data_4PK7
# 
_entry.id   4PK7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4PK7         
WWPDB D_1000201554 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4PK7 
_pdbx_database_status.recvd_initial_deposition_date   2014-05-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hara, K.'       1 
'Chen, Z.'       2 
'Tomchick, D.R.' 3 
'Yu, H.'         4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            21 
_citation.language                  ? 
_citation.page_first                864 
_citation.page_last                 870 
_citation.title                     
'Structure of cohesin subcomplex pinpoints direct shugoshin-Wapl antagonism in centromeric cohesion.' 
_citation.year                      2014 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2880 
_citation.pdbx_database_id_PubMed   25173175 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hara, K.'       1 
primary 'Zheng, G.'      2 
primary 'Qu, Q.'         3 
primary 'Liu, H.'        4 
primary 'Ouyang, Z.'     5 
primary 'Chen, Z.'       6 
primary 'Tomchick, D.R.' 7 
primary 'Yu, H.'         8 
# 
_cell.entry_id           4PK7 
_cell.length_a           78.455 
_cell.length_b           107.275 
_cell.length_c           180.103 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4PK7 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cohesin subunit SA-2'                             114980.609 1 ? ? ? ? 
2 polymer     man 'Double-strand-break repair protein rad21 homolog' 16772.426  1 ? ? ? ? 
3 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'             195.237    1 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'SCC3 homolog 2,Stromal antigen 2'                  
2 'hHR21,Nuclear matrix protein 1,NXP-1,SCC1 homolog' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GAMDPEFGRPGRPENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFFIQCSGCKGVVTAEMFRHMQNSEIIR
KMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKL
MTALVNVALNLSINMDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDAIAEIRA
ICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKELNSKLELFTSRFKDRIVSMTLDKEYDV
AVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVF
FFLESELHEHAAYLVDSMWDCATELLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKR
VLTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDT
DVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSKW
DLFACNYKLLKTGIENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQICQHYLTNVNTTVKEQ
AFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDNNSADGQQEDEASKIEALHKRRNLLA
AFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFS
GIKELARRFALTFGLDQLKTREAIAMLHKDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFM
TFQMSLRREDVWLPLMSYRNSLLAGGDDDTMSVI
;
;GAMDPEFGRPGRPENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFFIQCSGCKGVVTAEMFRHMQNSEIIR
KMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKL
MTALVNVALNLSINMDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDAIAEIRA
ICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKELNSKLELFTSRFKDRIVSMTLDKEYDV
AVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVF
FFLESELHEHAAYLVDSMWDCATELLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKR
VLTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDT
DVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSKW
DLFACNYKLLKTGIENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQICQHYLTNVNTTVKEQ
AFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDNNSADGQQEDEASKIEALHKRRNLLA
AFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFS
GIKELARRFALTFGLDQLKTREAIAMLHKDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFM
TFQMSLRREDVWLPLMSYRNSLLAGGDDDTMSVI
;
A ? 
2 'polypeptide(L)' no no 
;GPLGSGRPVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLD
LAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
;
;GPLGSGRPVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLD
LAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ASP n 
1 5   PRO n 
1 6   GLU n 
1 7   PHE n 
1 8   GLY n 
1 9   ARG n 
1 10  PRO n 
1 11  GLY n 
1 12  ARG n 
1 13  PRO n 
1 14  GLU n 
1 15  ASN n 
1 16  MET n 
1 17  MET n 
1 18  LEU n 
1 19  PHE n 
1 20  GLU n 
1 21  VAL n 
1 22  VAL n 
1 23  LYS n 
1 24  MET n 
1 25  GLY n 
1 26  LYS n 
1 27  SER n 
1 28  ALA n 
1 29  MET n 
1 30  GLN n 
1 31  SER n 
1 32  VAL n 
1 33  VAL n 
1 34  ASP n 
1 35  ASP n 
1 36  TRP n 
1 37  ILE n 
1 38  GLU n 
1 39  SER n 
1 40  TYR n 
1 41  LYS n 
1 42  HIS n 
1 43  ASP n 
1 44  ARG n 
1 45  ASP n 
1 46  ILE n 
1 47  ALA n 
1 48  LEU n 
1 49  LEU n 
1 50  ASP n 
1 51  LEU n 
1 52  ILE n 
1 53  ASN n 
1 54  PHE n 
1 55  PHE n 
1 56  ILE n 
1 57  GLN n 
1 58  CYS n 
1 59  SER n 
1 60  GLY n 
1 61  CYS n 
1 62  LYS n 
1 63  GLY n 
1 64  VAL n 
1 65  VAL n 
1 66  THR n 
1 67  ALA n 
1 68  GLU n 
1 69  MET n 
1 70  PHE n 
1 71  ARG n 
1 72  HIS n 
1 73  MET n 
1 74  GLN n 
1 75  ASN n 
1 76  SER n 
1 77  GLU n 
1 78  ILE n 
1 79  ILE n 
1 80  ARG n 
1 81  LYS n 
1 82  MET n 
1 83  THR n 
1 84  GLU n 
1 85  GLU n 
1 86  PHE n 
1 87  ASP n 
1 88  GLU n 
1 89  ASP n 
1 90  SER n 
1 91  GLY n 
1 92  ASP n 
1 93  TYR n 
1 94  PRO n 
1 95  LEU n 
1 96  THR n 
1 97  MET n 
1 98  ALA n 
1 99  GLY n 
1 100 PRO n 
1 101 GLN n 
1 102 TRP n 
1 103 LYS n 
1 104 LYS n 
1 105 PHE n 
1 106 LYS n 
1 107 SER n 
1 108 SER n 
1 109 PHE n 
1 110 CYS n 
1 111 GLU n 
1 112 PHE n 
1 113 ILE n 
1 114 GLY n 
1 115 VAL n 
1 116 LEU n 
1 117 VAL n 
1 118 ARG n 
1 119 GLN n 
1 120 CYS n 
1 121 GLN n 
1 122 TYR n 
1 123 SER n 
1 124 ILE n 
1 125 ILE n 
1 126 TYR n 
1 127 ASP n 
1 128 GLU n 
1 129 TYR n 
1 130 MET n 
1 131 MET n 
1 132 ASP n 
1 133 THR n 
1 134 VAL n 
1 135 ILE n 
1 136 SER n 
1 137 LEU n 
1 138 LEU n 
1 139 THR n 
1 140 GLY n 
1 141 LEU n 
1 142 SER n 
1 143 ASP n 
1 144 SER n 
1 145 GLN n 
1 146 VAL n 
1 147 ARG n 
1 148 ALA n 
1 149 PHE n 
1 150 ARG n 
1 151 HIS n 
1 152 THR n 
1 153 SER n 
1 154 THR n 
1 155 LEU n 
1 156 ALA n 
1 157 ALA n 
1 158 MET n 
1 159 LYS n 
1 160 LEU n 
1 161 MET n 
1 162 THR n 
1 163 ALA n 
1 164 LEU n 
1 165 VAL n 
1 166 ASN n 
1 167 VAL n 
1 168 ALA n 
1 169 LEU n 
1 170 ASN n 
1 171 LEU n 
1 172 SER n 
1 173 ILE n 
1 174 ASN n 
1 175 MET n 
1 176 ASP n 
1 177 ASN n 
1 178 THR n 
1 179 GLN n 
1 180 ARG n 
1 181 GLN n 
1 182 TYR n 
1 183 GLU n 
1 184 ALA n 
1 185 GLU n 
1 186 ARG n 
1 187 ASN n 
1 188 LYS n 
1 189 MET n 
1 190 ILE n 
1 191 GLY n 
1 192 LYS n 
1 193 ARG n 
1 194 ALA n 
1 195 ASN n 
1 196 GLU n 
1 197 ARG n 
1 198 LEU n 
1 199 GLU n 
1 200 LEU n 
1 201 LEU n 
1 202 LEU n 
1 203 GLN n 
1 204 LYS n 
1 205 ARG n 
1 206 LYS n 
1 207 GLU n 
1 208 LEU n 
1 209 GLN n 
1 210 GLU n 
1 211 ASN n 
1 212 GLN n 
1 213 ASP n 
1 214 GLU n 
1 215 ILE n 
1 216 GLU n 
1 217 ASN n 
1 218 MET n 
1 219 MET n 
1 220 ASN n 
1 221 ALA n 
1 222 ILE n 
1 223 PHE n 
1 224 LYS n 
1 225 GLY n 
1 226 VAL n 
1 227 PHE n 
1 228 VAL n 
1 229 HIS n 
1 230 ARG n 
1 231 TYR n 
1 232 ARG n 
1 233 ASP n 
1 234 ALA n 
1 235 ILE n 
1 236 ALA n 
1 237 GLU n 
1 238 ILE n 
1 239 ARG n 
1 240 ALA n 
1 241 ILE n 
1 242 CYS n 
1 243 ILE n 
1 244 GLU n 
1 245 GLU n 
1 246 ILE n 
1 247 GLY n 
1 248 ILE n 
1 249 TRP n 
1 250 MET n 
1 251 LYS n 
1 252 MET n 
1 253 TYR n 
1 254 SER n 
1 255 ASP n 
1 256 ALA n 
1 257 PHE n 
1 258 LEU n 
1 259 ASN n 
1 260 ASP n 
1 261 SER n 
1 262 TYR n 
1 263 LEU n 
1 264 LYS n 
1 265 TYR n 
1 266 VAL n 
1 267 GLY n 
1 268 TRP n 
1 269 THR n 
1 270 MET n 
1 271 HIS n 
1 272 ASP n 
1 273 LYS n 
1 274 GLN n 
1 275 GLY n 
1 276 GLU n 
1 277 VAL n 
1 278 ARG n 
1 279 LEU n 
1 280 LYS n 
1 281 CYS n 
1 282 LEU n 
1 283 THR n 
1 284 ALA n 
1 285 LEU n 
1 286 GLN n 
1 287 GLY n 
1 288 LEU n 
1 289 TYR n 
1 290 TYR n 
1 291 ASN n 
1 292 LYS n 
1 293 GLU n 
1 294 LEU n 
1 295 ASN n 
1 296 SER n 
1 297 LYS n 
1 298 LEU n 
1 299 GLU n 
1 300 LEU n 
1 301 PHE n 
1 302 THR n 
1 303 SER n 
1 304 ARG n 
1 305 PHE n 
1 306 LYS n 
1 307 ASP n 
1 308 ARG n 
1 309 ILE n 
1 310 VAL n 
1 311 SER n 
1 312 MET n 
1 313 THR n 
1 314 LEU n 
1 315 ASP n 
1 316 LYS n 
1 317 GLU n 
1 318 TYR n 
1 319 ASP n 
1 320 VAL n 
1 321 ALA n 
1 322 VAL n 
1 323 GLN n 
1 324 ALA n 
1 325 ILE n 
1 326 LYS n 
1 327 LEU n 
1 328 LEU n 
1 329 THR n 
1 330 LEU n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 SER n 
1 335 SER n 
1 336 GLU n 
1 337 GLU n 
1 338 VAL n 
1 339 LEU n 
1 340 THR n 
1 341 ALA n 
1 342 GLU n 
1 343 ASP n 
1 344 CYS n 
1 345 GLU n 
1 346 ASN n 
1 347 VAL n 
1 348 TYR n 
1 349 HIS n 
1 350 LEU n 
1 351 VAL n 
1 352 TYR n 
1 353 SER n 
1 354 ALA n 
1 355 HIS n 
1 356 ARG n 
1 357 PRO n 
1 358 VAL n 
1 359 ALA n 
1 360 VAL n 
1 361 ALA n 
1 362 ALA n 
1 363 GLY n 
1 364 GLU n 
1 365 PHE n 
1 366 LEU n 
1 367 TYR n 
1 368 LYS n 
1 369 LYS n 
1 370 LEU n 
1 371 PHE n 
1 372 SER n 
1 373 ARG n 
1 374 ARG n 
1 375 ASP n 
1 376 PRO n 
1 377 GLU n 
1 378 GLU n 
1 379 ASP n 
1 380 GLY n 
1 381 MET n 
1 382 MET n 
1 383 LYS n 
1 384 ARG n 
1 385 ARG n 
1 386 GLY n 
1 387 ARG n 
1 388 GLN n 
1 389 GLY n 
1 390 PRO n 
1 391 ASN n 
1 392 ALA n 
1 393 ASN n 
1 394 LEU n 
1 395 VAL n 
1 396 LYS n 
1 397 THR n 
1 398 LEU n 
1 399 VAL n 
1 400 PHE n 
1 401 PHE n 
1 402 PHE n 
1 403 LEU n 
1 404 GLU n 
1 405 SER n 
1 406 GLU n 
1 407 LEU n 
1 408 HIS n 
1 409 GLU n 
1 410 HIS n 
1 411 ALA n 
1 412 ALA n 
1 413 TYR n 
1 414 LEU n 
1 415 VAL n 
1 416 ASP n 
1 417 SER n 
1 418 MET n 
1 419 TRP n 
1 420 ASP n 
1 421 CYS n 
1 422 ALA n 
1 423 THR n 
1 424 GLU n 
1 425 LEU n 
1 426 LEU n 
1 427 LYS n 
1 428 ASP n 
1 429 TRP n 
1 430 GLU n 
1 431 CYS n 
1 432 MET n 
1 433 ASN n 
1 434 SER n 
1 435 LEU n 
1 436 LEU n 
1 437 LEU n 
1 438 GLU n 
1 439 GLU n 
1 440 PRO n 
1 441 LEU n 
1 442 SER n 
1 443 GLY n 
1 444 GLU n 
1 445 GLU n 
1 446 ALA n 
1 447 LEU n 
1 448 THR n 
1 449 ASP n 
1 450 ARG n 
1 451 GLN n 
1 452 GLU n 
1 453 SER n 
1 454 ALA n 
1 455 LEU n 
1 456 ILE n 
1 457 GLU n 
1 458 ILE n 
1 459 MET n 
1 460 LEU n 
1 461 CYS n 
1 462 THR n 
1 463 ILE n 
1 464 ARG n 
1 465 GLN n 
1 466 ALA n 
1 467 ALA n 
1 468 GLU n 
1 469 CYS n 
1 470 HIS n 
1 471 PRO n 
1 472 PRO n 
1 473 VAL n 
1 474 GLY n 
1 475 ARG n 
1 476 GLY n 
1 477 THR n 
1 478 GLY n 
1 479 LYS n 
1 480 ARG n 
1 481 VAL n 
1 482 LEU n 
1 483 THR n 
1 484 ALA n 
1 485 LYS n 
1 486 GLU n 
1 487 LYS n 
1 488 LYS n 
1 489 THR n 
1 490 GLN n 
1 491 LEU n 
1 492 ASP n 
1 493 ASP n 
1 494 ARG n 
1 495 THR n 
1 496 LYS n 
1 497 ILE n 
1 498 THR n 
1 499 GLU n 
1 500 LEU n 
1 501 PHE n 
1 502 ALA n 
1 503 VAL n 
1 504 ALA n 
1 505 LEU n 
1 506 PRO n 
1 507 GLN n 
1 508 LEU n 
1 509 LEU n 
1 510 ALA n 
1 511 LYS n 
1 512 TYR n 
1 513 SER n 
1 514 VAL n 
1 515 ASP n 
1 516 ALA n 
1 517 GLU n 
1 518 LYS n 
1 519 VAL n 
1 520 THR n 
1 521 ASN n 
1 522 LEU n 
1 523 LEU n 
1 524 GLN n 
1 525 LEU n 
1 526 PRO n 
1 527 GLN n 
1 528 TYR n 
1 529 PHE n 
1 530 ASP n 
1 531 LEU n 
1 532 GLU n 
1 533 ILE n 
1 534 TYR n 
1 535 THR n 
1 536 THR n 
1 537 GLY n 
1 538 ARG n 
1 539 LEU n 
1 540 GLU n 
1 541 LYS n 
1 542 HIS n 
1 543 LEU n 
1 544 ASP n 
1 545 ALA n 
1 546 LEU n 
1 547 LEU n 
1 548 ARG n 
1 549 GLN n 
1 550 ILE n 
1 551 ARG n 
1 552 ASN n 
1 553 ILE n 
1 554 VAL n 
1 555 GLU n 
1 556 LYS n 
1 557 HIS n 
1 558 THR n 
1 559 ASP n 
1 560 THR n 
1 561 ASP n 
1 562 VAL n 
1 563 LEU n 
1 564 GLU n 
1 565 ALA n 
1 566 CYS n 
1 567 SER n 
1 568 LYS n 
1 569 THR n 
1 570 TYR n 
1 571 HIS n 
1 572 ALA n 
1 573 LEU n 
1 574 CYS n 
1 575 ASN n 
1 576 GLU n 
1 577 GLU n 
1 578 PHE n 
1 579 THR n 
1 580 ILE n 
1 581 PHE n 
1 582 ASN n 
1 583 ARG n 
1 584 VAL n 
1 585 ASP n 
1 586 ILE n 
1 587 SER n 
1 588 ARG n 
1 589 SER n 
1 590 GLN n 
1 591 LEU n 
1 592 ILE n 
1 593 ASP n 
1 594 GLU n 
1 595 LEU n 
1 596 ALA n 
1 597 ASP n 
1 598 LYS n 
1 599 PHE n 
1 600 ASN n 
1 601 ARG n 
1 602 LEU n 
1 603 LEU n 
1 604 GLU n 
1 605 ASP n 
1 606 PHE n 
1 607 LEU n 
1 608 GLN n 
1 609 GLU n 
1 610 GLY n 
1 611 GLU n 
1 612 GLU n 
1 613 PRO n 
1 614 ASP n 
1 615 GLU n 
1 616 ASP n 
1 617 ASP n 
1 618 ALA n 
1 619 TYR n 
1 620 GLN n 
1 621 VAL n 
1 622 LEU n 
1 623 SER n 
1 624 THR n 
1 625 LEU n 
1 626 LYS n 
1 627 ARG n 
1 628 ILE n 
1 629 THR n 
1 630 ALA n 
1 631 PHE n 
1 632 HIS n 
1 633 ASN n 
1 634 ALA n 
1 635 HIS n 
1 636 ASP n 
1 637 LEU n 
1 638 SER n 
1 639 LYS n 
1 640 TRP n 
1 641 ASP n 
1 642 LEU n 
1 643 PHE n 
1 644 ALA n 
1 645 CYS n 
1 646 ASN n 
1 647 TYR n 
1 648 LYS n 
1 649 LEU n 
1 650 LEU n 
1 651 LYS n 
1 652 THR n 
1 653 GLY n 
1 654 ILE n 
1 655 GLU n 
1 656 ASN n 
1 657 GLY n 
1 658 ASP n 
1 659 MET n 
1 660 PRO n 
1 661 GLU n 
1 662 GLN n 
1 663 ILE n 
1 664 VAL n 
1 665 ILE n 
1 666 HIS n 
1 667 ALA n 
1 668 LEU n 
1 669 GLN n 
1 670 CYS n 
1 671 THR n 
1 672 HIS n 
1 673 TYR n 
1 674 VAL n 
1 675 ILE n 
1 676 LEU n 
1 677 TRP n 
1 678 GLN n 
1 679 LEU n 
1 680 ALA n 
1 681 LYS n 
1 682 ILE n 
1 683 THR n 
1 684 GLU n 
1 685 SER n 
1 686 SER n 
1 687 SER n 
1 688 THR n 
1 689 LYS n 
1 690 GLU n 
1 691 ASP n 
1 692 LEU n 
1 693 LEU n 
1 694 ARG n 
1 695 LEU n 
1 696 LYS n 
1 697 LYS n 
1 698 GLN n 
1 699 MET n 
1 700 ARG n 
1 701 VAL n 
1 702 PHE n 
1 703 CYS n 
1 704 GLN n 
1 705 ILE n 
1 706 CYS n 
1 707 GLN n 
1 708 HIS n 
1 709 TYR n 
1 710 LEU n 
1 711 THR n 
1 712 ASN n 
1 713 VAL n 
1 714 ASN n 
1 715 THR n 
1 716 THR n 
1 717 VAL n 
1 718 LYS n 
1 719 GLU n 
1 720 GLN n 
1 721 ALA n 
1 722 PHE n 
1 723 THR n 
1 724 ILE n 
1 725 LEU n 
1 726 CYS n 
1 727 ASP n 
1 728 ILE n 
1 729 LEU n 
1 730 MET n 
1 731 ILE n 
1 732 PHE n 
1 733 SER n 
1 734 HIS n 
1 735 GLN n 
1 736 ILE n 
1 737 MET n 
1 738 SER n 
1 739 GLY n 
1 740 GLY n 
1 741 ARG n 
1 742 ASP n 
1 743 MET n 
1 744 LEU n 
1 745 GLU n 
1 746 PRO n 
1 747 LEU n 
1 748 VAL n 
1 749 TYR n 
1 750 THR n 
1 751 PRO n 
1 752 ASP n 
1 753 SER n 
1 754 SER n 
1 755 LEU n 
1 756 GLN n 
1 757 SER n 
1 758 GLU n 
1 759 LEU n 
1 760 LEU n 
1 761 SER n 
1 762 PHE n 
1 763 ILE n 
1 764 LEU n 
1 765 ASP n 
1 766 HIS n 
1 767 VAL n 
1 768 PHE n 
1 769 ILE n 
1 770 GLU n 
1 771 GLN n 
1 772 ASP n 
1 773 ASP n 
1 774 ASP n 
1 775 ASN n 
1 776 ASN n 
1 777 SER n 
1 778 ALA n 
1 779 ASP n 
1 780 GLY n 
1 781 GLN n 
1 782 GLN n 
1 783 GLU n 
1 784 ASP n 
1 785 GLU n 
1 786 ALA n 
1 787 SER n 
1 788 LYS n 
1 789 ILE n 
1 790 GLU n 
1 791 ALA n 
1 792 LEU n 
1 793 HIS n 
1 794 LYS n 
1 795 ARG n 
1 796 ARG n 
1 797 ASN n 
1 798 LEU n 
1 799 LEU n 
1 800 ALA n 
1 801 ALA n 
1 802 PHE n 
1 803 CYS n 
1 804 LYS n 
1 805 LEU n 
1 806 ILE n 
1 807 VAL n 
1 808 TYR n 
1 809 THR n 
1 810 VAL n 
1 811 VAL n 
1 812 GLU n 
1 813 MET n 
1 814 ASN n 
1 815 THR n 
1 816 ALA n 
1 817 ALA n 
1 818 ASP n 
1 819 ILE n 
1 820 PHE n 
1 821 LYS n 
1 822 GLN n 
1 823 TYR n 
1 824 MET n 
1 825 LYS n 
1 826 TYR n 
1 827 TYR n 
1 828 ASN n 
1 829 ASP n 
1 830 TYR n 
1 831 GLY n 
1 832 ASP n 
1 833 ILE n 
1 834 ILE n 
1 835 LYS n 
1 836 GLU n 
1 837 THR n 
1 838 MET n 
1 839 SER n 
1 840 LYS n 
1 841 THR n 
1 842 ARG n 
1 843 GLN n 
1 844 ILE n 
1 845 ASP n 
1 846 LYS n 
1 847 ILE n 
1 848 GLN n 
1 849 CYS n 
1 850 ALA n 
1 851 LYS n 
1 852 THR n 
1 853 LEU n 
1 854 ILE n 
1 855 LEU n 
1 856 SER n 
1 857 LEU n 
1 858 GLN n 
1 859 GLN n 
1 860 LEU n 
1 861 PHE n 
1 862 ASN n 
1 863 GLU n 
1 864 MET n 
1 865 ILE n 
1 866 GLN n 
1 867 GLU n 
1 868 ASN n 
1 869 GLY n 
1 870 TYR n 
1 871 ASN n 
1 872 PHE n 
1 873 ASP n 
1 874 ARG n 
1 875 SER n 
1 876 SER n 
1 877 SER n 
1 878 THR n 
1 879 PHE n 
1 880 SER n 
1 881 GLY n 
1 882 ILE n 
1 883 LYS n 
1 884 GLU n 
1 885 LEU n 
1 886 ALA n 
1 887 ARG n 
1 888 ARG n 
1 889 PHE n 
1 890 ALA n 
1 891 LEU n 
1 892 THR n 
1 893 PHE n 
1 894 GLY n 
1 895 LEU n 
1 896 ASP n 
1 897 GLN n 
1 898 LEU n 
1 899 LYS n 
1 900 THR n 
1 901 ARG n 
1 902 GLU n 
1 903 ALA n 
1 904 ILE n 
1 905 ALA n 
1 906 MET n 
1 907 LEU n 
1 908 HIS n 
1 909 LYS n 
1 910 ASP n 
1 911 GLY n 
1 912 ILE n 
1 913 GLU n 
1 914 PHE n 
1 915 ALA n 
1 916 PHE n 
1 917 LYS n 
1 918 GLU n 
1 919 PRO n 
1 920 ASN n 
1 921 PRO n 
1 922 GLN n 
1 923 GLY n 
1 924 GLU n 
1 925 SER n 
1 926 HIS n 
1 927 PRO n 
1 928 PRO n 
1 929 LEU n 
1 930 ASN n 
1 931 LEU n 
1 932 ALA n 
1 933 PHE n 
1 934 LEU n 
1 935 ASP n 
1 936 ILE n 
1 937 LEU n 
1 938 SER n 
1 939 GLU n 
1 940 PHE n 
1 941 SER n 
1 942 SER n 
1 943 LYS n 
1 944 LEU n 
1 945 LEU n 
1 946 ARG n 
1 947 GLN n 
1 948 ASP n 
1 949 LYS n 
1 950 ARG n 
1 951 THR n 
1 952 VAL n 
1 953 TYR n 
1 954 VAL n 
1 955 TYR n 
1 956 LEU n 
1 957 GLU n 
1 958 LYS n 
1 959 PHE n 
1 960 MET n 
1 961 THR n 
1 962 PHE n 
1 963 GLN n 
1 964 MET n 
1 965 SER n 
1 966 LEU n 
1 967 ARG n 
1 968 ARG n 
1 969 GLU n 
1 970 ASP n 
1 971 VAL n 
1 972 TRP n 
1 973 LEU n 
1 974 PRO n 
1 975 LEU n 
1 976 MET n 
1 977 SER n 
1 978 TYR n 
1 979 ARG n 
1 980 ASN n 
1 981 SER n 
1 982 LEU n 
1 983 LEU n 
1 984 ALA n 
1 985 GLY n 
1 986 GLY n 
1 987 ASP n 
1 988 ASP n 
1 989 ASP n 
1 990 THR n 
1 991 MET n 
1 992 SER n 
1 993 VAL n 
1 994 ILE n 
2 1   GLY n 
2 2   PRO n 
2 3   LEU n 
2 4   GLY n 
2 5   SER n 
2 6   GLY n 
2 7   ARG n 
2 8   PRO n 
2 9   VAL n 
2 10  ASP n 
2 11  PRO n 
2 12  VAL n 
2 13  GLU n 
2 14  PRO n 
2 15  MET n 
2 16  PRO n 
2 17  THR n 
2 18  MET n 
2 19  THR n 
2 20  ASP n 
2 21  GLN n 
2 22  THR n 
2 23  THR n 
2 24  LEU n 
2 25  VAL n 
2 26  PRO n 
2 27  ASN n 
2 28  GLU n 
2 29  GLU n 
2 30  GLU n 
2 31  ALA n 
2 32  PHE n 
2 33  ALA n 
2 34  LEU n 
2 35  GLU n 
2 36  PRO n 
2 37  ILE n 
2 38  ASP n 
2 39  ILE n 
2 40  THR n 
2 41  VAL n 
2 42  LYS n 
2 43  GLU n 
2 44  THR n 
2 45  LYS n 
2 46  ALA n 
2 47  LYS n 
2 48  ARG n 
2 49  LYS n 
2 50  ARG n 
2 51  LYS n 
2 52  LEU n 
2 53  ILE n 
2 54  VAL n 
2 55  ASP n 
2 56  SER n 
2 57  VAL n 
2 58  LYS n 
2 59  GLU n 
2 60  LEU n 
2 61  ASP n 
2 62  SER n 
2 63  LYS n 
2 64  THR n 
2 65  ILE n 
2 66  ARG n 
2 67  ALA n 
2 68  GLN n 
2 69  LEU n 
2 70  SER n 
2 71  ASP n 
2 72  TYR n 
2 73  SER n 
2 74  ASP n 
2 75  ILE n 
2 76  VAL n 
2 77  THR n 
2 78  THR n 
2 79  LEU n 
2 80  ASP n 
2 81  LEU n 
2 82  ALA n 
2 83  PRO n 
2 84  PRO n 
2 85  THR n 
2 86  LYS n 
2 87  LYS n 
2 88  LEU n 
2 89  MET n 
2 90  MET n 
2 91  TRP n 
2 92  LYS n 
2 93  GLU n 
2 94  THR n 
2 95  GLY n 
2 96  GLY n 
2 97  VAL n 
2 98  GLU n 
2 99  LYS n 
2 100 LEU n 
2 101 PHE n 
2 102 SER n 
2 103 LEU n 
2 104 PRO n 
2 105 ALA n 
2 106 GLN n 
2 107 PRO n 
2 108 LEU n 
2 109 TRP n 
2 110 ASN n 
2 111 ASN n 
2 112 ARG n 
2 113 LEU n 
2 114 LEU n 
2 115 LYS n 
2 116 LEU n 
2 117 PHE n 
2 118 THR n 
2 119 ARG n 
2 120 CYS n 
2 121 LEU n 
2 122 THR n 
2 123 PRO n 
2 124 LEU n 
2 125 VAL n 
2 126 PRO n 
2 127 GLU n 
2 128 ASP n 
2 129 LEU n 
2 130 ARG n 
2 131 LYS n 
2 132 ARG n 
2 133 ARG n 
2 134 LYS n 
2 135 GLY n 
2 136 GLY n 
2 137 GLU n 
2 138 ALA n 
2 139 ASP n 
2 140 ASN n 
2 141 LEU n 
2 142 ASP n 
2 143 GLU n 
2 144 PHE n 
2 145 LEU n 
2 146 LYS n 
2 147 GLU n 
2 148 PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 994 Human ? 'STAG2, SA2'                  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? 'High Five' ? ? ? ? ? ? ? ? ? 'pFastBac HT ' ? ? 
2 1 sample 'Biological sequence' 1 148 Human ? 'RAD21, HR21, KIAA0078, NXP1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ?           ? ? ? ? ? ? ? ? ? ?              ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP STAG2_HUMAN Q8N3U4 1 
;ENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFFIQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDY
PLTMAGPQWKKFKSSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSI
NMDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDAIAEIRAICIEEIGIWMKMY
SDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKELNSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQ
SSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAY
LVDSMWDCATELLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKRVLTAKEKKTQLDD
RTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHAL
CNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSKWDLFACNYKLLKTG
IENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQICQHYLTNVNTTVKEQAFTILCDILMIFS
HQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDNNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEM
NTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTF
GLDQLKTREAIAMLHKDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREDVWL
PLMSYRNSLLAGGDDDTMSVI
;
80  ? 
2 UNP RAD21_HUMAN O60216 2 
;VDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKL
MMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
;
281 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4PK7 A 14 ? 994 ? Q8N3U4 80  ? 1060 ? 80  1060 
2 2 4PK7 B 9  ? 148 ? O60216 281 ? 420  ? 281 420  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4PK7 GLY A 1  ? UNP Q8N3U4 ? ? 'expression tag' 67  1  
1 4PK7 ALA A 2  ? UNP Q8N3U4 ? ? 'expression tag' 68  2  
1 4PK7 MET A 3  ? UNP Q8N3U4 ? ? 'expression tag' 69  3  
1 4PK7 ASP A 4  ? UNP Q8N3U4 ? ? 'expression tag' 70  4  
1 4PK7 PRO A 5  ? UNP Q8N3U4 ? ? 'expression tag' 71  5  
1 4PK7 GLU A 6  ? UNP Q8N3U4 ? ? 'expression tag' 72  6  
1 4PK7 PHE A 7  ? UNP Q8N3U4 ? ? 'expression tag' 73  7  
1 4PK7 GLY A 8  ? UNP Q8N3U4 ? ? 'expression tag' 74  8  
1 4PK7 ARG A 9  ? UNP Q8N3U4 ? ? 'expression tag' 75  9  
1 4PK7 PRO A 10 ? UNP Q8N3U4 ? ? 'expression tag' 76  10 
1 4PK7 GLY A 11 ? UNP Q8N3U4 ? ? 'expression tag' 77  11 
1 4PK7 ARG A 12 ? UNP Q8N3U4 ? ? 'expression tag' 78  12 
1 4PK7 PRO A 13 ? UNP Q8N3U4 ? ? 'expression tag' 79  13 
2 4PK7 GLY B 1  ? UNP O60216 ? ? 'expression tag' 273 14 
2 4PK7 PRO B 2  ? UNP O60216 ? ? 'expression tag' 274 15 
2 4PK7 LEU B 3  ? UNP O60216 ? ? 'expression tag' 275 16 
2 4PK7 GLY B 4  ? UNP O60216 ? ? 'expression tag' 276 17 
2 4PK7 SER B 5  ? UNP O60216 ? ? 'expression tag' 277 18 
2 4PK7 GLY B 6  ? UNP O60216 ? ? 'expression tag' 278 19 
2 4PK7 ARG B 7  ? UNP O60216 ? ? 'expression tag' 279 20 
2 4PK7 PRO B 8  ? UNP O60216 ? ? 'expression tag' 280 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1' 147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S'  195.237 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4PK7 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.88 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.24 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'0.12 M Morpheus Divalents Mix, 0.1 M Morpheus Buffer System 1, and 27-30% (v/v) Morpheus EOD_P8K (Molecular Dimensions).' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-05-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Rosenbaum-Rock high-resolution double-crystal monochromator' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            67.9 
_reflns.entry_id                         4PK7 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.95 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       32876 
_reflns.number_obs                       32876 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.2 
_reflns.pdbx_Rmerge_I_obs                0.111 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.95 
_reflns_shell.d_res_low                   3.00 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.959 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               88.1 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4PK7 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.95 
_refine.ls_d_res_low                             47.677 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     32803 
_refine.ls_number_reflns_R_free                  1642 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.84 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1908 
_refine.ls_R_factor_R_free                       0.2512 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1877 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4PJU 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.65 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.42 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7974 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7986 
_refine_hist.d_res_high                       2.95 
_refine_hist.d_res_low                        47.677 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 8120  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.205  ? 10936 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 16.244 ? 3059  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.060  ? 1251  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 1369  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 2.9469 3.0336  . . 133 2509 99.00  . . . 0.3518 . 0.2642 . . . . . . . . 
'X-RAY DIFFRACTION' 3.0336 3.1315  . . 134 2556 100.00 . . . 0.3121 . 0.2278 . . . . . . . . 
'X-RAY DIFFRACTION' 3.1315 3.2433  . . 136 2578 100.00 . . . 0.3116 . 0.2110 . . . . . . . . 
'X-RAY DIFFRACTION' 3.2433 3.3732  . . 134 2545 100.00 . . . 0.2837 . 0.2018 . . . . . . . . 
'X-RAY DIFFRACTION' 3.3732 3.5266  . . 135 2569 100.00 . . . 0.3136 . 0.2059 . . . . . . . . 
'X-RAY DIFFRACTION' 3.5266 3.7125  . . 136 2582 100.00 . . . 0.2478 . 0.1989 . . . . . . . . 
'X-RAY DIFFRACTION' 3.7125 3.9450  . . 137 2589 100.00 . . . 0.2560 . 0.1774 . . . . . . . . 
'X-RAY DIFFRACTION' 3.9450 4.2494  . . 136 2582 100.00 . . . 0.2687 . 0.1669 . . . . . . . . 
'X-RAY DIFFRACTION' 4.2494 4.6767  . . 138 2627 100.00 . . . 0.2424 . 0.1599 . . . . . . . . 
'X-RAY DIFFRACTION' 4.6767 5.3527  . . 136 2610 100.00 . . . 0.2201 . 0.1670 . . . . . . . . 
'X-RAY DIFFRACTION' 5.3527 6.7408  . . 141 2655 100.00 . . . 0.2744 . 0.2184 . . . . . . . . 
'X-RAY DIFFRACTION' 6.7408 47.6834 . . 146 2759 99.00  . . . 0.1934 . 0.1780 . . . . . . . . 
# 
_struct.entry_id                     4PK7 
_struct.title                        
;crystal structure of human Stromal Antigen 2 (SA2) in complex with Sister Chromatid Cohesion protein 1 (Scc1) with bound MES, native proteins
;
_struct.pdbx_descriptor              'human Stromal Antigen 2 (SA2), human Sister Chromatid Cohesion protein 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4PK7 
_struct_keywords.text            
'Sister chromatid cohesion, cohesin subunits, protein-protein interaction, HEAT repeat, CELL CYCLE' 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 MET A 17  ? MET A 24  ? MET A 83   MET A 90   1 ? 8  
HELX_P HELX_P2  AA2 ALA A 28  ? ASP A 43  ? ALA A 94   ASP A 109  1 ? 16 
HELX_P HELX_P3  AA3 ASP A 43  ? SER A 59  ? ASP A 109  SER A 125  1 ? 17 
HELX_P HELX_P4  AA4 THR A 66  ? MET A 73  ? THR A 132  MET A 139  1 ? 8  
HELX_P HELX_P5  AA5 GLN A 74  ? GLU A 85  ? GLN A 140  GLU A 151  1 ? 12 
HELX_P HELX_P6  AA6 TYR A 93  ? MET A 97  ? TYR A 159  MET A 163  5 ? 5  
HELX_P HELX_P7  AA7 GLY A 99  ? GLN A 119 ? GLY A 165  GLN A 185  1 ? 21 
HELX_P HELX_P8  AA8 SER A 123 ? ASP A 127 ? SER A 189  ASP A 193  5 ? 5  
HELX_P HELX_P9  AA9 TYR A 129 ? SER A 142 ? TYR A 195  SER A 208  1 ? 14 
HELX_P HELX_P10 AB1 VAL A 146 ? LYS A 188 ? VAL A 212  LYS A 254  1 ? 43 
HELX_P HELX_P11 AB2 GLU A 196 ? VAL A 226 ? GLU A 262  VAL A 292  1 ? 31 
HELX_P HELX_P12 AB3 VAL A 226 ? TYR A 231 ? VAL A 292  TYR A 297  1 ? 6  
HELX_P HELX_P13 AB4 ILE A 235 ? TYR A 253 ? ILE A 301  TYR A 319  1 ? 19 
HELX_P HELX_P14 AB5 TYR A 253 ? LEU A 258 ? TYR A 319  LEU A 324  1 ? 6  
HELX_P HELX_P15 AB6 ASN A 259 ? MET A 270 ? ASN A 325  MET A 336  1 ? 12 
HELX_P HELX_P16 AB7 GLN A 274 ? GLY A 287 ? GLN A 340  GLY A 353  1 ? 14 
HELX_P HELX_P17 AB8 ASN A 295 ? MET A 312 ? ASN A 361  MET A 378  1 ? 18 
HELX_P HELX_P18 AB9 THR A 313 ? ASP A 315 ? THR A 379  ASP A 381  5 ? 3  
HELX_P HELX_P19 AC1 GLU A 317 ? SER A 335 ? GLU A 383  SER A 401  1 ? 19 
HELX_P HELX_P20 AC2 THR A 340 ? LEU A 350 ? THR A 406  LEU A 416  1 ? 11 
HELX_P HELX_P21 AC3 VAL A 351 ? SER A 353 ? VAL A 417  SER A 419  5 ? 3  
HELX_P HELX_P22 AC4 HIS A 355 ? PHE A 371 ? HIS A 421  PHE A 437  1 ? 17 
HELX_P HELX_P23 AC5 ASN A 391 ? SER A 405 ? ASN A 457  SER A 471  1 ? 15 
HELX_P HELX_P24 AC6 ALA A 411 ? ASP A 420 ? ALA A 477  ASP A 486  1 ? 10 
HELX_P HELX_P25 AC7 ALA A 422 ? LYS A 427 ? ALA A 488  LYS A 493  1 ? 6  
HELX_P HELX_P26 AC8 ASP A 428 ? GLU A 438 ? ASP A 494  GLU A 504  1 ? 11 
HELX_P HELX_P27 AC9 THR A 448 ? GLU A 468 ? THR A 514  GLU A 534  1 ? 21 
HELX_P HELX_P28 AD1 THR A 483 ? SER A 513 ? THR A 549  SER A 579  1 ? 31 
HELX_P HELX_P29 AD2 ASP A 515 ? LEU A 523 ? ASP A 581  LEU A 589  1 ? 9  
HELX_P HELX_P30 AD3 GLN A 524 ? PHE A 529 ? GLN A 590  PHE A 595  5 ? 6  
HELX_P HELX_P31 AD4 ASP A 530 ? THR A 535 ? ASP A 596  THR A 601  5 ? 6  
HELX_P HELX_P32 AD5 LEU A 539 ? HIS A 557 ? LEU A 605  HIS A 623  1 ? 19 
HELX_P HELX_P33 AD6 ASP A 559 ? CYS A 574 ? ASP A 625  CYS A 640  1 ? 16 
HELX_P HELX_P34 AD7 ILE A 580 ? GLN A 608 ? ILE A 646  GLN A 674  1 ? 29 
HELX_P HELX_P35 AD8 ASP A 614 ? HIS A 635 ? ASP A 680  HIS A 701  1 ? 22 
HELX_P HELX_P36 AD9 LEU A 642 ? GLY A 657 ? LEU A 708  GLY A 723  1 ? 16 
HELX_P HELX_P37 AE1 PRO A 660 ? LEU A 679 ? PRO A 726  LEU A 745  1 ? 20 
HELX_P HELX_P38 AE2 ASP A 691 ? TYR A 709 ? ASP A 757  TYR A 775  1 ? 19 
HELX_P HELX_P39 AE3 LEU A 710 ? ASN A 712 ? LEU A 776  ASN A 778  5 ? 3  
HELX_P HELX_P40 AE4 ASN A 714 ? PHE A 732 ? ASN A 780  PHE A 798  1 ? 19 
HELX_P HELX_P41 AE5 SER A 733 ? SER A 738 ? SER A 799  SER A 804  5 ? 6  
HELX_P HELX_P42 AE6 ARG A 741 ? GLU A 745 ? ARG A 807  GLU A 811  5 ? 5  
HELX_P HELX_P43 AE7 ASP A 752 ? VAL A 767 ? ASP A 818  VAL A 833  1 ? 16 
HELX_P HELX_P44 AE8 LYS A 788 ? TYR A 808 ? LYS A 854  TYR A 874  1 ? 21 
HELX_P HELX_P45 AE9 GLU A 812 ? THR A 815 ? GLU A 878  THR A 881  5 ? 4  
HELX_P HELX_P46 AF1 ALA A 816 ? LYS A 821 ? ALA A 882  LYS A 887  1 ? 6  
HELX_P HELX_P47 AF2 TYR A 830 ? GLN A 843 ? TYR A 896  GLN A 909  1 ? 14 
HELX_P HELX_P48 AF3 ASP A 845 ? GLN A 866 ? ASP A 911  GLN A 932  1 ? 22 
HELX_P HELX_P49 AF4 SER A 876 ? LEU A 891 ? SER A 942  LEU A 957  1 ? 16 
HELX_P HELX_P50 AF5 ARG A 901 ? PHE A 916 ? ARG A 967  PHE A 982  1 ? 16 
HELX_P HELX_P51 AF6 PRO A 928 ? LEU A 931 ? PRO A 994  LEU A 997  5 ? 4  
HELX_P HELX_P52 AF7 ALA A 932 ? SER A 938 ? ALA A 998  SER A 1004 1 ? 7  
HELX_P HELX_P53 AF8 GLN A 947 ? LYS A 958 ? GLN A 1013 LYS A 1024 1 ? 12 
HELX_P HELX_P54 AF9 THR A 961 ? ARG A 967 ? THR A 1027 ARG A 1033 1 ? 7  
HELX_P HELX_P55 AG1 TRP A 972 ? ASN A 980 ? TRP A 1038 ASN A 1046 1 ? 9  
HELX_P HELX_P56 AG2 ASP B 61  ? ASP B 71  ? ASP B 333  ASP B 343  1 ? 11 
HELX_P HELX_P57 AG3 TYR B 72  ? VAL B 76  ? TYR B 344  VAL B 348  5 ? 5  
HELX_P HELX_P58 AG4 THR B 85  ? GLY B 95  ? THR B 357  GLY B 367  1 ? 11 
HELX_P HELX_P59 AG5 GLY B 96  ? PHE B 101 ? GLY B 368  PHE B 373  1 ? 6  
HELX_P HELX_P60 AG6 ASN B 110 ? ARG B 119 ? ASN B 382  ARG B 391  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 290 A . ? TYR 356  A ASN 291 A ? ASN 357  A 1 -6.44 
2 VAL 481 A . ? VAL 547  A LEU 482 A ? LEU 548  A 1 13.74 
3 SER 686 A . ? SER 752  A SER 687 A ? SER 753  A 1 -2.69 
4 ASN 871 A . ? ASN 937  A PHE 872 A ? PHE 938  A 1 -7.33 
5 LEU 944 A . ? LEU 1010 A LEU 945 A ? LEU 1011 A 1 -5.98 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    MES 
_struct_site.pdbx_auth_seq_id     1101 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue MES A 1101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 VAL A 228 ? VAL A 294 . ? 1_555 ? 
