804 -14.888 -0.669  1.00 25.05  ? 353  GLY A H    1 
ATOM   4249  H  HA2  . GLY A 1 274 ? -50.351 -15.230 -0.773  1.00 19.39  ? 353  GLY A HA2  1 
ATOM   4250  H  HA3  . GLY A 1 274 ? -49.307 -16.385 -0.553  1.00 19.39  ? 353  GLY A HA3  1 
ATOM   4251  N  N    . LEU A 1 275 ? -49.302 -15.302 2.173   1.00 27.02  ? 354  LEU A N    1 
ATOM   4252  C  CA   . LEU A 1 275 ? -49.649 -15.488 3.577   1.00 27.79  ? 354  LEU A CA   1 
ATOM   4253  C  C    . LEU A 1 275 ? -50.297 -14.242 4.160   1.00 35.13  ? 354  LEU A C    1 
ATOM   4254  O  O    . LEU A 1 275 ? -50.601 -14.197 5.351   1.00 36.34  ? 354  LEU A O    1 
ATOM   4255  C  CB   . LEU A 1 275 ? -48.406 -15.866 4.385   1.00 26.06  ? 354  LEU A CB   1 
ATOM   4256  C  CG   . LEU A 1 275 ? -47.664 -17.117 3.902   1.00 30.04  ? 354  LEU A CG   1 
ATOM   4257  C  CD1  . LEU A 1 275 ? -46.440 -17.402 4.770   1.00 33.00  ? 354  LEU A CD1  1 
ATOM   4258  C  CD2  . LEU A 1 275 ? -48.596 -18.325 3.870   1.00 34.70  ? 354  LEU A CD2  1 
ATOM   4259  H  H    . LEU A 1 275 ? -48.544 -14.916 2.047   1.00 32.42  ? 354  LEU A H    1 
ATOM   4260  H  HA   . LEU A 1 275 ? -50.285 -16.217 3.649   1.00 33.35  ? 354  LEU A HA   1 
ATOM   4261  H  HB2  . LEU A 1 275 ? -47.780 -15.125 4.351   1.00 31.28  ? 354  LEU A HB2  1 
ATOM   4262  H  HB3  . LEU A 1 275 ? -48.673 -16.022 5.304   1.00 31.28  ? 354  LEU A HB3  1 
ATOM   4263  H  HG   . LEU A 1 275 ? -47.352 -16.963 2.997   1.00 36.04  ? 354  LEU A HG   1 
ATOM   4264  H  HD11 . LEU A 1 275 ? -45.996 -18.198 4.438   1.00 39.60  ? 354  LEU A HD11 1 
ATOM   4265  H  HD12 . LEU A 1 275 ? -45.838 -16.643 4.725   1.00 39.60  ? 354  LEU A HD12 1 
ATOM   4266  H  HD13 . LEU A 1 275 ? -46.729 -17.542 5.686   1.00 39.60  ? 354  LEU A HD13 1 
ATOM   4267  H  HD21 . LEU A 1 275 ? -48.099 -19.098 3.561   1.00 41.64  ? 354  LEU A HD21 1 
ATOM   4268  H  HD22 . LEU A 1 275 ? -48.935 -18.484 4.764   1.00 41.64  ? 354  LEU A HD22 1 
ATOM   4269  H  HD23 . LEU A 1 275 ? -49.330 -18.140 3.265   1.00 41.64  ? 354  LEU A HD23 1 
ATOM   4270  N  N    . TYR A 1 276 ? -50.500 -13.231 3.322   1.00 38.78  ? 355  TYR A N    1 
ATOM   4271  C  CA   . TYR A 1 276 ? -51.237 -12.038 3.723   1.00 38.31  ? 355  TYR A CA   1 
ATOM   4272  C  C    . TYR A 1 276 ? -52.494 -11.848 2.884   1.00 40.32  ? 355  TYR A C    1 
ATOM   4273  O  O    . TYR A 1 276 ? -53.550 -11.503 3.411   1.00 49.08  ? 355  TYR A O    1 
ATOM   4274  C  CB   . TYR A 1 276 ? -50.355 -10.804 3.592   1.00 30.77  ? 355  TYR A CB   1 
ATOM   4275  C  CG   . TYR A 1 276 ? -49.259 -10.720 4.619   1.00 28.95  ? 355  TYR A CG   1 
ATOM   4276  C  CD1  . TYR A 1 276 ? -48.047 -11.358 4.418   1.00 32.64  ? 355  TYR A CD1  1 
ATOM   4277  C  CD2  . TYR A 1 276 ? -49.432 -9.991  5.785   1.00 28.07  ? 355  TYR A CD2  1 
ATOM   4278  C  CE1  . TYR A 1 276 ? -47.037 -11.278 5.351   1.00 27.98  ? 355  TYR A CE1  1 
ATOM   4279  C  CE2  . TYR A 1 276 ? -48.430 -9.901  6.724   1.00 25.13  ? 355  TYR A CE2  1 
ATOM   4280  C  CZ   . TYR A 1 276 ? -47.235 -10.547 6.503   1.00 29.25  ? 355  TYR A CZ   1 
ATOM   4281  O  OH   . TYR A 1 276 ? -46.244 -10.462 7.445   1.00 37.26  ? 355  TYR A OH   1 
ATOM   4282  H  H    . TYR A 1 276 ? -50.219 -13.211 2.509   1.00 46.54  ? 355  TYR A H    1 
ATOM   4283  H  HA   . TYR A 1 276 ? -51.502 -12.124 4.652   1.00 45.97  ? 355  TYR A HA   1 
ATOM   4284  H  HB2  . TYR A 1 276 ? -49.939 -10.810 2.716   1.00 36.93  ? 355  TYR A HB2  1 
ATOM   4285  H  HB3  . TYR A 1 276 ? -50.909 -10.013 3.686   1.00 36.93  ? 355  TYR A HB3  1 
ATOM   4286  H  HD1  . TYR A 1 276 ? -47.913 -11.850 3.640   1.00 39.17  ? 355  TYR A HD1  1 
ATOM   4287  H  HD2  . TYR A 1 276 ? -50.239 -9.553  5.934   1.00 33.69  ? 355  TYR A HD2  1 
ATOM   4288  H  HE1  . TYR A 1 276 ? -46.228 -11.715 5.205   1.00 33.57  ? 355  TYR A HE1  1 
ATOM   4289  H  HE2  . TYR A 1 276 ? -48.561 -9.411  7.504   1.00 30.16  ? 355  TYR A HE2  1 
ATOM   4290  H  HH   . TYR A 1 276 ? -46.500 -9.988  8.090   1.00 44.71  ? 355  TYR A HH   1 
ATOM   4291  N  N    . TYR A 1 277 ? -52.371 -12.071 1.579   1.00 58.59  ? 356  TYR A N    1 
ATOM   4292  C  CA   . TYR A 1 277 ? -53.497 -11.944 0.658   1.00 65.46  ? 356  TYR A CA   1 
ATOM   4293  C  C    . TYR A 1 277 ? -54.118 -13.315 0.381   1.00 75.99  ? 356  TYR A C    1 
ATOM   4294  O  O    . TYR A 1 277 ? -53.381 -14.275 0.162   1.00 71.90  ? 356  TYR A O    1 
ATOM   4295  C  CB   . TYR A 1 277 ? -53.007 -11.337 -0.657  1.00 65.99  ? 356  TYR A CB   1 
ATOM   4296  C  CG   . TYR A 1 277 ? -54.064 -11.249 -1.735  1.00 77.32  ? 356  TYR A CG   1 
ATOM   4297  C  CD1  . TYR A 1 277 ? -54.290 -12.310 -2.605  1.00 82.69  ? 356  TYR A CD1  1 
ATOM   4298  C  CD2  . TYR A 1 277 ? -54.830 -10.103 -1.889  1.00 82.54  ? 356  TYR A CD2  1 
ATOM   4299  C  CE1  . TYR A 1 277 ? -55.253 -12.234 -3.592  1.00 84.33  ? 356  TYR A CE1  1 
ATOM   4300  C  CE2  . TYR A 1 277 ? -55.794 -10.015 -2.874  1.00 86.98  ? 356  TYR A CE2  1 
ATOM   4301  C  CZ   . TYR A 1 277 ? -56.002 -11.084 -3.723  1.00 85.53  ? 356  TYR A CZ   1 
ATOM   4302  O  OH   . TYR A 1 277 ? -56.963 -11.011 -4.705  1.00 83.78  ? 356  TYR A OH   1 
ATOM   4303  H  H    . TYR A 1 277 ? -51.635 -12.299 1.198   1.00 70.31  ? 356  TYR A H    1 
ATOM   4304  H  HA   . TYR A 1 277 ? -54.173 -11.364 1.041   1.00 78.55  ? 356  TYR A HA   1 
ATOM   4305  H  HB2  . TYR A 1 277 ? -52.688 -10.437 -0.484  1.00 79.19  ? 356  TYR A HB2  1 
ATOM   4306  H  HB3  . TYR A 1 277 ? -52.281 -11.881 -1.000  1.00 79.19  ? 356  TYR A HB3  1 
ATOM   4307  H  HD1  . TYR A 1 277 ? -53.786 -13.087 -2.518  1.00 99.22  ? 356  TYR A HD1  1 
ATOM   4308  H  HD2  . TYR A 1 277 ? -54.692 -9.381  -1.319  1.00 99.04  ? 356  TYR A HD2  1 
ATOM   4309  H  HE1  . TYR A 1 277 ? -55.395 -12.952 -4.165  1.00 101.20 ? 356  TYR A HE1  1 
ATOM   4310  H  HE2  . TYR A 1 277 ? -56.302 -9.241  -2.964  1.00 104.37 ? 356  TYR A HE2  1 
ATOM   4311  H  HH   . TYR A 1 277 ? -57.345 -10.263 -4.678  1.00 100.54 ? 356  TYR A HH   1 
ATOM   4312  N  N    . ASN A 1 278 ? -55.448 -13.436 0.380   1.00 109.29 ? 357  ASN A N    1 
ATOM   4313  C  CA   . ASN A 1 278 ? -56.382 -12.360 0.697   1.00 108.45 ? 357  ASN A CA   1 
ATOM   4314  C  C    . ASN A 1 278 ? -56.506 -12.154 2.200   1.00 106.03 ? 357  ASN A C    1 
ATOM   4315  O  O    . ASN A 1 278 ? -56.814 -11.055 2.663   1.00 111.48 ? 357  ASN A O    1 
ATOM   4316  C  CB   . ASN A 1 278 ? -57.772 -12.690 0.136   1.00 111.86 ? 357  ASN A CB   1 
ATOM   4317  C  CG   . ASN A 1 278 ? -58.053 -11.995 -1.181  1.00 113.25 ? 357  ASN A CG   1 
ATOM   4318  O  OD1  . ASN A 1 278 ? -58.231 -10.778 -1.225  1.00 107.28 ? 357  ASN A OD1  1 
ATOM   4319  N  ND2  . ASN A 1 278 ? -58.114 -12.768 -2.262  1.00 116.11 ? 357  ASN A ND2  1 
ATOM   4320  H  H    . ASN A 1 278 ? -55.849 -14.172 0.189   1.00 131.15 ? 357  ASN A H    1 
ATOM   4321  H  HA   . ASN A 1 278 ? -56.074 -11.532 0.294   1.00 130.14 ? 357  ASN A HA   1 
ATOM   4322  H  HB2  . ASN A 1 278 ? -57.834 -13.647 -0.010  1.00 134.23 ? 357  ASN A HB2  1 
ATOM   4323  H  HB3  . ASN A 1 278 ? -58.445 -12.407 0.774   1.00 134.23 ? 357  ASN A HB3  1 
ATOM   4324  H  HD21 . ASN A 1 278 ? -58.272 -12.419 -3.032  1.00 139.34 ? 357  ASN A HD21 1 
ATOM   4325  H  HD22 . ASN A 1 278 ? -57.997 -13.617 -2.191  1.00 139.34 ? 357  ASN A HD22 1 
ATOM   4326  N  N    . LYS A 1 279 ? -56.239 -13.217 2.954   1.00 69.38  ? 358  LYS A N    1 
ATOM   4327  C  CA   . LYS A 1 279 ? -56.705 -13.322 4.334   1.00 72.19  ? 358  LYS A CA   1 
ATOM   4328  C  C    . LYS A 1 279 ? -55.609 -13.257 5.400   1.00 66.40  ? 358  LYS A C    1 
ATOM   4329  O  O    . LYS A 1 279 ? -54.458 -13.616 5.157   1.00 68.05  ? 358  LYS A O    1 
ATOM   4330  C  CB   . LYS A 1 279 ? -57.511 -14.615 4.489   1.00 81.07  ? 358  LYS A CB   1 
ATOM   4331  C  CG   . LYS A 1 279 ? -58.762 -14.663 3.609   1.00 82.04  ? 358  LYS A CG   1 
ATOM   4332  C  CD   . LYS A 1 279 ? -60.006 -14.132 4.325   1.00 77.76  ? 358  LYS A CD   1 
ATOM   4333  C  CE   . LYS A 1 279 ? -60.783 -13.128 3.477   1.00 78.80  ? 358  LYS A CE   1 
ATOM   4334  N  NZ   . LYS A 1 279 ? -60.341 -11.729 3.728   1.00 72.29  ? 358  LYS A NZ   1 
ATOM   4335  H  H    . LYS A 1 279 ? -55.785 -13.897 2.687   1.00 83.26  ? 358  LYS A H    1 
ATOM   4336  H  HA   . LYS A 1 279 ? -57.311 -12.584 4.504   1.00 86.62  ? 358  LYS A HA   1 
ATOM   4337  H  HB2  . LYS A 1 279 ? -56.948 -15.367 4.246   1.00 97.28  ? 358  LYS A HB2  1 
ATOM   4338  H  HB3  . LYS A 1 279 ? -57.794 -14.700 5.413   1.00 97.28  ? 358  LYS A HB3  1 
ATOM   4339  H  HG2  . LYS A 1 279 ? -58.615 -14.118 2.820   1.00 98.45  ? 358  LYS A HG2  1 
ATOM   4340  H  HG3  . LYS A 1 279 ? -58.933 -15.582 3.351   1.00 98.45  ? 358  LYS A HG3  1 
ATOM   4341  H  HD2  . LYS A 1 279 ? -60.596 -14.875 4.528   1.00 93.31  ? 358  LYS A HD2  1 
ATOM   4342  H  HD3  . LYS A 1 279 ? -59.736 -13.689 5.144   1.00 93.31  ? 358  LYS A HD3  1 
ATOM   4343  H  HE2  . LYS A 1 279 ? -60.640 -13.327 2.538   1.00 94.56  ? 358  LYS A HE2  1 
ATOM   4344  H  HE3  . LYS A 1 279 ? -61.726 -13.191 3.693   1.00 94.56  ? 358  LYS A HE3  1 
ATOM   4345  H  HZ1  . LYS A 1 279 ? -60.810 -11.166 3.222   1.00 86.75  ? 358  LYS A HZ1  1 
ATOM   4346  H  HZ2  . LYS A 1 279 ? -60.466 -11.519 4.584   1.00 86.75  ? 358  LYS A HZ2  1 
ATOM   4347  H  HZ3  . LYS A 1 279 ? -59.477 -11.643 3.533   1.00 86.75  ? 358  LYS A HZ3  1 
ATOM   4348  N  N    . GLU A 1 280 ? -56.011 -12.792 6.580   1.00 88.88  ? 359  GLU A N    1 
ATOM   4349  C  CA   . GLU A 1 280 ? -55.152 -12.645 7.750   1.00 95.99  ? 359  GLU A CA   1 
ATOM   4350  C  C    . GLU A 1 280 ? -55.916 -13.335 8.890   1.00 86.64  ? 359  GLU A C    1 
ATOM   4351  O  O    . GLU A 1 280 ? -57.017 -13.818 8.635   1.00 89.80  ? 359  GLU A O    1 
ATOM   4352  C  CB   . GLU A 1 280 ? -54.910 -11.150 7.969   1.00 104.14 ? 359  GLU A CB   1 
ATOM   4353  C  CG   . GLU A 1 280 ? -53.790 -10.596 7.079   1.00 103.25 ? 359  GLU A CG   1 
ATOM   4354  C  CD   . GLU A 1 280 ? -53.969 -9.128  6.715   1.00 111.30 ? 359  GLU A CD   1 
ATOM   4355  O  OE1  . GLU A 1 280 ? -55.001 -8.530  7.095   1.00 117.87 ? 359  GLU A OE1  1 
ATOM   4356  O  OE2  . GLU A 1 280 ? -53.075 -8.572  6.037   1.00 103.90 ? 359  GLU A OE2  1 
ATOM   4357  H  H    . GLU A 1 280 ? -56.820 -12.543 6.732   1.00 106.65 ? 359  GLU A H    1 
ATOM   4358  H  HA   . GLU A 1 280 ? -54.304 -13.095 7.608   1.00 115.19 ? 359  GLU A HA   1 
ATOM   4359  H  HB2  . GLU A 1 280 ? -55.724 -10.664 7.764   1.00 124.97 ? 359  GLU A HB2  1 
ATOM   4360  H  HB3  . GLU A 1 280 ? -54.659 -11.002 8.894   1.00 124.97 ? 359  GLU A HB3  1 
ATOM   4361  H  HG2  . GLU A 1 280 ? -52.945 -10.685 7.548   1.00 123.90 ? 359  GLU A HG2  1 
ATOM   4362  H  HG3  . GLU A 1 280 ? -53.764 -11.105 6.254   1.00 123.90 ? 359  GLU A HG3  1 
ATOM   4363  N  N    . LEU A 1 281 ? -55.406 -13.420 10.124  1.00 76.33  ? 360  LEU A N    1 
ATOM   4364  C  CA   . LEU A 1 281 ? -54.238 -12.720 10.644  1.00 72.74  ? 360  LEU A CA   1 
ATOM   4365  C  C    . LEU A 1 281 ? -53.476 -13.693 11.548  1.00 73.98  ? 360  LEU A C    1 
ATOM   4366  O  O    . LEU A 1 281 ? -54.098 -14.445 12.300  1.00 82.80  ? 360  LEU A O    1 
ATOM   4367  C  CB   . LEU A 1 281 ? -54.731 -11.523 11.464  1.00 76.21  ? 360  LEU A CB   1 
ATOM   4368  C  CG   . LEU A 1 281 ? -53.815 -10.375 11.898  1.00 93.10  ? 360  LEU A CG   1 
ATOM   4369  C  CD1  . LEU A 1 281 ? -54.675 -9.266  12.490  1.00 93.24  ? 360  LEU A CD1  1 
ATOM   4370  C  CD2  . LEU A 1 281 ? -52.768 -10.816 12.909  1.00 92.14  ? 360  LEU A CD2  1 
ATOM   4371  H  H    . LEU A 1 281 ? -55.759 -13.926 10.723  1.00 91.60  ? 360  LEU A H    1 
ATOM   4372  H  HA   . LEU A 1 281 ? -53.664 -12.416 9.924   1.00 87.28  ? 360  LEU A HA   1 
ATOM   4373  H  HB2  . LEU A 1 281 ? -55.446 -11.111 10.954  1.00 91.45  ? 360  LEU A HB2  1 
ATOM   4374  H  HB3  . LEU A 1 281 ? -55.109 -11.882 12.282  1.00 91.45  ? 360  LEU A HB3  1 
ATOM   4375  H  HG   . LEU A 1 281 ? -53.356 -10.021 11.121  1.00 111.71 ? 360  LEU A HG   1 
ATOM   4376  H  HD11 . LEU A 1 281 ? -54.101 -8.535  12.767  1.00 111.88 ? 360  LEU A HD11 1 
ATOM   4377  H  HD12 . LEU A 1 281 ? -55.301 -8.958  11.816  1.00 111.88 ? 360  LEU A HD12 1 
ATOM   4378  H  HD13 . LEU A 1 281 ? -55.159 -9.615  13.255  1.00 111.88 ? 360  LEU A HD13 1 
ATOM   4379  H  HD21 . LEU A 1 281 ? -52.219 -10.053 13.148  1.00 110.57 ? 360  LEU A HD21 1 
ATOM   4380  H  HD22 . LEU A 1 281 ? -53.215 -11.161 13.697  1.00 110.57 ? 360  LEU A HD22 1 
ATOM   4381  H  HD23 . LEU A 1 281 ? -52.217 -11.509 12.511  1.00 110.57 ? 360  LEU A HD23 1 
ATOM   4382  N  N    . ASN A 1 282 ? -52.143 -13.678 11.488  1.00 47.92  ? 361  ASN A N    1 
ATOM   4383  C  CA   . ASN A 1 282 ? -51.329 -14.674 12.192  1.00 46.53  ? 361  ASN A CA   1 
ATOM   4384  C  C    . ASN A 1 282 ? -50.251 -14.065 13.093  1.00 42.31  ? 361  ASN A C    1 
ATOM   4385  O  O    . ASN A 1 282 ? -49.404 -13.300 12.634  1.00 46.93  ? 361  ASN A O    1 
ATOM   4386  C  CB   . ASN A 1 282 ? -50.678 -15.624 11.179  1.00 46.41  ? 361  ASN A CB   1 
ATOM   4387  C  CG   . ASN A 1 282 ? -50.166 -16.902 11.821  1.00 46.86  ? 361  ASN A CG   1 
ATOM   4388  O  OD1  . ASN A 1 282 ? -49.222 -16.876 12.609  1.00 45.90  ? 361  ASN A OD1  1 
ATOM   4389  N  ND2  . ASN A 1 282 ? -50.779 -18.028 11.474  1.00 41.38  ? 361  ASN A ND2  1 
ATOM   4390  H  H    . ASN A 1 282 ? -51.685 -13.100 11.045  1.00 57.51  ? 361  ASN A H    1 
ATOM   4391  H  HA   . ASN A 1 282 ? -51.913 -15.205 12.755  1.00 55.83  ? 361  ASN A HA   1 
ATOM   4392  H  HB2  . ASN A 1 282 ? -51.334 -15.868 10.507  1.00 55.69  ? 361  ASN A HB2  1 
ATOM   4393  H  HB3  . ASN A 1 282 ? -49.926 -15.175 10.762  1.00 55.69  ? 361  ASN A HB3  1 
ATOM   4394  H  HD21 . ASN A 1 282 ? -50.524 -18.777 11.811  1.00 49.66  ? 361  ASN A HD21 1 
ATOM   4395  H  HD22 . ASN A 1 282 ? -51.430 -18.008 10.913  1.00 49.66  ? 361  ASN A HD22 1 
ATOM   4396  N  N    . SER A 1 283 ? -50.286 -14.423 14.375  1.00 44.80  ? 362  SER A N    1 
ATOM   4397  C  CA   . SER A 1 283 ? -49.305 -13.939 15.343  1.00 49.45  ? 362  SER A CA   1 
ATOM   4398  C  C    . SER A 1 283 ? -47.899 -14.447 15.022  1.00 53.29  ? 362  SER A C    1 
ATOM   4399  O  O    . SER A 1 283 ? -46.911 -13.742 15.244  1.00 54.20  ? 362  SER A O    1 
ATOM   4400  C  CB   . SER A 1 283 ? -49.693 -14.379 16.757  1.00 54.01  ? 362  SER A CB   1 
ATOM   4401  O  OG   . SER A 1 283 ? -49.982 -15.766 16.790  1.00 56.17  ? 362  SER A OG   1 
ATOM   4402  H  H    . SER A 1 283 ? -50.874 -14.952 14.712  1.00 53.76  ? 362  SER A H    1 
ATOM   4403  H  HA   . SER A 1 283 ? -49.289 -12.969 15.322  1.00 59.34  ? 362  SER A HA   1 
ATOM   4404  H  HB2  . SER A 1 283 ? -48.954 -14.196 17.358  1.00 64.81  ? 362  SER A HB2  1 
ATOM   4405  H  HB3  . SER A 1 283 ? -50.480 -13.885 17.037  1.00 64.81  ? 362  SER A HB3  1 
ATOM   4406  H  HG   . SER A 1 283 ? -50.194 -15.997 17.570  1.00 67.40  ? 362  SER A HG   1 
ATOM   4407  N  N    . LYS A 1 284 ? -47.808 -15.674 14.516  1.00 46.02  ? 363  LYS A N    1 
ATOM   4408  C  CA   . LYS A 1 284 ? -46.513 -16.272 14.198  1.00 39.83  ? 363  LYS A CA   1 
ATOM   4409  C  C    . LYS A 1 284 ? -45.904 -15.650 12.946  1.00 36.14  ? 363  LYS A C    1 
ATOM   4410  O  O    . LYS A 1 284 ? -44.683 -15.572 12.813  1.00 40.21  ? 363  LYS A O    1 
ATOM   4411  C  CB   . LYS A 1 284 ? -46.635 -17.791 14.021  1.00 44.41  ? 363  LYS A CB   1 
ATOM   4412  C  CG   . LYS A 1 284 ? -45.935 -18.608 15.107  1.00 51.47  ? 363  LYS A CG   1 
ATOM   4413  C  CD   . LYS A 1 284 ? -44.400 -18.530 15.012  1.00 50.47  ? 363  LYS A CD   1 
ATOM   4414  C  CE   . LYS A 1 284 ? -43.719 -19.452 16.024  1.00 48.07  ? 363  LYS A CE   1 
ATOM   4415  N  NZ   . LYS A 1 284 ? -43.963 -20.896 15.737  1.00 43.09  ? 363  LYS A NZ   1 
ATOM   4416  H  H    . LYS A 1 284 ? -48.482 -16.182 14.347  1.00 55.23  ? 363  LYS A H    1 
ATOM   4417  H  HA   . LYS A 1 284 ? -45.904 -16.108 14.936  1.00 47.79  ? 363  LYS A HA   1 
ATOM   4418  H  HB2  . LYS A 1 284 ? -47.575 -18.031 14.032  1.00 53.30  ? 363  LYS A HB2  1 
ATOM   4419  H  HB3  . LYS A 1 284 ? -46.244 -18.037 13.168  1.00 53.30  ? 363  LYS A HB3  1 
ATOM   4420  H  HG2  . LYS A 1 284 ? -46.199 -18.271 15.977  1.00 61.76  ? 363  LYS A HG2  1 
ATOM   4421  H  HG3  . LYS A 1 284 ? -46.194 -19.539 15.019  1.00 61.76  ? 363  LYS A HG3  1 
ATOM   4422  H  HD2  . LYS A 1 284 ? -44.122 -18.799 14.122  1.00 60.57  ? 363  LYS A HD2  1 
ATOM   4423  H  HD3  . LYS A 1 284 ? -44.116 -17.620 15.191  1.00 60.57  ? 363  LYS A HD3  1 
ATOM   4424  H  HE2  . LYS A 1 284 ? -42.762 -19.298 15.999  1.00 57.68  ? 363  LYS A HE2  1 
ATOM   4425  H  HE3  . LYS A 1 284 ? -44.064 -19.260 16.910  1.00 57.68  ? 363  LYS A HE3  1 
ATOM   4426  H  HZ1  . LYS A 1 284 ? -43.552 -21.400 16.344  1.00 51.70  ? 363  LYS A HZ1  1 
ATOM   4427  H  HZ2  . LYS A 1 284 ? -44.836 -21.067 15.760  1.00 51.70  ? 363  LYS A HZ2  1 
ATOM   4428  H  HZ3  . LYS A 1 284 ? -43.649 -21.102 14.930  1.00 51.70  ? 363  LYS A HZ3  1 
ATOM   4429  N  N    . LEU A 1 285 ? -46.758 -15.221 12.024  1.00 36.88  ? 364  LEU A N    1 
ATOM   4430  C  CA   . LEU A 1 285 ? -46.296 -14.577 10.801  1.00 29.78  ? 364  LEU A CA   1 
ATOM   4431  C  C    . LEU A 1 285 ? -45.752 -13.183 11.090  1.00 30.92  ? 364  LEU A C    1 
ATOM   4432  O  O    . LEU A 1 285 ? -44.751 -12.770 10.510  1.00 35.74  ? 364  LEU A O    1 
ATOM   4433  C  CB   . LEU A 1 285 ? -47.438 -14.475 9.791   1.00 24.83  ? 364  LEU A CB   1 
ATOM   4434  C  CG   . LEU A 1 285 ? -47.046 -13.982 8.396   1.00 23.16  ? 364  LEU A CG   1 
ATOM   4435  C  CD1  . LEU A 1 285 ? -46.100 -14.960 7.723   1.00 30.33  ? 364  LEU A CD1  1 
ATOM   4436  C  CD2  . LEU A 1 285 ? -48.271 -13.772 7.532   1.00 24.72  ? 364  LEU A CD2  1 
ATOM   4437  H  H    . LEU A 1 285 ? -47.614 -15.290 12.083  1.00 44.26  ? 364  LEU A H    1 
ATOM   4438  H  HA   . LEU A 1 285 ? -45.585 -15.107 10.407  1.00 35.73  ? 364  LEU A HA   1 
ATOM   4439  H  HB2  . LEU A 1 285 ? -47.834 -15.355 9.687   1.00 29.80  ? 364  LEU A HB2  1 
ATOM   4440  H  HB3  . LEU A 1 285 ? -48.102 -13.861 10.140  1.00 29.80  ? 364  LEU A HB3  1 
ATOM   4441  H  HG   . LEU A 1 285 ? -46.589 -13.131 8.479   1.00 27.79  ? 364  LEU A HG   1 
ATOM   4442  H  HD11 . LEU A 1 285 ? -45.870 -14.621 6.843   1.00 36.40  ? 364  LEU A HD11 1 
ATOM   4443  H  HD12 . LEU A 1 285 ? -45.300 -15.047 8.263   1.00 36.40  ? 364  LEU A HD12 1 
ATOM   4444  H  HD13 . LEU A 1 285 ? -46.541 -15.820 7.642   1.00 36.40  ? 364  LEU A HD13 1 
ATOM   4445  H  HD21 . LEU A 1 285 ? -47.990 -13.461 6.657   1.00 29.66  ? 364  LEU A HD21 1 
ATOM   4446  H  HD22 . LEU A 1 285 ? -48.745 -14.614 7.447   1.00 29.66  ? 364  LEU A HD22 1 
ATOM   4447  H  HD23 . LEU A 1 285 ? -48.843 -13.111 7.951   1.00 29.66  ? 364  LEU A HD23 1 
ATOM   4448  N  N    . GLU A 1 286 ? -46.425 -12.457 11.978  1.00 48.39  ? 365  GLU A N    1 
ATOM   4449  C  CA   . GLU A 1 286 ? -46.024 -11.094 12.322  1.00 54.20  ? 365  GLU A CA   1 
ATOM   4450  C  C    . GLU A 1 286 ? -44.712 -11.054 13.103  1.00 51.86  ? 365  GLU A C    1 
ATOM   4451  O  O    . GLU A 1 286 ? -43.981 -10.066 13.054  1.00 56.90  ? 365  GLU A O    1 
ATOM   4452  C  CB   . GLU A 1 286 ? -47.130 -10.396 13.121  1.00 57.57  ? 365  GLU A CB   1 
ATOM   4453  C  CG   . GLU A 1 286 ? -48.172 -9.690  12.257  1.00 64.78  ? 365  GLU A CG   1 
ATOM   4454  C  CD   . GLU A 1 286 ? -49.272 -9.030  13.071  1.00 77.16  ? 365  GLU A CD   1 
ATOM   4455  O  OE1  . GLU A 1 286 ? -49.119 -8.912  14.306  1.00 80.05  ? 365  GLU A OE1  1 
ATOM   4456  O  OE2  . GLU A 1 286 ? -50.289 -8.627  12.470  1.00 78.01  ? 365  GLU A OE2  1 
ATOM   4457  H  H    . GLU A 1 286 ? -47.122 -12.733 12.400  1.00 58.06  ? 365  GLU A H    1 
ATOM   4458  H  HA   . GLU A 1 286 ? -45.893 -10.594 11.502  1.00 65.04  ? 365  GLU A HA   1 
ATOM   4459  H  HB2  . GLU A 1 286 ? -47.592 -11.058 13.659  1.00 69.08  ? 365  GLU A HB2  1 
ATOM   4460  H  HB3  . GLU A 1 286 ? -46.724 -9.730  13.698  1.00 69.08  ? 365  GLU A HB3  1 
ATOM   4461  H  HG2  . GLU A 1 286 ? -47.733 -9.002  11.733  1.00 77.74  ? 365  GLU A HG2  1 
ATOM   4462  H  HG3  . GLU A 1 286 ? -48.586 -10.341 11.668  1.00 77.74  ? 365  GLU A HG3  1 
ATOM   4463  N  N    . LEU A 1 287 ? -44.420 -12.127 13.829  1.00 42.17  ? 366  LEU A N    1 
ATOM   4464  C  CA   . LEU A 1 287 ? -43.177 -12.214 14.584  1.00 44.07  ? 366  LEU A CA   1 
ATOM   4465  C  C    . LEU A 1 287 ? -42.005 -12.370 13.623  1.00 40.31  ? 366  LEU A C    1 
ATOM   4466  O  O    . LEU A 1 287 ? -40.980 -11.704 13.756  1.00 42.53  ? 366  LEU A O    1 
ATOM   4467  C  CB   . LEU A 1 287 ? -43.217 -13.404 15.542  1.00 47.94  ? 366  LEU A CB   1 
ATOM   4468  C  CG   . LEU A 1 287 ? -42.115 -13.404 16.602  1.00 51.31  ? 366  LEU A CG   1 
ATOM   4469  C  CD1  . LEU A 1 287 ? -42.436 -12.385 17.691  1.00 56.48  ? 366  LEU A CD1  1 
ATOM   4470  C  CD2  . LEU A 1 287 ? -41.911 -14.797 17.184  1.00 51.77  ? 366  LEU A CD2  1 
ATOM   4471  H  H    . LEU A 1 287 ? -44.926 -12.819 13.901  1.00 50.60  ? 366  LEU A H    1 
ATOM   4472  H  HA   . LEU A 1 287 ? -43.050 -11.403 15.101  1.00 52.88  ? 366  LEU A HA   1 
ATOM   4473  H  HB2  . LEU A 1 287 ? -44.070 -13.401 16.005  1.00 57.53  ? 366  LEU A HB2  1 
ATOM   4474  H  HB3  . LEU A 1 287 ? -43.129 -14.221 15.026  1.00 57.53  ? 366  LEU A HB3  1 
ATOM   4475  H  HG   . LEU A 1 287 ? -41.282 -13.134 16.183  1.00 61.57  ? 366  LEU A HG   1 
ATOM   4476  H  HD11 . LEU A 1 287 ? -41.728 -12.398 18.353  1.00 67.78  ? 366  LEU A HD11 1 
ATOM   4477  H  HD12 . LEU A 1 287 ? -42.499 -11.504 17.290  1.00 67.78  ? 366  LEU A HD12 1 
ATOM   4478  H  HD13 . LEU A 1 287 ? -43.281 -12.622 18.104  1.00 67.78  ? 366  LEU A HD13 1 
ATOM   4479  H  HD21 . LEU A 1 287 ? -41.207 -14.760 17.851  1.00 62.12  ? 366  LEU A HD21 1 
ATOM   4480  H  HD22 . LEU A 1 287 ? -42.739 -15.091 17.594  1.00 62.12  ? 366  LEU A HD22 1 
ATOM   4481  H  HD23 . LEU A 1 287 ? -41.660 -15.403 16.470  1.00 62.12  ? 366  LEU A HD23 1 
ATOM   4482  N  N    . PHE A 1 288 ? -42.177 -13.265 12.659  1.00 30.95  ? 367  PHE A N    1 
ATOM   4483  C  CA   . PHE A 1 288 ? -41.189 -13.500 11.617  1.00 28.64  ? 367  PHE A CA   1 
ATOM   4484  C  C    . PHE A 1 288 ? -40.953 -12.251 10.785  1.00 32.90  ? 367  PHE A C    1 
ATOM   4485  O  O    . PHE A 1 288 ? -39.818 -11.926 10.444  1.00 34.84  ? 367  PHE A O    1 
ATOM   4486  C  CB   . PHE A 1 288 ? -41.677 -14.629 10.712  1.00 24.98  ? 367  PHE A CB   1 
ATOM   4487  C  CG   . PHE A 1 288 ? -40.943 -14.733 9.399   1.00 22.84  ? 367  PHE A CG   1 
ATOM   4488  C  CD1  . PHE A 1 288 ? -39.835 -15.556 9.275   1.00 25.96  ? 367  PHE A CD1  1 
ATOM   4489  C  CD2  . PHE A 1 288 ? -41.388 -14.046 8.280   1.00 29.48  ? 367  PHE A CD2  1 
ATOM   4490  C  CE1  . PHE A 1 288 ? -39.168 -15.670 8.069   1.00 24.96  ? 367  PHE A CE1  1 
ATOM   4491  C  CE2  . PHE A 1 288 ? -40.723 -14.155 7.069   1.00 25.44  ? 367  PHE A CE2  1 
ATOM   4492  C  CZ   . PHE A 1 288 ? -39.615 -14.971 6.964   1.00 26.62  ? 367  PHE A CZ   1 
ATOM   4493  H  H    . PHE A 1 288 ? -42.876 -13.761 12.586  1.00 37.15  ? 367  PHE A H    1 
ATOM   4494  H  HA   . PHE A 1 288 ? -40.348 -13.767 12.020  1.00 34.36  ? 367  PHE A HA   1 
ATOM   4495  H  HB2  . PHE A 1 288 ? -41.566 -15.472 11.179  1.00 29.97  ? 367  PHE A HB2  1 
ATOM   4496  H  HB3  . PHE A 1 288 ? -42.615 -14.486 10.515  1.00 29.97  ? 367  PHE A HB3  1 
ATOM   4497  H  HD1  . PHE A 1 288 ? -39.530 -16.029 10.014  1.00 31.15  ? 367  PHE A HD1  1 
ATOM   4498  H  HD2  . PHE A 1 288 ? -42.134 -13.495 8.346   1.00 35.38  ? 367  PHE A HD2  1 
ATOM   4499  H  HE1  . PHE A 1 288 ? -38.421 -16.219 8.001   1.00 29.96  ? 367  PHE A HE1  1 
ATOM   4500  H  HE2  . PHE A 1 288 ? -41.026 -13.683 6.328   1.00 30.53  ? 367  PHE A HE2  1 
ATOM   4501  H  HZ   . PHE A 1 288 ? -39.167 -15.045 6.153   1.00 31.95  ? 367  PHE A HZ   1 
ATOM   4502  N  N    . THR A 1 289 ? -42.034 -11.562 10.445  1.00 41.09  ? 368  THR A N    1 
ATOM   4503  C  CA   . THR A 1 289 ? -41.943 -10.394 9.583   1.00 38.13  ? 368  THR A CA   1 
ATOM   4504  C  C    . THR A 1 289 ? -41.240 -9.263  10.317  1.00 38.43  ? 368  THR A C    1 
ATOM   4505  O  O    . THR A 1 289 ? -40.429 -8.547  9.733   1.00 45.30  ? 368  THR A O    1 
ATOM   4506  C  CB   . THR A 1 289 ? -43.340 -9.957  9.089   1.00 40.63  ? 368  THR A CB   1 
ATOM   4507  O  OG1  . THR A 1 289 ? -43.863 -10.960 8.209   1.00 33.47  ? 368  THR A OG1  1 
ATOM   4508  C  CG2  . THR A 1 289 ? -43.287 -8.622  8.343   1.00 42.78  ? 368  THR A CG2  1 
ATOM   4509  H  H    . THR A 1 289 ? -42.833 -11.750 10.701  1.00 49.31  ? 368  THR A H    1 
ATOM   4510  H  HA   . THR A 1 289 ? -41.410 -10.620 8.804   1.00 45.76  ? 368  THR A HA   1 
ATOM   4511  H  HB   . THR A 1 289 ? -43.933 -9.858  9.851   1.00 48.76  ? 368  THR A HB   1 
ATOM   4512  H  HG1  . THR A 1 289 ? -44.623 -10.733 7.934   1.00 40.17  ? 368  THR A HG1  1 
ATOM   4513  H  HG21 . THR A 1 289 ? -44.176 -8.373  8.045   1.00 51.33  ? 368  THR A HG21 1 
ATOM   4514  H  HG22 . THR A 1 289 ? -42.944 -7.928  8.928   1.00 51.33  ? 368  THR A HG22 1 
ATOM   4515  H  HG23 . THR A 1 289 ? -42.705 -8.697  7.570   1.00 51.33  ? 368  THR A HG23 1 
ATOM   4516  N  N    . SER A 1 290 ? -41.541 -9.112  11.602  1.00 38.48  ? 369  SER A N    1 
ATOM   4517  C  CA   . SER A 1 290 ? -40.883 -8.095  12.413  1.00 36.39  ? 369  SER A CA   1 
ATOM   4518  C  C    . SER A 1 290 ? -39.405 -8.437  12.557  1.00 33.15  ? 369  SER A C    1 
ATOM   4519  O  O    . SER A 1 290 ? -38.572 -7.559  12.777  1.00 39.17  ? 369  SER A O    1 
ATOM   4520  C  CB   . SER A 1 290 ? -41.539 -7.995  13.794  1.00 38.07  ? 369  SER A CB   1 
ATOM   4521  O  OG   . SER A 1 290 ? -41.223 -9.119  14.595  1.00 48.88  ? 369  SER A OG   1 
ATOM   4522  H  H    . SER A 1 290 ? -42.121 -9.584  12.028  1.00 46.18  ? 369  SER A H    1 
ATOM   4523  H  HA   . SER A 1 290 ? -40.959 -7.234  11.974  1.00 43.67  ? 369  SER A HA   1 
ATOM   4524  H  HB2  . SER A 1 290 ? -41.219 -7.194  14.236  1.00 45.68  ? 369  SER A HB2  1 
ATOM   4525  H  HB3  . SER A 1 290 ? -42.501 -7.949  13.682  1.00 45.68  ? 369  SER A HB3  1 
ATOM   4526  H  HG   . SER A 1 290 ? -41.495 -9.822  14.224  1.00 58.65  ? 369  SER A HG   1 
ATOM   4527  N  N    . ARG A 1 291 ? -39.093 -9.720  12.421  1.00 53.01  ? 370  ARG A N    1 
ATOM   4528  C  CA   . ARG A 1 291 ? -37.729 -10.213 12.556  1.00 53.13  ? 370  ARG A CA   1 
ATOM   4529  C  C    . ARG A 1 291 ? -36.932 -10.082 11.251  1.00 50.83  ? 370  ARG A C    1 
ATOM   4530  O  O    . ARG A 1 291 ? -35.702 -10.083 11.268  1.00 50.65  ? 370  ARG A O    1 
ATOM   4531  C  CB   . ARG A 1 291 ? -37.777 -11.672 13.011  1.00 51.50  ? 370  ARG A CB   1 
ATOM   4532  C  CG   . ARG A 1 291 ? -36.434 -12.297 13.308  1.00 67.24  ? 370  ARG A CG   1 
ATOM   4533  C  CD   . ARG A 1 291 ? -36.626 -13.612 14.049  1.00 81.19  ? 370  ARG A CD   1 
ATOM   4534  N  NE   . ARG A 1 291 ? -35.366 -14.283 14.359  1.00 88.86  ? 370  ARG A NE   1 
ATOM   4535  C  CZ   . ARG A 1 291 ? -34.586 -13.982 15.393  1.00 88.13  ? 370  ARG A CZ   1 
ATOM   4536  N  NH1  . ARG A 1 291 ? -34.915 -13.000 16.224  1.00 83.94  ? 370  ARG A NH1  1 
ATOM   4537  N  NH2  . ARG A 1 291 ? -33.463 -14.659 15.594  1.00 89.29  ? 370  ARG A NH2  1 
ATOM   4538  H  H    . ARG A 1 291 ? -39.666 -10.337 12.246  1.00 63.61  ? 370  ARG A H    1 
ATOM   4539  H  HA   . ARG A 1 291 ? -37.273 -9.699  13.240  1.00 63.75  ? 370  ARG A HA   1 
ATOM   4540  H  HB2  . ARG A 1 291 ? -38.309 -11.724 13.821  1.00 61.80  ? 370  ARG A HB2  1 
ATOM   4541  H  HB3  . ARG A 1 291 ? -38.197 -12.199 12.313  1.00 61.80  ? 370  ARG A HB3  1 
ATOM   4542  H  HG2  . ARG A 1 291 ? -35.969 -12.476 12.476  1.00 80.69  ? 370  ARG A HG2  1 
ATOM   4543  H  HG3  . ARG A 1 291 ? -35.914 -11.700 13.868  1.00 80.69  ? 370  ARG A HG3  1 
ATOM   4544  H  HD2  . ARG A 1 291 ? -37.086 -13.438 14.885  1.00 97.43  ? 370  ARG A HD2  1 
ATOM   4545  H  HD3  . ARG A 1 291 ? -37.155 -14.209 13.498  1.00 97.43  ? 370  ARG A HD3  1 
ATOM   4546  H  HE   . ARG A 1 291 ? -35.111 -14.918 13.836  1.00 106.63 ? 370  ARG A HE   1 
ATOM   4547  H  HH11 . ARG A 1 291 ? -35.643 -12.558 16.100  1.00 100.72 ? 370  ARG A HH11 1 
ATOM   4548  H  HH12 . ARG A 1 291 ? -34.404 -12.809 16.889  1.00 100.72 ? 370  ARG A HH12 1 
ATOM   4549  H  HH21 . ARG A 1 291 ? -33.242 -15.293 15.057  1.00 107.14 ? 370  ARG A HH21 1 
ATOM   4550  H  HH22 . ARG A 1 291 ? -32.954 -14.461 16.258  1.00 107.14 ? 370  ARG A HH22 1 
ATOM   4551  N  N    . PHE A 1 292 ? -37.645 -9.963  10.131  1.00 35.34  ? 371  PHE A N    1 
ATOM   4552  C  CA   . PHE A 1 292 ? -37.038 -9.856  8.801   1.00 24.69  ? 371  PHE A CA   1 
ATOM   4553  C  C    . PHE A 1 292 ? -37.479 -8.587  8.073   1.00 31.27  ? 371  PHE A C    1 
ATOM   4554  O  O    . PHE A 1 292 ? -37.284 -8.456  6.863   1.00 33.88  ? 371  PHE A O    1 
ATOM   4555  C  CB   . PHE A 1 292 ? -37.396 -11.081 7.954   1.00 25.38  ? 371  PHE A CB   1 
ATOM   4556  C  CG   . PHE A 1 292 ? -36.570 -12.286 8.266   1.00 31.74  ? 371  PHE A CG   1 
ATOM   4557  C  CD1  . PHE A 1 292 ? -35.270 -12.381 7.797   1.00 30.50  ? 371  PHE A CD1  1 
ATOM   4558  C  CD2  . PHE A 1 292 ? -37.084 -13.323 9.028   1.00 34.39  ? 371  PHE A CD2  1 
ATOM   4559  C  CE1  . PHE A 1 292 ? -34.496 -13.486 8.082   1.00 28.62  ? 371  PHE A CE1  1 
ATOM   4560  C  CE2  . PHE A 1 292 ? -36.317 -14.435 9.313   1.00 32.43  ? 371  PHE A CE2  1 
ATOM   4561  C  CZ   . PHE A 1 292 ? -35.021 -14.517 8.837   1.00 30.19  ? 371  PHE A CZ   1 
ATOM   4562  H  H    . PHE A 1 292 ? -38.504 -9.941  10.115  1.00 42.40  ? 371  PHE A H    1 
ATOM   4563  H  HA   . PHE A 1 292 ? -36.073 -9.827  8.896   1.00 29.63  ? 371  PHE A HA   1 
ATOM   4564  H  HB2  . PHE A 1 292 ? -38.325 -11.309 8.111   1.00 30.46  ? 371  PHE A HB2  1 
ATOM   4565  H  HB3  . PHE A 1 292 ? -37.263 -10.864 7.018   1.00 30.46  ? 371  PHE A HB3  1 
ATOM   4566  H  HD1  . PHE A 1 292 ? -34.915 -11.690 7.287   1.00 36.60  ? 371  PHE A HD1  1 
ATOM   4567  H  HD2  . PHE A 1 292 ? -37.956 -13.271 9.347   1.00 41.27  ? 371  PHE A HD2  1 
ATOM   4568  H  HE1  . PHE A 1 292 ? -33.625 -13.540 7.760   1.00 34.34  ? 371  PHE A HE1  1 
ATOM   4569  H  HE2  . PHE A 1 292 ? -36.670 -15.126 9.824   1.00 38.91  ? 371  PHE A HE2  1 
ATOM   4570  H  HZ   . PHE A 1 292 ? -34.501 -15.264 9.030   1.00 36.23  ? 371  PHE A HZ   1 
ATOM   4571  N  N    . LYS A 1 293 ? -38.068 -7.653  8.814   1.00 42.18  ? 372  LYS A N    1 
ATOM   4572  C  CA   . LYS A 1 293 ? -38.547 -6.398  8.239   1.00 36.38  ? 372  LYS A CA   1 
ATOM   4573  C  C    . LYS A 1 293 ? -37.410 -5.607  7.588   1.00 40.94  ? 372  LYS A C    1 
ATOM   4574  O  O    . LYS A 1 293 ? -37.544 -5.144  6.457   1.00 45.21  ? 372  LYS A O    1 
ATOM   4575  C  CB   . LYS A 1 293 ? -39.240 -5.557  9.316   1.00 33.74  ? 372  LYS A CB   1 
ATOM   4576  C  CG   . LYS A 1 293 ? -39.731 -4.192  8.857   1.00 39.37  ? 372  LYS A CG   1 
ATOM   4577  C  CD   . LYS A 1 293 ? -39.416 -3.111  9.878   1.00 49.59  ? 372  LYS A CD   1 
ATOM   4578  C  CE   . LYS A 1 293 ? -37.918 -2.841  9.971   1.00 50.63  ? 372  LYS A CE   1 
ATOM   4579  N  NZ   . LYS A 1 293 ? -37.592 -1.710  10.881  1.00 48.70  ? 372  LYS A NZ   1 
ATOM   4580  H  H    . LYS A 1 293 ? -38.203 -7.722  9.661   1.00 50.61  ? 372  LYS A H    1 
ATOM   4581  H  HA   . LYS A 1 293 ? -39.201 -6.599  7.552   1.00 43.65  ? 372  LYS A HA   1 
ATOM   4582  H  HB2  . LYS A 1 293 ? -40.009 -6.049  9.642   1.00 40.49  ? 372  LYS A HB2  1 
ATOM   4583  H  HB3  . LYS A 1 293 ? -38.615 -5.413  10.043  1.00 40.49  ? 372  LYS A HB3  1 
ATOM   4584  H  HG2  . LYS A 1 293 ? -39.294 -3.959  8.023   1.00 47.24  ? 372  LYS A HG2  1 
ATOM   4585  H  HG3  . LYS A 1 293 ? -40.693 -4.223  8.734   1.00 47.24  ? 372  LYS A HG3  1 
ATOM   4586  H  HD2  . LYS A 1 293 ? -39.857 -2.287  9.617   1.00 59.51  ? 372  LYS A HD2  1 
ATOM   4587  H  HD3  . LYS A 1 293 ? -39.727 -3.396  10.751  1.00 59.51  ? 372  LYS A HD3  1 
ATOM   4588  H  HE2  . LYS A 1 293 ? -37.474 -3.634  10.308  1.00 60.76  ? 372  LYS A HE2  1 
ATOM   4589  H  HE3  . LYS A 1 293 ? -37.581 -2.622  9.088   1.00 60.76  ? 372  LYS A HE3  1 
ATOM   4590  H  HZ1  . LYS A 1 293 ? -36.712 -1.585  10.908  1.00 58.44  ? 372  LYS A HZ1  1 
ATOM   4591  H  HZ2  . LYS A 1 293 ? -37.982 -0.964  10.590  1.00 58.44  ? 372  LYS A HZ2  1 
ATOM   4592  H  HZ3  . LYS A 1 293 ? -37.884 -1.888  11.703  1.00 58.44  ? 372  LYS A HZ3  1 
ATOM   4593  N  N    . ASP A 1 294 ? -36.295 -5.458  8.296   1.00 45.48  ? 373  ASP A N    1 
ATOM   4594  C  CA   . ASP A 1 294 ? -35.164 -4.683  7.784   1.00 42.73  ? 373  ASP A CA   1 
ATOM   4595  C  C    . ASP A 1 294 ? -34.674 -5.173  6.427   1.00 39.71  ? 373  ASP A C    1 
ATOM   4596  O  O    . ASP A 1 294 ? -34.445 -4.385  5.508   1.00 45.96  ? 373  ASP A O    1 
ATOM   4597  C  CB   . ASP A 1 294 ? -34.006 -4.710  8.782   1.00 43.93  ? 373  ASP A CB   1 
ATOM   4598  C  CG   . ASP A 1 294 ? -34.260 -3.830  9.990   1.00 58.13  ? 373  ASP A CG   1 
ATOM   4599  O  OD1  . ASP A 1 294 ? -34.973 -2.814  9.848   1.00 64.04  ? 373  ASP A OD1  1 
ATOM   4600  O  OD2  . ASP A 1 294 ? -33.746 -4.149  11.083  1.00 64.20  ? 373  ASP A OD2  1 
ATOM   4601  H  H    . ASP A 1 294 ? -36.166 -5.795  9.076   1.00 54.57  ? 373  ASP A H    1 
ATOM   4602  H  HA   . ASP A 1 294 ? -35.443 -3.760  7.681   1.00 51.28  ? 373  ASP A HA   1 
ATOM   4603  H  HB2  . ASP A 1 294 ? -33.877 -5.619  9.093   1.00 52.72  ? 373  ASP A HB2  1 
ATOM   4604  H  HB3  . ASP A 1 294 ? -33.202 -4.391  8.342   1.00 52.72  ? 373  ASP A HB3  1 
ATOM   4605  N  N    . ARG A 1 295 ? -34.511 -6.480  6.307   1.00 27.28  ? 374  ARG A N    1 
ATOM   4606  C  CA   . ARG A 1 295 ? -34.043 -7.073  5.067   1.00 17.74  ? 374  ARG A CA   1 
ATOM   4607  C  C    . ARG A 1 295 ? -35.104 -6.950  3.966   1.00 23.30  ? 374  ARG A C    1 
ATOM   4608  O  O    . ARG A 1 295 ? -34.770 -6.912  2.783   1.00 26.55  ? 374  ARG A O    1 
ATOM   4609  C  CB   . ARG A 1 295 ? -33.669 -8.537  5.315   1.00 14.76  ? 374  ARG A CB   1 
ATOM   4610  C  CG   . ARG A 1 295 ? -33.356 -9.347  4.071   1.00 14.49  ? 374  ARG A CG   1 
ATOM   4611  C  CD   . ARG A 1 295 ? -32.254 -8.742  3.203   1.00 16.47  ? 374  ARG A CD   1 
ATOM   4612  N  NE   . ARG A 1 295 ? -32.096 -9.494  1.957   1.00 18.11  ? 374  ARG A NE   1 
ATOM   4613  C  CZ   . ARG A 1 295 ? -31.823 -8.955  0.769   1.00 22.28  ? 374  ARG A CZ   1 
ATOM   4614  N  NH1  . ARG A 1 295 ? -31.674 -7.642  0.633   1.00 19.79  ? 374  ARG A NH1  1 
ATOM   4615  N  NH2  . ARG A 1 295 ? -31.702 -9.733  -0.302  1.00 18.25  ? 374  ARG A NH2  1 
ATOM   4616  H  H    . ARG A 1 295 ? -34.666 -7.049  6.933   1.00 32.74  ? 374  ARG A H    1 
ATOM   4617  H  HA   . ARG A 1 295 ? -33.246 -6.605  4.771   1.00 21.29  ? 374  ARG A HA   1 
ATOM   4618  H  HB2  . ARG A 1 295 ? -32.883 -8.561  5.884   1.00 17.71  ? 374  ARG A HB2  1 
ATOM   4619  H  HB3  . ARG A 1 295 ? -34.409 -8.971  5.767   1.00 17.71  ? 374  ARG A HB3  1 
ATOM   4620  H  HG2  . ARG A 1 295 ? -33.068 -10.234 4.339   1.00 17.39  ? 374  ARG A HG2  1 
ATOM   4621  H  HG3  . ARG A 1 295 ? -34.158 -9.412  3.530   1.00 17.39  ? 374  ARG A HG3  1 
ATOM   4622  H  HD2  . ARG A 1 295 ? -32.487 -7.827  2.981   1.00 19.77  ? 374  ARG A HD2  1 
ATOM   4623  H  HD3  . ARG A 1 295 ? -31.413 -8.769  3.686   1.00 19.77  ? 374  ARG A HD3  1 
ATOM   4624  H  HE   . ARG A 1 295 ? -32.185 -10.349 1.994   1.00 21.73  ? 374  ARG A HE   1 
ATOM   4625  H  HH11 . ARG A 1 295 ? -31.751 -7.127  1.318   1.00 23.75  ? 374  ARG A HH11 1 
ATOM   4626  H  HH12 . ARG A 1 295 ? -31.499 -7.307  -0.139  1.00 23.75  ? 374  ARG A HH12 1 
ATOM   4627  H  HH21 . ARG A 1 295 ? -31.796 -10.585 -0.227  1.00 21.90  ? 374  ARG A HH21 1 
ATOM   4628  H  HH22 . ARG A 1 295 ? -31.526 -9.385  -1.068  1.00 21.90  ? 374  ARG A HH22 1 
ATOM   4629  N  N    . ILE A 1 296 ? -36.379 -6.880  4.350   1.00 28.87  ? 375  ILE A N    1 
ATOM   4630  C  CA   . ILE A 1 296 ? -37.448 -6.675  3.364   1.00 17.45  ? 375  ILE A CA   1 
ATOM   4631  C  C    . ILE A 1 296 ? -37.423 -5.266  2.757   1.00 22.72  ? 375  ILE A C    1 
ATOM   4632  O  O    . ILE A 1 296 ? -37.496 -5.128  1.537   1.00 30.22  ? 375  ILE A O    1 
ATOM   4633  C  CB   . ILE A 1 296 ? -38.867 -6.998  3.920   1.00 21.01  ? 375  ILE A CB   1 
ATOM   4634  C  CG1  . ILE A 1 296 ? -39.031 -8.512  4.070   1.00 23.33  ? 375  ILE A CG1  1 
ATOM   4635  C  CG2  . ILE A 1 296 ? -39.960 -6.476  2.971   1.00 17.11  ? 375  ILE A CG2  1 
ATOM   4636  C  CD1  . ILE A 1 296 ? -40.311 -8.945  4.757   1.00 24.35  ? 375  ILE A CD1  1 
ATOM   4637  H  H    . ILE A 1 296 ? -36.651 -6.947  5.163   1.00 34.64  ? 375  ILE A H    1 
ATOM   4638  H  HA   . ILE A 1 296 ? -37.291 -7.293  2.633   1.00 20.94  ? 375  ILE A HA   1 
ATOM   4639  H  HB   . ILE A 1 296 ? -38.972 -6.579  4.788   1.00 25.21  ? 375  ILE A HB   1 
ATOM   4640  H  HG12 . ILE A 1 296 ? -39.021 -8.914  3.187   1.00 27.99  ? 375  ILE A HG12 1 
ATOM   4641  H  HG13 . ILE A 1 296 ? -38.288 -8.854  4.592   1.00 27.99  ? 375  ILE A HG13 1 
ATOM   4642  H  HG21 . ILE A 1 296 ? -40.829 -6.692  3.343   1.00 20.53  ? 375  ILE A HG21 1 
ATOM   4643  H  HG22 . ILE A 1 296 ? -39.867 -5.515  2.882   1.00 20.53  ? 375  ILE A HG22 1 
ATOM   4644  H  HG23 . ILE A 1 296 ? -39.855 -6.901  2.105   1.00 20.53  ? 375  ILE A HG23 1 
ATOM   4645  H  HD11 . ILE A 1 296 ? -40.330 -9.914  4.808   1.00 29.22  ? 375  ILE A HD11 1 
ATOM   4646  H  HD12 . ILE A 1 296 ? -40.334 -8.566  5.649   1.00 29.22  ? 375  ILE A HD12 1 
ATOM   4647  H  HD13 . ILE A 1 296 ? -41.068 -8.626  4.242   1.00 29.22  ? 375  ILE A HD13 1 
ATOM   4648  N  N    . VAL A 1 297 ? -37.326 -4.224  3.580   1.00 12.93  ? 376  VAL A N    1 
ATOM   4649  C  CA   . VAL A 1 297 ? -37.349 -2.870  3.030   1.00 15.40  ? 376  VAL A CA   1 
ATOM   4650  C  C    . VAL A 1 297 ? -36.107 -2.607  2.186   1.00 15.16  ? 376  VAL A C    1 
ATOM   4651  O  O    . VAL A 1 297 ? -36.132 -1.773  1.284   1.00 30.13  ? 376  VAL A O    1 
ATOM   4652  C  CB   . VAL A 1 297 ? -37.505 -1.752  4.108   1.00 16.56  ? 376  VAL A CB   1 
ATOM   4653  C  CG1  . VAL A 1 297 ? -38.444 -2.188  5.231   1.00 20.08  ? 376  VAL A CG1  1 
ATOM   4654  C  CG2  . VAL A 1 297 ? -36.161 -1.319  4.678   1.00 24.07  ? 376  VAL A CG2  1 
ATOM   4655  H  H    . VAL A 1 297 ? -37.249 -4.270  4.435   1.00 15.52  ? 376  VAL A H    1 
ATOM   4656  H  HA   . VAL A 1 297 ? -38.114 -2.801  2.438   1.00 18.48  ? 376  VAL A HA   1 
ATOM   4657  H  HB   . VAL A 1 297 ? -37.903 -0.975  3.686   1.00 19.87  ? 376  VAL A HB   1 
ATOM   4658  H  HG11 . VAL A 1 297 ? -38.516 -1.470  5.879   1.00 24.09  ? 376  VAL A HG11 1 
ATOM   4659  H  HG12 . VAL A 1 297 ? -39.317 -2.382  4.854   1.00 24.09  ? 376  VAL A HG12 1 
ATOM   4660  H  HG13 . VAL A 1 297 ? -38.082 -2.982  5.655   1.00 24.09  ? 376  VAL A HG13 1 
ATOM   4661  H  HG21 . VAL A 1 297 ? -36.307 -0.627  5.341   1.00 28.88  ? 376  VAL A HG21 1 
ATOM   4662  H  HG22 . VAL A 1 297 ? -35.731 -2.085  5.089   1.00 28.88  ? 376  VAL A HG22 1 
ATOM   4663  H  HG23 . VAL A 1 297 ? -35.609 -0.977  3.957   1.00 28.88  ? 376  VAL A HG23 1 
ATOM   4664  N  N    . SER A 1 298 ? -35.028 -3.332  2.467   1.00 28.44  ? 377  SER A N    1 
ATOM   4665  C  CA   . SER A 1 298 ? -33.796 -3.176  1.703   1.00 30.86  ? 377  SER A CA   1 
ATOM   4666  C  C    . SER A 1 298 ? -33.977 -3.764  0.310   1.00 32.07  ? 377  SER A C    1 
ATOM   4667  O  O    . SER A 1 298 ? -33.296 -3.367  -0.636  1.00 37.79  ? 377  SER A O    1 
ATOM   4668  C  CB   . SER A 1 298 ? -32.630 -3.866  2.407   1.00 33.04  ? 377  SER A CB   1 
ATOM   4669  O  OG   . SER A 1 298 ? -32.676 -5.266  2.199   1.00 37.74  ? 377  SER A OG   1 
ATOM   4670  H  H    . SER A 1 298 ? -34.984 -3.919  3.093   1.00 34.13  ? 377  SER A H    1 
ATOM   4671  H  HA   . SER A 1 298 ? -33.587 -2.232  1.614   1.00 37.03  ? 377  SER A HA   1 
ATOM   4672  H  HB2  . SER A 1 298 ? -31.797 -3.521  2.051   1.00 39.64  ? 377  SER A HB2  1 
ATOM   4673  H  HB3  . SER A 1 298 ? -32.685 -3.686  3.359   1.00 39.64  ? 377  SER A HB3  1 
ATOM   4674  H  HG   . SER A 1 298 ? -33.394 -5.578  2.503   1.00 45.29  ? 377  SER A HG   1 
HETATM 4675  N  N    . MSE A 1 299 ? -34.907 -4.707  0.189   1.00 30.44  ? 378  MSE A N    1 
HETATM 4676  C  CA   . MSE A 1 299 ? -35.173 -5.355  -1.091  1.00 28.00  ? 378  MSE A CA   1 
HETATM 4677  C  C    . MSE A 1 299 ? -36.038 -4.485  -1.993  1.00 32.32  ? 378  MSE A C    1 
HETATM 4678  O  O    . MSE A 1 299 ? -36.246 -4.808  -3.161  1.00 35.56  ? 378  MSE A O    1 
HETATM 4679  C  CB   . MSE A 1 299 ? -35.844 -6.713  -0.892  1.00 27.50  ? 378  MSE A CB   1 
HETATM 4680  C  CG   . MSE A 1 299 ? -34.888 -7.826  -0.539  1.00 30.11  ? 378  MSE A CG   1 
HETATM 4681  SE SE   . MSE A 1 299 ? -35.767 -9.540  -0.498  1.00 55.05  ? 378  MSE A SE   1 
HETATM 4682  C  CE   . MSE A 1 299 ? -35.820 -9.730  1.412   1.00 26.05  ? 378  MSE A CE   1 
HETATM 4683  H  H    . MSE A 1 299 ? -35.399 -4.990  0.835   1.00 36.53  ? 378  MSE A H    1 
HETATM 4684  H  HA   . MSE A 1 299 ? -34.326 -5.511  -1.537  1.00 33.60  ? 378  MSE A HA   1 
HETATM 4685  H  HB2  . MSE A 1 299 ? -36.490 -6.638  -0.172  1.00 33.00  ? 378  MSE A HB2  1 
HETATM 4686  H  HB3  . MSE A 1 299 ? -36.296 -6.960  -1.714  1.00 33.00  ? 378  MSE A HB3  1 
HETATM 4687  H  HG2  . MSE A 1 299 ? -34.183 -7.863  -1.203  1.00 36.14  ? 378  MSE A HG2  1 
HETATM 4688  H  HG3  . MSE A 1 299 ? -34.512 -7.657  0.339   1.00 36.14  ? 378  MSE A HG3  1 
HETATM 4689  H  HE1  . MSE A 1 299 ? -36.247 -10.572 1.634   1.00 31.27  ? 378  MSE A HE1  1 
HETATM 4690  H  HE2  . MSE A 1 299 ? -34.912 -9.718  1.755   1.00 31.27  ? 378  MSE A HE2  1 
HETATM 4691  H  HE3  . MSE A 1 299 ? -36.325 -8.993  1.789   1.00 31.27  ? 378  MSE A HE3  1 
ATOM   4692  N  N    . THR A 1 300 ? -36.542 -3.379  -1.457  1.00 26.88  ? 379  THR A N    1 
ATOM   4693  C  CA   . THR A 1 300 ? -37.253 -2.410  -2.280  1.00 22.57  ? 379  THR A CA   1 
ATOM   4694  C  C    . THR A 1 300 ? -36.267 -1.771  -3.252  1.00 20.77  ? 379  THR A C    1 
ATOM   4695  O  O    . THR A 1 300 ? -36.668 -1.135  -4.231  1.00 18.80  ? 379  THR A O    1 
ATOM   4696  C  CB   . THR A 1 300 ? -37.927 -1.312  -1.435  1.00 16.64  ? 379  THR A CB   1 
ATOM   4697  O  OG1  . THR A 1 300 ? -36.933 -0.574  -0.709  1.00 24.88  ? 379  THR A OG1  1 
ATOM   4698  C  CG2  . THR A 1 300 ? -38.931 -1.917  -0.468  1.00 19.01  ? 379  THR A CG2  1 
ATOM   4699  H  H    . THR A 1 300 ? -36.486 -3.167  -0.625  1.00 32.26  ? 379  THR A H    1 
ATOM   4700  H  HA   . THR A 1 300 ? -37.939 -2.866  -2.794  1.00 27.08  ? 379  THR A HA   1 
ATOM   4701  H  HB   . THR A 1 300 ? -38.404 -0.707  -2.024  1.00 19.97  ? 379  THR A HB   1 
ATOM   4702  H  HG1  . THR A 1 300 ? -36.508 -1.089  -0.200  1.00 29.85  ? 379  THR A HG1  1 
ATOM   4703  H  HG21 . THR A 1 300 ? -39.348 -1.216  0.058   1.00 22.81  ? 379  THR A HG21 1 
ATOM   4704  H  HG22 . THR A 1 300 ? -39.618 -2.393  -0.959  1.00 22.81  ? 379  THR A HG22 1 
ATOM   4705  H  HG23 . THR A 1 300 ? -38.484 -2.536  0.130   1.00 22.81  ? 379  THR A HG23 1 
ATOM   4706  N  N    . LEU A 1 301 ? -34.976 -1.944  -2.963  1.00 22.79  ? 380  LEU A N    1 
ATOM   4707  C  CA   . LEU A 1 301 ? -33.896 -1.524  -3.857  1.00 19.40  ? 380  LEU A CA   1 
ATOM   4708  C  C    . LEU A 1 301 ? -33.070 -2.720  -4.334  1.00 18.97  ? 380  LEU A C    1 
ATOM   4709  O  O    . LEU A 1 301 ? -31.872 -2.597  -4.580  1.00 25.41  ? 380  LEU A O    1 
ATOM   4710  C  CB   . LEU A 1 301 ? -32.982 -0.511  -3.162  1.00 16.64  ? 380  LEU A CB   1 
ATOM   4711  C  CG   . LEU A 1 301 ? -33.487 0.930   -3.092  1.00 18.72  ? 380  LEU A CG   1 
ATOM   4712  C  CD1  . LEU A 1 301 ? -32.628 1.737   -2.138  1.00 19.03  ? 380  LEU A CD1  1 
ATOM   4713  C  CD2  . LEU A 1 301 ? -33.489 1.576   -4.474  1.00 16.72  ? 380  LEU A CD2  1 
ATOM   4714  H  H    . LEU A 1 301 ? -34.694 -2.311  -2.237  1.00 27.35  ? 380  LEU A H    1 
ATOM   4715  H  HA   . LEU A 1 301 ? -34.282 -1.095  -4.638  1.00 23.29  ? 380  LEU A HA   1 
ATOM   4716  H  HB2  . LEU A 1 301 ? -32.837 -0.809  -2.250  1.00 19.97  ? 380  LEU A HB2  1 
ATOM   4717  H  HB3  . LEU A 1 301 ? -32.134 -0.495  -3.633  1.00 19.97  ? 380  LEU A HB3  1 
ATOM   4718  H  HG   . LEU A 1 301 ? -34.397 0.933   -2.755  1.00 22.46  ? 380  LEU A HG   1 
ATOM   4719  H  HD11 . LEU A 1 301 ? -32.963 2.647   -2.106  1.00 22.84  ? 380  LEU A HD11 1 
ATOM   4720  H  HD12 . LEU A 1 301 ? -32.674 1.336   -1.256  1.00 22.84  ? 380  LEU A HD12 1 
ATOM   4721  H  HD13 . LEU A 1 301 ? -31.712 1.732   -2.457  1.00 22.84  ? 380  LEU A HD13 1 
ATOM   4722  H  HD21 . LEU A 1 301 ? -33.813 2.487   -4.396  1.00 20.07  ? 380  LEU A HD21 1 
ATOM   4723  H  HD22 . LEU A 1 301 ? -32.584 1.576   -4.823  1.00 20.07  ? 380  LEU A HD22 1 
ATOM   4724  H  HD23 . LEU A 1 301 ? -34.070 1.066   -5.059  1.00 20.07  ? 380  LEU A HD23 1 
ATOM   4725  N  N    . ASP A 1 302 ? -33.705 -3.880  -4.462  1.00 15.83  ? 381  ASP A N    1 
ATOM   4726  C  CA   . ASP A 1 302 ? -33.016 -5.071  -4.952  1.00 12.73  ? 381  ASP A CA   1 
ATOM   4727  C  C    . ASP A 1 302 ? -32.394 -4.792  -6.315  1.00 13.22  ? 381  ASP A C    1 
ATOM   4728  O  O    . ASP A 1 302 ? -32.917 -3.989  -7.088  1.00 20.73  ? 381  ASP A O    1 
ATOM   4729  C  CB   . ASP A 1 302 ? -33.984 -6.249  -5.058  1.00 14.39  ? 381  ASP A CB   1 
ATOM   4730  C  CG   . ASP A 1 302 ? -33.278 -7.566  -5.326  1.00 19.11  ? 381  ASP A CG   1 
ATOM   4731  O  OD1  . ASP A 1 302 ? -32.845 -7.794  -6.479  1.00 21.34  ? 381  ASP A OD1  1 
ATOM   4732  O  OD2  . ASP A 1 302 ? -33.160 -8.377  -4.379  1.00 21.80  ? 381  ASP A OD2  1 
ATOM   4733  H  H    . ASP A 1 302 ? -34.535 -4.006  -4.273  1.00 19.00  ? 381  ASP A H    1 
ATOM   4734  H  HA   . ASP A 1 302 ? -32.307 -5.311  -4.335  1.00 15.27  ? 381  ASP A HA   1 
ATOM   4735  H  HB2  . ASP A 1 302 ? -34.472 -6.334  -4.224  1.00 17.27  ? 381  ASP A HB2  1 
ATOM   4736  H  HB3  . ASP A 1 302 ? -34.602 -6.086  -5.788  1.00 17.27  ? 381  ASP A HB3  1 
ATOM   4737  N  N    . LYS A 1 303 ? -31.270 -5.446  -6.597  1.00 20.57  ? 382  LYS A N    1 
ATOM   4738  C  CA   . LYS A 1 303 ? -30.581 -5.285  -7.874  1.00 24.10  ? 382  LYS A CA   1 
ATOM   4739  C  C    . LYS A 1 303 ? -31.495 -5.649  -9.037  1.00 20.52  ? 382  LYS A C    1 
ATOM   4740  O  O    . LYS A 1 303 ? -31.388 -5.082  -10.125 1.00 21.69  ? 382  LYS A O    1 
ATOM   4741  C  CB   . LYS A 1 303 ? -29.331 -6.166  -7.920  1.00 27.08  ? 382  LYS A CB   1 
ATOM   4742  C  CG   . LYS A 1 303 ? -28.023 -5.440  -7.663  1.00 24.04  ? 382  LYS A CG   1 
ATOM   4743  C  CD   . LYS A 1 303 ? -27.078 -5.602  -8.844  1.00 22.75  ? 382  LYS A CD   1 
ATOM   4744  C  CE   . LYS A 1 303 ? -25.706 -5.020  -8.549  1.00 34.90  ? 382  LYS A CE   1 
ATOM   4745  N  NZ   . LYS A 1 303 ? -25.063 -5.647  -7.356  1.00 32.05  ? 382  LYS A NZ   1 
ATOM   4746  H  H    . LYS A 1 303 ? -30.883 -5.995  -6.059  1.00 24.68  ? 382  LYS A H    1 
ATOM   4747  H  HA   . LYS A 1 303 ? -30.308 -4.360  -7.978  1.00 28.92  ? 382  LYS A HA   1 
ATOM   4748  H  HB2  . LYS A 1 303 ? -29.418 -6.860  -7.248  1.00 32.50  ? 382  LYS A HB2  1 
ATOM   4749  H  HB3  . LYS A 1 303 ? -29.272 -6.572  -8.799  1.00 32.50  ? 382  LYS A HB3  1 
ATOM   4750  H  HG2  . LYS A 1 303 ? -28.198 -4.494  -7.538  1.00 28.85  ? 382  LYS A HG2  1 
ATOM   4751  H  HG3  . LYS A 1 303 ? -27.596 -5.812  -6.876  1.00 28.85  ? 382  LYS A HG3  1 
ATOM   4752  H  HD2  . LYS A 1 303 ? -26.971 -6.546  -9.041  1.00 27.30  ? 382  LYS A HD2  1 
ATOM   4753  H  HD3  . LYS A 1 303 ? -27.445 -5.139  -9.613  1.00 27.30  ? 382  LYS A HD3  1 
ATOM   4754  H  HE2  . LYS A 1 303 ? -25.128 -5.167  -9.314  1.00 41.88  ? 382  LYS A HE2  1 
ATOM   4755  H  HE3  . LYS A 1 303 ? -25.795 -4.069  -8.378  1.00 41.88  ? 382  LYS A HE3  1 
ATOM   4756  H  HZ1  . LYS A 1 303 ? -24.264 -5.282  -7.214  1.00 38.46  ? 382  LYS A HZ1  1 
ATOM   4757  H  HZ2  . LYS A 1 303 ? -25.571 -5.520  -6.636  1.00 38.46  ? 382  LYS A HZ2  1 
ATOM   4758  H  HZ3  . LYS A 1 303 ? -24.963 -6.521  -7.489  1.00 38.46  ? 382  LYS A HZ3  1 
ATOM   4759  N  N    . GLU A 1 304 ? -32.380 -6.612  -8.799  1.00 32.34  ? 383  GLU A N    1 
ATOM   4760  C  CA   . GLU A 1 304 ? -33.383 -7.006  -9.778  1.00 32.48  ? 383  GLU A CA   1 
ATOM   4761  C  C    . GLU A 1 304 ? -34.703 -6.283  -9.508  1.00 32.45  ? 383  GLU A C    1 
ATOM   4762  O  O    . GLU A 1 304 ? -35.295 -6.439  -8.438  1.00 39.06  ? 383  GLU A O    1 
ATOM   4763  C  CB   . GLU A 1 304 ? -33.594 -8.518  -9.723  1.00 30.42  ? 383  GLU A CB   1 
ATOM   4764  C  CG   . GLU A 1 304 ? -32.407 -9.329  -10.232 1.00 35.88  ? 383  GLU A CG   1 
ATOM   4765  C  CD   . GLU A 1 304 ? -32.698 -10.135 -11.499 1.00 49.79  ? 383  GLU A CD   1 
ATOM   4766  O  OE1  . GLU A 1 304 ? -33.731 -9.898  -12.164 1.00 55.85  ? 383  GLU A OE1  1 
ATOM   4767  O  OE2  . GLU A 1 304 ? -31.871 -11.014 -11.833 1.00 51.90  ? 383  GLU A OE2  1 
ATOM   4768  H  H    . GLU A 1 304 ? -32.419 -7.058  -8.065  1.00 38.80  ? 383  GLU A H    1 
ATOM   4769  H  HA   . GLU A 1 304 ? -33.078 -6.769  -10.668 1.00 38.97  ? 383  GLU A HA   1 
ATOM   4770  H  HB2  . GLU A 1 304 ? -33.756 -8.776  -8.802  1.00 36.51  ? 383  GLU A HB2  1 
ATOM   4771  H  HB3  . GLU A 1 304 ? -34.363 -8.746  -10.267 1.00 36.51  ? 383  GLU A HB3  1 
ATOM   4772  H  HG2  . GLU A 1 304 ? -31.677 -8.722  -10.429 1.00 43.05  ? 383  GLU A HG2  1 
ATOM   4773  H  HG3  . GLU A 1 304 ? -32.137 -9.953  -9.540  1.00 43.05  ? 383  GLU A HG3  1 
ATOM   4774  N  N    . TYR A 1 305 ? -35.161 -5.501  -10.484 1.00 39.09  ? 384  TYR A N    1 
ATOM   4775  C  CA   . TYR A 1 305 ? -36.384 -4.709  -10.345 1.00 39.85  ? 384  TYR A CA   1 
ATOM   4776  C  C    . TYR A 1 305 ? -37.601 -5.571  -10.020 1.00 39.38  ? 384  TYR A C    1 
ATOM   4777  O  O    . TYR A 1 305 ? -38.364 -5.256  -9.108  1.00 46.36  ? 384  TYR A O    1 
ATOM   4778  C  CB   . TYR A 1 305 ? -36.656 -3.923  -11.632 1.00 44.39  ? 384  TYR A CB   1 
ATOM   4779  C  CG   . TYR A 1 305 ? -35.860 -2.646  -11.775 1.00 58.12  ? 384  TYR A CG   1 
ATOM   4780  C  CD1  . TYR A 1 305 ? -35.742 -1.759  -10.715 1.00 67.87  ? 384  TYR A CD1  1 
ATOM   4781  C  CD2  . TYR A 1 305 ? -35.235 -2.320  -12.974 1.00 63.19  ? 384  TYR A CD2  1 
ATOM   4782  C  CE1  . TYR A 1 305 ? -35.025 -0.587  -10.836 1.00 71.41  ? 384  TYR A CE1  1 
ATOM   4783  C  CE2  . TYR A 1 305 ? -34.511 -1.145  -13.106 1.00 68.05  ? 384  TYR A CE2  1 
ATOM   4784  C  CZ   . TYR A 1 305 ? -34.411 -0.283  -12.032 1.00 71.48  ? 384  TYR A CZ   1 
ATOM   4785  O  OH   . TYR A 1 305 ? -33.696 0.887   -12.143 1.00 75.67  ? 384  TYR A OH   1 
ATOM   4786  H  H    . TYR A 1 305 ? -34.776 -5.411  -11.247 1.00 46.91  ? 384  TYR A H    1 
ATOM   4787  H  HA   . TYR A 1 305 ? -36.267 -4.072  -9.623  1.00 47.82  ? 384  TYR A HA   1 
ATOM   4788  H  HB2  . TYR A 1 305 ? -36.441 -4.489  -12.391 1.00 53.27  ? 384  TYR A HB2  1 
ATOM   4789  H  HB3  . TYR A 1 305 ? -37.596 -3.687  -11.658 1.00 53.27  ? 384  TYR A HB3  1 
ATOM   4790  H  HD1  . TYR A 1 305 ? -36.155 -1.959  -9.906  1.00 81.45  ? 384  TYR A HD1  1 
ATOM   4791  H  HD2  . TYR A 1 305 ? -35.303 -2.899  -13.698 1.00 75.83  ? 384  TYR A HD2  1 
ATOM   4792  H  HE1  . TYR A 1 305 ? -34.955 -0.005  -10.114 1.00 85.69  ? 384  TYR A HE1  1 
ATOM   4793  H  HE2  . TYR A 1 305 ? -34.096 -0.939  -13.913 1.00 81.65  ? 384  TYR A HE2  1 
ATOM   4794  H  HH   . TYR A 1 305 ? -33.374 0.954   -12.915 1.00 90.80  ? 384  TYR A HH   1 
ATOM   4795  N  N    . ASP A 1 306 ? -37.772 -6.653  -10.777 1.00 28.12  ? 385  ASP A N    1 
ATOM   4796  C  CA   . ASP A 1 306 ? -38.884 -7.583  -10.585 1.00 22.11  ? 385  ASP A CA   1 
ATOM   4797  C  C    . ASP A 1 306 ? -38.992 -8.019  -9.123  1.00 25.72  ? 385  ASP A C    1 
ATOM   4798  O  O    . ASP A 1 306 ? -40.090 -8.236  -8.612  1.00 33.21  ? 385  ASP A O    1 
ATOM   4799  C  CB   . ASP A 1 306 ? -38.710 -8.819  -11.474 1.00 29.45  ? 385  ASP A CB   1 
ATOM   4800  C  CG   . ASP A 1 306 ? -39.144 -8.582  -12.914 1.00 43.75  ? 385  ASP A CG   1 
ATOM   4801  O  OD1  . ASP A 1 306 ? -39.113 -7.421  -13.375 1.00 45.23  ? 385  ASP A OD1  1 
ATOM   4802  O  OD2  . ASP A 1 306 ? -39.507 -9.570  -13.591 1.00 52.74  ? 385  ASP A OD2  1 
ATOM   4803  H  H    . ASP A 1 306 ? -37.247 -6.875  -11.420 1.00 33.74  ? 385  ASP A H    1 
ATOM   4804  H  HA   . ASP A 1 306 ? -39.713 -7.144  -10.833 1.00 26.54  ? 385  ASP A HA   1 
ATOM   4805  H  HB2  . ASP A 1 306 ? -37.774 -9.073  -11.481 1.00 35.34  ? 385  ASP A HB2  1 
ATOM   4806  H  HB3  . ASP A 1 306 ? -39.247 -9.543  -11.115 1.00 35.34  ? 385  ASP A HB3  1 
ATOM   4807  N  N    . VAL A 1 307 ? -37.848 -8.148  -8.457  1.00 16.41  ? 386  VAL A N    1 
ATOM   4808  C  CA   . VAL A 1 307 ? -37.817 -8.481  -7.034  1.00 13.29  ? 386  VAL A CA   1 
ATOM   4809  C  C    . VAL A 1 307 ? -38.226 -7.272  -6.204  1.00 17.03  ? 386  VAL A C    1 
ATOM   4810  O  O    . VAL A 1 307 ? -38.890 -7.408  -5.176  1.00 26.03  ? 386  VAL A O    1 
ATOM   4811  C  CB   . VAL A 1 307 ? -36.411 -8.954  -6.580  1.00 14.18  ? 386  VAL A CB   1 
ATOM   4812  C  CG1  . VAL A 1 307 ? -36.387 -9.258  -5.078  1.00 16.87  ? 386  VAL A CG1  1 
ATOM   4813  C  CG2  . VAL A 1 307 ? -35.986 -10.179 -7.368  1.00 11.99  ? 386  VAL A CG2  1 
ATOM   4814  H  H    . VAL A 1 307 ? -37.070 -8.046  -8.808  1.00 19.69  ? 386  VAL A H    1 
ATOM   4815  H  HA   . VAL A 1 307 ? -38.449 -9.196  -6.860  1.00 15.95  ? 386  VAL A HA   1 
ATOM   4816  H  HB   . VAL A 1 307 ? -35.769 -8.248  -6.754  1.00 17.01  ? 386  VAL A HB   1 
ATOM   4817  H  HG11 . VAL A 1 307 ? -35.497 -9.550  -4.830  1.00 20.24  ? 386  VAL A HG11 1 
ATOM   4818  H  HG12 . VAL A 1 307 ? -36.620 -8.453  -4.590  1.00 20.24  ? 386  VAL A HG12 1 
ATOM   4819  H  HG13 . VAL A 1 307 ? -37.031 -9.959  -4.888  1.00 20.24  ? 386  VAL A HG13 1 
ATOM   4820  H  HG21 . VAL A 1 307 ? -35.106 -10.457 -7.069  1.00 14.38  ? 386  VAL A HG21 1 
ATOM   4821  H  HG22 . VAL A 1 307 ? -36.627 -10.890 -7.216  1.00 14.38  ? 386  VAL A HG22 1 
ATOM   4822  H  HG23 . VAL A 1 307 ? -35.959 -9.954  -8.311  1.00 14.38  ? 386  VAL A HG23 1 
ATOM   4823  N  N    . ALA A 1 308 ? -37.835 -6.085  -6.655  1.00 15.43  ? 387  ALA A N    1 
ATOM   4824  C  CA   . ALA A 1 308 ? -38.097 -4.865  -5.900  1.00 11.94  ? 387  ALA A CA   1 
ATOM   4825  C  C    . ALA A 1 308 ? -39.590 -4.551  -5.830  1.00 16.57  ? 387  ALA A C    1 
ATOM   4826  O  O    . ALA A 1 308 ? -40.087 -4.094  -4.803  1.00 18.65  ? 387  ALA A O    1 
ATOM   4827  C  CB   . ALA A 1 308 ? -37.334 -3.696  -6.497  1.00 17.08  ? 387  ALA A CB   1 
ATOM   4828  H  H    . ALA A 1 308 ? -37.416 -5.959  -7.396  1.00 18.52  ? 387  ALA A H    1 
ATOM   4829  H  HA   . ALA A 1 308 ? -37.781 -4.990  -4.991  1.00 14.33  ? 387  ALA A HA   1 
ATOM   4830  H  HB1  . ALA A 1 308 ? -37.524 -2.898  -5.979  1.00 20.49  ? 387  ALA A HB1  1 
ATOM   4831  H  HB2  . ALA A 1 308 ? -36.384 -3.892  -6.468  1.00 20.49  ? 387  ALA A HB2  1 
ATOM   4832  H  HB3  . ALA A 1 308 ? -37.619 -3.570  -7.416  1.00 20.49  ? 387  ALA A HB3  1 
ATOM   4833  N  N    . VAL A 1 309 ? -40.305 -4.795  -6.923  1.00 19.49  ? 388  VAL A N    1 
ATOM   4834  C  CA   . VAL A 1 309 ? -41.744 -4.539  -6.956  1.00 18.10  ? 388  VAL A CA   1 
ATOM   4835  C  C    . VAL A 1 309 ? -42.455 -5.375  -5.893  1.00 19.53  ? 388  VAL A C    1 
ATOM   4836  O  O    . VAL A 1 309 ? -43.176 -4.845  -5.045  1.00 23.04  ? 388  VAL A O    1 
ATOM   4837  C  CB   . VAL A 1 309 ? -42.342 -4.832  -8.351  1.00 11.50  ? 388  VAL A CB   1 
ATOM   4838  C  CG1  . VAL A 1 309 ? -43.882 -4.820  -8.315  1.00 22.87  ? 388  VAL A CG1  1 
ATOM   4839  C  CG2  . VAL A 1 309 ? -41.818 -3.824  -9.362  1.00 13.88  ? 388  VAL A CG2  1 
ATOM   4840  H  H    . VAL A 1 309 ? -39.984 -5.106  -7.658  1.00 23.39  ? 388  VAL A H    1 
ATOM   4841  H  HA   . VAL A 1 309 ? -41.902 -3.604  -6.754  1.00 21.72  ? 388  VAL A HA   1 
ATOM   4842  H  HB   . VAL A 1 309 ? -42.058 -5.715  -8.636  1.00 13.80  ? 388  VAL A HB   1 
ATOM   4843  H  HG11 . VAL A 1 309 ? -44.219 -5.007  -9.205  1.00 27.44  ? 388  VAL A HG11 1 
ATOM   4844  H  HG12 . VAL A 1 309 ? -44.188 -5.501  -7.695  1.00 27.44  ? 388  VAL A HG12 1 
ATOM   4845  H  HG13 . VAL A 1 309 ? -44.184 -3.946  -8.024  1.00 27.44  ? 388  VAL A HG13 1 
ATOM   4846  H  HG21 . VAL A 1 309 ? -42.201 -4.020  -10.231 1.00 16.66  ? 388  VAL A HG21 1 
ATOM   4847  H  HG22 . VAL A 1 309 ? -42.075 -2.932  -9.080  1.00 16.66  ? 388  VAL A HG22 1 
ATOM   4848  H  HG23 . VAL A 1 309 ? -40.851 -3.893  -9.402  1.00 16.66  ? 388  VAL A HG23 1 
ATOM   4849  N  N    . GLN A 1 310 ? -42.227 -6.682  -5.938  1.00 20.84  ? 389  GLN A N    1 
ATOM   4850  C  CA   . GLN A 1 310 ? -42.803 -7.608  -4.972  1.00 14.54  ? 389  GLN A CA   1 
ATOM   4851  C  C    . GLN A 1 310 ? -42.478 -7.222  -3.533  1.00 17.88  ? 389  GLN A C    1 
ATOM   4852  O  O    . GLN A 1 310 ? -43.302 -7.403  -2.643  1.00 22.72  ? 389  GLN A O    1 
ATOM   4853  C  CB   . GLN A 1 310 ? -42.293 -9.025  -5.242  1.00 15.41  ? 389  GLN A CB   1 
ATOM   4854  C  CG   . GLN A 1 310 ? -42.595 -9.531  -6.644  1.00 19.20  ? 389  GLN A CG   1 
ATOM   4855  C  CD   . GLN A 1 310 ? -44.013 -9.223  -7.076  1.00 26.60  ? 389  GLN A CD   1 
ATOM   4856  O  OE1  . GLN A 1 310 ? -44.967 -9.440  -6.324  1.00 23.31  ? 389  GLN A OE1  1 
ATOM   4857  N  NE2  . GLN A 1 310 ? -44.160 -8.697  -8.288  1.00 20.21  ? 389  GLN A NE2  1 
ATOM   4858  H  H    . GLN A 1 310 ? -41.733 -7.064  -6.530  1.00 25.01  ? 389  GLN A H    1 
ATOM   4859  H  HA   . GLN A 1 310 ? -43.768 -7.610  -5.073  1.00 17.45  ? 389  GLN A HA   1 
ATOM   4860  H  HB2  . GLN A 1 310 ? -41.330 -9.039  -5.124  1.00 18.50  ? 389  GLN A HB2  1 
ATOM   4861  H  HB3  . GLN A 1 310 ? -42.710 -9.633  -4.612  1.00 18.50  ? 389  GLN A HB3  1 
ATOM   4862  H  HG2  . GLN A 1 310 ? -41.990 -9.106  -7.271  1.00 23.04  ? 389  GLN A HG2  1 
ATOM   4863  H  HG3  . GLN A 1 310 ? -42.476 -10.493 -6.666  1.00 23.04  ? 389  GLN A HG3  1 
ATOM   4864  H  HE21 . GLN A 1 310 ? -43.470 -8.550  -8.780  1.00 24.25  ? 389  GLN A HE21 1 
ATOM   4865  H  HE22 . GLN A 1 310 ? -44.945 -8.504  -8.581  1.00 24.25  ? 389  GLN A HE22 1 
ATOM   4866  N  N    . ALA A 1 311 ? -41.284 -6.690  -3.301  1.00 15.74  ? 390  ALA A N    1 
ATOM   4867  C  CA   . ALA A 1 311 ? -40.889 -6.296  -1.956  1.00 20.57  ? 390  ALA A CA   1 
ATOM   4868  C  C    . ALA A 1 311 ? -41.761 -5.143  -1.455  1.00 25.48  ? 390  ALA A C    1 
ATOM   4869  O  O    . ALA A 1 311 ? -42.101 -5.079  -0.275  1.00 33.66  ? 390  ALA A O    1 
ATOM   4870  C  CB   . ALA A 1 311 ? -39.425 -5.913  -1.928  1.00 15.61  ? 390  ALA A CB   1 
ATOM   4871  H  H    . ALA A 1 311 ? -40.686 -6.547  -3.903  1.00 18.89  ? 390  ALA A H    1 
ATOM   4872  H  HA   . ALA A 1 311 ? -41.014 -7.048  -1.357  1.00 24.69  ? 390  ALA A HA   1 
ATOM   4873  H  HB1  . ALA A 1 311 ? -39.183 -5.655  -1.025  1.00 18.73  ? 390  ALA A HB1  1 
ATOM   4874  H  HB2  . ALA A 1 311 ? -38.894 -6.676  -2.207  1.00 18.73  ? 390  ALA A HB2  1 
ATOM   4875  H  HB3  . ALA A 1 311 ? -39.281 -5.171  -2.535  1.00 18.73  ? 390  ALA A HB3  1 
ATOM   4876  N  N    . ILE A 1 312 ? -42.135 -4.243  -2.359  1.00 15.91  ? 391  ILE A N    1 
ATOM   4877  C  CA   . ILE A 1 312 ? -42.958 -3.099  -1.995  1.00 14.70  ? 391  ILE A CA   1 
ATOM   4878  C  C    . ILE A 1 312 ? -44.393 -3.567  -1.833  1.00 15.61  ? 391  ILE A C    1 
ATOM   4879  O  O    . ILE A 1 312 ? -45.094 -3.173  -0.902  1.00 20.56  ? 391  ILE A O    1 
ATOM   4880  C  CB   . ILE A 1 312 ? -42.905 -2.008  -3.071  1.00 14.96  ? 391  ILE A CB   1 
ATOM   4881  C  CG1  . ILE A 1 312 ? -41.465 -1.541  -3.282  1.00 23.31  ? 391  ILE A CG1  1 
ATOM   4882  C  CG2  . ILE A 1 312 ? -43.744 -0.817  -2.664  1.00 16.61  ? 391  ILE A CG2  1 
ATOM   4883  C  CD1  . ILE A 1 312 ? -41.269 -0.692  -4.512  1.00 22.26  ? 391  ILE A CD1  1 
ATOM   4884  H  H    . ILE A 1 312 ? -41.924 -4.274  -3.192  1.00 19.10  ? 391  ILE A H    1 
ATOM   4885  H  HA   . ILE A 1 312 ? -42.652 -2.726  -1.153  1.00 17.64  ? 391  ILE A HA   1 
ATOM   4886  H  HB   . ILE A 1 312 ? -43.248 -2.368  -3.904  1.00 17.95  ? 391  ILE A HB   1 
ATOM   4887  H  HG12 . ILE A 1 312 ? -41.193 -1.015  -2.513  1.00 27.98  ? 391  ILE A HG12 1 
ATOM   4888  H  HG13 . ILE A 1 312 ? -40.894 -2.320  -3.366  1.00 27.98  ? 391  ILE A HG13 1 
ATOM   4889  H  HG21 . ILE A 1 312 ? -43.694 -0.143  -3.361  1.00 19.94  ? 391  ILE A HG21 1 
ATOM   4890  H  HG22 . ILE A 1 312 ? -44.663 -1.104  -2.547  1.00 19.94  ? 391  ILE A HG22 1 
ATOM   4891  H  HG23 . ILE A 1 312 ? -43.400 -0.459  -1.831  1.00 19.94  ? 391  ILE A HG23 1 
ATOM   4892  H  HD11 . ILE A 1 312 ? -40.335 -0.438  -4.574  1.00 26.71  ? 391  ILE A HD11 1 
ATOM   4893  H  HD12 . ILE A 1 312 ? -41.525 -1.206  -5.294  1.00 26.71  ? 391  ILE A HD12 1 
ATOM   4894  H  HD13 . ILE A 1 312 ? -41.824 0.100   -4.440  1.00 26.71  ? 391  ILE A HD13 1 
ATOM   4895  N  N    . LYS A 1 313 ? -44.823 -4.417  -2.757  1.00 18.00  ? 392  LYS A N    1 
ATOM   4896  C  CA   . LYS A 1 313 ? -46.161 -4.980  -2.713  1.00 13.36  ? 392  LYS A CA   1 
ATOM   4897  C  C    . LYS A 1 313 ? -46.387 -5.785  -1.437  1.00 13.86  ? 392  LYS A C    1 
ATOM   4898  O  O    . LYS A 1 313 ? -47.478 -5.754  -0.867  1.00 31.44  ? 392  LYS A O    1 
ATOM   4899  C  CB   . LYS A 1 313 ? -46.414 -5.854  -3.942  1.00 13.10  ? 392  LYS A CB   1 
ATOM   4900  C  CG   . LYS A 1 313 ? -46.522 -5.059  -5.234  1.00 17.79  ? 392  LYS A CG   1 
ATOM   4901  C  CD   . LYS A 1 313 ? -47.338 -5.773  -6.299  1.00 21.21  ? 392  LYS A CD   1 
ATOM   4902  C  CE   . LYS A 1 313 ? -47.908 -4.767  -7.283  1.00 27.61  ? 392  LYS A CE   1 
ATOM   4903  N  NZ   . LYS A 1 313 ? -48.777 -5.418  -8.293  1.00 37.37  ? 392  LYS A NZ   1 
ATOM   4904  H  H    . LYS A 1 313 ? -44.353 -4.684  -3.426  1.00 21.60  ? 392  LYS A H    1 
ATOM   4905  H  HA   . LYS A 1 313 ? -46.807 -4.256  -2.725  1.00 16.03  ? 392  LYS A HA   1 
ATOM   4906  H  HB2  . LYS A 1 313 ? -45.680 -6.481  -4.038  1.00 15.72  ? 392  LYS A HB2  1 
ATOM   4907  H  HB3  . LYS A 1 313 ? -47.246 -6.337  -3.819  1.00 15.72  ? 392  LYS A HB3  1 
ATOM   4908  H  HG2  . LYS A 1 313 ? -46.950 -4.209  -5.047  1.00 21.34  ? 392  LYS A HG2  1 
ATOM   4909  H  HG3  . LYS A 1 313 ? -45.631 -4.911  -5.589  1.00 21.34  ? 392  LYS A HG3  1 
ATOM   4910  H  HD2  . LYS A 1 313 ? -46.769 -6.390  -6.785  1.00 25.45  ? 392  LYS A HD2  1 
ATOM   4911  H  HD3  . LYS A 1 313 ? -48.074 -6.246  -5.881  1.00 25.45  ? 392  LYS A HD3  1 
ATOM   4912  H  HE2  . LYS A 1 313 ? -48.439 -4.115  -6.800  1.00 33.13  ? 392  LYS A HE2  1 
ATOM   4913  H  HE3  . LYS A 1 313 ? -47.179 -4.328  -7.748  1.00 33.13  ? 392  LYS A HE3  1 
ATOM   4914  H  HZ1  . LYS A 1 313 ? -49.098 -4.808  -8.856  1.00 44.84  ? 392  LYS A HZ1  1 
ATOM   4915  H  HZ2  . LYS A 1 313 ? -48.311 -6.020  -8.753  1.00 44.84  ? 392  LYS A HZ2  1 
ATOM   4916  H  HZ3  . LYS A 1 313 ? -49.458 -5.826  -7.890  1.00 44.84  ? 392  LYS A HZ3  1 
ATOM   4917  N  N    . LEU A 1 314 ? -45.362 -6.498  -0.981  1.00 24.24  ? 393  LEU A N    1 
ATOM   4918  C  CA   . LEU A 1 314 ? -45.456 -7.199  0.293   1.00 25.50  ? 393  LEU A CA   1 
ATOM   4919  C  C    . LEU A 1 314 ? -45.585 -6.187  1.419   1.00 27.37  ? 393  LEU A C    1 
ATOM   4920  O  O    . LEU A 1 314 ? -46.413 -6.345  2.317   1.00 35.03  ? 393  LEU A O    1 
ATOM   4921  C  CB   . LEU A 1 314 ? -44.235 -8.085  0.539   1.00 23.04  ? 393  LEU A CB   1 
ATOM   4922  C  CG   . LEU A 1 314 ? -44.284 -8.822  1.882   1.00 20.98  ? 393  LEU A CG   1 
ATOM   4923  C  CD1  . LEU A 1 314 ? -45.283 -9.969  1.835   1.00 24.92  ? 393  LEU A CD1  1 
ATOM   4924  C  CD2  . LEU A 1 314 ? -42.911 -9.312  2.282   1.00 21.57  ? 393  LEU A CD2  1 
ATOM   4925  H  H    . LEU A 1 314 ? -44.609 -6.591  -1.386  1.00 29.08  ? 393  LEU A H    1 
ATOM   4926  H  HA   . LEU A 1 314 ? -46.247 -7.761  0.294   1.00 30.61  ? 393  LEU A HA   1 
ATOM   4927  H  HB2  . LEU A 1 314 ? -44.183 -8.750  -0.165  1.00 27.64  ? 393  LEU A HB2  1 
ATOM   4928  H  HB3  . LEU A 1 314 ? -43.439 -7.532  0.531   1.00 27.64  ? 393  LEU A HB3  1 
ATOM   4929  H  HG   . LEU A 1 314 ? -44.583 -8.201  2.564   1.00 25.18  ? 393  LEU A HG   1 
ATOM   4930  H  HD11 . LEU A 1 314 ? -45.292 -10.415 2.696   1.00 29.90  ? 393  LEU A HD11 1 
ATOM   4931  H  HD12 . LEU A 1 314 ? -46.164 -9.612  1.638   1.00 29.90  ? 393  LEU A HD12 1 
ATOM   4932  H  HD13 . LEU A 1 314 ? -45.016 -10.592 1.141   1.00 29.90  ? 393  LEU A HD13 1 
ATOM   4933  H  HD21 . LEU A 1 314 ? -42.976 -9.773  3.133   1.00 25.88  ? 393  LEU A HD21 1 
ATOM   4934  H  HD22 . LEU A 1 314 ? -42.582 -9.920  1.601   1.00 25.88  ? 393  LEU A HD22 1 
ATOM   4935  H  HD23 . LEU A 1 314 ? -42.315 -8.551  2.362   1.00 25.88  ? 393  LEU A HD23 1 
ATOM   4936  N  N    . LEU A 1 315 ? -44.756 -5.150  1.370   1.00 22.50  ? 394  LEU A N    1 
ATOM   4937  C  CA   . LEU A 1 315 ? -44.763 -4.122  2.404   1.00 22.04  ? 394  LEU A CA   1 
ATOM   4938  C  C    . LEU A 1 315 ? -46.105 -3.404  2.426   1.00 23.49  ? 394  LEU A C    1 
ATOM   4939  O  O    . LEU A 1 315 ? -46.536 -2.912  3.465   1.00 32.25  ? 394  LEU A O    1 
ATOM   4940  C  CB   . LEU A 1 315 ? -43.619 -3.129  2.186   1.00 20.56  ? 394  LEU A CB   1 
ATOM   4941  C  CG   . LEU A 1 315 ? -42.222 -3.679  2.485   1.00 25.52  ? 394  LEU A CG   1 
ATOM   4942  C  CD1  . LEU A 1 315 ? -41.155 -2.734  1.954   1.00 30.41  ? 394  LEU A CD1  1 
ATOM   4943  C  CD2  . LEU A 1 315 ? -42.050 -3.898  3.975   1.00 27.70  ? 394  LEU A CD2  1 
ATOM   4944  H  H    . LEU A 1 315 ? -44.179 -5.017  0.747   1.00 27.00  ? 394  LEU A H    1 
ATOM   4945  H  HA   . LEU A 1 315 ? -44.634 -4.543  3.268   1.00 26.45  ? 394  LEU A HA   1 
ATOM   4946  H  HB2  . LEU A 1 315 ? -43.630 -2.844  1.259   1.00 24.67  ? 394  LEU A HB2  1 
ATOM   4947  H  HB3  . LEU A 1 315 ? -43.762 -2.363  2.764   1.00 24.67  ? 394  LEU A HB3  1 
ATOM   4948  H  HG   . LEU A 1 315 ? -42.116 -4.534  2.040   1.00 30.63  ? 394  LEU A HG   1 
ATOM   4949  H  HD11 . LEU A 1 315 ? -40.280 -3.102  2.154   1.00 36.49  ? 394  LEU A HD11 1 
ATOM   4950  H  HD12 . LEU A 1 315 ? -41.264 -2.642  0.995   1.00 36.49  ? 394  LEU A HD12 1 
ATOM   4951  H  HD13 . LEU A 1 315 ? -41.257 -1.870  2.383   1.00 36.49  ? 394  LEU A HD13 1 
ATOM   4952  H  HD21 . LEU A 1 315 ? -41.160 -4.246  4.142   1.00 33.24  ? 394  LEU A HD21 1 
ATOM   4953  H  HD22 . LEU A 1 315 ? -42.166 -3.051  4.434   1.00 33.24  ? 394  LEU A HD22 1 
ATOM   4954  H  HD23 . LEU A 1 315 ? -42.717 -4.533  4.279   1.00 33.24  ? 394  LEU A HD23 1 
ATOM   4955  N  N    . THR A 1 316 ? -46.774 -3.361  1.281   1.00 31.89  ? 395  THR A N    1 
ATOM   4956  C  CA   . THR A 1 316 ? -48.122 -2.818  1.220   1.00 32.73  ? 395  THR A CA   1 
ATOM   4957  C  C    . THR A 1 316 ? -49.105 -3.739  1.950   1.00 34.79  ? 395  THR A C    1 
ATOM   4958  O  O    . THR A 1 316 ? -50.005 -3.263  2.641   1.00 42.68  ? 395  THR A O    1 
ATOM   4959  C  CB   . THR A 1 316 ? -48.568 -2.611  -0.236  1.00 36.22  ? 395  THR A CB   1 
ATOM   4960  O  OG1  . THR A 1 316 ? -47.645 -1.732  -0.894  1.00 32.92  ? 395  THR A OG1  1 
ATOM   4961  C  CG2  . THR A 1 316 ? -49.973 -2.016  -0.301  1.00 34.35  ? 395  THR A CG2  1 
ATOM   4962  H  H    . THR A 1 316 ? -46.470 -3.640  0.527   1.00 38.27  ? 395  THR A H    1 
ATOM   4963  H  HA   . THR A 1 316 ? -48.135 -1.955  1.663   1.00 39.28  ? 395  THR A HA   1 
ATOM   4964  H  HB   . THR A 1 316 ? -48.577 -3.466  -0.693  1.00 43.46  ? 395  THR A HB   1 
ATOM   4965  H  HG1  . THR A 1 316 ? -46.874 -2.065  -0.885  1.00 39.50  ? 395  THR A HG1  1 
ATOM   4966  H  HG21 . THR A 1 316 ? -50.238 -1.892  -1.226  1.00 41.22  ? 395  THR A HG21 1 
ATOM   4967  H  HG22 . THR A 1 316 ? -50.606 -2.612  0.130   1.00 41.22  ? 395  THR A HG22 1 
ATOM   4968  H  HG23 . THR A 1 316 ? -49.991 -1.157  0.150   1.00 41.22  ? 395  THR A HG23 1 
ATOM   4969  N  N    . LEU A 1 317 ? -48.934 -5.050  1.797   1.00 29.73  ? 396  LEU A N    1 
ATOM   4970  C  CA   . LEU A 1 317 ? -49.777 -6.020  2.499   1.00 24.35  ? 396  LEU A CA   1 
ATOM   4971  C  C    . LEU A 1 317 ? -49.497 -5.993  3.998   1.00 25.42  ? 396  LEU A C    1 
ATOM   4972  O  O    . LEU A 1 317 ? -50.419 -6.056  4.811   1.00 33.92  ? 396  LEU A O    1 
ATOM   4973  C  CB   . LEU A 1 317 ? -49.529 -7.434  1.979   1.00 20.35  ? 396  LEU A CB   1 
ATOM   4974  C  CG   . LEU A 1 317 ? -50.008 -7.763  0.566   1.00 23.62  ? 396  LEU A CG   1 
ATOM   4975  C  CD1  . LEU A 1 317 ? -49.444 -9.104  0.134   1.00 30.62  ? 396  LEU A CD1  1 
ATOM   4976  C  CD2  . LEU A 1 317 ? -51.523 -7.782  0.501   1.00 20.98  ? 396  LEU A CD2  1 
ATOM   4977  H  H    . LEU A 1 317 ? -48.336 -5.406  1.292   1.00 35.68  ? 396  LEU A H    1 
ATOM   4978  H  HA   . LEU A 1 317 ? -50.711 -5.799  2.356   1.00 29.22  ? 396  LEU A HA   1 
ATOM   4979  H  HB2  . LEU A 1 317 ? -48.573 -7.596  1.998   1.00 24.42  ? 396  LEU A HB2  1 
ATOM   4980  H  HB3  . LEU A 1 317 ? -49.969 -8.055  2.579   1.00 24.42  ? 396  LEU A HB3  1 
ATOM   4981  H  HG   . LEU A 1 317 ? -49.685 -7.085  -0.048  1.00 28.34  ? 396  LEU A HG   1 
ATOM   4982  H  HD11 . LEU A 1 317 ? -49.754 -9.303  -0.763  1.00 36.74  ? 396  LEU A HD11 1 
ATOM   4983  H  HD12 . LEU A 1 317 ? -48.475 -9.057  0.147   1.00 36.74  ? 396  LEU A HD12 1 
ATOM   4984  H  HD13 . LEU A 1 317 ? -49.750 -9.788  0.750   1.00 36.74  ? 396  LEU A HD13 1 
ATOM   4985  H  HD21 . LEU A 1 317 ? -51.798 -7.993  -0.405  1.00 25.17  ? 396  LEU A HD21 1 
ATOM   4986  H  HD22 . LEU A 1 317 ? -51.857 -8.456  1.114   1.00 25.17  ? 396  LEU A HD22 1 
ATOM   4987  H  HD23 . LEU A 1 317 ? -51.860 -6.908  0.754   1.00 25.17  ? 396  LEU A HD23 1 
ATOM   4988  N  N    . VAL A 1 318 ? -48.216 -5.922  4.354   1.00 32.34  ? 397  VAL A N    1 
ATOM   4989  C  CA   . VAL A 1 318 ? -47.801 -5.847  5.755   1.00 29.85  ? 397  VAL A CA   1 
ATOM   4990  C  C    . VAL A 1 318 ? -48.457 -4.639  6.409   1.00 36.23  ? 397  VAL A C    1 
ATOM   4991  O  O    . VAL A 1 318 ? -48.781 -4.658  7.594   1.00 44.15  ? 397  VAL A O    1 
ATOM   4992  C  CB   . VAL A 1 318 ? -46.259 -5.750  5.886   1.00 26.89  ? 397  VAL A CB   1 
ATOM   4993  C  CG1  . VAL A 1 318 ? -45.836 -5.324  7.294   1.00 32.28  ? 397  VAL A CG1  1 
ATOM   4994  C  CG2  . VAL A 1 318 ? -45.609 -7.081  5.539   1.00 29.98  ? 397  VAL A CG2  1 
ATOM   4995  H  H    . VAL A 1 318 ? -47.560 -5.917  3.797   1.00 38.81  ? 397  VAL A H    1 
ATOM   4996  H  HA   . VAL A 1 318 ? -48.097 -6.644  6.221   1.00 35.82  ? 397  VAL A HA   1 
ATOM   4997  H  HB   . VAL A 1 318 ? -45.931 -5.084  5.261   1.00 32.27  ? 397  VAL A HB   1 
ATOM   4998  H  HG11 . VAL A 1 318 ? -44.867 -5.276  7.331   1.00 38.74  ? 397  VAL A HG11 1 
ATOM   4999  H  HG12 . VAL A 1 318 ? -46.218 -4.454  7.489   1.00 38.74  ? 397  VAL A HG12 1 
ATOM   5000  H  HG13 . VAL A 1 318 ? -46.159 -5.979  7.932   1.00 38.74  ? 397  VAL A HG13 1 
ATOM   5001  H  HG21 . VAL A 1 318 ? -44.647 -6.995  5.629   1.00 35.98  ? 397  VAL A HG21 1 
ATOM   5002  H  HG22 . VAL A 1 318 ? -45.939 -7.760  6.148   1.00 35.98  ? 397  VAL A HG22 1 
ATOM   5003  H  HG23 . VAL A 1 318 ? -45.838 -7.315  4.626   1.00 35.98  ? 397  VAL A HG23 1 
ATOM   5004  N  N    . LEU A 1 319 ? -48.662 -3.597  5.611   1.00 45.02  ? 398  LEU A N    1 
ATOM   5005  C  CA   . LEU A 1 319 ? -49.304 -2.374  6.064   1.00 43.37  ? 398  LEU A CA   1 
ATOM   5006  C  C    . LEU A 1 319 ? -50.724 -2.647  6.545   1.00 46.35  ? 398  LEU A C    1 
ATOM   5007  O  O    . LEU A 1 319 ? -51.152 -2.130  7.575   1.00 50.89  ? 398  LEU A O    1 
ATOM   5008  C  CB   . LEU A 1 319 ? -49.347 -1.371  4.913   1.00 34.03  ? 398  LEU A CB   1 
ATOM   5009  C  CG   . LEU A 1 319 ? -49.319 0.119   5.243   1.00 40.29  ? 398  LEU A CG   1 
ATOM   5010  C  CD1  . LEU A 1 319 ? -48.051 0.501   5.993   1.00 44.25  ? 398  LEU A CD1  1 
ATOM   5011  C  CD2  . LEU A 1 319 ? -49.440 0.914   3.952   1.00 44.48  ? 398  LEU A CD2  1 
ATOM   5012  H  H    . LEU A 1 319 ? -48.431 -3.576  4.782   1.00 54.03  ? 398  LEU A H    1 
ATOM   5013  H  HA   . LEU A 1 319 ? -48.796 -1.989  6.795   1.00 52.05  ? 398  LEU A HA   1 
ATOM   5014  H  HB2  . LEU A 1 319 ? -48.585 -1.545  4.340   1.00 40.83  ? 398  LEU A HB2  1 
ATOM   5015  H  HB3  . LEU A 1 319 ? -50.162 -1.531  4.411   1.00 40.83  ? 398  LEU A HB3  1 