2 AC1 6 TYR A 231 ? TYR A 297 . ? 1_555 ? 
3 AC1 6 ARG A 232 ? ARG A 298 . ? 1_555 ? 
4 AC1 6 TYR A 265 ? TYR A 331 . ? 1_555 ? 
5 AC1 6 TRP A 268 ? TRP A 334 . ? 1_555 ? 
6 AC1 6 ARG B 66  ? ARG B 338 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4PK7 
_atom_sites.fract_transf_matrix[1][1]   0.012746 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009322 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005552 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . MET A 1 17  ? 44.918  152.310 67.213  1.00 74.35  ? 83   MET A N    1 
ATOM   2     C CA   . MET A 1 17  ? 46.364  152.125 67.343  1.00 90.88  ? 83   MET A CA   1 
ATOM   3     C C    . MET A 1 17  ? 46.717  150.829 68.080  1.00 89.74  ? 83   MET A C    1 
ATOM   4     O O    . MET A 1 17  ? 47.115  149.845 67.455  1.00 73.64  ? 83   MET A O    1 
ATOM   5     C CB   . MET A 1 17  ? 46.999  153.318 68.076  1.00 103.44 ? 83   MET A CB   1 
ATOM   6     C CG   . MET A 1 17  ? 47.016  154.640 67.290  1.00 110.66 ? 83   MET A CG   1 
ATOM   7     S SD   . MET A 1 17  ? 48.197  154.751 65.911  1.00 105.41 ? 83   MET A SD   1 
ATOM   8     C CE   . MET A 1 17  ? 49.772  154.621 66.764  1.00 119.78 ? 83   MET A CE   1 
ATOM   9     H HA   . MET A 1 17  ? 46.751  152.090 66.454  1.00 109.05 ? 83   MET A HA   1 
ATOM   10    H HB2  . MET A 1 17  ? 46.504  153.473 68.896  1.00 124.13 ? 83   MET A HB2  1 
ATOM   11    H HB3  . MET A 1 17  ? 47.918  153.093 68.290  1.00 124.13 ? 83   MET A HB3  1 
ATOM   12    H HG2  . MET A 1 17  ? 46.130  154.785 66.922  1.00 132.79 ? 83   MET A HG2  1 
ATOM   13    H HG3  . MET A 1 17  ? 47.228  155.357 67.908  1.00 132.79 ? 83   MET A HG3  1 
ATOM   14    H HE1  . MET A 1 17  ? 50.488  154.669 66.112  1.00 143.73 ? 83   MET A HE1  1 
ATOM   15    H HE2  . MET A 1 17  ? 49.850  155.352 67.396  1.00 143.73 ? 83   MET A HE2  1 
ATOM   16    H HE3  . MET A 1 17  ? 49.807  153.772 67.232  1.00 143.73 ? 83   MET A HE3  1 
ATOM   17    N N    . LEU A 1 18  ? 46.564  150.834 69.405  1.00 80.49  ? 84   LEU A N    1 
ATOM   18    C CA   . LEU A 1 18  ? 47.042  149.731 70.247  1.00 63.99  ? 84   LEU A CA   1 
ATOM   19    C C    . LEU A 1 18  ? 46.487  148.355 69.869  1.00 63.43  ? 84   LEU A C    1 
ATOM   20    O O    . LEU A 1 18  ? 47.241  147.398 69.703  1.00 63.12  ? 84   LEU A O    1 
ATOM   21    C CB   . LEU A 1 18  ? 46.722  150.001 71.718  1.00 60.99  ? 84   LEU A CB   1 
ATOM   22    C CG   . LEU A 1 18  ? 47.635  150.933 72.515  1.00 58.53  ? 84   LEU A CG   1 
ATOM   23    C CD1  . LEU A 1 18  ? 47.367  152.400 72.163  1.00 79.11  ? 84   LEU A CD1  1 
ATOM   24    C CD2  . LEU A 1 18  ? 47.444  150.680 73.994  1.00 44.33  ? 84   LEU A CD2  1 
ATOM   25    H H    . LEU A 1 18  ? 46.183  151.468 69.845  1.00 96.59  ? 84   LEU A H    1 
ATOM   26    H HA   . LEU A 1 18  ? 48.008  149.684 70.165  1.00 76.79  ? 84   LEU A HA   1 
ATOM   27    H HB2  . LEU A 1 18  ? 45.831  150.382 71.761  1.00 73.19  ? 84   LEU A HB2  1 
ATOM   28    H HB3  . LEU A 1 18  ? 46.722  149.149 72.181  1.00 73.19  ? 84   LEU A HB3  1 
ATOM   29    H HG   . LEU A 1 18  ? 48.559  150.735 72.293  1.00 70.24  ? 84   LEU A HG   1 
ATOM   30    H HD11 . LEU A 1 18  ? 47.961  152.963 72.683  1.00 94.93  ? 84   LEU A HD11 1 
ATOM   31    H HD12 . LEU A 1 18  ? 47.531  152.532 71.216  1.00 94.93  ? 84   LEU A HD12 1 
ATOM   32    H HD13 . LEU A 1 18  ? 46.444  152.611 72.371  1.00 94.93  ? 84   LEU A HD13 1 
ATOM   33    H HD21 . LEU A 1 18  ? 48.026  151.274 74.493  1.00 53.19  ? 84   LEU A HD21 1 
ATOM   34    H HD22 . LEU A 1 18  ? 46.518  150.852 74.225  1.00 53.19  ? 84   LEU A HD22 1 
ATOM   35    H HD23 . LEU A 1 18  ? 47.668  149.757 74.187  1.00 53.19  ? 84   LEU A HD23 1 
ATOM   36    N N    . PHE A 1 19  ? 45.165  148.263 69.769  1.00 73.86  ? 85   PHE A N    1 
ATOM   37    C CA   . PHE A 1 19  ? 44.498  147.021 69.403  1.00 69.39  ? 85   PHE A CA   1 
ATOM   38    C C    . PHE A 1 19  ? 45.121  146.459 68.136  1.00 80.99  ? 85   PHE A C    1 
ATOM   39    O O    . PHE A 1 19  ? 45.405  145.261 68.051  1.00 71.47  ? 85   PHE A O    1 
ATOM   40    C CB   . PHE A 1 19  ? 43.008  147.290 69.191  1.00 63.30  ? 85   PHE A CB   1 
ATOM   41    C CG   . PHE A 1 19  ? 42.269  146.177 68.496  1.00 59.14  ? 85   PHE A CG   1 
ATOM   42    C CD1  . PHE A 1 19  ? 41.980  144.997 69.151  1.00 58.99  ? 85   PHE A CD1  1 
ATOM   43    C CD2  . PHE A 1 19  ? 41.830  146.330 67.191  1.00 76.77  ? 85   PHE A CD2  1 
ATOM   44    C CE1  . PHE A 1 19  ? 41.286  143.983 68.512  1.00 54.68  ? 85   PHE A CE1  1 
ATOM   45    C CE2  . PHE A 1 19  ? 41.134  145.318 66.550  1.00 69.92  ? 85   PHE A CE2  1 
ATOM   46    C CZ   . PHE A 1 19  ? 40.863  144.148 67.212  1.00 55.29  ? 85   PHE A CZ   1 
ATOM   47    H H    . PHE A 1 19  ? 44.625  148.917 69.910  1.00 88.63  ? 85   PHE A H    1 
ATOM   48    H HA   . PHE A 1 19  ? 44.600  146.372 70.116  1.00 83.27  ? 85   PHE A HA   1 
ATOM   49    H HB2  . PHE A 1 19  ? 42.591  147.425 70.056  1.00 75.96  ? 85   PHE A HB2  1 
ATOM   50    H HB3  . PHE A 1 19  ? 42.910  148.090 68.652  1.00 75.96  ? 85   PHE A HB3  1 
ATOM   51    H HD1  . PHE A 1 19  ? 42.262  144.879 70.030  1.00 70.79  ? 85   PHE A HD1  1 
ATOM   52    H HD2  . PHE A 1 19  ? 42.010  147.122 66.737  1.00 92.13  ? 85   PHE A HD2  1 
ATOM   53    H HE1  . PHE A 1 19  ? 41.103  143.190 68.962  1.00 65.62  ? 85   PHE A HE1  1 
ATOM   54    H HE2  . PHE A 1 19  ? 40.851  145.432 65.671  1.00 83.90  ? 85   PHE A HE2  1 
ATOM   55    H HZ   . PHE A 1 19  ? 40.398  143.466 66.783  1.00 66.35  ? 85   PHE A HZ   1 
ATOM   56    N N    . GLU A 1 20  ? 45.349  147.339 67.160  1.00 97.07  ? 86   GLU A N    1 
ATOM   57    C CA   . GLU A 1 20  ? 46.034  146.958 65.919  1.00 101.25 ? 86   GLU A CA   1 
ATOM   58    C C    . GLU A 1 20  ? 47.434  146.408 66.210  1.00 91.63  ? 86   GLU A C    1 
ATOM   59    O O    . GLU A 1 20  ? 47.794  145.348 65.705  1.00 87.92  ? 86   GLU A O    1 
ATOM   60    C CB   . GLU A 1 20  ? 46.098  148.142 64.922  1.00 113.66 ? 86   GLU A CB   1 
ATOM   61    C CG   . GLU A 1 20  ? 47.042  147.957 63.689  1.00 126.74 ? 86   GLU A CG   1 
ATOM   62    C CD   . GLU A 1 20  ? 47.728  149.265 63.210  1.00 105.98 ? 86   GLU A CD   1 
ATOM   63    O OE1  . GLU A 1 20  ? 47.324  150.373 63.641  1.00 106.27 ? 86   GLU A OE1  1 
ATOM   64    O OE2  . GLU A 1 20  ? 48.680  149.176 62.394  1.00 93.24  ? 86   GLU A OE2  1 
ATOM   65    H H    . GLU A 1 20  ? 45.116  148.166 67.190  1.00 116.49 ? 86   GLU A H    1 
ATOM   66    H HA   . GLU A 1 20  ? 45.526  146.249 65.495  1.00 121.50 ? 86   GLU A HA   1 
ATOM   67    H HB2  . GLU A 1 20  ? 45.205  148.300 64.580  1.00 136.40 ? 86   GLU A HB2  1 
ATOM   68    H HB3  . GLU A 1 20  ? 46.403  148.927 65.403  1.00 136.40 ? 86   GLU A HB3  1 
ATOM   69    H HG2  . GLU A 1 20  ? 47.741  147.326 63.924  1.00 152.09 ? 86   GLU A HG2  1 
ATOM   70    H HG3  . GLU A 1 20  ? 46.522  147.608 62.948  1.00 152.09 ? 86   GLU A HG3  1 
ATOM   71    N N    . VAL A 1 21  ? 48.210  147.115 67.030  1.00 88.09  ? 87   VAL A N    1 
ATOM   72    C CA   . VAL A 1 21  ? 49.606  146.745 67.251  1.00 79.85  ? 87   VAL A CA   1 
ATOM   73    C C    . VAL A 1 21  ? 49.737  145.341 67.856  1.00 82.73  ? 87   VAL A C    1 
ATOM   74    O O    . VAL A 1 21  ? 50.689  144.617 67.561  1.00 87.05  ? 87   VAL A O    1 
ATOM   75    C CB   . VAL A 1 21  ? 50.345  147.778 68.139  1.00 66.31  ? 87   VAL A CB   1 
ATOM   76    C CG1  . VAL A 1 21  ? 51.801  147.384 68.323  1.00 78.13  ? 87   VAL A CG1  1 
ATOM   77    C CG2  . VAL A 1 21  ? 50.283  149.167 67.519  1.00 71.66  ? 87   VAL A CG2  1 
ATOM   78    H H    . VAL A 1 21  ? 47.954  147.810 67.468  1.00 105.70 ? 87   VAL A H    1 
ATOM   79    H HA   . VAL A 1 21  ? 50.055  146.730 66.392  1.00 95.82  ? 87   VAL A HA   1 
ATOM   80    H HB   . VAL A 1 21  ? 49.924  147.813 69.012  1.00 79.57  ? 87   VAL A HB   1 
ATOM   81    H HG11 . VAL A 1 21  ? 52.239  148.045 68.881  1.00 93.75  ? 87   VAL A HG11 1 
ATOM   82    H HG12 . VAL A 1 21  ? 51.840  146.513 68.749  1.00 93.75  ? 87   VAL A HG12 1 
ATOM   83    H HG13 . VAL A 1 21  ? 52.230  147.347 67.454  1.00 93.75  ? 87   VAL A HG13 1 
ATOM   84    H HG21 . VAL A 1 21  ? 50.753  149.791 68.095  1.00 85.99  ? 87   VAL A HG21 1 
ATOM   85    H HG22 . VAL A 1 21  ? 50.704  149.142 66.646  1.00 85.99  ? 87   VAL A HG22 1 
ATOM   86    H HG23 . VAL A 1 21  ? 49.354  149.432 67.432  1.00 85.99  ? 87   VAL A HG23 1 
ATOM   87    N N    . VAL A 1 22  ? 48.758  144.946 68.668  1.00 84.97  ? 88   VAL A N    1 
ATOM   88    C CA   . VAL A 1 22  ? 48.859  143.708 69.447  1.00 87.43  ? 88   VAL A CA   1 
ATOM   89    C C    . VAL A 1 22  ? 48.629  142.452 68.577  1.00 88.63  ? 88   VAL A C    1 
ATOM   90    O O    . VAL A 1 22  ? 49.558  141.669 68.386  1.00 96.77  ? 88   VAL A O    1 
ATOM   91    C CB   . VAL A 1 22  ? 47.939  143.755 70.710  1.00 60.74  ? 88   VAL A CB   1 
ATOM   92    C CG1  . VAL A 1 22  ? 48.076  142.494 71.548  1.00 66.23  ? 88   VAL A CG1  1 
ATOM   93    C CG2  . VAL A 1 22  ? 48.311  144.945 71.568  1.00 43.61  ? 88   VAL A CG2  1 
ATOM   94    H H    . VAL A 1 22  ? 48.023  145.375 68.787  1.00 101.97 ? 88   VAL A H    1 
ATOM   95    H HA   . VAL A 1 22  ? 49.770  143.647 69.775  1.00 104.92 ? 88   VAL A HA   1 
ATOM   96    H HB   . VAL A 1 22  ? 47.013  143.848 70.436  1.00 72.88  ? 88   VAL A HB   1 
ATOM   97    H HG11 . VAL A 1 22  ? 47.491  142.563 72.319  1.00 79.48  ? 88   VAL A HG11 1 
ATOM   98    H HG12 . VAL A 1 22  ? 47.824  141.728 71.009  1.00 79.48  ? 88   VAL A HG12 1 
ATOM   99    H HG13 . VAL A 1 22  ? 48.997  142.406 71.838  1.00 79.48  ? 88   VAL A HG13 1 
ATOM   100   H HG21 . VAL A 1 22  ? 47.735  144.965 72.348  1.00 52.33  ? 88   VAL A HG21 1 
ATOM   101   H HG22 . VAL A 1 22  ? 49.238  144.858 71.843  1.00 52.33  ? 88   VAL A HG22 1 
ATOM   102   H HG23 . VAL A 1 22  ? 48.195  145.757 71.050  1.00 52.33  ? 88   VAL A HG23 1 
ATOM   103   N N    . LYS A 1 23  ? 47.432  142.260 68.027  1.00 95.59  ? 89   LYS A N    1 
ATOM   104   C CA   . LYS A 1 23  ? 47.207  141.110 67.139  1.00 104.58 ? 89   LYS A CA   1 
ATOM   105   C C    . LYS A 1 23  ? 47.954  141.260 65.809  1.00 103.56 ? 89   LYS A C    1 
ATOM   106   O O    . LYS A 1 23  ? 48.741  140.387 65.426  1.00 100.25 ? 89   LYS A O    1 
ATOM   107   C CB   . LYS A 1 23  ? 45.696  140.849 66.905  1.00 107.68 ? 89   LYS A CB   1 
ATOM   108   C CG   . LYS A 1 23  ? 44.980  141.620 65.776  1.00 102.90 ? 89   LYS A CG   1 
ATOM   109   C CD   . LYS A 1 23  ? 43.711  140.896 65.301  1.00 106.06 ? 89   LYS A CD   1 
ATOM   110   C CE   . LYS A 1 23  ? 44.072  139.671 64.443  1.00 101.76 ? 89   LYS A CE   1 
ATOM   111   N NZ   . LYS A 1 23  ? 42.910  139.004 63.775  1.00 89.51  ? 89   LYS A NZ   1 
ATOM   112   H H    . LYS A 1 23  ? 46.747  142.766 68.144  1.00 114.71 ? 89   LYS A H    1 
ATOM   113   H HA   . LYS A 1 23  ? 47.566  140.322 67.576  1.00 125.50 ? 89   LYS A HA   1 
ATOM   114   H HB2  . LYS A 1 23  ? 45.586  139.904 66.713  1.00 129.21 ? 89   LYS A HB2  1 
ATOM   115   H HB3  . LYS A 1 23  ? 45.229  141.059 67.728  1.00 129.21 ? 89   LYS A HB3  1 
ATOM   116   H HG2  . LYS A 1 23  ? 44.724  142.497 66.102  1.00 123.48 ? 89   LYS A HG2  1 
ATOM   117   H HG3  . LYS A 1 23  ? 45.580  141.706 65.019  1.00 123.48 ? 89   LYS A HG3  1 
ATOM   118   H HD2  . LYS A 1 23  ? 43.205  140.592 66.071  1.00 127.27 ? 89   LYS A HD2  1 
ATOM   119   H HD3  . LYS A 1 23  ? 43.176  141.500 64.763  1.00 127.27 ? 89   LYS A HD3  1 
ATOM   120   H HE2  . LYS A 1 23  ? 44.688  139.952 63.748  1.00 122.11 ? 89   LYS A HE2  1 
ATOM   121   H HE3  . LYS A 1 23  ? 44.501  139.012 65.011  1.00 122.11 ? 89   LYS A HE3  1 
ATOM   122   H HZ1  . LYS A 1 23  ? 43.192  138.308 63.298  1.00 107.41 ? 89   LYS A HZ1  1 
ATOM   123   H HZ2  . LYS A 1 23  ? 42.329  138.720 64.387  1.00 107.41 ? 89   LYS A HZ2  1 
ATOM   124   H HZ3  . LYS A 1 23  ? 42.500  139.579 63.233  1.00 107.41 ? 89   LYS A HZ3  1 
ATOM   125   N N    . MET A 1 24  ? 47.718  142.380 65.132  1.00 109.27 ? 90   MET A N    1 
ATOM   126   C CA   . MET A 1 24  ? 48.010  142.486 63.709  1.00 113.14 ? 90   MET A CA   1 
ATOM   127   C C    . MET A 1 24  ? 49.496  142.278 63.470  1.00 116.04 ? 90   MET A C    1 
ATOM   128   O O    . MET A 1 24  ? 49.902  141.471 62.627  1.00 121.16 ? 90   MET A O    1 
ATOM   129   C CB   . MET A 1 24  ? 47.573  143.849 63.143  1.00 119.61 ? 90   MET A CB   1 
ATOM   130   C CG   . MET A 1 24  ? 46.139  144.299 63.485  1.00 128.95 ? 90   MET A CG   1 
ATOM   131   S SD   . MET A 1 24  ? 44.980  144.213 62.089  1.00 162.15 ? 90   MET A SD   1 
ATOM   132   C CE   . MET A 1 24  ? 45.094  145.888 61.427  1.00 129.05 ? 90   MET A CE   1 
ATOM   133   H H    . MET A 1 24  ? 47.388  143.096 65.476  1.00 131.12 ? 90   MET A H    1 
ATOM   134   H HA   . MET A 1 24  ? 47.517  141.796 63.237  1.00 135.76 ? 90   MET A HA   1 
ATOM   135   H HB2  . MET A 1 24  ? 48.177  144.528 63.483  1.00 143.53 ? 90   MET A HB2  1 
ATOM   136   H HB3  . MET A 1 24  ? 47.641  143.813 62.176  1.00 143.53 ? 90   MET A HB3  1 
ATOM   137   H HG2  . MET A 1 24  ? 45.795  143.730 64.190  1.00 154.74 ? 90   MET A HG2  1 
ATOM   138   H HG3  . MET A 1 24  ? 46.166  145.219 63.790  1.00 154.74 ? 90   MET A HG3  1 
ATOM   139   H HE1  . MET A 1 24  ? 44.505  145.965 60.660  1.00 154.86 ? 90   MET A HE1  1 
ATOM   140   H HE2  . MET A 1 24  ? 44.826  146.518 62.115  1.00 154.86 ? 90   MET A HE2  1 
ATOM   141   H HE3  . MET A 1 24  ? 46.010  146.060 61.159  1.00 154.86 ? 90   MET A HE3  1 
ATOM   142   N N    . GLY A 1 25  ? 50.304  143.009 64.231  1.00 117.82 ? 91   GLY A N    1 
ATOM   143   C CA   . GLY A 1 25  ? 51.748  142.919 64.125  1.00 115.20 ? 91   GLY A CA   1 
ATOM   144   C C    . GLY A 1 25  ? 52.328  142.163 65.288  1.00 103.38 ? 91   GLY A C    1 
ATOM   145   O O    . GLY A 1 25  ? 51.662  141.921 66.294  1.00 102.05 ? 91   GLY A O    1 
ATOM   146   H H    . GLY A 1 25  ? 50.033  143.571 64.823  1.00 141.39 ? 91   GLY A H    1 
ATOM   147   H HA2  . GLY A 1 25  ? 51.989  142.461 63.304  1.00 138.24 ? 91   GLY A HA2  1 
ATOM   148   H HA3  . GLY A 1 25  ? 52.132  143.810 64.109  1.00 138.24 ? 91   GLY A HA3  1 
ATOM   149   N N    . LYS A 1 26  ? 53.567  141.740 65.129  1.00 92.22  ? 92   LYS A N    1 
ATOM   150   C CA   . LYS A 1 26  ? 54.197  140.902 66.125  1.00 108.37 ? 92   LYS A CA   1 
ATOM   151   C C    . LYS A 1 26  ? 55.597  141.452 66.370  1.00 113.98 ? 92   LYS A C    1 
ATOM   152   O O    . LYS A 1 26  ? 56.611  140.733 66.326  1.00 96.09  ? 92   LYS A O    1 
ATOM   153   C CB   . LYS A 1 26  ? 54.195  139.458 65.643  1.00 110.16 ? 92   LYS A CB   1 
ATOM   154   C CG   . LYS A 1 26  ? 52.789  138.951 65.269  1.00 112.74 ? 92   LYS A CG   1 
ATOM   155   C CD   . LYS A 1 26  ? 52.860  137.739 64.348  1.00 119.54 ? 92   LYS A CD   1 
ATOM   156   C CE   . LYS A 1 26  ? 51.485  137.169 64.026  1.00 114.99 ? 92   LYS A CE   1 
ATOM   157   N NZ   . LYS A 1 26  ? 51.611  135.893 63.262  1.00 121.62 ? 92   LYS A NZ   1 
ATOM   158   H H    . LYS A 1 26  ? 54.065  141.924 64.452  1.00 110.67 ? 92   LYS A H    1 
ATOM   159   H HA   . LYS A 1 26  ? 53.697  140.951 66.954  1.00 130.04 ? 92   LYS A HA   1 
ATOM   160   H HB2  . LYS A 1 26  ? 54.758  139.388 64.856  1.00 132.19 ? 92   LYS A HB2  1 
ATOM   161   H HB3  . LYS A 1 26  ? 54.540  138.890 66.350  1.00 132.19 ? 92   LYS A HB3  1 
ATOM   162   H HG2  . LYS A 1 26  ? 52.316  138.693 66.075  1.00 135.29 ? 92   LYS A HG2  1 
ATOM   163   H HG3  . LYS A 1 26  ? 52.306  139.655 64.807  1.00 135.29 ? 92   LYS A HG3  1 
ATOM   164   H HD2  . LYS A 1 26  ? 53.280  137.999 63.514  1.00 143.45 ? 92   LYS A HD2  1 
ATOM   165   H HD3  . LYS A 1 26  ? 53.380  137.043 64.780  1.00 143.45 ? 92   LYS A HD3  1 
ATOM   166   H HE2  . LYS A 1 26  ? 51.010  136.987 64.852  1.00 137.99 ? 92   LYS A HE2  1 
ATOM   167   H HE3  . LYS A 1 26  ? 50.992  137.804 63.484  1.00 137.99 ? 92   LYS A HE3  1 
ATOM   168   H HZ1  . LYS A 1 26  ? 50.803  135.568 63.078  1.00 145.94 ? 92   LYS A HZ1  1 
ATOM   169   H HZ2  . LYS A 1 26  ? 52.045  136.038 62.498  1.00 145.94 ? 92   LYS A HZ2  1 
ATOM   170   H HZ3  . LYS A 1 26  ? 52.061  135.294 63.742  1.00 145.94 ? 92   LYS A HZ3  1 
ATOM   171   N N    . SER A 1 27  ? 55.620  142.770 66.560  1.00 116.20 ? 93   SER A N    1 
ATOM   172   C CA   . SER A 1 27  ? 56.687  143.443 67.287  1.00 111.18 ? 93   SER A CA   1 
ATOM   173   C C    . SER A 1 27  ? 56.622  142.944 68.726  1.00 99.69  ? 93   SER A C    1 
ATOM   174   O O    . SER A 1 27  ? 55.557  142.524 69.199  1.00 85.03  ? 93   SER A O    1 
ATOM   175   C CB   . SER A 1 27  ? 56.475  144.960 67.252  1.00 101.89 ? 93   SER A CB   1 
ATOM   176   O OG   . SER A 1 27  ? 55.240  145.301 67.861  1.00 102.69 ? 93   SER A OG   1 
ATOM   177   H H    . SER A 1 27  ? 55.013  143.305 66.270  1.00 139.44 ? 93   SER A H    1 
ATOM   178   H HA   . SER A 1 27  ? 57.552  143.225 66.905  1.00 133.42 ? 93   SER A HA   1 
ATOM   179   H HB2  . SER A 1 27  ? 57.197  145.392 67.735  1.00 122.27 ? 93   SER A HB2  1 
ATOM   180   H HB3  . SER A 1 27  ? 56.467  145.258 66.329  1.00 122.27 ? 93   SER A HB3  1 
ATOM   181   H HG   . SER A 1 27  ? 55.129  146.134 67.839  1.00 123.23 ? 93   SER A HG   1 
ATOM   182   N N    . ALA A 1 28  ? 57.761  142.982 69.412  1.00 84.72  ? 94   ALA A N    1 
ATOM   183   C CA   . ALA A 1 28  ? 57.858  142.539 70.796  1.00 75.24  ? 94   ALA A CA   1 
ATOM   184   C C    . ALA A 1 28  ? 56.762  143.160 71.665  1.00 88.21  ? 94   ALA A C    1 
ATOM   185   O O    . ALA A 1 28  ? 56.246  144.247 71.367  1.00 82.29  ? 94   ALA A O    1 
ATOM   186   C CB   . ALA A 1 28  ? 59.193  142.926 71.339  1.00 65.25  ? 94   ALA A CB   1 
ATOM   187   H H    . ALA A 1 28  ? 58.505  143.265 69.088  1.00 101.66 ? 94   ALA A H    1 
ATOM   188   H HA   . ALA A 1 28  ? 57.775  141.574 70.836  1.00 90.29  ? 94   ALA A HA   1 
ATOM   189   H HB1  . ALA A 1 28  ? 59.256  142.630 72.261  1.00 78.31  ? 94   ALA A HB1  1 
ATOM   190   H HB2  . ALA A 1 28  ? 59.884  142.501 70.807  1.00 78.31  ? 94   ALA A HB2  1 
ATOM   191   H HB3  . ALA A 1 28  ? 59.285  143.890 71.293  1.00 78.31  ? 94   ALA A HB3  1 
ATOM   192   N N    . MET A 1 29  ? 56.416  142.478 72.750  1.00 79.61  ? 95   MET A N    1 
ATOM   193   C CA   . MET A 1 29  ? 55.379  142.982 73.627  1.00 70.03  ? 95   MET A CA   1 
ATOM   194   C C    . MET A 1 29  ? 55.919  144.062 74.552  1.00 71.46  ? 95   MET A C    1 
ATOM   195   O O    . MET A 1 29  ? 55.225  145.043 74.839  1.00 61.78  ? 95   MET A O    1 
ATOM   196   C CB   . MET A 1 29  ? 54.762  141.849 74.444  1.00 68.01  ? 95   MET A CB   1 
ATOM   197   C CG   . MET A 1 29  ? 53.273  142.065 74.719  1.00 69.28  ? 95   MET A CG   1 
ATOM   198   S SD   . MET A 1 29  ? 52.277  142.086 73.203  1.00 73.09  ? 95   MET A SD   1 
ATOM   199   C CE   . MET A 1 29  ? 51.702  143.756 73.279  1.00 51.08  ? 95   MET A CE   1 
ATOM   200   H H    . MET A 1 29  ? 56.764  141.731 72.996  1.00 95.53  ? 95   MET A H    1 
ATOM   201   H HA   . MET A 1 29  ? 54.674  143.367 73.082  1.00 84.04  ? 95   MET A HA   1 
ATOM   202   H HB2  . MET A 1 29  ? 54.860  141.017 73.955  1.00 81.61  ? 95   MET A HB2  1 
ATOM   203   H HB3  . MET A 1 29  ? 55.220  141.789 75.297  1.00 81.61  ? 95   MET A HB3  1 
ATOM   204   H HG2  . MET A 1 29  ? 52.948  141.344 75.282  1.00 83.13  ? 95   MET A HG2  1 
ATOM   205   H HG3  . MET A 1 29  ? 53.154  142.916 75.168  1.00 83.13  ? 95   MET A HG3  1 
ATOM   206   H HE1  . MET A 1 29  ? 51.195  143.878 74.098  1.00 61.29  ? 95   MET A HE1  1 
ATOM   207   H HE2  . MET A 1 29  ? 52.466  144.354 73.270  1.00 61.29  ? 95   MET A HE2  1 
ATOM   208   H HE3  . MET A 1 29  ? 51.136  143.930 72.511  1.00 61.29  ? 95   MET A HE3  1 
ATOM   209   N N    . GLN A 1 30  ? 57.154  143.883 75.021  1.00 71.00  ? 96   GLN A N    1 
ATOM   210   C CA   . GLN A 1 30  ? 57.753  144.852 75.926  1.00 51.08  ? 96   GLN A CA   1 
ATOM   211   C C    . GLN A 1 30  ? 58.063  146.145 75.181  1.00 45.67  ? 96   GLN A C    1 
ATOM   212   O O    . GLN A 1 30  ? 58.213  147.201 75.791  1.00 51.35  ? 96   GLN A O    1 
ATOM   213   C CB   . GLN A 1 30  ? 59.008  144.298 76.609  1.00 47.83  ? 96   GLN A CB   1 
ATOM   214   C CG   . GLN A 1 30  ? 59.540  145.257 77.680  1.00 55.60  ? 96   GLN A CG   1 
ATOM   215   C CD   . GLN A 1 30  ? 60.668  144.694 78.511  1.00 55.95  ? 96   GLN A CD   1 
ATOM   216   O OE1  . GLN A 1 30  ? 60.471  143.796 79.327  1.00 74.70  ? 96   GLN A OE1  1 
ATOM   217   N NE2  . GLN A 1 30  ? 61.861  145.239 78.325  1.00 64.59  ? 96   GLN A NE2  1 
ATOM   218   H H    . GLN A 1 30  ? 57.659  143.213 74.830  1.00 85.21  ? 96   GLN A H    1 
ATOM   219   H HA   . GLN A 1 30  ? 57.110  145.062 76.622  1.00 61.30  ? 96   GLN A HA   1 
ATOM   220   H HB2  . GLN A 1 30  ? 58.794  143.454 77.036  1.00 57.39  ? 96   GLN A HB2  1 
ATOM   221   H HB3  . GLN A 1 30  ? 59.703  144.170 75.944  1.00 57.39  ? 96   GLN A HB3  1 
ATOM   222   H HG2  . GLN A 1 30  ? 59.866  146.060 77.245  1.00 66.72  ? 96   GLN A HG2  1 
ATOM   223   H HG3  . GLN A 1 30  ? 58.814  145.483 78.283  1.00 66.72  ? 96   GLN A HG3  1 
ATOM   224   H HE21 . GLN A 1 30  ? 61.959  145.877 77.757  1.00 77.51  ? 96   GLN A HE21 1 
ATOM   225   H HE22 . GLN A 1 30  ? 62.538  144.955 78.773  1.00 77.51  ? 96   GLN A HE22 1 
ATOM   226   N N    . SER A 1 31  ? 58.133  146.074 73.858  1.00 52.81  ? 97   SER A N    1 
ATOM   227   C CA   . SER A 1 31  ? 58.445  147.262 73.066  1.00 62.75  ? 97   SER A CA   1 
ATOM   228   C C    . SER A 1 31  ? 57.247  148.202 72.999  1.00 55.12  ? 97   SER A C    1 
ATOM   229   O O    . SER A 1 31  ? 57.401  149.421 72.959  1.00 64.65  ? 97   SER A O    1 
ATOM   230   C CB   . SER A 1 31  ? 58.898  146.879 71.656  1.00 72.43  ? 97   SER A CB   1 
ATOM   231   O OG   . SER A 1 31  ? 60.063  146.069 71.699  1.00 85.83  ? 97   SER A OG   1 
ATOM   232   H H    . SER A 1 31  ? 58.006  145.360 73.397  1.00 63.37  ? 97   SER A H    1 
ATOM   233   H HA   . SER A 1 31  ? 59.174  147.739 73.492  1.00 75.30  ? 97   SER A HA   1 
ATOM   234   H HB2  . SER A 1 31  ? 58.187  146.385 71.219  1.00 86.92  ? 97   SER A HB2  1 
ATOM   235   H HB3  . SER A 1 31  ? 59.094  147.687 71.157  1.00 86.92  ? 97   SER A HB3  1 
ATOM   236   H HG   . SER A 1 31  ? 60.301  145.867 70.919  1.00 102.99 ? 97   SER A HG   1 
ATOM   237   N N    . VAL A 1 32  ? 56.051  147.632 73.012  1.00 47.45  ? 98   VAL A N    1 
ATOM   238   C CA   . VAL A 1 32  ? 54.839  148.436 72.919  1.00 50.95  ? 98   VAL A CA   1 
ATOM   239   C C    . VAL A 1 32  ? 54.408  148.940 74.287  1.00 46.22  ? 98   VAL A C    1 
ATOM   240   O O    . VAL A 1 32  ? 53.826  150.016 74.388  1.00 49.92  ? 98   VAL A O    1 
ATOM   241   C CB   . VAL A 1 32  ? 53.672  147.682 72.212  1.00 66.43  ? 98   VAL A CB   1 
ATOM   242   C CG1  . VAL A 1 32  ? 53.492  146.342 72.769  1.00 79.10  ? 98   VAL A CG1  1 
ATOM   243   C CG2  . VAL A 1 32  ? 52.349  148.426 72.346  1.00 60.52  ? 98   VAL A CG2  1 
ATOM   244   H H    . VAL A 1 32  ? 55.912  146.786 73.073  1.00 56.94  ? 98   VAL A H    1 
ATOM   245   H HA   . VAL A 1 32  ? 55.040  149.217 72.379  1.00 61.14  ? 98   VAL A HA   1 
ATOM   246   H HB   . VAL A 1 32  ? 53.876  147.593 71.268  1.00 79.72  ? 98   VAL A HB   1 
ATOM   247   H HG11 . VAL A 1 32  ? 52.760  145.904 72.307  1.00 94.92  ? 98   VAL A HG11 1 
ATOM   248   H HG12 . VAL A 1 32  ? 54.310  145.836 72.647  1.00 94.92  ? 98   VAL A HG12 1 
ATOM   249   H HG13 . VAL A 1 32  ? 53.288  146.418 73.715  1.00 94.92  ? 98   VAL A HG13 1 
ATOM   250   H HG21 . VAL A 1 32  ? 51.656  147.921 71.893  1.00 72.63  ? 98   VAL A HG21 1 
ATOM   251   H HG22 . VAL A 1 32  ? 52.131  148.516 73.287  1.00 72.63  ? 98   VAL A HG22 1 
ATOM   252   H HG23 . VAL A 1 32  ? 52.438  149.303 71.941  1.00 72.63  ? 98   VAL A HG23 1 
ATOM   253   N N    . VAL A 1 33  ? 54.698  148.177 75.335  1.00 43.08  ? 99   VAL A N    1 
ATOM   254   C CA   . VAL A 1 33  ? 54.453  148.654 76.694  1.00 47.69  ? 99   VAL A CA   1 
ATOM   255   C C    . VAL A 1 33  ? 55.306  149.880 76.980  1.00 40.53  ? 99   VAL A C    1 
ATOM   256   O O    . VAL A 1 33  ? 54.806  150.917 77.402  1.00 37.04  ? 99   VAL A O    1 
ATOM   257   C CB   . VAL A 1 33  ? 54.706  147.549 77.740  1.00 39.77  ? 99   VAL A CB   1 
ATOM   258   C CG1  . VAL A 1 33  ? 54.648  148.096 79.165  1.00 32.97  ? 99   VAL A CG1  1 
ATOM   259   C CG2  . VAL A 1 33  ? 53.661  146.495 77.575  1.00 45.77  ? 99   VAL A CG2  1 
ATOM   260   H H    . VAL A 1 33  ? 55.034  147.386 75.290  1.00 51.69  ? 99   VAL A H    1 
ATOM   261   H HA   . VAL A 1 33  ? 53.522  148.919 76.767  1.00 57.22  ? 99   VAL A HA   1 
ATOM   262   H HB   . VAL A 1 33  ? 55.578  147.150 77.593  1.00 47.73  ? 99   VAL A HB   1 
ATOM   263   H HG11 . VAL A 1 33  ? 54.812  147.372 79.789  1.00 39.57  ? 99   VAL A HG11 1 
ATOM   264   H HG12 . VAL A 1 33  ? 55.326  148.782 79.268  1.00 39.57  ? 99   VAL A HG12 1 
ATOM   265   H HG13 . VAL A 1 33  ? 53.768  148.475 79.322  1.00 39.57  ? 99   VAL A HG13 1 
ATOM   266   H HG21 . VAL A 1 33  ? 53.812  145.795 78.229  1.00 54.92  ? 99   VAL A HG21 1 
ATOM   267   H HG22 . VAL A 1 33  ? 52.787  146.894 77.713  1.00 54.92  ? 99   VAL A HG22 1 
ATOM   268   H HG23 . VAL A 1 33  ? 53.720  146.129 76.678  1.00 54.92  ? 99   VAL A HG23 1 
ATOM   269   N N    . ASP A 1 34  ? 56.595  149.761 76.717  1.00 48.15  ? 100  ASP A N    1 
ATOM   270   C CA   . ASP A 1 34  ? 57.515  150.856 76.974  1.00 54.21  ? 100  ASP A CA   1 
ATOM   271   C C    . ASP A 1 34  ? 57.161  152.119 76.192  1.00 42.95  ? 100  ASP A C    1 
ATOM   272   O O    . ASP A 1 34  ? 57.281  153.228 76.715  1.00 36.31  ? 100  ASP A O    1 
ATOM   273   C CB   . ASP A 1 34  ? 58.948  150.407 76.694  1.00 61.52  ? 100  ASP A CB   1 
ATOM   274   C CG   . ASP A 1 34  ? 59.459  149.430 77.745  1.00 74.41  ? 100  ASP A CG   1 
ATOM   275   O OD1  . ASP A 1 34  ? 59.109  149.611 78.948  1.00 61.92  ? 100  ASP A OD1  1 
ATOM   276   O OD2  . ASP A 1 34  ? 60.202  148.489 77.365  1.00 64.75  ? 100  ASP A OD2  1 
ATOM   277   H H    . ASP A 1 34  ? 56.964  149.057 76.389  1.00 57.77  ? 100  ASP A H    1 
ATOM   278   H HA   . ASP A 1 34  ? 57.463  151.079 77.917  1.00 65.05  ? 100  ASP A HA   1 
ATOM   279   H HB2  . ASP A 1 34  ? 58.980  149.966 75.831  1.00 73.82  ? 100  ASP A HB2  1 
ATOM   280   H HB3  . ASP A 1 34  ? 59.530  151.183 76.695  1.00 73.82  ? 100  ASP A HB3  1 
ATOM   281   N N    . ASP A 1 35  ? 56.704  151.960 74.957  1.00 41.22  ? 101  ASP A N    1 
ATOM   282   C CA   . ASP A 1 35  ? 56.221  153.114 74.206  1.00 44.37  ? 101  ASP A CA   1 
ATOM   283   C C    . ASP A 1 35  ? 54.976  153.680 74.872  1.00 46.15  ? 101  ASP A C    1 
ATOM   284   O O    . ASP A 1 35  ? 54.785  154.894 74.879  1.00 51.48  ? 101  ASP A O    1 
ATOM   285   C CB   . ASP A 1 35  ? 55.937  152.760 72.749  1.00 56.57  ? 101  ASP A CB   1 
ATOM   286   C CG   . ASP A 1 35  ? 57.164  152.223 72.028  1.00 94.05  ? 101  ASP A CG   1 
ATOM   287   O OD1  . ASP A 1 35  ? 58.311  152.501 72.474  1.00 95.01  ? 101  ASP A OD1  1 
ATOM   288   O OD2  . ASP A 1 35  ? 56.975  151.515 71.009  1.00 107.57 ? 101  ASP A OD2  1 
ATOM   289   H H    . ASP A 1 35  ? 56.663  151.212 74.536  1.00 49.46  ? 101  ASP A H    1 
ATOM   290   H HA   . ASP A 1 35  ? 56.903  153.803 74.217  1.00 53.25  ? 101  ASP A HA   1 
ATOM   291   H HB2  . ASP A 1 35  ? 55.248  152.079 72.717  1.00 67.88  ? 101  ASP A HB2  1 
ATOM   292   H HB3  . ASP A 1 35  ? 55.639  153.557 72.282  1.00 67.88  ? 101  ASP A HB3  1 
ATOM   293   N N    . TRP A 1 36  ? 54.134  152.817 75.441  1.00 36.07  ? 102  TRP A N    1 
ATOM   294   C CA   . TRP A 1 36  ? 52.955  153.313 76.132  1.00 26.87  ? 102  TRP A CA   1 
ATOM   295   C C    . TRP A 1 36  ? 53.359  153.988 77.424  1.00 34.25  ? 102  TRP A C    1 
ATOM   296   O O    . TRP A 1 36  ? 52.784  155.010 77.792  1.00 45.84  ? 102  TRP A O    1 
ATOM   297   C CB   . TRP A 1 36  ? 51.912  152.227 76.441  1.00 38.37  ? 102  TRP A CB   1 
ATOM   298   C CG   . TRP A 1 36  ? 50.709  152.871 77.051  1.00 41.52  ? 102  TRP A CG   1 
ATOM   299   C CD1  . TRP A 1 36  ? 49.667  153.435 76.385  1.00 43.34  ? 102  TRP A CD1  1 
ATOM   300   C CD2  . TRP A 1 36  ? 50.461  153.092 78.449  1.00 34.96  ? 102  TRP A CD2  1 
ATOM   301   N NE1  . TRP A 1 36  ? 48.782  153.987 77.279  1.00 41.00  ? 102  TRP A NE1  1 
ATOM   302   C CE2  . TRP A 1 36  ? 49.246  153.784 78.553  1.00 36.37  ? 102  TRP A CE2  1 
ATOM   303   C CE3  . TRP A 1 36  ? 51.156  152.777 79.619  1.00 26.61  ? 102  TRP A CE3  1 
ATOM   304   C CZ2  . TRP A 1 36  ? 48.699  154.156 79.774  1.00 44.61  ? 102  TRP A CZ2  1 
ATOM   305   C CZ3  . TRP A 1 36  ? 50.618  153.150 80.826  1.00 33.97  ? 102  TRP A CZ3  1 
ATOM   306   C CH2  . TRP A 1 36  ? 49.397  153.833 80.898  1.00 39.39  ? 102  TRP A CH2  1 
ATOM   307   H H    . TRP A 1 36  ? 54.222  151.962 75.439  1.00 43.29  ? 102  TRP A H    1 
ATOM   308   H HA   . TRP A 1 36  ? 52.527  153.980 75.573  1.00 32.25  ? 102  TRP A HA   1 
ATOM   309   H HB2  . TRP A 1 36  ? 51.646  151.784 75.620  1.00 46.04  ? 102  TRP A HB2  1 
ATOM   310   H HB3  . TRP A 1 36  ? 52.279  151.589 77.073  1.00 46.04  ? 102  TRP A HB3  1 
ATOM   311   H HD1  . TRP A 1 36  ? 49.571  153.450 75.460  1.00 52.00  ? 102  TRP A HD1  1 
ATOM   312   H HE1  . TRP A 1 36  ? 48.044  154.379 77.073  1.00 49.20  ? 102  TRP A HE1  1 
ATOM   313   H HE3  . TRP A 1 36  ? 51.970  152.330 79.581  1.00 31.93  ? 102  TRP A HE3  1 
ATOM   314   H HZ2  . TRP A 1 36  ? 47.887  154.608 79.822  1.00 53.53  ? 102  TRP A HZ2  1 
ATOM   315   H HZ3  . TRP A 1 36  ? 51.068  152.937 81.611  1.00 40.77  ? 102  TRP A HZ3  1 
ATOM   316   H HH2  . TRP A 1 36  ? 49.052  154.062 81.730  1.00 47.27  ? 102  TRP A HH2  1 
ATOM   317   N N    . ILE A 1 37  ? 54.329  153.411 78.128  1.00 33.74  ? 103  ILE A N    1 
ATOM   318   C CA   . ILE A 1 37  ? 54.817  154.024 79.356  1.00 43.43  ? 103  ILE A CA   1 
ATOM   319   C C    . ILE A 1 37  ? 55.444  155.375 79.003  1.00 43.09  ? 103  ILE A C    1 
ATOM   320   O O    . ILE A 1 37  ? 55.267  156.366 79.715  1.00 46.74  ? 103  ILE A O    1 
ATOM   321   C CB   . ILE A 1 37  ? 55.833  153.125 80.117  1.00 46.60  ? 103  ILE A CB   1 
ATOM   322   C CG1  . ILE A 1 37  ? 55.189  151.791 80.523  1.00 41.08  ? 103  ILE A CG1  1 
ATOM   323   C CG2  . ILE A 1 37  ? 56.325  153.856 81.361  1.00 34.76  ? 103  ILE A CG2  1 
ATOM   324   C CD1  . ILE A 1 37  ? 56.090  150.834 81.304  1.00 42.64  ? 103  ILE A CD1  1 
ATOM   325   H H    . ILE A 1 37  ? 54.716  152.673 77.919  1.00 40.49  ? 103  ILE A H    1 
ATOM   326   H HA   . ILE A 1 37  ? 54.065  154.188 79.946  1.00 52.11  ? 103  ILE A HA   1 
ATOM   327   H HB   . ILE A 1 37  ? 56.590  152.945 79.538  1.00 55.92  ? 103  ILE A HB   1 
ATOM   328   H HG12 . ILE A 1 37  ? 54.416  151.980 81.077  1.00 49.29  ? 103  ILE A HG12 1 
ATOM   329   H HG13 . ILE A 1 37  ? 54.905  151.330 79.718  1.00 49.29  ? 103  ILE A HG13 1 
ATOM   330   H HG21 . ILE A 1 37  ? 56.958  153.289 81.830  1.00 41.71  ? 103  ILE A HG21 1 
ATOM   331   H HG22 . ILE A 1 37  ? 56.757  154.682 81.092  1.00 41.71  ? 103  ILE A HG22 1 
ATOM   332   H HG23 . ILE A 1 37  ? 55.567  154.050 81.934  1.00 41.71  ? 103  ILE A HG23 1 
ATOM   333   H HD11 . ILE A 1 37  ? 55.591  150.028 81.510  1.00 51.17  ? 103  ILE A HD11 1 
ATOM   334   H HD12 . ILE A 1 37  ? 56.864  150.615 80.762  1.00 51.17  ? 103  ILE A HD12 1 
ATOM   335   H HD13 . ILE A 1 37  ? 56.373  151.267 82.125  1.00 51.17  ? 103  ILE A HD13 1 
ATOM   336   N N    . GLU A 1 38  ? 56.171  155.412 77.894  1.00 37.53  ? 104  GLU A N    1 
ATOM   337   C CA   . GLU A 1 38  ? 56.716  156.667 77.399  1.00 51.28  ? 104  GLU A CA   1 
ATOM   338   C C    . GLU A 1 38  ? 55.638  157.733 77.333  1.00 48.69  ? 104  GLU A C    1 
ATOM   339   O O    . GLU A 1 38  ? 55.734  158.755 78.004  1.00 50.14  ? 104  GLU A O    1 
ATOM   340   C CB   . GLU A 1 38  ? 57.328  156.481 76.013  1.00 52.38  ? 104  GLU A CB   1 
ATOM   341   C CG   . GLU A 1 38  ? 58.850  156.509 75.993  1.00 59.93  ? 104  GLU A CG   1 
ATOM   342   C CD   . GLU A 1 38  ? 59.418  156.315 74.591  1.00 74.54  ? 104  GLU A CD   1 
ATOM   343   O OE1  . GLU A 1 38  ? 59.608  157.340 73.892  1.00 80.04  ? 104  GLU A OE1  1 
ATOM   344   O OE2  . GLU A 1 38  ? 59.675  155.145 74.190  1.00 66.51  ? 104  GLU A OE2  1 
ATOM   345   H H    . GLU A 1 38  ? 56.362  154.727 77.410  1.00 45.03  ? 104  GLU A H    1 
ATOM   346   H HA   . GLU A 1 38  ? 57.412  156.973 78.001  1.00 61.53  ? 104  GLU A HA   1 
ATOM   347   H HB2  . GLU A 1 38  ? 57.044  155.623 75.660  1.00 62.85  ? 104  GLU A HB2  1 
ATOM   348   H HB3  . GLU A 1 38  ? 57.012  157.193 75.436  1.00 62.85  ? 104  GLU A HB3  1 
ATOM   349   H HG2  . GLU A 1 38  ? 59.156  157.368 76.325  1.00 71.92  ? 104  GLU A HG2  1 
ATOM   350   H HG3  . GLU A 1 38  ? 59.188  155.795 76.556  1.00 71.92  ? 104  GLU A HG3  1 
ATOM   351   N N    . SER A 1 39  ? 54.611  157.480 76.526  1.00 41.00  ? 105  SER A N    1 
ATOM   352   C CA   . SER A 1 39  ? 53.513  158.422 76.359  1.00 38.91  ? 105  SER A CA   1 
ATOM   353   C C    . SER A 1 39  ? 52.813  158.783 77.663  1.00 39.27  ? 105  SER A C    1 
ATOM   354   O O    . SER A 1 39  ? 52.416  159.921 77.850  1.00 59.07  ? 105  SER A O    1 
ATOM   355   C CB   . SER A 1 39  ? 52.492  157.874 75.376  1.00 43.49  ? 105  SER A CB   1 
ATOM   356   O OG   . SER A 1 39  ? 52.262  156.515 75.644  1.00 49.09  ? 105  SER A OG   1 
ATOM   357   H H    . SER A 1 39  ? 54.528  156.762 76.061  1.00 49.20  ? 105  SER A H    1 
ATOM   358   H HA   . SER A 1 39  ? 53.869  159.243 75.983  1.00 46.70  ? 105  SER A HA   1 
ATOM   359   H HB2  . SER A 1 39  ? 51.661  158.364 75.472  1.00 52.19  ? 105  SER A HB2  1 
ATOM   360   H HB3  . SER A 1 39  ? 52.834  157.968 74.473  1.00 52.19  ? 105  SER A HB3  1 
ATOM   361   H HG   . SER A 1 39  ? 51.969  156.422 76.426  1.00 58.90  ? 105  SER A HG   1 
ATOM   362   N N    . TYR A 1 40  ? 52.638  157.827 78.559  1.00 37.13  ? 106  TYR A N    1 
ATOM   363   C CA   . TYR A 1 40  ? 51.978  158.128 79.823  1.00 49.89  ? 106  TYR A CA   1 
ATOM   364   C C    . TYR A 1 40  ? 52.751  159.245 80.530  1.00 61.64  ? 106  TYR A C    1 
ATOM   365   O O    . TYR A 1 40  ? 52.167  160.104 81.198  1.00 65.17  ? 106  TYR A O    1 
ATOM   366   C CB   . TYR A 1 40  ? 51.871  156.870 80.698  1.00 49.68  ? 106  TYR A CB   1 
ATOM   367   C CG   . TYR A 1 40  ? 51.197  157.093 82.035  1.00 38.68  ? 106  TYR A CG   1 
ATOM   368   C CD1  . TYR A 1 40  ? 49.832  157.273 82.127  1.00 31.87  ? 106  TYR A CD1  1 
ATOM   369   C CD2  . TYR A 1 40  ? 51.932  157.102 83.209  1.00 41.20  ? 106  TYR A CD2  1 
ATOM   370   C CE1  . TYR A 1 40  ? 49.222  157.478 83.350  1.00 24.63  ? 106  TYR A CE1  1 
ATOM   371   C CE2  . TYR A 1 40  ? 51.326  157.304 84.430  1.00 40.62  ? 106  TYR A CE2  1 
ATOM   372   C CZ   . TYR A 1 40  ? 49.977  157.499 84.490  1.00 31.11  ? 106  TYR A CZ   1 
ATOM   373   O OH   . TYR A 1 40  ? 49.387  157.698 85.709  1.00 43.63  ? 106  TYR A OH   1 
ATOM   374   H H    . TYR A 1 40  ? 52.887  157.009 78.467  1.00 44.55  ? 106  TYR A H    1 
ATOM   375   H HA   . TYR A 1 40  ? 51.080  158.448 79.644  1.00 59.87  ? 106  TYR A HA   1 
ATOM   376   H HB2  . TYR A 1 40  ? 51.359  156.201 80.217  1.00 59.62  ? 106  TYR A HB2  1 
ATOM   377   H HB3  . TYR A 1 40  ? 52.765  156.536 80.871  1.00 59.62  ? 106  TYR A HB3  1 
ATOM   378   H HD1  . TYR A 1 40  ? 49.317  157.270 81.353  1.00 38.24  ? 106  TYR A HD1  1 
ATOM   379   H HD2  . TYR A 1 40  ? 52.853  156.981 83.172  1.00 49.43  ? 106  TYR A HD2  1 
ATOM   380   H HE1  . TYR A 1 40  ? 48.303  157.607 83.396  1.00 29.55  ? 106  TYR A HE1  1 
ATOM   381   H HE2  . TYR A 1 40  ? 51.835  157.317 85.208  1.00 48.75  ? 106  TYR A HE2  1 
ATOM   382   H HH   . TYR A 1 40  ? 49.969  157.687 86.315  1.00 52.35  ? 106  TYR A HH   1 
ATOM   383   N N    . LYS A 1 41  ? 54.067  159.249 80.348  1.00 54.39  ? 107  LYS A N    1 
ATOM   384   C CA   . LYS A 1 41  ? 54.909  160.262 80.971  1.00 64.86  ? 107  LYS A CA   1 
ATOM   385   C C    . LYS A 1 41  ? 54.787  161.624 80.278  1.00 68.34  ? 107  LYS A C    1 
ATOM   386   O O    . LYS A 1 41  ? 54.687  162.654 80.946  1.00 71.65  ? 107  LYS A O    1 
ATOM   387   C CB   . LYS A 1 41  ? 56.362  159.795 81.005  1.00 57.61  ? 107  LYS A CB   1 
ATOM   388   C CG   . LYS A 1 41  ? 56.592  158.604 81.915  1.00 55.11  ? 107  LYS A CG   1 
ATOM   389   C CD   . LYS A 1 41  ? 57.861  157.860 81.540  1.00 58.47  ? 107  LYS A CD   1 
ATOM   390   C CE   . LYS A 1 41  ? 58.178  156.760 82.537  1.00 58.74  ? 107  LYS A CE   1 
ATOM   391   N NZ   . LYS A 1 41  ? 59.317  155.926 82.071  1.00 54.66  ? 107  LYS A NZ   1 
ATOM   392   H H    . LYS A 1 41  ? 54.496  158.678 79.869  1.00 65.27  ? 107  LYS A H    1 
ATOM   393   H HA   . LYS A 1 41  ? 54.620  160.377 81.889  1.00 77.83  ? 107  LYS A HA   1 
ATOM   394   H HB2  . LYS A 1 41  ? 56.631  159.541 80.109  1.00 69.13  ? 107  LYS A HB2  1 
ATOM   395   H HB3  . LYS A 1 41  ? 56.918  160.523 81.322  1.00 69.13  ? 107  LYS A HB3  1 
ATOM   396   H HG2  . LYS A 1 41  ? 56.679  158.912 82.831  1.00 66.13  ? 107  LYS A HG2  1 
ATOM   397   H HG3  . LYS A 1 41  ? 55.845  157.990 81.836  1.00 66.13  ? 107  LYS A HG3  1 
ATOM   398   H HD2  . LYS A 1 41  ? 57.748  157.455 80.666  1.00 70.16  ? 107  LYS A HD2  1 
ATOM   399   H HD3  . LYS A 1 41  ? 58.605  158.482 81.529  1.00 70.16  ? 107  LYS A HD3  1 
ATOM   400   H HE2  . LYS A 1 41  ? 58.419  157.157 83.388  1.00 70.49  ? 107  LYS A HE2  1 
ATOM   401   H HE3  . LYS A 1 41  ? 57.403  156.186 82.640  1.00 70.49  ? 107  LYS A HE3  1 
ATOM   402   H HZ1  . LYS A 1 41  ? 59.489  155.287 82.665  1.00 65.59  ? 107  LYS A HZ1  1 
ATOM   403   H HZ2  . LYS A 1 41  ? 59.117  155.549 81.290  1.00 65.59  ? 107  LYS A HZ2  1 
ATOM   404   H HZ3  . LYS A 1 41  ? 60.042  156.432 81.971  1.00 65.59  ? 107  LYS A HZ3  1 
ATOM   405   N N    . HIS A 1 42  ? 54.787  161.633 78.948  1.00 61.41  ? 108  HIS A N    1 
ATOM   406   C CA   . HIS A 1 42  ? 54.549  162.869 78.197  1.00 76.33  ? 108  HIS A CA   1 
ATOM   407   C C    . HIS A 1 42  ? 53.195  163.493 78.569  1.00 68.33  ? 108  HIS A C    1 
ATOM   408   O O    . HIS A 1 42  ? 53.126  164.652 78.977  1.00 76.15  ? 108  HIS A O    1 
ATOM   409   C CB   . HIS A 1 42  ? 54.612  162.589 76.691  1.00 84.38  ? 108  HIS A CB   1 
ATOM   410   C CG   . HIS A 1 42  ? 54.486  163.813 75.835  1.00 100.50 ? 108  HIS A CG   1 
ATOM   411   N ND1  . HIS A 1 42  ? 53.279  164.438 75.595  1.00 99.51  ? 108  HIS A ND1  1 
ATOM   412   C CD2  . HIS A 1 42  ? 55.415  164.519 75.145  1.00 103.25 ? 108  HIS A CD2  1 
ATOM   413   C CE1  . HIS A 1 42  ? 53.470  165.477 74.802  1.00 93.90  ? 108  HIS A CE1  1 
ATOM   414   N NE2  . HIS A 1 42  ? 54.759  165.547 74.512  1.00 105.25 ? 108  HIS A NE2  1 
ATOM   415   H H    . HIS A 1 42  ? 54.922  160.941 78.455  1.00 73.70  ? 108  HIS A H    1 
ATOM   416   H HA   . HIS A 1 42  ? 55.245  163.509 78.413  1.00 91.60  ? 108  HIS A HA   1 
ATOM   417   H HB2  . HIS A 1 42  ? 55.464  162.172 76.487  1.00 101.25 ? 108  HIS A HB2  1 
ATOM   418   H HB3  . HIS A 1 42  ? 53.888  161.988 76.456  1.00 101.25 ? 108  HIS A HB3  1 
ATOM   419   H HD1  . HIS A 1 42  ? 52.519  164.191 75.914  1.00 119.42 ? 108  HIS A HD1  1 
ATOM   420   H HD2  . HIS A 1 42  ? 56.327  164.341 75.107  1.00 123.90 ? 108  HIS A HD2  1 
ATOM   421   H HE1  . HIS A 1 42  ? 52.811  166.059 74.499  1.00 112.68 ? 108  HIS A HE1  1 
ATOM   422   H HE2  . HIS A 1 42  ? 55.127  166.143 74.013  1.00 126.31 ? 108  HIS A HE2  1 
ATOM   423   N N    . ASP A 1 43  ? 52.130  162.708 78.443  1.00 65.25  ? 109  ASP A N    1 
ATOM   424   C CA   . ASP A 1 43  ? 50.771  163.157 78.746  1.00 71.76  ? 109  ASP A CA   1 
ATOM   425   C C    . ASP A 1 43  ? 49.942  161.998 79.327  1.00 75.15  ? 109  ASP A C    1 
ATOM   426   O O    . ASP A 1 43  ? 49.526  161.096 78.586  1.00 70.43  ? 109  ASP A O    1 
ATOM   427   C CB   . ASP A 1 43  ? 50.111  163.661 77.460  1.00 64.27  ? 109  ASP A CB   1 
ATOM   428   C CG   . ASP A 1 43  ? 48.835  164.431 77.715  1.00 74.28  ? 109  ASP A CG   1 
ATOM   429   O OD1  . ASP A 1 43  ? 48.270  164.323 78.826  1.00 88.75  ? 109  ASP A OD1  1 
ATOM   430   O OD2  . ASP A 1 43  ? 48.393  165.150 76.798  1.00 84.39  ? 109  ASP A OD2  1 
ATOM   431   H H    . ASP A 1 43  ? 52.168  161.891 78.179  1.00 78.30  ? 109  ASP A H    1 
ATOM   432   H HA   . ASP A 1 43  ? 50.797  163.881 79.391  1.00 86.11  ? 109  ASP A HA   1 
ATOM   433   H HB2  . ASP A 1 43  ? 50.729  164.250 76.999  1.00 77.13  ? 109  ASP A HB2  1 
ATOM   434   H HB3  . ASP A 1 43  ? 49.895  162.901 76.898  1.00 77.13  ? 109  ASP A HB3  1 
ATOM   435   N N    . ARG A 1 44  ? 49.704  162.022 80.640  1.00 61.09  ? 110  ARG A N    1 
ATOM   436   C CA   . ARG A 1 44  ? 48.944  160.957 81.307  1.00 58.39  ? 110  ARG A CA   1 
ATOM   437   C C    . ARG A 1 44  ? 47.564  160.779 80.700  1.00 61.65  ? 110  ARG A C    1 
ATOM   438   O O    . ARG A 1 44  ? 47.085  159.657 80.522  1.00 57.82  ? 110  ARG A O    1 
ATOM   439   C CB   . ARG A 1 44  ? 48.744  161.249 82.796  1.00 48.58  ? 110  ARG A CB   1 
ATOM   440   C CG   . ARG A 1 44  ? 49.967  161.059 83.655  1.00 61.58  ? 110  ARG A CG   1 
ATOM   441   C CD   . ARG A 1 44  ? 49.898  161.922 84.903  1.00 82.72  ? 110  ARG A CD   1 
ATOM   442   N NE   . ARG A 1 44  ? 49.429  161.196 86.074  1.00 87.06  ? 110  ARG A NE   1 
ATOM   443   C CZ   . ARG A 1 44  ? 49.085  161.782 87.214  1.00 101.70 ? 110  ARG A CZ   1 
ATOM   444   N NH1  . ARG A 1 44  ? 49.111  163.104 87.322  1.00 113.26 ? 110  ARG A NH1  1 
ATOM   445   N NH2  . ARG A 1 44  ? 48.680  161.045 88.237  1.00 108.87 ? 110  ARG A NH2  1 
ATOM   446   H H    . ARG A 1 44  ? 49.971  162.645 81.169  1.00 73.31  ? 110  ARG A H    1 
ATOM   447   H HA   . ARG A 1 44  ? 49.426  160.119 81.222  1.00 70.07  ? 110  ARG A HA   1 
ATOM   448   H HB2  . ARG A 1 44  ? 48.459  162.171 82.893  1.00 58.29  ? 110  ARG A HB2  1 
ATOM   449   H HB3  . ARG A 1 44  ? 48.054  160.658 83.135  1.00 58.29  ? 110  ARG A HB3  1 
ATOM   450   H HG2  . ARG A 1 44  ? 50.026  160.130 83.929  1.00 73.90  ? 110  ARG A HG2  1 
ATOM   451   H HG3  . ARG A 1 44  ? 50.756  161.313 83.151  1.00 73.90  ? 110  ARG A HG3  1 
ATOM   452   H HD2  . ARG A 1 44  ? 50.784  162.264 85.099  1.00 99.26  ? 110  ARG A HD2  1 
ATOM   453   H HD3  . ARG A 1 44  ? 49.286  162.658 84.743  1.00 99.26  ? 110  ARG A HD3  1 
ATOM   454   H HE   . ARG A 1 44  ? 49.270  160.356 85.989  1.00 104.47 ? 110  ARG A HE   1 
ATOM   455   H HH11 . ARG A 1 44  ? 49.375  163.584 86.660  1.00 135.91 ? 110  ARG A HH11 1 
ATOM   456   H HH12 . ARG A 1 44  ? 48.880  163.480 88.061  1.00 135.91 ? 110  ARG A HH12 1 
ATOM   457   H HH21 . ARG A 1 44  ? 48.653  160.189 88.166  1.00 130.65 ? 110  ARG A HH21 1 
ATOM   458   H HH22 . ARG A 1 44  ? 48.444  161.424 88.973  1.00 130.65 ? 110  ARG A HH22 1 
ATOM   459   N N    . ASP A 1 45  ? 46.913  161.892 80.400  1.00 59.08  ? 111  ASP A N    1 
ATOM   460   C CA   . ASP A 1 45  ? 45.528  161.840 79.960  1.00 58.35  ? 111  ASP A CA   1 
ATOM   461   C C    . ASP A 1 45  ? 45.328  161.229 78.564  1.00 54.60  ? 111  ASP A C    1 
ATOM   462   O O    . ASP A 1 45  ? 44.485  160.359 78.421  1.00 60.05  ? 111  ASP A O    1 
ATOM   463   C CB   . ASP A 1 45  ? 44.862  163.217 80.090  1.00 66.98  ? 111  ASP A CB   1 
ATOM   464   C CG   . ASP A 1 45  ? 44.431  163.524 81.520  1.00 68.28  ? 111  ASP A CG   1 
ATOM   465   O OD1  . ASP A 1 45  ? 44.426  162.606 82.361  1.00 61.67  ? 111  ASP A OD1  1 
ATOM   466   O OD2  . ASP A 1 45  ? 44.068  164.685 81.800  1.00 83.95  ? 111  ASP A OD2  1 
ATOM   467   H H    . ASP A 1 45  ? 47.247  162.684 80.442  1.00 70.90  ? 111  ASP A H    1 
ATOM   468   H HA   . ASP A 1 45  ? 45.058  161.257 80.576  1.00 70.02  ? 111  ASP A HA   1 
ATOM   469   H HB2  . ASP A 1 45  ? 45.492  163.901 79.812  1.00 80.37  ? 111  ASP A HB2  1 
ATOM   470   H HB3  . ASP A 1 45  ? 44.074  163.242 79.526  1.00 80.37  ? 111  ASP A HB3  1 
ATOM   471   N N    . ILE A 1 46  ? 46.070  161.638 77.538  1.00 57.96  ? 112  ILE A N    1 
ATOM   472   C CA   . ILE A 1 46  ? 45.826  161.046 76.221  1.00 59.08  ? 112  ILE A CA   1 
ATOM   473   C C    . ILE A 1 46  ? 46.176  159.560 76.231  1.00 63.09  ? 112  ILE A C    1 
ATOM   474   O O    . ILE A 1 46  ? 45.545  158.765 75.532  1.00 67.98  ? 112  ILE A O    1 
ATOM   475   C CB   . ILE A 1 46  ? 46.586  161.752 75.049  1.00 46.22  ? 112  ILE A CB   1 
ATOM   476   C CG1  . ILE A 1 46  ? 48.038  161.284 74.946  1.00 83.12  ? 112  ILE A CG1  1 
ATOM   477   C CG2  . ILE A 1 46  ? 46.512  163.259 75.174  1.00 45.67  ? 112  ILE A CG2  1 
ATOM   478   C CD1  . ILE A 1 46  ? 48.255  160.177 73.920  1.00 92.54  ? 112  ILE A CD1  1 
ATOM   479   H H    . ILE A 1 46  ? 46.694  162.229 77.570  1.00 69.56  ? 112  ILE A H    1 
ATOM   480   H HA   . ILE A 1 46  ? 44.877  161.116 76.030  1.00 70.89  ? 112  ILE A HA   1 
ATOM   481   H HB   . ILE A 1 46  ? 46.141  161.505 74.223  1.00 55.46  ? 112  ILE A HB   1 
ATOM   482   H HG12 . ILE A 1 46  ? 48.592  162.038 74.690  1.00 99.74  ? 112  ILE A HG12 1 
ATOM   483   H HG13 . ILE A 1 46  ? 48.320  160.946 75.810  1.00 99.74  ? 112  ILE A HG13 1 
ATOM   484   H HG21 . ILE A 1 46  ? 46.992  163.661 74.433  1.00 54.81  ? 112  ILE A HG21 1 
ATOM   485   H HG22 . ILE A 1 46  ? 45.581  163.531 75.152  1.00 54.81  ? 112  ILE A HG22 1 
ATOM   486   H HG23 . ILE A 1 46  ? 46.915  163.526 76.014  1.00 54.81  ? 112  ILE A HG23 1 
ATOM   487   H HD11 . ILE A 1 46  ? 49.194  159.934 73.912  1.00 111.05 ? 112  ILE A HD11 1 
ATOM   488   H HD12 . ILE A 1 46  ? 47.716  159.409 74.166  1.00 111.05 ? 112  ILE A HD12 1 
ATOM   489   H HD13 . ILE A 1 46  ? 47.989  160.501 73.045  1.00 111.05 ? 112  ILE A HD13 1 
ATOM   490   N N    . ALA A 1 47  ? 47.180  159.188 77.020  1.00 60.78  ? 113  ALA A N    1 
ATOM   491   C CA   . ALA A 1 47  ? 47.685  157.820 77.004  1.00 57.92  ? 113  ALA A CA   1 
ATOM   492   C C    . ALA A 1 47  ? 46.744  156.876 77.754  1.00 46.08  ? 113  ALA A C    1 
ATOM   493   O O    . ALA A 1 47  ? 46.548  155.729 77.348  1.00 43.07  ? 113  ALA A O    1 
ATOM   494   C CB   . ALA A 1 47  ? 49.087  157.755 77.584  1.00 64.41  ? 113  ALA A CB   1 
ATOM   495   H H    . ALA A 1 47  ? 47.585  159.708 77.572  1.00 72.93  ? 113  ALA A H    1 
ATOM   496   H HA   . ALA A 1 47  ? 47.733  157.518 76.084  1.00 69.50  ? 113  ALA A HA   1 
ATOM   497   H HB1  . ALA A 1 47  ? 49.396  156.836 77.560  1.00 77.30  ? 113  ALA A HB1  1 
ATOM   498   H HB2  . ALA A 1 47  ? 49.674  158.315 77.052  1.00 77.30  ? 113  ALA A HB2  1 
ATOM   499   H HB3  . ALA A 1 47  ? 49.065  158.074 78.500  1.00 77.30  ? 113  ALA A HB3  1 
ATOM   500   N N    . LEU A 1 48  ? 46.154  157.352 78.843  1.00 36.58  ? 114  LEU A N    1 
ATOM   501   C CA   . LEU A 1 48  ? 45.169  156.538 79.543  1.00 43.51  ? 114  LEU A CA   1 
ATOM   502   C C    . LEU A 1 48  ? 43.929  156.359 78.675  1.00 44.75  ? 114  LEU A C    1 
ATOM   503   O O    . LEU A 1 48  ? 43.270  155.330 78.747  1.00 52.69  ? 114  LEU A O    1 
ATOM   504   C CB   . LEU A 1 48  ? 44.780  157.147 80.881  1.00 39.16  ? 114  LEU A CB   1 
ATOM   505   C CG   . LEU A 1 48  ? 45.590  156.690 82.087  1.00 45.95  ? 114  LEU A CG   1 
ATOM   506   C CD1  . LEU A 1 48  ? 44.940  157.205 83.339  1.00 48.75  ? 114  LEU A CD1  1 
ATOM   507   C CD2  . LEU A 1 48  ? 45.729  155.167 82.176  1.00 54.41  ? 114  LEU A CD2  1 
ATOM   508   H H    . LEU A 1 48  ? 46.301  158.125 79.191  1.00 43.89  ? 114  LEU A H    1 
ATOM   509   H HA   . LEU A 1 48  ? 45.547  155.661 79.712  1.00 52.21  ? 114  LEU A HA   1 
ATOM   510   H HB2  . LEU A 1 48  ? 44.876  158.110 80.817  1.00 46.99  ? 114  LEU A HB2  1 
ATOM   511   H HB3  . LEU A 1 48  ? 43.851  156.928 81.057  1.00 46.99  ? 114  LEU A HB3  1 
ATOM   512   H HG   . LEU A 1 48  ? 46.480  157.070 82.032  1.00 55.14  ? 114  LEU A HG   1 
ATOM   513   H HD11 . LEU A 1 48  ? 45.457  156.913 84.106  1.00 58.49  ? 114  LEU A HD11 1 
ATOM   514   H HD12 . LEU A 1 48  ? 44.916  158.175 83.306  1.00 58.49  ? 114  LEU A HD12 1 
ATOM   515   H HD13 . LEU A 1 48  ? 44.038  156.853 83.395  1.00 58.49  ? 114  LEU A HD13 1 
ATOM   516   H HD21 . LEU A 1 48  ? 46.253  154.944 82.962  1.00 65.30  ? 114  LEU A HD21 1 
ATOM   517   H HD22 . LEU A 1 48  ? 44.845  154.773 82.244  1.00 65.30  ? 114  LEU A HD22 1 
ATOM   518   H HD23 . LEU A 1 48  ? 46.175  154.844 81.378  1.00 65.30  ? 114  LEU A HD23 1 
ATOM   519   N N    . LEU A 1 49  ? 43.619  157.350 77.847  1.00 39.51  ? 115  LEU A N    1 
ATOM   520   C CA   . LEU A 1 49  ? 42.517  157.223 76.919  1.00 37.14  ? 115  LEU A CA   1 
ATOM   521   C C    . LEU A 1 49  ? 42.843  156.150 75.884  1.00 44.33  ? 115  LEU A C    1 
ATOM   522   O O    . LEU A 1 49  ? 42.019  155.288 75.611  1.00 46.72  ? 115  LEU A O    1 
ATOM   523   C CB   . LEU A 1 49  ? 42.203  158.566 76.264  1.00 33.36  ? 115  LEU A CB   1 
ATOM   524   C CG   . LEU A 1 49  ? 41.055  158.547 75.262  1.00 37.99  ? 115  LEU A CG   1 
ATOM   525   C CD1  . LEU A 1 49  ? 39.800  158.067 75.925  1.00 40.10  ? 115  LEU A CD1  1 
ATOM   526   C CD2  . LEU A 1 49  ? 40.859  159.915 74.666  1.00 34.56  ? 115  LEU A CD2  1 
ATOM   527   H H    . LEU A 1 49  ? 44.033  158.103 77.806  1.00 47.41  ? 115  LEU A H    1 
ATOM   528   H HA   . LEU A 1 49  ? 41.728  156.937 77.406  1.00 44.57  ? 115  LEU A HA   1 
ATOM   529   H HB2  . LEU A 1 49  ? 41.972  159.201 76.960  1.00 40.03  ? 115  LEU A HB2  1 
ATOM   530   H HB3  . LEU A 1 49  ? 42.995  158.872 75.795  1.00 40.03  ? 115  LEU A HB3  1 
ATOM   531   H HG   . LEU A 1 49  ? 41.271  157.933 74.543  1.00 45.58  ? 115  LEU A HG   1 
ATOM   532   H HD11 . LEU A 1 49  ? 39.082  158.062 75.273  1.00 48.12  ? 115  LEU A HD11 1 
ATOM   533   H HD12 . LEU A 1 49  ? 39.946  157.170 76.264  1.00 48.12  ? 115  LEU A HD12 1 
ATOM   534   H HD13 . LEU A 1 49  ? 39.580  158.666 76.655  1.00 48.12  ? 115  LEU A HD13 1 
ATOM   535   H HD21 . LEU A 1 49  ? 40.125  159.880 74.032  1.00 41.47  ? 115  LEU A HD21 1 
ATOM   536   H HD22 . LEU A 1 49  ? 40.653  160.542 75.376  1.00 41.47  ? 115  LEU A HD22 1 
ATOM   537   H HD23 . LEU A 1 49  ? 41.674  160.182 74.214  1.00 41.47  ? 115  LEU A HD23 1 
ATOM   538   N N    . ASP A 1 50  ? 44.049  156.176 75.326  1.00 56.80  ? 116  ASP A N    1 
ATOM   539   C CA   . ASP A 1 50  ? 44.463  155.135 74.374  1.00 63.85  ? 116  ASP A CA   1 
ATOM   540   C C    . ASP A 1 50  ? 44.303  153.743 74.995  1.00 54.52  ? 116  ASP A C    1 
ATOM   541   O O    . ASP A 1 50  ? 44.023  152.772 74.298  1.00 50.28  ? 116  ASP A O    1 
ATOM   542   C CB   . ASP A 1 50  ? 45.919  155.338 73.913  1.00 72.49  ? 116  ASP A CB   1 
ATOM   543   C CG   . ASP A 1 50  ? 46.078  156.493 72.905  1.00 91.44  ? 116  ASP A CG   1 
ATOM   544   O OD1  . ASP A 1 50  ? 45.317  157.492 72.999  1.00 98.70  ? 116  ASP A OD1  1 
ATOM   545   O OD2  . ASP A 1 50  ? 46.968  156.402 72.017  1.00 88.89  ? 116  ASP A OD2  1 
ATOM   546   H H    . ASP A 1 50  ? 44.645  156.777 75.477  1.00 68.16  ? 116  ASP A H    1 
ATOM   547   H HA   . ASP A 1 50  ? 43.893  155.180 73.591  1.00 76.62  ? 116  ASP A HA   1 
ATOM   548   H HB2  . ASP A 1 50  ? 46.470  155.538 74.686  1.00 86.99  ? 116  ASP A HB2  1 
ATOM   549   H HB3  . ASP A 1 50  ? 46.231  154.524 73.487  1.00 86.99  ? 116  ASP A HB3  1 
ATOM   550   N N    . LEU A 1 51  ? 44.460  153.670 76.315  1.00 47.41  ? 117  LEU A N    1 
ATOM   551   C CA   . LEU A 1 51  ? 44.347  152.425 77.055  1.00 31.73  ? 117  LEU A CA   1 
ATOM   552   C C    . LEU A 1 51  ? 42.872  152.042 77.294  1.00 49.29  ? 117  LEU A C    1 
ATOM   553   O O    . LEU A 1 51  ? 42.509  150.866 77.157  1.00 42.99  ? 117  LEU A O    1 
ATOM   554   C CB   . LEU A 1 51  ? 45.114  152.545 78.381  1.00 41.78  ? 117  LEU A CB   1 
ATOM   555   C CG   . LEU A 1 51  ? 45.394  151.295 79.232  1.00 42.78  ? 117  LEU A CG   1 
ATOM   556   C CD1  . LEU A 1 51  ? 46.193  150.265 78.453  1.00 55.25  ? 117  LEU A CD1  1 
ATOM   557   C CD2  . LEU A 1 51  ? 46.134  151.689 80.495  1.00 35.05  ? 117  LEU A CD2  1 
ATOM   558   H H    . LEU A 1 51  ? 44.637  154.349 76.813  1.00 56.89  ? 117  LEU A H    1 
ATOM   559   H HA   . LEU A 1 51  ? 44.757  151.715 76.538  1.00 38.08  ? 117  LEU A HA   1 
ATOM   560   H HB2  . LEU A 1 51  ? 45.978  152.939 78.181  1.00 50.14  ? 117  LEU A HB2  1 
ATOM   561   H HB3  . LEU A 1 51  ? 44.618  153.157 78.948  1.00 50.14  ? 117  LEU A HB3  1 
ATOM   562   H HG   . LEU A 1 51  ? 44.551  150.891 79.489  1.00 51.34  ? 117  LEU A HG   1 
ATOM   563   H HD11 . LEU A 1 51  ? 46.350  149.494 79.020  1.00 66.30  ? 117  LEU A HD11 1 
ATOM   564   H HD12 . LEU A 1 51  ? 45.688  150.002 77.668  1.00 66.30  ? 117  LEU A HD12 1 
ATOM   565   H HD13 . LEU A 1 51  ? 47.039  150.658 78.187  1.00 66.30  ? 117  LEU A HD13 1 
ATOM   566   H HD21 . LEU A 1 51  ? 46.304  150.893 81.022  1.00 42.06  ? 117  LEU A HD21 1 
ATOM   567   H HD22 . LEU A 1 51  ? 46.973  152.110 80.251  1.00 42.06  ? 117  LEU A HD22 1 
ATOM   568   H HD23 . LEU A 1 51  ? 45.586  152.310 81.000  1.00 42.06  ? 117  LEU A HD23 1 
ATOM   569   N N    . ILE A 1 52  ? 42.023  153.013 77.651  1.00 44.01  ? 118  ILE A N    1 
ATOM   570   C CA   . ILE A 1 52  ? 40.577  152.756 77.709  1.00 33.69  ? 118  ILE A CA   1 
ATOM   571   C C    . ILE A 1 52  ? 40.079  152.200 76.366  1.00 47.20  ? 118  ILE A C    1 
ATOM   572   O O    . ILE A 1 52  ? 39.421  151.164 76.327  1.00 43.81  ? 118  ILE A O    1 
ATOM   573   C CB   . ILE A 1 52  ? 39.732  154.023 77.963  1.00 39.88  ? 118  ILE A CB   1 
ATOM   574   C CG1  . ILE A 1 52  ? 40.078  154.710 79.279  1.00 38.32  ? 118  ILE A CG1  1 
ATOM   575   C CG2  . ILE A 1 52  ? 38.234  153.686 77.943  1.00 51.67  ? 118  ILE A CG2  1 
ATOM   576   C CD1  . ILE A 1 52  ? 39.982  153.840 80.488  1.00 63.86  ? 118  ILE A CD1  1 
ATOM   577   H H    . ILE A 1 52  ? 42.253  153.814 77.860  1.00 52.81  ? 118  ILE A H    1 
ATOM   578   H HA   . ILE A 1 52  ? 40.386  152.109 78.406  1.00 40.43  ? 118  ILE A HA   1 
ATOM   579   H HB   . ILE A 1 52  ? 39.909  154.650 77.243  1.00 47.86  ? 118  ILE A HB   1 
ATOM   580   H HG12 . ILE A 1 52  ? 40.990  155.037 79.226  1.00 45.99  ? 118  ILE A HG12 1 
ATOM   581   H HG13 . ILE A 1 52  ? 39.472  155.456 79.406  1.00 45.99  ? 118  ILE A HG13 1 
ATOM   582   H HG21 . ILE A 1 52  ? 37.726  154.496 78.104  1.00 62.00  ? 118  ILE A HG21 1 
ATOM   583   H HG22 . ILE A 1 52  ? 38.005  153.318 77.074  1.00 62.00  ? 118  ILE A HG22 1 
ATOM   584   H HG23 . ILE A 1 52  ? 38.048  153.034 78.637  1.00 62.00  ? 118  ILE A HG23 1 
ATOM   585   H HD11 . ILE A 1 52  ? 40.219  154.362 81.271  1.00 76.63  ? 118  ILE A HD11 1 
ATOM   586   H HD12 . ILE A 1 52  ? 39.073  153.514 80.570  1.00 76.63  ? 118  ILE A HD12 1 
ATOM   587   H HD13 . ILE A 1 52  ? 40.594  153.094 80.389  1.00 76.63  ? 118  ILE A HD13 1 
ATOM   588   N N    . ASN A 1 53  ? 40.368  152.897 75.268  1.00 28.95  ? 119  ASN A N    1 
ATOM   589   C CA   . ASN A 1 53  ? 39.914  152.448 73.961  1.00 29.38  ? 119  ASN A CA   1 
ATOM   590   C C    . ASN A 1 53  ? 40.457  151.088 73.610  1.00 31.22  ? 119  ASN A C    1 
ATOM   591   O O    . ASN A 1 53  ? 39.844  150.355 72.851  1.00 31.05  ? 119  ASN A O    1 
ATOM   592   C CB   . ASN A 1 53  ? 40.318  153.425 72.865  1.00 29.39  ? 119  ASN A CB   1 
ATOM   593   C CG   . ASN A 1 53  ? 39.481  154.680 72.873  1.00 49.17  ? 119  ASN A CG   1 
ATOM   594   O OD1  . ASN A 1 53  ? 38.333  154.688 72.418  1.00 51.27  ? 119  ASN A OD1  1 
ATOM   595   N ND2  . ASN A 1 53  ? 40.048  155.753 73.399  1.00 67.47  ? 119  ASN A ND2  1 
ATOM   596   H H    . ASN A 1 53  ? 40.822  153.627 75.255  1.00 34.74  ? 119  ASN A H    1 
ATOM   597   H HA   . ASN A 1 53  ? 38.946  152.391 73.968  1.00 35.26  ? 119  ASN A HA   1 
ATOM   598   H HB2  . ASN A 1 53  ? 41.244  153.680 72.994  1.00 35.26  ? 119  ASN A HB2  1 
ATOM   599   H HB3  . ASN A 1 53  ? 40.208  152.995 72.002  1.00 35.26  ? 119  ASN A HB3  1 
ATOM   600   H HD21 . ASN A 1 53  ? 39.616  156.497 73.429  1.00 80.96  ? 119  ASN A HD21 1 
ATOM   601   H HD22 . ASN A 1 53  ? 40.848  155.708 73.710  1.00 80.96  ? 119  ASN A HD22 1 
ATOM   602   N N    . PHE A 1 54  ? 41.620  150.756 74.148  1.00 45.77  ? 120  PHE A N    1 
ATOM   603   C CA   . PHE A 1 54  ? 42.236  149.479 73.839  1.00 39.77  ? 120  PHE A CA   1 
ATOM   604   C C    . PHE A 1 54  ? 41.358  148.335 74.337  1.00 43.12  ? 120  PHE A C    1 
ATOM   605   O O    . PHE A 1 54  ? 41.136  147.361 73.622  1.00 45.09  ? 120  PHE A O    1 
ATOM   606   C CB   . PHE A 1 54  ? 43.633  149.375 74.450  1.00 43.89  ? 120  PHE A CB   1 
ATOM   607   C CG   . PHE A 1 54  ? 44.141  147.979 74.515  1.00 38.11  ? 120  PHE A CG   1 
ATOM   608   C CD1  . PHE A 1 54  ? 44.696  147.384 73.404  1.00 37.94  ? 120  PHE A CD1  1 
ATOM   609   C CD2  . PHE A 1 54  ? 44.040  147.252 75.682  1.00 26.18  ? 120  PHE A CD2  1 
ATOM   610   C CE1  . PHE A 1 54  ? 45.151  146.089 73.459  1.00 41.07  ? 120  PHE A CE1  1 
ATOM   611   C CE2  . PHE A 1 54  ? 44.480  145.965 75.736  1.00 37.97  ? 120  PHE A CE2  1 
ATOM   612   C CZ   . PHE A 1 54  ? 45.046  145.380 74.627  1.00 37.19  ? 120  PHE A CZ   1 
ATOM   613   H H    . PHE A 1 54  ? 42.070  151.248 74.691  1.00 54.92  ? 120  PHE A H    1 
ATOM   614   H HA   . PHE A 1 54  ? 42.323  149.394 72.877  1.00 47.72  ? 120  PHE A HA   1 
ATOM   615   H HB2  . PHE A 1 54  ? 44.252  149.893 73.912  1.00 52.66  ? 120  PHE A HB2  1 
ATOM   616   H HB3  . PHE A 1 54  ? 43.608  149.726 75.354  1.00 52.66  ? 120  PHE A HB3  1 
ATOM   617   H HD1  . PHE A 1 54  ? 44.767  147.865 72.611  1.00 45.52  ? 120  PHE A HD1  1 
ATOM   618   H HD2  . PHE A 1 54  ? 43.658  147.641 76.435  1.00 31.41  ? 120  PHE A HD2  1 
ATOM   619   H HE1  . PHE A 1 54  ? 45.529  145.695 72.706  1.00 49.29  ? 120  PHE A HE1  1 
ATOM   620   H HE2  . PHE A 1 54  ? 44.414  145.486 76.531  1.00 45.57  ? 120  PHE A HE2  1 
ATOM   621   H HZ   . PHE A 1 54  ? 45.354  144.503 74.668  1.00 44.62  ? 120  PHE A HZ   1 
ATOM   622   N N    . PHE A 1 55  ? 40.866  148.457 75.566  1.00 34.93  ? 121  PHE A N    1 
ATOM   623   C CA   . PHE A 1 55  ? 40.031  147.421 76.154  1.00 34.29  ? 121  PHE A CA   1 
ATOM   624   C C    . PHE A 1 55  ? 38.659  147.327 75.476  1.00 47.98  ? 121  PHE A C    1 
ATOM   625   O O    . PHE A 1 55  ? 38.126  146.238 75.263  1.00 55.94  ? 121  PHE A O    1 
ATOM   626   C CB   . PHE A 1 55  ? 39.856  147.674 77.646  1.00 23.53  ? 121  PHE A CB   1 
ATOM   627   C CG   . PHE A 1 55  ? 41.030  147.263 78.461  1.00 34.82  ? 121  PHE A CG   1 
ATOM   628   C CD1  . PHE A 1 55  ? 41.579  145.998 78.321  1.00 40.97  ? 121  PHE A CD1  1 
ATOM   629   C CD2  . PHE A 1 55  ? 41.598  148.134 79.360  1.00 25.78  ? 121  PHE A CD2  1 
ATOM   630   C CE1  . PHE A 1 55  ? 42.671  145.609 79.072  1.00 40.51  ? 121  PHE A CE1  1 
ATOM   631   C CE2  . PHE A 1 55  ? 42.693  147.746 80.112  1.00 27.44  ? 121  PHE A CE2  1 
ATOM   632   C CZ   . PHE A 1 55  ? 43.225  146.482 79.968  1.00 28.24  ? 121  PHE A CZ   1 
ATOM   633   H H    . PHE A 1 55  ? 41.002  149.133 76.080  1.00 41.92  ? 121  PHE A H    1 
ATOM   634   H HA   . PHE A 1 55  ? 40.474  146.565 76.047  1.00 41.15  ? 121  PHE A HA   1 
ATOM   635   H HB2  . PHE A 1 55  ? 39.713  148.622 77.788  1.00 28.24  ? 121  PHE A HB2  1 
ATOM   636   H HB3  . PHE A 1 55  ? 39.087  147.174 77.960  1.00 28.24  ? 121  PHE A HB3  1 
ATOM   637   H HD1  . PHE A 1 55  ? 41.204  145.400 77.716  1.00 49.17  ? 121  PHE A HD1  1 
ATOM   638   H HD2  . PHE A 1 55  ? 41.243  148.988 79.465  1.00 30.94  ? 121  PHE A HD2  1 
ATOM   639   H HE1  . PHE A 1 55  ? 43.027  144.756 78.970  1.00 48.61  ? 121  PHE A HE1  1 
ATOM   640   H HE2  . PHE A 1 55  ? 43.070  148.340 80.721  1.00 32.92  ? 121  PHE A HE2  1 
ATOM   641   H HZ   . PHE A 1 55  ? 43.961  146.225 80.475  1.00 33.89  ? 121  PHE A HZ   1 
ATOM   642   N N    . ILE A 1 56  ? 38.080  148.469 75.143  1.00 37.40  ? 122  ILE A N    1 
ATOM   643   C CA   . ILE A 1 56  ? 36.824  148.492 74.417  1.00 38.37  ? 122  ILE A CA   1 
ATOM   644   C C    . ILE A 1 56  ? 36.934  147.754 73.087  1.00 45.57  ? 122  ILE A C    1 
ATOM   645   O O    . ILE A 1 56  ? 36.076  146.953 72.728  1.00 56.93  ? 122  ILE A O    1 
ATOM   646   C CB   . ILE A 1 56  ? 36.435  149.930 74.086  1.00 46.87  ? 122  ILE A CB   1 
ATOM   647   C CG1  . ILE A 1 56  ? 36.081  150.716 75.355  1.00 37.47  ? 122  ILE A CG1  1 
ATOM   648   C CG2  . ILE A 1 56  ? 35.313  149.968 73.061  1.00 53.16  ? 122  ILE A CG2  1 
ATOM   649   C CD1  . ILE A 1 56  ? 35.065  150.080 76.256  1.00 29.08  ? 122  ILE A CD1  1 
ATOM   650   H H    . ILE A 1 56  ? 38.396  149.248 75.327  1.00 44.88  ? 122  ILE A H    1 
ATOM   651   H HA   . ILE A 1 56  ? 36.122  148.087 74.950  1.00 46.04  ? 122  ILE A HA   1 
ATOM   652   H HB   . ILE A 1 56  ? 37.209  150.357 73.686  1.00 56.24  ? 122  ILE A HB   1 
ATOM   653   H HG12 . ILE A 1 56  ? 36.891  150.840 75.874  1.00 44.97  ? 122  ILE A HG12 1 
ATOM   654   H HG13 . ILE A 1 56  ? 35.732  151.582 75.091  1.00 44.97  ? 122  ILE A HG13 1 
ATOM   655   H HG21 . ILE A 1 56  ? 35.089  150.893 72.872  1.00 63.79  ? 122  ILE A HG21 1 
ATOM   656   H HG22 . ILE A 1 56  ? 35.611  149.527 72.250  1.00 63.79  ? 122  ILE A HG22 1 
ATOM   657   H HG23 . ILE A 1 56  ? 34.539  149.507 73.423  1.00 63.79  ? 122  ILE A HG23 1 
ATOM   658   H HD11 . ILE A 1 56  ? 34.917  150.657 77.022  1.00 34.89  ? 122  ILE A HD11 1 
ATOM   659   H HD12 . ILE A 1 56  ? 34.237  149.963 75.764  1.00 34.89  ? 122  ILE A HD12 1 
ATOM   660   H HD13 . ILE A 1 56  ? 35.400  149.218 76.550  1.00 34.89  ? 122  ILE A HD13 1 
ATOM   661   N N    . GLN A 1 57  ? 37.971  148.068 72.332  1.00 38.26  ? 123  GLN A N    1 
ATOM   662   C CA   . GLN A 1 57  ? 38.114  147.528 70.996  1.00 38.55  ? 123  GLN A CA   1 
ATOM   663   C C    . GLN A 1 57  ? 38.509  146.065 70.996  1.00 48.36  ? 123  GLN A C    1 
ATOM   664   O O    . GLN A 1 57  ? 38.333  145.381 69.997  1.00 58.05  ? 123  GLN A O    1 
ATOM   665   C CB   . GLN A 1 57  ? 39.124  148.354 70.217  1.00 38.56  ? 123  GLN A CB   1 
ATOM   666   C CG   . GLN A 1 57  ? 38.589  149.729 69.907  1.00 62.33  ? 123  GLN A CG   1 
ATOM   667   C CD   . GLN A 1 57  ? 39.572  150.590 69.167  1.00 70.69  ? 123  GLN A CD   1 
ATOM   668   O OE1  . GLN A 1 57  ? 40.559  150.096 68.596  1.00 64.07  ? 123  GLN A OE1  1 
ATOM   669   N NE2  . GLN A 1 57  ? 39.318  151.900 69.175  1.00 65.79  ? 123  GLN A NE2  1 
ATOM   670   H H    . GLN A 1 57  ? 38.608  148.594 72.571  1.00 45.91  ? 123  GLN A H    1 
ATOM   671   H HA   . GLN A 1 57  ? 37.261  147.601 70.540  1.00 46.26  ? 123  GLN A HA   1 
ATOM   672   H HB2  . GLN A 1 57  ? 39.932  148.454 70.744  1.00 46.27  ? 123  GLN A HB2  1 
ATOM   673   H HB3  . GLN A 1 57  ? 39.323  147.909 69.378  1.00 46.27  ? 123  GLN A HB3  1 
ATOM   674   H HG2  . GLN A 1 57  ? 37.795  149.641 69.356  1.00 74.80  ? 123  GLN A HG2  1 
ATOM   675   H HG3  . GLN A 1 57  ? 38.367  150.176 70.738  1.00 74.80  ? 123  GLN A HG3  1 
ATOM   676   H HE21 . GLN A 1 57  ? 38.626  152.201 69.588  1.00 78.95  ? 123  GLN A HE21 1 
ATOM   677   H HE22 . GLN A 1 57  ? 39.846  152.444 68.768  1.00 78.95  ? 123  GLN A HE22 1 
ATOM   678   N N    . CYS A 1 58  ? 39.034  145.578 72.112  1.00 39.29  ? 124  CYS A N    1 
ATOM   679   C CA   . CYS A 1 58  ? 39.418  144.175 72.205  1.00 35.91  ? 124  CYS A CA   1 
ATOM   680   C C    . CYS A 1 58  ? 38.171  143.326 72.341  1.00 41.48  ? 124  CYS A C    1 
ATOM   681   O O    . CYS A 1 58  ? 38.204  142.120 72.128  1.00 51.71  ? 124  CYS A O    1 
ATOM   682   C CB   . CYS A 1 58  ? 40.345  143.946 73.402  1.00 41.88  ? 124  CYS A CB   1 
ATOM   683   S SG   . CYS A 1 58  ? 42.096  144.390 73.106  1.00 52.63  ? 124  CYS A SG   1 
ATOM   684   H H    . CYS A 1 58  ? 39.177  146.035 72.826  1.00 47.15  ? 124  CYS A H    1 
ATOM   685   H HA   . CYS A 1 58  ? 39.885  143.911 71.397  1.00 43.09  ? 124  CYS A HA   1 
ATOM   686   H HB2  . CYS A 1 58  ? 40.028  144.481 74.147  1.00 50.25  ? 124  CYS A HB2  1 
ATOM   687   H HB3  . CYS A 1 58  ? 40.317  143.006 73.641  1.00 50.25  ? 124  CYS A HB3  1 
ATOM   688   H HG   . CYS A 1 58  ? 42.161  145.556 72.826  1.00 63.15  ? 124  CYS A HG   1 
ATOM   689   N N    . SER A 1 59  ? 37.073  143.977 72.707  1.00 48.95  ? 125  SER A N    1 
ATOM   690   C CA   . SER A 1 59  ? 35.791  143.310 72.893  1.00 47.42  ? 125  SER A CA   1 
ATOM   691   C C    . SER A 1 59  ? 35.055  143.150 71.567  1.00 42.56  ? 125  SER A C    1 
ATOM   692   O O    . SER A 1 59  ? 34.036  142.482 71.498  1.00 53.61  ? 125  SER A O    1 
ATOM   693   C CB   . SER A 1 59  ? 34.926  144.104 73.864  1.00 47.08  ? 125  SER A CB   1 
ATOM   694   O OG   . SER A 1 59  ? 35.643  144.366 75.062  1.00 50.94  ? 125  SER A OG   1 
ATOM   695   H H    . SER A 1 59  ? 37.045  144.823 72.857  1.00 58.74  ? 125  SER A H    1 
ATOM   696   H HA   . SER A 1 59  ? 35.939  142.427 73.268  1.00 56.91  ? 125  SER A HA   1 
ATOM   697   H HB2  . SER A 1 59  ? 34.678  144.947 73.452  1.00 56.50  ? 125  SER A HB2  1 
ATOM   698   H HB3  . SER A 1 59  ? 34.131  143.590 74.075  1.00 56.50  ? 125  SER A HB3  1 
ATOM   699   H HG   . SER A 1 59  ? 36.335  144.810 74.891  1.00 61.13  ? 125  SER A HG   1 
ATOM   700   N N    . GLY A 1 60  ? 35.584  143.753 70.513  1.00 39.10  ? 126  GLY A N    1 
ATOM   701   C CA   . GLY A 1 60  ? 34.950  143.708 69.212  1.00 33.95  ? 126  GLY A CA   1 
ATOM   702   C C    . GLY A 1 60  ? 34.221  144.998 68.919  1.00 41.64  ? 126  GLY A C    1 
ATOM   703   O O    . GLY A 1 60  ? 33.763  145.210 67.796  1.00 58.92  ? 126  GLY A O    1 
ATOM   704   H H    . GLY A 1 60  ? 36.319  144.199 70.528  1.00 46.92  ? 126  GLY A H    1 
ATOM   705   H HA2  . GLY A 1 60  ? 35.621  143.567 68.525  1.00 40.74  ? 126  GLY A HA2  1 
ATOM   706   H HA3  . GLY A 1 60  ? 34.314  142.977 69.182  1.00 40.74  ? 126  GLY A HA3  1 
ATOM   707   N N    . CYS A 1 61  ? 34.119  145.863 69.924  1.00 34.44  ? 127  CYS A N    1 
ATOM   708   C CA   . CYS A 1 61  ? 33.387  147.115 69.783  1.00 40.91  ? 127  CYS A CA   1 
ATOM   709   C C    . CYS A 1 61  ? 34.101  148.024 68.782  1.00 52.82  ? 127  CYS A C    1 
ATOM   710   O O    . CYS A 1 61  ? 35.324  148.090 68.746  1.00 46.43  ? 127  CYS A O    1 
ATOM   711   C CB   . CYS A 1 61  ? 33.241  147.784 71.154  1.00 59.92  ? 127  CYS A CB   1 
ATOM   712   S SG   . CYS A 1 61  ? 32.421  149.407 71.209  1.00 46.65  ? 127  CYS A SG   1 
ATOM   713   H H    . CYS A 1 61  ? 34.467  145.746 70.702  1.00 41.33  ? 127  CYS A H    1 
ATOM   714   H HA   . CYS A 1 61  ? 32.498  146.928 69.442  1.00 49.09  ? 127  CYS A HA   1 
ATOM   715   H HB2  . CYS A 1 61  ? 32.732  147.189 71.727  1.00 71.90  ? 127  CYS A HB2  1 
ATOM   716   H HB3  . CYS A 1 61  ? 34.129  147.901 71.527  1.00 71.90  ? 127  CYS A HB3  1 
ATOM   717   H HG   . CYS A 1 61  ? 31.305  149.296 70.783  1.00 55.99  ? 127  CYS A HG   1 
ATOM   718   N N    . LYS A 1 62  ? 33.324  148.689 67.936  1.00 66.28  ? 128  LYS A N    1 
ATOM   719   C CA   . LYS A 1 62  ? 33.870  149.581 66.921  1.00 49.61  ? 128  LYS A CA   1 
ATOM   720   C C    . LYS A 1 62  ? 33.641  151.026 67.335  1.00 42.16  ? 128  LYS A C    1 
ATOM   721   O O    . LYS A 1 62  ? 33.839  151.950 66.553  1.00 44.72  ? 128  LYS A O    1 
ATOM   722   C CB   . LYS A 1 62  ? 33.236  149.291 65.549  1.00 45.83  ? 128  LYS A CB   1 
ATOM   723   C CG   . LYS A 1 62  ? 34.046  148.321 64.684  1.00 47.77  ? 128  LYS A CG   1 
ATOM   724   C CD   . LYS A 1 62  ? 33.478  148.182 63.263  1.00 58.76  ? 128  LYS A CD   1 
ATOM   725   C CE   . LYS A 1 62  ? 32.354  147.152 63.176  1.00 70.86  ? 128  LYS A CE   1 
ATOM   726   N NZ   . LYS A 1 62  ? 32.736  145.761 63.598  1.00 85.20  ? 128  LYS A NZ   1 
ATOM   727   H H    . LYS A 1 62  ? 32.465  148.640 67.930  1.00 79.54  ? 128  LYS A H    1 
ATOM   728   H HA   . LYS A 1 62  ? 34.826  149.434 66.849  1.00 59.53  ? 128  LYS A HA   1 
ATOM   729   H HB2  . LYS A 1 62  ? 32.358  148.902 65.687  1.00 54.99  ? 128  LYS A HB2  1 
ATOM   730   H HB3  . LYS A 1 62  ? 33.153  150.125 65.061  1.00 54.99  ? 128  LYS A HB3  1 
ATOM   731   H HG2  . LYS A 1 62  ? 34.957  148.646 64.613  1.00 57.32  ? 128  LYS A HG2  1 
ATOM   732   H HG3  . LYS A 1 62  ? 34.037  147.444 65.098  1.00 57.32  ? 128  LYS A HG3  1 
ATOM   733   H HD2  . LYS A 1 62  ? 33.122  149.039 62.979  1.00 70.51  ? 128  LYS A HD2  1 
ATOM   734   H HD3  . LYS A 1 62  ? 34.188  147.903 62.664  1.00 70.51  ? 128  LYS A HD3  1 
ATOM   735   H HE2  . LYS A 1 62  ? 31.625  147.442 63.747  1.00 85.03  ? 128  LYS A HE2  1 
ATOM   736   H HE3  . LYS A 1 62  ? 32.048  147.106 62.257  1.00 85.03  ? 128  LYS A HE3  1 
ATOM   737   H HZ1  . LYS A 1 62  ? 32.035  145.217 63.522  1.00 102.24 ? 128  LYS A HZ1  1 
ATOM   738   H HZ2  . LYS A 1 62  ? 33.395  145.457 63.083  1.00 102.24 ? 128  LYS A HZ2  1 
ATOM   739   H HZ3  . LYS A 1 62  ? 33.008  145.764 64.445  1.00 102.24 ? 128  LYS A HZ3  1 
ATOM   740   N N    . GLY A 1 63  ? 33.231  151.222 68.579  1.00 45.90  ? 129  GLY A N    1 
ATOM   741   C CA   . GLY A 1 63  ? 33.026  152.559 69.089  1.00 50.05  ? 129  GLY A CA   1 
ATOM   742   C C    . GLY A 1 63  ? 34.362  153.164 69.466  1.00 54.14  ? 129  GLY A C    1 
ATOM   743   O O    . GLY A 1 63  ? 35.371  152.464 69.579  1.00 52.78  ? 129  GLY A O    1 
ATOM   744   H H    . GLY A 1 63  ? 33.064  150.596 69.145  1.00 55.08  ? 129  GLY A H    1 
ATOM   745   H HA2  . GLY A 1 63  ? 32.606  153.113 68.412  1.00 60.06  ? 129  GLY A HA2  1 
ATOM   746   H HA3  . GLY A 1 63  ? 32.457  152.532 69.874  1.00 60.06  ? 129  GLY A HA3  1 
ATOM   747   N N    . VAL A 1 64  ? 34.354  154.470 69.699  1.00 63.49  ? 130  VAL A N    1 
ATOM   748   C CA   . VAL A 1 64  ? 35.531  155.180 70.170  1.00 59.00  ? 130  VAL A CA   1 
ATOM   749   C C    . VAL A 1 64  ? 35.143  156.059 71.359  1.00 58.11  ? 130  VAL A C    1 
ATOM   750   O O    . VAL A 1 64  ? 34.090  156.707 71.355  1.00 70.98  ? 130  VAL A O    1 
ATOM   751   C CB   . VAL A 1 64  ? 36.164  156.005 69.023  1.00 51.85  ? 130  VAL A CB   1 
ATOM   752   C CG1  . VAL A 1 64  ? 37.079  157.094 69.554  1.00 56.37  ? 130  VAL A CG1  1 
ATOM   753   C CG2  . VAL A 1 64  ? 36.929  155.076 68.084  1.00 48.01  ? 130  VAL A CG2  1 
ATOM   754   H H    . VAL A 1 64  ? 33.667  154.974 69.589  1.00 76.19  ? 130  VAL A H    1 
ATOM   755   H HA   . VAL A 1 64  ? 36.189  154.536 70.475  1.00 70.80  ? 130  VAL A HA   1 
ATOM   756   H HB   . VAL A 1 64  ? 35.457  156.430 68.513  1.00 62.22  ? 130  VAL A HB   1 
ATOM   757   H HG11 . VAL A 1 64  ? 37.453  157.584 68.805  1.00 67.64  ? 130  VAL A HG11 1 
ATOM   758   H HG12 . VAL A 1 64  ? 36.563  157.692 70.118  1.00 67.64  ? 130  VAL A HG12 1 
ATOM   759   H HG13 . VAL A 1 64  ? 37.791  156.684 70.070  1.00 67.64  ? 130  VAL A HG13 1 
ATOM   760   H HG21 . VAL A 1 64  ? 37.321  155.603 67.370  1.00 57.62  ? 130  VAL A HG21 1 
ATOM   761   H HG22 . VAL A 1 64  ? 37.627  154.627 68.585  1.00 57.62  ? 130  VAL A HG22 1 
ATOM   762   H HG23 . VAL A 1 64  ? 36.313  154.424 67.715  1.00 57.62  ? 130  VAL A HG23 1 
ATOM   763   N N    . VAL A 1 65  ? 35.979  156.042 72.392  1.00 42.61  ? 131  VAL A N    1 
ATOM   764   C CA   . VAL A 1 65  ? 35.817  156.947 73.524  1.00 54.15  ? 131  VAL A CA   1 
ATOM   765   C C    . VAL A 1 65  ? 36.672  158.170 73.238  1.00 59.46  ? 131  VAL A C    1 
ATOM   766   O O    . VAL A 1 65  ? 37.865  158.037 72.968  1.00 64.47  ? 131  VAL A O    1 
ATOM   767   C CB   . VAL A 1 65  ? 36.301  156.343 74.866  1.00 51.70  ? 131  VAL A CB   1 
ATOM   768   C CG1  . VAL A 1 65  ? 35.683  157.108 76.022  1.00 44.90  ? 131  VAL A CG1  1 
ATOM   769   C CG2  . VAL A 1 65  ? 35.970  154.864 74.975  1.00 27.72  ? 131  VAL A CG2  1 
ATOM   770   H H    . VAL A 1 65  ? 36.653  155.512 72.462  1.00 51.13  ? 131  VAL A H    1 
ATOM   771   H HA   . VAL A 1 65  ? 34.889  157.217 73.609  1.00 64.98  ? 131  VAL A HA   1 
ATOM   772   H HB   . VAL A 1 65  ? 37.264  156.439 74.925  1.00 62.04  ? 131  VAL A HB   1 
ATOM   773   H HG11 . VAL A 1 65  ? 35.992  156.722 76.856  1.00 53.88  ? 131  VAL A HG11 1 
ATOM   774   H HG12 . VAL A 1 65  ? 35.955  158.037 75.966  1.00 53.88  ? 131  VAL A HG12 1 
ATOM   775   H HG13 . VAL A 1 65  ? 34.717  157.041 75.964  1.00 53.88  ? 131  VAL A HG13 1 
ATOM   776   H HG21 . VAL A 1 65  ? 36.291  154.531 75.828  1.00 33.26  ? 131  VAL A HG21 1 
ATOM   777   H HG22 . VAL A 1 65  ? 35.009  154.751 74.916  1.00 33.26  ? 131  VAL A HG22 1 
ATOM   778   H HG23 . VAL A 1 65  ? 36.405  154.390 74.249  1.00 33.26  ? 131  VAL A HG23 1 
ATOM   779   N N    . THR A 1 66  ? 36.069  159.355 73.290  1.00 63.05  ? 132  THR A N    1 
ATOM   780   C CA   . THR A 1 66  ? 36.783  160.590 72.959  1.00 66.42  ? 132  THR A CA   1 
ATOM   781   C C    . THR A 1 66  ? 37.251  161.299 74.228  1.00 62.90  ? 132  THR A C    1 
ATOM   782   O O    . THR A 1 66  ? 36.847  160.937 75.333  1.00 75.04  ? 132  THR A O    1 
ATOM   783   C CB   . THR A 1 66  ? 35.899  161.532 72.133  1.00 61.12  ? 132  THR A CB   1 
ATOM   784   O OG1  . THR A 1 66  ? 34.802  161.985 72.932  1.00 66.14  ? 132  THR A OG1  1 
ATOM   785   C CG2  . THR A 1 66  ? 35.367  160.813 70.895  1.00 47.20  ? 132  THR A CG2  1 
ATOM   786   H H    . THR A 1 66  ? 35.247  159.473 73.514  1.00 75.66  ? 132  THR A H    1 
ATOM   787   H HA   . THR A 1 66  ? 37.566  160.371 72.430  1.00 79.70  ? 132  THR A HA   1 
ATOM   788   H HB   . THR A 1 66  ? 36.423  162.295 71.843  1.00 73.35  ? 132  THR A HB   1 
ATOM   789   H HG1  . THR A 1 66  ? 34.314  162.502 72.484  1.00 79.37  ? 132  THR A HG1  1 
ATOM   790   H HG21 . THR A 1 66  ? 34.809  161.414 70.377  1.00 56.64  ? 132  THR A HG21 1 
ATOM   791   H HG22 . THR A 1 66  ? 36.106  160.514 70.342  1.00 56.64  ? 132  THR A HG22 1 
ATOM   792   H HG23 . THR A 1 66  ? 34.840  160.043 71.160  1.00 56.64  ? 132  THR A HG23 1 
ATOM   793   N N    . ALA A 1 67  ? 38.115  162.294 74.076  1.00 52.91  ? 133  ALA A N    1 
ATOM   794   C CA   . ALA A 1 67  ? 38.641  163.003 75.236  1.00 45.50  ? 133  ALA A CA   1 
ATOM   795   C C    . ALA A 1 67  ? 37.521  163.687 76.015  1.00 56.43  ? 133  ALA A C    1 
ATOM   796   O O    . ALA A 1 67  ? 37.578  163.804 77.239  1.00 51.11  ? 133  ALA A O    1 
ATOM   797   C CB   . ALA A 1 67  ? 39.663  164.026 74.799  1.00 53.93  ? 133  ALA A CB   1 
ATOM   798   H H    . ALA A 1 67  ? 38.412  162.575 73.320  1.00 63.50  ? 133  ALA A H    1 
ATOM   799   H HA   . ALA A 1 67  ? 39.078  162.370 75.826  1.00 54.60  ? 133  ALA A HA   1 
ATOM   800   H HB1  . ALA A 1 67  ? 40.001  164.488 75.582  1.00 64.71  ? 133  ALA A HB1  1 
ATOM   801   H HB2  . ALA A 1 67  ? 40.389  163.572 74.343  1.00 64.71  ? 133  ALA A HB2  1 
ATOM   802   H HB3  . ALA A 1 67  ? 39.239  164.659 74.198  1.00 64.71  ? 133  ALA A HB3  1 
ATOM   803   N N    . GLU A 1 68  ? 36.497  164.144 75.303  1.00 63.76  ? 134  GLU A N    1 
ATOM   804   C CA   . GLU A 1 68  ? 35.420  164.880 75.948  1.00 61.32  ? 134  GLU A CA   1 
ATOM   805   C C    . GLU A 1 68  ? 34.671  163.915 76.822  1.00 54.14  ? 134  GLU A C    1 
ATOM   806   O O    . GLU A 1 68  ? 34.280  164.251 77.935  1.00 52.84  ? 134  GLU A O    1 
ATOM   807   C CB   . GLU A 1 68  ? 34.488  165.509 74.918  1.00 65.01  ? 134  GLU A CB   1 
ATOM   808   C CG   . GLU A 1 68  ? 35.176  166.540 74.046  1.00 84.51  ? 134  GLU A CG   1 
ATOM   809   C CD   . GLU A 1 68  ? 35.692  167.733 74.853  1.00 100.26 ? 134  GLU A CD   1 
ATOM   810   O OE1  . GLU A 1 68  ? 35.128  168.014 75.939  1.00 89.07  ? 134  GLU A OE1  1 
ATOM   811   O OE2  . GLU A 1 68  ? 36.665  168.384 74.399  1.00 107.82 ? 134  GLU A OE2  1 
ATOM   812   H H    . GLU A 1 68  ? 36.404  164.043 74.455  1.00 76.51  ? 134  GLU A H    1 
ATOM   813   H HA   . GLU A 1 68  ? 35.790  165.582 76.505  1.00 73.59  ? 134  GLU A HA   1 
ATOM   814   H HB2  . GLU A 1 68  ? 34.141  164.812 74.340  1.00 78.01  ? 134  GLU A HB2  1 
ATOM   815   H HB3  . GLU A 1 68  ? 33.758  165.949 75.381  1.00 78.01  ? 134  GLU A HB3  1 
ATOM   816   H HG2  . GLU A 1 68  ? 35.933  166.126 73.603  1.00 101.41 ? 134  GLU A HG2  1 
ATOM   817   H HG3  . GLU A 1 68  ? 34.545  166.872 73.388  1.00 101.41 ? 134  GLU A HG3  1 
ATOM   818   N N    . MET A 1 69  ? 34.488  162.704 76.310  1.00 48.61  ? 135  MET A N    1 
ATOM   819   C CA   . MET A 1 69  ? 33.836  161.648 77.077  1.00 50.89  ? 135  MET A CA   1 
ATOM   820   C C    . MET A 1 69  ? 34.665  161.289 78.302  1.00 43.82  ? 135  MET A C    1 
ATOM   821   O O    . MET A 1 69  ? 34.153  161.213 79.422  1.00 43.88  ? 135  MET A O    1 
ATOM   822   C CB   . MET A 1 69  ? 33.680  160.381 76.233  1.00 55.87  ? 135  MET A CB   1 
ATOM   823   C CG   . MET A 1 69  ? 32.749  160.489 75.045  1.00 58.57  ? 135  MET A CG   1 
ATOM   824   S SD   . MET A 1 69  ? 32.627  158.926 74.172  1.00 55.21  ? 135  MET A SD   1 
ATOM   825   C CE   . MET A 1 69  ? 32.007  157.868 75.482  1.00 73.55  ? 135  MET A CE   1 
ATOM   826   H H    . MET A 1 69  ? 34.732  162.466 75.521  1.00 58.33  ? 135  MET A H    1 
ATOM   827   H HA   . MET A 1 69  ? 32.955  161.945 77.355  1.00 61.07  ? 135  MET A HA   1 