ATOM   5016  H  HG   . LEU A 1 319 ? -50.080 0.336   5.805   1.00 48.35  ? 398  LEU A HG   1 
ATOM   5017  H  HD11 . LEU A 1 319 ? -48.072 1.452   6.183   1.00 53.09  ? 398  LEU A HD11 1 
ATOM   5018  H  HD12 . LEU A 1 319 ? -48.011 -0.002  6.821   1.00 53.09  ? 398  LEU A HD12 1 
ATOM   5019  H  HD13 . LEU A 1 319 ? -47.283 0.291   5.440   1.00 53.09  ? 398  LEU A HD13 1 
ATOM   5020  H  HD21 . LEU A 1 319 ? -49.422 1.861   4.162   1.00 53.37  ? 398  LEU A HD21 1 
ATOM   5021  H  HD22 . LEU A 1 319 ? -48.695 0.689   3.372   1.00 53.37  ? 398  LEU A HD22 1 
ATOM   5022  H  HD23 . LEU A 1 319 ? -50.278 0.687   3.519   1.00 53.37  ? 398  LEU A HD23 1 
ATOM   5023  N  N    . GLN A 1 320 ? -51.452 -3.463  5.790   1.00 62.28  ? 399  GLN A N    1 
ATOM   5024  C  CA   . GLN A 1 320 ? -52.849 -3.759  6.096   1.00 66.22  ? 399  GLN A CA   1 
ATOM   5025  C  C    . GLN A 1 320 ? -53.006 -4.380  7.478   1.00 67.63  ? 399  GLN A C    1 
ATOM   5026  O  O    . GLN A 1 320 ? -53.814 -3.924  8.285   1.00 77.31  ? 399  GLN A O    1 
ATOM   5027  C  CB   . GLN A 1 320 ? -53.430 -4.700  5.039   1.00 67.57  ? 399  GLN A CB   1 
ATOM   5028  C  CG   . GLN A 1 320 ? -53.480 -4.088  3.645   1.00 66.25  ? 399  GLN A CG   1 
ATOM   5029  C  CD   . GLN A 1 320 ? -53.945 -5.058  2.561   1.00 72.83  ? 399  GLN A CD   1 
ATOM   5030  O  OE1  . GLN A 1 320 ? -53.853 -4.752  1.372   1.00 69.13  ? 399  GLN A OE1  1 
ATOM   5031  N  NE2  . GLN A 1 320 ? -54.446 -6.227  2.964   1.00 75.57  ? 399  GLN A NE2  1 
ATOM   5032  H  H    . GLN A 1 320 ? -51.157 -3.862  5.087   1.00 74.73  ? 399  GLN A H    1 
ATOM   5033  H  HA   . GLN A 1 320 ? -53.359 -2.934  6.077   1.00 79.46  ? 399  GLN A HA   1 
ATOM   5034  H  HB2  . GLN A 1 320 ? -52.880 -5.498  4.994   1.00 81.08  ? 399  GLN A HB2  1 
ATOM   5035  H  HB3  . GLN A 1 320 ? -54.335 -4.937  5.294   1.00 81.08  ? 399  GLN A HB3  1 
ATOM   5036  H  HG2  . GLN A 1 320 ? -54.096 -3.338  3.655   1.00 79.50  ? 399  GLN A HG2  1 
ATOM   5037  H  HG3  . GLN A 1 320 ? -52.592 -3.780  3.406   1.00 79.50  ? 399  GLN A HG3  1 
ATOM   5038  H  HE21 . GLN A 1 320 ? -54.496 -6.407  3.803   1.00 90.68  ? 399  GLN A HE21 1 
ATOM   5039  H  HE22 . GLN A 1 320 ? -54.719 -6.800  2.384   1.00 90.68  ? 399  GLN A HE22 1 
ATOM   5040  N  N    . SER A 1 321 ? -52.215 -5.410  7.749   1.00 61.23  ? 400  SER A N    1 
ATOM   5041  C  CA   . SER A 1 321 ? -52.275 -6.118  9.024   1.00 70.06  ? 400  SER A CA   1 
ATOM   5042  C  C    . SER A 1 321 ? -52.002 -5.229  10.237  1.00 69.69  ? 400  SER A C    1 
ATOM   5043  O  O    . SER A 1 321 ? -52.710 -5.318  11.240  1.00 72.39  ? 400  SER A O    1 
ATOM   5044  C  CB   . SER A 1 321 ? -51.274 -7.279  9.031   1.00 81.58  ? 400  SER A CB   1 
ATOM   5045  O  OG   . SER A 1 321 ? -49.937 -6.807  8.927   1.00 80.58  ? 400  SER A OG   1 
ATOM   5046  H  H    . SER A 1 321 ? -51.627 -5.724  7.205   1.00 73.47  ? 400  SER A H    1 
ATOM   5047  H  HA   . SER A 1 321 ? -53.164 -6.494  9.128   1.00 84.08  ? 400  SER A HA   1 
ATOM   5048  H  HB2  . SER A 1 321 ? -51.369 -7.772  9.860   1.00 97.89  ? 400  SER A HB2  1 
ATOM   5049  H  HB3  . SER A 1 321 ? -51.461 -7.860  8.277   1.00 97.89  ? 400  SER A HB3  1 
ATOM   5050  H  HG   . SER A 1 321 ? -49.839 -6.378  8.211   1.00 96.70  ? 400  SER A HG   1 
ATOM   5051  N  N    . SER A 1 322 ? -50.982 -4.376  10.150  1.00 96.20  ? 401  SER A N    1 
ATOM   5052  C  CA   . SER A 1 322 ? -50.417 -3.757  11.351  1.00 105.29 ? 401  SER A CA   1 
ATOM   5053  C  C    . SER A 1 322 ? -50.097 -2.260  11.261  1.00 107.08 ? 401  SER A C    1 
ATOM   5054  O  O    . SER A 1 322 ? -50.721 -1.452  11.947  1.00 113.27 ? 401  SER A O    1 
ATOM   5055  C  CB   . SER A 1 322 ? -49.147 -4.514  11.760  1.00 107.89 ? 401  SER A CB   1 
ATOM   5056  O  OG   . SER A 1 322 ? -49.402 -5.903  11.889  1.00 112.22 ? 401  SER A OG   1 
ATOM   5057  H  H    . SER A 1 322 ? -50.602 -4.139  9.415   1.00 115.44 ? 401  SER A H    1 
ATOM   5058  H  HA   . SER A 1 322 ? -51.058 -3.866  12.072  1.00 126.35 ? 401  SER A HA   1 
ATOM   5059  H  HB2  . SER A 1 322 ? -48.468 -4.380  11.080  1.00 129.46 ? 401  SER A HB2  1 
ATOM   5060  H  HB3  . SER A 1 322 ? -48.836 -4.169  12.611  1.00 129.46 ? 401  SER A HB3  1 
ATOM   5061  H  HG   . SER A 1 322 ? -48.698 -6.304  12.113  1.00 134.67 ? 401  SER A HG   1 
ATOM   5062  N  N    . GLU A 1 323 ? -49.111 -1.910  10.435  1.00 112.21 ? 402  GLU A N    1 
ATOM   5063  C  CA   . GLU A 1 323 ? -48.460 -0.589  10.461  1.00 114.63 ? 402  GLU A CA   1 
ATOM   5064  C  C    . GLU A 1 323 ? -47.645 -0.375  11.745  1.00 118.31 ? 402  GLU A C    1 
ATOM   5065  O  O    . GLU A 1 323 ? -47.052 0.686   11.944  1.00 123.35 ? 402  GLU A O    1 
ATOM   5066  C  CB   . GLU A 1 323 ? -49.452 0.572   10.273  1.00 117.08 ? 402  GLU A CB   1 
ATOM   5067  C  CG   . GLU A 1 323 ? -50.164 0.583   8.930   1.00 120.71 ? 402  GLU A CG   1 
ATOM   5068  C  CD   . GLU A 1 323 ? -51.677 0.448   9.033   1.00 122.73 ? 402  GLU A CD   1 
ATOM   5069  O  OE1  . GLU A 1 323 ? -52.166 -0.286  9.917   1.00 121.34 ? 402  GLU A OE1  1 
ATOM   5070  O  OE2  . GLU A 1 323 ? -52.374 1.078   8.210   1.00 120.20 ? 402  GLU A OE2  1 
ATOM   5071  H  H    . GLU A 1 323 ? -48.790 -2.433  9.832   1.00 134.65 ? 402  GLU A H    1 
ATOM   5072  H  HA   . GLU A 1 323 ? -47.835 -0.550  9.720   1.00 137.56 ? 402  GLU A HA   1 
ATOM   5073  H  HB2  . GLU A 1 323 ? -50.129 0.516   10.965  1.00 140.49 ? 402  GLU A HB2  1 
ATOM   5074  H  HB3  . GLU A 1 323 ? -48.968 1.409   10.356  1.00 140.49 ? 402  GLU A HB3  1 
ATOM   5075  H  HG2  . GLU A 1 323 ? -49.972 1.422   8.482   1.00 144.85 ? 402  GLU A HG2  1 
ATOM   5076  H  HG3  . GLU A 1 323 ? -49.836 -0.157  8.396   1.00 144.85 ? 402  GLU A HG3  1 
ATOM   5077  N  N    . GLU A 1 324 ? -47.605 -1.393  12.600  1.00 111.87 ? 403  GLU A N    1 
ATOM   5078  C  CA   . GLU A 1 324 ? -46.883 -1.326  13.862  1.00 106.06 ? 403  GLU A CA   1 
ATOM   5079  C  C    . GLU A 1 324 ? -45.409 -1.586  13.600  1.00 102.27 ? 403  GLU A C    1 
ATOM   5080  O  O    . GLU A 1 324 ? -44.532 -0.930  14.162  1.00 102.99 ? 403  GLU A O    1 
ATOM   5081  C  CB   . GLU A 1 324 ? -47.399 -2.403  14.817  1.00 104.06 ? 403  GLU A CB   1 
ATOM   5082  C  CG   . GLU A 1 324 ? -48.915 -2.448  14.983  1.00 105.97 ? 403  GLU A CG   1 
ATOM   5083  C  CD   . GLU A 1 324 ? -49.433 -3.847  15.282  1.00 108.35 ? 403  GLU A CD   1 
ATOM   5084  O  OE1  . GLU A 1 324 ? -48.650 -4.683  15.784  1.00 104.87 ? 403  GLU A OE1  1 
ATOM   5085  O  OE2  . GLU A 1 324 ? -50.625 -4.111  15.011  1.00 111.62 ? 403  GLU A OE2  1 
ATOM   5086  H  H    . GLU A 1 324 ? -47.997 -2.147  12.467  1.00 134.24 ? 403  GLU A H    1 
ATOM   5087  H  HA   . GLU A 1 324 ? -46.990 -0.453  14.270  1.00 127.27 ? 403  GLU A HA   1 
ATOM   5088  H  HB2  . GLU A 1 324 ? -47.116 -3.270  14.487  1.00 124.88 ? 403  GLU A HB2  1 
ATOM   5089  H  HB3  . GLU A 1 324 ? -47.014 -2.248  15.694  1.00 124.88 ? 403  GLU A HB3  1 
ATOM   5090  H  HG2  . GLU A 1 324 ? -49.169 -1.870  15.720  1.00 127.16 ? 403  GLU A HG2  1 
ATOM   5091  H  HG3  . GLU A 1 324 ? -49.332 -2.142  14.163  1.00 127.16 ? 403  GLU A HG3  1 
ATOM   5092  N  N    . VAL A 1 325 ? -45.158 -2.560  12.732  1.00 80.23  ? 404  VAL A N    1 
ATOM   5093  C  CA   . VAL A 1 325 ? -43.813 -3.057  12.468  1.00 80.42  ? 404  VAL A CA   1 
ATOM   5094  C  C    . VAL A 1 325 ? -42.916 -2.030  11.772  1.00 76.77  ? 404  VAL A C    1 
ATOM   5095  O  O    . VAL A 1 325 ? -41.726 -1.929  12.075  1.00 72.25  ? 404  VAL A O    1 
ATOM   5096  C  CB   . VAL A 1 325 ? -43.871 -4.338  11.609  1.00 77.87  ? 404  VAL A CB   1 
ATOM   5097  C  CG1  . VAL A 1 325 ? -42.470 -4.861  11.326  1.00 81.50  ? 404  VAL A CG1  1 
ATOM   5098  C  CG2  . VAL A 1 325 ? -44.701 -5.405  12.308  1.00 77.49  ? 404  VAL A CG2  1 
ATOM   5099  H  H    . VAL A 1 325 ? -45.766 -2.959  12.272  1.00 96.28  ? 404  VAL A H    1 
ATOM   5100  H  HA   . VAL A 1 325 ? -43.396 -3.287  13.314  1.00 96.51  ? 404  VAL A HA   1 
ATOM   5101  H  HB   . VAL A 1 325 ? -44.294 -4.133  10.761  1.00 93.44  ? 404  VAL A HB   1 
ATOM   5102  H  HG11 . VAL A 1 325 ? -42.536 -5.663  10.786  1.00 97.80  ? 404  VAL A HG11 1 
ATOM   5103  H  HG12 . VAL A 1 325 ? -41.970 -4.180  10.848  1.00 97.80  ? 404  VAL A HG12 1 
ATOM   5104  H  HG13 . VAL A 1 325 ? -42.032 -5.063  12.168  1.00 97.80  ? 404  VAL A HG13 1 
ATOM   5105  H  HG21 . VAL A 1 325 ? -44.725 -6.200  11.753  1.00 92.98  ? 404  VAL A HG21 1 
ATOM   5106  H  HG22 . VAL A 1 325 ? -44.293 -5.611  13.164  1.00 92.98  ? 404  VAL A HG22 1 
ATOM   5107  H  HG23 . VAL A 1 325 ? -45.600 -5.067  12.442  1.00 92.98  ? 404  VAL A HG23 1 
ATOM   5108  N  N    . LEU A 1 326 ? -43.484 -1.289  10.826  1.00 79.51  ? 405  LEU A N    1 
ATOM   5109  C  CA   . LEU A 1 326 ? -42.726 -0.303  10.063  1.00 77.21  ? 405  LEU A CA   1 
ATOM   5110  C  C    . LEU A 1 326 ? -42.388 0.921   10.909  1.00 76.77  ? 405  LEU A C    1 
ATOM   5111  O  O    . LEU A 1 326 ? -43.087 1.229   11.874  1.00 88.44  ? 405  LEU A O    1 
ATOM   5112  C  CB   . LEU A 1 326 ? -43.530 0.152   8.845   1.00 76.99  ? 405  LEU A CB   1 
ATOM   5113  C  CG   . LEU A 1 326 ? -44.140 -0.928  7.950   1.00 73.21  ? 405  LEU A CG   1 
ATOM   5114  C  CD1  . LEU A 1 326 ? -45.137 -0.297  7.008   1.00 82.86  ? 405  LEU A CD1  1 
ATOM   5115  C  CD2  . LEU A 1 326 ? -43.076 -1.652  7.162   1.00 55.29  ? 405  LEU A CD2  1 
ATOM   5116  H  H    . LEU A 1 326 ? -44.313 -1.340  10.605  1.00 95.41  ? 405  LEU A H    1 
ATOM   5117  H  HA   . LEU A 1 326 ? -41.897 -0.701  9.753   1.00 92.65  ? 405  LEU A HA   1 
ATOM   5118  H  HB2  . LEU A 1 326 ? -44.262 0.705   9.159   1.00 92.39  ? 405  LEU A HB2  1 
ATOM   5119  H  HB3  . LEU A 1 326 ? -42.946 0.687   8.285   1.00 92.39  ? 405  LEU A HB3  1 
ATOM   5120  H  HG   . LEU A 1 326 ? -44.607 -1.576  8.500   1.00 87.85  ? 405  LEU A HG   1 
ATOM   5121  H  HD11 . LEU A 1 326 ? -45.520 -0.987  6.444   1.00 99.43  ? 405  LEU A HD11 1 
ATOM   5122  H  HD12 . LEU A 1 326 ? -45.836 0.131   7.528   1.00 99.43  ? 405  LEU A HD12 1 
ATOM   5123  H  HD13 . LEU A 1 326 ? -44.681 0.362   6.461   1.00 99.43  ? 405  LEU A HD13 1 
ATOM   5124  H  HD21 . LEU A 1 326 ? -43.499 -2.327  6.608   1.00 66.35  ? 405  LEU A HD21 1 
ATOM   5125  H  HD22 . LEU A 1 326 ? -42.607 -1.013  6.604   1.00 66.35  ? 405  LEU A HD22 1 
ATOM   5126  H  HD23 . LEU A 1 326 ? -42.456 -2.071  7.779   1.00 66.35  ? 405  LEU A HD23 1 
ATOM   5127  N  N    . THR A 1 327 ? -41.319 1.617   10.528  1.00 45.98  ? 406  THR A N    1 
ATOM   5128  C  CA   . THR A 1 327 ? -40.936 2.873   11.163  1.00 49.65  ? 406  THR A CA   1 
ATOM   5129  C  C    . THR A 1 327 ? -41.057 3.994   10.143  1.00 51.48  ? 406  THR A C    1 
ATOM   5130  O  O    . THR A 1 327 ? -41.290 3.739   8.961   1.00 51.48  ? 406  THR A O    1 
ATOM   5131  C  CB   . THR A 1 327 ? -39.487 2.831   11.687  1.00 54.57  ? 406  THR A CB   1 
ATOM   5132  O  OG1  . THR A 1 327 ? -38.578 2.660   10.592  1.00 49.50  ? 406  THR A OG1  1 
ATOM   5133  C  CG2  . THR A 1 327 ? -39.307 1.691   12.678  1.00 59.85  ? 406  THR A CG2  1 
ATOM   5134  H  H    . THR A 1 327 ? -40.792 1.376   9.893   1.00 55.18  ? 406  THR A H    1 
ATOM   5135  H  HA   . THR A 1 327 ? -41.531 3.060   11.905  1.00 59.58  ? 406  THR A HA   1 
ATOM   5136  H  HB   . THR A 1 327 ? -39.287 3.664   12.142  1.00 65.48  ? 406  THR A HB   1 
ATOM   5137  H  HG1  . THR A 1 327 ? -37.788 2.637   10.876  1.00 59.40  ? 406  THR A HG1  1 
ATOM   5138  H  HG21 . THR A 1 327 ? -38.392 1.675   13.001  1.00 71.81  ? 406  THR A HG21 1 
ATOM   5139  H  HG22 . THR A 1 327 ? -39.905 1.810   13.432  1.00 71.81  ? 406  THR A HG22 1 
ATOM   5140  H  HG23 . THR A 1 327 ? -39.505 0.844   12.249  1.00 71.81  ? 406  THR A HG23 1 
ATOM   5141  N  N    . ALA A 1 328 ? -40.907 5.233   10.601  1.00 48.12  ? 407  ALA A N    1 
ATOM   5142  C  CA   . ALA A 1 328 ? -40.984 6.386   9.713   1.00 37.24  ? 407  ALA A CA   1 
ATOM   5143  C  C    . ALA A 1 328 ? -39.926 6.285   8.631   1.00 34.03  ? 407  ALA A C    1 
ATOM   5144  O  O    . ALA A 1 328 ? -40.164 6.638   7.477   1.00 41.10  ? 407  ALA A O    1 
ATOM   5145  C  CB   . ALA A 1 328 ? -40.793 7.659   10.496  1.00 38.47  ? 407  ALA A CB   1 
ATOM   5146  H  H    . ALA A 1 328 ? -40.758 5.432   11.424  1.00 57.74  ? 407  ALA A H    1 
ATOM   5147  H  HA   . ALA A 1 328 ? -41.857 6.412   9.290   1.00 44.69  ? 407  ALA A HA   1 
ATOM   5148  H  HB1  . ALA A 1 328 ? -40.848 8.414   9.889   1.00 46.17  ? 407  ALA A HB1  1 
ATOM   5149  H  HB2  . ALA A 1 328 ? -41.489 7.724   11.169  1.00 46.17  ? 407  ALA A HB2  1 
ATOM   5150  H  HB3  . ALA A 1 328 ? -39.921 7.639   10.922  1.00 46.17  ? 407  ALA A HB3  1 
ATOM   5151  N  N    . GLU A 1 329 ? -38.755 5.793   9.014   1.00 42.86  ? 408  GLU A N    1 
ATOM   5152  C  CA   . GLU A 1 329 ? -37.626 5.711   8.102   1.00 46.00  ? 408  GLU A CA   1 
ATOM   5153  C  C    . GLU A 1 329 ? -37.853 4.602   7.082   1.00 52.38  ? 408  GLU A C    1 
ATOM   5154  O  O    . GLU A 1 329 ? -37.436 4.714   5.929   1.00 59.55  ? 408  GLU A O    1 
ATOM   5155  C  CB   . GLU A 1 329 ? -36.332 5.478   8.884   1.00 48.12  ? 408  GLU A CB   1 
ATOM   5156  C  CG   . GLU A 1 329 ? -36.135 6.451   10.047  1.00 61.07  ? 408  GLU A CG   1 
ATOM   5157  C  CD   . GLU A 1 329 ? -36.746 5.951   11.347  1.00 71.79  ? 408  GLU A CD   1 
ATOM   5158  O  OE1  . GLU A 1 329 ? -36.236 4.954   11.903  1.00 78.73  ? 408  GLU A OE1  1 
ATOM   5159  O  OE2  . GLU A 1 329 ? -37.738 6.554   11.811  1.00 69.95  ? 408  GLU A OE2  1 
ATOM   5160  H  H    . GLU A 1 329 ? -38.588 5.498   9.805   1.00 51.43  ? 408  GLU A H    1 
ATOM   5161  H  HA   . GLU A 1 329 ? -37.542 6.550   7.623   1.00 55.20  ? 408  GLU A HA   1 
ATOM   5162  H  HB2  . GLU A 1 329 ? -36.344 4.579   9.248   1.00 57.74  ? 408  GLU A HB2  1 
ATOM   5163  H  HB3  . GLU A 1 329 ? -35.579 5.579   8.281   1.00 57.74  ? 408  GLU A HB3  1 
ATOM   5164  H  HG2  . GLU A 1 329 ? -35.185 6.580   10.193  1.00 73.28  ? 408  GLU A HG2  1 
ATOM   5165  H  HG3  . GLU A 1 329 ? -36.555 7.297   9.824   1.00 73.28  ? 408  GLU A HG3  1 
ATOM   5166  N  N    . ASP A 1 330 ? -38.526 3.537   7.508   1.00 51.84  ? 409  ASP A N    1 
ATOM   5167  C  CA   . ASP A 1 330 ? -38.892 2.454   6.605   1.00 49.16  ? 409  ASP A CA   1 
ATOM   5168  C  C    . ASP A 1 330 ? -39.817 2.985   5.526   1.00 45.51  ? 409  ASP A C    1 
ATOM   5169  O  O    . ASP A 1 330 ? -39.599 2.753   4.339   1.00 45.24  ? 409  ASP A O    1 
ATOM   5170  C  CB   . ASP A 1 330 ? -39.602 1.332   7.364   1.00 51.20  ? 409  ASP A CB   1 
ATOM   5171  C  CG   . ASP A 1 330 ? -38.711 0.667   8.394   1.00 54.76  ? 409  ASP A CG   1 
ATOM   5172  O  OD1  . ASP A 1 330 ? -37.494 0.534   8.134   1.00 52.40  ? 409  ASP A OD1  1 
ATOM   5173  O  OD2  . ASP A 1 330 ? -39.230 0.277   9.463   1.00 56.27  ? 409  ASP A OD2  1 
ATOM   5174  H  H    . ASP A 1 330 ? -38.782 3.419   8.320   1.00 62.21  ? 409  ASP A H    1 
ATOM   5175  H  HA   . ASP A 1 330 ? -38.096 2.092   6.185   1.00 58.99  ? 409  ASP A HA   1 
ATOM   5176  H  HB2  . ASP A 1 330 ? -40.372 1.700   7.825   1.00 61.45  ? 409  ASP A HB2  1 
ATOM   5177  H  HB3  . ASP A 1 330 ? -39.887 0.653   6.731   1.00 61.45  ? 409  ASP A HB3  1 
ATOM   5178  N  N    . CYS A 1 331 ? -40.856 3.695   5.953   1.00 46.66  ? 410  CYS A N    1 
ATOM   5179  C  CA   . CYS A 1 331 ? -41.840 4.249   5.034   1.00 42.19  ? 410  CYS A CA   1 
ATOM   5180  C  C    . CYS A 1 331 ? -41.249 5.337   4.148   1.00 43.65  ? 410  CYS A C    1 
ATOM   5181  O  O    . CYS A 1 331 ? -41.535 5.389   2.953   1.00 47.91  ? 410  CYS A O    1 
ATOM   5182  C  CB   . CYS A 1 331 ? -43.023 4.815   5.813   1.00 39.91  ? 410  CYS A CB   1 
ATOM   5183  S  SG   . CYS A 1 331 ? -43.956 3.574   6.731   1.00 50.14  ? 410  CYS A SG   1 
ATOM   5184  H  H    . CYS A 1 331 ? -41.014 3.871   6.780   1.00 55.99  ? 410  CYS A H    1 
ATOM   5185  H  HA   . CYS A 1 331 ? -42.170 3.541   4.459   1.00 50.63  ? 410  CYS A HA   1 
ATOM   5186  H  HB2  . CYS A 1 331 ? -42.694 5.469   6.450   1.00 47.89  ? 410  CYS A HB2  1 
ATOM   5187  H  HB3  . CYS A 1 331 ? -43.632 5.241   5.190   1.00 47.89  ? 410  CYS A HB3  1 
ATOM   5188  H  HG   . CYS A 1 331 ? -44.387 2.761   5.961   1.00 60.16  ? 410  CYS A HG   1 
ATOM   5189  N  N    . GLU A 1 332 ? -40.431 6.206   4.737   1.00 42.94  ? 411  GLU A N    1 
ATOM   5190  C  CA   . GLU A 1 332 ? -39.807 7.297   3.997   1.00 42.23  ? 411  GLU A CA   1 
ATOM   5191  C  C    . GLU A 1 332 ? -38.946 6.763   2.858   1.00 44.71  ? 411  GLU A C    1 
ATOM   5192  O  O    . GLU A 1 332 ? -38.896 7.355   1.782   1.00 49.15  ? 411  GLU A O    1 
ATOM   5193  C  CB   . GLU A 1 332 ? -38.953 8.140   4.937   1.00 48.73  ? 411  GLU A CB   1 
ATOM   5194  C  CG   . GLU A 1 332 ? -38.436 9.428   4.318   1.00 57.19  ? 411  GLU A CG   1 
ATOM   5195  C  CD   . GLU A 1 332 ? -39.537 10.432  4.039   1.00 61.85  ? 411  GLU A CD   1 
ATOM   5196  O  OE1  . GLU A 1 332 ? -40.588 10.367  4.714   1.00 56.12  ? 411  GLU A OE1  1 
ATOM   5197  O  OE2  . GLU A 1 332 ? -39.348 11.288  3.146   1.00 67.18  ? 411  GLU A OE2  1 
ATOM   5198  H  H    . GLU A 1 332 ? -40.221 6.184   5.570   1.00 51.53  ? 411  GLU A H    1 
ATOM   5199  H  HA   . GLU A 1 332 ? -40.496 7.864   3.619   1.00 50.68  ? 411  GLU A HA   1 
ATOM   5200  H  HB2  . GLU A 1 332 ? -39.485 8.378   5.712   1.00 58.47  ? 411  GLU A HB2  1 
ATOM   5201  H  HB3  . GLU A 1 332 ? -38.185 7.617   5.214   1.00 58.47  ? 411  GLU A HB3  1 
ATOM   5202  H  HG2  . GLU A 1 332 ? -37.803 9.839   4.927   1.00 68.63  ? 411  GLU A HG2  1 
ATOM   5203  H  HG3  . GLU A 1 332 ? -38.000 9.221   3.476   1.00 68.63  ? 411  GLU A HG3  1 
ATOM   5204  N  N    . ASN A 1 333 ? -38.266 5.648   3.104   1.00 47.08  ? 412  ASN A N    1 
ATOM   5205  C  CA   . ASN A 1 333 ? -37.452 5.015   2.077   1.00 41.94  ? 412  ASN A CA   1 
ATOM   5206  C  C    . ASN A 1 333 ? -38.298 4.538   0.905   1.00 43.64  ? 412  ASN A C    1 
ATOM   5207  O  O    . ASN A 1 333 ? -37.888 4.652   -0.248  1.00 52.62  ? 412  ASN A O    1 
ATOM   5208  C  CB   . ASN A 1 333 ? -36.686 3.826   2.654   1.00 37.86  ? 412  ASN A CB   1 
ATOM   5209  C  CG   . ASN A 1 333 ? -35.494 4.243   3.487   1.00 45.97  ? 412  ASN A CG   1 
ATOM   5210  O  OD1  . ASN A 1 333 ? -34.997 5.366   3.374   1.00 47.29  ? 412  ASN A OD1  1 
ATOM   5211  N  ND2  . ASN A 1 333 ? -35.019 3.328   4.326   1.00 49.39  ? 412  ASN A ND2  1 
ATOM   5212  H  H    . ASN A 1 333 ? -38.260 5.238   3.860   1.00 56.49  ? 412  ASN A H    1 
ATOM   5213  H  HA   . ASN A 1 333 ? -36.807 5.657   1.743   1.00 50.32  ? 412  ASN A HA   1 
ATOM   5214  H  HB2  . ASN A 1 333 ? -37.282 3.312   3.220   1.00 45.43  ? 412  ASN A HB2  1 
ATOM   5215  H  HB3  . ASN A 1 333 ? -36.364 3.275   1.924   1.00 45.43  ? 412  ASN A HB3  1 
ATOM   5216  H  HD21 . ASN A 1 333 ? -34.342 3.511   4.824   1.00 59.26  ? 412  ASN A HD21 1 
ATOM   5217  H  HD22 . ASN A 1 333 ? -35.388 2.552   4.370   1.00 59.26  ? 412  ASN A HD22 1 
ATOM   5218  N  N    . VAL A 1 334 ? -39.472 3.989   1.201   1.00 37.14  ? 413  VAL A N    1 
ATOM   5219  C  CA   . VAL A 1 334 ? -40.373 3.509   0.156   1.00 37.79  ? 413  VAL A CA   1 
ATOM   5220  C  C    . VAL A 1 334 ? -40.943 4.685   -0.641  1.00 41.41  ? 413  VAL A C    1 
ATOM   5221  O  O    . VAL A 1 334 ? -41.172 4.571   -1.846  1.00 39.84  ? 413  VAL A O    1 
ATOM   5222  C  CB   . VAL A 1 334 ? -41.511 2.634   0.748   1.00 35.71  ? 413  VAL A CB   1 
ATOM   5223  C  CG1  . VAL A 1 334 ? -42.513 2.193   -0.327  1.00 35.38  ? 413  VAL A CG1  1 
ATOM   5224  C  CG2  . VAL A 1 334 ? -40.917 1.417   1.424   1.00 32.01  ? 413  VAL A CG2  1 
ATOM   5225  H  H    . VAL A 1 334 ? -39.771 3.881   2.000   1.00 44.57  ? 413  VAL A H    1 
ATOM   5226  H  HA   . VAL A 1 334 ? -39.867 2.955   -0.459  1.00 45.35  ? 413  VAL A HA   1 
ATOM   5227  H  HB   . VAL A 1 334 ? -41.991 3.147   1.417   1.00 42.86  ? 413  VAL A HB   1 
ATOM   5228  H  HG11 . VAL A 1 334 ? -43.203 1.651   0.088   1.00 42.46  ? 413  VAL A HG11 1 
ATOM   5229  H  HG12 . VAL A 1 334 ? -42.910 2.981   -0.731  1.00 42.46  ? 413  VAL A HG12 1 
ATOM   5230  H  HG13 . VAL A 1 334 ? -42.046 1.675   -1.000  1.00 42.46  ? 413  VAL A HG13 1 
ATOM   5231  H  HG21 . VAL A 1 334 ? -41.636 0.877   1.791   1.00 38.41  ? 413  VAL A HG21 1 
ATOM   5232  H  HG22 . VAL A 1 334 ? -40.419 0.904   0.769   1.00 38.41  ? 413  VAL A HG22 1 
ATOM   5233  H  HG23 . VAL A 1 334 ? -40.326 1.708   2.136   1.00 38.41  ? 413  VAL A HG23 1 
ATOM   5234  N  N    . TYR A 1 335 ? -41.146 5.819   0.027   1.00 31.97  ? 414  TYR A N    1 
ATOM   5235  C  CA   . TYR A 1 335 ? -41.686 7.005   -0.632  1.00 26.46  ? 414  TYR A CA   1 
ATOM   5236  C  C    . TYR A 1 335 ? -40.748 7.497   -1.726  1.00 25.62  ? 414  TYR A C    1 
ATOM   5237  O  O    . TYR A 1 335 ? -41.194 8.023   -2.744  1.00 31.88  ? 414  TYR A O    1 
ATOM   5238  C  CB   . TYR A 1 335 ? -41.886 8.149   0.362   1.00 24.04  ? 414  TYR A CB   1 
ATOM   5239  C  CG   . TYR A 1 335 ? -42.927 7.928   1.437   1.00 35.48  ? 414  TYR A CG   1 
ATOM   5240  C  CD1  . TYR A 1 335 ? -43.989 7.047   1.259   1.00 33.74  ? 414  TYR A CD1  1 
ATOM   5241  C  CD2  . TYR A 1 335 ? -42.848 8.623   2.634   1.00 33.86  ? 414  TYR A CD2  1 
ATOM   5242  C  CE1  . TYR A 1 335 ? -44.936 6.867   2.257   1.00 34.18  ? 414  TYR A CE1  1 
ATOM   5243  C  CE2  . TYR A 1 335 ? -43.774 8.448   3.626   1.00 35.91  ? 414  TYR A CE2  1 
ATOM   5244  C  CZ   . TYR A 1 335 ? -44.815 7.575   3.439   1.00 37.76  ? 414  TYR A CZ   1 
ATOM   5245  O  OH   . TYR A 1 335 ? -45.720 7.437   4.459   1.00 39.59  ? 414  TYR A OH   1 
ATOM   5246  H  H    . TYR A 1 335 ? -40.978 5.927   0.864   1.00 38.36  ? 414  TYR A H    1 
ATOM   5247  H  HA   . TYR A 1 335 ? -42.543 6.791   -1.033  1.00 31.75  ? 414  TYR A HA   1 
ATOM   5248  H  HB2  . TYR A 1 335 ? -41.041 8.315   0.809   1.00 28.85  ? 414  TYR A HB2  1 
ATOM   5249  H  HB3  . TYR A 1 335 ? -42.147 8.941   -0.134  1.00 28.85  ? 414  TYR A HB3  1 
ATOM   5250  H  HD1  . TYR A 1 335 ? -44.065 6.574   0.463   1.00 40.49  ? 414  TYR A HD1  1 
ATOM   5251  H  HD2  . TYR A 1 335 ? -42.144 9.216   2.770   1.00 40.64  ? 414  TYR A HD2  1 
ATOM   5252  H  HE1  . TYR A 1 335 ? -45.643 6.275   2.134   1.00 41.01  ? 414  TYR A HE1  1 
ATOM   5253  H  HE2  . TYR A 1 335 ? -43.701 8.922   4.422   1.00 43.10  ? 414  TYR A HE2  1 
ATOM   5254  H  HH   . TYR A 1 335 ? -45.505 7.933   5.103   1.00 47.50  ? 414  TYR A HH   1 
ATOM   5255  N  N    . HIS A 1 336 ? -39.446 7.352   -1.499  1.00 26.57  ? 415  HIS A N    1 
ATOM   5256  C  CA   . HIS A 1 336 ? -38.453 7.839   -2.449  1.00 28.46  ? 415  HIS A CA   1 
ATOM   5257  C  C    . HIS A 1 336 ? -38.630 7.164   -3.802  1.00 32.67  ? 415  HIS A C    1 
ATOM   5258  O  O    . HIS A 1 336 ? -38.377 7.769   -4.844  1.00 35.09  ? 415  HIS A O    1 
ATOM   5259  C  CB   . HIS A 1 336 ? -37.040 7.580   -1.930  1.00 27.32  ? 415  HIS A CB   1 
ATOM   5260  C  CG   . HIS A 1 336 ? -36.692 8.358   -0.691  1.00 31.59  ? 415  HIS A CG   1 
ATOM   5261  N  ND1  . HIS A 1 336 ? -35.578 8.083   0.058   1.00 38.69  ? 415  HIS A ND1  1 
ATOM   5262  C  CD2  . HIS A 1 336 ? -37.321 9.396   -0.096  1.00 36.57  ? 415  HIS A CD2  1 
ATOM   5263  C  CE1  . HIS A 1 336 ? -35.526 8.930   1.086   1.00 42.83  ? 415  HIS A CE1  1 
ATOM   5264  N  NE2  . HIS A 1 336 ? -36.567 9.727   1.012   1.00 44.51  ? 415  HIS A NE2  1 
ATOM   5265  H  H    . HIS A 1 336 ? -39.112 6.974   -0.803  1.00 31.89  ? 415  HIS A H    1 
ATOM   5266  H  HA   . HIS A 1 336 ? -38.564 8.796   -2.567  1.00 34.15  ? 415  HIS A HA   1 
ATOM   5267  H  HB2  . HIS A 1 336 ? -36.953 6.636   -1.721  1.00 32.79  ? 415  HIS A HB2  1 
ATOM   5268  H  HB3  . HIS A 1 336 ? -36.404 7.823   -2.621  1.00 32.79  ? 415  HIS A HB3  1 
ATOM   5269  H  HD1  . HIS A 1 336 ? -35.004 7.464   -0.109  1.00 46.43  ? 415  HIS A HD1  1 
ATOM   5270  H  HD2  . HIS A 1 336 ? -38.108 9.805   -0.376  1.00 43.88  ? 415  HIS A HD2  1 
ATOM   5271  H  HE1  . HIS A 1 336 ? -34.868 8.951   1.743   1.00 51.40  ? 415  HIS A HE1  1 
ATOM   5272  H  HE2  . HIS A 1 336 ? -36.750 10.358  1.566   1.00 53.41  ? 415  HIS A HE2  1 
ATOM   5273  N  N    . LEU A 1 337 ? -39.089 5.917   -3.776  1.00 24.16  ? 416  LEU A N    1 
ATOM   5274  C  CA   . LEU A 1 337 ? -39.158 5.093   -4.977  1.00 22.29  ? 416  LEU A CA   1 
ATOM   5275  C  C    . LEU A 1 337 ? -40.217 5.561   -5.965  1.00 23.97  ? 416  LEU A C    1 
ATOM   5276  O  O    . LEU A 1 337 ? -40.273 5.088   -7.098  1.00 22.62  ? 416  LEU A O    1 
ATOM   5277  C  CB   . LEU A 1 337 ? -39.419 3.642   -4.586  1.00 19.34  ? 416  LEU A CB   1 
ATOM   5278  C  CG   . LEU A 1 337 ? -38.361 3.027   -3.669  1.00 19.94  ? 416  LEU A CG   1 
ATOM   5279  C  CD1  . LEU A 1 337 ? -38.738 1.605   -3.342  1.00 24.66  ? 416  LEU A CD1  1 
ATOM   5280  C  CD2  . LEU A 1 337 ? -36.987 3.070   -4.307  1.00 24.37  ? 416  LEU A CD2  1 
ATOM   5281  H  H    . LEU A 1 337 ? -39.369 5.520   -3.066  1.00 29.00  ? 416  LEU A H    1 
ATOM   5282  H  HA   . LEU A 1 337 ? -38.299 5.127   -5.427  1.00 26.75  ? 416  LEU A HA   1 
ATOM   5283  H  HB2  . LEU A 1 337 ? -40.271 3.594   -4.125  1.00 23.21  ? 416  LEU A HB2  1 
ATOM   5284  H  HB3  . LEU A 1 337 ? -39.455 3.106   -5.393  1.00 23.21  ? 416  LEU A HB3  1 
ATOM   5285  H  HG   . LEU A 1 337 ? -38.326 3.530   -2.840  1.00 23.93  ? 416  LEU A HG   1 
ATOM   5286  H  HD11 . LEU A 1 337 ? -38.060 1.225   -2.760  1.00 29.59  ? 416  LEU A HD11 1 
ATOM   5287  H  HD12 . LEU A 1 337 ? -39.598 1.601   -2.894  1.00 29.59  ? 416  LEU A HD12 1 
ATOM   5288  H  HD13 . LEU A 1 337 ? -38.790 1.095   -4.165  1.00 29.59  ? 416  LEU A HD13 1 
ATOM   5289  H  HD21 . LEU A 1 337 ? -36.344 2.673   -3.698  1.00 29.24  ? 416  LEU A HD21 1 
ATOM   5290  H  HD22 . LEU A 1 337 ? -37.009 2.570   -5.137  1.00 29.24  ? 416  LEU A HD22 1 
ATOM   5291  H  HD23 . LEU A 1 337 ? -36.750 3.994   -4.482  1.00 29.24  ? 416  LEU A HD23 1 
ATOM   5292  N  N    . VAL A 1 338 ? -41.055 6.492   -5.534  1.00 27.31  ? 417  VAL A N    1 
ATOM   5293  C  CA   . VAL A 1 338 ? -42.036 7.096   -6.420  1.00 23.32  ? 417  VAL A CA   1 
ATOM   5294  C  C    . VAL A 1 338 ? -41.318 7.877   -7.529  1.00 26.62  ? 417  VAL A C    1 
ATOM   5295  O  O    . VAL A 1 338 ? -41.892 8.163   -8.583  1.00 20.49  ? 417  VAL A O    1 
ATOM   5296  C  CB   . VAL A 1 338 ? -42.979 8.007   -5.630  1.00 21.91  ? 417  VAL A CB   1 
ATOM   5297  C  CG1  . VAL A 1 338 ? -44.082 8.512   -6.506  1.00 32.10  ? 417  VAL A CG1  1 
ATOM   5298  C  CG2  . VAL A 1 338 ? -43.627 7.235   -4.497  1.00 33.17  ? 417  VAL A CG2  1 
ATOM   5299  H  H    . VAL A 1 338 ? -41.076 6.793   -4.729  1.00 32.77  ? 417  VAL A H    1 
ATOM   5300  H  HA   . VAL A 1 338 ? -42.565 6.397   -6.835  1.00 27.99  ? 417  VAL A HA   1 
ATOM   5301  H  HB   . VAL A 1 338 ? -42.491 8.761   -5.265  1.00 26.29  ? 417  VAL A HB   1 
ATOM   5302  H  HG11 . VAL A 1 338 ? -44.664 9.085   -5.982  1.00 38.52  ? 417  VAL A HG11 1 
ATOM   5303  H  HG12 . VAL A 1 338 ? -43.696 9.015   -7.241  1.00 38.52  ? 417  VAL A HG12 1 
ATOM   5304  H  HG13 . VAL A 1 338 ? -44.583 7.756   -6.850  1.00 38.52  ? 417  VAL A HG13 1 
ATOM   5305  H  HG21 . VAL A 1 338 ? -44.220 7.829   -4.010  1.00 39.81  ? 417  VAL A HG21 1 
ATOM   5306  H  HG22 . VAL A 1 338 ? -44.132 6.494   -4.868  1.00 39.81  ? 417  VAL A HG22 1 
ATOM   5307  H  HG23 . VAL A 1 338 ? -42.934 6.901   -3.906  1.00 39.81  ? 417  VAL A HG23 1 
ATOM   5308  N  N    . TYR A 1 339 ? -40.046 8.190   -7.286  1.00 25.54  ? 418  TYR A N    1 
ATOM   5309  C  CA   . TYR A 1 339 ? -39.210 8.901   -8.246  1.00 20.89  ? 418  TYR A CA   1 
ATOM   5310  C  C    . TYR A 1 339 ? -38.270 7.947   -8.970  1.00 21.29  ? 418  TYR A C    1 
ATOM   5311  O  O    . TYR A 1 339 ? -37.312 8.376   -9.611  1.00 27.32  ? 418  TYR A O    1 
ATOM   5312  C  CB   . TYR A 1 339 ? -38.408 9.982   -7.524  1.00 22.54  ? 418  TYR A CB   1 
ATOM   5313  C  CG   . TYR A 1 339 ? -39.291 10.981  -6.813  1.00 23.66  ? 418  TYR A CG   1 
ATOM   5314  C  CD1  . TYR A 1 339 ? -40.082 11.864  -7.530  1.00 26.11  ? 418  TYR A CD1  1 
ATOM   5315  C  CD2  . TYR A 1 339 ? -39.343 11.035  -5.426  1.00 27.16  ? 418  TYR A CD2  1 
ATOM   5316  C  CE1  . TYR A 1 339 ? -40.900 12.770  -6.893  1.00 26.13  ? 418  TYR A CE1  1 
ATOM   5317  C  CE2  . TYR A 1 339 ? -40.160 11.946  -4.778  1.00 34.38  ? 418  TYR A CE2  1 
ATOM   5318  C  CZ   . TYR A 1 339 ? -40.934 12.813  -5.520  1.00 34.68  ? 418  TYR A CZ   1 
ATOM   5319  O  OH   . TYR A 1 339 ? -41.757 13.724  -4.896  1.00 40.78  ? 418  TYR A OH   1 
ATOM   5320  H  H    . TYR A 1 339 ? -39.638 7.995   -6.555  1.00 30.65  ? 418  TYR A H    1 
ATOM   5321  H  HA   . TYR A 1 339 ? -39.776 9.332   -8.907  1.00 25.07  ? 418  TYR A HA   1 
ATOM   5322  H  HB2  . TYR A 1 339 ? -37.835 9.562   -6.863  1.00 27.05  ? 418  TYR A HB2  1 
ATOM   5323  H  HB3  . TYR A 1 339 ? -37.870 10.463  -8.172  1.00 27.05  ? 418  TYR A HB3  1 
ATOM   5324  H  HD1  . TYR A 1 339 ? -40.064 11.840  -8.460  1.00 31.33  ? 418  TYR A HD1  1 
ATOM   5325  H  HD2  . TYR A 1 339 ? -38.821 10.451  -4.926  1.00 32.59  ? 418  TYR A HD2  1 
ATOM   5326  H  HE1  . TYR A 1 339 ? -41.423 13.356  -7.391  1.00 31.36  ? 418  TYR A HE1  1 
ATOM   5327  H  HE2  . TYR A 1 339 ? -40.185 11.973  -3.848  1.00 41.25  ? 418  TYR A HE2  1 
ATOM   5328  H  HH   . TYR A 1 339 ? -42.170 14.178  -5.470  1.00 48.94  ? 418  TYR A HH   1 
ATOM   5329  N  N    . SER A 1 340 ? -38.551 6.652   -8.873  1.00 25.79  ? 419  SER A N    1 
ATOM   5330  C  CA   . SER A 1 340 ? -37.716 5.643   -9.512  1.00 21.40  ? 419  SER A CA   1 
ATOM   5331  C  C    . SER A 1 340 ? -37.787 5.734   -11.037 1.00 24.86  ? 419  SER A C    1 
ATOM   5332  O  O    . SER A 1 340 ? -38.806 6.136   -11.597 1.00 24.66  ? 419  SER A O    1 
ATOM   5333  C  CB   . SER A 1 340 ? -38.135 4.246   -9.062  1.00 22.30  ? 419  SER A CB   1 
ATOM   5334  O  OG   . SER A 1 340 ? -37.526 3.263   -9.883  1.00 25.26  ? 419  SER A OG   1 
ATOM   5335  H  H    . SER A 1 340 ? -39.222 6.331   -8.442  1.00 30.95  ? 419  SER A H    1 
ATOM   5336  H  HA   . SER A 1 340 ? -36.794 5.781   -9.245  1.00 25.67  ? 419  SER A HA   1 
ATOM   5337  H  HB2  . SER A 1 340 ? -37.855 4.110   -8.144  1.00 26.76  ? 419  SER A HB2  1 
ATOM   5338  H  HB3  . SER A 1 340 ? -39.099 4.165   -9.132  1.00 26.76  ? 419  SER A HB3  1 
ATOM   5339  H  HG   . SER A 1 340 ? -37.759 2.495   -9.633  1.00 30.31  ? 419  SER A HG   1 
ATOM   5340  N  N    . ALA A 1 341 ? -36.697 5.360   -11.701 1.00 26.52  ? 420  ALA A N    1 
ATOM   5341  C  CA   . ALA A 1 341 ? -36.632 5.365   -13.161 1.00 22.30  ? 420  ALA A CA   1 
ATOM   5342  C  C    . ALA A 1 341 ? -37.569 4.324   -13.759 1.00 23.43  ? 420  ALA A C    1 
ATOM   5343  O  O    . ALA A 1 341 ? -38.039 4.469   -14.886 1.00 34.91  ? 420  ALA A O    1 
ATOM   5344  C  CB   . ALA A 1 341 ? -35.212 5.087   -13.614 1.00 26.38  ? 420  ALA A CB   1 
ATOM   5345  H  H    . ALA A 1 341 ? -35.971 5.097   -11.323 1.00 31.82  ? 420  ALA A H    1 
ATOM   5346  H  HA   . ALA A 1 341 ? -36.894 6.238   -13.493 1.00 26.76  ? 420  ALA A HA   1 
ATOM   5347  H  HB1  . ALA A 1 341 ? -35.183 5.092   -14.583 1.00 31.65  ? 420  ALA A HB1  1 
ATOM   5348  H  HB2  . ALA A 1 341 ? -34.628 5.776   -13.261 1.00 31.65  ? 420  ALA A HB2  1 
ATOM   5349  H  HB3  . ALA A 1 341 ? -34.939 4.218   -13.279 1.00 31.65  ? 420  ALA A HB3  1 
ATOM   5350  N  N    . HIS A 1 342 ? -37.823 3.274   -12.989 1.00 30.89  ? 421  HIS A N    1 
ATOM   5351  C  CA   . HIS A 1 342 ? -38.560 2.112   -13.457 1.00 30.31  ? 421  HIS A CA   1 
ATOM   5352  C  C    . HIS A 1 342 ? -40.025 2.203   -13.015 1.00 30.66  ? 421  HIS A C    1 
ATOM   5353  O  O    . HIS A 1 342 ? -40.308 2.317   -11.823 1.00 34.51  ? 421  HIS A O    1 
ATOM   5354  C  CB   . HIS A 1 342 ? -37.905 0.863   -12.872 1.00 35.40  ? 421  HIS A CB   1 
ATOM   5355  C  CG   . HIS A 1 342 ? -38.143 -0.376  -13.674 1.00 43.30  ? 421  HIS A CG   1 
ATOM   5356  N  ND1  . HIS A 1 342 ? -38.845 -1.457  -13.184 1.00 41.82  ? 421  HIS A ND1  1 
ATOM   5357  C  CD2  . HIS A 1 342 ? -37.774 -0.703  -14.934 1.00 50.46  ? 421  HIS A CD2  1 
ATOM   5358  C  CE1  . HIS A 1 342 ? -38.902 -2.397  -14.112 1.00 45.21  ? 421  HIS A CE1  1 
ATOM   5359  N  NE2  . HIS A 1 342 ? -38.260 -1.965  -15.183 1.00 56.99  ? 421  HIS A NE2  1 
ATOM   5360  H  H    . HIS A 1 342 ? -37.572 3.211   -12.169 1.00 37.07  ? 421  HIS A H    1 
ATOM   5361  H  HA   . HIS A 1 342 ? -38.524 2.064   -14.425 1.00 36.37  ? 421  HIS A HA   1 
ATOM   5362  H  HB2  . HIS A 1 342 ? -36.946 1.006   -12.825 1.00 42.48  ? 421  HIS A HB2  1 
ATOM   5363  H  HB3  . HIS A 1 342 ? -38.259 0.712   -11.982 1.00 42.48  ? 421  HIS A HB3  1 
ATOM   5364  H  HD1  . HIS A 1 342 ? -39.195 -1.509  -12.400 1.00 50.18  ? 421  HIS A HD1  1 
ATOM   5365  H  HD2  . HIS A 1 342 ? -37.288 -0.173  -15.522 1.00 60.56  ? 421  HIS A HD2  1 
ATOM   5366  H  HE1  . HIS A 1 342 ? -39.319 -3.223  -14.024 1.00 54.25  ? 421  HIS A HE1  1 
ATOM   5367  H  HE2  . HIS A 1 342 ? -38.159 -2.404  -15.916 1.00 68.39  ? 421  HIS A HE2  1 
ATOM   5368  N  N    . ARG A 1 343 ? -40.960 2.138   -13.961 1.00 36.22  ? 422  ARG A N    1 
ATOM   5369  C  CA   . ARG A 1 343 ? -42.362 2.432   -13.644 1.00 33.15  ? 422  ARG A CA   1 
ATOM   5370  C  C    . ARG A 1 343 ? -43.031 1.409   -12.720 1.00 34.18  ? 422  ARG A C    1 
ATOM   5371  O  O    . ARG A 1 343 ? -43.788 1.795   -11.825 1.00 35.18  ? 422  ARG A O    1 
ATOM   5372  C  CB   . ARG A 1 343 ? -43.213 2.615   -14.911 1.00 36.00  ? 422  ARG A CB   1 
ATOM   5373  C  CG   . ARG A 1 343 ? -44.609 3.171   -14.606 1.00 41.80  ? 422  ARG A CG   1 
ATOM   5374  C  CD   . ARG A 1 343 ? -45.365 3.633   -15.840 1.00 37.99  ? 422  ARG A CD   1 
ATOM   5375  N  NE   . ARG A 1 343 ? -46.416 4.567   -15.445 1.00 33.13  ? 422  ARG A NE   1 
ATOM   5376  C  CZ   . ARG A 1 343 ? -47.635 4.209   -15.054 1.00 37.68  ? 422  ARG A CZ   1 
ATOM   5377  N  NH1  . ARG A 1 343 ? -47.987 2.930   -15.026 1.00 39.98  ? 422  ARG A NH1  1 
ATOM   5378  N  NH2  . ARG A 1 343 ? -48.514 5.134   -14.697 1.00 45.73  ? 422  ARG A NH2  1 
ATOM   5379  H  H    . ARG A 1 343 ? -40.815 1.929   -14.782 1.00 43.46  ? 422  ARG A H    1 
ATOM   5380  H  HA   . ARG A 1 343 ? -42.381 3.280   -13.174 1.00 39.77  ? 422  ARG A HA   1 
ATOM   5381  H  HB2  . ARG A 1 343 ? -42.765 3.236   -15.506 1.00 43.20  ? 422  ARG A HB2  1 
ATOM   5382  H  HB3  . ARG A 1 343 ? -43.321 1.755   -15.347 1.00 43.20  ? 422  ARG A HB3  1 
ATOM   5383  H  HG2  . ARG A 1 343 ? -45.136 2.478   -14.178 1.00 50.16  ? 422  ARG A HG2  1 
ATOM   5384  H  HG3  . ARG A 1 343 ? -44.520 3.931   -14.011 1.00 50.16  ? 422  ARG A HG3  1 
ATOM   5385  H  HD2  . ARG A 1 343 ? -44.758 4.088   -16.444 1.00 45.59  ? 422  ARG A HD2  1 
ATOM   5386  H  HD3  . ARG A 1 343 ? -45.776 2.871   -16.277 1.00 45.59  ? 422  ARG A HD3  1 
ATOM   5387  H  HE   . ARG A 1 343 ? -46.233 5.407   -15.466 1.00 39.76  ? 422  ARG A HE   1 
ATOM   5388  H  HH11 . ARG A 1 343 ? -47.422 2.323   -15.252 1.00 47.98  ? 422  ARG A HH11 1 
ATOM   5389  H  HH12 . ARG A 1 343 ? -48.780 2.707   -14.776 1.00 47.98  ? 422  ARG A HH12 1 
ATOM   5390  H  HH21 . ARG A 1 343 ? -48.295 5.966   -14.718 1.00 54.88  ? 422  ARG A HH21 1 
ATOM   5391  H  HH22 . ARG A 1 343 ? -49.306 4.904   -14.454 1.00 54.88  ? 422  ARG A HH22 1 
ATOM   5392  N  N    . PRO A 1 344 ? -42.776 0.108   -12.938 1.00 21.25  ? 423  PRO A N    1 
ATOM   5393  C  CA   . PRO A 1 344 ? -43.420 -0.871  -12.052 1.00 18.47  ? 423  PRO A CA   1 
ATOM   5394  C  C    . PRO A 1 344 ? -43.066 -0.645  -10.581 1.00 20.95  ? 423  PRO A C    1 
ATOM   5395  O  O    . PRO A 1 344 ? -43.918 -0.815  -9.704  1.00 24.27  ? 423  PRO A O    1 
ATOM   5396  C  CB   . PRO A 1 344 ? -42.871 -2.210  -12.550 1.00 12.75  ? 423  PRO A CB   1 
ATOM   5397  C  CG   . PRO A 1 344 ? -42.530 -1.964  -13.979 1.00 12.93  ? 423  PRO A CG   1 
ATOM   5398  C  CD   . PRO A 1 344 ? -42.043 -0.543  -14.038 1.00 16.53  ? 423  PRO A CD   1 
ATOM   5399  H  HA   . PRO A 1 344 ? -44.383 -0.852  -12.164 1.00 22.17  ? 423  PRO A HA   1 
ATOM   5400  H  HB2  . PRO A 1 344 ? -42.079 -2.449  -12.043 1.00 15.30  ? 423  PRO A HB2  1 
ATOM   5401  H  HB3  . PRO A 1 344 ? -43.553 -2.895  -12.471 1.00 15.30  ? 423  PRO A HB3  1 
ATOM   5402  H  HG2  . PRO A 1 344 ? -41.831 -2.577  -14.256 1.00 15.51  ? 423  PRO A HG2  1 
ATOM   5403  H  HG3  . PRO A 1 344 ? -43.322 -2.078  -14.527 1.00 15.51  ? 423  PRO A HG3  1 
ATOM   5404  H  HD2  . PRO A 1 344 ? -41.087 -0.505  -13.878 1.00 19.83  ? 423  PRO A HD2  1 
ATOM   5405  H  HD3  . PRO A 1 344 ? -42.278 -0.140  -14.888 1.00 19.83  ? 423  PRO A HD3  1 
ATOM   5406  N  N    . VAL A 1 345 ? -41.830 -0.237  -10.324 1.00 13.20  ? 424  VAL A N    1 
ATOM   5407  C  CA   . VAL A 1 345 ? -41.397 0.087   -8.974  1.00 12.60  ? 424  VAL A CA   1 
ATOM   5408  C  C    . VAL A 1 345 ? -42.087 1.359   -8.515  1.00 14.78  ? 424  VAL A C    1 
ATOM   5409  O  O    . VAL A 1 345 ? -42.595 1.430   -7.398  1.00 13.42  ? 424  VAL A O    1 
ATOM   5410  C  CB   . VAL A 1 345 ? -39.865 0.276   -8.914  1.00 12.24  ? 424  VAL A CB   1 
ATOM   5411  C  CG1  . VAL A 1 345 ? -39.439 1.034   -7.657  1.00 12.40  ? 424  VAL A CG1  1 
ATOM   5412  C  CG2  . VAL A 1 345 ? -39.174 -1.070  -8.971  1.00 11.67  ? 424  VAL A CG2  1 
ATOM   5413  H  H    . VAL A 1 345 ? -41.218 -0.140  -10.921 1.00 15.84  ? 424  VAL A H    1 
ATOM   5414  H  HA   . VAL A 1 345 ? -41.643 -0.632  -8.372  1.00 15.12  ? 424  VAL A HA   1 
ATOM   5415  H  HB   . VAL A 1 345 ? -39.580 0.791   -9.685  1.00 14.68  ? 424  VAL A HB   1 
ATOM   5416  H  HG11 . VAL A 1 345 ? -38.474 1.131   -7.659  1.00 14.88  ? 424  VAL A HG11 1 
ATOM   5417  H  HG12 . VAL A 1 345 ? -39.859 1.909   -7.658  1.00 14.88  ? 424  VAL A HG12 1 
ATOM   5418  H  HG13 . VAL A 1 345 ? -39.720 0.533   -6.876  1.00 14.88  ? 424  VAL A HG13 1 
ATOM   5419  H  HG21 . VAL A 1 345 ? -38.215 -0.934  -8.933  1.00 14.01  ? 424  VAL A HG21 1 
ATOM   5420  H  HG22 . VAL A 1 345 ? -39.463 -1.605  -8.215  1.00 14.01  ? 424  VAL A HG22 1 
ATOM   5421  H  HG23 . VAL A 1 345 ? -39.413 -1.513  -9.800  1.00 14.01  ? 424  VAL A HG23 1 
ATOM   5422  N  N    . ALA A 1 346 ? -42.093 2.365   -9.385  1.00 24.83  ? 425  ALA A N    1 
ATOM   5423  C  CA   . ALA A 1 346 ? -42.696 3.656   -9.068  1.00 24.31  ? 425  ALA A CA   1 
ATOM   5424  C  C    . ALA A 1 346 ? -44.167 3.505   -8.713  1.00 24.56  ? 425  ALA A C    1 
ATOM   5425  O  O    . ALA A 1 346 ? -44.632 4.026   -7.700  1.00 27.07  ? 425  ALA A O    1 
ATOM   5426  C  CB   . ALA A 1 346 ? -42.537 4.610   -10.239 1.00 23.59  ? 425  ALA A CB   1 
ATOM   5427  H  H    . ALA A 1 346 ? -41.751 2.324   -10.173 1.00 29.79  ? 425  ALA A H    1 
ATOM   5428  H  HA   . ALA A 1 346 ? -42.239 4.040   -8.303  1.00 29.17  ? 425  ALA A HA   1 
ATOM   5429  H  HB1  . ALA A 1 346 ? -42.943 5.461   -10.009 1.00 28.31  ? 425  ALA A HB1  1 
ATOM   5430  H  HB2  . ALA A 1 346 ? -41.592 4.733   -10.420 1.00 28.31  ? 425  ALA A HB2  1 
ATOM   5431  H  HB3  . ALA A 1 346 ? -42.977 4.232   -11.016 1.00 28.31  ? 425  ALA A HB3  1 
ATOM   5432  N  N    . VAL A 1 347 ? -44.890 2.774   -9.551  1.00 19.34  ? 426  VAL A N    1 
ATOM   5433  C  CA   . VAL A 1 347 ? -46.316 2.578   -9.365  1.00 17.56  ? 426  VAL A CA   1 
ATOM   5434  C  C    . VAL A 1 347 ? -46.586 1.749   -8.115  1.00 21.82  ? 426  VAL A C    1 
ATOM   5435  O  O    . VAL A 1 347 ? -47.515 2.040   -7.364  1.00 32.61  ? 426  VAL A O    1 
ATOM   5436  C  CB   . VAL A 1 347 ? -46.917 1.919   -10.619 1.00 15.59  ? 426  VAL A CB   1 
ATOM   5437  C  CG1  . VAL A 1 347 ? -48.251 1.255   -10.329 1.00 17.05  ? 426  VAL A CG1  1 
ATOM   5438  C  CG2  . VAL A 1 347 ? -47.063 2.954   -11.723 1.00 23.14  ? 426  VAL A CG2  1 
ATOM   5439  H  H    . VAL A 1 347 ? -44.571 2.377   -10.244 1.00 23.21  ? 426  VAL A H    1 
ATOM   5440  H  HA   . VAL A 1 347 ? -46.740 3.442   -9.248  1.00 21.07  ? 426  VAL A HA   1 
ATOM   5441  H  HB   . VAL A 1 347 ? -46.308 1.234   -10.935 1.00 18.71  ? 426  VAL A HB   1 
ATOM   5442  H  HG11 . VAL A 1 347 ? -48.589 0.856   -11.146 1.00 20.46  ? 426  VAL A HG11 1 
ATOM   5443  H  HG12 . VAL A 1 347 ? -48.121 0.570   -9.654  1.00 20.46  ? 426  VAL A HG12 1 
ATOM   5444  H  HG13 . VAL A 1 347 ? -48.873 1.925   -10.006 1.00 20.46  ? 426  VAL A HG13 1 
ATOM   5445  H  HG21 . VAL A 1 347 ? -47.442 2.528   -12.507 1.00 27.77  ? 426  VAL A HG21 1 
ATOM   5446  H  HG22 . VAL A 1 347 ? -47.649 3.663   -11.415 1.00 27.77  ? 426  VAL A HG22 1 
ATOM   5447  H  HG23 . VAL A 1 347 ? -46.188 3.316   -11.933 1.00 27.77  ? 426  VAL A HG23 1 
ATOM   5448  N  N    . ALA A 1 348 ? -45.773 0.726   -7.879  1.00 22.95  ? 427  ALA A N    1 
ATOM   5449  C  CA   . ALA A 1 348 ? -45.961 -0.105  -6.696  1.00 21.47  ? 427  ALA A CA   1 
ATOM   5450  C  C    . ALA A 1 348 ? -45.680 0.711   -5.440  1.00 21.85  ? 427  ALA A C    1 
ATOM   5451  O  O    . ALA A 1 348 ? -46.395 0.604   -4.441  1.00 26.16  ? 427  ALA A O    1 
ATOM   5452  C  CB   . ALA A 1 348 ? -45.071 -1.321  -6.746  1.00 14.70  ? 427  ALA A CB   1 
ATOM   5453  H  H    . ALA A 1 348 ? -45.113 0.494   -8.379  1.00 27.54  ? 427  ALA A H    1 
ATOM   5454  H  HA   . ALA A 1 348 ? -46.882 -0.406  -6.661  1.00 25.76  ? 427  ALA A HA   1 
ATOM   5455  H  HB1  . ALA A 1 348 ? -45.218 -1.853  -5.948  1.00 17.65  ? 427  ALA A HB1  1 
ATOM   5456  H  HB2  . ALA A 1 348 ? -45.291 -1.841  -7.536  1.00 17.65  ? 427  ALA A HB2  1 
ATOM   5457  H  HB3  . ALA A 1 348 ? -44.146 -1.034  -6.787  1.00 17.65  ? 427  ALA A HB3  1 
ATOM   5458  N  N    . ALA A 1 349 ? -44.640 1.531   -5.500  1.00 25.69  ? 428  ALA A N    1 
ATOM   5459  C  CA   . ALA A 1 349 ? -44.310 2.417   -4.396  1.00 27.13  ? 428  ALA A CA   1 
ATOM   5460  C  C    . ALA A 1 349 ? -45.389 3.478   -4.231  1.00 32.43  ? 428  ALA A C    1 
ATOM   5461  O  O    . ALA A 1 349 ? -45.642 3.957   -3.126  1.00 33.61  ? 428  ALA A O    1 
ATOM   5462  C  CB   . ALA A 1 349 ? -42.979 3.067   -4.644  1.00 25.53  ? 428  ALA A CB   1 
ATOM   5463  H  H    . ALA A 1 349 ? -44.107 1.593   -6.172  1.00 30.83  ? 428  ALA A H    1 
ATOM   5464  H  HA   . ALA A 1 349 ? -44.255 1.904   -3.575  1.00 32.55  ? 428  ALA A HA   1 
ATOM   5465  H  HB1  . ALA A 1 349 ? -42.772 3.655   -3.900  1.00 30.64  ? 428  ALA A HB1  1 
ATOM   5466  H  HB2  . ALA A 1 349 ? -42.300 2.378   -4.720  1.00 30.64  ? 428  ALA A HB2  1 
ATOM   5467  H  HB3  . ALA A 1 349 ? -43.025 3.578   -5.467  1.00 30.64  ? 428  ALA A HB3  1 
ATOM   5468  N  N    . GLY A 1 350 ? -46.018 3.851   -5.341  1.00 35.26  ? 429  GLY A N    1 
ATOM   5469  C  CA   . GLY A 1 350 ? -47.062 4.857   -5.319  1.00 35.97  ? 429  GLY A CA   1 
ATOM   5470  C  C    . GLY A 1 350 ? -48.329 4.353   -4.659  1.00 34.56  ? 429  GLY A C    1 
ATOM   5471  O  O    . GLY A 1 350 ? -49.006 5.102   -3.956  1.00 31.49  ? 429  GLY A O    1 
ATOM   5472  H  H    . GLY A 1 350 ? -45.854 3.531   -6.123  1.00 42.31  ? 429  GLY A H    1 
ATOM   5473  H  HA2  . GLY A 1 350 ? -46.750 5.636   -4.833  1.00 43.16  ? 429  GLY A HA2  1 
ATOM   5474  H  HA3  . GLY A 1 350 ? -47.273 5.124   -6.227  1.00 43.16  ? 429  GLY A HA3  1 
ATOM   5475  N  N    . GLU A 1 351 ? -48.656 3.083   -4.884  1.00 47.35  ? 430  GLU A N    1 
ATOM   5476  C  CA   . GLU A 1 351 ? -49.817 2.481   -4.241  1.00 43.47  ? 430  GLU A CA   1 
ATOM   5477  C  C    . GLU A 1 351 ? -49.571 2.388   -2.741  1.00 40.55  ? 430  GLU A C    1 
ATOM   5478  O  O    . GLU A 1 351 ? -50.494 2.524   -1.942  1.00 46.62  ? 430  GLU A O    1 
ATOM   5479  C  CB   . GLU A 1 351 ? -50.113 1.095   -4.820  1.00 44.41  ? 430  GLU A CB   1 
ATOM   5480  C  CG   . GLU A 1 351 ? -51.346 0.429   -4.207  1.00 64.11  ? 430  GLU A CG   1 
ATOM   5481  C  CD   . GLU A 1 351 ? -51.618 -0.959  -4.764  1.00 75.97  ? 430  GLU A CD   1 
ATOM   5482  O  OE1  . GLU A 1 351 ? -50.729 -1.519  -5.443  1.00 83.74  ? 430  GLU A OE1  1 
ATOM   5483  O  OE2  . GLU A 1 351 ? -52.723 -1.491  -4.516  1.00 71.97  ? 430  GLU A OE2  1 
ATOM   5484  H  H    . GLU A 1 351 ? -48.223 2.552   -5.403  1.00 56.82  ? 430  GLU A H    1 
ATOM   5485  H  HA   . GLU A 1 351 ? -50.593 3.044   -4.389  1.00 52.16  ? 430  GLU A HA   1 
ATOM   5486  H  HB2  . GLU A 1 351 ? -50.263 1.180   -5.774  1.00 53.29  ? 430  GLU A HB2  1 
ATOM   5487  H  HB3  . GLU A 1 351 ? -49.351 0.518   -4.656  1.00 53.29  ? 430  GLU A HB3  1 
ATOM   5488  H  HG2  . GLU A 1 351 ? -51.216 0.346   -3.250  1.00 76.93  ? 430  GLU A HG2  1 
ATOM   5489  H  HG3  . GLU A 1 351 ? -52.124 0.980   -4.388  1.00 76.93  ? 430  GLU A HG3  1 
ATOM   5490  N  N    . PHE A 1 352 ? -48.317 2.162   -2.364  1.00 31.13  ? 431  PHE A N    1 
ATOM   5491  C  CA   . PHE A 1 352 ? -47.943 2.132   -0.955  1.00 25.64  ? 431  PHE A CA   1 
ATOM   5492  C  C    . PHE A 1 352 ? -48.156 3.505   -0.331  1.00 25.34  ? 431  PHE A C    1 
ATOM   5493  O  O    . PHE A 1 352 ? -48.746 3.624   0.746   1.00 32.50  ? 431  PHE A O    1 
ATOM   5494  C  CB   . PHE A 1 352 ? -46.482 1.708   -0.789  1.00 29.05  ? 431  PHE A CB   1 
ATOM   5495  C  CG   . PHE A 1 352 ? -46.026 1.675   0.641   1.00 27.53  ? 431  PHE A CG   1 
ATOM   5496  C  CD1  . PHE A 1 352 ? -46.244 0.558   1.428   1.00 26.65  ? 431  PHE A CD1  1 
ATOM   5497  C  CD2  . PHE A 1 352 ? -45.388 2.768   1.199   1.00 21.48  ? 431  PHE A CD2  1 
ATOM   5498  C  CE1  . PHE A 1 352 ? -45.829 0.532   2.746   1.00 27.11  ? 431  PHE A CE1  1 
ATOM   5499  C  CE2  . PHE A 1 352 ? -44.969 2.747   2.511   1.00 22.45  ? 431  PHE A CE2  1 
ATOM   5500  C  CZ   . PHE A 1 352 ? -45.193 1.628   3.289   1.00 25.38  ? 431  PHE A CZ   1 
ATOM   5501  H  H    . PHE A 1 352 ? -47.664 2.023   -2.905  1.00 37.36  ? 431  PHE A H    1 
ATOM   5502  H  HA   . PHE A 1 352 ? -48.502 1.492   -0.487  1.00 30.77  ? 431  PHE A HA   1 
ATOM   5503  H  HB2  . PHE A 1 352 ? -46.370 0.818   -1.157  1.00 34.86  ? 431  PHE A HB2  1 
ATOM   5504  H  HB3  . PHE A 1 352 ? -45.917 2.335   -1.267  1.00 34.86  ? 431  PHE A HB3  1 
ATOM   5505  H  HD1  . PHE A 1 352 ? -46.674 -0.183  1.066   1.00 31.98  ? 431  PHE A HD1  1 
ATOM   5506  H  HD2  . PHE A 1 352 ? -45.236 3.525   0.681   1.00 25.78  ? 431  PHE A HD2  1 
ATOM   5507  H  HE1  . PHE A 1 352 ? -45.979 -0.224  3.266   1.00 32.53  ? 431  PHE A HE1  1 
ATOM   5508  H  HE2  . PHE A 1 352 ? -44.541 3.488   2.875   1.00 26.94  ? 431  PHE A HE2  1 
ATOM   5509  H  HZ   . PHE A 1 352 ? -44.910 1.612   4.174   1.00 30.45  ? 431  PHE A HZ   1 
ATOM   5510  N  N    . LEU A 1 353 ? -47.677 4.535   -1.022  1.00 27.81  ? 432  LEU A N    1 
ATOM   5511  C  CA   . LEU A 1 353 ? -47.862 5.920   -0.599  1.00 23.90  ? 432  LEU A CA   1 
ATOM   5512  C  C    . LEU A 1 353 ? -49.336 6.280   -0.414  1.00 25.52  ? 432  LEU A C    1 
ATOM   5513  O  O    . LEU A 1 353 ? -49.699 6.955   0.549   1.00 28.28  ? 432  LEU A O    1 
ATOM   5514  C  CB   . LEU A 1 353 ? -47.240 6.861   -1.629  1.00 25.00  ? 432  LEU A CB   1 
ATOM   5515  C  CG   . LEU A 1 353 ? -47.379 8.359   -1.354  1.00 23.43  ? 432  LEU A CG   1 
ATOM   5516  C  CD1  . LEU A 1 353 ? -46.715 8.738   -0.040  1.00 21.39  ? 432  LEU A CD1  1 
ATOM   5517  C  CD2  . LEU A 1 353 ? -46.784 9.165   -2.498  1.00 21.88  ? 432  LEU A CD2  1 
ATOM   5518  H  H    . LEU A 1 353 ? -47.232 4.456   -1.754  1.00 33.38  ? 432  LEU A H    1 
ATOM   5519  H  HA   . LEU A 1 353 ? -47.409 6.057   0.248   1.00 28.68  ? 432  LEU A HA   1 
ATOM   5520  H  HB2  . LEU A 1 353 ? -46.292 6.666   -1.685  1.00 30.00  ? 432  LEU A HB2  1 
ATOM   5521  H  HB3  . LEU A 1 353 ? -47.655 6.687   -2.488  1.00 30.00  ? 432  LEU A HB3  1 
ATOM   5522  H  HG   . LEU A 1 353 ? -48.320 8.582   -1.289  1.00 28.12  ? 432  LEU A HG   1 
ATOM   5523  H  HD11 . LEU A 1 353 ? -46.820 9.692   0.103   1.00 25.67  ? 432  LEU A HD11 1 
ATOM   5524  H  HD12 . LEU A 1 353 ? -47.138 8.246   0.680   1.00 25.67  ? 432  LEU A HD12 1 
ATOM   5525  H  HD13 . LEU A 1 353 ? -45.772 8.513   -0.087  1.00 25.67  ? 432  LEU A HD13 1 
ATOM   5526  H  HD21 . LEU A 1 353 ? -46.883 10.110  -2.303  1.00 26.25  ? 432  LEU A HD21 1 
ATOM   5527  H  HD22 . LEU A 1 353 ? -45.845 8.942   -2.586  1.00 26.25  ? 432  LEU A HD22 1 
ATOM   5528  H  HD23 . LEU A 1 353 ? -47.256 8.945   -3.317  1.00 26.25  ? 432  LEU A HD23 1 
ATOM   5529  N  N    . TYR A 1 354 ? -50.176 5.834   -1.342  1.00 41.45  ? 433  TYR A N    1 
ATOM   5530  C  CA   . TYR A 1 354 ? -51.604 6.125   -1.288  1.00 41.97  ? 433  TYR A CA   1 
ATOM   5531  C  C    . TYR A 1 354 ? -52.232 5.561   -0.020  1.00 42.12  ? 433  TYR A C    1 
ATOM   5532  O  O    . TYR A 1 354 ? -52.871 6.287   0.737   1.00 45.94  ? 433  TYR A O    1 
ATOM   5533  C  CB   . TYR A 1 354 ? -52.307 5.551   -2.520  1.00 43.84  ? 433  TYR A CB   1 
ATOM   5534  C  CG   . TYR A 1 354 ? -53.710 6.071   -2.730  1.00 49.80  ? 433  TYR A CG   1 
ATOM   5535  C  CD1  . TYR A 1 354 ? -53.939 7.415   -2.999  1.00 51.11  ? 433  TYR A CD1  1 
ATOM   5536  C  CD2  . TYR A 1 354 ? -54.802 5.218   -2.675  1.00 52.84  ? 433  TYR A CD2  1 
ATOM   5537  C  CE1  . TYR A 1 354 ? -55.217 7.896   -3.198  1.00 53.76  ? 433  TYR A CE1  1 
ATOM   5538  C  CE2  . TYR A 1 354 ? -56.084 5.687   -2.872  1.00 60.54  ? 433  TYR A CE2  1 
ATOM   5539  C  CZ   . TYR A 1 354 ? -56.290 7.027   -3.133  1.00 62.62  ? 433  TYR A CZ   1 
ATOM   5540  O  OH   . TYR A 1 354 ? -57.576 7.489   -3.330  1.00 63.61  ? 433  TYR A OH   1 
ATOM   5541  H  H    . TYR A 1 354 ? -49.942 5.358   -2.019  1.00 49.74  ? 433  TYR A H    1 
ATOM   5542  H  HA   . TYR A 1 354 ? -51.733 7.086   -1.287  1.00 50.36  ? 433  TYR A HA   1 
ATOM   5543  H  HB2  . TYR A 1 354 ? -51.787 5.775   -3.307  1.00 52.60  ? 433  TYR A HB2  1 
ATOM   5544  H  HB3  . TYR A 1 354 ? -52.360 4.587   -2.427  1.00 52.60  ? 433  TYR A HB3  1 
ATOM   5545  H  HD1  . TYR A 1 354 ? -53.219 8.002   -3.042  1.00 61.33  ? 433  TYR A HD1  1 
ATOM   5546  H  HD2  . TYR A 1 354 ? -54.668 4.315   -2.499  1.00 63.41  ? 433  TYR A HD2  1 
ATOM   5547  H  HE1  . TYR A 1 354 ? -55.356 8.799   -3.374  1.00 64.51  ? 433  TYR A HE1  1 
ATOM   5548  H  HE2  . TYR A 1 354 ? -56.807 5.103   -2.829  1.00 72.65  ? 433  TYR A HE2  1 
ATOM   5549  H  HH   . TYR A 1 354 ? -57.565 8.316   -3.481  1.00 76.33  ? 433  TYR A HH   1 
ATOM   5550  N  N    . LYS A 1 355 ? -52.039 4.268   0.220   1.00 48.12  ? 434  LYS A N    1 
ATOM   5551  C  CA   . LYS A 1 355 ? -52.686 3.611   1.352   1.00 48.32  ? 434  LYS A CA   1 
ATOM   5552  C  C    . LYS A 1 355 ? -52.148 4.128   2.681   1.00 48.08  ? 434  LYS A C    1 
ATOM   5553  O  O    . LYS A 1 355 ? -52.826 4.044   3.702   1.00 59.98  ? 434  LYS A O    1 
ATOM   5554  C  CB   . LYS A 1 355 ? -52.517 2.090   1.273   1.00 48.72  ? 434  LYS A CB   1 
ATOM   5555  C  CG   . LYS A 1 355 ? -52.780 1.517   -0.117  1.00 52.09  ? 434  LYS A CG   1 
ATOM   5556  C  CD   . LYS A 1 355 ? -53.769 0.363   -0.102  1.00 58.50  ? 434  LYS A CD   1 
ATOM   5557  C  CE   . LYS A 1 355 ? -53.185 -0.862  0.573   1.00 50.06  ? 434  LYS A CE   1 
ATOM   5558  N  NZ   . LYS A 1 355 ? -53.586 -2.116  -0.124  1.00 58.54  ? 434  LYS A NZ   1 
ATOM   5559  H  H    . LYS A 1 355 ? -51.541 3.751   -0.254  1.00 57.75  ? 434  LYS A H    1 
ATOM   5560  H  HA   . LYS A 1 355 ? -53.636 3.804   1.323   1.00 57.98  ? 434  LYS A HA   1 
ATOM   5561  H  HB2  . LYS A 1 355 ? -51.607 1.862   1.521   1.00 58.46  ? 434  LYS A HB2  1 
ATOM   5562  H  HB3  . LYS A 1 355 ? -53.140 1.673   1.888   1.00 58.46  ? 434  LYS A HB3  1 
ATOM   5563  H  HG2  . LYS A 1 355 ? -53.143 2.216   -0.683  1.00 62.51  ? 434  LYS A HG2  1 
ATOM   5564  H  HG3  . LYS A 1 355 ? -51.944 1.191   -0.487  1.00 62.51  ? 434  LYS A HG3  1 
ATOM   5565  H  HD2  . LYS A 1 355 ? -54.564 0.630   0.386   1.00 70.20  ? 434  LYS A HD2  1 
ATOM   5566  H  HD3  . LYS A 1 355 ? -53.999 0.127   -1.015  1.00 70.20  ? 434  LYS A HD3  1 
ATOM   5567  H  HE2  . LYS A 1 355 ? -52.217 -0.804  0.560   1.00 60.07  ? 434  LYS A HE2  1 
ATOM   5568  H  HE3  . LYS A 1 355 ? -53.506 -0.907  1.488   1.00 60.07  ? 434  LYS A HE3  1 
ATOM   5569  H  HZ1  . LYS A 1 355 ? -53.232 -2.820  0.289   1.00 70.25  ? 434  LYS A HZ1  1 
ATOM   5570  H  HZ2  . LYS A 1 355 ? -54.473 -2.195  -0.122  1.00 70.25  ? 434  LYS A HZ2  1 
ATOM   5571  H  HZ3  . LYS A 1 355 ? -53.299 -2.100  -0.967  1.00 70.25  ? 434  LYS A HZ3  1 
ATOM   5572  N  N    . LYS A 1 356 ? -50.937 4.672   2.668   1.00 34.80  ? 435  LYS A N    1 
ATOM   5573  C  CA   . LYS A 1 356 ? -50.316 5.154   3.895   1.00 37.90  ? 435  LYS A CA   1 
ATOM   5574  C  C    . LYS A 1 356 ? -50.815 6.548   4.290   1.00 39.11  ? 435  LYS A C    1 
ATOM   5575  O  O    . LYS A 1 356 ? -51.043 6.806   5.472   1.00 41.58  ? 435  LYS A O    1 
ATOM   5576  C  CB   . LYS A 1 356 ? -48.793 5.166   3.736   1.00 39.86  ? 435  LYS A CB   1 
ATOM   5577  C  CG   . LYS A 1 356 ? -47.997 5.468   5.002   1.00 41.82  ? 435  LYS A CG   1 
ATOM   5578  C  CD   . LYS A 1 356 ? -48.075 4.348   6.036   1.00 40.76  ? 435  LYS A CD   1 
ATOM   5579  C  CE   . LYS A 1 356 ? -47.051 4.563   7.149   1.00 46.02  ? 435  LYS A CE   1 
ATOM   5580  N  NZ   . LYS A 1 356 ? -47.565 5.373   8.287   1.00 52.01  ? 435  LYS A NZ   1 
ATOM   5581  H  H    . LYS A 1 356 ? -50.454 4.773   1.964   1.00 41.76  ? 435  LYS A H    1 
ATOM   5582  H  HA   . LYS A 1 356 ? -50.535 4.545   4.618   1.00 45.47  ? 435  LYS A HA   1 
ATOM   5583  H  HB2  . LYS A 1 356 ? -48.512 4.293   3.419   1.00 47.84  ? 435  LYS A HB2  1 
ATOM   5584  H  HB3  . LYS A 1 356 ? -48.559 5.839   3.079   1.00 47.84  ? 435  LYS A HB3  1 
ATOM   5585  H  HG2  . LYS A 1 356 ? -47.065 5.593   4.766   1.00 50.18  ? 435  LYS A HG2  1 
ATOM   5586  H  HG3  . LYS A 1 356 ? -48.347 6.276   5.409   1.00 50.18  ? 435  LYS A HG3  1 
ATOM   5587  H  HD2  . LYS A 1 356 ? -48.960 4.337   6.433   1.00 48.91  ? 435  LYS A HD2  1 
ATOM   5588  H  HD3  . LYS A 1 356 ? -47.886 3.500   5.607   1.00 48.91  ? 435  LYS A HD3  1 
ATOM   5589  H  HE2  . LYS A 1 356 ? -46.782 3.699   7.498   1.00 55.23  ? 435  LYS A HE2  1 
ATOM   5590  H  HE3  . LYS A 1 356 ? -46.281 5.024   6.781   1.00 55.23  ? 435  LYS A HE3  1 
ATOM   5591  H  HZ1  . LYS A 1 356 ? -46.930 5.466   8.904   1.00 62.41  ? 435  LYS A HZ1  1 
ATOM   5592  H  HZ2  . LYS A 1 356 ? -47.811 6.178   8.001   1.00 62.41  ? 435  LYS A HZ2  1 
ATOM   5593  H  HZ3  . LYS A 1 356 ? -48.268 4.969   8.654   1.00 62.41  ? 435  LYS A HZ3  1 
ATOM   5594  N  N    . LEU A 1 357 ? -50.989 7.434   3.305   1.00 39.32  ? 436  LEU A N    1 
ATOM   5595  C  CA   . LEU A 1 357 ? -51.259 8.852   3.577   1.00 32.03  ? 436  LEU A CA   1 
ATOM   5596  C  C    . LEU A 1 357 ? -52.467 9.451   2.850   1.00 35.15  ? 436  LEU A C    1 
ATOM   5597  O  O    . LEU A 1 357 ? -52.640 10.669  2.869   1.00 41.92  ? 436  LEU A O    1 
ATOM   5598  C  CB   . LEU A 1 357 ? -50.030 9.703   3.226   1.00 33.13  ? 436  LEU A CB   1 
ATOM   5599  C  CG   . LEU A 1 357 ? -48.721 9.448   3.975   1.00 41.52  ? 436  LEU A CG   1 
ATOM   5600  C  CD1  . LEU A 1 357 ? -47.686 10.468  3.526   1.00 36.60  ? 436  LEU A CD1  1 
ATOM   5601  C  CD2  . LEU A 1 357 ? -48.915 9.512   5.484   1.00 49.41  ? 436  LEU A CD2  1 
ATOM   5602  H  H    . LEU A 1 357 ? -50.956 7.239   2.468   1.00 47.18  ? 436  LEU A H    1 
ATOM   5603  H  HA   . LEU A 1 357 ? -51.417 8.953   4.528   1.00 38.44  ? 436  LEU A HA   1 
ATOM   5604  H  HB2  . LEU A 1 357 ? -49.841 9.575   2.283   1.00 39.75  ? 436  LEU A HB2  1 
ATOM   5605  H  HB3  . LEU A 1 357 ? -50.261 10.633  3.376   1.00 39.75  ? 436  LEU A HB3  1 
ATOM   5606  H  HG   . LEU A 1 357 ? -48.392 8.564   3.749   1.00 49.83  ? 436  LEU A HG   1 
ATOM   5607  H  HD11 . LEU A 1 357 ? -46.857 10.306  4.002   1.00 43.92  ? 436  LEU A HD11 1 
ATOM   5608  H  HD12 . LEU A 1 357 ? -47.545 10.374  2.571   1.00 43.92  ? 436  LEU A HD12 1 
ATOM   5609  H  HD13 . LEU A 1 357 ? -48.014 11.359  3.726   1.00 43.92  ? 436  LEU A HD13 1 
ATOM   5610  H  HD21 . LEU A 1 357 ? -48.064 9.345   5.919   1.00 59.29  ? 436  LEU A HD21 1 
ATOM   5611  H  HD22 . LEU A 1 357 ? -49.242 10.393  5.723   1.00 59.29  ? 436  LEU A HD22 1 
ATOM   5612  H  HD23 . LEU A 1 357 ? -49.560 8.837   5.748   1.00 59.29  ? 436  LEU A HD23 1 
ATOM   5613  N  N    . PHE A 1 358 ? -53.296 8.626   2.214   1.00 48.04  ? 437  PHE A N    1 
ATOM   5614  C  CA   . PHE A 1 358 ? -54.461 9.145   1.492   1.00 58.16  ? 437  PHE A CA   1 
ATOM   5615  C  C    . PHE A 1 358 ? -55.761 8.442   1.884   1.00 67.76  ? 437  PHE A C    1 
ATOM   5616  O  O    . PHE A 1 358 ? -56.167 7.455   1.267   1.00 67.62  ? 437  PHE A O    1 
ATOM   5617  C  CB   . PHE A 1 358 ? -54.236 9.087   -0.025  1.00 58.14  ? 437  PHE A CB   1 
ATOM   5618  C  CG   . PHE A 1 358 ? -53.196 10.060  -0.519  1.00 55.88  ? 437  PHE A CG   1 
ATOM   5619  C  CD1  . PHE A 1 358 ? -51.852 9.865   -0.244  1.00 60.09  ? 437  PHE A CD1  1 
ATOM   5620  C  CD2  . PHE A 1 358 ? -53.563 11.168  -1.262  1.00 56.71  ? 437  PHE A CD2  1 
ATOM   5621  C  CE1  . PHE A 1 358 ? -50.897 10.762  -0.697  1.00 54.59  ? 437  PHE A CE1  1 
ATOM   5622  C  CE2  . PHE A 1 358 ? -52.616 12.067  -1.715  1.00 51.82  ? 437  PHE A CE2  1 
ATOM   5623  C  CZ   . PHE A 1 358 ? -51.282 11.863  -1.433  1.00 50.03  ? 437  PHE A CZ   1 
ATOM   5624  H  H    . PHE A 1 358 ? -53.209 7.771   2.184   1.00 57.65  ? 437  PHE A H    1 
ATOM   5625  H  HA   . PHE A 1 358 ? -54.565 10.080  1.727   1.00 69.79  ? 437  PHE A HA   1 
ATOM   5626  H  HB2  . PHE A 1 358 ? -53.945 8.194   -0.264  1.00 69.77  ? 437  PHE A HB2  1 
ATOM   5627  H  HB3  . PHE A 1 358 ? -55.072 9.293   -0.473  1.00 69.77  ? 437  PHE A HB3  1 
ATOM   5628  H  HD1  . PHE A 1 358 ? -51.587 9.125   0.254   1.00 72.11  ? 437  PHE A HD1  1 
ATOM   5629  H  HD2  . PHE A 1 358 ? -54.461 11.314  -1.454  1.00 68.05  ? 437  PHE A HD2  1 
ATOM   5630  H  HE1  . PHE A 1 358 ? -49.998 10.621  -0.505  1.00 65.51  ? 437  PHE A HE1  1 
ATOM   5631  H  HE2  . PHE A 1 358 ? -52.878 12.807  -2.213  1.00 62.18  ? 437  PHE A HE2  1 
ATOM   5632  H  HZ   . PHE A 1 358 ? -50.644 12.465  -1.740  1.00 60.04  ? 437  PHE A HZ   1 
ATOM   5633  N  N    . SER A 1 359 ? -56.401 8.971   2.923   1.00 88.09  ? 438  SER A N    1 
ATOM   5634  C  CA   . SER A 1 359 ? -57.678 8.452   3.403   1.00 91.56  ? 438  SER A CA   1 
ATOM   5635  C  C    . SER A 1 359 ? -58.602 9.595   3.821   1.00 84.38  ? 438  SER A C    1 
ATOM   5636  O  O    . SER A 1 359 ? -59.703 9.750   3.288   1.00 77.78  ? 438  SER A O    1 
ATOM   5637  C  CB   . SER A 1 359 ? -57.454 7.510   4.586   1.00 91.40  ? 438  SER A CB   1 
ATOM   5638  O  OG   . SER A 1 359 ? -56.984 8.216   5.722   1.00 91.64  ? 438  SER A OG   1 
ATOM   5639  H  H    . SER A 1 359 ? -56.111 9.644   3.374   1.00 105.71 ? 438  SER A H    1 
ATOM   5640  H  HA   . SER A 1 359 ? -58.110 7.954   2.693   1.00 109.87 ? 438  SER A HA   1 
ATOM   5641  H  HB2  . SER A 1 359 ? -58.295 7.080   4.809   1.00 109.68 ? 438  SER A HB2  1 
ATOM   5642  H  HB3  . SER A 1 359 ? -56.797 6.842   4.337   1.00 109.68 ? 438  SER A HB3  1 
ATOM   5643  H  HG   . SER A 1 359 ? -56.866 7.685   6.362   1.00 109.97 ? 438  SER A HG   1 
ATOM   5644  N  N    . GLY A 1 376 ? -65.081 20.855  -0.645  1.00 76.85  ? 455  GLY A N    1 
ATOM   5645  C  CA   . GLY A 1 376 ? -63.693 20.457  -0.528  1.00 80.52  ? 455  GLY A CA   1 
ATOM   5646  C  C    . GLY A 1 376 ? -63.524 19.068  0.054   1.00 85.52  ? 455  GLY A C    1 
ATOM   5647  O  O    . GLY A 1 376 ? -62.837 18.887  1.065   1.00 78.04  ? 455  GLY A O    1 
ATOM   5648  N  N    . PRO A 1 377 ? -64.165 18.069  -0.572  1.00 114.24 ? 456  PRO A N    1 
ATOM   5649  C  CA   . PRO A 1 377 ? -63.967 16.688  -0.122  1.00 109.37 ? 456  PRO A CA   1 
ATOM   5650  C  C    . PRO A 1 377 ? -62.554 16.181  -0.446  1.00 104.23 ? 456  PRO A C    1 
ATOM   5651  O  O    . PRO A 1 377 ? -61.926 15.531  0.392   1.00 103.90 ? 456  PRO A O    1 
ATOM   5652  C  CB   . PRO A 1 377 ? -65.025 15.911  -0.911  1.00 108.52 ? 456  PRO A CB   1 
ATOM   5653  C  CG   . PRO A 1 377 ? -65.261 16.730  -2.135  1.00 105.79 ? 456  PRO A CG   1 
ATOM   5654  C  CD   . PRO A 1 377 ? -65.111 18.156  -1.700  1.00 111.81 ? 456  PRO A CD   1 
ATOM   5655  H  HA   . PRO A 1 377 ? -64.138 16.606  0.829   1.00 131.25 ? 456  PRO A HA   1 
ATOM   5656  H  HB2  . PRO A 1 377 ? -64.683 15.034  -1.144  1.00 130.23 ? 456  PRO A HB2  1 
ATOM   5657  H  HB3  . PRO A 1 377 ? -65.837 15.837  -0.385  1.00 130.23 ? 456  PRO A HB3  1 
ATOM   5658  H  HG2  . PRO A 1 377 ? -64.600 16.506  -2.808  1.00 126.95 ? 456  PRO A HG2  1 
ATOM   5659  H  HG3  . PRO A 1 377 ? -66.157 16.567  -2.468  1.00 126.95 ? 456  PRO A HG3  1 
ATOM   5660  H  HD2  . PRO A 1 377 ? -64.735 18.690  -2.417  1.00 134.18 ? 456  PRO A HD2  1 
ATOM   5661  H  HD3  . PRO A 1 377 ? -65.963 18.510  -1.400  1.00 134.18 ? 456  PRO A HD3  1 
ATOM   5662  N  N    . ASN A 1 378 ? -62.066 16.497  -1.646  1.00 76.69  ? 457  ASN A N    1 
ATOM   5663  C  CA   . ASN A 1 378 ? -60.734 16.087  -2.097  1.00 67.64  ? 457  ASN A CA   1 
ATOM   5664  C  C    . ASN A 1 378 ? -59.665 17.143  -1.816  1.00 67.42  ? 457  ASN A C    1 
ATOM   5665  O  O    . ASN A 1 378 ? -58.475 16.895  -2.016  1.00 67.00  ? 457  ASN A O    1 
ATOM   5666  C  CB   . ASN A 1 378 ? -60.749 15.779  -3.606  1.00 58.93  ? 457  ASN A CB   1 
ATOM   5667  C  CG   . ASN A 1 378 ? -61.338 14.412  -3.924  1.00 68.33  ? 457  ASN A CG   1 
ATOM   5668  O  OD1  . ASN A 1 378 ? -61.509 13.578  -3.036  1.00 74.69  ? 457  ASN A OD1  1 
ATOM   5669  N  ND2  . ASN A 1 378 ? -61.636 14.171  -5.200  1.00 60.34  ? 457  ASN A ND2  1 
ATOM   5670  H  H    . ASN A 1 378 ? -62.498 16.959  -2.230  1.00 92.03  ? 457  ASN A H    1 
ATOM   5671  H  HA   . ASN A 1 378 ? -60.481 15.276  -1.630  1.00 81.17  ? 457  ASN A HA   1 
ATOM   5672  H  HB2  . ASN A 1 378 ? -61.285 16.449  -4.060  1.00 70.72  ? 457  ASN A HB2  1 
ATOM   5673  H  HB3  . ASN A 1 378 ? -59.839 15.799  -3.941  1.00 70.72  ? 457  ASN A HB3  1 
ATOM   5674  H  HD21 . ASN A 1 378 ? -61.971 13.413  -5.428  1.00 72.40  ? 457  ASN A HD21 1 
ATOM   5675  H  HD22 . ASN A 1 378 ? -61.494 14.775  -5.796  1.00 72.40  ? 457  ASN A HD22 1 
ATOM   5676  N  N    . ALA A 1 379 ? -60.088 18.317  -1.354  1.00 59.62  ? 458  ALA A N    1 
ATOM   5677  C  CA   . ALA A 1 379 ? -59.166 19.433  -1.156  1.00 57.23  ? 458  ALA A CA   1 
ATOM   5678  C  C    . ALA A 1 379 ? -58.061 19.088  -0.161  1.00 59.50  ? 458  ALA A C    1 
ATOM   5679  O  O    . ALA A 1 379 ? -56.935 19.567  -0.285  1.00 61.71  ? 458  ALA A O    1 
ATOM   5680  C  CB   . ALA A 1 379 ? -59.924 20.677  -0.704  1.00 57.13  ? 458  ALA A CB   1 
ATOM   5681  H  H    . ALA A 1 379 ? -60.904 18.493  -1.147  1.00 71.55  ? 458  ALA A H    1 
ATOM   5682  H  HA   . ALA A 1 379 ? -58.744 19.639  -2.005  1.00 68.68  ? 458  ALA A HA   1 
ATOM   5683  H  HB1  . ALA A 1 379 ? -59.292 21.403  -0.580  1.00 68.55  ? 458  ALA A HB1  1 
ATOM   5684  H  HB2  . ALA A 1 379 ? -60.573 20.915  -1.384  1.00 68.55  ? 458  ALA A HB2  1 
ATOM   5685  H  HB3  . ALA A 1 379 ? -60.376 20.484  0.132   1.00 68.55  ? 458  ALA A HB3  1 
ATOM   5686  N  N    . ASN A 1 380 ? -58.378 18.254  0.821   1.00 71.82  ? 459  ASN A N    1 
ATOM   5687  C  CA   . ASN A 1 380 ? -57.390 17.872  1.815   1.00 72.12  ? 459  ASN A CA   1 
ATOM   5688  C  C    . ASN A 1 380 ? -56.407 16.855  1.241   1.00 69.89  ? 459  ASN A C    1 
ATOM   5689  O  O    . ASN A 1 380 ? -55.253 16.785  1.666   1.00 69.96  ? 459  ASN A O    1 
ATOM   5690  C  CB   . ASN A 1 380 ? -58.074 17.308  3.056   1.00 74.17  ? 459  ASN A CB   1 
ATOM   5691  C  CG   . ASN A 1 380 ? -57.252 17.511  4.311   1.00 83.63  ? 459  ASN A CG   1 
ATOM   5692  O  OD1  . ASN A 1 380 ? -56.796 18.619  4.598   1.00 85.24  ? 459  ASN A OD1  1 
ATOM   5693  N  ND2  . ASN A 1 380 ? -57.045 16.436  5.059   1.00 88.82  ? 459  ASN A ND2  1 
ATOM   5694  H  H    . ASN A 1 380 ? -59.154 17.899  0.933   1.00 86.19  ? 459  ASN A H    1 
ATOM   5695  H  HA   . ASN A 1 380 ? -56.888 18.658  2.080   1.00 86.55  ? 459  ASN A HA   1 
ATOM   5696  H  HB2  . ASN A 1 380 ? -58.926 17.754  3.179   1.00 89.01  ? 459  ASN A HB2  1 
ATOM   5697  H  HB3  . ASN A 1 380 ? -58.211 16.355  2.937   1.00 89.01  ? 459  ASN A HB3  1 
ATOM   5698  H  HD21 . ASN A 1 380 ? -56.585 16.498  5.783   1.00 106.59 ? 459  ASN A HD21 1 
ATOM   5699  H  HD22 . ASN A 1 380 ? -57.372 15.677  4.821   1.00 106.59 ? 459  ASN A HD22 1 
ATOM   5700  N  N    . LEU A 1 381 ? -56.870 16.071  0.271   1.00 46.55  ? 460  LEU A N    1 
ATOM   5701  C  CA   . LEU A 1 381 ? -56.008 15.119  -0.416  1.00 44.84  ? 460  LEU A CA   1 
ATOM   5702  C  C    . LEU A 1 381 ? -55.107 15.844  -1.405  1.00 45.55  ? 460  LEU A C    1 
ATOM   5703  O  O    . LEU A 1 381 ? -53.951 15.465  -1.585  1.00 41.96  ? 460  LEU A O    1 
ATOM   5704  C  CB   . LEU A 1 381 ? -56.834 14.069  -1.161  1.00 43.54  ? 460  LEU A CB   1 
ATOM   5705  C  CG   . LEU A 1 381 ? -57.550 12.997  -0.338  1.00 41.90  ? 460  LEU A CG   1 
ATOM   5706  C  CD1  . LEU A 1 381 ? -58.349 12.074  -1.269  1.00 39.19  ? 460  LEU A CD1  1 
ATOM   5707  C  CD2  . LEU A 1 381 ? -56.570 12.198  0.519   1.00 37.33  ? 460  LEU A CD2  1 
ATOM   5708  H  H    . LEU A 1 381 ? -57.683 16.073  -0.008  1.00 55.86  ? 460  LEU A H    1 
ATOM   5709  H  HA   . LEU A 1 381 ? -55.448 14.665  0.233   1.00 53.80  ? 460  LEU A HA   1 
ATOM   5710  H  HB2  . LEU A 1 381 ? -57.515 14.534  -1.671  1.00 52.24  ? 460  LEU A HB2  1 
ATOM   5711  H  HB3  . LEU A 1 381 ? -56.242 13.605  -1.773  1.00 52.24  ? 460  LEU A HB3  1 
ATOM   5712  H  HG   . LEU A 1 381 ? -58.179 13.431  0.259   1.00 50.28  ? 460  LEU A HG   1 
ATOM   5713  H  HD11 . LEU A 1 381 ? -58.798 11.400  -0.736  1.00 47.02  ? 460  LEU A HD11 1 
ATOM   5714  H  HD12 . LEU A 1 381 ? -59.003 12.603  -1.752  1.00 47.02  ? 460  LEU A HD12 1 
ATOM   5715  H  HD13 . LEU A 1 381 ? -57.739 11.651  -1.893  1.00 47.02  ? 460  LEU A HD13 1 
ATOM   5716  H  HD21 . LEU A 1 381 ? -57.062 11.531  1.023   1.00 44.79  ? 460  LEU A HD21 1 
ATOM   5717  H  HD22 . LEU A 1 381 ? -55.924 11.765  -0.061  1.00 44.79  ? 460  LEU A HD22 1 
ATOM   5718  H  HD23 . LEU A 1 381 ? -56.116 12.803  1.126   1.00 44.79  ? 460  LEU A HD23 1 
ATOM   5719  N  N    . VAL A 1 382 ? -55.643 16.869  -2.063  1.00 31.21  ? 461  VAL A N    1 
ATOM   5720  C  CA   . VAL A 1 382 ? -54.833 17.678  -2.961  1.00 28.53  ? 461  VAL A CA   1 
ATOM   5721  C  C    . VAL A 1 382 ? -53.766 18.408  -2.159  1.00 29.95  ? 461  VAL A C    1 
ATOM   5722  O  O    . VAL A 1 382 ? -52.591 18.387  -2.527  1.00 37.25  ? 461  VAL A O    1 
ATOM   5723  C  CB   . VAL A 1 382 ? -55.676 18.684  -3.761  1.00 29.71  ? 461  VAL A CB   1 
ATOM   5724  C  CG1  . VAL A 1 382 ? -54.781 19.719  -4.458  1.00 30.28  ? 461  VAL A CG1  1 
ATOM   5725  C  CG2  . VAL A 1 382 ? -56.526 17.952  -4.787  1.00 30.40  ? 461  VAL A CG2  1 
ATOM   5726  H  H    . VAL A 1 382 ? -56.465 17.114  -2.005  1.00 37.45  ? 461  VAL A H    1 
ATOM   5727  H  HA   . VAL A 1 382 ? -54.385 17.094  -3.593  1.00 34.24  ? 461  VAL A HA   1 
ATOM   5728  H  HB   . VAL A 1 382 ? -56.269 19.155  -3.156  1.00 35.66  ? 461  VAL A HB   1 
ATOM   5729  H  HG11 . VAL A 1 382 ? -55.342 20.337  -4.953  1.00 36.34  ? 461  VAL A HG11 1 
ATOM   5730  H  HG12 . VAL A 1 382 ? -54.271 20.198  -3.786  1.00 36.34  ? 461  VAL A HG12 1 
ATOM   5731  H  HG13 . VAL A 1 382 ? -54.180 19.259  -5.064  1.00 36.34  ? 461  VAL A HG13 1 
ATOM   5732  H  HG21 . VAL A 1 382 ? -57.051 18.601  -5.281  1.00 36.48  ? 461  VAL A HG21 1 
ATOM   5733  H  HG22 . VAL A 1 382 ? -55.943 17.467  -5.391  1.00 36.48  ? 461  VAL A HG22 1 
ATOM   5734  H  HG23 . VAL A 1 382 ? -57.114 17.334  -4.325  1.00 36.48  ? 461  VAL A HG23 1 
ATOM   5735  N  N    . LYS A 1 383 ? -54.165 19.045  -1.061  1.00 53.18  ? 462  LYS A N    1 
ATOM   5736  C  CA   . LYS A 1 383 ? -53.196 19.728  -0.219  1.00 55.90  ? 462  LYS A CA   1 
ATOM   5737  C  C    . LYS A 1 383 ? -52.188 18.716  0.319   1.00 53.97  ? 462  LYS A C    1 
ATOM   5738  O  O    . LYS A 1 383 ? -51.006 19.014  0.408   1.00 56.22  ? 462  LYS A O    1 
ATOM   5739  C  CB   . LYS A 1 383 ? -53.865 20.514  0.916   1.00 63.95  ? 462  LYS A CB   1 
ATOM   5740  C  CG   . LYS A 1 383 ? -53.307 21.932  1.030   1.00 68.75  ? 462  LYS A CG   1 
ATOM   5741  C  CD   . LYS A 1 383 ? -53.628 22.640  2.348   1.00 74.84  ? 462  LYS A CD   1 
ATOM   5742  C  CE   . LYS A 1 383 ? -52.905 23.992  2.415   1.00 74.76  ? 462  LYS A CE   1 
ATOM   5743  N  NZ   . LYS A 1 383 ? -53.205 24.793  3.639   1.00 68.62  ? 462  LYS A NZ   1 
ATOM   5744  H  H    . LYS A 1 383 ? -54.979 19.095  -0.788  1.00 63.81  ? 462  LYS A H    1 
ATOM   5745  H  HA   . LYS A 1 383 ? -52.707 20.363  -0.766  1.00 67.08  ? 462  LYS A HA   1 
ATOM   5746  H  HB2  . LYS A 1 383 ? -54.817 20.576  0.742   1.00 76.74  ? 462  LYS A HB2  1 
ATOM   5747  H  HB3  . LYS A 1 383 ? -53.706 20.057  1.757   1.00 76.74  ? 462  LYS A HB3  1 
ATOM   5748  H  HG2  . LYS A 1 383 ? -52.342 21.893  0.945   1.00 82.50  ? 462  LYS A HG2  1 
ATOM   5749  H  HG3  . LYS A 1 383 ? -53.677 22.469  0.311   1.00 82.50  ? 462  LYS A HG3  1 
ATOM   5750  H  HD2  . LYS A 1 383 ? -54.584 22.798  2.407   1.00 89.80  ? 462  LYS A HD2  1 
ATOM   5751  H  HD3  . LYS A 1 383 ? -53.329 22.092  3.091   1.00 89.80  ? 462  LYS A HD3  1 
ATOM   5752  H  HE2  . LYS A 1 383 ? -51.948 23.833  2.395   1.00 89.71  ? 462  LYS A HE2  1 
ATOM   5753  H  HE3  . LYS A 1 383 ? -53.165 24.521  1.646   1.00 89.71  ? 462  LYS A HE3  1 
ATOM   5754  H  HZ1  . LYS A 1 383 ? -52.756 25.561  3.617   1.00 82.34  ? 462  LYS A HZ1  1 
ATOM   5755  H  HZ2  . LYS A 1 383 ? -54.076 24.968  3.682   1.00 82.34  ? 462  LYS A HZ2  1 
ATOM   5756  H  HZ3  . LYS A 1 383 ? -52.965 24.339  4.366   1.00 82.34  ? 462  LYS A HZ3  1 
ATOM   5757  N  N    . THR A 1 384 ? -52.652 17.512  0.645   1.00 42.78  ? 463  THR A N    1 
ATOM   5758  C  CA   . THR A 1 384 ? -51.762 16.451  1.125   1.00 45.01  ? 463  THR A CA   1 
ATOM   5759  C  C    . THR A 1 384 ? -50.646 16.166  0.119   1.00 41.65  ? 463  THR A C    1 
ATOM   5760  O  O    . THR A 1 384 ? -49.470 16.080  0.482   1.00 36.22  ? 463  THR A O    1 
ATOM   5761  C  CB   . THR A 1 384 ? -52.534 15.134  1.401   1.00 42.05  ? 463  THR A CB   1 
ATOM   5762  O  OG1  . THR A 1 384 ? -53.254 15.244  2.633   1.00 43.63  ? 463  THR A OG1  1 
ATOM   5763  C  CG2  . THR A 1 384 ? -51.583 13.951  1.514   1.00 41.39  ? 463  THR A CG2  1 
ATOM   5764  H  H    . THR A 1 384 ? -53.480 17.281  0.598   1.00 51.34  ? 463  THR A H    1 
ATOM   5765  H  HA   . THR A 1 384 ? -51.350 16.737  1.956   1.00 54.01  ? 463  THR A HA   1 
ATOM   5766  H  HB   . THR A 1 384 ? -53.154 14.963  0.676   1.00 50.46  ? 463  THR A HB   1 
ATOM   5767  H  HG1  . THR A 1 384 ? -53.803 15.879  2.589   1.00 52.36  ? 463  THR A HG1  1 
ATOM   5768  H  HG21 . THR A 1 384 ? -52.084 13.138  1.687   1.00 49.67  ? 463  THR A HG21 1 
ATOM   5769  H  HG22 . THR A 1 384 ? -51.086 13.845  0.688   1.00 49.67  ? 463  THR A HG22 1 
ATOM   5770  H  HG23 . THR A 1 384 ? -50.957 14.096  2.241   1.00 49.67  ? 463  THR A HG23 1 
ATOM   5771  N  N    . LEU A 1 385 ? -51.024 16.023  -1.147  1.00 45.16  ? 464  LEU A N    1 
ATOM   5772  C  CA   . LEU A 1 385 ? -50.068 15.695  -2.197  1.00 37.21  ? 464  LEU A CA   1 
ATOM   5773  C  C    . LEU A 1 385 ? -49.022 16.796  -2.353  1.00 36.03  ? 464  LEU A C    1 
ATOM   5774  O  O    . LEU A 1 385 ? -47.866 16.520  -2.669  1.00 31.99  ? 464  LEU A O    1 
ATOM   5775  C  CB   . LEU A 1 385 ? -50.797 15.454  -3.522  1.00 34.06  ? 464  LEU A CB   1 
ATOM   5776  C  CG   . LEU A 1 385 ? -49.935 15.103  -4.739  1.00 32.36  ? 464  LEU A CG   1 
ATOM   5777  C  CD1  . LEU A 1 385 ? -49.043 13.885  -4.482  1.00 28.96  ? 464  LEU A CD1  1 
ATOM   5778  C  CD2  . LEU A 1 385 ? -50.829 14.882  -5.964  1.00 30.46  ? 464  LEU A CD2  1 
ATOM   5779  H  H    . LEU A 1 385 ? -51.833 16.112  -1.425  1.00 54.20  ? 464  LEU A H    1 
ATOM   5780  H  HA   . LEU A 1 385 ? -49.607 14.877  -1.957  1.00 44.65  ? 464  LEU A HA   1 
ATOM   5781  H  HB2  . LEU A 1 385 ? -51.420 14.722  -3.393  1.00 40.88  ? 464  LEU A HB2  1 
ATOM   5782  H  HB3  . LEU A 1 385 ? -51.291 16.258  -3.744  1.00 40.88  ? 464  LEU A HB3  1 