ATOM   828   H HB2  . MET A 1 69  ? 34.553  160.130 75.895  1.00 67.04  ? 135  MET A HB2  1 
ATOM   829   H HB3  . MET A 1 69  ? 33.340  159.674 76.804  1.00 67.04  ? 135  MET A HB3  1 
ATOM   830   H HG2  . MET A 1 69  ? 31.863  160.736 75.352  1.00 70.28  ? 135  MET A HG2  1 
ATOM   831   H HG3  . MET A 1 69  ? 33.091  161.156 74.429  1.00 70.28  ? 135  MET A HG3  1 
ATOM   832   H HE1  . MET A 1 69  ? 31.894  156.969 75.134  1.00 88.27  ? 135  MET A HE1  1 
ATOM   833   H HE2  . MET A 1 69  ? 32.646  157.862 76.212  1.00 88.27  ? 135  MET A HE2  1 
ATOM   834   H HE3  . MET A 1 69  ? 31.155  158.214 75.790  1.00 88.27  ? 135  MET A HE3  1 
ATOM   835   N N    . PHE A 1 70  ? 35.945  161.035 78.059  1.00 28.39  ? 136  PHE A N    1 
ATOM   836   C CA   . PHE A 1 70  ? 36.877  160.682 79.106  1.00 54.27  ? 136  PHE A CA   1 
ATOM   837   C C    . PHE A 1 70  ? 36.861  161.717 80.228  1.00 64.68  ? 136  PHE A C    1 
ATOM   838   O O    . PHE A 1 70  ? 36.843  161.369 81.412  1.00 63.62  ? 136  PHE A O    1 
ATOM   839   C CB   . PHE A 1 70  ? 38.278  160.594 78.515  1.00 73.61  ? 136  PHE A CB   1 
ATOM   840   C CG   . PHE A 1 70  ? 39.335  160.193 79.507  1.00 73.11  ? 136  PHE A CG   1 
ATOM   841   C CD1  . PHE A 1 70  ? 39.951  161.142 80.308  1.00 71.02  ? 136  PHE A CD1  1 
ATOM   842   C CD2  . PHE A 1 70  ? 39.721  158.869 79.627  1.00 60.11  ? 136  PHE A CD2  1 
ATOM   843   C CE1  . PHE A 1 70  ? 40.928  160.776 81.210  1.00 72.18  ? 136  PHE A CE1  1 
ATOM   844   C CE2  . PHE A 1 70  ? 40.689  158.500 80.526  1.00 63.57  ? 136  PHE A CE2  1 
ATOM   845   C CZ   . PHE A 1 70  ? 41.299  159.457 81.318  1.00 70.65  ? 136  PHE A CZ   1 
ATOM   846   H H    . PHE A 1 70  ? 36.300  161.063 77.277  1.00 34.07  ? 136  PHE A H    1 
ATOM   847   H HA   . PHE A 1 70  ? 36.640  159.817 79.477  1.00 65.13  ? 136  PHE A HA   1 
ATOM   848   H HB2  . PHE A 1 70  ? 38.276  159.936 77.803  1.00 88.33  ? 136  PHE A HB2  1 
ATOM   849   H HB3  . PHE A 1 70  ? 38.521  161.463 78.159  1.00 88.33  ? 136  PHE A HB3  1 
ATOM   850   H HD1  . PHE A 1 70  ? 39.705  162.036 80.235  1.00 85.22  ? 136  PHE A HD1  1 
ATOM   851   H HD2  . PHE A 1 70  ? 39.317  158.222 79.095  1.00 72.14  ? 136  PHE A HD2  1 
ATOM   852   H HE1  . PHE A 1 70  ? 41.335  161.420 81.745  1.00 86.61  ? 136  PHE A HE1  1 
ATOM   853   H HE2  . PHE A 1 70  ? 40.940  157.608 80.599  1.00 76.28  ? 136  PHE A HE2  1 
ATOM   854   H HZ   . PHE A 1 70  ? 41.954  159.206 81.929  1.00 84.78  ? 136  PHE A HZ   1 
ATOM   855   N N    . ARG A 1 71  ? 36.859  162.990 79.843  1.00 63.54  ? 137  ARG A N    1 
ATOM   856   C CA   . ARG A 1 71  ? 36.935  164.086 80.801  1.00 52.98  ? 137  ARG A CA   1 
ATOM   857   C C    . ARG A 1 71  ? 35.679  164.278 81.636  1.00 55.52  ? 137  ARG A C    1 
ATOM   858   O O    . ARG A 1 71  ? 35.758  164.807 82.745  1.00 60.56  ? 137  ARG A O    1 
ATOM   859   C CB   . ARG A 1 71  ? 37.241  165.399 80.078  1.00 51.78  ? 137  ARG A CB   1 
ATOM   860   C CG   . ARG A 1 71  ? 38.726  165.689 79.928  1.00 75.97  ? 137  ARG A CG   1 
ATOM   861   C CD   . ARG A 1 71  ? 38.968  167.128 79.518  1.00 78.25  ? 137  ARG A CD   1 
ATOM   862   N NE   . ARG A 1 71  ? 38.658  167.338 78.108  1.00 83.15  ? 137  ARG A NE   1 
ATOM   863   C CZ   . ARG A 1 71  ? 39.526  167.178 77.109  1.00 99.79  ? 137  ARG A CZ   1 
ATOM   864   N NH1  . ARG A 1 71  ? 40.783  166.796 77.343  1.00 102.55 ? 137  ARG A NH1  1 
ATOM   865   N NH2  . ARG A 1 71  ? 39.128  167.389 75.856  1.00 96.84  ? 137  ARG A NH2  1 
ATOM   866   H H    . ARG A 1 71  ? 36.814  163.247 79.024  1.00 76.25  ? 137  ARG A H    1 
ATOM   867   H HA   . ARG A 1 71  ? 37.668  163.910 81.412  1.00 63.57  ? 137  ARG A HA   1 
ATOM   868   H HB2  . ARG A 1 71  ? 36.854  165.363 79.189  1.00 62.14  ? 137  ARG A HB2  1 
ATOM   869   H HB3  . ARG A 1 71  ? 36.845  166.129 80.579  1.00 62.14  ? 137  ARG A HB3  1 
ATOM   870   H HG2  . ARG A 1 71  ? 39.170  165.535 80.776  1.00 91.17  ? 137  ARG A HG2  1 
ATOM   871   H HG3  . ARG A 1 71  ? 39.098  165.111 79.243  1.00 91.17  ? 137  ARG A HG3  1 
ATOM   872   H HD2  . ARG A 1 71  ? 38.400  167.711 80.045  1.00 93.90  ? 137  ARG A HD2  1 
ATOM   873   H HD3  . ARG A 1 71  ? 39.902  167.349 79.660  1.00 93.90  ? 137  ARG A HD3  1 
ATOM   874   H HE   . ARG A 1 71  ? 37.859  167.583 77.908  1.00 99.79  ? 137  ARG A HE   1 
ATOM   875   H HH11 . ARG A 1 71  ? 41.046  166.654 78.150  1.00 123.06 ? 137  ARG A HH11 1 
ATOM   876   H HH12 . ARG A 1 71  ? 41.332  166.696 76.688  1.00 123.06 ? 137  ARG A HH12 1 
ATOM   877   H HH21 . ARG A 1 71  ? 38.320  167.635 75.697  1.00 116.21 ? 137  ARG A HH21 1 
ATOM   878   H HH22 . ARG A 1 71  ? 39.683  167.289 75.206  1.00 116.21 ? 137  ARG A HH22 1 
ATOM   879   N N    . HIS A 1 72  ? 34.535  163.826 81.122  1.00 55.12  ? 138  HIS A N    1 
ATOM   880   C CA   . HIS A 1 72  ? 33.241  164.294 81.614  1.00 47.83  ? 138  HIS A CA   1 
ATOM   881   C C    . HIS A 1 72  ? 32.213  163.229 81.966  1.00 60.65  ? 138  HIS A C    1 
ATOM   882   O O    . HIS A 1 72  ? 31.391  163.447 82.856  1.00 76.05  ? 138  HIS A O    1 
ATOM   883   C CB   . HIS A 1 72  ? 32.645  165.245 80.590  1.00 47.95  ? 138  HIS A CB   1 
ATOM   884   C CG   . HIS A 1 72  ? 33.386  166.541 80.487  1.00 67.53  ? 138  HIS A CG   1 
ATOM   885   N ND1  . HIS A 1 72  ? 33.526  167.402 81.554  1.00 65.77  ? 138  HIS A ND1  1 
ATOM   886   C CD2  . HIS A 1 72  ? 34.031  167.121 79.447  1.00 73.51  ? 138  HIS A CD2  1 
ATOM   887   C CE1  . HIS A 1 72  ? 34.224  168.457 81.176  1.00 66.64  ? 138  HIS A CE1  1 
ATOM   888   N NE2  . HIS A 1 72  ? 34.544  168.310 79.902  1.00 72.03  ? 138  HIS A NE2  1 
ATOM   889   H H    . HIS A 1 72  ? 34.481  163.248 80.488  1.00 66.15  ? 138  HIS A H    1 
ATOM   890   H HA   . HIS A 1 72  ? 33.399  164.808 82.420  1.00 57.40  ? 138  HIS A HA   1 
ATOM   891   H HB2  . HIS A 1 72  ? 32.663  164.820 79.718  1.00 57.54  ? 138  HIS A HB2  1 
ATOM   892   H HB3  . HIS A 1 72  ? 31.729  165.444 80.841  1.00 57.54  ? 138  HIS A HB3  1 
ATOM   893   H HD1  . HIS A 1 72  ? 33.208  167.273 82.343  1.00 78.92  ? 138  HIS A HD1  1 
ATOM   894   H HD2  . HIS A 1 72  ? 34.112  166.777 78.587  1.00 88.22  ? 138  HIS A HD2  1 
ATOM   895   H HE1  . HIS A 1 72  ? 34.453  169.180 81.714  1.00 79.96  ? 138  HIS A HE1  1 
ATOM   896   H HE2  . HIS A 1 72  ? 34.997  168.871 79.433  1.00 86.43  ? 138  HIS A HE2  1 
ATOM   897   N N    . MET A 1 73  ? 32.248  162.090 81.284  1.00 54.31  ? 139  MET A N    1 
ATOM   898   C CA   . MET A 1 73  ? 31.250  161.051 81.509  1.00 60.81  ? 139  MET A CA   1 
ATOM   899   C C    . MET A 1 73  ? 31.731  160.022 82.527  1.00 65.98  ? 139  MET A C    1 
ATOM   900   O O    . MET A 1 73  ? 32.926  159.740 82.614  1.00 56.66  ? 139  MET A O    1 
ATOM   901   C CB   . MET A 1 73  ? 30.948  160.320 80.207  1.00 67.22  ? 139  MET A CB   1 
ATOM   902   C CG   . MET A 1 73  ? 30.450  161.175 79.064  1.00 45.76  ? 139  MET A CG   1 
ATOM   903   S SD   . MET A 1 73  ? 30.129  160.103 77.657  1.00 76.33  ? 139  MET A SD   1 
ATOM   904   C CE   . MET A 1 73  ? 28.624  159.288 78.197  1.00 85.29  ? 139  MET A CE   1 
ATOM   905   H H    . MET A 1 73  ? 32.837  161.894 80.688  1.00 65.17  ? 139  MET A H    1 
ATOM   906   H HA   . MET A 1 73  ? 30.429  161.459 81.828  1.00 72.97  ? 139  MET A HA   1 
ATOM   907   H HB2  . MET A 1 73  ? 31.760  159.882 79.907  1.00 80.66  ? 139  MET A HB2  1 
ATOM   908   H HB3  . MET A 1 73  ? 30.268  159.651 80.384  1.00 80.66  ? 139  MET A HB3  1 
ATOM   909   H HG2  . MET A 1 73  ? 29.625  161.616 79.317  1.00 54.91  ? 139  MET A HG2  1 
ATOM   910   H HG3  . MET A 1 73  ? 31.128  161.823 78.817  1.00 54.91  ? 139  MET A HG3  1 
ATOM   911   H HE1  . MET A 1 73  ? 28.338  158.667 77.509  1.00 102.34 ? 139  MET A HE1  1 
ATOM   912   H HE2  . MET A 1 73  ? 28.803  158.810 79.022  1.00 102.34 ? 139  MET A HE2  1 
ATOM   913   H HE3  . MET A 1 73  ? 27.938  159.958 78.345  1.00 102.34 ? 139  MET A HE3  1 
ATOM   914   N N    . GLN A 1 74  ? 30.794  159.453 83.281  1.00 61.53  ? 140  GLN A N    1 
ATOM   915   C CA   . GLN A 1 74  ? 31.093  158.326 84.151  1.00 58.27  ? 140  GLN A CA   1 
ATOM   916   C C    . GLN A 1 74  ? 31.258  157.099 83.282  1.00 58.25  ? 140  GLN A C    1 
ATOM   917   O O    . GLN A 1 74  ? 30.816  157.090 82.143  1.00 46.53  ? 140  GLN A O    1 
ATOM   918   C CB   . GLN A 1 74  ? 29.956  158.074 85.140  1.00 76.06  ? 140  GLN A CB   1 
ATOM   919   C CG   . GLN A 1 74  ? 29.798  159.128 86.213  1.00 83.14  ? 140  GLN A CG   1 
ATOM   920   C CD   . GLN A 1 74  ? 31.006  159.215 87.118  1.00 73.96  ? 140  GLN A CD   1 
ATOM   921   O OE1  . GLN A 1 74  ? 31.276  158.306 87.904  1.00 81.62  ? 140  GLN A OE1  1 
ATOM   922   N NE2  . GLN A 1 74  ? 31.746  160.308 87.009  1.00 62.90  ? 140  GLN A NE2  1 
ATOM   923   H H    . GLN A 1 74  ? 29.972  159.705 83.305  1.00 73.84  ? 140  GLN A H    1 
ATOM   924   H HA   . GLN A 1 74  ? 31.915  158.486 84.640  1.00 69.93  ? 140  GLN A HA   1 
ATOM   925   H HB2  . GLN A 1 74  ? 29.122  158.031 84.646  1.00 91.27  ? 140  GLN A HB2  1 
ATOM   926   H HB3  . GLN A 1 74  ? 30.116  157.226 85.584  1.00 91.27  ? 140  GLN A HB3  1 
ATOM   927   H HG2  . GLN A 1 74  ? 29.674  159.993 85.792  1.00 99.77  ? 140  GLN A HG2  1 
ATOM   928   H HG3  . GLN A 1 74  ? 29.027  158.910 86.760  1.00 99.77  ? 140  GLN A HG3  1 
ATOM   929   H HE21 . GLN A 1 74  ? 31.528  160.920 86.446  1.00 75.48  ? 140  GLN A HE21 1 
ATOM   930   H HE22 . GLN A 1 74  ? 32.444  160.406 87.502  1.00 75.48  ? 140  GLN A HE22 1 
ATOM   931   N N    . ASN A 1 75  ? 31.884  156.061 83.827  1.00 58.96  ? 141  ASN A N    1 
ATOM   932   C CA   . ASN A 1 75  ? 32.077  154.829 83.090  1.00 43.25  ? 141  ASN A CA   1 
ATOM   933   C C    . ASN A 1 75  ? 30.747  154.257 82.646  1.00 54.64  ? 141  ASN A C    1 
ATOM   934   O O    . ASN A 1 75  ? 30.573  153.902 81.481  1.00 51.92  ? 141  ASN A O    1 
ATOM   935   C CB   . ASN A 1 75  ? 32.802  153.806 83.948  1.00 52.33  ? 141  ASN A CB   1 
ATOM   936   C CG   . ASN A 1 75  ? 34.295  154.073 84.048  1.00 53.79  ? 141  ASN A CG   1 
ATOM   937   O OD1  . ASN A 1 75  ? 34.866  154.812 83.254  1.00 48.16  ? 141  ASN A OD1  1 
ATOM   938   N ND2  . ASN A 1 75  ? 34.935  153.453 85.032  1.00 71.83  ? 141  ASN A ND2  1 
ATOM   939   H H    . ASN A 1 75  ? 32.206  156.049 84.624  1.00 70.75  ? 141  ASN A H    1 
ATOM   940   H HA   . ASN A 1 75  ? 32.614  155.005 82.301  1.00 51.90  ? 141  ASN A HA   1 
ATOM   941   H HB2  . ASN A 1 75  ? 32.432  153.828 84.844  1.00 62.79  ? 141  ASN A HB2  1 
ATOM   942   H HB3  . ASN A 1 75  ? 32.680  152.926 83.560  1.00 62.79  ? 141  ASN A HB3  1 
ATOM   943   H HD21 . ASN A 1 75  ? 35.781  153.569 85.134  1.00 86.19  ? 141  ASN A HD21 1 
ATOM   944   H HD22 . ASN A 1 75  ? 34.504  152.936 85.567  1.00 86.19  ? 141  ASN A HD22 1 
ATOM   945   N N    . SER A 1 76  ? 29.804  154.190 83.580  1.00 62.05  ? 142  SER A N    1 
ATOM   946   C CA   . SER A 1 76  ? 28.480  153.648 83.303  1.00 53.35  ? 142  SER A CA   1 
ATOM   947   C C    . SER A 1 76  ? 27.882  154.257 82.049  1.00 47.63  ? 142  SER A C    1 
ATOM   948   O O    . SER A 1 76  ? 27.250  153.559 81.260  1.00 61.28  ? 142  SER A O    1 
ATOM   949   C CB   . SER A 1 76  ? 27.545  153.885 84.489  1.00 62.77  ? 142  SER A CB   1 
ATOM   950   O OG   . SER A 1 76  ? 27.421  155.264 84.777  1.00 61.47  ? 142  SER A OG   1 
ATOM   951   H H    . SER A 1 76  ? 29.909  154.455 84.392  1.00 74.46  ? 142  SER A H    1 
ATOM   952   H HA   . SER A 1 76  ? 28.553  152.690 83.166  1.00 64.02  ? 142  SER A HA   1 
ATOM   953   H HB2  . SER A 1 76  ? 26.669  153.529 84.274  1.00 75.33  ? 142  SER A HB2  1 
ATOM   954   H HB3  . SER A 1 76  ? 27.904  153.432 85.268  1.00 75.33  ? 142  SER A HB3  1 
ATOM   955   H HG   . SER A 1 76  ? 26.905  155.375 85.430  1.00 73.76  ? 142  SER A HG   1 
ATOM   956   N N    . GLU A 1 77  ? 28.113  155.550 81.854  1.00 46.50  ? 143  GLU A N    1 
ATOM   957   C CA   . GLU A 1 77  ? 27.556  156.279 80.716  1.00 54.51  ? 143  GLU A CA   1 
ATOM   958   C C    . GLU A 1 77  ? 28.397  156.101 79.466  1.00 63.58  ? 143  GLU A C    1 
ATOM   959   O O    . GLU A 1 77  ? 27.865  156.093 78.355  1.00 68.70  ? 143  GLU A O    1 
ATOM   960   C CB   . GLU A 1 77  ? 27.426  157.758 81.066  1.00 72.20  ? 143  GLU A CB   1 
ATOM   961   C CG   . GLU A 1 77  ? 26.629  157.965 82.360  1.00 95.02  ? 143  GLU A CG   1 
ATOM   962   C CD   . GLU A 1 77  ? 26.708  159.373 82.915  1.00 107.30 ? 143  GLU A CD   1 
ATOM   963   O OE1  . GLU A 1 77  ? 27.735  160.061 82.681  1.00 97.65  ? 143  GLU A OE1  1 
ATOM   964   O OE2  . GLU A 1 77  ? 25.739  159.777 83.605  1.00 117.58 ? 143  GLU A OE2  1 
ATOM   965   H H    . GLU A 1 77  ? 28.596  156.036 82.374  1.00 55.80  ? 143  GLU A H    1 
ATOM   966   H HA   . GLU A 1 77  ? 26.667  155.938 80.529  1.00 65.41  ? 143  GLU A HA   1 
ATOM   967   H HB2  . GLU A 1 77  ? 28.311  158.136 81.190  1.00 86.64  ? 143  GLU A HB2  1 
ATOM   968   H HB3  . GLU A 1 77  ? 26.963  158.217 80.347  1.00 86.64  ? 143  GLU A HB3  1 
ATOM   969   H HG2  . GLU A 1 77  ? 25.696  157.767 82.186  1.00 114.02 ? 143  GLU A HG2  1 
ATOM   970   H HG3  . GLU A 1 77  ? 26.972  157.361 83.037  1.00 114.02 ? 143  GLU A HG3  1 
ATOM   971   N N    . ILE A 1 78  ? 29.711  155.962 79.648  1.00 66.93  ? 144  ILE A N    1 
ATOM   972   C CA   . ILE A 1 78  ? 30.597  155.579 78.555  1.00 51.22  ? 144  ILE A CA   1 
ATOM   973   C C    . ILE A 1 78  ? 30.251  154.177 78.095  1.00 41.51  ? 144  ILE A C    1 
ATOM   974   O O    . ILE A 1 78  ? 30.119  153.934 76.906  1.00 50.99  ? 144  ILE A O    1 
ATOM   975   C CB   . ILE A 1 78  ? 32.089  155.605 78.955  1.00 52.63  ? 144  ILE A CB   1 
ATOM   976   C CG1  . ILE A 1 78  ? 32.510  157.029 79.326  1.00 49.58  ? 144  ILE A CG1  1 
ATOM   977   C CG2  . ILE A 1 78  ? 32.958  155.092 77.793  1.00 41.82  ? 144  ILE A CG2  1 
ATOM   978   C CD1  . ILE A 1 78  ? 33.936  157.165 79.794  1.00 36.79  ? 144  ILE A CD1  1 
ATOM   979   H H    . ILE A 1 78  ? 30.112  156.084 80.399  1.00 80.32  ? 144  ILE A H    1 
ATOM   980   H HA   . ILE A 1 78  ? 30.469  156.186 77.810  1.00 61.46  ? 144  ILE A HA   1 
ATOM   981   H HB   . ILE A 1 78  ? 32.219  155.028 79.724  1.00 63.16  ? 144  ILE A HB   1 
ATOM   982   H HG12 . ILE A 1 78  ? 32.401  157.596 78.547  1.00 59.50  ? 144  ILE A HG12 1 
ATOM   983   H HG13 . ILE A 1 78  ? 31.935  157.344 80.041  1.00 59.50  ? 144  ILE A HG13 1 
ATOM   984   H HG21 . ILE A 1 78  ? 33.890  155.116 78.062  1.00 50.19  ? 144  ILE A HG21 1 
ATOM   985   H HG22 . ILE A 1 78  ? 32.697  154.182 77.582  1.00 50.19  ? 144  ILE A HG22 1 
ATOM   986   H HG23 . ILE A 1 78  ? 32.822  155.663 77.021  1.00 50.19  ? 144  ILE A HG23 1 
ATOM   987   H HD11 . ILE A 1 78  ? 34.111  158.095 80.005  1.00 44.14  ? 144  ILE A HD11 1 
ATOM   988   H HD12 . ILE A 1 78  ? 34.062  156.616 80.583  1.00 44.14  ? 144  ILE A HD12 1 
ATOM   989   H HD13 . ILE A 1 78  ? 34.529  156.869 79.086  1.00 44.14  ? 144  ILE A HD13 1 
ATOM   990   N N    . ILE A 1 79  ? 30.107  153.251 79.035  1.00 48.58  ? 145  ILE A N    1 
ATOM   991   C CA   . ILE A 1 79  ? 29.792  151.873 78.671  1.00 40.54  ? 145  ILE A CA   1 
ATOM   992   C C    . ILE A 1 79  ? 28.477  151.789 77.897  1.00 44.67  ? 145  ILE A C    1 
ATOM   993   O O    . ILE A 1 79  ? 28.382  151.013 76.952  1.00 36.45  ? 145  ILE A O    1 
ATOM   994   C CB   . ILE A 1 79  ? 29.751  150.940 79.899  1.00 35.72  ? 145  ILE A CB   1 
ATOM   995   C CG1  . ILE A 1 79  ? 31.111  150.935 80.603  1.00 46.55  ? 145  ILE A CG1  1 
ATOM   996   C CG2  . ILE A 1 79  ? 29.405  149.521 79.465  1.00 27.42  ? 145  ILE A CG2  1 
ATOM   997   C CD1  . ILE A 1 79  ? 31.187  150.089 81.856  1.00 46.08  ? 145  ILE A CD1  1 
ATOM   998   H H    . ILE A 1 79  ? 30.186  153.390 79.880  1.00 58.30  ? 145  ILE A H    1 
ATOM   999   H HA   . ILE A 1 79  ? 30.492  151.547 78.085  1.00 48.64  ? 145  ILE A HA   1 
ATOM   1000  H HB   . ILE A 1 79  ? 29.075  151.257 80.517  1.00 42.86  ? 145  ILE A HB   1 
ATOM   1001  H HG12 . ILE A 1 79  ? 31.778  150.599 79.983  1.00 55.86  ? 145  ILE A HG12 1 
ATOM   1002  H HG13 . ILE A 1 79  ? 31.331  151.846 80.852  1.00 55.86  ? 145  ILE A HG13 1 
ATOM   1003  H HG21 . ILE A 1 79  ? 29.383  148.949 80.248  1.00 32.90  ? 145  ILE A HG21 1 
ATOM   1004  H HG22 . ILE A 1 79  ? 28.535  149.527 79.035  1.00 32.90  ? 145  ILE A HG22 1 
ATOM   1005  H HG23 . ILE A 1 79  ? 30.080  149.208 78.843  1.00 32.90  ? 145  ILE A HG23 1 
ATOM   1006  H HD11 . ILE A 1 79  ? 32.081  150.151 82.225  1.00 55.29  ? 145  ILE A HD11 1 
ATOM   1007  H HD12 . ILE A 1 79  ? 30.539  150.419 82.499  1.00 55.29  ? 145  ILE A HD12 1 
ATOM   1008  H HD13 . ILE A 1 79  ? 30.986  149.168 81.627  1.00 55.29  ? 145  ILE A HD13 1 
ATOM   1009  N N    . ARG A 1 80  ? 27.480  152.589 78.292  1.00 48.48  ? 146  ARG A N    1 
ATOM   1010  C CA   . ARG A 1 80  ? 26.179  152.628 77.611  1.00 50.67  ? 146  ARG A CA   1 
ATOM   1011  C C    . ARG A 1 80  ? 26.296  153.118 76.170  1.00 45.59  ? 146  ARG A C    1 
ATOM   1012  O O    . ARG A 1 80  ? 25.683  152.559 75.254  1.00 37.32  ? 146  ARG A O    1 
ATOM   1013  C CB   . ARG A 1 80  ? 25.208  153.538 78.368  1.00 56.27  ? 146  ARG A CB   1 
ATOM   1014  C CG   . ARG A 1 80  ? 24.519  152.868 79.543  1.00 80.53  ? 146  ARG A CG   1 
ATOM   1015  C CD   . ARG A 1 80  ? 23.681  153.848 80.369  1.00 98.84  ? 146  ARG A CD   1 
ATOM   1016  N NE   . ARG A 1 80  ? 23.693  153.490 81.790  1.00 116.25 ? 146  ARG A NE   1 
ATOM   1017  C CZ   . ARG A 1 80  ? 22.935  154.059 82.726  1.00 125.82 ? 146  ARG A CZ   1 
ATOM   1018  N NH1  . ARG A 1 80  ? 22.064  155.007 82.400  1.00 132.86 ? 146  ARG A NH1  1 
ATOM   1019  N NH2  . ARG A 1 80  ? 23.027  153.659 83.990  1.00 124.62 ? 146  ARG A NH2  1 
ATOM   1020  H H    . ARG A 1 80  ? 27.534  153.126 78.962  1.00 58.18  ? 146  ARG A H    1 
ATOM   1021  H HA   . ARG A 1 80  ? 25.803  151.734 77.595  1.00 60.80  ? 146  ARG A HA   1 
ATOM   1022  H HB2  . ARG A 1 80  ? 25.699  154.302 78.710  1.00 67.53  ? 146  ARG A HB2  1 
ATOM   1023  H HB3  . ARG A 1 80  ? 24.520  153.839 77.754  1.00 67.53  ? 146  ARG A HB3  1 
ATOM   1024  H HG2  . ARG A 1 80  ? 23.928  152.174 79.210  1.00 96.63  ? 146  ARG A HG2  1 
ATOM   1025  H HG3  . ARG A 1 80  ? 25.191  152.481 80.126  1.00 96.63  ? 146  ARG A HG3  1 
ATOM   1026  H HD2  . ARG A 1 80  ? 24.048  154.741 80.276  1.00 118.61 ? 146  ARG A HD2  1 
ATOM   1027  H HD3  . ARG A 1 80  ? 22.763  153.828 80.057  1.00 118.61 ? 146  ARG A HD3  1 
ATOM   1028  H HE   . ARG A 1 80  ? 24.230  152.866 82.039  1.00 139.50 ? 146  ARG A HE   1 
ATOM   1029  H HH11 . ARG A 1 80  ? 21.999  155.269 81.584  1.00 159.43 ? 146  ARG A HH11 1 
ATOM   1030  H HH12 . ARG A 1 80  ? 21.574  155.367 83.008  1.00 159.43 ? 146  ARG A HH12 1 
ATOM   1031  H HH21 . ARG A 1 80  ? 23.585  153.042 84.206  1.00 149.54 ? 146  ARG A HH21 1 
ATOM   1032  H HH22 . ARG A 1 80  ? 22.532  154.022 84.592  1.00 149.54 ? 146  ARG A HH22 1 
ATOM   1033  N N    . LYS A 1 81  ? 27.073  154.181 75.991  1.00 39.45  ? 147  LYS A N    1 
ATOM   1034  C CA   . LYS A 1 81  ? 27.272  154.807 74.692  1.00 43.71  ? 147  LYS A CA   1 
ATOM   1035  C C    . LYS A 1 81  ? 28.073  153.888 73.780  1.00 45.44  ? 147  LYS A C    1 
ATOM   1036  O O    . LYS A 1 81  ? 27.946  153.923 72.555  1.00 44.69  ? 147  LYS A O    1 
ATOM   1037  C CB   . LYS A 1 81  ? 28.018  156.127 74.888  1.00 48.15  ? 147  LYS A CB   1 
ATOM   1038  C CG   . LYS A 1 81  ? 28.545  156.798 73.618  1.00 62.93  ? 147  LYS A CG   1 
ATOM   1039  C CD   . LYS A 1 81  ? 27.457  157.603 72.927  1.00 67.78  ? 147  LYS A CD   1 
ATOM   1040  C CE   . LYS A 1 81  ? 27.870  158.012 71.529  1.00 69.09  ? 147  LYS A CE   1 
ATOM   1041  N NZ   . LYS A 1 81  ? 26.687  158.108 70.625  1.00 80.13  ? 147  LYS A NZ   1 
ATOM   1042  H H    . LYS A 1 81  ? 27.506  154.567 76.626  1.00 47.34  ? 147  LYS A H    1 
ATOM   1043  H HA   . LYS A 1 81  ? 26.413  154.989 74.279  1.00 52.45  ? 147  LYS A HA   1 
ATOM   1044  H HB2  . LYS A 1 81  ? 27.417  156.755 75.319  1.00 57.78  ? 147  LYS A HB2  1 
ATOM   1045  H HB3  . LYS A 1 81  ? 28.780  155.963 75.466  1.00 57.78  ? 147  LYS A HB3  1 
ATOM   1046  H HG2  . LYS A 1 81  ? 29.269  157.401 73.850  1.00 75.52  ? 147  LYS A HG2  1 
ATOM   1047  H HG3  . LYS A 1 81  ? 28.859  156.117 73.002  1.00 75.52  ? 147  LYS A HG3  1 
ATOM   1048  H HD2  . LYS A 1 81  ? 26.654  157.064 72.861  1.00 81.34  ? 147  LYS A HD2  1 
ATOM   1049  H HD3  . LYS A 1 81  ? 27.281  158.407 73.439  1.00 81.34  ? 147  LYS A HD3  1 
ATOM   1050  H HE2  . LYS A 1 81  ? 28.299  158.881 71.563  1.00 82.90  ? 147  LYS A HE2  1 
ATOM   1051  H HE3  . LYS A 1 81  ? 28.478  157.349 71.167  1.00 82.90  ? 147  LYS A HE3  1 
ATOM   1052  H HZ1  . LYS A 1 81  ? 26.948  158.349 69.809  1.00 96.15  ? 147  LYS A HZ1  1 
ATOM   1053  H HZ2  . LYS A 1 81  ? 26.277  157.319 70.576  1.00 96.15  ? 147  LYS A HZ2  1 
ATOM   1054  H HZ3  . LYS A 1 81  ? 26.114  158.713 70.936  1.00 96.15  ? 147  LYS A HZ3  1 
ATOM   1055  N N    . MET A 1 82  ? 28.917  153.073 74.391  1.00 47.82  ? 148  MET A N    1 
ATOM   1056  C CA   . MET A 1 82  ? 29.778  152.179 73.640  1.00 42.17  ? 148  MET A CA   1 
ATOM   1057  C C    . MET A 1 82  ? 29.036  150.898 73.300  1.00 51.06  ? 148  MET A C    1 
ATOM   1058  O O    . MET A 1 82  ? 29.413  150.199 72.371  1.00 64.81  ? 148  MET A O    1 
ATOM   1059  C CB   . MET A 1 82  ? 31.063  151.927 74.420  1.00 34.24  ? 148  MET A CB   1 
ATOM   1060  C CG   . MET A 1 82  ? 31.911  153.206 74.544  1.00 61.24  ? 148  MET A CG   1 
ATOM   1061  S SD   . MET A 1 82  ? 32.395  153.958 72.967  1.00 56.22  ? 148  MET A SD   1 
ATOM   1062  C CE   . MET A 1 82  ? 33.411  152.617 72.502  1.00 49.86  ? 148  MET A CE   1 
ATOM   1063  H H    . MET A 1 82  ? 29.011  153.018 75.245  1.00 57.38  ? 148  MET A H    1 
ATOM   1064  H HA   . MET A 1 82  ? 30.025  152.618 72.811  1.00 50.61  ? 148  MET A HA   1 
ATOM   1065  H HB2  . MET A 1 82  ? 30.840  151.623 75.313  1.00 41.09  ? 148  MET A HB2  1 
ATOM   1066  H HB3  . MET A 1 82  ? 31.591  151.257 73.958  1.00 41.09  ? 148  MET A HB3  1 
ATOM   1067  H HG2  . MET A 1 82  ? 31.403  153.867 75.040  1.00 73.48  ? 148  MET A HG2  1 
ATOM   1068  H HG3  . MET A 1 82  ? 32.724  152.991 75.028  1.00 73.48  ? 148  MET A HG3  1 
ATOM   1069  H HE1  . MET A 1 82  ? 33.803  152.805 71.634  1.00 59.83  ? 148  MET A HE1  1 
ATOM   1070  H HE2  . MET A 1 82  ? 34.110  152.507 73.164  1.00 59.83  ? 148  MET A HE2  1 
ATOM   1071  H HE3  . MET A 1 82  ? 32.870  151.813 72.454  1.00 59.83  ? 148  MET A HE3  1 
ATOM   1072  N N    . THR A 1 83  ? 27.970  150.604 74.041  1.00 40.01  ? 149  THR A N    1 
ATOM   1073  C CA   . THR A 1 83  ? 27.015  149.599 73.611  1.00 43.84  ? 149  THR A CA   1 
ATOM   1074  C C    . THR A 1 83  ? 26.233  150.131 72.398  1.00 49.75  ? 149  THR A C    1 
ATOM   1075  O O    . THR A 1 83  ? 25.994  149.408 71.431  1.00 47.65  ? 149  THR A O    1 
ATOM   1076  C CB   . THR A 1 83  ? 26.011  149.226 74.724  1.00 44.04  ? 149  THR A CB   1 
ATOM   1077  O OG1  . THR A 1 83  ? 26.706  148.913 75.934  1.00 40.19  ? 149  THR A OG1  1 
ATOM   1078  C CG2  . THR A 1 83  ? 25.171  148.024 74.304  1.00 22.37  ? 149  THR A CG2  1 
ATOM   1079  H H    . THR A 1 83  ? 27.782  150.973 74.795  1.00 48.02  ? 149  THR A H    1 
ATOM   1080  H HA   . THR A 1 83  ? 27.489  148.796 73.343  1.00 52.61  ? 149  THR A HA   1 
ATOM   1081  H HB   . THR A 1 83  ? 25.414  149.974 74.881  1.00 52.85  ? 149  THR A HB   1 
ATOM   1082  H HG1  . THR A 1 83  ? 27.156  149.576 76.186  1.00 48.23  ? 149  THR A HG1  1 
ATOM   1083  H HG21 . THR A 1 83  ? 24.543  147.796 75.008  1.00 26.84  ? 149  THR A HG21 1 
ATOM   1084  H HG22 . THR A 1 83  ? 24.676  148.231 73.496  1.00 26.84  ? 149  THR A HG22 1 
ATOM   1085  H HG23 . THR A 1 83  ? 25.745  147.261 74.135  1.00 26.84  ? 149  THR A HG23 1 
ATOM   1086  N N    . GLU A 1 84  ? 25.822  151.392 72.460  1.00 51.30  ? 150  GLU A N    1 
ATOM   1087  C CA   . GLU A 1 84  ? 25.040  151.981 71.378  1.00 55.87  ? 150  GLU A CA   1 
ATOM   1088  C C    . GLU A 1 84  ? 25.847  152.032 70.093  1.00 63.45  ? 150  GLU A C    1 
ATOM   1089  O O    . GLU A 1 84  ? 25.328  151.723 69.024  1.00 67.47  ? 150  GLU A O    1 
ATOM   1090  C CB   . GLU A 1 84  ? 24.558  153.398 71.730  1.00 73.44  ? 150  GLU A CB   1 
ATOM   1091  C CG   . GLU A 1 84  ? 23.730  154.063 70.604  1.00 95.03  ? 150  GLU A CG   1 
ATOM   1092  C CD   . GLU A 1 84  ? 23.422  155.549 70.841  1.00 107.89 ? 150  GLU A CD   1 
ATOM   1093  O OE1  . GLU A 1 84  ? 23.700  156.055 71.954  1.00 108.16 ? 150  GLU A OE1  1 
ATOM   1094  O OE2  . GLU A 1 84  ? 22.919  156.212 69.897  1.00 106.12 ? 150  GLU A OE2  1 
ATOM   1095  H H    . GLU A 1 84  ? 25.982  151.927 73.114  1.00 61.56  ? 150  GLU A H    1 
ATOM   1096  H HA   . GLU A 1 84  ? 24.258  151.429 71.219  1.00 67.04  ? 150  GLU A HA   1 
ATOM   1097  H HB2  . GLU A 1 84  ? 24.000  153.352 72.522  1.00 88.13  ? 150  GLU A HB2  1 
ATOM   1098  H HB3  . GLU A 1 84  ? 25.330  153.958 71.903  1.00 88.13  ? 150  GLU A HB3  1 
ATOM   1099  H HG2  . GLU A 1 84  ? 24.223  153.993 69.772  1.00 114.04 ? 150  GLU A HG2  1 
ATOM   1100  H HG3  . GLU A 1 84  ? 22.883  153.596 70.523  1.00 114.04 ? 150  GLU A HG3  1 
ATOM   1101  N N    . GLU A 1 85  ? 27.114  152.428 70.198  1.00 58.40  ? 151  GLU A N    1 
ATOM   1102  C CA   . GLU A 1 85  ? 27.926  152.712 69.021  1.00 48.69  ? 151  GLU A CA   1 
ATOM   1103  C C    . GLU A 1 85  ? 28.811  151.545 68.668  1.00 46.21  ? 151  GLU A C    1 
ATOM   1104  O O    . GLU A 1 85  ? 29.803  151.705 67.966  1.00 61.67  ? 151  GLU A O    1 
ATOM   1105  C CB   . GLU A 1 85  ? 28.784  153.949 69.261  1.00 63.68  ? 151  GLU A CB   1 
ATOM   1106  C CG   . GLU A 1 85  ? 27.991  155.248 69.357  1.00 76.46  ? 151  GLU A CG   1 
ATOM   1107  C CD   . GLU A 1 85  ? 27.675  155.871 67.998  1.00 96.59  ? 151  GLU A CD   1 
ATOM   1108  O OE1  . GLU A 1 85  ? 28.182  155.377 66.955  1.00 94.67  ? 151  GLU A OE1  1 
ATOM   1109  O OE2  . GLU A 1 85  ? 26.959  156.901 67.981  1.00 112.47 ? 151  GLU A OE2  1 
ATOM   1110  H H    . GLU A 1 85  ? 27.527  152.539 70.944  1.00 70.09  ? 151  GLU A H    1 
ATOM   1111  H HA   . GLU A 1 85  ? 27.343  152.890 68.266  1.00 58.43  ? 151  GLU A HA   1 
ATOM   1112  H HB2  . GLU A 1 85  ? 29.267  153.835 70.095  1.00 76.41  ? 151  GLU A HB2  1 
ATOM   1113  H HB3  . GLU A 1 85  ? 29.413  154.039 68.528  1.00 76.41  ? 151  GLU A HB3  1 
ATOM   1114  H HG2  . GLU A 1 85  ? 27.150  155.069 69.805  1.00 91.75  ? 151  GLU A HG2  1 
ATOM   1115  H HG3  . GLU A 1 85  ? 28.506  155.892 69.867  1.00 91.75  ? 151  GLU A HG3  1 
ATOM   1116  N N    . PHE A 1 86  ? 28.424  150.368 69.139  1.00 43.86  ? 152  PHE A N    1 
ATOM   1117  C CA   . PHE A 1 86  ? 29.167  149.131 68.914  1.00 45.57  ? 152  PHE A CA   1 
ATOM   1118  C C    . PHE A 1 86  ? 29.314  148.754 67.422  1.00 54.88  ? 152  PHE A C    1 
ATOM   1119  O O    . PHE A 1 86  ? 30.397  148.365 66.991  1.00 45.35  ? 152  PHE A O    1 
ATOM   1120  C CB   . PHE A 1 86  ? 28.468  148.016 69.691  1.00 36.86  ? 152  PHE A CB   1 
ATOM   1121  C CG   . PHE A 1 86  ? 29.337  146.844 70.001  1.00 39.74  ? 152  PHE A CG   1 
ATOM   1122  C CD1  . PHE A 1 86  ? 29.737  145.980 69.003  1.00 46.89  ? 152  PHE A CD1  1 
ATOM   1123  C CD2  . PHE A 1 86  ? 29.723  146.583 71.304  1.00 46.81  ? 152  PHE A CD2  1 
ATOM   1124  C CE1  . PHE A 1 86  ? 30.527  144.883 69.290  1.00 42.10  ? 152  PHE A CE1  1 
ATOM   1125  C CE2  . PHE A 1 86  ? 30.514  145.488 71.601  1.00 50.52  ? 152  PHE A CE2  1 
ATOM   1126  C CZ   . PHE A 1 86  ? 30.912  144.631 70.588  1.00 36.04  ? 152  PHE A CZ   1 
ATOM   1127  H H    . PHE A 1 86  ? 27.711  150.255 69.606  1.00 52.63  ? 152  PHE A H    1 
ATOM   1128  H HA   . PHE A 1 86  ? 30.059  149.233 69.281  1.00 54.69  ? 152  PHE A HA   1 
ATOM   1129  H HB2  . PHE A 1 86  ? 28.149  148.377 70.533  1.00 44.23  ? 152  PHE A HB2  1 
ATOM   1130  H HB3  . PHE A 1 86  ? 27.717  147.695 69.167  1.00 44.23  ? 152  PHE A HB3  1 
ATOM   1131  H HD1  . PHE A 1 86  ? 29.477  146.141 68.125  1.00 56.26  ? 152  PHE A HD1  1 
ATOM   1132  H HD2  . PHE A 1 86  ? 29.454  147.155 71.987  1.00 56.17  ? 152  PHE A HD2  1 
ATOM   1133  H HE1  . PHE A 1 86  ? 30.794  144.312 68.607  1.00 50.51  ? 152  PHE A HE1  1 
ATOM   1134  H HE2  . PHE A 1 86  ? 30.774  145.324 72.479  1.00 60.63  ? 152  PHE A HE2  1 
ATOM   1135  H HZ   . PHE A 1 86  ? 31.448  143.895 70.781  1.00 43.25  ? 152  PHE A HZ   1 
ATOM   1136  N N    . ASP A 1 87  ? 28.225  148.860 66.655  1.00 49.25  ? 153  ASP A N    1 
ATOM   1137  C CA   . ASP A 1 87  ? 28.227  148.595 65.206  1.00 54.31  ? 153  ASP A CA   1 
ATOM   1138  C C    . ASP A 1 87  ? 28.611  147.150 64.829  1.00 54.52  ? 153  ASP A C    1 
ATOM   1139  O O    . ASP A 1 87  ? 29.437  146.920 63.946  1.00 56.41  ? 153  ASP A O    1 
ATOM   1140  C CB   . ASP A 1 87  ? 29.127  149.610 64.479  1.00 70.26  ? 153  ASP A CB   1 
ATOM   1141  C CG   . ASP A 1 87  ? 28.495  150.151 63.187  1.00 92.60  ? 153  ASP A CG   1 
ATOM   1142  O OD1  . ASP A 1 87  ? 28.043  149.346 62.343  1.00 95.37  ? 153  ASP A OD1  1 
ATOM   1143  O OD2  . ASP A 1 87  ? 28.450  151.391 63.019  1.00 103.78 ? 153  ASP A OD2  1 
ATOM   1144  H H    . ASP A 1 87  ? 27.453  149.090 66.956  1.00 59.10  ? 153  ASP A H    1 
ATOM   1145  H HA   . ASP A 1 87  ? 27.325  148.737 64.880  1.00 65.18  ? 153  ASP A HA   1 
ATOM   1146  H HB2  . ASP A 1 87  ? 29.295  150.362 65.068  1.00 84.31  ? 153  ASP A HB2  1 
ATOM   1147  H HB3  . ASP A 1 87  ? 29.964  149.179 64.245  1.00 84.31  ? 153  ASP A HB3  1 
ATOM   1148  N N    . GLU A 1 88  ? 27.970  146.177 65.468  1.00 58.91  ? 154  GLU A N    1 
ATOM   1149  C CA   . GLU A 1 88  ? 28.286  144.766 65.232  1.00 58.91  ? 154  GLU A CA   1 
ATOM   1150  C C    . GLU A 1 88  ? 27.605  144.205 63.980  1.00 70.52  ? 154  GLU A C    1 
ATOM   1151  O O    . GLU A 1 88  ? 26.534  144.664 63.588  1.00 82.81  ? 154  GLU A O    1 
ATOM   1152  C CB   . GLU A 1 88  ? 27.917  143.918 66.459  1.00 49.49  ? 154  GLU A CB   1 
ATOM   1153  C CG   . GLU A 1 88  ? 26.433  143.595 66.644  1.00 51.77  ? 154  GLU A CG   1 
ATOM   1154  C CD   . GLU A 1 88  ? 25.588  144.791 67.084  1.00 52.92  ? 154  GLU A CD   1 
ATOM   1155  O OE1  . GLU A 1 88  ? 26.147  145.850 67.441  1.00 51.35  ? 154  GLU A OE1  1 
ATOM   1156  O OE2  . GLU A 1 88  ? 24.347  144.670 67.070  1.00 61.02  ? 154  GLU A OE2  1 
ATOM   1157  H H    . GLU A 1 88  ? 27.345  146.304 66.045  1.00 70.69  ? 154  GLU A H    1 
ATOM   1158  H HA   . GLU A 1 88  ? 29.244  144.686 65.101  1.00 70.69  ? 154  GLU A HA   1 
ATOM   1159  H HB2  . GLU A 1 88  ? 28.389  143.073 66.397  1.00 59.38  ? 154  GLU A HB2  1 
ATOM   1160  H HB3  . GLU A 1 88  ? 28.209  144.391 67.254  1.00 59.38  ? 154  GLU A HB3  1 
ATOM   1161  H HG2  . GLU A 1 88  ? 26.076  143.274 65.802  1.00 62.13  ? 154  GLU A HG2  1 
ATOM   1162  H HG3  . GLU A 1 88  ? 26.345  142.906 67.322  1.00 62.13  ? 154  GLU A HG3  1 
ATOM   1163  N N    . ASP A 1 89  ? 28.241  143.213 63.358  1.00 84.39  ? 155  ASP A N    1 
ATOM   1164  C CA   . ASP A 1 89  ? 27.632  142.455 62.263  1.00 78.97  ? 155  ASP A CA   1 
ATOM   1165  C C    . ASP A 1 89  ? 26.902  141.244 62.843  1.00 64.48  ? 155  ASP A C    1 
ATOM   1166  O O    . ASP A 1 89  ? 25.691  141.130 62.718  1.00 68.53  ? 155  ASP A O    1 
ATOM   1167  C CB   . ASP A 1 89  ? 28.696  142.005 61.250  1.00 86.15  ? 155  ASP A CB   1 
ATOM   1168  C CG   . ASP A 1 89  ? 29.288  143.163 60.460  1.00 93.34  ? 155  ASP A CG   1 
ATOM   1169  O OD1  . ASP A 1 89  ? 28.702  144.271 60.471  1.00 95.71  ? 155  ASP A OD1  1 
ATOM   1170  O OD2  . ASP A 1 89  ? 30.346  142.957 59.825  1.00 92.28  ? 155  ASP A OD2  1 
ATOM   1171  H H    . ASP A 1 89  ? 29.037  142.956 63.555  1.00 101.27 ? 155  ASP A H    1 
ATOM   1172  H HA   . ASP A 1 89  ? 26.985  143.013 61.804  1.00 94.77  ? 155  ASP A HA   1 
ATOM   1173  H HB2  . ASP A 1 89  ? 29.418  141.566 61.725  1.00 103.38 ? 155  ASP A HB2  1 
ATOM   1174  H HB3  . ASP A 1 89  ? 28.291  141.389 60.620  1.00 103.38 ? 155  ASP A HB3  1 
ATOM   1175  N N    . SER A 1 90  ? 27.655  140.355 63.487  1.00 58.12  ? 156  SER A N    1 
ATOM   1176  C CA   . SER A 1 90  ? 27.099  139.180 64.145  1.00 51.13  ? 156  SER A CA   1 
ATOM   1177  C C    . SER A 1 90  ? 27.169  139.323 65.669  1.00 51.30  ? 156  SER A C    1 
ATOM   1178  O O    . SER A 1 90  ? 27.290  140.428 66.185  1.00 54.80  ? 156  SER A O    1 
ATOM   1179  C CB   . SER A 1 90  ? 27.886  137.949 63.718  1.00 53.62  ? 156  SER A CB   1 
ATOM   1180  O OG   . SER A 1 90  ? 29.238  138.071 64.109  1.00 59.32  ? 156  SER A OG   1 
ATOM   1181  H H    . SER A 1 90  ? 28.510  140.413 63.557  1.00 69.74  ? 156  SER A H    1 
ATOM   1182  H HA   . SER A 1 90  ? 26.172  139.064 63.885  1.00 61.36  ? 156  SER A HA   1 
ATOM   1183  H HB2  . SER A 1 90  ? 27.503  137.164 64.141  1.00 64.34  ? 156  SER A HB2  1 
ATOM   1184  H HB3  . SER A 1 90  ? 27.841  137.862 62.753  1.00 64.34  ? 156  SER A HB3  1 
ATOM   1185  H HG   . SER A 1 90  ? 29.669  137.390 63.872  1.00 71.18  ? 156  SER A HG   1 
ATOM   1186  N N    . GLY A 1 91  ? 27.080  138.201 66.378  1.00 47.97  ? 157  GLY A N    1 
ATOM   1187  C CA   . GLY A 1 91  ? 27.315  138.152 67.814  1.00 48.26  ? 157  GLY A CA   1 
ATOM   1188  C C    . GLY A 1 91  ? 28.731  137.665 68.103  1.00 59.31  ? 157  GLY A C    1 
ATOM   1189  O O    . GLY A 1 91  ? 29.047  137.194 69.206  1.00 49.09  ? 157  GLY A O    1 
ATOM   1190  H H    . GLY A 1 91  ? 26.878  137.437 66.039  1.00 57.57  ? 157  GLY A H    1 
ATOM   1191  H HA2  . GLY A 1 91  ? 27.202  139.035 68.197  1.00 57.91  ? 157  GLY A HA2  1 
ATOM   1192  H HA3  . GLY A 1 91  ? 26.683  137.545 68.231  1.00 57.91  ? 157  GLY A HA3  1 
ATOM   1193  N N    . ASP A 1 92  ? 29.590  137.763 67.092  1.00 48.65  ? 158  ASP A N    1 
ATOM   1194  C CA   . ASP A 1 92  ? 30.988  137.409 67.254  1.00 46.78  ? 158  ASP A CA   1 
ATOM   1195  C C    . ASP A 1 92  ? 31.759  138.486 67.985  1.00 53.73  ? 158  ASP A C    1 
ATOM   1196  O O    . ASP A 1 92  ? 31.450  139.674 67.890  1.00 51.18  ? 158  ASP A O    1 
ATOM   1197  C CB   . ASP A 1 92  ? 31.655  137.180 65.903  1.00 50.28  ? 158  ASP A CB   1 
ATOM   1198  C CG   . ASP A 1 92  ? 31.345  135.823 65.335  1.00 65.90  ? 158  ASP A CG   1 
ATOM   1199  O OD1  . ASP A 1 92  ? 30.845  134.963 66.105  1.00 50.71  ? 158  ASP A OD1  1 
ATOM   1200  O OD2  . ASP A 1 92  ? 31.609  135.618 64.124  1.00 68.06  ? 158  ASP A OD2  1 
ATOM   1201  H H    . ASP A 1 92  ? 29.383  138.033 66.302  1.00 58.38  ? 158  ASP A H    1 
ATOM   1202  H HA   . ASP A 1 92  ? 31.051  136.588 67.767  1.00 56.14  ? 158  ASP A HA   1 
ATOM   1203  H HB2  . ASP A 1 92  ? 31.338  137.848 65.276  1.00 60.34  ? 158  ASP A HB2  1 
ATOM   1204  H HB3  . ASP A 1 92  ? 32.616  137.250 66.008  1.00 60.34  ? 158  ASP A HB3  1 
ATOM   1205  N N    . TYR A 1 93  ? 32.765  138.045 68.731  1.00 57.45  ? 159  TYR A N    1 
ATOM   1206  C CA   . TYR A 1 93  ? 33.728  138.936 69.342  1.00 34.62  ? 159  TYR A CA   1 
ATOM   1207  C C    . TYR A 1 93  ? 35.037  138.181 69.487  1.00 39.76  ? 159  TYR A C    1 
ATOM   1208  O O    . TYR A 1 93  ? 35.026  136.957 69.615  1.00 40.38  ? 159  TYR A O    1 
ATOM   1209  C CB   . TYR A 1 93  ? 33.227  139.496 70.681  1.00 28.82  ? 159  TYR A CB   1 
ATOM   1210  C CG   . TYR A 1 93  ? 32.838  138.502 71.766  1.00 32.08  ? 159  TYR A CG   1 
ATOM   1211  C CD1  . TYR A 1 93  ? 31.535  138.065 71.887  1.00 33.54  ? 159  TYR A CD1  1 
ATOM   1212  C CD2  . TYR A 1 93  ? 33.757  138.058 72.702  1.00 32.05  ? 159  TYR A CD2  1 
ATOM   1213  C CE1  . TYR A 1 93  ? 31.157  137.201 72.880  1.00 32.83  ? 159  TYR A CE1  1 
ATOM   1214  C CE2  . TYR A 1 93  ? 33.385  137.191 73.710  1.00 36.70  ? 159  TYR A CE2  1 
ATOM   1215  C CZ   . TYR A 1 93  ? 32.074  136.761 73.793  1.00 41.79  ? 159  TYR A CZ   1 
ATOM   1216  O OH   . TYR A 1 93  ? 31.653  135.882 74.778  1.00 30.00  ? 159  TYR A OH   1 
ATOM   1217  H H    . TYR A 1 93  ? 32.909  137.214 68.899  1.00 68.94  ? 159  TYR A H    1 
ATOM   1218  H HA   . TYR A 1 93  ? 33.882  139.685 68.746  1.00 41.54  ? 159  TYR A HA   1 
ATOM   1219  H HB2  . TYR A 1 93  ? 33.926  140.058 71.050  1.00 34.58  ? 159  TYR A HB2  1 
ATOM   1220  H HB3  . TYR A 1 93  ? 32.444  140.041 70.502  1.00 34.58  ? 159  TYR A HB3  1 
ATOM   1221  H HD1  . TYR A 1 93  ? 30.898  138.360 71.276  1.00 40.25  ? 159  TYR A HD1  1 
ATOM   1222  H HD2  . TYR A 1 93  ? 34.639  138.350 72.652  1.00 38.46  ? 159  TYR A HD2  1 
ATOM   1223  H HE1  . TYR A 1 93  ? 30.275  136.913 72.933  1.00 39.40  ? 159  TYR A HE1  1 
ATOM   1224  H HE2  . TYR A 1 93  ? 34.015  136.891 74.325  1.00 44.04  ? 159  TYR A HE2  1 
ATOM   1225  H HH   . TYR A 1 93  ? 30.835  135.718 74.686  1.00 36.01  ? 159  TYR A HH   1 
ATOM   1226  N N    . PRO A 1 94  ? 36.169  138.912 69.464  1.00 50.31  ? 160  PRO A N    1 
ATOM   1227  C CA   . PRO A 1 94  ? 37.515  138.335 69.416  1.00 51.09  ? 160  PRO A CA   1 
ATOM   1228  C C    . PRO A 1 94  ? 37.789  137.080 70.275  1.00 42.12  ? 160  PRO A C    1 
ATOM   1229  O O    . PRO A 1 94  ? 38.419  136.172 69.754  1.00 49.16  ? 160  PRO A O    1 
ATOM   1230  C CB   . PRO A 1 94  ? 38.383  139.517 69.836  1.00 37.08  ? 160  PRO A CB   1 
ATOM   1231  C CG   . PRO A 1 94  ? 37.682  140.662 69.255  1.00 23.89  ? 160  PRO A CG   1 
ATOM   1232  C CD   . PRO A 1 94  ? 36.236  140.386 69.463  1.00 24.09  ? 160  PRO A CD   1 
ATOM   1233  H HA   . PRO A 1 94  ? 37.731  138.117 68.496  1.00 61.30  ? 160  PRO A HA   1 
ATOM   1234  H HB2  . PRO A 1 94  ? 38.415  139.580 70.803  1.00 44.49  ? 160  PRO A HB2  1 
ATOM   1235  H HB3  . PRO A 1 94  ? 39.274  139.426 69.461  1.00 44.49  ? 160  PRO A HB3  1 
ATOM   1236  H HG2  . PRO A 1 94  ? 37.946  141.473 69.717  1.00 28.67  ? 160  PRO A HG2  1 
ATOM   1237  H HG3  . PRO A 1 94  ? 37.887  140.723 68.309  1.00 28.67  ? 160  PRO A HG3  1 
ATOM   1238  H HD2  . PRO A 1 94  ? 35.944  140.739 70.317  1.00 28.90  ? 160  PRO A HD2  1 
ATOM   1239  H HD3  . PRO A 1 94  ? 35.714  140.748 68.730  1.00 28.90  ? 160  PRO A HD3  1 
ATOM   1240  N N    . LEU A 1 95  ? 37.346  137.010 71.527  1.00 42.17  ? 161  LEU A N    1 
ATOM   1241  C CA   . LEU A 1 95  ? 37.674  135.847 72.366  1.00 38.89  ? 161  LEU A CA   1 
ATOM   1242  C C    . LEU A 1 95  ? 36.835  134.596 72.086  1.00 37.61  ? 161  LEU A C    1 
ATOM   1243  O O    . LEU A 1 95  ? 36.976  133.578 72.770  1.00 46.34  ? 161  LEU A O    1 
ATOM   1244  C CB   . LEU A 1 95  ? 37.562  136.203 73.837  1.00 20.13  ? 161  LEU A CB   1 
ATOM   1245  C CG   . LEU A 1 95  ? 38.490  137.323 74.265  1.00 42.04  ? 161  LEU A CG   1 
ATOM   1246  C CD1  . LEU A 1 95  ? 38.096  137.799 75.652  1.00 59.78  ? 161  LEU A CD1  1 
ATOM   1247  C CD2  . LEU A 1 95  ? 39.951  136.854 74.229  1.00 46.66  ? 161  LEU A CD2  1 
ATOM   1248  H H    . LEU A 1 95  ? 36.863  137.608 71.914  1.00 50.60  ? 161  LEU A H    1 
ATOM   1249  H HA   . LEU A 1 95  ? 38.600  135.611 72.199  1.00 46.67  ? 161  LEU A HA   1 
ATOM   1250  H HB2  . LEU A 1 95  ? 36.652  136.484 74.023  1.00 24.16  ? 161  LEU A HB2  1 
ATOM   1251  H HB3  . LEU A 1 95  ? 37.779  135.419 74.366  1.00 24.16  ? 161  LEU A HB3  1 
ATOM   1252  H HG   . LEU A 1 95  ? 38.396  138.068 73.651  1.00 50.45  ? 161  LEU A HG   1 
ATOM   1253  H HD11 . LEU A 1 95  ? 38.693  138.515 75.921  1.00 71.74  ? 161  LEU A HD11 1 
ATOM   1254  H HD12 . LEU A 1 95  ? 37.182  138.122 75.627  1.00 71.74  ? 161  LEU A HD12 1 
ATOM   1255  H HD13 . LEU A 1 95  ? 38.169  137.057 76.273  1.00 71.74  ? 161  LEU A HD13 1 
ATOM   1256  H HD21 . LEU A 1 95  ? 40.525  137.586 74.506  1.00 56.00  ? 161  LEU A HD21 1 
ATOM   1257  H HD22 . LEU A 1 95  ? 40.056  136.103 74.834  1.00 56.00  ? 161  LEU A HD22 1 
ATOM   1258  H HD23 . LEU A 1 95  ? 40.173  136.583 73.324  1.00 56.00  ? 161  LEU A HD23 1 
ATOM   1259  N N    . THR A 1 96  ? 35.970  134.667 71.083  1.00 42.37  ? 162  THR A N    1 
ATOM   1260  C CA   . THR A 1 96  ? 35.122  133.532 70.734  1.00 54.51  ? 162  THR A CA   1 
ATOM   1261  C C    . THR A 1 96  ? 35.304  133.130 69.277  1.00 62.25  ? 162  THR A C    1 
ATOM   1262  O O    . THR A 1 96  ? 34.676  132.181 68.803  1.00 72.44  ? 162  THR A O    1 
ATOM   1263  C CB   . THR A 1 96  ? 33.637  133.837 71.005  1.00 39.96  ? 162  THR A CB   1 
ATOM   1264  O OG1  . THR A 1 96  ? 33.272  135.078 70.390  1.00 50.31  ? 162  THR A OG1  1 
ATOM   1265  C CG2  . THR A 1 96  ? 33.390  133.918 72.494  1.00 52.00  ? 162  THR A CG2  1 
ATOM   1266  H H    . THR A 1 96  ? 35.854  135.360 70.587  1.00 50.85  ? 162  THR A H    1 
ATOM   1267  H HA   . THR A 1 96  ? 35.374  132.774 71.284  1.00 65.42  ? 162  THR A HA   1 
ATOM   1268  H HB   . THR A 1 96  ? 33.089  133.123 70.641  1.00 47.96  ? 162  THR A HB   1 
ATOM   1269  H HG1  . THR A 1 96  ? 33.740  135.702 70.703  1.00 60.37  ? 162  THR A HG1  1 
ATOM   1270  H HG21 . THR A 1 96  ? 32.454  134.110 72.665  1.00 62.40  ? 162  THR A HG21 1 
ATOM   1271  H HG22 . THR A 1 96  ? 33.620  133.075 72.915  1.00 62.40  ? 162  THR A HG22 1 
ATOM   1272  H HG23 . THR A 1 96  ? 33.932  134.623 72.882  1.00 62.40  ? 162  THR A HG23 1 
ATOM   1273  N N    . MET A 1 97  ? 36.170  133.849 68.575  1.00 51.17  ? 163  MET A N    1 
ATOM   1274  C CA   . MET A 1 97  ? 36.447  133.534 67.192  1.00 55.67  ? 163  MET A CA   1 
ATOM   1275  C C    . MET A 1 97  ? 37.368  132.323 67.192  1.00 63.79  ? 163  MET A C    1 
ATOM   1276  O O    . MET A 1 97  ? 38.001  132.034 68.209  1.00 74.09  ? 163  MET A O    1 
ATOM   1277  C CB   . MET A 1 97  ? 37.094  134.727 66.516  1.00 40.01  ? 163  MET A CB   1 
ATOM   1278  C CG   . MET A 1 97  ? 36.268  135.978 66.600  1.00 47.25  ? 163  MET A CG   1 
ATOM   1279  S SD   . MET A 1 97  ? 35.320  136.291 65.118  1.00 67.75  ? 163  MET A SD   1 
ATOM   1280  C CE   . MET A 1 97  ? 35.448  138.102 65.072  1.00 68.39  ? 163  MET A CE   1 
ATOM   1281  H H    . MET A 1 97  ? 36.607  134.523 68.881  1.00 61.40  ? 163  MET A H    1 
ATOM   1282  H HA   . MET A 1 97  ? 35.621  133.322 66.730  1.00 66.81  ? 163  MET A HA   1 
ATOM   1283  H HB2  . MET A 1 97  ? 37.948  134.905 66.941  1.00 48.01  ? 163  MET A HB2  1 
ATOM   1284  H HB3  . MET A 1 97  ? 37.229  134.521 65.578  1.00 48.01  ? 163  MET A HB3  1 
ATOM   1285  H HG2  . MET A 1 97  ? 35.647  135.896 67.340  1.00 56.70  ? 163  MET A HG2  1 
ATOM   1286  H HG3  . MET A 1 97  ? 36.857  136.735 66.743  1.00 56.70  ? 163  MET A HG3  1 
ATOM   1287  H HE1  . MET A 1 97  ? 34.967  138.432 64.297  1.00 82.06  ? 163  MET A HE1  1 
ATOM   1288  H HE2  . MET A 1 97  ? 35.061  138.467 65.883  1.00 82.06  ? 163  MET A HE2  1 
ATOM   1289  H HE3  . MET A 1 97  ? 36.384  138.350 65.011  1.00 82.06  ? 163  MET A HE3  1 
ATOM   1290  N N    . ALA A 1 98  ? 37.407  131.602 66.070  1.00 65.03  ? 164  ALA A N    1 
ATOM   1291  C CA   . ALA A 1 98  ? 38.305  130.464 65.897  1.00 62.70  ? 164  ALA A CA   1 
ATOM   1292  C C    . ALA A 1 98  ? 39.477  130.806 64.946  1.00 67.72  ? 164  ALA A C    1 
ATOM   1293  O O    . ALA A 1 98  ? 39.459  131.810 64.220  1.00 58.03  ? 164  ALA A O    1 
ATOM   1294  C CB   . ALA A 1 98  ? 37.528  129.268 65.384  1.00 45.84  ? 164  ALA A CB   1 
ATOM   1295  H H    . ALA A 1 98  ? 36.913  131.758 65.383  1.00 78.03  ? 164  ALA A H    1 
ATOM   1296  H HA   . ALA A 1 98  ? 38.681  130.227 66.759  1.00 75.24  ? 164  ALA A HA   1 
ATOM   1297  H HB1  . ALA A 1 98  ? 38.136  128.520 65.274  1.00 55.01  ? 164  ALA A HB1  1 
ATOM   1298  H HB2  . ALA A 1 98  ? 36.837  129.041 66.027  1.00 55.01  ? 164  ALA A HB2  1 
ATOM   1299  H HB3  . ALA A 1 98  ? 37.125  129.495 64.532  1.00 55.01  ? 164  ALA A HB3  1 
ATOM   1300  N N    . GLY A 1 99  ? 40.503  129.966 64.975  1.00 60.62  ? 165  GLY A N    1 
ATOM   1301  C CA   . GLY A 1 99  ? 41.664  130.141 64.122  1.00 67.11  ? 165  GLY A CA   1 
ATOM   1302  C C    . GLY A 1 99  ? 42.943  130.362 64.908  1.00 78.79  ? 165  GLY A C    1 
ATOM   1303  O O    . GLY A 1 99  ? 42.911  130.649 66.101  1.00 84.21  ? 165  GLY A O    1 
ATOM   1304  H H    . GLY A 1 99  ? 40.550  129.278 65.488  1.00 72.75  ? 165  GLY A H    1 
ATOM   1305  H HA2  . GLY A 1 99  ? 41.777  129.354 63.567  1.00 80.53  ? 165  GLY A HA2  1 
ATOM   1306  H HA3  . GLY A 1 99  ? 41.525  130.907 63.542  1.00 80.53  ? 165  GLY A HA3  1 
ATOM   1307  N N    . PRO A 1 100 ? 44.094  130.197 64.249  1.00 84.38  ? 166  PRO A N    1 
ATOM   1308  C CA   . PRO A 1 100 ? 45.345  130.456 64.966  1.00 85.82  ? 166  PRO A CA   1 
ATOM   1309  C C    . PRO A 1 100 ? 45.590  131.944 65.172  1.00 82.10  ? 166  PRO A C    1 
ATOM   1310  O O    . PRO A 1 100 ? 46.258  132.303 66.141  1.00 79.00  ? 166  PRO A O    1 
ATOM   1311  C CB   . PRO A 1 100 ? 46.419  129.868 64.035  1.00 88.27  ? 166  PRO A CB   1 
ATOM   1312  C CG   . PRO A 1 100 ? 45.675  128.956 63.106  1.00 92.47  ? 166  PRO A CG   1 
ATOM   1313  C CD   . PRO A 1 100 ? 44.336  129.591 62.930  1.00 92.92  ? 166  PRO A CD   1 
ATOM   1314  H HA   . PRO A 1 100 ? 45.358  129.995 65.819  1.00 102.99 ? 166  PRO A HA   1 
ATOM   1315  H HB2  . PRO A 1 100 ? 46.851  130.582 63.541  1.00 105.93 ? 166  PRO A HB2  1 
ATOM   1316  H HB3  . PRO A 1 100 ? 47.068  129.371 64.557  1.00 105.93 ? 166  PRO A HB3  1 
ATOM   1317  H HG2  . PRO A 1 100 ? 46.143  128.900 62.258  1.00 110.96 ? 166  PRO A HG2  1 
ATOM   1318  H HG3  . PRO A 1 100 ? 45.589  128.078 63.509  1.00 110.96 ? 166  PRO A HG3  1 
ATOM   1319  H HD2  . PRO A 1 100 ? 44.371  130.274 62.242  1.00 111.50 ? 166  PRO A HD2  1 
ATOM   1320  H HD3  . PRO A 1 100 ? 43.664  128.919 62.735  1.00 111.50 ? 166  PRO A HD3  1 
ATOM   1321  N N    . GLN A 1 101 ? 45.066  132.789 64.287  1.00 74.58  ? 167  GLN A N    1 
ATOM   1322  C CA   . GLN A 1 101 ? 45.383  134.216 64.339  1.00 67.77  ? 167  GLN A CA   1 
ATOM   1323  C C    . GLN A 1 101 ? 44.596  134.923 65.449  1.00 80.34  ? 167  GLN A C    1 
ATOM   1324  O O    . GLN A 1 101 ? 44.952  136.031 65.857  1.00 88.52  ? 167  GLN A O    1 
ATOM   1325  C CB   . GLN A 1 101 ? 45.195  134.906 62.970  1.00 66.29  ? 167  GLN A CB   1 
ATOM   1326  C CG   . GLN A 1 101 ? 43.756  135.234 62.565  1.00 85.42  ? 167  GLN A CG   1 
ATOM   1327  C CD   . GLN A 1 101 ? 42.932  133.998 62.207  1.00 92.09  ? 167  GLN A CD   1 
ATOM   1328  O OE1  . GLN A 1 101 ? 43.170  132.897 62.720  1.00 98.79  ? 167  GLN A OE1  1 
ATOM   1329  N NE2  . GLN A 1 101 ? 41.945  134.183 61.331  1.00 70.24  ? 167  GLN A NE2  1 
ATOM   1330  H H    . GLN A 1 101 ? 44.530  132.566 63.652  1.00 89.50  ? 167  GLN A H    1 
ATOM   1331  H HA   . GLN A 1 101 ? 46.322  134.301 64.566  1.00 81.32  ? 167  GLN A HA   1 
ATOM   1332  H HB2  . GLN A 1 101 ? 45.688  135.742 62.980  1.00 79.54  ? 167  GLN A HB2  1 
ATOM   1333  H HB3  . GLN A 1 101 ? 45.562  134.326 62.284  1.00 79.54  ? 167  GLN A HB3  1 
ATOM   1334  H HG2  . GLN A 1 101 ? 43.316  135.681 63.305  1.00 102.51 ? 167  GLN A HG2  1 
ATOM   1335  H HG3  . GLN A 1 101 ? 43.773  135.816 61.790  1.00 102.51 ? 167  GLN A HG3  1 
ATOM   1336  H HE21 . GLN A 1 101 ? 41.803  134.964 61.002  1.00 84.28  ? 167  GLN A HE21 1 
ATOM   1337  H HE22 . GLN A 1 101 ? 41.450  133.520 61.094  1.00 84.28  ? 167  GLN A HE22 1 
ATOM   1338  N N    . TRP A 1 102 ? 43.541  134.277 65.946  1.00 73.34  ? 168  TRP A N    1 
ATOM   1339  C CA   . TRP A 1 102 ? 42.828  134.775 67.119  1.00 52.45  ? 168  TRP A CA   1 
ATOM   1340  C C    . TRP A 1 102 ? 43.399  134.141 68.384  1.00 47.12  ? 168  TRP A C    1 
ATOM   1341  O O    . TRP A 1 102 ? 43.445  134.773 69.428  1.00 65.89  ? 168  TRP A O    1 
ATOM   1342  C CB   . TRP A 1 102 ? 41.323  134.520 67.017  1.00 53.60  ? 168  TRP A CB   1 
ATOM   1343  C CG   . TRP A 1 102 ? 40.634  135.358 65.976  1.00 56.99  ? 168  TRP A CG   1 
ATOM   1344  C CD1  . TRP A 1 102 ? 40.075  134.919 64.808  1.00 54.65  ? 168  TRP A CD1  1 
ATOM   1345  C CD2  . TRP A 1 102 ? 40.430  136.779 66.006  1.00 57.91  ? 168  TRP A CD2  1 
ATOM   1346  N NE1  . TRP A 1 102 ? 39.539  135.978 64.110  1.00 52.73  ? 168  TRP A NE1  1 
ATOM   1347  C CE2  . TRP A 1 102 ? 39.739  137.129 64.824  1.00 52.76  ? 168  TRP A CE2  1 
ATOM   1348  C CE3  . TRP A 1 102 ? 40.764  137.789 66.916  1.00 59.72  ? 168  TRP A CE3  1 
ATOM   1349  C CZ2  . TRP A 1 102 ? 39.370  138.442 64.530  1.00 48.29  ? 168  TRP A CZ2  1 
ATOM   1350  C CZ3  . TRP A 1 102 ? 40.405  139.103 66.616  1.00 60.68  ? 168  TRP A CZ3  1 
ATOM   1351  C CH2  . TRP A 1 102 ? 39.715  139.414 65.433  1.00 56.81  ? 168  TRP A CH2  1 
ATOM   1352  H H    . TRP A 1 102 ? 43.220  133.549 65.621  1.00 88.01  ? 168  TRP A H    1 
ATOM   1353  H HA   . TRP A 1 102 ? 42.962  135.734 67.183  1.00 62.95  ? 168  TRP A HA   1 
ATOM   1354  H HB2  . TRP A 1 102 ? 41.179  133.588 66.789  1.00 64.32  ? 168  TRP A HB2  1 
ATOM   1355  H HB3  . TRP A 1 102 ? 40.914  134.716 67.874  1.00 64.32  ? 168  TRP A HB3  1 
ATOM   1356  H HD1  . TRP A 1 102 ? 40.059  134.033 64.526  1.00 65.58  ? 168  TRP A HD1  1 
ATOM   1357  H HE1  . TRP A 1 102 ? 39.135  135.923 63.353  1.00 63.28  ? 168  TRP A HE1  1 
ATOM   1358  H HE3  . TRP A 1 102 ? 41.219  137.589 67.702  1.00 71.66  ? 168  TRP A HE3  1 
ATOM   1359  H HZ2  . TRP A 1 102 ? 38.921  138.652 63.743  1.00 57.94  ? 168  TRP A HZ2  1 
ATOM   1360  H HZ3  . TRP A 1 102 ? 40.617  139.783 67.214  1.00 72.81  ? 168  TRP A HZ3  1 
ATOM   1361  H HH2  . TRP A 1 102 ? 39.484  140.298 65.260  1.00 68.18  ? 168  TRP A HH2  1 
ATOM   1362  N N    . LYS A 1 103 ? 43.841  132.894 68.304  1.00 57.42  ? 169  LYS A N    1 
ATOM   1363  C CA   . LYS A 1 103 ? 44.514  132.290 69.446  1.00 61.30  ? 169  LYS A CA   1 
ATOM   1364  C C    . LYS A 1 103 ? 45.776  133.110 69.744  1.00 64.09  ? 169  LYS A C    1 
ATOM   1365  O O    . LYS A 1 103 ? 46.084  133.400 70.902  1.00 59.07  ? 169  LYS A O    1 
ATOM   1366  C CB   . LYS A 1 103 ? 44.847  130.814 69.186  1.00 57.14  ? 169  LYS A CB   1 
ATOM   1367  C CG   . LYS A 1 103 ? 45.414  130.089 70.404  1.00 70.41  ? 169  LYS A CG   1 
ATOM   1368  C CD   . LYS A 1 103 ? 45.447  128.567 70.219  1.00 82.31  ? 169  LYS A CD   1 
ATOM   1369  C CE   . LYS A 1 103 ? 45.311  127.835 71.560  1.00 81.73  ? 169  LYS A CE   1 
ATOM   1370  N NZ   . LYS A 1 103 ? 45.423  126.350 71.441  1.00 75.96  ? 169  LYS A NZ   1 
ATOM   1371  H H    . LYS A 1 103 ? 43.766  132.384 67.615  1.00 68.91  ? 169  LYS A H    1 
ATOM   1372  H HA   . LYS A 1 103 ? 43.932  132.337 70.221  1.00 73.56  ? 169  LYS A HA   1 
ATOM   1373  H HB2  . LYS A 1 103 ? 44.037  130.353 68.917  1.00 68.57  ? 169  LYS A HB2  1 
ATOM   1374  H HB3  . LYS A 1 103 ? 45.506  130.762 68.477  1.00 68.57  ? 169  LYS A HB3  1 
ATOM   1375  H HG2  . LYS A 1 103 ? 46.322  130.393 70.560  1.00 84.49  ? 169  LYS A HG2  1 
ATOM   1376  H HG3  . LYS A 1 103 ? 44.860  130.286 71.176  1.00 84.49  ? 169  LYS A HG3  1 
ATOM   1377  H HD2  . LYS A 1 103 ? 44.709  128.298 69.650  1.00 98.78  ? 169  LYS A HD2  1 
ATOM   1378  H HD3  . LYS A 1 103 ? 46.292  128.312 69.817  1.00 98.78  ? 169  LYS A HD3  1 
ATOM   1379  H HE2  . LYS A 1 103 ? 46.014  128.139 72.156  1.00 98.08  ? 169  LYS A HE2  1 
ATOM   1380  H HE3  . LYS A 1 103 ? 44.443  128.038 71.942  1.00 98.08  ? 169  LYS A HE3  1 
ATOM   1381  H HZ1  . LYS A 1 103 ? 45.338  125.974 72.243  1.00 91.15  ? 169  LYS A HZ1  1 
ATOM   1382  H HZ2  . LYS A 1 103 ? 44.783  126.039 70.906  1.00 91.15  ? 169  LYS A HZ2  1 
ATOM   1383  H HZ3  . LYS A 1 103 ? 46.216  126.131 71.101  1.00 91.15  ? 169  LYS A HZ3  1 
ATOM   1384  N N    . LYS A 1 104 ? 46.492  133.496 68.689  1.00 63.97  ? 170  LYS A N    1 
ATOM   1385  C CA   . LYS A 1 104 ? 47.665  134.346 68.838  1.00 50.03  ? 170  LYS A CA   1 
ATOM   1386  C C    . LYS A 1 104 ? 47.231  135.654 69.460  1.00 59.49  ? 170  LYS A C    1 
ATOM   1387  O O    . LYS A 1 104 ? 47.946  136.225 70.272  1.00 71.72  ? 170  LYS A O    1 
ATOM   1388  C CB   . LYS A 1 104 ? 48.352  134.593 67.492  1.00 60.56  ? 170  LYS A CB   1 
ATOM   1389  C CG   . LYS A 1 104 ? 49.197  133.404 67.021  1.00 98.71  ? 170  LYS A CG   1 
ATOM   1390  C CD   . LYS A 1 104 ? 49.537  133.453 65.521  1.00 101.96 ? 170  LYS A CD   1 
ATOM   1391  C CE   . LYS A 1 104 ? 49.979  132.079 64.993  1.00 89.07  ? 170  LYS A CE   1 
ATOM   1392  N NZ   . LYS A 1 104 ? 51.337  131.675 65.470  1.00 90.17  ? 170  LYS A NZ   1 
ATOM   1393  H H    . LYS A 1 104 ? 46.317  133.277 67.876  1.00 76.77  ? 170  LYS A H    1 
ATOM   1394  H HA   . LYS A 1 104 ? 48.300  133.919 69.434  1.00 60.04  ? 170  LYS A HA   1 
ATOM   1395  H HB2  . LYS A 1 104 ? 47.675  134.763 66.819  1.00 72.67  ? 170  LYS A HB2  1 
ATOM   1396  H HB3  . LYS A 1 104 ? 48.938  135.362 67.574  1.00 72.67  ? 170  LYS A HB3  1 
ATOM   1397  H HG2  . LYS A 1 104 ? 50.032  133.396 67.516  1.00 118.45 ? 170  LYS A HG2  1 
ATOM   1398  H HG3  . LYS A 1 104 ? 48.706  132.584 67.189  1.00 118.45 ? 170  LYS A HG3  1 
ATOM   1399  H HD2  . LYS A 1 104 ? 48.751  133.730 65.024  1.00 122.35 ? 170  LYS A HD2  1 
ATOM   1400  H HD3  . LYS A 1 104 ? 50.263  134.081 65.378  1.00 122.35 ? 170  LYS A HD3  1 
ATOM   1401  H HE2  . LYS A 1 104 ? 49.346  131.408 65.291  1.00 106.88 ? 170  LYS A HE2  1 
ATOM   1402  H HE3  . LYS A 1 104 ? 50.000  132.107 64.023  1.00 106.88 ? 170  LYS A HE3  1 
ATOM   1403  H HZ1  . LYS A 1 104 ? 51.550  130.876 65.140  1.00 108.21 ? 170  LYS A HZ1  1 
ATOM   1404  H HZ2  . LYS A 1 104 ? 51.943  132.269 65.202  1.00 108.21 ? 170  LYS A HZ2  1 
ATOM   1405  H HZ3  . LYS A 1 104 ? 51.346  131.632 66.359  1.00 108.21 ? 170  LYS A HZ3  1 
ATOM   1406  N N    . PHE A 1 105 ? 46.045  136.124 69.101  1.00 59.75  ? 171  PHE A N    1 
ATOM   1407  C CA   . PHE A 1 105 ? 45.546  137.383 69.653  1.00 63.55  ? 171  PHE A CA   1 
ATOM   1408  C C    . PHE A 1 105 ? 45.274  137.322 71.157  1.00 56.44  ? 171  PHE A C    1 
ATOM   1409  O O    . PHE A 1 105 ? 45.799  138.132 71.925  1.00 50.96  ? 171  PHE A O    1 
ATOM   1410  C CB   . PHE A 1 105 ? 44.266  137.812 68.958  1.00 54.14  ? 171  PHE A CB   1 
ATOM   1411  C CG   . PHE A 1 105 ? 43.526  138.877 69.692  1.00 49.74  ? 171  PHE A CG   1 
ATOM   1412  C CD1  . PHE A 1 105 ? 44.022  140.161 69.725  1.00 46.61  ? 171  PHE A CD1  1 
ATOM   1413  C CD2  . PHE A 1 105 ? 42.341  138.601 70.356  1.00 57.55  ? 171  PHE A CD2  1 
ATOM   1414  C CE1  . PHE A 1 105 ? 43.361  141.161 70.382  1.00 46.10  ? 171  PHE A CE1  1 
ATOM   1415  C CE2  . PHE A 1 105 ? 41.667  139.608 71.030  1.00 55.77  ? 171  PHE A CE2  1 
ATOM   1416  C CZ   . PHE A 1 105 ? 42.181  140.889 71.038  1.00 49.21  ? 171  PHE A CZ   1 
ATOM   1417  H H    . PHE A 1 105 ? 45.511  135.741 68.546  1.00 71.70  ? 171  PHE A H    1 
ATOM   1418  H HA   . PHE A 1 105 ? 46.211  138.073 69.501  1.00 76.26  ? 171  PHE A HA   1 
ATOM   1419  H HB2  . PHE A 1 105 ? 44.486  138.155 68.078  1.00 64.97  ? 171  PHE A HB2  1 
ATOM   1420  H HB3  . PHE A 1 105 ? 43.680  137.044 68.876  1.00 64.97  ? 171  PHE A HB3  1 
ATOM   1421  H HD1  . PHE A 1 105 ? 44.815  140.354 69.279  1.00 55.93  ? 171  PHE A HD1  1 
ATOM   1422  H HD2  . PHE A 1 105 ? 41.994  137.738 70.344  1.00 69.05  ? 171  PHE A HD2  1 
ATOM   1423  H HE1  . PHE A 1 105 ? 43.711  142.023 70.391  1.00 55.32  ? 171  PHE A HE1  1 
ATOM   1424  H HE2  . PHE A 1 105 ? 40.870  139.421 71.472  1.00 66.92  ? 171  PHE A HE2  1 
ATOM   1425  H HZ   . PHE A 1 105 ? 41.734  141.566 71.492  1.00 59.05  ? 171  PHE A HZ   1 
ATOM   1426  N N    . LYS A 1 106 ? 44.427  136.386 71.567  1.00 42.76  ? 172  LYS A N    1 
ATOM   1427  C CA   . LYS A 1 106 ? 44.087  136.241 72.972  1.00 43.29  ? 172  LYS A CA   1 
ATOM   1428  C C    . LYS A 1 106 ? 45.350  136.184 73.841  1.00 46.18  ? 172  LYS A C    1 
ATOM   1429  O O    . LYS A 1 106 ? 45.392  136.766 74.918  1.00 54.34  ? 172  LYS A O    1 
ATOM   1430  C CB   . LYS A 1 106 ? 43.219  135.000 73.196  1.00 34.63  ? 172  LYS A CB   1 
ATOM   1431  C CG   . LYS A 1 106 ? 43.105  134.574 74.638  1.00 21.29  ? 172  LYS A CG   1 
ATOM   1432  C CD   . LYS A 1 106 ? 42.230  133.379 74.782  1.00 19.77  ? 172  LYS A CD   1 
ATOM   1433  C CE   . LYS A 1 106 ? 42.463  132.710 76.118  1.00 43.43  ? 172  LYS A CE   1 
ATOM   1434  N NZ   . LYS A 1 106 ? 41.885  131.331 76.129  1.00 59.28  ? 172  LYS A NZ   1 
ATOM   1435  H H    . LYS A 1 106 ? 44.035  135.822 71.049  1.00 51.31  ? 172  LYS A H    1 
ATOM   1436  H HA   . LYS A 1 106 ? 43.573  137.016 73.249  1.00 51.95  ? 172  LYS A HA   1 
ATOM   1437  H HB2  . LYS A 1 106 ? 42.324  135.184 72.871  1.00 41.55  ? 172  LYS A HB2  1 
ATOM   1438  H HB3  . LYS A 1 106 ? 43.601  134.260 72.699  1.00 41.55  ? 172  LYS A HB3  1 
ATOM   1439  H HG2  . LYS A 1 106 ? 43.986  134.349 74.977  1.00 25.55  ? 172  LYS A HG2  1 
ATOM   1440  H HG3  . LYS A 1 106 ? 42.720  135.298 75.157  1.00 25.55  ? 172  LYS A HG3  1 
ATOM   1441  H HD2  . LYS A 1 106 ? 41.300  133.651 74.734  1.00 23.73  ? 172  LYS A HD2  1 
ATOM   1442  H HD3  . LYS A 1 106 ? 42.434  132.742 74.080  1.00 23.73  ? 172  LYS A HD3  1 
ATOM   1443  H HE2  . LYS A 1 106 ? 43.417  132.644 76.283  1.00 52.12  ? 172  LYS A HE2  1 
ATOM   1444  H HE3  . LYS A 1 106 ? 42.035  133.228 76.817  1.00 52.12  ? 172  LYS A HE3  1 
ATOM   1445  H HZ1  . LYS A 1 106 ? 42.028  130.948 76.920  1.00 71.14  ? 172  LYS A HZ1  1 
ATOM   1446  H HZ2  . LYS A 1 106 ? 41.008  131.368 75.981  1.00 71.14  ? 172  LYS A HZ2  1 
ATOM   1447  H HZ3  . LYS A 1 106 ? 42.266  130.837 75.495  1.00 71.14  ? 172  LYS A HZ3  1 
ATOM   1448  N N    . SER A 1 107 ? 46.391  135.504 73.381  1.00 44.66  ? 173  SER A N    1 
ATOM   1449  C CA   . SER A 1 107 ? 47.599  135.435 74.187  1.00 50.58  ? 173  SER A CA   1 
ATOM   1450  C C    . SER A 1 107 ? 48.377  136.763 74.164  1.00 34.03  ? 173  SER A C    1 
ATOM   1451  O O    . SER A 1 107 ? 48.930  137.154 75.175  1.00 40.36  ? 173  SER A O    1 
ATOM   1452  C CB   . SER A 1 107 ? 48.480  134.252 73.784  1.00 43.59  ? 173  SER A CB   1 
ATOM   1453  O OG   . SER A 1 107 ? 49.076  134.475 72.531  1.00 62.73  ? 173  SER A OG   1 
ATOM   1454  H H    . SER A 1 107 ? 46.425  135.086 72.630  1.00 53.60  ? 173  SER A H    1 
ATOM   1455  H HA   . SER A 1 107 ? 47.332  135.284 75.107  1.00 60.70  ? 173  SER A HA   1 
ATOM   1456  H HB2  . SER A 1 107 ? 49.176  134.136 74.449  1.00 52.31  ? 173  SER A HB2  1 
ATOM   1457  H HB3  . SER A 1 107 ? 47.932  133.453 73.736  1.00 52.31  ? 173  SER A HB3  1 
ATOM   1458  H HG   . SER A 1 107 ? 48.483  134.578 71.945  1.00 75.27  ? 173  SER A HG   1 
ATOM   1459  N N    . SER A 1 108 ? 48.395  137.471 73.041  1.00 44.59  ? 174  SER A N    1 
ATOM   1460  C CA   . SER A 1 108 ? 49.054  138.787 72.985  1.00 40.75  ? 174  SER A CA   1 
ATOM   1461  C C    . SER A 1 108 ? 48.335  139.803 73.855  1.00 40.45  ? 174  SER A C    1 
ATOM   1462  O O    . SER A 1 108 ? 48.959  140.658 74.468  1.00 51.78  ? 174  SER A O    1 
ATOM   1463  C CB   . SER A 1 108 ? 49.118  139.328 71.559  1.00 37.38  ? 174  SER A CB   1 
ATOM   1464  O OG   . SER A 1 108 ? 49.906  138.497 70.735  1.00 57.31  ? 174  SER A OG   1 
ATOM   1465  H H    . SER A 1 108 ? 48.039  137.222 72.299  1.00 53.51  ? 174  SER A H    1 
ATOM   1466  H HA   . SER A 1 108 ? 49.962  138.699 73.314  1.00 48.90  ? 174  SER A HA   1 
ATOM   1467  H HB2  . SER A 1 108 ? 48.219  139.369 71.197  1.00 44.85  ? 174  SER A HB2  1 
ATOM   1468  H HB3  . SER A 1 108 ? 49.508  140.216 71.576  1.00 44.85  ? 174  SER A HB3  1 
ATOM   1469  H HG   . SER A 1 108 ? 49.579  137.723 70.710  1.00 68.77  ? 174  SER A HG   1 
ATOM   1470  N N    . PHE A 1 109 ? 47.015  139.713 73.882  1.00 36.34  ? 175  PHE A N    1 
ATOM   1471  C CA   . PHE A 1 109 ? 46.187  140.492 74.789  1.00 33.91  ? 175  PHE A CA   1 
ATOM   1472  C C    . PHE A 1 109 ? 46.580  140.263 76.261  1.00 40.47  ? 175  PHE A C    1 
ATOM   1473  O O    . PHE A 1 109 ? 46.803  141.208 77.008  1.00 41.22  ? 175  PHE A O    1 
ATOM   1474  C CB   . PHE A 1 109 ? 44.723  140.103 74.538  1.00 37.96  ? 175  PHE A CB   1 
ATOM   1475  C CG   . PHE A 1 109 ? 43.758  140.670 75.519  1.00 35.82  ? 175  PHE A CG   1 
ATOM   1476  C CD1  . PHE A 1 109 ? 43.267  141.951 75.364  1.00 33.06  ? 175  PHE A CD1  1 
ATOM   1477  C CD2  . PHE A 1 109 ? 43.327  139.910 76.598  1.00 47.00  ? 175  PHE A CD2  1 
ATOM   1478  C CE1  . PHE A 1 109 ? 42.373  142.482 76.276  1.00 35.29  ? 175  PHE A CE1  1 
ATOM   1479  C CE2  . PHE A 1 109 ? 42.433  140.436 77.522  1.00 52.95  ? 175  PHE A CE2  1 
ATOM   1480  C CZ   . PHE A 1 109 ? 41.952  141.726 77.355  1.00 38.41  ? 175  PHE A CZ   1 
ATOM   1481  H H    . PHE A 1 109 ? 46.562  139.193 73.368  1.00 43.61  ? 175  PHE A H    1 
ATOM   1482  H HA   . PHE A 1 109 ? 46.291  141.435 74.589  1.00 40.69  ? 175  PHE A HA   1 
ATOM   1483  H HB2  . PHE A 1 109 ? 44.465  140.418 73.657  1.00 45.56  ? 175  PHE A HB2  1 
ATOM   1484  H HB3  . PHE A 1 109 ? 44.647  139.137 74.575  1.00 45.56  ? 175  PHE A HB3  1 
ATOM   1485  H HD1  . PHE A 1 109 ? 43.548  142.467 74.644  1.00 39.67  ? 175  PHE A HD1  1 
ATOM   1486  H HD2  . PHE A 1 109 ? 43.653  139.047 76.712  1.00 56.40  ? 175  PHE A HD2  1 
ATOM   1487  H HE1  . PHE A 1 109 ? 42.052  143.348 76.162  1.00 42.35  ? 175  PHE A HE1  1 
ATOM   1488  H HE2  . PHE A 1 109 ? 42.151  139.922 78.244  1.00 63.54  ? 175  PHE A HE2  1 
ATOM   1489  H HZ   . PHE A 1 109 ? 41.348  142.082 77.966  1.00 46.09  ? 175  PHE A HZ   1 
ATOM   1490  N N    . CYS A 1 110 ? 46.682  139.007 76.673  1.00 39.80  ? 176  CYS A N    1 
ATOM   1491  C CA   . CYS A 1 110 ? 46.965  138.688 78.066  1.00 41.76  ? 176  CYS A CA   1 
ATOM   1492  C C    . CYS A 1 110 ? 48.388  138.993 78.458  1.00 33.17  ? 176  CYS A C    1 
ATOM   1493  O O    . CYS A 1 110 ? 48.668  139.274 79.625  1.00 33.79  ? 176  CYS A O    1 
ATOM   1494  C CB   . CYS A 1 110 ? 46.750  137.209 78.323  1.00 43.55  ? 176  CYS A CB   1 
ATOM   1495  S SG   . CYS A 1 110 ? 45.074  136.682 78.213  1.00 56.79  ? 176  CYS A SG   1 
ATOM   1496  H H    . CYS A 1 110 ? 46.591  138.318 76.166  1.00 47.76  ? 176  CYS A H    1 
ATOM   1497  H HA   . CYS A 1 110 ? 46.371  139.193 78.643  1.00 50.11  ? 176  CYS A HA   1 
ATOM   1498  H HB2  . CYS A 1 110 ? 47.260  136.704 77.672  1.00 52.26  ? 176  CYS A HB2  1 
ATOM   1499  H HB3  . CYS A 1 110 ? 47.065  137.001 79.217  1.00 52.26  ? 176  CYS A HB3  1 
ATOM   1500  H HG   . CYS A 1 110 ? 44.664  136.912 77.108  1.00 68.15  ? 176  CYS A HG   1 
ATOM   1501  N N    . GLU A 1 111 ? 49.284  138.867 77.484  1.00 40.54  ? 177  GLU A N    1 
ATOM   1502  C CA   . GLU A 1 111 ? 50.708  139.102 77.679  1.00 32.59  ? 177  GLU A CA   1 
ATOM   1503  C C    . GLU A 1 111 ? 50.907  140.592 77.894  1.00 30.59  ? 177  GLU A C    1 
ATOM   1504  O O    . GLU A 1 111 ? 51.625  140.999 78.790  1.00 40.30  ? 177  GLU A O    1 
ATOM   1505  C CB   . GLU A 1 111 ? 51.490  138.582 76.468  1.00 23.76  ? 177  GLU A CB   1 
ATOM   1506  C CG   . GLU A 1 111 ? 52.985  138.902 76.421  1.00 61.51  ? 177  GLU A CG   1 
ATOM   1507  C CD   . GLU A 1 111 ? 53.857  137.984 77.287  1.00 77.41  ? 177  GLU A CD   1 
ATOM   1508  O OE1  . GLU A 1 111 ? 53.357  136.956 77.803  1.00 68.89  ? 177  GLU A OE1  1 
ATOM   1509  O OE2  . GLU A 1 111 ? 55.058  138.306 77.452  1.00 84.40  ? 177  GLU A OE2  1 
ATOM   1510  H H    . GLU A 1 111 ? 49.084  138.641 76.679  1.00 48.64  ? 177  GLU A H    1 
ATOM   1511  H HA   . GLU A 1 111 ? 51.011  138.630 78.470  1.00 39.11  ? 177  GLU A HA   1 
ATOM   1512  H HB2  . GLU A 1 111 ? 51.404  137.616 76.444  1.00 28.51  ? 177  GLU A HB2  1 
ATOM   1513  H HB3  . GLU A 1 111 ? 51.092  138.958 75.667  1.00 28.51  ? 177  GLU A HB3  1 
ATOM   1514  H HG2  . GLU A 1 111 ? 53.292  138.821 75.505  1.00 73.82  ? 177  GLU A HG2  1 
ATOM   1515  H HG3  . GLU A 1 111 ? 53.118  139.812 76.731  1.00 73.82  ? 177  GLU A HG3  1 
ATOM   1516  N N    . PHE A 1 112 ? 50.224  141.408 77.105  1.00 29.35  ? 178  PHE A N    1 
ATOM   1517  C CA   . PHE A 1 112 ? 50.316  142.862 77.237  1.00 30.91  ? 178  PHE A CA   1 
ATOM   1518  C C    . PHE A 1 112 ? 49.864  143.379 78.612  1.00 34.24  ? 178  PHE A C    1 
ATOM   1519  O O    . PHE A 1 112 ? 50.448  144.312 79.159  1.00 29.02  ? 178  PHE A O    1 
ATOM   1520  C CB   . PHE A 1 112 ? 49.452  143.527 76.174  1.00 22.17  ? 178  PHE A CB   1 
ATOM   1521  C CG   . PHE A 1 112 ? 49.413  145.030 76.271  1.00 35.83  ? 178  PHE A CG   1 
ATOM   1522  C CD1  . PHE A 1 112 ? 50.442  145.819 75.788  1.00 29.04  ? 178  PHE A CD1  1 
ATOM   1523  C CD2  . PHE A 1 112 ? 48.314  145.657 76.848  1.00 45.18  ? 178  PHE A CD2  1 
ATOM   1524  C CE1  . PHE A 1 112 ? 50.376  147.206 75.886  1.00 44.65  ? 178  PHE A CE1  1 
ATOM   1525  C CE2  . PHE A 1 112 ? 48.238  147.044 76.939  1.00 40.97  ? 178  PHE A CE2  1 
ATOM   1526  C CZ   . PHE A 1 112 ? 49.260  147.815 76.454  1.00 40.07  ? 178  PHE A CZ   1 
ATOM   1527  H H    . PHE A 1 112 ? 49.695  141.147 76.479  1.00 35.22  ? 178  PHE A H    1 
ATOM   1528  H HA   . PHE A 1 112 ? 51.235  143.137 77.097  1.00 37.09  ? 178  PHE A HA   1 
ATOM   1529  H HB2  . PHE A 1 112 ? 49.801  143.296 75.299  1.00 26.61  ? 178  PHE A HB2  1 
ATOM   1530  H HB3  . PHE A 1 112 ? 48.543  143.200 76.261  1.00 26.61  ? 178  PHE A HB3  1 
ATOM   1531  H HD1  . PHE A 1 112 ? 51.186  145.419 75.399  1.00 34.85  ? 178  PHE A HD1  1 
ATOM   1532  H HD2  . PHE A 1 112 ? 47.611  145.140 77.171  1.00 54.22  ? 178  PHE A HD2  1 
ATOM   1533  H HE1  . PHE A 1 112 ? 51.071  147.728 75.556  1.00 53.58  ? 178  PHE A HE1  1 
ATOM   1534  H HE2  . PHE A 1 112 ? 47.495  147.445 77.328  1.00 49.16  ? 178  PHE A HE2  1 
ATOM   1535  H HZ   . PHE A 1 112 ? 49.219  148.741 76.523  1.00 48.08  ? 178  PHE A HZ   1 
ATOM   1536  N N    . ILE A 1 113 ? 48.799  142.801 79.154  1.00 30.14  ? 179  ILE A N    1 
ATOM   1537  C CA   . ILE A 1 113 ? 48.278  143.258 80.424  1.00 22.18  ? 179  ILE A CA   1 
ATOM   1538  C C    . ILE A 1 113 ? 49.291  142.919 81.503  1.00 38.76  ? 179  ILE A C    1 
ATOM   1539  O O    . ILE A 1 113 ? 49.617  143.758 82.345  1.00 36.72  ? 179  ILE A O    1 
ATOM   1540  C CB   . ILE A 1 113 ? 46.883  142.656 80.722  1.00 30.24  ? 179  ILE A CB   1 
ATOM   1541  C CG1  . ILE A 1 113 ? 45.829  143.303 79.820  1.00 29.61  ? 179  ILE A CG1  1 
ATOM   1542  C CG2  . ILE A 1 113 ? 46.471  142.877 82.185  1.00 37.59  ? 179  ILE A CG2  1 
ATOM   1543  C CD1  . ILE A 1 113 ? 44.542  142.541 79.792  1.00 39.41  ? 179  ILE A CD1  1 
ATOM   1544  H H    . ILE A 1 113 ? 48.365  142.146 78.805  1.00 36.17  ? 179  ILE A H    1 
ATOM   1545  H HA   . ILE A 1 113 ? 48.185  144.223 80.396  1.00 26.62  ? 179  ILE A HA   1 
ATOM   1546  H HB   . ILE A 1 113 ? 46.907  141.702 80.543  1.00 36.29  ? 179  ILE A HB   1 
ATOM   1547  H HG12 . ILE A 1 113 ? 45.641  144.197 80.146  1.00 35.54  ? 179  ILE A HG12 1 
ATOM   1548  H HG13 . ILE A 1 113 ? 46.172  143.345 78.914  1.00 35.54  ? 179  ILE A HG13 1 
ATOM   1549  H HG21 . ILE A 1 113 ? 45.595  142.487 82.329  1.00 45.11  ? 179  ILE A HG21 1 
ATOM   1550  H HG22 . ILE A 1 113 ? 47.123  142.452 82.764  1.00 45.11  ? 179  ILE A HG22 1 
ATOM   1551  H HG23 . ILE A 1 113 ? 46.442  143.830 82.364  1.00 45.11  ? 179  ILE A HG23 1 
ATOM   1552  H HD11 . ILE A 1 113 ? 43.918  142.998 79.207  1.00 47.30  ? 179  ILE A HD11 1 
ATOM   1553  H HD12 . ILE A 1 113 ? 44.713  141.646 79.460  1.00 47.30  ? 179  ILE A HD12 1 
ATOM   1554  H HD13 . ILE A 1 113 ? 44.182  142.497 80.692  1.00 47.30  ? 179  ILE A HD13 1 
ATOM   1555  N N    . GLY A 1 114 ? 49.813  141.699 81.458  1.00 35.92  ? 180  GLY A N    1 
ATOM   1556  C CA   . GLY A 1 114 ? 50.837  141.277 82.393  1.00 28.71  ? 180  GLY A CA   1 
ATOM   1557  C C    . GLY A 1 114 ? 52.086  142.130 82.313  1.00 28.23  ? 180  GLY A C    1 
ATOM   1558  O O    . GLY A 1 114 ? 52.519  142.709 83.292  1.00 37.49  ? 180  GLY A O    1 
ATOM   1559  H H    . GLY A 1 114 ? 49.588  141.095 80.889  1.00 43.11  ? 180  GLY A H    1 
ATOM   1560  H HA2  . GLY A 1 114 ? 50.489  141.328 83.297  1.00 34.45  ? 180  GLY A HA2  1 
ATOM   1561  H HA3  . GLY A 1 114 ? 51.083  140.357 82.210  1.00 34.45  ? 180  GLY A HA3  1 
ATOM   1562  N N    . VAL A 1 115 ? 52.659  142.213 81.127  1.00 33.34  ? 181  VAL A N    1 
ATOM   1563  C CA   . VAL A 1 115 ? 53.893  142.960 80.906  1.00 28.32  ? 181  VAL A CA   1 
ATOM   1564  C C    . VAL A 1 115 ? 53.731  144.459 81.205  1.00 35.25  ? 181  VAL A C    1 
ATOM   1565  O O    . VAL A 1 115 ? 54.708  145.136 81.524  1.00 43.63  ? 181  VAL A O    1 
ATOM   1566  C CB   . VAL A 1 115 ? 54.421  142.716 79.446  1.00 44.10  ? 181  VAL A CB   1 
ATOM   1567  C CG1  . VAL A 1 115 ? 55.453  143.748 78.998  1.00 30.21  ? 181  VAL A CG1  1 
ATOM   1568  C CG2  . VAL A 1 115 ? 55.019  141.313 79.355  1.00 37.71  ? 181  VAL A CG2  1 
ATOM   1569  H H    . VAL A 1 115 ? 52.350  141.840 80.417  1.00 40.01  ? 181  VAL A H    1 
ATOM   1570  H HA   . VAL A 1 115 ? 54.566  142.619 81.515  1.00 33.98  ? 181  VAL A HA   1 
ATOM   1571  H HB   . VAL A 1 115 ? 53.672  142.759 78.832  1.00 52.92  ? 181  VAL A HB   1 
ATOM   1572  H HG11 . VAL A 1 115 ? 55.735  143.540 78.094  1.00 36.25  ? 181  VAL A HG11 1 
ATOM   1573  H HG12 . VAL A 1 115 ? 55.048  144.630 79.024  1.00 36.25  ? 181  VAL A HG12 1 
ATOM   1574  H HG13 . VAL A 1 115 ? 56.213  143.715 79.599  1.00 36.25  ? 181  VAL A HG13 1 
ATOM   1575  H HG21 . VAL A 1 115 ? 55.343  141.166 78.452  1.00 45.25  ? 181  VAL A HG21 1 
ATOM   1576  H HG22 . VAL A 1 115 ? 55.751  141.240 79.986  1.00 45.25  ? 181  VAL A HG22 1 
ATOM   1577  H HG23 . VAL A 1 115 ? 54.331  140.663 79.569  1.00 45.25  ? 181  VAL A HG23 1 
ATOM   1578  N N    . LEU A 1 116 ? 52.513  144.986 81.114  1.00 36.53  ? 182  LEU A N    1 
ATOM   1579  C CA   . LEU A 1 116 ? 52.283  146.411 81.418  1.00 34.97  ? 182  LEU A CA   1 
ATOM   1580  C C    . LEU A 1 116 ? 52.430  146.698 82.926  1.00 46.26  ? 182  LEU A C    1 
ATOM   1581  O O    . LEU A 1 116 ? 53.083  147.656 83.351  1.00 35.19  ? 182  LEU A O    1 
ATOM   1582  C CB   . LEU A 1 116 ? 50.906  146.875 80.911  1.00 22.25  ? 182  LEU A CB   1 
ATOM   1583  C CG   . LEU A 1 116 ? 50.499  148.317 81.248  1.00 18.37  ? 182  LEU A CG   1 
ATOM   1584  C CD1  . LEU A 1 116 ? 51.520  149.329 80.771  1.00 25.24  ? 182  LEU A CD1  1 
ATOM   1585  C CD2  . LEU A 1 116 ? 49.174  148.638 80.644  1.00 26.47  ? 182  LEU A CD2  1 
ATOM   1586  H H    . LEU A 1 116 ? 51.807  144.552 80.882  1.00 43.83  ? 182  LEU A H    1 
ATOM   1587  H HA   . LEU A 1 116 ? 52.956  146.936 80.955  1.00 41.96  ? 182  LEU A HA   1 
ATOM   1588  H HB2  . LEU A 1 116 ? 50.895  146.793 79.945  1.00 26.70  ? 182  LEU A HB2  1 
ATOM   1589  H HB3  . LEU A 1 116 ? 50.231  146.291 81.290  1.00 26.70  ? 182  LEU A HB3  1 
ATOM   1590  H HG   . LEU A 1 116 ? 50.417  148.405 82.211  1.00 22.05  ? 182  LEU A HG   1 
ATOM   1591  H HD11 . LEU A 1 116 ? 51.216  150.219 81.008  1.00 30.29  ? 182  LEU A HD11 1 
ATOM   1592  H HD12 . LEU A 1 116 ? 52.370  149.145 81.200  1.00 30.29  ? 182  LEU A HD12 1 
ATOM   1593  H HD13 . LEU A 1 116 ? 51.611  149.255 79.808  1.00 30.29  ? 182  LEU A HD13 1 
ATOM   1594  H HD21 . LEU A 1 116 ? 48.938  149.551 80.869  1.00 31.76  ? 182  LEU A HD21 1 
ATOM   1595  H HD22 . LEU A 1 116 ? 49.235  148.539 79.681  1.00 31.76  ? 182  LEU A HD22 1 
ATOM   1596  H HD23 . LEU A 1 116 ? 48.509  148.027 80.998  1.00 31.76  ? 182  LEU A HD23 1 
ATOM   1597  N N    . VAL A 1 117 ? 51.821  145.845 83.730  1.00 39.24  ? 183  VAL A N    1 
ATOM   1598  C CA   . VAL A 1 117 ? 51.857  146.000 85.164  1.00 31.78  ? 183  VAL A CA   1 
ATOM   1599  C C    . VAL A 1 117 ? 53.272  145.763 85.662  1.00 33.80  ? 183  VAL A C    1 
ATOM   1600  O O    . VAL A 1 117 ? 53.805  146.569 86.431  1.00 35.25  ? 183  VAL A O    1 
ATOM   1601  C CB   . VAL A 1 117 ? 50.868  145.024 85.822  1.00 37.08  ? 183  VAL A CB   1 
ATOM   1602  C CG1  . VAL A 1 117 ? 50.974  145.043 87.344  1.00 38.60  ? 183  VAL A CG1  1 
ATOM   1603  C CG2  . VAL A 1 117 ? 49.460  145.353 85.384  1.00 15.71  ? 183  VAL A CG2  1 
ATOM   1604  H H    . VAL A 1 117 ? 51.376  145.159 83.463  1.00 47.09  ? 183  VAL A H    1 
ATOM   1605  H HA   . VAL A 1 117 ? 51.597  146.905 85.397  1.00 38.14  ? 183  VAL A HA   1 
ATOM   1606  H HB   . VAL A 1 117 ? 51.070  144.124 85.521  1.00 44.49  ? 183  VAL A HB   1 
ATOM   1607  H HG11 . VAL A 1 117 ? 50.334  144.415 87.713  1.00 46.32  ? 183  VAL A HG11 1 
ATOM   1608  H HG12 . VAL A 1 117 ? 51.874  144.788 87.600  1.00 46.32  ? 183  VAL A HG12 1 
ATOM   1609  H HG13 . VAL A 1 117 ? 50.780  145.939 87.662  1.00 46.32  ? 183  VAL A HG13 1 
ATOM   1610  H HG21 . VAL A 1 117 ? 48.846  144.731 85.805  1.00 18.85  ? 183  VAL A HG21 1 
ATOM   1611  H HG22 . VAL A 1 117 ? 49.250  146.260 85.654  1.00 18.85  ? 183  VAL A HG22 1 
ATOM   1612  H HG23 . VAL A 1 117 ? 49.403  145.272 84.419  1.00 18.85  ? 183  VAL A HG23 1 
ATOM   1613  N N    . ARG A 1 118 ? 53.890  144.674 85.205  1.00 37.53  ? 184  ARG A N    1 
ATOM   1614  C CA   . ARG A 1 118 ? 55.243  144.330 85.650  1.00 25.53  ? 184  ARG A CA   1 
ATOM   1615  C C    . ARG A 1 118 ? 56.200  145.490 85.343  1.00 30.32  ? 184  ARG A C    1 
ATOM   1616  O O    . ARG A 1 118 ? 56.978  145.865 86.199  1.00 26.72  ? 184  ARG A O    1 
ATOM   1617  C CB   . ARG A 1 118 ? 55.715  142.967 85.079  1.00 30.51  ? 184  ARG A CB   1 
ATOM   1618  C CG   . ARG A 1 118 ? 54.988  141.707 85.709  1.00 70.55  ? 184  ARG A CG   1 
ATOM   1619  C CD   . ARG A 1 118 ? 55.025  140.452 84.789  1.00 73.64  ? 184  ARG A CD   1 
ATOM   1620  N NE   . ARG A 1 118 ? 54.435  139.213 85.348  1.00 94.47  ? 184  ARG A NE   1 
ATOM   1621  C CZ   . ARG A 1 118 ? 53.141  138.854 85.267  1.00 76.95  ? 184  ARG A CZ   1 
ATOM   1622  N NH1  . ARG A 1 118 ? 52.246  139.649 84.698  1.00 59.29  ? 184  ARG A NH1  1 
ATOM   1623  N NH2  . ARG A 1 118 ? 52.729  137.698 85.784  1.00 48.38  ? 184  ARG A NH2  1 
ATOM   1624  H H    . ARG A 1 118 ? 53.551  144.120 84.641  1.00 45.04  ? 184  ARG A H    1 
ATOM   1625  H HA   . ARG A 1 118 ? 55.222  144.234 86.615  1.00 30.64  ? 184  ARG A HA   1 
ATOM   1626  H HB2  . ARG A 1 118 ? 55.548  142.956 84.124  1.00 36.61  ? 184  ARG A HB2  1 
ATOM   1627  H HB3  . ARG A 1 118 ? 56.666  142.872 85.246  1.00 36.61  ? 184  ARG A HB3  1 
ATOM   1628  H HG2  . ARG A 1 118 ? 55.425  141.477 86.544  1.00 84.65  ? 184  ARG A HG2  1 
ATOM   1629  H HG3  . ARG A 1 118 ? 54.058  141.929 85.873  1.00 84.65  ? 184  ARG A HG3  1 
ATOM   1630  H HD2  . ARG A 1 118 ? 54.542  140.658 83.973  1.00 88.37  ? 184  ARG A HD2  1 
ATOM   1631  H HD3  . ARG A 1 118 ? 55.951  140.259 84.574  1.00 88.37  ? 184  ARG A HD3  1 
ATOM   1632  H HE   . ARG A 1 118 ? 54.966  138.677 85.760  1.00 113.36 ? 184  ARG A HE   1 
ATOM   1633  H HH11 . ARG A 1 118 ? 52.494  140.397 84.352  1.00 71.15  ? 184  ARG A HH11 1 
ATOM   1634  H HH12 . ARG A 1 118 ? 51.421  139.410 84.660  1.00 71.15  ? 184  ARG A HH12 1 
ATOM   1635  H HH21 . ARG A 1 118 ? 53.292  137.173 86.168  1.00 58.05  ? 184  ARG A HH21 1 
ATOM   1636  H HH22 . ARG A 1 118 ? 51.897  137.482 85.746  1.00 58.05  ? 184  ARG A HH22 1 
ATOM   1637  N N    . GLN A 1 119 ? 56.092  146.107 84.168  1.00 27.78  ? 185  GLN A N    1 
ATOM   1638  C CA   . GLN A 1 119 ? 56.876  147.314 83.861  1.00 31.72  ? 185  GLN A CA   1 
ATOM   1639  C C    . GLN A 1 119 ? 56.435  148.616 84.567  1.00 32.88  ? 185  GLN A C    1 
ATOM   1640  O O    . GLN A 1 119 ? 57.026  149.663 84.326  1.00 32.64  ? 185  GLN A O    1 
ATOM   1641  C CB   . GLN A 1 119 ? 56.877  147.573 82.351  1.00 28.39  ? 185  GLN A CB   1 
ATOM   1642  C CG   . GLN A 1 119 ? 57.463  146.446 81.534  1.00 39.87  ? 185  GLN A CG   1 
ATOM   1643  C CD   . GLN A 1 119 ? 58.966  146.353 81.660  1.00 37.50  ? 185  GLN A CD   1 
ATOM   1644  O OE1  . GLN A 1 119 ? 59.700  147.073 80.989  1.00 39.64  ? 185  GLN A OE1  1 
ATOM   1645  N NE2  . GLN A 1 119 ? 59.432  145.453 82.520  1.00 30.37  ? 185  GLN A NE2  1 
ATOM   1646  H H    . GLN A 1 119 ? 55.574  145.853 83.531  1.00 33.34  ? 185  GLN A H    1 
ATOM   1647  H HA   . GLN A 1 119 ? 57.795  147.147 84.123  1.00 38.06  ? 185  GLN A HA   1 
ATOM   1648  H HB2  . GLN A 1 119 ? 55.962  147.707 82.058  1.00 34.07  ? 185  GLN A HB2  1 
ATOM   1649  H HB3  . GLN A 1 119 ? 57.398  148.371 82.172  1.00 34.07  ? 185  GLN A HB3  1 
ATOM   1650  H HG2  . GLN A 1 119 ? 57.084  145.606 81.836  1.00 47.85  ? 185  GLN A HG2  1 
ATOM   1651  H HG3  . GLN A 1 119 ? 57.249  146.590 80.599  1.00 47.85  ? 185  GLN A HG3  1 
ATOM   1652  H HE21 . GLN A 1 119 ? 58.885  144.963 82.968  1.00 36.44  ? 185  GLN A HE21 1 
ATOM   1653  H HE22 . GLN A 1 119 ? 60.280  145.361 82.629  1.00 36.44  ? 185  GLN A HE22 1 
ATOM   1654  N N    . CYS A 1 120 ? 55.398  148.577 85.401  1.00 26.45  ? 186  CYS A N    1 
ATOM   1655  C CA   . CYS A 1 120 ? 54.960  149.775 86.127  1.00 32.76  ? 186  CYS A CA   1 
ATOM   1656  C C    . CYS A 1 120 ? 55.115  149.633 87.648  1.00 44.40  ? 186  CYS A C    1 
ATOM   1657  O O    . CYS A 1 120 ? 54.774  150.547 88.408  1.00 40.48  ? 186  CYS A O    1 
ATOM   1658  C CB   . CYS A 1 120 ? 53.496  150.091 85.806  1.00 39.67  ? 186  CYS A CB   1 
ATOM   1659  S SG   . CYS A 1 120 ? 53.156  150.730 84.159  1.00 39.20  ? 186  CYS A SG   1 
ATOM   1660  H H    . CYS A 1 120 ? 54.931  147.873 85.565  1.00 31.74  ? 186  CYS A H    1 