ATOM   5783  H  HG   . LEU A 1 385 ? -49.353 15.855  -4.933  1.00 38.83  ? 464  LEU A HG   1 
ATOM   5784  H  HD11 . LEU A 1 385 ? -48.519 13.704  -5.278  1.00 34.75  ? 464  LEU A HD11 1 
ATOM   5785  H  HD12 . LEU A 1 385 ? -48.455 14.077  -3.735  1.00 34.75  ? 464  LEU A HD12 1 
ATOM   5786  H  HD13 . LEU A 1 385 ? -49.604 13.122  -4.274  1.00 34.75  ? 464  LEU A HD13 1 
ATOM   5787  H  HD21 . LEU A 1 385 ? -50.271 14.661  -6.726  1.00 36.55  ? 464  LEU A HD21 1 
ATOM   5788  H  HD22 . LEU A 1 385 ? -51.442 14.153  -5.780  1.00 36.55  ? 464  LEU A HD22 1 
ATOM   5789  H  HD23 . LEU A 1 385 ? -51.327 15.696  -6.142  1.00 36.55  ? 464  LEU A HD23 1 
ATOM   5790  N  N    . VAL A 1 386 ? -49.422 18.040  -2.112  1.00 38.26  ? 465  VAL A N    1 
ATOM   5791  C  CA   . VAL A 1 386 ? -48.496 19.159  -2.207  1.00 35.27  ? 465  VAL A CA   1 
ATOM   5792  C  C    . VAL A 1 386 ? -47.438 19.067  -1.117  1.00 38.58  ? 465  VAL A C    1 
ATOM   5793  O  O    . VAL A 1 386 ? -46.254 19.283  -1.381  1.00 44.51  ? 465  VAL A O    1 
ATOM   5794  C  CB   . VAL A 1 386 ? -49.222 20.512  -2.097  1.00 40.36  ? 465  VAL A CB   1 
ATOM   5795  C  CG1  . VAL A 1 386 ? -48.207 21.671  -2.065  1.00 39.83  ? 465  VAL A CG1  1 
ATOM   5796  C  CG2  . VAL A 1 386 ? -50.227 20.666  -3.246  1.00 33.66  ? 465  VAL A CG2  1 
ATOM   5797  H  H    . VAL A 1 386 ? -50.224 18.261  -1.892  1.00 45.91  ? 465  VAL A H    1 
ATOM   5798  H  HA   . VAL A 1 386 ? -48.047 19.127  -3.066  1.00 42.32  ? 465  VAL A HA   1 
ATOM   5799  H  HB   . VAL A 1 386 ? -49.720 20.532  -1.265  1.00 48.43  ? 465  VAL A HB   1 
ATOM   5800  H  HG11 . VAL A 1 386 ? -48.688 22.510  -1.996  1.00 47.79  ? 465  VAL A HG11 1 
ATOM   5801  H  HG12 . VAL A 1 386 ? -47.624 21.559  -1.298  1.00 47.79  ? 465  VAL A HG12 1 
ATOM   5802  H  HG13 . VAL A 1 386 ? -47.684 21.655  -2.882  1.00 47.79  ? 465  VAL A HG13 1 
ATOM   5803  H  HG21 . VAL A 1 386 ? -50.674 21.522  -3.161  1.00 40.39  ? 465  VAL A HG21 1 
ATOM   5804  H  HG22 . VAL A 1 386 ? -49.750 20.624  -4.090  1.00 40.39  ? 465  VAL A HG22 1 
ATOM   5805  H  HG23 . VAL A 1 386 ? -50.876 19.947  -3.196  1.00 40.39  ? 465  VAL A HG23 1 
ATOM   5806  N  N    . PHE A 1 387 ? -47.862 18.768  0.107   1.00 52.28  ? 466  PHE A N    1 
ATOM   5807  C  CA   . PHE A 1 387 ? -46.914 18.622  1.203   1.00 54.41  ? 466  PHE A CA   1 
ATOM   5808  C  C    . PHE A 1 387 ? -45.936 17.485  0.913   1.00 48.27  ? 466  PHE A C    1 
ATOM   5809  O  O    . PHE A 1 387 ? -44.741 17.629  1.145   1.00 47.68  ? 466  PHE A O    1 
ATOM   5810  C  CB   . PHE A 1 387 ? -47.627 18.413  2.543   1.00 64.91  ? 466  PHE A CB   1 
ATOM   5811  C  CG   . PHE A 1 387 ? -48.204 19.680  3.129   1.00 79.43  ? 466  PHE A CG   1 
ATOM   5812  C  CD1  . PHE A 1 387 ? -49.346 20.247  2.592   1.00 75.03  ? 466  PHE A CD1  1 
ATOM   5813  C  CD2  . PHE A 1 387 ? -47.605 20.299  4.218   1.00 82.26  ? 466  PHE A CD2  1 
ATOM   5814  C  CE1  . PHE A 1 387 ? -49.886 21.402  3.118   1.00 71.42  ? 466  PHE A CE1  1 
ATOM   5815  C  CE2  . PHE A 1 387 ? -48.145 21.461  4.754   1.00 78.81  ? 466  PHE A CE2  1 
ATOM   5816  C  CZ   . PHE A 1 387 ? -49.287 22.011  4.200   1.00 77.64  ? 466  PHE A CZ   1 
ATOM   5817  H  H    . PHE A 1 387 ? -48.684 18.645  0.327   1.00 62.73  ? 466  PHE A H    1 
ATOM   5818  H  HA   . PHE A 1 387 ? -46.397 19.440  1.273   1.00 65.29  ? 466  PHE A HA   1 
ATOM   5819  H  HB2  . PHE A 1 387 ? -48.356 17.786  2.415   1.00 77.89  ? 466  PHE A HB2  1 
ATOM   5820  H  HB3  . PHE A 1 387 ? -46.992 18.052  3.182   1.00 77.89  ? 466  PHE A HB3  1 
ATOM   5821  H  HD1  . PHE A 1 387 ? -49.757 19.842  1.863   1.00 90.03  ? 466  PHE A HD1  1 
ATOM   5822  H  HD2  . PHE A 1 387 ? -46.838 19.931  4.593   1.00 98.72  ? 466  PHE A HD2  1 
ATOM   5823  H  HE1  . PHE A 1 387 ? -50.655 21.769  2.744   1.00 85.70  ? 466  PHE A HE1  1 
ATOM   5824  H  HE2  . PHE A 1 387 ? -47.738 21.871  5.483   1.00 94.57  ? 466  PHE A HE2  1 
ATOM   5825  H  HZ   . PHE A 1 387 ? -49.649 22.790  4.556   1.00 93.16  ? 466  PHE A HZ   1 
ATOM   5826  N  N    . PHE A 1 388 ? -46.430 16.373  0.377   1.00 35.65  ? 467  PHE A N    1 
ATOM   5827  C  CA   . PHE A 1 388 ? -45.544 15.263  0.042   1.00 32.78  ? 467  PHE A CA   1 
ATOM   5828  C  C    . PHE A 1 388 ? -44.509 15.705  -0.977  1.00 35.87  ? 467  PHE A C    1 
ATOM   5829  O  O    . PHE A 1 388 ? -43.318 15.432  -0.826  1.00 36.46  ? 467  PHE A O    1 
ATOM   5830  C  CB   . PHE A 1 388 ? -46.307 14.072  -0.531  1.00 31.87  ? 467  PHE A CB   1 
ATOM   5831  C  CG   . PHE A 1 388 ? -45.411 12.934  -0.913  1.00 30.88  ? 467  PHE A CG   1 
ATOM   5832  C  CD1  . PHE A 1 388 ? -44.909 12.083  0.053   1.00 32.29  ? 467  PHE A CD1  1 
ATOM   5833  C  CD2  . PHE A 1 388 ? -45.041 12.735  -2.233  1.00 38.76  ? 467  PHE A CD2  1 
ATOM   5834  C  CE1  . PHE A 1 388 ? -44.071 11.043  -0.288  1.00 35.71  ? 467  PHE A CE1  1 
ATOM   5835  C  CE2  . PHE A 1 388 ? -44.198 11.696  -2.580  1.00 35.54  ? 467  PHE A CE2  1 
ATOM   5836  C  CZ   . PHE A 1 388 ? -43.714 10.850  -1.606  1.00 30.52  ? 467  PHE A CZ   1 
ATOM   5837  H  H    . PHE A 1 388 ? -47.261 16.236  0.201   1.00 42.78  ? 467  PHE A H    1 
ATOM   5838  H  HA   . PHE A 1 388 ? -45.080 14.971  0.842   1.00 39.34  ? 467  PHE A HA   1 
ATOM   5839  H  HB2  . PHE A 1 388 ? -46.934 13.748  0.135   1.00 38.24  ? 467  PHE A HB2  1 
ATOM   5840  H  HB3  . PHE A 1 388 ? -46.786 14.356  -1.326  1.00 38.24  ? 467  PHE A HB3  1 
ATOM   5841  H  HD1  . PHE A 1 388 ? -45.146 12.208  0.943   1.00 38.75  ? 467  PHE A HD1  1 
ATOM   5842  H  HD2  . PHE A 1 388 ? -45.365 13.305  -2.893  1.00 46.51  ? 467  PHE A HD2  1 
ATOM   5843  H  HE1  . PHE A 1 388 ? -43.745 10.473  0.370   1.00 42.85  ? 467  PHE A HE1  1 
ATOM   5844  H  HE2  . PHE A 1 388 ? -43.961 11.566  -3.470  1.00 42.65  ? 467  PHE A HE2  1 
ATOM   5845  H  HZ   . PHE A 1 388 ? -43.150 10.148  -1.838  1.00 36.63  ? 467  PHE A HZ   1 
ATOM   5846  N  N    . PHE A 1 389 ? -44.977 16.379  -2.021  1.00 34.16  ? 468  PHE A N    1 
ATOM   5847  C  CA   . PHE A 1 389 ? -44.098 16.833  -3.092  1.00 34.12  ? 468  PHE A CA   1 
ATOM   5848  C  C    . PHE A 1 389 ? -43.072 17.840  -2.583  1.00 32.88  ? 468  PHE A C    1 
ATOM   5849  O  O    . PHE A 1 389 ? -41.913 17.818  -2.999  1.00 36.13  ? 468  PHE A O    1 
ATOM   5850  C  CB   . PHE A 1 389 ? -44.910 17.449  -4.233  1.00 37.64  ? 468  PHE A CB   1 
ATOM   5851  C  CG   . PHE A 1 389 ? -44.064 17.972  -5.362  1.00 40.30  ? 468  PHE A CG   1 
ATOM   5852  C  CD1  . PHE A 1 389 ? -43.072 17.185  -5.927  1.00 36.82  ? 468  PHE A CD1  1 
ATOM   5853  C  CD2  . PHE A 1 389 ? -44.262 19.250  -5.861  1.00 41.87  ? 468  PHE A CD2  1 
ATOM   5854  C  CE1  . PHE A 1 389 ? -42.291 17.665  -6.966  1.00 37.81  ? 468  PHE A CE1  1 
ATOM   5855  C  CE2  . PHE A 1 389 ? -43.484 19.733  -6.901  1.00 33.28  ? 468  PHE A CE2  1 
ATOM   5856  C  CZ   . PHE A 1 389 ? -42.497 18.940  -7.451  1.00 36.96  ? 468  PHE A CZ   1 
ATOM   5857  H  H    . PHE A 1 389 ? -45.804 16.588  -2.133  1.00 40.99  ? 468  PHE A H    1 
ATOM   5858  H  HA   . PHE A 1 389 ? -43.616 16.069  -3.447  1.00 40.94  ? 468  PHE A HA   1 
ATOM   5859  H  HB2  . PHE A 1 389 ? -45.503 16.773  -4.595  1.00 45.16  ? 468  PHE A HB2  1 
ATOM   5860  H  HB3  . PHE A 1 389 ? -45.429 18.190  -3.883  1.00 45.16  ? 468  PHE A HB3  1 
ATOM   5861  H  HD1  . PHE A 1 389 ? -42.927 16.325  -5.602  1.00 44.19  ? 468  PHE A HD1  1 
ATOM   5862  H  HD2  . PHE A 1 389 ? -44.924 19.790  -5.493  1.00 50.24  ? 468  PHE A HD2  1 
ATOM   5863  H  HE1  . PHE A 1 389 ? -41.628 17.127  -7.336  1.00 45.37  ? 468  PHE A HE1  1 
ATOM   5864  H  HE2  . PHE A 1 389 ? -43.625 20.593  -7.227  1.00 39.93  ? 468  PHE A HE2  1 
ATOM   5865  H  HZ   . PHE A 1 389 ? -41.975 19.262  -8.150  1.00 44.35  ? 468  PHE A HZ   1 
ATOM   5866  N  N    . LEU A 1 390 ? -43.501 18.720  -1.685  1.00 33.21  ? 469  LEU A N    1 
ATOM   5867  C  CA   . LEU A 1 390 ? -42.611 19.731  -1.124  1.00 37.67  ? 469  LEU A CA   1 
ATOM   5868  C  C    . LEU A 1 390 ? -41.581 19.134  -0.165  1.00 41.49  ? 469  LEU A C    1 
ATOM   5869  O  O    . LEU A 1 390 ? -40.498 19.695  0.012   1.00 47.23  ? 469  LEU A O    1 
ATOM   5870  C  CB   . LEU A 1 390 ? -43.421 20.810  -0.408  1.00 44.03  ? 469  LEU A CB   1 
ATOM   5871  C  CG   . LEU A 1 390 ? -44.100 21.837  -1.313  1.00 40.88  ? 469  LEU A CG   1 
ATOM   5872  C  CD1  . LEU A 1 390 ? -45.066 22.677  -0.510  1.00 43.17  ? 469  LEU A CD1  1 
ATOM   5873  C  CD2  . LEU A 1 390 ? -43.077 22.733  -1.981  1.00 34.63  ? 469  LEU A CD2  1 
ATOM   5874  H  H    . LEU A 1 390 ? -44.306 18.753  -1.383  1.00 39.86  ? 469  LEU A H    1 
ATOM   5875  H  HA   . LEU A 1 390 ? -42.127 20.156  -1.849  1.00 45.21  ? 469  LEU A HA   1 
ATOM   5876  H  HB2  . LEU A 1 390 ? -44.116 20.377  0.112   1.00 52.83  ? 469  LEU A HB2  1 
ATOM   5877  H  HB3  . LEU A 1 390 ? -42.827 21.295  0.187   1.00 52.83  ? 469  LEU A HB3  1 
ATOM   5878  H  HG   . LEU A 1 390 ? -44.599 21.376  -2.004  1.00 49.06  ? 469  LEU A HG   1 
ATOM   5879  H  HD11 . LEU A 1 390 ? -45.487 23.323  -1.098  1.00 51.81  ? 469  LEU A HD11 1 
ATOM   5880  H  HD12 . LEU A 1 390 ? -45.738 22.097  -0.119  1.00 51.81  ? 469  LEU A HD12 1 
ATOM   5881  H  HD13 . LEU A 1 390 ? -44.578 23.137  0.191   1.00 51.81  ? 469  LEU A HD13 1 
ATOM   5882  H  HD21 . LEU A 1 390 ? -43.539 23.372  -2.546  1.00 41.56  ? 469  LEU A HD21 1 
ATOM   5883  H  HD22 . LEU A 1 390 ? -42.573 23.201  -1.297  1.00 41.56  ? 469  LEU A HD22 1 
ATOM   5884  H  HD23 . LEU A 1 390 ? -42.481 22.187  -2.517  1.00 41.56  ? 469  LEU A HD23 1 
ATOM   5885  N  N    . GLU A 1 391 ? -41.921 18.008  0.458   1.00 52.29  ? 470  GLU A N    1 
ATOM   5886  C  CA   . GLU A 1 391 ? -41.009 17.336  1.380   1.00 51.60  ? 470  GLU A CA   1 
ATOM   5887  C  C    . GLU A 1 391 ? -40.017 16.448  0.634   1.00 57.92  ? 470  GLU A C    1 
ATOM   5888  O  O    . GLU A 1 391 ? -39.048 15.963  1.220   1.00 60.63  ? 470  GLU A O    1 
ATOM   5889  C  CB   . GLU A 1 391 ? -41.781 16.497  2.405   1.00 53.89  ? 470  GLU A CB   1 
ATOM   5890  C  CG   . GLU A 1 391 ? -42.605 17.305  3.407   1.00 65.05  ? 470  GLU A CG   1 
ATOM   5891  C  CD   . GLU A 1 391 ? -41.793 18.365  4.120   1.00 80.97  ? 470  GLU A CD   1 
ATOM   5892  O  OE1  . GLU A 1 391 ? -40.746 18.018  4.708   1.00 87.58  ? 470  GLU A OE1  1 
ATOM   5893  O  OE2  . GLU A 1 391 ? -42.200 19.550  4.080   1.00 80.04  ? 470  GLU A OE2  1 
ATOM   5894  H  H    . GLU A 1 391 ? -42.678 17.611  0.363   1.00 62.75  ? 470  GLU A H    1 
ATOM   5895  H  HA   . GLU A 1 391 ? -40.502 18.007  1.864   1.00 61.92  ? 470  GLU A HA   1 
ATOM   5896  H  HB2  . GLU A 1 391 ? -42.391 15.912  1.929   1.00 64.67  ? 470  GLU A HB2  1 
ATOM   5897  H  HB3  . GLU A 1 391 ? -41.146 15.965  2.909   1.00 64.67  ? 470  GLU A HB3  1 
ATOM   5898  H  HG2  . GLU A 1 391 ? -43.329 17.748  2.937   1.00 78.06  ? 470  GLU A HG2  1 
ATOM   5899  H  HG3  . GLU A 1 391 ? -42.965 16.703  4.077   1.00 78.06  ? 470  GLU A HG3  1 
ATOM   5900  N  N    . SER A 1 392 ? -40.261 16.234  -0.657  1.00 77.34  ? 471  SER A N    1 
ATOM   5901  C  CA   . SER A 1 392 ? -39.349 15.457  -1.493  1.00 74.76  ? 471  SER A CA   1 
ATOM   5902  C  C    . SER A 1 392 ? -38.163 16.311  -1.930  1.00 72.33  ? 471  SER A C    1 
ATOM   5903  O  O    . SER A 1 392 ? -38.329 17.287  -2.661  1.00 83.86  ? 471  SER A O    1 
ATOM   5904  C  CB   . SER A 1 392 ? -40.076 14.919  -2.729  1.00 73.35  ? 471  SER A CB   1 
ATOM   5905  O  OG   . SER A 1 392 ? -41.213 14.151  -2.372  1.00 74.03  ? 471  SER A OG   1 
ATOM   5906  H  H    . SER A 1 392 ? -40.953 16.530  -1.074  1.00 92.81  ? 471  SER A H    1 
ATOM   5907  H  HA   . SER A 1 392 ? -39.012 14.703  -0.985  1.00 89.71  ? 471  SER A HA   1 
ATOM   5908  H  HB2  . SER A 1 392 ? -40.361 15.668  -3.275  1.00 88.02  ? 471  SER A HB2  1 
ATOM   5909  H  HB3  . SER A 1 392 ? -39.464 14.359  -3.232  1.00 88.02  ? 471  SER A HB3  1 
ATOM   5910  H  HG   . SER A 1 392 ? -41.596 13.867  -3.064  1.00 88.83  ? 471  SER A HG   1 
ATOM   5911  N  N    . GLU A 1 393 ? -36.971 15.937  -1.475  1.00 63.22  ? 472  GLU A N    1 
ATOM   5912  C  CA   . GLU A 1 393 ? -35.738 16.646  -1.813  1.00 67.57  ? 472  GLU A CA   1 
ATOM   5913  C  C    . GLU A 1 393 ? -35.035 15.993  -3.008  1.00 70.74  ? 472  GLU A C    1 
ATOM   5914  O  O    . GLU A 1 393 ? -33.885 16.306  -3.314  1.00 82.64  ? 472  GLU A O    1 
ATOM   5915  C  CB   . GLU A 1 393 ? -34.812 16.651  -0.591  1.00 76.29  ? 472  GLU A CB   1 
ATOM   5916  C  CG   . GLU A 1 393 ? -33.644 17.640  -0.640  1.00 88.70  ? 472  GLU A CG   1 
ATOM   5917  C  CD   . GLU A 1 393 ? -34.095 19.089  -0.604  1.00 93.63  ? 472  GLU A CD   1 
ATOM   5918  O  OE1  . GLU A 1 393 ? -34.926 19.434  0.265   1.00 86.68  ? 472  GLU A OE1  1 
ATOM   5919  O  OE2  . GLU A 1 393 ? -33.616 19.884  -1.443  1.00 94.16  ? 472  GLU A OE2  1 
ATOM   5920  H  H    . GLU A 1 393 ? -36.847 15.261  -0.958  1.00 75.86  ? 472  GLU A H    1 
ATOM   5921  H  HA   . GLU A 1 393 ? -35.947 17.565  -2.043  1.00 81.09  ? 472  GLU A HA   1 
ATOM   5922  H  HB2  . GLU A 1 393 ? -35.341 16.866  0.192   1.00 91.54  ? 472  GLU A HB2  1 
ATOM   5923  H  HB3  . GLU A 1 393 ? -34.435 15.763  -0.491  1.00 91.54  ? 472  GLU A HB3  1 
ATOM   5924  H  HG2  . GLU A 1 393 ? -33.069 17.486  0.126   1.00 106.43 ? 472  GLU A HG2  1 
ATOM   5925  H  HG3  . GLU A 1 393 ? -33.147 17.501  -1.461  1.00 106.43 ? 472  GLU A HG3  1 
ATOM   5926  N  N    . LEU A 1 394 ? -35.738 15.091  -3.685  1.00 51.42  ? 473  LEU A N    1 
ATOM   5927  C  CA   . LEU A 1 394 ? -35.171 14.333  -4.798  1.00 40.91  ? 473  LEU A CA   1 
ATOM   5928  C  C    . LEU A 1 394 ? -35.599 14.868  -6.168  1.00 41.45  ? 473  LEU A C    1 
ATOM   5929  O  O    . LEU A 1 394 ? -34.857 14.746  -7.141  1.00 37.59  ? 473  LEU A O    1 
ATOM   5930  C  CB   . LEU A 1 394 ? -35.579 12.862  -4.685  1.00 38.15  ? 473  LEU A CB   1 
ATOM   5931  C  CG   . LEU A 1 394 ? -34.754 11.937  -3.788  1.00 33.46  ? 473  LEU A CG   1 
ATOM   5932  C  CD1  . LEU A 1 394 ? -35.380 10.555  -3.769  1.00 38.84  ? 473  LEU A CD1  1 
ATOM   5933  C  CD2  . LEU A 1 394 ? -33.333 11.840  -4.282  1.00 38.99  ? 473  LEU A CD2  1 
ATOM   5934  H  H    . LEU A 1 394 ? -36.559 14.896  -3.517  1.00 61.71  ? 473  LEU A H    1 
ATOM   5935  H  HA   . LEU A 1 394 ? -34.203 14.379  -4.749  1.00 49.09  ? 473  LEU A HA   1 
ATOM   5936  H  HB2  . LEU A 1 394 ? -36.490 12.833  -4.354  1.00 45.78  ? 473  LEU A HB2  1 
ATOM   5937  H  HB3  . LEU A 1 394 ? -35.556 12.480  -5.576  1.00 45.78  ? 473  LEU A HB3  1 
ATOM   5938  H  HG   . LEU A 1 394 ? -34.744 12.285  -2.882  1.00 40.15  ? 473  LEU A HG   1 
ATOM   5939  H  HD11 . LEU A 1 394 ? -34.851 9.977   -3.198  1.00 46.61  ? 473  LEU A HD11 1 
ATOM   5940  H  HD12 . LEU A 1 394 ? -36.284 10.623  -3.424  1.00 46.61  ? 473  LEU A HD12 1 
ATOM   5941  H  HD13 . LEU A 1 394 ? -35.397 10.204  -4.673  1.00 46.61  ? 473  LEU A HD13 1 
ATOM   5942  H  HD21 . LEU A 1 394 ? -32.834 11.249  -3.696  1.00 46.79  ? 473  LEU A HD21 1 
ATOM   5943  H  HD22 . LEU A 1 394 ? -33.336 11.486  -5.185  1.00 46.79  ? 473  LEU A HD22 1 
ATOM   5944  H  HD23 . LEU A 1 394 ? -32.936 12.726  -4.275  1.00 46.79  ? 473  LEU A HD23 1 
ATOM   5945  N  N    . HIS A 1 395 ? -36.793 15.452  -6.241  1.00 36.23  ? 474  HIS A N    1 
ATOM   5946  C  CA   . HIS A 1 395 ? -37.334 15.964  -7.502  1.00 31.07  ? 474  HIS A CA   1 
ATOM   5947  C  C    . HIS A 1 395 ? -37.840 17.401  -7.354  1.00 33.92  ? 474  HIS A C    1 
ATOM   5948  O  O    . HIS A 1 395 ? -38.476 17.748  -6.359  1.00 34.72  ? 474  HIS A O    1 
ATOM   5949  C  CB   . HIS A 1 395 ? -38.469 15.064  -8.007  1.00 29.02  ? 474  HIS A CB   1 
ATOM   5950  C  CG   . HIS A 1 395 ? -38.038 14.038  -9.015  1.00 29.62  ? 474  HIS A CG   1 
ATOM   5951  N  ND1  . HIS A 1 395 ? -36.819 13.394  -8.948  1.00 29.38  ? 474  HIS A ND1  1 
ATOM   5952  C  CD2  . HIS A 1 395 ? -38.666 13.544  -10.104 1.00 28.08  ? 474  HIS A CD2  1 
ATOM   5953  C  CE1  . HIS A 1 395 ? -36.717 12.547  -9.961  1.00 24.75  ? 474  HIS A CE1  1 
ATOM   5954  N  NE2  . HIS A 1 395 ? -37.825 12.621  -10.678 1.00 27.30  ? 474  HIS A NE2  1 
ATOM   5955  H  H    . HIS A 1 395 ? -37.315 15.566  -5.567  1.00 43.48  ? 474  HIS A H    1 
ATOM   5956  H  HA   . HIS A 1 395 ? -36.631 15.962  -8.170  1.00 37.29  ? 474  HIS A HA   1 
ATOM   5957  H  HB2  . HIS A 1 395 ? -38.851 14.592  -7.250  1.00 34.83  ? 474  HIS A HB2  1 
ATOM   5958  H  HB3  . HIS A 1 395 ? -39.146 15.620  -8.422  1.00 34.83  ? 474  HIS A HB3  1 
ATOM   5959  H  HD1  . HIS A 1 395 ? -36.220 13.523  -8.344  1.00 35.25  ? 474  HIS A HD1  1 
ATOM   5960  H  HD2  . HIS A 1 395 ? -39.510 13.787  -10.411 1.00 33.70  ? 474  HIS A HD2  1 
ATOM   5961  H  HE1  . HIS A 1 395 ? -35.989 11.996  -10.138 1.00 29.71  ? 474  HIS A HE1  1 
ATOM   5962  H  HE2  . HIS A 1 395 ? -37.993 12.164  -11.387 1.00 32.76  ? 474  HIS A HE2  1 
ATOM   5963  N  N    . GLU A 1 396 ? -37.555 18.226  -8.357  1.00 42.27  ? 475  GLU A N    1 
ATOM   5964  C  CA   . GLU A 1 396 ? -37.953 19.630  -8.347  1.00 39.58  ? 475  GLU A CA   1 
ATOM   5965  C  C    . GLU A 1 396 ? -39.157 19.886  -9.256  1.00 33.41  ? 475  GLU A C    1 
ATOM   5966  O  O    . GLU A 1 396 ? -39.664 21.007  -9.314  1.00 40.93  ? 475  GLU A O    1 
ATOM   5967  C  CB   . GLU A 1 396 ? -36.767 20.515  -8.745  1.00 50.49  ? 475  GLU A CB   1 
ATOM   5968  C  CG   . GLU A 1 396 ? -35.753 20.701  -7.623  1.00 59.16  ? 475  GLU A CG   1 
ATOM   5969  C  CD   . GLU A 1 396 ? -34.461 21.340  -8.099  1.00 75.68  ? 475  GLU A CD   1 
ATOM   5970  O  OE1  . GLU A 1 396 ? -34.417 21.797  -9.263  1.00 77.57  ? 475  GLU A OE1  1 
ATOM   5971  O  OE2  . GLU A 1 396 ? -33.489 21.383  -7.312  1.00 85.46  ? 475  GLU A OE2  1 
ATOM   5972  H  H    . GLU A 1 396 ? -37.126 17.993  -9.064  1.00 50.72  ? 475  GLU A H    1 
ATOM   5973  H  HA   . GLU A 1 396 ? -38.211 19.873  -7.444  1.00 47.50  ? 475  GLU A HA   1 
ATOM   5974  H  HB2  . GLU A 1 396 ? -36.309 20.107  -9.497  1.00 60.59  ? 475  GLU A HB2  1 
ATOM   5975  H  HB3  . GLU A 1 396 ? -37.098 21.391  -8.996  1.00 60.59  ? 475  GLU A HB3  1 
ATOM   5976  H  HG2  . GLU A 1 396 ? -36.138 21.273  -6.942  1.00 70.99  ? 475  GLU A HG2  1 
ATOM   5977  H  HG3  . GLU A 1 396 ? -35.538 19.834  -7.246  1.00 70.99  ? 475  GLU A HG3  1 
ATOM   5978  N  N    . HIS A 1 397 ? -39.614 18.841  -9.946  1.00 27.10  ? 476  HIS A N    1 
ATOM   5979  C  CA   . HIS A 1 397 ? -40.843 18.896  -10.742 1.00 25.05  ? 476  HIS A CA   1 
ATOM   5980  C  C    . HIS A 1 397 ? -41.699 17.670  -10.412 1.00 30.72  ? 476  HIS A C    1 
ATOM   5981  O  O    . HIS A 1 397 ? -41.214 16.711  -9.804  1.00 31.24  ? 476  HIS A O    1 
ATOM   5982  C  CB   . HIS A 1 397 ? -40.537 18.977  -12.243 1.00 26.50  ? 476  HIS A CB   1 
ATOM   5983  C  CG   . HIS A 1 397 ? -39.800 17.791  -12.783 1.00 24.93  ? 476  HIS A CG   1 
ATOM   5984  N  ND1  . HIS A 1 397 ? -40.193 17.129  -13.924 1.00 27.72  ? 476  HIS A ND1  1 
ATOM   5985  C  CD2  . HIS A 1 397 ? -38.684 17.159  -12.344 1.00 27.62  ? 476  HIS A CD2  1 
ATOM   5986  C  CE1  . HIS A 1 397 ? -39.357 16.131  -14.163 1.00 25.47  ? 476  HIS A CE1  1 
ATOM   5987  N  NE2  . HIS A 1 397 ? -38.434 16.130  -13.220 1.00 26.54  ? 476  HIS A NE2  1 
ATOM   5988  H  H    . HIS A 1 397 ? -39.223 18.076  -9.971  1.00 32.52  ? 476  HIS A H    1 
ATOM   5989  H  HA   . HIS A 1 397 ? -41.344 19.689  -10.494 1.00 30.06  ? 476  HIS A HA   1 
ATOM   5990  H  HB2  . HIS A 1 397 ? -41.374 19.050  -12.728 1.00 31.81  ? 476  HIS A HB2  1 
ATOM   5991  H  HB3  . HIS A 1 397 ? -39.993 19.763  -12.409 1.00 31.81  ? 476  HIS A HB3  1 
ATOM   5992  H  HD1  . HIS A 1 397 ? -40.878 17.329  -14.403 1.00 33.26  ? 476  HIS A HD1  1 
ATOM   5993  H  HD2  . HIS A 1 397 ? -38.184 17.377  -11.591 1.00 33.15  ? 476  HIS A HD2  1 
ATOM   5994  H  HE1  . HIS A 1 397 ? -39.410 15.535  -14.875 1.00 30.57  ? 476  HIS A HE1  1 
ATOM   5995  H  HE2  . HIS A 1 397 ? -37.781 15.574  -13.162 1.00 31.85  ? 476  HIS A HE2  1 
ATOM   5996  N  N    . ALA A 1 398 ? -42.967 17.703  -10.817 1.00 31.44  ? 477  ALA A N    1 
ATOM   5997  C  CA   . ALA A 1 398 ? -43.949 16.714  -10.372 1.00 24.53  ? 477  ALA A CA   1 
ATOM   5998  C  C    . ALA A 1 398 ? -44.308 15.655  -11.426 1.00 27.79  ? 477  ALA A C    1 
ATOM   5999  O  O    . ALA A 1 398 ? -45.148 14.793  -11.168 1.00 29.31  ? 477  ALA A O    1 
ATOM   6000  C  CB   . ALA A 1 398 ? -45.205 17.432  -9.911  1.00 29.53  ? 477  ALA A CB   1 
ATOM   6001  H  H    . ALA A 1 398 ? -43.286 18.293  -11.354 1.00 37.73  ? 477  ALA A H    1 
ATOM   6002  H  HA   . ALA A 1 398 ? -43.584 16.246  -9.605  1.00 29.44  ? 477  ALA A HA   1 
ATOM   6003  H  HB1  . ALA A 1 398 ? -45.854 16.774  -9.617  1.00 35.44  ? 477  ALA A HB1  1 
ATOM   6004  H  HB2  . ALA A 1 398 ? -44.978 18.024  -9.176  1.00 35.44  ? 477  ALA A HB2  1 
ATOM   6005  H  HB3  . ALA A 1 398 ? -45.565 17.945  -10.651 1.00 35.44  ? 477  ALA A HB3  1 
ATOM   6006  N  N    . ALA A 1 399 ? -43.667 15.708  -12.594 1.00 24.45  ? 478  ALA A N    1 
ATOM   6007  C  CA   . ALA A 1 399 ? -44.003 14.815  -13.713 1.00 19.76  ? 478  ALA A CA   1 
ATOM   6008  C  C    . ALA A 1 399 ? -43.947 13.333  -13.340 1.00 23.46  ? 478  ALA A C    1 
ATOM   6009  O  O    . ALA A 1 399 ? -44.736 12.531  -13.841 1.00 28.83  ? 478  ALA A O    1 
ATOM   6010  C  CB   . ALA A 1 399 ? -43.085 15.090  -14.919 1.00 19.64  ? 478  ALA A CB   1 
ATOM   6011  H  H    . ALA A 1 399 ? -43.027 16.256  -12.767 1.00 29.33  ? 478  ALA A H    1 
ATOM   6012  H  HA   . ALA A 1 399 ? -44.911 15.007  -13.992 1.00 23.72  ? 478  ALA A HA   1 
ATOM   6013  H  HB1  . ALA A 1 399 ? -43.326 14.490  -15.642 1.00 23.57  ? 478  ALA A HB1  1 
ATOM   6014  H  HB2  . ALA A 1 399 ? -43.201 16.011  -15.200 1.00 23.57  ? 478  ALA A HB2  1 
ATOM   6015  H  HB3  . ALA A 1 399 ? -42.164 14.938  -14.655 1.00 23.57  ? 478  ALA A HB3  1 
ATOM   6016  N  N    . TYR A 1 400 ? -43.025 12.974  -12.452 1.00 28.30  ? 479  TYR A N    1 
ATOM   6017  C  CA   . TYR A 1 400 ? -42.787 11.571  -12.125 1.00 23.98  ? 479  TYR A CA   1 
ATOM   6018  C  C    . TYR A 1 400 ? -43.515 11.112  -10.867 1.00 24.32  ? 479  TYR A C    1 
ATOM   6019  O  O    . TYR A 1 400 ? -43.985 9.975   -10.801 1.00 29.84  ? 479  TYR A O    1 
ATOM   6020  C  CB   . TYR A 1 400 ? -41.287 11.314  -12.027 1.00 24.21  ? 479  TYR A CB   1 
ATOM   6021  C  CG   . TYR A 1 400 ? -40.639 11.396  -13.382 1.00 17.23  ? 479  TYR A CG   1 
ATOM   6022  C  CD1  . TYR A 1 400 ? -40.670 10.314  -14.249 1.00 16.87  ? 479  TYR A CD1  1 
ATOM   6023  C  CD2  . TYR A 1 400 ? -40.026 12.565  -13.811 1.00 25.26  ? 479  TYR A CD2  1 
ATOM   6024  C  CE1  . TYR A 1 400 ? -40.101 10.386  -15.499 1.00 16.90  ? 479  TYR A CE1  1 
ATOM   6025  C  CE2  . TYR A 1 400 ? -39.450 12.648  -15.063 1.00 26.37  ? 479  TYR A CE2  1 
ATOM   6026  C  CZ   . TYR A 1 400 ? -39.484 11.553  -15.899 1.00 17.61  ? 479  TYR A CZ   1 
ATOM   6027  O  OH   . TYR A 1 400 ? -38.910 11.639  -17.144 1.00 26.44  ? 479  TYR A OH   1 
ATOM   6028  H  H    . TYR A 1 400 ? -42.521 13.525  -12.025 1.00 33.95  ? 479  TYR A H    1 
ATOM   6029  H  HA   . TYR A 1 400 ? -43.121 11.031  -12.858 1.00 28.78  ? 479  TYR A HA   1 
ATOM   6030  H  HB2  . TYR A 1 400 ? -40.883 11.983  -11.453 1.00 29.05  ? 479  TYR A HB2  1 
ATOM   6031  H  HB3  . TYR A 1 400 ? -41.136 10.425  -11.669 1.00 29.05  ? 479  TYR A HB3  1 
ATOM   6032  H  HD1  . TYR A 1 400 ? -41.084 9.525   -13.980 1.00 20.24  ? 479  TYR A HD1  1 
ATOM   6033  H  HD2  . TYR A 1 400 ? -40.001 13.303  -13.246 1.00 30.31  ? 479  TYR A HD2  1 
ATOM   6034  H  HE1  . TYR A 1 400 ? -40.122 9.650   -16.067 1.00 20.27  ? 479  TYR A HE1  1 
ATOM   6035  H  HE2  . TYR A 1 400 ? -39.035 13.434  -15.337 1.00 31.65  ? 479  TYR A HE2  1 
ATOM   6036  H  HH   . TYR A 1 400 ? -39.006 10.913  -17.555 1.00 31.73  ? 479  TYR A HH   1 
ATOM   6037  N  N    . LEU A 1 401 ? -43.610 11.990  -9.876  1.00 23.86  ? 480  LEU A N    1 
ATOM   6038  C  CA   . LEU A 1 401 ? -44.509 11.764  -8.753  1.00 25.94  ? 480  LEU A CA   1 
ATOM   6039  C  C    . LEU A 1 401 ? -45.914 11.481  -9.274  1.00 31.41  ? 480  LEU A C    1 
ATOM   6040  O  O    . LEU A 1 401 ? -46.537 10.485  -8.909  1.00 35.62  ? 480  LEU A O    1 
ATOM   6041  C  CB   . LEU A 1 401 ? -44.545 12.992  -7.847  1.00 29.62  ? 480  LEU A CB   1 
ATOM   6042  C  CG   . LEU A 1 401 ? -45.734 13.074  -6.889  1.00 29.86  ? 480  LEU A CG   1 
ATOM   6043  C  CD1  . LEU A 1 401 ? -45.826 11.811  -6.043  1.00 26.06  ? 480  LEU A CD1  1 
ATOM   6044  C  CD2  . LEU A 1 401 ? -45.605 14.303  -6.007  1.00 31.97  ? 480  LEU A CD2  1 
ATOM   6045  H  H    . LEU A 1 401 ? -43.165 12.725  -9.831  1.00 28.63  ? 480  LEU A H    1 
ATOM   6046  H  HA   . LEU A 1 401 ? -44.206 11.001  -8.236  1.00 31.13  ? 480  LEU A HA   1 
ATOM   6047  H  HB2  . LEU A 1 401 ? -43.738 12.999  -7.308  1.00 35.55  ? 480  LEU A HB2  1 
ATOM   6048  H  HB3  . LEU A 1 401 ? -44.567 13.785  -8.405  1.00 35.55  ? 480  LEU A HB3  1 
ATOM   6049  H  HG   . LEU A 1 401 ? -46.552 13.155  -7.403  1.00 35.83  ? 480  LEU A HG   1 
ATOM   6050  H  HD11 . LEU A 1 401 ? -46.586 11.886  -5.445  1.00 31.27  ? 480  LEU A HD11 1 
ATOM   6051  H  HD12 . LEU A 1 401 ? -45.940 11.046  -6.629  1.00 31.27  ? 480  LEU A HD12 1 
ATOM   6052  H  HD13 . LEU A 1 401 ? -45.008 11.715  -5.529  1.00 31.27  ? 480  LEU A HD13 1 
ATOM   6053  H  HD21 . LEU A 1 401 ? -46.366 14.341  -5.406  1.00 38.36  ? 480  LEU A HD21 1 
ATOM   6054  H  HD22 . LEU A 1 401 ? -44.782 14.240  -5.497  1.00 38.36  ? 480  LEU A HD22 1 
ATOM   6055  H  HD23 . LEU A 1 401 ? -45.587 15.094  -6.569  1.00 38.36  ? 480  LEU A HD23 1 
ATOM   6056  N  N    . VAL A 1 402 ? -46.398 12.369  -10.137 1.00 30.83  ? 481  VAL A N    1 
ATOM   6057  C  CA   . VAL A 1 402 ? -47.755 12.289  -10.674 1.00 25.93  ? 481  VAL A CA   1 
ATOM   6058  C  C    . VAL A 1 402 ? -48.014 10.994  -11.438 1.00 25.21  ? 481  VAL A C    1 
ATOM   6059  O  O    . VAL A 1 402 ? -49.039 10.346  -11.228 1.00 33.02  ? 481  VAL A O    1 
ATOM   6060  C  CB   . VAL A 1 402 ? -48.060 13.512  -11.579 1.00 29.89  ? 481  VAL A CB   1 
ATOM   6061  C  CG1  . VAL A 1 402 ? -49.316 13.294  -12.423 1.00 29.96  ? 481  VAL A CG1  1 
ATOM   6062  C  CG2  . VAL A 1 402 ? -48.214 14.770  -10.727 1.00 26.91  ? 481  VAL A CG2  1 
ATOM   6063  H  H    . VAL A 1 402 ? -45.950 13.041  -10.433 1.00 37.00  ? 481  VAL A H    1 
ATOM   6064  H  HA   . VAL A 1 402 ? -48.378 12.316  -9.932  1.00 31.12  ? 481  VAL A HA   1 
ATOM   6065  H  HB   . VAL A 1 402 ? -47.314 13.651  -12.183 1.00 35.87  ? 481  VAL A HB   1 
ATOM   6066  H  HG11 . VAL A 1 402 ? -49.469 14.079  -12.971 1.00 35.95  ? 481  VAL A HG11 1 
ATOM   6067  H  HG12 . VAL A 1 402 ? -49.185 12.516  -12.989 1.00 35.95  ? 481  VAL A HG12 1 
ATOM   6068  H  HG13 . VAL A 1 402 ? -50.072 13.149  -11.833 1.00 35.95  ? 481  VAL A HG13 1 
ATOM   6069  H  HG21 . VAL A 1 402 ? -48.405 15.523  -11.308 1.00 32.29  ? 481  VAL A HG21 1 
ATOM   6070  H  HG22 . VAL A 1 402 ? -48.946 14.641  -10.103 1.00 32.29  ? 481  VAL A HG22 1 
ATOM   6071  H  HG23 . VAL A 1 402 ? -47.389 14.926  -10.242 1.00 32.29  ? 481  VAL A HG23 1 
ATOM   6072  N  N    . ASP A 1 403 ? -47.095 10.618  -12.322 1.00 31.42  ? 482  ASP A N    1 
ATOM   6073  C  CA   . ASP A 1 403 ? -47.261 9.404   -13.115 1.00 31.09  ? 482  ASP A CA   1 
ATOM   6074  C  C    . ASP A 1 403 ? -47.377 8.162   -12.233 1.00 31.49  ? 482  ASP A C    1 
ATOM   6075  O  O    . ASP A 1 403 ? -48.100 7.223   -12.560 1.00 31.59  ? 482  ASP A O    1 
ATOM   6076  C  CB   . ASP A 1 403 ? -46.095 9.224   -14.086 1.00 30.11  ? 482  ASP A CB   1 
ATOM   6077  C  CG   . ASP A 1 403 ? -46.143 7.886   -14.805 1.00 32.48  ? 482  ASP A CG   1 
ATOM   6078  O  OD1  . ASP A 1 403 ? -47.202 7.558   -15.388 1.00 32.06  ? 482  ASP A OD1  1 
ATOM   6079  O  OD2  . ASP A 1 403 ? -45.131 7.154   -14.773 1.00 26.82  ? 482  ASP A OD2  1 
ATOM   6080  H  H    . ASP A 1 403 ? -46.367 11.048  -12.482 1.00 37.70  ? 482  ASP A H    1 
ATOM   6081  H  HA   . ASP A 1 403 ? -48.076 9.477   -13.636 1.00 37.31  ? 482  ASP A HA   1 
ATOM   6082  H  HB2  . ASP A 1 403 ? -46.127 9.927   -14.753 1.00 36.13  ? 482  ASP A HB2  1 
ATOM   6083  H  HB3  . ASP A 1 403 ? -45.261 9.271   -13.592 1.00 36.13  ? 482  ASP A HB3  1 
ATOM   6084  N  N    . SER A 1 404 ? -46.662 8.167   -11.116 1.00 37.37  ? 483  SER A N    1 
ATOM   6085  C  CA   . SER A 1 404 ? -46.668 7.042   -10.191 1.00 36.85  ? 483  SER A CA   1 
ATOM   6086  C  C    . SER A 1 404 ? -48.021 6.895   -9.513  1.00 43.06  ? 483  SER A C    1 
ATOM   6087  O  O    . SER A 1 404 ? -48.415 5.799   -9.111  1.00 44.66  ? 483  SER A O    1 
ATOM   6088  C  CB   . SER A 1 404 ? -45.602 7.259   -9.127  1.00 36.76  ? 483  SER A CB   1 
ATOM   6089  O  OG   . SER A 1 404 ? -44.352 7.542   -9.724  1.00 41.76  ? 483  SER A OG   1 
ATOM   6090  H  H    . SER A 1 404 ? -46.158 8.818   -10.867 1.00 44.85  ? 483  SER A H    1 
ATOM   6091  H  HA   . SER A 1 404 ? -46.468 6.223   -10.670 1.00 44.22  ? 483  SER A HA   1 
ATOM   6092  H  HB2  . SER A 1 404 ? -45.862 8.007   -8.566  1.00 44.11  ? 483  SER A HB2  1 
ATOM   6093  H  HB3  . SER A 1 404 ? -45.522 6.454   -8.591  1.00 44.11  ? 483  SER A HB3  1 
ATOM   6094  H  HG   . SER A 1 404 ? -43.770 7.661   -9.129  1.00 50.11  ? 483  SER A HG   1 
HETATM 6095  N  N    . MSE A 1 405 ? -48.722 8.015   -9.381  1.00 48.33  ? 484  MSE A N    1 
HETATM 6096  C  CA   . MSE A 1 405 ? -50.006 8.046   -8.700  1.00 48.71  ? 484  MSE A CA   1 
HETATM 6097  C  C    . MSE A 1 405 ? -51.151 7.871   -9.688  1.00 53.08  ? 484  MSE A C    1 
HETATM 6098  O  O    . MSE A 1 405 ? -52.311 7.737   -9.293  1.00 49.26  ? 484  MSE A O    1 
HETATM 6099  C  CB   . MSE A 1 405 ? -50.171 9.383   -7.983  1.00 51.36  ? 484  MSE A CB   1 
HETATM 6100  C  CG   . MSE A 1 405 ? -49.145 9.636   -6.900  1.00 47.68  ? 484  MSE A CG   1 
HETATM 6101  SE SE   . MSE A 1 405 ? -49.323 8.387   -5.430  1.00 81.28  ? 484  MSE A SE   1 
HETATM 6102  C  CE   . MSE A 1 405 ? -49.809 9.658   -4.035  1.00 53.80  ? 484  MSE A CE   1 
HETATM 6103  H  H    . MSE A 1 405 ? -48.470 8.780   -9.682  1.00 57.99  ? 484  MSE A H    1 
HETATM 6104  H  HA   . MSE A 1 405 ? -50.039 7.337   -8.039  1.00 58.46  ? 484  MSE A HA   1 
HETATM 6105  H  HB2  . MSE A 1 405 ? -50.095 10.098  -8.634  1.00 61.63  ? 484  MSE A HB2  1 
HETATM 6106  H  HB3  . MSE A 1 405 ? -51.048 9.408   -7.569  1.00 61.63  ? 484  MSE A HB3  1 
HETATM 6107  H  HG2  . MSE A 1 405 ? -48.255 9.537   -7.274  1.00 57.21  ? 484  MSE A HG2  1 
HETATM 6108  H  HG3  . MSE A 1 405 ? -49.264 10.533  -6.551  1.00 57.21  ? 484  MSE A HG3  1 
HETATM 6109  H  HE1  . MSE A 1 405 ? -49.940 9.178   -3.202  1.00 64.56  ? 484  MSE A HE1  1 
HETATM 6110  H  HE2  . MSE A 1 405 ? -49.094 10.306  -3.935  1.00 64.56  ? 484  MSE A HE2  1 
HETATM 6111  H  HE3  . MSE A 1 405 ? -50.630 10.107  -4.290  1.00 64.56  ? 484  MSE A HE3  1 
ATOM   6112  N  N    . TRP A 1 406 ? -50.814 7.868   -10.973 1.00 38.19  ? 485  TRP A N    1 
ATOM   6113  C  CA   . TRP A 1 406 ? -51.811 7.901   -12.033 1.00 34.05  ? 485  TRP A CA   1 
ATOM   6114  C  C    . TRP A 1 406 ? -52.787 6.733   -11.984 1.00 38.59  ? 485  TRP A C    1 
ATOM   6115  O  O    . TRP A 1 406 ? -53.976 6.906   -12.232 1.00 46.96  ? 485  TRP A O    1 
ATOM   6116  C  CB   . TRP A 1 406 ? -51.117 7.912   -13.387 1.00 40.19  ? 485  TRP A CB   1 
ATOM   6117  C  CG   . TRP A 1 406 ? -51.974 8.420   -14.491 1.00 42.99  ? 485  TRP A CG   1 
ATOM   6118  C  CD1  . TRP A 1 406 ? -52.464 7.708   -15.546 1.00 44.43  ? 485  TRP A CD1  1 
ATOM   6119  C  CD2  . TRP A 1 406 ? -52.449 9.760   -14.654 1.00 40.87  ? 485  TRP A CD2  1 
ATOM   6120  N  NE1  . TRP A 1 406 ? -53.210 8.526   -16.361 1.00 45.72  ? 485  TRP A NE1  1 
ATOM   6121  C  CE2  . TRP A 1 406 ? -53.218 9.786   -15.834 1.00 44.70  ? 485  TRP A CE2  1 
ATOM   6122  C  CE3  . TRP A 1 406 ? -52.297 10.935  -13.917 1.00 38.24  ? 485  TRP A CE3  1 
ATOM   6123  C  CZ2  . TRP A 1 406 ? -53.828 10.952  -16.294 1.00 51.95  ? 485  TRP A CZ2  1 
ATOM   6124  C  CZ3  . TRP A 1 406 ? -52.907 12.087  -14.375 1.00 40.93  ? 485  TRP A CZ3  1 
ATOM   6125  C  CH2  . TRP A 1 406 ? -53.662 12.088  -15.551 1.00 48.53  ? 485  TRP A CH2  1 
ATOM   6126  H  H    . TRP A 1 406 ? -50.004 7.848   -11.260 1.00 45.83  ? 485  TRP A H    1 
ATOM   6127  H  HA   . TRP A 1 406 ? -52.325 8.720   -11.954 1.00 40.86  ? 485  TRP A HA   1 
ATOM   6128  H  HB2  . TRP A 1 406 ? -50.334 8.482   -13.333 1.00 48.23  ? 485  TRP A HB2  1 
ATOM   6129  H  HB3  . TRP A 1 406 ? -50.851 7.007   -13.610 1.00 48.23  ? 485  TRP A HB3  1 
ATOM   6130  H  HD1  . TRP A 1 406 ? -52.309 6.803   -15.696 1.00 53.32  ? 485  TRP A HD1  1 
ATOM   6131  H  HE1  . TRP A 1 406 ? -53.610 8.283   -17.083 1.00 54.86  ? 485  TRP A HE1  1 
ATOM   6132  H  HE3  . TRP A 1 406 ? -51.792 10.944  -13.136 1.00 45.89  ? 485  TRP A HE3  1 
ATOM   6133  H  HZ2  . TRP A 1 406 ? -54.336 10.956  -17.073 1.00 62.34  ? 485  TRP A HZ2  1 
ATOM   6134  H  HZ3  . TRP A 1 406 ? -52.811 12.877  -13.893 1.00 49.12  ? 485  TRP A HZ3  1 
ATOM   6135  H  HH2  . TRP A 1 406 ? -54.063 12.878  -15.834 1.00 58.23  ? 485  TRP A HH2  1 
ATOM   6136  N  N    . ASP A 1 407 ? -52.285 5.543   -11.686 1.00 74.02  ? 486  ASP A N    1 
ATOM   6137  C  CA   . ASP A 1 407 ? -53.129 4.355   -11.689 1.00 75.42  ? 486  ASP A CA   1 
ATOM   6138  C  C    . ASP A 1 407 ? -54.155 4.315   -10.551 1.00 70.89  ? 486  ASP A C    1 
ATOM   6139  O  O    . ASP A 1 407 ? -55.286 3.877   -10.758 1.00 77.95  ? 486  ASP A O    1 
ATOM   6140  C  CB   . ASP A 1 407 ? -52.260 3.095   -11.643 1.00 81.87  ? 486  ASP A CB   1 
ATOM   6141  C  CG   . ASP A 1 407 ? -51.627 2.766   -12.990 1.00 80.94  ? 486  ASP A CG   1 
ATOM   6142  O  OD1  . ASP A 1 407 ? -52.154 3.218   -14.034 1.00 83.09  ? 486  ASP A OD1  1 
ATOM   6143  O  OD2  . ASP A 1 407 ? -50.605 2.040   -13.001 1.00 72.27  ? 486  ASP A OD2  1 
ATOM   6144  H  H    . ASP A 1 407 ? -51.463 5.395   -11.480 1.00 88.82  ? 486  ASP A H    1 
ATOM   6145  H  HA   . ASP A 1 407 ? -53.624 4.335   -12.523 1.00 90.50  ? 486  ASP A HA   1 
ATOM   6146  H  HB2  . ASP A 1 407 ? -51.546 3.226   -11.000 1.00 98.25  ? 486  ASP A HB2  1 
ATOM   6147  H  HB3  . ASP A 1 407 ? -52.811 2.341   -11.379 1.00 98.25  ? 486  ASP A HB3  1 
ATOM   6148  N  N    . CYS A 1 408 ? -53.769 4.774   -9.362  1.00 51.43  ? 487  CYS A N    1 
ATOM   6149  C  CA   . CYS A 1 408 ? -54.602 4.599   -8.171  1.00 54.32  ? 487  CYS A CA   1 
ATOM   6150  C  C    . CYS A 1 408 ? -55.383 5.841   -7.723  1.00 55.96  ? 487  CYS A C    1 
ATOM   6151  O  O    . CYS A 1 408 ? -56.523 5.719   -7.270  1.00 66.56  ? 487  CYS A O    1 
ATOM   6152  C  CB   . CYS A 1 408 ? -53.757 4.060   -7.010  1.00 55.91  ? 487  CYS A CB   1 
ATOM   6153  S  SG   . CYS A 1 408 ? -52.085 4.739   -6.883  1.00 57.87  ? 487  CYS A SG   1 
ATOM   6154  H  H    . CYS A 1 408 ? -53.030 5.191   -9.217  1.00 61.72  ? 487  CYS A H    1 
ATOM   6155  H  HA   . CYS A 1 408 ? -55.262 3.918   -8.375  1.00 65.19  ? 487  CYS A HA   1 
ATOM   6156  H  HB2  . CYS A 1 408 ? -54.216 4.258   -6.179  1.00 67.09  ? 487  CYS A HB2  1 
ATOM   6157  H  HB3  . CYS A 1 408 ? -53.674 3.099   -7.112  1.00 67.09  ? 487  CYS A HB3  1 
ATOM   6158  H  HG   . CYS A 1 408 ? -52.156 5.928   -6.733  1.00 69.44  ? 487  CYS A HG   1 
ATOM   6159  N  N    . ALA A 1 409 ? -54.777 7.019   -7.834  1.00 33.27  ? 488  ALA A N    1 
ATOM   6160  C  CA   . ALA A 1 409 ? -55.435 8.263   -7.427  1.00 32.91  ? 488  ALA A CA   1 
ATOM   6161  C  C    . ALA A 1 409 ? -55.932 9.049   -8.638  1.00 31.14  ? 488  ALA A C    1 
ATOM   6162  O  O    . ALA A 1 409 ? -55.929 10.281  -8.629  1.00 27.00  ? 488  ALA A O    1 
ATOM   6163  C  CB   . ALA A 1 409 ? -54.484 9.117   -6.603  1.00 23.34  ? 488  ALA A CB   1 
ATOM   6164  H  H    . ALA A 1 409 ? -53.982 7.128   -8.142  1.00 39.92  ? 488  ALA A H    1 
ATOM   6165  H  HA   . ALA A 1 409 ? -56.201 8.048   -6.874  1.00 39.50  ? 488  ALA A HA   1 
ATOM   6166  H  HB1  . ALA A 1 409 ? -54.938 9.935   -6.345  1.00 28.01  ? 488  ALA A HB1  1 
ATOM   6167  H  HB2  . ALA A 1 409 ? -54.219 8.621   -5.813  1.00 28.01  ? 488  ALA A HB2  1 
ATOM   6168  H  HB3  . ALA A 1 409 ? -53.704 9.327   -7.139  1.00 28.01  ? 488  ALA A HB3  1 
ATOM   6169  N  N    . THR A 1 410 ? -56.360 8.334   -9.674  1.00 49.48  ? 489  THR A N    1 
ATOM   6170  C  CA   . THR A 1 410 ? -56.774 8.963   -10.927 1.00 52.52  ? 489  THR A CA   1 
ATOM   6171  C  C    . THR A 1 410 ? -57.904 9.974   -10.731 1.00 56.44  ? 489  THR A C    1 
ATOM   6172  O  O    . THR A 1 410 ? -58.022 10.938  -11.487 1.00 58.49  ? 489  THR A O    1 
ATOM   6173  C  CB   . THR A 1 410 ? -57.217 7.909   -11.968 1.00 56.64  ? 489  THR A CB   1 
ATOM   6174  O  OG1  . THR A 1 410 ? -57.127 8.466   -13.285 1.00 58.29  ? 489  THR A OG1  1 
ATOM   6175  C  CG2  . THR A 1 410 ? -58.649 7.424   -11.711 1.00 63.95  ? 489  THR A CG2  1 
ATOM   6176  H  H    . THR A 1 410 ? -56.421 7.476   -9.678  1.00 59.37  ? 489  THR A H    1 
ATOM   6177  H  HA   . THR A 1 410 ? -56.016 9.440   -11.297 1.00 63.02  ? 489  THR A HA   1 
ATOM   6178  H  HB   . THR A 1 410 ? -56.627 7.141   -11.910 1.00 67.97  ? 489  THR A HB   1 
ATOM   6179  H  HG1  . THR A 1 410 ? -57.625 9.140   -13.347 1.00 69.94  ? 489  THR A HG1  1 
ATOM   6180  H  HG21 . THR A 1 410 ? -58.900 6.765   -12.377 1.00 76.74  ? 489  THR A HG21 1 
ATOM   6181  H  HG22 . THR A 1 410 ? -58.709 7.022   -10.830 1.00 76.74  ? 489  THR A HG22 1 
ATOM   6182  H  HG23 . THR A 1 410 ? -59.265 8.172   -11.759 1.00 76.74  ? 489  THR A HG23 1 
ATOM   6183  N  N    . GLU A 1 411 ? -58.739 9.736   -9.727  1.00 77.76  ? 490  GLU A N    1 
ATOM   6184  C  CA   . GLU A 1 411 ? -59.849 10.634  -9.418  1.00 77.36  ? 490  GLU A CA   1 
ATOM   6185  C  C    . GLU A 1 411 ? -59.375 11.919  -8.735  1.00 69.95  ? 490  GLU A C    1 
ATOM   6186  O  O    . GLU A 1 411 ? -59.878 13.003  -9.026  1.00 70.20  ? 490  GLU A O    1 
ATOM   6187  C  CB   . GLU A 1 411 ? -60.902 9.921   -8.556  1.00 76.89  ? 490  GLU A CB   1 
ATOM   6188  C  CG   . GLU A 1 411 ? -60.500 9.628   -7.104  1.00 83.25  ? 490  GLU A CG   1 
ATOM   6189  C  CD   . GLU A 1 411 ? -59.336 8.653   -6.980  1.00 86.39  ? 490  GLU A CD   1 
ATOM   6190  O  OE1  . GLU A 1 411 ? -59.182 7.787   -7.870  1.00 79.96  ? 490  GLU A OE1  1 
ATOM   6191  O  OE2  . GLU A 1 411 ? -58.580 8.752   -5.990  1.00 82.92  ? 490  GLU A OE2  1 
ATOM   6192  H  H    . GLU A 1 411 ? -58.686 9.056   -9.204  1.00 93.31  ? 490  GLU A H    1 
ATOM   6193  H  HA   . GLU A 1 411 ? -60.278 10.889  -10.250 1.00 92.83  ? 490  GLU A HA   1 
ATOM   6194  H  HB2  . GLU A 1 411 ? -61.699 10.473  -8.529  1.00 92.27  ? 490  GLU A HB2  1 
ATOM   6195  H  HB3  . GLU A 1 411 ? -61.113 9.071   -8.974  1.00 92.27  ? 490  GLU A HB3  1 
ATOM   6196  H  HG2  . GLU A 1 411 ? -60.238 10.460  -6.678  1.00 99.90  ? 490  GLU A HG2  1 
ATOM   6197  H  HG3  . GLU A 1 411 ? -61.260 9.245   -6.639  1.00 99.90  ? 490  GLU A HG3  1 
ATOM   6198  N  N    . LEU A 1 412 ? -58.411 11.791  -7.828  1.00 54.95  ? 491  LEU A N    1 
ATOM   6199  C  CA   . LEU A 1 412 ? -57.840 12.946  -7.138  1.00 54.05  ? 491  LEU A CA   1 
ATOM   6200  C  C    . LEU A 1 412 ? -57.055 13.828  -8.099  1.00 59.60  ? 491  LEU A C    1 
ATOM   6201  O  O    . LEU A 1 412 ? -57.028 15.049  -7.957  1.00 65.30  ? 491  LEU A O    1 
ATOM   6202  C  CB   . LEU A 1 412 ? -56.917 12.481  -6.005  1.00 50.94  ? 491  LEU A CB   1 
ATOM   6203  C  CG   . LEU A 1 412 ? -55.982 13.520  -5.372  1.00 49.22  ? 491  LEU A CG   1 
ATOM   6204  C  CD1  . LEU A 1 412 ? -56.780 14.631  -4.733  1.00 49.92  ? 491  LEU A CD1  1 
ATOM   6205  C  CD2  . LEU A 1 412 ? -55.071 12.876  -4.343  1.00 47.95  ? 491  LEU A CD2  1 
ATOM   6206  H  H    . LEU A 1 412 ? -58.067 11.039  -7.591  1.00 65.94  ? 491  LEU A H    1 
ATOM   6207  H  HA   . LEU A 1 412 ? -58.555 13.475  -6.752  1.00 64.86  ? 491  LEU A HA   1 
ATOM   6208  H  HB2  . LEU A 1 412 ? -57.473 12.129  -5.292  1.00 61.12  ? 491  LEU A HB2  1 
ATOM   6209  H  HB3  . LEU A 1 412 ? -56.356 11.769  -6.350  1.00 61.12  ? 491  LEU A HB3  1 
ATOM   6210  H  HG   . LEU A 1 412 ? -55.425 13.909  -6.064  1.00 59.06  ? 491  LEU A HG   1 
ATOM   6211  H  HD11 . LEU A 1 412 ? -56.168 15.273  -4.340  1.00 59.90  ? 491  LEU A HD11 1 
ATOM   6212  H  HD12 . LEU A 1 412 ? -57.321 15.062  -5.412  1.00 59.90  ? 491  LEU A HD12 1 
ATOM   6213  H  HD13 . LEU A 1 412 ? -57.350 14.254  -4.045  1.00 59.90  ? 491  LEU A HD13 1 
ATOM   6214  H  HD21 . LEU A 1 412 ? -54.495 13.556  -3.962  1.00 57.54  ? 491  LEU A HD21 1 
ATOM   6215  H  HD22 . LEU A 1 412 ? -55.616 12.476  -3.647  1.00 57.54  ? 491  LEU A HD22 1 
ATOM   6216  H  HD23 . LEU A 1 412 ? -54.536 12.194  -4.778  1.00 57.54  ? 491  LEU A HD23 1 
ATOM   6217  N  N    . LEU A 1 413 ? -56.403 13.200  -9.070  1.00 56.07  ? 492  LEU A N    1 
ATOM   6218  C  CA   . LEU A 1 413 ? -55.499 13.918  -9.960  1.00 51.41  ? 492  LEU A CA   1 
ATOM   6219  C  C    . LEU A 1 413 ? -56.216 14.622  -11.110 1.00 47.93  ? 492  LEU A C    1 
ATOM   6220  O  O    . LEU A 1 413 ? -55.666 15.550  -11.703 1.00 50.96  ? 492  LEU A O    1 
ATOM   6221  C  CB   . LEU A 1 413 ? -54.433 12.968  -10.510 1.00 45.04  ? 492  LEU A CB   1 
ATOM   6222  C  CG   . LEU A 1 413 ? -53.470 12.366  -9.479  1.00 40.48  ? 492  LEU A CG   1 
ATOM   6223  C  CD1  . LEU A 1 413 ? -52.495 11.419  -10.153 1.00 38.91  ? 492  LEU A CD1  1 
ATOM   6224  C  CD2  . LEU A 1 413 ? -52.712 13.440  -8.703  1.00 39.39  ? 492  LEU A CD2  1 
ATOM   6225  H  H    . LEU A 1 413 ? -56.466 12.358  -9.235  1.00 67.29  ? 492  LEU A H    1 
ATOM   6226  H  HA   . LEU A 1 413 ? -55.041 14.600  -9.444  1.00 61.69  ? 492  LEU A HA   1 
ATOM   6227  H  HB2  . LEU A 1 413 ? -54.881 12.230  -10.953 1.00 54.04  ? 492  LEU A HB2  1 
ATOM   6228  H  HB3  . LEU A 1 413 ? -53.897 13.454  -11.157 1.00 54.04  ? 492  LEU A HB3  1 
ATOM   6229  H  HG   . LEU A 1 413 ? -53.985 11.851  -8.839  1.00 48.58  ? 492  LEU A HG   1 
ATOM   6230  H  HD11 . LEU A 1 413 ? -51.898 11.051  -9.483  1.00 46.69  ? 492  LEU A HD11 1 
ATOM   6231  H  HD12 . LEU A 1 413 ? -52.994 10.704  -10.580 1.00 46.69  ? 492  LEU A HD12 1 
ATOM   6232  H  HD13 . LEU A 1 413 ? -51.986 11.909  -10.817 1.00 46.69  ? 492  LEU A HD13 1 
ATOM   6233  H  HD21 . LEU A 1 413 ? -52.119 13.009  -8.067  1.00 47.27  ? 492  LEU A HD21 1 
ATOM   6234  H  HD22 . LEU A 1 413 ? -52.196 13.975  -9.326  1.00 47.27  ? 492  LEU A HD22 1 
ATOM   6235  H  HD23 . LEU A 1 413 ? -53.350 14.000  -8.234  1.00 47.27  ? 492  LEU A HD23 1 
ATOM   6236  N  N    . LYS A 1 414 ? -57.434 14.189  -11.424 1.00 41.99  ? 493  LYS A N    1 
ATOM   6237  C  CA   . LYS A 1 414 ? -58.203 14.812  -12.496 1.00 44.98  ? 493  LYS A CA   1 
ATOM   6238  C  C    . LYS A 1 414 ? -59.203 15.822  -11.935 1.00 49.74  ? 493  LYS A C    1 
ATOM   6239  O  O    . LYS A 1 414 ? -60.070 16.321  -12.655 1.00 54.23  ? 493  LYS A O    1 
ATOM   6240  C  CB   . LYS A 1 414 ? -58.931 13.754  -13.326 1.00 41.91  ? 493  LYS A CB   1 
ATOM   6241  C  CG   . LYS A 1 414 ? -58.036 12.928  -14.228 1.00 40.51  ? 493  LYS A CG   1 
ATOM   6242  C  CD   . LYS A 1 414 ? -58.880 12.090  -15.159 1.00 44.29  ? 493  LYS A CD   1 
ATOM   6243  C  CE   . LYS A 1 414 ? -58.040 11.139  -15.980 1.00 49.76  ? 493  LYS A CE   1 
ATOM   6244  N  NZ   . LYS A 1 414 ? -58.897 10.280  -16.841 1.00 56.16  ? 493  LYS A NZ   1 
ATOM   6245  H  H    . LYS A 1 414 ? -57.836 13.537  -11.033 1.00 50.39  ? 493  LYS A H    1 
ATOM   6246  H  HA   . LYS A 1 414 ? -57.596 15.287  -13.084 1.00 53.98  ? 493  LYS A HA   1 
ATOM   6247  H  HB2  . LYS A 1 414 ? -59.381 13.143  -12.722 1.00 50.29  ? 493  LYS A HB2  1 
ATOM   6248  H  HB3  . LYS A 1 414 ? -59.585 14.198  -13.888 1.00 50.29  ? 493  LYS A HB3  1 
ATOM   6249  H  HG2  . LYS A 1 414 ? -57.478 13.516  -14.761 1.00 48.61  ? 493  LYS A HG2  1 
ATOM   6250  H  HG3  . LYS A 1 414 ? -57.488 12.335  -13.690 1.00 48.61  ? 493  LYS A HG3  1 
ATOM   6251  H  HD2  . LYS A 1 414 ? -59.507 11.566  -14.637 1.00 53.15  ? 493  LYS A HD2  1 
ATOM   6252  H  HD3  . LYS A 1 414 ? -59.359 12.674  -15.768 1.00 53.15  ? 493  LYS A HD3  1 
ATOM   6253  H  HE2  . LYS A 1 414 ? -57.445 11.648  -16.553 1.00 59.71  ? 493  LYS A HE2  1 
ATOM   6254  H  HE3  . LYS A 1 414 ? -57.530 10.566  -15.387 1.00 59.71  ? 493  LYS A HE3  1 
ATOM   6255  H  HZ1  . LYS A 1 414 ? -58.390 9.726   -17.318 1.00 67.39  ? 493  LYS A HZ1  1 
ATOM   6256  H  HZ2  . LYS A 1 414 ? -59.452 9.801   -16.335 1.00 67.39  ? 493  LYS A HZ2  1 
ATOM   6257  H  HZ3  . LYS A 1 414 ? -59.375 10.786  -17.396 1.00 67.39  ? 493  LYS A HZ3  1 
ATOM   6258  N  N    . ASP A 1 415 ? -59.069 16.130  -10.648 1.00 43.48  ? 494  ASP A N    1 
ATOM   6259  C  CA   . ASP A 1 415 ? -59.976 17.061  -9.984  1.00 46.37  ? 494  ASP A CA   1 
ATOM   6260  C  C    . ASP A 1 415 ? -59.498 18.501  -10.205 1.00 45.12  ? 494  ASP A C    1 
ATOM   6261  O  O    . ASP A 1 415 ? -59.076 19.183  -9.270  1.00 43.73  ? 494  ASP A O    1 
ATOM   6262  C  CB   . ASP A 1 415 ? -60.070 16.731  -8.489  1.00 54.15  ? 494  ASP A CB   1 
ATOM   6263  C  CG   . ASP A 1 415 ? -61.320 17.298  -7.839  1.00 61.23  ? 494  ASP A CG   1 
ATOM   6264  O  OD1  . ASP A 1 415 ? -61.933 18.224  -8.415  1.00 62.39  ? 494  ASP A OD1  1 
ATOM   6265  O  OD2  . ASP A 1 415 ? -61.686 16.813  -6.746  1.00 65.61  ? 494  ASP A OD2  1 
ATOM   6266  H  H    . ASP A 1 415 ? -58.458 15.811  -10.134 1.00 52.17  ? 494  ASP A H    1 
ATOM   6267  H  HA   . ASP A 1 415 ? -60.861 16.974  -10.370 1.00 55.64  ? 494  ASP A HA   1 
ATOM   6268  H  HB2  . ASP A 1 415 ? -60.086 15.767  -8.380  1.00 64.99  ? 494  ASP A HB2  1 
ATOM   6269  H  HB3  . ASP A 1 415 ? -59.299 17.104  -8.034  1.00 64.99  ? 494  ASP A HB3  1 
ATOM   6270  N  N    . TRP A 1 416 ? -59.585 18.963  -11.450 1.00 59.25  ? 495  TRP A N    1 
ATOM   6271  C  CA   . TRP A 1 416 ? -59.009 20.250  -11.831 1.00 56.20  ? 495  TRP A CA   1 
ATOM   6272  C  C    . TRP A 1 416 ? -59.833 21.411  -11.282 1.00 55.82  ? 495  TRP A C    1 
ATOM   6273  O  O    . TRP A 1 416 ? -59.280 22.452  -10.925 1.00 47.83  ? 495  TRP A O    1 
ATOM   6274  C  CB   . TRP A 1 416 ? -58.855 20.346  -13.357 1.00 52.85  ? 495  TRP A CB   1 
ATOM   6275  C  CG   . TRP A 1 416 ? -57.959 19.274  -13.917 1.00 51.42  ? 495  TRP A CG   1 
ATOM   6276  C  CD1  . TRP A 1 416 ? -56.644 19.068  -13.616 1.00 50.64  ? 495  TRP A CD1  1 
ATOM   6277  C  CD2  . TRP A 1 416 ? -58.313 18.266  -14.868 1.00 48.04  ? 495  TRP A CD2  1 
ATOM   6278  N  NE1  . TRP A 1 416 ? -56.158 17.991  -14.315 1.00 45.51  ? 495  TRP A NE1  1 
ATOM   6279  C  CE2  . TRP A 1 416 ? -57.167 17.480  -15.098 1.00 47.80  ? 495  TRP A CE2  1 
ATOM   6280  C  CE3  . TRP A 1 416 ? -59.490 17.946  -15.553 1.00 55.88  ? 495  TRP A CE3  1 
ATOM   6281  C  CZ2  . TRP A 1 416 ? -57.158 16.400  -15.974 1.00 46.93  ? 495  TRP A CZ2  1 
ATOM   6282  C  CZ3  . TRP A 1 416 ? -59.481 16.875  -16.428 1.00 56.62  ? 495  TRP A CZ3  1 
ATOM   6283  C  CH2  . TRP A 1 416 ? -58.326 16.113  -16.627 1.00 49.19  ? 495  TRP A CH2  1 
ATOM   6284  H  H    . TRP A 1 416 ? -59.973 18.548  -12.095 1.00 71.10  ? 495  TRP A H    1 
ATOM   6285  H  HA   . TRP A 1 416 ? -58.122 20.316  -11.445 1.00 67.44  ? 495  TRP A HA   1 
ATOM   6286  H  HB2  . TRP A 1 416 ? -59.727 20.253  -13.770 1.00 63.41  ? 495  TRP A HB2  1 
ATOM   6287  H  HB3  . TRP A 1 416 ? -58.470 21.207  -13.583 1.00 63.41  ? 495  TRP A HB3  1 
ATOM   6288  H  HD1  . TRP A 1 416 ? -56.149 19.579  -13.016 1.00 60.77  ? 495  TRP A HD1  1 
ATOM   6289  H  HE1  . TRP A 1 416 ? -55.354 17.689  -14.274 1.00 54.61  ? 495  TRP A HE1  1 
ATOM   6290  H  HE3  . TRP A 1 416 ? -60.264 18.445  -15.423 1.00 67.05  ? 495  TRP A HE3  1 
ATOM   6291  H  HZ2  . TRP A 1 416 ? -56.390 15.895  -16.112 1.00 56.32  ? 495  TRP A HZ2  1 
ATOM   6292  H  HZ3  . TRP A 1 416 ? -60.260 16.653  -16.886 1.00 67.95  ? 495  TRP A HZ3  1 
ATOM   6293  H  HH2  . TRP A 1 416 ? -58.350 15.399  -17.223 1.00 59.03  ? 495  TRP A HH2  1 
ATOM   6294  N  N    . GLU A 1 417 ? -61.148 21.220  -11.205 1.00 64.94  ? 496  GLU A N    1 
ATOM   6295  C  CA   . GLU A 1 417 ? -62.043 22.205  -10.603 1.00 65.69  ? 496  GLU A CA   1 
ATOM   6296  C  C    . GLU A 1 417 ? -61.606 22.496  -9.174  1.00 62.74  ? 496  GLU A C    1 
ATOM   6297  O  O    . GLU A 1 417 ? -61.544 23.652  -8.753  1.00 64.96  ? 496  GLU A O    1 
ATOM   6298  C  CB   . GLU A 1 417 ? -63.481 21.683  -10.595 1.00 71.88  ? 496  GLU A CB   1 
ATOM   6299  C  CG   . GLU A 1 417 ? -64.120 21.590  -11.977 1.00 82.52  ? 496  GLU A CG   1 
ATOM   6300  C  CD   . GLU A 1 417 ? -65.227 20.546  -12.061 1.00 97.22  ? 496  GLU A CD   1 
ATOM   6301  O  OE1  . GLU A 1 417 ? -65.670 20.040  -11.006 1.00 101.58 ? 496  GLU A OE1  1 
ATOM   6302  O  OE2  . GLU A 1 417 ? -65.654 20.230  -13.193 1.00 97.28  ? 496  GLU A OE2  1 
ATOM   6303  H  H    . GLU A 1 417 ? -61.552 20.520  -11.499 1.00 77.92  ? 496  GLU A H    1 
ATOM   6304  H  HA   . GLU A 1 417 ? -62.013 23.030  -11.112 1.00 78.83  ? 496  GLU A HA   1 
ATOM   6305  H  HB2  . GLU A 1 417 ? -63.487 20.794  -10.206 1.00 86.26  ? 496  GLU A HB2  1 
ATOM   6306  H  HB3  . GLU A 1 417 ? -64.025 22.279  -10.057 1.00 86.26  ? 496  GLU A HB3  1 
ATOM   6307  H  HG2  . GLU A 1 417 ? -64.504 22.451  -12.204 1.00 99.03  ? 496  GLU A HG2  1 
ATOM   6308  H  HG3  . GLU A 1 417 ? -63.437 21.352  -12.623 1.00 99.03  ? 496  GLU A HG3  1 
ATOM   6309  N  N    . CYS A 1 418 ? -61.293 21.433  -8.439  1.00 50.14  ? 497  CYS A N    1 
ATOM   6310  C  CA   . CYS A 1 418 ? -60.848 21.552  -7.056  1.00 49.99  ? 497  CYS A CA   1 
ATOM   6311  C  C    . CYS A 1 418 ? -59.500 22.260  -6.971  1.00 48.47  ? 497  CYS A C    1 
ATOM   6312  O  O    . CYS A 1 418 ? -59.344 23.226  -6.226  1.00 43.90  ? 497  CYS A O    1 
ATOM   6313  C  CB   . CYS A 1 418 ? -60.748 20.170  -6.409  1.00 45.97  ? 497  CYS A CB   1 
ATOM   6314  S  SG   . CYS A 1 418 ? -59.930 20.162  -4.799  1.00 55.82  ? 497  CYS A SG   1 
ATOM   6315  H  H    . CYS A 1 418 ? -61.331 20.622  -8.723  1.00 60.17  ? 497  CYS A H    1 
ATOM   6316  H  HA   . CYS A 1 418 ? -61.496 22.074  -6.557  1.00 59.99  ? 497  CYS A HA   1 
ATOM   6317  H  HB2  . CYS A 1 418 ? -61.644 19.819  -6.286  1.00 55.17  ? 497  CYS A HB2  1 
ATOM   6318  H  HB3  . CYS A 1 418 ? -60.245 19.587  -6.998  1.00 55.17  ? 497  CYS A HB3  1 
ATOM   6319  H  HG   . CYS A 1 418 ? -59.903 19.038  -4.380  1.00 66.99  ? 497  CYS A HG   1 
HETATM 6320  N  N    . MSE A 1 419 ? -58.530 21.781  -7.741  1.00 67.14  ? 498  MSE A N    1 
HETATM 6321  C  CA   . MSE A 1 419 ? -57.190 22.354  -7.717  1.00 68.06  ? 498  MSE A CA   1 
HETATM 6322  C  C    . MSE A 1 419 ? -57.222 23.819  -8.125  1.00 67.23  ? 498  MSE A C    1 
HETATM 6323  O  O    . MSE A 1 419 ? -56.505 24.646  -7.565  1.00 69.49  ? 498  MSE A O    1 
HETATM 6324  C  CB   . MSE A 1 419 ? -56.258 21.570  -8.642  1.00 71.97  ? 498  MSE A CB   1 
HETATM 6325  C  CG   . MSE A 1 419 ? -55.691 20.302  -8.019  1.00 73.53  ? 498  MSE A CG   1 
HETATM 6326  SE SE   . MSE A 1 419 ? -54.469 19.357  -9.209  1.00 87.14  ? 498  MSE A SE   1 
HETATM 6327  C  CE   . MSE A 1 419 ? -55.725 18.891  -10.613 1.00 49.85  ? 498  MSE A CE   1 
HETATM 6328  H  H    . MSE A 1 419 ? -58.621 21.123  -8.288  1.00 80.57  ? 498  MSE A H    1 
HETATM 6329  H  HA   . MSE A 1 419 ? -56.838 22.288  -6.815  1.00 81.68  ? 498  MSE A HA   1 
HETATM 6330  H  HB2  . MSE A 1 419 ? -56.750 21.314  -9.437  1.00 86.37  ? 498  MSE A HB2  1 
HETATM 6331  H  HB3  . MSE A 1 419 ? -55.511 22.139  -8.887  1.00 86.37  ? 498  MSE A HB3  1 
HETATM 6332  H  HG2  . MSE A 1 419 ? -55.204 20.537  -7.213  1.00 88.24  ? 498  MSE A HG2  1 
HETATM 6333  H  HG3  . MSE A 1 419 ? -56.422 19.703  -7.802  1.00 88.24  ? 498  MSE A HG3  1 
HETATM 6334  H  HE1  . MSE A 1 419 ? -55.256 18.400  -11.305 1.00 59.81  ? 498  MSE A HE1  1 
HETATM 6335  H  HE2  . MSE A 1 419 ? -56.430 18.342  -10.236 1.00 59.81  ? 498  MSE A HE2  1 
HETATM 6336  H  HE3  . MSE A 1 419 ? -56.102 19.705  -10.982 1.00 59.81  ? 498  MSE A HE3  1 
ATOM   6337  N  N    . ASN A 1 420 ? -58.065 24.136  -9.101  1.00 49.09  ? 499  ASN A N    1 
ATOM   6338  C  CA   . ASN A 1 420 ? -58.199 25.508  -9.576  1.00 58.11  ? 499  ASN A CA   1 
ATOM   6339  C  C    . ASN A 1 420 ? -58.769 26.438  -8.504  1.00 60.96  ? 499  ASN A C    1 
ATOM   6340  O  O    . ASN A 1 420 ? -58.467 27.633  -8.481  1.00 57.95  ? 499  ASN A O    1 
ATOM   6341  C  CB   . ASN A 1 420 ? -59.074 25.553  -10.832 1.00 58.47  ? 499  ASN A CB   1 
ATOM   6342  C  CG   . ASN A 1 420 ? -59.282 26.963  -11.350 1.00 61.23  ? 499  ASN A CG   1 
ATOM   6343  O  OD1  . ASN A 1 420 ? -60.406 27.363  -11.657 1.00 73.15  ? 499  ASN A OD1  1 
ATOM   6344  N  ND2  . ASN A 1 420 ? -58.198 27.728  -11.442 1.00 54.10  ? 499  ASN A ND2  1 
ATOM   6345  H  H    . ASN A 1 420 ? -58.573 23.573  -9.506  1.00 58.91  ? 499  ASN A H    1 
ATOM   6346  H  HA   . ASN A 1 420 ? -57.320 25.841  -9.817  1.00 69.73  ? 499  ASN A HA   1 
ATOM   6347  H  HB2  . ASN A 1 420 ? -58.647 25.036  -11.533 1.00 70.17  ? 499  ASN A HB2  1 
ATOM   6348  H  HB3  . ASN A 1 420 ? -59.944 25.177  -10.626 1.00 70.17  ? 499  ASN A HB3  1 
ATOM   6349  H  HD21 . ASN A 1 420 ? -58.266 28.536  -11.731 1.00 64.92  ? 499  ASN A HD21 1 
ATOM   6350  H  HD22 . ASN A 1 420 ? -57.430 27.416  -11.214 1.00 64.92  ? 499  ASN A HD22 1 
ATOM   6351  N  N    . SER A 1 421 ? -59.579 25.880  -7.608  1.00 65.83  ? 500  SER A N    1 
ATOM   6352  C  CA   . SER A 1 421 ? -60.226 26.667  -6.564  1.00 61.28  ? 500  SER A CA   1 
ATOM   6353  C  C    . SER A 1 421 ? -59.233 27.110  -5.496  1.00 62.03  ? 500  SER A C    1 
ATOM   6354  O  O    . SER A 1 421 ? -59.273 28.254  -5.046  1.00 73.09  ? 500  SER A O    1 
ATOM   6355  C  CB   . SER A 1 421 ? -61.357 25.863  -5.920  1.00 67.77  ? 500  SER A CB   1 
ATOM   6356  O  OG   . SER A 1 421 ? -62.304 25.455  -6.890  1.00 76.32  ? 500  SER A OG   1 
ATOM   6357  H  H    . SER A 1 421 ? -59.771 25.043  -7.584  1.00 79.00  ? 500  SER A H    1 
ATOM   6358  H  HA   . SER A 1 421 ? -60.613 27.462  -6.962  1.00 73.54  ? 500  SER A HA   1 
ATOM   6359  H  HB2  . SER A 1 421 ? -60.982 25.076  -5.494  1.00 81.32  ? 500  SER A HB2  1 
ATOM   6360  H  HB3  . SER A 1 421 ? -61.802 26.417  -5.259  1.00 81.32  ? 500  SER A HB3  1 
ATOM   6361  H  HG   . SER A 1 421 ? -62.637 26.127  -7.268  1.00 91.59  ? 500  SER A HG   1 
ATOM   6362  N  N    . LEU A 1 422 ? -58.347 26.205  -5.091  1.00 53.84  ? 501  LEU A N    1 
ATOM   6363  C  CA   . LEU A 1 422 ? -57.390 26.499  -4.025  1.00 50.72  ? 501  LEU A CA   1 
ATOM   6364  C  C    . LEU A 1 422 ? -56.447 27.649  -4.380  1.00 50.86  ? 501  LEU A C    1 
ATOM   6365  O  O    . LEU A 1 422 ? -55.969 28.361  -3.495  1.00 51.99  ? 501  LEU A O    1 
ATOM   6366  C  CB   . LEU A 1 422 ? -56.555 25.265  -3.686  1.00 48.27  ? 501  LEU A CB   1 
ATOM   6367  C  CG   . LEU A 1 422 ? -57.178 24.218  -2.767  1.00 44.91  ? 501  LEU A CG   1 
ATOM   6368  C  CD1  . LEU A 1 422 ? -58.231 23.417  -3.498  1.00 50.04  ? 501  LEU A CD1  1 
ATOM   6369  C  CD2  . LEU A 1 422 ? -56.089 23.306  -2.226  1.00 48.79  ? 501  LEU A CD2  1 
ATOM   6370  H  H    . LEU A 1 422 ? -58.278 25.412  -5.416  1.00 64.61  ? 501  LEU A H    1 
ATOM   6371  H  HA   . LEU A 1 422 ? -57.880 26.754  -3.228  1.00 60.86  ? 501  LEU A HA   1 
ATOM   6372  H  HB2  . LEU A 1 422 ? -56.333 24.817  -4.516  1.00 57.93  ? 501  LEU A HB2  1 
ATOM   6373  H  HB3  . LEU A 1 422 ? -55.737 25.566  -3.259  1.00 57.93  ? 501  LEU A HB3  1 
ATOM   6374  H  HG   . LEU A 1 422 ? -57.601 24.663  -2.016  1.00 53.89  ? 501  LEU A HG   1 
ATOM   6375  H  HD11 . LEU A 1 422 ? -58.608 22.762  -2.890  1.00 60.05  ? 501  LEU A HD11 1 
ATOM   6376  H  HD12 . LEU A 1 422 ? -58.926 24.019  -3.808  1.00 60.05  ? 501  LEU A HD12 1 
ATOM   6377  H  HD13 . LEU A 1 422 ? -57.819 22.970  -4.253  1.00 60.05  ? 501  LEU A HD13 1 
ATOM   6378  H  HD21 . LEU A 1 422 ? -56.493 22.643  -1.643  1.00 58.55  ? 501  LEU A HD21 1 
ATOM   6379  H  HD22 . LEU A 1 422 ? -55.647 22.867  -2.970  1.00 58.55  ? 501  LEU A HD22 1 
ATOM   6380  H  HD23 . LEU A 1 422 ? -55.449 23.838  -1.729  1.00 58.55  ? 501  LEU A HD23 1 
ATOM   6381  N  N    . LEU A 1 423 ? -56.172 27.820  -5.670  1.00 49.27  ? 502  LEU A N    1 
ATOM   6382  C  CA   . LEU A 1 423 ? -55.236 28.841  -6.132  1.00 55.64  ? 502  LEU A CA   1 
ATOM   6383  C  C    . LEU A 1 423 ? -55.855 30.243  -6.163  1.00 67.15  ? 502  LEU A C    1 
ATOM   6384  O  O    . LEU A 1 423 ? -55.133 31.241  -6.218  1.00 67.00  ? 502  LEU A O    1 
ATOM   6385  C  CB   . LEU A 1 423 ? -54.718 28.477  -7.527  1.00 54.83  ? 502  LEU A CB   1 
ATOM   6386  C  CG   . LEU A 1 423 ? -53.834 27.231  -7.627  1.00 49.97  ? 502  LEU A CG   1 
ATOM   6387  C  CD1  . LEU A 1 423 ? -53.774 26.745  -9.071  1.00 51.02  ? 502  LEU A CD1  1 
ATOM   6388  C  CD2  . LEU A 1 423 ? -52.432 27.501  -7.085  1.00 43.16  ? 502  LEU A CD2  1 
ATOM   6389  H  H    . LEU A 1 423 ? -56.518 27.353  -6.303  1.00 59.13  ? 502  LEU A H    1 
ATOM   6390  H  HA   . LEU A 1 423 ? -54.476 28.865  -5.529  1.00 66.77  ? 502  LEU A HA   1 
ATOM   6391  H  HB2  . LEU A 1 423 ? -55.483 28.333  -8.106  1.00 65.80  ? 502  LEU A HB2  1 
ATOM   6392  H  HB3  . LEU A 1 423 ? -54.199 29.224  -7.863  1.00 65.80  ? 502  LEU A HB3  1 
ATOM   6393  H  HG   . LEU A 1 423 ? -54.228 26.524  -7.092  1.00 59.97  ? 502  LEU A HG   1 
ATOM   6394  H  HD11 . LEU A 1 423 ? -53.211 25.957  -9.115  1.00 61.22  ? 502  LEU A HD11 1 
ATOM   6395  H  HD12 . LEU A 1 423 ? -54.671 26.528  -9.369  1.00 61.22  ? 502  LEU A HD12 1 
ATOM   6396  H  HD13 . LEU A 1 423 ? -53.402 27.449  -9.625  1.00 61.22  ? 502  LEU A HD13 1 
ATOM   6397  H  HD21 . LEU A 1 423 ? -51.902 26.693  -7.163  1.00 51.79  ? 502  LEU A HD21 1 
ATOM   6398  H  HD22 . LEU A 1 423 ? -52.026 28.215  -7.602  1.00 51.79  ? 502  LEU A HD22 1 
ATOM   6399  H  HD23 . LEU A 1 423 ? -52.499 27.764  -6.153  1.00 51.79  ? 502  LEU A HD23 1 
ATOM   6400  N  N    . LEU A 1 424 ? -57.185 30.313  -6.112  1.00 66.63  ? 503  LEU A N    1 
ATOM   6401  C  CA   . LEU A 1 424 ? -57.900 31.574  -6.316  1.00 63.77  ? 503  LEU A CA   1 
ATOM   6402  C  C    . LEU A 1 424 ? -58.617 32.140  -5.082  1.00 69.16  ? 503  LEU A C    1 
ATOM   6403  O  O    . LEU A 1 424 ? -58.383 33.288  -4.706  1.00 72.68  ? 503  LEU A O    1 
ATOM   6404  C  CB   . LEU A 1 424 ? -58.924 31.409  -7.447  1.00 63.28  ? 503  LEU A CB   1 
ATOM   6405  C  CG   . LEU A 1 424 ? -58.376 31.098  -8.843  1.00 59.61  ? 503  LEU A CG   1 
ATOM   6406  C  CD1  . LEU A 1 424 ? -59.518 30.916  -9.828  1.00 56.59  ? 503  LEU A CD1  1 
ATOM   6407  C  CD2  . LEU A 1 424 ? -57.447 32.202  -9.314  1.00 56.65  ? 503  LEU A CD2  1 
ATOM   6408  H  H    . LEU A 1 424 ? -57.699 29.640  -5.960  1.00 79.96  ? 503  LEU A H    1 
ATOM   6409  H  HA   . LEU A 1 424 ? -57.258 32.241  -6.604  1.00 76.52  ? 503  LEU A HA   1 
ATOM   6410  H  HB2  . LEU A 1 424 ? -59.523 30.685  -7.208  1.00 75.93  ? 503  LEU A HB2  1 
ATOM   6411  H  HB3  . LEU A 1 424 ? -59.431 32.233  -7.517  1.00 75.93  ? 503  LEU A HB3  1 
ATOM   6412  H  HG   . LEU A 1 424 ? -57.870 30.271  -8.810  1.00 71.53  ? 503  LEU A HG   1 
ATOM   6413  H  HD11 . LEU A 1 424 ? -59.150 30.721  -10.704 1.00 67.91  ? 503  LEU A HD11 1 
ATOM   6414  H  HD12 . LEU A 1 424 ? -60.076 30.181  -9.532  1.00 67.91  ? 503  LEU A HD12 1 
ATOM   6415  H  HD13 . LEU A 1 424 ? -60.038 31.734  -9.863  1.00 67.91  ? 503  LEU A HD13 1 
ATOM   6416  H  HD21 . LEU A 1 424 ? -57.115 31.980  -10.198 1.00 67.98  ? 503  LEU A HD21 1 
ATOM   6417  H  HD22 . LEU A 1 424 ? -57.940 33.037  -9.345  1.00 67.98  ? 503  LEU A HD22 1 
ATOM   6418  H  HD23 . LEU A 1 424 ? -56.706 32.278  -8.691  1.00 67.98  ? 503  LEU A HD23 1 
ATOM   6419  N  N    . GLU A 1 425 ? -59.471 31.335  -4.452  1.00 94.64  ? 504  GLU A N    1 
ATOM   6420  C  CA   . GLU A 1 425 ? -60.580 31.871  -3.657  1.00 100.77 ? 504  GLU A CA   1 
ATOM   6421  C  C    . GLU A 1 425 ? -60.530 31.588  -2.146  1.00 106.56 ? 504  GLU A C    1 
ATOM   6422  O  O    . GLU A 1 425 ? -61.404 30.909  -1.605  1.00 109.37 ? 504  GLU A O    1 
ATOM   6423  C  CB   . GLU A 1 425 ? -61.913 31.395  -4.265  1.00 99.68  ? 504  GLU A CB   1 
ATOM   6424  C  CG   . GLU A 1 425 ? -61.881 29.982  -4.850  1.00 95.82  ? 504  GLU A CG   1 
ATOM   6425  C  CD   . GLU A 1 425 ? -63.173 29.596  -5.548  1.00 100.50 ? 504  GLU A CD   1 
ATOM   6426  O  OE1  . GLU A 1 425 ? -64.258 29.768  -4.952  1.00 102.84 ? 504  GLU A OE1  1 
ATOM   6427  O  OE2  . GLU A 1 425 ? -63.099 29.124  -6.703  1.00 100.49 ? 504  GLU A OE2  1 
ATOM   6428  H  H    . GLU A 1 425 ? -59.432 30.476  -4.468  1.00 113.56 ? 504  GLU A H    1 
ATOM   6429  H  HA   . GLU A 1 425 ? -60.563 32.836  -3.752  1.00 120.93 ? 504  GLU A HA   1 
ATOM   6430  H  HB2  . GLU A 1 425 ? -62.593 31.411  -3.573  1.00 119.62 ? 504  GLU A HB2  1 
ATOM   6431  H  HB3  . GLU A 1 425 ? -62.162 32.003  -4.979  1.00 119.62 ? 504  GLU A HB3  1 
ATOM   6432  H  HG2  . GLU A 1 425 ? -61.162 29.927  -5.499  1.00 114.98 ? 504  GLU A HG2  1 
ATOM   6433  H  HG3  . GLU A 1 425 ? -61.728 29.348  -4.132  1.00 114.98 ? 504  GLU A HG3  1 
ATOM   6434  N  N    . GLU A 1 426 ? -59.511 32.131  -1.481  1.00 91.42  ? 505  GLU A N    1 
ATOM   6435  C  CA   . GLU A 1 426 ? -59.465 32.208  -0.015  1.00 90.14  ? 505  GLU A CA   1 
ATOM   6436  C  C    . GLU A 1 426 ? -59.824 30.901  0.696   1.00 75.55  ? 505  GLU A C    1 
ATOM   6437  O  O    . GLU A 1 426 ? -59.570 30.742  1.891   1.00 57.69  ? 505  GLU A O    1 
ATOM   6438  C  CB   . GLU A 1 426 ? -60.394 33.325  0.461   1.00 98.14  ? 505  GLU A CB   1 
ATOM   6439  C  CG   . GLU A 1 426 ? -59.916 34.716  0.090   1.00 103.86 ? 505  GLU A CG   1 
ATOM   6440  C  CD   . GLU A 1 426 ? -60.931 35.783  0.441   1.00 112.01 ? 505  GLU A CD   1 
ATOM   6441  O  OE1  . GLU A 1 426 ? -62.027 35.424  0.922   1.00 114.20 ? 505  GLU A OE1  1 
ATOM   6442  O  OE2  . GLU A 1 426 ? -60.634 36.980  0.240   1.00 113.00 ? 505  GLU A OE2  1 
ATOM   6443  H  H    . GLU A 1 426 ? -58.819 32.470  -1.862  1.00 109.70 ? 505  GLU A H    1 
ATOM   6444  H  HA   . GLU A 1 426 ? -58.563 32.445  0.251   1.00 108.17 ? 505  GLU A HA   1 
ATOM   6445  H  HB2  . GLU A 1 426 ? -61.269 33.196  0.063   1.00 117.76 ? 505  GLU A HB2  1 
ATOM   6446  H  HB3  . GLU A 1 426 ? -60.462 33.284  1.428   1.00 117.76 ? 505  GLU A HB3  1 
ATOM   6447  H  HG2  . GLU A 1 426 ? -59.096 34.909  0.571   1.00 124.63 ? 505  GLU A HG2  1 
ATOM   6448  H  HG3  . GLU A 1 426 ? -59.757 34.752  -0.866  1.00 124.63 ? 505  GLU A HG3  1 
ATOM   6449  N  N    . LEU A 1 434 ? -51.792 27.646  0.284   1.00 70.73  ? 513  LEU A N    1 
ATOM   6450  C  CA   . LEU A 1 434 ? -51.869 28.938  0.956   1.00 74.96  ? 513  LEU A CA   1 
ATOM   6451  C  C    . LEU A 1 434 ? -50.574 29.732  0.798   1.00 73.24  ? 513  LEU A C    1 
ATOM   6452  O  O    . LEU A 1 434 ? -50.575 30.819  0.220   1.00 77.14  ? 513  LEU A O    1 
ATOM   6453  C  CB   . LEU A 1 434 ? -52.179 28.753  2.442   1.00 78.24  ? 513  LEU A CB   1 
ATOM   6454  C  CG   . LEU A 1 434 ? -53.595 29.100  2.913   1.00 78.71  ? 513  LEU A CG   1 
ATOM   6455  C  CD1  . LEU A 1 434 ? -53.737 28.792  4.395   1.00 79.86  ? 513  LEU A CD1  1 
ATOM   6456  C  CD2  . LEU A 1 434 ? -53.946 30.557  2.641   1.00 74.07  ? 513  LEU A CD2  1 
ATOM   6457  H  HA   . LEU A 1 434 ? -52.588 29.456  0.562   1.00 89.95  ? 513  LEU A HA   1 
ATOM   6458  H  HB2  . LEU A 1 434 ? -52.023 27.823  2.668   1.00 93.89  ? 513  LEU A HB2  1 
ATOM   6459  H  HB3  . LEU A 1 434 ? -51.567 29.310  2.948   1.00 93.89  ? 513  LEU A HB3  1 
ATOM   6460  H  HG   . LEU A 1 434 ? -54.230 28.546  2.432   1.00 94.46  ? 513  LEU A HG   1 
ATOM   6461  H  HD11 . LEU A 1 434 ? -54.637 29.016  4.679   1.00 95.83  ? 513  LEU A HD11 1 
ATOM   6462  H  HD12 . LEU A 1 434 ? -53.569 27.847  4.539   1.00 95.83  ? 513  LEU A HD12 1 
ATOM   6463  H  HD13 . LEU A 1 434 ? -53.092 29.322  4.890   1.00 95.83  ? 513  LEU A HD13 1 
ATOM   6464  H  HD21 . LEU A 1 434 ? -54.848 30.728  2.954   1.00 88.88  ? 513  LEU A HD21 1 
ATOM   6465  H  HD22 . LEU A 1 434 ? -53.318 31.126  3.113   1.00 88.88  ? 513  LEU A HD22 1 
ATOM   6466  H  HD23 . LEU A 1 434 ? -53.890 30.722  1.687   1.00 88.88  ? 513  LEU A HD23 1 
ATOM   6467  N  N    . THR A 1 435 ? -49.477 29.200  1.332   1.00 47.77  ? 514  THR A N    1 
ATOM   6468  C  CA   . THR A 1 435 ? -48.176 29.848  1.189   1.00 48.53  ? 514  THR A CA   1 
ATOM   6469  C  C    . THR A 1 435 ? -47.708 29.776  -0.261  1.00 53.41  ? 514  THR A C    1 
ATOM   6470  O  O    . THR A 1 435 ? -48.096 28.875  -1.003  1.00 57.64  ? 514  THR A O    1 
ATOM   6471  C  CB   . THR A 1 435 ? -47.111 29.212  2.102   1.00 54.17  ? 514  THR A CB   1 
ATOM   6472  O  OG1  . THR A 1 435 ? -46.858 27.867  1.685   1.00 56.69  ? 514  THR A OG1  1 
ATOM   6473  C  CG2  . THR A 1 435 ? -47.571 29.213  3.556   1.00 60.05  ? 514  THR A CG2  1 
ATOM   6474  H  H    . THR A 1 435 ? -49.459 28.468  1.782   1.00 57.33  ? 514  THR A H    1 
ATOM   6475  H  HA   . THR A 1 435 ? -48.259 30.783  1.432   1.00 58.24  ? 514  THR A HA   1 
ATOM   6476  H  HB   . THR A 1 435 ? -46.290 29.725  2.042   1.00 65.00  ? 514  THR A HB   1 
ATOM   6477  H  HG1  . THR A 1 435 ? -47.565 27.414  1.730   1.00 68.02  ? 514  THR A HG1  1 
ATOM   6478  H  HG21 . THR A 1 435 ? -46.892 28.810  4.119   1.00 72.06  ? 514  THR A HG21 1 
ATOM   6479  H  HG22 . THR A 1 435 ? -47.728 30.123  3.853   1.00 72.06  ? 514  THR A HG22 1 
ATOM   6480  H  HG23 . THR A 1 435 ? -48.394 28.707  3.643   1.00 72.06  ? 514  THR A HG23 1 
ATOM   6481  N  N    . ASP A 1 436 ? -46.874 30.729  -0.664  1.00 86.07  ? 515  ASP A N    1 
ATOM   6482  C  CA   . ASP A 1 436 ? -46.497 30.861  -2.068  1.00 87.64  ? 515  ASP A CA   1 
ATOM   6483  C  C    . ASP A 1 436 ? -45.566 29.743  -2.551  1.00 82.92  ? 515  ASP A C    1 
ATOM   6484  O  O    . ASP A 1 436 ? -45.422 29.537  -3.756  1.00 83.76  ? 515  ASP A O    1 
ATOM   6485  C  CB   . ASP A 1 436 ? -45.889 32.244  -2.338  1.00 92.74  ? 515  ASP A CB   1 
ATOM   6486  C  CG   . ASP A 1 436 ? -46.947 33.293  -2.653  1.00 99.77  ? 515  ASP A CG   1 
ATOM   6487  O  OD1  . ASP A 1 436 ? -47.360 33.388  -3.830  1.00 99.70  ? 515  ASP A OD1  1 
ATOM   6488  O  OD2  . ASP A 1 436 ? -47.363 34.024  -1.729  1.00 100.59 ? 515  ASP A OD2  1 
ATOM   6489  H  H    . ASP A 1 436 ? -46.512 31.312  -0.145  1.00 103.29 ? 515  ASP A H    1 
ATOM   6490  H  HA   . ASP A 1 436 ? -47.306 30.800  -2.599  1.00 105.17 ? 515  ASP A HA   1 
ATOM   6491  H  HB2  . ASP A 1 436 ? -45.401 32.535  -1.552  1.00 111.29 ? 515  ASP A HB2  1 
ATOM   6492  H  HB3  . ASP A 1 436 ? -45.289 32.183  -3.099  1.00 111.29 ? 515  ASP A HB3  1 
ATOM   6493  N  N    . ARG A 1 437 ? -44.949 29.015  -1.625  1.00 69.09  ? 516  ARG A N    1 
ATOM   6494  C  CA   . ARG A 1 437 ? -44.167 27.844  -2.008  1.00 60.71  ? 516  ARG A CA   1 
ATOM   6495  C  C    . ARG A 1 437 ? -45.124 26.706  -2.341  1.00 55.34  ? 516  ARG A C    1 
ATOM   6496  O  O    . ARG A 1 437 ? -44.856 25.885  -3.218  1.00 52.07  ? 516  ARG A O    1 
ATOM   6497  C  CB   . ARG A 1 437 ? -43.201 27.418  -0.900  1.00 49.42  ? 516  ARG A CB   1 
ATOM   6498  C  CG   . ARG A 1 437 ? -42.154 26.435  -1.395  1.00 60.84  ? 516  ARG A CG   1 
ATOM   6499  C  CD   . ARG A 1 437 ? -41.219 25.941  -0.304  1.00 72.31  ? 516  ARG A CD   1 
ATOM   6500  N  NE   . ARG A 1 437 ? -40.548 24.714  -0.726  1.00 78.32  ? 516  ARG A NE   1 
ATOM   6501  C  CZ   . ARG A 1 437 ? -39.626 24.073  -0.017  1.00 74.54  ? 516  ARG A CZ   1 
ATOM   6502  N  NH1  . ARG A 1 437 ? -39.245 24.540  1.165   1.00 68.66  ? 516  ARG A NH1  1 
ATOM   6503  N  NH2  . ARG A 1 437 ? -39.082 22.961  -0.495  1.00 71.32  ? 516  ARG A NH2  1 
ATOM   6504  H  H    . ARG A 1 437 ? -44.967 29.175  -0.780  1.00 82.91  ? 516  ARG A H    1 
ATOM   6505  H  HA   . ARG A 1 437 ? -43.649 28.050  -2.801  1.00 72.85  ? 516  ARG A HA   1 
ATOM   6506  H  HB2  . ARG A 1 437 ? -42.742 28.202  -0.561  1.00 59.30  ? 516  ARG A HB2  1 
ATOM   6507  H  HB3  . ARG A 1 437 ? -43.703 26.991  -0.188  1.00 59.30  ? 516  ARG A HB3  1 
ATOM   6508  H  HG2  . ARG A 1 437 ? -42.604 25.663  -1.772  1.00 73.01  ? 516  ARG A HG2  1 
ATOM   6509  H  HG3  . ARG A 1 437 ? -41.615 26.867  -2.075  1.00 73.01  ? 516  ARG A HG3  1 
ATOM   6510  H  HD2  . ARG A 1 437 ? -40.544 26.615  -0.127  1.00 86.77  ? 516  ARG A HD2  1 
ATOM   6511  H  HD3  . ARG A 1 437 ? -41.729 25.753  0.499   1.00 86.77  ? 516  ARG A HD3  1 
ATOM   6512  H  HE   . ARG A 1 437 ? -40.766 24.382  -1.489  1.00 93.99  ? 516  ARG A HE   1 
ATOM   6513  H  HH11 . ARG A 1 437 ? -39.598 25.260  1.477   1.00 82.39  ? 516  ARG A HH11 1 
ATOM   6514  H  HH12 . ARG A 1 437 ? -38.647 24.122  1.621   1.00 82.39  ? 516  ARG A HH12 1 
ATOM   6515  H  HH21 . ARG A 1 437 ? -39.327 22.657  -1.261  1.00 85.58  ? 516  ARG A HH21 1 
ATOM   6516  H  HH22 . ARG A 1 437 ? -38.483 22.544  -0.039  1.00 85.58  ? 516  ARG A HH22 1 
ATOM   6517  N  N    . GLN A 1 438 ? -46.252 26.674  -1.638  1.00 46.02  ? 517  GLN A N    1 
ATOM   6518  C  CA   . GLN A 1 438 ? -47.283 25.673  -1.876  1.00 40.18  ? 517  GLN A CA   1 
ATOM   6519  C  C    . GLN A 1 438 ? -48.093 26.006  -3.124  1.00 43.73  ? 517  GLN A C    1 
ATOM   6520  O  O    . GLN A 1 438 ? -48.573 25.109  -3.817  1.00 45.16  ? 517  GLN A O    1 
ATOM   6521  C  CB   . GLN A 1 438 ? -48.211 25.570  -0.667  1.00 46.36  ? 517  GLN A CB   1 
ATOM   6522  C  CG   . GLN A 1 438 ? -47.535 25.032  0.581   1.00 53.01  ? 517  GLN A CG   1 
ATOM   6523  C  CD   . GLN A 1 438 ? -48.403 25.162  1.818   1.00 53.74  ? 517  GLN A CD   1 
ATOM   6524  O  OE1  . GLN A 1 438 ? -49.447 25.814  1.792   1.00 55.64  ? 517  GLN A OE1  1 
ATOM   6525  N  NE2  . GLN A 1 438 ? -47.975 24.541  2.909   1.00 58.09  ? 517  GLN A NE2  1 
ATOM   6526  H  H    . GLN A 1 438 ? -46.444 27.229  -1.010  1.00 55.22  ? 517  GLN A H    1 
ATOM   6527  H  HA   . GLN A 1 438 ? -46.864 24.809  -2.010  1.00 48.22  ? 517  GLN A HA   1 
ATOM   6528  H  HB2  . GLN A 1 438 ? -48.554 26.454  -0.460  1.00 55.63  ? 517  GLN A HB2  1 
ATOM   6529  H  HB3  . GLN A 1 438 ? -48.945 24.976  -0.886  1.00 55.63  ? 517  GLN A HB3  1 
ATOM   6530  H  HG2  . GLN A 1 438 ? -47.334 24.092  0.451   1.00 63.61  ? 517  GLN A HG2  1 
ATOM   6531  H  HG3  . GLN A 1 438 ? -46.715 25.528  0.735   1.00 63.61  ? 517  GLN A HG3  1 
ATOM   6532  H  HE21 . GLN A 1 438 ? -47.240 24.095  2.890   1.00 69.71  ? 517  GLN A HE21 1 
ATOM   6533  H  HE22 . GLN A 1 438 ? -48.433 24.585  3.636   1.00 69.71  ? 517  GLN A HE22 1 
ATOM   6534  N  N    . GLU A 1 439 ? -48.241 27.296  -3.413  1.00 56.53  ? 518  GLU A N    1 
ATOM   6535  C  CA   . GLU A 1 439 ? -48.992 27.728  -4.589  1.00 58.97  ? 518  GLU A CA   1 
ATOM   6536  C  C    . GLU A 1 439 ? -48.256 27.356  -5.880  1.00 59.78  ? 518  GLU A C    1 
ATOM   6537  O  O    . GLU A 1 439 ? -48.869 26.914  -6.852  1.00 53.45  ? 518  GLU A O    1 
ATOM   6538  C  CB   . GLU A 1 439 ? -49.270 29.234  -4.532  1.00 63.08  ? 518  GLU A CB   1 
ATOM   6539  C  CG   . GLU A 1 439 ? -50.322 29.630  -3.493  1.00 65.82  ? 518  GLU A CG   1 
ATOM   6540  C  CD   . GLU A 1 439 ? -50.669 31.108  -3.535  1.00 68.83  ? 518  GLU A CD   1 
ATOM   6541  O  OE1  . GLU A 1 439 ? -49.830 31.904  -4.007  1.00 66.90  ? 518  GLU A OE1  1 
ATOM   6542  O  OE2  . GLU A 1 439 ? -51.781 31.473  -3.095  1.00 69.39  ? 518  GLU A OE2  1 
ATOM   6543  H  H    . GLU A 1 439 ? -47.918 27.941  -2.944  1.00 67.84  ? 518  GLU A H    1 
ATOM   6544  H  HA   . GLU A 1 439 ? -49.848 27.270  -4.596  1.00 70.76  ? 518  GLU A HA   1 
ATOM   6545  H  HB2  . GLU A 1 439 ? -48.446 29.696  -4.310  1.00 75.70  ? 518  GLU A HB2  1 
ATOM   6546  H  HB3  . GLU A 1 439 ? -49.587 29.527  -5.401  1.00 75.70  ? 518  GLU A HB3  1 
ATOM   6547  H  HG2  . GLU A 1 439 ? -51.134 29.127  -3.659  1.00 78.99  ? 518  GLU A HG2  1 
ATOM   6548  H  HG3  . GLU A 1 439 ? -49.982 29.427  -2.607  1.00 78.99  ? 518  GLU A HG3  1 
ATOM   6549  N  N    . SER A 1 440 ? -46.936 27.515  -5.876  1.00 65.97  ? 519  SER A N    1 
ATOM   6550  C  CA   . SER A 1 440 ? -46.121 27.158  -7.034  1.00 59.40  ? 519  SER A CA   1 