ATOM   1661  H HA   . CYS A 1 120 ? 55.498  150.530 85.842  1.00 39.31  ? 186  CYS A HA   1 
ATOM   1662  H HB2  . CYS A 1 120 ? 52.979  149.277 85.910  1.00 47.60  ? 186  CYS A HB2  1 
ATOM   1663  H HB3  . CYS A 1 120 ? 53.182  150.754 86.442  1.00 47.60  ? 186  CYS A HB3  1 
ATOM   1664  H HG   . CYS A 1 120 ? 53.509  149.922 83.346  1.00 47.04  ? 186  CYS A HG   1 
ATOM   1665  N N    . GLN A 1 121 ? 55.669  148.509 88.090  1.00 37.96  ? 187  GLN A N    1 
ATOM   1666  C CA   . GLN A 1 121 ? 55.555  148.107 89.486  1.00 24.00  ? 187  GLN A CA   1 
ATOM   1667  C C    . GLN A 1 121 ? 56.396  148.840 90.510  1.00 33.50  ? 187  GLN A C    1 
ATOM   1668  O O    . GLN A 1 121 ? 56.323  148.526 91.723  1.00 33.43  ? 187  GLN A O    1 
ATOM   1669  C CB   . GLN A 1 121 ? 55.842  146.622 89.620  1.00 41.77  ? 187  GLN A CB   1 
ATOM   1670  C CG   . GLN A 1 121 ? 57.238  146.159 89.329  1.00 12.83  ? 187  GLN A CG   1 
ATOM   1671  C CD   . GLN A 1 121 ? 57.304  144.661 89.531  1.00 39.08  ? 187  GLN A CD   1 
ATOM   1672  O OE1  . GLN A 1 121 ? 57.191  144.168 90.660  1.00 22.39  ? 187  GLN A OE1  1 
ATOM   1673  N NE2  . GLN A 1 121 ? 57.418  143.920 88.436  1.00 32.15  ? 187  GLN A NE2  1 
ATOM   1674  H H    . GLN A 1 121 ? 56.117  147.961 87.600  1.00 45.56  ? 187  GLN A H    1 
ATOM   1675  H HA   . GLN A 1 121 ? 54.630  148.237 89.749  1.00 28.80  ? 187  GLN A HA   1 
ATOM   1676  H HB2  . GLN A 1 121 ? 55.639  146.359 90.531  1.00 50.13  ? 187  GLN A HB2  1 
ATOM   1677  H HB3  . GLN A 1 121 ? 55.252  146.147 89.014  1.00 50.13  ? 187  GLN A HB3  1 
ATOM   1678  H HG2  . GLN A 1 121 ? 57.466  146.360 88.408  1.00 15.40  ? 187  GLN A HG2  1 
ATOM   1679  H HG3  . GLN A 1 121 ? 57.860  146.584 89.939  1.00 15.40  ? 187  GLN A HG3  1 
ATOM   1680  H HE21 . GLN A 1 121 ? 57.450  144.297 87.663  1.00 38.58  ? 187  GLN A HE21 1 
ATOM   1681  H HE22 . GLN A 1 121 ? 57.460  143.063 88.498  1.00 38.58  ? 187  GLN A HE22 1 
ATOM   1682  N N    . TYR A 1 122 ? 57.198  149.791 90.043  1.00 32.92  ? 188  TYR A N    1 
ATOM   1683  C CA   . TYR A 1 122 ? 58.154  150.473 90.918  1.00 43.25  ? 188  TYR A CA   1 
ATOM   1684  C C    . TYR A 1 122 ? 57.804  151.937 91.085  1.00 34.06  ? 188  TYR A C    1 
ATOM   1685  O O    . TYR A 1 122 ? 57.998  152.497 92.157  1.00 53.08  ? 188  TYR A O    1 
ATOM   1686  C CB   . TYR A 1 122 ? 59.596  150.251 90.428  1.00 38.29  ? 188  TYR A CB   1 
ATOM   1687  C CG   . TYR A 1 122 ? 59.982  148.789 90.487  1.00 31.30  ? 188  TYR A CG   1 
ATOM   1688  C CD1  . TYR A 1 122 ? 59.812  148.084 91.651  1.00 13.24  ? 188  TYR A CD1  1 
ATOM   1689  C CD2  . TYR A 1 122 ? 60.473  148.113 89.373  1.00 33.57  ? 188  TYR A CD2  1 
ATOM   1690  C CE1  . TYR A 1 122 ? 60.128  146.766 91.742  1.00 30.23  ? 188  TYR A CE1  1 
ATOM   1691  C CE2  . TYR A 1 122 ? 60.802  146.760 89.450  1.00 42.21  ? 188  TYR A CE2  1 
ATOM   1692  C CZ   . TYR A 1 122 ? 60.617  146.099 90.648  1.00 39.28  ? 188  TYR A CZ   1 
ATOM   1693  O OH   . TYR A 1 122 ? 60.916  144.771 90.787  1.00 37.93  ? 188  TYR A OH   1 
ATOM   1694  H H    . TYR A 1 122 ? 57.210  150.061 89.227  1.00 39.51  ? 188  TYR A H    1 
ATOM   1695  H HA   . TYR A 1 122 ? 58.092  150.068 91.798  1.00 51.90  ? 188  TYR A HA   1 
ATOM   1696  H HB2  . TYR A 1 122 ? 59.670  150.548 89.507  1.00 45.95  ? 188  TYR A HB2  1 
ATOM   1697  H HB3  . TYR A 1 122 ? 60.207  150.750 90.992  1.00 45.95  ? 188  TYR A HB3  1 
ATOM   1698  H HD1  . TYR A 1 122 ? 59.478  148.522 92.401  1.00 15.89  ? 188  TYR A HD1  1 
ATOM   1699  H HD2  . TYR A 1 122 ? 60.590  148.570 88.572  1.00 40.29  ? 188  TYR A HD2  1 
ATOM   1700  H HE1  . TYR A 1 122 ? 60.006  146.313 92.545  1.00 36.28  ? 188  TYR A HE1  1 
ATOM   1701  H HE2  . TYR A 1 122 ? 61.134  146.311 88.707  1.00 50.65  ? 188  TYR A HE2  1 
ATOM   1702  H HH   . TYR A 1 122 ? 61.206  144.464 90.061  1.00 45.52  ? 188  TYR A HH   1 
ATOM   1703  N N    . SER A 1 123 ? 57.234  152.539 90.050  1.00 44.59  ? 189  SER A N    1 
ATOM   1704  C CA   . SER A 1 123 ? 56.803  153.934 90.128  1.00 34.03  ? 189  SER A CA   1 
ATOM   1705  C C    . SER A 1 123 ? 55.315  154.137 89.761  1.00 35.64  ? 189  SER A C    1 
ATOM   1706  O O    . SER A 1 123 ? 54.481  154.346 90.655  1.00 23.70  ? 189  SER A O    1 
ATOM   1707  C CB   . SER A 1 123 ? 57.719  154.788 89.266  1.00 16.19  ? 189  SER A CB   1 
ATOM   1708  O OG   . SER A 1 123 ? 57.755  154.271 87.947  1.00 47.03  ? 189  SER A OG   1 
ATOM   1709  H H    . SER A 1 123 ? 57.083  152.164 89.290  1.00 53.51  ? 189  SER A H    1 
ATOM   1710  H HA   . SER A 1 123 ? 56.913  154.233 91.044  1.00 40.84  ? 189  SER A HA   1 
ATOM   1711  H HB2  . SER A 1 123 ? 57.381  155.697 89.244  1.00 19.43  ? 189  SER A HB2  1 
ATOM   1712  H HB3  . SER A 1 123 ? 58.614  154.772 89.640  1.00 19.43  ? 189  SER A HB3  1 
ATOM   1713  H HG   . SER A 1 123 ? 56.983  154.276 87.615  1.00 56.43  ? 189  SER A HG   1 
ATOM   1714  N N    . ILE A 1 124 ? 54.992  154.026 88.470  1.00 24.37  ? 190  ILE A N    1 
ATOM   1715  C CA   . ILE A 1 124 ? 53.676  154.425 87.948  1.00 28.46  ? 190  ILE A CA   1 
ATOM   1716  C C    . ILE A 1 124 ? 52.506  153.799 88.661  1.00 24.84  ? 190  ILE A C    1 
ATOM   1717  O O    . ILE A 1 124 ? 51.507  154.445 88.898  1.00 42.15  ? 190  ILE A O    1 
ATOM   1718  C CB   . ILE A 1 124 ? 53.541  154.072 86.466  1.00 39.16  ? 190  ILE A CB   1 
ATOM   1719  C CG1  . ILE A 1 124 ? 54.327  155.082 85.632  1.00 30.53  ? 190  ILE A CG1  1 
ATOM   1720  C CG2  . ILE A 1 124 ? 52.056  154.044 86.015  1.00 21.61  ? 190  ILE A CG2  1 
ATOM   1721  C CD1  . ILE A 1 124 ? 54.534  154.671 84.198  1.00 32.30  ? 190  ILE A CD1  1 
ATOM   1722  H H    . ILE A 1 124 ? 55.523  153.718 87.867  1.00 29.24  ? 190  ILE A H    1 
ATOM   1723  H HA   . ILE A 1 124 ? 53.590  155.387 88.032  1.00 34.16  ? 190  ILE A HA   1 
ATOM   1724  H HB   . ILE A 1 124 ? 53.923  153.192 86.323  1.00 47.00  ? 190  ILE A HB   1 
ATOM   1725  H HG12 . ILE A 1 124 ? 53.848  155.925 85.631  1.00 36.63  ? 190  ILE A HG12 1 
ATOM   1726  H HG13 . ILE A 1 124 ? 55.202  155.203 86.033  1.00 36.63  ? 190  ILE A HG13 1 
ATOM   1727  H HG21 . ILE A 1 124 ? 52.017  153.817 85.072  1.00 25.94  ? 190  ILE A HG21 1 
ATOM   1728  H HG22 . ILE A 1 124 ? 51.581  153.377 86.536  1.00 25.94  ? 190  ILE A HG22 1 
ATOM   1729  H HG23 . ILE A 1 124 ? 51.665  154.919 86.161  1.00 25.94  ? 190  ILE A HG23 1 
ATOM   1730  H HD11 . ILE A 1 124 ? 55.038  155.362 83.741  1.00 38.76  ? 190  ILE A HD11 1 
ATOM   1731  H HD12 . ILE A 1 124 ? 55.025  153.834 84.177  1.00 38.76  ? 190  ILE A HD12 1 
ATOM   1732  H HD13 . ILE A 1 124 ? 53.669  154.557 83.774  1.00 38.76  ? 190  ILE A HD13 1 
ATOM   1733  N N    . ILE A 1 125 ? 52.640  152.531 88.991  1.00 30.85  ? 191  ILE A N    1 
ATOM   1734  C CA   . ILE A 1 125 ? 51.559  151.761 89.597  1.00 32.55  ? 191  ILE A CA   1 
ATOM   1735  C C    . ILE A 1 125 ? 51.074  152.353 90.917  1.00 28.68  ? 191  ILE A C    1 
ATOM   1736  O O    . ILE A 1 125 ? 49.948  152.106 91.329  1.00 32.07  ? 191  ILE A O    1 
ATOM   1737  C CB   . ILE A 1 125 ? 52.031  150.301 89.818  1.00 37.29  ? 191  ILE A CB   1 
ATOM   1738  C CG1  . ILE A 1 125 ? 50.844  149.348 89.866  1.00 33.04  ? 191  ILE A CG1  1 
ATOM   1739  C CG2  . ILE A 1 125 ? 52.957  150.207 91.042  1.00 36.90  ? 191  ILE A CG2  1 
ATOM   1740  C CD1  . ILE A 1 125 ? 51.204  147.938 90.289  1.00 40.94  ? 191  ILE A CD1  1 
ATOM   1741  H H    . ILE A 1 125 ? 53.362  152.078 88.874  1.00 37.02  ? 191  ILE A H    1 
ATOM   1742  H HA   . ILE A 1 125 ? 50.807  151.742 88.985  1.00 39.05  ? 191  ILE A HA   1 
ATOM   1743  H HB   . ILE A 1 125 ? 52.561  150.054 89.043  1.00 44.75  ? 191  ILE A HB   1 
ATOM   1744  H HG12 . ILE A 1 125 ? 50.194  149.691 90.500  1.00 39.65  ? 191  ILE A HG12 1 
ATOM   1745  H HG13 . ILE A 1 125 ? 50.446  149.299 88.982  1.00 39.65  ? 191  ILE A HG13 1 
ATOM   1746  H HG21 . ILE A 1 125 ? 53.236  149.285 91.155  1.00 44.28  ? 191  ILE A HG21 1 
ATOM   1747  H HG22 . ILE A 1 125 ? 53.732  150.772 90.896  1.00 44.28  ? 191  ILE A HG22 1 
ATOM   1748  H HG23 . ILE A 1 125 ? 52.473  150.505 91.827  1.00 44.28  ? 191  ILE A HG23 1 
ATOM   1749  H HD11 . ILE A 1 125 ? 50.400  147.396 90.295  1.00 49.13  ? 191  ILE A HD11 1 
ATOM   1750  H HD12 . ILE A 1 125 ? 51.844  147.574 89.659  1.00 49.13  ? 191  ILE A HD12 1 
ATOM   1751  H HD13 . ILE A 1 125 ? 51.592  147.966 91.178  1.00 49.13  ? 191  ILE A HD13 1 
ATOM   1752  N N    . TYR A 1 126 ? 51.940  153.127 91.572  1.00 34.89  ? 192  TYR A N    1 
ATOM   1753  C CA   . TYR A 1 126 ? 51.644  153.729 92.870  1.00 27.22  ? 192  TYR A CA   1 
ATOM   1754  C C    . TYR A 1 126 ? 51.332  155.213 92.782  1.00 45.17  ? 192  TYR A C    1 
ATOM   1755  O O    . TYR A 1 126 ? 51.249  155.881 93.823  1.00 42.73  ? 192  TYR A O    1 
ATOM   1756  C CB   . TYR A 1 126 ? 52.808  153.570 93.843  1.00 22.13  ? 192  TYR A CB   1 
ATOM   1757  C CG   . TYR A 1 126 ? 53.202  152.156 94.150  1.00 29.16  ? 192  TYR A CG   1 
ATOM   1758  C CD1  . TYR A 1 126 ? 52.401  151.344 94.926  1.00 26.84  ? 192  TYR A CD1  1 
ATOM   1759  C CD2  . TYR A 1 126 ? 54.407  151.643 93.691  1.00 39.64  ? 192  TYR A CD2  1 
ATOM   1760  C CE1  . TYR A 1 126 ? 52.776  150.053 95.211  1.00 29.47  ? 192  TYR A CE1  1 
ATOM   1761  C CE2  . TYR A 1 126 ? 54.783  150.363 93.967  1.00 23.44  ? 192  TYR A CE2  1 
ATOM   1762  C CZ   . TYR A 1 126 ? 53.966  149.572 94.726  1.00 27.24  ? 192  TYR A CZ   1 
ATOM   1763  O OH   . TYR A 1 126 ? 54.352  148.288 94.993  1.00 43.69  ? 192  TYR A OH   1 
ATOM   1764  H H    . TYR A 1 126 ? 52.724  153.321 91.276  1.00 41.87  ? 192  TYR A H    1 
ATOM   1765  H HA   . TYR A 1 126 ? 50.872  153.284 93.253  1.00 32.66  ? 192  TYR A HA   1 
ATOM   1766  H HB2  . TYR A 1 126 ? 53.585  154.014 93.467  1.00 26.56  ? 192  TYR A HB2  1 
ATOM   1767  H HB3  . TYR A 1 126 ? 52.567  153.994 94.681  1.00 26.56  ? 192  TYR A HB3  1 
ATOM   1768  H HD1  . TYR A 1 126 ? 51.593  151.669 95.249  1.00 32.21  ? 192  TYR A HD1  1 
ATOM   1769  H HD2  . TYR A 1 126 ? 54.961  152.178 93.170  1.00 47.56  ? 192  TYR A HD2  1 
ATOM   1770  H HE1  . TYR A 1 126 ? 52.225  149.508 95.725  1.00 35.36  ? 192  TYR A HE1  1 
ATOM   1771  H HE2  . TYR A 1 126 ? 55.588  150.030 93.643  1.00 28.13  ? 192  TYR A HE2  1 
ATOM   1772  H HH   . TYR A 1 126 ? 55.096  148.131 94.635  1.00 52.43  ? 192  TYR A HH   1 
ATOM   1773  N N    . ASP A 1 127 ? 51.180  155.750 91.569  1.00 32.82  ? 193  ASP A N    1 
ATOM   1774  C CA   . ASP A 1 127 ? 50.488  157.015 91.457  1.00 33.73  ? 193  ASP A CA   1 
ATOM   1775  C C    . ASP A 1 127 ? 49.035  156.693 91.819  1.00 60.19  ? 193  ASP A C    1 
ATOM   1776  O O    . ASP A 1 127 ? 48.702  155.551 92.180  1.00 69.71  ? 193  ASP A O    1 
ATOM   1777  C CB   . ASP A 1 127 ? 50.684  157.689 90.090  1.00 30.95  ? 193  ASP A CB   1 
ATOM   1778  C CG   . ASP A 1 127 ? 49.944  157.012 88.944  1.00 50.62  ? 193  ASP A CG   1 
ATOM   1779  O OD1  . ASP A 1 127 ? 48.906  156.347 89.140  1.00 54.26  ? 193  ASP A OD1  1 
ATOM   1780  O OD2  . ASP A 1 127 ? 50.404  157.187 87.798  1.00 39.07  ? 193  ASP A OD2  1 
ATOM   1781  H H    . ASP A 1 127 ? 51.459  155.412 90.830  1.00 39.38  ? 193  ASP A H    1 
ATOM   1782  H HA   . ASP A 1 127 ? 50.834  157.619 92.133  1.00 40.48  ? 193  ASP A HA   1 
ATOM   1783  H HB2  . ASP A 1 127 ? 50.366  158.604 90.146  1.00 37.14  ? 193  ASP A HB2  1 
ATOM   1784  H HB3  . ASP A 1 127 ? 51.630  157.684 89.873  1.00 37.14  ? 193  ASP A HB3  1 
ATOM   1785  N N    . GLU A 1 128 ? 48.160  157.675 91.757  1.00 38.01  ? 194  GLU A N    1 
ATOM   1786  C CA   . GLU A 1 128 ? 46.787  157.435 92.179  1.00 46.15  ? 194  GLU A CA   1 
ATOM   1787  C C    . GLU A 1 128 ? 45.860  157.433 90.979  1.00 47.83  ? 194  GLU A C    1 
ATOM   1788  O O    . GLU A 1 128 ? 44.641  157.426 91.128  1.00 53.69  ? 194  GLU A O    1 
ATOM   1789  C CB   . GLU A 1 128 ? 46.353  158.540 93.135  1.00 72.81  ? 194  GLU A CB   1 
ATOM   1790  C CG   . GLU A 1 128 ? 47.368  158.873 94.249  1.00 71.53  ? 194  GLU A CG   1 
ATOM   1791  C CD   . GLU A 1 128 ? 47.381  157.834 95.350  1.00 77.98  ? 194  GLU A CD   1 
ATOM   1792  O OE1  . GLU A 1 128 ? 46.791  156.758 95.127  1.00 84.47  ? 194  GLU A OE1  1 
ATOM   1793  O OE2  . GLU A 1 128 ? 47.973  158.086 96.430  1.00 80.31  ? 194  GLU A OE2  1 
ATOM   1794  H H    . GLU A 1 128 ? 48.324  158.473 91.483  1.00 45.61  ? 194  GLU A H    1 
ATOM   1795  H HA   . GLU A 1 128 ? 46.722  156.580 92.632  1.00 55.38  ? 194  GLU A HA   1 
ATOM   1796  H HB2  . GLU A 1 128 ? 46.205  159.351 92.623  1.00 87.37  ? 194  GLU A HB2  1 
ATOM   1797  H HB3  . GLU A 1 128 ? 45.526  158.271 93.564  1.00 87.37  ? 194  GLU A HB3  1 
ATOM   1798  H HG2  . GLU A 1 128 ? 48.258  158.915 93.865  1.00 85.84  ? 194  GLU A HG2  1 
ATOM   1799  H HG3  . GLU A 1 128 ? 47.136  159.727 94.644  1.00 85.84  ? 194  GLU A HG3  1 
ATOM   1800  N N    . TYR A 1 129 ? 46.450  157.443 89.790  1.00 44.50  ? 195  TYR A N    1 
ATOM   1801  C CA   . TYR A 1 129 ? 45.721  157.687 88.562  1.00 33.71  ? 195  TYR A CA   1 
ATOM   1802  C C    . TYR A 1 129 ? 45.531  156.438 87.704  1.00 42.14  ? 195  TYR A C    1 
ATOM   1803  O O    . TYR A 1 129 ? 44.415  156.027 87.396  1.00 45.81  ? 195  TYR A O    1 
ATOM   1804  C CB   . TYR A 1 129 ? 46.497  158.721 87.760  1.00 41.65  ? 195  TYR A CB   1 
ATOM   1805  C CG   . TYR A 1 129 ? 45.682  159.524 86.805  1.00 35.05  ? 195  TYR A CG   1 
ATOM   1806  C CD1  . TYR A 1 129 ? 44.564  160.207 87.239  1.00 39.98  ? 195  TYR A CD1  1 
ATOM   1807  C CD2  . TYR A 1 129 ? 46.054  159.639 85.480  1.00 53.99  ? 195  TYR A CD2  1 
ATOM   1808  C CE1  . TYR A 1 129 ? 43.813  160.947 86.380  1.00 50.80  ? 195  TYR A CE1  1 
ATOM   1809  C CE2  . TYR A 1 129 ? 45.314  160.390 84.606  1.00 68.92  ? 195  TYR A CE2  1 
ATOM   1810  C CZ   . TYR A 1 129 ? 44.191  161.043 85.061  1.00 61.28  ? 195  TYR A CZ   1 
ATOM   1811  O OH   . TYR A 1 129 ? 43.450  161.792 84.178  1.00 71.93  ? 195  TYR A OH   1 
ATOM   1812  H H    . TYR A 1 129 ? 47.291  157.308 89.670  1.00 53.40  ? 195  TYR A H    1 
ATOM   1813  H HA   . TYR A 1 129 ? 44.847  158.052 88.771  1.00 40.45  ? 195  TYR A HA   1 
ATOM   1814  H HB2  . TYR A 1 129 ? 46.915  159.340 88.379  1.00 49.98  ? 195  TYR A HB2  1 
ATOM   1815  H HB3  . TYR A 1 129 ? 47.181  158.263 87.247  1.00 49.98  ? 195  TYR A HB3  1 
ATOM   1816  H HD1  . TYR A 1 129 ? 44.304  160.139 88.129  1.00 47.97  ? 195  TYR A HD1  1 
ATOM   1817  H HD2  . TYR A 1 129 ? 46.811  159.193 85.175  1.00 64.79  ? 195  TYR A HD2  1 
ATOM   1818  H HE1  . TYR A 1 129 ? 43.057  161.394 86.684  1.00 60.96  ? 195  TYR A HE1  1 
ATOM   1819  H HE2  . TYR A 1 129 ? 45.565  160.453 83.713  1.00 82.71  ? 195  TYR A HE2  1 
ATOM   1820  H HH   . TYR A 1 129 ? 43.795  161.761 83.413  1.00 86.31  ? 195  TYR A HH   1 
ATOM   1821  N N    . MET A 1 130 ? 46.640  155.835 87.322  1.00 58.58  ? 196  MET A N    1 
ATOM   1822  C CA   . MET A 1 130 ? 46.657  154.818 86.282  1.00 35.84  ? 196  MET A CA   1 
ATOM   1823  C C    . MET A 1 130 ? 45.858  153.555 86.615  1.00 39.36  ? 196  MET A C    1 
ATOM   1824  O O    . MET A 1 130 ? 44.963  153.175 85.873  1.00 44.91  ? 196  MET A O    1 
ATOM   1825  C CB   . MET A 1 130 ? 48.106  154.464 85.989  1.00 44.73  ? 196  MET A CB   1 
ATOM   1826  C CG   . MET A 1 130 ? 48.294  153.655 84.766  1.00 32.64  ? 196  MET A CG   1 
ATOM   1827  S SD   . MET A 1 130 ? 48.336  151.939 85.195  1.00 55.57  ? 196  MET A SD   1 
ATOM   1828  C CE   . MET A 1 130 ? 48.717  151.258 83.575  1.00 64.79  ? 196  MET A CE   1 
ATOM   1829  H H    . MET A 1 130 ? 47.415  155.999 87.655  1.00 70.29  ? 196  MET A H    1 
ATOM   1830  H HA   . MET A 1 130 ? 46.286  155.205 85.473  1.00 43.01  ? 196  MET A HA   1 
ATOM   1831  H HB2  . MET A 1 130 ? 48.612  155.285 85.881  1.00 53.68  ? 196  MET A HB2  1 
ATOM   1832  H HB3  . MET A 1 130 ? 48.460  153.957 86.736  1.00 53.68  ? 196  MET A HB3  1 
ATOM   1833  H HG2  . MET A 1 130 ? 47.553  153.805 84.158  1.00 39.16  ? 196  MET A HG2  1 
ATOM   1834  H HG3  . MET A 1 130 ? 49.136  153.890 84.344  1.00 39.16  ? 196  MET A HG3  1 
ATOM   1835  H HE1  . MET A 1 130 ? 48.776  150.292 83.645  1.00 77.74  ? 196  MET A HE1  1 
ATOM   1836  H HE2  . MET A 1 130 ? 48.012  151.503 82.956  1.00 77.74  ? 196  MET A HE2  1 
ATOM   1837  H HE3  . MET A 1 130 ? 49.565  151.620 83.272  1.00 77.74  ? 196  MET A HE3  1 
ATOM   1838  N N    . MET A 1 131 ? 46.165  152.907 87.729  1.00 41.70  ? 197  MET A N    1 
ATOM   1839  C CA   . MET A 1 131 ? 45.500  151.657 88.071  1.00 32.39  ? 197  MET A CA   1 
ATOM   1840  C C    . MET A 1 131 ? 44.076  151.839 88.520  1.00 37.18  ? 197  MET A C    1 
ATOM   1841  O O    . MET A 1 131 ? 43.254  150.979 88.267  1.00 51.77  ? 197  MET A O    1 
ATOM   1842  C CB   . MET A 1 131 ? 46.256  150.926 89.172  1.00 42.47  ? 197  MET A CB   1 
ATOM   1843  C CG   . MET A 1 131 ? 47.554  150.258 88.693  1.00 66.60  ? 197  MET A CG   1 
ATOM   1844  S SD   . MET A 1 131 ? 47.318  148.931 87.478  1.00 59.24  ? 197  MET A SD   1 
ATOM   1845  C CE   . MET A 1 131 ? 46.211  147.869 88.416  1.00 68.52  ? 197  MET A CE   1 
ATOM   1846  H H    . MET A 1 131 ? 46.751  153.167 88.302  1.00 50.04  ? 197  MET A H    1 
ATOM   1847  H HA   . MET A 1 131 ? 45.503  151.086 87.287  1.00 38.87  ? 197  MET A HA   1 
ATOM   1848  H HB2  . MET A 1 131 ? 46.488  151.561 89.867  1.00 50.96  ? 197  MET A HB2  1 
ATOM   1849  H HB3  . MET A 1 131 ? 45.683  150.233 89.537  1.00 50.96  ? 197  MET A HB3  1 
ATOM   1850  H HG2  . MET A 1 131 ? 48.118  150.933 88.284  1.00 79.92  ? 197  MET A HG2  1 
ATOM   1851  H HG3  . MET A 1 131 ? 48.008  149.876 89.461  1.00 79.92  ? 197  MET A HG3  1 
ATOM   1852  H HE1  . MET A 1 131 ? 45.989  147.092 87.879  1.00 82.22  ? 197  MET A HE1  1 
ATOM   1853  H HE2  . MET A 1 131 ? 46.657  147.592 89.232  1.00 82.22  ? 197  MET A HE2  1 
ATOM   1854  H HE3  . MET A 1 131 ? 45.406  148.365 88.631  1.00 82.22  ? 197  MET A HE3  1 
ATOM   1855  N N    . ASP A 1 132 ? 43.767  152.931 89.205  1.00 43.91  ? 198  ASP A N    1 
ATOM   1856  C CA   . ASP A 1 132 ? 42.398  153.134 89.664  1.00 44.90  ? 198  ASP A CA   1 
ATOM   1857  C C    . ASP A 1 132 ? 41.504  153.329 88.444  1.00 37.26  ? 198  ASP A C    1 
ATOM   1858  O O    . ASP A 1 132 ? 40.375  152.851 88.396  1.00 41.44  ? 198  ASP A O    1 
ATOM   1859  C CB   . ASP A 1 132 ? 42.303  154.311 90.646  1.00 61.14  ? 198  ASP A CB   1 
ATOM   1860  C CG   . ASP A 1 132 ? 43.120  154.072 91.935  1.00 97.38  ? 198  ASP A CG   1 
ATOM   1861  O OD1  . ASP A 1 132 ? 43.510  152.906 92.196  1.00 104.07 ? 198  ASP A OD1  1 
ATOM   1862  O OD2  . ASP A 1 132 ? 43.368  155.046 92.693  1.00 97.27  ? 198  ASP A OD2  1 
ATOM   1863  H H    . ASP A 1 132 ? 44.317  153.559 89.414  1.00 52.69  ? 198  ASP A H    1 
ATOM   1864  H HA   . ASP A 1 132 ? 42.100  152.335 90.127  1.00 53.87  ? 198  ASP A HA   1 
ATOM   1865  H HB2  . ASP A 1 132 ? 42.645  155.110 90.216  1.00 73.36  ? 198  ASP A HB2  1 
ATOM   1866  H HB3  . ASP A 1 132 ? 41.375  154.439 90.897  1.00 73.36  ? 198  ASP A HB3  1 
ATOM   1867  N N    . THR A 1 133 ? 42.038  153.998 87.440  1.00 25.65  ? 199  THR A N    1 
ATOM   1868  C CA   . THR A 1 133 ? 41.334  154.170 86.190  1.00 29.74  ? 199  THR A CA   1 
ATOM   1869  C C    . THR A 1 133 ? 41.087  152.842 85.479  1.00 35.38  ? 199  THR A C    1 
ATOM   1870  O O    . THR A 1 133 ? 39.977  152.532 85.061  1.00 40.07  ? 199  THR A O    1 
ATOM   1871  C CB   . THR A 1 133 ? 42.137  155.069 85.261  1.00 40.57  ? 199  THR A CB   1 
ATOM   1872  O OG1  . THR A 1 133 ? 42.087  156.413 85.759  1.00 53.82  ? 199  THR A OG1  1 
ATOM   1873  C CG2  . THR A 1 133 ? 41.589  155.034 83.825  1.00 45.27  ? 199  THR A CG2  1 
ATOM   1874  H H    . THR A 1 133 ? 42.815  154.367 87.460  1.00 30.78  ? 199  THR A H    1 
ATOM   1875  H HA   . THR A 1 133 ? 40.477  154.591 86.358  1.00 35.68  ? 199  THR A HA   1 
ATOM   1876  H HB   . THR A 1 133 ? 43.060  154.769 85.243  1.00 48.69  ? 199  THR A HB   1 
ATOM   1877  H HG1  . THR A 1 133 ? 42.413  156.446 86.533  1.00 64.58  ? 199  THR A HG1  1 
ATOM   1878  H HG21 . THR A 1 133 ? 42.117  155.614 83.254  1.00 54.32  ? 199  THR A HG21 1 
ATOM   1879  H HG22 . THR A 1 133 ? 41.628  154.130 83.477  1.00 54.32  ? 199  THR A HG22 1 
ATOM   1880  H HG23 . THR A 1 133 ? 40.667  155.336 83.814  1.00 54.32  ? 199  THR A HG23 1 
ATOM   1881  N N    . VAL A 1 134 ? 42.139  152.066 85.311  1.00 37.48  ? 200  VAL A N    1 
ATOM   1882  C CA   . VAL A 1 134 ? 42.024  150.810 84.604  1.00 32.75  ? 200  VAL A CA   1 
ATOM   1883  C C    . VAL A 1 134 ? 41.083  149.876 85.354  1.00 36.65  ? 200  VAL A C    1 
ATOM   1884  O O    . VAL A 1 134 ? 40.318  149.125 84.749  1.00 48.06  ? 200  VAL A O    1 
ATOM   1885  C CB   . VAL A 1 134 ? 43.417  150.162 84.416  1.00 31.11  ? 200  VAL A CB   1 
ATOM   1886  C CG1  . VAL A 1 134 ? 43.311  148.718 83.936  1.00 33.11  ? 200  VAL A CG1  1 
ATOM   1887  C CG2  . VAL A 1 134 ? 44.236  150.979 83.442  1.00 26.11  ? 200  VAL A CG2  1 
ATOM   1888  H H    . VAL A 1 134 ? 42.931  152.245 85.595  1.00 44.98  ? 200  VAL A H    1 
ATOM   1889  H HA   . VAL A 1 134 ? 41.648  150.974 83.725  1.00 39.30  ? 200  VAL A HA   1 
ATOM   1890  H HB   . VAL A 1 134 ? 43.881  150.161 85.268  1.00 37.34  ? 200  VAL A HB   1 
ATOM   1891  H HG11 . VAL A 1 134 ? 44.204  148.354 83.832  1.00 39.73  ? 200  VAL A HG11 1 
ATOM   1892  H HG12 . VAL A 1 134 ? 42.818  148.203 84.593  1.00 39.73  ? 200  VAL A HG12 1 
ATOM   1893  H HG13 . VAL A 1 134 ? 42.846  148.702 83.085  1.00 39.73  ? 200  VAL A HG13 1 
ATOM   1894  H HG21 . VAL A 1 134 ? 45.105  150.562 83.334  1.00 31.33  ? 200  VAL A HG21 1 
ATOM   1895  H HG22 . VAL A 1 134 ? 43.774  151.008 82.590  1.00 31.33  ? 200  VAL A HG22 1 
ATOM   1896  H HG23 . VAL A 1 134 ? 44.341  151.877 83.794  1.00 31.33  ? 200  VAL A HG23 1 
ATOM   1897  N N    . ILE A 1 135 ? 41.119  149.926 86.675  1.00 34.29  ? 201  ILE A N    1 
ATOM   1898  C CA   . ILE A 1 135 ? 40.373  148.953 87.453  1.00 23.43  ? 201  ILE A CA   1 
ATOM   1899  C C    . ILE A 1 135 ? 38.897  149.258 87.388  1.00 34.02  ? 201  ILE A C    1 
ATOM   1900  O O    . ILE A 1 135 ? 38.082  148.348 87.248  1.00 40.06  ? 201  ILE A O    1 
ATOM   1901  C CB   . ILE A 1 135 ? 40.877  148.872 88.894  1.00 24.25  ? 201  ILE A CB   1 
ATOM   1902  C CG1  . ILE A 1 135 ? 42.210  148.117 88.887  1.00 23.59  ? 201  ILE A CG1  1 
ATOM   1903  C CG2  . ILE A 1 135 ? 39.864  148.174 89.793  1.00 13.46  ? 201  ILE A CG2  1 
ATOM   1904  C CD1  . ILE A 1 135 ? 42.828  147.887 90.216  1.00 30.55  ? 201  ILE A CD1  1 
ATOM   1905  H H    . ILE A 1 135 ? 41.558  150.502 87.139  1.00 41.15  ? 201  ILE A H    1 
ATOM   1906  H HA   . ILE A 1 135 ? 40.504  148.079 87.053  1.00 28.12  ? 201  ILE A HA   1 
ATOM   1907  H HB   . ILE A 1 135 ? 41.026  149.771 89.227  1.00 29.10  ? 201  ILE A HB   1 
ATOM   1908  H HG12 . ILE A 1 135 ? 42.067  147.249 88.479  1.00 28.30  ? 201  ILE A HG12 1 
ATOM   1909  H HG13 . ILE A 1 135 ? 42.845  148.623 88.356  1.00 28.30  ? 201  ILE A HG13 1 
ATOM   1910  H HG21 . ILE A 1 135 ? 40.215  148.140 90.696  1.00 16.15  ? 201  ILE A HG21 1 
ATOM   1911  H HG22 . ILE A 1 135 ? 39.033  148.674 89.779  1.00 16.15  ? 201  ILE A HG22 1 
ATOM   1912  H HG23 . ILE A 1 135 ? 39.716  147.275 89.461  1.00 16.15  ? 201  ILE A HG23 1 
ATOM   1913  H HD11 . ILE A 1 135 ? 43.661  147.405 90.096  1.00 36.66  ? 201  ILE A HD11 1 
ATOM   1914  H HD12 . ILE A 1 135 ? 42.998  148.744 90.637  1.00 36.66  ? 201  ILE A HD12 1 
ATOM   1915  H HD13 . ILE A 1 135 ? 42.218  147.365 90.760  1.00 36.66  ? 201  ILE A HD13 1 
ATOM   1916  N N    . SER A 1 136 ? 38.549  150.539 87.456  1.00 35.19  ? 202  SER A N    1 
ATOM   1917  C CA   . SER A 1 136 ? 37.154  150.932 87.432  1.00 22.79  ? 202  SER A CA   1 
ATOM   1918  C C    . SER A 1 136 ? 36.487  150.579 86.128  1.00 35.32  ? 202  SER A C    1 
ATOM   1919  O O    . SER A 1 136 ? 35.323  150.184 86.109  1.00 50.45  ? 202  SER A O    1 
ATOM   1920  C CB   . SER A 1 136 ? 37.033  152.413 87.662  1.00 30.10  ? 202  SER A CB   1 
ATOM   1921  O OG   . SER A 1 136 ? 37.413  152.684 88.984  1.00 49.13  ? 202  SER A OG   1 
ATOM   1922  H H    . SER A 1 136 ? 39.103  151.194 87.516  1.00 42.22  ? 202  SER A H    1 
ATOM   1923  H HA   . SER A 1 136 ? 36.683  150.475 88.146  1.00 27.35  ? 202  SER A HA   1 
ATOM   1924  H HB2  . SER A 1 136 ? 37.622  152.885 87.053  1.00 36.12  ? 202  SER A HB2  1 
ATOM   1925  H HB3  . SER A 1 136 ? 36.113  152.688 87.527  1.00 36.12  ? 202  SER A HB3  1 
ATOM   1926  H HG   . SER A 1 136 ? 38.206  152.440 89.111  1.00 58.96  ? 202  SER A HG   1 
ATOM   1927  N N    . LEU A 1 137 ? 37.214  150.734 85.032  1.00 30.34  ? 203  LEU A N    1 
ATOM   1928  C CA   . LEU A 1 137 ? 36.665  150.408 83.732  1.00 28.74  ? 203  LEU A CA   1 
ATOM   1929  C C    . LEU A 1 137 ? 36.478  148.899 83.599  1.00 47.19  ? 203  LEU A C    1 
ATOM   1930  O O    . LEU A 1 137 ? 35.462  148.428 83.083  1.00 52.15  ? 203  LEU A O    1 
ATOM   1931  C CB   . LEU A 1 137 ? 37.586  150.896 82.627  1.00 29.52  ? 203  LEU A CB   1 
ATOM   1932  C CG   . LEU A 1 137 ? 37.043  150.619 81.232  1.00 37.29  ? 203  LEU A CG   1 
ATOM   1933  C CD1  . LEU A 1 137 ? 36.008  151.656 80.903  1.00 38.36  ? 203  LEU A CD1  1 
ATOM   1934  C CD2  . LEU A 1 137 ? 38.162  150.592 80.206  1.00 51.25  ? 203  LEU A CD2  1 
ATOM   1935  H H    . LEU A 1 137 ? 38.023  151.024 85.016  1.00 36.41  ? 203  LEU A H    1 
ATOM   1936  H HA   . LEU A 1 137 ? 35.801  150.837 83.627  1.00 34.49  ? 203  LEU A HA   1 
ATOM   1937  H HB2  . LEU A 1 137 ? 37.704  151.855 82.716  1.00 35.43  ? 203  LEU A HB2  1 
ATOM   1938  H HB3  . LEU A 1 137 ? 38.442  150.448 82.709  1.00 35.43  ? 203  LEU A HB3  1 
ATOM   1939  H HG   . LEU A 1 137 ? 36.610  149.751 81.227  1.00 44.75  ? 203  LEU A HG   1 
ATOM   1940  H HD11 . LEU A 1 137 ? 35.660  151.483 80.015  1.00 46.03  ? 203  LEU A HD11 1 
ATOM   1941  H HD12 . LEU A 1 137 ? 35.292  151.605 81.556  1.00 46.03  ? 203  LEU A HD12 1 
ATOM   1942  H HD13 . LEU A 1 137 ? 36.421  152.534 80.932  1.00 46.03  ? 203  LEU A HD13 1 
ATOM   1943  H HD21 . LEU A 1 137 ? 37.783  150.413 79.331  1.00 61.50  ? 203  LEU A HD21 1 
ATOM   1944  H HD22 . LEU A 1 137 ? 38.609  151.453 80.204  1.00 61.50  ? 203  LEU A HD22 1 
ATOM   1945  H HD23 . LEU A 1 137 ? 38.790  149.892 80.444  1.00 61.50  ? 203  LEU A HD23 1 
ATOM   1946  N N    . LEU A 1 138 ? 37.466  148.134 84.045  1.00 38.36  ? 204  LEU A N    1 
ATOM   1947  C CA   . LEU A 1 138 ? 37.357  146.691 83.966  1.00 43.23  ? 204  LEU A CA   1 
ATOM   1948  C C    . LEU A 1 138 ? 36.270  146.207 84.900  1.00 39.15  ? 204  LEU A C    1 
ATOM   1949  O O    . LEU A 1 138 ? 35.588  145.227 84.607  1.00 49.42  ? 204  LEU A O    1 
ATOM   1950  C CB   . LEU A 1 138 ? 38.681  146.016 84.301  1.00 36.98  ? 204  LEU A CB   1 
ATOM   1951  C CG   . LEU A 1 138 ? 39.820  146.234 83.310  1.00 32.73  ? 204  LEU A CG   1 
ATOM   1952  C CD1  . LEU A 1 138 ? 40.792  145.095 83.466  1.00 40.71  ? 204  LEU A CD1  1 
ATOM   1953  C CD2  . LEU A 1 138 ? 39.343  146.326 81.865  1.00 31.68  ? 204  LEU A CD2  1 
ATOM   1954  H H    . LEU A 1 138 ? 38.197  148.423 84.393  1.00 46.03  ? 204  LEU A H    1 
ATOM   1955  H HA   . LEU A 1 138 ? 37.112  146.440 83.061  1.00 51.88  ? 204  LEU A HA   1 
ATOM   1956  H HB2  . LEU A 1 138 ? 38.981  146.346 85.162  1.00 44.38  ? 204  LEU A HB2  1 
ATOM   1957  H HB3  . LEU A 1 138 ? 38.528  145.060 84.359  1.00 44.38  ? 204  LEU A HB3  1 
ATOM   1958  H HG   . LEU A 1 138 ? 40.281  147.058 83.530  1.00 39.27  ? 204  LEU A HG   1 
ATOM   1959  H HD11 . LEU A 1 138 ? 41.525  145.217 82.842  1.00 48.86  ? 204  LEU A HD11 1 
ATOM   1960  H HD12 . LEU A 1 138 ? 41.129  145.090 84.376  1.00 48.86  ? 204  LEU A HD12 1 
ATOM   1961  H HD13 . LEU A 1 138 ? 40.334  144.261 83.279  1.00 48.86  ? 204  LEU A HD13 1 
ATOM   1962  H HD21 . LEU A 1 138 ? 40.111  146.464 81.288  1.00 38.02  ? 204  LEU A HD21 1 
ATOM   1963  H HD22 . LEU A 1 138 ? 38.895  145.500 81.628  1.00 38.02  ? 204  LEU A HD22 1 
ATOM   1964  H HD23 . LEU A 1 138 ? 38.729  147.072 81.783  1.00 38.02  ? 204  LEU A HD23 1 
ATOM   1965  N N    . THR A 1 139 ? 36.091  146.894 86.016  1.00 25.58  ? 205  THR A N    1 
ATOM   1966  C CA   . THR A 1 139 ? 35.071  146.480 86.960  1.00 36.41  ? 205  THR A CA   1 
ATOM   1967  C C    . THR A 1 139 ? 33.682  146.794 86.424  1.00 35.54  ? 205  THR A C    1 
ATOM   1968  O O    . THR A 1 139 ? 32.753  146.034 86.639  1.00 39.80  ? 205  THR A O    1 
ATOM   1969  C CB   . THR A 1 139 ? 35.254  147.153 88.309  1.00 36.21  ? 205  THR A CB   1 
ATOM   1970  O OG1  . THR A 1 139 ? 36.611  147.001 88.717  1.00 30.71  ? 205  THR A OG1  1 
ATOM   1971  C CG2  . THR A 1 139 ? 34.365  146.509 89.345  1.00 24.65  ? 205  THR A CG2  1 
ATOM   1972  H H    . THR A 1 139 ? 36.537  147.592 86.247  1.00 30.69  ? 205  THR A H    1 
ATOM   1973  H HA   . THR A 1 139 ? 35.132  145.521 87.092  1.00 43.69  ? 205  THR A HA   1 
ATOM   1974  H HB   . THR A 1 139 ? 35.032  148.095 88.243  1.00 43.46  ? 205  THR A HB   1 
ATOM   1975  H HG1  . THR A 1 139 ? 37.122  147.356 88.154  1.00 36.85  ? 205  THR A HG1  1 
ATOM   1976  H HG21 . THR A 1 139 ? 34.488  146.944 90.204  1.00 29.58  ? 205  THR A HG21 1 
ATOM   1977  H HG22 . THR A 1 139 ? 33.435  146.590 89.081  1.00 29.58  ? 205  THR A HG22 1 
ATOM   1978  H HG23 . THR A 1 139 ? 34.587  145.569 89.434  1.00 29.58  ? 205  THR A HG23 1 
ATOM   1979  N N    . GLY A 1 140 ? 33.549  147.908 85.718  1.00 42.01  ? 206  GLY A N    1 
ATOM   1980  C CA   . GLY A 1 140 ? 32.263  148.325 85.202  1.00 14.66  ? 206  GLY A CA   1 
ATOM   1981  C C    . GLY A 1 140 ? 31.873  147.475 84.020  1.00 35.12  ? 206  GLY A C    1 
ATOM   1982  O O    . GLY A 1 140 ? 30.746  147.017 83.928  1.00 32.17  ? 206  GLY A O    1 
ATOM   1983  H H    . GLY A 1 140 ? 34.195  148.441 85.524  1.00 50.41  ? 206  GLY A H    1 
ATOM   1984  H HA2  . GLY A 1 140 ? 31.586  148.234 85.891  1.00 17.59  ? 206  GLY A HA2  1 
ATOM   1985  H HA3  . GLY A 1 140 ? 32.304  149.252 84.923  1.00 17.59  ? 206  GLY A HA3  1 
ATOM   1986  N N    . LEU A 1 141 ? 32.824  147.269 83.115  1.00 40.22  ? 207  LEU A N    1 
ATOM   1987  C CA   . LEU A 1 141 ? 32.641  146.406 81.957  1.00 30.16  ? 207  LEU A CA   1 
ATOM   1988  C C    . LEU A 1 141 ? 32.297  144.978 82.351  1.00 36.37  ? 207  LEU A C    1 
ATOM   1989  O O    . LEU A 1 141 ? 31.507  144.322 81.678  1.00 41.36  ? 207  LEU A O    1 
ATOM   1990  C CB   . LEU A 1 141 ? 33.916  146.386 81.115  1.00 28.14  ? 207  LEU A CB   1 
ATOM   1991  C CG   . LEU A 1 141 ? 34.219  147.650 80.314  1.00 37.54  ? 207  LEU A CG   1 
ATOM   1992  C CD1  . LEU A 1 141 ? 35.639  147.642 79.829  1.00 33.93  ? 207  LEU A CD1  1 
ATOM   1993  C CD2  . LEU A 1 141 ? 33.268  147.791 79.128  1.00 43.98  ? 207  LEU A CD2  1 
ATOM   1994  H H    . LEU A 1 141 ? 33.604  147.628 83.154  1.00 48.27  ? 207  LEU A H    1 
ATOM   1995  H HA   . LEU A 1 141 ? 31.919  146.753 81.410  1.00 36.19  ? 207  LEU A HA   1 
ATOM   1996  H HB2  . LEU A 1 141 ? 34.669  146.232 81.707  1.00 33.77  ? 207  LEU A HB2  1 
ATOM   1997  H HB3  . LEU A 1 141 ? 33.850  145.653 80.482  1.00 33.77  ? 207  LEU A HB3  1 
ATOM   1998  H HG   . LEU A 1 141 ? 34.102  148.424 80.887  1.00 45.04  ? 207  LEU A HG   1 
ATOM   1999  H HD11 . LEU A 1 141 ? 35.805  148.453 79.325  1.00 40.72  ? 207  LEU A HD11 1 
ATOM   2000  H HD12 . LEU A 1 141 ? 36.233  147.600 80.595  1.00 40.72  ? 207  LEU A HD12 1 
ATOM   2001  H HD13 . LEU A 1 141 ? 35.774  146.866 79.263  1.00 40.72  ? 207  LEU A HD13 1 
ATOM   2002  H HD21 . LEU A 1 141 ? 33.488  148.601 78.643  1.00 52.78  ? 207  LEU A HD21 1 
ATOM   2003  H HD22 . LEU A 1 141 ? 33.370  147.020 78.549  1.00 52.78  ? 207  LEU A HD22 1 
ATOM   2004  H HD23 . LEU A 1 141 ? 32.358  147.839 79.459  1.00 52.78  ? 207  LEU A HD23 1 
ATOM   2005  N N    . SER A 1 142 ? 32.899  144.479 83.423  1.00 30.53  ? 208  SER A N    1 
ATOM   2006  C CA   . SER A 1 142 ? 32.627  143.106 83.838  1.00 38.29  ? 208  SER A CA   1 
ATOM   2007  C C    . SER A 1 142 ? 31.228  142.991 84.450  1.00 42.94  ? 208  SER A C    1 
ATOM   2008  O O    . SER A 1 142 ? 30.718  141.895 84.694  1.00 37.08  ? 208  SER A O    1 
ATOM   2009  C CB   . SER A 1 142 ? 33.667  142.618 84.838  1.00 29.18  ? 208  SER A CB   1 
ATOM   2010  O OG   . SER A 1 142 ? 33.411  143.171 86.114  1.00 37.83  ? 208  SER A OG   1 
ATOM   2011  H H    . SER A 1 142 ? 33.459  144.903 83.919  1.00 36.63  ? 208  SER A H    1 
ATOM   2012  H HA   . SER A 1 142 ? 32.664  142.528 83.060  1.00 45.95  ? 208  SER A HA   1 
ATOM   2013  H HB2  . SER A 1 142 ? 33.623  141.651 84.896  1.00 35.02  ? 208  SER A HB2  1 
ATOM   2014  H HB3  . SER A 1 142 ? 34.548  142.895 84.542  1.00 35.02  ? 208  SER A HB3  1 
ATOM   2015  H HG   . SER A 1 142 ? 33.444  144.009 86.076  1.00 45.39  ? 208  SER A HG   1 
ATOM   2016  N N    . ASP A 1 143 ? 30.613  144.128 84.723  1.00 27.77  ? 209  ASP A N    1 
ATOM   2017  C CA   . ASP A 1 143 ? 29.264  144.120 85.252  1.00 35.67  ? 209  ASP A CA   1 
ATOM   2018  C C    . ASP A 1 143 ? 28.197  144.214 84.122  1.00 45.73  ? 209  ASP A C    1 
ATOM   2019  O O    . ASP A 1 143 ? 26.997  144.157 84.379  1.00 30.34  ? 209  ASP A O    1 
ATOM   2020  C CB   . ASP A 1 143 ? 29.109  145.258 86.260  1.00 35.78  ? 209  ASP A CB   1 
ATOM   2021  C CG   . ASP A 1 143 ? 27.826  145.151 87.077  1.00 57.76  ? 209  ASP A CG   1 
ATOM   2022  O OD1  . ASP A 1 143 ? 27.502  144.042 87.586  1.00 60.26  ? 209  ASP A OD1  1 
ATOM   2023  O OD2  . ASP A 1 143 ? 27.140  146.188 87.205  1.00 58.73  ? 209  ASP A OD2  1 
ATOM   2024  H H    . ASP A 1 143 ? 30.951  144.911 84.612  1.00 33.32  ? 209  ASP A H    1 
ATOM   2025  H HA   . ASP A 1 143 ? 29.120  143.285 85.725  1.00 42.81  ? 209  ASP A HA   1 
ATOM   2026  H HB2  . ASP A 1 143 ? 29.858  145.239 86.876  1.00 42.94  ? 209  ASP A HB2  1 
ATOM   2027  H HB3  . ASP A 1 143 ? 29.091  146.102 85.784  1.00 42.94  ? 209  ASP A HB3  1 
ATOM   2028  N N    . SER A 1 144 ? 28.652  144.330 82.877  1.00 31.01  ? 210  SER A N    1 
ATOM   2029  C CA   . SER A 1 144 ? 27.779  144.621 81.757  1.00 24.15  ? 210  SER A CA   1 
ATOM   2030  C C    . SER A 1 144 ? 26.975  143.399 81.324  1.00 31.58  ? 210  SER A C    1 
ATOM   2031  O O    . SER A 1 144 ? 27.452  142.277 81.358  1.00 39.67  ? 210  SER A O    1 
ATOM   2032  C CB   . SER A 1 144 ? 28.610  145.130 80.574  1.00 24.58  ? 210  SER A CB   1 
ATOM   2033  O OG   . SER A 1 144 ? 27.786  145.496 79.477  1.00 40.15  ? 210  SER A OG   1 
ATOM   2034  H H    . SER A 1 144 ? 29.479  144.241 82.657  1.00 37.21  ? 210  SER A H    1 
ATOM   2035  H HA   . SER A 1 144 ? 27.156  145.319 82.012  1.00 28.98  ? 210  SER A HA   1 
ATOM   2036  H HB2  . SER A 1 144 ? 29.117  145.906 80.858  1.00 29.50  ? 210  SER A HB2  1 
ATOM   2037  H HB3  . SER A 1 144 ? 29.216  144.427 80.291  1.00 29.50  ? 210  SER A HB3  1 
ATOM   2038  H HG   . SER A 1 144 ? 28.260  145.771 78.841  1.00 48.18  ? 210  SER A HG   1 
ATOM   2039  N N    . GLN A 1 145 ? 25.743  143.618 80.897  1.00 33.42  ? 211  GLN A N    1 
ATOM   2040  C CA   . GLN A 1 145 ? 24.964  142.533 80.334  1.00 41.04  ? 211  GLN A CA   1 
ATOM   2041  C C    . GLN A 1 145 ? 25.469  142.209 78.947  1.00 42.78  ? 211  GLN A C    1 
ATOM   2042  O O    . GLN A 1 145 ? 25.214  141.126 78.427  1.00 41.75  ? 211  GLN A O    1 
ATOM   2043  C CB   . GLN A 1 145 ? 23.500  142.911 80.245  1.00 53.94  ? 211  GLN A CB   1 
ATOM   2044  C CG   . GLN A 1 145 ? 22.825  143.040 81.586  1.00 60.21  ? 211  GLN A CG   1 
ATOM   2045  C CD   . GLN A 1 145 ? 21.393  143.484 81.430  1.00 71.37  ? 211  GLN A CD   1 
ATOM   2046  O OE1  . GLN A 1 145 ? 20.705  143.069 80.489  1.00 60.59  ? 211  GLN A OE1  1 
ATOM   2047  N NE2  . GLN A 1 145 ? 20.940  144.357 82.332  1.00 78.02  ? 211  GLN A NE2  1 
ATOM   2048  H H    . GLN A 1 145 ? 25.339  144.377 80.921  1.00 40.11  ? 211  GLN A H    1 
ATOM   2049  H HA   . GLN A 1 145 ? 25.051  141.744 80.891  1.00 49.25  ? 211  GLN A HA   1 
ATOM   2050  H HB2  . GLN A 1 145 ? 23.424  143.765 79.791  1.00 64.73  ? 211  GLN A HB2  1 
ATOM   2051  H HB3  . GLN A 1 145 ? 23.030  142.227 79.741  1.00 64.73  ? 211  GLN A HB3  1 
ATOM   2052  H HG2  . GLN A 1 145 ? 22.832  142.180 82.034  1.00 72.25  ? 211  GLN A HG2  1 
ATOM   2053  H HG3  . GLN A 1 145 ? 23.294  143.701 82.119  1.00 72.25  ? 211  GLN A HG3  1 
ATOM   2054  H HE21 . GLN A 1 145 ? 21.458  144.636 82.959  1.00 93.63  ? 211  GLN A HE21 1 
ATOM   2055  H HE22 . GLN A 1 145 ? 20.129  144.640 82.286  1.00 93.63  ? 211  GLN A HE22 1 
ATOM   2056  N N    . VAL A 1 146 ? 26.179  143.152 78.337  1.00 33.08  ? 212  VAL A N    1 
ATOM   2057  C CA   . VAL A 1 146 ? 26.813  142.880 77.054  1.00 37.22  ? 212  VAL A CA   1 
ATOM   2058  C C    . VAL A 1 146 ? 27.919  141.846 77.272  1.00 44.15  ? 212  VAL A C    1 
ATOM   2059  O O    . VAL A 1 146 ? 28.828  142.046 78.073  1.00 35.12  ? 212  VAL A O    1 
ATOM   2060  C CB   . VAL A 1 146 ? 27.422  144.134 76.437  1.00 32.38  ? 212  VAL A CB   1 
ATOM   2061  C CG1  . VAL A 1 146 ? 27.998  143.815 75.067  1.00 45.11  ? 212  VAL A CG1  1 
ATOM   2062  C CG2  . VAL A 1 146 ? 26.391  145.236 76.340  1.00 50.37  ? 212  VAL A CG2  1 
ATOM   2063  H H    . VAL A 1 146 ? 26.308  143.946 78.640  1.00 39.69  ? 212  VAL A H    1 
ATOM   2064  H HA   . VAL A 1 146 ? 26.160  142.513 76.436  1.00 44.66  ? 212  VAL A HA   1 
ATOM   2065  H HB   . VAL A 1 146 ? 28.145  144.447 77.003  1.00 38.86  ? 212  VAL A HB   1 
ATOM   2066  H HG11 . VAL A 1 146 ? 28.380  144.623 74.690  1.00 54.14  ? 212  VAL A HG11 1 
ATOM   2067  H HG12 . VAL A 1 146 ? 28.685  143.137 75.164  1.00 54.14  ? 212  VAL A HG12 1 
ATOM   2068  H HG13 . VAL A 1 146 ? 27.287  143.487 74.495  1.00 54.14  ? 212  VAL A HG13 1 
ATOM   2069  H HG21 . VAL A 1 146 ? 26.805  146.020 75.946  1.00 60.44  ? 212  VAL A HG21 1 
ATOM   2070  H HG22 . VAL A 1 146 ? 25.657  144.934 75.784  1.00 60.44  ? 212  VAL A HG22 1 
ATOM   2071  H HG23 . VAL A 1 146 ? 26.068  145.445 77.231  1.00 60.44  ? 212  VAL A HG23 1 
ATOM   2072  N N    . ARG A 1 147 ? 27.845  140.730 76.562  1.00 38.55  ? 213  ARG A N    1 
ATOM   2073  C CA   . ARG A 1 147 ? 28.770  139.650 76.826  1.00 36.81  ? 213  ARG A CA   1 
ATOM   2074  C C    . ARG A 1 147 ? 30.172  139.982 76.342  1.00 34.42  ? 213  ARG A C    1 
ATOM   2075  O O    . ARG A 1 147 ? 31.153  139.670 77.012  1.00 39.74  ? 213  ARG A O    1 
ATOM   2076  C CB   . ARG A 1 147 ? 28.298  138.338 76.208  1.00 41.92  ? 213  ARG A CB   1 
ATOM   2077  C CG   . ARG A 1 147 ? 29.039  137.148 76.795  1.00 26.10  ? 213  ARG A CG   1 
ATOM   2078  C CD   . ARG A 1 147 ? 28.624  135.869 76.159  1.00 35.63  ? 213  ARG A CD   1 
ATOM   2079  N NE   . ARG A 1 147 ? 27.268  135.524 76.546  1.00 43.79  ? 213  ARG A NE   1 
ATOM   2080  C CZ   . ARG A 1 147 ? 26.487  134.686 75.874  1.00 47.70  ? 213  ARG A CZ   1 
ATOM   2081  N NH1  . ARG A 1 147 ? 26.914  134.109 74.751  1.00 54.25  ? 213  ARG A NH1  1 
ATOM   2082  N NH2  . ARG A 1 147 ? 25.264  134.444 76.319  1.00 37.49  ? 213  ARG A NH2  1 
ATOM   2083  H H    . ARG A 1 147 ? 27.278  140.578 75.934  1.00 46.25  ? 213  ARG A H    1 
ATOM   2084  H HA   . ARG A 1 147 ? 28.819  139.517 77.786  1.00 44.17  ? 213  ARG A HA   1 
ATOM   2085  H HB2  . ARG A 1 147 ? 27.351  138.224 76.383  1.00 50.31  ? 213  ARG A HB2  1 
ATOM   2086  H HB3  . ARG A 1 147 ? 28.463  138.358 75.252  1.00 50.31  ? 213  ARG A HB3  1 
ATOM   2087  H HG2  . ARG A 1 147 ? 29.991  137.263 76.651  1.00 31.32  ? 213  ARG A HG2  1 
ATOM   2088  H HG3  . ARG A 1 147 ? 28.848  137.091 77.744  1.00 31.32  ? 213  ARG A HG3  1 
ATOM   2089  H HD2  . ARG A 1 147 ? 28.653  135.964 75.194  1.00 42.75  ? 213  ARG A HD2  1 
ATOM   2090  H HD3  . ARG A 1 147 ? 29.216  135.158 76.448  1.00 42.75  ? 213  ARG A HD3  1 
ATOM   2091  H HE   . ARG A 1 147 ? 26.950  135.885 77.258  1.00 52.55  ? 213  ARG A HE   1 
ATOM   2092  H HH11 . ARG A 1 147 ? 27.708  134.268 74.461  1.00 65.09  ? 213  ARG A HH11 1 
ATOM   2093  H HH12 . ARG A 1 147 ? 26.400  133.570 74.321  1.00 65.09  ? 213  ARG A HH12 1 
ATOM   2094  H HH21 . ARG A 1 147 ? 24.987  134.819 77.041  1.00 44.98  ? 213  ARG A HH21 1 
ATOM   2095  H HH22 . ARG A 1 147 ? 24.749  133.906 75.888  1.00 44.98  ? 213  ARG A HH22 1 
ATOM   2096  N N    . ALA A 1 148 ? 30.280  140.626 75.191  1.00 29.23  ? 214  ALA A N    1 
ATOM   2097  C CA   . ALA A 1 148 ? 31.597  140.941 74.655  1.00 32.02  ? 214  ALA A CA   1 
ATOM   2098  C C    . ALA A 1 148 ? 32.394  141.795 75.647  1.00 42.71  ? 214  ALA A C    1 
ATOM   2099  O O    . ALA A 1 148 ? 33.617  141.646 75.754  1.00 45.17  ? 214  ALA A O    1 
ATOM   2100  C CB   . ALA A 1 148 ? 31.487  141.630 73.321  1.00 22.35  ? 214  ALA A CB   1 
ATOM   2101  H H    . ALA A 1 148 ? 29.620  140.888 74.707  1.00 35.08  ? 214  ALA A H    1 
ATOM   2102  H HA   . ALA A 1 148 ? 32.084  140.113 74.520  1.00 38.43  ? 214  ALA A HA   1 
ATOM   2103  H HB1  . ALA A 1 148 ? 32.379  141.825 72.993  1.00 26.83  ? 214  ALA A HB1  1 
ATOM   2104  H HB2  . ALA A 1 148 ? 31.027  141.045 72.700  1.00 26.83  ? 214  ALA A HB2  1 
ATOM   2105  H HB3  . ALA A 1 148 ? 30.988  142.454 73.432  1.00 26.83  ? 214  ALA A HB3  1 
ATOM   2106  N N    . PHE A 1 149 ? 31.717  142.678 76.383  1.00 34.81  ? 215  PHE A N    1 
ATOM   2107  C CA   . PHE A 1 149 ? 32.399  143.435 77.434  1.00 35.70  ? 215  PHE A CA   1 
ATOM   2108  C C    . PHE A 1 149 ? 32.620  142.558 78.665  1.00 34.61  ? 215  PHE A C    1 
ATOM   2109  O O    . PHE A 1 149 ? 33.714  142.509 79.217  1.00 36.08  ? 215  PHE A O    1 
ATOM   2110  C CB   . PHE A 1 149 ? 31.623  144.694 77.834  1.00 27.74  ? 215  PHE A CB   1 
ATOM   2111  C CG   . PHE A 1 149 ? 31.545  145.747 76.759  1.00 34.38  ? 215  PHE A CG   1 
ATOM   2112  C CD1  . PHE A 1 149 ? 32.496  145.824 75.762  1.00 41.67  ? 215  PHE A CD1  1 
ATOM   2113  C CD2  . PHE A 1 149 ? 30.520  146.675 76.763  1.00 35.11  ? 215  PHE A CD2  1 
ATOM   2114  C CE1  . PHE A 1 149 ? 32.416  146.794 74.778  1.00 47.14  ? 215  PHE A CE1  1 
ATOM   2115  C CE2  . PHE A 1 149 ? 30.433  147.639 75.788  1.00 36.40  ? 215  PHE A CE2  1 
ATOM   2116  C CZ   . PHE A 1 149 ? 31.384  147.703 74.796  1.00 45.43  ? 215  PHE A CZ   1 
ATOM   2117  H H    . PHE A 1 149 ? 30.880  142.855 76.298  1.00 41.77  ? 215  PHE A H    1 
ATOM   2118  H HA   . PHE A 1 149 ? 33.269  143.713 77.106  1.00 42.84  ? 215  PHE A HA   1 
ATOM   2119  H HB2  . PHE A 1 149 ? 30.716  144.439 78.063  1.00 33.28  ? 215  PHE A HB2  1 
ATOM   2120  H HB3  . PHE A 1 149 ? 32.055  145.092 78.605  1.00 33.28  ? 215  PHE A HB3  1 
ATOM   2121  H HD1  . PHE A 1 149 ? 33.193  145.210 75.744  1.00 50.00  ? 215  PHE A HD1  1 
ATOM   2122  H HD2  . PHE A 1 149 ? 29.871  146.637 77.428  1.00 42.13  ? 215  PHE A HD2  1 
ATOM   2123  H HE1  . PHE A 1 149 ? 33.060  146.833 74.110  1.00 56.56  ? 215  PHE A HE1  1 
ATOM   2124  H HE2  . PHE A 1 149 ? 29.736  148.254 75.802  1.00 43.67  ? 215  PHE A HE2  1 
ATOM   2125  H HZ   . PHE A 1 149 ? 31.328  148.358 74.138  1.00 54.52  ? 215  PHE A HZ   1 
ATOM   2126  N N    . ARG A 1 150 ? 31.590  141.851 79.098  1.00 28.85  ? 216  ARG A N    1 
ATOM   2127  C CA   . ARG A 1 150 ? 31.721  141.088 80.322  1.00 27.62  ? 216  ARG A CA   1 
ATOM   2128  C C    . ARG A 1 150 ? 32.796  140.011 80.182  1.00 32.48  ? 216  ARG A C    1 
ATOM   2129  O O    . ARG A 1 150 ? 33.599  139.803 81.085  1.00 40.36  ? 216  ARG A O    1 
ATOM   2130  C CB   . ARG A 1 150 ? 30.394  140.470 80.734  1.00 24.72  ? 216  ARG A CB   1 
ATOM   2131  C CG   . ARG A 1 150 ? 30.427  139.951 82.145  1.00 37.21  ? 216  ARG A CG   1 
ATOM   2132  C CD   . ARG A 1 150 ? 29.035  139.790 82.741  1.00 30.19  ? 216  ARG A CD   1 
ATOM   2133  N NE   . ARG A 1 150 ? 28.477  138.518 82.363  1.00 22.51  ? 216  ARG A NE   1 
ATOM   2134  C CZ   . ARG A 1 150 ? 27.720  138.308 81.304  1.00 37.99  ? 216  ARG A CZ   1 
ATOM   2135  N NH1  . ARG A 1 150 ? 27.391  139.312 80.495  1.00 40.30  ? 216  ARG A NH1  1 
ATOM   2136  N NH2  . ARG A 1 150 ? 27.266  137.077 81.067  1.00 31.75  ? 216  ARG A NH2  1 
ATOM   2137  H H    . ARG A 1 150 ? 30.823  141.798 78.713  1.00 34.62  ? 216  ARG A H    1 
ATOM   2138  H HA   . ARG A 1 150 ? 31.998  141.688 81.032  1.00 33.14  ? 216  ARG A HA   1 
ATOM   2139  H HB2  . ARG A 1 150 ? 29.698  141.143 80.676  1.00 29.66  ? 216  ARG A HB2  1 
ATOM   2140  H HB3  . ARG A 1 150 ? 30.191  139.728 80.144  1.00 29.66  ? 216  ARG A HB3  1 
ATOM   2141  H HG2  . ARG A 1 150 ? 30.860  139.083 82.153  1.00 44.65  ? 216  ARG A HG2  1 
ATOM   2142  H HG3  . ARG A 1 150 ? 30.921  140.574 82.700  1.00 44.65  ? 216  ARG A HG3  1 
ATOM   2143  H HD2  . ARG A 1 150 ? 29.091  139.827 83.709  1.00 36.22  ? 216  ARG A HD2  1 
ATOM   2144  H HD3  . ARG A 1 150 ? 28.456  140.493 82.406  1.00 36.22  ? 216  ARG A HD3  1 
ATOM   2145  H HE   . ARG A 1 150 ? 28.650  137.844 82.867  1.00 27.02  ? 216  ARG A HE   1 
ATOM   2146  H HH11 . ARG A 1 150 ? 27.685  140.104 80.653  1.00 48.36  ? 216  ARG A HH11 1 
ATOM   2147  H HH12 . ARG A 1 150 ? 26.894  139.166 79.809  1.00 48.36  ? 216  ARG A HH12 1 
ATOM   2148  H HH21 . ARG A 1 150 ? 27.477  136.432 81.594  1.00 38.10  ? 216  ARG A HH21 1 
ATOM   2149  H HH22 . ARG A 1 150 ? 26.767  136.927 80.382  1.00 38.10  ? 216  ARG A HH22 1 
ATOM   2150  N N    . HIS A 1 151 ? 32.834  139.342 79.043  1.00 25.27  ? 217  HIS A N    1 
ATOM   2151  C CA   . HIS A 1 151 ? 33.771  138.251 78.862  1.00 26.84  ? 217  HIS A CA   1 
ATOM   2152  C C    . HIS A 1 151 ? 35.198  138.827 78.798  1.00 40.52  ? 217  HIS A C    1 
ATOM   2153  O O    . HIS A 1 151 ? 36.072  138.445 79.577  1.00 42.49  ? 217  HIS A O    1 
ATOM   2154  C CB   . HIS A 1 151 ? 33.393  137.476 77.593  1.00 28.22  ? 217  HIS A CB   1 
ATOM   2155  C CG   . HIS A 1 151 ? 34.261  136.291 77.309  1.00 42.77  ? 217  HIS A CG   1 
ATOM   2156  N ND1  . HIS A 1 151 ? 33.935  135.351 76.357  1.00 41.91  ? 217  HIS A ND1  1 
ATOM   2157  C CD2  . HIS A 1 151 ? 35.454  135.909 77.825  1.00 48.73  ? 217  HIS A CD2  1 
ATOM   2158  C CE1  . HIS A 1 151 ? 34.883  134.429 76.313  1.00 50.74  ? 217  HIS A CE1  1 
ATOM   2159  N NE2  . HIS A 1 151 ? 35.814  134.744 77.192  1.00 52.70  ? 217  HIS A NE2  1 
ATOM   2160  H H    . HIS A 1 151 ? 32.331  139.499 78.363  1.00 30.32  ? 217  HIS A H    1 
ATOM   2161  H HA   . HIS A 1 151 ? 33.717  137.647 79.619  1.00 32.21  ? 217  HIS A HA   1 
ATOM   2162  H HB2  . HIS A 1 151 ? 32.481  137.158 77.684  1.00 33.86  ? 217  HIS A HB2  1 
ATOM   2163  H HB3  . HIS A 1 151 ? 33.456  138.076 76.833  1.00 33.86  ? 217  HIS A HB3  1 
ATOM   2164  H HD1  . HIS A 1 151 ? 33.223  135.357 75.875  1.00 50.30  ? 217  HIS A HD1  1 
ATOM   2165  H HD2  . HIS A 1 151 ? 35.933  136.347 78.491  1.00 58.48  ? 217  HIS A HD2  1 
ATOM   2166  H HE1  . HIS A 1 151 ? 34.892  133.686 75.754  1.00 60.89  ? 217  HIS A HE1  1 
ATOM   2167  H HE2  . HIS A 1 151 ? 36.531  134.293 77.343  1.00 63.24  ? 217  HIS A HE2  1 
ATOM   2168  N N    . THR A 1 152 ? 35.409  139.774 77.886  1.00 41.05  ? 218  THR A N    1 
ATOM   2169  C CA   . THR A 1 152 ? 36.701  140.431 77.691  1.00 32.27  ? 218  THR A CA   1 
ATOM   2170  C C    . THR A 1 152 ? 37.275  141.094 78.952  1.00 35.58  ? 218  THR A C    1 
ATOM   2171  O O    . THR A 1 152 ? 38.419  140.857 79.315  1.00 28.02  ? 218  THR A O    1 
ATOM   2172  C CB   . THR A 1 152 ? 36.578  141.480 76.582  1.00 32.69  ? 218  THR A CB   1 
ATOM   2173  O OG1  . THR A 1 152 ? 36.312  140.819 75.340  1.00 31.80  ? 218  THR A OG1  1 
ATOM   2174  C CG2  . THR A 1 152 ? 37.853  142.288 76.437  1.00 44.96  ? 218  THR A CG2  1 
ATOM   2175  H H    . THR A 1 152 ? 34.799  140.061 77.352  1.00 49.26  ? 218  THR A H    1 
ATOM   2176  H HA   . THR A 1 152 ? 37.342  139.766 77.394  1.00 38.73  ? 218  THR A HA   1 
ATOM   2177  H HB   . THR A 1 152 ? 35.850  142.087 76.789  1.00 39.22  ? 218  THR A HB   1 
ATOM   2178  H HG1  . THR A 1 152 ? 35.595  140.385 75.394  1.00 38.17  ? 218  THR A HG1  1 
ATOM   2179  H HG21 . THR A 1 152 ? 37.750  142.944 75.730  1.00 53.95  ? 218  THR A HG21 1 
ATOM   2180  H HG22 . THR A 1 152 ? 38.049  142.748 77.268  1.00 53.95  ? 218  THR A HG22 1 
ATOM   2181  H HG23 . THR A 1 152 ? 38.594  141.701 76.218  1.00 53.95  ? 218  THR A HG23 1 
ATOM   2182  N N    . SER A 1 153 ? 36.487  141.928 79.613  1.00 29.14  ? 219  SER A N    1 
ATOM   2183  C CA   . SER A 1 153 ? 36.943  142.613 80.821  1.00 32.07  ? 219  SER A CA   1 
ATOM   2184  C C    . SER A 1 153 ? 37.348  141.673 81.961  1.00 34.59  ? 219  SER A C    1 
ATOM   2185  O O    . SER A 1 153 ? 38.273  141.978 82.706  1.00 35.47  ? 219  SER A O    1 
ATOM   2186  C CB   . SER A 1 153 ? 35.846  143.537 81.339  1.00 47.98  ? 219  SER A CB   1 
ATOM   2187  O OG   . SER A 1 153 ? 34.754  142.767 81.825  1.00 46.19  ? 219  SER A OG   1 
ATOM   2188  H H    . SER A 1 153 ? 35.680  142.118 79.384  1.00 34.96  ? 219  SER A H    1 
ATOM   2189  H HA   . SER A 1 153 ? 37.713  143.160 80.599  1.00 38.48  ? 219  SER A HA   1 
ATOM   2190  H HB2  . SER A 1 153 ? 36.200  144.078 82.062  1.00 57.58  ? 219  SER A HB2  1 
ATOM   2191  H HB3  . SER A 1 153 ? 35.539  144.104 80.615  1.00 57.58  ? 219  SER A HB3  1 
ATOM   2192  H HG   . SER A 1 153 ? 34.441  142.291 81.207  1.00 55.43  ? 219  SER A HG   1 
ATOM   2193  N N    . THR A 1 154 ? 36.629  140.565 82.123  1.00 17.91  ? 220  THR A N    1 
ATOM   2194  C CA   . THR A 1 154 ? 36.960  139.591 83.156  1.00 26.19  ? 220  THR A CA   1 
ATOM   2195  C C    . THR A 1 154 ? 38.334  138.968 82.894  1.00 37.77  ? 220  THR A C    1 
ATOM   2196  O O    . THR A 1 154 ? 39.176  138.882 83.792  1.00 23.73  ? 220  THR A O    1 
ATOM   2197  C CB   . THR A 1 154 ? 35.902  138.479 83.242  1.00 21.97  ? 220  THR A CB   1 
ATOM   2198  O OG1  . THR A 1 154 ? 34.653  139.050 83.625  1.00 26.99  ? 220  THR A OG1  1 
ATOM   2199  C CG2  . THR A 1 154 ? 36.281  137.431 84.278  1.00 24.05  ? 220  THR A CG2  1 
ATOM   2200  H H    . THR A 1 154 ? 35.945  140.355 81.647  1.00 21.49  ? 220  THR A H    1 
ATOM   2201  H HA   . THR A 1 154 ? 36.993  140.041 84.015  1.00 31.43  ? 220  THR A HA   1 
ATOM   2202  H HB   . THR A 1 154 ? 35.812  138.046 82.378  1.00 26.37  ? 220  THR A HB   1 
ATOM   2203  H HG1  . THR A 1 154 ? 34.411  139.621 83.059  1.00 32.39  ? 220  THR A HG1  1 
ATOM   2204  H HG21 . THR A 1 154 ? 35.601  136.740 84.315  1.00 28.86  ? 220  THR A HG21 1 
ATOM   2205  H HG22 . THR A 1 154 ? 37.130  137.025 84.043  1.00 28.86  ? 220  THR A HG22 1 
ATOM   2206  H HG23 . THR A 1 154 ? 36.359  137.843 85.153  1.00 28.86  ? 220  THR A HG23 1 
ATOM   2207  N N    . LEU A 1 155 ? 38.560  138.530 81.662  1.00 23.62  ? 221  LEU A N    1 
ATOM   2208  C CA   . LEU A 1 155 ? 39.888  138.077 81.271  1.00 25.63  ? 221  LEU A CA   1 
ATOM   2209  C C    . LEU A 1 155 ? 40.938  139.147 81.603  1.00 24.99  ? 221  LEU A C    1 
ATOM   2210  O O    . LEU A 1 155 ? 41.868  138.879 82.350  1.00 32.79  ? 221  LEU A O    1 
ATOM   2211  C CB   . LEU A 1 155 ? 39.927  137.725 79.787  1.00 19.33  ? 221  LEU A CB   1 
ATOM   2212  C CG   . LEU A 1 155 ? 41.176  137.005 79.292  1.00 26.33  ? 221  LEU A CG   1 
ATOM   2213  C CD1  . LEU A 1 155 ? 41.296  135.624 79.923  1.00 21.30  ? 221  LEU A CD1  1 
ATOM   2214  C CD2  . LEU A 1 155 ? 41.166  136.913 77.769  1.00 22.29  ? 221  LEU A CD2  1 
ATOM   2215  H H    . LEU A 1 155 ? 37.969  138.485 81.039  1.00 28.34  ? 221  LEU A H    1 
ATOM   2216  H HA   . LEU A 1 155 ? 40.108  137.277 81.773  1.00 30.75  ? 221  LEU A HA   1 
ATOM   2217  H HB2  . LEU A 1 155 ? 39.169  137.153 79.590  1.00 23.19  ? 221  LEU A HB2  1 
ATOM   2218  H HB3  . LEU A 1 155 ? 39.849  138.548 79.278  1.00 23.19  ? 221  LEU A HB3  1 
ATOM   2219  H HG   . LEU A 1 155 ? 41.956  137.519 79.552  1.00 31.60  ? 221  LEU A HG   1 
ATOM   2220  H HD11 . LEU A 1 155 ? 42.098  135.194 79.589  1.00 25.57  ? 221  LEU A HD11 1 
ATOM   2221  H HD12 . LEU A 1 155 ? 41.349  135.722 80.887  1.00 25.57  ? 221  LEU A HD12 1 
ATOM   2222  H HD13 . LEU A 1 155 ? 40.515  135.100 79.686  1.00 25.57  ? 221  LEU A HD13 1 
ATOM   2223  H HD21 . LEU A 1 155 ? 41.968  136.452 77.476  1.00 26.75  ? 221  LEU A HD21 1 
ATOM   2224  H HD22 . LEU A 1 155 ? 40.379  136.420 77.488  1.00 26.75  ? 221  LEU A HD22 1 
ATOM   2225  H HD23 . LEU A 1 155 ? 41.145  137.809 77.398  1.00 26.75  ? 221  LEU A HD23 1 
ATOM   2226  N N    . ALA A 1 156 ? 40.768  140.360 81.083  1.00 28.42  ? 222  ALA A N    1 
ATOM   2227  C CA   . ALA A 1 156 ? 41.658  141.465 81.427  1.00 30.41  ? 222  ALA A CA   1 
ATOM   2228  C C    . ALA A 1 156 ? 41.857  141.605 82.944  1.00 25.55  ? 222  ALA A C    1 
ATOM   2229  O O    . ALA A 1 156 ? 42.981  141.537 83.430  1.00 30.01  ? 222  ALA A O    1 
ATOM   2230  C CB   . ALA A 1 156 ? 41.152  142.763 80.834  1.00 24.39  ? 222  ALA A CB   1 
ATOM   2231  H H    . ALA A 1 156 ? 40.145  140.569 80.529  1.00 34.10  ? 222  ALA A H    1 
ATOM   2232  H HA   . ALA A 1 156 ? 42.528  141.289 81.037  1.00 36.49  ? 222  ALA A HA   1 
ATOM   2233  H HB1  . ALA A 1 156 ? 41.760  143.479 81.077  1.00 29.27  ? 222  ALA A HB1  1 
ATOM   2234  H HB2  . ALA A 1 156 ? 41.113  142.674 79.869  1.00 29.27  ? 222  ALA A HB2  1 
ATOM   2235  H HB3  . ALA A 1 156 ? 40.267  142.946 81.186  1.00 29.27  ? 222  ALA A HB3  1 
ATOM   2236  N N    . ALA A 1 157 ? 40.774  141.790 83.690  1.00 29.52  ? 223  ALA A N    1 
ATOM   2237  C CA   . ALA A 1 157 ? 40.861  141.874 85.150  1.00 32.22  ? 223  ALA A CA   1 
ATOM   2238  C C    . ALA A 1 157 ? 41.526  140.630 85.778  1.00 25.98  ? 223  ALA A C    1 
ATOM   2239  O O    . ALA A 1 157 ? 42.252  140.725 86.756  1.00 33.53  ? 223  ALA A O    1 
ATOM   2240  C CB   . ALA A 1 157 ? 39.488  142.096 85.753  1.00 22.70  ? 223  ALA A CB   1 
ATOM   2241  H H    . ALA A 1 157 ? 39.977  141.871 83.379  1.00 35.42  ? 223  ALA A H    1 
ATOM   2242  H HA   . ALA A 1 157 ? 41.407  142.642 85.380  1.00 38.66  ? 223  ALA A HA   1 
ATOM   2243  H HB1  . ALA A 1 157 ? 39.573  142.148 86.718  1.00 27.24  ? 223  ALA A HB1  1 
ATOM   2244  H HB2  . ALA A 1 157 ? 39.123  142.926 85.407  1.00 27.24  ? 223  ALA A HB2  1 
ATOM   2245  H HB3  . ALA A 1 157 ? 38.913  141.354 85.510  1.00 27.24  ? 223  ALA A HB3  1 
ATOM   2246  N N    . MET A 1 158 ? 41.293  139.456 85.218  1.00 31.07  ? 224  MET A N    1 
ATOM   2247  C CA   . MET A 1 158 ? 41.865  138.254 85.807  1.00 27.56  ? 224  MET A CA   1 
ATOM   2248  C C    . MET A 1 158 ? 43.358  138.165 85.559  1.00 29.31  ? 224  MET A C    1 
ATOM   2249  O O    . MET A 1 158 ? 44.083  137.617 86.388  1.00 30.14  ? 224  MET A O    1 
ATOM   2250  C CB   . MET A 1 158 ? 41.189  136.994 85.265  1.00 26.17  ? 224  MET A CB   1 
ATOM   2251  C CG   . MET A 1 158 ? 39.853  136.638 85.876  1.00 43.38  ? 224  MET A CG   1 
ATOM   2252  S SD   . MET A 1 158 ? 39.870  136.637 87.661  1.00 41.46  ? 224  MET A SD   1 
ATOM   2253  C CE   . MET A 1 158 ? 39.328  138.317 87.970  1.00 28.18  ? 224  MET A CE   1 
ATOM   2254  H H    . MET A 1 158 ? 40.818  139.327 84.513  1.00 37.29  ? 224  MET A H    1 
ATOM   2255  H HA   . MET A 1 158 ? 41.713  138.278 86.765  1.00 33.07  ? 224  MET A HA   1 
ATOM   2256  H HB2  . MET A 1 158 ? 41.048  137.111 84.312  1.00 31.41  ? 224  MET A HB2  1 
ATOM   2257  H HB3  . MET A 1 158 ? 41.783  136.242 85.412  1.00 31.41  ? 224  MET A HB3  1 
ATOM   2258  H HG2  . MET A 1 158 ? 39.191  137.285 85.585  1.00 52.06  ? 224  MET A HG2  1 
ATOM   2259  H HG3  . MET A 1 158 ? 39.599  135.750 85.580  1.00 52.06  ? 224  MET A HG3  1 
ATOM   2260  H HE1  . MET A 1 158 ? 39.289  138.465 88.928  1.00 33.81  ? 224  MET A HE1  1 
ATOM   2261  H HE2  . MET A 1 158 ? 39.960  138.932 87.566  1.00 33.81  ? 224  MET A HE2  1 
ATOM   2262  H HE3  . MET A 1 158 ? 38.448  138.442 87.580  1.00 33.81  ? 224  MET A HE3  1 
ATOM   2263  N N    . LYS A 1 159 ? 43.801  138.675 84.407  1.00 30.72  ? 225  LYS A N    1 
ATOM   2264  C CA   . LYS A 1 159 ? 45.225  138.778 84.081  1.00 30.27  ? 225  LYS A CA   1 
ATOM   2265  C C    . LYS A 1 159 ? 45.887  139.855 84.907  1.00 39.90  ? 225  LYS A C    1 
ATOM   2266  O O    . LYS A 1 159 ? 46.996  139.676 85.413  1.00 28.18  ? 225  LYS A O    1 
ATOM   2267  C CB   . LYS A 1 159 ? 45.418  139.147 82.615  1.00 14.55  ? 225  LYS A CB   1 
ATOM   2268  C CG   . LYS A 1 159 ? 45.412  137.990 81.636  1.00 23.99  ? 225  LYS A CG   1 
ATOM   2269  C CD   . LYS A 1 159 ? 45.407  136.626 82.305  1.00 25.36  ? 225  LYS A CD   1 
ATOM   2270  C CE   . LYS A 1 159 ? 45.476  135.487 81.310  1.00 35.62  ? 225  LYS A CE   1 
ATOM   2271  N NZ   . LYS A 1 159 ? 45.563  134.223 82.074  1.00 42.42  ? 225  LYS A NZ   1 
ATOM   2272  H H    . LYS A 1 159 ? 43.285  138.974 83.787  1.00 36.87  ? 225  LYS A H    1 
ATOM   2273  H HA   . LYS A 1 159 ? 45.666  137.932 84.254  1.00 36.32  ? 225  LYS A HA   1 
ATOM   2274  H HB2  . LYS A 1 159 ? 44.704  139.749 82.355  1.00 17.45  ? 225  LYS A HB2  1 
ATOM   2275  H HB3  . LYS A 1 159 ? 46.271  139.599 82.524  1.00 17.45  ? 225  LYS A HB3  1 
ATOM   2276  H HG2  . LYS A 1 159 ? 44.618  138.052 81.082  1.00 28.79  ? 225  LYS A HG2  1 
ATOM   2277  H HG3  . LYS A 1 159 ? 46.206  138.046 81.081  1.00 28.79  ? 225  LYS A HG3  1 
ATOM   2278  H HD2  . LYS A 1 159 ? 46.176  136.558 82.892  1.00 30.43  ? 225  LYS A HD2  1 
ATOM   2279  H HD3  . LYS A 1 159 ? 44.589  136.528 82.817  1.00 30.43  ? 225  LYS A HD3  1 
ATOM   2280  H HE2  . LYS A 1 159 ? 44.672  135.472 80.767  1.00 42.74  ? 225  LYS A HE2  1 
ATOM   2281  H HE3  . LYS A 1 159 ? 46.268  135.577 80.757  1.00 42.74  ? 225  LYS A HE3  1 
ATOM   2282  H HZ1  . LYS A 1 159 ? 45.605  133.532 81.515  1.00 50.90  ? 225  LYS A HZ1  1 
ATOM   2283  H HZ2  . LYS A 1 159 ? 46.292  134.227 82.585  1.00 50.90  ? 225  LYS A HZ2  1 
ATOM   2284  H HZ3  . LYS A 1 159 ? 44.846  134.132 82.594  1.00 50.90  ? 225  LYS A HZ3  1 
ATOM   2285  N N    . LEU A 1 160 ? 45.192  140.985 85.011  1.00 44.87  ? 226  LEU A N    1 
ATOM   2286  C CA   . LEU A 1 160 ? 45.653  142.129 85.767  1.00 29.88  ? 226  LEU A CA   1 
ATOM   2287  C C    . LEU A 1 160 ? 45.965  141.689 87.164  1.00 18.84  ? 226  LEU A C    1 
ATOM   2288  O O    . LEU A 1 160 ? 46.985  142.026 87.718  1.00 25.91  ? 226  LEU A O    1 
ATOM   2289  C CB   . LEU A 1 160 ? 44.554  143.178 85.797  1.00 30.89  ? 226  LEU A CB   1 
ATOM   2290  C CG   . LEU A 1 160 ? 44.876  144.530 86.419  1.00 29.83  ? 226  LEU A CG   1 
ATOM   2291  C CD1  . LEU A 1 160 ? 46.197  145.039 85.925  1.00 31.76  ? 226  LEU A CD1  1 
ATOM   2292  C CD2  . LEU A 1 160 ? 43.773  145.495 86.059  1.00 39.54  ? 226  LEU A CD2  1 
ATOM   2293  H H    . LEU A 1 160 ? 44.427  141.110 84.637  1.00 53.85  ? 226  LEU A H    1 
ATOM   2294  H HA   . LEU A 1 160 ? 46.449  142.506 85.361  1.00 35.86  ? 226  LEU A HA   1 
ATOM   2295  H HB2  . LEU A 1 160 ? 44.278  143.347 84.882  1.00 37.06  ? 226  LEU A HB2  1 
ATOM   2296  H HB3  . LEU A 1 160 ? 43.804  142.811 86.291  1.00 37.06  ? 226  LEU A HB3  1 
ATOM   2297  H HG   . LEU A 1 160 ? 44.915  144.446 87.385  1.00 35.80  ? 226  LEU A HG   1 
ATOM   2298  H HD11 . LEU A 1 160 ? 46.377  145.899 86.336  1.00 38.11  ? 226  LEU A HD11 1 
ATOM   2299  H HD12 . LEU A 1 160 ? 46.890  144.405 86.166  1.00 38.11  ? 226  LEU A HD12 1 
ATOM   2300  H HD13 . LEU A 1 160 ? 46.157  145.135 84.961  1.00 38.11  ? 226  LEU A HD13 1 
ATOM   2301  H HD21 . LEU A 1 160 ? 43.970  146.360 86.451  1.00 47.44  ? 226  LEU A HD21 1 
ATOM   2302  H HD22 . LEU A 1 160 ? 43.725  145.573 85.093  1.00 47.44  ? 226  LEU A HD22 1 
ATOM   2303  H HD23 . LEU A 1 160 ? 42.933  145.157 86.406  1.00 47.44  ? 226  LEU A HD23 1 
ATOM   2304  N N    . MET A 1 161 ? 45.076  140.904 87.732  1.00 27.73  ? 227  MET A N    1 
ATOM   2305  C CA   . MET A 1 161 ? 45.250  140.454 89.096  1.00 25.68  ? 227  MET A CA   1 
ATOM   2306  C C    . MET A 1 161 ? 46.468  139.571 89.206  1.00 25.53  ? 227  MET A C    1 
ATOM   2307  O O    . MET A 1 161 ? 47.222  139.677 90.154  1.00 31.17  ? 227  MET A O    1 
ATOM   2308  C CB   . MET A 1 161 ? 44.014  139.691 89.570  1.00 30.77  ? 227  MET A CB   1 
ATOM   2309  C CG   . MET A 1 161 ? 44.128  139.092 90.973  1.00 41.14  ? 227  MET A CG   1 
ATOM   2310  S SD   . MET A 1 161 ? 43.485  140.057 92.327  1.00 39.50  ? 227  MET A SD   1 
ATOM   2311  C CE   . MET A 1 161 ? 43.423  138.753 93.526  1.00 24.02  ? 227  MET A CE   1 
ATOM   2312  H H    . MET A 1 161 ? 44.361  140.615 87.351  1.00 33.28  ? 227  MET A H    1 
ATOM   2313  H HA   . MET A 1 161 ? 45.365  141.227 89.672  1.00 30.81  ? 227  MET A HA   1 
ATOM   2314  H HB2  . MET A 1 161 ? 43.258  140.298 89.571  1.00 36.93  ? 227  MET A HB2  1 
ATOM   2315  H HB3  . MET A 1 161 ? 43.846  138.962 88.953  1.00 36.93  ? 227  MET A HB3  1 
ATOM   2316  H HG2  . MET A 1 161 ? 43.655  138.245 90.977  1.00 49.37  ? 227  MET A HG2  1 
ATOM   2317  H HG3  . MET A 1 161 ? 45.067  138.934 91.157  1.00 49.37  ? 227  MET A HG3  1 
ATOM   2318  H HE1  . MET A 1 161 ? 43.083  139.109 94.362  1.00 28.83  ? 227  MET A HE1  1 
ATOM   2319  H HE2  . MET A 1 161 ? 42.836  138.053 93.200  1.00 28.83  ? 227  MET A HE2  1 
ATOM   2320  H HE3  . MET A 1 161 ? 44.318  138.401 93.656  1.00 28.83  ? 227  MET A HE3  1 
ATOM   2321  N N    . THR A 1 162 ? 46.668  138.688 88.242  1.00 18.21  ? 228  THR A N    1 
ATOM   2322  C CA   . THR A 1 162 ? 47.815  137.796 88.295  1.00 20.61  ? 228  THR A CA   1 
ATOM   2323  C C    . THR A 1 162 ? 49.112  138.595 88.219  1.00 31.25  ? 228  THR A C    1 
ATOM   2324  O O    . THR A 1 162 ? 50.089  138.252 88.868  1.00 33.43  ? 228  THR A O    1 
ATOM   2325  C CB   . THR A 1 162 ? 47.792  136.789 87.156  1.00 15.79  ? 228  THR A CB   1 
ATOM   2326  O OG1  . THR A 1 162 ? 46.534  136.125 87.136  1.00 41.39  ? 228  THR A OG1  1 
ATOM   2327  C CG2  . THR A 1 162 ? 48.855  135.754 87.341  1.00 15.53  ? 228  THR A CG2  1 
ATOM   2328  H H    . THR A 1 162 ? 46.163  138.585 87.554  1.00 21.86  ? 228  THR A H    1 
ATOM   2329  H HA   . THR A 1 162 ? 47.804  137.309 89.133  1.00 24.73  ? 228  THR A HA   1 
ATOM   2330  H HB   . THR A 1 162 ? 47.938  137.242 86.311  1.00 18.95  ? 228  THR A HB   1 
ATOM   2331  H HG1  . THR A 1 162 ? 46.513  135.566 86.509  1.00 49.67  ? 228  THR A HG1  1 
ATOM   2332  H HG21 . THR A 1 162 ? 48.830  135.118 86.609  1.00 18.63  ? 228  THR A HG21 1 
ATOM   2333  H HG22 . THR A 1 162 ? 49.728  136.176 87.362  1.00 18.63  ? 228  THR A HG22 1 
ATOM   2334  H HG23 . THR A 1 162 ? 48.714  135.280 88.176  1.00 18.63  ? 228  THR A HG23 1 
ATOM   2335  N N    . ALA A 1 163 ? 49.113  139.656 87.421  1.00 23.89  ? 229  ALA A N    1 
ATOM   2336  C CA   . ALA A 1 163 ? 50.247  140.554 87.343  1.00 29.37  ? 229  ALA A CA   1 
ATOM   2337  C C    . ALA A 1 163 ? 50.483  141.228 88.697  1.00 38.50  ? 229  ALA A C    1 
ATOM   2338  O O    . ALA A 1 163 ? 51.631  141.407 89.144  1.00 42.60  ? 229  ALA A O    1 
ATOM   2339  C CB   . ALA A 1 163 ? 50.009  141.600 86.279  1.00 33.62  ? 229  ALA A CB   1 
ATOM   2340  H H    . ALA A 1 163 ? 48.458  139.877 86.909  1.00 28.67  ? 229  ALA A H    1 
ATOM   2341  H HA   . ALA A 1 163 ? 51.042  140.051 87.108  1.00 35.25  ? 229  ALA A HA   1 
ATOM   2342  H HB1  . ALA A 1 163 ? 50.777  142.191 86.241  1.00 40.35  ? 229  ALA A HB1  1 
ATOM   2343  H HB2  . ALA A 1 163 ? 49.889  141.157 85.424  1.00 40.35  ? 229  ALA A HB2  1 
ATOM   2344  H HB3  . ALA A 1 163 ? 49.212  142.105 86.505  1.00 40.35  ? 229  ALA A HB3  1 
ATOM   2345  N N    . LEU A 1 164 ? 49.389  141.608 89.341  1.00 24.48  ? 230  LEU A N    1 
ATOM   2346  C CA   . LEU A 1 164 ? 49.456  142.273 90.620  1.00 21.21  ? 230  LEU A CA   1 
ATOM   2347  C C    . LEU A 1 164 ? 49.960  141.343 91.711  1.00 28.18  ? 230  LEU A C    1 
ATOM   2348  O O    . LEU A 1 164 ? 50.640  141.794 92.630  1.00 32.37  ? 230  LEU A O    1 
ATOM   2349  C CB   . LEU A 1 164 ? 48.077  142.808 91.000  1.00 29.67  ? 230  LEU A CB   1 
ATOM   2350  C CG   . LEU A 1 164 ? 47.659  144.157 90.424  1.00 26.33  ? 230  LEU A CG   1 
ATOM   2351  C CD1  . LEU A 1 164 ? 46.240  144.507 90.858  1.00 18.54  ? 230  LEU A CD1  1 
ATOM   2352  C CD2  . LEU A 1 164 ? 48.645  145.251 90.850  1.00 29.51  ? 230  LEU A CD2  1 
ATOM   2353  H H    . LEU A 1 164 ? 48.588  141.488 89.050  1.00 29.37  ? 230  LEU A H    1 
ATOM   2354  H HA   . LEU A 1 164 ? 50.065  143.025 90.557  1.00 25.45  ? 230  LEU A HA   1 
ATOM   2355  H HB2  . LEU A 1 164 ? 47.415  142.160 90.713  1.00 35.60  ? 230  LEU A HB2  1 
ATOM   2356  H HB3  . LEU A 1 164 ? 48.044  142.890 91.966  1.00 35.60  ? 230  LEU A HB3  1 
ATOM   2357  H HG   . LEU A 1 164 ? 47.671  144.103 89.456  1.00 31.60  ? 230  LEU A HG   1 
ATOM   2358  H HD11 . LEU A 1 164 ? 45.998  145.367 90.479  1.00 22.25  ? 230  LEU A HD11 1 
ATOM   2359  H HD12 . LEU A 1 164 ? 45.634  143.821 90.536  1.00 22.25  ? 230  LEU A HD12 1 
ATOM   2360  H HD13 . LEU A 1 164 ? 46.208  144.550 91.826  1.00 22.25  ? 230  LEU A HD13 1 
ATOM   2361  H HD21 . LEU A 1 164 ? 48.359  146.097 90.473  1.00 35.41  ? 230  LEU A HD21 1 
ATOM   2362  H HD22 . LEU A 1 164 ? 48.656  145.306 91.818  1.00 35.41  ? 230  LEU A HD22 1 
ATOM   2363  H HD23 . LEU A 1 164 ? 49.529  145.023 90.522  1.00 35.41  ? 230  LEU A HD23 1 
ATOM   2364  N N    . VAL A 1 165 ? 49.624  140.055 91.634  1.00 32.35  ? 231  VAL A N    1 
ATOM   2365  C CA   . VAL A 1 165 ? 50.110  139.097 92.632  1.00 35.61  ? 231  VAL A CA   1 
ATOM   2366  C C    . VAL A 1 165 ? 51.634  139.022 92.593  1.00 37.77  ? 231  VAL A C    1 
ATOM   2367  O O    . VAL A 1 165 ? 52.267  138.855 93.623  1.00 43.13  ? 231  VAL A O    1 
ATOM   2368  C CB   . VAL A 1 165 ? 49.573  137.672 92.408  1.00 36.76  ? 231  VAL A CB   1 
ATOM   2369  C CG1  . VAL A 1 165 ? 50.172  136.700 93.434  1.00 23.04  ? 231  VAL A CG1  1 
ATOM   2370  C CG2  . VAL A 1 165 ? 48.073  137.629 92.500  1.00 26.98  ? 231  VAL A CG2  1 
ATOM   2371  H H    . VAL A 1 165 ? 49.123  139.713 91.024  1.00 38.83  ? 231  VAL A H    1 
ATOM   2372  H HA   . VAL A 1 165 ? 49.841  139.390 93.517  1.00 42.73  ? 231  VAL A HA   1 
ATOM   2373  H HB   . VAL A 1 165 ? 49.829  137.372 91.522  1.00 44.11  ? 231  VAL A HB   1 
ATOM   2374  H HG11 . VAL A 1 165 ? 49.819  135.812 93.271  1.00 27.65  ? 231  VAL A HG11 1 
ATOM   2375  H HG12 . VAL A 1 165 ? 51.138  136.695 93.337  1.00 27.65  ? 231  VAL A HG12 1 
ATOM   2376  H HG13 . VAL A 1 165 ? 49.931  136.995 94.326  1.00 27.65  ? 231  VAL A HG13 1 
ATOM   2377  H HG21 . VAL A 1 165 ? 47.774  136.718 92.354  1.00 32.37  ? 231  VAL A HG21 1 
ATOM   2378  H HG22 . VAL A 1 165 ? 47.803  137.929 93.382  1.00 32.37  ? 231  VAL A HG22 1 
ATOM   2379  H HG23 . VAL A 1 165 ? 47.699  138.213 91.822  1.00 32.37  ? 231  VAL A HG23 1 
ATOM   2380  N N    . ASN A 1 166 ? 52.215  139.123 91.396  1.00 40.15  ? 232  ASN A N    1 
ATOM   2381  C CA   . ASN A 1 166 ? 53.657  139.079 91.236  1.00 24.88  ? 232  ASN A CA   1 
ATOM   2382  C C    . ASN A 1 166 ? 54.278  140.273 91.925  1.00 24.56  ? 232  ASN A C    1 
ATOM   2383  O O    . ASN A 1 166 ? 55.225  140.125 92.690  1.00 40.27  ? 232  ASN A O    1 
ATOM   2384  C CB   . ASN A 1 166 ? 54.049  139.073 89.758  1.00 44.77  ? 232  ASN A CB   1 
ATOM   2385  C CG   . ASN A 1 166 ? 55.427  138.460 89.519  1.00 65.36  ? 232  ASN A CG   1 
ATOM   2386  O OD1  . ASN A 1 166 ? 55.666  137.311 89.869  1.00 82.93  ? 232  ASN A OD1  1 
ATOM   2387  N ND2  . ASN A 1 166 ? 56.326  139.221 88.903  1.00 72.66  ? 232  ASN A ND2  1 
ATOM   2388  H H    . ASN A 1 166 ? 51.786  139.219 90.657  1.00 48.18  ? 232  ASN A H    1 
ATOM   2389  H HA   . ASN A 1 166 ? 54.003  138.272 91.648  1.00 29.86  ? 232  ASN A HA   1 
ATOM   2390  H HB2  . ASN A 1 166 ? 53.398  138.553 89.260  1.00 53.72  ? 232  ASN A HB2  1 
ATOM   2391  H HB3  . ASN A 1 166 ? 54.065  139.986 89.431  1.00 53.72  ? 232  ASN A HB3  1 
ATOM   2392  H HD21 . ASN A 1 166 ? 57.115  138.914 88.749  1.00 87.20  ? 232  ASN A HD21 1 
ATOM   2393  H HD22 . ASN A 1 166 ? 56.119  140.019 88.659  1.00 87.20  ? 232  ASN A HD22 1 
ATOM   2394  N N    . VAL A 1 167 ? 53.746  141.460 91.650  1.00 33.27  ? 233  VAL A N    1 
ATOM   2395  C CA   . VAL A 1 167 ? 54.233  142.683 92.278  1.00 21.99  ? 233  VAL A CA   1 
ATOM   2396  C C    . VAL A 1 167 ? 54.250  142.541 93.790  1.00 31.54  ? 233  VAL A C    1 
ATOM   2397  O O    . VAL A 1 167 ? 55.261  142.860 94.442  1.00 40.36  ? 233  VAL A O    1 
ATOM   2398  C CB   . VAL A 1 167 ? 53.386  143.881 91.896  1.00 20.19  ? 233  VAL A CB   1 
ATOM   2399  C CG1  . VAL A 1 167 ? 53.785  145.108 92.688  1.00 12.66  ? 233  VAL A CG1  1 
ATOM   2400  C CG2  . VAL A 1 167 ? 53.515  144.153 90.409  1.00 27.31  ? 233  VAL A CG2  1 
ATOM   2401  H H    . VAL A 1 167 ? 53.097  141.584 91.100  1.00 39.92  ? 233  VAL A H    1 
ATOM   2402  H HA   . VAL A 1 167 ? 55.142  142.850 91.982  1.00 26.39  ? 233  VAL A HA   1 
ATOM   2403  H HB   . VAL A 1 167 ? 52.456  143.687 92.088  1.00 24.22  ? 233  VAL A HB   1 
ATOM   2404  H HG11 . VAL A 1 167 ? 53.224  145.853 92.418  1.00 15.19  ? 233  VAL A HG11 1 
ATOM   2405  H HG12 . VAL A 1 167 ? 53.663  144.927 93.633  1.00 15.19  ? 233  VAL A HG12 1 
ATOM   2406  H HG13 . VAL A 1 167 ? 54.716  145.312 92.507  1.00 15.19  ? 233  VAL A HG13 1 
ATOM   2407  H HG21 . VAL A 1 167 ? 52.968  144.922 90.181  1.00 32.77  ? 233  VAL A HG21 1 
ATOM   2408  H HG22 . VAL A 1 167 ? 54.444  144.335 90.201  1.00 32.77  ? 233  VAL A HG22 1 
ATOM   2409  H HG23 . VAL A 1 167 ? 53.212  143.374 89.919  1.00 32.77  ? 233  VAL A HG23 1 
ATOM   2410  N N    . ALA A 1 168 ? 53.142  142.062 94.344  1.00 18.45  ? 234  ALA A N    1 
ATOM   2411  C CA   . ALA A 1 168 ? 53.061  141.796 95.773  1.00 22.99  ? 234  ALA A CA   1 
ATOM   2412  C C    . ALA A 1 168 ? 54.178  140.867 96.210  1.00 25.94  ? 234  ALA A C    1 
ATOM   2413  O O    . ALA A 1 168 ? 54.856  141.142 97.181  1.00 46.83  ? 234  ALA A O    1 
ATOM   2414  C CB   . ALA A 1 168 ? 51.741  141.179 96.109  1.00 21.65  ? 234  ALA A CB   1 
ATOM   2415  H H    . ALA A 1 168 ? 52.420  141.883 93.911  1.00 22.14  ? 234  ALA A H    1 
ATOM   2416  H HA   . ALA A 1 168 ? 53.145  142.629 96.262  1.00 27.59  ? 234  ALA A HA   1 
ATOM   2417  H HB1  . ALA A 1 168 ? 51.706  141.009 97.064  1.00 25.98  ? 234  ALA A HB1  1 
ATOM   2418  H HB2  . ALA A 1 168 ? 51.033  141.791 95.856  1.00 25.98  ? 234  ALA A HB2  1 
ATOM   2419  H HB3  . ALA A 1 168 ? 51.649  140.346 95.621  1.00 25.98  ? 234  ALA A HB3  1 
ATOM   2420  N N    . LEU A 1 169 ? 54.357  139.761 95.492  1.00 29.27  ? 235  LEU A N    1 
ATOM   2421  C CA   . LEU A 1 169 ? 55.389  138.782 95.814  1.00 28.77  ? 235  LEU A CA   1 
ATOM   2422  C C    . LEU A 1 169 ? 56.798  139.395 95.814  1.00 42.81  ? 235  LEU A C    1 
ATOM   2423  O O    . LEU A 1 169 ? 57.554  139.230 96.776  1.00 33.81  ? 235  LEU A O    1 
ATOM   2424  C CB   . LEU A 1 169 ? 55.339  137.613 94.828  1.00 24.33  ? 235  LEU A CB   1 
ATOM   2425  C CG   . LEU A 1 169 ? 56.311  136.456 95.076  1.00 25.64  ? 235  LEU A CG   1 
ATOM   2426  C CD1  . LEU A 1 169 ? 56.246  135.952 96.493  1.00 23.92  ? 235  LEU A CD1  1 
ATOM   2427  C CD2  . LEU A 1 169 ? 55.982  135.346 94.133  1.00 33.15  ? 235  LEU A CD2  1 
ATOM   2428  H H    . LEU A 1 169 ? 53.887  139.554 94.803  1.00 35.13  ? 235  LEU A H    1 
ATOM   2429  H HA   . LEU A 1 169 ? 55.219  138.429 96.701  1.00 34.52  ? 235  LEU A HA   1 
ATOM   2430  H HB2  . LEU A 1 169 ? 54.443  137.242 94.844  1.00 29.20  ? 235  LEU A HB2  1 
ATOM   2431  H HB3  . LEU A 1 169 ? 55.525  137.958 93.941  1.00 29.20  ? 235  LEU A HB3  1 
ATOM   2432  H HG   . LEU A 1 169 ? 57.217  136.752 94.896  1.00 30.77  ? 235  LEU A HG   1 
ATOM   2433  H HD11 . LEU A 1 169 ? 56.878  135.223 96.597  1.00 28.70  ? 235  LEU A HD11 1 
ATOM   2434  H HD12 . LEU A 1 169 ? 56.474  136.676 97.096  1.00 28.70  ? 235  LEU A HD12 1 
ATOM   2435  H HD13 . LEU A 1 169 ? 55.346  135.639 96.676  1.00 28.70  ? 235  LEU A HD13 1 
ATOM   2436  H HD21 . LEU A 1 169 ? 56.595  134.610 94.286  1.00 39.77  ? 235  LEU A HD21 1 
ATOM   2437  H HD22 . LEU A 1 169 ? 55.070  135.056 94.293  1.00 39.77  ? 235  LEU A HD22 1 
ATOM   2438  H HD23 . LEU A 1 169 ? 56.072  135.668 93.223  1.00 39.77  ? 235  LEU A HD23 1 
ATOM   2439  N N    . ASN A 1 170 ? 57.154  140.076 94.728  1.00 27.46  ? 236  ASN A N    1 
ATOM   2440  C CA   . ASN A 1 170 ? 58.387  140.823 94.694  1.00 23.24  ? 236  ASN A CA   1 
ATOM   2441  C C    . ASN A 1 170 ? 58.471  141.732 95.900  1.00 31.48  ? 236  ASN A C    1 
ATOM   2442  O O    . ASN A 1 170 ? 59.533  141.932 96.483  1.00 36.95  ? 236  ASN A O    1 
ATOM   2443  C CB   . ASN A 1 170 ? 58.418  141.724 93.484  1.00 35.29  ? 236  ASN A CB   1 
ATOM   2444  C CG   . ASN A 1 170 ? 58.616  140.993 92.226  1.00 24.74  ? 236  ASN A CG   1 
ATOM   2445  O OD1  . ASN A 1 170 ? 59.306  139.983 92.173  1.00 29.07  ? 236  ASN A OD1  1 
ATOM   2446  N ND2  . ASN A 1 170 ? 58.025  141.512 91.169  1.00 34.77  ? 236  ASN A ND2  1 
ATOM   2447  H H    . ASN A 1 170 ? 56.694  140.116 94.003  1.00 32.96  ? 236  ASN A H    1 
ATOM   2448  H HA   . ASN A 1 170 ? 59.151  140.226 94.678  1.00 27.89  ? 236  ASN A HA   1 
ATOM   2449  H HB2  . ASN A 1 170 ? 57.575  142.200 93.424  1.00 42.34  ? 236  ASN A HB2  1 
ATOM   2450  H HB3  . ASN A 1 170 ? 59.148  142.356 93.581  1.00 42.34  ? 236  ASN A HB3  1 
ATOM   2451  H HD21 . ASN A 1 170 ? 58.102  141.130 90.403  1.00 41.72  ? 236  ASN A HD21 1 
ATOM   2452  H HD22 . ASN A 1 170 ? 57.561  142.232 91.246  1.00 41.72  ? 236  ASN A HD22 1 
ATOM   2453  N N    . LEU A 1 171 ? 57.348  142.334 96.252  1.00 36.07  ? 237  LEU A N    1 
ATOM   2454  C CA   . LEU A 1 171 ? 57.389  143.362 97.272  1.00 39.03  ? 237  LEU A CA   1 
ATOM   2455  C C    . LEU A 1 171 ? 57.707  142.705 98.585  1.00 28.62  ? 237  LEU A C    1 
ATOM   2456  O O    . LEU A 1 171 ? 58.503  143.201 99.374  1.00 32.27  ? 237  LEU A O    1 
ATOM   2457  C CB   . LEU A 1 171 ? 56.064  144.090 97.366  1.00 33.44  ? 237  LEU A CB   1 
ATOM   2458  C CG   . LEU A 1 171 ? 56.079  145.550 96.936  1.00 21.93  ? 237  LEU A CG   1 
ATOM   2459  C CD1  . LEU A 1 171 ? 54.700  146.099 97.055  1.00 26.66  ? 237  LEU A CD1  1 
ATOM   2460  C CD2  . LEU A 1 171 ? 57.030  146.373 97.776  1.00 29.06  ? 237  LEU A CD2  1 
ATOM   2461  H H    . LEU A 1 171 ? 56.569  142.171 95.926  1.00 43.28  ? 237  LEU A H    1 
ATOM   2462  H HA   . LEU A 1 171 ? 58.086  144.004 97.066  1.00 46.83  ? 237  LEU A HA   1 
ATOM   2463  H HB2  . LEU A 1 171 ? 55.422  143.629 96.804  1.00 40.13  ? 237  LEU A HB2  1 
ATOM   2464  H HB3  . LEU A 1 171 ? 55.765  144.063 98.288  1.00 40.13  ? 237  LEU A HB3  1 
ATOM   2465  H HG   . LEU A 1 171 ? 56.356  145.612 96.009  1.00 26.32  ? 237  LEU A HG   1 
ATOM   2466  H HD11 . LEU A 1 171 ? 54.706  147.030 96.781  1.00 31.99  ? 237  LEU A HD11 1 
ATOM   2467  H HD12 . LEU A 1 171 ? 54.107  145.589 96.481  1.00 31.99  ? 237  LEU A HD12 1 
ATOM   2468  H HD13 . LEU A 1 171 ? 54.410  146.027 97.978  1.00 31.99  ? 237  LEU A HD13 1 
ATOM   2469  H HD21 . LEU A 1 171 ? 57.007  147.293 97.469  1.00 34.87  ? 237  LEU A HD21 1 
ATOM   2470  H HD22 . LEU A 1 171 ? 56.751  146.327 98.704  1.00 34.87  ? 237  LEU A HD22 1 
ATOM   2471  H HD23 . LEU A 1 171 ? 57.926  146.014 97.681  1.00 34.87  ? 237  LEU A HD23 1 
ATOM   2472  N N    . SER A 1 172 ? 57.082  141.559 98.784  1.00 25.79  ? 238  SER A N    1 
ATOM   2473  C CA   . SER A 1 172 ? 57.240  140.789 99.992  1.00 24.71  ? 238  SER A CA   1 
ATOM   2474  C C    . SER A 1 172 ? 58.699  140.440 100.201 1.00 25.20  ? 238  SER A C    1 
ATOM   2475  O O    . SER A 1 172 ? 59.236  140.589 101.287 1.00 37.15  ? 238  SER A O    1 
ATOM   2476  C CB   . SER A 1 172 ? 56.403  139.526 99.875  1.00 15.11  ? 238  SER A CB   1 
ATOM   2477  O OG   . SER A 1 172 ? 56.843  138.574 100.807 1.00 57.69  ? 238  SER A OG   1 
ATOM   2478  H H    . SER A 1 172 ? 56.547  141.200 98.215  1.00 30.94  ? 238  SER A H    1 
ATOM   2479  H HA   . SER A 1 172 ? 56.928  141.303 100.753 1.00 29.66  ? 238  SER A HA   1 
ATOM   2480  H HB2  . SER A 1 172 ? 55.474  139.741 100.053 1.00 18.13  ? 238  SER A HB2  1 
ATOM   2481  H HB3  . SER A 1 172 ? 56.497  139.163 98.980  1.00 18.13  ? 238  SER A HB3  1 
ATOM   2482  H HG   . SER A 1 172 ? 56.381  137.875 100.744 1.00 69.22  ? 238  SER A HG   1 
ATOM   2483  N N    . ILE A 1 173 ? 59.319  139.969 99.130  1.00 30.32  ? 239  ILE A N    1 
ATOM   2484  C CA   . ILE A 1 173 ? 60.733  139.652 99.088  1.00 15.41  ? 239  ILE A CA   1 
ATOM   2485  C C    . ILE A 1 173 ? 61.605  140.871 99.408  1.00 33.88  ? 239  ILE A C    1 
ATOM   2486  O O    . ILE A 1 173 ? 62.500  140.793 100.242 1.00 29.04  ? 239  ILE A O    1 
ATOM   2487  C CB   . ILE A 1 173 ? 61.059  139.072 97.712  1.00 26.05  ? 239  ILE A CB   1 
ATOM   2488  C CG1  . ILE A 1 173 ? 60.669  137.601 97.705  1.00 24.91  ? 239  ILE A CG1  1 
ATOM   2489  C CG2  . ILE A 1 173 ? 62.526  139.229 97.360  1.00 17.44  ? 239  ILE A CG2  1 
ATOM   2490  C CD1  . ILE A 1 173 ? 60.625  136.987 96.340  1.00 25.63  ? 239  ILE A CD1  1 
ATOM   2491  H H    . ILE A 1 173 ? 58.921  139.820 98.382  1.00 36.38  ? 239  ILE A H    1 
ATOM   2492  H HA   . ILE A 1 173 ? 60.921  138.969 99.751  1.00 18.50  ? 239  ILE A HA   1 