ATOM   6551  C  C    . SER A 1 440 ? -46.135 25.649  -7.240  1.00 55.93  ? 519  SER A C    1 
ATOM   6552  O  O    . SER A 1 440 ? -46.232 25.171  -8.370  1.00 64.33  ? 519  SER A O    1 
ATOM   6553  C  CB   . SER A 1 440 ? -44.680 27.661  -6.866  1.00 53.82  ? 519  SER A CB   1 
ATOM   6554  O  OG   . SER A 1 440 ? -44.150 27.301  -5.604  1.00 56.51  ? 519  SER A OG   1 
ATOM   6555  H  H    . SER A 1 440 ? -46.486 27.828  -5.214  1.00 79.17  ? 519  SER A H    1 
ATOM   6556  H  HA   . SER A 1 440 ? -46.495 27.574  -7.826  1.00 71.27  ? 519  SER A HA   1 
ATOM   6557  H  HB2  . SER A 1 440 ? -44.128 27.270  -7.561  1.00 64.59  ? 519  SER A HB2  1 
ATOM   6558  H  HB3  . SER A 1 440 ? -44.674 28.628  -6.944  1.00 64.59  ? 519  SER A HB3  1 
ATOM   6559  H  HG   . SER A 1 440 ? -43.363 27.584  -5.531  1.00 67.81  ? 519  SER A HG   1 
ATOM   6560  N  N    . ALA A 1 441 ? -46.050 24.903  -6.143  1.00 40.16  ? 520  ALA A N    1 
ATOM   6561  C  CA   . ALA A 1 441 ? -46.032 23.443  -6.210  1.00 37.84  ? 520  ALA A CA   1 
ATOM   6562  C  C    . ALA A 1 441 ? -47.375 22.882  -6.681  1.00 37.03  ? 520  ALA A C    1 
ATOM   6563  O  O    . ALA A 1 441 ? -47.425 21.888  -7.408  1.00 36.14  ? 520  ALA A O    1 
ATOM   6564  C  CB   . ALA A 1 441 ? -45.658 22.853  -4.859  1.00 31.64  ? 520  ALA A CB   1 
ATOM   6565  H  H    . ALA A 1 441 ? -46.002 25.218  -5.345  1.00 48.19  ? 520  ALA A H    1 
ATOM   6566  H  HA   . ALA A 1 441 ? -45.357 23.169  -6.849  1.00 45.40  ? 520  ALA A HA   1 
ATOM   6567  H  HB1  . ALA A 1 441 ? -45.653 21.885  -4.928  1.00 37.96  ? 520  ALA A HB1  1 
ATOM   6568  H  HB2  . ALA A 1 441 ? -44.777 23.172  -4.609  1.00 37.96  ? 520  ALA A HB2  1 
ATOM   6569  H  HB3  . ALA A 1 441 ? -46.312 23.134  -4.200  1.00 37.96  ? 520  ALA A HB3  1 
ATOM   6570  N  N    . LEU A 1 442 ? -48.464 23.518  -6.268  1.00 32.86  ? 521  LEU A N    1 
ATOM   6571  C  CA   . LEU A 1 442 ? -49.790 23.098  -6.706  1.00 33.68  ? 521  LEU A CA   1 
ATOM   6572  C  C    . LEU A 1 442 ? -49.971 23.383  -8.198  1.00 39.09  ? 521  LEU A C    1 
ATOM   6573  O  O    . LEU A 1 442 ? -50.596 22.602  -8.917  1.00 38.54  ? 521  LEU A O    1 
ATOM   6574  C  CB   . LEU A 1 442 ? -50.879 23.789  -5.880  1.00 37.36  ? 521  LEU A CB   1 
ATOM   6575  C  CG   . LEU A 1 442 ? -52.320 23.590  -6.362  1.00 40.00  ? 521  LEU A CG   1 
ATOM   6576  C  CD1  . LEU A 1 442 ? -52.668 22.107  -6.501  1.00 41.81  ? 521  LEU A CD1  1 
ATOM   6577  C  CD2  . LEU A 1 442 ? -53.299 24.286  -5.424  1.00 38.36  ? 521  LEU A CD2  1 
ATOM   6578  H  H    . LEU A 1 442 ? -48.464 24.193  -5.735  1.00 39.43  ? 521  LEU A H    1 
ATOM   6579  H  HA   . LEU A 1 442 ? -49.877 22.141  -6.572  1.00 40.41  ? 521  LEU A HA   1 
ATOM   6580  H  HB2  . LEU A 1 442 ? -50.830 23.454  -4.971  1.00 44.83  ? 521  LEU A HB2  1 
ATOM   6581  H  HB3  . LEU A 1 442 ? -50.703 24.743  -5.881  1.00 44.83  ? 521  LEU A HB3  1 
ATOM   6582  H  HG   . LEU A 1 442 ? -52.412 23.997  -7.238  1.00 48.00  ? 521  LEU A HG   1 
ATOM   6583  H  HD11 . LEU A 1 442 ? -53.585 22.026  -6.807  1.00 50.17  ? 521  LEU A HD11 1 
ATOM   6584  H  HD12 . LEU A 1 442 ? -52.066 21.701  -7.144  1.00 50.17  ? 521  LEU A HD12 1 
ATOM   6585  H  HD13 . LEU A 1 442 ? -52.568 21.678  -5.637  1.00 50.17  ? 521  LEU A HD13 1 
ATOM   6586  H  HD21 . LEU A 1 442 ? -54.202 24.146  -5.750  1.00 46.04  ? 521  LEU A HD21 1 
ATOM   6587  H  HD22 . LEU A 1 442 ? -53.206 23.909  -4.535  1.00 46.04  ? 521  LEU A HD22 1 
ATOM   6588  H  HD23 . LEU A 1 442 ? -53.098 25.235  -5.404  1.00 46.04  ? 521  LEU A HD23 1 
ATOM   6589  N  N    . ILE A 1 443 ? -49.415 24.499  -8.660  1.00 47.06  ? 522  ILE A N    1 
ATOM   6590  C  CA   . ILE A 1 443 ? -49.438 24.834  -10.083 1.00 47.52  ? 522  ILE A CA   1 
ATOM   6591  C  C    . ILE A 1 443 ? -48.643 23.795  -10.866 1.00 44.73  ? 522  ILE A C    1 
ATOM   6592  O  O    . ILE A 1 443 ? -49.065 23.339  -11.930 1.00 37.67  ? 522  ILE A O    1 
ATOM   6593  C  CB   . ILE A 1 443 ? -48.847 26.236  -10.342 1.00 49.35  ? 522  ILE A CB   1 
ATOM   6594  C  CG1  . ILE A 1 443 ? -49.843 27.311  -9.904  1.00 52.79  ? 522  ILE A CG1  1 
ATOM   6595  C  CG2  . ILE A 1 443 ? -48.512 26.426  -11.826 1.00 51.48  ? 522  ILE A CG2  1 
ATOM   6596  C  CD1  . ILE A 1 443 ? -49.289 28.722  -9.913  1.00 53.05  ? 522  ILE A CD1  1 
ATOM   6597  H  H    . ILE A 1 443 ? -49.017 25.082  -8.170  1.00 56.47  ? 522  ILE A H    1 
ATOM   6598  H  HA   . ILE A 1 443 ? -50.354 24.823  -10.402 1.00 57.02  ? 522  ILE A HA   1 
ATOM   6599  H  HB   . ILE A 1 443 ? -48.034 26.334  -9.822  1.00 59.23  ? 522  ILE A HB   1 
ATOM   6600  H  HG12 . ILE A 1 443 ? -50.605 27.290  -10.503 1.00 63.34  ? 522  ILE A HG12 1 
ATOM   6601  H  HG13 . ILE A 1 443 ? -50.133 27.114  -8.999  1.00 63.34  ? 522  ILE A HG13 1 
ATOM   6602  H  HG21 . ILE A 1 443 ? -48.144 27.314  -11.955 1.00 61.77  ? 522  ILE A HG21 1 
ATOM   6603  H  HG22 . ILE A 1 443 ? -47.862 25.756  -12.090 1.00 61.77  ? 522  ILE A HG22 1 
ATOM   6604  H  HG23 . ILE A 1 443 ? -49.323 26.324  -12.348 1.00 61.77  ? 522  ILE A HG23 1 
ATOM   6605  H  HD11 . ILE A 1 443 ? -49.983 29.335  -9.623  1.00 63.66  ? 522  ILE A HD11 1 
ATOM   6606  H  HD12 . ILE A 1 443 ? -48.533 28.768  -9.307  1.00 63.66  ? 522  ILE A HD12 1 
ATOM   6607  H  HD13 . ILE A 1 443 ? -49.006 28.944  -10.814 1.00 63.66  ? 522  ILE A HD13 1 
ATOM   6608  N  N    . GLU A 1 444 ? -47.484 23.435  -10.324 1.00 40.04  ? 523  GLU A N    1 
ATOM   6609  C  CA   . GLU A 1 444 ? -46.635 22.404  -10.907 1.00 31.38  ? 523  GLU A CA   1 
ATOM   6610  C  C    . GLU A 1 444 ? -47.410 21.098  -11.056 1.00 35.66  ? 523  GLU A C    1 
ATOM   6611  O  O    . GLU A 1 444 ? -47.579 20.594  -12.166 1.00 37.67  ? 523  GLU A O    1 
ATOM   6612  C  CB   . GLU A 1 444 ? -45.393 22.191  -10.032 1.00 33.35  ? 523  GLU A CB   1 
ATOM   6613  C  CG   . GLU A 1 444 ? -44.535 20.975  -10.389 1.00 47.49  ? 523  GLU A CG   1 
ATOM   6614  C  CD   . GLU A 1 444 ? -43.944 21.054  -11.784 1.00 44.54  ? 523  GLU A CD   1 
ATOM   6615  O  OE1  . GLU A 1 444 ? -43.779 22.181  -12.300 1.00 44.33  ? 523  GLU A OE1  1 
ATOM   6616  O  OE2  . GLU A 1 444 ? -43.648 19.987  -12.362 1.00 38.03  ? 523  GLU A OE2  1 
ATOM   6617  H  H    . GLU A 1 444 ? -47.162 23.780  -9.605  1.00 48.04  ? 523  GLU A H    1 
ATOM   6618  H  HA   . GLU A 1 444 ? -46.344 22.687  -11.787 1.00 37.66  ? 523  GLU A HA   1 
ATOM   6619  H  HB2  . GLU A 1 444 ? -44.829 22.976  -10.105 1.00 40.03  ? 523  GLU A HB2  1 
ATOM   6620  H  HB3  . GLU A 1 444 ? -45.681 22.083  -9.112  1.00 40.03  ? 523  GLU A HB3  1 
ATOM   6621  H  HG2  . GLU A 1 444 ? -43.801 20.911  -9.757  1.00 56.99  ? 523  GLU A HG2  1 
ATOM   6622  H  HG3  . GLU A 1 444 ? -45.084 20.177  -10.342 1.00 56.99  ? 523  GLU A HG3  1 
ATOM   6623  N  N    . ILE A 1 445 ? -47.874 20.557  -9.933  1.00 31.78  ? 524  ILE A N    1 
ATOM   6624  C  CA   . ILE A 1 445 ? -48.654 19.322  -9.939  1.00 32.50  ? 524  ILE A CA   1 
ATOM   6625  C  C    . ILE A 1 445 ? -49.814 19.389  -10.929 1.00 37.86  ? 524  ILE A C    1 
ATOM   6626  O  O    . ILE A 1 445 ? -50.026 18.467  -11.718 1.00 36.85  ? 524  ILE A O    1 
ATOM   6627  C  CB   . ILE A 1 445 ? -49.211 19.008  -8.536  1.00 29.55  ? 524  ILE A CB   1 
ATOM   6628  C  CG1  . ILE A 1 445 ? -48.059 18.621  -7.605  1.00 25.30  ? 524  ILE A CG1  1 
ATOM   6629  C  CG2  . ILE A 1 445 ? -50.284 17.888  -8.601  1.00 34.29  ? 524  ILE A CG2  1 
ATOM   6630  C  CD1  . ILE A 1 445 ? -48.493 18.264  -6.216  1.00 32.81  ? 524  ILE A CD1  1 
ATOM   6631  H  H    . ILE A 1 445 ? -47.751 20.889  -9.149  1.00 38.14  ? 524  ILE A H    1 
ATOM   6632  H  HA   . ILE A 1 445 ? -48.078 18.588  -10.203 1.00 39.00  ? 524  ILE A HA   1 
ATOM   6633  H  HB   . ILE A 1 445 ? -49.629 19.810  -8.186  1.00 35.46  ? 524  ILE A HB   1 
ATOM   6634  H  HG12 . ILE A 1 445 ? -47.601 17.852  -7.979  1.00 30.35  ? 524  ILE A HG12 1 
ATOM   6635  H  HG13 . ILE A 1 445 ? -47.446 19.370  -7.541  1.00 30.35  ? 524  ILE A HG13 1 
ATOM   6636  H  HG21 . ILE A 1 445 ? -50.613 17.714  -7.705  1.00 41.15  ? 524  ILE A HG21 1 
ATOM   6637  H  HG22 . ILE A 1 445 ? -51.012 18.181  -9.170  1.00 41.15  ? 524  ILE A HG22 1 
ATOM   6638  H  HG23 . ILE A 1 445 ? -49.880 17.085  -8.967  1.00 41.15  ? 524  ILE A HG23 1 
ATOM   6639  H  HD11 . ILE A 1 445 ? -47.711 18.033  -5.691  1.00 39.37  ? 524  ILE A HD11 1 
ATOM   6640  H  HD12 . ILE A 1 445 ? -48.943 19.027  -5.821  1.00 39.37  ? 524  ILE A HD12 1 
ATOM   6641  H  HD13 . ILE A 1 445 ? -49.099 17.508  -6.259  1.00 39.37  ? 524  ILE A HD13 1 
HETATM 6642  N  N    . MSE A 1 446 ? -50.567 20.482  -10.863 1.00 54.84  ? 525  MSE A N    1 
HETATM 6643  C  CA   . MSE A 1 446 ? -51.725 20.689  -11.722 1.00 52.47  ? 525  MSE A CA   1 
HETATM 6644  C  C    . MSE A 1 446 ? -51.377 20.529  -13.198 1.00 49.37  ? 525  MSE A C    1 
HETATM 6645  O  O    . MSE A 1 446 ? -52.082 19.852  -13.945 1.00 48.76  ? 525  MSE A O    1 
HETATM 6646  C  CB   . MSE A 1 446 ? -52.298 22.086  -11.482 1.00 59.55  ? 525  MSE A CB   1 
HETATM 6647  C  CG   . MSE A 1 446 ? -53.568 22.374  -12.263 1.00 66.48  ? 525  MSE A CG   1 
HETATM 6648  SE SE   . MSE A 1 446 ? -54.583 23.859  -11.511 1.00 79.96  ? 525  MSE A SE   1 
HETATM 6649  C  CE   . MSE A 1 446 ? -53.701 25.345  -12.422 1.00 46.70  ? 525  MSE A CE   1 
HETATM 6650  H  H    . MSE A 1 446 ? -50.423 21.131  -10.316 1.00 65.81  ? 525  MSE A H    1 
HETATM 6651  H  HA   . MSE A 1 446 ? -52.409 20.042  -11.488 1.00 62.96  ? 525  MSE A HA   1 
HETATM 6652  H  HB2  . MSE A 1 446 ? -52.503 22.181  -10.539 1.00 71.46  ? 525  MSE A HB2  1 
HETATM 6653  H  HB3  . MSE A 1 446 ? -51.635 22.744  -11.742 1.00 71.46  ? 525  MSE A HB3  1 
HETATM 6654  H  HG2  . MSE A 1 446 ? -53.334 22.601  -13.177 1.00 79.77  ? 525  MSE A HG2  1 
HETATM 6655  H  HG3  . MSE A 1 446 ? -54.134 21.586  -12.251 1.00 79.77  ? 525  MSE A HG3  1 
HETATM 6656  H  HE1  . MSE A 1 446 ? -54.112 26.177  -12.139 1.00 56.04  ? 525  MSE A HE1  1 
HETATM 6657  H  HE2  . MSE A 1 446 ? -52.760 25.344  -12.189 1.00 56.04  ? 525  MSE A HE2  1 
HETATM 6658  H  HE3  . MSE A 1 446 ? -53.804 25.233  -13.380 1.00 56.04  ? 525  MSE A HE3  1 
ATOM   6659  N  N    . LEU A 1 447 ? -50.285 21.159  -13.611 1.00 44.34  ? 526  LEU A N    1 
ATOM   6660  C  CA   . LEU A 1 447 ? -49.856 21.117  -15.001 1.00 44.47  ? 526  LEU A CA   1 
ATOM   6661  C  C    . LEU A 1 447 ? -49.456 19.704  -15.437 1.00 45.11  ? 526  LEU A C    1 
ATOM   6662  O  O    . LEU A 1 447 ? -49.628 19.332  -16.601 1.00 44.36  ? 526  LEU A O    1 
ATOM   6663  C  CB   . LEU A 1 447 ? -48.697 22.090  -15.216 1.00 43.79  ? 526  LEU A CB   1 
ATOM   6664  C  CG   . LEU A 1 447 ? -48.141 22.143  -16.641 1.00 52.25  ? 526  LEU A CG   1 
ATOM   6665  C  CD1  . LEU A 1 447 ? -49.192 22.690  -17.608 1.00 54.23  ? 526  LEU A CD1  1 
ATOM   6666  C  CD2  . LEU A 1 447 ? -46.857 22.959  -16.696 1.00 56.34  ? 526  LEU A CD2  1 
ATOM   6667  H  H    . LEU A 1 447 ? -49.771 21.622  -13.100 1.00 53.20  ? 526  LEU A H    1 
ATOM   6668  H  HA   . LEU A 1 447 ? -50.593 21.403  -15.564 1.00 53.36  ? 526  LEU A HA   1 
ATOM   6669  H  HB2  . LEU A 1 447 ? -48.999 22.983  -14.988 1.00 52.55  ? 526  LEU A HB2  1 
ATOM   6670  H  HB3  . LEU A 1 447 ? -47.968 21.834  -14.629 1.00 52.55  ? 526  LEU A HB3  1 
ATOM   6671  H  HG   . LEU A 1 447 ? -47.926 21.240  -16.922 1.00 62.70  ? 526  LEU A HG   1 
ATOM   6672  H  HD11 . LEU A 1 447 ? -48.816 22.714  -18.502 1.00 65.08  ? 526  LEU A HD11 1 
ATOM   6673  H  HD12 . LEU A 1 447 ? -49.969 22.110  -17.591 1.00 65.08  ? 526  LEU A HD12 1 
ATOM   6674  H  HD13 . LEU A 1 447 ? -49.441 23.586  -17.330 1.00 65.08  ? 526  LEU A HD13 1 
ATOM   6675  H  HD21 . LEU A 1 447 ? -46.531 22.973  -17.610 1.00 67.61  ? 526  LEU A HD21 1 
ATOM   6676  H  HD22 . LEU A 1 447 ? -47.044 23.862  -16.397 1.00 67.61  ? 526  LEU A HD22 1 
ATOM   6677  H  HD23 . LEU A 1 447 ? -46.197 22.548  -16.116 1.00 67.61  ? 526  LEU A HD23 1 
ATOM   6678  N  N    . CYS A 1 448 ? -48.926 18.918  -14.504 1.00 37.36  ? 527  CYS A N    1 
ATOM   6679  C  CA   . CYS A 1 448 ? -48.504 17.554  -14.809 1.00 41.07  ? 527  CYS A CA   1 
ATOM   6680  C  C    . CYS A 1 448 ? -49.719 16.660  -15.035 1.00 39.17  ? 527  CYS A C    1 
ATOM   6681  O  O    . CYS A 1 448 ? -49.786 15.926  -16.022 1.00 32.80  ? 527  CYS A O    1 
ATOM   6682  C  CB   . CYS A 1 448 ? -47.623 16.995  -13.687 1.00 41.97  ? 527  CYS A CB   1 
ATOM   6683  S  SG   . CYS A 1 448 ? -45.993 17.770  -13.573 1.00 38.96  ? 527  CYS A SG   1 
ATOM   6684  H  H    . CYS A 1 448 ? -48.800 19.151  -13.686 1.00 44.83  ? 527  CYS A H    1 
ATOM   6685  H  HA   . CYS A 1 448 ? -47.981 17.561  -15.626 1.00 49.28  ? 527  CYS A HA   1 
ATOM   6686  H  HB2  . CYS A 1 448 ? -48.075 17.130  -12.840 1.00 50.36  ? 527  CYS A HB2  1 
ATOM   6687  H  HB3  . CYS A 1 448 ? -47.489 16.046  -13.840 1.00 50.36  ? 527  CYS A HB3  1 
ATOM   6688  H  HG   . CYS A 1 448 ? -46.132 18.944  -13.368 1.00 46.75  ? 527  CYS A HG   1 
ATOM   6689  N  N    . THR A 1 449 ? -50.684 16.743  -14.125 1.00 27.86  ? 528  THR A N    1 
ATOM   6690  C  CA   . THR A 1 449 ? -51.925 15.989  -14.248 1.00 31.24  ? 528  THR A CA   1 
ATOM   6691  C  C    . THR A 1 449 ? -52.589 16.290  -15.585 1.00 31.28  ? 528  THR A C    1 
ATOM   6692  O  O    . THR A 1 449 ? -53.134 15.400  -16.243 1.00 26.20  ? 528  THR A O    1 
ATOM   6693  C  CB   . THR A 1 449 ? -52.907 16.372  -13.140 1.00 30.00  ? 528  THR A CB   1 
ATOM   6694  O  OG1  . THR A 1 449 ? -53.074 17.794  -13.132 1.00 40.80  ? 528  THR A OG1  1 
ATOM   6695  C  CG2  . THR A 1 449 ? -52.386 15.934  -11.790 1.00 37.00  ? 528  THR A CG2  1 
ATOM   6696  H  H    . THR A 1 449 ? -50.643 17.233  -13.420 1.00 33.43  ? 528  THR A H    1 
ATOM   6697  H  HA   . THR A 1 449 ? -51.742 15.038  -14.193 1.00 37.49  ? 528  THR A HA   1 
ATOM   6698  H  HB   . THR A 1 449 ? -53.762 15.943  -13.298 1.00 36.00  ? 528  THR A HB   1 
ATOM   6699  H  HG1  . THR A 1 449 ? -52.336 18.170  -12.992 1.00 48.96  ? 528  THR A HG1  1 
ATOM   6700  H  HG21 . THR A 1 449 ? -53.015 16.182  -11.096 1.00 44.40  ? 528  THR A HG21 1 
ATOM   6701  H  HG22 . THR A 1 449 ? -52.266 14.972  -11.778 1.00 44.40  ? 528  THR A HG22 1 
ATOM   6702  H  HG23 . THR A 1 449 ? -51.533 16.361  -11.610 1.00 44.40  ? 528  THR A HG23 1 
ATOM   6703  N  N    . ILE A 1 450 ? -52.526 17.558  -15.979 1.00 26.73  ? 529  ILE A N    1 
ATOM   6704  C  CA   . ILE A 1 450 ? -53.162 18.026  -17.203 1.00 30.27  ? 529  ILE A CA   1 
ATOM   6705  C  C    . ILE A 1 450 ? -52.486 17.449  -18.434 1.00 27.82  ? 529  ILE A C    1 
ATOM   6706  O  O    . ILE A 1 450 ? -53.155 16.913  -19.320 1.00 27.74  ? 529  ILE A O    1 
ATOM   6707  C  CB   . ILE A 1 450 ? -53.175 19.571  -17.245 1.00 30.53  ? 529  ILE A CB   1 
ATOM   6708  C  CG1  . ILE A 1 450 ? -54.261 20.066  -16.291 1.00 32.97  ? 529  ILE A CG1  1 
ATOM   6709  C  CG2  . ILE A 1 450 ? -53.398 20.118  -18.677 1.00 31.73  ? 529  ILE A CG2  1 
ATOM   6710  C  CD1  . ILE A 1 450 ? -54.329 21.543  -16.146 1.00 35.93  ? 529  ILE A CD1  1 
ATOM   6711  H  H    . ILE A 1 450 ? -52.112 18.175  -15.546 1.00 32.08  ? 529  ILE A H    1 
ATOM   6712  H  HA   . ILE A 1 450 ? -54.084 17.725  -17.206 1.00 36.33  ? 529  ILE A HA   1 
ATOM   6713  H  HB   . ILE A 1 450 ? -52.318 19.893  -16.925 1.00 36.63  ? 529  ILE A HB   1 
ATOM   6714  H  HG12 . ILE A 1 450 ? -55.123 19.763  -16.617 1.00 39.56  ? 529  ILE A HG12 1 
ATOM   6715  H  HG13 . ILE A 1 450 ? -54.095 19.692  -15.411 1.00 39.56  ? 529  ILE A HG13 1 
ATOM   6716  H  HG21 . ILE A 1 450 ? -53.397 21.088  -18.647 1.00 38.08  ? 529  ILE A HG21 1 
ATOM   6717  H  HG22 . ILE A 1 450 ? -52.681 19.804  -19.249 1.00 38.08  ? 529  ILE A HG22 1 
ATOM   6718  H  HG23 . ILE A 1 450 ? -54.251 19.797  -19.008 1.00 38.08  ? 529  ILE A HG23 1 
ATOM   6719  H  HD11 . ILE A 1 450 ? -55.041 21.767  -15.527 1.00 43.12  ? 529  ILE A HD11 1 
ATOM   6720  H  HD12 . ILE A 1 450 ? -53.480 21.866  -15.806 1.00 43.12  ? 529  ILE A HD12 1 
ATOM   6721  H  HD13 . ILE A 1 450 ? -54.509 21.937  -17.014 1.00 43.12  ? 529  ILE A HD13 1 
ATOM   6722  N  N    . ARG A 1 451 ? -51.162 17.557  -18.483 1.00 43.37  ? 530  ARG A N    1 
ATOM   6723  C  CA   . ARG A 1 451 ? -50.392 17.058  -19.615 1.00 42.78  ? 530  ARG A CA   1 
ATOM   6724  C  C    . ARG A 1 451 ? -50.585 15.555  -19.776 1.00 40.95  ? 530  ARG A C    1 
ATOM   6725  O  O    . ARG A 1 451 ? -50.863 15.069  -20.868 1.00 38.81  ? 530  ARG A O    1 
ATOM   6726  C  CB   . ARG A 1 451 ? -48.907 17.386  -19.431 1.00 50.19  ? 530  ARG A CB   1 
ATOM   6727  C  CG   . ARG A 1 451 ? -47.986 16.828  -20.521 1.00 48.64  ? 530  ARG A CG   1 
ATOM   6728  C  CD   . ARG A 1 451 ? -46.549 17.269  -20.312 1.00 48.26  ? 530  ARG A CD   1 
ATOM   6729  N  NE   . ARG A 1 451 ? -46.073 16.954  -18.969 1.00 51.79  ? 530  ARG A NE   1 
ATOM   6730  C  CZ   . ARG A 1 451 ? -45.114 17.627  -18.338 1.00 56.13  ? 530  ARG A CZ   1 
ATOM   6731  N  NH1  . ARG A 1 451 ? -44.523 18.663  -18.922 1.00 55.81  ? 530  ARG A NH1  1 
ATOM   6732  N  NH2  . ARG A 1 451 ? -44.750 17.270  -17.115 1.00 55.12  ? 530  ARG A NH2  1 
ATOM   6733  H  H    . ARG A 1 451 ? -50.683 17.919  -17.868 1.00 52.04  ? 530  ARG A H    1 
ATOM   6734  H  HA   . ARG A 1 451 ? -50.699 17.491  -20.427 1.00 51.33  ? 530  ARG A HA   1 
ATOM   6735  H  HB2  . ARG A 1 451 ? -48.802 18.350  -19.423 1.00 60.22  ? 530  ARG A HB2  1 
ATOM   6736  H  HB3  . ARG A 1 451 ? -48.613 17.019  -18.582 1.00 60.22  ? 530  ARG A HB3  1 
ATOM   6737  H  HG2  . ARG A 1 451 ? -48.014 15.859  -20.498 1.00 58.37  ? 530  ARG A HG2  1 
ATOM   6738  H  HG3  . ARG A 1 451 ? -48.281 17.153  -21.386 1.00 58.37  ? 530  ARG A HG3  1 
ATOM   6739  H  HD2  . ARG A 1 451 ? -45.980 16.811  -20.950 1.00 57.91  ? 530  ARG A HD2  1 
ATOM   6740  H  HD3  . ARG A 1 451 ? -46.489 18.229  -20.437 1.00 57.91  ? 530  ARG A HD3  1 
ATOM   6741  H  HE   . ARG A 1 451 ? -46.436 16.291  -18.559 1.00 62.15  ? 530  ARG A HE   1 
ATOM   6742  H  HH11 . ARG A 1 451 ? -44.757 18.900  -19.715 1.00 66.97  ? 530  ARG A HH11 1 
ATOM   6743  H  HH12 . ARG A 1 451 ? -43.905 19.094  -18.509 1.00 66.97  ? 530  ARG A HH12 1 
ATOM   6744  H  HH21 . ARG A 1 451 ? -45.129 16.600  -16.731 1.00 66.14  ? 530  ARG A HH21 1 
ATOM   6745  H  HH22 . ARG A 1 451 ? -44.130 17.705  -16.707 1.00 66.14  ? 530  ARG A HH22 1 
ATOM   6746  N  N    . GLN A 1 452 ? -50.462 14.824  -18.675 1.00 29.79  ? 531  GLN A N    1 
ATOM   6747  C  CA   . GLN A 1 452 ? -50.582 13.374  -18.708 1.00 33.84  ? 531  GLN A CA   1 
ATOM   6748  C  C    . GLN A 1 452 ? -52.015 12.933  -18.994 1.00 41.26  ? 531  GLN A C    1 
ATOM   6749  O  O    . GLN A 1 452 ? -52.253 11.795  -19.404 1.00 41.48  ? 531  GLN A O    1 
ATOM   6750  C  CB   . GLN A 1 452 ? -50.099 12.780  -17.385 1.00 42.19  ? 531  GLN A CB   1 
ATOM   6751  C  CG   . GLN A 1 452 ? -50.182 11.265  -17.334 1.00 39.39  ? 531  GLN A CG   1 
ATOM   6752  C  CD   . GLN A 1 452 ? -49.088 10.631  -16.499 1.00 31.34  ? 531  GLN A CD   1 
ATOM   6753  O  OE1  . GLN A 1 452 ? -48.341 11.314  -15.797 1.00 31.81  ? 531  GLN A OE1  1 
ATOM   6754  N  NE2  . GLN A 1 452 ? -48.987 9.310   -16.576 1.00 36.00  ? 531  GLN A NE2  1 
ATOM   6755  H  H    . GLN A 1 452 ? -50.309 15.147  -17.893 1.00 35.75  ? 531  GLN A H    1 
ATOM   6756  H  HA   . GLN A 1 452 ? -50.016 13.027  -19.415 1.00 40.61  ? 531  GLN A HA   1 
ATOM   6757  H  HB2  . GLN A 1 452 ? -49.172 13.032  -17.249 1.00 50.63  ? 531  GLN A HB2  1 
ATOM   6758  H  HB3  . GLN A 1 452 ? -50.645 13.132  -16.665 1.00 50.63  ? 531  GLN A HB3  1 
ATOM   6759  H  HG2  . GLN A 1 452 ? -51.035 11.010  -16.951 1.00 47.26  ? 531  GLN A HG2  1 
ATOM   6760  H  HG3  . GLN A 1 452 ? -50.107 10.916  -18.236 1.00 47.26  ? 531  GLN A HG3  1 
ATOM   6761  H  HE21 . GLN A 1 452 ? -49.525 8.866   -17.080 1.00 43.19  ? 531  GLN A HE21 1 
ATOM   6762  H  HE22 . GLN A 1 452 ? -48.384 8.897   -16.123 1.00 43.19  ? 531  GLN A HE22 1 
ATOM   6763  N  N    . ALA A 1 453 ? -52.967 13.836  -18.778 1.00 36.37  ? 532  ALA A N    1 
ATOM   6764  C  CA   . ALA A 1 453 ? -54.354 13.571  -19.131 1.00 35.90  ? 532  ALA A CA   1 
ATOM   6765  C  C    . ALA A 1 453 ? -54.599 13.946  -20.590 1.00 36.87  ? 532  ALA A C    1 
ATOM   6766  O  O    . ALA A 1 453 ? -55.346 13.265  -21.300 1.00 33.86  ? 532  ALA A O    1 
ATOM   6767  C  CB   . ALA A 1 453 ? -55.290 14.341  -18.222 1.00 40.26  ? 532  ALA A CB   1 
ATOM   6768  H  H    . ALA A 1 453 ? -52.834 14.610  -18.427 1.00 43.64  ? 532  ALA A H    1 
ATOM   6769  H  HA   . ALA A 1 453 ? -54.537 12.624  -19.024 1.00 43.08  ? 532  ALA A HA   1 
ATOM   6770  H  HB1  . ALA A 1 453 ? -56.206 14.148  -18.477 1.00 48.32  ? 532  ALA A HB1  1 
ATOM   6771  H  HB2  . ALA A 1 453 ? -55.136 14.066  -17.305 1.00 48.32  ? 532  ALA A HB2  1 
ATOM   6772  H  HB3  . ALA A 1 453 ? -55.112 15.290  -18.318 1.00 48.32  ? 532  ALA A HB3  1 
ATOM   6773  N  N    . ALA A 1 454 ? -53.958 15.028  -21.031 1.00 39.18  ? 533  ALA A N    1 
ATOM   6774  C  CA   . ALA A 1 454 ? -54.150 15.557  -22.380 1.00 42.83  ? 533  ALA A CA   1 
ATOM   6775  C  C    . ALA A 1 454 ? -53.544 14.584  -23.391 1.00 50.27  ? 533  ALA A C    1 
ATOM   6776  O  O    . ALA A 1 454 ? -54.270 13.871  -24.087 1.00 57.70  ? 533  ALA A O    1 
ATOM   6777  C  CB   . ALA A 1 454 ? -53.518 16.950  -22.506 1.00 40.24  ? 533  ALA A CB   1 
ATOM   6778  H  H    . ALA A 1 454 ? -53.398 15.480  -20.560 1.00 47.02  ? 533  ALA A H    1 
ATOM   6779  H  HA   . ALA A 1 454 ? -55.099 15.635  -22.563 1.00 51.40  ? 533  ALA A HA   1 
ATOM   6780  H  HB1  . ALA A 1 454 ? -53.658 17.279  -23.408 1.00 48.29  ? 533  ALA A HB1  1 
ATOM   6781  H  HB2  . ALA A 1 454 ? -53.938 17.546  -21.867 1.00 48.29  ? 533  ALA A HB2  1 
ATOM   6782  H  HB3  . ALA A 1 454 ? -52.568 16.883  -22.322 1.00 48.29  ? 533  ALA A HB3  1 
ATOM   6783  N  N    . GLU A 1 455 ? -52.216 14.568  -23.470 1.00 55.75  ? 534  GLU A N    1 
ATOM   6784  C  CA   . GLU A 1 455 ? -51.497 13.491  -24.143 1.00 51.87  ? 534  GLU A CA   1 
ATOM   6785  C  C    . GLU A 1 455 ? -51.584 12.274  -23.230 1.00 54.33  ? 534  GLU A C    1 
ATOM   6786  O  O    . GLU A 1 455 ? -51.555 12.416  -22.010 1.00 62.97  ? 534  GLU A O    1 
ATOM   6787  C  CB   . GLU A 1 455 ? -50.038 13.873  -24.428 1.00 55.52  ? 534  GLU A CB   1 
ATOM   6788  C  CG   . GLU A 1 455 ? -49.323 14.667  -23.332 1.00 54.15  ? 534  GLU A CG   1 
ATOM   6789  C  CD   . GLU A 1 455 ? -47.981 15.217  -23.798 1.00 61.23  ? 534  GLU A CD   1 
ATOM   6790  O  OE1  . GLU A 1 455 ? -46.933 14.775  -23.271 1.00 59.72  ? 534  GLU A OE1  1 
ATOM   6791  O  OE2  . GLU A 1 455 ? -47.977 16.103  -24.686 1.00 56.59  ? 534  GLU A OE2  1 
ATOM   6792  H  H    . GLU A 1 455 ? -51.704 15.175  -23.138 1.00 66.90  ? 534  GLU A H    1 
ATOM   6793  H  HA   . GLU A 1 455 ? -51.934 13.281  -24.983 1.00 62.25  ? 534  GLU A HA   1 
ATOM   6794  H  HB2  . GLU A 1 455 ? -49.531 13.058  -24.571 1.00 66.63  ? 534  GLU A HB2  1 
ATOM   6795  H  HB3  . GLU A 1 455 ? -50.016 14.411  -25.235 1.00 66.63  ? 534  GLU A HB3  1 
ATOM   6796  H  HG2  . GLU A 1 455 ? -49.881 15.416  -23.068 1.00 64.98  ? 534  GLU A HG2  1 
ATOM   6797  H  HG3  . GLU A 1 455 ? -49.164 14.086  -22.572 1.00 64.98  ? 534  GLU A HG3  1 
ATOM   6798  N  N    . CYS A 1 456 ? -51.692 11.083  -23.812 1.00 44.98  ? 535  CYS A N    1 
ATOM   6799  C  CA   . CYS A 1 456 ? -52.109 9.899   -23.055 1.00 55.73  ? 535  CYS A CA   1 
ATOM   6800  C  C    . CYS A 1 456 ? -50.968 8.978   -22.630 1.00 53.57  ? 535  CYS A C    1 
ATOM   6801  O  O    . CYS A 1 456 ? -51.205 7.878   -22.128 1.00 54.29  ? 535  CYS A O    1 
ATOM   6802  C  CB   . CYS A 1 456 ? -53.131 9.102   -23.867 1.00 64.41  ? 535  CYS A CB   1 
ATOM   6803  S  SG   . CYS A 1 456 ? -54.801 9.201   -23.205 1.00 59.14  ? 535  CYS A SG   1 
ATOM   6804  H  H    . CYS A 1 456 ? -51.530 10.930  -24.643 1.00 53.98  ? 535  CYS A H    1 
ATOM   6805  H  HA   . CYS A 1 456 ? -52.553 10.197  -22.246 1.00 66.88  ? 535  CYS A HA   1 
ATOM   6806  H  HB2  . CYS A 1 456 ? -53.150 9.446   -24.773 1.00 77.30  ? 535  CYS A HB2  1 
ATOM   6807  H  HB3  . CYS A 1 456 ? -52.868 8.168   -23.874 1.00 77.30  ? 535  CYS A HB3  1 
ATOM   6808  H  HG   . CYS A 1 456 ? -55.535 8.552   -23.897 1.00 70.97  ? 535  CYS A HG   1 
ATOM   6809  N  N    . HIS A 1 457 ? -49.735 9.430   -22.823 1.00 52.49  ? 536  HIS A N    1 
ATOM   6810  C  CA   . HIS A 1 457 ? -48.571 8.615   -22.501 1.00 46.14  ? 536  HIS A CA   1 
ATOM   6811  C  C    . HIS A 1 457 ? -47.912 9.058   -21.191 1.00 45.88  ? 536  HIS A C    1 
ATOM   6812  O  O    . HIS A 1 457 ? -48.087 10.201  -20.761 1.00 40.39  ? 536  HIS A O    1 
ATOM   6813  C  CB   . HIS A 1 457 ? -47.561 8.679   -23.645 1.00 39.23  ? 536  HIS A CB   1 
ATOM   6814  C  CG   . HIS A 1 457 ? -47.112 10.067  -23.981 1.00 38.66  ? 536  HIS A CG   1 
ATOM   6815  N  ND1  . HIS A 1 457 ? -46.268 10.794  -23.166 1.00 46.22  ? 536  HIS A ND1  1 
ATOM   6816  C  CD2  . HIS A 1 457 ? -47.382 10.861  -25.043 1.00 47.25  ? 536  HIS A CD2  1 
ATOM   6817  C  CE1  . HIS A 1 457 ? -46.043 11.973  -23.711 1.00 46.97  ? 536  HIS A CE1  1 
ATOM   6818  N  NE2  . HIS A 1 457 ? -46.706 12.043  -24.852 1.00 51.43  ? 536  HIS A NE2  1 
ATOM   6819  H  H    . HIS A 1 457 ? -49.545 10.206  -23.140 1.00 62.99  ? 536  HIS A H    1 
ATOM   6820  H  HA   . HIS A 1 457 ? -48.850 7.692   -22.398 1.00 55.37  ? 536  HIS A HA   1 
ATOM   6821  H  HB2  . HIS A 1 457 ? -46.775 8.166   -23.398 1.00 47.08  ? 536  HIS A HB2  1 
ATOM   6822  H  HB3  . HIS A 1 457 ? -47.965 8.298   -24.440 1.00 47.08  ? 536  HIS A HB3  1 
ATOM   6823  H  HD1  . HIS A 1 457 ? -45.942 10.521  -22.419 1.00 55.46  ? 536  HIS A HD1  1 
ATOM   6824  H  HD2  . HIS A 1 457 ? -47.925 10.647  -25.767 1.00 56.70  ? 536  HIS A HD2  1 
ATOM   6825  H  HE1  . HIS A 1 457 ? -45.507 12.643  -23.352 1.00 56.36  ? 536  HIS A HE1  1 
ATOM   6826  H  HE2  . HIS A 1 457 ? -46.714 12.717  -25.387 1.00 61.72  ? 536  HIS A HE2  1 
ATOM   6827  N  N    . PRO A 1 458 ? -47.174 8.144   -20.534 1.00 54.29  ? 537  PRO A N    1 
ATOM   6828  C  CA   . PRO A 1 458 ? -46.356 8.542   -19.382 1.00 53.48  ? 537  PRO A CA   1 
ATOM   6829  C  C    . PRO A 1 458 ? -45.205 9.461   -19.784 1.00 50.82  ? 537  PRO A C    1 
ATOM   6830  O  O    . PRO A 1 458 ? -44.894 9.560   -20.973 1.00 55.56  ? 537  PRO A O    1 
ATOM   6831  C  CB   . PRO A 1 458 ? -45.799 7.209   -18.873 1.00 54.91  ? 537  PRO A CB   1 
ATOM   6832  C  CG   . PRO A 1 458 ? -46.764 6.188   -19.348 1.00 52.57  ? 537  PRO A CG   1 
ATOM   6833  C  CD   . PRO A 1 458 ? -47.232 6.678   -20.679 1.00 56.28  ? 537  PRO A CD   1 
ATOM   6834  H  HA   . PRO A 1 458 ? -46.898 8.962   -18.695 1.00 64.18  ? 537  PRO A HA   1 
ATOM   6835  H  HB2  . PRO A 1 458 ? -44.920 7.055   -19.253 1.00 65.89  ? 537  PRO A HB2  1 
ATOM   6836  H  HB3  . PRO A 1 458 ? -45.758 7.220   -17.904 1.00 65.89  ? 537  PRO A HB3  1 
ATOM   6837  H  HG2  . PRO A 1 458 ? -46.316 5.331   -19.435 1.00 63.09  ? 537  PRO A HG2  1 
ATOM   6838  H  HG3  . PRO A 1 458 ? -47.506 6.125   -18.725 1.00 63.09  ? 537  PRO A HG3  1 
ATOM   6839  H  HD2  . PRO A 1 458 ? -46.630 6.382   -21.380 1.00 67.54  ? 537  PRO A HD2  1 
ATOM   6840  H  HD3  . PRO A 1 458 ? -48.143 6.389   -20.846 1.00 67.54  ? 537  PRO A HD3  1 
ATOM   6841  N  N    . PRO A 1 459 ? -44.569 10.120  -18.801 1.00 23.97  ? 538  PRO A N    1 
ATOM   6842  C  CA   . PRO A 1 459 ? -43.419 10.991  -19.076 1.00 23.90  ? 538  PRO A CA   1 
ATOM   6843  C  C    . PRO A 1 459 ? -42.223 10.182  -19.579 1.00 28.34  ? 538  PRO A C    1 
ATOM   6844  O  O    . PRO A 1 459 ? -42.224 8.958   -19.446 1.00 31.19  ? 538  PRO A O    1 
ATOM   6845  C  CB   . PRO A 1 459 ? -43.121 11.617  -17.709 1.00 24.68  ? 538  PRO A CB   1 
ATOM   6846  C  CG   . PRO A 1 459 ? -43.634 10.640  -16.732 1.00 26.48  ? 538  PRO A CG   1 
ATOM   6847  C  CD   . PRO A 1 459 ? -44.839 10.010  -17.358 1.00 23.82  ? 538  PRO A CD   1 
ATOM   6848  H  HA   . PRO A 1 459 ? -43.650 11.682  -19.716 1.00 28.67  ? 538  PRO A HA   1 
ATOM   6849  H  HB2  . PRO A 1 459 ? -42.164 11.738  -17.606 1.00 29.61  ? 538  PRO A HB2  1 
ATOM   6850  H  HB3  . PRO A 1 459 ? -43.587 12.463  -17.627 1.00 29.61  ? 538  PRO A HB3  1 
ATOM   6851  H  HG2  . PRO A 1 459 ? -42.954 9.971   -16.557 1.00 31.78  ? 538  PRO A HG2  1 
ATOM   6852  H  HG3  . PRO A 1 459 ? -43.877 11.100  -15.914 1.00 31.78  ? 538  PRO A HG3  1 
ATOM   6853  H  HD2  . PRO A 1 459 ? -44.908 9.079   -17.096 1.00 28.58  ? 538  PRO A HD2  1 
ATOM   6854  H  HD3  . PRO A 1 459 ? -45.639 10.506  -17.124 1.00 28.58  ? 538  PRO A HD3  1 
ATOM   6855  N  N    . VAL A 1 460 ? -41.218 10.847  -20.142 1.00 30.02  ? 539  VAL A N    1 
ATOM   6856  C  CA   . VAL A 1 460 ? -40.110 10.131  -20.769 1.00 27.05  ? 539  VAL A CA   1 
ATOM   6857  C  C    . VAL A 1 460 ? -39.396 9.233   -19.760 1.00 27.31  ? 539  VAL A C    1 
ATOM   6858  O  O    . VAL A 1 460 ? -39.128 9.640   -18.631 1.00 27.21  ? 539  VAL A O    1 
ATOM   6859  C  CB   . VAL A 1 460 ? -39.102 11.089  -21.445 1.00 24.37  ? 539  VAL A CB   1 
ATOM   6860  C  CG1  . VAL A 1 460 ? -38.280 11.864  -20.420 1.00 29.79  ? 539  VAL A CG1  1 
ATOM   6861  C  CG2  . VAL A 1 460 ? -38.186 10.313  -22.362 1.00 26.11  ? 539  VAL A CG2  1 
ATOM   6862  H  H    . VAL A 1 460 ? -41.154 11.704  -20.176 1.00 36.02  ? 539  VAL A H    1 
ATOM   6863  H  HA   . VAL A 1 460 ? -40.471 9.557   -21.462 1.00 32.46  ? 539  VAL A HA   1 
ATOM   6864  H  HB   . VAL A 1 460 ? -39.591 11.731  -21.983 1.00 29.24  ? 539  VAL A HB   1 
ATOM   6865  H  HG11 . VAL A 1 460 ? -37.665 12.450  -20.888 1.00 35.75  ? 539  VAL A HG11 1 
ATOM   6866  H  HG12 . VAL A 1 460 ? -38.880 12.388  -19.866 1.00 35.75  ? 539  VAL A HG12 1 
ATOM   6867  H  HG13 . VAL A 1 460 ? -37.787 11.235  -19.871 1.00 35.75  ? 539  VAL A HG13 1 
ATOM   6868  H  HG21 . VAL A 1 460 ? -37.561 10.928  -22.777 1.00 31.33  ? 539  VAL A HG21 1 
ATOM   6869  H  HG22 . VAL A 1 460 ? -37.703 9.653   -21.840 1.00 31.33  ? 539  VAL A HG22 1 
ATOM   6870  H  HG23 . VAL A 1 460 ? -38.719 9.873   -23.042 1.00 31.33  ? 539  VAL A HG23 1 
ATOM   6871  N  N    . GLY A 1 461 ? -39.114 8.001   -20.172 1.00 31.98  ? 540  GLY A N    1 
ATOM   6872  C  CA   . GLY A 1 461 ? -38.474 7.031   -19.303 1.00 30.52  ? 540  GLY A CA   1 
ATOM   6873  C  C    . GLY A 1 461 ? -39.465 6.151   -18.558 1.00 28.96  ? 540  GLY A C    1 
ATOM   6874  O  O    . GLY A 1 461 ? -39.073 5.171   -17.925 1.00 34.87  ? 540  GLY A O    1 
ATOM   6875  H  H    . GLY A 1 461 ? -39.286 7.703   -20.960 1.00 38.38  ? 540  GLY A H    1 
ATOM   6876  H  HA2  . GLY A 1 461 ? -37.896 6.459   -19.831 1.00 36.62  ? 540  GLY A HA2  1 
ATOM   6877  H  HA3  . GLY A 1 461 ? -37.929 7.497   -18.649 1.00 36.62  ? 540  GLY A HA3  1 
ATOM   6878  N  N    . ARG A 1 462 ? -40.749 6.498   -18.638 1.00 25.68  ? 541  ARG A N    1 
ATOM   6879  C  CA   . ARG A 1 462 ? -41.808 5.723   -17.992 1.00 26.34  ? 541  ARG A CA   1 
ATOM   6880  C  C    . ARG A 1 462 ? -42.659 4.981   -19.021 1.00 29.65  ? 541  ARG A C    1 
ATOM   6881  O  O    . ARG A 1 462 ? -43.523 4.184   -18.655 1.00 30.97  ? 541  ARG A O    1 
ATOM   6882  C  CB   . ARG A 1 462 ? -42.709 6.631   -17.142 1.00 31.23  ? 541  ARG A CB   1 
ATOM   6883  C  CG   . ARG A 1 462 ? -42.049 7.199   -15.887 1.00 30.40  ? 541  ARG A CG   1 
ATOM   6884  C  CD   . ARG A 1 462 ? -41.982 6.173   -14.766 1.00 21.55  ? 541  ARG A CD   1 
ATOM   6885  N  NE   . ARG A 1 462 ? -41.362 6.722   -13.559 1.00 19.81  ? 541  ARG A NE   1 
ATOM   6886  C  CZ   . ARG A 1 462 ? -42.023 7.197   -12.504 1.00 19.09  ? 541  ARG A CZ   1 
ATOM   6887  N  NH1  . ARG A 1 462 ? -43.349 7.194   -12.472 1.00 22.64  ? 541  ARG A NH1  1 
ATOM   6888  N  NH2  . ARG A 1 462 ? -41.350 7.669   -11.462 1.00 15.82  ? 541  ARG A NH2  1 
ATOM   6889  H  H    . ARG A 1 462 ? -41.036 7.186   -19.067 1.00 30.82  ? 541  ARG A H    1 
ATOM   6890  H  HA   . ARG A 1 462 ? -41.405 5.065   -17.404 1.00 31.61  ? 541  ARG A HA   1 
ATOM   6891  H  HB2  . ARG A 1 462 ? -42.995 7.380   -17.688 1.00 37.47  ? 541  ARG A HB2  1 
ATOM   6892  H  HB3  . ARG A 1 462 ? -43.484 6.120   -16.860 1.00 37.47  ? 541  ARG A HB3  1 
ATOM   6893  H  HG2  . ARG A 1 462 ? -41.144 7.475   -16.099 1.00 36.48  ? 541  ARG A HG2  1 
ATOM   6894  H  HG3  . ARG A 1 462 ? -42.564 7.959   -15.572 1.00 36.48  ? 541  ARG A HG3  1 
ATOM   6895  H  HD2  . ARG A 1 462 ? -42.882 5.888   -14.541 1.00 25.86  ? 541  ARG A HD2  1 
ATOM   6896  H  HD3  . ARG A 1 462 ? -41.454 5.415   -15.059 1.00 25.86  ? 541  ARG A HD3  1 
ATOM   6897  H  HE   . ARG A 1 462 ? -40.503 6.740   -13.529 1.00 23.78  ? 541  ARG A HE   1 
ATOM   6898  H  HH11 . ARG A 1 462 ? -43.795 6.889   -13.141 1.00 27.17  ? 541  ARG A HH11 1 
ATOM   6899  H  HH12 . ARG A 1 462 ? -43.764 7.502   -11.784 1.00 27.17  ? 541  ARG A HH12 1 
ATOM   6900  H  HH21 . ARG A 1 462 ? -40.490 7.674   -11.472 1.00 18.98  ? 541  ARG A HH21 1 
ATOM   6901  H  HH22 . ARG A 1 462 ? -41.774 7.975   -10.779 1.00 18.98  ? 541  ARG A HH22 1 
ATOM   6902  N  N    . GLY A 1 463 ? -42.415 5.239   -20.303 1.00 48.42  ? 542  GLY A N    1 
ATOM   6903  C  CA   . GLY A 1 463 ? -43.166 4.595   -21.367 1.00 50.07  ? 542  GLY A CA   1 
ATOM   6904  C  C    . GLY A 1 463 ? -42.865 3.112   -21.482 1.00 52.00  ? 542  GLY A C    1 
ATOM   6905  O  O    . GLY A 1 463 ? -42.178 2.546   -20.632 1.00 55.31  ? 542  GLY A O    1 
ATOM   6906  H  H    . GLY A 1 463 ? -41.814 5.788   -20.581 1.00 58.10  ? 542  GLY A H    1 
ATOM   6907  H  HA2  . GLY A 1 463 ? -44.116 4.703   -21.202 1.00 60.08  ? 542  GLY A HA2  1 
ATOM   6908  H  HA3  . GLY A 1 463 ? -42.952 5.018   -22.214 1.00 60.08  ? 542  GLY A HA3  1 
ATOM   6909  N  N    . THR A 1 464 ? -43.384 2.486   -22.536 1.00 77.83  ? 543  THR A N    1 
ATOM   6910  C  CA   . THR A 1 464 ? -43.172 1.062   -22.783 1.00 77.50  ? 543  THR A CA   1 
ATOM   6911  C  C    . THR A 1 464 ? -42.648 0.853   -24.199 1.00 78.69  ? 543  THR A C    1 
ATOM   6912  O  O    . THR A 1 464 ? -43.220 1.362   -25.164 1.00 79.91  ? 543  THR A O    1 
ATOM   6913  C  CB   . THR A 1 464 ? -44.476 0.253   -22.623 1.00 84.14  ? 543  THR A CB   1 
ATOM   6914  O  OG1  . THR A 1 464 ? -45.371 0.561   -23.699 1.00 96.01  ? 543  THR A OG1  1 
ATOM   6915  C  CG2  . THR A 1 464 ? -45.152 0.566   -21.294 1.00 80.98  ? 543  THR A CG2  1 
ATOM   6916  H  H    . THR A 1 464 ? -43.871 2.871   -23.132 1.00 93.40  ? 543  THR A H    1 
ATOM   6917  H  HA   . THR A 1 464 ? -42.516 0.718   -22.156 1.00 93.00  ? 543  THR A HA   1 
ATOM   6918  H  HB   . THR A 1 464 ? -44.268 -0.694  -22.641 1.00 100.97 ? 543  THR A HB   1 
ATOM   6919  H  HG1  . THR A 1 464 ? -46.083 0.123   -23.615 1.00 115.21 ? 543  THR A HG1  1 
ATOM   6920  H  HG21 . THR A 1 464 ? -45.969 0.050   -21.209 1.00 97.17  ? 543  THR A HG21 1 
ATOM   6921  H  HG22 . THR A 1 464 ? -44.559 0.342   -20.560 1.00 97.17  ? 543  THR A HG22 1 
ATOM   6922  H  HG23 . THR A 1 464 ? -45.369 1.510   -21.247 1.00 97.17  ? 543  THR A HG23 1 
ATOM   6923  N  N    . LEU A 1 469 ? -54.908 4.758   -26.146 1.00 59.83  ? 548  LEU A N    1 
ATOM   6924  C  CA   . LEU A 1 469 ? -54.669 4.110   -27.432 1.00 72.54  ? 548  LEU A CA   1 
ATOM   6925  C  C    . LEU A 1 469 ? -55.779 3.119   -27.753 1.00 74.58  ? 548  LEU A C    1 
ATOM   6926  O  O    . LEU A 1 469 ? -56.138 2.934   -28.915 1.00 77.52  ? 548  LEU A O    1 
ATOM   6927  C  CB   . LEU A 1 469 ? -53.313 3.396   -27.430 1.00 74.63  ? 548  LEU A CB   1 
ATOM   6928  C  CG   . LEU A 1 469 ? -52.962 2.566   -28.671 1.00 69.86  ? 548  LEU A CG   1 
ATOM   6929  C  CD1  . LEU A 1 469 ? -51.550 2.885   -29.152 1.00 65.04  ? 548  LEU A CD1  1 
ATOM   6930  C  CD2  . LEU A 1 469 ? -53.111 1.074   -28.382 1.00 60.46  ? 548  LEU A CD2  1 
ATOM   6931  H  HA   . LEU A 1 469 ? -54.655 4.784   -28.129 1.00 87.04  ? 548  LEU A HA   1 
ATOM   6932  H  HB2  . LEU A 1 469 ? -52.619 4.067   -27.330 1.00 89.56  ? 548  LEU A HB2  1 
ATOM   6933  H  HB3  . LEU A 1 469 ? -53.290 2.796   -26.669 1.00 89.56  ? 548  LEU A HB3  1 
ATOM   6934  H  HG   . LEU A 1 469 ? -53.578 2.793   -29.385 1.00 83.83  ? 548  LEU A HG   1 
ATOM   6935  H  HD11 . LEU A 1 469 ? -51.354 2.347   -29.935 1.00 78.05  ? 548  LEU A HD11 1 
ATOM   6936  H  HD12 . LEU A 1 469 ? -51.499 3.828   -29.376 1.00 78.05  ? 548  LEU A HD12 1 
ATOM   6937  H  HD13 . LEU A 1 469 ? -50.920 2.679   -28.443 1.00 78.05  ? 548  LEU A HD13 1 
ATOM   6938  H  HD21 . LEU A 1 469 ? -52.884 0.573   -29.181 1.00 72.55  ? 548  LEU A HD21 1 
ATOM   6939  H  HD22 . LEU A 1 469 ? -52.514 0.832   -27.657 1.00 72.55  ? 548  LEU A HD22 1 
ATOM   6940  H  HD23 . LEU A 1 469 ? -54.030 0.893   -28.128 1.00 72.55  ? 548  LEU A HD23 1 
ATOM   6941  N  N    . THR A 1 470 ? -56.314 2.473   -26.720 1.00 63.45  ? 549  THR A N    1 
ATOM   6942  C  CA   . THR A 1 470 ? -57.430 1.552   -26.898 1.00 65.45  ? 549  THR A CA   1 
ATOM   6943  C  C    . THR A 1 470 ? -58.712 2.343   -27.150 1.00 69.06  ? 549  THR A C    1 
ATOM   6944  O  O    . THR A 1 470 ? -58.709 3.575   -27.112 1.00 67.06  ? 549  THR A O    1 
ATOM   6945  C  CB   . THR A 1 470 ? -57.629 0.629   -25.673 1.00 71.86  ? 549  THR A CB   1 
ATOM   6946  O  OG1  . THR A 1 470 ? -58.278 1.346   -24.616 1.00 64.59  ? 549  THR A OG1  1 
ATOM   6947  C  CG2  . THR A 1 470 ? -56.292 0.074   -25.175 1.00 77.13  ? 549  THR A CG2  1 
ATOM   6948  H  H    . THR A 1 470 ? -56.049 2.552   -25.906 1.00 76.14  ? 549  THR A H    1 
ATOM   6949  H  HA   . THR A 1 470 ? -57.262 0.994   -27.674 1.00 78.54  ? 549  THR A HA   1 
ATOM   6950  H  HB   . THR A 1 470 ? -58.186 -0.122  -25.932 1.00 86.23  ? 549  THR A HB   1 
ATOM   6951  H  HG1  . THR A 1 470 ? -58.385 0.844   -23.951 1.00 77.50  ? 549  THR A HG1  1 
ATOM   6952  H  HG21 . THR A 1 470 ? -56.437 -0.502  -24.408 1.00 92.56  ? 549  THR A HG21 1 
ATOM   6953  H  HG22 . THR A 1 470 ? -55.864 -0.440  -25.878 1.00 92.56  ? 549  THR A HG22 1 
ATOM   6954  H  HG23 . THR A 1 470 ? -55.706 0.802   -24.916 1.00 92.56  ? 549  THR A HG23 1 
ATOM   6955  N  N    . ALA A 1 471 ? -59.803 1.630   -27.409 1.00 66.02  ? 550  ALA A N    1 
ATOM   6956  C  CA   . ALA A 1 471 ? -61.078 2.259   -27.743 1.00 68.83  ? 550  ALA A CA   1 
ATOM   6957  C  C    . ALA A 1 471 ? -61.578 3.188   -26.639 1.00 63.07  ? 550  ALA A C    1 
ATOM   6958  O  O    . ALA A 1 471 ? -61.932 4.337   -26.901 1.00 60.60  ? 550  ALA A O    1 
ATOM   6959  C  CB   . ALA A 1 471 ? -62.121 1.195   -28.038 1.00 74.40  ? 550  ALA A CB   1 
ATOM   6960  H  H    . ALA A 1 471 ? -59.832 0.770   -27.399 1.00 79.23  ? 550  ALA A H    1 
ATOM   6961  H  HA   . ALA A 1 471 ? -60.962 2.791   -28.546 1.00 82.60  ? 550  ALA A HA   1 
ATOM   6962  H  HB1  . ALA A 1 471 ? -62.960 1.629   -28.257 1.00 89.28  ? 550  ALA A HB1  1 
ATOM   6963  H  HB2  . ALA A 1 471 ? -61.820 0.658   -28.787 1.00 89.28  ? 550  ALA A HB2  1 
ATOM   6964  H  HB3  . ALA A 1 471 ? -62.232 0.636   -27.253 1.00 89.28  ? 550  ALA A HB3  1 
ATOM   6965  N  N    . LYS A 1 472 ? -61.598 2.688   -25.407 1.00 83.68  ? 551  LYS A N    1 
ATOM   6966  C  CA   . LYS A 1 472 ? -62.206 3.410   -24.293 1.00 81.12  ? 551  LYS A CA   1 
ATOM   6967  C  C    . LYS A 1 472 ? -61.301 4.508   -23.730 1.00 81.86  ? 551  LYS A C    1 
ATOM   6968  O  O    . LYS A 1 472 ? -61.772 5.405   -23.031 1.00 86.63  ? 551  LYS A O    1 
ATOM   6969  C  CB   . LYS A 1 472 ? -62.580 2.435   -23.173 1.00 80.46  ? 551  LYS A CB   1 
ATOM   6970  C  CG   . LYS A 1 472 ? -63.307 1.178   -23.645 1.00 91.54  ? 551  LYS A CG   1 
ATOM   6971  C  CD   . LYS A 1 472 ? -64.580 1.507   -24.428 1.00 98.24  ? 551  LYS A CD   1 
ATOM   6972  C  CE   . LYS A 1 472 ? -65.396 0.259   -24.739 1.00 96.07  ? 551  LYS A CE   1 
ATOM   6973  N  NZ   . LYS A 1 472 ? -65.871 -0.419  -23.503 1.00 95.29  ? 551  LYS A NZ   1 
ATOM   6974  H  H    . LYS A 1 472 ? -61.263 1.926   -25.188 1.00 100.42 ? 551  LYS A H    1 
ATOM   6975  H  HA   . LYS A 1 472 ? -63.023 3.831   -24.604 1.00 97.34  ? 551  LYS A HA   1 
ATOM   6976  H  HB2  . LYS A 1 472 ? -61.768 2.154   -22.723 1.00 96.55  ? 551  LYS A HB2  1 
ATOM   6977  H  HB3  . LYS A 1 472 ? -63.161 2.892   -22.545 1.00 96.55  ? 551  LYS A HB3  1 
ATOM   6978  H  HG2  . LYS A 1 472 ? -62.719 0.669   -24.225 1.00 109.84 ? 551  LYS A HG2  1 
ATOM   6979  H  HG3  . LYS A 1 472 ? -63.557 0.646   -22.874 1.00 109.84 ? 551  LYS A HG3  1 
ATOM   6980  H  HD2  . LYS A 1 472 ? -65.132 2.106   -23.902 1.00 117.89 ? 551  LYS A HD2  1 
ATOM   6981  H  HD3  . LYS A 1 472 ? -64.337 1.928   -25.268 1.00 117.89 ? 551  LYS A HD3  1 
ATOM   6982  H  HE2  . LYS A 1 472 ? -66.172 0.509   -25.265 1.00 115.28 ? 551  LYS A HE2  1 
ATOM   6983  H  HE3  . LYS A 1 472 ? -64.844 -0.367  -25.234 1.00 115.28 ? 551  LYS A HE3  1 
ATOM   6984  H  HZ1  . LYS A 1 472 ? -66.344 -1.142  -23.716 1.00 114.35 ? 551  LYS A HZ1  1 
ATOM   6985  H  HZ2  . LYS A 1 472 ? -65.176 -0.663  -23.004 1.00 114.35 ? 551  LYS A HZ2  1 
ATOM   6986  H  HZ3  . LYS A 1 472 ? -66.385 0.134   -23.032 1.00 114.35 ? 551  LYS A HZ3  1 
ATOM   6987  N  N    . GLU A 1 473 ? -60.007 4.434   -24.031 1.00 77.19  ? 552  GLU A N    1 
ATOM   6988  C  CA   . GLU A 1 473 ? -59.043 5.399   -23.507 1.00 75.36  ? 552  GLU A CA   1 
ATOM   6989  C  C    . GLU A 1 473 ? -59.102 6.736   -24.239 1.00 76.95  ? 552  GLU A C    1 
ATOM   6990  O  O    . GLU A 1 473 ? -58.978 7.793   -23.621 1.00 74.17  ? 552  GLU A O    1 
ATOM   6991  C  CB   . GLU A 1 473 ? -57.629 4.823   -23.572 1.00 80.76  ? 552  GLU A CB   1 
ATOM   6992  C  CG   . GLU A 1 473 ? -57.279 3.938   -22.387 1.00 85.07  ? 552  GLU A CG   1 
ATOM   6993  C  CD   . GLU A 1 473 ? -56.338 2.809   -22.756 1.00 84.19  ? 552  GLU A CD   1 
ATOM   6994  O  OE1  . GLU A 1 473 ? -56.601 1.660   -22.339 1.00 87.69  ? 552  GLU A OE1  1 
ATOM   6995  O  OE2  . GLU A 1 473 ? -55.337 3.070   -23.456 1.00 74.18  ? 552  GLU A OE2  1 
ATOM   6996  H  H    . GLU A 1 473 ? -59.661 3.833   -24.538 1.00 92.63  ? 552  GLU A H    1 
ATOM   6997  H  HA   . GLU A 1 473 ? -59.249 5.566   -22.574 1.00 90.43  ? 552  GLU A HA   1 
ATOM   6998  H  HB2  . GLU A 1 473 ? -57.545 4.288   -24.377 1.00 96.92  ? 552  GLU A HB2  1 
ATOM   6999  H  HB3  . GLU A 1 473 ? -56.993 5.555   -23.595 1.00 96.92  ? 552  GLU A HB3  1 
ATOM   7000  H  HG2  . GLU A 1 473 ? -56.847 4.478   -21.706 1.00 102.08 ? 552  GLU A HG2  1 
ATOM   7001  H  HG3  . GLU A 1 473 ? -58.093 3.547   -22.033 1.00 102.08 ? 552  GLU A HG3  1 
ATOM   7002  N  N    . LYS A 1 474 ? -59.286 6.687   -25.555 1.00 69.46  ? 553  LYS A N    1 
ATOM   7003  C  CA   . LYS A 1 474 ? -59.442 7.900   -26.353 1.00 67.84  ? 553  LYS A CA   1 
ATOM   7004  C  C    . LYS A 1 474 ? -60.703 8.650   -25.938 1.00 64.54  ? 553  LYS A C    1 
ATOM   7005  O  O    . LYS A 1 474 ? -60.788 9.872   -26.070 1.00 62.03  ? 553  LYS A O    1 
ATOM   7006  C  CB   . LYS A 1 474 ? -59.517 7.547   -27.837 1.00 65.72  ? 553  LYS A CB   1 
ATOM   7007  C  CG   . LYS A 1 474 ? -58.199 7.064   -28.422 1.00 69.32  ? 553  LYS A CG   1 
ATOM   7008  C  CD   . LYS A 1 474 ? -58.392 5.978   -29.476 1.00 75.06  ? 553  LYS A CD   1 
ATOM   7009  C  CE   . LYS A 1 474 ? -57.853 6.402   -30.835 1.00 80.07  ? 553  LYS A CE   1 
ATOM   7010  N  NZ   . LYS A 1 474 ? -58.059 5.338   -31.857 1.00 72.22  ? 553  LYS A NZ   1 
ATOM   7011  H  H    . LYS A 1 474 ? -59.324 5.960   -26.012 1.00 83.36  ? 553  LYS A H    1 
ATOM   7012  H  HA   . LYS A 1 474 ? -58.677 8.480   -26.212 1.00 81.41  ? 553  LYS A HA   1 
ATOM   7013  H  HB2  . LYS A 1 474 ? -60.171 6.841   -27.958 1.00 78.87  ? 553  LYS A HB2  1 
ATOM   7014  H  HB3  . LYS A 1 474 ? -59.789 8.336   -28.332 1.00 78.87  ? 553  LYS A HB3  1 
ATOM   7015  H  HG2  . LYS A 1 474 ? -57.745 7.812   -28.841 1.00 83.19  ? 553  LYS A HG2  1 
ATOM   7016  H  HG3  . LYS A 1 474 ? -57.651 6.699   -27.710 1.00 83.19  ? 553  LYS A HG3  1 
ATOM   7017  H  HD2  . LYS A 1 474 ? -57.919 5.178   -29.199 1.00 90.07  ? 553  LYS A HD2  1 
ATOM   7018  H  HD3  . LYS A 1 474 ? -59.339 5.791   -29.571 1.00 90.07  ? 553  LYS A HD3  1 
ATOM   7019  H  HE2  . LYS A 1 474 ? -58.318 7.200   -31.129 1.00 96.08  ? 553  LYS A HE2  1 
ATOM   7020  H  HE3  . LYS A 1 474 ? -56.901 6.575   -30.762 1.00 96.08  ? 553  LYS A HE3  1 
ATOM   7021  H  HZ1  . LYS A 1 474 ? -57.737 5.605   -32.642 1.00 86.66  ? 553  LYS A HZ1  1 
ATOM   7022  H  HZ2  . LYS A 1 474 ? -57.637 4.594   -31.610 1.00 86.66  ? 553  LYS A HZ2  1 
ATOM   7023  H  HZ3  . LYS A 1 474 ? -58.927 5.163   -31.944 1.00 86.66  ? 553  LYS A HZ3  1 
ATOM   7024  N  N    . LYS A 1 475 ? -61.682 7.905   -25.441 1.00 63.81  ? 554  LYS A N    1 
ATOM   7025  C  CA   . LYS A 1 475 ? -62.915 8.490   -24.943 1.00 66.88  ? 554  LYS A CA   1 
ATOM   7026  C  C    . LYS A 1 475 ? -62.623 9.338   -23.710 1.00 67.56  ? 554  LYS A C    1 
ATOM   7027  O  O    . LYS A 1 475 ? -63.011 10.505  -23.641 1.00 69.03  ? 554  LYS A O    1 
ATOM   7028  C  CB   . LYS A 1 475 ? -63.906 7.383   -24.592 1.00 70.21  ? 554  LYS A CB   1 
ATOM   7029  C  CG   . LYS A 1 475 ? -65.323 7.856   -24.338 1.00 77.17  ? 554  LYS A CG   1 
ATOM   7030  C  CD   . LYS A 1 475 ? -66.219 6.675   -24.013 1.00 88.22  ? 554  LYS A CD   1 
ATOM   7031  C  CE   . LYS A 1 475 ? -67.611 7.123   -23.610 1.00 95.85  ? 554  LYS A CE   1 
ATOM   7032  N  NZ   . LYS A 1 475 ? -68.573 5.986   -23.589 1.00 102.65 ? 554  LYS A NZ   1 
ATOM   7033  H  H    . LYS A 1 475 ? -61.654 7.047   -25.381 1.00 76.57  ? 554  LYS A H    1 
ATOM   7034  H  HA   . LYS A 1 475 ? -63.309 9.056   -25.625 1.00 80.25  ? 554  LYS A HA   1 
ATOM   7035  H  HB2  . LYS A 1 475 ? -63.936 6.750   -25.326 1.00 84.25  ? 554  LYS A HB2  1 
ATOM   7036  H  HB3  . LYS A 1 475 ? -63.598 6.936   -23.788 1.00 84.25  ? 554  LYS A HB3  1 
ATOM   7037  H  HG2  . LYS A 1 475 ? -65.331 8.466   -23.583 1.00 92.60  ? 554  LYS A HG2  1 
ATOM   7038  H  HG3  . LYS A 1 475 ? -65.666 8.294   -25.133 1.00 92.60  ? 554  LYS A HG3  1 
ATOM   7039  H  HD2  . LYS A 1 475 ? -66.298 6.108   -24.796 1.00 105.86 ? 554  LYS A HD2  1 
ATOM   7040  H  HD3  . LYS A 1 475 ? -65.836 6.176   -23.274 1.00 105.86 ? 554  LYS A HD3  1 
ATOM   7041  H  HE2  . LYS A 1 475 ? -67.577 7.509   -22.721 1.00 115.02 ? 554  LYS A HE2  1 
ATOM   7042  H  HE3  . LYS A 1 475 ? -67.932 7.779   -24.248 1.00 115.02 ? 554  LYS A HE3  1 
ATOM   7043  H  HZ1  . LYS A 1 475 ? -69.380 6.275   -23.350 1.00 123.18 ? 554  LYS A HZ1  1 
ATOM   7044  H  HZ2  . LYS A 1 475 ? -68.625 5.616   -24.397 1.00 123.18 ? 554  LYS A HZ2  1 
ATOM   7045  H  HZ3  . LYS A 1 475 ? -68.302 5.370   -23.006 1.00 123.18 ? 554  LYS A HZ3  1 
ATOM   7046  N  N    . THR A 1 476 ? -61.937 8.737   -22.741 1.00 63.30  ? 555  THR A N    1 
ATOM   7047  C  CA   . THR A 1 476 ? -61.554 9.429   -21.516 1.00 57.71  ? 555  THR A CA   1 
ATOM   7048  C  C    . THR A 1 476 ? -60.677 10.626  -21.857 1.00 56.26  ? 555  THR A C    1 
ATOM   7049  O  O    . THR A 1 476 ? -60.768 11.674  -21.219 1.00 57.55  ? 555  THR A O    1 
ATOM   7050  C  CB   . THR A 1 476 ? -60.784 8.492   -20.555 1.00 54.59  ? 555  THR A CB   1 
ATOM   7051  O  OG1  . THR A 1 476 ? -61.577 7.332   -20.272 1.00 54.05  ? 555  THR A OG1  1 
ATOM   7052  C  CG2  . THR A 1 476 ? -60.448 9.199   -19.245 1.00 53.38  ? 555  THR A CG2  1 
ATOM   7053  H  H    . THR A 1 476 ? -61.680 7.917   -22.771 1.00 75.96  ? 555  THR A H    1 
ATOM   7054  H  HA   . THR A 1 476 ? -62.349 9.749   -21.062 1.00 69.25  ? 555  THR A HA   1 
ATOM   7055  H  HB   . THR A 1 476 ? -59.953 8.217   -20.974 1.00 65.51  ? 555  THR A HB   1 
ATOM   7056  H  HG1  . THR A 1 476 ? -61.161 6.821   -19.750 1.00 64.86  ? 555  THR A HG1  1 
ATOM   7057  H  HG21 . THR A 1 476 ? -59.966 8.596   -18.658 1.00 64.05  ? 555  THR A HG21 1 
ATOM   7058  H  HG22 . THR A 1 476 ? -59.895 9.976   -19.421 1.00 64.05  ? 555  THR A HG22 1 
ATOM   7059  H  HG23 . THR A 1 476 ? -61.263 9.484   -18.804 1.00 64.05  ? 555  THR A HG23 1 
ATOM   7060  N  N    . GLN A 1 477 ? -59.827 10.463  -22.867 1.00 60.90  ? 556  GLN A N    1 
ATOM   7061  C  CA   . GLN A 1 477 ? -58.981 11.555  -23.327 1.00 63.81  ? 556  GLN A CA   1 
ATOM   7062  C  C    . GLN A 1 477 ? -59.844 12.727  -23.787 1.00 69.09  ? 556  GLN A C    1 
ATOM   7063  O  O    . GLN A 1 477 ? -59.690 13.844  -23.298 1.00 66.32  ? 556  GLN A O    1 
ATOM   7064  C  CB   . GLN A 1 477 ? -58.065 11.098  -24.466 1.00 56.89  ? 556  GLN A CB   1 
ATOM   7065  C  CG   . GLN A 1 477 ? -56.979 12.105  -24.823 1.00 50.83  ? 556  GLN A CG   1 
ATOM   7066  C  CD   . GLN A 1 477 ? -56.289 11.779  -26.132 1.00 59.83  ? 556  GLN A CD   1 
ATOM   7067  O  OE1  . GLN A 1 477 ? -56.665 10.834  -26.824 1.00 68.32  ? 556  GLN A OE1  1 
ATOM   7068  N  NE2  . GLN A 1 477 ? -55.273 12.563  -26.481 1.00 57.03  ? 556  GLN A NE2  1 
ATOM   7069  H  H    . GLN A 1 477 ? -59.723 9.728   -23.302 1.00 73.09  ? 556  GLN A H    1 
ATOM   7070  H  HA   . GLN A 1 477 ? -58.424 11.858  -22.593 1.00 76.57  ? 556  GLN A HA   1 
ATOM   7071  H  HB2  . GLN A 1 477 ? -57.630 10.272  -24.204 1.00 68.26  ? 556  GLN A HB2  1 
ATOM   7072  H  HB3  . GLN A 1 477 ? -58.604 10.949  -25.259 1.00 68.26  ? 556  GLN A HB3  1 
ATOM   7073  H  HG2  . GLN A 1 477 ? -57.378 12.985  -24.905 1.00 60.99  ? 556  GLN A HG2  1 
ATOM   7074  H  HG3  . GLN A 1 477 ? -56.308 12.108  -24.123 1.00 60.99  ? 556  GLN A HG3  1 
ATOM   7075  H  HE21 . GLN A 1 477 ? -55.039 13.216  -25.972 1.00 68.44  ? 556  GLN A HE21 1 
ATOM   7076  H  HE22 . GLN A 1 477 ? -54.850 12.418  -27.215 1.00 68.44  ? 556  GLN A HE22 1 
ATOM   7077  N  N    . LEU A 1 478 ? -60.753 12.464  -24.722 1.00 61.29  ? 557  LEU A N    1 
ATOM   7078  C  CA   . LEU A 1 478 ? -61.642 13.497  -25.250 1.00 58.76  ? 557  LEU A CA   1 
ATOM   7079  C  C    . LEU A 1 478 ? -62.464 14.152  -24.141 1.00 54.95  ? 557  LEU A C    1 
ATOM   7080  O  O    . LEU A 1 478 ? -62.690 15.363  -24.158 1.00 50.80  ? 557  LEU A O    1 
ATOM   7081  C  CB   . LEU A 1 478 ? -62.579 12.903  -26.300 1.00 57.87  ? 557  LEU A CB   1 
ATOM   7082  C  CG   . LEU A 1 478 ? -63.603 13.879  -26.885 1.00 61.92  ? 557  LEU A CG   1 
ATOM   7083  C  CD1  . LEU A 1 478 ? -62.908 15.017  -27.623 1.00 66.26  ? 557  LEU A CD1  1 
ATOM   7084  C  CD2  . LEU A 1 478 ? -64.579 13.159  -27.797 1.00 65.34  ? 557  LEU A CD2  1 
ATOM   7085  H  H    . LEU A 1 478 ? -60.877 11.688  -25.071 1.00 73.55  ? 557  LEU A H    1 
ATOM   7086  H  HA   . LEU A 1 478 ? -61.109 14.186  -25.676 1.00 70.52  ? 557  LEU A HA   1 
ATOM   7087  H  HB2  . LEU A 1 478 ? -62.043 12.567  -27.036 1.00 69.45  ? 557  LEU A HB2  1 
ATOM   7088  H  HB3  . LEU A 1 478 ? -63.071 12.172  -25.896 1.00 69.45  ? 557  LEU A HB3  1 
ATOM   7089  H  HG   . LEU A 1 478 ? -64.112 14.269  -26.156 1.00 74.30  ? 557  LEU A HG   1 
ATOM   7090  H  HD11 . LEU A 1 478 ? -63.580 15.617  -27.982 1.00 79.52  ? 557  LEU A HD11 1 
ATOM   7091  H  HD12 . LEU A 1 478 ? -62.335 15.493  -27.002 1.00 79.52  ? 557  LEU A HD12 1 
ATOM   7092  H  HD13 . LEU A 1 478 ? -62.376 14.645  -28.345 1.00 79.52  ? 557  LEU A HD13 1 
ATOM   7093  H  HD21 . LEU A 1 478 ? -65.213 13.801  -28.151 1.00 78.41  ? 557  LEU A HD21 1 
ATOM   7094  H  HD22 . LEU A 1 478 ? -64.086 12.746  -28.523 1.00 78.41  ? 557  LEU A HD22 1 
ATOM   7095  H  HD23 . LEU A 1 478 ? -65.046 12.479  -27.285 1.00 78.41  ? 557  LEU A HD23 1 
ATOM   7096  N  N    . ASP A 1 479 ? -62.925 13.337  -23.195 1.00 55.59  ? 558  ASP A N    1 
ATOM   7097  C  CA   . ASP A 1 479 ? -63.607 13.835  -22.005 1.00 57.59  ? 558  ASP A CA   1 
ATOM   7098  C  C    . ASP A 1 479 ? -62.675 14.767  -21.228 1.00 52.53  ? 558  ASP A C    1 
ATOM   7099  O  O    . ASP A 1 479 ? -63.081 15.843  -20.786 1.00 54.37  ? 558  ASP A O    1 
ATOM   7100  C  CB   . ASP A 1 479 ? -64.044 12.668  -21.107 1.00 61.10  ? 558  ASP A CB   1 
ATOM   7101  C  CG   . ASP A 1 479 ? -65.331 12.003  -21.577 1.00 62.73  ? 558  ASP A CG   1 
ATOM   7102  O  OD1  . ASP A 1 479 ? -66.304 12.724  -21.888 1.00 74.02  ? 558  ASP A OD1  1 
ATOM   7103  O  OD2  . ASP A 1 479 ? -65.373 10.755  -21.625 1.00 55.30  ? 558  ASP A OD2  1 
ATOM   7104  H  H    . ASP A 1 479 ? -62.853 12.481  -23.220 1.00 66.71  ? 558  ASP A H    1 
ATOM   7105  H  HA   . ASP A 1 479 ? -64.396 14.335  -22.267 1.00 69.11  ? 558  ASP A HA   1 
ATOM   7106  H  HB2  . ASP A 1 479 ? -63.345 11.995  -21.103 1.00 73.33  ? 558  ASP A HB2  1 
ATOM   7107  H  HB3  . ASP A 1 479 ? -64.190 12.999  -20.207 1.00 73.33  ? 558  ASP A HB3  1 
ATOM   7108  N  N    . ASP A 1 480 ? -61.420 14.347  -21.078 1.00 48.62  ? 559  ASP A N    1 
ATOM   7109  C  CA   . ASP A 1 480 ? -60.428 15.101  -20.312 1.00 45.01  ? 559  ASP A CA   1 
ATOM   7110  C  C    . ASP A 1 480 ? -60.084 16.453  -20.939 1.00 45.18  ? 559  ASP A C    1 
ATOM   7111  O  O    . ASP A 1 480 ? -59.966 17.451  -20.227 1.00 40.95  ? 559  ASP A O    1 
ATOM   7112  C  CB   . ASP A 1 480 ? -59.154 14.265  -20.132 1.00 46.64  ? 559  ASP A CB   1 
ATOM   7113  C  CG   . ASP A 1 480 ? -59.277 13.240  -19.015 1.00 54.38  ? 559  ASP A CG   1 
ATOM   7114  O  OD1  . ASP A 1 480 ? -60.369 13.132  -18.413 1.00 55.72  ? 559  ASP A OD1  1 
ATOM   7115  O  OD2  . ASP A 1 480 ? -58.280 12.531  -18.748 1.00 57.70  ? 559  ASP A OD2  1 
ATOM   7116  H  H    . ASP A 1 480 ? -61.114 13.618  -21.415 1.00 58.35  ? 559  ASP A H    1 
ATOM   7117  H  HA   . ASP A 1 480 ? -60.790 15.274  -19.429 1.00 54.01  ? 559  ASP A HA   1 
ATOM   7118  H  HB2  . ASP A 1 480 ? -58.968 13.789  -20.956 1.00 55.96  ? 559  ASP A HB2  1 
ATOM   7119  H  HB3  . ASP A 1 480 ? -58.416 14.856  -19.916 1.00 55.96  ? 559  ASP A HB3  1 
ATOM   7120  N  N    . ARG A 1 481 ? -59.933 16.498  -22.261 1.00 50.44  ? 560  ARG A N    1 
ATOM   7121  C  CA   . ARG A 1 481 ? -59.551 17.740  -22.924 1.00 55.24  ? 560  ARG A CA   1 
ATOM   7122  C  C    . ARG A 1 481 ? -60.642 18.798  -22.781 1.00 61.19  ? 560  ARG A C    1 
ATOM   7123  O  O    . ARG A 1 481 ? -60.364 19.944  -22.424 1.00 60.36  ? 560  ARG A O    1 
ATOM   7124  C  CB   . ARG A 1 481 ? -59.269 17.511  -24.407 1.00 59.20  ? 560  ARG A CB   1 
ATOM   7125  C  CG   . ARG A 1 481 ? -58.282 16.407  -24.702 1.00 60.39  ? 560  ARG A CG   1 
ATOM   7126  C  CD   . ARG A 1 481 ? -57.824 16.500  -26.136 1.00 64.22  ? 560  ARG A CD   1 
ATOM   7127  N  NE   . ARG A 1 481 ? -56.926 17.636  -26.355 1.00 63.98  ? 560  ARG A NE   1 
ATOM   7128  C  CZ   . ARG A 1 481 ? -55.627 17.541  -26.641 1.00 63.23  ? 560  ARG A CZ   1 
ATOM   7129  N  NH1  . ARG A 1 481 ? -55.034 16.356  -26.760 1.00 58.01  ? 560  ARG A NH1  1 
ATOM   7130  N  NH2  . ARG A 1 481 ? -54.912 18.644  -26.820 1.00 65.47  ? 560  ARG A NH2  1 
ATOM   7131  H  H    . ARG A 1 481 ? -60.044 15.830  -22.790 1.00 60.53  ? 560  ARG A H    1 
ATOM   7132  H  HA   . ARG A 1 481 ? -58.742 18.084  -22.513 1.00 66.28  ? 560  ARG A HA   1 
ATOM   7133  H  HB2  . ARG A 1 481 ? -60.103 17.284  -24.848 1.00 71.04  ? 560  ARG A HB2  1 
ATOM   7134  H  HB3  . ARG A 1 481 ? -58.914 18.331  -24.784 1.00 71.04  ? 560  ARG A HB3  1 
ATOM   7135  H  HG2  . ARG A 1 481 ? -57.508 16.499  -24.124 1.00 72.47  ? 560  ARG A HG2  1 
ATOM   7136  H  HG3  . ARG A 1 481 ? -58.707 15.546  -24.568 1.00 72.47  ? 560  ARG A HG3  1 
ATOM   7137  H  HD2  . ARG A 1 481 ? -57.347 15.688  -26.371 1.00 77.07  ? 560  ARG A HD2  1 
ATOM   7138  H  HD3  . ARG A 1 481 ? -58.597 16.611  -26.711 1.00 77.07  ? 560  ARG A HD3  1 
ATOM   7139  H  HE   . ARG A 1 481 ? -57.263 18.425  -26.295 1.00 76.77  ? 560  ARG A HE   1 
ATOM   7140  H  HH11 . ARG A 1 481 ? -55.489 15.635  -26.647 1.00 69.62  ? 560  ARG A HH11 1 
ATOM   7141  H  HH12 . ARG A 1 481 ? -54.196 16.311  -26.946 1.00 69.62  ? 560  ARG A HH12 1 
ATOM   7142  H  HH21 . ARG A 1 481 ? -55.285 19.416  -26.747 1.00 78.56  ? 560  ARG A HH21 1 
ATOM   7143  H  HH22 . ARG A 1 481 ? -54.074 18.588  -27.006 1.00 78.56  ? 560  ARG A HH22 1 
ATOM   7144  N  N    . THR A 1 482 ? -61.880 18.404  -23.069 1.00 73.62  ? 561  THR A N    1 
ATOM   7145  C  CA   . THR A 1 482 ? -63.017 19.319  -23.021 1.00 76.25  ? 561  THR A CA   1 
ATOM   7146  C  C    . THR A 1 482 ? -63.250 19.842  -21.610 1.00 70.54  ? 561  THR A C    1 
ATOM   7147  O  O    . THR A 1 482 ? -63.621 21.000  -21.425 1.00 73.39  ? 561  THR A O    1 
ATOM   7148  C  CB   . THR A 1 482 ? -64.312 18.647  -23.528 1.00 74.53  ? 561  THR A CB   1 
ATOM   7149  O  OG1  . THR A 1 482 ? -64.319 17.264  -23.152 1.00 80.77  ? 561  THR A OG1  1 
ATOM   7150  C  CG2  . THR A 1 482 ? -64.420 18.761  -25.043 1.00 74.15  ? 561  THR A CG2  1 
ATOM   7151  H  H    . THR A 1 482 ? -62.090 17.602  -23.297 1.00 88.34  ? 561  THR A H    1 
ATOM   7152  H  HA   . THR A 1 482 ? -62.832 20.080  -23.594 1.00 91.50  ? 561  THR A HA   1 
ATOM   7153  H  HB   . THR A 1 482 ? -65.080 19.091  -23.133 1.00 89.44  ? 561  THR A HB   1 
ATOM   7154  H  HG1  . THR A 1 482 ? -63.657 16.872  -23.488 1.00 96.92  ? 561  THR A HG1  1 
ATOM   7155  H  HG21 . THR A 1 482 ? -65.236 18.336  -25.350 1.00 88.98  ? 561  THR A HG21 1 
ATOM   7156  H  HG22 . THR A 1 482 ? -64.433 19.695  -25.305 1.00 88.98  ? 561  THR A HG22 1 
ATOM   7157  H  HG23 . THR A 1 482 ? -63.661 18.327  -25.463 1.00 88.98  ? 561  THR A HG23 1 
ATOM   7158  N  N    . LYS A 1 483 ? -63.032 18.987  -20.618 1.00 44.62  ? 562  LYS A N    1 
ATOM   7159  C  CA   . LYS A 1 483 ? -63.149 19.402  -19.228 1.00 49.41  ? 562  LYS A CA   1 
ATOM   7160  C  C    . LYS A 1 483 ? -62.043 20.405  -18.894 1.00 52.88  ? 562  LYS A C    1 
ATOM   7161  O  O    . LYS A 1 483 ? -62.295 21.432  -18.262 1.00 45.80  ? 562  LYS A O    1 
ATOM   7162  C  CB   . LYS A 1 483 ? -63.089 18.184  -18.304 1.00 53.40  ? 562  LYS A CB   1 
ATOM   7163  C  CG   . LYS A 1 483 ? -63.320 18.507  -16.835 1.00 62.85  ? 562  LYS A CG   1 
ATOM   7164  C  CD   . LYS A 1 483 ? -63.806 17.286  -16.059 1.00 69.45  ? 562  LYS A CD   1 
ATOM   7165  C  CE   . LYS A 1 483 ? -62.972 17.031  -14.810 1.00 65.39  ? 562  LYS A CE   1 
ATOM   7166  N  NZ   . LYS A 1 483 ? -63.003 18.169  -13.849 1.00 62.80  ? 562  LYS A NZ   1 
ATOM   7167  H  H    . LYS A 1 483 ? -62.816 18.161  -20.724 1.00 53.54  ? 562  LYS A H    1 
ATOM   7168  H  HA   . LYS A 1 483 ? -64.004 19.840  -19.097 1.00 59.30  ? 562  LYS A HA   1 
ATOM   7169  H  HB2  . LYS A 1 483 ? -63.771 17.551  -18.578 1.00 64.08  ? 562  LYS A HB2  1 
ATOM   7170  H  HB3  . LYS A 1 483 ? -62.212 17.777  -18.382 1.00 64.08  ? 562  LYS A HB3  1 
ATOM   7171  H  HG2  . LYS A 1 483 ? -62.486 18.806  -16.438 1.00 75.42  ? 562  LYS A HG2  1 
ATOM   7172  H  HG3  . LYS A 1 483 ? -63.993 19.201  -16.762 1.00 75.42  ? 562  LYS A HG3  1 
ATOM   7173  H  HD2  . LYS A 1 483 ? -64.725 17.430  -15.784 1.00 83.34  ? 562  LYS A HD2  1 
ATOM   7174  H  HD3  . LYS A 1 483 ? -63.746 16.503  -16.628 1.00 83.34  ? 562  LYS A HD3  1 
ATOM   7175  H  HE2  . LYS A 1 483 ? -63.316 16.246  -14.356 1.00 78.47  ? 562  LYS A HE2  1 
ATOM   7176  H  HE3  . LYS A 1 483 ? -62.049 16.885  -15.072 1.00 78.47  ? 562  LYS A HE3  1 
ATOM   7177  H  HZ1  . LYS A 1 483 ? -62.505 17.979  -13.137 1.00 75.37  ? 562  LYS A HZ1  1 
ATOM   7178  H  HZ2  . LYS A 1 483 ? -62.684 18.904  -14.237 1.00 75.37  ? 562  LYS A HZ2  1 
ATOM   7179  H  HZ3  . LYS A 1 483 ? -63.839 18.321  -13.585 1.00 75.37  ? 562  LYS A HZ3  1 
ATOM   7180  N  N    . ILE A 1 484 ? -60.824 20.107  -19.341 1.00 53.70  ? 563  ILE A N    1 
ATOM   7181  C  CA   . ILE A 1 484 ? -59.684 21.001  -19.148 1.00 51.74  ? 563  ILE A CA   1 
ATOM   7182  C  C    . ILE A 1 484 ? -59.920 22.318  -19.872 1.00 48.18  ? 563  ILE A C    1 
ATOM   7183  O  O    . ILE A 1 484 ? -59.774 23.392  -19.288 1.00 43.22  ? 563  ILE A O    1 
ATOM   7184  C  CB   . ILE A 1 484 ? -58.371 20.363  -19.668 1.00 39.75  ? 563  ILE A CB   1 
ATOM   7185  C  CG1  . ILE A 1 484 ? -57.903 19.271  -18.711 1.00 43.20  ? 563  ILE A CG1  1 
ATOM   7186  C  CG2  . ILE A 1 484 ? -57.245 21.407  -19.819 1.00 36.96  ? 563  ILE A CG2  1 
ATOM   7187  C  CD1  . ILE A 1 484 ? -56.841 18.367  -19.291 1.00 45.83  ? 563  ILE A CD1  1 
ATOM   7188  H  H    . ILE A 1 484 ? -60.630 19.384  -19.764 1.00 64.43  ? 563  ILE A H    1 
ATOM   7189  H  HA   . ILE A 1 484 ? -59.578 21.188  -18.202 1.00 62.09  ? 563  ILE A HA   1 
ATOM   7190  H  HB   . ILE A 1 484 ? -58.542 19.964  -20.535 1.00 47.71  ? 563  ILE A HB   1 
ATOM   7191  H  HG12 . ILE A 1 484 ? -57.536 19.688  -17.916 1.00 51.84  ? 563  ILE A HG12 1 
ATOM   7192  H  HG13 . ILE A 1 484 ? -58.664 18.719  -18.472 1.00 51.84  ? 563  ILE A HG13 1 
ATOM   7193  H  HG21 . ILE A 1 484 ? -56.446 20.964  -20.145 1.00 44.35  ? 563  ILE A HG21 1 
ATOM   7194  H  HG22 . ILE A 1 484 ? -57.528 22.087  -20.450 1.00 44.35  ? 563  ILE A HG22 1 
ATOM   7195  H  HG23 . ILE A 1 484 ? -57.071 21.810  -18.954 1.00 44.35  ? 563  ILE A HG23 1 
ATOM   7196  H  HD11 . ILE A 1 484 ? -56.596 17.702  -18.629 1.00 54.99  ? 563  ILE A HD11 1 
ATOM   7197  H  HD12 . ILE A 1 484 ? -57.195 17.932  -20.082 1.00 54.99  ? 563  ILE A HD12 1 
ATOM   7198  H  HD13 . ILE A 1 484 ? -56.066 18.902  -19.526 1.00 54.99  ? 563  ILE A HD13 1 
ATOM   7199  N  N    . THR A 1 485 ? -60.284 22.227  -21.147 1.00 54.84  ? 564  THR A N    1 
ATOM   7200  C  CA   . THR A 1 485 ? -60.475 23.413  -21.976 1.00 61.29  ? 564  THR A CA   1 
ATOM   7201  C  C    . THR A 1 485 ? -61.564 24.327  -21.408 1.00 61.74  ? 564  THR A C    1 
ATOM   7202  O  O    . THR A 1 485 ? -61.341 25.522  -21.220 1.00 57.96  ? 564  THR A O    1 
ATOM   7203  C  CB   . THR A 1 485 ? -60.846 23.045  -23.430 1.00 62.44  ? 564  THR A CB   1 
ATOM   7204  O  OG1  . THR A 1 485 ? -59.909 22.092  -23.946 1.00 57.48  ? 564  THR A OG1  1 
ATOM   7205  C  CG2  . THR A 1 485 ? -60.839 24.289  -24.313 1.00 62.92  ? 564  THR A CG2  1 
ATOM   7206  H  H    . THR A 1 485 ? -60.428 21.486  -21.559 1.00 65.80  ? 564  THR A H    1 
ATOM   7207  H  HA   . THR A 1 485 ? -59.646 23.916  -21.999 1.00 73.55  ? 564  THR A HA   1 
ATOM   7208  H  HB   . THR A 1 485 ? -61.737 22.663  -23.447 1.00 74.93  ? 564  THR A HB   1 
ATOM   7209  H  HG1  . THR A 1 485 ? -59.920 21.395  -23.477 1.00 68.98  ? 564  THR A HG1  1 
ATOM   7210  H  HG21 . THR A 1 485 ? -61.073 24.049  -25.224 1.00 75.50  ? 564  THR A HG21 1 
ATOM   7211  H  HG22 . THR A 1 485 ? -61.483 24.934  -23.982 1.00 75.50  ? 564  THR A HG22 1 
ATOM   7212  H  HG23 . THR A 1 485 ? -59.958 24.693  -24.310 1.00 75.50  ? 564  THR A HG23 1 
ATOM   7213  N  N    . GLU A 1 486 ? -62.735 23.753  -21.135 1.00 58.83  ? 565  GLU A N    1 
ATOM   7214  C  CA   . GLU A 1 486 ? -63.886 24.513  -20.643 1.00 55.08  ? 565  GLU A CA   1 
ATOM   7215  C  C    . GLU A 1 486 ? -63.601 25.192  -19.309 1.00 55.47  ? 565  GLU A C    1 
ATOM   7216  O  O    . GLU A 1 486 ? -64.076 26.299  -19.055 1.00 64.91  ? 565  GLU A O    1 
ATOM   7217  C  CB   . GLU A 1 486 ? -65.110 23.599  -20.496 1.00 59.22  ? 565  GLU A CB   1 
ATOM   7218  C  CG   . GLU A 1 486 ? -65.751 23.184  -21.821 1.00 62.81  ? 565  GLU A CG   1 
ATOM   7219  C  CD   . GLU A 1 486 ? -66.926 22.230  -21.650 1.00 70.80  ? 565  GLU A CD   1 
ATOM   7220  O  OE1  . GLU A 1 486 ? -67.207 21.815  -20.505 1.00 67.18  ? 565  GLU A OE1  1 
ATOM   7221  O  OE2  . GLU A 1 486 ? -67.570 21.897  -22.669 1.00 77.33  ? 565  GLU A OE2  1 
ATOM   7222  H  H    . GLU A 1 486 ? -62.891 22.913  -21.228 1.00 70.60  ? 565  GLU A H    1 
ATOM   7223  H  HA   . GLU A 1 486 ? -64.106 25.203  -21.289 1.00 66.09  ? 565  GLU A HA   1 
ATOM   7224  H  HB2  . GLU A 1 486 ? -64.840 22.791  -20.033 1.00 71.06  ? 565  GLU A HB2  1 
ATOM   7225  H  HB3  . GLU A 1 486 ? -65.784 24.064  -19.975 1.00 71.06  ? 565  GLU A HB3  1 
ATOM   7226  H  HG2  . GLU A 1 486 ? -66.075 23.978  -22.275 1.00 75.37  ? 565  GLU A HG2  1 
ATOM   7227  H  HG3  . GLU A 1 486 ? -65.084 22.740  -22.367 1.00 75.37  ? 565  GLU A HG3  1 
ATOM   7228  N  N    . LEU A 1 487 ? -62.834 24.522  -18.456 1.00 58.09  ? 566  LEU A N    1 
ATOM   7229  C  CA   . LEU A 1 487 ? -62.509 25.054  -17.137 1.00 61.90  ? 566  LEU A CA   1 
ATOM   7230  C  C    . LEU A 1 487 ? -61.403 26.106  -17.208 1.00 62.93  ? 566  LEU A C    1 
ATOM   7231  O  O    . LEU A 1 487 ? -61.522 27.182  -16.619 1.00 61.71  ? 566  LEU A O    1 
ATOM   7232  C  CB   . LEU A 1 487 ? -62.101 23.923  -16.189 1.00 60.54  ? 566  LEU A CB   1 
ATOM   7233  C  CG   . LEU A 1 487 ? -61.478 24.348  -14.855 1.00 62.38  ? 566  LEU A CG   1 
ATOM   7234  C  CD1  . LEU A 1 487 ? -62.365 25.323  -14.094 1.00 69.44  ? 566  LEU A CD1  1 
ATOM   7235  C  CD2  . LEU A 1 487 ? -61.209 23.132  -13.997 1.00 62.30  ? 566  LEU A CD2  1 
ATOM   7236  H  H    . LEU A 1 487 ? -62.486 23.752  -18.618 1.00 69.70  ? 566  LEU A H    1 
ATOM   7237  H  HA   . LEU A 1 487 ? -63.300 25.479  -16.769 1.00 74.28  ? 566  LEU A HA   1 
ATOM   7238  H  HB2  . LEU A 1 487 ? -62.890 23.398  -15.984 1.00 72.65  ? 566  LEU A HB2  1 
ATOM   7239  H  HB3  . LEU A 1 487 ? -61.452 23.363  -16.644 1.00 72.65  ? 566  LEU A HB3  1 
ATOM   7240  H  HG   . LEU A 1 487 ? -60.630 24.786  -15.028 1.00 74.85  ? 566  LEU A HG   1 
ATOM   7241  H  HD11 . LEU A 1 487 ? -61.930 25.561  -13.260 1.00 83.33  ? 566  LEU A HD11 1 
ATOM   7242  H  HD12 . LEU A 1 487 ? -62.500 26.116  -14.636 1.00 83.33  ? 566  LEU A HD12 1 
ATOM   7243  H  HD13 . LEU A 1 487 ? -63.218 24.897  -13.912 1.00 83.33  ? 566  LEU A HD13 1 
ATOM   7244  H  HD21 . LEU A 1 487 ? -60.815 23.419  -13.158 1.00 74.76  ? 566  LEU A HD21 1 
ATOM   7245  H  HD22 . LEU A 1 487 ? -62.046 22.672  -13.830 1.00 74.76  ? 566  LEU A HD22 1 
ATOM   7246  H  HD23 . LEU A 1 487 ? -60.596 22.544  -14.467 1.00 74.76  ? 566  LEU A HD23 1 
ATOM   7247  N  N    . PHE A 1 488 ? -60.335 25.800  -17.940 1.00 59.78  ? 567  PHE A N    1 
ATOM   7248  C  CA   . PHE A 1 488 ? -59.138 26.641  -17.939 1.00 56.68  ? 567  PHE A CA   1 
ATOM   7249  C  C    . PHE A 1 488 ? -59.166 27.749  -18.989 1.00 56.90  ? 567  PHE A C    1 
ATOM   7250  O  O    . PHE A 1 488 ? -58.358 28.674  -18.936 1.00 54.01  ? 567  PHE A O    1 
ATOM   7251  C  CB   . PHE A 1 488 ? -57.877 25.778  -18.076 1.00 49.49  ? 567  PHE A CB   1 
ATOM   7252  C  CG   . PHE A 1 488 ? -57.529 25.031  -16.818 1.00 43.19  ? 567  PHE A CG   1 
ATOM   7253  C  CD1  . PHE A 1 488 ? -57.006 25.704  -15.726 1.00 42.46  ? 567  PHE A CD1  1 
ATOM   7254  C  CD2  . PHE A 1 488 ? -57.746 23.667  -16.717 1.00 43.39  ? 567  PHE A CD2  1 
ATOM   7255  C  CE1  . PHE A 1 488 ? -56.701 25.030  -14.558 1.00 45.13  ? 567  PHE A CE1  1 
ATOM   7256  C  CE2  . PHE A 1 488 ? -57.439 22.986  -15.550 1.00 43.98  ? 567  PHE A CE2  1 
ATOM   7257  C  CZ   . PHE A 1 488 ? -56.912 23.669  -14.472 1.00 41.26  ? 567  PHE A CZ   1 
ATOM   7258  H  H    . PHE A 1 488 ? -60.278 25.108  -18.448 1.00 71.74  ? 567  PHE A H    1 
ATOM   7259  H  HA   . PHE A 1 488 ? -59.085 27.078  -17.074 1.00 68.02  ? 567  PHE A HA   1 
ATOM   7260  H  HB2  . PHE A 1 488 ? -58.017 25.126  -18.781 1.00 59.39  ? 567  PHE A HB2  1 
ATOM   7261  H  HB3  . PHE A 1 488 ? -57.127 26.351  -18.300 1.00 59.39  ? 567  PHE A HB3  1 
ATOM   7262  H  HD1  . PHE A 1 488 ? -56.861 26.621  -15.778 1.00 50.95  ? 567  PHE A HD1  1 
ATOM   7263  H  HD2  . PHE A 1 488 ? -58.101 23.202  -17.441 1.00 52.06  ? 567  PHE A HD2  1 
ATOM   7264  H  HE1  . PHE A 1 488 ? -56.344 25.493  -13.834 1.00 54.15  ? 567  PHE A HE1  1 
ATOM   7265  H  HE2  . PHE A 1 488 ? -57.584 22.069  -15.494 1.00 52.78  ? 567  PHE A HE2  1 
ATOM   7266  H  HZ   . PHE A 1 488 ? -56.704 23.213  -13.688 1.00 49.51  ? 567  PHE A HZ   1 
ATOM   7267  N  N    . ALA A 1 489 ? -60.099 27.670  -19.931 1.00 63.06  ? 568  ALA A N    1 
ATOM   7268  C  CA   . ALA A 1 489 ? -60.297 28.771  -20.864 1.00 63.79  ? 568  ALA A CA   1 
ATOM   7269  C  C    . ALA A 1 489 ? -60.762 29.984  -20.066 1.00 73.65  ? 568  ALA A C    1 
ATOM   7270  O  O    . ALA A 1 489 ? -60.391 31.120  -20.362 1.00 74.57  ? 568  ALA A O    1 
ATOM   7271  C  CB   . ALA A 1 489 ? -61.321 28.406  -21.923 1.00 63.67  ? 568  ALA A CB   1 
ATOM   7272  H  H    . ALA A 1 489 ? -60.623 26.999  -20.051 1.00 75.67  ? 568  ALA A H    1 
ATOM   7273  H  HA   . ALA A 1 489 ? -59.458 28.986  -21.301 1.00 76.55  ? 568  ALA A HA   1 
ATOM   7274  H  HB1  . ALA A 1 489 ? -61.431 29.157  -22.527 1.00 76.41  ? 568  ALA A HB1  1 
ATOM   7275  H  HB2  . ALA A 1 489 ? -61.005 27.630  -22.413 1.00 76.41  ? 568  ALA A HB2  1 
ATOM   7276  H  HB3  . ALA A 1 489 ? -62.165 28.203  -21.490 1.00 76.41  ? 568  ALA A HB3  1 
ATOM   7277  N  N    . VAL A 1 490 ? -61.563 29.718  -19.036 1.00 57.51  ? 569  VAL A N    1 
ATOM   7278  C  CA   . VAL A 1 490 ? -62.126 30.756  -18.176 1.00 52.85  ? 569  VAL A CA   1 
ATOM   7279  C  C    . VAL A 1 490 ? -61.205 31.085  -17.005 1.00 53.05  ? 569  VAL A C    1 
ATOM   7280  O  O    . VAL A 1 490 ? -61.119 32.239  -16.580 1.00 55.95  ? 569  VAL A O    1 
ATOM   7281  C  CB   . VAL A 1 490 ? -63.487 30.307  -17.588 1.00 58.10  ? 569  VAL A CB   1 
ATOM   7282  C  CG1  . VAL A 1 490 ? -64.120 31.421  -16.750 1.00 51.55  ? 569  VAL A CG1  1 
ATOM   7283  C  CG2  . VAL A 1 490 ? -64.433 29.870  -18.697 1.00 62.02  ? 569  VAL A CG2  1 
ATOM   7284  H  H    . VAL A 1 490 ? -61.801 28.923  -18.810 1.00 69.02  ? 569  VAL A H    1 
ATOM   7285  H  HA   . VAL A 1 490 ? -62.266 31.564  -18.694 1.00 63.43  ? 569  VAL A HA   1 
ATOM   7286  H  HB   . VAL A 1 490 ? -63.340 29.545  -17.006 1.00 69.71  ? 569  VAL A HB   1 
ATOM   7287  H  HG11 . VAL A 1 490 ? -64.968 31.107  -16.398 1.00 61.86  ? 569  VAL A HG11 1 
ATOM   7288  H  HG12 . VAL A 1 490 ? -63.522 31.646  -16.021 1.00 61.86  ? 569  VAL A HG12 1 
ATOM   7289  H  HG13 . VAL A 1 490 ? -64.262 32.197  -17.314 1.00 61.86  ? 569  VAL A HG13 1 
ATOM   7290  H  HG21 . VAL A 1 490 ? -65.275 29.595  -18.303 1.00 74.42  ? 569  VAL A HG21 1 
ATOM   7291  H  HG22 . VAL A 1 490 ? -64.578 30.616  -19.300 1.00 74.42  ? 569  VAL A HG22 1 
ATOM   7292  H  HG23 . VAL A 1 490 ? -64.034 29.128  -19.178 1.00 74.42  ? 569  VAL A HG23 1 
ATOM   7293  N  N    . ALA A 1 491 ? -60.524 30.066  -16.487 1.00 56.96  ? 570  ALA A N    1 
ATOM   7294  C  CA   . ALA A 1 491 ? -59.751 30.200  -15.255 1.00 55.47  ? 570  ALA A CA   1 
ATOM   7295  C  C    . ALA A 1 491 ? -58.337 30.708  -15.497 1.00 54.42  ? 570  ALA A C    1 
ATOM   7296  O  O    . ALA A 1 491 ? -57.774 31.403  -14.652 1.00 51.49  ? 570  ALA A O    1 
ATOM   7297  C  CB   . ALA A 1 491 ? -59.703 28.871  -14.522 1.00 53.66  ? 570  ALA A CB   1 
ATOM   7298  H  H    . ALA A 1 491 ? -60.492 29.280  -16.834 1.00 68.36  ? 570  ALA A H    1 
ATOM   7299  H  HA   . ALA A 1 491 ? -60.198 30.838  -14.677 1.00 66.57  ? 570  ALA A HA   1 
ATOM   7300  H  HB1  . ALA A 1 491 ? -59.187 28.979  -13.708 1.00 64.39  ? 570  ALA A HB1  1 
ATOM   7301  H  HB2  . ALA A 1 491 ? -60.608 28.597  -14.307 1.00 64.39  ? 570  ALA A HB2  1 
ATOM   7302  H  HB3  . ALA A 1 491 ? -59.284 28.210  -15.095 1.00 64.39  ? 570  ALA A HB3  1 
ATOM   7303  N  N    . LEU A 1 492 ? -57.757 30.361  -16.642 1.00 52.11  ? 571  LEU A N    1 
ATOM   7304  C  CA   . LEU A 1 492 ? -56.360 30.707  -16.909 1.00 53.02  ? 571  LEU A CA   1 
ATOM   7305  C  C    . LEU A 1 492 ? -56.094 32.216  -16.918 1.00 54.57  ? 571  LEU A C    1 
ATOM   7306  O  O    . LEU A 1 492 ? -55.092 32.663  -16.358 1.00 48.48  ? 571  LEU A O    1 
ATOM   7307  C  CB   . LEU A 1 492 ? -55.863 30.065  -18.212 1.00 50.68  ? 571  LEU A CB   1 
ATOM   7308  C  CG   . LEU A 1 492 ? -54.417 30.376  -18.615 1.00 50.26  ? 571  LEU A CG   1 
ATOM   7309  C  CD1  . LEU A 1 492 ? -53.434 30.020  -17.502 1.00 42.25  ? 571  LEU A CD1  1 
ATOM   7310  C  CD2  . LEU A 1 492 ? -54.067 29.631  -19.893 1.00 54.82  ? 571  LEU A CD2  1 
ATOM   7311  H  H    . LEU A 1 492 ? -58.145 29.929  -17.276 1.00 62.53  ? 571  LEU A H    1 
ATOM   7312  H  HA   . LEU A 1 492 ? -55.823 30.334  -16.192 1.00 63.62  ? 571  LEU A HA   1 
ATOM   7313  H  HB2  . LEU A 1 492 ? -55.936 29.102  -18.123 1.00 60.81  ? 571  LEU A HB2  1 
ATOM   7314  H  HB3  . LEU A 1 492 ? -56.434 30.366  -18.935 1.00 60.81  ? 571  LEU A HB3  1 
ATOM   7315  H  HG   . LEU A 1 492 ? -54.336 31.326  -18.791 1.00 60.31  ? 571  LEU A HG   1 
ATOM   7316  H  HD11 . LEU A 1 492 ? -52.535 30.231  -17.797 1.00 50.70  ? 571  LEU A HD11 1 
ATOM   7317  H  HD12 . LEU A 1 492 ? -53.654 30.536  -16.711 1.00 50.70  ? 571  LEU A HD12 1 
ATOM   7318  H  HD13 . LEU A 1 492 ? -53.506 29.072  -17.310 1.00 50.70  ? 571  LEU A HD13 1 
ATOM   7319  H  HD21 . LEU A 1 492 ? -53.150 29.836  -20.137 1.00 65.79  ? 571  LEU A HD21 1 
ATOM   7320  H  HD22 . LEU A 1 492 ? -54.163 28.678  -19.740 1.00 65.79  ? 571  LEU A HD22 1 
ATOM   7321  H  HD23 . LEU A 1 492 ? -54.668 29.916  -20.599 1.00 65.79  ? 571  LEU A HD23 1 
ATOM   7322  N  N    . PRO A 1 493 ? -56.982 33.008  -17.550 1.00 56.22  ? 572  PRO A N    1 
ATOM   7323  C  CA   . PRO A 1 493 ? -56.763 34.460  -17.544 1.00 51.04  ? 572  PRO A CA   1 
ATOM   7324  C  C    . PRO A 1 493 ? -56.749 35.032  -16.129 1.00 49.14  ? 572  PRO A C    1 
ATOM   7325  O  O    . PRO A 1 493 ? -55.949 35.921  -15.834 1.00 45.50  ? 572  PRO A O    1 
ATOM   7326  C  CB   . PRO A 1 493 ? -57.954 34.999  -18.341 1.00 53.26  ? 572  PRO A CB   1 
ATOM   7327  C  CG   . PRO A 1 493 ? -58.389 33.845  -19.202 1.00 49.82  ? 572  PRO A CG   1 
ATOM   7328  C  CD   . PRO A 1 493 ? -58.151 32.632  -18.366 1.00 53.43  ? 572  PRO A CD   1 
ATOM   7329  H  HA   . PRO A 1 493 ? -55.936 34.685  -17.998 1.00 61.25  ? 572  PRO A HA   1 
ATOM   7330  H  HB2  . PRO A 1 493 ? -58.664 35.262  -17.734 1.00 63.91  ? 572  PRO A HB2  1 
ATOM   7331  H  HB3  . PRO A 1 493 ? -57.672 35.749  -18.888 1.00 63.91  ? 572  PRO A HB3  1 
ATOM   7332  H  HG2  . PRO A 1 493 ? -59.330 33.933  -19.419 1.00 59.79  ? 572  PRO A HG2  1 
ATOM   7333  H  HG3  . PRO A 1 493 ? -57.851 33.817  -20.009 1.00 59.79  ? 572  PRO A HG3  1 
ATOM   7334  H  HD2  . PRO A 1 493 ? -58.918 32.456  -17.798 1.00 64.12  ? 572  PRO A HD2  1 
ATOM   7335  H  HD3  . PRO A 1 493 ? -57.941 31.869  -18.927 1.00 64.12  ? 572  PRO A HD3  1 
ATOM   7336  N  N    . GLN A 1 494 ? -57.609 34.508  -15.262 1.00 51.25  ? 573  GLN A N    1 
ATOM   7337  C  CA   . GLN A 1 494 ? -57.630 34.928  -13.866 1.00 54.41  ? 573  GLN A CA   1 
ATOM   7338  C  C    . GLN A 1 494 ? -56.364 34.447  -13.174 1.00 52.80  ? 573  GLN A C    1 
ATOM   7339  O  O    . GLN A 1 494 ? -55.821 35.131  -12.307 1.00 55.35  ? 573  GLN A O    1 
ATOM   7340  C  CB   . GLN A 1 494 ? -58.838 34.346  -13.134 1.00 58.84  ? 573  GLN A CB   1 
ATOM   7341  C  CG   . GLN A 1 494 ? -60.152 34.476  -13.868 1.00 63.28  ? 573  GLN A CG   1 
ATOM   7342  C  CD   . GLN A 1 494 ? -61.284 33.802  -13.120 1.00 62.53  ? 573  GLN A CD   1 
ATOM   7343  O  OE1  . GLN A 1 494 ? -61.995 32.959  -13.669 1.00 64.11  ? 573  GLN A OE1  1 
ATOM   7344  N  NE2  . GLN A 1 494 ? -61.450 34.162  -11.852 1.00 62.75  ? 573  GLN A NE2  1 
ATOM   7345  H  H    . GLN A 1 494 ? -58.192 33.907  -15.457 1.00 61.50  ? 573  GLN A H    1 
ATOM   7346  H  HA   . GLN A 1 494 ? -57.668 35.896  -13.813 1.00 65.29  ? 573  GLN A HA   1 
ATOM   7347  H  HB2  . GLN A 1 494 ? -58.680 33.401  -12.981 1.00 70.61  ? 573  GLN A HB2  1 
ATOM   7348  H  HB3  . GLN A 1 494 ? -58.932 34.802  -12.283 1.00 70.61  ? 573  GLN A HB3  1 
ATOM   7349  H  HG2  . GLN A 1 494 ? -60.372 35.415  -13.967 1.00 75.93  ? 573  GLN A HG2  1 
ATOM   7350  H  HG3  . GLN A 1 494 ? -60.074 34.057  -14.739 1.00 75.93  ? 573  GLN A HG3  1 
ATOM   7351  H  HE21 . GLN A 1 494 ? -60.929 34.749  -11.500 1.00 75.30  ? 573  GLN A HE21 1 
ATOM   7352  H  HE22 . GLN A 1 494 ? -62.078 33.809  -11.383 1.00 75.30  ? 573  GLN A HE22 1 
ATOM   7353  N  N    . LEU A 1 495 ? -55.902 33.262  -13.564 1.00 48.55  ? 574  LEU A N    1 
ATOM   7354  C  CA   . LEU A 1 495 ? -54.727 32.650  -12.951 1.00 46.24  ? 574  LEU A CA   1 
ATOM   7355  C  C    . LEU A 1 495 ? -53.452 33.419  -13.278 1.00 46.74  ? 574  LEU A C    1 
ATOM   7356  O  O    . LEU A 1 495 ? -52.601 33.617  -12.412 1.00 43.48  ? 574  LEU A O    1 
ATOM   7357  C  CB   . LEU A 1 495 ? -54.582 31.197  -13.408 1.00 44.89  ? 574  LEU A CB   1 
ATOM   7358  C  CG   . LEU A 1 495 ? -55.310 30.144  -12.569 1.00 45.35  ? 574  LEU A CG   1 
ATOM   7359  C  CD1  . LEU A 1 495 ? -55.325 28.795  -13.293 1.00 37.17  ? 574  LEU A CD1  1 
ATOM   7360  C  CD2  . LEU A 1 495 ? -54.684 30.018  -11.175 1.00 43.33  ? 574  LEU A CD2  1 
ATOM   7361  H  H    . LEU A 1 495 ? -56.255 32.787  -14.188 1.00 58.26  ? 574  LEU A H    1 
ATOM   7362  H  HA   . LEU A 1 495 ? -54.838 32.651  -11.987 1.00 55.49  ? 574  LEU A HA   1 
ATOM   7363  H  HB2  . LEU A 1 495 ? -54.921 31.128  -14.314 1.00 53.87  ? 574  LEU A HB2  1 
ATOM   7364  H  HB3  . LEU A 1 495 ? -53.639 30.969  -13.399 1.00 53.87  ? 574  LEU A HB3  1 
ATOM   7365  H  HG   . LEU A 1 495 ? -56.232 30.425  -12.453 1.00 54.42  ? 574  LEU A HG   1 
ATOM   7366  H  HD11 . LEU A 1 495 ? -55.791 28.147  -12.742 1.00 44.60  ? 574  LEU A HD11 1 
ATOM   7367  H  HD12 . LEU A 1 495 ? -55.782 28.898  -14.142 1.00 44.60  ? 574  LEU A HD12 1 
ATOM   7368  H  HD13 . LEU A 1 495 ? -54.411 28.507  -13.441 1.00 44.60  ? 574  LEU A HD13 1 
ATOM   7369  H  HD21 . LEU A 1 495 ? -55.168 29.345  -10.671 1.00 52.00  ? 574  LEU A HD21 1 
ATOM   7370  H  HD22 . LEU A 1 495 ? -53.754 29.757  -11.269 1.00 52.00  ? 574  LEU A HD22 1 
ATOM   7371  H  HD23 . LEU A 1 495 ? -54.743 30.875  -10.724 1.00 52.00  ? 574  LEU A HD23 1 
ATOM   7372  N  N    . LEU A 1 496 ? -53.319 33.844  -14.529 1.00 48.70  ? 575  LEU A N    1 
ATOM   7373  C  CA   . LEU A 1 496 ? -52.170 34.641  -14.928 1.00 50.28  ? 575  LEU A CA   1 
ATOM   7374  C  C    . LEU A 1 496 ? -52.212 35.983  -14.208 1.00 54.10  ? 575  LEU A C    1 
ATOM   7375  O  O    . LEU A 1 496 ? -51.193 36.454  -13.710 1.00 53.79  ? 575  LEU A O    1 
ATOM   7376  C  CB   . LEU A 1 496 ? -52.145 34.843  -16.447 1.00 52.22  ? 575  LEU A CB   1 
ATOM   7377  C  CG   . LEU A 1 496 ? -51.753 33.625  -17.289 1.00 51.05  ? 575  LEU A CG   1 
ATOM   7378  C  CD1  . LEU A 1 496 ? -51.936 33.921  -18.771 1.00 48.80  ? 575  LEU A CD1  1 
ATOM   7379  C  CD2  . LEU A 1 496 ? -50.316 33.204  -17.001 1.00 48.58  ? 575  LEU A CD2  1 
ATOM   7380  H  H    . LEU A 1 496 ? -53.878 33.685  -15.162 1.00 58.43  ? 575  LEU A H    1 
ATOM   7381  H  HA   . LEU A 1 496 ? -51.355 34.182  -14.669 1.00 60.34  ? 575  LEU A HA   1 
ATOM   7382  H  HB2  . LEU A 1 496 ? -53.031 35.116  -16.731 1.00 62.66  ? 575  LEU A HB2  1 
ATOM   7383  H  HB3  . LEU A 1 496 ? -51.512 35.549  -16.649 1.00 62.66  ? 575  LEU A HB3  1 
ATOM   7384  H  HG   . LEU A 1 496 ? -52.333 32.883  -17.059 1.00 61.26  ? 575  LEU A HG   1 
ATOM   7385  H  HD11 . LEU A 1 496 ? -51.682 33.137  -19.283 1.00 58.56  ? 575  LEU A HD11 1 
ATOM   7386  H  HD12 . LEU A 1 496 ? -52.867 34.138  -18.937 1.00 58.56  ? 575  LEU A HD12 1 
ATOM   7387  H  HD13 . LEU A 1 496 ? -51.373 34.673  -19.015 1.00 58.56  ? 575  LEU A HD13 1 
ATOM   7388  H  HD21 . LEU A 1 496 ? -50.098 32.434  -17.548 1.00 58.30  ? 575  LEU A HD21 1 
ATOM   7389  H  HD22 . LEU A 1 496 ? -49.723 33.941  -17.215 1.00 58.30  ? 575  LEU A HD22 1 
ATOM   7390  H  HD23 . LEU A 1 496 ? -50.237 32.977  -16.062 1.00 58.30  ? 575  LEU A HD23 1 
ATOM   7391  N  N    . ALA A 1 497 ? -53.399 36.581  -14.144 1.00 54.92  ? 576  ALA A N    1 
ATOM   7392  C  CA   . ALA A 1 497 ? -53.590 37.851  -13.448 1.00 48.87  ? 576  ALA A CA   1 
ATOM   7393  C  C    . ALA A 1 497 ? -53.051 37.796  -12.021 1.00 49.80  ? 576  ALA A C    1 
ATOM   7394  O  O    . ALA A 1 497 ? -52.272 38.656  -11.608 1.00 47.10  ? 576  ALA A O    1 
ATOM   7395  C  CB   . ALA A 1 497 ? -55.064 38.222  -13.434 1.00 48.94  ? 576  ALA A CB   1 
ATOM   7396  H  H    . ALA A 1 497 ? -54.117 36.269  -14.501 1.00 65.90  ? 576  ALA A H    1 
ATOM   7397  H  HA   . ALA A 1 497 ? -53.110 38.547  -13.923 1.00 58.65  ? 576  ALA A HA   1 
ATOM   7398  H  HB1  . ALA A 1 497 ? -55.171 39.067  -12.968 1.00 58.73  ? 576  ALA A HB1  1 
ATOM   7399  H  HB2  . ALA A 1 497 ? -55.377 38.306  -14.348 1.00 58.73  ? 576  ALA A HB2  1 
ATOM   7400  H  HB3  . ALA A 1 497 ? -55.560 37.526  -12.976 1.00 58.73  ? 576  ALA A HB3  1 
ATOM   7401  N  N    . LYS A 1 498 ? -53.464 36.773  -11.279 1.00 52.04  ? 577  LYS A N    1 
ATOM   7402  C  CA   . LYS A 1 498 ? -53.071 36.627  -9.883  1.00 47.81  ? 577  LYS A CA   1 
ATOM   7403  C  C    . LYS A 1 498 ? -51.569 36.434  -9.713  1.00 49.49  ? 577  LYS A C    1 
ATOM   7404  O  O    . LYS A 1 498 ? -50.961 37.051  -8.840  1.00 53.87  ? 577  LYS A O    1 
ATOM   7405  C  CB   . LYS A 1 498 ? -53.812 35.448  -9.248  1.00 46.56  ? 577  LYS A CB   1 
ATOM   7406  C  CG   . LYS A 1 498 ? -53.409 35.173  -7.806  1.00 47.80  ? 577  LYS A CG   1 
ATOM   7407  C  CD   . LYS A 1 498 ? -54.556 34.581  -6.991  1.00 46.69  ? 577  LYS A CD   1 
ATOM   7408  C  CE   . LYS A 1 498 ? -54.091 34.139  -5.608  1.00 57.93  ? 577  LYS A CE   1 
ATOM   7409  N  NZ   . LYS A 1 498 ? -53.230 35.153  -4.933  1.00 59.08  ? 577  LYS A NZ   1 
ATOM   7410  H  H    . LYS A 1 498 ? -53.977 36.145  -11.564 1.00 62.44  ? 577  LYS A H    1 
ATOM   7411  H  HA   . LYS A 1 498 ? -53.323 37.431  -9.402  1.00 57.37  ? 577  LYS A HA   1 
ATOM   7412  H  HB2  . LYS A 1 498 ? -54.764 35.635  -9.260  1.00 55.87  ? 577  LYS A HB2  1 
ATOM   7413  H  HB3  . LYS A 1 498 ? -53.627 34.648  -9.766  1.00 55.87  ? 577  LYS A HB3  1 
ATOM   7414  H  HG2  . LYS A 1 498 ? -52.674 34.540  -7.797  1.00 57.36  ? 577  LYS A HG2  1 
ATOM   7415  H  HG3  . LYS A 1 498 ? -53.139 36.005  -7.387  1.00 57.36  ? 577  LYS A HG3  1 
ATOM   7416  H  HD2  . LYS A 1 498 ? -55.248 35.251  -6.880  1.00 56.02  ? 577  LYS A HD2  1 
ATOM   7417  H  HD3  . LYS A 1 498 ? -54.910 33.806  -7.454  1.00 56.02  ? 577  LYS A HD3  1 
ATOM   7418  H  HE2  . LYS A 1 498 ? -54.868 33.987  -5.048  1.00 69.52  ? 577  LYS A HE2  1 
ATOM   7419  H  HE3  . LYS A 1 498 ? -53.578 33.321  -5.693  1.00 69.52  ? 577  LYS A HE3  1 
ATOM   7420  H  HZ1  . LYS A 1 498 ? -52.982 34.857  -4.132  1.00 70.90  ? 577  LYS A HZ1  1 
ATOM   7421  H  HZ2  . LYS A 1 498 ? -52.502 35.308  -5.422  1.00 70.90  ? 577  LYS A HZ2  1 
ATOM   7422  H  HZ3  . LYS A 1 498 ? -53.679 35.915  -4.833  1.00 70.90  ? 577  LYS A HZ3  1 
ATOM   7423  N  N    . TYR A 1 499 ? -50.976 35.592  -10.557 1.00 53.01  ? 578  TYR A N    1 
ATOM   7424  C  CA   . TYR A 1 499 ? -49.599 35.136  -10.354 1.00 50.31  ? 578  TYR A CA   1 
ATOM   7425  C  C    . TYR A 1 499 ? -48.596 35.697  -11.362 1.00 47.86  ? 578  TYR A C    1 
ATOM   7426  O  O    . TYR A 1 499 ? -47.459 35.235  -11.415 1.00 48.87  ? 578  TYR A O    1 
ATOM   7427  C  CB   . TYR A 1 499 ? -49.551 33.603  -10.398 1.00 41.52  ? 578  TYR A CB   1 
ATOM   7428  C  CG   . TYR A 1 499 ? -50.422 32.929  -9.355  1.00 36.37  ? 578  TYR A CG   1 
ATOM   7429  C  CD1  . TYR A 1 499 ? -50.048 32.906  -8.015  1.00 37.45  ? 578  TYR A CD1  1 
ATOM   7430  C  CD2  . TYR A 1 499 ? -51.616 32.314  -9.712  1.00 38.27  ? 578  TYR A CD2  1 
ATOM   7431  C  CE1  . TYR A 1 499 ? -50.843 32.295  -7.061  1.00 39.26  ? 578  TYR A CE1  1 
ATOM   7432  C  CE2  . TYR A 1 499 ? -52.419 31.701  -8.762  1.00 43.50  ? 578  TYR A CE2  1 
ATOM   7433  C  CZ   . TYR A 1 499 ? -52.026 31.695  -7.440  1.00 45.35  ? 578  TYR A CZ   1 
ATOM   7434  O  OH   . TYR A 1 499 ? -52.817 31.082  -6.498  1.00 49.22  ? 578  TYR A OH   1 
ATOM   7435  H  H    . TYR A 1 499 ? -51.350 35.268  -11.260 1.00 63.61  ? 578  TYR A H    1 
ATOM   7436  H  HA   . TYR A 1 499 ? -49.311 35.413  -9.470  1.00 60.37  ? 578  TYR A HA   1 
ATOM   7437  H  HB2  . TYR A 1 499 ? -49.852 33.306  -11.271 1.00 49.82  ? 578  TYR A HB2  1 
ATOM   7438  H  HB3  . TYR A 1 499 ? -48.637 33.315  -10.250 1.00 49.82  ? 578  TYR A HB3  1 
ATOM   7439  H  HD1  . TYR A 1 499 ? -49.253 33.312  -7.756  1.00 44.94  ? 578  TYR A HD1  1 
ATOM   7440  H  HD2  . TYR A 1 499 ? -51.885 32.319  -10.602 1.00 45.92  ? 578  TYR A HD2  1 
ATOM   7441  H  HE1  . TYR A 1 499 ? -50.580 32.288  -6.169  1.00 47.11  ? 578  TYR A HE1  1 
ATOM   7442  H  HE2  . TYR A 1 499 ? -53.216 31.293  -9.016  1.00 52.20  ? 578  TYR A HE2  1 
ATOM   7443  H  HH   . TYR A 1 499 ? -53.502 30.760  -6.863  1.00 59.07  ? 578  TYR A HH   1 
ATOM   7444  N  N    . SER A 1 500 ? -49.000 36.703  -12.133 1.00 54.31  ? 579  SER A N    1 
ATOM   7445  C  CA   . SER A 1 500 ? -48.165 37.223  -13.219 1.00 52.48  ? 579  SER A CA   1 
ATOM   7446  C  C    . SER A 1 500 ? -46.749 37.631  -12.798 1.00 54.86  ? 579  SER A C    1 
ATOM   7447  O  O    . SER A 1 500 ? -45.812 37.531  -13.591 1.00 50.73  ? 579  SER A O    1 
ATOM   7448  C  CB   . SER A 1 500 ? -48.836 38.426  -13.885 1.00 52.16  ? 579  SER A CB   1 
ATOM   7449  O  OG   . SER A 1 500 ? -49.185 39.403  -12.920 1.00 57.10  ? 579  SER A OG   1 
ATOM   7450  H  H    . SER A 1 500 ? -49.756 37.106  -12.049 1.00 65.17  ? 579  SER A H    1 
ATOM   7451  H  HA   . SER A 1 500 ? -48.077 36.531  -13.893 1.00 62.98  ? 579  SER A HA   1 
ATOM   7452  H  HB2  . SER A 1 500 ? -48.221 38.818  -14.523 1.00 62.60  ? 579  SER A HB2  1 
ATOM   7453  H  HB3  . SER A 1 500 ? -49.640 38.128  -14.338 1.00 62.60  ? 579  SER A HB3  1 
ATOM   7454  H  HG   . SER A 1 500 ? -49.553 40.058  -13.295 1.00 68.52  ? 579  SER A HG   1 
ATOM   7455  N  N    . VAL A 1 501 ? -46.590 38.099  -11.564 1.00 68.23  ? 580  VAL A N    1 
ATOM   7456  C  CA   . VAL A 1 501 ? -45.294 38.609  -11.110 1.00 70.23  ? 580  VAL A CA   1 
ATOM   7457  C  C    . VAL A 1 501 ? -44.241 37.502  -10.951 1.00 68.02  ? 580  VAL A C    1 
ATOM   7458  O  O    . VAL A 1 501 ? -43.040 37.767  -11.031 1.00 63.98  ? 580  VAL A O    1 
ATOM   7459  C  CB   . VAL A 1 501 ? -45.431 39.423  -9.787  1.00 72.99  ? 580  VAL A CB   1 
ATOM   7460  C  CG1  . VAL A 1 501 ? -46.099 38.597  -8.692  1.00 76.39  ? 580  VAL A CG1  1 
ATOM   7461  C  CG2  . VAL A 1 501 ? -44.072 39.956  -9.320  1.00 66.55  ? 580  VAL A CG2  1 
ATOM   7462  H  H    . VAL A 1 501 ? -47.212 38.134  -10.971 1.00 81.88  ? 580  VAL A H    1 
ATOM   7463  H  HA   . VAL A 1 501 ? -44.961 39.221  -11.785 1.00 84.28  ? 580  VAL A HA   1 
ATOM   7464  H  HB   . VAL A 1 501 ? -46.000 40.190  -9.959  1.00 87.58  ? 580  VAL A HB   1 
ATOM   7465  H  HG11 . VAL A 1 501 ? -46.167 39.135  -7.888  1.00 91.66  ? 580  VAL A HG11 1 
ATOM   7466  H  HG12 . VAL A 1 501 ? -46.984 38.334  -8.991  1.00 91.66  ? 580  VAL A HG12 1 
ATOM   7467  H  HG13 . VAL A 1 501 ? -45.561 37.809  -8.519  1.00 91.66  ? 580  VAL A HG13 1 
ATOM   7468  H  HG21 . VAL A 1 501 ? -44.196 40.456  -8.497  1.00 79.86  ? 580  VAL A HG21 1 
ATOM   7469  H  HG22 . VAL A 1 501 ? -43.476 39.207  -9.165  1.00 79.86  ? 580  VAL A HG22 1 
ATOM   7470  H  HG23 . VAL A 1 501 ? -43.707 40.535  -10.007 1.00 79.86  ? 580  VAL A HG23 1 
ATOM   7471  N  N    . ASP A 1 502 ? -44.695 36.267  -10.755 1.00 86.16  ? 581  ASP A N    1 
ATOM   7472  C  CA   . ASP A 1 502 ? -43.797 35.141  -10.509 1.00 86.23  ? 581  ASP A CA   1 
ATOM   7473  C  C    . ASP A 1 502 ? -43.440 34.427  -11.808 1.00 85.62  ? 581  ASP A C    1 
ATOM   7474  O  O    . ASP A 1 502 ? -44.316 33.935  -12.519 1.00 84.85  ? 581  ASP A O    1 
ATOM   7475  C  CB   . ASP A 1 502 ? -44.447 34.154  -9.541  1.00 90.36  ? 581  ASP A CB   1 
ATOM   7476  C  CG   . ASP A 1 502 ? -44.983 34.831  -8.294  1.00 105.15 ? 581  ASP A CG   1 
ATOM   7477  O  OD1  . ASP A 1 502 ? -44.180 35.114  -7.379  1.00 113.30 ? 581  ASP A OD1  1 
ATOM   7478  O  OD2  . ASP A 1 502 ? -46.207 35.078  -8.227  1.00 104.54 ? 581  ASP A OD2  1 
ATOM   7479  H  H    . ASP A 1 502 ? -45.528 36.053  -10.761 1.00 103.39 ? 581  ASP A H    1 
ATOM   7480  H  HA   . ASP A 1 502 ? -42.978 35.467  -10.106 1.00 103.48 ? 581  ASP A HA   1 
ATOM   7481  H  HB2  . ASP A 1 502 ? -45.188 33.714  -9.986  1.00 108.43 ? 581  ASP A HB2  1 
ATOM   7482  H  HB3  . ASP A 1 502 ? -43.788 33.498  -9.267  1.00 108.43 ? 581  ASP A HB3  1 
ATOM   7483  N  N    . ALA A 1 503 ? -42.146 34.375  -12.109 1.00 47.77  ? 582  ALA A N    1 
ATOM   7484  C  CA   . ALA A 1 503 ? -41.658 33.759  -13.338 1.00 44.42  ? 582  ALA A CA   1 
ATOM   7485  C  C    . ALA A 1 503 ? -41.897 32.251  -13.392 1.00 46.11  ? 582  ALA A C    1 
ATOM   7486  O  O    . ALA A 1 503 ? -42.310 31.724  -14.424 1.00 45.87  ? 582  ALA A O    1 
ATOM   7487  C  CB   . ALA A 1 503 ? -40.184 34.053  -13.513 1.00 42.40  ? 582  ALA A CB   1 
ATOM   7488  H  H    . ALA A 1 503 ? -41.522 34.695  -11.610 1.00 57.32  ? 582  ALA A H    1 
ATOM   7489  H  HA   . ALA A 1 503 ? -42.127 34.156  -14.088 1.00 53.31  ? 582  ALA A HA   1 
ATOM   7490  H  HB1  . ALA A 1 503 ? -39.874 33.637  -14.333 1.00 50.88  ? 582  ALA A HB1  1 
ATOM   7491  H  HB2  . ALA A 1 503 ? -40.058 35.014  -13.561 1.00 50.88  ? 582  ALA A HB2  1 
ATOM   7492  H  HB3  . ALA A 1 503 ? -39.698 33.693  -12.755 1.00 50.88  ? 582  ALA A HB3  1 
ATOM   7493  N  N    . GLU A 1 504 ? -41.629 31.556  -12.292 1.00 67.46  ? 583  GLU A N    1 
ATOM   7494  C  CA   . GLU A 1 504 ? -41.776 30.105  -12.268 1.00 66.73  ? 583  GLU A CA   1 
ATOM   7495  C  C    . GLU A 1 504 ? -43.239 29.687  -12.441 1.00 69.34  ? 583  GLU A C    1 
ATOM   7496  O  O    . GLU A 1 504 ? -43.539 28.735  -13.166 1.00 66.74  ? 583  GLU A O    1 
ATOM   7497  C  CB   . GLU A 1 504 ? -41.191 29.511  -10.976 1.00 76.10  ? 583  GLU A CB   1 
ATOM   7498  C  CG   . GLU A 1 504 ? -41.775 30.062  -9.659  1.00 88.16  ? 583  GLU A CG   1 
ATOM   7499  C  CD   . GLU A 1 504 ? -41.080 31.315  -9.131  1.00 90.21  ? 583  GLU A CD   1 
ATOM   7500  O  OE1  . GLU A 1 504 ? -41.682 31.990  -8.266  1.00 87.80  ? 583  GLU A OE1  1 
ATOM   7501  O  OE2  . GLU A 1 504 ? -39.944 31.618  -9.561  1.00 87.77  ? 583  GLU A OE2  1 
ATOM   7502  H  H    . GLU A 1 504 ? -41.363 31.899  -11.549 1.00 80.95  ? 583  GLU A H    1 
ATOM   7503  H  HA   . GLU A 1 504 ? -41.276 29.733  -13.012 1.00 80.08  ? 583  GLU A HA   1 
ATOM   7504  H  HB2  . GLU A 1 504 ? -41.345 28.553  -10.983 1.00 91.32  ? 583  GLU A HB2  1 
ATOM   7505  H  HB3  . GLU A 1 504 ? -40.237 29.684  -10.964 1.00 91.32  ? 583  GLU A HB3  1 
ATOM   7506  H  HG2  . GLU A 1 504 ? -42.709 30.281  -9.802  1.00 105.80 ? 583  GLU A HG2  1 
ATOM   7507  H  HG3  . GLU A 1 504 ? -41.702 29.376  -8.976  1.00 105.80 ? 583  GLU A HG3  1 
ATOM   7508  N  N    . LYS A 1 505 ? -44.145 30.409  -11.788 1.00 40.42  ? 584  LYS A N    1 
ATOM   7509  C  CA   . LYS A 1 505 ? -45.569 30.091  -11.844 1.00 37.38  ? 584  LYS A CA   1 
ATOM   7510  C  C    . LYS A 1 505 ? -46.142 30.368  -13.233 1.00 35.28  ? 584  LYS A C    1 
ATOM   7511  O  O    . LYS A 1 505 ? -46.954 29.599  -13.750 1.00 30.87  ? 584  LYS A O    1 
ATOM   7512  C  CB   . LYS A 1 505 ? -46.346 30.893  -10.793 1.00 35.00  ? 584  LYS A CB   1 
ATOM   7513  C  CG   . LYS A 1 505 ? -45.974 30.581  -9.351  1.00 42.09  ? 584  LYS A CG   1 
ATOM   7514  C  CD   . LYS A 1 505 ? -46.786 31.428  -8.374  1.00 50.17  ? 584  LYS A CD   1 
ATOM   7515  C  CE   . LYS A 1 505 ? -46.473 31.082  -6.921  1.00 47.11  ? 584  LYS A CE   1 
ATOM   7516  N  NZ   . LYS A 1 505 ? -45.031 31.256  -6.584  1.00 45.60  ? 584  LYS A NZ   1 
ATOM   7517  H  H    . LYS A 1 505 ? -43.959 31.093  -11.301 1.00 48.50  ? 584  LYS A H    1 
ATOM   7518  H  HA   . LYS A 1 505 ? -45.690 29.148  -11.652 1.00 44.85  ? 584  LYS A HA   1 
ATOM   7519  H  HB2  . LYS A 1 505 ? -46.181 31.838  -10.941 1.00 42.00  ? 584  LYS A HB2  1 
ATOM   7520  H  HB3  . LYS A 1 505 ? -47.292 30.707  -10.899 1.00 42.00  ? 584  LYS A HB3  1 
ATOM   7521  H  HG2  . LYS A 1 505 ? -46.155 29.646  -9.168  1.00 50.51  ? 584  LYS A HG2  1 
ATOM   7522  H  HG3  . LYS A 1 505 ? -45.033 30.775  -9.213  1.00 50.51  ? 584  LYS A HG3  1 
ATOM   7523  H  HD2  . LYS A 1 505 ? -46.576 32.365  -8.514  1.00 60.20  ? 584  LYS A HD2  1 
ATOM   7524  H  HD3  . LYS A 1 505 ? -47.731 31.270  -8.526  1.00 60.20  ? 584  LYS A HD3  1 
ATOM   7525  H  HE2  . LYS A 1 505 ? -46.989 31.663  -6.340  1.00 56.53  ? 584  LYS A HE2  1 
ATOM   7526  H  HE3  . LYS A 1 505 ? -46.710 30.156  -6.759  1.00 56.53  ? 584  LYS A HE3  1 
ATOM   7527  H  HZ1  . LYS A 1 505 ? -44.891 31.045  -5.731  1.00 54.72  ? 584  LYS A HZ1  1 
ATOM   7528  H  HZ2  . LYS A 1 505 ? -44.533 30.727  -7.098  1.00 54.72  ? 584  LYS A HZ2  1 
ATOM   7529  H  HZ3  . LYS A 1 505 ? -44.788 32.101  -6.717  1.00 54.72  ? 584  LYS A HZ3  1 
ATOM   7530  N  N    . VAL A 1 506 ? -45.711 31.473  -13.831 1.00 37.30  ? 585  VAL A N    1 
ATOM   7531  C  CA   . VAL A 1 506 ? -46.210 31.880  -15.137 1.00 37.23  ? 585  VAL A CA   1 
ATOM   7532  C  C    . VAL A 1 506 ? -45.732 30.938  -16.237 1.00 37.45  ? 585  VAL A C    1 
ATOM   7533  O  O    . VAL A 1 506 ? -46.503 30.586  -17.130 1.00 35.48  ? 585  VAL A O    1 
ATOM   7534  C  CB   . VAL A 1 506 ? -45.810 33.343  -15.443 1.00 37.12  ? 585  VAL A CB   1 
ATOM   7535  C  CG1  . VAL A 1 506 ? -45.583 33.576  -16.934 1.00 41.57  ? 585  VAL A CG1  1 
ATOM   7536  C  CG2  . VAL A 1 506 ? -46.877 34.285  -14.927 1.00 39.13  ? 585  VAL A CG2  1 
ATOM   7537  H  H    . VAL A 1 506 ? -45.126 32.007  -13.498 1.00 44.76  ? 585  VAL A H    1 
ATOM   7538  H  HA   . VAL A 1 506 ? -47.179 31.841  -15.121 1.00 44.68  ? 585  VAL A HA   1 
ATOM   7539  H  HB   . VAL A 1 506 ? -44.982 33.546  -14.980 1.00 44.55  ? 585  VAL A HB   1 
ATOM   7540  H  HG11 . VAL A 1 506 ? -45.335 34.503  -17.074 1.00 49.89  ? 585  VAL A HG11 1 
ATOM   7541  H  HG12 . VAL A 1 506 ? -44.871 32.993  -17.240 1.00 49.89  ? 585  VAL A HG12 1 
ATOM   7542  H  HG13 . VAL A 1 506 ? -46.403 33.376  -17.413 1.00 49.89  ? 585  VAL A HG13 1 
ATOM   7543  H  HG21 . VAL A 1 506 ? -46.615 35.198  -15.125 1.00 46.95  ? 585  VAL A HG21 1 
ATOM   7544  H  HG22 . VAL A 1 506 ? -47.718 34.080  -15.365 1.00 46.95  ? 585  VAL A HG22 1 
ATOM   7545  H  HG23 . VAL A 1 506 ? -46.966 34.166  -13.968 1.00 46.95  ? 585  VAL A HG23 1 
ATOM   7546  N  N    . THR A 1 507 ? -44.467 30.529  -16.172 1.00 37.79  ? 586  THR A N    1 
ATOM   7547  C  CA   . THR A 1 507 ? -43.920 29.604  -17.160 1.00 33.20  ? 586  THR A CA   1 
ATOM   7548  C  C    . THR A 1 507 ? -44.748 28.327  -17.169 1.00 35.02  ? 586  THR A C    1 
ATOM   7549  O  O    . THR A 1 507 ? -44.958 27.728  -18.217 1.00 33.84  ? 586  THR A O    1 
ATOM   7550  C  CB   . THR A 1 507 ? -42.441 29.237  -16.880 1.00 29.19  ? 586  THR A CB   1 
ATOM   7551  O  OG1  . THR A 1 507 ? -41.660 30.430  -16.738 1.00 29.86  ? 586  THR A OG1  1 
ATOM   7552  C  CG2  . THR A 1 507 ? -41.868 28.393  -18.017 1.00 27.04  ? 586  THR A CG2  1 
ATOM   7553  H  H    . THR A 1 507 ? -43.906 30.773  -15.567 1.00 45.34  ? 586  THR A H    1 
ATOM   7554  H  HA   . THR A 1 507 ? -43.972 30.007  -18.041 1.00 39.84  ? 586  THR A HA   1 
ATOM   7555  H  HB   . THR A 1 507 ? -42.389 28.720  -16.061 1.00 35.03  ? 586  THR A HB   1 
ATOM   7556  H  HG1  . THR A 1 507 ? -41.953 30.891  -16.100 1.00 35.83  ? 586  THR A HG1  1 
ATOM   7557  H  HG21 . THR A 1 507 ? -40.942 28.170  -17.830 1.00 32.45  ? 586  THR A HG21 1 
ATOM   7558  H  HG22 . THR A 1 507 ? -42.377 27.573  -18.111 1.00 32.45  ? 586  THR A HG22 1 
ATOM   7559  H  HG23 . THR A 1 507 ? -41.911 28.887  -18.851 1.00 32.45  ? 586  THR A HG23 1 
ATOM   7560  N  N    . ASN A 1 508 ? -45.224 27.928  -15.994 1.00 45.95  ? 587  ASN A N    1 
ATOM   7561  C  CA   . ASN A 1 508 ? -46.053 26.737  -15.861 1.00 43.75  ? 587  ASN A CA   1 
ATOM   7562  C  C    . ASN A 1 508 ? -47.453 26.943  -16.428 1.00 48.08  ? 587  ASN A C    1 
ATOM   7563  O  O    . ASN A 1 508 ? -47.912 26.164  -17.263 1.00 48.09  ? 587  ASN A O    1 
ATOM   7564  C  CB   . ASN A 1 508 ? -46.152 26.327  -14.388 1.00 43.05  ? 587  ASN A CB   1 
ATOM   7565  C  CG   . ASN A 1 508 ? -45.093 25.314  -13.986 1.00 39.23  ? 587  ASN A CG   1 
ATOM   7566  O  OD1  . ASN A 1 508 ? -44.726 24.438  -14.769 1.00 44.79  ? 587  ASN A OD1  1 
ATOM   7567  N  ND2  . ASN A 1 508 ? -44.606 25.423  -12.753 1.00 41.30  ? 587  ASN A ND2  1 
ATOM   7568  H  H    . ASN A 1 508 ? -45.078 28.336  -15.250 1.00 55.14  ? 587  ASN A H    1 
ATOM   7569  H  HA   . ASN A 1 508 ? -45.637 26.008  -16.347 1.00 52.50  ? 587  ASN A HA   1 
ATOM   7570  H  HB2  . ASN A 1 508 ? -46.040 27.114  -13.832 1.00 51.66  ? 587  ASN A HB2  1 
ATOM   7571  H  HB3  . ASN A 1 508 ? -47.022 25.930  -14.228 1.00 51.66  ? 587  ASN A HB3  1 
ATOM   7572  H  HD21 . ASN A 1 508 ? -44.004 24.873  -12.478 1.00 49.56  ? 587  ASN A HD21 1 
ATOM   7573  H  HD22 . ASN A 1 508 ? -44.892 26.043  -12.230 1.00 49.56  ? 587  ASN A HD22 1 
ATOM   7574  N  N    . LEU A 1 509 ? -48.129 27.989  -15.963 1.00 39.93  ? 588  LEU A N    1 
ATOM   7575  C  CA   . LEU A 1 509 ? -49.498 28.274  -16.383 1.00 41.09  ? 588  LEU A CA   1 
ATOM   7576  C  C    . LEU A 1 509 ? -49.609 28.481  -17.890 1.00 44.08  ? 588  LEU A C    1 
ATOM   7577  O  O    . LEU A 1 509 ? -50.641 28.185  -18.489 1.00 43.16  ? 588  LEU A O    1 
ATOM   7578  C  CB   . LEU A 1 509 ? -50.024 29.514  -15.661 1.00 40.98  ? 588  LEU A CB   1 
ATOM   7579  C  CG   . LEU A 1 509 ? -50.260 29.349  -14.159 1.00 39.22  ? 588  LEU A CG   1 
ATOM   7580  C  CD1  . LEU A 1 509 ? -50.370 30.699  -13.474 1.00 37.76  ? 588  LEU A CD1  1 
ATOM   7581  C  CD2  . LEU A 1 509 ? -51.511 28.526  -13.901 1.00 37.91  ? 588  LEU A CD2  1 
ATOM   7582  H  H    . LEU A 1 509 ? -47.813 28.555  -15.397 1.00 47.92  ? 588  LEU A H    1 
ATOM   7583  H  HA   . LEU A 1 509 ? -50.064 27.524  -16.142 1.00 49.31  ? 588  LEU A HA   1 
ATOM   7584  H  HB2  . LEU A 1 509 ? -49.383 30.232  -15.778 1.00 49.18  ? 588  LEU A HB2  1 
ATOM   7585  H  HB3  . LEU A 1 509 ? -50.870 29.766  -16.062 1.00 49.18  ? 588  LEU A HB3  1 
ATOM   7586  H  HG   . LEU A 1 509 ? -49.506 28.877  -13.771 1.00 47.06  ? 588  LEU A HG   1 
ATOM   7587  H  HD11 . LEU A 1 509 ? -50.519 30.561  -12.525 1.00 45.31  ? 588  LEU A HD11 1 
ATOM   7588  H  HD12 . LEU A 1 509 ? -49.546 31.191  -13.612 1.00 45.31  ? 588  LEU A HD12 1 
ATOM   7589  H  HD13 . LEU A 1 509 ? -51.115 31.187  -13.858 1.00 45.31  ? 588  LEU A HD13 1 
ATOM   7590  H  HD21 . LEU A 1 509 ? -51.638 28.437  -12.944 1.00 45.49  ? 588  LEU A HD21 1 
ATOM   7591  H  HD22 . LEU A 1 509 ? -52.272 28.979  -14.296 1.00 45.49  ? 588  LEU A HD22 1 
ATOM   7592  H  HD23 . LEU A 1 509 ? -51.401 27.651  -14.304 1.00 45.49  ? 588  LEU A HD23 1 
ATOM   7593  N  N    . LEU A 1 510 ? -48.543 28.989  -18.500 1.00 51.27  ? 589  LEU A N    1 
ATOM   7594  C  CA   . LEU A 1 510 ? -48.546 29.280  -19.929 1.00 49.11  ? 589  LEU A CA   1 
ATOM   7595  C  C    . LEU A 1 510 ? -48.467 28.026  -20.799 1.00 52.85  ? 589  LEU A C    1 
ATOM   7596  O  O    . LEU A 1 510 ? -48.721 28.092  -21.999 1.00 56.37  ? 589  LEU A O    1 
ATOM   7597  C  CB   . LEU A 1 510 ? -47.390 30.217  -20.279 1.00 47.14  ? 589  LEU A CB   1 
ATOM   7598  C  CG   . LEU A 1 510 ? -47.546 31.684  -19.872 1.00 50.37  ? 589  LEU A CG   1 
ATOM   7599  C  CD1  . LEU A 1 510 ? -46.209 32.407  -19.984 1.00 53.74  ? 589  LEU A CD1  1 
ATOM   7600  C  CD2  . LEU A 1 510 ? -48.599 32.373  -20.723 1.00 55.10  ? 589  LEU A CD2  1 
ATOM   7601  H  H    . LEU A 1 510 ? -47.801 29.174  -18.106 1.00 61.53  ? 589  LEU A H    1 
ATOM   7602  H  HA   . LEU A 1 510 ? -49.373 29.738  -20.149 1.00 58.93  ? 589  LEU A HA   1 
ATOM   7603  H  HB2  . LEU A 1 510 ? -46.588 29.883  -19.847 1.00 56.57  ? 589  LEU A HB2  1 
ATOM   7604  H  HB3  . LEU A 1 510 ? -47.266 30.198  -21.241 1.00 56.57  ? 589  LEU A HB3  1 
ATOM   7605  H  HG   . LEU A 1 510 ? -47.834 31.726  -18.947 1.00 60.45  ? 589  LEU A HG   1 
ATOM   7606  H  HD11 . LEU A 1 510 ? -46.328 33.333  -19.722 1.00 64.48  ? 589  LEU A HD11 1 
ATOM   7607  H  HD12 . LEU A 1 510 ? -45.567 31.977  -19.396 1.00 64.48  ? 589  LEU A HD12 1 
ATOM   7608  H  HD13 . LEU A 1 510 ? -45.900 32.360  -20.902 1.00 64.48  ? 589  LEU A HD13 1 
ATOM   7609  H  HD21 . LEU A 1 510 ? -48.675 33.299  -20.442 1.00 66.12  ? 589  LEU A HD21 1 
ATOM   7610  H  HD22 . LEU A 1 510 ? -48.329 32.331  -21.654 1.00 66.12  ? 589  LEU A HD22 1 
ATOM   7611  H  HD23 . LEU A 1 510 ? -49.448 31.920  -20.603 1.00 66.12  ? 589  LEU A HD23 1 
ATOM   7612  N  N    . GLN A 1 511 ? -48.111 26.890  -20.205 1.00 50.51  ? 590  GLN A N    1 
ATOM   7613  C  CA   . GLN A 1 511 ? -48.034 25.642  -20.961 1.00 48.38  ? 590  GLN A CA   1 
ATOM   7614  C  C    . GLN A 1 511 ? -49.427 25.084  -21.233 1.00 49.16  ? 590  GLN A C    1 
ATOM   7615  O  O    . GLN A 1 511 ? -49.584 24.152  -22.020 1.00 58.42  ? 590  GLN A O    1 
ATOM   7616  C  CB   . GLN A 1 511 ? -47.245 24.579  -20.193 1.00 51.60  ? 590  GLN A CB   1 
ATOM   7617  C  CG   . GLN A 1 511 ? -45.941 25.039  -19.573 1.00 49.12  ? 590  GLN A CG   1 
ATOM   7618  C  CD   . GLN A 1 511 ? -44.870 25.382  -20.587 1.00 51.27  ? 590  GLN A CD   1 
ATOM   7619  O  OE1  . GLN A 1 511 ? -44.937 24.978  -21.749 1.00 60.78  ? 590  GLN A OE1  1 
ATOM   7620  N  NE2  . GLN A 1 511 ? -43.866 26.132  -20.146 1.00 45.05  ? 590  GLN A NE2  1 
ATOM   7621  H  H    . GLN A 1 511 ? -47.910 26.814  -19.373 1.00 60.61  ? 590  GLN A H    1 
ATOM   7622  H  HA   . GLN A 1 511 ? -47.593 25.802  -21.810 1.00 58.06  ? 590  GLN A HA   1 
ATOM   7623  H  HB2  . GLN A 1 511 ? -47.804 24.243  -19.475 1.00 61.92  ? 590  GLN A HB2  1 
ATOM   7624  H  HB3  . GLN A 1 511 ? -47.035 23.855  -20.804 1.00 61.92  ? 590  GLN A HB3  1 
ATOM   7625  H  HG2  . GLN A 1 511 ? -46.111 25.832  -19.041 1.00 58.94  ? 590  GLN A HG2  1 
ATOM   7626  H  HG3  . GLN A 1 511 ? -45.597 24.330  -19.007 1.00 58.94  ? 590  GLN A HG3  1 
ATOM   7627  H  HE21 . GLN A 1 511 ? -43.852 26.393  -19.327 1.00 54.06  ? 590  GLN A HE21 1 
ATOM   7628  H  HE22 . GLN A 1 511 ? -43.230 26.357  -20.680 1.00 54.06  ? 590  GLN A HE22 1 
ATOM   7629  N  N    . LEU A 1 512 ? -50.431 25.649  -20.570 1.00 42.79  ? 591  LEU A N    1 
ATOM   7630  C  CA   . LEU A 1 512 ? -51.781 25.089  -20.575 1.00 48.91  ? 591  LEU A CA   1 
ATOM   7631  C  C    . LEU A 1 512 ? -52.484 25.095  -21.939 1.00 51.16  ? 591  LEU A C    1 
ATOM   7632  O  O    . LEU A 1 512 ? -52.884 24.034  -22.423 1.00 45.12  ? 591  LEU A O    1 
ATOM   7633  C  CB   . LEU A 1 512 ? -52.641 25.792  -19.520 1.00 51.40  ? 591  LEU A CB   1 
ATOM   7634  C  CG   . LEU A 1 512 ? -52.456 25.269  -18.095 1.00 53.56  ? 591  LEU A CG   1 
ATOM   7635  C  CD1  . LEU A 1 512 ? -52.920 26.281  -17.057 1.00 54.91  ? 591  LEU A CD1  1 
ATOM   7636  C  CD2  . LEU A 1 512 ? -53.219 23.988  -17.921 1.00 57.70  ? 591  LEU A CD2  1 
ATOM   7637  H  H    . LEU A 1 512 ? -50.356 26.367  -20.102 1.00 51.34  ? 591  LEU A H    1 
ATOM   7638  H  HA   . LEU A 1 512 ? -51.713 24.160  -20.305 1.00 58.69  ? 591  LEU A HA   1 
ATOM   7639  H  HB2  . LEU A 1 512 ? -52.418 26.736  -19.518 1.00 61.67  ? 591  LEU A HB2  1 
ATOM   7640  H  HB3  . LEU A 1 512 ? -53.575 25.677  -19.756 1.00 61.67  ? 591  LEU A HB3  1 
ATOM   7641  H  HG   . LEU A 1 512 ? -51.516 25.086  -17.941 1.00 64.27  ? 591  LEU A HG   1 
ATOM   7642  H  HD11 . LEU A 1 512 ? -52.785 25.910  -16.172 1.00 65.89  ? 591  LEU A HD11 1 
ATOM   7643  H  HD12 . LEU A 1 512 ? -52.403 27.096  -17.157 1.00 65.89  ? 591  LEU A HD12 1 
ATOM   7644  H  HD13 . LEU A 1 512 ? -53.862 26.468  -17.198 1.00 65.89  ? 591  LEU A HD13 1 
ATOM   7645  H  HD21 . LEU A 1 512 ? -53.094 23.667  -17.015 1.00 69.25  ? 591  LEU A HD21 1 
ATOM   7646  H  HD22 . LEU A 1 512 ? -54.160 24.156  -18.087 1.00 69.25  ? 591  LEU A HD22 1 
ATOM   7647  H  HD23 . LEU A 1 512 ? -52.883 23.333  -18.554 1.00 69.25  ? 591  LEU A HD23 1 
ATOM   7648  N  N    . PRO A 1 513 ? -52.637 26.279  -22.566 1.00 44.92  ? 592  PRO A N    1 
ATOM   7649  C  CA   . PRO A 1 513 ? -53.370 26.354  -23.840 1.00 44.74  ? 592  PRO A CA   1 
ATOM   7650  C  C    . PRO A 1 513 ? -52.902 25.379  -24.921 1.00 46.16  ? 592  PRO A C    1 
ATOM   7651  O  O    . PRO A 1 513 ? -53.625 25.142  -25.890 1.00 46.08  ? 592  PRO A O    1 
ATOM   7652  C  CB   . PRO A 1 513 ? -53.115 27.790  -24.300 1.00 46.16  ? 592  PRO A CB   1 
ATOM   7653  C  CG   . PRO A 1 513 ? -52.919 28.545  -23.050 1.00 43.53  ? 592  PRO A CG   1 
ATOM   7654  C  CD   . PRO A 1 513 ? -52.229 27.617  -22.099 1.00 41.41  ? 592  PRO A CD   1 
ATOM   7655  H  HA   . PRO A 1 513 ? -54.321 26.232  -23.689 1.00 53.68  ? 592  PRO A HA   1 
ATOM   7656  H  HB2  . PRO A 1 513 ? -52.317 27.822  -24.852 1.00 55.39  ? 592  PRO A HB2  1 
ATOM   7657  H  HB3  . PRO A 1 513 ? -53.886 28.122  -24.787 1.00 55.39  ? 592  PRO A HB3  1 
ATOM   7658  H  HG2  . PRO A 1 513 ? -52.366 29.323  -23.226 1.00 52.24  ? 592  PRO A HG2  1 
ATOM   7659  H  HG3  . PRO A 1 513 ? -53.781 28.814  -22.697 1.00 52.24  ? 592  PRO A HG3  1 
ATOM   7660  H  HD2  . PRO A 1 513 ? -51.266 27.719  -22.166 1.00 49.69  ? 592  PRO A HD2  1 
ATOM   7661  H  HD3  . PRO A 1 513 ? -52.541 27.769  -21.193 1.00 49.69  ? 592  PRO A HD3  1 
ATOM   7662  N  N    . GLN A 1 514 ? -51.702 24.834  -24.759 1.00 65.82  ? 593  GLN A N    1 
ATOM   7663  C  CA   . GLN A 1 514 ? -51.167 23.848  -25.692 1.00 68.02  ? 593  GLN A CA   1 
ATOM   7664  C  C    . GLN A 1 514 ? -51.887 22.501  -25.552 1.00 67.39  ? 593  GLN A C    1 
ATOM   7665  O  O    . GLN A 1 514 ? -51.665 21.579  -26.339 1.00 65.92  ? 593  GLN A O    1 
ATOM   7666  C  CB   . GLN A 1 514 ? -49.664 23.678  -25.456 1.00 66.17  ? 593  GLN A CB   1 
ATOM   7667  C  CG   . GLN A 1 514 ? -48.892 25.002  -25.378 1.00 69.47  ? 593  GLN A CG   1 
ATOM   7668  C  CD   . GLN A 1 514 ? -47.389 24.808  -25.235 1.00 75.73  ? 593  GLN A CD   1 
ATOM   7669  O  OE1  . GLN A 1 514 ? -46.899 23.679  -25.170 1.00 83.38  ? 593  GLN A OE1  1 
ATOM   7670  N  NE2  . GLN A 1 514 ? -46.652 25.914  -25.186 1.00 62.08  ? 593  GLN A NE2  1 
ATOM   7671  H  H    . GLN A 1 514 ? -51.171 25.020  -24.108 1.00 78.98  ? 593  GLN A H    1 
ATOM   7672  H  HA   . GLN A 1 514 ? -51.296 24.167  -26.599 1.00 81.62  ? 593  GLN A HA   1 
ATOM   7673  H  HB2  . GLN A 1 514 ? -49.531 23.208  -24.617 1.00 79.41  ? 593  GLN A HB2  1 
ATOM   7674  H  HB3  . GLN A 1 514 ? -49.290 23.160  -26.185 1.00 79.41  ? 593  GLN A HB3  1 
ATOM   7675  H  HG2  . GLN A 1 514 ? -49.052 25.508  -26.190 1.00 83.36  ? 593  GLN A HG2  1 
ATOM   7676  H  HG3  . GLN A 1 514 ? -49.203 25.503  -24.608 1.00 83.36  ? 593  GLN A HG3  1 
ATOM   7677  H  HE21 . GLN A 1 514 ? -47.030 26.685  -25.235 1.00 74.50  ? 593  GLN A HE21 1 
ATOM   7678  H  HE22 . GLN A 1 514 ? -45.798 25.858  -25.106 1.00 74.50  ? 593  GLN A HE22 1 
ATOM   7679  N  N    . TYR A 1 515 ? -52.759 22.403  -24.551 1.00 54.26  ? 594  TYR A N    1 
ATOM   7680  C  CA   . TYR A 1 515 ? -53.504 21.177  -24.274 1.00 53.57  ? 594  TYR A CA   1 
ATOM   7681  C  C    . TYR A 1 515 ? -55.002 21.317  -24.564 1.00 54.65  ? 594  TYR A C    1 
ATOM   7682  O  O    . TYR A 1 515 ? -55.767 20.373  -24.362 1.00 52.05  ? 594  TYR A O    1 
ATOM   7683  C  CB   . TYR A 1 515 ? -53.288 20.763  -22.815 1.00 49.44  ? 594  TYR A CB   1 
ATOM   7684  C  CG   . TYR A 1 515 ? -51.838 20.506  -22.484 1.00 44.95  ? 594  TYR A CG   1 
ATOM   7685  C  CD1  . TYR A 1 515 ? -51.155 19.451  -23.069 1.00 41.16  ? 594  TYR A CD1  1 
ATOM   7686  C  CD2  . TYR A 1 515 ? -51.148 21.322  -21.595 1.00 38.72  ? 594  TYR A CD2  1 
ATOM   7687  C  CE1  . TYR A 1 515 ? -49.829 19.206  -22.778 1.00 36.50  ? 594  TYR A CE1  1 
ATOM   7688  C  CE2  . TYR A 1 515 ? -49.818 21.082  -21.291 1.00 34.10  ? 594  TYR A CE2  1 
ATOM   7689  C  CZ   . TYR A 1 515 ? -49.160 20.022  -21.895 1.00 38.72  ? 594  TYR A CZ   1 
ATOM   7690  O  OH   . TYR A 1 515 ? -47.832 19.752  -21.631 1.00 45.06  ? 594  TYR A OH   1 
ATOM   7691  H  H    . TYR A 1 515 ? -52.940 23.045  -24.008 1.00 65.12  ? 594  TYR A H    1 
ATOM   7692  H  HA   . TYR A 1 515 ? -53.158 20.467  -24.839 1.00 64.28  ? 594  TYR A HA   1 
ATOM   7693  H  HB2  . TYR A 1 515 ? -53.606 21.473  -22.236 1.00 59.32  ? 594  TYR A HB2  1 
ATOM   7694  H  HB3  . TYR A 1 515 ? -53.783 19.947  -22.642 1.00 59.32  ? 594  TYR A HB3  1 
ATOM   7695  H  HD1  . TYR A 1 515 ? -51.600 18.897  -23.669 1.00 49.39  ? 594  TYR A HD1  1 
ATOM   7696  H  HD2  . TYR A 1 515 ? -51.590 22.034  -21.191 1.00 46.47  ? 594  TYR A HD2  1 
ATOM   7697  H  HE1  . TYR A 1 515 ? -49.387 18.494  -23.182 1.00 43.80  ? 594  TYR A HE1  1 
ATOM   7698  H  HE2  . TYR A 1 515 ? -49.366 21.637  -20.696 1.00 40.93  ? 594  TYR A HE2  1 
ATOM   7699  H  HH   . TYR A 1 515 ? -47.529 20.311  -21.082 1.00 54.08  ? 594  TYR A HH   1 
ATOM   7700  N  N    . PHE A 1 516 ? -55.416 22.482  -25.055 1.00 46.32  ? 595  PHE A N    1 
ATOM   7701  C  CA   . PHE A 1 516 ? -56.825 22.721  -25.338 1.00 46.64  ? 595  PHE A CA   1 
ATOM   7702  C  C    . PHE A 1 516 ? -57.241 22.150  -26.685 1.00 53.90  ? 595  PHE A C    1 
ATOM   7703  O  O    . PHE A 1 516 ? -56.488 22.206  -27.660 1.00 57.87  ? 595  PHE A O    1 
ATOM   7704  C  CB   . PHE A 1 516 ? -57.136 24.221  -25.361 1.00 38.85  ? 595  PHE A CB   1 
ATOM   7705  C  CG   . PHE A 1 516 ? -56.970 24.912  -24.042 1.00 37.17  ? 595  PHE A CG   1 
ATOM   7706  C  CD1  . PHE A 1 516 ? -56.851 24.200  -22.859 1.00 42.39  ? 595  PHE A CD1  1 
ATOM   7707  C  CD2  . PHE A 1 516 ? -56.948 26.292  -23.991 1.00 38.30  ? 595  PHE A CD2  1 
ATOM   7708  C  CE1  . PHE A 1 516 ? -56.702 24.860  -21.653 1.00 41.77  ? 595  PHE A CE1  1 
ATOM   7709  C  CE2  . PHE A 1 516 ? -56.795 26.956  -22.793 1.00 38.97  ? 595  PHE A CE2  1 
ATOM   7710  C  CZ   . PHE A 1 516 ? -56.673 26.241  -21.622 1.00 37.77  ? 595  PHE A CZ   1 
ATOM   7711  H  H    . PHE A 1 516 ? -54.902 23.147  -25.232 1.00 55.58  ? 595  PHE A H    1 
ATOM   7712  H  HA   . PHE A 1 516 ? -57.367 22.307  -24.649 1.00 55.97  ? 595  PHE A HA   1 
ATOM   7713  H  HB2  . PHE A 1 516 ? -56.541 24.652  -25.995 1.00 46.62  ? 595  PHE A HB2  1 
ATOM   7714  H  HB3  . PHE A 1 516 ? -58.056 24.343  -25.643 1.00 46.62  ? 595  PHE A HB3  1 
ATOM   7715  H  HD1  . PHE A 1 516 ? -56.867 23.270  -22.877 1.00 50.86  ? 595  PHE A HD1  1 
ATOM   7716  H  HD2  . PHE A 1 516 ? -57.027 26.780  -24.778 1.00 45.96  ? 595  PHE A HD2  1 
ATOM   7717  H  HE1  . PHE A 1 516 ? -56.619 24.374  -20.864 1.00 50.12  ? 595  PHE A HE1  1 
ATOM   7718  H  HE2  . PHE A 1 516 ? -56.779 27.886  -22.774 1.00 46.77  ? 595  PHE A HE2  1 
ATOM   7719  H  HZ   . PHE A 1 516 ? -56.574 26.687  -20.811 1.00 45.32  ? 595  PHE A HZ   1 
ATOM   7720  N  N    . ASP A 1 517 ? -58.447 21.594  -26.721 1.00 81.97  ? 596  ASP A N    1 
ATOM   7721  C  CA   . ASP A 1 517 ? -59.206 21.495  -27.958 1.00 89.49  ? 596  ASP A CA   1 
ATOM   7722  C  C    . ASP A 1 517 ? -59.755 22.894  -28.239 1.00 88.80  ? 596  ASP A C    1 
ATOM   7723  O  O    . ASP A 1 517 ? -60.703 23.338  -27.593 1.00 78.82  ? 596  ASP A O    1 
ATOM   7724  C  CB   . ASP A 1 517 ? -60.348 20.490  -27.809 1.00 89.05  ? 596  ASP A CB   1 
ATOM   7725  C  CG   . ASP A 1 517 ? -61.288 20.491  -28.999 1.00 93.81  ? 596  ASP A CG   1 
ATOM   7726  O  OD1  . ASP A 1 517 ? -60.851 20.862  -30.110 1.00 98.14  ? 596  ASP A OD1  1 
ATOM   7727  O  OD2  . ASP A 1 517 ? -62.467 20.120  -28.823 1.00 95.08  ? 596  ASP A OD2  1 
ATOM   7728  H  H    . ASP A 1 517 ? -58.850 21.266  -26.036 1.00 98.36  ? 596  ASP A H    1 
ATOM   7729  H  HA   . ASP A 1 517 ? -58.629 21.221  -28.689 1.00 107.39 ? 596  ASP A HA   1 
ATOM   7730  H  HB2  . ASP A 1 517 ? -59.975 19.598  -27.721 1.00 106.86 ? 596  ASP A HB2  1 
ATOM   7731  H  HB3  . ASP A 1 517 ? -60.864 20.713  -27.018 1.00 106.86 ? 596  ASP A HB3  1 
ATOM   7732  N  N    . LEU A 1 518 ? -59.152 23.589  -29.200 1.00 77.95  ? 597  LEU A N    1 
ATOM   7733  C  CA   . LEU A 1 518 ? -59.408 25.017  -29.389 1.00 75.40  ? 597  LEU A CA   1 
ATOM   7734  C  C    . LEU A 1 518 ? -60.799 25.328  -29.945 1.00 83.30  ? 597  LEU A C    1 
ATOM   7735  O  O    . LEU A 1 518 ? -61.267 26.462  -29.833 1.00 85.79  ? 597  LEU A O    1 
ATOM   7736  C  CB   . LEU A 1 518 ? -58.346 25.635  -30.303 1.00 75.66  ? 597  LEU A CB   1 
ATOM   7737  C  CG   . LEU A 1 518 ? -56.899 25.644  -29.802 1.00 69.95  ? 597  LEU A CG   1 
ATOM   7738  C  CD1  . LEU A 1 518 ? -55.964 25.951  -30.963 1.00 65.00  ? 597  LEU A CD1  1 
ATOM   7739  C  CD2  . LEU A 1 518 ? -56.707 26.654  -28.675 1.00 62.54  ? 597  LEU A CD2  1 
ATOM   7740  H  H    . LEU A 1 518 ? -58.589 23.257  -29.759 1.00 93.53  ? 597  LEU A H    1 
ATOM   7741  H  HA   . LEU A 1 518 ? -59.338 25.455  -28.527 1.00 90.47  ? 597  LEU A HA   1 
ATOM   7742  H  HB2  . LEU A 1 518 ? -58.352 25.149  -31.142 1.00 90.79  ? 597  LEU A HB2  1 
ATOM   7743  H  HB3  . LEU A 1 518 ? -58.594 26.558  -30.469 1.00 90.79  ? 597  LEU A HB3  1 
ATOM   7744  H  HG   . LEU A 1 518 ? -56.677 24.765  -29.460 1.00 83.94  ? 597  LEU A HG   1 
ATOM   7745  H  HD11 . LEU A 1 518 ? -55.050 25.955  -30.638 1.00 78.00  ? 597  LEU A HD11 1 
ATOM   7746  H  HD12 . LEU A 1 518 ? -56.071 25.268  -31.643 1.00 78.00  ? 597  LEU A HD12 1 
ATOM   7747  H  HD13 . LEU A 1 518 ? -56.189 26.821  -31.328 1.00 78.00  ? 597  LEU A HD13 1 
ATOM   7748  H  HD21 . LEU A 1 518 ? -55.781 26.631  -28.385 1.00 75.04  ? 597  LEU A HD21 1 
ATOM   7749  H  HD22 . LEU A 1 518 ? -56.929 27.540  -29.003 1.00 75.04  ? 597  LEU A HD22 1 
ATOM   7750  H  HD23 . LEU A 1 518 ? -57.291 26.419  -27.937 1.00 75.04  ? 597  LEU A HD23 1 
ATOM   7751  N  N    . GLU A 1 519 ? -61.446 24.332  -30.550 1.00 107.41 ? 598  GLU A N    1 
ATOM   7752  C  CA   . GLU A 1 519 ? -62.810 24.486  -31.058 1.00 107.87 ? 598  GLU A CA   1 
ATOM   7753  C  C    . GLU A 1 519 ? -63.707 25.161  -30.033 1.00 108.47 ? 598  GLU A C    1 
ATOM   7754  O  O    . GLU A 1 519 ? -64.529 26.015  -30.366 1.00 113.88 ? 598  GLU A O    1 
ATOM   7755  C  CB   . GLU A 1 519 ? -63.418 23.120  -31.380 1.00 111.13 ? 598  GLU A CB   1 
ATOM   7756  C  CG   . GLU A 1 519 ? -62.849 22.430  -32.602 1.00 116.44 ? 598  GLU A CG   1 
ATOM   7757  C  CD   . GLU A 1 519 ? -63.492 21.075  -32.846 1.00 125.97 ? 598  GLU A CD   1 
ATOM   7758  O  OE1  . GLU A 1 519 ? -64.525 20.781  -32.205 1.00 125.25 ? 598  GLU A OE1  1 
ATOM   7759  O  OE2  . GLU A 1 519 ? -62.966 20.304  -33.678 1.00 130.85 ? 598  GLU A OE2  1 
ATOM   7760  H  H    . GLU A 1 519 ? -61.114 23.549  -30.679 1.00 128.90 ? 598  GLU A H    1 
ATOM   7761  H  HA   . GLU A 1 519 ? -62.801 25.022  -31.867 1.00 129.44 ? 598  GLU A HA   1 
ATOM   7762  H  HB2  . GLU A 1 519 ? -63.275 22.533  -30.621 1.00 133.36 ? 598  GLU A HB2  1 
ATOM   7763  H  HB3  . GLU A 1 519 ? -64.370 23.234  -31.527 1.00 133.36 ? 598  GLU A HB3  1 
ATOM   7764  H  HG2  . GLU A 1 519 ? -63.007 22.985  -33.383 1.00 139.72 ? 598  GLU A HG2  1 
ATOM   7765  H  HG3  . GLU A 1 519 ? -61.897 22.295  -32.476 1.00 139.72 ? 598  GLU A HG3  1 
ATOM   7766  N  N    . ILE A 1 520 ? -63.518 24.770  -28.779 1.00 63.80  ? 599  ILE A N    1 
ATOM   7767  C  CA   . ILE A 1 520 ? -64.403 25.142  -27.686 1.00 55.34  ? 599  ILE A CA   1 
ATOM   7768  C  C    . ILE A 1 520 ? -64.406 26.651  -27.429 1.00 59.37  ? 599  ILE A C    1 
ATOM   7769  O  O    . ILE A 1 520 ? -65.308 27.175  -26.777 1.00 66.84  ? 599  ILE A O    1 
ATOM   7770  C  CB   . ILE A 1 520 ? -64.009 24.360  -26.409 1.00 45.58  ? 599  ILE A CB   1 
ATOM   7771  C  CG1  . ILE A 1 520 ? -63.977 22.848  -26.695 1.00 51.53  ? 599  ILE A CG1  1 
ATOM   7772  C  CG2  . ILE A 1 520 ? -64.942 24.667  -25.243 1.00 51.87  ? 599  ILE A CG2  1 
ATOM   7773  C  CD1  . ILE A 1 520 ? -65.080 22.321  -27.635 1.00 62.13  ? 599  ILE A CD1  1 
ATOM   7774  H  H    . ILE A 1 520 ? -62.862 24.273  -28.530 1.00 76.56  ? 599  ILE A H    1 
ATOM   7775  H  HA   . ILE A 1 520 ? -65.308 24.884  -27.921 1.00 66.41  ? 599  ILE A HA   1 
ATOM   7776  H  HB   . ILE A 1 520 ? -63.114 24.635  -26.156 1.00 54.70  ? 599  ILE A HB   1 
ATOM   7777  H  HG12 . ILE A 1 520 ? -63.123 22.631  -27.099 1.00 61.83  ? 599  ILE A HG12 1 
ATOM   7778  H  HG13 . ILE A 1 520 ? -64.065 22.376  -25.852 1.00 61.83  ? 599  ILE A HG13 1 
ATOM   7779  H  HG21 . ILE A 1 520 ? -64.657 24.156  -24.469 1.00 62.25  ? 599  ILE A HG21 1 
ATOM   7780  H  HG22 . ILE A 1 520 ? -64.900 25.616  -25.047 1.00 62.25  ? 599  ILE A HG22 1 
ATOM   7781  H  HG23 . ILE A 1 520 ? -65.846 24.418  -25.489 1.00 62.25  ? 599  ILE A HG23 1 
ATOM   7782  H  HD11 . ILE A 1 520 ? -64.969 21.364  -27.747 1.00 74.55  ? 599  ILE A HD11 1 
ATOM   7783  H  HD12 . ILE A 1 520 ? -65.947 22.510  -27.242 1.00 74.55  ? 599  ILE A HD12 1 
ATOM   7784  H  HD13 . ILE A 1 520 ? -65.002 22.765  -28.494 1.00 74.55  ? 599  ILE A HD13 1 
ATOM   7785  N  N    . TYR A 1 521 ? -63.408 27.356  -27.949 1.00 66.03  ? 600  TYR A N    1 
ATOM   7786  C  CA   . TYR A 1 521 ? -63.396 28.812  -27.853 1.00 70.32  ? 600  TYR A CA   1 
ATOM   7787  C  C    . TYR A 1 521 ? -64.485 29.428  -28.736 1.00 72.67  ? 600  TYR A C    1 
ATOM   7788  O  O    . TYR A 1 521 ? -64.977 30.521  -28.455 1.00 67.39  ? 600  TYR A O    1 
ATOM   7789  C  CB   . TYR A 1 521 ? -62.023 29.363  -28.250 1.00 66.51  ? 600  TYR A CB   1 
ATOM   7790  C  CG   . TYR A 1 521 ? -61.100 29.659  -27.086 1.00 58.83  ? 600  TYR A CG   1 
ATOM   7791  C  CD1  . TYR A 1 521 ? -61.538 30.409  -26.000 1.00 59.09  ? 600  TYR A CD1  1 
ATOM   7792  C  CD2  . TYR A 1 521 ? -59.790 29.193  -27.076 1.00 53.18  ? 600  TYR A CD2  1 
ATOM   7793  C  CE1  . TYR A 1 521 ? -60.704 30.686  -24.938 1.00 59.23  ? 600  TYR A CE1  1 
ATOM   7794  C  CE2  . TYR A 1 521 ? -58.941 29.465  -26.013 1.00 51.80  ? 600  TYR A CE2  1 
ATOM   7795  C  CZ   . TYR A 1 521 ? -59.408 30.216  -24.944 1.00 55.24  ? 600  TYR A CZ   1 
ATOM   7796  O  OH   . TYR A 1 521 ? -58.598 30.513  -23.869 1.00 49.64  ? 600  TYR A OH   1 
ATOM   7797  H  H    . TYR A 1 521 ? -62.730 27.020  -28.359 1.00 79.24  ? 600  TYR A H    1 
ATOM   7798  H  HA   . TYR A 1 521 ? -63.571 29.071  -26.935 1.00 84.39  ? 600  TYR A HA   1 
ATOM   7799  H  HB2  . TYR A 1 521 ? -61.581 28.713  -28.817 1.00 79.82  ? 600  TYR A HB2  1 
ATOM   7800  H  HB3  . TYR A 1 521 ? -62.152 30.190  -28.740 1.00 79.82  ? 600  TYR A HB3  1 
ATOM   7801  H  HD1  . TYR A 1 521 ? -62.411 30.730  -25.989 1.00 70.91  ? 600  TYR A HD1  1 
ATOM   7802  H  HD2  . TYR A 1 521 ? -59.478 28.690  -27.794 1.00 63.81  ? 600  TYR A HD2  1 
ATOM   7803  H  HE1  . TYR A 1 521 ? -61.014 31.190  -24.220 1.00 71.08  ? 600  TYR A HE1  1 
ATOM   7804  H  HE2  . TYR A 1 521 ? -58.066 29.149  -26.018 1.00 62.16  ? 600  TYR A HE2  1 
ATOM   7805  H  HH   . TYR A 1 521 ? -57.836 30.178  -23.982 1.00 59.56  ? 600  TYR A HH   1 
ATOM   7806  N  N    . THR A 1 522 ? -64.853 28.718  -29.800 1.00 82.41  ? 601  THR A N    1 
ATOM   7807  C  CA   . THR A 1 522 ? -65.891 29.175  -30.723 1.00 84.81  ? 601  THR A CA   1 
ATOM   7808  C  C    . THR A 1 522 ? -67.258 28.673  -30.290 1.00 84.50  ? 601  THR A C    1 
ATOM   7809  O  O    . THR A 1 522 ? -68.133 29.451  -29.909 1.00 90.63  ? 601  THR A O    1 
ATOM   7810  C  CB   . THR A 1 522 ? -65.626 28.667  -32.160 1.00 86.84  ? 601  THR A CB   1 
ATOM   7811  O  OG1  . THR A 1 522 ? -64.577 29.434  -32.755 1.00 86.30  ? 601  THR A OG1  1 
ATOM   7812  C  CG2  . THR A 1 522 ? -66.869 28.787  -33.047 1.00 91.36  ? 601  THR A CG2  1 
ATOM   7813  H  H    . THR A 1 522 ? -64.512 27.958  -30.013 1.00 98.89  ? 601  THR A H    1 
ATOM   7814  H  HA   . THR A 1 522 ? -65.909 30.145  -30.736 1.00 101.77 ? 601  THR A HA   1 
ATOM   7815  H  HB   . THR A 1 522 ? -65.363 27.734  -32.128 1.00 104.21 ? 601  THR A HB   1 
ATOM   7816  H  HG1  . THR A 1 522 ? -64.430 29.162  -33.535 1.00 103.56 ? 601  THR A HG1  1 
ATOM   7817  H  HG21 . THR A 1 522 ? -66.672 28.461  -33.939 1.00 109.63 ? 601  THR A HG21 1 
ATOM   7818  H  HG22 . THR A 1 522 ? -67.594 28.262  -32.673 1.00 109.63 ? 601  THR A HG22 1 
ATOM   7819  H  HG23 . THR A 1 522 ? -67.147 29.714  -33.103 1.00 109.63 ? 601  THR A HG23 1 
ATOM   7820  N  N    . THR A 1 523 ? -67.430 27.359  -30.363 1.00 63.57  ? 602  THR A N    1 
ATOM   7821  C  CA   . THR A 1 523 ? -68.721 26.736  -30.119 1.00 65.37  ? 602  THR A CA   1 
ATOM   7822  C  C    . THR A 1 523 ? -69.190 26.958  -28.685 1.00 71.20  ? 602  THR A C    1 
ATOM   7823  O  O    . THR A 1 523 ? -70.390 26.951  -28.409 1.00 74.08  ? 602  THR A O    1 
ATOM   7824  C  CB   . THR A 1 523 ? -68.663 25.230  -30.403 1.00 69.12  ? 602  THR A CB   1 
ATOM   7825  O  OG1  . THR A 1 523 ? -67.817 24.588  -29.440 1.00 66.35  ? 602  THR A OG1  1 
ATOM   7826  C  CG2  . THR A 1 523 ? -68.124 24.980  -31.803 1.00 72.08  ? 602  THR A CG2  1 
ATOM   7827  H  H    . THR A 1 523 ? -66.805 26.800  -30.555 1.00 76.29  ? 602  THR A H    1 
ATOM   7828  H  HA   . THR A 1 523 ? -69.379 27.129  -30.714 1.00 78.44  ? 602  THR A HA   1 
ATOM   7829  H  HB   . THR A 1 523 ? -69.556 24.857  -30.347 1.00 82.95  ? 602  THR A HB   1 
ATOM   7830  H  HG1  . THR A 1 523 ? -67.783 23.762  -29.593 1.00 79.62  ? 602  THR A HG1  1 
ATOM   7831  H  HG21 . THR A 1 523 ? -68.089 24.027  -31.979 1.00 86.49  ? 602  THR A HG21 1 
ATOM   7832  H  HG22 . THR A 1 523 ? -68.701 25.401  -32.460 1.00 86.49  ? 602  THR A HG22 1 
ATOM   7833  H  HG23 . THR A 1 523 ? -67.231 25.349  -31.885 1.00 86.49  ? 602  THR A HG23 1 
ATOM   7834  N  N    . GLY A 1 524 ? -68.237 27.155  -27.780 1.00 68.31  ? 603  GLY A N    1 
ATOM   7835  C  CA   . GLY A 1 524 ? -68.545 27.407  -26.385 1.00 64.48  ? 603  GLY A CA   1 
ATOM   7836  C  C    . GLY A 1 524 ? -68.825 28.873  -26.117 1.00 67.73  ? 603  GLY A C    1 
ATOM   7837  O  O    . GLY A 1 524 ? -69.138 29.249  -24.988 1.00 73.39  ? 603  GLY A O    1 
ATOM   7838  H  H    . GLY A 1 524 ? -67.395 27.146  -27.955 1.00 81.97  ? 603  GLY A H    1 
ATOM   7839  H  HA2  . GLY A 1 524 ? -69.325 26.892  -26.127 1.00 77.37  ? 603  GLY A HA2  1 
ATOM   7840  H  HA3  . GLY A 1 524 ? -67.797 27.130  -25.833 1.00 77.37  ? 603  GLY A HA3  1 
ATOM   7841  N  N    . ARG A 1 525 ? -68.713 29.698  -27.156 1.00 74.46  ? 604  ARG A N    1 
ATOM   7842  C  CA   . ARG A 1 525 ? -68.963 31.133  -27.043 1.00 79.75  ? 604  ARG A CA   1 
ATOM   7843  C  C    . ARG A 1 525 ? -68.135 31.744  -25.907 1.00 81.97  ? 604  ARG A C    1 
ATOM   7844  O  O    . ARG A 1 525 ? -68.671 32.391  -25.006 1.00 74.73  ? 604  ARG A O    1 
ATOM   7845  C  CB   . ARG A 1 525 ? -70.462 31.396  -26.848 1.00 86.94  ? 604  ARG A CB   1 
ATOM   7846  C  CG   . ARG A 1 525 ? -71.308 30.944  -28.033 1.00 92.43  ? 604  ARG A CG   1 
ATOM   7847  C  CD   . ARG A 1 525 ? -72.726 31.493  -27.982 1.00 101.68 ? 604  ARG A CD   1 
ATOM   7848  N  NE   . ARG A 1 525 ? -73.312 31.573  -29.318 1.00 110.28 ? 604  ARG A NE   1 
ATOM   7849  C  CZ   . ARG A 1 525 ? -74.609 31.733  -29.569 1.00 114.04 ? 604  ARG A CZ   1 
ATOM   7850  N  NH1  . ARG A 1 525 ? -75.486 31.820  -28.577 1.00 115.73 ? 604  ARG A NH1  1 
ATOM   7851  N  NH2  . ARG A 1 525 ? -75.032 31.797  -30.824 1.00 105.73 ? 604  ARG A NH2  1 
ATOM   7852  H  H    . ARG A 1 525 ? -68.491 29.447  -27.948 1.00 89.35  ? 604  ARG A H    1 
ATOM   7853  H  HA   . ARG A 1 525 ? -68.693 31.563  -27.869 1.00 95.70  ? 604  ARG A HA   1 
ATOM   7854  H  HB2  . ARG A 1 525 ? -70.767 30.915  -26.063 1.00 104.33 ? 604  ARG A HB2  1 
ATOM   7855  H  HB3  . ARG A 1 525 ? -70.602 32.349  -26.728 1.00 104.33 ? 604  ARG A HB3  1 
ATOM   7856  H  HG2  . ARG A 1 525 ? -70.895 31.254  -28.854 1.00 110.91 ? 604  ARG A HG2  1 
ATOM   7857  H  HG3  . ARG A 1 525 ? -71.361 29.975  -28.033 1.00 110.91 ? 604  ARG A HG3  1 
ATOM   7858  H  HD2  . ARG A 1 525 ? -73.278 30.906  -27.442 1.00 122.02 ? 604  ARG A HD2  1 
ATOM   7859  H  HD3  . ARG A 1 525 ? -72.711 32.385  -27.602 1.00 122.02 ? 604  ARG A HD3  1 
ATOM   7860  H  HE   . ARG A 1 525 ? -72.781 31.513  -29.991 1.00 132.34 ? 604  ARG A HE   1 
ATOM   7861  H  HH11 . ARG A 1 525 ? -75.217 31.779  -27.761 1.00 138.87 ? 604  ARG A HH11 1 
ATOM   7862  H  HH12 . ARG A 1 525 ? -76.322 31.921  -28.749 1.00 138.87 ? 604  ARG A HH12 1 
ATOM   7863  H  HH21 . ARG A 1 525 ? -74.468 31.739  -31.471 1.00 126.88 ? 604  ARG A HH21 1 
ATOM   7864  H  HH22 . ARG A 1 525 ? -75.869 31.896  -30.991 1.00 126.88 ? 604  ARG A HH22 1 
ATOM   7865  N  N    . LEU A 1 526 ? -66.822 31.530  -25.977 1.00 82.05  ? 605  LEU A N    1 
ATOM   7866  C  CA   . LEU A 1 526 ? -65.893 31.898  -24.909 1.00 77.38  ? 605  LEU A CA   1 
ATOM   7867  C  C    . LEU A 1 526 ? -64.894 32.974  -25.339 1.00 71.64  ? 605  LEU A C    1 
ATOM   7868  O  O    . LEU A 1 526 ? -63.918 33.233  -24.633 1.00 58.67  ? 605  LEU A O    1 
ATOM   7869  C  CB   . LEU A 1 526 ? -65.118 30.656  -24.460 1.00 71.42  ? 605  LEU A CB   1 
ATOM   7870  C  CG   . LEU A 1 526 ? -65.877 29.614  -23.639 1.00 72.66  ? 605  LEU A CG   1 
ATOM   7871  C  CD1  . LEU A 1 526 ? -65.062 28.331  -23.564 1.00 70.47  ? 605  LEU A CD1  1 
ATOM   7872  C  CD2  . LEU A 1 526 ? -66.169 30.141  -22.244 1.00 69.70  ? 605  LEU A CD2  1 
ATOM   7873  H  H    . LEU A 1 526 ? -66.435 31.162  -26.652 1.00 98.45  ? 605  LEU A H    1 
ATOM   7874  H  HA   . LEU A 1 526 ? -66.395 32.235  -24.151 1.00 92.86  ? 605  LEU A HA   1 
ATOM   7875  H  HB2  . LEU A 1 526 ? -64.785 30.206  -25.252 1.00 85.70  ? 605  LEU A HB2  1 
ATOM   7876  H  HB3  . LEU A 1 526 ? -64.366 30.949  -23.922 1.00 85.70  ? 605  LEU A HB3  1 
ATOM   7877  H  HG   . LEU A 1 526 ? -66.721 29.415  -24.073 1.00 87.20  ? 605  LEU A HG   1 
ATOM   7878  H  HD11 . LEU A 1 526 ? -65.552 27.677  -23.041 1.00 84.56  ? 605  LEU A HD11 1 
ATOM   7879  H  HD12 . LEU A 1 526 ? -64.918 27.997  -24.463 1.00 84.56  ? 605  LEU A HD12 1 
ATOM   7880  H  HD13 . LEU A 1 526 ? -64.211 28.523  -23.141 1.00 84.56  ? 605  LEU A HD13 1 
ATOM   7881  H  HD21 . LEU A 1 526 ? -66.650 29.463  -21.745 1.00 83.64  ? 605  LEU A HD21 1 
ATOM   7882  H  HD22 . LEU A 1 526 ? -65.329 30.345  -21.802 1.00 83.64  ? 605  LEU A HD22 1 
ATOM   7883  H  HD23 . LEU A 1 526 ? -66.708 30.944  -22.317 1.00 83.64  ? 605  LEU A HD23 1 
ATOM   7884  N  N    . GLU A 1 527 ? -65.147 33.608  -26.482 1.00 80.85  ? 606  GLU A N    1 
ATOM   7885  C  CA   . GLU A 1 527 ? -64.184 34.531  -27.085 1.00 76.15  ? 606  GLU A CA   1 
ATOM   7886  C  C    . GLU A 1 527 ? -63.830 35.713  -26.182 1.00 73.25  ? 606  GLU A C    1 
ATOM   7887  O  O    . GLU A 1 527 ? -62.795 36.353  -26.369 1.00 73.60  ? 606  GLU A O    1 
ATOM   7888  C  CB   . GLU A 1 527 ? -64.699 35.051  -28.432 1.00 80.70  ? 606  GLU A CB   1 
ATOM   7889  C  CG   . GLU A 1 527 ? -65.002 33.960  -29.462 1.00 82.78  ? 606  GLU A CG   1 
ATOM   7890  C  CD   . GLU A 1 527 ? -66.425 33.425  -29.380 1.00 89.75  ? 606  GLU A CD   1 
ATOM   7891  O  OE1  . GLU A 1 527 ? -67.101 33.652  -28.353 1.00 90.92  ? 606  GLU A OE1  1 
ATOM   7892  O  OE2  . GLU A 1 527 ? -66.867 32.773  -30.351 1.00 88.13  ? 606  GLU A OE2  1 
ATOM   7893  H  H    . GLU A 1 527 ? -65.875 33.520  -26.932 1.00 97.01  ? 606  GLU A H    1 
ATOM   7894  H  HA   . GLU A 1 527 ? -63.363 34.044  -27.258 1.00 91.38  ? 606  GLU A HA   1 
ATOM   7895  H  HB2  . GLU A 1 527 ? -65.519 35.547  -28.280 1.00 96.84  ? 606  GLU A HB2  1 
ATOM   7896  H  HB3  . GLU A 1 527 ? -64.029 35.639  -28.814 1.00 96.84  ? 606  GLU A HB3  1 
ATOM   7897  H  HG2  . GLU A 1 527 ? -64.872 34.325  -30.352 1.00 99.34  ? 606  GLU A HG2  1 
ATOM   7898  H  HG3  . GLU A 1 527 ? -64.395 33.217  -29.319 1.00 99.34  ? 606  GLU A HG3  1 
ATOM   7899  N  N    . LYS A 1 528 ? -64.690 36.008  -25.211 1.00 65.09  ? 607  LYS A N    1 
ATOM   7900  C  CA   . LYS A 1 528 ? -64.423 37.089  -24.270 1.00 65.24  ? 607  LYS A CA   1 
ATOM   7901  C  C    . LYS A 1 528 ? -63.243 36.722  -23.377 1.00 61.34  ? 607  LYS A C    1 
ATOM   7902  O  O    . LYS A 1 528 ? -62.440 37.579  -23.011 1.00 57.06  ? 607  LYS A O    1 
ATOM   7903  C  CB   . LYS A 1 528 ? -65.655 37.385  -23.411 1.00 70.60  ? 607  LYS A CB   1 
ATOM   7904  C  CG   . LYS A 1 528 ? -66.902 37.740  -24.205 1.00 76.86  ? 607  LYS A CG   1 
ATOM   7905  C  CD   . LYS A 1 528 ? -67.436 39.111  -23.816 1.00 76.28  ? 607  LYS A CD   1 
ATOM   7906  C  CE   . LYS A 1 528 ? -68.754 39.415  -24.510 1.00 77.24  ? 607  LYS A CE   1 
ATOM   7907  N  NZ   . LYS A 1 528 ? -69.845 38.498  -24.076 1.00 82.07  ? 607  LYS A NZ   1 
ATOM   7908  H  H    . LYS A 1 528 ? -65.434 35.597  -25.077 1.00 78.11  ? 607  LYS A H    1 
ATOM   7909  H  HA   . LYS A 1 528 ? -64.194 37.894  -24.762 1.00 78.28  ? 607  LYS A HA   1 
ATOM   7910  H  HB2  . LYS A 1 528 ? -65.859 36.599  -22.879 1.00 84.72  ? 607  LYS A HB2  1 
ATOM   7911  H  HB3  . LYS A 1 528 ? -65.455 38.132  -22.826 1.00 84.72  ? 607  LYS A HB3  1 
ATOM   7912  H  HG2  . LYS A 1 528 ? -66.686 37.755  -25.150 1.00 92.24  ? 607  LYS A HG2  1 
ATOM   7913  H  HG3  . LYS A 1 528 ? -67.593 37.083  -24.028 1.00 92.24  ? 607  LYS A HG3  1 
ATOM   7914  H  HD2  . LYS A 1 528 ? -67.585 39.136  -22.857 1.00 91.53  ? 607  LYS A HD2  1 
ATOM   7915  H  HD3  . LYS A 1 528 ? -66.793 39.790  -24.073 1.00 91.53  ? 607  LYS A HD3  1 
ATOM   7916  H  HE2  . LYS A 1 528 ? -69.021 40.324  -24.300 1.00 92.68  ? 607  LYS A HE2  1 
ATOM   7917  H  HE3  . LYS A 1 528 ? -68.639 39.315  -25.468 1.00 92.68  ? 607  LYS A HE3  1 
ATOM   7918  H  HZ1  . LYS A 1 528 ? -70.601 38.703  -24.500 1.00 98.48  ? 607  LYS A HZ1  1 
ATOM   7919  H  HZ2  . LYS A 1 528 ? -69.627 37.656  -24.263 1.00 98.48  ? 607  LYS A HZ2  1 
ATOM   7920  H  HZ3  . LYS A 1 528 ? -69.976 38.576  -23.199 1.00 98.48  ? 607  LYS A HZ3  1 
ATOM   7921  N  N    . HIS A 1 529 ? -63.143 35.440  -23.036 1.00 69.96  ? 608  HIS A N    1 
ATOM   7922  C  CA   . HIS A 1 529 ? -62.065 34.948  -22.182 1.00 65.87  ? 608  HIS A CA   1 
ATOM   7923  C  C    . HIS A 1 529 ? -60.749 34.845  -22.941 1.00 62.94  ? 608  HIS A C    1 
ATOM   7924  O  O    . HIS A 1 529 ? -59.677 35.105  -22.394 1.00 58.02  ? 608  HIS A O    1 
ATOM   7925  C  CB   . HIS A 1 529 ? -62.419 33.574  -21.626 1.00 56.86  ? 608  HIS A CB   1 
ATOM   7926  C  CG   . HIS A 1 529 ? -63.697 33.549  -20.854 1.00 59.27  ? 608  HIS A CG   1 
ATOM   7927  N  ND1  . HIS A 1 529 ? -64.905 33.217  -21.428 1.00 61.60  ? 608  HIS A ND1  1 
ATOM   7928  C  CD2  . HIS A 1 529 ? -63.960 33.818  -19.554 1.00 60.32  ? 608  HIS A CD2  1 
ATOM   7929  C  CE1  . HIS A 1 529 ? -65.856 33.277  -20.514 1.00 68.36  ? 608  HIS A CE1  1 
ATOM   7930  N  NE2  . HIS A 1 529 ? -65.309 33.641  -19.367 1.00 69.36  ? 608  HIS A NE2  1 
ATOM   7931  H  H    . HIS A 1 529 ? -63.693 34.829  -23.290 1.00 83.96  ? 608  HIS A H    1 
ATOM   7932  H  HA   . HIS A 1 529 ? -61.941 35.557  -21.437 1.00 79.04  ? 608  HIS A HA   1 
ATOM   7933  H  HB2  . HIS A 1 529 ? -62.506 32.951  -22.364 1.00 68.23  ? 608  HIS A HB2  1 
ATOM   7934  H  HB3  . HIS A 1 529 ? -61.709 33.284  -21.032 1.00 68.23  ? 608  HIS A HB3  1 
ATOM   7935  H  HD1  . HIS A 1 529 ? -65.021 33.000  -22.253 1.00 73.92  ? 608  HIS A HD1  1 
ATOM   7936  H  HD2  . HIS A 1 529 ? -63.342 34.072  -18.907 1.00 72.38  ? 608  HIS A HD2  1 
ATOM   7937  H  HE1  . HIS A 1 529 ? -66.757 33.098  -20.654 1.00 82.03  ? 608  HIS A HE1  1 
ATOM   7938  H  HE2  . HIS A 1 529 ? -65.730 33.749  -18.625 1.00 83.23  ? 608  HIS A HE2  1 
ATOM   7939  N  N    . LEU A 1 530 ? -60.843 34.432  -24.198 1.00 57.12  ? 609  LEU A N    1 
ATOM   7940  C  CA   . LEU A 1 530 ? -59.685 34.351  -25.070 1.00 53.32  ? 609  LEU A CA   1 
ATOM   7941  C  C    . LEU A 1 530 ? -58.987 35.700  -25.181 1.00 59.16  ? 609  LEU A C    1 
ATOM   7942  O  O    . LEU A 1 530 ? -57.766 35.776  -25.143 1.00 60.33  ? 609  LEU A O    1 
ATOM   7943  C  CB   . LEU A 1 530 ? -60.113 33.869  -26.451 1.00 47.08  ? 609  LEU A CB   1 
ATOM   7944  C  CG   . LEU A 1 530 ? -59.059 33.986  -27.555 1.00 51.42  ? 609  LEU A CG   1 
ATOM   7945  C  CD1  . LEU A 1 530 ? -57.745 33.309  -27.184 1.00 50.83  ? 609  LEU A CD1  1 
ATOM   7946  C  CD2  . LEU A 1 530 ? -59.598 33.381  -28.822 1.00 56.95  ? 609  LEU A CD2  1 
ATOM   7947  H  H    . LEU A 1 530 ? -61.578 34.191  -24.573 1.00 68.54  ? 609  LEU A H    1 
ATOM   7948  H  HA   . LEU A 1 530 ? -59.054 33.710  -24.705 1.00 63.98  ? 609  LEU A HA   1 
ATOM   7949  H  HB2  . LEU A 1 530 ? -60.360 32.933  -26.385 1.00 56.50  ? 609  LEU A HB2  1 
ATOM   7950  H  HB3  . LEU A 1 530 ? -60.883 34.388  -26.730 1.00 56.50  ? 609  LEU A HB3  1 
ATOM   7951  H  HG   . LEU A 1 530 ? -58.878 34.925  -27.722 1.00 61.71  ? 609  LEU A HG   1 
ATOM   7952  H  HD11 . LEU A 1 530 ? -57.119 33.415  -27.917 1.00 61.00  ? 609  LEU A HD11 1 
ATOM   7953  H  HD12 . LEU A 1 530 ? -57.391 33.726  -26.383 1.00 61.00  ? 609  LEU A HD12 1 
ATOM   7954  H  HD13 . LEU A 1 530 ? -57.911 32.367  -27.023 1.00 61.00  ? 609  LEU A HD13 1 
ATOM   7955  H  HD21 . LEU A 1 530 ? -58.927 33.458  -29.518 1.00 68.34  ? 609  LEU A HD21 1 
ATOM   7956  H  HD22 . LEU A 1 530 ? -59.804 32.447  -28.663 1.00 68.34  ? 609  LEU A HD22 1 
ATOM   7957  H  HD23 . LEU A 1 530 ? -60.401 33.858  -29.083 1.00 68.34  ? 609  LEU A HD23 1 
ATOM   7958  N  N    . ASP A 1 531 ? -59.765 36.766  -25.319 1.00 75.41  ? 610  ASP A N    1 
ATOM   7959  C  CA   . ASP A 1 531 ? -59.199 38.108  -25.369 1.00 74.56  ? 610  ASP A CA   1 
ATOM   7960  C  C    . ASP A 1 531 ? -58.523 38.478  -24.045 1.00 71.25  ? 610  ASP A C    1 
ATOM   7961  O  O    . ASP A 1 531 ? -57.534 39.212  -24.034 1.00 68.39  ? 610  ASP A O    1 
ATOM   7962  C  CB   . ASP A 1 531 ? -60.284 39.129  -25.718 1.00 78.53  ? 610  ASP A CB   1 
ATOM   7963  C  CG   . ASP A 1 531 ? -60.659 39.103  -27.191 1.00 87.74  ? 610  ASP A CG   1 
ATOM   7964  O  OD1  . ASP A 1 531 ? -59.748 38.975  -28.040 1.00 86.62  ? 610  ASP A OD1  1 
ATOM   7965  O  OD2  . ASP A 1 531 ? -61.867 39.210  -27.498 1.00 91.48  ? 610  ASP A OD2  1 
ATOM   7966  H  H    . ASP A 1 531 ? -60.622 36.740  -25.387 1.00 90.49  ? 610  ASP A H    1 
ATOM   7967  H  HA   . ASP A 1 531 ? -58.526 38.139  -26.066 1.00 89.48  ? 610  ASP A HA   1 
ATOM   7968  H  HB2  . ASP A 1 531 ? -61.082 38.934  -25.202 1.00 94.23  ? 610  ASP A HB2  1 
ATOM   7969  H  HB3  . ASP A 1 531 ? -59.961 40.019  -25.506 1.00 94.23  ? 610  ASP A HB3  1 
ATOM   7970  N  N    . ALA A 1 532 ? -59.058 37.969  -22.937 1.00 61.59  ? 611  ALA A N    1 
ATOM   7971  C  CA   . ALA A 1 532 ? -58.477 38.222  -21.619 1.00 63.85  ? 611  ALA A CA   1 
ATOM   7972  C  C    . ALA A 1 532 ? -57.113 37.548  -21.515 1.00 65.42  ? 611  ALA A C    1 
ATOM   7973  O  O    . ALA A 1 532 ? -56.175 38.096  -20.935 1.00 64.36  ? 611  ALA A O    1 
ATOM   7974  C  CB   . ALA A 1 532 ? -59.406 37.720  -20.512 1.00 58.93  ? 611  ALA A CB   1 
ATOM   7975  H  H    . ALA A 1 532 ? -59.760 37.473  -22.921 1.00 73.91  ? 611  ALA A H    1 
ATOM   7976  H  HA   . ALA A 1 532 ? -58.354 39.176  -21.502 1.00 76.62  ? 611  ALA A HA   1 
ATOM   7977  H  HB1  . ALA A 1 532 ? -58.996 37.900  -19.651 1.00 70.72  ? 611  ALA A HB1  1 
ATOM   7978  H  HB2  . ALA A 1 532 ? -60.255 38.184  -20.578 1.00 70.72  ? 611  ALA A HB2  1 
ATOM   7979  H  HB3  . ALA A 1 532 ? -59.540 36.765  -20.622 1.00 70.72  ? 611  ALA A HB3  1 
ATOM   7980  N  N    . LEU A 1 533 ? -57.019 36.352  -22.085 1.00 64.43  ? 612  LEU A N    1 
ATOM   7981  C  CA   . LEU A 1 533 ? -55.775 35.598  -22.114 1.00 60.12  ? 612  LEU A CA   1 
ATOM   7982  C  C    . LEU A 1 533 ? -54.724 36.382  -22.885 1.00 62.66  ? 612  LEU A C    1 
ATOM   7983  O  O    . LEU A 1 533 ? -53.634 36.647  -22.379 1.00 56.50  ? 612  LEU A O    1 
ATOM   7984  C  CB   . LEU A 1 533 ? -56.012 34.241  -22.778 1.00 56.09  ? 612  LEU A CB   1 
ATOM   7985  C  CG   . LEU A 1 533 ? -54.825 33.297  -22.955 1.00 49.17  ? 612  LEU A CG   1 
ATOM   7986  C  CD1  . LEU A 1 533 ? -54.149 33.003  -21.628 1.00 48.85  ? 612  LEU A CD1  1 
ATOM   7987  C  CD2  . LEU A 1 533 ? -55.301 32.012  -23.612 1.00 47.25  ? 612  LEU A CD2  1 
ATOM   7988  H  H    . LEU A 1 533 ? -57.675 35.949  -22.469 1.00 77.32  ? 612  LEU A H    1 
ATOM   7989  H  HA   . LEU A 1 533 ? -55.457 35.453  -21.209 1.00 72.14  ? 612  LEU A HA   1 
ATOM   7990  H  HB2  . LEU A 1 533 ? -56.672 33.765  -22.250 1.00 67.31  ? 612  LEU A HB2  1 
ATOM   7991  H  HB3  . LEU A 1 533 ? -56.374 34.404  -23.663 1.00 67.31  ? 612  LEU A HB3  1 
ATOM   7992  H  HG   . LEU A 1 533 ? -54.173 33.712  -23.540 1.00 59.00  ? 612  LEU A HG   1 
ATOM   7993  H  HD11 . LEU A 1 533 ? -53.402 32.402  -21.780 1.00 58.62  ? 612  LEU A HD11 1 
ATOM   7994  H  HD12 . LEU A 1 533 ? -53.831 33.835  -21.244 1.00 58.62  ? 612  LEU A HD12 1 
ATOM   7995  H  HD13 . LEU A 1 533 ? -54.791 32.588  -21.031 1.00 58.62  ? 612  LEU A HD13 1 
ATOM   7996  H  HD21 . LEU A 1 533 ? -54.544 31.415  -23.722 1.00 56.70  ? 612  LEU A HD21 1 
ATOM   7997  H  HD22 . LEU A 1 533 ? -55.970 31.596  -23.046 1.00 56.70  ? 612  LEU A HD22 1 
ATOM   7998  H  HD23 . LEU A 1 533 ? -55.684 32.223  -24.477 1.00 56.70  ? 612  LEU A HD23 1 
ATOM   7999  N  N    . LEU A 1 534 ? -55.070 36.762  -24.109 1.00 51.63  ? 613  LEU A N    1 
ATOM   8000  C  CA   . LEU A 1 534 ? -54.145 37.466  -24.988 1.00 43.18  ? 613  LEU A CA   1 
ATOM   8001  C  C    . LEU A 1 534 ? -53.687 38.792  -24.375 1.00 41.04  ? 613  LEU A C    1 
ATOM   8002  O  O    . LEU A 1 534 ? -52.623 39.303  -24.717 1.00 46.01  ? 613  LEU A O    1 
ATOM   8003  C  CB   . LEU A 1 534 ? -54.790 37.689  -26.358 1.00 45.05  ? 613  LEU A CB   1 
ATOM   8004  C  CG   . LEU A 1 534 ? -55.296 36.393  -26.999 1.00 52.85  ? 613  LEU A CG   1 
ATOM   8005  C  CD1  . LEU A 1 534 ? -56.226 36.681  -28.168 1.00 55.28  ? 613  LEU A CD1  1 
ATOM   8006  C  CD2  . LEU A 1 534 ? -54.137 35.513  -27.428 1.00 54.22  ? 613  LEU A CD2  1 
ATOM   8007  H  H    . LEU A 1 534 ? -55.843 36.623  -24.458 1.00 61.95  ? 613  LEU A H    1 
ATOM   8008  H  HA   . LEU A 1 534 ? -53.358 36.914  -25.118 1.00 51.82  ? 613  LEU A HA   1 
ATOM   8009  H  HB2  . LEU A 1 534 ? -55.546 38.288  -26.257 1.00 54.07  ? 613  LEU A HB2  1 
ATOM   8010  H  HB3  . LEU A 1 534 ? -54.134 38.082  -26.955 1.00 54.07  ? 613  LEU A HB3  1 
ATOM   8011  H  HG   . LEU A 1 534 ? -55.805 35.901  -26.336 1.00 63.42  ? 613  LEU A HG   1 
ATOM   8012  H  HD11 . LEU A 1 534 ? -56.526 35.840  -28.547 1.00 66.33  ? 613  LEU A HD11 1 
ATOM   8013  H  HD12 . LEU A 1 534 ? -56.987 37.190  -27.847 1.00 66.33  ? 613  LEU A HD12 1 
ATOM   8014  H  HD13 . LEU A 1 534 ? -55.744 37.193  -28.836 1.00 66.33  ? 613  LEU A HD13 1 
ATOM   8015  H  HD21 . LEU A 1 534 ? -54.488 34.702  -27.829 1.00 65.07  ? 613  LEU A HD21 1 
ATOM   8016  H  HD22 . LEU A 1 534 ? -53.597 35.995  -28.074 1.00 65.07  ? 613  LEU A HD22 1 
ATOM   8017  H  HD23 . LEU A 1 534 ? -53.602 35.293  -26.649 1.00 65.07  ? 613  LEU A HD23 1 
ATOM   8018  N  N    . ARG A 1 535 ? -54.490 39.335  -23.462 1.00 52.03  ? 614  ARG A N    1 
ATOM   8019  C  CA   . ARG A 1 535 ? -54.133 40.560  -22.748 1.00 58.22  ? 614  ARG A CA   1 
ATOM   8020  C  C    . ARG A 1 535 ? -53.121 40.267  -21.646 1.00 58.59  ? 614  ARG A C    1 
ATOM   8021  O  O    . ARG A 1 535 ? -52.142 40.993  -21.478 1.00 55.35  ? 614  ARG A O    1 
ATOM   8022  C  CB   . ARG A 1 535 ? -55.376 41.211  -22.134 1.00 65.69  ? 614  ARG A CB   1 
ATOM   8023  C  CG   . ARG A 1 535 ? -55.723 42.570  -22.729 1.00 68.58  ? 614  ARG A CG   1 
ATOM   8024  C  CD   . ARG A 1 535 ? -56.735 43.329  -21.876 1.00 74.91  ? 614  ARG A CD   1 
ATOM   8025  N  NE   . ARG A 1 535 ? -57.854 42.487  -21.460 1.00 75.78  ? 614  ARG A NE   1 
ATOM   8026  C  CZ   . ARG A 1 535 ? -58.882 42.162  -22.238 1.00 75.36  ? 614  ARG A CZ   1 
ATOM   8027  N  NH1  . ARG A 1 535 ? -58.943 42.599  -23.490 1.00 76.61  ? 614  ARG A NH1  1 
ATOM   8028  N  NH2  . ARG A 1 535 ? -59.851 41.391  -21.765 1.00 71.47  ? 614  ARG A NH2  1 
ATOM   8029  H  H    . ARG A 1 535 ? -55.253 39.011  -23.236 1.00 62.44  ? 614  ARG A H    1 
ATOM   8030  H  HA   . ARG A 1 535 ? -53.734 41.189  -23.369 1.00 69.86  ? 614  ARG A HA   1 
ATOM   8031  H  HB2  . ARG A 1 535 ? -56.136 40.624  -22.273 1.00 78.82  ? 614  ARG A HB2  1 
ATOM   8032  H  HB3  . ARG A 1 535 ? -55.226 41.334  -21.183 1.00 78.82  ? 614  ARG A HB3  1 
ATOM   8033  H  HG2  . ARG A 1 535 ? -54.917 43.106  -22.789 1.00 82.29  ? 614  ARG A HG2  1 
ATOM   8034  H  HG3  . ARG A 1 535 ? -56.106 42.442  -23.611 1.00 82.29  ? 614  ARG A HG3  1 
ATOM   8035  H  HD2  . ARG A 1 535 ? -56.293 43.659  -21.078 1.00 89.90  ? 614  ARG A HD2  1 
ATOM   8036  H  HD3  . ARG A 1 535 ? -57.091 44.070  -22.391 1.00 89.90  ? 614  ARG A HD3  1 
ATOM   8037  H  HE   . ARG A 1 535 ? -57.847 42.180  -20.656 1.00 90.94  ? 614  ARG A HE   1 
ATOM   8038  H  HH11 . ARG A 1 535 ? -58.317 43.099  -23.801 1.00 91.93  ? 614  ARG A HH11 1 
ATOM   8039  H  HH12 . ARG A 1 535 ? -59.610 42.384  -23.988 1.00 91.93  ? 614  ARG A HH12 1 
ATOM   8040  H  HH21 . ARG A 1 535 ? -59.815 41.104  -20.955 1.00 85.77  ? 614  ARG A HH21 1 
ATOM   8041  H  HH22 . ARG A 1 535 ? -60.516 41.178  -22.268 1.00 85.77  ? 614  ARG A HH22 1 
ATOM   8042  N  N    . GLN A 1 536 ? -53.374 39.203  -20.891 1.00 69.16  ? 615  GLN A N    1 
ATOM   8043  C  CA   . GLN A 1 536 ? -52.514 38.830  -19.776 1.00 65.07  ? 615  GLN A CA   1 
ATOM   8044  C  C    . GLN A 1 536 ? -51.162 38.334  -20.280 1.00 67.90  ? 615  GLN A C    1 
ATOM   8045  O  O    . GLN A 1 536 ? -50.125 38.604  -19.672 1.00 70.12  ? 615  GLN A O    1 
ATOM   8046  C  CB   . GLN A 1 536 ? -53.193 37.759  -18.920 1.00 58.23  ? 615  GLN A CB   1 
ATOM   8047  C  CG   . GLN A 1 536 ? -54.409 38.265  -18.158 1.00 57.10  ? 615  GLN A CG   1 
ATOM   8048  C  CD   . GLN A 1 536 ? -54.049 39.290  -17.099 1.00 65.75  ? 615  GLN A CD   1 
ATOM   8049  O  OE1  . GLN A 1 536 ? -52.997 39.205  -16.468 1.00 63.44  ? 615  GLN A OE1  1 
ATOM   8050  N  NE2  . GLN A 1 536 ? -54.922 40.270  -16.904 1.00 75.80  ? 615  GLN A NE2  1 
ATOM   8051  H  H    . GLN A 1 536 ? -54.044 38.677  -21.006 1.00 83.00  ? 615  GLN A H    1 
ATOM   8052  H  HA   . GLN A 1 536 ? -52.361 39.609  -19.218 1.00 78.08  ? 615  GLN A HA   1 
ATOM   8053  H  HB2  . GLN A 1 536 ? -53.485 37.036  -19.497 1.00 69.88  ? 615  GLN A HB2  1 
ATOM   8054  H  HB3  . GLN A 1 536 ? -52.554 37.425  -18.271 1.00 69.88  ? 615  GLN A HB3  1 
ATOM   8055  H  HG2  . GLN A 1 536 ? -55.023 38.681  -18.783 1.00 68.53  ? 615  GLN A HG2  1 
ATOM   8056  H  HG3  . GLN A 1 536 ? -54.840 37.516  -17.717 1.00 68.53  ? 615  GLN A HG3  1 
ATOM   8057  H  HE21 . GLN A 1 536 ? -55.646 40.300  -17.367 1.00 90.96  ? 615  GLN A HE21 1 
ATOM   8058  H  HE22 . GLN A 1 536 ? -54.764 40.876  -16.315 1.00 90.96  ? 615  GLN A HE22 1 
ATOM   8059  N  N    . ILE A 1 537 ? -51.176 37.611  -21.397 1.00 58.06  ? 616  ILE A N    1 
ATOM   8060  C  CA   . ILE A 1 537 ? -49.940 37.162  -22.023 1.00 51.85  ? 616  ILE A CA   1 
ATOM   8061  C  C    . ILE A 1 537 ? -49.118 38.370  -22.434 1.00 60.61  ? 616  ILE A C    1 
ATOM   8062  O  O    . ILE A 1 537 ? -47.916 38.424  -22.180 1.00 65.16  ? 616  ILE A O    1 
ATOM   8063  C  CB   . ILE A 1 537 ? -50.210 36.289  -23.263 1.00 48.38  ? 616  ILE A CB   1 
ATOM   8064  C  CG1  . ILE A 1 537 ? -50.876 34.981  -22.837 1.00 47.98  ? 616  ILE A CG1  1 
ATOM   8065  C  CG2  . ILE A 1 537 ? -48.906 35.989  -24.012 1.00 47.58  ? 616  ILE A CG2  1 
ATOM   8066  C  CD1  . ILE A 1 537 ? -51.341 34.112  -23.983 1.00 45.68  ? 616  ILE A CD1  1 
ATOM   8067  H  H    . ILE A 1 537 ? -51.890 37.369  -21.811 1.00 69.67  ? 616  ILE A H    1 
ATOM   8068  H  HA   . ILE A 1 537 ? -49.426 36.642  -21.386 1.00 62.22  ? 616  ILE A HA   1 
ATOM   8069  H  HB   . ILE A 1 537 ? -50.809 36.766  -23.857 1.00 58.06  ? 616  ILE A HB   1 
ATOM   8070  H  HG12 . ILE A 1 537 ? -50.242 34.465  -22.315 1.00 57.57  ? 616  ILE A HG12 1 
ATOM   8071  H  HG13 . ILE A 1 537 ? -51.652 35.191  -22.294 1.00 57.57  ? 616  ILE A HG13 1 
ATOM   8072  H  HG21 . ILE A 1 537 ? -49.106 35.439  -24.785 1.00 57.10  ? 616  ILE A HG21 1 
ATOM   8073  H  HG22 . ILE A 1 537 ? -48.505 36.825  -24.295 1.00 57.10  ? 616  ILE A HG22 1 
ATOM   8074  H  HG23 . ILE A 1 537 ? -48.302 35.517  -23.417 1.00 57.10  ? 616  ILE A HG23 1 
ATOM   8075  H  HD11 . ILE A 1 537 ? -51.749 33.308  -23.624 1.00 54.81  ? 616  ILE A HD11 1 
ATOM   8076  H  HD12 . ILE A 1 537 ? -51.989 34.605  -24.510 1.00 54.81  ? 616  ILE A HD12 1 
ATOM   8077  H  HD13 . ILE A 1 537 ? -50.576 33.878  -24.532 1.00 54.81  ? 616  ILE A HD13 1 
ATOM   8078  N  N    . ARG A 1 538 ? -49.773 39.332  -23.077 1.00 74.50  ? 617  ARG A N    1 
ATOM   8079  C  CA   . ARG A 1 538 ? -49.102 40.544  -23.532 1.00 73.59  ? 617  ARG A CA   1 
ATOM   8080  C  C    . ARG A 1 538 ? -48.463 41.313  -22.378 1.00 69.60  ? 617  ARG A C    1 
ATOM   8081  O  O    . ARG A 1 538 ? -47.344 41.804  -22.501 1.00 70.51  ? 617  ARG A O    1 
ATOM   8082  C  CB   . ARG A 1 538 ? -50.076 41.459  -24.275 1.00 76.86  ? 617  ARG A CB   1 
ATOM   8083  C  CG   . ARG A 1 538 ? -50.193 41.182  -25.769 1.00 74.92  ? 617  ARG A CG   1 
ATOM   8084  C  CD   . ARG A 1 538 ? -50.635 42.435  -26.511 1.00 88.58  ? 617  ARG A CD   1 
ATOM   8085  N  NE   . ARG A 1 538 ? -51.759 42.193  -27.412 1.00 103.61 ? 617  ARG A NE   1 
ATOM   8086  C  CZ   . ARG A 1 538 ? -52.573 43.145  -27.863 1.00 106.53 ? 617  ARG A CZ   1 
ATOM   8087  N  NH1  . ARG A 1 538 ? -52.399 44.410  -27.496 1.00 104.27 ? 617  ARG A NH1  1 
ATOM   8088  N  NH2  . ARG A 1 538 ? -53.570 42.832  -28.680 1.00 103.07 ? 617  ARG A NH2  1 
ATOM   8089  H  H    . ARG A 1 538 ? -50.612 39.307  -23.262 1.00 89.39  ? 617  ARG A H    1 
ATOM   8090  H  HA   . ARG A 1 538 ? -48.396 40.297  -24.150 1.00 88.31  ? 617  ARG A HA   1 
ATOM   8091  H  HB2  . ARG A 1 538 ? -50.958 41.352  -23.887 1.00 92.23  ? 617  ARG A HB2  1 
ATOM   8092  H  HB3  . ARG A 1 538 ? -49.781 42.377  -24.169 1.00 92.23  ? 617  ARG A HB3  1 
ATOM   8093  H  HG2  . ARG A 1 538 ? -49.330 40.909  -26.116 1.00 89.91  ? 617  ARG A HG2  1 
ATOM   8094  H  HG3  . ARG A 1 538 ? -50.854 40.488  -25.918 1.00 89.91  ? 617  ARG A HG3  1 
ATOM   8095  H  HD2  . ARG A 1 538 ? -50.908 43.104  -25.864 1.00 106.30 ? 617  ARG A HD2  1 
ATOM   8096  H  HD3  . ARG A 1 538 ? -49.893 42.767  -27.039 1.00 106.30 ? 617  ARG A HD3  1 
ATOM   8097  H  HE   . ARG A 1 538 ? -51.885 41.390  -27.692 1.00 124.33 ? 617  ARG A HE   1 
ATOM   8098  H  HH11 . ARG A 1 538 ? -51.755 44.619  -26.966 1.00 125.12 ? 617  ARG A HH11 1 
ATOM   8099  H  HH12 . ARG A 1 538 ? -52.929 45.020  -27.790 1.00 125.12 ? 617  ARG A HH12 1 
ATOM   8100  H  HH21 . ARG A 1 538 ? -53.689 42.015  -28.921 1.00 123.68 ? 617  ARG A HH21 1 
ATOM   8101  H  HH22 . ARG A 1 538 ? -54.097 43.447  -28.970 1.00 123.68 ? 617  ARG A HH22 1 
ATOM   8102  N  N    . ASN A 1 539 ? -49.168 41.412  -21.256 1.00 58.65  ? 618  ASN A N    1 
ATOM   8103  C  CA   . ASN A 1 539 ? -48.645 42.134  -20.105 1.00 67.18  ? 618  ASN A CA   1 
ATOM   8104  C  C    . ASN A 1 539 ? -47.427 41.427  -19.529 1.00 67.53  ? 618  ASN A C    1 
ATOM   8105  O  O    . ASN A 1 539 ? -46.489 42.074  -19.063 1.00 73.74  ? 618  ASN A O    1 
ATOM   8106  C  CB   . ASN A 1 539 ? -49.714 42.287  -19.022 1.00 77.09  ? 618  ASN A CB   1 
ATOM   8107  C  CG   . ASN A 1 539 ? -49.191 42.997  -17.787 1.00 84.13  ? 618  ASN A CG   1 
ATOM   8108  O  OD1  . ASN A 1 539 ? -48.916 42.369  -16.764 1.00 84.76  ? 618  ASN A OD1  1 
ATOM   8109  N  ND2  . ASN A 1 539 ? -49.042 44.314  -17.881 1.00 82.13  ? 618  ASN A ND2  1 
ATOM   8110  H  H    . ASN A 1 539 ? -49.948 41.071  -21.137 1.00 70.38  ? 618  ASN A H    1 
ATOM   8111  H  HA   . ASN A 1 539 ? -48.373 43.022  -20.385 1.00 80.62  ? 618  ASN A HA   1 
ATOM   8112  H  HB2  . ASN A 1 539 ? -50.453 42.806  -19.378 1.00 92.51  ? 618  ASN A HB2  1 
ATOM   8113  H  HB3  . ASN A 1 539 ? -50.023 41.407  -18.756 1.00 92.51  ? 618  ASN A HB3  1 
ATOM   8114  H  HD21 . ASN A 1 539 ? -48.749 44.763  -17.208 1.00 98.55  ? 618  ASN A HD21 1 
ATOM   8115  H  HD22 . ASN A 1 539 ? -49.239 44.718  -18.614 1.00 98.55  ? 618  ASN A HD22 1 
ATOM   8116  N  N    . ILE A 1 540 ? -47.444 40.096  -19.569 1.00 55.50  ? 619  ILE A N    1 
ATOM   8117  C  CA   . ILE A 1 540 ? -46.317 39.301  -19.080 1.00 54.46  ? 619  ILE A CA   1 
ATOM   8118  C  C    . ILE A 1 540 ? -45.075 39.515  -19.939 1.00 54.31  ? 619  ILE A C    1 
ATOM   8119  O  O    . ILE A 1 540 ? -43.988 39.746  -19.410 1.00 53.44  ? 619  ILE A O    1 
ATOM   8120  C  CB   . ILE A 1 540 ? -46.657 37.792  -19.012 1.00 50.61  ? 619  ILE A CB   1 
ATOM   8121  C  CG1  . ILE A 1 540 ? -47.577 37.534  -17.820 1.00 50.63  ? 619  ILE A CG1  1 
ATOM   8122  C  CG2  . ILE A 1 540 ? -45.378 36.927  -18.884 1.00 45.03  ? 619  ILE A CG2  1 
ATOM   8123  C  CD1  . ILE A 1 540 ? -48.114 36.131  -17.743 1.00 52.81  ? 619  ILE A CD1  1 
ATOM   8124  H  H    . ILE A 1 540 ? -48.097 39.628  -19.874 1.00 66.60  ? 619  ILE A H    1 
ATOM   8125  H  HA   . ILE A 1 540 ? -46.103 39.593  -18.180 1.00 65.36  ? 619  ILE A HA   1 
ATOM   8126  H  HB   . ILE A 1 540 ? -47.123 37.540  -19.825 1.00 60.73  ? 619  ILE A HB   1 
ATOM   8127  H  HG12 . ILE A 1 540 ? -47.082 37.706  -17.003 1.00 60.76  ? 619  ILE A HG12 1 
ATOM   8128  H  HG13 . ILE A 1 540 ? -48.334 38.138  -17.876 1.00 60.76  ? 619  ILE A HG13 1 
ATOM   8129  H  HG21 . ILE A 1 540 ? -45.632 35.991  -18.845 1.00 54.03  ? 619  ILE A HG21 1 
ATOM   8130  H  HG22 . ILE A 1 540 ? -44.812 37.084  -19.656 1.00 54.03  ? 619  ILE A HG22 1 
ATOM   8131  H  HG23 . ILE A 1 540 ? -44.908 37.177  -18.073 1.00 54.03  ? 619  ILE A HG23 1 
ATOM   8132  H  HD11 . ILE A 1 540 ? -48.685 36.054  -16.962 1.00 63.37  ? 619  ILE A HD11 1 
ATOM   8133  H  HD12 . ILE A 1 540 ? -48.625 35.945  -18.546 1.00 63.37  ? 619  ILE A HD12 1 
ATOM   8134  H  HD13 . ILE A 1 540 ? -47.371 35.512  -17.672 1.00 63.37  ? 619  ILE A HD13 1 
ATOM   8135  N  N    . VAL A 1 541 ? -45.243 39.434  -21.257 1.00 51.44  ? 620  VAL A N    1 
ATOM   8136  C  CA   . VAL A 1 541 ? -44.133 39.620  -22.186 1.00 50.96  ? 620  VAL A CA   1 
ATOM   8137  C  C    . VAL A 1 541 ? -43.374 40.900  -21.875 1.00 56.83  ? 620  VAL A C    1 
ATOM   8138  O  O    . VAL A 1 541 ? -42.148 40.933  -21.936 1.00 63.36  ? 620  VAL A O    1 
ATOM   8139  C  CB   . VAL A 1 541 ? -44.622 39.680  -23.655 1.00 49.58  ? 620  VAL A CB   1 
ATOM   8140  C  CG1  . VAL A 1 541 ? -43.511 40.159  -24.599 1.00 55.31  ? 620  VAL A CG1  1 
ATOM   8141  C  CG2  . VAL A 1 541 ? -45.122 38.324  -24.106 1.00 44.65  ? 620  VAL A CG2  1 
ATOM   8142  H  H    . VAL A 1 541 ? -45.995 39.271  -21.640 1.00 61.73  ? 620  VAL A H    1 
ATOM   8143  H  HA   . VAL A 1 541 ? -43.518 38.874  -22.102 1.00 61.15  ? 620  VAL A HA   1 
ATOM   8144  H  HB   . VAL A 1 541 ? -45.360 40.307  -23.716 1.00 59.49  ? 620  VAL A HB   1 
ATOM   8145  H  HG11 . VAL A 1 541 ? -43.857 40.183  -25.505 1.00 66.37  ? 620  VAL A HG11 1 
ATOM   8146  H  HG12 . VAL A 1 541 ? -43.229 41.047  -24.329 1.00 66.37  ? 620  VAL A HG12 1 
ATOM   8147  H  HG13 . VAL A 1 541 ? -42.764 39.543  -24.546 1.00 66.37  ? 620  VAL A HG13 1 
ATOM   8148  H  HG21 . VAL A 1 541 ? -45.422 38.389  -25.027 1.00 53.58  ? 620  VAL A HG21 1 
ATOM   8149  H  HG22 . VAL A 1 541 ? -44.398 37.682  -24.038 1.00 53.58  ? 620  VAL A HG22 1 
ATOM   8150  H  HG23 . VAL A 1 541 ? -45.859 38.054  -23.536 1.00 53.58  ? 620  VAL A HG23 1 
ATOM   8151  N  N    . GLU A 1 542 ? -44.109 41.946  -21.516 1.00 77.36  ? 621  GLU A N    1 
ATOM   8152  C  CA   . GLU A 1 542 ? -43.531 43.279  -21.405 1.00 83.76  ? 621  GLU A CA   1 
ATOM   8153  C  C    . GLU A 1 542 ? -42.905 43.592  -20.042 1.00 87.87  ? 621  GLU A C    1 
ATOM   8154  O  O    . GLU A 1 542 ? -42.069 44.492  -19.944 1.00 94.45  ? 621  GLU A O    1 
ATOM   8155  C  CB   . GLU A 1 542 ? -44.585 44.326  -21.766 1.00 84.39  ? 621  GLU A CB   1 
ATOM   8156  C  CG   . GLU A 1 542 ? -45.120 44.159  -23.182 1.00 89.89  ? 621  GLU A CG   1 
ATOM   8157  C  CD   . GLU A 1 542 ? -45.931 45.351  -23.654 1.00 102.57 ? 621  GLU A CD   1 
ATOM   8158  O  OE1  . GLU A 1 542 ? -46.921 45.708  -22.975 1.00 105.87 ? 621  GLU A OE1  1 
ATOM   8159  O  OE2  . GLU A 1 542 ? -45.581 45.924  -24.711 1.00 102.38 ? 621  GLU A OE2  1 
ATOM   8160  H  H    . GLU A 1 542 ? -44.948 41.910  -21.332 1.00 92.83  ? 621  GLU A H    1 
ATOM   8161  H  HA   . GLU A 1 542 ? -42.822 43.352  -22.063 1.00 100.51 ? 621  GLU A HA   1 
ATOM   8162  H  HB2  . GLU A 1 542 ? -45.332 44.247  -21.153 1.00 101.27 ? 621  GLU A HB2  1 
ATOM   8163  H  HB3  . GLU A 1 542 ? -44.190 45.209  -21.697 1.00 101.27 ? 621  GLU A HB3  1 
ATOM   8164  H  HG2  . GLU A 1 542 ? -44.372 44.046  -23.790 1.00 107.87 ? 621  GLU A HG2  1 
ATOM   8165  H  HG3  . GLU A 1 542 ? -45.692 43.376  -23.213 1.00 107.87 ? 621  GLU A HG3  1 
ATOM   8166  N  N    . LYS A 1 543 ? -43.294 42.855  -19.002 1.00 80.14  ? 622  LYS A N    1 
ATOM   8167  C  CA   . LYS A 1 543 ? -42.715 43.050  -17.669 1.00 78.93  ? 622  LYS A CA   1 
ATOM   8168  C  C    . LYS A 1 543 ? -41.649 42.005  -17.340 1.00 76.64  ? 622  LYS A C    1 
ATOM   8169  O  O    . LYS A 1 543 ? -40.954 42.125  -16.330 1.00 79.17  ? 622  LYS A O    1 
ATOM   8170  C  CB   . LYS A 1 543 ? -43.799 43.048  -16.579 1.00 85.07  ? 622  LYS A CB   1 
ATOM   8171  C  CG   . LYS A 1 543 ? -44.411 41.680  -16.264 1.00 82.90  ? 622  LYS A CG   1 
ATOM   8172  C  CD   . LYS A 1 543 ? -45.545 41.784  -15.243 1.00 81.07  ? 622  LYS A CD   1 
ATOM   8173  C  CE   . LYS A 1 543 ? -45.045 42.252  -13.885 1.00 82.99  ? 622  LYS A CE   1 
ATOM   8174  N  NZ   . LYS A 1 543 ? -46.132 42.244  -12.866 1.00 82.65  ? 622  LYS A NZ   1 
ATOM   8175  H  H    . LYS A 1 543 ? -43.889 42.236  -19.041 1.00 96.17  ? 622  LYS A H    1 
ATOM   8176  H  HA   . LYS A 1 543 ? -42.284 43.919  -17.647 1.00 94.72  ? 622  LYS A HA   1 
ATOM   8177  H  HB2  . LYS A 1 543 ? -43.411 43.389  -15.758 1.00 102.08 ? 622  LYS A HB2  1 
ATOM   8178  H  HB3  . LYS A 1 543 ? -44.521 43.631  -16.862 1.00 102.08 ? 622  LYS A HB3  1 
ATOM   8179  H  HG2  . LYS A 1 543 ? -44.771 41.297  -17.079 1.00 99.48  ? 622  LYS A HG2  1 
ATOM   8180  H  HG3  . LYS A 1 543 ? -43.725 41.101  -15.897 1.00 99.48  ? 622  LYS A HG3  1 
ATOM   8181  H  HD2  . LYS A 1 543 ? -46.202 42.423  -15.560 1.00 97.28  ? 622  LYS A HD2  1 
ATOM   8182  H  HD3  . LYS A 1 543 ? -45.954 40.912  -15.131 1.00 97.28  ? 622  LYS A HD3  1 
ATOM   8183  H  HE2  . LYS A 1 543 ? -44.341 41.658  -13.581 1.00 99.59  ? 622  LYS A HE2  1 
ATOM   8184  H  HE3  . LYS A 1 543 ? -44.709 43.158  -13.963 1.00 99.59  ? 622  LYS A HE3  1 
ATOM   8185  H  HZ1  . LYS A 1 543 ? -45.815 42.521  -12.082 1.00 99.17  ? 622  LYS A HZ1  1 
ATOM   8186  H  HZ2  . LYS A 1 543 ? -46.790 42.787  -13.120 1.00 99.17  ? 622  LYS A HZ2  1 
ATOM   8187  H  HZ3  . LYS A 1 543 ? -46.456 41.421  -12.773 1.00 99.17  ? 622  LYS A HZ3  1 
ATOM   8188  N  N    . HIS A 1 544 ? -41.511 40.995  -18.197 1.00 59.73  ? 623  HIS A N    1 
ATOM   8189  C  CA   . HIS A 1 544 ? -40.550 39.917  -17.960 1.00 54.82  ? 623  HIS A CA   1 
ATOM   8190  C  C    . HIS A 1 544 ? -39.399 39.923  -18.953 1.00 57.54  ? 623  HIS A C    1 
ATOM   8191  O  O    . HIS A 1 544 ? -39.575 40.239  -20.131 1.00 61.69  ? 623  HIS A O    1 
ATOM   8192  C  CB   . HIS A 1 544 ? -41.240 38.550  -17.975 1.00 55.15  ? 623  HIS A CB   1 
ATOM   8193  C  CG   . HIS A 1 544 ? -41.834 38.166  -16.656 1.00 58.69  ? 623  HIS A CG   1 
ATOM   8194  N  ND1  . HIS A 1 544 ? -41.076 37.664  -15.618 1.00 51.38  ? 623  HIS A ND1  1 
ATOM   8195  C  CD2  . HIS A 1 544 ? -43.106 38.222  -16.201 1.00 57.41  ? 623  HIS A CD2  1 
ATOM   8196  C  CE1  . HIS A 1 544 ? -41.859 37.424  -14.583 1.00 56.64  ? 623  HIS A CE1  1 
ATOM   8197  N  NE2  . HIS A 1 544 ? -43.096 37.752  -14.908 1.00 55.52  ? 623  HIS A NE2  1 
ATOM   8198  H  H    . HIS A 1 544 ? -41.962 40.909  -18.924 1.00 71.68  ? 623  HIS A H    1 
ATOM   8199  H  HA   . HIS A 1 544 ? -40.169 40.038  -17.076 1.00 65.78  ? 623  HIS A HA   1 
ATOM   8200  H  HB2  . HIS A 1 544 ? -41.956 38.568  -18.630 1.00 66.18  ? 623  HIS A HB2  1 
ATOM   8201  H  HB3  . HIS A 1 544 ? -40.589 37.873  -18.217 1.00 66.18  ? 623  HIS A HB3  1 
ATOM   8202  H  HD1  . HIS A 1 544 ? -40.227 37.529  -15.642 1.00 61.65  ? 623  HIS A HD1  1 
ATOM   8203  H  HD2  . HIS A 1 544 ? -43.850 38.519  -16.674 1.00 68.89  ? 623  HIS A HD2  1 
ATOM   8204  H  HE1  . HIS A 1 544 ? -41.586 37.080  -13.763 1.00 67.97  ? 623  HIS A HE1  1 
ATOM   8205  H  HE2  . HIS A 1 544 ? -43.783 37.683  -14.395 1.00 66.62  ? 623  HIS A HE2  1 
ATOM   8206  N  N    . THR A 1 545 ? -38.221 39.569  -18.450 1.00 57.85  ? 624  THR A N    1 
ATOM   8207  C  CA   . THR A 1 545 ? -37.014 39.482  -19.262 1.00 56.35  ? 624  THR A CA   1 
ATOM   8208  C  C    . THR A 1 545 ? -36.368 38.105  -19.139 1.00 54.19  ? 624  THR A C    1 
ATOM   8209  O  O    . THR A 1 545 ? -35.366 37.821  -19.794 1.00 55.68  ? 624  THR A O    1 
ATOM   8210  C  CB   . THR A 1 545 ? -35.986 40.548  -18.844 1.00 62.97  ? 624  THR A CB   1 
ATOM   8211  O  OG1  . THR A 1 545 ? -35.520 40.280  -17.514 1.00 57.58  ? 624  THR A OG1  1 
ATOM   8212  C  CG2  . THR A 1 545 ? -36.605 41.939  -18.895 1.00 67.34  ? 624  THR A CG2  1 
ATOM   8213  H  H    . THR A 1 545 ? -38.093 39.370  -17.623 1.00 69.42  ? 624  THR A H    1 
ATOM   8214  H  HA   . THR A 1 545 ? -37.243 39.629  -20.193 1.00 67.62  ? 624  THR A HA   1 
ATOM   8215  H  HB   . THR A 1 545 ? -35.235 40.526  -19.457 1.00 75.57  ? 624  THR A HB   1 
ATOM   8216  H  HG1  . THR A 1 545 ? -34.958 40.861  -17.285 1.00 69.10  ? 624  THR A HG1  1 
ATOM   8217  H  HG21 . THR A 1 545 ? -35.949 42.603  -18.630 1.00 80.80  ? 624  THR A HG21 1 
ATOM   8218  H  HG22 . THR A 1 545 ? -36.905 42.134  -19.796 1.00 80.80  ? 624  THR A HG22 1 
ATOM   8219  H  HG23 . THR A 1 545 ? -37.363 41.986  -18.293 1.00 80.80  ? 624  THR A HG23 1 
ATOM   8220  N  N    . ASP A 1 546 ? -36.944 37.256  -18.292 1.00 55.17  ? 625  ASP A N    1 
ATOM   8221  C  CA   . ASP A 1 546 ? -36.454 35.896  -18.098 1.00 50.69  ? 625  ASP A CA   1 
ATOM   8222  C  C    . ASP A 1 546 ? -36.681 35.079  -19.361 1.00 49.87  ? 625  ASP A C    1 
ATOM   8223  O  O    . ASP A 1 546 ? -37.768 35.095  -19.936 1.00 48.18  ? 625  ASP A O    1 
ATOM   8224  C  CB   . ASP A 1 546 ? -37.174 35.249  -16.916 1.00 52.40  ? 625  ASP A CB   1 
ATOM   8225  C  CG   . ASP A 1 546 ? -36.745 33.817  -16.681 1.00 59.66  ? 625  ASP A CG   1 
ATOM   8226  O  OD1  . ASP A 1 546 ? -37.365 32.906  -17.267 1.00 62.80  ? 625  ASP A OD1  1 
ATOM   8227  O  OD2  . ASP A 1 546 ? -35.793 33.601  -15.904 1.00 64.80  ? 625  ASP A OD2  1 
ATOM   8228  H  H    . ASP A 1 546 ? -37.630 37.448  -17.811 1.00 66.20  ? 625  ASP A H    1 
ATOM   8229  H  HA   . ASP A 1 546 ? -35.503 35.916  -17.908 1.00 60.83  ? 625  ASP A HA   1 
ATOM   8230  H  HB2  . ASP A 1 546 ? -36.979 35.756  -16.112 1.00 62.88  ? 625  ASP A HB2  1 
ATOM   8231  H  HB3  . ASP A 1 546 ? -38.128 35.252  -17.087 1.00 62.88  ? 625  ASP A HB3  1 
ATOM   8232  N  N    . THR A 1 547 ? -35.648 34.360  -19.779 1.00 40.54  ? 626  THR A N    1 
ATOM   8233  C  CA   . THR A 1 547 ? -35.657 33.655  -21.054 1.00 34.60  ? 626  THR A CA   1 
ATOM   8234  C  C    . THR A 1 547 ? -36.763 32.604  -21.154 1.00 40.54  ? 626  THR A C    1 
ATOM   8235  O  O    . THR A 1 547 ? -37.392 32.454  -22.202 1.00 44.25  ? 626  THR A O    1 
ATOM   8236  C  CB   . THR A 1 547 ? -34.280 33.004  -21.314 1.00 37.31  ? 626  THR A CB   1 
ATOM   8237  O  OG1  . THR A 1 547 ? -33.391 33.979  -21.870 1.00 45.81  ? 626  THR A OG1  1 
ATOM   8238  C  CG2  . THR A 1 547 ? -34.386 31.828  -22.280 1.00 30.94  ? 626  THR A CG2  1 
ATOM   8239  H  H    . THR A 1 547 ? -34.918 34.263  -19.335 1.00 48.64  ? 626  THR A H    1 
ATOM   8240  H  HA   . THR A 1 547 ? -35.809 34.303  -21.759 1.00 41.52  ? 626  THR A HA   1 
ATOM   8241  H  HB   . THR A 1 547 ? -33.916 32.678  -20.476 1.00 44.78  ? 626  THR A HB   1 
ATOM   8242  H  HG1  . THR A 1 547 ? -32.639 33.633  -22.015 1.00 54.97  ? 626  THR A HG1  1 
ATOM   8243  H  HG21 . THR A 1 547 ? -33.509 31.439  -22.425 1.00 37.12  ? 626  THR A HG21 1 
ATOM   8244  H  HG22 . THR A 1 547 ? -34.975 31.150  -21.914 1.00 37.12  ? 626  THR A HG22 1 
ATOM   8245  H  HG23 . THR A 1 547 ? -34.742 32.129  -23.131 1.00 37.12  ? 626  THR A HG23 1 
ATOM   8246  N  N    . ASP A 1 548 ? -36.994 31.875  -20.068 1.00 48.38  ? 627  ASP A N    1 
ATOM   8247  C  CA   . ASP A 1 548 ? -37.994 30.812  -20.073 1.00 49.06  ? 627  ASP A CA   1 
ATOM   8248  C  C    . ASP A 1 548 ? -39.415 31.358  -20.166 1.00 48.95  ? 627  ASP A C    1 
ATOM   8249  O  O    . ASP A 1 548 ? -40.243 30.821  -20.899 1.00 47.86  ? 627  ASP A O    1 
ATOM   8250  C  CB   . ASP A 1 548 ? -37.847 29.935  -18.830 1.00 45.19  ? 627  ASP A CB   1 
ATOM   8251  C  CG   . ASP A 1 548 ? -36.498 29.249  -18.762 1.00 53.48  ? 627  ASP A CG   1 
ATOM   8252  O  OD1  . ASP A 1 548 ? -35.996 28.820  -19.824 1.00 59.83  ? 627  ASP A OD1  1 
ATOM   8253  O  OD2  . ASP A 1 548 ? -35.939 29.141  -17.650 1.00 59.80  ? 627  ASP A OD2  1 
ATOM   8254  H  H    . ASP A 1 548 ? -36.587 31.974  -19.317 1.00 58.05  ? 627  ASP A H    1 
ATOM   8255  H  HA   . ASP A 1 548 ? -37.844 30.249  -20.849 1.00 58.87  ? 627  ASP A HA   1 
ATOM   8256  H  HB2  . ASP A 1 548 ? -37.944 30.488  -18.039 1.00 54.23  ? 627  ASP A HB2  1 
ATOM   8257  H  HB3  . ASP A 1 548 ? -38.533 29.249  -18.843 1.00 54.23  ? 627  ASP A HB3  1 
ATOM   8258  N  N    . VAL A 1 549 ? -39.690 32.430  -19.431 1.00 35.07  ? 628  VAL A N    1 
ATOM   8259  C  CA   . VAL A 1 549 ? -41.010 33.046  -19.444 1.00 33.27  ? 628  VAL A CA   1 
ATOM   8260  C  C    . VAL A 1 549 ? -41.392 33.488  -20.851 1.00 35.29  ? 628  VAL A C    1 
ATOM   8261  O  O    . VAL A 1 549 ? -42.523 33.286  -21.291 1.00 35.19  ? 628  VAL A O    1 
ATOM   8262  C  CB   . VAL A 1 549 ? -41.053 34.269  -18.522 1.00 38.01  ? 628  VAL A CB   1 
ATOM   8263  C  CG1  . VAL A 1 549 ? -42.419 34.929  -18.576 1.00 41.13  ? 628  VAL A CG1  1 
ATOM   8264  C  CG2  . VAL A 1 549 ? -40.717 33.867  -17.092 1.00 43.76  ? 628  VAL A CG2  1 
ATOM   8265  H  H    . VAL A 1 549 ? -39.126 32.822  -18.913 1.00 42.08  ? 628  VAL A H    1 
ATOM   8266  H  HA   . VAL A 1 549 ? -41.668 32.405  -19.134 1.00 39.92  ? 628  VAL A HA   1 
ATOM   8267  H  HB   . VAL A 1 549 ? -40.392 34.915  -18.818 1.00 45.62  ? 628  VAL A HB   1 
ATOM   8268  H  HG11 . VAL A 1 549 ? -42.421 35.699  -17.985 1.00 49.35  ? 628  VAL A HG11 1 
ATOM   8269  H  HG12 . VAL A 1 549 ? -42.599 35.210  -19.487 1.00 49.35  ? 628  VAL A HG12 1 
ATOM   8270  H  HG13 . VAL A 1 549 ? -43.090 34.290  -18.288 1.00 49.35  ? 628  VAL A HG13 1 
ATOM   8271  H  HG21 . VAL A 1 549 ? -40.750 34.655  -16.527 1.00 52.51  ? 628  VAL A HG21 1 
ATOM   8272  H  HG22 . VAL A 1 549 ? -41.367 33.214  -16.788 1.00 52.51  ? 628  VAL A HG22 1 
ATOM   8273  H  HG23 . VAL A 1 549 ? -39.827 33.483  -17.073 1.00 52.51  ? 628  VAL A HG23 1 
ATOM   8274  N  N    . LEU A 1 550 ? -40.440 34.094  -21.551 1.00 39.35  ? 629  LEU A N    1 
ATOM   8275  C  CA   . LEU A 1 550 ? -40.686 34.609  -22.893 1.00 41.03  ? 629  LEU A CA   1 
ATOM   8276  C  C    . LEU A 1 550 ? -40.819 33.471  -23.901 1.00 40.29  ? 629  LEU A C    1 
ATOM   8277  O  O    . LEU A 1 550 ? -41.586 33.567  -24.860 1.00 38.34  ? 629  LEU A O    1 
ATOM   8278  C  CB   . LEU A 1 550 ? -39.562 35.561  -23.309 1.00 39.88  ? 629  LEU A CB   1 
ATOM   8279  C  CG   . LEU A 1 550 ? -39.359 36.762  -22.379 1.00 41.36  ? 629  LEU A CG   1 
ATOM   8280  C  CD1  . LEU A 1 550 ? -38.107 37.539  -22.757 1.00 44.40  ? 629  LEU A CD1  1 
ATOM   8281  C  CD2  . LEU A 1 550 ? -40.578 37.670  -22.392 1.00 40.00  ? 629  LEU A CD2  1 
ATOM   8282  H  H    . LEU A 1 550 ? -39.637 34.220  -21.269 1.00 47.22  ? 629  LEU A H    1 
ATOM   8283  H  HA   . LEU A 1 550 ? -41.517 35.108  -22.892 1.00 49.24  ? 629  LEU A HA   1 
ATOM   8284  H  HB2  . LEU A 1 550 ? -38.729 35.064  -23.333 1.00 47.85  ? 629  LEU A HB2  1 
ATOM   8285  H  HB3  . LEU A 1 550 ? -39.761 35.906  -24.194 1.00 47.85  ? 629  LEU A HB3  1 
ATOM   8286  H  HG   . LEU A 1 550 ? -39.242 36.437  -21.472 1.00 49.63  ? 629  LEU A HG   1 
ATOM   8287  H  HD11 . LEU A 1 550 ? -38.007 38.290  -22.151 1.00 53.27  ? 629  LEU A HD11 1 
ATOM   8288  H  HD12 . LEU A 1 550 ? -37.338 36.952  -22.686 1.00 53.27  ? 629  LEU A HD12 1 
ATOM   8289  H  HD13 . LEU A 1 550 ? -38.197 37.858  -23.669 1.00 53.27  ? 629  LEU A HD13 1 
ATOM   8290  H  HD21 . LEU A 1 550 ? -40.420 38.419  -21.796 1.00 48.00  ? 629  LEU A HD21 1 
ATOM   8291  H  HD22 . LEU A 1 550 ? -40.722 37.991  -23.296 1.00 48.00  ? 629  LEU A HD22 1 
ATOM   8292  H  HD23 . LEU A 1 550 ? -41.350 37.166  -22.093 1.00 48.00  ? 629  LEU A HD23 1 
ATOM   8293  N  N    . GLU A 1 551 ? -40.076 32.392  -23.677 1.00 48.07  ? 630  GLU A N    1 
ATOM   8294  C  CA   . GLU A 1 551 ? -40.188 31.207  -24.517 1.00 43.38  ? 630  GLU A CA   1 
ATOM   8295  C  C    . GLU A 1 551 ? -41.600 30.663  -24.387 1.00 45.96  ? 630  GLU A C    1 
ATOM   8296  O  O    . GLU A 1 551 ? -42.217 30.264  -25.374 1.00 48.04  ? 630  GLU A O    1 
ATOM   8297  C  CB   . GLU A 1 551 ? -39.162 30.141  -24.109 1.00 45.80  ? 630  GLU A CB   1 
ATOM   8298  C  CG   . GLU A 1 551 ? -39.386 28.771  -24.762 1.00 50.56  ? 630  GLU A CG   1 
ATOM   8299  C  CD   . GLU A 1 551 ? -38.259 27.773  -24.505 1.00 55.81  ? 630  GLU A CD   1 
ATOM   8300  O  OE1  . GLU A 1 551 ? -37.102 28.199  -24.291 1.00 58.58  ? 630  GLU A OE1  1 
ATOM   8301  O  OE2  . GLU A 1 551 ? -38.536 26.554  -24.527 1.00 49.11  ? 630  GLU A OE2  1 
ATOM   8302  H  H    . GLU A 1 551 ? -39.499 32.321  -23.043 1.00 57.68  ? 630  GLU A H    1 
ATOM   8303  H  HA   . GLU A 1 551 ? -40.033 31.449  -25.444 1.00 52.05  ? 630  GLU A HA   1 
ATOM   8304  H  HB2  . GLU A 1 551 ? -38.277 30.448  -24.362 1.00 54.96  ? 630  GLU A HB2  1 
ATOM   8305  H  HB3  . GLU A 1 551 ? -39.204 30.020  -23.148 1.00 54.96  ? 630  GLU A HB3  1 
ATOM   8306  H  HG2  . GLU A 1 551 ? -40.206 28.388  -24.413 1.00 60.67  ? 630  GLU A HG2  1 
ATOM   8307  H  HG3  . GLU A 1 551 ? -39.462 28.891  -25.722 1.00 60.67  ? 630  GLU A HG3  1 
ATOM   8308  N  N    . ALA A 1 552 ? -42.116 30.663  -23.162 1.00 31.68  ? 631  ALA A N    1 
ATOM   8309  C  CA   . ALA A 1 552 ? -43.459 30.156  -22.905 1.00 31.74  ? 631  ALA A CA   1 
ATOM   8310  C  C    . ALA A 1 552 ? -44.503 31.012  -23.622 1.00 33.65  ? 631  ALA A C    1 
ATOM   8311  O  O    . ALA A 1 552 ? -45.397 30.485  -24.285 1.00 32.62  ? 631  ALA A O    1 
ATOM   8312  C  CB   . ALA A 1 552 ? -43.743 30.106  -21.405 1.00 32.06  ? 631  ALA A CB   1 
ATOM   8313  H  H    . ALA A 1 552 ? -41.709 30.952  -22.462 1.00 38.02  ? 631  ALA A H    1 
ATOM   8314  H  HA   . ALA A 1 552 ? -43.526 29.253  -23.252 1.00 38.09  ? 631  ALA A HA   1 
ATOM   8315  H  HB1  . ALA A 1 552 ? -44.641 29.766  -21.266 1.00 38.48  ? 631  ALA A HB1  1 
ATOM   8316  H  HB2  . ALA A 1 552 ? -43.097 29.519  -20.982 1.00 38.48  ? 631  ALA A HB2  1 
ATOM   8317  H  HB3  . ALA A 1 552 ? -43.668 31.001  -21.040 1.00 38.48  ? 631  ALA A HB3  1 
ATOM   8318  N  N    . CYS A 1 553 ? -44.375 32.330  -23.492 1.00 41.99  ? 632  CYS A N    1 
ATOM   8319  C  CA   . CYS A 1 553 ? -45.278 33.268  -24.152 1.00 36.86  ? 632  CYS A CA   1 
ATOM   8320  C  C    . CYS A 1 553 ? -45.304 33.040  -25.654 1.00 38.27  ? 632  CYS A C    1 
ATOM   8321  O  O    . CYS A 1 553 ? -46.370 32.934  -26.258 1.00 43.41  ? 632  CYS A O    1 
ATOM   8322  C  CB   . CYS A 1 553 ? -44.836 34.703  -23.875 1.00 36.79  ? 632  CYS A CB   1 
ATOM   8323  S  SG   . CYS A 1 553 ? -45.195 35.284  -22.202 1.00 46.51  ? 632  CYS A SG   1 
ATOM   8324  H  H    . CYS A 1 553 ? -43.764 32.710  -23.021 1.00 50.39  ? 632  CYS A H    1 
ATOM   8325  H  HA   . CYS A 1 553 ? -46.176 33.150  -23.807 1.00 44.23  ? 632  CYS A HA   1 
ATOM   8326  H  HB2  . CYS A 1 553 ? -43.877 34.764  -24.008 1.00 44.14  ? 632  CYS A HB2  1 
ATOM   8327  H  HB3  . CYS A 1 553 ? -45.291 35.293  -24.496 1.00 44.14  ? 632  CYS A HB3  1 
ATOM   8328  H  HG   . CYS A 1 553 ? -44.629 34.580  -21.413 1.00 55.81  ? 632  CYS A HG   1 
ATOM   8329  N  N    . SER A 1 554 ? -44.121 32.973  -26.251 1.00 33.93  ? 633  SER A N    1 
ATOM   8330  C  CA   . SER A 1 554 ? -43.996 32.769  -27.688 1.00 33.12  ? 633  SER A CA   1 
ATOM   8331  C  C    . SER A 1 554 ? -44.583 31.430  -28.131 1.00 32.71  ? 633  SER A C    1 
ATOM   8332  O  O    . SER A 1 554 ? -45.370 31.369  -29.076 1.00 38.24  ? 633  SER A O    1 
ATOM   8333  C  CB   . SER A 1 554 ? -42.531 32.850  -28.107 1.00 33.27  ? 633  SER A CB   1 
ATOM   8334  O  OG   . SER A 1 554 ? -42.409 32.686  -29.508 1.00 39.94  ? 633  SER A OG   1 
ATOM   8335  H  H    . SER A 1 554 ? -43.368 33.043  -25.841 1.00 40.72  ? 633  SER A H    1 
ATOM   8336  H  HA   . SER A 1 554 ? -44.479 33.473  -28.148 1.00 39.74  ? 633  SER A HA   1 
ATOM   8337  H  HB2  . SER A 1 554 ? -42.177 33.719  -27.858 1.00 39.92  ? 633  SER A HB2  1 
ATOM   8338  H  HB3  . SER A 1 554 ? -42.033 32.147  -27.661 1.00 39.92  ? 633  SER A HB3  1 
ATOM   8339  H  HG   . SER A 1 554 ? -41.601 32.732  -29.734 1.00 47.93  ? 633  SER A HG   1 
ATOM   8340  N  N    . LYS A 1 555 ? -44.190 30.358  -27.451 1.00 48.89  ? 634  LYS A N    1 
ATOM   8341  C  CA   . LYS A 1 555 ? -44.679 29.024  -27.783 1.00 47.39  ? 634  LYS A CA   1 
ATOM   8342  C  C    . LYS A 1 555 ? -46.196 28.935  -27.620 1.00 50.26  ? 634  LYS A C    1 
ATOM   8343  O  O    . LYS A 1 555 ? -46.859 28.173  -28.325 1.00 50.68  ? 634  LYS A O    1 
ATOM   8344  C  CB   . LYS A 1 555 ? -43.988 27.969  -26.914 1.00 46.29  ? 634  LYS A CB   1 
ATOM   8345  C  CG   . LYS A 1 555 ? -42.724 27.386  -27.537 1.00 49.62  ? 634  LYS A CG   1 
ATOM   8346  C  CD   . LYS A 1 555 ? -41.839 26.712  -26.497 1.00 54.46  ? 634  LYS A CD   1 
ATOM   8347  C  CE   . LYS A 1 555 ? -40.613 26.061  -27.128 1.00 52.66  ? 634  LYS A CE   1 
ATOM   8348  N  NZ   . LYS A 1 555 ? -40.943 24.842  -27.915 1.00 60.71  ? 634  LYS A NZ   1 
ATOM   8349  H  H    . LYS A 1 555 ? -43.639 30.376  -26.791 1.00 58.67  ? 634  LYS A H    1 
ATOM   8350  H  HA   . LYS A 1 555 ? -44.467 28.833  -28.710 1.00 56.87  ? 634  LYS A HA   1 
ATOM   8351  H  HB2  . LYS A 1 555 ? -43.741 28.374  -26.068 1.00 55.54  ? 634  LYS A HB2  1 
ATOM   8352  H  HB3  . LYS A 1 555 ? -44.606 27.237  -26.760 1.00 55.54  ? 634  LYS A HB3  1 
ATOM   8353  H  HG2  . LYS A 1 555 ? -42.971 26.723  -28.200 1.00 59.55  ? 634  LYS A HG2  1 
ATOM   8354  H  HG3  . LYS A 1 555 ? -42.214 28.100  -27.952 1.00 59.55  ? 634  LYS A HG3  1 
ATOM   8355  H  HD2  . LYS A 1 555 ? -41.534 27.376  -25.859 1.00 65.36  ? 634  LYS A HD2  1 
ATOM   8356  H  HD3  . LYS A 1 555 ? -42.348 26.022  -26.044 1.00 65.36  ? 634  LYS A HD3  1 
ATOM   8357  H  HE2  . LYS A 1 555 ? -40.190 26.698  -27.725 1.00 63.19  ? 634  LYS A HE2  1 
ATOM   8358  H  HE3  . LYS A 1 555 ? -39.995 25.805  -26.425 1.00 63.19  ? 634  LYS A HE3  1 
ATOM   8359  H  HZ1  . LYS A 1 555 ? -40.202 24.496  -28.264 1.00 72.85  ? 634  LYS A HZ1  1 
ATOM   8360  H  HZ2  . LYS A 1 555 ? -41.326 24.235  -27.389 1.00 72.85  ? 634  LYS A HZ2  1 
ATOM   8361  H  HZ3  . LYS A 1 555 ? -41.504 25.049  -28.574 1.00 72.85  ? 634  LYS A HZ3  1 
ATOM   8362  N  N    . THR A 1 556 ? -46.738 29.724  -26.695 1.00 48.29  ? 635  THR A N    1 
ATOM   8363  C  CA   . THR A 1 556 ? -48.178 29.745  -26.441 1.00 50.58  ? 635  THR A CA   1 
ATOM   8364  C  C    . THR A 1 556 ? -48.916 30.483  -27.555 1.00 53.62  ? 635  THR A C    1 
ATOM   8365  O  O    . THR A 1 556 ? -49.890 29.970  -28.109 1.00 53.07  ? 635  THR A O    1 
ATOM   8366  C  CB   . THR A 1 556 ? -48.518 30.421  -25.091 1.00 53.67  ? 635  THR A CB   1 
ATOM   8367  O  OG1  . THR A 1 556 ? -47.900 29.701  -24.018 1.00 59.48  ? 635  THR A OG1  1 
ATOM   8368  C  CG2  . THR A 1 556 ? -50.031 30.453  -24.859 1.00 53.53  ? 635  THR A CG2  1 
ATOM   8369  H  H    . THR A 1 556 ? -46.289 30.262  -26.195 1.00 57.95  ? 635  THR A H    1 
ATOM   8370  H  HA   . THR A 1 556 ? -48.509 28.833  -26.413 1.00 60.70  ? 635  THR A HA   1 
ATOM   8371  H  HB   . THR A 1 556 ? -48.191 31.334  -25.097 1.00 64.41  ? 635  THR A HB   1 
ATOM   8372  H  HG1  . THR A 1 556 ? -47.066 29.695  -24.119 1.00 71.38  ? 635  THR A HG1  1 
ATOM   8373  H  HG21 . THR A 1 556 ? -50.227 30.879  -24.010 1.00 64.23  ? 635  THR A HG21 1 
ATOM   8374  H  HG22 . THR A 1 556 ? -50.465 30.951  -25.569 1.00 64.23  ? 635  THR A HG22 1 
ATOM   8375  H  HG23 . THR A 1 556 ? -50.384 29.549  -24.847 1.00 64.23  ? 635  THR A HG23 1 
ATOM   8376  N  N    . TYR A 1 557 ? -48.457 31.691  -27.870 1.00 46.09  ? 636  TYR A N    1 
ATOM   8377  C  CA   . TYR A 1 557 ? -49.042 32.475  -28.956 1.00 45.32  ? 636  TYR A CA   1 
ATOM   8378  C  C    . TYR A 1 557 ? -49.050 31.687  -30.265 1.00 51.78  ? 636  TYR A C    1 
ATOM   8379  O  O    . TYR A 1 557 ? -49.891 31.917  -31.133 1.00 58.37  ? 636  TYR A O    1 
ATOM   8380  C  CB   . TYR A 1 557 ? -48.272 33.783  -29.162 1.00 42.96  ? 636  TYR A CB   1 
ATOM   8381  C  CG   . TYR A 1 557 ? -49.044 35.026  -28.786 1.00 47.13  ? 636  TYR A CG   1 
ATOM   8382  C  CD1  . TYR A 1 557 ? -50.099 35.477  -29.569 1.00 52.90  ? 636  TYR A CD1  1 
ATOM   8383  C  CD2  . TYR A 1 557 ? -48.708 35.757  -27.656 1.00 46.45  ? 636  TYR A CD2  1 
ATOM   8384  C  CE1  . TYR A 1 557 ? -50.809 36.617  -29.228 1.00 47.51  ? 636  TYR A CE1  1 
ATOM   8385  C  CE2  . TYR A 1 557 ? -49.405 36.900  -27.309 1.00 53.71  ? 636  TYR A CE2  1 
ATOM   8386  C  CZ   . TYR A 1 557 ? -50.455 37.327  -28.101 1.00 52.47  ? 636  TYR A CZ   1 
ATOM   8387  O  OH   . TYR A 1 557 ? -51.163 38.461  -27.763 1.00 58.01  ? 636  TYR A OH   1 
ATOM   8388  H  H    . TYR A 1 557 ? -47.803 32.081  -27.470 1.00 55.31  ? 636  TYR A H    1 
ATOM   8389  H  HA   . TYR A 1 557 ? -49.959 32.697  -28.730 1.00 54.38  ? 636  TYR A HA   1 
ATOM   8390  H  HB2  . TYR A 1 557 ? -47.468 33.759  -28.619 1.00 51.55  ? 636  TYR A HB2  1 
ATOM   8391  H  HB3  . TYR A 1 557 ? -48.032 33.857  -30.099 1.00 51.55  ? 636  TYR A HB3  1 
ATOM   8392  H  HD1  . TYR A 1 557 ? -50.339 35.001  -30.331 1.00 63.48  ? 636  TYR A HD1  1 
ATOM   8393  H  HD2  . TYR A 1 557 ? -48.002 35.473  -27.121 1.00 55.74  ? 636  TYR A HD2  1 
ATOM   8394  H  HE1  . TYR A 1 557 ? -51.514 36.906  -29.761 1.00 57.01  ? 636  TYR A HE1  1 
ATOM   8395  H  HE2  . TYR A 1 557 ? -49.171 37.377  -26.546 1.00 64.45  ? 636  TYR A HE2  1 
ATOM   8396  H  HH   . TYR A 1 557 ? -50.849 38.797  -27.060 1.00 69.61  ? 636  TYR A HH   1 
ATOM   8397  N  N    . HIS A 1 558 ? -48.105 30.763  -30.403 1.00 48.31  ? 637  HIS A N    1 
ATOM   8398  C  CA   . HIS A 1 558 ? -48.021 29.923  -31.591 1.00 52.89  ? 637  HIS A CA   1 
ATOM   8399  C  C    . HIS A 1 558 ? -49.119 28.869  -31.589 1.00 49.17  ? 637  HIS A C    1 
ATOM   8400  O  O    . HIS A 1 558 ? -49.737 28.599  -32.620 1.00 52.31  ? 637  HIS A O    1 
ATOM   8401  C  CB   . HIS A 1 558 ? -46.653 29.245  -31.662 1.00 45.85  ? 637  HIS A CB   1 
ATOM   8402  C  CG   . HIS A 1 558 ? -46.445 28.429  -32.900 1.00 39.75  ? 637  HIS A CG   1 
ATOM   8403  N  ND1  . HIS A 1 558 ? -46.426 27.051  -32.890 1.00 44.83  ? 637  HIS A ND1  1 
ATOM   8404  C  CD2  . HIS A 1 558 ? -46.243 28.800  -34.186 1.00 47.42  ? 637  HIS A CD2  1 
ATOM   8405  C  CE1  . HIS A 1 558 ? -46.215 26.608  -34.117 1.00 50.12  ? 637  HIS A CE1  1 
ATOM   8406  N  NE2  . HIS A 1 558 ? -46.102 27.647  -34.922 1.00 57.66  ? 637  HIS A NE2  1 
ATOM   8407  H  H    . HIS A 1 558 ? -47.495 30.603  -29.817 1.00 57.98  ? 637  HIS A H    1 
ATOM   8408  H  HA   . HIS A 1 558 ? -48.129 30.474  -32.382 1.00 63.46  ? 637  HIS A HA   1 
ATOM   8409  H  HB2  . HIS A 1 558 ? -45.964 29.927  -31.637 1.00 55.02  ? 637  HIS A HB2  1 
ATOM   8410  H  HB3  . HIS A 1 558 ? -46.557 28.654  -30.898 1.00 55.02  ? 637  HIS A HB3  1 
ATOM   8411  H  HD1  . HIS A 1 558 ? -46.528 26.557  -32.194 1.00 53.80  ? 637  HIS A HD1  1 
ATOM   8412  H  HD2  . HIS A 1 558 ? -46.202 29.670  -34.510 1.00 56.91  ? 637  HIS A HD2  1 
ATOM   8413  H  HE1  . HIS A 1 558 ? -46.162 25.715  -34.371 1.00 60.14  ? 637  HIS A HE1  1 
ATOM   8414  H  HE2  . HIS A 1 558 ? -45.966 27.610  -35.770 1.00 69.19  ? 637  HIS A HE2  1 
ATOM   8415  N  N    . ALA A 1 559 ? -49.353 28.268  -30.428 1.00 43.73  ? 638  ALA A N    1 
ATOM   8416  C  CA   . ALA A 1 559 ? -50.401 27.267  -30.290 1.00 51.25  ? 638  ALA A CA   1 
ATOM   8417  C  C    . ALA A 1 559 ? -51.766 27.858  -30.633 1.00 54.85  ? 638  ALA A C    1 
ATOM   8418  O  O    . ALA A 1 559 ? -52.573 27.222  -31.311 1.00 52.26  ? 638  ALA A O    1 
ATOM   8419  C  CB   . ALA A 1 559 ? -50.413 26.714  -28.884 1.00 47.33  ? 638  ALA A CB   1 
ATOM   8420  H  H    . ALA A 1 559 ? -48.916 28.423  -29.704 1.00 52.47  ? 638  ALA A H    1 
ATOM   8421  H  HA   . ALA A 1 559 ? -50.225 26.535  -30.901 1.00 61.50  ? 638  ALA A HA   1 
ATOM   8422  H  HB1  . ALA A 1 559 ? -51.117 26.050  -28.812 1.00 56.80  ? 638  ALA A HB1  1 
ATOM   8423  H  HB2  . ALA A 1 559 ? -49.553 26.307  -28.697 1.00 56.80  ? 638  ALA A HB2  1 
ATOM   8424  H  HB3  . ALA A 1 559 ? -50.578 27.440  -28.261 1.00 56.80  ? 638  ALA A HB3  1 
ATOM   8425  N  N    . LEU A 1 560 ? -52.015 29.079  -30.163 1.00 42.41  ? 639  LEU A N    1 
ATOM   8426  C  CA   . LEU A 1 560 ? -53.286 29.756  -30.407 1.00 39.21  ? 639  LEU A CA   1 
ATOM   8427  C  C    . LEU A 1 560 ? -53.425 30.225  -31.858 1.00 47.25  ? 639  LEU A C    1 
ATOM   8428  O  O    . LEU A 1 560 ? -54.538 30.362  -32.364 1.00 51.75  ? 639  LEU A O    1 
ATOM   8429  C  CB   . LEU A 1 560 ? -53.447 30.947  -29.453 1.00 39.42  ? 639  LEU A CB   1 
ATOM   8430  C  CG   . LEU A 1 560 ? -53.652 30.626  -27.964 1.00 37.12  ? 639  LEU A CG   1 
ATOM   8431  C  CD1  . LEU A 1 560 ? -53.546 31.892  -27.102 1.00 37.16  ? 639  LEU A CD1  1 
ATOM   8432  C  CD2  . LEU A 1 560 ? -54.983 29.909  -27.719 1.00 37.75  ? 639  LEU A CD2  1 
ATOM   8433  H  H    . LEU A 1 560 ? -51.458 29.539  -29.696 1.00 50.89  ? 639  LEU A H    1 
ATOM   8434  H  HA   . LEU A 1 560 ? -54.009 29.134  -30.227 1.00 47.05  ? 639  LEU A HA   1 
ATOM   8435  H  HB2  . LEU A 1 560 ? -52.651 31.497  -29.519 1.00 47.30  ? 639  LEU A HB2  1 
ATOM   8436  H  HB3  . LEU A 1 560 ? -54.216 31.463  -29.742 1.00 47.30  ? 639  LEU A HB3  1 
ATOM   8437  H  HG   . LEU A 1 560 ? -52.945 30.026  -27.682 1.00 44.54  ? 639  LEU A HG   1 
ATOM   8438  H  HD11 . LEU A 1 560 ? -53.680 31.652  -26.172 1.00 44.59  ? 639  LEU A HD11 1 
ATOM   8439  H  HD12 . LEU A 1 560 ? -52.665 32.281  -27.220 1.00 44.59  ? 639  LEU A HD12 1 
ATOM   8440  H  HD13 . LEU A 1 560 ? -54.227 32.523  -27.383 1.00 44.59  ? 639  LEU A HD13 1 
ATOM   8441  H  HD21 . LEU A 1 560 ? -55.072 29.725  -26.771 1.00 45.30  ? 639  LEU A HD21 1 
ATOM   8442  H  HD22 . LEU A 1 560 ? -55.709 30.480  -28.016 1.00 45.30  ? 639  LEU A HD22 1 
ATOM   8443  H  HD23 . LEU A 1 560 ? -54.989 29.077  -28.219 1.00 45.30  ? 639  LEU A HD23 1 
ATOM   8444  N  N    . CYS A 1 561 ? -52.300 30.470  -32.522 1.00 63.84  ? 640  CYS A N    1 
ATOM   8445  C  CA   . CYS A 1 561 ? -52.318 30.925  -33.911 1.00 59.25  ? 640  CYS A CA   1 
ATOM   8446  C  C    . CYS A 1 561 ? -52.310 29.753  -34.896 1.00 61.35  ? 640  CYS A C    1 
ATOM   8447  O  O    . CYS A 1 561 ? -51.573 29.759  -35.883 1.00 68.61  ? 640  CYS A O    1 
ATOM   8448  C  CB   . CYS A 1 561 ? -51.145 31.873  -34.182 1.00 54.86  ? 640  CYS A CB   1 
ATOM   8449  S  SG   . CYS A 1 561 ? -51.419 33.558  -33.584 1.00 68.99  ? 640  CYS A SG   1 
ATOM   8450  H  H    . CYS A 1 561 ? -51.511 30.381  -32.192 1.00 76.61  ? 640  CYS A H    1 
ATOM   8451  H  HA   . CYS A 1 561 ? -53.136 31.424  -34.060 1.00 71.10  ? 640  CYS A HA   1 
ATOM   8452  H  HB2  . CYS A 1 561 ? -50.354 31.527  -33.740 1.00 65.84  ? 640  CYS A HB2  1 
ATOM   8453  H  HB3  . CYS A 1 561 ? -50.994 31.919  -35.139 1.00 65.84  ? 640  CYS A HB3  1 
ATOM   8454  H  HG   . CYS A 1 561 ? -51.594 33.528  -32.397 1.00 82.78  ? 640  CYS A HG   1 
ATOM   8455  N  N    . ASN A 1 562 ? -53.139 28.748  -34.619 1.00 45.30  ? 641  ASN A N    1 
ATOM   8456  C  CA   . ASN A 1 562 ? -53.356 27.652  -35.559 1.00 49.79  ? 641  ASN A CA   1 
ATOM   8457  C  C    . ASN A 1 562 ? -54.467 28.057  -36.523 1.00 66.15  ? 641  ASN A C    1 
ATOM   8458  O  O    . ASN A 1 562 ? -55.535 28.496  -36.093 1.00 72.95  ? 641  ASN A O    1 
ATOM   8459  C  CB   . ASN A 1 562 ? -53.717 26.357  -34.819 1.00 53.06  ? 641  ASN A CB   1 
ATOM   8460  C  CG   . ASN A 1 562 ? -53.599 25.121  -35.702 1.00 63.51  ? 641  ASN A CG   1 
ATOM   8461  O  OD1  . ASN A 1 562 ? -53.306 25.220  -36.893 1.00 64.73  ? 641  ASN A OD1  1 
ATOM   8462  N  ND2  . ASN A 1 562 ? -53.811 23.947  -35.112 1.00 69.21  ? 641  ASN A ND2  1 
ATOM   8463  H  H    . ASN A 1 562 ? -53.590 28.678  -33.890 1.00 54.36  ? 641  ASN A H    1 
ATOM   8464  H  HA   . ASN A 1 562 ? -52.546 27.498  -36.070 1.00 59.75  ? 641  ASN A HA   1 
ATOM   8465  H  HB2  . ASN A 1 562 ? -53.117 26.246  -34.065 1.00 63.68  ? 641  ASN A HB2  1 
ATOM   8466  H  HB3  . ASN A 1 562 ? -54.634 26.416  -34.506 1.00 63.68  ? 641  ASN A HB3  1 
ATOM   8467  H  HD21 . ASN A 1 562 ? -53.756 23.221  -35.568 1.00 83.05  ? 641  ASN A HD21 1 
ATOM   8468  H  HD22 . ASN A 1 562 ? -54.003 23.915  -34.274 1.00 83.05  ? 641  ASN A HD22 1 
ATOM   8469  N  N    . GLU A 1 563 ? -54.206 27.934  -37.823 1.00 100.24 ? 642  GLU A N    1 
ATOM   8470  C  CA   . GLU A 1 563 ? -55.135 28.421  -38.841 1.00 99.70  ? 642  GLU A CA   1 
ATOM   8471  C  C    . GLU A 1 563 ? -56.094 27.334  -39.323 1.00 100.68 ? 642  GLU A C    1 
ATOM   8472  O  O    . GLU A 1 563 ? -56.639 27.423  -40.420 1.00 103.29 ? 642  GLU A O    1 
ATOM   8473  C  CB   . GLU A 1 563 ? -54.371 29.005  -40.033 1.00 102.89 ? 642  GLU A CB   1 
ATOM   8474  C  CG   . GLU A 1 563 ? -55.182 30.016  -40.835 1.00 113.06 ? 642  GLU A CG   1 
ATOM   8475  C  CD   . GLU A 1 563 ? -54.403 30.628  -41.988 1.00 116.06 ? 642  GLU A CD   1 
ATOM   8476  O  OE1  . GLU A 1 563 ? -53.285 30.148  -42.277 1.00 114.25 ? 642  GLU A OE1  1 
ATOM   8477  O  OE2  . GLU A 1 563 ? -54.912 31.589  -42.605 1.00 116.02 ? 642  GLU A OE2  1 
ATOM   8478  H  H    . GLU A 1 563 ? -53.495 27.570  -38.142 1.00 120.29 ? 642  GLU A H    1 
ATOM   8479  H  HA   . GLU A 1 563 ? -55.668 29.134  -38.456 1.00 119.64 ? 642  GLU A HA   1 
ATOM   8480  N  N    . GLU A 1 564 ? -56.294 26.307  -38.505 1.00 92.18  ? 643  GLU A N    1 
ATOM   8481  C  CA   . GLU A 1 564 ? -57.316 25.310  -38.788 1.00 96.29  ? 643  GLU A CA   1 
ATOM   8482  C  C    . GLU A 1 564 ? -58.502 25.579  -37.873 1.00 95.87  ? 643  GLU A C    1 
ATOM   8483  O  O    . GLU A 1 564 ? -59.447 24.790  -37.798 1.00 100.32 ? 643  GLU A O    1 
ATOM   8484  C  CB   . GLU A 1 564 ? -56.777 23.896  -38.572 1.00 100.60 ? 643  GLU A CB   1 
ATOM   8485  C  CG   . GLU A 1 564 ? -57.746 22.798  -38.995 1.00 109.67 ? 643  GLU A CG   1 
ATOM   8486  C  CD   . GLU A 1 564 ? -57.166 21.410  -38.813 1.00 118.04 ? 643  GLU A CD   1 
ATOM   8487  O  OE1  . GLU A 1 564 ? -55.948 21.305  -38.549 1.00 114.10 ? 643  GLU A OE1  1 
ATOM   8488  O  OE2  . GLU A 1 564 ? -57.927 20.426  -38.931 1.00 126.55 ? 643  GLU A OE2  1 
ATOM   8489  N  N    . PHE A 1 565 ? -58.440 26.712  -37.182 1.00 67.67  ? 644  PHE A N    1 
ATOM   8490  C  CA   . PHE A 1 565 ? -59.462 27.078  -36.217 1.00 69.91  ? 644  PHE A CA   1 
ATOM   8491  C  C    . PHE A 1 565 ? -59.975 28.493  -36.473 1.00 74.78  ? 644  PHE A C    1 
ATOM   8492  O  O    . PHE A 1 565 ? -59.215 29.380  -36.863 1.00 71.72  ? 644  PHE A O    1 
ATOM   8493  C  CB   . PHE A 1 565 ? -58.911 26.963  -34.794 1.00 70.80  ? 644  PHE A CB   1 
ATOM   8494  C  CG   . PHE A 1 565 ? -58.486 25.568  -34.416 1.00 74.91  ? 644  PHE A CG   1 
ATOM   8495  C  CD1  . PHE A 1 565 ? -57.237 25.083  -34.780 1.00 74.91  ? 644  PHE A CD1  1 
ATOM   8496  C  CD2  . PHE A 1 565 ? -59.333 24.745  -33.690 1.00 72.26  ? 644  PHE A CD2  1 
ATOM   8497  C  CE1  . PHE A 1 565 ? -56.845 23.799  -34.430 1.00 72.36  ? 644  PHE A CE1  1 
ATOM   8498  C  CE2  . PHE A 1 565 ? -58.944 23.464  -33.335 1.00 68.76  ? 644  PHE A CE2  1 
ATOM   8499  C  CZ   . PHE A 1 565 ? -57.700 22.992  -33.706 1.00 71.33  ? 644  PHE A CZ   1 
ATOM   8500  N  N    . THR A 1 566 ? -61.269 28.690  -36.238 1.00 76.80  ? 645  THR A N    1 
ATOM   8501  C  CA   . THR A 1 566 ? -61.941 29.973  -36.437 1.00 73.40  ? 645  THR A CA   1 
ATOM   8502  C  C    . THR A 1 566 ? -61.270 31.099  -35.658 1.00 67.62  ? 645  THR A C    1 
ATOM   8503  O  O    . THR A 1 566 ? -61.439 32.281  -35.963 1.00 68.30  ? 645  THR A O    1 
ATOM   8504  C  CB   . THR A 1 566 ? -63.398 29.881  -35.950 1.00 76.36  ? 645  THR A CB   1 
ATOM   8505  O  OG1  . THR A 1 566 ? -63.955 28.613  -36.322 1.00 79.44  ? 645  THR A OG1  1 
ATOM   8506  C  CG2  . THR A 1 566 ? -64.247 30.996  -36.531 1.00 78.26  ? 645  THR A CG2  1 
ATOM   8507  H  HA   . THR A 1 566 ? -61.940 30.201  -37.380 1.00 88.08  ? 645  THR A HA   1 
ATOM   8508  H  HB   . THR A 1 566 ? -63.415 29.963  -34.984 1.00 91.64  ? 645  THR A HB   1 
ATOM   8509  H  HG1  . THR A 1 566 ? -63.510 27.991  -35.974 1.00 95.33  ? 645  THR A HG1  1 
ATOM   8510  H  HG21 . THR A 1 566 ? -65.159 30.919  -36.212 1.00 93.92  ? 645  THR A HG21 1 
ATOM   8511  H  HG22 . THR A 1 566 ? -63.891 31.858  -36.262 1.00 93.92  ? 645  THR A HG22 1 
ATOM   8512  H  HG23 . THR A 1 566 ? -64.246 30.943  -37.500 1.00 93.92  ? 645  THR A HG23 1 
ATOM   8513  N  N    . ILE A 1 567 ? -60.499 30.714  -34.651 1.00 68.26  ? 646  ILE A N    1 
ATOM   8514  C  CA   . ILE A 1 567 ? -59.931 31.648  -33.696 1.00 66.93  ? 646  ILE A CA   1 
ATOM   8515  C  C    . ILE A 1 567 ? -58.694 32.386  -34.235 1.00 62.55  ? 646  ILE A C    1 
ATOM   8516  O  O    . ILE A 1 567 ? -58.376 33.482  -33.765 1.00 51.41  ? 646  ILE A O    1 
ATOM   8517  C  CB   . ILE A 1 567 ? -59.605 30.899  -32.386 1.00 64.88  ? 646  ILE A CB   1 
ATOM   8518  C  CG1  . ILE A 1 567 ? -60.902 30.502  -31.676 1.00 62.70  ? 646  ILE A CG1  1 
ATOM   8519  C  CG2  . ILE A 1 567 ? -58.771 31.749  -31.457 1.00 65.85  ? 646  ILE A CG2  1 
ATOM   8520  C  CD1  . ILE A 1 567 ? -61.560 29.227  -32.191 1.00 66.18  ? 646  ILE A CD1  1 
ATOM   8521  H  H    . ILE A 1 567 ? -60.287 29.895  -34.498 1.00 81.91  ? 646  ILE A H    1 
ATOM   8522  H  HA   . ILE A 1 567 ? -60.600 32.319  -33.489 1.00 80.32  ? 646  ILE A HA   1 
ATOM   8523  H  HB   . ILE A 1 567 ? -59.109 30.094  -32.602 1.00 77.86  ? 646  ILE A HB   1 
ATOM   8524  H  HG12 . ILE A 1 567 ? -60.710 30.372  -30.734 1.00 75.24  ? 646  ILE A HG12 1 
ATOM   8525  H  HG13 . ILE A 1 567 ? -61.543 31.224  -31.779 1.00 75.24  ? 646  ILE A HG13 1 
ATOM   8526  H  HG21 . ILE A 1 567 ? -58.588 31.245  -30.648 1.00 79.03  ? 646  ILE A HG21 1 
ATOM   8527  H  HG22 . ILE A 1 567 ? -57.939 31.977  -31.900 1.00 79.03  ? 646  ILE A HG22 1 
ATOM   8528  H  HG23 . ILE A 1 567 ? -59.263 32.556  -31.240 1.00 79.03  ? 646  ILE A HG23 1 
ATOM   8529  H  HD11 . ILE A 1 567 ? -62.369 29.062  -31.682 1.00 79.41  ? 646  ILE A HD11 1 
ATOM   8530  H  HD12 . ILE A 1 567 ? -61.777 29.341  -33.129 1.00 79.41  ? 646  ILE A HD12 1 
ATOM   8531  H  HD13 . ILE A 1 567 ? -60.942 28.487  -32.082 1.00 79.41  ? 646  ILE A HD13 1 
ATOM   8532  N  N    . PHE A 1 568 ? -58.030 31.794  -35.229 1.00 78.84  ? 647  PHE A N    1 
ATOM   8533  C  CA   . PHE A 1 568 ? -56.787 32.327  -35.799 1.00 81.19  ? 647  PHE A CA   1 
ATOM   8534  C  C    . PHE A 1 568 ? -56.816 33.838  -35.970 1.00 83.45  ? 647  PHE A C    1 
ATOM   8535  O  O    . PHE A 1 568 ? -55.942 34.547  -35.472 1.00 84.67  ? 647  PHE A O    1 
ATOM   8536  C  CB   . PHE A 1 568 ? -56.514 31.690  -37.169 1.00 88.11  ? 647  PHE A CB   1 
ATOM   8537  C  CG   . PHE A 1 568 ? -55.297 32.241  -37.870 1.00 89.09  ? 647  PHE A CG   1 
ATOM   8538  C  CD1  . PHE A 1 568 ? -55.339 33.470  -38.517 1.00 86.11  ? 647  PHE A CD1  1 
ATOM   8539  C  CD2  . PHE A 1 568 ? -54.114 31.522  -37.892 1.00 88.60  ? 647  PHE A CD2  1 
ATOM   8540  C  CE1  . PHE A 1 568 ? -54.223 33.974  -39.154 1.00 86.73  ? 647  PHE A CE1  1 
ATOM   8541  C  CE2  . PHE A 1 568 ? -52.995 32.021  -38.534 1.00 87.40  ? 647  PHE A CE2  1 
ATOM   8542  C  CZ   . PHE A 1 568 ? -53.050 33.248  -39.166 1.00 87.87  ? 647  PHE A CZ   1 
ATOM   8543  H  H    . PHE A 1 568 ? -58.285 31.061  -35.601 1.00 94.60  ? 647  PHE A H    1 
ATOM   8544  H  HA   . PHE A 1 568 ? -56.048 32.105  -35.211 1.00 97.43  ? 647  PHE A HA   1 
ATOM   8545  H  HB2  . PHE A 1 568 ? -56.381 30.737  -37.049 1.00 105.73 ? 647  PHE A HB2  1 
ATOM   8546  H  HB3  . PHE A 1 568 ? -57.281 31.844  -37.743 1.00 105.73 ? 647  PHE A HB3  1 
ATOM   8547  H  HD1  . PHE A 1 568 ? -56.126 33.965  -38.511 1.00 103.33 ? 647  PHE A HD1  1 
ATOM   8548  H  HD2  . PHE A 1 568 ? -54.070 30.696  -37.466 1.00 106.31 ? 647  PHE A HD2  1 
ATOM   8549  H  HE1  . PHE A 1 568 ? -54.264 34.799  -39.582 1.00 104.07 ? 647  PHE A HE1  1 
ATOM   8550  H  HE2  . PHE A 1 568 ? -52.204 31.531  -38.539 1.00 104.88 ? 647  PHE A HE2  1 
ATOM   8551  H  HZ   . PHE A 1 568 ? -52.298 33.584  -39.598 1.00 105.44 ? 647  PHE A HZ   1 
ATOM   8552  N  N    . ASN A 1 569 ? -57.825 34.315  -36.693 1.00 90.89  ? 648  ASN A N    1 
ATOM   8553  C  CA   . ASN A 1 569 ? -57.894 35.712  -37.108 1.00 90.72  ? 648  ASN A CA   1 
ATOM   8554  C  C    . ASN A 1 569 ? -57.918 36.669  -35.918 1.00 81.72  ? 648  ASN A C    1 
ATOM   8555  O  O    . ASN A 1 569 ? -57.341 37.753  -35.976 1.00 78.42  ? 648  ASN A O    1 
ATOM   8556  C  CB   . ASN A 1 569 ? -59.114 35.946  -38.011 1.00 93.50  ? 648  ASN A CB   1 
ATOM   8557  C  CG   . ASN A 1 569 ? -59.283 34.860  -39.071 1.00 96.37  ? 648  ASN A CG   1 
ATOM   8558  O  OD1  . ASN A 1 569 ? -59.953 33.852  -38.839 1.00 94.05  ? 648  ASN A OD1  1 
ATOM   8559  N  ND2  . ASN A 1 569 ? -58.683 35.067  -40.241 1.00 93.22  ? 648  ASN A ND2  1 
ATOM   8560  H  H    . ASN A 1 569 ? -58.491 33.841  -36.961 1.00 109.07 ? 648  ASN A H    1 
ATOM   8561  H  HA   . ASN A 1 569 ? -57.102 35.916  -37.630 1.00 108.86 ? 648  ASN A HA   1 
ATOM   8562  H  HB2  . ASN A 1 569 ? -59.915 35.957  -37.464 1.00 112.19 ? 648  ASN A HB2  1 
ATOM   8563  H  HB3  . ASN A 1 569 ? -59.011 36.796  -38.467 1.00 112.19 ? 648  ASN A HB3  1 
ATOM   8564  H  HD21 . ASN A 1 569 ? -58.750 34.482  -40.868 1.00 111.87 ? 648  ASN A HD21 1 
ATOM   8565  H  HD22 . ASN A 1 569 ? -58.228 35.785  -40.370 1.00 111.87 ? 648  ASN A HD22 1 
ATOM   8566  N  N    . ARG A 1 570 ? -58.573 36.262  -34.836 1.00 69.71  ? 649  ARG A N    1 
ATOM   8567  C  CA   . ARG A 1 570 ? -58.614 37.074  -33.628 1.00 65.36  ? 649  ARG A CA   1 
ATOM   8568  C  C    . ARG A 1 570 ? -57.221 37.180  -33.020 1.00 64.95  ? 649  ARG A C    1 
ATOM   8569  O  O    . ARG A 1 570 ? -56.776 38.269  -32.658 1.00 66.20  ? 649  ARG A O    1 
ATOM   8570  C  CB   . ARG A 1 570 ? -59.578 36.468  -32.612 1.00 67.23  ? 649  ARG A CB   1 
ATOM   8571  C  CG   . ARG A 1 570 ? -59.675 37.244  -31.315 1.00 65.05  ? 649  ARG A CG   1 
ATOM   8572  C  CD   . ARG A 1 570 ? -60.651 36.577  -30.366 1.00 73.31  ? 649  ARG A CD   1 
ATOM   8573  N  NE   . ARG A 1 570 ? -62.012 36.528  -30.905 1.00 79.96  ? 649  ARG A NE   1 
ATOM   8574  C  CZ   . ARG A 1 570 ? -62.984 37.389  -30.607 1.00 78.81  ? 649  ARG A CZ   1 
ATOM   8575  N  NH1  . ARG A 1 570 ? -62.773 38.392  -29.763 1.00 70.58  ? 649  ARG A NH1  1 
ATOM   8576  N  NH2  . ARG A 1 570 ? -64.182 37.246  -31.157 1.00 82.76  ? 649  ARG A NH2  1 
ATOM   8577  H  H    . ARG A 1 570 ? -59.002 35.519  -34.776 1.00 83.66  ? 649  ARG A H    1 
ATOM   8578  H  HA   . ARG A 1 570 ? -58.922 37.967  -33.849 1.00 78.44  ? 649  ARG A HA   1 
ATOM   8579  H  HB2  . ARG A 1 570 ? -60.465 36.435  -33.004 1.00 80.68  ? 649  ARG A HB2  1 
ATOM   8580  H  HB3  . ARG A 1 570 ? -59.281 35.570  -32.398 1.00 80.68  ? 649  ARG A HB3  1 
ATOM   8581  H  HG2  . ARG A 1 570 ? -58.803 37.272  -30.889 1.00 78.06  ? 649  ARG A HG2  1 
ATOM   8582  H  HG3  . ARG A 1 570 ? -59.990 38.143  -31.499 1.00 78.06  ? 649  ARG A HG3  1 
ATOM   8583  H  HD2  . ARG A 1 570 ? -60.360 35.667  -30.200 1.00 87.97  ? 649  ARG A HD2  1 
ATOM   8584  H  HD3  . ARG A 1 570 ? -60.676 37.076  -29.534 1.00 87.97  ? 649  ARG A HD3  1 
ATOM   8585  H  HE   . ARG A 1 570 ? -62.198 35.894  -31.456 1.00 95.95  ? 649  ARG A HE   1 
ATOM   8586  H  HH11 . ARG A 1 570 ? -61.999 38.494  -29.400 1.00 84.70  ? 649  ARG A HH11 1 
ATOM   8587  H  HH12 . ARG A 1 570 ? -63.409 38.941  -29.579 1.00 84.70  ? 649  ARG A HH12 1 
ATOM   8588  H  HH21 . ARG A 1 570 ? -64.330 36.600  -31.705 1.00 99.31  ? 649  ARG A HH21 1 
ATOM   8589  H  HH22 . ARG A 1 570 ? -64.812 37.800  -30.967 1.00 99.31  ? 649  ARG A HH22 1 
ATOM   8590  N  N    . VAL A 1 571 ? -56.533 36.044  -32.913 1.00 62.83  ? 650  VAL A N    1 
ATOM   8591  C  CA   . VAL A 1 571 ? -55.220 36.007  -32.272 1.00 61.52  ? 650  VAL A CA   1 
ATOM   8592  C  C    . VAL A 1 571 ? -54.176 36.691  -33.146 1.00 58.51  ? 650  VAL A C    1 
ATOM   8593  O  O    . VAL A 1 571 ? -53.308 37.405  -32.644 1.00 58.23  ? 650  VAL A O    1 
ATOM   8594  C  CB   . VAL A 1 571 ? -54.725 34.562  -31.979 1.00 61.33  ? 650  VAL A CB   1 
ATOM   8595  C  CG1  . VAL A 1 571 ? -53.547 34.598  -31.002 1.00 55.67  ? 650  VAL A CG1  1 
ATOM   8596  C  CG2  . VAL A 1 571 ? -55.839 33.692  -31.417 1.00 56.89  ? 650  VAL A CG2  1 
ATOM   8597  H  H    . VAL A 1 571 ? -56.805 35.282  -33.203 1.00 75.40  ? 650  VAL A H    1 
ATOM   8598  H  HA   . VAL A 1 571 ? -55.266 36.486  -31.430 1.00 73.83  ? 650  VAL A HA   1 
ATOM   8599  H  HB   . VAL A 1 571 ? -54.417 34.159  -32.805 1.00 73.60  ? 650  VAL A HB   1 
ATOM   8600  H  HG11 . VAL A 1 571 ? -53.252 33.690  -30.830 1.00 66.80  ? 650  VAL A HG11 1 
ATOM   8601  H  HG12 . VAL A 1 571 ? -52.825 35.112  -31.397 1.00 66.80  ? 650  VAL A HG12 1 
ATOM   8602  H  HG13 . VAL A 1 571 ? -53.836 35.015  -30.175 1.00 66.80  ? 650  VAL A HG13 1 
ATOM   8603  H  HG21 . VAL A 1 571 ? -55.490 32.803  -31.248 1.00 68.27  ? 650  VAL A HG21 1 
ATOM   8604  H  HG22 . VAL A 1 571 ? -56.159 34.085  -30.590 1.00 68.27  ? 650  VAL A HG22 1 
ATOM   8605  H  HG23 . VAL A 1 571 ? -56.561 33.647  -32.063 1.00 68.27  ? 650  VAL A HG23 1 
ATOM   8606  N  N    . ASP A 1 572 ? -54.261 36.464  -34.452 1.00 75.91  ? 651  ASP A N    1 
ATOM   8607  C  CA   . ASP A 1 572 ? -53.294 37.021  -35.388 1.00 75.64  ? 651  ASP A CA   1 
ATOM   8608  C  C    . ASP A 1 572 ? -53.231 38.542  -35.276 1.00 79.48  ? 651  ASP A C    1 
ATOM   8609  O  O    . ASP A 1 572 ? -52.166 39.137  -35.438 1.00 84.20  ? 651  ASP A O    1 
ATOM   8610  C  CB   . ASP A 1 572 ? -53.649 36.619  -36.819 1.00 80.45  ? 651  ASP A CB   1 
ATOM   8611  C  CG   . ASP A 1 572 ? -52.540 36.934  -37.807 1.00 92.59  ? 651  ASP A CG   1 
ATOM   8612  O  OD1  . ASP A 1 572 ? -51.390 37.163  -37.371 1.00 87.74  ? 651  ASP A OD1  1 
ATOM   8613  O  OD2  . ASP A 1 572 ? -52.817 36.946  -39.026 1.00 103.08 ? 651  ASP A OD2  1 
ATOM   8614  H  H    . ASP A 1 572 ? -54.874 35.987  -34.823 1.00 91.09  ? 651  ASP A H    1 
ATOM   8615  H  HA   . ASP A 1 572 ? -52.415 36.667  -35.184 1.00 90.77  ? 651  ASP A HA   1 
ATOM   8616  H  HB2  . ASP A 1 572 ? -53.814 35.664  -36.847 1.00 96.54  ? 651  ASP A HB2  1 
ATOM   8617  H  HB3  . ASP A 1 572 ? -54.444 37.102  -37.095 1.00 96.54  ? 651  ASP A HB3  1 
ATOM   8618  N  N    . ILE A 1 573 ? -54.372 39.164  -34.995 1.00 82.05  ? 652  ILE A N    1 
ATOM   8619  C  CA   . ILE A 1 573 ? -54.428 40.610  -34.811 1.00 88.85  ? 652  ILE A CA   1 
ATOM   8620  C  C    . ILE A 1 573 ? -53.609 41.017  -33.590 1.00 87.30  ? 652  ILE A C    1 
ATOM   8621  O  O    . ILE A 1 573 ? -52.821 41.957  -33.648 1.00 88.66  ? 652  ILE A O    1 
ATOM   8622  C  CB   . ILE A 1 573 ? -55.884 41.109  -34.660 1.00 90.38  ? 652  ILE A CB   1 
ATOM   8623  C  CG1  . ILE A 1 573 ? -56.651 40.897  -35.966 1.00 90.80  ? 652  ILE A CG1  1 
ATOM   8624  C  CG2  . ILE A 1 573 ? -55.922 42.595  -34.304 1.00 88.17  ? 652  ILE A CG2  1 
ATOM   8625  C  CD1  . ILE A 1 573 ? -58.148 41.118  -35.849 1.00 93.23  ? 652  ILE A CD1  1 
ATOM   8626  H  H    . ILE A 1 573 ? -55.131 38.769  -34.905 1.00 98.46  ? 652  ILE A H    1 
ATOM   8627  H  HA   . ILE A 1 573 ? -54.041 41.043  -35.589 1.00 106.62 ? 652  ILE A HA   1 
ATOM   8628  H  HB   . ILE A 1 573 ? -56.318 40.605  -33.955 1.00 108.46 ? 652  ILE A HB   1 
ATOM   8629  H  HG12 . ILE A 1 573 ? -56.312 41.517  -36.630 1.00 108.96 ? 652  ILE A HG12 1 
ATOM   8630  H  HG13 . ILE A 1 573 ? -56.509 39.986  -36.266 1.00 108.96 ? 652  ILE A HG13 1 
ATOM   8631  H  HG21 . ILE A 1 573 ? -56.846 42.875  -34.217 1.00 105.80 ? 652  ILE A HG21 1 
ATOM   8632  H  HG22 . ILE A 1 573 ? -55.454 42.729  -33.465 1.00 105.80 ? 652  ILE A HG22 1 
ATOM   8633  H  HG23 . ILE A 1 573 ? -55.488 43.099  -35.010 1.00 105.80 ? 652  ILE A HG23 1 
ATOM   8634  H  HD11 . ILE A 1 573 ? -58.557 40.965  -36.715 1.00 111.88 ? 652  ILE A HD11 1 
ATOM   8635  H  HD12 . ILE A 1 573 ? -58.508 40.497  -35.198 1.00 111.88 ? 652  ILE A HD12 1 
ATOM   8636  H  HD13 . ILE A 1 573 ? -58.310 42.030  -35.563 1.00 111.88 ? 652  ILE A HD13 1 
ATOM   8637  N  N    . SER A 1 574 ? -53.794 40.298  -32.488 1.00 72.46  ? 653  SER A N    1 
ATOM   8638  C  CA   . SER A 1 574 ? -53.089 40.601  -31.247 1.00 67.08  ? 653  SER A CA   1 
ATOM   8639  C  C    . SER A 1 574 ? -51.592 40.318  -31.369 1.00 68.09  ? 653  SER A C    1 
ATOM   8640  O  O    . SER A 1 574 ? -50.770 41.056  -30.822 1.00 61.89  ? 653  SER A O    1 
ATOM   8641  C  CB   . SER A 1 574 ? -53.690 39.804  -30.090 1.00 63.86  ? 653  SER A CB   1 
ATOM   8642  O  OG   . SER A 1 574 ? -54.114 38.529  -30.528 1.00 71.06  ? 653  SER A OG   1 
ATOM   8643  H  H    . SER A 1 574 ? -54.327 39.625  -32.432 1.00 86.95  ? 653  SER A H    1 
ATOM   8644  H  HA   . SER A 1 574 ? -53.198 41.544  -31.047 1.00 80.50  ? 653  SER A HA   1 
ATOM   8645  H  HB2  . SER A 1 574 ? -53.018 39.693  -29.399 1.00 76.64  ? 653  SER A HB2  1 
ATOM   8646  H  HB3  . SER A 1 574 ? -54.454 40.286  -29.736 1.00 76.64  ? 653  SER A HB3  1 
ATOM   8647  H  HG   . SER A 1 574 ? -54.442 38.099  -29.886 1.00 85.27  ? 653  SER A HG   1 
ATOM   8648  N  N    . ARG A 1 575 ? -51.242 39.251  -32.084 1.00 68.87  ? 654  ARG A N    1 
ATOM   8649  C  CA   . ARG A 1 575 ? -49.844 38.955  -32.378 1.00 62.82  ? 654  ARG A CA   1 
ATOM   8650  C  C    . ARG A 1 575 ? -49.261 40.088  -33.202 1.00 66.38  ? 654  ARG A C    1 
ATOM   8651  O  O    . ARG A 1 575 ? -48.224 40.657  -32.856 1.00 64.09  ? 654  ARG A O    1 
ATOM   8652  C  CB   . ARG A 1 575 ? -49.712 37.644  -33.159 1.00 65.04  ? 654  ARG A CB   1 
ATOM   8653  C  CG   . ARG A 1 575 ? -48.314 37.404  -33.737 1.00 63.17  ? 654  ARG A CG   1 
ATOM   8654  C  CD   . ARG A 1 575 ? -48.139 35.980  -34.236 1.00 57.18  ? 654  ARG A CD   1 
ATOM   8655  N  NE   . ARG A 1 575 ? -48.847 35.734  -35.491 1.00 60.58  ? 654  ARG A NE   1 
ATOM   8656  C  CZ   . ARG A 1 575 ? -48.936 34.542  -36.073 1.00 63.14  ? 654  ARG A CZ   1 
ATOM   8657  N  NH1  . ARG A 1 575 ? -48.367 33.487  -35.510 1.00 67.00  ? 654  ARG A NH1  1 
ATOM   8658  N  NH2  . ARG A 1 575 ? -49.594 34.402  -37.215 1.00 63.78  ? 654  ARG A NH2  1 
ATOM   8659  H  H    . ARG A 1 575 ? -51.798 38.682  -32.410 1.00 82.64  ? 654  ARG A H    1 
ATOM   8660  H  HA   . ARG A 1 575 ? -49.342 38.879  -31.551 1.00 75.39  ? 654  ARG A HA   1 
ATOM   8661  H  HB2  . ARG A 1 575 ? -49.918 36.905  -32.565 1.00 78.05  ? 654  ARG A HB2  1 
ATOM   8662  H  HB3  . ARG A 1 575 ? -50.340 37.656  -33.898 1.00 78.05  ? 654  ARG A HB3  1 
ATOM   8663  H  HG2  . ARG A 1 575 ? -48.171 38.006  -34.483 1.00 75.80  ? 654  ARG A HG2  1 
ATOM   8664  H  HG3  . ARG A 1 575 ? -47.652 37.565  -33.046 1.00 75.80  ? 654  ARG A HG3  1 
ATOM   8665  H  HD2  . ARG A 1 575 ? -47.196 35.811  -34.385 1.00 68.62  ? 654  ARG A HD2  1 
ATOM   8666  H  HD3  . ARG A 1 575 ? -48.486 35.366  -33.570 1.00 68.62  ? 654  ARG A HD3  1 
ATOM   8667  H  HE   . ARG A 1 575 ? -49.172 36.412  -35.908 1.00 72.70  ? 654  ARG A HE   1 
ATOM   8668  H  HH11 . ARG A 1 575 ? -47.938 33.573  -34.770 1.00 80.40  ? 654  ARG A HH11 1 
ATOM   8669  H  HH12 . ARG A 1 575 ? -48.425 32.715  -35.886 1.00 80.40  ? 654  ARG A HH12 1 
ATOM   8670  H  HH21 . ARG A 1 575 ? -49.966 35.084  -37.584 1.00 76.54  ? 654  ARG A HH21 1 
ATOM   8671  H  HH22 . ARG A 1 575 ? -49.650 33.628  -37.587 1.00 76.54  ? 654  ARG A HH22 1 
ATOM   8672  N  N    . SER A 1 576 ? -49.947 40.408  -34.294 1.00 57.59  ? 655  SER A N    1 
ATOM   8673  C  CA   . SER A 1 576 ? -49.519 41.459  -35.210 1.00 57.61  ? 655  SER A CA   1 
ATOM   8674  C  C    . SER A 1 576 ? -49.435 42.822  -34.516 1.00 54.69  ? 655  SER A C    1 
ATOM   8675  O  O    . SER A 1 576 ? -48.744 43.721  -34.989 1.00 64.09  ? 655  SER A O    1 
ATOM   8676  C  CB   . SER A 1 576 ? -50.477 41.535  -36.406 1.00 62.29  ? 655  SER A CB   1 
ATOM   8677  O  OG   . SER A 1 576 ? -49.928 42.311  -37.456 1.00 68.54  ? 655  SER A OG   1 
ATOM   8678  H  H    . SER A 1 576 ? -50.679 40.023  -34.531 1.00 69.11  ? 655  SER A H    1 
ATOM   8679  H  HA   . SER A 1 576 ? -48.637 41.241  -35.548 1.00 69.14  ? 655  SER A HA   1 
ATOM   8680  H  HB2  . SER A 1 576 ? -50.644 40.637  -36.732 1.00 74.75  ? 655  SER A HB2  1 
ATOM   8681  H  HB3  . SER A 1 576 ? -51.309 41.941  -36.117 1.00 74.75  ? 655  SER A HB3  1 
ATOM   8682  H  HG   . SER A 1 576 ? -49.207 41.971  -37.718 1.00 82.25  ? 655  SER A HG   1 
ATOM   8683  N  N    . GLN A 1 577 ? -50.128 42.964  -33.389 1.00 47.63  ? 656  GLN A N    1 
ATOM   8684  C  CA   . GLN A 1 577 ? -50.163 44.230  -32.660 1.00 48.62  ? 656  GLN A CA   1 
ATOM   8685  C  C    . GLN A 1 577 ? -49.100 44.302  -31.567 1.00 47.41  ? 656  GLN A C    1 
ATOM   8686  O  O    . GLN A 1 577 ? -48.485 45.349  -31.370 1.00 48.35  ? 656  GLN A O    1 
ATOM   8687  C  CB   . GLN A 1 577 ? -51.549 44.452  -32.054 1.00 60.99  ? 656  GLN A CB   1 
ATOM   8688  C  CG   . GLN A 1 577 ? -52.577 44.962  -33.051 1.00 66.83  ? 656  GLN A CG   1 
ATOM   8689  C  CD   . GLN A 1 577 ? -53.988 45.040  -32.485 1.00 74.86  ? 656  GLN A CD   1 
ATOM   8690  O  OE1  . GLN A 1 577 ? -54.936 45.331  -33.215 1.00 80.82  ? 656  GLN A OE1  1 
ATOM   8691  N  NE2  . GLN A 1 577 ? -54.136 44.786  -31.184 1.00 74.05  ? 656  GLN A NE2  1 
ATOM   8692  H  H    . GLN A 1 577 ? -50.590 42.338  -33.023 1.00 57.16  ? 656  GLN A H    1 
ATOM   8693  H  HA   . GLN A 1 577 ? -49.994 44.953  -33.284 1.00 58.34  ? 656  GLN A HA   1 
ATOM   8694  H  HB2  . GLN A 1 577 ? -51.873 43.610  -31.697 1.00 73.19  ? 656  GLN A HB2  1 
ATOM   8695  H  HB3  . GLN A 1 577 ? -51.477 45.106  -31.341 1.00 73.19  ? 656  GLN A HB3  1 
ATOM   8696  H  HG2  . GLN A 1 577 ? -52.322 45.854  -33.336 1.00 80.20  ? 656  GLN A HG2  1 
ATOM   8697  H  HG3  . GLN A 1 577 ? -52.596 44.365  -33.815 1.00 80.20  ? 656  GLN A HG3  1 
ATOM   8698  H  HE21 . GLN A 1 577 ? -53.450 44.589  -30.704 1.00 88.86  ? 656  GLN A HE21 1 
ATOM   8699  H  HE22 . GLN A 1 577 ? -54.917 44.819  -30.825 1.00 88.86  ? 656  GLN A HE22 1 
ATOM   8700  N  N    . LEU A 1 578 ? -48.903 43.197  -30.849 1.00 80.83  ? 657  LEU A N    1 
ATOM   8701  C  CA   . LEU A 1 578 ? -47.871 43.119  -29.813 1.00 77.13  ? 657  LEU A CA   1 
ATOM   8702  C  C    . LEU A 1 578 ? -46.489 43.407  -30.385 1.00 83.04  ? 657  LEU A C    1 
ATOM   8703  O  O    . LEU A 1 578 ? -45.651 44.034  -29.738 1.00 82.22  ? 657  LEU A O    1 
ATOM   8704  C  CB   . LEU A 1 578 ? -47.862 41.730  -29.164 1.00 64.59  ? 657  LEU A CB   1 
ATOM   8705  C  CG   . LEU A 1 578 ? -46.639 41.407  -28.291 1.00 65.73  ? 657  LEU A CG   1 
ATOM   8706  C  CD1  . LEU A 1 578 ? -46.543 42.355  -27.092 1.00 70.02  ? 657  LEU A CD1  1 
ATOM   8707  C  CD2  . LEU A 1 578 ? -46.639 39.951  -27.843 1.00 54.43  ? 657  LEU A CD2  1 
ATOM   8708  H  H    . LEU A 1 578 ? -49.357 42.473  -30.944 1.00 96.99  ? 657  LEU A H    1 
ATOM   8709  H  HA   . LEU A 1 578 ? -48.059 43.775  -29.125 1.00 92.56  ? 657  LEU A HA   1 
ATOM   8710  H  HB2  . LEU A 1 578 ? -48.649 41.650  -28.601 1.00 77.51  ? 657  LEU A HB2  1 
ATOM   8711  H  HB3  . LEU A 1 578 ? -47.900 41.063  -29.867 1.00 77.51  ? 657  LEU A HB3  1 
ATOM   8712  H  HG   . LEU A 1 578 ? -45.841 41.542  -28.826 1.00 78.88  ? 657  LEU A HG   1 
ATOM   8713  H  HD11 . LEU A 1 578 ? -45.762 42.122  -26.567 1.00 84.02  ? 657  LEU A HD11 1 
ATOM   8714  H  HD12 . LEU A 1 578 ? -46.465 43.266  -27.416 1.00 84.02  ? 657  LEU A HD12 1 
ATOM   8715  H  HD13 . LEU A 1 578 ? -47.345 42.264  -26.553 1.00 84.02  ? 657  LEU A HD13 1 
ATOM   8716  H  HD21 . LEU A 1 578 ? -45.853 39.790  -27.297 1.00 65.32  ? 657  LEU A HD21 1 
ATOM   8717  H  HD22 . LEU A 1 578 ? -47.442 39.780  -27.327 1.00 65.32  ? 657  LEU A HD22 1 
ATOM   8718  H  HD23 . LEU A 1 578 ? -46.620 39.380  -28.626 1.00 65.32  ? 657  LEU A HD23 1 
ATOM   8719  N  N    . ILE A 1 579 ? -46.256 42.932  -31.602 1.00 86.36  ? 658  ILE A N    1 
ATOM   8720  C  CA   . ILE A 1 579 ? -44.936 42.989  -32.207 1.00 82.96  ? 658  ILE A CA   1 
ATOM   8721  C  C    . ILE A 1 579 ? -44.680 44.345  -32.860 1.00 84.02  ? 658  ILE A C    1 
ATOM   8722  O  O    . ILE A 1 579 ? -43.532 44.786  -32.950 1.00 84.81  ? 658  ILE A O    1 
ATOM   8723  C  CB   . ILE A 1 579 ? -44.760 41.824  -33.192 1.00 82.90  ? 658  ILE A CB   1 
ATOM   8724  C  CG1  . ILE A 1 579 ? -44.766 40.514  -32.394 1.00 79.06  ? 658  ILE A CG1  1 
ATOM   8725  C  CG2  . ILE A 1 579 ? -43.469 41.970  -33.997 1.00 86.13  ? 658  ILE A CG2  1 
ATOM   8726  C  CD1  . ILE A 1 579 ? -44.640 39.270  -33.214 1.00 77.19  ? 658  ILE A CD1  1 
ATOM   8727  H  H    . ILE A 1 579 ? -46.854 42.568  -32.101 1.00 103.63 ? 658  ILE A H    1 
ATOM   8728  H  HA   . ILE A 1 579 ? -44.274 42.877  -31.506 1.00 99.56  ? 658  ILE A HA   1 
ATOM   8729  H  HB   . ILE A 1 579 ? -45.511 41.818  -33.806 1.00 99.48  ? 658  ILE A HB   1 
ATOM   8730  H  HG12 . ILE A 1 579 ? -44.022 40.529  -31.771 1.00 94.87  ? 658  ILE A HG12 1 
ATOM   8731  H  HG13 . ILE A 1 579 ? -45.600 40.457  -31.902 1.00 94.87  ? 658  ILE A HG13 1 
ATOM   8732  H  HG21 . ILE A 1 579 ? -43.391 41.220  -34.607 1.00 103.36 ? 658  ILE A HG21 1 
ATOM   8733  H  HG22 . ILE A 1 579 ? -43.502 42.801  -34.497 1.00 103.36 ? 658  ILE A HG22 1 
ATOM   8734  H  HG23 . ILE A 1 579 ? -42.715 41.981  -33.386 1.00 103.36 ? 658  ILE A HG23 1 
ATOM   8735  H  HD11 . ILE A 1 579 ? -44.654 38.501  -32.623 1.00 92.63  ? 658  ILE A HD11 1 
ATOM   8736  H  HD12 . ILE A 1 579 ? -45.385 39.225  -33.834 1.00 92.63  ? 658  ILE A HD12 1 
ATOM   8737  H  HD13 . ILE A 1 579 ? -43.803 39.298  -33.702 1.00 92.63  ? 658  ILE A HD13 1 
ATOM   8738  N  N    . ASP A 1 580 ? -45.748 45.009  -33.295 1.00 83.24  ? 659  ASP A N    1 
ATOM   8739  C  CA   . ASP A 1 580 ? -45.652 46.390  -33.757 1.00 87.21  ? 659  ASP A CA   1 
ATOM   8740  C  C    . ASP A 1 580 ? -45.054 47.225  -32.626 1.00 87.02  ? 659  ASP A C    1 
ATOM   8741  O  O    . ASP A 1 580 ? -44.211 48.091  -32.855 1.00 89.55  ? 659  ASP A O    1 
ATOM   8742  C  CB   . ASP A 1 580 ? -47.033 46.948  -34.143 1.00 87.48  ? 659  ASP A CB   1 
ATOM   8743  C  CG   . ASP A 1 580 ? -47.492 46.511  -35.532 1.00 90.59  ? 659  ASP A CG   1 
ATOM   8744  O  OD1  . ASP A 1 580 ? -46.646 46.124  -36.366 1.00 91.35  ? 659  ASP A OD1  1 
ATOM   8745  O  OD2  . ASP A 1 580 ? -48.714 46.569  -35.789 1.00 85.71  ? 659  ASP A OD2  1 
ATOM   8746  H  H    . ASP A 1 580 ? -46.542 44.680  -33.334 1.00 99.89  ? 659  ASP A H    1 
ATOM   8747  H  HA   . ASP A 1 580 ? -45.066 46.441  -34.528 1.00 104.65 ? 659  ASP A HA   1 
ATOM   8748  H  HB2  . ASP A 1 580 ? -47.689 46.637  -33.500 1.00 104.97 ? 659  ASP A HB2  1 
ATOM   8749  H  HB3  . ASP A 1 580 ? -46.995 47.917  -34.133 1.00 104.97 ? 659  ASP A HB3  1 
ATOM   8750  N  N    . GLU A 1 581 ? -45.491 46.943  -31.400 1.00 85.42  ? 660  GLU A N    1 
ATOM   8751  C  CA   . GLU A 1 581 ? -45.004 47.658  -30.223 1.00 87.20  ? 660  GLU A CA   1 
ATOM   8752  C  C    . GLU A 1 581 ? -43.528 47.363  -29.981 1.00 83.81  ? 660  GLU A C    1 
ATOM   8753  O  O    . GLU A 1 581 ? -42.739 48.274  -29.733 1.00 82.20  ? 660  GLU A O    1 
ATOM   8754  C  CB   . GLU A 1 581 ? -45.818 47.282  -28.977 1.00 89.14  ? 660  GLU A CB   1 
ATOM   8755  C  CG   . GLU A 1 581 ? -47.310 47.570  -29.095 1.00 92.42  ? 660  GLU A CG   1 
ATOM   8756  C  CD   . GLU A 1 581 ? -48.087 47.269  -27.822 1.00 98.39  ? 660  GLU A CD   1 
ATOM   8757  O  OE1  . GLU A 1 581 ? -47.468 46.867  -26.815 1.00 101.47 ? 660  GLU A OE1  1 
ATOM   8758  O  OE2  . GLU A 1 581 ? -49.325 47.437  -27.834 1.00 99.69  ? 660  GLU A OE2  1 
ATOM   8759  H  H    . GLU A 1 581 ? -46.074 46.336  -31.222 1.00 102.51 ? 660  GLU A H    1 
ATOM   8760  H  HA   . GLU A 1 581 ? -45.101 48.612  -30.370 1.00 104.64 ? 660  GLU A HA   1 
ATOM   8761  H  HB2  . GLU A 1 581 ? -45.712 46.332  -28.811 1.00 106.97 ? 660  GLU A HB2  1 
ATOM   8762  H  HB3  . GLU A 1 581 ? -45.479 47.786  -28.220 1.00 106.97 ? 660  GLU A HB3  1 
ATOM   8763  H  HG2  . GLU A 1 581 ? -47.433 48.509  -29.304 1.00 110.90 ? 660  GLU A HG2  1 
ATOM   8764  H  HG3  . GLU A 1 581 ? -47.680 47.023  -29.805 1.00 110.90 ? 660  GLU A HG3  1 
ATOM   8765  N  N    . LEU A 1 582 ? -43.159 46.088  -30.056 1.00 67.13  ? 661  LEU A N    1 
ATOM   8766  C  CA   . LEU A 1 582 ? -41.789 45.676  -29.761 1.00 62.87  ? 661  LEU A CA   1 
ATOM   8767  C  C    . LEU A 1 582 ? -40.791 46.215  -30.783 1.00 63.77  ? 661  LEU A C    1 
ATOM   8768  O  O    . LEU A 1 582 ? -39.720 46.695  -30.412 1.00 63.08  ? 661  LEU A O    1 
ATOM   8769  C  CB   . LEU A 1 582 ? -41.682 44.149  -29.664 1.00 55.10  ? 661  LEU A CB   1 
ATOM   8770  C  CG   . LEU A 1 582 ? -42.177 43.542  -28.346 1.00 46.30  ? 661  LEU A CG   1 
ATOM   8771  C  CD1  . LEU A 1 582 ? -42.233 42.024  -28.429 1.00 41.69  ? 661  LEU A CD1  1 
ATOM   8772  C  CD2  . LEU A 1 582 ? -41.300 43.969  -27.166 1.00 43.12  ? 661  LEU A CD2  1 
ATOM   8773  H  H    . LEU A 1 582 ? -43.682 45.442  -30.276 1.00 80.56  ? 661  LEU A H    1 
ATOM   8774  H  HA   . LEU A 1 582 ? -41.541 46.039  -28.896 1.00 75.44  ? 661  LEU A HA   1 
ATOM   8775  H  HB2  . LEU A 1 582 ? -42.205 43.757  -30.380 1.00 66.12  ? 661  LEU A HB2  1 
ATOM   8776  H  HB3  . LEU A 1 582 ? -40.750 43.898  -29.768 1.00 66.12  ? 661  LEU A HB3  1 
ATOM   8777  H  HG   . LEU A 1 582 ? -43.077 43.862  -28.176 1.00 55.56  ? 661  LEU A HG   1 
ATOM   8778  H  HD11 . LEU A 1 582 ? -42.549 41.673  -27.582 1.00 50.03  ? 661  LEU A HD11 1 
ATOM   8779  H  HD12 . LEU A 1 582 ? -42.841 41.770  -29.141 1.00 50.03  ? 661  LEU A HD12 1 
ATOM   8780  H  HD13 . LEU A 1 582 ? -41.343 41.686  -28.617 1.00 50.03  ? 661  LEU A HD13 1 
ATOM   8781  H  HD21 . LEU A 1 582 ? -41.646 43.565  -26.354 1.00 51.75  ? 661  LEU A HD21 1 
ATOM   8782  H  HD22 . LEU A 1 582 ? -40.391 43.669  -27.323 1.00 51.75  ? 661  LEU A HD22 1 
ATOM   8783  H  HD23 . LEU A 1 582 ? -41.322 44.935  -27.090 1.00 51.75  ? 661  LEU A HD23 1 
ATOM   8784  N  N    . ALA A 1 583 ? -41.146 46.151  -32.064 1.00 60.66  ? 662  ALA A N    1 
ATOM   8785  C  CA   . ALA A 1 583 ? -40.266 46.631  -33.129 1.00 58.19  ? 662  ALA A CA   1 
ATOM   8786  C  C    . ALA A 1 583 ? -40.015 48.134  -33.000 1.00 61.11  ? 662  ALA A C    1 
ATOM   8787  O  O    . ALA A 1 583 ? -38.880 48.594  -33.127 1.00 65.41  ? 662  ALA A O    1 
ATOM   8788  C  CB   . ALA A 1 583 ? -40.856 46.302  -34.503 1.00 55.64  ? 662  ALA A CB   1 
ATOM   8789  H  H    . ALA A 1 583 ? -41.894 45.833  -32.344 1.00 72.80  ? 662  ALA A H    1 
ATOM   8790  H  HA   . ALA A 1 583 ? -39.411 46.180  -33.056 1.00 69.82  ? 662  ALA A HA   1 
ATOM   8791  H  HB1  . ALA A 1 583 ? -40.255 46.630  -35.191 1.00 66.76  ? 662  ALA A HB1  1 
ATOM   8792  H  HB2  . ALA A 1 583 ? -40.955 45.340  -34.581 1.00 66.76  ? 662  ALA A HB2  1 
ATOM   8793  H  HB3  . ALA A 1 583 ? -41.721 46.732  -34.586 1.00 66.76  ? 662  ALA A HB3  1 
ATOM   8794  N  N    . ASP A 1 584 ? -41.077 48.889  -32.728 1.00 68.37  ? 663  ASP A N    1 
ATOM   8795  C  CA   . ASP A 1 584 ? -40.982 50.341  -32.602 1.00 72.09  ? 663  ASP A CA   1 
ATOM   8796  C  C    . ASP A 1 584 ? -40.152 50.734  -31.378 1.00 75.37  ? 663  ASP A C    1 
ATOM   8797  O  O    . ASP A 1 584 ? -39.334 51.651  -31.447 1.00 82.67  ? 663  ASP A O    1 
ATOM   8798  C  CB   . ASP A 1 584 ? -42.381 50.969  -32.520 1.00 83.78  ? 663  ASP A CB   1 
ATOM   8799  C  CG   . ASP A 1 584 ? -43.151 50.868  -33.828 1.00 92.86  ? 663  ASP A CG   1 
ATOM   8800  O  OD1  . ASP A 1 584 ? -42.933 49.897  -34.583 1.00 90.98  ? 663  ASP A OD1  1 
ATOM   8801  O  OD2  . ASP A 1 584 ? -43.980 51.761  -34.098 1.00 100.79 ? 663  ASP A OD2  1 
ATOM   8802  H  H    . ASP A 1 584 ? -41.871 48.581  -32.611 1.00 82.04  ? 663  ASP A H    1 
ATOM   8803  H  HA   . ASP A 1 584 ? -40.541 50.697  -33.389 1.00 86.50  ? 663  ASP A HA   1 
ATOM   8804  H  HB2  . ASP A 1 584 ? -42.893 50.511  -31.835 1.00 100.53 ? 663  ASP A HB2  1 
ATOM   8805  H  HB3  . ASP A 1 584 ? -42.293 51.909  -32.296 1.00 100.53 ? 663  ASP A HB3  1 
ATOM   8806  N  N    . LYS A 1 585 ? -40.372 50.043  -30.262 1.00 72.27  ? 664  LYS A N    1 
ATOM   8807  C  CA   . LYS A 1 585 ? -39.577 50.240  -29.049 1.00 67.05  ? 664  LYS A CA   1 
ATOM   8808  C  C    . LYS A 1 585 ? -38.120 49.916  -29.341 1.00 71.37  ? 664  LYS A C    1 
ATOM   8809  O  O    . LYS A 1 585 ? -37.207 50.581  -28.850 1.00 73.84  ? 664  LYS A O    1 
ATOM   8810  C  CB   . LYS A 1 585 ? -40.116 49.342  -27.924 1.00 58.16  ? 664  LYS A CB   1 
ATOM   8811  C  CG   . LYS A 1 585 ? -39.167 49.024  -26.758 1.00 62.15  ? 664  LYS A CG   1 
ATOM   8812  C  CD   . LYS A 1 585 ? -39.120 50.124  -25.712 1.00 67.51  ? 664  LYS A CD   1 
ATOM   8813  C  CE   . LYS A 1 585 ? -38.781 49.535  -24.348 1.00 68.18  ? 664  LYS A CE   1 
ATOM   8814  N  NZ   . LYS A 1 585 ? -38.620 50.556  -23.281 1.00 66.82  ? 664  LYS A NZ   1 
ATOM   8815  H  H    . LYS A 1 585 ? -40.985 49.445  -30.179 1.00 86.73  ? 664  LYS A H    1 
ATOM   8816  H  HA   . LYS A 1 585 ? -39.638 51.165  -28.765 1.00 80.46  ? 664  LYS A HA   1 
ATOM   8817  H  HB2  . LYS A 1 585 ? -40.898 49.773  -27.545 1.00 69.79  ? 664  LYS A HB2  1 
ATOM   8818  H  HB3  . LYS A 1 585 ? -40.379 48.495  -28.317 1.00 69.79  ? 664  LYS A HB3  1 
ATOM   8819  H  HG2  . LYS A 1 585 ? -39.465 48.210  -26.322 1.00 74.58  ? 664  LYS A HG2  1 
ATOM   8820  H  HG3  . LYS A 1 585 ? -38.269 48.904  -27.106 1.00 74.58  ? 664  LYS A HG3  1 
ATOM   8821  H  HD2  . LYS A 1 585 ? -38.435 50.768  -25.949 1.00 81.01  ? 664  LYS A HD2  1 
ATOM   8822  H  HD3  . LYS A 1 585 ? -39.987 50.555  -25.655 1.00 81.01  ? 664  LYS A HD3  1 
ATOM   8823  H  HE2  . LYS A 1 585 ? -39.494 48.935  -24.080 1.00 81.82  ? 664  LYS A HE2  1 
ATOM   8824  H  HE3  . LYS A 1 585 ? -37.947 49.044  -24.418 1.00 81.82  ? 664  LYS A HE3  1 
ATOM   8825  H  HZ1  . LYS A 1 585 ? -38.423 50.160  -22.508 1.00 80.18  ? 664  LYS A HZ1  1 
ATOM   8826  H  HZ2  . LYS A 1 585 ? -37.963 51.117  -23.494 1.00 80.18  ? 664  LYS A HZ2  1 
ATOM   8827  H  HZ3  . LYS A 1 585 ? -39.375 51.018  -23.185 1.00 80.18  ? 664  LYS A HZ3  1 
ATOM   8828  N  N    . PHE A 1 586 ? -37.912 48.883  -30.147 1.00 86.43  ? 665  PHE A N    1 
ATOM   8829  C  CA   . PHE A 1 586 ? -36.575 48.396  -30.440 1.00 84.10  ? 665  PHE A CA   1 
ATOM   8830  C  C    . PHE A 1 586 ? -35.809 49.396  -31.306 1.00 89.37  ? 665  PHE A C    1 
ATOM   8831  O  O    . PHE A 1 586 ? -34.637 49.669  -31.053 1.00 89.49  ? 665  PHE A O    1 
ATOM   8832  C  CB   . PHE A 1 586 ? -36.673 47.033  -31.131 1.00 81.53  ? 665  PHE A CB   1 
ATOM   8833  C  CG   . PHE A 1 586 ? -35.387 46.263  -31.164 1.00 82.32  ? 665  PHE A CG   1 
ATOM   8834  C  CD1  . PHE A 1 586 ? -34.581 46.170  -30.042 1.00 83.10  ? 665  PHE A CD1  1 
ATOM   8835  C  CD2  . PHE A 1 586 ? -35.006 45.596  -32.314 1.00 81.93  ? 665  PHE A CD2  1 
ATOM   8836  C  CE1  . PHE A 1 586 ? -33.405 45.449  -30.079 1.00 79.44  ? 665  PHE A CE1  1 
ATOM   8837  C  CE2  . PHE A 1 586 ? -33.835 44.871  -32.357 1.00 80.81  ? 665  PHE A CE2  1 
ATOM   8838  C  CZ   . PHE A 1 586 ? -33.034 44.795  -31.237 1.00 77.14  ? 665  PHE A CZ   1 
ATOM   8839  H  H    . PHE A 1 586 ? -38.538 48.444  -30.541 1.00 103.72 ? 665  PHE A H    1 
ATOM   8840  H  HA   . PHE A 1 586 ? -36.088 48.280  -29.609 1.00 100.91 ? 665  PHE A HA   1 
ATOM   8841  H  HB2  . PHE A 1 586 ? -37.327 46.493  -30.662 1.00 97.84  ? 665  PHE A HB2  1 
ATOM   8842  H  HB3  . PHE A 1 586 ? -36.958 47.170  -32.048 1.00 97.84  ? 665  PHE A HB3  1 
ATOM   8843  H  HD1  . PHE A 1 586 ? -34.827 46.610  -29.261 1.00 99.73  ? 665  PHE A HD1  1 
ATOM   8844  H  HD2  . PHE A 1 586 ? -35.543 45.645  -33.072 1.00 98.32  ? 665  PHE A HD2  1 
ATOM   8845  H  HE1  . PHE A 1 586 ? -32.866 45.398  -29.322 1.00 95.33  ? 665  PHE A HE1  1 
ATOM   8846  H  HE2  . PHE A 1 586 ? -33.586 44.434  -33.139 1.00 96.97  ? 665  PHE A HE2  1 
ATOM   8847  H  HZ   . PHE A 1 586 ? -32.242 44.308  -31.264 1.00 92.57  ? 665  PHE A HZ   1 
ATOM   8848  N  N    . ASN A 1 587 ? -36.481 49.951  -32.312 1.00 86.96  ? 666  ASN A N    1 
ATOM   8849  C  CA   . ASN A 1 587 ? -35.869 50.922  -33.216 1.00 85.67  ? 666  ASN A CA   1 
ATOM   8850  C  C    . ASN A 1 587 ? -35.441 52.192  -32.492 1.00 84.98  ? 666  ASN A C    1 
ATOM   8851  O  O    . ASN A 1 587 ? -34.392 52.764  -32.786 1.00 89.64  ? 666  ASN A O    1 
ATOM   8852  C  CB   . ASN A 1 587 ? -36.840 51.283  -34.344 1.00 87.28  ? 666  ASN A CB   1 
ATOM   8853  C  CG   . ASN A 1 587 ? -37.185 50.093  -35.220 1.00 89.07  ? 666  ASN A CG   1 
ATOM   8854  O  OD1  . ASN A 1 587 ? -36.561 49.037  -35.123 1.00 89.79  ? 666  ASN A OD1  1 
ATOM   8855  N  ND2  . ASN A 1 587 ? -38.176 50.261  -36.089 1.00 90.27  ? 666  ASN A ND2  1 
ATOM   8856  H  H    . ASN A 1 587 ? -37.304 49.779  -32.494 1.00 104.35 ? 666  ASN A H    1 
ATOM   8857  H  HA   . ASN A 1 587 ? -35.079 50.525  -33.616 1.00 102.80 ? 666  ASN A HA   1 
ATOM   8858  H  HB2  . ASN A 1 587 ? -37.663 51.620  -33.957 1.00 104.74 ? 666  ASN A HB2  1 
ATOM   8859  H  HB3  . ASN A 1 587 ? -36.434 51.962  -34.905 1.00 104.74 ? 666  ASN A HB3  1 
ATOM   8860  H  HD21 . ASN A 1 587 ? -38.408 49.615  -36.607 1.00 108.33 ? 666  ASN A HD21 1 
ATOM   8861  H  HD22 . ASN A 1 587 ? -38.586 51.016  -36.133 1.00 108.33 ? 666  ASN A HD22 1 
ATOM   8862  N  N    . ARG A 1 588 ? -36.262 52.623  -31.542 1.00 83.32  ? 667  ARG A N    1 
ATOM   8863  C  CA   . ARG A 1 588 ? -36.018 53.862  -30.819 1.00 89.70  ? 667  ARG A CA   1 
ATOM   8864  C  C    . ARG A 1 588 ? -34.888 53.695  -29.814 1.00 87.74  ? 667  ARG A C    1 
ATOM   8865  O  O    . ARG A 1 588 ? -34.083 54.604  -29.614 1.00 89.63  ? 667  ARG A O    1 
ATOM   8866  C  CB   . ARG A 1 588 ? -37.294 54.302  -30.106 1.00 88.99  ? 667  ARG A CB   1 
ATOM   8867  C  CG   . ARG A 1 588 ? -38.370 54.824  -31.052 1.00 92.65  ? 667  ARG A CG   1 
ATOM   8868  C  CD   . ARG A 1 588 ? -39.766 54.820  -30.431 1.00 91.49  ? 667  ARG A CD   1 
ATOM   8869  N  NE   . ARG A 1 588 ? -39.760 54.515  -29.000 1.00 94.51  ? 667  ARG A NE   1 
ATOM   8870  C  CZ   . ARG A 1 588 ? -40.727 53.857  -28.362 1.00 94.10  ? 667  ARG A CZ   1 
ATOM   8871  N  NH1  . ARG A 1 588 ? -41.800 53.416  -29.012 1.00 92.33  ? 667  ARG A NH1  1 
ATOM   8872  N  NH2  . ARG A 1 588 ? -40.620 53.632  -27.059 1.00 89.31  ? 667  ARG A NH2  1 
ATOM   8873  H  H    . ARG A 1 588 ? -36.975 52.211  -31.296 1.00 99.98  ? 667  ARG A H    1 
ATOM   8874  H  HA   . ARG A 1 588 ? -35.765 54.556  -31.448 1.00 107.65 ? 667  ARG A HA   1 
ATOM   8875  H  HB2  . ARG A 1 588 ? -37.662 53.544  -29.626 1.00 106.79 ? 667  ARG A HB2  1 
ATOM   8876  H  HB3  . ARG A 1 588 ? -37.075 55.013  -29.483 1.00 106.79 ? 667  ARG A HB3  1 
ATOM   8877  H  HG2  . ARG A 1 588 ? -38.156 55.737  -31.300 1.00 111.18 ? 667  ARG A HG2  1 
ATOM   8878  H  HG3  . ARG A 1 588 ? -38.393 54.263  -31.843 1.00 111.18 ? 667  ARG A HG3  1 
ATOM   8879  H  HD2  . ARG A 1 588 ? -40.164 55.696  -30.548 1.00 109.79 ? 667  ARG A HD2  1 
ATOM   8880  H  HD3  . ARG A 1 588 ? -40.306 54.149  -30.877 1.00 109.79 ? 667  ARG A HD3  1 
ATOM   8881  H  HE   . ARG A 1 588 ? -39.085 54.780  -28.538 1.00 113.42 ? 667  ARG A HE   1 
ATOM   8882  H  HH11 . ARG A 1 588 ? -41.878 53.556  -29.857 1.00 110.80 ? 667  ARG A HH11 1 
ATOM   8883  H  HH12 . ARG A 1 588 ? -42.416 52.992  -28.587 1.00 110.80 ? 667  ARG A HH12 1 
ATOM   8884  H  HH21 . ARG A 1 588 ? -39.930 53.912  -26.629 1.00 107.17 ? 667  ARG A HH21 1 
ATOM   8885  H  HH22 . ARG A 1 588 ? -41.242 53.207  -26.643 1.00 107.17 ? 667  ARG A HH22 1 
ATOM   8886  N  N    . LEU A 1 589 ? -34.837 52.533  -29.174 1.00 68.06  ? 668  LEU A N    1 
ATOM   8887  C  CA   . LEU A 1 589 ? -33.747 52.229  -28.262 1.00 69.22  ? 668  LEU A CA   1 
ATOM   8888  C  C    . LEU A 1 589 ? -32.439 52.189  -29.040 1.00 68.63  ? 668  LEU A C    1 
ATOM   8889  O  O    . LEU A 1 589 ? -31.415 52.692  -28.581 1.00 68.97  ? 668  LEU A O    1 
ATOM   8890  C  CB   . LEU A 1 589 ? -33.991 50.894  -27.562 1.00 65.22  ? 668  LEU A CB   1 
ATOM   8891  C  CG   . LEU A 1 589 ? -34.931 50.969  -26.362 1.00 56.80  ? 668  LEU A CG   1 
ATOM   8892  C  CD1  . LEU A 1 589 ? -35.473 49.599  -26.034 1.00 58.30  ? 668  LEU A CD1  1 
ATOM   8893  C  CD2  . LEU A 1 589 ? -34.207 51.547  -25.161 1.00 55.63  ? 668  LEU A CD2  1 
ATOM   8894  H  H    . LEU A 1 589 ? -35.420 51.906  -29.252 1.00 81.68  ? 668  LEU A H    1 
ATOM   8895  H  HA   . LEU A 1 589 ? -33.684 52.923  -27.588 1.00 83.06  ? 668  LEU A HA   1 
ATOM   8896  H  HB2  . LEU A 1 589 ? -34.378 50.275  -28.201 1.00 78.27  ? 668  LEU A HB2  1 
ATOM   8897  H  HB3  . LEU A 1 589 ? -33.140 50.549  -27.248 1.00 78.27  ? 668  LEU A HB3  1 
ATOM   8898  H  HG   . LEU A 1 589 ? -35.679 51.549  -26.576 1.00 68.16  ? 668  LEU A HG   1 
ATOM   8899  H  HD11 . LEU A 1 589 ? -36.067 49.670  -25.270 1.00 69.97  ? 668  LEU A HD11 1 
ATOM   8900  H  HD12 . LEU A 1 589 ? -35.959 49.260  -26.801 1.00 69.97  ? 668  LEU A HD12 1 
ATOM   8901  H  HD13 . LEU A 1 589 ? -34.732 49.009  -25.823 1.00 69.97  ? 668  LEU A HD13 1 
ATOM   8902  H  HD21 . LEU A 1 589 ? -34.822 51.587  -24.411 1.00 66.76  ? 668  LEU A HD21 1 
ATOM   8903  H  HD22 . LEU A 1 589 ? -33.454 50.977  -24.942 1.00 66.76  ? 668  LEU A HD22 1 
ATOM   8904  H  HD23 . LEU A 1 589 ? -33.895 52.439  -25.380 1.00 66.76  ? 668  LEU A HD23 1 
ATOM   8905  N  N    . LEU A 1 590 ? -32.489 51.604  -30.232 1.00 64.11  ? 669  LEU A N    1 
ATOM   8906  C  CA   . LEU A 1 590 ? -31.303 51.453  -31.066 1.00 65.22  ? 669  LEU A CA   1 
ATOM   8907  C  C    . LEU A 1 590 ? -30.831 52.774  -31.675 1.00 78.12  ? 669  LEU A C    1 
ATOM   8908  O  O    . LEU A 1 590 ? -29.754 52.841  -32.250 1.00 78.19  ? 669  LEU A O    1 
ATOM   8909  C  CB   . LEU A 1 590 ? -31.570 50.442  -32.184 1.00 61.28  ? 669  LEU A CB   1 
ATOM   8910  C  CG   . LEU A 1 590 ? -30.709 49.172  -32.265 1.00 57.29  ? 669  LEU A CG   1 
ATOM   8911  C  CD1  . LEU A 1 590 ? -30.395 48.535  -30.910 1.00 55.44  ? 669  LEU A CD1  1 
ATOM   8912  C  CD2  . LEU A 1 590 ? -31.411 48.151  -33.145 1.00 56.22  ? 669  LEU A CD2  1 
ATOM   8913  H  H    . LEU A 1 590 ? -33.206 51.284  -30.583 1.00 76.93  ? 669  LEU A H    1 
ATOM   8914  H  HA   . LEU A 1 590 ? -30.581 51.105  -30.520 1.00 78.26  ? 669  LEU A HA   1 
ATOM   8915  H  HB2  . LEU A 1 590 ? -32.491 50.150  -32.102 1.00 73.53  ? 669  LEU A HB2  1 
ATOM   8916  H  HB3  . LEU A 1 590 ? -31.462 50.905  -33.030 1.00 73.53  ? 669  LEU A HB3  1 
ATOM   8917  H  HG   . LEU A 1 590 ? -29.866 49.395  -32.688 1.00 68.74  ? 669  LEU A HG   1 
ATOM   8918  H  HD11 . LEU A 1 590 ? -29.852 47.744  -31.051 1.00 66.53  ? 669  LEU A HD11 1 
ATOM   8919  H  HD12 . LEU A 1 590 ? -29.912 49.176  -30.365 1.00 66.53  ? 669  LEU A HD12 1 
ATOM   8920  H  HD13 . LEU A 1 590 ? -31.227 48.292  -30.475 1.00 66.53  ? 669  LEU A HD13 1 
ATOM   8921  H  HD21 . LEU A 1 590 ? -30.866 47.350  -33.194 1.00 67.46  ? 669  LEU A HD21 1 
ATOM   8922  H  HD22 . LEU A 1 590 ? -32.275 47.941  -32.757 1.00 67.46  ? 669  LEU A HD22 1 
ATOM   8923  H  HD23 . LEU A 1 590 ? -31.529 48.527  -34.031 1.00 67.46  ? 669  LEU A HD23 1 
ATOM   8924  N  N    . GLU A 1 591 ? -31.631 53.826  -31.562 1.00 110.12 ? 670  GLU A N    1 
ATOM   8925  C  CA   . GLU A 1 591 ? -31.206 55.133  -32.053 1.00 107.81 ? 670  GLU A CA   1 
ATOM   8926  C  C    . GLU A 1 591 ? -30.241 55.792  -31.068 1.00 112.28 ? 670  GLU A C    1 
ATOM   8927  O  O    . GLU A 1 591 ? -29.111 56.129  -31.428 1.00 119.39 ? 670  GLU A O    1 
ATOM   8928  C  CB   . GLU A 1 591 ? -32.419 56.021  -32.323 1.00 108.29 ? 670  GLU A CB   1 
ATOM   8929  C  CG   . GLU A 1 591 ? -32.992 55.822  -33.723 1.00 112.40 ? 670  GLU A CG   1 
ATOM   8930  C  CD   . GLU A 1 591 ? -34.437 56.272  -33.862 1.00 115.48 ? 670  GLU A CD   1 
ATOM   8931  O  OE1  . GLU A 1 591 ? -35.034 56.725  -32.861 1.00 112.95 ? 670  GLU A OE1  1 
ATOM   8932  O  OE2  . GLU A 1 591 ? -34.979 56.168  -34.985 1.00 114.79 ? 670  GLU A OE2  1 
ATOM   8933  H  H    . GLU A 1 591 ? -32.415 53.813  -31.210 1.00 132.14 ? 670  GLU A H    1 
ATOM   8934  H  HA   . GLU A 1 591 ? -30.736 55.012  -32.892 1.00 129.37 ? 670  GLU A HA   1 
ATOM   8935  H  HB2  . GLU A 1 591 ? -33.115 55.810  -31.681 1.00 129.95 ? 670  GLU A HB2  1 
ATOM   8936  H  HB3  . GLU A 1 591 ? -32.156 56.950  -32.235 1.00 129.95 ? 670  GLU A HB3  1 
ATOM   8937  H  HG2  . GLU A 1 591 ? -32.460 56.332  -34.354 1.00 134.88 ? 670  GLU A HG2  1 
ATOM   8938  H  HG3  . GLU A 1 591 ? -32.952 54.878  -33.946 1.00 134.88 ? 670  GLU A HG3  1 
ATOM   8939  N  N    . ASP A 1 592 ? -30.677 55.948  -29.820 1.00 102.71 ? 671  ASP A N    1 
ATOM   8940  C  CA   . ASP A 1 592 ? -29.837 56.540  -28.777 1.00 108.77 ? 671  ASP A CA   1 
ATOM   8941  C  C    . ASP A 1 592 ? -28.618 55.657  -28.497 1.00 106.04 ? 671  ASP A C    1 
ATOM   8942  O  O    . ASP A 1 592 ? -27.572 56.142  -28.064 1.00 109.83 ? 671  ASP A O    1 
ATOM   8943  C  CB   . ASP A 1 592 ? -30.643 56.733  -27.480 1.00 111.21 ? 671  ASP A CB   1 
ATOM   8944  C  CG   . ASP A 1 592 ? -30.003 57.735  -26.528 1.00 115.29 ? 671  ASP A CG   1 
ATOM   8945  O  OD1  . ASP A 1 592 ? -29.745 58.883  -26.947 1.00 121.28 ? 671  ASP A OD1  1 
ATOM   8946  O  OD2  . ASP A 1 592 ? -29.765 57.374  -25.356 1.00 113.84 ? 671  ASP A OD2  1 
ATOM   8947  H  H    . ASP A 1 592 ? -31.460 55.719  -29.549 1.00 123.25 ? 671  ASP A H    1 
ATOM   8948  H  HA   . ASP A 1 592 ? -29.523 57.408  -29.072 1.00 130.52 ? 671  ASP A HA   1 
ATOM   8949  H  HB2  . ASP A 1 592 ? -31.529 57.057  -27.705 1.00 133.45 ? 671  ASP A HB2  1 
ATOM   8950  H  HB3  . ASP A 1 592 ? -30.709 55.882  -27.020 1.00 133.45 ? 671  ASP A HB3  1 
ATOM   8951  N  N    . PHE A 1 593 ? -28.754 54.362  -28.770 1.00 81.24  ? 672  PHE A N    1 
ATOM   8952  C  CA   . PHE A 1 593 ? -27.771 53.366  -28.338 1.00 82.55  ? 672  PHE A CA   1 
ATOM   8953  C  C    . PHE A 1 593 ? -26.511 53.301  -29.212 1.00 82.61  ? 672  PHE A C    1 
ATOM   8954  O  O    . PHE A 1 593 ? -25.427 52.992  -28.713 1.00 78.33  ? 672  PHE A O    1 
ATOM   8955  C  CB   . PHE A 1 593 ? -28.439 51.986  -28.277 1.00 74.11  ? 672  PHE A CB   1 
ATOM   8956  C  CG   . PHE A 1 593 ? -27.596 50.920  -27.637 1.00 66.39  ? 672  PHE A CG   1 
ATOM   8957  C  CD1  . PHE A 1 593 ? -27.223 51.022  -26.308 1.00 64.98  ? 672  PHE A CD1  1 
ATOM   8958  C  CD2  . PHE A 1 593 ? -27.202 49.801  -28.354 1.00 64.81  ? 672  PHE A CD2  1 
ATOM   8959  C  CE1  . PHE A 1 593 ? -26.458 50.040  -25.710 1.00 67.12  ? 672  PHE A CE1  1 
ATOM   8960  C  CE2  . PHE A 1 593 ? -26.437 48.812  -27.760 1.00 62.02  ? 672  PHE A CE2  1 
ATOM   8961  C  CZ   . PHE A 1 593 ? -26.064 48.933  -26.436 1.00 61.31  ? 672  PHE A CZ   1 
ATOM   8962  H  H    . PHE A 1 593 ? -29.414 54.029  -29.209 1.00 97.49  ? 672  PHE A H    1 
ATOM   8963  H  HA   . PHE A 1 593 ? -27.486 53.590  -27.438 1.00 99.06  ? 672  PHE A HA   1 
ATOM   8964  H  HB2  . PHE A 1 593 ? -29.259 52.060  -27.765 1.00 88.93  ? 672  PHE A HB2  1 
ATOM   8965  H  HB3  . PHE A 1 593 ? -28.642 51.699  -29.181 1.00 88.93  ? 672  PHE A HB3  1 
ATOM   8966  H  HD1  . PHE A 1 593 ? -27.484 51.766  -25.814 1.00 77.97  ? 672  PHE A HD1  1 
ATOM   8967  H  HD2  . PHE A 1 593 ? -27.451 49.716  -29.246 1.00 77.77  ? 672  PHE A HD2  1 
ATOM   8968  H  HE1  . PHE A 1 593 ? -26.209 50.124  -24.818 1.00 80.54  ? 672  PHE A HE1  1 
ATOM   8969  H  HE2  . PHE A 1 593 ? -26.173 48.069  -28.252 1.00 74.42  ? 672  PHE A HE2  1 
ATOM   8970  H  HZ   . PHE A 1 593 ? -25.549 48.271  -26.035 1.00 73.58  ? 672  PHE A HZ   1 
ATOM   8971  N  N    . LEU A 1 594 ? -26.646 53.599  -30.502 1.00 104.57 ? 673  LEU A N    1 
ATOM   8972  C  CA   . LEU A 1 594 ? -25.535 53.432  -31.444 1.00 106.28 ? 673  LEU A CA   1 
ATOM   8973  C  C    . LEU A 1 594 ? -24.580 54.623  -31.479 1.00 116.26 ? 673  LEU A C    1 
ATOM   8974  O  O    . LEU A 1 594 ? -23.365 54.444  -31.563 1.00 122.13 ? 673  LEU A O    1 
ATOM   8975  C  CB   . LEU A 1 594 ? -26.055 53.178  -32.858 1.00 102.33 ? 673  LEU A CB   1 
ATOM   8976  C  CG   . LEU A 1 594 ? -26.933 51.944  -33.054 1.00 99.15  ? 673  LEU A CG   1 
ATOM   8977  C  CD1  . LEU A 1 594 ? -27.460 51.918  -34.491 1.00 103.92 ? 673  LEU A CD1  1 
ATOM   8978  C  CD2  . LEU A 1 594 ? -26.205 50.664  -32.713 1.00 82.16  ? 673  LEU A CD2  1 
ATOM   8979  H  H    . LEU A 1 594 ? -27.368 53.899  -30.859 1.00 125.48 ? 673  LEU A H    1 
ATOM   8980  H  HA   . LEU A 1 594 ? -25.020 52.654  -31.177 1.00 127.54 ? 673  LEU A HA   1 
ATOM   8981  H  HB2  . LEU A 1 594 ? -26.578 53.949  -33.130 1.00 122.79 ? 673  LEU A HB2  1 
ATOM   8982  H  HB3  . LEU A 1 594 ? -25.292 53.084  -33.449 1.00 122.79 ? 673  LEU A HB3  1 
ATOM   8983  H  HG   . LEU A 1 594 ? -27.699 52.012  -32.463 1.00 118.98 ? 673  LEU A HG   1 
ATOM   8984  H  HD11 . LEU A 1 594 ? -28.017 51.133  -34.609 1.00 124.70 ? 673  LEU A HD11 1 
ATOM   8985  H  HD12 . LEU A 1 594 ? -27.982 52.721  -34.649 1.00 124.70 ? 673  LEU A HD12 1 
ATOM   8986  H  HD13 . LEU A 1 594 ? -26.708 51.886  -35.102 1.00 124.70 ? 673  LEU A HD13 1 
ATOM   8987  H  HD21 . LEU A 1 594 ? -26.803 49.913  -32.854 1.00 98.59  ? 673  LEU A HD21 1 
ATOM   8988  H  HD22 . LEU A 1 594 ? -25.428 50.581  -33.288 1.00 98.59  ? 673  LEU A HD22 1 
ATOM   8989  H  HD23 . LEU A 1 594 ? -25.928 50.697  -31.784 1.00 98.59  ? 673  LEU A HD23 1 
ATOM   8990  N  N    . GLN A 1 595 ? -25.130 55.834  -31.429 1.00 108.24 ? 674  GLN A N    1 
ATOM   8991  C  CA   . GLN A 1 595 ? -24.315 57.047  -31.445 1.00 113.36 ? 674  GLN A CA   1 
ATOM   8992  C  C    . GLN A 1 595 ? -23.459 57.123  -30.185 1.00 124.47 ? 674  GLN A C    1 
ATOM   8993  O  O    . GLN A 1 595 ? -23.502 56.223  -29.341 1.00 126.78 ? 674  GLN A O    1 
ATOM   8994  C  CB   . GLN A 1 595 ? -25.198 58.304  -31.565 1.00 112.02 ? 674  GLN A CB   1 
ATOM   8995  C  CG   . GLN A 1 595 ? -26.265 58.462  -30.460 1.00 117.51 ? 674  GLN A CG   1 
ATOM   8996  C  CD   . GLN A 1 595 ? -27.135 59.707  -30.626 1.00 118.36 ? 674  GLN A CD   1 
ATOM   8997  O  OE1  . GLN A 1 595 ? -27.393 60.155  -31.744 1.00 110.60 ? 674  GLN A OE1  1 
ATOM   8998  N  NE2  . GLN A 1 595 ? -27.590 60.267  -29.506 1.00 119.40 ? 674  GLN A NE2  1 
ATOM   8999  H  H    . GLN A 1 595 ? -25.976 55.981  -31.385 1.00 129.88 ? 674  GLN A H    1 
ATOM   9000  H  HA   . GLN A 1 595 ? -23.721 57.021  -32.212 1.00 136.03 ? 674  GLN A HA   1 
ATOM   9001  H  HB2  . GLN A 1 595 ? -24.626 59.087  -31.532 1.00 134.42 ? 674  GLN A HB2  1 
ATOM   9002  H  HB3  . GLN A 1 595 ? -25.661 58.275  -32.417 1.00 134.42 ? 674  GLN A HB3  1 
ATOM   9003  H  HG2  . GLN A 1 595 ? -26.849 57.687  -30.476 1.00 141.01 ? 674  GLN A HG2  1 
ATOM   9004  H  HG3  . GLN A 1 595 ? -25.820 58.522  -29.601 1.00 141.01 ? 674  GLN A HG3  1 
ATOM   9005  H  HE21 . GLN A 1 595 ? -27.391 59.925  -28.742 1.00 143.28 ? 674  GLN A HE21 1 
ATOM   9006  H  HE22 . GLN A 1 595 ? -28.084 60.970  -29.546 1.00 143.28 ? 674  GLN A HE22 1 
ATOM   9007  N  N    . GLU A 1 596 ? -22.673 58.190  -30.069 1.00 126.57 ? 675  GLU A N    1 
ATOM   9008  C  CA   . GLU A 1 596 ? -21.922 58.446  -28.847 1.00 128.12 ? 675  GLU A CA   1 
ATOM   9009  C  C    . GLU A 1 596 ? -22.857 58.422  -27.642 1.00 124.93 ? 675  GLU A C    1 
ATOM   9010  O  O    . GLU A 1 596 ? -22.653 57.643  -26.710 1.00 122.25 ? 675  GLU A O    1 
ATOM   9011  C  CB   . GLU A 1 596 ? -21.190 59.787  -28.925 1.00 133.68 ? 675  GLU A CB   1 
ATOM   9012  C  CG   . GLU A 1 596 ? -19.725 59.685  -29.333 1.00 143.04 ? 675  GLU A CG   1 
ATOM   9013  C  CD   . GLU A 1 596 ? -18.854 59.044  -28.261 1.00 149.86 ? 675  GLU A CD   1 
ATOM   9014  O  OE1  . GLU A 1 596 ? -19.349 58.161  -27.528 1.00 145.68 ? 675  GLU A OE1  1 
ATOM   9015  O  OE2  . GLU A 1 596 ? -17.669 59.425  -28.152 1.00 156.89 ? 675  GLU A OE2  1 
ATOM   9016  N  N    . GLY A 1 597 ? -23.892 59.262  -27.688 1.00 159.61 ? 676  GLY A N    1 
ATOM   9017  C  CA   . GLY A 1 597 ? -24.893 59.339  -26.636 1.00 159.69 ? 676  GLY A CA   1 
ATOM   9018  C  C    . GLY A 1 597 ? -24.233 59.374  -25.275 1.00 161.40 ? 676  GLY A C    1 
ATOM   9019  O  O    . GLY A 1 597 ? -23.188 60.000  -25.112 1.00 164.13 ? 676  GLY A O    1 
ATOM   9020  N  N    . GLU A 1 598 ? -24.832 58.706  -24.294 1.00 136.88 ? 677  GLU A N    1 
ATOM   9021  C  CA   . GLU A 1 598 ? -24.166 58.477  -23.014 1.00 134.50 ? 677  GLU A CA   1 
ATOM   9022  C  C    . GLU A 1 598 ? -24.783 57.249  -22.350 1.00 130.14 ? 677  GLU A C    1 
ATOM   9023  O  O    . GLU A 1 598 ? -26.000 57.189  -22.242 1.00 125.30 ? 677  GLU A O    1 
ATOM   9024  C  CB   . GLU A 1 598 ? -24.331 59.670  -22.060 1.00 135.06 ? 677  GLU A CB   1 
ATOM   9025  C  CG   . GLU A 1 598 ? -24.163 61.052  -22.666 1.00 139.66 ? 677  GLU A CG   1 
ATOM   9026  C  CD   . GLU A 1 598 ? -25.410 61.519  -23.405 1.00 144.79 ? 677  GLU A CD   1 
ATOM   9027  O  OE1  . GLU A 1 598 ? -26.304 60.679  -23.663 1.00 142.03 ? 677  GLU A OE1  1 
ATOM   9028  O  OE2  . GLU A 1 598 ? -25.500 62.727  -23.719 1.00 147.97 ? 677  GLU A OE2  1 
ATOM   9029  H  HA   . GLU A 1 598 ? -23.220 58.316  -23.156 1.00 161.40 ? 677  GLU A HA   1 
ATOM   9030  N  N    . GLU A 1 599 ? -23.994 56.260  -21.920 1.00 126.70 ? 678  GLU A N    1 
ATOM   9031  C  CA   . GLU A 1 599 ? -22.563 56.145  -22.190 1.00 130.04 ? 678  GLU A CA   1 
ATOM   9032  C  C    . GLU A 1 599 ? -22.305 55.606  -23.607 1.00 125.08 ? 678  GLU A C    1 
ATOM   9033  O  O    . GLU A 1 599 ? -21.458 56.146  -24.322 1.00 126.29 ? 678  GLU A O    1 
ATOM   9034  C  CB   . GLU A 1 599 ? -21.909 55.231  -21.143 1.00 134.62 ? 678  GLU A CB   1 
ATOM   9035  C  CG   . GLU A 1 599 ? -20.386 55.143  -21.216 1.00 140.16 ? 678  GLU A CG   1 
ATOM   9036  C  CD   . GLU A 1 599 ? -19.703 56.432  -20.800 1.00 146.76 ? 678  GLU A CD   1 
ATOM   9037  O  OE1  . GLU A 1 599 ? -19.962 56.913  -19.675 1.00 140.47 ? 678  GLU A OE1  1 
ATOM   9038  O  OE2  . GLU A 1 599 ? -18.908 56.965  -21.604 1.00 155.65 ? 678  GLU A OE2  1 
ATOM   9039  H  H    . GLU A 1 599 ? -24.288 55.609  -21.443 1.00 152.04 ? 678  GLU A H    1 
ATOM   9040  H  HA   . GLU A 1 599 ? -22.156 57.022  -22.122 1.00 156.04 ? 678  GLU A HA   1 
ATOM   9041  N  N    . PRO A 1 600 ? -23.028 54.543  -24.029 1.00 96.53  ? 679  PRO A N    1 
ATOM   9042  C  CA   . PRO A 1 600 ? -24.064 53.744  -23.349 1.00 88.07  ? 679  PRO A CA   1 
ATOM   9043  C  C    . PRO A 1 600 ? -23.521 52.867  -22.215 1.00 85.97  ? 679  PRO A C    1 
ATOM   9044  O  O    . PRO A 1 600 ? -22.546 52.136  -22.408 1.00 84.64  ? 679  PRO A O    1 
ATOM   9045  C  CB   . PRO A 1 600 ? -24.631 52.875  -24.477 1.00 82.66  ? 679  PRO A CB   1 
ATOM   9046  C  CG   . PRO A 1 600 ? -23.536 52.762  -25.455 1.00 82.88  ? 679  PRO A CG   1 
ATOM   9047  C  CD   . PRO A 1 600 ? -22.810 54.074  -25.410 1.00 91.58  ? 679  PRO A CD   1 
ATOM   9048  H  HA   . PRO A 1 600 ? -24.763 54.321  -23.005 1.00 105.69 ? 679  PRO A HA   1 
ATOM   9049  H  HB2  . PRO A 1 600 ? -24.872 52.002  -24.129 1.00 99.19  ? 679  PRO A HB2  1 
ATOM   9050  H  HB3  . PRO A 1 600 ? -25.401 53.313  -24.873 1.00 99.19  ? 679  PRO A HB3  1 
ATOM   9051  H  HG2  . PRO A 1 600 ? -22.946 52.036  -25.199 1.00 99.46  ? 679  PRO A HG2  1 
ATOM   9052  H  HG3  . PRO A 1 600 ? -23.905 52.606  -26.339 1.00 99.46  ? 679  PRO A HG3  1 
ATOM   9053  H  HD2  . PRO A 1 600 ? -21.864 53.942  -25.577 1.00 109.90 ? 679  PRO A HD2  1 
ATOM   9054  H  HD3  . PRO A 1 600 ? -23.199 54.697  -26.043 1.00 109.90 ? 679  PRO A HD3  1 
ATOM   9055  N  N    . ASP A 1 601 ? -24.159 52.952  -21.048 1.00 91.29  ? 680  ASP A N    1 
ATOM   9056  C  CA   . ASP A 1 601 ? -23.697 52.263  -19.842 1.00 88.22  ? 680  ASP A CA   1 
ATOM   9057  C  C    . ASP A 1 601 ? -24.408 50.926  -19.620 1.00 83.21  ? 680  ASP A C    1 
ATOM   9058  O  O    . ASP A 1 601 ? -25.228 50.497  -20.434 1.00 81.49  ? 680  ASP A O    1 
ATOM   9059  C  CB   . ASP A 1 601 ? -23.869 53.164  -18.606 1.00 91.96  ? 680  ASP A CB   1 
ATOM   9060  C  CG   . ASP A 1 601 ? -25.272 53.734  -18.479 1.00 87.09  ? 680  ASP A CG   1 
ATOM   9061  O  OD1  . ASP A 1 601 ? -25.936 53.926  -19.518 1.00 86.54  ? 680  ASP A OD1  1 
ATOM   9062  O  OD2  . ASP A 1 601 ? -25.707 54.003  -17.339 1.00 83.04  ? 680  ASP A OD2  1 
ATOM   9063  H  H    . ASP A 1 601 ? -24.875 53.411  -20.927 1.00 109.55 ? 680  ASP A H    1 
ATOM   9064  H  HA   . ASP A 1 601 ? -22.750 52.077  -19.938 1.00 105.86 ? 680  ASP A HA   1 
ATOM   9065  H  HB2  . ASP A 1 601 ? -23.684 52.644  -17.808 1.00 110.35 ? 680  ASP A HB2  1 
ATOM   9066  H  HB3  . ASP A 1 601 ? -23.249 53.907  -18.669 1.00 110.35 ? 680  ASP A HB3  1 
ATOM   9067  N  N    . GLU A 1 602 ? -24.067 50.277  -18.511 1.00 105.08 ? 681  GLU A N    1 
ATOM   9068  C  CA   . GLU A 1 602 ? -24.648 48.998  -18.121 1.00 101.46 ? 681  GLU A CA   1 
ATOM   9069  C  C    . GLU A 1 602 ? -26.177 49.041  -18.136 1.00 101.45 ? 681  GLU A C    1 
ATOM   9070  O  O    . GLU A 1 602 ? -26.834 48.031  -18.391 1.00 103.33 ? 681  GLU A O    1 
ATOM   9071  C  CB   . GLU A 1 602 ? -24.155 48.629  -16.720 1.00 114.76 ? 681  GLU A CB   1 
ATOM   9072  C  CG   . GLU A 1 602 ? -24.633 47.277  -16.219 1.00 121.14 ? 681  GLU A CG   1 
ATOM   9073  C  CD   . GLU A 1 602 ? -24.159 46.967  -14.808 1.00 123.25 ? 681  GLU A CD   1 
ATOM   9074  O  OE1  . GLU A 1 602 ? -23.614 47.875  -14.143 1.00 123.16 ? 681  GLU A OE1  1 
ATOM   9075  O  OE2  . GLU A 1 602 ? -24.333 45.811  -14.365 1.00 118.73 ? 681  GLU A OE2  1 
ATOM   9076  H  H    . GLU A 1 602 ? -23.483 50.568  -17.951 1.00 126.09 ? 681  GLU A H    1 
ATOM   9077  H  HA   . GLU A 1 602 ? -24.356 48.310  -18.739 1.00 121.75 ? 681  GLU A HA   1 
ATOM   9078  H  HB2  . GLU A 1 602 ? -23.185 48.615  -16.726 1.00 137.71 ? 681  GLU A HB2  1 
ATOM   9079  H  HB3  . GLU A 1 602 ? -24.467 49.302  -16.094 1.00 137.71 ? 681  GLU A HB3  1 
ATOM   9080  H  HG2  . GLU A 1 602 ? -25.603 47.266  -16.219 1.00 145.37 ? 681  GLU A HG2  1 
ATOM   9081  H  HG3  . GLU A 1 602 ? -24.294 46.585  -16.808 1.00 145.37 ? 681  GLU A HG3  1 
ATOM   9082  N  N    . ASP A 1 603 ? -26.731 50.222  -17.877 1.00 66.23  ? 682  ASP A N    1 
ATOM   9083  C  CA   . ASP A 1 603 ? -28.178 50.403  -17.769 1.00 63.06  ? 682  ASP A CA   1 
ATOM   9084  C  C    . ASP A 1 603 ? -28.837 50.558  -19.141 1.00 65.55  ? 682  ASP A C    1 
ATOM   9085  O  O    . ASP A 1 603 ? -29.893 49.976  -19.399 1.00 61.35  ? 682  ASP A O    1 
ATOM   9086  C  CB   . ASP A 1 603 ? -28.500 51.622  -16.895 1.00 67.73  ? 682  ASP A CB   1 
ATOM   9087  C  CG   . ASP A 1 603 ? -28.123 51.415  -15.436 1.00 73.80  ? 682  ASP A CG   1 
ATOM   9088  O  OD1  . ASP A 1 603 ? -27.417 50.429  -15.132 1.00 77.22  ? 682  ASP A OD1  1 
ATOM   9089  O  OD2  . ASP A 1 603 ? -28.525 52.245  -14.594 1.00 70.49  ? 682  ASP A OD2  1 
ATOM   9090  H  H    . ASP A 1 603 ? -26.283 50.946  -17.756 1.00 79.47  ? 682  ASP A H    1 
ATOM   9091  H  HA   . ASP A 1 603 ? -28.561 49.621  -17.342 1.00 75.67  ? 682  ASP A HA   1 
ATOM   9092  H  HB2  . ASP A 1 603 ? -28.006 52.388  -17.227 1.00 81.27  ? 682  ASP A HB2  1 
ATOM   9093  H  HB3  . ASP A 1 603 ? -29.453 51.798  -16.937 1.00 81.27  ? 682  ASP A HB3  1 
ATOM   9094  N  N    . ASP A 1 604 ? -28.218 51.346  -20.016 1.00 79.56  ? 683  ASP A N    1 
ATOM   9095  C  CA   . ASP A 1 604 ? -28.723 51.518  -21.377 1.00 76.85  ? 683  ASP A CA   1 
ATOM   9096  C  C    . ASP A 1 604 ? -28.704 50.195  -22.134 1.00 67.27  ? 683  ASP A C    1 
ATOM   9097  O  O    . ASP A 1 604 ? -29.474 50.001  -23.069 1.00 65.32  ? 683  ASP A O    1 
ATOM   9098  C  CB   . ASP A 1 604 ? -27.899 52.558  -22.147 1.00 82.43  ? 683  ASP A CB   1 
ATOM   9099  C  CG   . ASP A 1 604 ? -28.097 53.971  -21.625 1.00 88.57  ? 683  ASP A CG   1 
ATOM   9100  O  OD1  . ASP A 1 604 ? -29.125 54.240  -20.968 1.00 87.59  ? 683  ASP A OD1  1 
ATOM   9101  O  OD2  . ASP A 1 604 ? -27.219 54.818  -21.885 1.00 92.83  ? 683  ASP A OD2  1 
ATOM   9102  H  H    . ASP A 1 604 ? -27.502 51.792  -19.848 1.00 95.47  ? 683  ASP A H    1 
ATOM   9103  H  HA   . ASP A 1 604 ? -29.640 51.830  -21.338 1.00 92.22  ? 683  ASP A HA   1 
ATOM   9104  H  HB2  . ASP A 1 604 ? -26.958 52.338  -22.066 1.00 98.91  ? 683  ASP A HB2  1 
ATOM   9105  H  HB3  . ASP A 1 604 ? -28.165 52.543  -23.079 1.00 98.91  ? 683  ASP A HB3  1 
ATOM   9106  N  N    . ALA A 1 605 ? -27.822 49.288  -21.725 1.00 54.77  ? 684  ALA A N    1 
ATOM   9107  C  CA   . ALA A 1 605 ? -27.698 47.988  -22.378 1.00 52.49  ? 684  ALA A CA   1 
ATOM   9108  C  C    . ALA A 1 605 ? -28.837 47.049  -21.981 1.00 50.34  ? 684  ALA A C    1 
ATOM   9109  O  O    . ALA A 1 605 ? -29.505 46.466  -22.839 1.00 48.95  ? 684  ALA A O    1 
ATOM   9110  C  CB   . ALA A 1 605 ? -26.359 47.360  -22.041 1.00 52.31  ? 684  ALA A CB   1 
ATOM   9111  H  H    . ALA A 1 605 ? -27.280 49.402  -21.067 1.00 65.72  ? 684  ALA A H    1 
ATOM   9112  H  HA   . ALA A 1 605 ? -27.735 48.114  -23.339 1.00 62.99  ? 684  ALA A HA   1 
ATOM   9113  H  HB1  . ALA A 1 605 ? -26.295 46.498  -22.483 1.00 62.78  ? 684  ALA A HB1  1 
ATOM   9114  H  HB2  . ALA A 1 605 ? -25.649 47.944  -22.350 1.00 62.78  ? 684  ALA A HB2  1 
ATOM   9115  H  HB3  . ALA A 1 605 ? -26.298 47.244  -21.080 1.00 62.78  ? 684  ALA A HB3  1 
ATOM   9116  N  N    . TYR A 1 606 ? -29.047 46.902  -20.675 1.00 64.33  ? 685  TYR A N    1 
ATOM   9117  C  CA   . TYR A 1 606 ? -30.120 46.066  -20.144 1.00 58.47  ? 685  TYR A CA   1 
ATOM   9118  C  C    . TYR A 1 606 ? -31.469 46.482  -20.738 1.00 62.94  ? 685  TYR A C    1 
ATOM   9119  O  O    . TYR A 1 606 ? -32.379 45.662  -20.875 1.00 63.21  ? 685  TYR A O    1 
ATOM   9120  C  CB   . TYR A 1 606 ? -30.145 46.153  -18.613 1.00 62.32  ? 685  TYR A CB   1 
ATOM   9121  C  CG   . TYR A 1 606 ? -31.163 45.255  -17.938 1.00 68.71  ? 685  TYR A CG   1 
ATOM   9122  C  CD1  . TYR A 1 606 ? -32.486 45.658  -17.795 1.00 67.82  ? 685  TYR A CD1  1 
ATOM   9123  C  CD2  . TYR A 1 606 ? -30.795 44.014  -17.426 1.00 70.84  ? 685  TYR A CD2  1 
ATOM   9124  C  CE1  . TYR A 1 606 ? -33.418 44.848  -17.176 1.00 69.60  ? 685  TYR A CE1  1 
ATOM   9125  C  CE2  . TYR A 1 606 ? -31.723 43.195  -16.802 1.00 72.10  ? 685  TYR A CE2  1 
ATOM   9126  C  CZ   . TYR A 1 606 ? -33.035 43.620  -16.680 1.00 77.09  ? 685  TYR A CZ   1 
ATOM   9127  O  OH   . TYR A 1 606 ? -33.975 42.824  -16.064 1.00 83.24  ? 685  TYR A OH   1 
ATOM   9128  H  H    . TYR A 1 606 ? -28.573 47.283  -20.066 1.00 77.20  ? 685  TYR A H    1 
ATOM   9129  H  HA   . TYR A 1 606 ? -29.955 45.142  -20.391 1.00 70.16  ? 685  TYR A HA   1 
ATOM   9130  H  HB2  . TYR A 1 606 ? -29.269 45.908  -18.275 1.00 74.78  ? 685  TYR A HB2  1 
ATOM   9131  H  HB3  . TYR A 1 606 ? -30.347 47.067  -18.359 1.00 74.78  ? 685  TYR A HB3  1 
ATOM   9132  H  HD1  . TYR A 1 606 ? -32.749 46.485  -18.128 1.00 81.39  ? 685  TYR A HD1  1 
ATOM   9133  H  HD2  . TYR A 1 606 ? -29.915 43.728  -17.509 1.00 85.00  ? 685  TYR A HD2  1 
ATOM   9134  H  HE1  . TYR A 1 606 ? -34.300 45.132  -17.092 1.00 83.52  ? 685  TYR A HE1  1 
ATOM   9135  H  HE2  . TYR A 1 606 ? -31.466 42.366  -16.468 1.00 86.52  ? 685  TYR A HE2  1 
ATOM   9136  H  HH   . TYR A 1 606 ? -33.621 42.107  -15.807 1.00 99.89  ? 685  TYR A HH   1 
ATOM   9137  N  N    . GLN A 1 607 ? -31.585 47.757  -21.101 1.00 69.59  ? 686  GLN A N    1 
ATOM   9138  C  CA   . GLN A 1 607 ? -32.767 48.250  -21.796 1.00 70.63  ? 686  GLN A CA   1 
ATOM   9139  C  C    . GLN A 1 607 ? -32.894 47.580  -23.162 1.00 64.59  ? 686  GLN A C    1 
ATOM   9140  O  O    . GLN A 1 607 ? -33.945 47.036  -23.500 1.00 63.22  ? 686  GLN A O    1 
ATOM   9141  C  CB   . GLN A 1 607 ? -32.691 49.770  -21.966 1.00 81.31  ? 686  GLN A CB   1 
ATOM   9142  C  CG   . GLN A 1 607 ? -33.076 50.561  -20.731 1.00 86.35  ? 686  GLN A CG   1 
ATOM   9143  C  CD   . GLN A 1 607 ? -34.520 50.340  -20.330 1.00 83.30  ? 686  GLN A CD   1 
ATOM   9144  O  OE1  . GLN A 1 607 ? -35.441 50.785  -21.016 1.00 87.30  ? 686  GLN A OE1  1 
ATOM   9145  N  NE2  . GLN A 1 607 ? -34.726 49.643  -19.219 1.00 75.11  ? 686  GLN A NE2  1 
ATOM   9146  H  H    . GLN A 1 607 ? -30.989 48.359  -20.955 1.00 83.51  ? 686  GLN A H    1 
ATOM   9147  H  HA   . GLN A 1 607 ? -33.558 48.038  -21.277 1.00 84.75  ? 686  GLN A HA   1 
ATOM   9148  H  HB2  . GLN A 1 607 ? -31.781 50.011  -22.197 1.00 97.57  ? 686  GLN A HB2  1 
ATOM   9149  H  HB3  . GLN A 1 607 ? -33.291 50.032  -22.682 1.00 97.57  ? 686  GLN A HB3  1 
ATOM   9150  H  HG2  . GLN A 1 607 ? -32.513 50.286  -19.990 1.00 103.62 ? 686  GLN A HG2  1 
ATOM   9151  H  HG3  . GLN A 1 607 ? -32.954 51.506  -20.909 1.00 103.62 ? 686  GLN A HG3  1 
ATOM   9152  H  HE21 . GLN A 1 607 ? -34.057 49.343  -18.769 1.00 90.13  ? 686  GLN A HE21 1 
ATOM   9153  H  HE22 . GLN A 1 607 ? -35.528 49.491  -18.949 1.00 90.13  ? 686  GLN A HE22 1 
ATOM   9154  N  N    . VAL A 1 608 ? -31.815 47.621  -23.942 1.00 56.40  ? 687  VAL A N    1 
ATOM   9155  C  CA   . VAL A 1 608 ? -31.803 47.020  -25.274 1.00 53.36  ? 687  VAL A CA   1 
ATOM   9156  C  C    . VAL A 1 608 ? -32.004 45.521  -25.170 1.00 47.64  ? 687  VAL A C    1 
ATOM   9157  O  O    . VAL A 1 608 ? -32.913 44.964  -25.787 1.00 52.57  ? 687  VAL A O    1 
ATOM   9158  C  CB   . VAL A 1 608 ? -30.467 47.264  -26.011 1.00 51.06  ? 687  VAL A CB   1 
ATOM   9159  C  CG1  . VAL A 1 608 ? -30.515 46.678  -27.422 1.00 50.33  ? 687  VAL A CG1  1 
ATOM   9160  C  CG2  . VAL A 1 608 ? -30.152 48.744  -26.074 1.00 53.68  ? 687  VAL A CG2  1 
ATOM   9161  H  H    . VAL A 1 608 ? -31.072 47.993  -23.721 1.00 67.68  ? 687  VAL A H    1 
ATOM   9162  H  HA   . VAL A 1 608 ? -32.524 47.393  -25.806 1.00 64.03  ? 687  VAL A HA   1 
ATOM   9163  H  HB   . VAL A 1 608 ? -29.752 46.824  -25.526 1.00 61.27  ? 687  VAL A HB   1 
ATOM   9164  H  HG11 . VAL A 1 608 ? -29.666 46.845  -27.862 1.00 60.40  ? 687  VAL A HG11 1 
ATOM   9165  H  HG12 . VAL A 1 608 ? -30.675 45.724  -27.362 1.00 60.40  ? 687  VAL A HG12 1 
ATOM   9166  H  HG13 . VAL A 1 608 ? -31.232 47.104  -27.917 1.00 60.40  ? 687  VAL A HG13 1 
ATOM   9167  H  HG21 . VAL A 1 608 ? -29.311 48.867  -26.540 1.00 64.41  ? 687  VAL A HG21 1 
ATOM   9168  H  HG22 . VAL A 1 608 ? -30.865 49.198  -26.550 1.00 64.41  ? 687  VAL A HG22 1 
ATOM   9169  H  HG23 . VAL A 1 608 ? -30.084 49.090  -25.170 1.00 64.41  ? 687  VAL A HG23 1 
ATOM   9170  N  N    . LEU A 1 609 ? -31.136 44.879  -24.391 1.00 45.72  ? 688  LEU A N    1 
ATOM   9171  C  CA   . LEU A 1 609 ? -31.174 43.435  -24.199 1.00 43.64  ? 688  LEU A CA   1 
ATOM   9172  C  C    . LEU A 1 609 ? -32.584 42.942  -23.895 1.00 42.47  ? 688  LEU A C    1 
ATOM   9173  O  O    . LEU A 1 609 ? -33.090 42.042  -24.568 1.00 43.72  ? 688  LEU A O    1 
ATOM   9174  C  CB   . LEU A 1 609 ? -30.236 43.026  -23.062 1.00 43.50  ? 688  LEU A CB   1 
ATOM   9175  C  CG   . LEU A 1 609 ? -30.323 41.557  -22.636 1.00 41.57  ? 688  LEU A CG   1 
ATOM   9176  C  CD1  . LEU A 1 609 ? -30.146 40.614  -23.826 1.00 40.33  ? 688  LEU A CD1  1 
ATOM   9177  C  CD2  . LEU A 1 609 ? -29.297 41.251  -21.555 1.00 41.75  ? 688  LEU A CD2  1 
ATOM   9178  H  H    . LEU A 1 609 ? -30.504 45.267  -23.956 1.00 54.87  ? 688  LEU A H    1 
ATOM   9179  H  HA   . LEU A 1 609 ? -30.872 42.999  -25.011 1.00 52.37  ? 688  LEU A HA   1 
ATOM   9180  H  HB2  . LEU A 1 609 ? -29.323 43.194  -23.342 1.00 52.19  ? 688  LEU A HB2  1 
ATOM   9181  H  HB3  . LEU A 1 609 ? -30.442 43.568  -22.285 1.00 52.19  ? 688  LEU A HB3  1 
ATOM   9182  H  HG   . LEU A 1 609 ? -31.202 41.394  -22.260 1.00 49.88  ? 688  LEU A HG   1 
ATOM   9183  H  HD11 . LEU A 1 609 ? -30.207 39.698  -23.514 1.00 48.40  ? 688  LEU A HD11 1 
ATOM   9184  H  HD12 . LEU A 1 609 ? -30.845 40.791  -24.475 1.00 48.40  ? 688  LEU A HD12 1 
ATOM   9185  H  HD13 . LEU A 1 609 ? -29.276 40.771  -24.226 1.00 48.40  ? 688  LEU A HD13 1 
ATOM   9186  H  HD21 . LEU A 1 609 ? -29.373 40.317  -21.304 1.00 50.10  ? 688  LEU A HD21 1 
ATOM   9187  H  HD22 . LEU A 1 609 ? -28.409 41.429  -21.904 1.00 50.10  ? 688  LEU A HD22 1 
ATOM   9188  H  HD23 . LEU A 1 609 ? -29.470 41.816  -20.786 1.00 50.10  ? 688  LEU A HD23 1 
ATOM   9189  N  N    . SER A 1 610 ? -33.207 43.539  -22.882 1.00 45.50  ? 689  SER A N    1 
ATOM   9190  C  CA   . SER A 1 610 ? -34.547 43.148  -22.462 1.00 50.40  ? 689  SER A CA   1 
ATOM   9191  C  C    . SER A 1 610 ? -35.494 43.142  -23.654 1.00 52.01  ? 689  SER A C    1 
ATOM   9192  O  O    . SER A 1 610 ? -36.128 42.132  -23.936 1.00 52.08  ? 689  SER A O    1 
ATOM   9193  C  CB   . SER A 1 610 ? -35.061 44.084  -21.363 1.00 54.56  ? 689  SER A CB   1 
ATOM   9194  O  OG   . SER A 1 610 ? -34.331 43.904  -20.161 1.00 57.41  ? 689  SER A OG   1 
ATOM   9195  H  H    . SER A 1 610 ? -32.870 44.180  -22.418 1.00 54.60  ? 689  SER A H    1 
ATOM   9196  H  HA   . SER A 1 610 ? -34.515 42.248  -22.099 1.00 60.48  ? 689  SER A HA   1 
ATOM   9197  H  HB2  . SER A 1 610 ? -34.960 45.002  -21.659 1.00 65.47  ? 689  SER A HB2  1 
ATOM   9198  H  HB3  . SER A 1 610 ? -35.996 43.891  -21.197 1.00 65.47  ? 689  SER A HB3  1 
ATOM   9199  H  HG   . SER A 1 610 ? -33.518 44.068  -20.292 1.00 68.89  ? 689  SER A HG   1 
ATOM   9200  N  N    . THR A 1 611 ? -35.561 44.260  -24.370 1.00 61.02  ? 690  THR A N    1 
ATOM   9201  C  CA   . THR A 1 611 ? -36.438 44.364  -25.531 1.00 60.75  ? 690  THR A CA   1 
ATOM   9202  C  C    . THR A 1 611 ? -36.022 43.388  -26.632 1.00 61.32  ? 690  THR A C    1 
ATOM   9203  O  O    . THR A 1 611 ? -36.877 42.795  -27.291 1.00 62.70  ? 690  THR A O    1 
ATOM   9204  C  CB   . THR A 1 611 ? -36.465 45.803  -26.090 1.00 60.41  ? 690  THR A CB   1 
ATOM   9205  O  OG1  . THR A 1 611 ? -36.990 46.692  -25.097 1.00 65.63  ? 690  THR A OG1  1 
ATOM   9206  C  CG2  . THR A 1 611 ? -37.337 45.891  -27.344 1.00 63.65  ? 690  THR A CG2  1 
ATOM   9207  H  H    . THR A 1 611 ? -35.109 44.972  -24.205 1.00 73.23  ? 690  THR A H    1 
ATOM   9208  H  HA   . THR A 1 611 ? -37.341 44.137  -25.260 1.00 72.90  ? 690  THR A HA   1 
ATOM   9209  H  HB   . THR A 1 611 ? -35.563 46.075  -26.323 1.00 72.49  ? 690  THR A HB   1 
ATOM   9210  H  HG1  . THR A 1 611 ? -36.508 46.672  -24.410 1.00 78.75  ? 690  THR A HG1  1 
ATOM   9211  H  HG21 . THR A 1 611 ? -37.342 46.801  -27.680 1.00 76.38  ? 690  THR A HG21 1 
ATOM   9212  H  HG22 . THR A 1 611 ? -36.989 45.302  -28.031 1.00 76.38  ? 690  THR A HG22 1 
ATOM   9213  H  HG23 . THR A 1 611 ? -38.246 45.628  -27.134 1.00 76.38  ? 690  THR A HG23 1 
ATOM   9214  N  N    . LEU A 1 612 ? -34.716 43.220  -26.823 1.00 42.59  ? 691  LEU A N    1 
ATOM   9215  C  CA   . LEU A 1 612 ? -34.198 42.298  -27.833 1.00 41.73  ? 691  LEU A CA   1 
ATOM   9216  C  C    . LEU A 1 612 ? -34.582 40.854  -27.516 1.00 43.88  ? 691  LEU A C    1 
ATOM   9217  O  O    . LEU A 1 612 ? -34.908 40.084  -28.419 1.00 42.60  ? 691  LEU A O    1 
ATOM   9218  C  CB   . LEU A 1 612 ? -32.675 42.423  -27.940 1.00 46.08  ? 691  LEU A CB   1 
ATOM   9219  C  CG   . LEU A 1 612 ? -31.927 41.339  -28.727 1.00 41.30  ? 691  LEU A CG   1 
ATOM   9220  C  CD1  . LEU A 1 612 ? -32.440 41.223  -30.158 1.00 41.52  ? 691  LEU A CD1  1 
ATOM   9221  C  CD2  . LEU A 1 612 ? -30.438 41.630  -28.726 1.00 42.13  ? 691  LEU A CD2  1 
ATOM   9222  H  H    . LEU A 1 612 ? -34.104 43.630  -26.379 1.00 51.11  ? 691  LEU A H    1 
ATOM   9223  H  HA   . LEU A 1 612 ? -34.579 42.527  -28.695 1.00 50.07  ? 691  LEU A HA   1 
ATOM   9224  H  HB2  . LEU A 1 612 ? -32.474 43.272  -28.364 1.00 55.30  ? 691  LEU A HB2  1 
ATOM   9225  H  HB3  . LEU A 1 612 ? -32.311 42.423  -27.041 1.00 55.30  ? 691  LEU A HB3  1 
ATOM   9226  H  HG   . LEU A 1 612 ? -32.063 40.483  -28.292 1.00 49.56  ? 691  LEU A HG   1 
ATOM   9227  H  HD11 . LEU A 1 612 ? -31.941 40.530  -30.617 1.00 49.83  ? 691  LEU A HD11 1 
ATOM   9228  H  HD12 . LEU A 1 612 ? -33.383 40.995  -30.137 1.00 49.83  ? 691  LEU A HD12 1 
ATOM   9229  H  HD13 . LEU A 1 612 ? -32.315 42.074  -30.607 1.00 49.83  ? 691  LEU A HD13 1 
ATOM   9230  H  HD21 . LEU A 1 612 ? -29.981 40.936  -29.228 1.00 50.55  ? 691  LEU A HD21 1 
ATOM   9231  H  HD22 . LEU A 1 612 ? -30.285 42.493  -29.141 1.00 50.55  ? 691  LEU A HD22 1 
ATOM   9232  H  HD23 . LEU A 1 612 ? -30.119 41.641  -27.810 1.00 50.55  ? 691  LEU A HD23 1 
ATOM   9233  N  N    . LYS A 1 613 ? -34.534 40.491  -26.236 1.00 59.58  ? 692  LYS A N    1 
ATOM   9234  C  CA   . LYS A 1 613 ? -34.935 39.152  -25.805 1.00 49.88  ? 692  LYS A CA   1 
ATOM   9235  C  C    . LYS A 1 613 ? -36.375 38.855  -26.206 1.00 53.25  ? 692  LYS A C    1 
ATOM   9236  O  O    . LYS A 1 613 ? -36.679 37.779  -26.724 1.00 54.50  ? 692  LYS A O    1 
ATOM   9237  C  CB   . LYS A 1 613 ? -34.802 38.999  -24.289 1.00 41.93  ? 692  LYS A CB   1 
ATOM   9238  C  CG   . LYS A 1 613 ? -33.376 38.862  -23.782 1.00 47.42  ? 692  LYS A CG   1 
ATOM   9239  C  CD   . LYS A 1 613 ? -33.328 38.009  -22.515 1.00 51.98  ? 692  LYS A CD   1 
ATOM   9240  C  CE   . LYS A 1 613 ? -32.306 38.506  -21.500 1.00 60.13  ? 692  LYS A CE   1 
ATOM   9241  N  NZ   . LYS A 1 613 ? -31.296 37.465  -21.165 1.00 56.14  ? 692  LYS A NZ   1 
ATOM   9242  H  H    . LYS A 1 613 ? -34.273 41.002  -25.596 1.00 71.49  ? 692  LYS A H    1 
ATOM   9243  H  HA   . LYS A 1 613 ? -34.360 38.495  -26.229 1.00 59.86  ? 692  LYS A HA   1 
ATOM   9244  H  HB2  . LYS A 1 613 ? -35.190 39.780  -23.864 1.00 50.32  ? 692  LYS A HB2  1 
ATOM   9245  H  HB3  . LYS A 1 613 ? -35.287 38.204  -24.015 1.00 50.32  ? 692  LYS A HB3  1 
ATOM   9246  H  HG2  . LYS A 1 613 ? -32.833 38.433  -24.461 1.00 56.91  ? 692  LYS A HG2  1 
ATOM   9247  H  HG3  . LYS A 1 613 ? -33.023 39.741  -23.573 1.00 56.91  ? 692  LYS A HG3  1 
ATOM   9248  H  HD2  . LYS A 1 613 ? -34.201 38.023  -22.092 1.00 62.37  ? 692  LYS A HD2  1 
ATOM   9249  H  HD3  . LYS A 1 613 ? -33.092 37.099  -22.756 1.00 62.37  ? 692  LYS A HD3  1 
ATOM   9250  H  HE2  . LYS A 1 613 ? -31.839 39.273  -21.868 1.00 72.15  ? 692  LYS A HE2  1 
ATOM   9251  H  HE3  . LYS A 1 613 ? -32.765 38.756  -20.683 1.00 72.15  ? 692  LYS A HE3  1 
ATOM   9252  H  HZ1  . LYS A 1 613 ? -30.715 37.785  -20.571 1.00 67.36  ? 692  LYS A HZ1  1 
ATOM   9253  H  HZ2  . LYS A 1 613 ? -31.698 36.751  -20.819 1.00 67.36  ? 692  LYS A HZ2  1 
ATOM   9254  H  HZ3  . LYS A 1 613 ? -30.855 37.222  -21.899 1.00 67.36  ? 692  LYS A HZ3  1 
ATOM   9255  N  N    . ARG A 1 614 ? -37.259 39.815  -25.962 1.00 45.55  ? 693  ARG A N    1 
ATOM   9256  C  CA   . ARG A 1 614 ? -38.673 39.630  -26.254 1.00 48.01  ? 693  ARG A CA   1 
ATOM   9257  C  C    . ARG A 1 614 ? -38.861 39.411  -27.752 1.00 46.56  ? 693  ARG A C    1 
ATOM   9258  O  O    . ARG A 1 614 ? -39.650 38.569  -28.177 1.00 45.75  ? 693  ARG A O    1 
ATOM   9259  C  CB   . ARG A 1 614 ? -39.484 40.839  -25.778 1.00 50.37  ? 693  ARG A CB   1 
ATOM   9260  C  CG   . ARG A 1 614 ? -39.195 41.221  -24.342 1.00 52.73  ? 693  ARG A CG   1 
ATOM   9261  C  CD   . ARG A 1 614 ? -40.190 42.213  -23.779 1.00 50.64  ? 693  ARG A CD   1 
ATOM   9262  N  NE   . ARG A 1 614 ? -39.964 42.418  -22.345 1.00 48.61  ? 693  ARG A NE   1 
ATOM   9263  C  CZ   . ARG A 1 614 ? -39.361 43.478  -21.805 1.00 57.38  ? 693  ARG A CZ   1 
ATOM   9264  N  NH1  . ARG A 1 614 ? -38.919 44.476  -22.562 1.00 58.81  ? 693  ARG A NH1  1 
ATOM   9265  N  NH2  . ARG A 1 614 ? -39.207 43.547  -20.490 1.00 59.05  ? 693  ARG A NH2  1 
ATOM   9266  H  H    . ARG A 1 614 ? -37.066 40.583  -25.627 1.00 54.66  ? 693  ARG A H    1 
ATOM   9267  H  HA   . ARG A 1 614 ? -38.996 38.844  -25.788 1.00 57.61  ? 693  ARG A HA   1 
ATOM   9268  H  HB2  . ARG A 1 614 ? -39.270 41.602  -26.339 1.00 60.44  ? 693  ARG A HB2  1 
ATOM   9269  H  HB3  . ARG A 1 614 ? -40.429 40.631  -25.848 1.00 60.44  ? 693  ARG A HB3  1 
ATOM   9270  H  HG2  . ARG A 1 614 ? -39.226 40.422  -23.792 1.00 63.27  ? 693  ARG A HG2  1 
ATOM   9271  H  HG3  . ARG A 1 614 ? -38.314 41.622  -24.294 1.00 63.27  ? 693  ARG A HG3  1 
ATOM   9272  H  HD2  . ARG A 1 614 ? -40.086 43.065  -24.231 1.00 60.77  ? 693  ARG A HD2  1 
ATOM   9273  H  HD3  . ARG A 1 614 ? -41.090 41.873  -23.902 1.00 60.77  ? 693  ARG A HD3  1 
ATOM   9274  H  HE   . ARG A 1 614 ? -40.243 41.806  -21.809 1.00 58.33  ? 693  ARG A HE   1 
ATOM   9275  H  HH11 . ARG A 1 614 ? -39.011 44.442  -23.416 1.00 70.57  ? 693  ARG A HH11 1 
ATOM   9276  H  HH12 . ARG A 1 614 ? -38.534 45.154  -22.198 1.00 70.57  ? 693  ARG A HH12 1 
ATOM   9277  H  HH21 . ARG A 1 614 ? -39.493 42.908  -19.989 1.00 70.86  ? 693  ARG A HH21 1 
ATOM   9278  H  HH22 . ARG A 1 614 ? -38.824 44.231  -20.137 1.00 70.86  ? 693  ARG A HH22 1 
ATOM   9279  N  N    . ILE A 1 615 ? -38.111 40.159  -28.550 1.00 64.37  ? 694  ILE A N    1 
ATOM   9280  C  CA   . ILE A 1 615 ? -38.213 40.064  -30.002 1.00 66.16  ? 694  ILE A CA   1 
ATOM   9281  C  C    . ILE A 1 615 ? -37.654 38.741  -30.525 1.00 67.00  ? 694  ILE A C    1 
ATOM   9282  O  O    . ILE A 1 615 ? -38.270 38.091  -31.371 1.00 69.07  ? 694  ILE A O    1 
ATOM   9283  C  CB   . ILE A 1 615 ? -37.516 41.270  -30.696 1.00 70.57  ? 694  ILE A CB   1 
ATOM   9284  C  CG1  . ILE A 1 615 ? -38.424 42.505  -30.598 1.00 72.30  ? 694  ILE A CG1  1 
ATOM   9285  C  CG2  . ILE A 1 615 ? -37.151 40.948  -32.158 1.00 64.61  ? 694  ILE A CG2  1 
ATOM   9286  C  CD1  . ILE A 1 615 ? -38.102 43.645  -31.558 1.00 76.04  ? 694  ILE A CD1  1 
ATOM   9287  H  H    . ILE A 1 615 ? -37.532 40.733  -28.275 1.00 77.24  ? 694  ILE A H    1 
ATOM   9288  H  HA   . ILE A 1 615 ? -39.152 40.095  -30.243 1.00 79.40  ? 694  ILE A HA   1 
ATOM   9289  H  HB   . ILE A 1 615 ? -36.695 41.461  -30.216 1.00 84.69  ? 694  ILE A HB   1 
ATOM   9290  H  HG12 . ILE A 1 615 ? -39.337 42.228  -30.774 1.00 86.76  ? 694  ILE A HG12 1 
ATOM   9291  H  HG13 . ILE A 1 615 ? -38.363 42.860  -29.697 1.00 86.76  ? 694  ILE A HG13 1 
ATOM   9292  H  HG21 . ILE A 1 615 ? -36.721 41.722  -32.553 1.00 77.54  ? 694  ILE A HG21 1 
ATOM   9293  H  HG22 . ILE A 1 615 ? -36.547 40.190  -32.172 1.00 77.54  ? 694  ILE A HG22 1 
ATOM   9294  H  HG23 . ILE A 1 615 ? -37.962 40.735  -32.646 1.00 77.54  ? 694  ILE A HG23 1 
ATOM   9295  H  HD11 . ILE A 1 615 ? -38.733 44.368  -31.412 1.00 91.25  ? 694  ILE A HD11 1 
ATOM   9296  H  HD12 . ILE A 1 615 ? -37.199 43.954  -31.389 1.00 91.25  ? 694  ILE A HD12 1 
ATOM   9297  H  HD13 . ILE A 1 615 ? -38.176 43.320  -32.469 1.00 91.25  ? 694  ILE A HD13 1 
ATOM   9298  N  N    . THR A 1 616 ? -36.490 38.345  -30.022 1.00 49.64  ? 695  THR A N    1 
ATOM   9299  C  CA   . THR A 1 616 ? -35.845 37.118  -30.468 1.00 46.90  ? 695  THR A CA   1 
ATOM   9300  C  C    . THR A 1 616 ? -36.714 35.887  -30.217 1.00 48.06  ? 695  THR A C    1 
ATOM   9301  O  O    . THR A 1 616 ? -36.906 35.060  -31.111 1.00 47.23  ? 695  THR A O    1 
ATOM   9302  C  CB   . THR A 1 616 ? -34.501 36.924  -29.759 1.00 45.56  ? 695  THR A CB   1 
ATOM   9303  O  OG1  . THR A 1 616 ? -33.652 38.043  -30.040 1.00 50.48  ? 695  THR A OG1  1 
ATOM   9304  C  CG2  . THR A 1 616 ? -33.820 35.645  -30.229 1.00 45.10  ? 695  THR A CG2  1 
ATOM   9305  H  H    . THR A 1 616 ? -36.052 38.773  -29.417 1.00 59.57  ? 695  THR A H    1 
ATOM   9306  H  HA   . THR A 1 616 ? -35.677 37.177  -31.421 1.00 56.28  ? 695  THR A HA   1 
ATOM   9307  H  HB   . THR A 1 616 ? -34.647 36.861  -28.802 1.00 54.67  ? 695  THR A HB   1 
ATOM   9308  H  HG1  . THR A 1 616 ? -32.912 37.945  -29.655 1.00 60.57  ? 695  THR A HG1  1 
ATOM   9309  H  HG21 . THR A 1 616 ? -32.971 35.535  -29.772 1.00 54.12  ? 695  THR A HG21 1 
ATOM   9310  H  HG22 . THR A 1 616 ? -34.384 34.879  -30.036 1.00 54.12  ? 695  THR A HG22 1 
ATOM   9311  H  HG23 . THR A 1 616 ? -33.661 35.686  -31.185 1.00 54.12  ? 695  THR A HG23 1 
ATOM   9312  N  N    . ALA A 1 617 ? -37.223 35.769  -28.995 1.00 49.12  ? 696  ALA A N    1 
ATOM   9313  C  CA   . ALA A 1 617 ? -38.069 34.643  -28.609 1.00 46.29  ? 696  ALA A CA   1 
ATOM   9314  C  C    . ALA A 1 617 ? -39.249 34.479  -29.561 1.00 45.91  ? 696  ALA A C    1 
ATOM   9315  O  O    . ALA A 1 617 ? -39.592 33.362  -29.954 1.00 42.89  ? 696  ALA A O    1 
ATOM   9316  C  CB   . ALA A 1 617 ? -38.574 34.835  -27.192 1.00 46.87  ? 696  ALA A CB   1 
ATOM   9317  H  H    . ALA A 1 617 ? -37.091 36.336  -28.362 1.00 58.94  ? 696  ALA A H    1 
ATOM   9318  H  HA   . ALA A 1 617 ? -37.545 33.828  -28.635 1.00 55.55  ? 696  ALA A HA   1 
ATOM   9319  H  HB1  . ALA A 1 617 ? -39.134 34.080  -26.951 1.00 56.25  ? 696  ALA A HB1  1 
ATOM   9320  H  HB2  . ALA A 1 617 ? -37.814 34.889  -26.591 1.00 56.25  ? 696  ALA A HB2  1 
ATOM   9321  H  HB3  . ALA A 1 617 ? -39.089 35.656  -27.148 1.00 56.25  ? 696  ALA A HB3  1 
ATOM   9322  N  N    . PHE A 1 618 ? -39.867 35.597  -29.929 1.00 45.27  ? 697  PHE A N    1 
ATOM   9323  C  CA   . PHE A 1 618 ? -41.042 35.568  -30.797 1.00 51.18  ? 697  PHE A CA   1 
ATOM   9324  C  C    . PHE A 1 618 ? -40.680 35.284  -32.256 1.00 48.55  ? 697  PHE A C    1 
ATOM   9325  O  O    . PHE A 1 618 ? -41.436 34.626  -32.973 1.00 40.45  ? 697  PHE A O    1 
ATOM   9326  C  CB   . PHE A 1 618 ? -41.837 36.876  -30.680 1.00 47.26  ? 697  PHE A CB   1 
ATOM   9327  C  CG   . PHE A 1 618 ? -42.887 36.849  -29.601 1.00 46.25  ? 697  PHE A CG   1 
ATOM   9328  C  CD1  . PHE A 1 618 ? -44.159 36.369  -29.864 1.00 42.98  ? 697  PHE A CD1  1 
ATOM   9329  C  CD2  . PHE A 1 618 ? -42.598 37.297  -28.324 1.00 42.23  ? 697  PHE A CD2  1 
ATOM   9330  C  CE1  . PHE A 1 618 ? -45.123 36.340  -28.875 1.00 41.54  ? 697  PHE A CE1  1 
ATOM   9331  C  CE2  . PHE A 1 618 ? -43.554 37.266  -27.330 1.00 38.75  ? 697  PHE A CE2  1 
ATOM   9332  C  CZ   . PHE A 1 618 ? -44.819 36.790  -27.605 1.00 47.31  ? 697  PHE A CZ   1 
ATOM   9333  H  H    . PHE A 1 618 ? -39.626 36.387  -29.690 1.00 54.33  ? 697  PHE A H    1 
ATOM   9334  H  HA   . PHE A 1 618 ? -41.622 34.850  -30.499 1.00 61.41  ? 697  PHE A HA   1 
ATOM   9335  H  HB2  . PHE A 1 618 ? -41.222 37.599  -30.478 1.00 56.71  ? 697  PHE A HB2  1 
ATOM   9336  H  HB3  . PHE A 1 618 ? -42.283 37.048  -31.524 1.00 56.71  ? 697  PHE A HB3  1 
ATOM   9337  H  HD1  . PHE A 1 618 ? -44.368 36.065  -30.718 1.00 51.57  ? 697  PHE A HD1  1 
ATOM   9338  H  HD2  . PHE A 1 618 ? -41.747 37.619  -28.131 1.00 50.67  ? 697  PHE A HD2  1 
ATOM   9339  H  HE1  . PHE A 1 618 ? -45.974 36.017  -29.064 1.00 49.84  ? 697  PHE A HE1  1 
ATOM   9340  H  HE2  . PHE A 1 618 ? -43.348 37.572  -26.476 1.00 46.50  ? 697  PHE A HE2  1 
ATOM   9341  H  HZ   . PHE A 1 618 ? -45.466 36.772  -26.937 1.00 56.77  ? 697  PHE A HZ   1 
ATOM   9342  N  N    . HIS A 1 619 ? -39.523 35.767  -32.696 1.00 43.22  ? 698  HIS A N    1 
ATOM   9343  C  CA   . HIS A 1 619 ? -39.120 35.572  -34.084 1.00 47.72  ? 698  HIS A CA   1 
ATOM   9344  C  C    . HIS A 1 619 ? -38.832 34.097  -34.360 1.00 48.27  ? 698  HIS A C    1 
ATOM   9345  O  O    . HIS A 1 619 ? -38.949 33.634  -35.495 1.00 48.38  ? 698  HIS A O    1 
ATOM   9346  C  CB   . HIS A 1 619 ? -37.898 36.427  -34.425 1.00 49.60  ? 698  HIS A CB   1 
ATOM   9347  C  CG   . HIS A 1 619 ? -37.832 36.835  -35.863 1.00 54.48  ? 698  HIS A CG   1 
ATOM   9348  N  ND1  . HIS A 1 619 ? -38.291 36.031  -36.891 1.00 50.77  ? 698  HIS A ND1  1 
ATOM   9349  C  CD2  . HIS A 1 619 ? -37.376 37.964  -36.452 1.00 53.51  ? 698  HIS A CD2  1 
ATOM   9350  C  CE1  . HIS A 1 619 ? -38.110 36.645  -38.041 1.00 52.32  ? 698  HIS A CE1  1 
ATOM   9351  N  NE2  . HIS A 1 619 ? -37.556 37.824  -37.806 1.00 56.03  ? 698  HIS A NE2  1 
ATOM   9352  H  H    . HIS A 1 619 ? -38.960 36.206  -32.217 1.00 51.87  ? 698  HIS A H    1 
ATOM   9353  H  HA   . HIS A 1 619 ? -39.847 35.848  -34.663 1.00 57.26  ? 698  HIS A HA   1 
ATOM   9354  H  HB2  . HIS A 1 619 ? -37.922 37.235  -33.889 1.00 59.52  ? 698  HIS A HB2  1 
ATOM   9355  H  HB3  . HIS A 1 619 ? -37.096 35.921  -34.223 1.00 59.52  ? 698  HIS A HB3  1 
ATOM   9356  H  HD1  . HIS A 1 619 ? -38.636 35.250  -36.794 1.00 60.93  ? 698  HIS A HD1  1 
ATOM   9357  H  HD2  . HIS A 1 619 ? -37.005 38.698  -36.020 1.00 64.21  ? 698  HIS A HD2  1 
ATOM   9358  H  HE1  . HIS A 1 619 ? -38.336 36.308  -38.878 1.00 62.78  ? 698  HIS A HE1  1 
ATOM   9359  H  HE2  . HIS A 1 619 ? -37.343 38.406  -38.403 1.00 67.24  ? 698  HIS A HE2  1 
ATOM   9360  N  N    . ASN A 1 620 ? -38.456 33.364  -33.317 1.00 48.26  ? 699  ASN A N    1 
ATOM   9361  C  CA   . ASN A 1 620 ? -38.235 31.926  -33.424 1.00 45.12  ? 699  ASN A CA   1 
ATOM   9362  C  C    . ASN A 1 620 ? -39.521 31.223  -33.850 1.00 42.85  ? 699  ASN A C    1 
ATOM   9363  O  O    . ASN A 1 620 ? -39.546 30.506  -34.852 1.00 44.52  ? 699  ASN A O    1 
ATOM   9364  C  CB   . ASN A 1 620 ? -37.766 31.367  -32.075 1.00 45.61  ? 699  ASN A CB   1 
ATOM   9365  C  CG   . ASN A 1 620 ? -37.010 30.040  -32.198 1.00 40.85  ? 699  ASN A CG   1 
ATOM   9366  O  OD1  . ASN A 1 620 ? -36.067 29.800  -31.448 1.00 39.22  ? 699  ASN A OD1  1 
ATOM   9367  N  ND2  . ASN A 1 620 ? -37.419 29.179  -33.130 1.00 40.10  ? 699  ASN A ND2  1 
ATOM   9368  H  H    . ASN A 1 620 ? -38.321 33.679  -32.528 1.00 57.91  ? 699  ASN A H    1 
ATOM   9369  H  HA   . ASN A 1 620 ? -37.551 31.749  -34.088 1.00 54.15  ? 699  ASN A HA   1 
ATOM   9370  H  HB2  . ASN A 1 620 ? -37.172 32.010  -31.658 1.00 54.73  ? 699  ASN A HB2  1 
ATOM   9371  H  HB3  . ASN A 1 620 ? -38.540 31.217  -31.511 1.00 54.73  ? 699  ASN A HB3  1 
ATOM   9372  H  HD21 . ASN A 1 620 ? -37.017 28.425  -33.225 1.00 48.12  ? 699  ASN A HD21 1 
ATOM   9373  H  HD22 . ASN A 1 620 ? -38.086 29.377  -33.636 1.00 48.12  ? 699  ASN A HD22 1 
ATOM   9374  N  N    . ALA A 1 621 ? -40.587 31.439  -33.083 1.00 55.03  ? 700  ALA A N    1 
ATOM   9375  C  CA   . ALA A 1 621 ? -41.846 30.735  -33.295 1.00 51.78  ? 700  ALA A CA   1 
ATOM   9376  C  C    . ALA A 1 621 ? -42.713 31.386  -34.371 1.00 47.25  ? 700  ALA A C    1 
ATOM   9377  O  O    . ALA A 1 621 ? -43.545 30.714  -34.981 1.00 45.31  ? 700  ALA A O    1 
ATOM   9378  C  CB   . ALA A 1 621 ? -42.620 30.653  -31.989 1.00 52.37  ? 700  ALA A CB   1 
ATOM   9379  H  H    . ALA A 1 621 ? -40.604 31.994  -32.427 1.00 66.03  ? 700  ALA A H    1 
ATOM   9380  H  HA   . ALA A 1 621 ? -41.652 29.829  -33.581 1.00 62.13  ? 700  ALA A HA   1 
ATOM   9381  H  HB1  . ALA A 1 621 ? -43.454 30.183  -32.146 1.00 62.84  ? 700  ALA A HB1  1 
ATOM   9382  H  HB2  . ALA A 1 621 ? -42.087 30.172  -31.337 1.00 62.84  ? 700  ALA A HB2  1 
ATOM   9383  H  HB3  . ALA A 1 621 ? -42.801 31.551  -31.672 1.00 62.84  ? 700  ALA A HB3  1 
ATOM   9384  N  N    . HIS A 1 622 ? -42.520 32.684  -34.597 1.00 48.90  ? 701  HIS A N    1 
ATOM   9385  C  CA   . HIS A 1 622 ? -43.387 33.447  -35.495 1.00 58.12  ? 701  HIS A CA   1 
ATOM   9386  C  C    . HIS A 1 622 ? -42.620 34.156  -36.603 1.00 58.37  ? 701  HIS A C    1 
ATOM   9387  O  O    . HIS A 1 622 ? -41.567 34.745  -36.366 1.00 53.38  ? 701  HIS A O    1 
ATOM   9388  C  CB   . HIS A 1 622 ? -44.189 34.478  -34.699 1.00 54.94  ? 701  HIS A CB   1 
ATOM   9389  C  CG   . HIS A 1 622 ? -44.830 33.920  -33.468 1.00 50.63  ? 701  HIS A CG   1 
ATOM   9390  N  ND1  . HIS A 1 622 ? -45.944 33.114  -33.509 1.00 55.15  ? 701  HIS A ND1  1 
ATOM   9391  C  CD2  . HIS A 1 622 ? -44.507 34.051  -32.158 1.00 47.34  ? 701  HIS A CD2  1 
ATOM   9392  C  CE1  . HIS A 1 622 ? -46.285 32.771  -32.277 1.00 55.21  ? 701  HIS A CE1  1 
ATOM   9393  N  NE2  . HIS A 1 622 ? -45.428 33.330  -31.441 1.00 52.19  ? 701  HIS A NE2  1 
ATOM   9394  H  H    . HIS A 1 622 ? -41.890 33.149  -34.241 1.00 58.68  ? 701  HIS A H    1 
ATOM   9395  H  HA   . HIS A 1 622 ? -44.017 32.838  -35.912 1.00 69.74  ? 701  HIS A HA   1 
ATOM   9396  H  HB2  . HIS A 1 622 ? -43.594 35.193  -34.425 1.00 65.92  ? 701  HIS A HB2  1 
ATOM   9397  H  HB3  . HIS A 1 622 ? -44.892 34.833  -35.265 1.00 65.92  ? 701  HIS A HB3  1 
ATOM   9398  H  HD1  . HIS A 1 622 ? -46.356 32.871  -34.224 1.00 66.19  ? 701  HIS A HD1  1 
ATOM   9399  H  HD2  . HIS A 1 622 ? -43.796 34.540  -31.811 1.00 56.80  ? 701  HIS A HD2  1 
ATOM   9400  H  HE1  . HIS A 1 622 ? -47.004 32.232  -32.040 1.00 66.25  ? 701  HIS A HE1  1 
ATOM   9401  H  HE2  . HIS A 1 622 ? -45.443 33.251  -30.585 1.00 62.63  ? 701  HIS A HE2  1 
ATOM   9402  N  N    . ASP A 1 623 ? -43.173 34.097  -37.812 1.00 56.90  ? 702  ASP A N    1 
ATOM   9403  C  CA   . ASP A 1 623 ? -42.627 34.806  -38.963 1.00 55.08  ? 702  ASP A CA   1 
ATOM   9404  C  C    . ASP A 1 623 ? -42.816 36.307  -38.790 1.00 50.07  ? 702  ASP A C    1 
ATOM   9405  O  O    . ASP A 1 623 ? -43.933 36.813  -38.889 1.00 49.01  ? 702  ASP A O    1 
ATOM   9406  C  CB   . ASP A 1 623 ? -43.330 34.347  -40.241 1.00 53.39  ? 702  ASP A CB   1 
ATOM   9407  C  CG   . ASP A 1 623 ? -42.688 34.907  -41.503 1.00 61.89  ? 702  ASP A CG   1 
ATOM   9408  O  OD1  . ASP A 1 623 ? -41.958 35.918  -41.423 1.00 63.51  ? 702  ASP A OD1  1 
ATOM   9409  O  OD2  . ASP A 1 623 ? -42.919 34.330  -42.586 1.00 68.43  ? 702  ASP A OD2  1 
ATOM   9410  H  H    . ASP A 1 623 ? -43.881 33.643  -37.993 1.00 68.27  ? 702  ASP A H    1 
ATOM   9411  H  HA   . ASP A 1 623 ? -41.679 34.618  -39.044 1.00 66.10  ? 702  ASP A HA   1 
ATOM   9412  H  HB2  . ASP A 1 623 ? -43.294 33.379  -40.292 1.00 64.07  ? 702  ASP A HB2  1 
ATOM   9413  H  HB3  . ASP A 1 623 ? -44.253 34.643  -40.218 1.00 64.07  ? 702  ASP A HB3  1 
ATOM   9414  N  N    . LEU A 1 624 ? -41.717 37.017  -38.554 1.00 59.93  ? 703  LEU A N    1 
ATOM   9415  C  CA   . LEU A 1 624 ? -41.763 38.455  -38.320 1.00 64.02  ? 703  LEU A CA   1 
ATOM   9416  C  C    . LEU A 1 624 ? -41.073 39.211  -39.446 1.00 74.32  ? 703  LEU A C    1 
ATOM   9417  O  O    . LEU A 1 624 ? -40.544 40.302  -39.238 1.00 82.61  ? 703  LEU A O    1 
ATOM   9418  C  CB   . LEU A 1 624 ? -41.096 38.800  -36.985 1.00 64.91  ? 703  LEU A CB   1 
ATOM   9419  C  CG   . LEU A 1 624 ? -41.633 38.105  -35.730 1.00 62.49  ? 703  LEU A CG   1 
ATOM   9420  C  CD1  . LEU A 1 624 ? -41.165 38.841  -34.472 1.00 54.85  ? 703  LEU A CD1  1 
ATOM   9421  C  CD2  . LEU A 1 624 ? -43.155 37.976  -35.751 1.00 64.81  ? 703  LEU A CD2  1 
ATOM   9422  H  H    . LEU A 1 624 ? -40.924 36.684  -38.523 1.00 71.91  ? 703  LEU A H    1 
ATOM   9423  H  HA   . LEU A 1 624 ? -42.688 38.744  -38.282 1.00 76.82  ? 703  LEU A HA   1 
ATOM   9424  H  HB2  . LEU A 1 624 ? -40.154 38.577  -37.053 1.00 77.90  ? 703  LEU A HB2  1 
ATOM   9425  H  HB3  . LEU A 1 624 ? -41.186 39.756  -36.842 1.00 77.90  ? 703  LEU A HB3  1 
ATOM   9426  H  HG   . LEU A 1 624 ? -41.266 37.208  -35.695 1.00 74.99  ? 703  LEU A HG   1 
ATOM   9427  H  HD11 . LEU A 1 624 ? -41.516 38.385  -33.691 1.00 65.82  ? 703  LEU A HD11 1 
ATOM   9428  H  HD12 . LEU A 1 624 ? -40.195 38.839  -34.449 1.00 65.82  ? 703  LEU A HD12 1 
ATOM   9429  H  HD13 . LEU A 1 624 ? -41.494 39.753  -34.499 1.00 65.82  ? 703  LEU A HD13 1 
ATOM   9430  H  HD21 . LEU A 1 624 ? -43.445 37.531  -34.939 1.00 77.77  ? 703  LEU A HD21 1 
ATOM   9431  H  HD22 . LEU A 1 624 ? -43.546 38.862  -35.801 1.00 77.77  ? 703  LEU A HD22 1 
ATOM   9432  H  HD23 . LEU A 1 624 ? -43.416 37.454  -36.526 1.00 77.77  ? 703  LEU A HD23 1 
ATOM   9433  N  N    . SER A 1 625 ? -41.079 38.625  -40.638 1.00 63.38  ? 704  SER A N    1 
ATOM   9434  C  CA   . SER A 1 625 ? -40.437 39.236  -41.794 1.00 64.24  ? 704  SER A CA   1 
ATOM   9435  C  C    . SER A 1 625 ? -41.083 40.560  -42.197 1.00 65.21  ? 704  SER A C    1 
ATOM   9436  O  O    . SER A 1 625 ? -40.421 41.432  -42.761 1.00 65.87  ? 704  SER A O    1 
ATOM   9437  C  CB   . SER A 1 625 ? -40.471 38.273  -42.976 1.00 67.04  ? 704  SER A CB   1 
ATOM   9438  O  OG   . SER A 1 625 ? -39.697 37.119  -42.706 1.00 72.58  ? 704  SER A OG   1 
ATOM   9439  H  H    . SER A 1 625 ? -41.451 37.868  -40.804 1.00 76.05  ? 704  SER A H    1 
ATOM   9440  H  HA   . SER A 1 625 ? -39.507 39.412  -41.580 1.00 77.09  ? 704  SER A HA   1 
ATOM   9441  H  HB2  . SER A 1 625 ? -41.389 38.006  -43.141 1.00 80.44  ? 704  SER A HB2  1 
ATOM   9442  H  HB3  . SER A 1 625 ? -40.110 38.719  -43.758 1.00 80.44  ? 704  SER A HB3  1 
ATOM   9443  H  HG   . SER A 1 625 ? -39.999 36.722  -42.030 1.00 87.09  ? 704  SER A HG   1 
ATOM   9444  N  N    . LYS A 1 626 ? -42.370 40.709  -41.897 1.00 73.16  ? 705  LYS A N    1 
ATOM   9445  C  CA   . LYS A 1 626 ? -43.110 41.915  -42.257 1.00 75.09  ? 705  LYS A CA   1 
ATOM   9446  C  C    . LYS A 1 626 ? -42.496 43.121  -41.548 1.00 71.26  ? 705  LYS A C    1 
ATOM   9447  O  O    . LYS A 1 626 ? -42.744 44.268  -41.917 1.00 80.76  ? 705  LYS A O    1 
ATOM   9448  C  CB   . LYS A 1 626 ? -44.594 41.758  -41.902 1.00 84.59  ? 705  LYS A CB   1 
ATOM   9449  C  CG   . LYS A 1 626 ? -45.154 40.356  -42.182 1.00 86.91  ? 705  LYS A CG   1 
ATOM   9450  C  CD   . LYS A 1 626 ? -46.663 40.356  -42.367 1.00 89.41  ? 705  LYS A CD   1 
ATOM   9451  C  CE   . LYS A 1 626 ? -47.385 40.892  -41.147 1.00 84.50  ? 705  LYS A CE   1 
ATOM   9452  N  NZ   . LYS A 1 626 ? -48.856 40.883  -41.354 1.00 85.93  ? 705  LYS A NZ   1 
ATOM   9453  H  H    . LYS A 1 626 ? -42.841 40.122  -41.482 1.00 87.79  ? 705  LYS A H    1 
ATOM   9454  H  HA   . LYS A 1 626 ? -43.041 42.059  -43.214 1.00 90.10  ? 705  LYS A HA   1 
ATOM   9455  H  HB2  . LYS A 1 626 ? -44.710 41.940  -40.957 1.00 101.50 ? 705  LYS A HB2  1 
ATOM   9456  H  HB3  . LYS A 1 626 ? -45.109 42.392  -42.425 1.00 101.50 ? 705  LYS A HB3  1 
ATOM   9457  H  HG2  . LYS A 1 626 ? -44.752 40.010  -42.994 1.00 104.29 ? 705  LYS A HG2  1 
ATOM   9458  H  HG3  . LYS A 1 626 ? -44.944 39.776  -41.433 1.00 104.29 ? 705  LYS A HG3  1 
ATOM   9459  H  HD2  . LYS A 1 626 ? -46.891 40.919  -43.124 1.00 107.30 ? 705  LYS A HD2  1 
ATOM   9460  H  HD3  . LYS A 1 626 ? -46.966 39.448  -42.523 1.00 107.30 ? 705  LYS A HD3  1 
ATOM   9461  H  HE2  . LYS A 1 626 ? -47.181 40.333  -40.381 1.00 101.40 ? 705  LYS A HE2  1 
ATOM   9462  H  HE3  . LYS A 1 626 ? -47.105 41.806  -40.982 1.00 101.40 ? 705  LYS A HE3  1 
ATOM   9463  H  HZ1  . LYS A 1 626 ? -49.267 41.200  -40.631 1.00 103.12 ? 705  LYS A HZ1  1 
ATOM   9464  H  HZ2  . LYS A 1 626 ? -49.068 41.392  -42.053 1.00 103.12 ? 705  LYS A HZ2  1 
ATOM   9465  H  HZ3  . LYS A 1 626 ? -49.137 40.052  -41.506 1.00 103.12 ? 705  LYS A HZ3  1 
ATOM   9466  N  N    . TRP A 1 627 ? -41.705 42.834  -40.517 1.00 71.09  ? 706  TRP A N    1 
ATOM   9467  C  CA   . TRP A 1 627 ? -40.802 43.802  -39.914 1.00 80.97  ? 706  TRP A CA   1 
ATOM   9468  C  C    . TRP A 1 627 ? -39.388 43.445  -40.375 1.00 91.24  ? 706  TRP A C    1 
ATOM   9469  O  O    . TRP A 1 627 ? -38.857 42.404  -39.991 1.00 97.55  ? 706  TRP A O    1 
ATOM   9470  C  CB   . TRP A 1 627 ? -40.863 43.719  -38.385 1.00 80.68  ? 706  TRP A CB   1 
ATOM   9471  C  CG   . TRP A 1 627 ? -42.233 43.920  -37.774 1.00 81.59  ? 706  TRP A CG   1 
ATOM   9472  C  CD1  . TRP A 1 627 ? -42.669 45.016  -37.080 1.00 82.61  ? 706  TRP A CD1  1 
ATOM   9473  C  CD2  . TRP A 1 627 ? -43.333 42.997  -37.791 1.00 78.42  ? 706  TRP A CD2  1 
ATOM   9474  N  NE1  . TRP A 1 627 ? -43.969 44.833  -36.670 1.00 78.77  ? 706  TRP A NE1  1 
ATOM   9475  C  CE2  . TRP A 1 627 ? -44.400 43.601  -37.095 1.00 75.62  ? 706  TRP A CE2  1 
ATOM   9476  C  CE3  . TRP A 1 627 ? -43.519 41.718  -38.327 1.00 79.08  ? 706  TRP A CE3  1 
ATOM   9477  C  CZ2  . TRP A 1 627 ? -45.633 42.975  -36.922 1.00 74.30  ? 706  TRP A CZ2  1 
ATOM   9478  C  CZ3  . TRP A 1 627 ? -44.746 41.098  -38.159 1.00 73.41  ? 706  TRP A CZ3  1 
ATOM   9479  C  CH2  . TRP A 1 627 ? -45.787 41.726  -37.462 1.00 71.98  ? 706  TRP A CH2  1 
ATOM   9480  H  H    . TRP A 1 627 ? -41.676 42.062  -40.141 1.00 85.30  ? 706  TRP A H    1 
ATOM   9481  H  HA   . TRP A 1 627 ? -41.022 44.702  -40.202 1.00 97.17  ? 706  TRP A HA   1 
ATOM   9482  H  HB2  . TRP A 1 627 ? -40.549 42.842  -38.113 1.00 96.81  ? 706  TRP A HB2  1 
ATOM   9483  H  HB3  . TRP A 1 627 ? -40.278 44.400  -38.018 1.00 96.81  ? 706  TRP A HB3  1 
ATOM   9484  H  HD1  . TRP A 1 627 ? -42.160 45.776  -36.910 1.00 99.13  ? 706  TRP A HD1  1 
ATOM   9485  H  HE1  . TRP A 1 627 ? -44.436 45.399  -36.222 1.00 94.52  ? 706  TRP A HE1  1 
ATOM   9486  H  HE3  . TRP A 1 627 ? -42.835 41.295  -38.793 1.00 94.90  ? 706  TRP A HE3  1 
ATOM   9487  H  HZ2  . TRP A 1 627 ? -46.326 43.390  -36.461 1.00 89.16  ? 706  TRP A HZ2  1 
ATOM   9488  H  HZ3  . TRP A 1 627 ? -44.881 40.248  -38.512 1.00 88.09  ? 706  TRP A HZ3  1 
ATOM   9489  H  HH2  . TRP A 1 627 ? -46.599 41.285  -37.362 1.00 86.38  ? 706  TRP A HH2  1 
ATOM   9490  N  N    . ASP A 1 628 ? -38.779 44.280  -41.209 1.00 104.45 ? 707  ASP A N    1 
ATOM   9491  C  CA   . ASP A 1 628 ? -37.431 43.987  -41.692 1.00 104.91 ? 707  ASP A CA   1 
ATOM   9492  C  C    . ASP A 1 628 ? -36.395 44.320  -40.615 1.00 101.32 ? 707  ASP A C    1 
ATOM   9493  O  O    . ASP A 1 628 ? -35.767 45.380  -40.651 1.00 107.03 ? 707  ASP A O    1 
ATOM   9494  C  CB   . ASP A 1 628 ? -37.123 44.756  -42.979 1.00 108.42 ? 707  ASP A CB   1 
ATOM   9495  C  CG   . ASP A 1 628 ? -35.760 44.407  -43.549 1.00 111.77 ? 707  ASP A CG   1 
ATOM   9496  O  OD1  . ASP A 1 628 ? -35.402 43.209  -43.544 1.00 114.82 ? 707  ASP A OD1  1 
ATOM   9497  O  OD2  . ASP A 1 628 ? -35.043 45.330  -43.991 1.00 108.33 ? 707  ASP A OD2  1 
ATOM   9498  H  H    . ASP A 1 628 ? -39.117 45.012  -41.509 1.00 125.35 ? 707  ASP A H    1 
ATOM   9499  H  HA   . ASP A 1 628 ? -37.366 43.040  -41.887 1.00 125.89 ? 707  ASP A HA   1 
ATOM   9500  H  HB2  . ASP A 1 628 ? -37.793 44.539  -43.647 1.00 130.11 ? 707  ASP A HB2  1 
ATOM   9501  H  HB3  . ASP A 1 628 ? -37.137 45.708  -42.792 1.00 130.11 ? 707  ASP A HB3  1 
ATOM   9502  N  N    . LEU A 1 629 ? -36.220 43.404  -39.664 1.00 64.62  ? 708  LEU A N    1 
ATOM   9503  C  CA   . LEU A 1 629 ? -35.325 43.630  -38.526 1.00 66.81  ? 708  LEU A CA   1 
ATOM   9504  C  C    . LEU A 1 629 ? -33.930 43.018  -38.704 1.00 66.09  ? 708  LEU A C    1 
ATOM   9505  O  O    . LEU A 1 629 ? -33.167 42.928  -37.741 1.00 63.52  ? 708  LEU A O    1 
ATOM   9506  C  CB   . LEU A 1 629 ? -35.957 43.141  -37.208 1.00 61.88  ? 708  LEU A CB   1 
ATOM   9507  C  CG   . LEU A 1 629 ? -37.226 42.290  -37.244 1.00 57.04  ? 708  LEU A CG   1 
ATOM   9508  C  CD1  . LEU A 1 629 ? -36.973 40.901  -37.832 1.00 58.85  ? 708  LEU A CD1  1 
ATOM   9509  C  CD2  . LEU A 1 629 ? -37.809 42.181  -35.841 1.00 47.18  ? 708  LEU A CD2  1 
ATOM   9510  H  H    . LEU A 1 629 ? -36.610 42.638  -39.654 1.00 77.54  ? 708  LEU A H    1 
ATOM   9511  H  HA   . LEU A 1 629 ? -35.199 44.587  -38.437 1.00 80.17  ? 708  LEU A HA   1 
ATOM   9512  H  HB2  . LEU A 1 629 ? -35.287 42.618  -36.740 1.00 74.25  ? 708  LEU A HB2  1 
ATOM   9513  H  HB3  . LEU A 1 629 ? -36.166 43.925  -36.677 1.00 74.25  ? 708  LEU A HB3  1 
ATOM   9514  H  HG   . LEU A 1 629 ? -37.883 42.733  -37.804 1.00 68.44  ? 708  LEU A HG   1 
ATOM   9515  H  HD11 . LEU A 1 629 ? -37.805 40.403  -37.833 1.00 70.62  ? 708  LEU A HD11 1 
ATOM   9516  H  HD12 . LEU A 1 629 ? -36.644 40.998  -38.740 1.00 70.62  ? 708  LEU A HD12 1 
ATOM   9517  H  HD13 . LEU A 1 629 ? -36.314 40.443  -37.288 1.00 70.62  ? 708  LEU A HD13 1 
ATOM   9518  H  HD21 . LEU A 1 629 ? -38.613 41.639  -35.875 1.00 56.61  ? 708  LEU A HD21 1 
ATOM   9519  H  HD22 . LEU A 1 629 ? -37.154 41.765  -35.259 1.00 56.61  ? 708  LEU A HD22 1 
ATOM   9520  H  HD23 . LEU A 1 629 ? -38.022 43.070  -35.518 1.00 56.61  ? 708  LEU A HD23 1 
ATOM   9521  N  N    . PHE A 1 630 ? -33.589 42.601  -39.921 1.00 75.19  ? 709  PHE A N    1 
ATOM   9522  C  CA   . PHE A 1 630 ? -32.202 42.250  -40.216 1.00 72.23  ? 709  PHE A CA   1 
ATOM   9523  C  C    . PHE A 1 630 ? -31.371 43.513  -40.100 1.00 72.79  ? 709  PHE A C    1 
ATOM   9524  O  O    . PHE A 1 630 ? -30.235 43.488  -39.626 1.00 70.93  ? 709  PHE A O    1 
ATOM   9525  C  CB   . PHE A 1 630 ? -32.035 41.685  -41.626 1.00 68.92  ? 709  PHE A CB   1 
ATOM   9526  C  CG   . PHE A 1 630 ? -30.608 41.345  -41.973 1.00 73.50  ? 709  PHE A CG   1 
ATOM   9527  C  CD1  . PHE A 1 630 ? -29.747 42.315  -42.469 1.00 75.65  ? 709  PHE A CD1  1 
ATOM   9528  C  CD2  . PHE A 1 630 ? -30.125 40.060  -41.797 1.00 75.00  ? 709  PHE A CD2  1 
ATOM   9529  C  CE1  . PHE A 1 630 ? -28.437 42.006  -42.784 1.00 74.19  ? 709  PHE A CE1  1 
ATOM   9530  C  CE2  . PHE A 1 630 ? -28.816 39.746  -42.114 1.00 71.51  ? 709  PHE A CE2  1 
ATOM   9531  C  CZ   . PHE A 1 630 ? -27.971 40.720  -42.607 1.00 74.78  ? 709  PHE A CZ   1 
ATOM   9532  H  H    . PHE A 1 630 ? -34.131 42.514  -40.584 1.00 90.23  ? 709  PHE A H    1 
ATOM   9533  H  HA   . PHE A 1 630 ? -31.879 41.598  -39.573 1.00 86.68  ? 709  PHE A HA   1 
ATOM   9534  H  HB2  . PHE A 1 630 ? -32.561 40.874  -41.703 1.00 82.70  ? 709  PHE A HB2  1 
ATOM   9535  H  HB3  . PHE A 1 630 ? -32.349 42.343  -42.266 1.00 82.70  ? 709  PHE A HB3  1 
ATOM   9536  H  HD1  . PHE A 1 630 ? -30.055 43.184  -42.591 1.00 90.78  ? 709  PHE A HD1  1 
ATOM   9537  H  HD2  . PHE A 1 630 ? -30.689 39.399  -41.466 1.00 90.00  ? 709  PHE A HD2  1 
ATOM   9538  H  HE1  . PHE A 1 630 ? -27.870 42.664  -43.117 1.00 89.02  ? 709  PHE A HE1  1 
ATOM   9539  H  HE2  . PHE A 1 630 ? -28.504 38.878  -41.992 1.00 85.82  ? 709  PHE A HE2  1 
ATOM   9540  H  HZ   . PHE A 1 630 ? -27.090 40.510  -42.819 1.00 89.73  ? 709  PHE A HZ   1 
ATOM   9541  N  N    . ALA A 1 631 ? -31.952 44.615  -40.562 1.00 81.23  ? 710  ALA A N    1 
ATOM   9542  C  CA   . ALA A 1 631 ? -31.305 45.917  -40.526 1.00 81.24  ? 710  ALA A CA   1 
ATOM   9543  C  C    . ALA A 1 631 ? -30.879 46.277  -39.108 1.00 82.56  ? 710  ALA A C    1 
ATOM   9544  O  O    . ALA A 1 631 ? -29.721 46.604  -38.867 1.00 77.68  ? 710  ALA A O    1 
ATOM   9545  C  CB   . ALA A 1 631 ? -32.247 46.971  -41.074 1.00 82.33  ? 710  ALA A CB   1 
ATOM   9546  H  H    . ALA A 1 631 ? -32.739 44.632  -40.908 1.00 97.48  ? 710  ALA A H    1 
ATOM   9547  H  HA   . ALA A 1 631 ? -30.513 45.896  -41.085 1.00 97.49  ? 710  ALA A HA   1 
ATOM   9548  H  HB1  . ALA A 1 631 ? -31.805 47.834  -41.045 1.00 98.80  ? 710  ALA A HB1  1 
ATOM   9549  H  HB2  . ALA A 1 631 ? -32.474 46.745  -41.990 1.00 98.80  ? 710  ALA A HB2  1 
ATOM   9550  H  HB3  . ALA A 1 631 ? -33.049 46.991  -40.529 1.00 98.80  ? 710  ALA A HB3  1 
ATOM   9551  N  N    . CYS A 1 632 ? -31.822 46.207  -38.175 1.00 83.42  ? 711  CYS A N    1 
ATOM   9552  C  CA   . CYS A 1 632 ? -31.566 46.584  -36.790 1.00 76.72  ? 711  CYS A CA   1 
ATOM   9553  C  C    . CYS A 1 632 ? -30.550 45.641  -36.148 1.00 75.81  ? 711  CYS A C    1 
ATOM   9554  O  O    . CYS A 1 632 ? -29.714 46.068  -35.351 1.00 71.35  ? 711  CYS A O    1 
ATOM   9555  C  CB   . CYS A 1 632 ? -32.872 46.568  -35.992 1.00 71.03  ? 711  CYS A CB   1 
ATOM   9556  S  SG   . CYS A 1 632 ? -34.336 46.997  -36.963 1.00 103.79 ? 711  CYS A SG   1 
ATOM   9557  H  H    . CYS A 1 632 ? -32.628 45.942  -38.320 1.00 100.10 ? 711  CYS A H    1 
ATOM   9558  H  HA   . CYS A 1 632 ? -31.205 47.484  -36.765 1.00 92.06  ? 711  CYS A HA   1 
ATOM   9559  H  HB2  . CYS A 1 632 ? -33.007 45.677  -35.633 1.00 85.24  ? 711  CYS A HB2  1 
ATOM   9560  H  HB3  . CYS A 1 632 ? -32.802 47.207  -35.266 1.00 85.24  ? 711  CYS A HB3  1 
ATOM   9561  H  HG   . CYS A 1 632 ? -35.302 46.956  -36.252 1.00 124.55 ? 711  CYS A HG   1 
ATOM   9562  N  N    . ASN A 1 633 ? -30.629 44.361  -36.501 1.00 79.74  ? 712  ASN A N    1 
ATOM   9563  C  CA   . ASN A 1 633 ? -29.742 43.344  -35.939 1.00 78.14  ? 712  ASN A CA   1 
ATOM   9564  C  C    . ASN A 1 633 ? -28.338 43.377  -36.541 1.00 79.42  ? 712  ASN A C    1 
ATOM   9565  O  O    . ASN A 1 633 ? -27.344 43.238  -35.827 1.00 75.92  ? 712  ASN A O    1 
ATOM   9566  C  CB   . ASN A 1 633 ? -30.350 41.947  -36.118 1.00 78.74  ? 712  ASN A CB   1 
ATOM   9567  C  CG   . ASN A 1 633 ? -31.266 41.551  -34.971 1.00 70.14  ? 712  ASN A CG   1 
ATOM   9568  O  OD1  . ASN A 1 633 ? -30.975 41.825  -33.806 1.00 73.24  ? 712  ASN A OD1  1 
ATOM   9569  N  ND2  . ASN A 1 633 ? -32.375 40.895  -35.296 1.00 61.07  ? 712  ASN A ND2  1 
ATOM   9570  H  H    . ASN A 1 633 ? -31.194 44.052  -37.071 1.00 95.69  ? 712  ASN A H    1 
ATOM   9571  H  HA   . ASN A 1 633 ? -29.655 43.504  -34.986 1.00 93.77  ? 712  ASN A HA   1 
ATOM   9572  H  HB2  . ASN A 1 633 ? -30.871 41.932  -36.937 1.00 94.49  ? 712  ASN A HB2  1 
ATOM   9573  H  HB3  . ASN A 1 633 ? -29.634 41.295  -36.169 1.00 94.49  ? 712  ASN A HB3  1 
ATOM   9574  H  HD21 . ASN A 1 633 ? -32.925 40.649  -34.682 1.00 73.29  ? 712  ASN A HD21 1 
ATOM   9575  H  HD22 . ASN A 1 633 ? -32.542 40.715  -36.120 1.00 73.29  ? 712  ASN A HD22 1 
ATOM   9576  N  N    . TYR A 1 634 ? -28.261 43.547  -37.856 1.00 84.71  ? 713  TYR A N    1 
ATOM   9577  C  CA   . TYR A 1 634 ? -26.975 43.638  -38.534 1.00 83.52  ? 713  TYR A CA   1 
ATOM   9578  C  C    . TYR A 1 634 ? -26.213 44.845  -38.014 1.00 83.14  ? 713  TYR A C    1 
ATOM   9579  O  O    . TYR A 1 634 ? -25.015 44.771  -37.738 1.00 85.36  ? 713  TYR A O    1 
ATOM   9580  C  CB   . TYR A 1 634 ? -27.175 43.775  -40.039 1.00 88.96  ? 713  TYR A CB   1 
ATOM   9581  C  CG   . TYR A 1 634 ? -25.882 43.947  -40.793 1.00 92.59  ? 713  TYR A CG   1 
ATOM   9582  C  CD1  . TYR A 1 634 ? -24.965 42.910  -40.874 1.00 91.65  ? 713  TYR A CD1  1 
ATOM   9583  C  CD2  . TYR A 1 634 ? -25.575 45.145  -41.423 1.00 96.46  ? 713  TYR A CD2  1 
ATOM   9584  C  CE1  . TYR A 1 634 ? -23.778 43.059  -41.559 1.00 95.60  ? 713  TYR A CE1  1 
ATOM   9585  C  CE2  . TYR A 1 634 ? -24.388 45.304  -42.114 1.00 102.05 ? 713  TYR A CE2  1 
ATOM   9586  C  CZ   . TYR A 1 634 ? -23.492 44.255  -42.175 1.00 98.22  ? 713  TYR A CZ   1 
ATOM   9587  O  OH   . TYR A 1 634 ? -22.305 44.393  -42.856 1.00 95.75  ? 713  TYR A OH   1 
ATOM   9588  H  H    . TYR A 1 634 ? -28.940 43.613  -38.379 1.00 101.65 ? 713  TYR A H    1 
ATOM   9589  H  HA   . TYR A 1 634 ? -26.454 42.839  -38.359 1.00 100.22 ? 713  TYR A HA   1 
ATOM   9590  H  HB2  . TYR A 1 634 ? -27.612 42.977  -40.373 1.00 106.76 ? 713  TYR A HB2  1 
ATOM   9591  H  HB3  . TYR A 1 634 ? -27.728 44.553  -40.213 1.00 106.76 ? 713  TYR A HB3  1 
ATOM   9592  H  HD1  . TYR A 1 634 ? -25.152 42.101  -40.457 1.00 109.98 ? 713  TYR A HD1  1 
ATOM   9593  H  HD2  . TYR A 1 634 ? -26.177 45.852  -41.380 1.00 115.75 ? 713  TYR A HD2  1 
ATOM   9594  H  HE1  . TYR A 1 634 ? -23.173 42.354  -41.603 1.00 114.72 ? 713  TYR A HE1  1 
ATOM   9595  H  HE2  . TYR A 1 634 ? -24.193 46.112  -42.531 1.00 122.46 ? 713  TYR A HE2  1 
ATOM   9596  H  HH   . TYR A 1 634 ? -22.251 45.164  -43.186 1.00 114.89 ? 713  TYR A HH   1 
ATOM   9597  N  N    . LYS A 1 635 ? -26.933 45.953  -37.877 1.00 73.95  ? 714  LYS A N    1 
ATOM   9598  C  CA   . LYS A 1 635 ? -26.379 47.194  -37.351 1.00 70.11  ? 714  LYS A CA   1 
ATOM   9599  C  C    . LYS A 1 635 ? -25.884 47.021  -35.921 1.00 72.24  ? 714  LYS A C    1 
ATOM   9600  O  O    . LYS A 1 635 ? -25.092 47.824  -35.431 1.00 79.61  ? 714  LYS A O    1 
ATOM   9601  C  CB   . LYS A 1 635 ? -27.451 48.279  -37.373 1.00 67.91  ? 714  LYS A CB   1 
ATOM   9602  C  CG   . LYS A 1 635 ? -26.916 49.687  -37.444 1.00 74.02  ? 714  LYS A CG   1 
ATOM   9603  C  CD   . LYS A 1 635 ? -27.722 50.494  -38.447 1.00 87.62  ? 714  LYS A CD   1 
ATOM   9604  C  CE   . LYS A 1 635 ? -27.103 51.851  -38.729 1.00 98.81  ? 714  LYS A CE   1 
ATOM   9605  N  NZ   . LYS A 1 635 ? -27.663 52.450  -39.975 1.00 99.99  ? 714  LYS A NZ   1 
ATOM   9606  H  H    . LYS A 1 635 ? -27.765 46.011  -38.087 1.00 88.74  ? 714  LYS A H    1 
ATOM   9607  H  HA   . LYS A 1 635 ? -25.635 47.480  -37.904 1.00 84.13  ? 714  LYS A HA   1 
ATOM   9608  H  HB2  . LYS A 1 635 ? -28.017 48.140  -38.149 1.00 81.50  ? 714  LYS A HB2  1 
ATOM   9609  H  HB3  . LYS A 1 635 ? -27.982 48.207  -36.565 1.00 81.50  ? 714  LYS A HB3  1 
ATOM   9610  H  HG2  . LYS A 1 635 ? -26.993 50.109  -36.574 1.00 88.82  ? 714  LYS A HG2  1 
ATOM   9611  H  HG3  . LYS A 1 635 ? -25.990 49.669  -37.734 1.00 88.82  ? 714  LYS A HG3  1 
ATOM   9612  H  HD2  . LYS A 1 635 ? -27.769 50.005  -39.284 1.00 105.15 ? 714  LYS A HD2  1 
ATOM   9613  H  HD3  . LYS A 1 635 ? -28.614 50.637  -38.095 1.00 105.15 ? 714  LYS A HD3  1 
ATOM   9614  H  HE2  . LYS A 1 635 ? -27.292 52.451  -37.991 1.00 118.57 ? 714  LYS A HE2  1 
ATOM   9615  H  HE3  . LYS A 1 635 ? -26.145 51.750  -38.844 1.00 118.57 ? 714  LYS A HE3  1 
ATOM   9616  H  HZ1  . LYS A 1 635 ? -27.290 53.244  -40.125 1.00 119.99 ? 714  LYS A HZ1  1 
ATOM   9617  H  HZ2  . LYS A 1 635 ? -27.499 51.917  -40.668 1.00 119.99 ? 714  LYS A HZ2  1 
ATOM   9618  H  HZ3  . LYS A 1 635 ? -28.543 52.554  -39.892 1.00 119.99 ? 714  LYS A HZ3  1 
ATOM   9619  N  N    . LEU A 1 636 ? -26.370 45.975  -35.259 1.00 76.50  ? 715  LEU A N    1 
ATOM   9620  C  CA   . LEU A 1 636 ? -26.059 45.715  -33.859 1.00 77.95  ? 715  LEU A CA   1 
ATOM   9621  C  C    . LEU A 1 636 ? -24.945 44.679  -33.717 1.00 74.87  ? 715  LEU A C    1 
ATOM   9622  O  O    . LEU A 1 636 ? -24.279 44.615  -32.684 1.00 72.59  ? 715  LEU A O    1 
ATOM   9623  C  CB   . LEU A 1 636 ? -27.324 45.238  -33.142 1.00 77.77  ? 715  LEU A CB   1 
ATOM   9624  C  CG   . LEU A 1 636 ? -27.251 44.945  -31.644 1.00 66.81  ? 715  LEU A CG   1 
ATOM   9625  C  CD1  . LEU A 1 636 ? -26.808 46.171  -30.865 1.00 64.99  ? 715  LEU A CD1  1 
ATOM   9626  C  CD2  . LEU A 1 636 ? -28.611 44.462  -31.162 1.00 63.64  ? 715  LEU A CD2  1 
ATOM   9627  H  H    . LEU A 1 636 ? -26.894 45.390  -35.608 1.00 91.80  ? 715  LEU A H    1 
ATOM   9628  H  HA   . LEU A 1 636 ? -25.764 46.538  -33.439 1.00 93.54  ? 715  LEU A HA   1 
ATOM   9629  H  HB2  . LEU A 1 636 ? -28.006 45.918  -33.261 1.00 93.33  ? 715  LEU A HB2  1 
ATOM   9630  H  HB3  . LEU A 1 636 ? -27.617 44.420  -33.573 1.00 93.33  ? 715  LEU A HB3  1 
ATOM   9631  H  HG   . LEU A 1 636 ? -26.605 44.238  -31.488 1.00 80.17  ? 715  LEU A HG   1 
ATOM   9632  H  HD11 . LEU A 1 636 ? -26.773 45.949  -29.921 1.00 77.99  ? 715  LEU A HD11 1 
ATOM   9633  H  HD12 . LEU A 1 636 ? -25.930 46.441  -31.174 1.00 77.99  ? 715  LEU A HD12 1 
ATOM   9634  H  HD13 . LEU A 1 636 ? -27.446 46.886  -31.013 1.00 77.99  ? 715  LEU A HD13 1 
ATOM   9635  H  HD21 . LEU A 1 636 ? -28.561 44.277  -30.211 1.00 76.37  ? 715  LEU A HD21 1 
ATOM   9636  H  HD22 . LEU A 1 636 ? -29.269 45.154  -31.331 1.00 76.37  ? 715  LEU A HD22 1 
ATOM   9637  H  HD23 . LEU A 1 636 ? -28.847 43.654  -31.645 1.00 76.37  ? 715  LEU A HD23 1 
ATOM   9638  N  N    . LEU A 1 637 ? -24.742 43.874  -34.758 1.00 60.88  ? 716  LEU A N    1 
ATOM   9639  C  CA   . LEU A 1 637 ? -23.683 42.867  -34.754 1.00 57.99  ? 716  LEU A CA   1 
ATOM   9640  C  C    . LEU A 1 637 ? -22.386 43.420  -35.335 1.00 63.38  ? 716  LEU A C    1 
ATOM   9641  O  O    . LEU A 1 637 ? -21.300 43.144  -34.825 1.00 62.05  ? 716  LEU A O    1 
ATOM   9642  C  CB   . LEU A 1 637 ? -24.112 41.629  -35.545 1.00 52.17  ? 716  LEU A CB   1 
ATOM   9643  C  CG   . LEU A 1 637 ? -24.999 40.614  -34.825 1.00 45.72  ? 716  LEU A CG   1 
ATOM   9644  C  CD1  . LEU A 1 637 ? -25.489 39.578  -35.819 1.00 44.81  ? 716  LEU A CD1  1 
ATOM   9645  C  CD2  . LEU A 1 637 ? -24.262 39.938  -33.675 1.00 47.48  ? 716  LEU A CD2  1 
ATOM   9646  H  H    . LEU A 1 637 ? -25.205 43.892  -35.482 1.00 73.05  ? 716  LEU A H    1 
ATOM   9647  H  HA   . LEU A 1 637 ? -23.510 42.594  -33.839 1.00 69.59  ? 716  LEU A HA   1 
ATOM   9648  H  HB2  . LEU A 1 637 ? -24.598 41.927  -36.330 1.00 62.60  ? 716  LEU A HB2  1 
ATOM   9649  H  HB3  . LEU A 1 637 ? -23.311 41.159  -35.826 1.00 62.60  ? 716  LEU A HB3  1 
ATOM   9650  H  HG   . LEU A 1 637 ? -25.773 41.072  -34.460 1.00 54.87  ? 716  LEU A HG   1 
ATOM   9651  H  HD11 . LEU A 1 637 ? -26.052 38.937  -35.355 1.00 53.77  ? 716  LEU A HD11 1 
ATOM   9652  H  HD12 . LEU A 1 637 ? -25.999 40.023  -36.514 1.00 53.77  ? 716  LEU A HD12 1 
ATOM   9653  H  HD13 . LEU A 1 637 ? -24.724 39.126  -36.207 1.00 53.77  ? 716  LEU A HD13 1 
ATOM   9654  H  HD21 . LEU A 1 637 ? -24.858 39.304  -33.247 1.00 56.98  ? 716  LEU A HD21 1 
ATOM   9655  H  HD22 . LEU A 1 637 ? -23.485 39.476  -34.026 1.00 56.98  ? 716  LEU A HD22 1 
ATOM   9656  H  HD23 . LEU A 1 637 ? -23.984 40.615  -33.037 1.00 56.98  ? 716  LEU A HD23 1 
ATOM   9657  N  N    . LYS A 1 638 ? -22.503 44.199  -36.406 1.00 62.57  ? 717  LYS A N    1 
ATOM   9658  C  CA   . LYS A 1 638 ? -21.334 44.774  -37.059 1.00 63.61  ? 717  LYS A CA   1 
ATOM   9659  C  C    . LYS A 1 638 ? -20.741 45.878  -36.187 1.00 66.31  ? 717  LYS A C    1 
ATOM   9660  O  O    . LYS A 1 638 ? -19.528 46.093  -36.183 1.00 77.00  ? 717  LYS A O    1 
ATOM   9661  C  CB   . LYS A 1 638 ? -21.694 45.308  -38.454 1.00 66.33  ? 717  LYS A CB   1 
ATOM   9662  C  CG   . LYS A 1 638 ? -22.027 46.796  -38.522 1.00 69.50  ? 717  LYS A CG   1 
ATOM   9663  C  CD   . LYS A 1 638 ? -22.398 47.202  -39.939 1.00 72.72  ? 717  LYS A CD   1 
ATOM   9664  C  CE   . LYS A 1 638 ? -22.498 48.711  -40.087 1.00 79.87  ? 717  LYS A CE   1 
ATOM   9665  N  NZ   . LYS A 1 638 ? -22.559 49.118  -41.519 1.00 80.44  ? 717  LYS A NZ   1 
ATOM   9666  H  H    . LYS A 1 638 ? -23.251 44.410  -36.775 1.00 75.08  ? 717  LYS A H    1 
ATOM   9667  H  HA   . LYS A 1 638 ? -20.661 44.084  -37.167 1.00 76.33  ? 717  LYS A HA   1 
ATOM   9668  H  HB2  . LYS A 1 638 ? -20.943 45.150  -39.046 1.00 79.59  ? 717  LYS A HB2  1 
ATOM   9669  H  HB3  . LYS A 1 638 ? -22.469 44.822  -38.778 1.00 79.59  ? 717  LYS A HB3  1 
ATOM   9670  H  HG2  . LYS A 1 638 ? -22.781 46.985  -37.942 1.00 83.40  ? 717  LYS A HG2  1 
ATOM   9671  H  HG3  . LYS A 1 638 ? -21.252 47.312  -38.249 1.00 83.40  ? 717  LYS A HG3  1 
ATOM   9672  H  HD2  . LYS A 1 638 ? -21.718 46.882  -40.551 1.00 87.26  ? 717  LYS A HD2  1 
ATOM   9673  H  HD3  . LYS A 1 638 ? -23.260 46.818  -40.165 1.00 87.26  ? 717  LYS A HD3  1 
ATOM   9674  H  HE2  . LYS A 1 638 ? -23.304 49.024  -39.648 1.00 95.84  ? 717  LYS A HE2  1 
ATOM   9675  H  HE3  . LYS A 1 638 ? -21.716 49.124  -39.687 1.00 95.84  ? 717  LYS A HE3  1 
ATOM   9676  H  HZ1  . LYS A 1 638 ? -22.617 50.003  -41.581 1.00 96.53  ? 717  LYS A HZ1  1 
ATOM   9677  H  HZ2  . LYS A 1 638 ? -21.826 48.845  -41.944 1.00 96.53  ? 717  LYS A HZ2  1 
ATOM   9678  H  HZ3  . LYS A 1 638 ? -23.272 48.753  -41.908 1.00 96.53  ? 717  LYS A HZ3  1 
ATOM   9679  N  N    . THR A 1 639 ? -21.601 46.569  -35.445 1.00 66.16  ? 718  THR A N    1 
ATOM   9680  C  CA   . THR A 1 639 ? -21.156 47.623  -34.540 1.00 69.15  ? 718  THR A CA   1 
ATOM   9681  C  C    . THR A 1 639 ? -20.455 47.015  -33.325 1.00 69.69  ? 718  THR A C    1 
ATOM   9682  O  O    . THR A 1 639 ? -19.651 47.674  -32.661 1.00 65.58  ? 718  THR A O    1 
ATOM   9683  C  CB   . THR A 1 639 ? -22.338 48.500  -34.065 1.00 62.33  ? 718  THR A CB   1 
ATOM   9684  O  OG1  . THR A 1 639 ? -21.845 49.634  -33.342 1.00 62.65  ? 718  THR A OG1  1 
ATOM   9685  C  CG2  . THR A 1 639 ? -23.265 47.707  -33.170 1.00 67.66  ? 718  THR A CG2  1 
ATOM   9686  H  H    . THR A 1 639 ? -22.452 46.445  -35.447 1.00 79.39  ? 718  THR A H    1 
ATOM   9687  H  HA   . THR A 1 639 ? -20.522 48.193  -35.002 1.00 82.98  ? 718  THR A HA   1 
ATOM   9688  H  HB   . THR A 1 639 ? -22.843 48.804  -34.835 1.00 74.80  ? 718  THR A HB   1 
ATOM   9689  H  HG1  . THR A 1 639 ? -22.486 50.111  -33.083 1.00 75.18  ? 718  THR A HG1  1 
ATOM   9690  H  HG21 . THR A 1 639 ? -24.003 48.265  -32.878 1.00 81.19  ? 718  THR A HG21 1 
ATOM   9691  H  HG22 . THR A 1 639 ? -23.620 46.944  -33.653 1.00 81.19  ? 718  THR A HG22 1 
ATOM   9692  H  HG23 . THR A 1 639 ? -22.783 47.389  -32.391 1.00 81.19  ? 718  THR A HG23 1 
ATOM   9693  N  N    . GLY A 1 640 ? -20.763 45.752  -33.042 1.00 102.03 ? 719  GLY A N    1 
ATOM   9694  C  CA   . GLY A 1 640 ? -20.168 45.053  -31.919 1.00 98.91  ? 719  GLY A CA   1 
ATOM   9695  C  C    . GLY A 1 640 ? -18.732 44.658  -32.205 1.00 99.52  ? 719  GLY A C    1 
ATOM   9696  O  O    . GLY A 1 640 ? -17.892 44.622  -31.306 1.00 98.95  ? 719  GLY A O    1 
ATOM   9697  H  H    . GLY A 1 640 ? -21.321 45.278  -33.493 1.00 122.44 ? 719  GLY A H    1 
ATOM   9698  H  HA2  . GLY A 1 640 ? -20.182 45.623  -31.134 1.00 118.70 ? 719  GLY A HA2  1 
ATOM   9699  H  HA3  . GLY A 1 640 ? -20.678 44.250  -31.727 1.00 118.70 ? 719  GLY A HA3  1 
ATOM   9700  N  N    . ILE A 1 641 ? -18.451 44.357  -33.468 1.00 74.63  ? 720  ILE A N    1 
ATOM   9701  C  CA   . ILE A 1 641 ? -17.103 43.995  -33.887 1.00 79.10  ? 720  ILE A CA   1 
ATOM   9702  C  C    . ILE A 1 641 ? -16.167 45.199  -33.811 1.00 85.00  ? 720  ILE A C    1 
ATOM   9703  O  O    . ILE A 1 641 ? -15.095 45.126  -33.209 1.00 85.98  ? 720  ILE A O    1 
ATOM   9704  C  CB   . ILE A 1 641 ? -17.097 43.436  -35.325 1.00 75.72  ? 720  ILE A CB   1 
ATOM   9705  C  CG1  . ILE A 1 641 ? -17.908 42.139  -35.383 1.00 75.32  ? 720  ILE A CG1  1 
ATOM   9706  C  CG2  . ILE A 1 641 ? -15.663 43.184  -35.803 1.00 76.26  ? 720  ILE A CG2  1 
ATOM   9707  C  CD1  . ILE A 1 641 ? -18.102 41.585  -36.778 1.00 78.94  ? 720  ILE A CD1  1 
ATOM   9708  H  H    . ILE A 1 641 ? -19.028 44.354  -34.105 1.00 89.56  ? 720  ILE A H    1 
ATOM   9709  H  HA   . ILE A 1 641 ? -16.760 43.308  -33.295 1.00 94.93  ? 720  ILE A HA   1 
ATOM   9710  H  HB   . ILE A 1 641 ? -17.510 44.087  -35.913 1.00 90.86  ? 720  ILE A HB   1 
ATOM   9711  H  HG12 . ILE A 1 641 ? -17.452 41.463  -34.858 1.00 90.38  ? 720  ILE A HG12 1 
ATOM   9712  H  HG13 . ILE A 1 641 ? -18.787 42.306  -35.007 1.00 90.38  ? 720  ILE A HG13 1 
ATOM   9713  H  HG21 . ILE A 1 641 ? -15.689 42.833  -36.707 1.00 91.51  ? 720  ILE A HG21 1 
ATOM   9714  H  HG22 . ILE A 1 641 ? -15.173 44.021  -35.786 1.00 91.51  ? 720  ILE A HG22 1 
ATOM   9715  H  HG23 . ILE A 1 641 ? -15.241 42.542  -35.211 1.00 91.51  ? 720  ILE A HG23 1 
ATOM   9716  H  HD11 . ILE A 1 641 ? -18.623 40.768  -36.724 1.00 94.72  ? 720  ILE A HD11 1 
ATOM   9717  H  HD12 . ILE A 1 641 ? -18.571 42.242  -37.316 1.00 94.72  ? 720  ILE A HD12 1 
ATOM   9718  H  HD13 . ILE A 1 641 ? -17.233 41.398  -37.167 1.00 94.72  ? 720  ILE A HD13 1 
ATOM   9719  N  N    . GLU A 1 642 ? -16.581 46.305  -34.423 1.00 111.75 ? 721  GLU A N    1 
ATOM   9720  C  CA   . GLU A 1 642 ? -15.750 47.502  -34.514 1.00 115.60 ? 721  GLU A CA   1 
ATOM   9721  C  C    . GLU A 1 642 ? -15.410 48.089  -33.147 1.00 121.37 ? 721  GLU A C    1 
ATOM   9722  O  O    . GLU A 1 642 ? -14.269 48.478  -32.901 1.00 128.39 ? 721  GLU A O    1 
ATOM   9723  C  CB   . GLU A 1 642 ? -16.449 48.560  -35.371 1.00 119.73 ? 721  GLU A CB   1 
ATOM   9724  C  CG   . GLU A 1 642 ? -16.619 48.158  -36.829 1.00 123.08 ? 721  GLU A CG   1 
ATOM   9725  C  CD   . GLU A 1 642 ? -15.293 48.000  -37.554 1.00 127.85 ? 721  GLU A CD   1 
ATOM   9726  O  OE1  . GLU A 1 642 ? -14.300 48.630  -37.133 1.00 132.96 ? 721  GLU A OE1  1 
ATOM   9727  O  OE2  . GLU A 1 642 ? -15.246 47.243  -38.546 1.00 125.27 ? 721  GLU A OE2  1 
ATOM   9728  H  H    . GLU A 1 642 ? -17.351 46.387  -34.798 1.00 134.10 ? 721  GLU A H    1 
ATOM   9729  H  HA   . GLU A 1 642 ? -14.916 47.270  -34.952 1.00 138.73 ? 721  GLU A HA   1 
ATOM   9730  H  HB2  . GLU A 1 642 ? -17.332 48.724  -35.005 1.00 143.68 ? 721  GLU A HB2  1 
ATOM   9731  H  HB3  . GLU A 1 642 ? -15.926 49.376  -35.347 1.00 143.68 ? 721  GLU A HB3  1 
ATOM   9732  H  HG2  . GLU A 1 642 ? -17.086 47.309  -36.870 1.00 147.69 ? 721  GLU A HG2  1 
ATOM   9733  H  HG3  . GLU A 1 642 ? -17.132 48.842  -37.287 1.00 147.69 ? 721  GLU A HG3  1 
ATOM   9734  N  N    . ASN A 1 643 ? -16.400 48.159  -32.263 1.00 119.59 ? 722  ASN A N    1 
ATOM   9735  C  CA   . ASN A 1 643 ? -16.187 48.722  -30.935 1.00 122.08 ? 722  ASN A CA   1 
ATOM   9736  C  C    . ASN A 1 643 ? -15.427 47.740  -30.047 1.00 116.46 ? 722  ASN A C    1 
ATOM   9737  O  O    . ASN A 1 643 ? -14.643 48.146  -29.189 1.00 122.35 ? 722  ASN A O    1 
ATOM   9738  C  CB   . ASN A 1 643 ? -17.521 49.103  -30.283 1.00 126.88 ? 722  ASN A CB   1 
ATOM   9739  C  CG   . ASN A 1 643 ? -17.404 50.321  -29.380 1.00 133.85 ? 722  ASN A CG   1 
ATOM   9740  O  OD1  . ASN A 1 643 ? -16.337 50.604  -28.835 1.00 136.58 ? 722  ASN A OD1  1 
ATOM   9741  N  ND2  . ASN A 1 643 ? -18.506 51.049  -29.218 1.00 134.49 ? 722  ASN A ND2  1 
ATOM   9742  H  H    . ASN A 1 643 ? -17.204 47.889  -32.408 1.00 143.51 ? 722  ASN A H    1 
ATOM   9743  H  HA   . ASN A 1 643 ? -15.653 49.527  -31.016 1.00 146.50 ? 722  ASN A HA   1 
ATOM   9744  H  HB2  . ASN A 1 643 ? -18.166 49.305  -30.978 1.00 152.26 ? 722  ASN A HB2  1 
ATOM   9745  H  HB3  . ASN A 1 643 ? -17.834 48.359  -29.745 1.00 152.26 ? 722  ASN A HB3  1 
ATOM   9746  H  HD21 . ASN A 1 643 ? -18.490 51.747  -28.717 1.00 161.39 ? 722  ASN A HD21 1 
ATOM   9747  H  HD22 . ASN A 1 643 ? -19.234 50.820  -29.615 1.00 161.39 ? 722  ASN A HD22 1 
ATOM   9748  N  N    . GLY A 1 644 ? -15.661 46.448  -30.262 1.00 107.72 ? 723  GLY A N    1 
ATOM   9749  C  CA   . GLY A 1 644 ? -14.984 45.405  -29.510 1.00 110.63 ? 723  GLY A CA   1 
ATOM   9750  C  C    . GLY A 1 644 ? -15.537 45.200  -28.110 1.00 110.63 ? 723  GLY A C    1 
ATOM   9751  O  O    . GLY A 1 644 ? -15.125 44.277  -27.405 1.00 104.91 ? 723  GLY A O    1 
ATOM   9752  H  H    . GLY A 1 644 ? -16.217 46.149  -30.846 1.00 129.26 ? 723  GLY A H    1 
ATOM   9753  H  HA2  . GLY A 1 644 ? -15.058 44.566  -29.991 1.00 132.76 ? 723  GLY A HA2  1 
ATOM   9754  H  HA3  . GLY A 1 644 ? -14.043 45.629  -29.433 1.00 132.76 ? 723  GLY A HA3  1 
ATOM   9755  N  N    . ASP A 1 645 ? -16.468 46.062  -27.706 1.00 126.46 ? 724  ASP A N    1 
ATOM   9756  C  CA   . ASP A 1 645 ? -17.130 45.943  -26.410 1.00 122.28 ? 724  ASP A CA   1 
ATOM   9757  C  C    . ASP A 1 645 ? -18.641 45.986  -26.593 1.00 119.97 ? 724  ASP A C    1 
ATOM   9758  O  O    . ASP A 1 645 ? -19.234 47.051  -26.758 1.00 122.92 ? 724  ASP A O    1 
ATOM   9759  C  CB   . ASP A 1 645 ? -16.665 47.041  -25.445 1.00 126.20 ? 724  ASP A CB   1 
ATOM   9760  C  CG   . ASP A 1 645 ? -16.481 48.385  -26.125 1.00 134.51 ? 724  ASP A CG   1 
ATOM   9761  O  OD1  . ASP A 1 645 ? -17.484 49.104  -26.318 1.00 136.41 ? 724  ASP A OD1  1 
ATOM   9762  O  OD2  . ASP A 1 645 ? -15.325 48.728  -26.450 1.00 137.68 ? 724  ASP A OD2  1 
ATOM   9763  H  H    . ASP A 1 645 ? -16.737 46.733  -28.172 1.00 151.75 ? 724  ASP A H    1 
ATOM   9764  H  HA   . ASP A 1 645 ? -16.901 45.086  -26.018 1.00 146.73 ? 724  ASP A HA   1 
ATOM   9765  H  HB2  . ASP A 1 645 ? -17.329 47.148  -24.746 1.00 151.44 ? 724  ASP A HB2  1 
ATOM   9766  H  HB3  . ASP A 1 645 ? -15.814 46.782  -25.058 1.00 151.44 ? 724  ASP A HB3  1 
HETATM 9767  N  N    . MSE A 1 646 ? -19.247 44.804  -26.578 1.00 116.99 ? 725  MSE A N    1 
HETATM 9768  C  CA   . MSE A 1 646 ? -20.688 44.653  -26.704 1.00 104.31 ? 725  MSE A CA   1 
HETATM 9769  C  C    . MSE A 1 646 ? -21.091 43.530  -25.756 1.00 100.91 ? 725  MSE A C    1 
HETATM 9770  O  O    . MSE A 1 646 ? -20.640 42.398  -25.930 1.00 102.28 ? 725  MSE A O    1 
HETATM 9771  C  CB   . MSE A 1 646 ? -21.056 44.289  -28.144 1.00 97.39  ? 725  MSE A CB   1 
HETATM 9772  C  CG   . MSE A 1 646 ? -22.549 44.105  -28.388 1.00 95.17  ? 725  MSE A CG   1 
HETATM 9773  SE SE   . MSE A 1 646 ? -23.567 45.761  -28.242 1.00 125.02 ? 725  MSE A SE   1 
HETATM 9774  C  CE   . MSE A 1 646 ? -22.785 46.708  -29.752 1.00 107.47 ? 725  MSE A CE   1 
HETATM 9775  H  H    . MSE A 1 646 ? -18.831 44.056  -26.494 1.00 140.38 ? 725  MSE A H    1 
HETATM 9776  H  HA   . MSE A 1 646 ? -21.135 45.478  -26.458 1.00 125.17 ? 725  MSE A HA   1 
HETATM 9777  H  HB2  . MSE A 1 646 ? -20.747 44.997  -28.731 1.00 116.87 ? 725  MSE A HB2  1 
HETATM 9778  H  HB3  . MSE A 1 646 ? -20.615 43.457  -28.376 1.00 116.87 ? 725  MSE A HB3  1 
HETATM 9779  H  HG2  . MSE A 1 646 ? -22.681 43.752  -29.282 1.00 114.21 ? 725  MSE A HG2  1 
HETATM 9780  H  HG3  . MSE A 1 646 ? -22.900 43.481  -27.733 1.00 114.21 ? 725  MSE A HG3  1 
HETATM 9781  H  HE1  . MSE A 1 646 ? -23.197 47.583  -29.822 1.00 128.97 ? 725  MSE A HE1  1 
HETATM 9782  H  HE2  . MSE A 1 646 ? -21.831 46.801  -29.606 1.00 128.97 ? 725  MSE A HE2  1 
HETATM 9783  H  HE3  . MSE A 1 646 ? -22.948 46.199  -30.562 1.00 128.97 ? 725  MSE A HE3  1 
ATOM   9784  N  N    . PRO A 1 647 ? -21.922 43.837  -24.741 1.00 67.71  ? 726  PRO A N    1 
ATOM   9785  C  CA   . PRO A 1 647 ? -22.262 42.833  -23.727 1.00 63.85  ? 726  PRO A CA   1 
ATOM   9786  C  C    . PRO A 1 647 ? -22.703 41.495  -24.309 1.00 61.66  ? 726  PRO A C    1 
ATOM   9787  O  O    . PRO A 1 647 ? -23.653 41.452  -25.096 1.00 57.87  ? 726  PRO A O    1 
ATOM   9788  C  CB   . PRO A 1 647 ? -23.417 43.485  -22.964 1.00 64.17  ? 726  PRO A CB   1 
ATOM   9789  C  CG   . PRO A 1 647 ? -23.170 44.926  -23.087 1.00 67.43  ? 726  PRO A CG   1 
ATOM   9790  C  CD   . PRO A 1 647 ? -22.565 45.132  -24.451 1.00 68.93  ? 726  PRO A CD   1 
ATOM   9791  H  HA   . PRO A 1 647 ? -21.515 42.693  -23.125 1.00 76.62  ? 726  PRO A HA   1 
ATOM   9792  H  HB2  . PRO A 1 647 ? -24.261 43.243  -23.376 1.00 77.00  ? 726  PRO A HB2  1 
ATOM   9793  H  HB3  . PRO A 1 647 ? -23.394 43.209  -22.035 1.00 77.00  ? 726  PRO A HB3  1 
ATOM   9794  H  HG2  . PRO A 1 647 ? -24.009 45.406  -23.011 1.00 80.92  ? 726  PRO A HG2  1 
ATOM   9795  H  HG3  . PRO A 1 647 ? -22.552 45.208  -22.395 1.00 80.92  ? 726  PRO A HG3  1 
ATOM   9796  H  HD2  . PRO A 1 647 ? -23.258 45.319  -25.103 1.00 82.72  ? 726  PRO A HD2  1 
ATOM   9797  H  HD3  . PRO A 1 647 ? -21.902 45.840  -24.424 1.00 82.72  ? 726  PRO A HD3  1 
ATOM   9798  N  N    . GLU A 1 648 ? -21.989 40.440  -23.915 1.00 66.32  ? 727  GLU A N    1 
ATOM   9799  C  CA   . GLU A 1 648 ? -22.284 39.053  -24.274 1.00 58.95  ? 727  GLU A CA   1 
ATOM   9800  C  C    . GLU A 1 648 ? -23.737 38.757  -24.625 1.00 56.93  ? 727  GLU A C    1 
ATOM   9801  O  O    . GLU A 1 648 ? -24.037 38.309  -25.732 1.00 60.13  ? 727  GLU A O    1 
ATOM   9802  C  CB   . GLU A 1 648 ? -21.880 38.153  -23.101 1.00 55.83  ? 727  GLU A CB   1 
ATOM   9803  C  CG   . GLU A 1 648 ? -22.563 36.796  -22.996 1.00 53.94  ? 727  GLU A CG   1 
ATOM   9804  C  CD   . GLU A 1 648 ? -22.317 36.159  -21.638 1.00 63.64  ? 727  GLU A CD   1 
ATOM   9805  O  OE1  . GLU A 1 648 ? -21.156 36.189  -21.171 1.00 63.25  ? 727  GLU A OE1  1 
ATOM   9806  O  OE2  . GLU A 1 648 ? -23.286 35.654  -21.025 1.00 67.27  ? 727  GLU A OE2  1 
ATOM   9807  H  H    . GLU A 1 648 ? -21.294 40.510  -23.412 1.00 79.59  ? 727  GLU A H    1 
ATOM   9808  H  HA   . GLU A 1 648 ? -21.739 38.807  -25.038 1.00 70.75  ? 727  GLU A HA   1 
ATOM   9809  H  HB2  . GLU A 1 648 ? -20.926 37.987  -23.164 1.00 67.00  ? 727  GLU A HB2  1 
ATOM   9810  H  HB3  . GLU A 1 648 ? -22.066 38.630  -22.278 1.00 67.00  ? 727  GLU A HB3  1 
ATOM   9811  H  HG2  . GLU A 1 648 ? -23.519 36.908  -23.111 1.00 64.73  ? 727  GLU A HG2  1 
ATOM   9812  H  HG3  . GLU A 1 648 ? -22.209 36.204  -23.678 1.00 64.73  ? 727  GLU A HG3  1 
ATOM   9813  N  N    . GLN A 1 649 ? -24.645 39.085  -23.733 1.00 58.30  ? 728  GLN A N    1 
ATOM   9814  C  CA   . GLN A 1 649 ? -26.038 38.667  -23.850 1.00 61.47  ? 728  GLN A CA   1 
ATOM   9815  C  C    . GLN A 1 649 ? -26.727 39.315  -25.053 1.00 62.13  ? 728  GLN A C    1 
ATOM   9816  O  O    . GLN A 1 649 ? -27.580 38.690  -25.685 1.00 62.81  ? 728  GLN A O    1 
ATOM   9817  C  CB   . GLN A 1 649 ? -26.810 38.973  -22.563 1.00 67.15  ? 728  GLN A CB   1 
ATOM   9818  C  CG   . GLN A 1 649 ? -26.479 38.030  -21.415 1.00 69.13  ? 728  GLN A CG   1 
ATOM   9819  C  CD   . GLN A 1 649 ? -26.826 36.583  -21.726 1.00 68.52  ? 728  GLN A CD   1 
ATOM   9820  O  OE1  . GLN A 1 649 ? -27.865 36.293  -22.320 1.00 67.26  ? 728  GLN A OE1  1 
ATOM   9821  N  NE2  . GLN A 1 649 ? -25.946 35.668  -21.334 1.00 67.31  ? 728  GLN A NE2  1 
ATOM   9822  H  H    . GLN A 1 649 ? -24.455 39.407  -22.937 1.00 69.96  ? 728  GLN A H    1 
ATOM   9823  H  HA   . GLN A 1 649 ? -26.078 37.708  -23.984 1.00 73.76  ? 728  GLN A HA   1 
ATOM   9824  H  HB2  . GLN A 1 649 ? -26.598 39.875  -22.277 1.00 80.58  ? 728  GLN A HB2  1 
ATOM   9825  H  HB3  . GLN A 1 649 ? -27.760 38.899  -22.743 1.00 80.58  ? 728  GLN A HB3  1 
ATOM   9826  H  HG2  . GLN A 1 649 ? -25.528 38.078  -21.230 1.00 82.96  ? 728  GLN A HG2  1 
ATOM   9827  H  HG3  . GLN A 1 649 ? -26.984 38.298  -20.631 1.00 82.96  ? 728  GLN A HG3  1 
ATOM   9828  H  HE21 . GLN A 1 649 ? -25.227 35.909  -20.928 1.00 80.77  ? 728  GLN A HE21 1 
ATOM   9829  H  HE22 . GLN A 1 649 ? -26.095 34.835  -21.486 1.00 80.77  ? 728  GLN A HE22 1 
ATOM   9830  N  N    . ILE A 1 650 ? -26.363 40.554  -25.377 1.00 49.03  ? 729  ILE A N    1 
ATOM   9831  C  CA   . ILE A 1 650 ? -26.921 41.211  -26.557 1.00 46.39  ? 729  ILE A CA   1 
ATOM   9832  C  C    . ILE A 1 650 ? -26.404 40.530  -27.818 1.00 46.26  ? 729  ILE A C    1 
ATOM   9833  O  O    . ILE A 1 650 ? -27.173 40.265  -28.742 1.00 46.50  ? 729  ILE A O    1 
ATOM   9834  C  CB   . ILE A 1 650 ? -26.585 42.721  -26.610 1.00 52.89  ? 729  ILE A CB   1 
ATOM   9835  C  CG1  . ILE A 1 650 ? -27.288 43.447  -25.459 1.00 55.93  ? 729  ILE A CG1  1 
ATOM   9836  C  CG2  . ILE A 1 650 ? -26.997 43.323  -27.967 1.00 53.52  ? 729  ILE A CG2  1 
ATOM   9837  C  CD1  . ILE A 1 650 ? -27.147 44.966  -25.467 1.00 60.06  ? 729  ILE A CD1  1 
ATOM   9838  H  H    . ILE A 1 650 ? -25.800 41.031  -24.935 1.00 58.83  ? 729  ILE A H    1 
ATOM   9839  H  HA   . ILE A 1 650 ? -27.886 41.120  -26.542 1.00 55.67  ? 729  ILE A HA   1 
ATOM   9840  H  HB   . ILE A 1 650 ? -25.627 42.828  -26.503 1.00 63.47  ? 729  ILE A HB   1 
ATOM   9841  H  HG12 . ILE A 1 650 ? -28.235 43.241  -25.498 1.00 67.12  ? 729  ILE A HG12 1 
ATOM   9842  H  HG13 . ILE A 1 650 ? -26.921 43.124  -24.621 1.00 67.12  ? 729  ILE A HG13 1 
ATOM   9843  H  HG21 . ILE A 1 650 ? -26.776 44.268  -27.973 1.00 64.23  ? 729  ILE A HG21 1 
ATOM   9844  H  HG22 . ILE A 1 650 ? -26.516 42.866  -28.674 1.00 64.23  ? 729  ILE A HG22 1 
ATOM   9845  H  HG23 . ILE A 1 650 ? -27.952 43.206  -28.087 1.00 64.23  ? 729  ILE A HG23 1 
ATOM   9846  H  HD11 . ILE A 1 650 ? -27.624 45.331  -24.705 1.00 72.07  ? 729  ILE A HD11 1 
ATOM   9847  H  HD12 . ILE A 1 650 ? -26.207 45.196  -25.411 1.00 72.07  ? 729  ILE A HD12 1 
ATOM   9848  H  HD13 . ILE A 1 650 ? -27.525 45.313  -26.290 1.00 72.07  ? 729  ILE A HD13 1 
ATOM   9849  N  N    . VAL A 1 651 ? -25.101 40.252  -27.853 1.00 42.48  ? 730  VAL A N    1 
ATOM   9850  C  CA   . VAL A 1 651 ? -24.489 39.602  -29.011 1.00 42.21  ? 730  VAL A CA   1 
ATOM   9851  C  C    . VAL A 1 651 ? -25.154 38.254  -29.268 1.00 40.29  ? 730  VAL A C    1 
ATOM   9852  O  O    . VAL A 1 651 ? -25.557 37.963  -30.397 1.00 40.09  ? 730  VAL A O    1 
ATOM   9853  C  CB   . VAL A 1 651 ? -22.957 39.405  -28.835 1.00 42.80  ? 730  VAL A CB   1 
ATOM   9854  C  CG1  . VAL A 1 651 ? -22.344 38.679  -30.047 1.00 42.55  ? 730  VAL A CG1  1 
ATOM   9855  C  CG2  . VAL A 1 651 ? -22.270 40.739  -28.633 1.00 44.94  ? 730  VAL A CG2  1 
ATOM   9856  H  H    . VAL A 1 651 ? -24.549 40.429  -27.217 1.00 50.97  ? 730  VAL A H    1 
ATOM   9857  H  HA   . VAL A 1 651 ? -24.629 40.158  -29.794 1.00 50.65  ? 730  VAL A HA   1 
ATOM   9858  H  HB   . VAL A 1 651 ? -22.796 38.862  -28.047 1.00 51.36  ? 730  VAL A HB   1 
ATOM   9859  H  HG11 . VAL A 1 651 ? -21.391 38.574  -29.902 1.00 51.06  ? 730  VAL A HG11 1 
ATOM   9860  H  HG12 . VAL A 1 651 ? -22.764 37.809  -30.138 1.00 51.06  ? 730  VAL A HG12 1 
ATOM   9861  H  HG13 . VAL A 1 651 ? -22.502 39.208  -30.844 1.00 51.06  ? 730  VAL A HG13 1 
ATOM   9862  H  HG21 . VAL A 1 651 ? -21.318 40.590  -28.526 1.00 53.93  ? 730  VAL A HG21 1 
ATOM   9863  H  HG22 . VAL A 1 651 ? -22.433 41.298  -29.409 1.00 53.93  ? 730  VAL A HG22 1 
ATOM   9864  H  HG23 . VAL A 1 651 ? -22.631 41.162  -27.838 1.00 53.93  ? 730  VAL A HG23 1 
ATOM   9865  N  N    . ILE A 1 652 ? -25.275 37.448  -28.215 1.00 40.40  ? 731  ILE A N    1 
ATOM   9866  C  CA   . ILE A 1 652 ? -25.919 36.141  -28.304 1.00 38.70  ? 731  ILE A CA   1 
ATOM   9867  C  C    . ILE A 1 652 ? -27.265 36.249  -28.992 1.00 40.95  ? 731  ILE A C    1 
ATOM   9868  O  O    . ILE A 1 652 ? -27.529 35.552  -29.968 1.00 46.58  ? 731  ILE A O    1 
ATOM   9869  C  CB   . ILE A 1 652 ? -26.175 35.533  -26.900 1.00 41.88  ? 731  ILE A CB   1 
ATOM   9870  C  CG1  . ILE A 1 652 ? -24.865 35.302  -26.143 1.00 39.94  ? 731  ILE A CG1  1 
ATOM   9871  C  CG2  . ILE A 1 652 ? -26.961 34.219  -26.986 1.00 40.94  ? 731  ILE A CG2  1 
ATOM   9872  C  CD1  . ILE A 1 652 ? -23.795 34.623  -26.934 1.00 45.69  ? 731  ILE A CD1  1 
ATOM   9873  H  H    . ILE A 1 652 ? -24.987 37.639  -27.428 1.00 48.48  ? 731  ILE A H    1 
ATOM   9874  H  HA   . ILE A 1 652 ? -25.359 35.532  -28.810 1.00 46.44  ? 731  ILE A HA   1 
ATOM   9875  H  HB   . ILE A 1 652 ? -26.706 36.167  -26.392 1.00 50.25  ? 731  ILE A HB   1 
ATOM   9876  H  HG12 . ILE A 1 652 ? -24.517 36.161  -25.856 1.00 47.93  ? 731  ILE A HG12 1 
ATOM   9877  H  HG13 . ILE A 1 652 ? -25.050 34.750  -25.366 1.00 47.93  ? 731  ILE A HG13 1 
ATOM   9878  H  HG21 . ILE A 1 652 ? -27.099 33.874  -26.089 1.00 49.12  ? 731  ILE A HG21 1 
ATOM   9879  H  HG22 . ILE A 1 652 ? -27.817 34.390  -27.409 1.00 49.12  ? 731  ILE A HG22 1 
ATOM   9880  H  HG23 . ILE A 1 652 ? -26.454 33.581  -27.512 1.00 49.12  ? 731  ILE A HG23 1 
ATOM   9881  H  HD11 . ILE A 1 652 ? -23.008 34.520  -26.376 1.00 54.83  ? 731  ILE A HD11 1 
ATOM   9882  H  HD12 . ILE A 1 652 ? -24.116 33.753  -27.218 1.00 54.83  ? 731  ILE A HD12 1 
ATOM   9883  H  HD13 . ILE A 1 652 ? -23.583 35.167  -27.708 1.00 54.83  ? 731  ILE A HD13 1 
ATOM   9884  N  N    . HIS A 1 653 ? -28.116 37.131  -28.478 1.00 44.41  ? 732  HIS A N    1 
ATOM   9885  C  CA   . HIS A 1 653 ? -29.504 37.178  -28.912 1.00 47.66  ? 732  HIS A CA   1 
ATOM   9886  C  C    . HIS A 1 653 ? -29.676 37.790  -30.291 1.00 46.59  ? 732  HIS A C    1 
ATOM   9887  O  O    . HIS A 1 653 ? -30.597 37.422  -31.016 1.00 51.45  ? 732  HIS A O    1 
ATOM   9888  C  CB   . HIS A 1 653 ? -30.358 37.906  -27.881 1.00 44.09  ? 732  HIS A CB   1 
ATOM   9889  C  CG   . HIS A 1 653 ? -30.689 37.060  -26.693 1.00 39.79  ? 732  HIS A CG   1 
ATOM   9890  N  ND1  . HIS A 1 653 ? -30.014 37.159  -25.496 1.00 39.02  ? 732  HIS A ND1  1 
ATOM   9891  C  CD2  . HIS A 1 653 ? -31.599 36.073  -26.534 1.00 35.03  ? 732  HIS A CD2  1 
ATOM   9892  C  CE1  . HIS A 1 653 ? -30.509 36.281  -24.642 1.00 37.19  ? 732  HIS A CE1  1 
ATOM   9893  N  NE2  . HIS A 1 653 ? -31.472 35.610  -25.245 1.00 39.04  ? 732  HIS A NE2  1 
ATOM   9894  H  H    . HIS A 1 653 ? -27.913 37.713  -27.878 1.00 53.29  ? 732  HIS A H    1 
ATOM   9895  H  HA   . HIS A 1 653 ? -29.834 36.268  -28.963 1.00 57.20  ? 732  HIS A HA   1 
ATOM   9896  H  HB2  . HIS A 1 653 ? -29.876 38.687  -27.568 1.00 52.91  ? 732  HIS A HB2  1 
ATOM   9897  H  HB3  . HIS A 1 653 ? -31.192 38.177  -28.297 1.00 52.91  ? 732  HIS A HB3  1 
ATOM   9898  H  HD1  . HIS A 1 653 ? -29.376 37.712  -25.328 1.00 46.82  ? 732  HIS A HD1  1 
ATOM   9899  H  HD2  . HIS A 1 653 ? -32.204 35.772  -27.172 1.00 42.04  ? 732  HIS A HD2  1 
ATOM   9900  H  HE1  . HIS A 1 653 ? -30.227 36.157  -23.765 1.00 44.63  ? 732  HIS A HE1  1 
ATOM   9901  H  HE2  . HIS A 1 653 ? -31.943 34.983  -24.890 1.00 46.85  ? 732  HIS A HE2  1 
ATOM   9902  N  N    . ALA A 1 654 ? -28.788 38.708  -30.659 1.00 50.72  ? 733  ALA A N    1 
ATOM   9903  C  CA   . ALA A 1 654 ? -28.753 39.196  -32.030 1.00 58.81  ? 733  ALA A CA   1 
ATOM   9904  C  C    . ALA A 1 654 ? -28.438 38.022  -32.948 1.00 59.79  ? 733  ALA A C    1 
ATOM   9905  O  O    . ALA A 1 654 ? -29.206 37.725  -33.864 1.00 60.08  ? 733  ALA A O    1 
ATOM   9906  C  CB   . ALA A 1 654 ? -27.716 40.294  -32.192 1.00 62.37  ? 733  ALA A CB   1 
ATOM   9907  H  H    . ALA A 1 654 ? -28.202 39.061  -30.138 1.00 60.87  ? 733  ALA A H    1 
ATOM   9908  H  HA   . ALA A 1 654 ? -29.622 39.553  -32.271 1.00 70.57  ? 733  ALA A HA   1 
ATOM   9909  H  HB1  . ALA A 1 654 ? -27.718 40.596  -33.114 1.00 74.85  ? 733  ALA A HB1  1 
ATOM   9910  H  HB2  . ALA A 1 654 ? -27.941 41.030  -31.602 1.00 74.85  ? 733  ALA A HB2  1 
ATOM   9911  H  HB3  . ALA A 1 654 ? -26.843 39.940  -31.961 1.00 74.85  ? 733  ALA A HB3  1 
ATOM   9912  N  N    . LEU A 1 655 ? -27.315 37.354  -32.685 1.00 39.86  ? 734  LEU A N    1 
ATOM   9913  C  CA   . LEU A 1 655 ? -26.908 36.184  -33.460 1.00 41.45  ? 734  LEU A CA   1 
ATOM   9914  C  C    . LEU A 1 655 ? -28.082 35.235  -33.667 1.00 42.79  ? 734  LEU A C    1 
ATOM   9915  O  O    . LEU A 1 655 ? -28.357 34.813  -34.788 1.00 45.73  ? 734  LEU A O    1 
ATOM   9916  C  CB   . LEU A 1 655 ? -25.753 35.446  -32.772 1.00 42.77  ? 734  LEU A CB   1 
ATOM   9917  C  CG   . LEU A 1 655 ? -24.328 35.939  -33.043 1.00 42.29  ? 734  LEU A CG   1 
ATOM   9918  C  CD1  . LEU A 1 655 ? -23.345 35.228  -32.113 1.00 39.08  ? 734  LEU A CD1  1 
ATOM   9919  C  CD2  . LEU A 1 655 ? -23.938 35.736  -34.507 1.00 43.07  ? 734  LEU A CD2  1 
ATOM   9920  H  H    . LEU A 1 655 ? -26.766 37.562  -32.056 1.00 47.83  ? 734  LEU A H    1 
ATOM   9921  H  HA   . LEU A 1 655 ? -26.600 36.474  -34.332 1.00 49.74  ? 734  LEU A HA   1 
ATOM   9922  H  HB2  . LEU A 1 655 ? -25.893 35.500  -31.813 1.00 51.33  ? 734  LEU A HB2  1 
ATOM   9923  H  HB3  . LEU A 1 655 ? -25.787 34.516  -33.045 1.00 51.33  ? 734  LEU A HB3  1 
ATOM   9924  H  HG   . LEU A 1 655 ? -24.284 36.889  -32.852 1.00 50.74  ? 734  LEU A HG   1 
ATOM   9925  H  HD11 . LEU A 1 655 ? -22.449 35.550  -32.296 1.00 46.90  ? 734  LEU A HD11 1 
ATOM   9926  H  HD12 . LEU A 1 655 ? -23.585 35.421  -31.193 1.00 46.90  ? 734  LEU A HD12 1 
ATOM   9927  H  HD13 . LEU A 1 655 ? -23.393 34.273  -32.274 1.00 46.90  ? 734  LEU A HD13 1 
ATOM   9928  H  HD21 . LEU A 1 655 ? -23.033 36.059  -34.640 1.00 51.69  ? 734  LEU A HD21 1 
ATOM   9929  H  HD22 . LEU A 1 655 ? -23.987 34.791  -34.719 1.00 51.69  ? 734  LEU A HD22 1 
ATOM   9930  H  HD23 . LEU A 1 655 ? -24.552 36.234  -35.069 1.00 51.69  ? 734  LEU A HD23 1 
ATOM   9931  N  N    . GLN A 1 656 ? -28.780 34.914  -32.583 1.00 47.58  ? 735  GLN A N    1 
ATOM   9932  C  CA   . GLN A 1 656 ? -30.001 34.123  -32.667 1.00 45.16  ? 735  GLN A CA   1 
ATOM   9933  C  C    . GLN A 1 656 ? -31.052 34.813  -33.525 1.00 44.12  ? 735  GLN A C    1 
ATOM   9934  O  O    . GLN A 1 656 ? -31.633 34.202  -34.418 1.00 40.60  ? 735  GLN A O    1 
ATOM   9935  C  CB   . GLN A 1 656 ? -30.582 33.906  -31.277 1.00 45.40  ? 735  GLN A CB   1 
ATOM   9936  C  CG   . GLN A 1 656 ? -30.094 32.667  -30.578 1.00 47.12  ? 735  GLN A CG   1 
ATOM   9937  C  CD   . GLN A 1 656 ? -30.608 32.596  -29.160 1.00 48.94  ? 735  GLN A CD   1 
ATOM   9938  O  OE1  . GLN A 1 656 ? -30.953 33.617  -28.564 1.00 50.65  ? 735  GLN A OE1  1 
ATOM   9939  N  NE2  . GLN A 1 656 ? -30.682 31.390  -28.614 1.00 53.35  ? 735  GLN A NE2  1 
ATOM   9940  H  H    . GLN A 1 656 ? -28.566 35.144  -31.783 1.00 57.10  ? 735  GLN A H    1 
ATOM   9941  H  HA   . GLN A 1 656 ? -29.802 33.258  -33.058 1.00 54.20  ? 735  GLN A HA   1 
ATOM   9942  H  HB2  . GLN A 1 656 ? -30.350 34.667  -30.722 1.00 54.48  ? 735  GLN A HB2  1 
ATOM   9943  H  HB3  . GLN A 1 656 ? -31.547 33.839  -31.352 1.00 54.48  ? 735  GLN A HB3  1 
ATOM   9944  H  HG2  . GLN A 1 656 ? -30.409 31.884  -31.055 1.00 56.54  ? 735  GLN A HG2  1 
ATOM   9945  H  HG3  . GLN A 1 656 ? -29.124 32.677  -30.549 1.00 56.54  ? 735  GLN A HG3  1 
ATOM   9946  H  HE21 . GLN A 1 656 ? -30.442 30.699  -29.066 1.00 64.02  ? 735  GLN A HE21 1 
ATOM   9947  H  HE22 . GLN A 1 656 ? -30.969 31.299  -27.809 1.00 64.02  ? 735  GLN A HE22 1 
ATOM   9948  N  N    . CYS A 1 657 ? -31.293 36.090  -33.245 1.00 46.69  ? 736  CYS A N    1 
ATOM   9949  C  CA   . CYS A 1 657 ? -32.370 36.822  -33.899 1.00 49.88  ? 736  CYS A CA   1 
ATOM   9950  C  C    . CYS A 1 657 ? -32.208 36.879  -35.421 1.00 56.28  ? 736  CYS A C    1 
ATOM   9951  O  O    . CYS A 1 657 ? -33.160 36.598  -36.147 1.00 62.03  ? 736  CYS A O    1 
ATOM   9952  C  CB   . CYS A 1 657 ? -32.497 38.235  -33.324 1.00 54.29  ? 736  CYS A CB   1 
ATOM   9953  S  SG   . CYS A 1 657 ? -34.063 39.038  -33.721 1.00 51.84  ? 736  CYS A SG   1 
ATOM   9954  H  H    . CYS A 1 657 ? -30.846 36.556  -32.677 1.00 56.03  ? 736  CYS A H    1 
ATOM   9955  H  HA   . CYS A 1 657 ? -33.204 36.361  -33.717 1.00 59.86  ? 736  CYS A HA   1 
ATOM   9956  H  HB2  . CYS A 1 657 ? -32.425 38.187  -32.358 1.00 65.15  ? 736  CYS A HB2  1 
ATOM   9957  H  HB3  . CYS A 1 657 ? -31.782 38.784  -33.681 1.00 65.15  ? 736  CYS A HB3  1 
ATOM   9958  H  HG   . CYS A 1 657 ? -34.168 39.121  -34.914 1.00 62.20  ? 736  CYS A HG   1 
ATOM   9959  N  N    . THR A 1 658 ? -31.018 37.230  -35.909 1.00 47.71  ? 737  THR A N    1 
ATOM   9960  C  CA   . THR A 1 658 ? -30.809 37.314  -37.360 1.00 46.56  ? 737  THR A CA   1 
ATOM   9961  C  C    . THR A 1 658 ? -30.762 35.926  -38.002 1.00 41.32  ? 737  THR A C    1 
ATOM   9962  O  O    . THR A 1 658 ? -31.017 35.786  -39.198 1.00 41.84  ? 737  THR A O    1 
ATOM   9963  C  CB   . THR A 1 658 ? -29.549 38.147  -37.783 1.00 43.29  ? 737  THR A CB   1 
ATOM   9964  O  OG1  . THR A 1 658 ? -28.913 37.527  -38.908 1.00 47.76  ? 737  THR A OG1  1 
ATOM   9965  C  CG2  . THR A 1 658 ? -28.538 38.286  -36.664 1.00 42.80  ? 737  THR A CG2  1 
ATOM   9966  H  H    . THR A 1 658 ? -30.326 37.421  -35.435 1.00 57.26  ? 737  THR A H    1 
ATOM   9967  H  HA   . THR A 1 658 ? -31.578 37.767  -37.739 1.00 55.88  ? 737  THR A HA   1 
ATOM   9968  H  HB   . THR A 1 658 ? -29.835 39.038  -38.037 1.00 51.94  ? 737  THR A HB   1 
ATOM   9969  H  HG1  . THR A 1 658 ? -28.671 36.747  -38.708 1.00 57.31  ? 737  THR A HG1  1 
ATOM   9970  H  HG21 . THR A 1 658 ? -27.778 38.807  -36.968 1.00 51.36  ? 737  THR A HG21 1 
ATOM   9971  H  HG22 . THR A 1 658 ? -28.944 38.734  -35.905 1.00 51.36  ? 737  THR A HG22 1 
ATOM   9972  H  HG23 . THR A 1 658 ? -28.229 37.410  -36.385 1.00 51.36  ? 737  THR A HG23 1 
ATOM   9973  N  N    . HIS A 1 659 ? -30.438 34.908  -37.208 1.00 49.78  ? 738  HIS A N    1 
ATOM   9974  C  CA   . HIS A 1 659 ? -30.510 33.527  -37.679 1.00 46.55  ? 738  HIS A CA   1 
ATOM   9975  C  C    . HIS A 1 659 ? -31.944 33.238  -38.093 1.00 46.98  ? 738  HIS A C    1 
ATOM   9976  O  O    . HIS A 1 659 ? -32.189 32.639  -39.137 1.00 53.17  ? 738  HIS A O    1 
ATOM   9977  C  CB   . HIS A 1 659 ? -30.057 32.547  -36.588 1.00 46.69  ? 738  HIS A CB   1 
ATOM   9978  C  CG   . HIS A 1 659 ? -30.116 31.104  -36.997 1.00 44.52  ? 738  HIS A CG   1 
ATOM   9979  N  ND1  . HIS A 1 659 ? -29.723 30.660  -38.239 1.00 49.20  ? 738  HIS A ND1  1 
ATOM   9980  C  CD2  . HIS A 1 659 ? -30.518 30.008  -36.310 1.00 48.21  ? 738  HIS A CD2  1 
ATOM   9981  C  CE1  . HIS A 1 659 ? -29.884 29.346  -38.304 1.00 48.51  ? 738  HIS A CE1  1 
ATOM   9982  N  NE2  . HIS A 1 659 ? -30.363 28.929  -37.150 1.00 45.53  ? 738  HIS A NE2  1 
ATOM   9983  H  H    . HIS A 1 659 ? -30.175 34.989  -36.393 1.00 59.74  ? 738  HIS A H    1 
ATOM   9984  H  HA   . HIS A 1 659 ? -29.935 33.416  -38.453 1.00 55.86  ? 738  HIS A HA   1 
ATOM   9985  H  HB2  . HIS A 1 659 ? -29.139 32.749  -36.349 1.00 56.03  ? 738  HIS A HB2  1 
ATOM   9986  H  HB3  . HIS A 1 659 ? -30.629 32.658  -35.812 1.00 56.03  ? 738  HIS A HB3  1 
ATOM   9987  H  HD1  . HIS A 1 659 ? -29.422 31.158  -38.872 1.00 59.04  ? 738  HIS A HD1  1 
ATOM   9988  H  HD2  . HIS A 1 659 ? -30.839 29.988  -35.438 1.00 57.85  ? 738  HIS A HD2  1 
ATOM   9989  H  HE1  . HIS A 1 659 ? -29.691 28.810  -39.040 1.00 58.21  ? 738  HIS A HE1  1 
ATOM   9990  H  HE2  . HIS A 1 659 ? -30.550 28.113  -36.954 1.00 54.64  ? 738  HIS A HE2  1 
ATOM   9991  N  N    . TYR A 1 660 ? -32.891 33.696  -37.280 1.00 39.46  ? 739  TYR A N    1 
ATOM   9992  C  CA   . TYR A 1 660 ? -34.311 33.477  -37.546 1.00 47.11  ? 739  TYR A CA   1 
ATOM   9993  C  C    . TYR A 1 660 ? -34.829 34.344  -38.695 1.00 50.89  ? 739  TYR A C    1 
ATOM   9994  O  O    . TYR A 1 660 ? -35.689 33.908  -39.459 1.00 50.59  ? 739  TYR A O    1 
ATOM   9995  C  CB   . TYR A 1 660 ? -35.133 33.744  -36.284 1.00 41.71  ? 739  TYR A CB   1 
ATOM   9996  C  CG   . TYR A 1 660 ? -34.694 32.922  -35.098 1.00 42.88  ? 739  TYR A CG   1 
ATOM   9997  C  CD1  . TYR A 1 660 ? -34.371 31.579  -35.242 1.00 43.79  ? 739  TYR A CD1  1 
ATOM   9998  C  CD2  . TYR A 1 660 ? -34.591 33.490  -33.837 1.00 39.56  ? 739  TYR A CD2  1 
ATOM   9999  C  CE1  . TYR A 1 660 ? -33.967 30.822  -34.162 1.00 38.10  ? 739  TYR A CE1  1 
ATOM   10000 C  CE2  . TYR A 1 660 ? -34.184 32.742  -32.749 1.00 34.08  ? 739  TYR A CE2  1 
ATOM   10001 C  CZ   . TYR A 1 660 ? -33.870 31.409  -32.918 1.00 35.33  ? 739  TYR A CZ   1 
ATOM   10002 O  OH   . TYR A 1 660 ? -33.464 30.659  -31.840 1.00 38.14  ? 739  TYR A OH   1 
ATOM   10003 H  H    . TYR A 1 660 ? -32.736 34.141  -36.561 1.00 47.36  ? 739  TYR A H    1 
ATOM   10004 H  HA   . TYR A 1 660 ? -34.443 32.548  -37.794 1.00 56.54  ? 739  TYR A HA   1 
ATOM   10005 H  HB2  . TYR A 1 660 ? -35.047 34.680  -36.045 1.00 50.05  ? 739  TYR A HB2  1 
ATOM   10006 H  HB3  . TYR A 1 660 ? -36.063 33.534  -36.464 1.00 50.05  ? 739  TYR A HB3  1 
ATOM   10007 H  HD1  . TYR A 1 660 ? -34.434 31.182  -36.081 1.00 52.55  ? 739  TYR A HD1  1 
ATOM   10008 H  HD2  . TYR A 1 660 ? -34.800 34.389  -33.721 1.00 47.47  ? 739  TYR A HD2  1 
ATOM   10009 H  HE1  . TYR A 1 660 ? -33.754 29.923  -34.274 1.00 45.72  ? 739  TYR A HE1  1 
ATOM   10010 H  HE2  . TYR A 1 660 ? -34.120 33.135  -31.909 1.00 40.90  ? 739  TYR A HE2  1 
ATOM   10011 H  HH   . TYR A 1 660 ? -33.448 31.136  -31.148 1.00 45.77  ? 739  TYR A HH   1 
ATOM   10012 N  N    . VAL A 1 661 ? -34.317 35.568  -38.812 1.00 57.46  ? 740  VAL A N    1 
ATOM   10013 C  CA   . VAL A 1 661 ? -34.699 36.446  -39.920 1.00 56.10  ? 740  VAL A CA   1 
ATOM   10014 C  C    . VAL A 1 661 ? -34.343 35.777  -41.238 1.00 51.84  ? 740  VAL A C    1 
ATOM   10015 O  O    . VAL A 1 661 ? -35.169 35.686  -42.143 1.00 58.42  ? 740  VAL A O    1 
ATOM   10016 C  CB   . VAL A 1 661 ? -33.993 37.824  -39.857 1.00 56.71  ? 740  VAL A CB   1 
ATOM   10017 C  CG1  . VAL A 1 661 ? -34.387 38.695  -41.051 1.00 59.98  ? 740  VAL A CG1  1 
ATOM   10018 C  CG2  . VAL A 1 661 ? -34.333 38.544  -38.565 1.00 53.73  ? 740  VAL A CG2  1 
ATOM   10019 H  H    . VAL A 1 661 ? -33.748 35.913  -38.267 1.00 68.95  ? 740  VAL A H    1 
ATOM   10020 H  HA   . VAL A 1 661 ? -35.658 36.591  -39.899 1.00 67.32  ? 740  VAL A HA   1 
ATOM   10021 H  HB   . VAL A 1 661 ? -33.032 37.691  -39.884 1.00 68.06  ? 740  VAL A HB   1 
ATOM   10022 H  HG11 . VAL A 1 661 ? -33.931 39.548  -40.983 1.00 71.98  ? 740  VAL A HG11 1 
ATOM   10023 H  HG12 . VAL A 1 661 ? -34.128 38.244  -41.870 1.00 71.98  ? 740  VAL A HG12 1 
ATOM   10024 H  HG13 . VAL A 1 661 ? -35.348 38.831  -41.038 1.00 71.98  ? 740  VAL A HG13 1 
ATOM   10025 H  HG21 . VAL A 1 661 ? -33.879 39.401  -38.553 1.00 64.47  ? 740  VAL A HG21 1 
ATOM   10026 H  HG22 . VAL A 1 661 ? -35.293 38.677  -38.521 1.00 64.47  ? 740  VAL A HG22 1 
ATOM   10027 H  HG23 . VAL A 1 661 ? -34.039 38.003  -37.815 1.00 64.47  ? 740  VAL A HG23 1 
ATOM   10028 N  N    . ILE A 1 662 ? -33.104 35.307  -41.333 1.00 43.45  ? 741  ILE A N    1 
ATOM   10029 C  CA   . ILE A 1 662 ? -32.639 34.582  -42.506 1.00 44.15  ? 741  ILE A CA   1 
ATOM   10030 C  C    . ILE A 1 662 ? -33.528 33.369  -42.764 1.00 45.38  ? 741  ILE A C    1 
ATOM   10031 O  O    . ILE A 1 662 ? -34.151 33.265  -43.821 1.00 50.51  ? 741  ILE A O    1 
ATOM   10032 C  CB   . ILE A 1 662 ? -31.170 34.133  -42.326 1.00 43.60  ? 741  ILE A CB   1 
ATOM   10033 C  CG1  . ILE A 1 662 ? -30.242 35.347  -42.394 1.00 44.86  ? 741  ILE A CG1  1 
ATOM   10034 C  CG2  . ILE A 1 662 ? -30.764 33.105  -43.384 1.00 44.00  ? 741  ILE A CG2  1 
ATOM   10035 C  CD1  . ILE A 1 662 ? -28.806 35.042  -42.028 1.00 50.68  ? 741  ILE A CD1  1 
ATOM   10036 H  H    . ILE A 1 662 ? -32.506 35.398  -40.721 1.00 52.14  ? 741  ILE A H    1 
ATOM   10037 H  HA   . ILE A 1 662 ? -32.687 35.163  -43.281 1.00 52.98  ? 741  ILE A HA   1 
ATOM   10038 H  HB   . ILE A 1 662 ? -31.078 33.726  -41.451 1.00 52.31  ? 741  ILE A HB   1 
ATOM   10039 H  HG12 . ILE A 1 662 ? -30.249 35.695  -43.299 1.00 53.84  ? 741  ILE A HG12 1 
ATOM   10040 H  HG13 . ILE A 1 662 ? -30.567 36.023  -41.779 1.00 53.84  ? 741  ILE A HG13 1 
ATOM   10041 H  HG21 . ILE A 1 662 ? -29.839 32.850  -43.238 1.00 52.80  ? 741  ILE A HG21 1 
ATOM   10042 H  HG22 . ILE A 1 662 ? -31.338 32.327  -43.305 1.00 52.80  ? 741  ILE A HG22 1 
ATOM   10043 H  HG23 . ILE A 1 662 ? -30.863 33.501  -44.264 1.00 52.80  ? 741  ILE A HG23 1 
ATOM   10044 H  HD11 . ILE A 1 662 ? -28.284 35.857  -42.095 1.00 60.82  ? 741  ILE A HD11 1 
ATOM   10045 H  HD12 . ILE A 1 662 ? -28.777 34.704  -41.119 1.00 60.82  ? 741  ILE A HD12 1 
ATOM   10046 H  HD13 . ILE A 1 662 ? -28.459 34.376  -42.641 1.00 60.82  ? 741  ILE A HD13 1 
ATOM   10047 N  N    . LEU A 1 663 ? -33.593 32.466  -41.789 1.00 51.37  ? 742  LEU A N    1 
ATOM   10048 C  CA   . LEU A 1 663 ? -34.324 31.213  -41.949 1.00 50.09  ? 742  LEU A CA   1 
ATOM   10049 C  C    . LEU A 1 663 ? -35.782 31.424  -42.371 1.00 51.40  ? 742  LEU A C    1 
ATOM   10050 O  O    . LEU A 1 663 ? -36.319 30.657  -43.173 1.00 52.85  ? 742  LEU A O    1 
ATOM   10051 C  CB   . LEU A 1 663 ? -34.272 30.392  -40.654 1.00 47.09  ? 742  LEU A CB   1 
ATOM   10052 C  CG   . LEU A 1 663 ? -32.962 29.689  -40.274 1.00 50.51  ? 742  LEU A CG   1 
ATOM   10053 C  CD1  . LEU A 1 663 ? -33.252 28.587  -39.265 1.00 47.28  ? 742  LEU A CD1  1 
ATOM   10054 C  CD2  . LEU A 1 663 ? -32.206 29.127  -41.475 1.00 54.78  ? 742  LEU A CD2  1 
ATOM   10055 H  H    . LEU A 1 663 ? -33.219 32.557  -41.020 1.00 61.64  ? 742  LEU A H    1 
ATOM   10056 H  HA   . LEU A 1 663 ? -33.892 30.692  -42.643 1.00 60.11  ? 742  LEU A HA   1 
ATOM   10057 H  HB2  . LEU A 1 663 ? -34.493 30.986  -39.920 1.00 56.50  ? 742  LEU A HB2  1 
ATOM   10058 H  HB3  . LEU A 1 663 ? -34.951 29.702  -40.716 1.00 56.50  ? 742  LEU A HB3  1 
ATOM   10059 H  HG   . LEU A 1 663 ? -32.381 30.335  -39.842 1.00 60.61  ? 742  LEU A HG   1 
ATOM   10060 H  HD11 . LEU A 1 663 ? -32.420 28.148  -39.030 1.00 56.74  ? 742  LEU A HD11 1 
ATOM   10061 H  HD12 . LEU A 1 663 ? -33.653 28.981  -38.475 1.00 56.74  ? 742  LEU A HD12 1 
ATOM   10062 H  HD13 . LEU A 1 663 ? -33.863 27.948  -39.663 1.00 56.74  ? 742  LEU A HD13 1 
ATOM   10063 H  HD21 . LEU A 1 663 ? -31.393 28.700  -41.163 1.00 65.74  ? 742  LEU A HD21 1 
ATOM   10064 H  HD22 . LEU A 1 663 ? -32.769 28.480  -41.926 1.00 65.74  ? 742  LEU A HD22 1 
ATOM   10065 H  HD23 . LEU A 1 663 ? -31.988 29.855  -42.078 1.00 65.74  ? 742  LEU A HD23 1 
ATOM   10066 N  N    . TRP A 1 664 ? -36.423 32.459  -41.839 1.00 50.93  ? 743  TRP A N    1 
ATOM   10067 C  CA   . TRP A 1 664 ? -37.824 32.715  -42.159 1.00 58.74  ? 743  TRP A CA   1 
ATOM   10068 C  C    . TRP A 1 664 ? -37.996 33.167  -43.605 1.00 66.35  ? 743  TRP A C    1 
ATOM   10069 O  O    . TRP A 1 664 ? -38.968 32.803  -44.265 1.00 68.79  ? 743  TRP A O    1 
ATOM   10070 C  CB   . TRP A 1 664 ? -38.426 33.751  -41.208 1.00 55.57  ? 743  TRP A CB   1 
ATOM   10071 C  CG   . TRP A 1 664 ? -39.040 33.144  -39.979 1.00 55.39  ? 743  TRP A CG   1 
ATOM   10072 C  CD1  . TRP A 1 664 ? -38.634 33.310  -38.686 1.00 55.63  ? 743  TRP A CD1  1 
ATOM   10073 C  CD2  . TRP A 1 664 ? -40.169 32.264  -39.935 1.00 55.38  ? 743  TRP A CD2  1 
ATOM   10074 N  NE1  . TRP A 1 664 ? -39.443 32.589  -37.840 1.00 51.33  ? 743  TRP A NE1  1 
ATOM   10075 C  CE2  . TRP A 1 664 ? -40.387 31.936  -38.581 1.00 51.68  ? 743  TRP A CE2  1 
ATOM   10076 C  CE3  . TRP A 1 664 ? -41.012 31.722  -40.908 1.00 59.46  ? 743  TRP A CE3  1 
ATOM   10077 C  CZ2  . TRP A 1 664 ? -41.430 31.099  -38.179 1.00 54.63  ? 743  TRP A CZ2  1 
ATOM   10078 C  CZ3  . TRP A 1 664 ? -42.040 30.887  -40.505 1.00 57.10  ? 743  TRP A CZ3  1 
ATOM   10079 C  CH2  . TRP A 1 664 ? -42.242 30.587  -39.152 1.00 55.21  ? 743  TRP A CH2  1 
ATOM   10080 H  H    . TRP A 1 664 ? -36.073 33.025  -41.294 1.00 61.12  ? 743  TRP A H    1 
ATOM   10081 H  HA   . TRP A 1 664 ? -38.322 31.890  -42.048 1.00 70.49  ? 743  TRP A HA   1 
ATOM   10082 H  HB2  . TRP A 1 664 ? -37.727 34.359  -40.922 1.00 66.68  ? 743  TRP A HB2  1 
ATOM   10083 H  HB3  . TRP A 1 664 ? -39.120 34.241  -41.676 1.00 66.68  ? 743  TRP A HB3  1 
ATOM   10084 H  HD1  . TRP A 1 664 ? -37.913 33.832  -38.417 1.00 66.76  ? 743  TRP A HD1  1 
ATOM   10085 H  HE1  . TRP A 1 664 ? -39.366 32.553  -36.985 1.00 61.60  ? 743  TRP A HE1  1 
ATOM   10086 H  HE3  . TRP A 1 664 ? -40.887 31.922  -41.808 1.00 71.35  ? 743  TRP A HE3  1 
ATOM   10087 H  HZ2  . TRP A 1 664 ? -41.563 30.893  -37.282 1.00 65.56  ? 743  TRP A HZ2  1 
ATOM   10088 H  HZ3  . TRP A 1 664 ? -42.609 30.522  -41.144 1.00 68.52  ? 743  TRP A HZ3  1 
ATOM   10089 H  HH2  . TRP A 1 664 ? -42.937 30.019  -38.911 1.00 66.26  ? 743  TRP A HH2  1 
ATOM   10090 N  N    . GLN A 1 665 ? -37.057 33.967  -44.096 1.00 66.08  ? 744  GLN A N    1 
ATOM   10091 C  CA   . GLN A 1 665 ? -37.092 34.398  -45.488 1.00 66.42  ? 744  GLN A CA   1 
ATOM   10092 C  C    . GLN A 1 665 ? -36.902 33.203  -46.423 1.00 66.98  ? 744  GLN A C    1 
ATOM   10093 O  O    . GLN A 1 665 ? -37.477 33.159  -47.511 1.00 71.31  ? 744  GLN A O    1 
ATOM   10094 C  CB   . GLN A 1 665 ? -36.032 35.472  -45.743 1.00 65.25  ? 744  GLN A CB   1 
ATOM   10095 C  CG   . GLN A 1 665 ? -36.571 36.892  -45.609 1.00 74.66  ? 744  GLN A CG   1 
ATOM   10096 C  CD   . GLN A 1 665 ? -35.506 37.900  -45.210 1.00 79.00  ? 744  GLN A CD   1 
ATOM   10097 O  OE1  . GLN A 1 665 ? -34.310 37.630  -45.311 1.00 78.47  ? 744  GLN A OE1  1 
ATOM   10098 N  NE2  . GLN A 1 665 ? -35.940 39.070  -44.748 1.00 79.01  ? 744  GLN A NE2  1 
ATOM   10099 H  H    . GLN A 1 665 ? -36.391 34.273  -43.646 1.00 79.29  ? 744  GLN A H    1 
ATOM   10100 H  HA   . GLN A 1 665 ? -37.961 34.786  -45.674 1.00 79.70  ? 744  GLN A HA   1 
ATOM   10101 H  HB2  . GLN A 1 665 ? -35.313 35.364  -45.102 1.00 78.30  ? 744  GLN A HB2  1 
ATOM   10102 H  HB3  . GLN A 1 665 ? -35.689 35.368  -46.645 1.00 78.30  ? 744  GLN A HB3  1 
ATOM   10103 H  HG2  . GLN A 1 665 ? -36.941 37.170  -46.461 1.00 89.59  ? 744  GLN A HG2  1 
ATOM   10104 H  HG3  . GLN A 1 665 ? -37.263 36.903  -44.929 1.00 89.59  ? 744  GLN A HG3  1 
ATOM   10105 H  HE21 . GLN A 1 665 ? -36.784 39.223  -44.689 1.00 94.81  ? 744  GLN A HE21 1 
ATOM   10106 H  HE22 . GLN A 1 665 ? -35.375 39.673  -44.509 1.00 94.81  ? 744  GLN A HE22 1 
ATOM   10107 N  N    . LEU A 1 666 ? -36.111 32.229  -45.982 1.00 54.76  ? 745  LEU A N    1 
ATOM   10108 C  CA   . LEU A 1 666 ? -35.890 31.008  -46.751 1.00 57.25  ? 745  LEU A CA   1 
ATOM   10109 C  C    . LEU A 1 666 ? -37.132 30.122  -46.722 1.00 61.64  ? 745  LEU A C    1 
ATOM   10110 O  O    . LEU A 1 666 ? -37.328 29.279  -47.599 1.00 61.01  ? 745  LEU A O    1 
ATOM   10111 C  CB   . LEU A 1 666 ? -34.683 30.243  -46.202 1.00 50.36  ? 745  LEU A CB   1 
ATOM   10112 C  CG   . LEU A 1 666 ? -34.467 28.823  -46.735 1.00 50.29  ? 745  LEU A CG   1 
ATOM   10113 C  CD1  . LEU A 1 666 ? -34.309 28.810  -48.251 1.00 59.23  ? 745  LEU A CD1  1 
ATOM   10114 C  CD2  . LEU A 1 666 ? -33.253 28.201  -46.080 1.00 55.39  ? 745  LEU A CD2  1 
ATOM   10115 H  H    . LEU A 1 666 ? -35.686 32.251  -45.235 1.00 65.71  ? 745  LEU A H    1 
ATOM   10116 H  HA   . LEU A 1 666 ? -35.706 31.241  -47.674 1.00 68.70  ? 745  LEU A HA   1 
ATOM   10117 H  HB2  . LEU A 1 666 ? -33.883 30.751  -46.408 1.00 60.43  ? 745  LEU A HB2  1 
ATOM   10118 H  HB3  . LEU A 1 666 ? -34.779 30.176  -45.239 1.00 60.43  ? 745  LEU A HB3  1 
ATOM   10119 H  HG   . LEU A 1 666 ? -35.240 28.281  -46.510 1.00 60.34  ? 745  LEU A HG   1 
ATOM   10120 H  HD11 . LEU A 1 666 ? -34.176 27.895  -48.546 1.00 71.07  ? 745  LEU A HD11 1 
ATOM   10121 H  HD12 . LEU A 1 666 ? -35.112 29.174  -48.655 1.00 71.07  ? 745  LEU A HD12 1 
ATOM   10122 H  HD13 . LEU A 1 666 ? -33.542 29.351  -48.493 1.00 71.07  ? 745  LEU A HD13 1 
ATOM   10123 H  HD21 . LEU A 1 666 ? -33.132 27.304  -46.429 1.00 66.47  ? 745  LEU A HD21 1 
ATOM   10124 H  HD22 . LEU A 1 666 ? -32.474 28.742  -46.281 1.00 66.47  ? 745  LEU A HD22 1 
ATOM   10125 H  HD23 . LEU A 1 666 ? -33.394 28.167  -45.121 1.00 66.47  ? 745  LEU A HD23 1 
ATOM   10126 N  N    . ALA A 1 667 ? -37.970 30.310  -45.707 1.00 56.93  ? 746  ALA A N    1 
ATOM   10127 C  CA   . ALA A 1 667 ? -39.200 29.534  -45.596 1.00 55.73  ? 746  ALA A CA   1 
ATOM   10128 C  C    . ALA A 1 667 ? -40.181 29.874  -46.723 1.00 59.77  ? 746  ALA A C    1 
ATOM   10129 O  O    . ALA A 1 667 ? -40.768 28.976  -47.327 1.00 60.74  ? 746  ALA A O    1 
ATOM   10130 C  CB   . ALA A 1 667 ? -39.852 29.745  -44.235 1.00 55.29  ? 746  ALA A CB   1 
ATOM   10131 H  H    . ALA A 1 667 ? -37.850 30.878  -45.073 1.00 68.32  ? 746  ALA A H    1 
ATOM   10132 H  HA   . ALA A 1 667 ? -38.980 28.593  -45.674 1.00 66.88  ? 746  ALA A HA   1 
ATOM   10133 H  HB1  . ALA A 1 667 ? -40.666 29.218  -44.190 1.00 66.35  ? 746  ALA A HB1  1 
ATOM   10134 H  HB2  . ALA A 1 667 ? -39.235 29.461  -43.543 1.00 66.35  ? 746  ALA A HB2  1 
ATOM   10135 H  HB3  . ALA A 1 667 ? -40.061 30.686  -44.128 1.00 66.35  ? 746  ALA A HB3  1 
ATOM   10136 N  N    . LYS A 1 668 ? -40.352 31.164  -47.010 1.00 90.49  ? 747  LYS A N    1 
ATOM   10137 C  CA   . LYS A 1 668 ? -41.274 31.590  -48.063 1.00 96.49  ? 747  LYS A CA   1 
ATOM   10138 C  C    . LYS A 1 668 ? -40.562 31.768  -49.401 1.00 101.27 ? 747  LYS A C    1 
ATOM   10139 O  O    . LYS A 1 668 ? -40.359 32.887  -49.873 1.00 104.96 ? 747  LYS A O    1 
ATOM   10140 C  CB   . LYS A 1 668 ? -42.030 32.865  -47.664 1.00 96.34  ? 747  LYS A CB   1 
ATOM   10141 C  CG   . LYS A 1 668 ? -41.175 34.022  -47.164 1.00 91.43  ? 747  LYS A CG   1 
ATOM   10142 C  CD   . LYS A 1 668 ? -42.071 35.167  -46.708 1.00 94.25  ? 747  LYS A CD   1 
ATOM   10143 C  CE   . LYS A 1 668 ? -41.465 35.984  -45.577 1.00 103.41 ? 747  LYS A CE   1 
ATOM   10144 N  NZ   . LYS A 1 668 ? -40.585 37.077  -46.070 1.00 109.55 ? 747  LYS A NZ   1 
ATOM   10145 H  H    . LYS A 1 668 ? -39.947 31.810  -46.612 1.00 108.58 ? 747  LYS A H    1 
ATOM   10146 H  HA   . LYS A 1 668 ? -41.936 30.891  -48.183 1.00 115.79 ? 747  LYS A HA   1 
ATOM   10147 H  HB2  . LYS A 1 668 ? -42.521 33.183  -48.438 1.00 115.61 ? 747  LYS A HB2  1 
ATOM   10148 H  HB3  . LYS A 1 668 ? -42.655 32.641  -46.957 1.00 115.61 ? 747  LYS A HB3  1 
ATOM   10149 H  HG2  . LYS A 1 668 ? -40.640 33.729  -46.409 1.00 109.72 ? 747  LYS A HG2  1 
ATOM   10150 H  HG3  . LYS A 1 668 ? -40.606 34.341  -47.882 1.00 109.72 ? 747  LYS A HG3  1 
ATOM   10151 H  HD2  . LYS A 1 668 ? -42.225 35.763  -47.458 1.00 113.10 ? 747  LYS A HD2  1 
ATOM   10152 H  HD3  . LYS A 1 668 ? -42.914 34.803  -46.396 1.00 113.10 ? 747  LYS A HD3  1 
ATOM   10153 H  HE2  . LYS A 1 668 ? -42.180 36.385  -45.058 1.00 124.09 ? 747  LYS A HE2  1 
ATOM   10154 H  HE3  . LYS A 1 668 ? -40.933 35.400  -45.014 1.00 124.09 ? 747  LYS A HE3  1 
ATOM   10155 H  HZ1  . LYS A 1 668 ? -40.250 37.532  -45.383 1.00 131.46 ? 747  LYS A HZ1  1 
ATOM   10156 H  HZ2  . LYS A 1 668 ? -39.914 36.735  -46.546 1.00 131.46 ? 747  LYS A HZ2  1 
ATOM   10157 H  HZ3  . LYS A 1 668 ? -41.050 37.633  -46.586 1.00 131.46 ? 747  LYS A HZ3  1 
ATOM   10158 N  N    . ILE A 1 669 ? -40.192 30.641  -50.003 1.00 86.63  ? 748  ILE A N    1 
ATOM   10159 C  CA   . ILE A 1 669 ? -39.557 30.624  -51.317 1.00 88.62  ? 748  ILE A CA   1 
ATOM   10160 C  C    . ILE A 1 669 ? -39.979 29.372  -52.081 1.00 88.03  ? 748  ILE A C    1 
ATOM   10161 O  O    . ILE A 1 669 ? -41.023 29.359  -52.734 1.00 91.64  ? 748  ILE A O    1 
ATOM   10162 C  CB   . ILE A 1 669 ? -38.009 30.706  -51.194 1.00 86.07  ? 748  ILE A CB   1 
ATOM   10163 C  CG1  . ILE A 1 669 ? -37.580 32.173  -51.055 1.00 81.26  ? 748  ILE A CG1  1 
ATOM   10164 C  CG2  . ILE A 1 669 ? -37.306 30.049  -52.395 1.00 86.33  ? 748  ILE A CG2  1 
ATOM   10165 C  CD1  . ILE A 1 669 ? -36.082 32.404  -50.995 1.00 75.73  ? 748  ILE A CD1  1 
ATOM   10166 H  H    . ILE A 1 669 ? -40.300 29.859  -49.664 1.00 103.96 ? 748  ILE A H    1 
ATOM   10167 H  HA   . ILE A 1 669 ? -39.857 31.396  -51.821 1.00 106.34 ? 748  ILE A HA   1 
ATOM   10168 H  HB   . ILE A 1 669 ? -37.742 30.234  -50.390 1.00 103.28 ? 748  ILE A HB   1 
ATOM   10169 H  HG12 . ILE A 1 669 ? -37.921 32.667  -51.816 1.00 97.51  ? 748  ILE A HG12 1 
ATOM   10170 H  HG13 . ILE A 1 669 ? -37.963 32.529  -50.238 1.00 97.51  ? 748  ILE A HG13 1 
ATOM   10171 H  HG21 . ILE A 1 669 ? -36.346 30.123  -52.278 1.00 103.59 ? 748  ILE A HG21 1 
ATOM   10172 H  HG22 . ILE A 1 669 ? -37.563 29.115  -52.439 1.00 103.59 ? 748  ILE A HG22 1 
ATOM   10173 H  HG23 . ILE A 1 669 ? -37.577 30.505  -53.208 1.00 103.59 ? 748  ILE A HG23 1 
ATOM   10174 H  HD11 . ILE A 1 669 ? -35.914 33.355  -50.907 1.00 90.87  ? 748  ILE A HD11 1 
ATOM   10175 H  HD12 . ILE A 1 669 ? -35.721 31.932  -50.229 1.00 90.87  ? 748  ILE A HD12 1 
ATOM   10176 H  HD13 . ILE A 1 669 ? -35.679 32.070  -51.811 1.00 90.87  ? 748  ILE A HD13 1 
ATOM   10177 N  N    . SER A 1 674 ? -39.149 33.430  -57.435 1.00 118.36 ? 753  SER A N    1 
ATOM   10178 C  CA   . SER A 1 674 ? -40.552 33.687  -57.134 1.00 123.83 ? 753  SER A CA   1 
ATOM   10179 C  C    . SER A 1 674 ? -40.733 34.186  -55.699 1.00 122.93 ? 753  SER A C    1 
ATOM   10180 O  O    . SER A 1 674 ? -41.246 33.450  -54.854 1.00 121.55 ? 753  SER A O    1 
ATOM   10181 C  CB   . SER A 1 674 ? -41.375 32.414  -57.345 1.00 122.11 ? 753  SER A CB   1 
ATOM   10182 O  OG   . SER A 1 674 ? -42.721 32.605  -56.943 1.00 117.42 ? 753  SER A OG   1 
ATOM   10183 H  HA   . SER A 1 674 ? -40.888 34.369  -57.737 1.00 148.60 ? 753  SER A HA   1 
ATOM   10184 H  HB2  . SER A 1 674 ? -41.358 32.181  -58.287 1.00 146.53 ? 753  SER A HB2  1 
ATOM   10185 H  HB3  . SER A 1 674 ? -40.988 31.697  -56.819 1.00 146.53 ? 753  SER A HB3  1 
ATOM   10186 H  HG   . SER A 1 674 ? -43.070 33.224  -57.391 1.00 140.90 ? 753  SER A HG   1 
ATOM   10187 N  N    . THR A 1 675 ? -40.313 35.418  -55.410 1.00 115.35 ? 754  THR A N    1 
ATOM   10188 C  CA   . THR A 1 675 ? -39.660 36.304  -56.376 1.00 120.15 ? 754  THR A CA   1 
ATOM   10189 C  C    . THR A 1 675 ? -38.170 36.006  -56.479 1.00 119.63 ? 754  THR A C    1 
ATOM   10190 O  O    . THR A 1 675 ? -37.634 35.216  -55.702 1.00 121.63 ? 754  THR A O    1 
ATOM   10191 C  CB   . THR A 1 675 ? -39.822 37.778  -55.969 1.00 123.41 ? 754  THR A CB   1 
ATOM   10192 O  OG1  . THR A 1 675 ? -39.900 37.876  -54.541 1.00 125.45 ? 754  THR A OG1  1 
ATOM   10193 C  CG2  . THR A 1 675 ? -41.079 38.366  -56.586 1.00 123.74 ? 754  THR A CG2  1 
ATOM   10194 H  H    . THR A 1 675 ? -40.399 35.776  -54.633 1.00 138.42 ? 754  THR A H    1 
ATOM   10195 H  HA   . THR A 1 675 ? -40.060 36.180  -57.250 1.00 144.18 ? 754  THR A HA   1 
ATOM   10196 H  HB   . THR A 1 675 ? -39.058 38.286  -56.285 1.00 148.09 ? 754  THR A HB   1 
ATOM   10197 H  HG1  . THR A 1 675 ? -39.989 38.679  -54.312 1.00 150.54 ? 754  THR A HG1  1 
ATOM   10198 H  HG21 . THR A 1 675 ? -41.173 39.295  -56.324 1.00 148.49 ? 754  THR A HG21 1 
ATOM   10199 H  HG22 . THR A 1 675 ? -41.029 38.314  -57.553 1.00 148.49 ? 754  THR A HG22 1 
ATOM   10200 H  HG23 . THR A 1 675 ? -41.858 37.873  -56.283 1.00 148.49 ? 754  THR A HG23 1 
ATOM   10201 N  N    . LYS A 1 676 ? -37.510 36.647  -57.440 1.00 110.39 ? 755  LYS A N    1 
ATOM   10202 C  CA   . LYS A 1 676 ? -36.075 36.477  -57.642 1.00 112.64 ? 755  LYS A CA   1 
ATOM   10203 C  C    . LYS A 1 676 ? -35.322 37.740  -57.227 1.00 117.78 ? 755  LYS A C    1 
ATOM   10204 O  O    . LYS A 1 676 ? -34.089 37.766  -57.203 1.00 112.22 ? 755  LYS A O    1 
ATOM   10205 C  CB   . LYS A 1 676 ? -35.784 36.148  -59.105 1.00 115.83 ? 755  LYS A CB   1 
ATOM   10206 C  CG   . LYS A 1 676 ? -34.784 35.013  -59.295 1.00 112.30 ? 755  LYS A CG   1 
ATOM   10207 C  CD   . LYS A 1 676 ? -34.506 34.742  -60.767 1.00 113.44 ? 755  LYS A CD   1 
ATOM   10208 C  CE   . LYS A 1 676 ? -35.732 34.211  -61.504 1.00 120.72 ? 755  LYS A CE   1 
ATOM   10209 N  NZ   . LYS A 1 676 ? -35.597 34.352  -62.976 1.00 127.37 ? 755  LYS A NZ   1 
ATOM   10210 H  H    . LYS A 1 676 ? -37.876 37.192  -57.996 1.00 132.47 ? 755  LYS A H    1 
ATOM   10211 H  HA   . LYS A 1 676 ? -35.759 35.741  -57.096 1.00 135.17 ? 755  LYS A HA   1 
ATOM   10212 H  HB2  . LYS A 1 676 ? -36.612 35.888  -59.537 1.00 139.00 ? 755  LYS A HB2  1 
ATOM   10213 H  HB3  . LYS A 1 676 ? -35.421 36.938  -59.536 1.00 139.00 ? 755  LYS A HB3  1 
ATOM   10214 H  HG2  . LYS A 1 676 ? -33.946 35.252  -58.868 1.00 134.76 ? 755  LYS A HG2  1 
ATOM   10215 H  HG3  . LYS A 1 676 ? -35.142 34.203  -58.900 1.00 134.76 ? 755  LYS A HG3  1 
ATOM   10216 H  HD2  . LYS A 1 676 ? -34.232 35.568  -61.195 1.00 136.12 ? 755  LYS A HD2  1 
ATOM   10217 H  HD3  . LYS A 1 676 ? -33.801 34.080  -60.840 1.00 136.12 ? 755  LYS A HD3  1 
ATOM   10218 H  HE2  . LYS A 1 676 ? -35.845 33.270  -61.299 1.00 144.86 ? 755  LYS A HE2  1 
ATOM   10219 H  HE3  . LYS A 1 676 ? -36.515 34.711  -61.223 1.00 144.86 ? 755  LYS A HE3  1 
ATOM   10220 H  HZ1  . LYS A 1 676 ? -36.324 34.036  -63.380 1.00 152.85 ? 755  LYS A HZ1  1 
ATOM   10221 H  HZ2  . LYS A 1 676 ? -35.497 35.210  -63.191 1.00 152.85 ? 755  LYS A HZ2  1 
ATOM   10222 H  HZ3  . LYS A 1 676 ? -34.886 33.898  -63.261 1.00 152.85 ? 755  LYS A HZ3  1 
ATOM   10223 N  N    . GLU A 1 677 ? -36.077 38.784  -56.902 1.00 145.60 ? 756  GLU A N    1 
ATOM   10224 C  CA   . GLU A 1 677 ? -35.510 40.018  -56.380 1.00 145.05 ? 756  GLU A CA   1 
ATOM   10225 C  C    . GLU A 1 677 ? -35.354 39.857  -54.873 1.00 136.97 ? 756  GLU A C    1 
ATOM   10226 O  O    . GLU A 1 677 ? -34.474 40.459  -54.255 1.00 136.82 ? 756  GLU A O    1 
ATOM   10227 C  CB   . GLU A 1 677 ? -36.416 41.208  -56.706 1.00 150.25 ? 756  GLU A CB   1 
ATOM   10228 C  CG   . GLU A 1 677 ? -36.588 41.492  -58.203 1.00 158.68 ? 756  GLU A CG   1 
ATOM   10229 C  CD   . GLU A 1 677 ? -37.539 40.531  -58.902 1.00 158.50 ? 756  GLU A CD   1 
ATOM   10230 O  OE1  . GLU A 1 677 ? -38.069 40.898  -59.973 1.00 155.02 ? 756  GLU A OE1  1 
ATOM   10231 O  OE2  . GLU A 1 677 ? -37.753 39.413  -58.388 1.00 158.81 ? 756  GLU A OE2  1 
ATOM   10232 H  H    . GLU A 1 677 ? -36.934 38.801  -56.977 1.00 174.72 ? 756  GLU A H    1 
ATOM   10233 H  HA   . GLU A 1 677 ? -34.636 40.172  -56.773 1.00 174.05 ? 756  GLU A HA   1 
ATOM   10234 H  HB2  . GLU A 1 677 ? -37.296 41.036  -56.336 1.00 180.31 ? 756  GLU A HB2  1 
ATOM   10235 H  HB3  . GLU A 1 677 ? -36.040 42.003  -56.297 1.00 180.31 ? 756  GLU A HB3  1 
ATOM   10236 H  HG2  . GLU A 1 677 ? -36.939 42.389  -58.313 1.00 190.41 ? 756  GLU A HG2  1 
ATOM   10237 H  HG3  . GLU A 1 677 ? -35.723 41.421  -58.637 1.00 190.41 ? 756  GLU A HG3  1 
ATOM   10238 N  N    . ASP A 1 678 ? -36.218 39.025  -54.295 1.00 126.33 ? 757  ASP A N    1 
ATOM   10239 C  CA   . ASP A 1 678 ? -36.113 38.634  -52.894 1.00 124.81 ? 757  ASP A CA   1 
ATOM   10240 C  C    . ASP A 1 678 ? -35.033 37.563  -52.741 1.00 123.99 ? 757  ASP A C    1 
ATOM   10241 O  O    . ASP A 1 678 ? -34.314 37.534  -51.742 1.00 122.87 ? 757  ASP A O    1 
ATOM   10242 C  CB   . ASP A 1 678 ? -37.451 38.079  -52.378 1.00 124.93 ? 757  ASP A CB   1 
ATOM   10243 C  CG   . ASP A 1 678 ? -38.496 39.161  -52.135 1.00 125.21 ? 757  ASP A CG   1 
ATOM   10244 O  OD1  . ASP A 1 678 ? -38.124 40.332  -51.916 1.00 127.61 ? 757  ASP A OD1  1 
ATOM   10245 O  OD2  . ASP A 1 678 ? -39.700 38.825  -52.147 1.00 119.10 ? 757  ASP A OD2  1 
ATOM   10246 H  H    . ASP A 1 678 ? -36.885 38.668  -54.703 1.00 151.60 ? 757  ASP A H    1 
ATOM   10247 H  HA   . ASP A 1 678 ? -35.867 39.404  -52.357 1.00 149.77 ? 757  ASP A HA   1 
ATOM   10248 H  HB2  . ASP A 1 678 ? -37.809 37.461  -53.034 1.00 149.91 ? 757  ASP A HB2  1 
ATOM   10249 H  HB3  . ASP A 1 678 ? -37.298 37.618  -51.539 1.00 149.91 ? 757  ASP A HB3  1 
ATOM   10250 N  N    . LEU A 1 679 ? -34.924 36.684  -53.736 1.00 103.13 ? 758  LEU A N    1 
ATOM   10251 C  CA   . LEU A 1 679 ? -34.012 35.540  -53.660 1.00 94.07  ? 758  LEU A CA   1 
ATOM   10252 C  C    . LEU A 1 679 ? -32.544 35.959  -53.683 1.00 93.82  ? 758  LEU A C    1 
ATOM   10253 O  O    . LEU A 1 679 ? -31.704 35.335  -53.033 1.00 88.98  ? 758  LEU A O    1 
ATOM   10254 C  CB   . LEU A 1 679 ? -34.283 34.552  -54.802 1.00 91.25  ? 758  LEU A CB   1 
ATOM   10255 C  CG   . LEU A 1 679 ? -33.331 33.355  -54.910 1.00 89.27  ? 758  LEU A CG   1 
ATOM   10256 C  CD1  . LEU A 1 679 ? -33.257 32.608  -53.597 1.00 90.66  ? 758  LEU A CD1  1 
ATOM   10257 C  CD2  . LEU A 1 679 ? -33.785 32.411  -56.008 1.00 83.20  ? 758  LEU A CD2  1 
ATOM   10258 H  H    . LEU A 1 679 ? -35.370 36.726  -54.470 1.00 123.76 ? 758  LEU A H    1 
ATOM   10259 H  HA   . LEU A 1 679 ? -34.170 35.074  -52.825 1.00 112.88 ? 758  LEU A HA   1 
ATOM   10260 H  HB2  . LEU A 1 679 ? -35.179 34.197  -54.689 1.00 109.50 ? 758  LEU A HB2  1 
ATOM   10261 H  HB3  . LEU A 1 679 ? -34.233 35.036  -55.641 1.00 109.50 ? 758  LEU A HB3  1 
ATOM   10262 H  HG   . LEU A 1 679 ? -32.442 33.673  -55.130 1.00 107.12 ? 758  LEU A HG   1 
ATOM   10263 H  HD11 . LEU A 1 679 ? -32.649 31.859  -53.694 1.00 108.79 ? 758  LEU A HD11 1 
ATOM   10264 H  HD12 . LEU A 1 679 ? -32.932 33.211  -52.909 1.00 108.79 ? 758  LEU A HD12 1 
ATOM   10265 H  HD13 . LEU A 1 679 ? -34.143 32.289  -53.365 1.00 108.79 ? 758  LEU A HD13 1 
ATOM   10266 H  HD21 . LEU A 1 679 ? -33.168 31.664  -56.056 1.00 99.84  ? 758  LEU A HD21 1 
ATOM   10267 H  HD22 . LEU A 1 679 ? -34.677 32.091  -55.800 1.00 99.84  ? 758  LEU A HD22 1 
ATOM   10268 H  HD23 . LEU A 1 679 ? -33.793 32.889  -56.852 1.00 99.84  ? 758  LEU A HD23 1 
ATOM   10269 N  N    . LEU A 1 680 ? -32.233 37.006  -54.438 1.00 95.18  ? 759  LEU A N    1 
ATOM   10270 C  CA   . LEU A 1 680 ? -30.864 37.503  -54.507 1.00 94.69  ? 759  LEU A CA   1 
ATOM   10271 C  C    . LEU A 1 680 ? -30.487 38.236  -53.222 1.00 88.85  ? 759  LEU A C    1 
ATOM   10272 O  O    . LEU A 1 680 ? -29.320 38.253  -52.830 1.00 84.88  ? 759  LEU A O    1 
ATOM   10273 C  CB   . LEU A 1 680 ? -30.680 38.417  -55.722 1.00 102.18 ? 759  LEU A CB   1 
ATOM   10274 C  CG   . LEU A 1 680 ? -30.646 37.704  -57.078 1.00 105.97 ? 759  LEU A CG   1 
ATOM   10275 C  CD1  . LEU A 1 680 ? -30.817 38.695  -58.224 1.00 114.27 ? 759  LEU A CD1  1 
ATOM   10276 C  CD2  . LEU A 1 680 ? -29.350 36.912  -57.240 1.00 93.63  ? 759  LEU A CD2  1 
ATOM   10277 H  H    . LEU A 1 680 ? -32.795 37.447  -54.918 1.00 114.21 ? 759  LEU A H    1 
ATOM   10278 H  HA   . LEU A 1 680 ? -30.262 36.749  -54.607 1.00 113.63 ? 759  LEU A HA   1 
ATOM   10279 H  HB2  . LEU A 1 680 ? -31.413 39.051  -55.744 1.00 122.61 ? 759  LEU A HB2  1 
ATOM   10280 H  HB3  . LEU A 1 680 ? -29.841 38.895  -55.623 1.00 122.61 ? 759  LEU A HB3  1 
ATOM   10281 H  HG   . LEU A 1 680 ? -31.384 37.076  -57.118 1.00 127.17 ? 759  LEU A HG   1 
ATOM   10282 H  HD11 . LEU A 1 680 ? -30.791 38.213  -59.065 1.00 137.13 ? 759  LEU A HD11 1 
ATOM   10283 H  HD12 . LEU A 1 680 ? -31.670 39.146  -58.127 1.00 137.13 ? 759  LEU A HD12 1 
ATOM   10284 H  HD13 . LEU A 1 680 ? -30.095 39.342  -58.191 1.00 137.13 ? 759  LEU A HD13 1 
ATOM   10285 H  HD21 . LEU A 1 680 ? -29.355 36.472  -58.104 1.00 112.36 ? 759  LEU A HD21 1 
ATOM   10286 H  HD22 . LEU A 1 680 ? -28.598 37.522  -57.183 1.00 112.36 ? 759  LEU A HD22 1 
ATOM   10287 H  HD23 . LEU A 1 680 ? -29.294 36.251  -56.532 1.00 112.36 ? 759  LEU A HD23 1 
ATOM   10288 N  N    . ARG A 1 681 ? -31.478 38.831  -52.565 1.00 120.23 ? 760  ARG A N    1 
ATOM   10289 C  CA   . ARG A 1 681 ? -31.239 39.545  -51.314 1.00 123.55 ? 760  ARG A CA   1 
ATOM   10290 C  C    . ARG A 1 681 ? -31.028 38.575  -50.153 1.00 121.47 ? 760  ARG A C    1 
ATOM   10291 O  O    . ARG A 1 681 ? -30.365 38.908  -49.173 1.00 118.84 ? 760  ARG A O    1 
ATOM   10292 C  CB   . ARG A 1 681 ? -32.406 40.478  -50.988 1.00 122.04 ? 760  ARG A CB   1 
ATOM   10293 C  CG   . ARG A 1 681 ? -32.187 41.338  -49.745 1.00 118.16 ? 760  ARG A CG   1 
ATOM   10294 C  CD   . ARG A 1 681 ? -33.404 42.196  -49.448 1.00 124.36 ? 760  ARG A CD   1 
ATOM   10295 N  NE   . ARG A 1 681 ? -34.607 41.389  -49.236 1.00 125.98 ? 760  ARG A NE   1 
ATOM   10296 C  CZ   . ARG A 1 681 ? -35.090 41.031  -48.046 1.00 127.58 ? 760  ARG A CZ   1 
ATOM   10297 N  NH1  . ARG A 1 681 ? -34.491 41.404  -46.921 1.00 126.41 ? 760  ARG A NH1  1 
ATOM   10298 N  NH2  . ARG A 1 681 ? -36.190 40.293  -47.980 1.00 129.66 ? 760  ARG A NH2  1 
ATOM   10299 H  H    . ARG A 1 681 ? -32.298 38.837  -52.822 1.00 144.27 ? 760  ARG A H    1 
ATOM   10300 H  HA   . ARG A 1 681 ? -30.438 40.084  -51.404 1.00 148.26 ? 760  ARG A HA   1 
ATOM   10301 H  HB2  . ARG A 1 681 ? -32.547 41.074  -51.739 1.00 146.45 ? 760  ARG A HB2  1 
ATOM   10302 H  HB3  . ARG A 1 681 ? -33.201 39.942  -50.840 1.00 146.45 ? 760  ARG A HB3  1 
ATOM   10303 H  HG2  . ARG A 1 681 ? -32.025 40.763  -48.981 1.00 141.79 ? 760  ARG A HG2  1 
ATOM   10304 H  HG3  . ARG A 1 681 ? -31.429 41.925  -49.891 1.00 141.79 ? 760  ARG A HG3  1 
ATOM   10305 H  HD2  . ARG A 1 681 ? -33.241 42.712  -48.643 1.00 149.24 ? 760  ARG A HD2  1 
ATOM   10306 H  HD3  . ARG A 1 681 ? -33.567 42.789  -50.198 1.00 149.24 ? 760  ARG A HD3  1 
ATOM   10307 H  HE   . ARG A 1 681 ? -35.035 41.125  -49.933 1.00 151.18 ? 760  ARG A HE   1 
ATOM   10308 H  HH11 . ARG A 1 681 ? -33.777 41.882  -46.952 1.00 151.69 ? 760  ARG A HH11 1 
ATOM   10309 H  HH12 . ARG A 1 681 ? -34.816 41.166  -46.161 1.00 151.69 ? 760  ARG A HH12 1 
ATOM   10310 H  HH21 . ARG A 1 681 ? -36.587 40.047  -48.702 1.00 155.60 ? 760  ARG A HH21 1 
ATOM   10311 H  HH22 . ARG A 1 681 ? -36.507 40.062  -47.215 1.00 155.60 ? 760  ARG A HH22 1 
ATOM   10312 N  N    . LEU A 1 682 ? -31.607 37.382  -50.253 1.00 84.66  ? 761  LEU A N    1 
ATOM   10313 C  CA   . LEU A 1 682 ? -31.445 36.379  -49.203 1.00 73.64  ? 761  LEU A CA   1 
ATOM   10314 C  C    . LEU A 1 682 ? -29.995 35.912  -49.112 1.00 67.00  ? 761  LEU A C    1 
ATOM   10315 O  O    . LEU A 1 682 ? -29.456 35.776  -48.014 1.00 65.62  ? 761  LEU A O    1 
ATOM   10316 C  CB   . LEU A 1 682 ? -32.368 35.181  -49.439 1.00 69.04  ? 761  LEU A CB   1 
ATOM   10317 C  CG   . LEU A 1 682 ? -32.215 34.001  -48.471 1.00 60.05  ? 761  LEU A CG   1 
ATOM   10318 C  CD1  . LEU A 1 682 ? -32.691 34.352  -47.070 1.00 59.53  ? 761  LEU A CD1  1 
ATOM   10319 C  CD2  . LEU A 1 682 ? -32.971 32.807  -49.006 1.00 61.20  ? 761  LEU A CD2  1 
ATOM   10320 H  H    . LEU A 1 682 ? -32.096 37.129  -50.913 1.00 101.60 ? 761  LEU A H    1 
ATOM   10321 H  HA   . LEU A 1 682 ? -31.684 36.775  -48.351 1.00 88.37  ? 761  LEU A HA   1 
ATOM   10322 H  HB2  . LEU A 1 682 ? -33.286 35.489  -49.375 1.00 82.85  ? 761  LEU A HB2  1 
ATOM   10323 H  HB3  . LEU A 1 682 ? -32.204 34.843  -50.333 1.00 82.85  ? 761  LEU A HB3  1 
ATOM   10324 H  HG   . LEU A 1 682 ? -31.277 33.760  -48.416 1.00 72.06  ? 761  LEU A HG   1 
ATOM   10325 H  HD11 . LEU A 1 682 ? -32.576 33.579  -46.495 1.00 71.44  ? 761  LEU A HD11 1 
ATOM   10326 H  HD12 . LEU A 1 682 ? -32.165 35.095  -46.735 1.00 71.44  ? 761  LEU A HD12 1 
ATOM   10327 H  HD13 . LEU A 1 682 ? -33.628 34.599  -47.108 1.00 71.44  ? 761  LEU A HD13 1 
ATOM   10328 H  HD21 . LEU A 1 682 ? -32.868 32.066  -48.388 1.00 73.44  ? 761  LEU A HD21 1 
ATOM   10329 H  HD22 . LEU A 1 682 ? -33.908 33.040  -49.092 1.00 73.44  ? 761  LEU A HD22 1 
ATOM   10330 H  HD23 . LEU A 1 682 ? -32.608 32.567  -49.873 1.00 73.44  ? 761  LEU A HD23 1 
ATOM   10331 N  N    . LYS A 1 683 ? -29.370 35.661  -50.259 1.00 81.13  ? 762  LYS A N    1 
ATOM   10332 C  CA   . LYS A 1 683 ? -27.972 35.253  -50.275 1.00 82.35  ? 762  LYS A CA   1 
ATOM   10333 C  C    . LYS A 1 683 ? -27.104 36.394  -49.764 1.00 80.95  ? 762  LYS A C    1 
ATOM   10334 O  O    . LYS A 1 683 ? -26.116 36.155  -49.079 1.00 76.61  ? 762  LYS A O    1 
ATOM   10335 C  CB   . LYS A 1 683 ? -27.523 34.838  -51.679 1.00 91.11  ? 762  LYS A CB   1 
ATOM   10336 C  CG   . LYS A 1 683 ? -26.182 34.097  -51.696 1.00 103.02 ? 762  LYS A CG   1 
ATOM   10337 C  CD   . LYS A 1 683 ? -25.730 33.736  -53.113 1.00 108.88 ? 762  LYS A CD   1 
ATOM   10338 C  CE   . LYS A 1 683 ? -24.270 33.280  -53.157 1.00 103.75 ? 762  LYS A CE   1 
ATOM   10339 N  NZ   . LYS A 1 683 ? -24.042 31.947  -52.525 1.00 93.90  ? 762  LYS A NZ   1 
ATOM   10340 H  H    . LYS A 1 683 ? -29.732 35.719  -51.037 1.00 97.36  ? 762  LYS A H    1 
ATOM   10341 H  HA   . LYS A 1 683 ? -27.854 34.493  -49.683 1.00 98.82  ? 762  LYS A HA   1 
ATOM   10342 H  HB2  . LYS A 1 683 ? -28.193 34.250  -52.061 1.00 109.33 ? 762  LYS A HB2  1 
ATOM   10343 H  HB3  . LYS A 1 683 ? -27.431 35.633  -52.227 1.00 109.33 ? 762  LYS A HB3  1 
ATOM   10344 H  HG2  . LYS A 1 683 ? -25.503 34.663  -51.299 1.00 123.63 ? 762  LYS A HG2  1 
ATOM   10345 H  HG3  . LYS A 1 683 ? -26.268 33.274  -51.189 1.00 123.63 ? 762  LYS A HG3  1 
ATOM   10346 H  HD2  . LYS A 1 683 ? -26.283 33.013  -53.448 1.00 130.65 ? 762  LYS A HD2  1 
ATOM   10347 H  HD3  . LYS A 1 683 ? -25.820 34.516  -53.683 1.00 130.65 ? 762  LYS A HD3  1 
ATOM   10348 H  HE2  . LYS A 1 683 ? -23.988 33.222  -54.083 1.00 124.49 ? 762  LYS A HE2  1 
ATOM   10349 H  HE3  . LYS A 1 683 ? -23.725 33.929  -52.686 1.00 124.49 ? 762  LYS A HE3  1 
ATOM   10350 H  HZ1  . LYS A 1 683 ? -23.181 31.729  -52.577 1.00 112.69 ? 762  LYS A HZ1  1 
ATOM   10351 H  HZ2  . LYS A 1 683 ? -24.283 31.971  -51.669 1.00 112.69 ? 762  LYS A HZ2  1 
ATOM   10352 H  HZ3  . LYS A 1 683 ? -24.523 31.326  -52.943 1.00 112.69 ? 762  LYS A HZ3  1 
ATOM   10353 N  N    . LYS A 1 684 ? -27.475 37.630  -50.095 1.00 90.34  ? 763  LYS A N    1 
ATOM   10354 C  CA   . LYS A 1 684 ? -26.766 38.798  -49.571 1.00 94.29  ? 763  LYS A CA   1 
ATOM   10355 C  C    . LYS A 1 684 ? -26.644 38.666  -48.056 1.00 91.33  ? 763  LYS A C    1 
ATOM   10356 O  O    . LYS A 1 684 ? -25.552 38.471  -47.535 1.00 90.71  ? 763  LYS A O    1 
ATOM   10357 C  CB   . LYS A 1 684 ? -27.480 40.107  -49.944 1.00 102.18 ? 763  LYS A CB   1 
ATOM   10358 C  CG   . LYS A 1 684 ? -26.778 41.377  -49.451 1.00 104.70 ? 763  LYS A CG   1 
ATOM   10359 C  CD   . LYS A 1 684 ? -27.638 42.617  -49.674 1.00 108.45 ? 763  LYS A CD   1 
ATOM   10360 C  CE   . LYS A 1 684 ? -27.761 42.970  -51.148 1.00 111.03 ? 763  LYS A CE   1 
ATOM   10361 N  NZ   . LYS A 1 684 ? -28.601 44.183  -51.362 1.00 102.72 ? 763  LYS A NZ   1 
ATOM   10362 H  H    . LYS A 1 684 ? -28.130 37.819  -50.619 1.00 108.41 ? 763  LYS A H    1 
ATOM   10363 H  HA   . LYS A 1 684 ? -25.872 38.823  -49.947 1.00 113.14 ? 763  LYS A HA   1 
ATOM   10364 H  HB2  . LYS A 1 684 ? -27.542 40.163  -50.910 1.00 122.62 ? 763  LYS A HB2  1 
ATOM   10365 H  HB3  . LYS A 1 684 ? -28.370 40.096  -49.559 1.00 122.62 ? 763  LYS A HB3  1 
ATOM   10366 H  HG2  . LYS A 1 684 ? -26.602 41.297  -48.500 1.00 125.64 ? 763  LYS A HG2  1 
ATOM   10367 H  HG3  . LYS A 1 684 ? -25.947 41.493  -49.937 1.00 125.64 ? 763  LYS A HG3  1 
ATOM   10368 H  HD2  . LYS A 1 684 ? -28.529 42.454  -49.327 1.00 130.14 ? 763  LYS A HD2  1 
ATOM   10369 H  HD3  . LYS A 1 684 ? -27.234 43.371  -49.215 1.00 130.14 ? 763  LYS A HD3  1 
ATOM   10370 H  HE2  . LYS A 1 684 ? -26.878 43.146  -51.508 1.00 133.23 ? 763  LYS A HE2  1 
ATOM   10371 H  HE3  . LYS A 1 684 ? -28.174 42.230  -51.619 1.00 133.23 ? 763  LYS A HE3  1 
ATOM   10372 H  HZ1  . LYS A 1 684 ? -28.655 44.365  -52.232 1.00 123.26 ? 763  LYS A HZ1  1 
ATOM   10373 H  HZ2  . LYS A 1 684 ? -29.420 44.046  -51.044 1.00 123.26 ? 763  LYS A HZ2  1 
ATOM   10374 H  HZ3  . LYS A 1 684 ? -28.240 44.880  -50.943 1.00 123.26 ? 763  LYS A HZ3  1 
ATOM   10375 N  N    . GLN A 1 685 ? -27.775 38.726  -47.361 1.00 84.53  ? 764  GLN A N    1 
ATOM   10376 C  CA   . GLN A 1 685 ? -27.797 38.622  -45.906 1.00 73.37  ? 764  GLN A CA   1 
ATOM   10377 C  C    . GLN A 1 685 ? -27.095 37.367  -45.392 1.00 64.33  ? 764  GLN A C    1 
ATOM   10378 O  O    . GLN A 1 685 ? -26.360 37.420  -44.406 1.00 65.75  ? 764  GLN A O    1 
ATOM   10379 C  CB   . GLN A 1 685 ? -29.245 38.626  -45.417 1.00 74.92  ? 764  GLN A CB   1 
ATOM   10380 C  CG   . GLN A 1 685 ? -29.969 39.949  -45.644 1.00 80.27  ? 764  GLN A CG   1 
ATOM   10381 C  CD   . GLN A 1 685 ? -31.476 39.848  -45.464 1.00 83.46  ? 764  GLN A CD   1 
ATOM   10382 O  OE1  . GLN A 1 685 ? -32.095 40.715  -44.847 1.00 86.26  ? 764  GLN A OE1  1 
ATOM   10383 N  NE2  . GLN A 1 685 ? -32.075 38.796  -46.016 1.00 80.29  ? 764  GLN A NE2  1 
ATOM   10384 H  H    . GLN A 1 685 ? -28.553 38.827  -47.713 1.00 101.43 ? 764  GLN A H    1 
ATOM   10385 H  HA   . GLN A 1 685 ? -27.349 39.394  -45.526 1.00 88.05  ? 764  GLN A HA   1 
ATOM   10386 H  HB2  . GLN A 1 685 ? -29.735 37.934  -45.889 1.00 89.91  ? 764  GLN A HB2  1 
ATOM   10387 H  HB3  . GLN A 1 685 ? -29.253 38.443  -44.464 1.00 89.91  ? 764  GLN A HB3  1 
ATOM   10388 H  HG2  . GLN A 1 685 ? -29.636 40.602  -45.009 1.0