ATOM   2493  H HB   . ILE A 1 173 ? 60.529  139.537 97.046  1.00 31.27  ? 239  ILE A HB   1 
ATOM   2494  H HG12 . ILE A 1 173 ? 61.315  137.105 98.232  1.00 29.89  ? 239  ILE A HG12 1 
ATOM   2495  H HG13 . ILE A 1 173 ? 59.787  137.511 98.098  1.00 29.89  ? 239  ILE A HG13 1 
ATOM   2496  H HG21 . ILE A 1 173 ? 62.682  138.848 96.482  1.00 20.93  ? 239  ILE A HG21 1 
ATOM   2497  H HG22 . ILE A 1 173 ? 62.750  140.172 97.356  1.00 20.93  ? 239  ILE A HG22 1 
ATOM   2498  H HG23 . ILE A 1 173 ? 63.060  138.764 98.022  1.00 20.93  ? 239  ILE A HG23 1 
ATOM   2499  H HD11 . ILE A 1 173 ? 60.371  136.054 96.422  1.00 30.76  ? 239  ILE A HD11 1 
ATOM   2500  H HD12 . ILE A 1 173 ? 59.974  137.462 95.801  1.00 30.76  ? 239  ILE A HD12 1 
ATOM   2501  H HD13 . ILE A 1 173 ? 61.504  137.056 95.935  1.00 30.76  ? 239  ILE A HD13 1 
ATOM   2502  N N    . ASN A 1 174 ? 61.338  141.999 98.760  1.00 18.91  ? 240  ASN A N    1 
ATOM   2503  C CA   . ASN A 1 174 ? 62.088  143.208 99.040  1.00 26.11  ? 240  ASN A CA   1 
ATOM   2504  C C    . ASN A 1 174 ? 61.946  143.637 100.482 1.00 37.27  ? 240  ASN A C    1 
ATOM   2505  O O    . ASN A 1 174 ? 62.874  144.189 101.031 1.00 47.59  ? 240  ASN A O    1 
ATOM   2506  C CB   . ASN A 1 174 ? 61.638  144.353 98.152  1.00 34.17  ? 240  ASN A CB   1 
ATOM   2507  C CG   . ASN A 1 174 ? 62.754  145.324 97.862  1.00 19.54  ? 240  ASN A CG   1 
ATOM   2508  O OD1  . ASN A 1 174 ? 63.883  144.921 97.619  1.00 48.18  ? 240  ASN A OD1  1 
ATOM   2509  N ND2  . ASN A 1 174 ? 62.442  146.609 97.875  1.00 39.66  ? 240  ASN A ND2  1 
ATOM   2510  H H    . ASN A 1 174 ? 60.731  142.088 98.157  1.00 22.69  ? 240  ASN A H    1 
ATOM   2511  H HA   . ASN A 1 174 ? 63.028  143.044 98.866  1.00 31.33  ? 240  ASN A HA   1 
ATOM   2512  H HB2  . ASN A 1 174 ? 61.322  143.995 97.308  1.00 41.01  ? 240  ASN A HB2  1 
ATOM   2513  H HB3  . ASN A 1 174 ? 60.925  144.838 98.597  1.00 41.01  ? 240  ASN A HB3  1 
ATOM   2514  H HD21 . ASN A 1 174 ? 63.047  147.199 97.715  1.00 47.59  ? 240  ASN A HD21 1 
ATOM   2515  H HD22 . ASN A 1 174 ? 61.636  146.854 98.044  1.00 47.59  ? 240  ASN A HD22 1 
ATOM   2516  N N    . MET A 1 175 ? 60.780  143.408 101.088 1.00 51.25  ? 241  MET A N    1 
ATOM   2517  C CA   . MET A 1 175 ? 60.575  143.649 102.522 1.00 31.55  ? 241  MET A CA   1 
ATOM   2518  C C    . MET A 1 175 ? 61.424  142.746 103.403 1.00 43.19  ? 241  MET A C    1 
ATOM   2519  O O    . MET A 1 175 ? 62.002  143.193 104.384 1.00 37.20  ? 241  MET A O    1 
ATOM   2520  C CB   . MET A 1 175 ? 59.144  143.339 102.925 1.00 43.54  ? 241  MET A CB   1 
ATOM   2521  C CG   . MET A 1 175 ? 58.145  144.440 102.706 1.00 71.27  ? 241  MET A CG   1 
ATOM   2522  S SD   . MET A 1 175 ? 58.648  146.001 103.461 1.00 163.45 ? 241  MET A SD   1 
ATOM   2523  C CE   . MET A 1 175 ? 58.164  145.718 105.159 1.00 37.71  ? 241  MET A CE   1 
ATOM   2524  H H    . MET A 1 175 ? 60.081  143.108 100.686 1.00 61.50  ? 241  MET A H    1 
ATOM   2525  H HA   . MET A 1 175 ? 60.763  144.578 102.728 1.00 37.86  ? 241  MET A HA   1 
ATOM   2526  H HB2  . MET A 1 175 ? 58.843  142.570 102.416 1.00 52.25  ? 241  MET A HB2  1 
ATOM   2527  H HB3  . MET A 1 175 ? 59.133  143.123 103.871 1.00 52.25  ? 241  MET A HB3  1 
ATOM   2528  H HG2  . MET A 1 175 ? 58.041  144.588 101.753 1.00 85.53  ? 241  MET A HG2  1 
ATOM   2529  H HG3  . MET A 1 175 ? 57.296  144.179 103.096 1.00 85.53  ? 241  MET A HG3  1 
ATOM   2530  H HE1  . MET A 1 175 ? 58.385  146.502 105.685 1.00 45.25  ? 241  MET A HE1  1 
ATOM   2531  H HE2  . MET A 1 175 ? 57.208  145.556 105.191 1.00 45.25  ? 241  MET A HE2  1 
ATOM   2532  H HE3  . MET A 1 175 ? 58.642  144.946 105.498 1.00 45.25  ? 241  MET A HE3  1 
ATOM   2533  N N    . ASP A 1 176 ? 61.422  141.452 103.105 1.00 25.80  ? 242  ASP A N    1 
ATOM   2534  C CA   . ASP A 1 176 ? 62.210  140.520 103.876 1.00 25.68  ? 242  ASP A CA   1 
ATOM   2535  C C    . ASP A 1 176 ? 63.709  140.868 103.794 1.00 37.44  ? 242  ASP A C    1 
ATOM   2536  O O    . ASP A 1 176 ? 64.385  140.882 104.811 1.00 39.42  ? 242  ASP A O    1 
ATOM   2537  C CB   . ASP A 1 176 ? 61.952  139.084 103.418 1.00 51.00  ? 242  ASP A CB   1 
ATOM   2538  C CG   . ASP A 1 176 ? 60.602  138.544 103.897 1.00 73.77  ? 242  ASP A CG   1 
ATOM   2539  O OD1  . ASP A 1 176 ? 60.013  139.128 104.838 1.00 76.11  ? 242  ASP A OD1  1 
ATOM   2540  O OD2  . ASP A 1 176 ? 60.130  137.525 103.333 1.00 75.77  ? 242  ASP A OD2  1 
ATOM   2541  H H    . ASP A 1 176 ? 60.973  141.095 102.464 1.00 30.96  ? 242  ASP A H    1 
ATOM   2542  H HA   . ASP A 1 176 ? 61.944  140.585 104.807 1.00 30.81  ? 242  ASP A HA   1 
ATOM   2543  H HB2  . ASP A 1 176 ? 61.959  139.055 102.449 1.00 61.20  ? 242  ASP A HB2  1 
ATOM   2544  H HB3  . ASP A 1 176 ? 62.648  138.509 103.773 1.00 61.20  ? 242  ASP A HB3  1 
ATOM   2545  N N    . ASN A 1 177 ? 64.226  141.166 102.606 1.00 20.20  ? 243  ASN A N    1 
ATOM   2546  C CA   . ASN A 1 177 ? 65.629  141.536 102.477 1.00 24.48  ? 243  ASN A CA   1 
ATOM   2547  C C    . ASN A 1 177 ? 65.931  142.811 103.224 1.00 27.19  ? 243  ASN A C    1 
ATOM   2548  O O    . ASN A 1 177 ? 66.939  142.909 103.923 1.00 33.62  ? 243  ASN A O    1 
ATOM   2549  C CB   . ASN A 1 177 ? 66.025  141.724 101.020 1.00 16.49  ? 243  ASN A CB   1 
ATOM   2550  C CG   . ASN A 1 177 ? 66.030  140.440 100.265 1.00 35.45  ? 243  ASN A CG   1 
ATOM   2551  O OD1  . ASN A 1 177 ? 66.368  139.399 100.816 1.00 36.18  ? 243  ASN A OD1  1 
ATOM   2552  N ND2  . ASN A 1 177 ? 65.654  140.492 98.988  1.00 54.59  ? 243  ASN A ND2  1 
ATOM   2553  H H    . ASN A 1 177 ? 63.789  141.162 101.866 1.00 24.24  ? 243  ASN A H    1 
ATOM   2554  H HA   . ASN A 1 177 ? 66.179  140.830 102.851 1.00 29.37  ? 243  ASN A HA   1 
ATOM   2555  H HB2  . ASN A 1 177 ? 65.391  142.321 100.593 1.00 19.79  ? 243  ASN A HB2  1 
ATOM   2556  H HB3  . ASN A 1 177 ? 66.917  142.101 100.979 1.00 19.79  ? 243  ASN A HB3  1 
ATOM   2557  H HD21 . ASN A 1 177 ? 65.642  139.774 98.514  1.00 65.51  ? 243  ASN A HD21 1 
ATOM   2558  H HD22 . ASN A 1 177 ? 65.424  141.243 98.638  1.00 65.51  ? 243  ASN A HD22 1 
ATOM   2559  N N    . THR A 1 178 ? 65.061  143.795 103.061 1.00 30.84  ? 244  THR A N    1 
ATOM   2560  C CA   . THR A 1 178 ? 65.293  145.110 103.620 1.00 33.49  ? 244  THR A CA   1 
ATOM   2561  C C    . THR A 1 178 ? 65.193  145.040 105.149 1.00 38.38  ? 244  THR A C    1 
ATOM   2562  O O    . THR A 1 178 ? 65.898  145.751 105.859 1.00 36.01  ? 244  THR A O    1 
ATOM   2563  C CB   . THR A 1 178 ? 64.321  146.140 103.023 1.00 27.75  ? 244  THR A CB   1 
ATOM   2564  O OG1  . THR A 1 178 ? 64.622  147.441 103.518 1.00 42.21  ? 244  THR A OG1  1 
ATOM   2565  C CG2  . THR A 1 178 ? 62.942  145.832 103.421 1.00 68.88  ? 244  THR A CG2  1 
ATOM   2566  H H    . THR A 1 178 ? 64.322  143.724 102.627 1.00 37.00  ? 244  THR A H    1 
ATOM   2567  H HA   . THR A 1 178 ? 66.194  145.390 103.395 1.00 40.19  ? 244  THR A HA   1 
ATOM   2568  H HB   . THR A 1 178 ? 64.380  146.132 102.055 1.00 33.30  ? 244  THR A HB   1 
ATOM   2569  H HG1  . THR A 1 178 ? 64.089  148.003 103.191 1.00 50.66  ? 244  THR A HG1  1 
ATOM   2570  H HG21 . THR A 1 178 ? 62.334  146.486 103.041 1.00 82.66  ? 244  THR A HG21 1 
ATOM   2571  H HG22 . THR A 1 178 ? 62.695  144.950 103.103 1.00 82.66  ? 244  THR A HG22 1 
ATOM   2572  H HG23 . THR A 1 178 ? 62.864  145.853 104.388 1.00 82.66  ? 244  THR A HG23 1 
ATOM   2573  N N    . GLN A 1 179 ? 64.340  144.159 105.654 1.00 32.97  ? 245  GLN A N    1 
ATOM   2574  C CA   . GLN A 1 179 ? 64.271  143.905 107.090 1.00 25.12  ? 245  GLN A CA   1 
ATOM   2575  C C    . GLN A 1 179 ? 65.542  143.208 107.621 1.00 34.51  ? 245  GLN A C    1 
ATOM   2576  O O    . GLN A 1 179 ? 66.009  143.524 108.708 1.00 39.65  ? 245  GLN A O    1 
ATOM   2577  C CB   . GLN A 1 179 ? 63.020  143.086 107.408 1.00 34.83  ? 245  GLN A CB   1 
ATOM   2578  C CG   . GLN A 1 179 ? 62.891  142.585 108.851 1.00 40.68  ? 245  GLN A CG   1 
ATOM   2579  C CD   . GLN A 1 179 ? 62.494  143.668 109.839 1.00 61.78  ? 245  GLN A CD   1 
ATOM   2580  O OE1  . GLN A 1 179 ? 62.018  144.746 109.458 1.00 72.15  ? 245  GLN A OE1  1 
ATOM   2581  N NE2  . GLN A 1 179 ? 62.683  143.381 111.128 1.00 65.65  ? 245  GLN A NE2  1 
ATOM   2582  H H    . GLN A 1 179 ? 63.788  143.693 105.187 1.00 39.56  ? 245  GLN A H    1 
ATOM   2583  H HA   . GLN A 1 179 ? 64.190  144.755 107.550 1.00 30.14  ? 245  GLN A HA   1 
ATOM   2584  H HB2  . GLN A 1 179 ? 62.242  143.635 107.223 1.00 41.80  ? 245  GLN A HB2  1 
ATOM   2585  H HB3  . GLN A 1 179 ? 63.010  142.307 106.830 1.00 41.80  ? 245  GLN A HB3  1 
ATOM   2586  H HG2  . GLN A 1 179 ? 62.213  141.892 108.882 1.00 48.82  ? 245  GLN A HG2  1 
ATOM   2587  H HG3  . GLN A 1 179 ? 63.745  142.223 109.134 1.00 48.82  ? 245  GLN A HG3  1 
ATOM   2588  H HE21 . GLN A 1 179 ? 63.011  142.619 111.355 1.00 78.78  ? 245  GLN A HE21 1 
ATOM   2589  H HE22 . GLN A 1 179 ? 62.476  143.957 111.732 1.00 78.78  ? 245  GLN A HE22 1 
ATOM   2590  N N    . ARG A 1 180 ? 66.098  142.269 106.859 1.00 42.03  ? 246  ARG A N    1 
ATOM   2591  C CA   . ARG A 1 180 ? 67.352  141.619 107.238 1.00 43.76  ? 246  ARG A CA   1 
ATOM   2592  C C    . ARG A 1 180 ? 68.517  142.622 107.260 1.00 58.72  ? 246  ARG A C    1 
ATOM   2593  O O    . ARG A 1 180 ? 69.489  142.449 108.011 1.00 56.07  ? 246  ARG A O    1 
ATOM   2594  C CB   . ARG A 1 180 ? 67.658  140.424 106.319 1.00 26.95  ? 246  ARG A CB   1 
ATOM   2595  C CG   . ARG A 1 180 ? 66.989  139.139 106.792 1.00 56.12  ? 246  ARG A CG   1 
ATOM   2596  C CD   . ARG A 1 180 ? 67.290  137.934 105.923 1.00 53.90  ? 246  ARG A CD   1 
ATOM   2597  N NE   . ARG A 1 180 ? 66.867  138.131 104.538 1.00 50.24  ? 246  ARG A NE   1 
ATOM   2598  C CZ   . ARG A 1 180 ? 65.647  137.870 104.076 1.00 64.45  ? 246  ARG A CZ   1 
ATOM   2599  N NH1  . ARG A 1 180 ? 64.702  137.402 104.893 1.00 82.05  ? 246  ARG A NH1  1 
ATOM   2600  N NH2  . ARG A 1 180 ? 65.361  138.093 102.796 1.00 55.54  ? 246  ARG A NH2  1 
ATOM   2601  H H    . ARG A 1 180 ? 65.769  141.990 106.115 1.00 50.44  ? 246  ARG A H    1 
ATOM   2602  H HA   . ARG A 1 180 ? 67.254  141.272 108.138 1.00 52.51  ? 246  ARG A HA   1 
ATOM   2603  H HB2  . ARG A 1 180 ? 67.334  140.621 105.426 1.00 32.34  ? 246  ARG A HB2  1 
ATOM   2604  H HB3  . ARG A 1 180 ? 68.616  140.276 106.300 1.00 32.34  ? 246  ARG A HB3  1 
ATOM   2605  H HG2  . ARG A 1 180 ? 67.296  138.940 107.691 1.00 67.35  ? 246  ARG A HG2  1 
ATOM   2606  H HG3  . ARG A 1 180 ? 66.028  139.269 106.795 1.00 67.35  ? 246  ARG A HG3  1 
ATOM   2607  H HD2  . ARG A 1 180 ? 68.246  137.771 105.926 1.00 64.68  ? 246  ARG A HD2  1 
ATOM   2608  H HD3  . ARG A 1 180 ? 66.819  137.163 106.275 1.00 64.68  ? 246  ARG A HD3  1 
ATOM   2609  H HE   . ARG A 1 180 ? 67.448  138.437 103.983 1.00 60.29  ? 246  ARG A HE   1 
ATOM   2610  H HH11 . ARG A 1 180 ? 64.882  137.260 105.722 1.00 98.46  ? 246  ARG A HH11 1 
ATOM   2611  H HH12 . ARG A 1 180 ? 63.915  137.237 104.589 1.00 98.46  ? 246  ARG A HH12 1 
ATOM   2612  H HH21 . ARG A 1 180 ? 65.967  138.395 102.266 1.00 66.65  ? 246  ARG A HH21 1 
ATOM   2613  H HH22 . ARG A 1 180 ? 64.573  137.925 102.496 1.00 66.65  ? 246  ARG A HH22 1 
ATOM   2614  N N    . GLN A 1 181 ? 68.420  143.669 106.442 1.00 58.48  ? 247  GLN A N    1 
ATOM   2615  C CA   . GLN A 1 181 ? 69.427  144.729 106.459 1.00 63.64  ? 247  GLN A CA   1 
ATOM   2616  C C    . GLN A 1 181 ? 69.242  145.584 107.701 1.00 60.59  ? 247  GLN A C    1 
ATOM   2617  O O    . GLN A 1 181 ? 70.212  145.965 108.349 1.00 60.99  ? 247  GLN A O    1 
ATOM   2618  C CB   . GLN A 1 181 ? 69.340  145.618 105.206 1.00 58.18  ? 247  GLN A CB   1 
ATOM   2619  C CG   . GLN A 1 181 ? 70.199  145.186 104.004 1.00 60.04  ? 247  GLN A CG   1 
ATOM   2620  C CD   . GLN A 1 181 ? 71.528  144.549 104.406 1.00 72.01  ? 247  GLN A CD   1 
ATOM   2621  O OE1  . GLN A 1 181 ? 72.334  145.153 105.126 1.00 65.15  ? 247  GLN A OE1  1 
ATOM   2622  N NE2  . GLN A 1 181 ? 71.748  143.309 103.962 1.00 74.97  ? 247  GLN A NE2  1 
ATOM   2623  H H    . GLN A 1 181 ? 67.787  143.789 105.872 1.00 70.17  ? 247  GLN A H    1 
ATOM   2624  H HA   . GLN A 1 181 ? 70.311  144.332 106.491 1.00 76.37  ? 247  GLN A HA   1 
ATOM   2625  H HB2  . GLN A 1 181 ? 68.417  145.636 104.909 1.00 69.81  ? 247  GLN A HB2  1 
ATOM   2626  H HB3  . GLN A 1 181 ? 69.617  146.515 105.450 1.00 69.81  ? 247  GLN A HB3  1 
ATOM   2627  H HG2  . GLN A 1 181 ? 69.703  144.536 103.482 1.00 72.05  ? 247  GLN A HG2  1 
ATOM   2628  H HG3  . GLN A 1 181 ? 70.394  145.966 103.462 1.00 72.05  ? 247  GLN A HG3  1 
ATOM   2629  H HE21 . GLN A 1 181 ? 71.156  142.915 103.479 1.00 89.96  ? 247  GLN A HE21 1 
ATOM   2630  H HE22 . GLN A 1 181 ? 72.481  142.905 104.159 1.00 89.96  ? 247  GLN A HE22 1 
ATOM   2631  N N    . TYR A 1 182 ? 67.989  145.883 108.026 1.00 60.95  ? 248  TYR A N    1 
ATOM   2632  C CA   . TYR A 1 182 ? 67.686  146.675 109.201 1.00 55.73  ? 248  TYR A CA   1 
ATOM   2633  C C    . TYR A 1 182 ? 68.231  146.026 110.459 1.00 63.04  ? 248  TYR A C    1 
ATOM   2634  O O    . TYR A 1 182 ? 68.878  146.683 111.270 1.00 68.31  ? 248  TYR A O    1 
ATOM   2635  C CB   . TYR A 1 182 ? 66.188  146.857 109.348 1.00 54.53  ? 248  TYR A CB   1 
ATOM   2636  C CG   . TYR A 1 182 ? 65.816  147.600 110.602 1.00 64.61  ? 248  TYR A CG   1 
ATOM   2637  C CD1  . TYR A 1 182 ? 65.598  146.923 111.786 1.00 66.52  ? 248  TYR A CD1  1 
ATOM   2638  C CD2  . TYR A 1 182 ? 65.694  148.980 110.602 1.00 66.45  ? 248  TYR A CD2  1 
ATOM   2639  C CE1  . TYR A 1 182 ? 65.267  147.595 112.931 1.00 67.29  ? 248  TYR A CE1  1 
ATOM   2640  C CE2  . TYR A 1 182 ? 65.358  149.658 111.740 1.00 64.26  ? 248  TYR A CE2  1 
ATOM   2641  C CZ   . TYR A 1 182 ? 65.149  148.960 112.903 1.00 71.11  ? 248  TYR A CZ   1 
ATOM   2642  O OH   . TYR A 1 182 ? 64.815  149.626 114.053 1.00 88.65  ? 248  TYR A OH   1 
ATOM   2643  H H    . TYR A 1 182 ? 67.297  145.636 107.579 1.00 73.14  ? 248  TYR A H    1 
ATOM   2644  H HA   . TYR A 1 182 ? 68.092  147.551 109.110 1.00 66.88  ? 248  TYR A HA   1 
ATOM   2645  H HB2  . TYR A 1 182 ? 65.855  147.362 108.589 1.00 65.44  ? 248  TYR A HB2  1 
ATOM   2646  H HB3  . TYR A 1 182 ? 65.765  145.985 109.378 1.00 65.44  ? 248  TYR A HB3  1 
ATOM   2647  H HD1  . TYR A 1 182 ? 65.680  145.997 111.806 1.00 79.82  ? 248  TYR A HD1  1 
ATOM   2648  H HD2  . TYR A 1 182 ? 65.837  149.452 109.814 1.00 79.73  ? 248  TYR A HD2  1 
ATOM   2649  H HE1  . TYR A 1 182 ? 65.121  147.129 113.723 1.00 80.75  ? 248  TYR A HE1  1 
ATOM   2650  H HE2  . TYR A 1 182 ? 65.279  150.585 111.728 1.00 77.11  ? 248  TYR A HE2  1 
ATOM   2651  H HH   . TYR A 1 182 ? 64.775  150.452 113.905 1.00 106.38 ? 248  TYR A HH   1 
ATOM   2652  N N    . GLU A 1 183 ? 67.962  144.738 110.629 1.00 60.52  ? 249  GLU A N    1 
ATOM   2653  C CA   . GLU A 1 183 ? 68.420  144.032 111.817 1.00 66.14  ? 249  GLU A CA   1 
ATOM   2654  C C    . GLU A 1 183 ? 69.944  143.943 111.881 1.00 73.21  ? 249  GLU A C    1 
ATOM   2655  O O    . GLU A 1 183 ? 70.517  144.037 112.962 1.00 82.74  ? 249  GLU A O    1 
ATOM   2656  C CB   . GLU A 1 183 ? 67.823  142.629 111.894 1.00 83.88  ? 249  GLU A CB   1 
ATOM   2657  C CG   . GLU A 1 183 ? 67.956  142.016 113.288 1.00 118.95 ? 249  GLU A CG   1 
ATOM   2658  C CD   . GLU A 1 183 ? 67.109  140.764 113.486 1.00 131.59 ? 249  GLU A CD   1 
ATOM   2659  O OE1  . GLU A 1 183 ? 66.127  140.579 112.724 1.00 125.38 ? 249  GLU A OE1  1 
ATOM   2660  O OE2  . GLU A 1 183 ? 67.428  139.975 114.413 1.00 129.53 ? 249  GLU A OE2  1 
ATOM   2661  H H    . GLU A 1 183 ? 67.518  144.253 110.075 1.00 72.62  ? 249  GLU A H    1 
ATOM   2662  H HA   . GLU A 1 183 ? 68.122  144.520 112.600 1.00 79.37  ? 249  GLU A HA   1 
ATOM   2663  H HB2  . GLU A 1 183 ? 66.879  142.673 111.673 1.00 100.65 ? 249  GLU A HB2  1 
ATOM   2664  H HB3  . GLU A 1 183 ? 68.286  142.052 111.267 1.00 100.65 ? 249  GLU A HB3  1 
ATOM   2665  H HG2  . GLU A 1 183 ? 68.883  141.774 113.437 1.00 142.74 ? 249  GLU A HG2  1 
ATOM   2666  H HG3  . GLU A 1 183 ? 67.676  142.671 113.946 1.00 142.74 ? 249  GLU A HG3  1 
ATOM   2667  N N    . ALA A 1 184 ? 70.603  143.766 110.737 1.00 73.42  ? 250  ALA A N    1 
ATOM   2668  C CA   . ALA A 1 184 ? 72.068  143.711 110.705 1.00 69.56  ? 250  ALA A CA   1 
ATOM   2669  C C    . ALA A 1 184 ? 72.705  145.007 111.227 1.00 65.78  ? 250  ALA A C    1 
ATOM   2670  O O    . ALA A 1 184 ? 73.805  144.994 111.773 1.00 76.44  ? 250  ALA A O    1 
ATOM   2671  C CB   . ALA A 1 184 ? 72.572  143.397 109.298 1.00 67.33  ? 250  ALA A CB   1 
ATOM   2672  H H    . ALA A 1 184 ? 70.229  143.677 109.967 1.00 88.11  ? 250  ALA A H    1 
ATOM   2673  H HA   . ALA A 1 184 ? 72.360  142.990 111.285 1.00 83.47  ? 250  ALA A HA   1 
ATOM   2674  H HB1  . ALA A 1 184 ? 73.542  143.367 109.310 1.00 80.80  ? 250  ALA A HB1  1 
ATOM   2675  H HB2  . ALA A 1 184 ? 72.218  142.538 109.021 1.00 80.80  ? 250  ALA A HB2  1 
ATOM   2676  H HB3  . ALA A 1 184 ? 72.270  144.092 108.693 1.00 80.80  ? 250  ALA A HB3  1 
ATOM   2677  N N    . GLU A 1 185 ? 72.003  146.120 111.073 1.00 62.56  ? 251  GLU A N    1 
ATOM   2678  C CA   . GLU A 1 185 ? 72.505  147.402 111.552 1.00 73.50  ? 251  GLU A CA   1 
ATOM   2679  C C    . GLU A 1 185 ? 72.105  147.701 112.995 1.00 96.83  ? 251  GLU A C    1 
ATOM   2680  O O    . GLU A 1 185 ? 72.903  148.274 113.731 1.00 116.20 ? 251  GLU A O    1 
ATOM   2681  C CB   . GLU A 1 185 ? 72.042  148.537 110.646 1.00 76.55  ? 251  GLU A CB   1 
ATOM   2682  C CG   . GLU A 1 185 ? 72.939  148.729 109.440 1.00 74.49  ? 251  GLU A CG   1 
ATOM   2683  C CD   . GLU A 1 185 ? 73.764  149.999 109.505 1.00 88.07  ? 251  GLU A CD   1 
ATOM   2684  O OE1  . GLU A 1 185 ? 73.259  151.014 110.048 1.00 89.96  ? 251  GLU A OE1  1 
ATOM   2685  O OE2  . GLU A 1 185 ? 74.917  149.982 108.999 1.00 99.80  ? 251  GLU A OE2  1 
ATOM   2686  H H    . GLU A 1 185 ? 71.232  146.162 110.695 1.00 75.07  ? 251  GLU A H    1 
ATOM   2687  H HA   . GLU A 1 185 ? 73.474  147.381 111.519 1.00 88.20  ? 251  GLU A HA   1 
ATOM   2688  H HB2  . GLU A 1 185 ? 71.148  148.340 110.325 1.00 91.86  ? 251  GLU A HB2  1 
ATOM   2689  H HB3  . GLU A 1 185 ? 72.039  149.364 111.152 1.00 91.86  ? 251  GLU A HB3  1 
ATOM   2690  H HG2  . GLU A 1 185 ? 73.551  147.979 109.381 1.00 89.38  ? 251  GLU A HG2  1 
ATOM   2691  H HG3  . GLU A 1 185 ? 72.388  148.771 108.643 1.00 89.38  ? 251  GLU A HG3  1 
ATOM   2692  N N    . ARG A 1 186 ? 70.882  147.345 113.393 1.00 97.18  ? 252  ARG A N    1 
ATOM   2693  C CA   . ARG A 1 186 ? 70.484  147.444 114.801 1.00 96.40  ? 252  ARG A CA   1 
ATOM   2694  C C    . ARG A 1 186 ? 71.563  146.771 115.648 1.00 108.15 ? 252  ARG A C    1 
ATOM   2695  O O    . ARG A 1 186 ? 71.991  147.308 116.674 1.00 119.99 ? 252  ARG A O    1 
ATOM   2696  C CB   . ARG A 1 186 ? 69.139  146.757 115.062 1.00 97.27  ? 252  ARG A CB   1 
ATOM   2697  C CG   . ARG A 1 186 ? 68.180  147.562 115.941 1.00 100.92 ? 252  ARG A CG   1 
ATOM   2698  C CD   . ARG A 1 186 ? 67.092  146.676 116.557 1.00 109.31 ? 252  ARG A CD   1 
ATOM   2699  N NE   . ARG A 1 186 ? 67.646  145.742 117.543 1.00 124.62 ? 252  ARG A NE   1 
ATOM   2700  C CZ   . ARG A 1 186 ? 67.337  145.709 118.841 1.00 125.75 ? 252  ARG A CZ   1 
ATOM   2701  N NH1  . ARG A 1 186 ? 66.460  146.557 119.371 1.00 124.13 ? 252  ARG A NH1  1 
ATOM   2702  N NH2  . ARG A 1 186 ? 67.921  144.810 119.626 1.00 119.59 ? 252  ARG A NH2  1 
ATOM   2703  H H    . ARG A 1 186 ? 70.267  147.045 112.873 1.00 116.61 ? 252  ARG A H    1 
ATOM   2704  H HA   . ARG A 1 186 ? 70.417  148.376 115.061 1.00 115.68 ? 252  ARG A HA   1 
ATOM   2705  H HB2  . ARG A 1 186 ? 68.699  146.602 114.212 1.00 116.73 ? 252  ARG A HB2  1 
ATOM   2706  H HB3  . ARG A 1 186 ? 69.303  145.910 115.505 1.00 116.73 ? 252  ARG A HB3  1 
ATOM   2707  H HG2  . ARG A 1 186 ? 68.679  147.975 116.663 1.00 121.10 ? 252  ARG A HG2  1 
ATOM   2708  H HG3  . ARG A 1 186 ? 67.747  148.241 115.401 1.00 121.10 ? 252  ARG A HG3  1 
ATOM   2709  H HD2  . ARG A 1 186 ? 66.439  147.237 117.004 1.00 131.18 ? 252  ARG A HD2  1 
ATOM   2710  H HD3  . ARG A 1 186 ? 66.666  146.159 115.855 1.00 131.18 ? 252  ARG A HD3  1 
ATOM   2711  H HE   . ARG A 1 186 ? 68.219  145.167 117.260 1.00 149.55 ? 252  ARG A HE   1 
ATOM   2712  H HH11 . ARG A 1 186 ? 66.076  147.145 118.875 1.00 148.96 ? 252  ARG A HH11 1 
ATOM   2713  H HH12 . ARG A 1 186 ? 66.276  146.516 120.211 1.00 148.96 ? 252  ARG A HH12 1 
ATOM   2714  H HH21 . ARG A 1 186 ? 68.489  144.255 119.296 1.00 143.51 ? 252  ARG A HH21 1 
ATOM   2715  H HH22 . ARG A 1 186 ? 67.727  144.780 120.463 1.00 143.51 ? 252  ARG A HH22 1 
ATOM   2716  N N    . ASN A 1 187 ? 72.004  145.599 115.191 1.00 105.98 ? 253  ASN A N    1 
ATOM   2717  C CA   . ASN A 1 187 ? 73.091  144.862 115.835 1.00 98.54  ? 253  ASN A CA   1 
ATOM   2718  C C    . ASN A 1 187 ? 74.383  145.674 115.924 1.00 91.42  ? 253  ASN A C    1 
ATOM   2719  O O    . ASN A 1 187 ? 75.063  145.660 116.945 1.00 84.06  ? 253  ASN A O    1 
ATOM   2720  C CB   . ASN A 1 187 ? 73.359  143.543 115.097 1.00 97.78  ? 253  ASN A CB   1 
ATOM   2721  C CG   . ASN A 1 187 ? 72.245  142.527 115.290 1.00 114.68 ? 253  ASN A CG   1 
ATOM   2722  O OD1  . ASN A 1 187 ? 71.487  142.597 116.261 1.00 124.43 ? 253  ASN A OD1  1 
ATOM   2723  N ND2  . ASN A 1 187 ? 72.140  141.574 114.362 1.00 113.90 ? 253  ASN A ND2  1 
ATOM   2724  H H    . ASN A 1 187 ? 71.685  145.203 114.497 1.00 127.17 ? 253  ASN A H    1 
ATOM   2725  H HA   . ASN A 1 187 ? 72.820  144.643 116.740 1.00 118.25 ? 253  ASN A HA   1 
ATOM   2726  H HB2  . ASN A 1 187 ? 73.440  143.723 114.147 1.00 117.34 ? 253  ASN A HB2  1 
ATOM   2727  H HB3  . ASN A 1 187 ? 74.181  143.154 115.433 1.00 117.34 ? 253  ASN A HB3  1 
ATOM   2728  H HD21 . ASN A 1 187 ? 71.525  140.976 114.428 1.00 136.68 ? 253  ASN A HD21 1 
ATOM   2729  H HD22 . ASN A 1 187 ? 72.686  141.558 113.698 1.00 136.68 ? 253  ASN A HD22 1 
ATOM   2730  N N    . LYS A 1 188 ? 74.711  146.384 114.853 1.00 96.89  ? 254  LYS A N    1 
ATOM   2731  C CA   . LYS A 1 188 ? 75.943  147.162 114.797 1.00 95.78  ? 254  LYS A CA   1 
ATOM   2732  C C    . LYS A 1 188 ? 75.682  148.641 115.105 1.00 85.38  ? 254  LYS A C    1 
ATOM   2733  O O    . LYS A 1 188 ? 75.323  149.012 116.227 1.00 71.22  ? 254  LYS A O    1 
ATOM   2734  C CB   . LYS A 1 188 ? 76.597  147.007 113.417 1.00 91.30  ? 254  LYS A CB   1 
ATOM   2735  C CG   . LYS A 1 188 ? 76.883  145.561 113.019 1.00 94.29  ? 254  LYS A CG   1 
ATOM   2736  C CD   . LYS A 1 188 ? 77.818  145.505 111.820 1.00 98.59  ? 254  LYS A CD   1 
ATOM   2737  C CE   . LYS A 1 188 ? 78.228  144.080 111.472 1.00 84.96  ? 254  LYS A CE   1 
ATOM   2738  N NZ   . LYS A 1 188 ? 78.699  143.986 110.060 1.00 76.17  ? 254  LYS A NZ   1 
ATOM   2739  H H    . LYS A 1 188 ? 74.235  146.433 114.138 1.00 116.27 ? 254  LYS A H    1 
ATOM   2740  H HA   . LYS A 1 188 ? 76.562  146.822 115.463 1.00 114.93 ? 254  LYS A HA   1 
ATOM   2741  H HB2  . LYS A 1 188 ? 76.005  147.385 112.748 1.00 109.56 ? 254  LYS A HB2  1 
ATOM   2742  H HB3  . LYS A 1 188 ? 77.441  147.486 113.417 1.00 109.56 ? 254  LYS A HB3  1 
ATOM   2743  H HG2  . LYS A 1 188 ? 77.308  145.101 113.760 1.00 113.15 ? 254  LYS A HG2  1 
ATOM   2744  H HG3  . LYS A 1 188 ? 76.052  145.122 112.780 1.00 113.15 ? 254  LYS A HG3  1 
ATOM   2745  H HD2  . LYS A 1 188 ? 77.369  145.887 111.049 1.00 118.31 ? 254  LYS A HD2  1 
ATOM   2746  H HD3  . LYS A 1 188 ? 78.622  146.010 112.020 1.00 118.31 ? 254  LYS A HD3  1 
ATOM   2747  H HE2  . LYS A 1 188 ? 78.952  143.803 112.054 1.00 101.95 ? 254  LYS A HE2  1 
ATOM   2748  H HE3  . LYS A 1 188 ? 77.465  143.491 111.579 1.00 101.95 ? 254  LYS A HE3  1 
ATOM   2749  H HZ1  . LYS A 1 188 ? 78.934  143.148 109.873 1.00 91.40  ? 254  LYS A HZ1  1 
ATOM   2750  H HZ2  . LYS A 1 188 ? 78.048  144.234 109.505 1.00 91.40  ? 254  LYS A HZ2  1 
ATOM   2751  H HZ3  . LYS A 1 188 ? 79.402  144.518 109.938 1.00 91.40  ? 254  LYS A HZ3  1 
ATOM   2752  N N    . ASN A 1 195 ? 73.360  153.523 112.493 1.00 87.41  ? 261  ASN A N    1 
ATOM   2753  C CA   . ASN A 1 195 ? 73.700  154.912 112.758 1.00 96.61  ? 261  ASN A CA   1 
ATOM   2754  C C    . ASN A 1 195 ? 72.650  155.839 112.117 1.00 101.44 ? 261  ASN A C    1 
ATOM   2755  O O    . ASN A 1 195 ? 71.585  156.061 112.694 1.00 95.03  ? 261  ASN A O    1 
ATOM   2756  C CB   . ASN A 1 195 ? 75.133  155.196 112.274 1.00 104.83 ? 261  ASN A CB   1 
ATOM   2757  C CG   . ASN A 1 195 ? 75.763  156.391 112.971 1.00 107.10 ? 261  ASN A CG   1 
ATOM   2758  O OD1  . ASN A 1 195 ? 75.072  157.326 113.385 1.00 107.15 ? 261  ASN A OD1  1 
ATOM   2759  N ND2  . ASN A 1 195 ? 77.088  156.355 113.121 1.00 101.90 ? 261  ASN A ND2  1 
ATOM   2760  H HA   . ASN A 1 195 ? 73.678  155.060 113.716 1.00 115.94 ? 261  ASN A HA   1 
ATOM   2761  H HB2  . ASN A 1 195 ? 75.686  154.419 112.451 1.00 125.80 ? 261  ASN A HB2  1 
ATOM   2762  H HB3  . ASN A 1 195 ? 75.114  155.380 111.322 1.00 125.80 ? 261  ASN A HB3  1 
ATOM   2763  H HD21 . ASN A 1 195 ? 77.495  157.006 113.508 1.00 122.28 ? 261  ASN A HD21 1 
ATOM   2764  H HD22 . ASN A 1 195 ? 77.535  155.681 112.829 1.00 122.28 ? 261  ASN A HD22 1 
ATOM   2765  N N    . GLU A 1 196 ? 72.945  156.364 110.929 1.00 106.12 ? 262  GLU A N    1 
ATOM   2766  C CA   . GLU A 1 196 ? 71.998  157.186 110.168 1.00 92.60  ? 262  GLU A CA   1 
ATOM   2767  C C    . GLU A 1 196 ? 71.408  156.352 109.036 1.00 83.06  ? 262  GLU A C    1 
ATOM   2768  O O    . GLU A 1 196 ? 70.362  156.683 108.482 1.00 62.88  ? 262  GLU A O    1 
ATOM   2769  C CB   . GLU A 1 196 ? 72.703  158.421 109.596 1.00 96.26  ? 262  GLU A CB   1 
ATOM   2770  C CG   . GLU A 1 196 ? 73.435  159.276 110.636 1.00 111.90 ? 262  GLU A CG   1 
ATOM   2771  C CD   . GLU A 1 196 ? 72.494  159.962 111.623 1.00 121.28 ? 262  GLU A CD   1 
ATOM   2772  O OE1  . GLU A 1 196 ? 72.562  161.207 111.747 1.00 109.28 ? 262  GLU A OE1  1 
ATOM   2773  O OE2  . GLU A 1 196 ? 71.694  159.258 112.281 1.00 130.97 ? 262  GLU A OE2  1 
ATOM   2774  H H    . GLU A 1 196 ? 73.701  156.258 110.533 1.00 127.34 ? 262  GLU A H    1 
ATOM   2775  H HA   . GLU A 1 196 ? 71.277  157.478 110.748 1.00 111.12 ? 262  GLU A HA   1 
ATOM   2776  H HB2  . GLU A 1 196 ? 73.358  158.130 108.943 1.00 115.51 ? 262  GLU A HB2  1 
ATOM   2777  H HB3  . GLU A 1 196 ? 72.041  158.985 109.166 1.00 115.51 ? 262  GLU A HB3  1 
ATOM   2778  H HG2  . GLU A 1 196 ? 74.037  158.709 111.142 1.00 134.28 ? 262  GLU A HG2  1 
ATOM   2779  H HG3  . GLU A 1 196 ? 73.940  159.966 110.177 1.00 134.28 ? 262  GLU A HG3  1 
ATOM   2780  N N    . ARG A 1 197 ? 72.097  155.264 108.700 1.00 88.33  ? 263  ARG A N    1 
ATOM   2781  C CA   . ARG A 1 197 ? 71.579  154.294 107.748 1.00 72.59  ? 263  ARG A CA   1 
ATOM   2782  C C    . ARG A 1 197 ? 70.362  153.633 108.378 1.00 71.65  ? 263  ARG A C    1 
ATOM   2783  O O    . ARG A 1 197 ? 69.537  153.036 107.690 1.00 70.60  ? 263  ARG A O    1 
ATOM   2784  C CB   . ARG A 1 197 ? 72.638  153.240 107.393 1.00 55.32  ? 263  ARG A CB   1 
ATOM   2785  C CG   . ARG A 1 197 ? 72.107  152.080 106.555 1.00 47.73  ? 263  ARG A CG   1 
ATOM   2786  C CD   . ARG A 1 197 ? 73.213  151.183 106.020 1.00 41.37  ? 263  ARG A CD   1 
ATOM   2787  N NE   . ARG A 1 197 ? 72.730  150.290 104.959 1.00 66.90  ? 263  ARG A NE   1 
ATOM   2788  C CZ   . ARG A 1 197 ? 72.580  148.963 105.059 1.00 68.67  ? 263  ARG A CZ   1 
ATOM   2789  N NH1  . ARG A 1 197 ? 72.895  148.303 106.173 1.00 54.67  ? 263  ARG A NH1  1 
ATOM   2790  N NH2  . ARG A 1 197 ? 72.129  148.279 104.011 1.00 51.21  ? 263  ARG A NH2  1 
ATOM   2791  H H    . ARG A 1 197 ? 72.873  155.066 109.013 1.00 105.99 ? 263  ARG A H    1 
ATOM   2792  H HA   . ARG A 1 197 ? 71.304  154.747 106.935 1.00 87.10  ? 263  ARG A HA   1 
ATOM   2793  H HB2  . ARG A 1 197 ? 73.347  153.668 106.889 1.00 66.39  ? 263  ARG A HB2  1 
ATOM   2794  H HB3  . ARG A 1 197 ? 72.996  152.870 108.215 1.00 66.39  ? 263  ARG A HB3  1 
ATOM   2795  H HG2  . ARG A 1 197 ? 71.519  151.537 107.103 1.00 57.27  ? 263  ARG A HG2  1 
ATOM   2796  H HG3  . ARG A 1 197 ? 71.617  152.437 105.797 1.00 57.27  ? 263  ARG A HG3  1 
ATOM   2797  H HD2  . ARG A 1 197 ? 73.921  151.735 105.652 1.00 49.65  ? 263  ARG A HD2  1 
ATOM   2798  H HD3  . ARG A 1 197 ? 73.558  150.636 106.743 1.00 49.65  ? 263  ARG A HD3  1 
ATOM   2799  H HE   . ARG A 1 197 ? 72.525  150.651 104.207 1.00 80.28  ? 263  ARG A HE   1 
ATOM   2800  H HH11 . ARG A 1 197 ? 73.189  148.732 106.858 1.00 65.61  ? 263  ARG A HH11 1 
ATOM   2801  H HH12 . ARG A 1 197 ? 72.794  147.450 106.210 1.00 65.61  ? 263  ARG A HH12 1 
ATOM   2802  H HH21 . ARG A 1 197 ? 71.927  148.691 103.283 1.00 61.45  ? 263  ARG A HH21 1 
ATOM   2803  H HH22 . ARG A 1 197 ? 72.035  147.426 104.063 1.00 61.45  ? 263  ARG A HH22 1 
ATOM   2804  N N    . LEU A 1 198 ? 70.248  153.756 109.696 1.00 83.03  ? 264  LEU A N    1 
ATOM   2805  C CA   . LEU A 1 198 ? 69.156  153.131 110.424 1.00 71.29  ? 264  LEU A CA   1 
ATOM   2806  C C    . LEU A 1 198 ? 67.835  153.815 110.127 1.00 46.85  ? 264  LEU A C    1 
ATOM   2807  O O    . LEU A 1 198 ? 66.851  153.154 109.869 1.00 42.78  ? 264  LEU A O    1 
ATOM   2808  C CB   . LEU A 1 198 ? 69.427  153.163 111.921 1.00 63.19  ? 264  LEU A CB   1 
ATOM   2809  C CG   . LEU A 1 198 ? 68.696  152.078 112.706 1.00 68.26  ? 264  LEU A CG   1 
ATOM   2810  C CD1  . LEU A 1 198 ? 69.212  150.683 112.344 1.00 65.43  ? 264  LEU A CD1  1 
ATOM   2811  C CD2  . LEU A 1 198 ? 68.810  152.319 114.213 1.00 77.47  ? 264  LEU A CD2  1 
ATOM   2812  H H    . LEU A 1 198 ? 70.793  154.199 110.192 1.00 99.64  ? 264  LEU A H    1 
ATOM   2813  H HA   . LEU A 1 198 ? 69.083  152.203 110.151 1.00 85.54  ? 264  LEU A HA   1 
ATOM   2814  H HB2  . LEU A 1 198 ? 70.379  153.044 112.068 1.00 75.83  ? 264  LEU A HB2  1 
ATOM   2815  H HB3  . LEU A 1 198 ? 69.146  154.022 112.271 1.00 75.83  ? 264  LEU A HB3  1 
ATOM   2816  H HG   . LEU A 1 198 ? 67.754  152.111 112.475 1.00 81.92  ? 264  LEU A HG   1 
ATOM   2817  H HD11 . LEU A 1 198 ? 68.725  150.023 112.861 1.00 78.52  ? 264  LEU A HD11 1 
ATOM   2818  H HD12 . LEU A 1 198 ? 69.071  150.531 111.396 1.00 78.52  ? 264  LEU A HD12 1 
ATOM   2819  H HD13 . LEU A 1 198 ? 70.158  150.634 112.550 1.00 78.52  ? 264  LEU A HD13 1 
ATOM   2820  H HD21 . LEU A 1 198 ? 68.336  151.614 114.682 1.00 92.96  ? 264  LEU A HD21 1 
ATOM   2821  H HD22 . LEU A 1 198 ? 69.747  152.311 114.463 1.00 92.96  ? 264  LEU A HD22 1 
ATOM   2822  H HD23 . LEU A 1 198 ? 68.418  153.180 114.425 1.00 92.96  ? 264  LEU A HD23 1 
ATOM   2823  N N    . GLU A 1 199 ? 67.817  155.140 110.164 1.00 63.04  ? 265  GLU A N    1 
ATOM   2824  C CA   . GLU A 1 199 ? 66.593  155.893 109.905 1.00 75.26  ? 265  GLU A CA   1 
ATOM   2825  C C    . GLU A 1 199 ? 66.148  155.660 108.475 1.00 72.55  ? 265  GLU A C    1 
ATOM   2826  O O    . GLU A 1 199 ? 64.947  155.599 108.195 1.00 79.52  ? 265  GLU A O    1 
ATOM   2827  C CB   . GLU A 1 199 ? 66.822  157.391 110.117 1.00 81.69  ? 265  GLU A CB   1 
ATOM   2828  C CG   . GLU A 1 199 ? 67.289  157.767 111.526 1.00 95.92  ? 265  GLU A CG   1 
ATOM   2829  C CD   . GLU A 1 199 ? 66.151  158.023 112.501 1.00 105.03 ? 265  GLU A CD   1 
ATOM   2830  O OE1  . GLU A 1 199 ? 64.992  158.170 112.046 1.00 100.92 ? 265  GLU A OE1  1 
ATOM   2831  O OE2  . GLU A 1 199 ? 66.429  158.081 113.725 1.00 105.85 ? 265  GLU A OE2  1 
ATOM   2832  H H    . GLU A 1 199 ? 68.501  155.631 110.338 1.00 75.65  ? 265  GLU A H    1 
ATOM   2833  H HA   . GLU A 1 199 ? 65.890  155.596 110.504 1.00 90.31  ? 265  GLU A HA   1 
ATOM   2834  H HB2  . GLU A 1 199 ? 67.500  157.693 109.492 1.00 98.03  ? 265  GLU A HB2  1 
ATOM   2835  H HB3  . GLU A 1 199 ? 65.989  157.859 109.947 1.00 98.03  ? 265  GLU A HB3  1 
ATOM   2836  H HG2  . GLU A 1 199 ? 67.826  157.042 111.881 1.00 115.10 ? 265  GLU A HG2  1 
ATOM   2837  H HG3  . GLU A 1 199 ? 67.821  158.576 111.473 1.00 115.10 ? 265  GLU A HG3  1 
ATOM   2838  N N    . LEU A 1 200 ? 67.121  155.530 107.575 1.00 56.84  ? 266  LEU A N    1 
ATOM   2839  C CA   . LEU A 1 200 ? 66.832  155.279 106.171 1.00 47.56  ? 266  LEU A CA   1 
ATOM   2840  C C    . LEU A 1 200 ? 66.219  153.902 105.979 1.00 43.61  ? 266  LEU A C    1 
ATOM   2841  O O    . LEU A 1 200 ? 65.191  153.798 105.339 1.00 40.16  ? 266  LEU A O    1 
ATOM   2842  C CB   . LEU A 1 200 ? 68.081  155.436 105.312 1.00 46.69  ? 266  LEU A CB   1 
ATOM   2843  C CG   . LEU A 1 200 ? 68.609  156.870 105.302 1.00 51.33  ? 266  LEU A CG   1 
ATOM   2844  C CD1  . LEU A 1 200 ? 69.958  156.972 104.591 1.00 69.62  ? 266  LEU A CD1  1 
ATOM   2845  C CD2  . LEU A 1 200 ? 67.608  157.823 104.673 1.00 37.97  ? 266  LEU A CD2  1 
ATOM   2846  H H    . LEU A 1 200 ? 67.960  155.585 107.756 1.00 68.20  ? 266  LEU A H    1 
ATOM   2847  H HA   . LEU A 1 200 ? 66.183  155.933 105.867 1.00 57.08  ? 266  LEU A HA   1 
ATOM   2848  H HB2  . LEU A 1 200 ? 68.780  154.861 105.662 1.00 56.03  ? 266  LEU A HB2  1 
ATOM   2849  H HB3  . LEU A 1 200 ? 67.871  155.187 104.399 1.00 56.03  ? 266  LEU A HB3  1 
ATOM   2850  H HG   . LEU A 1 200 ? 68.743  157.153 106.220 1.00 61.59  ? 266  LEU A HG   1 
ATOM   2851  H HD11 . LEU A 1 200 ? 70.254  157.895 104.608 1.00 83.54  ? 266  LEU A HD11 1 
ATOM   2852  H HD12 . LEU A 1 200 ? 70.600  156.409 105.051 1.00 83.54  ? 266  LEU A HD12 1 
ATOM   2853  H HD13 . LEU A 1 200 ? 69.854  156.674 103.674 1.00 83.54  ? 266  LEU A HD13 1 
ATOM   2854  H HD21 . LEU A 1 200 ? 67.977  158.720 104.684 1.00 45.56  ? 266  LEU A HD21 1 
ATOM   2855  H HD22 . LEU A 1 200 ? 67.440  157.545 103.759 1.00 45.56  ? 266  LEU A HD22 1 
ATOM   2856  H HD23 . LEU A 1 200 ? 66.784  157.797 105.184 1.00 45.56  ? 266  LEU A HD23 1 
ATOM   2857  N N    . LEU A 1 201 ? 66.819  152.852 106.540 1.00 46.62  ? 267  LEU A N    1 
ATOM   2858  C CA   . LEU A 1 201 ? 66.226  151.514 106.445 1.00 44.61  ? 267  LEU A CA   1 
ATOM   2859  C C    . LEU A 1 201 ? 64.830  151.480 107.073 1.00 50.33  ? 267  LEU A C    1 
ATOM   2860  O O    . LEU A 1 201 ? 63.930  150.820 106.568 1.00 50.00  ? 267  LEU A O    1 
ATOM   2861  C CB   . LEU A 1 201 ? 67.130  150.464 107.077 1.00 32.84  ? 267  LEU A CB   1 
ATOM   2862  C CG   . LEU A 1 201 ? 68.422  150.231 106.287 1.00 48.00  ? 267  LEU A CG   1 
ATOM   2863  C CD1  . LEU A 1 201 ? 69.307  149.160 106.906 1.00 40.60  ? 267  LEU A CD1  1 
ATOM   2864  C CD2  . LEU A 1 201 ? 68.132  149.876 104.841 1.00 48.90  ? 267  LEU A CD2  1 
ATOM   2865  H H    . LEU A 1 201 ? 67.560  152.884 106.975 1.00 55.94  ? 267  LEU A H    1 
ATOM   2866  H HA   . LEU A 1 201 ? 66.129  151.288 105.506 1.00 53.54  ? 267  LEU A HA   1 
ATOM   2867  H HB2  . LEU A 1 201 ? 67.374  150.754 107.970 1.00 39.40  ? 267  LEU A HB2  1 
ATOM   2868  H HB3  . LEU A 1 201 ? 66.651  149.622 107.122 1.00 39.40  ? 267  LEU A HB3  1 
ATOM   2869  H HG   . LEU A 1 201 ? 68.929  151.057 106.285 1.00 57.60  ? 267  LEU A HG   1 
ATOM   2870  H HD11 . LEU A 1 201 ? 70.105  149.058 106.364 1.00 48.72  ? 267  LEU A HD11 1 
ATOM   2871  H HD12 . LEU A 1 201 ? 69.549  149.432 107.805 1.00 48.72  ? 267  LEU A HD12 1 
ATOM   2872  H HD13 . LEU A 1 201 ? 68.817  148.323 106.935 1.00 48.72  ? 267  LEU A HD13 1 
ATOM   2873  H HD21 . LEU A 1 201 ? 68.972  149.736 104.376 1.00 58.68  ? 267  LEU A HD21 1 
ATOM   2874  H HD22 . LEU A 1 201 ? 67.601  149.064 104.816 1.00 58.68  ? 267  LEU A HD22 1 
ATOM   2875  H HD23 . LEU A 1 201 ? 67.642  150.605 104.430 1.00 58.68  ? 267  LEU A HD23 1 
ATOM   2876  N N    . LEU A 1 202 ? 64.635  152.204 108.164 1.00 59.74  ? 268  LEU A N    1 
ATOM   2877  C CA   . LEU A 1 202 ? 63.314  152.299 108.740 1.00 44.49  ? 268  LEU A CA   1 
ATOM   2878  C C    . LEU A 1 202 ? 62.384  153.014 107.785 1.00 39.54  ? 268  LEU A C    1 
ATOM   2879  O O    . LEU A 1 202 ? 61.242  152.606 107.604 1.00 45.41  ? 268  LEU A O    1 
ATOM   2880  C CB   . LEU A 1 202 ? 63.362  153.054 110.050 1.00 43.31  ? 268  LEU A CB   1 
ATOM   2881  C CG   . LEU A 1 202 ? 62.120  152.773 110.876 1.00 59.53  ? 268  LEU A CG   1 
ATOM   2882  C CD1  . LEU A 1 202 ? 62.192  151.373 111.470 1.00 60.41  ? 268  LEU A CD1  1 
ATOM   2883  C CD2  . LEU A 1 202 ? 61.975  153.819 111.944 1.00 71.83  ? 268  LEU A CD2  1 
ATOM   2884  H H    . LEU A 1 202 ? 65.245  152.643 108.582 1.00 71.69  ? 268  LEU A H    1 
ATOM   2885  H HA   . LEU A 1 202 ? 62.965  151.409 108.906 1.00 53.39  ? 268  LEU A HA   1 
ATOM   2886  H HB2  . LEU A 1 202 ? 64.138  152.770 110.558 1.00 51.98  ? 268  LEU A HB2  1 
ATOM   2887  H HB3  . LEU A 1 202 ? 63.403  154.007 109.873 1.00 51.98  ? 268  LEU A HB3  1 
ATOM   2888  H HG   . LEU A 1 202 ? 61.339  152.818 110.302 1.00 71.44  ? 268  LEU A HG   1 
ATOM   2889  H HD11 . LEU A 1 202 ? 61.392  151.211 111.994 1.00 72.49  ? 268  LEU A HD11 1 
ATOM   2890  H HD12 . LEU A 1 202 ? 62.253  150.727 110.749 1.00 72.49  ? 268  LEU A HD12 1 
ATOM   2891  H HD13 . LEU A 1 202 ? 62.977  151.312 112.037 1.00 72.49  ? 268  LEU A HD13 1 
ATOM   2892  H HD21 . LEU A 1 202 ? 61.178  153.629 112.465 1.00 86.20  ? 268  LEU A HD21 1 
ATOM   2893  H HD22 . LEU A 1 202 ? 62.758  153.795 112.517 1.00 86.20  ? 268  LEU A HD22 1 
ATOM   2894  H HD23 . LEU A 1 202 ? 61.896  154.690 111.525 1.00 86.20  ? 268  LEU A HD23 1 
ATOM   2895  N N    . GLN A 1 203 ? 62.877  154.083 107.176 1.00 39.44  ? 269  GLN A N    1 
ATOM   2896  C CA   . GLN A 1 203 ? 62.073  154.864 106.242 1.00 50.67  ? 269  GLN A CA   1 
ATOM   2897  C C    . GLN A 1 203 ? 61.636  153.996 105.058 1.00 56.03  ? 269  GLN A C    1 
ATOM   2898  O O    . GLN A 1 203 ? 60.468  153.998 104.676 1.00 55.39  ? 269  GLN A O    1 
ATOM   2899  C CB   . GLN A 1 203 ? 62.870  156.077 105.753 1.00 44.07  ? 269  GLN A CB   1 
ATOM   2900  C CG   . GLN A 1 203 ? 62.074  157.079 104.946 1.00 51.42  ? 269  GLN A CG   1 
ATOM   2901  C CD   . GLN A 1 203 ? 60.769  157.459 105.617 1.00 71.07  ? 269  GLN A CD   1 
ATOM   2902  O OE1  . GLN A 1 203 ? 60.686  157.564 106.848 1.00 74.64  ? 269  GLN A OE1  1 
ATOM   2903  N NE2  . GLN A 1 203 ? 59.730  157.643 104.811 1.00 78.20  ? 269  GLN A NE2  1 
ATOM   2904  H H    . GLN A 1 203 ? 63.677  154.380 107.285 1.00 47.32  ? 269  GLN A H    1 
ATOM   2905  H HA   . GLN A 1 203 ? 61.277  155.184 106.695 1.00 60.81  ? 269  GLN A HA   1 
ATOM   2906  H HB2  . GLN A 1 203 ? 63.229  156.542 106.525 1.00 52.89  ? 269  GLN A HB2  1 
ATOM   2907  H HB3  . GLN A 1 203 ? 63.598  155.763 105.195 1.00 52.89  ? 269  GLN A HB3  1 
ATOM   2908  H HG2  . GLN A 1 203 ? 62.600  157.886 104.834 1.00 61.71  ? 269  GLN A HG2  1 
ATOM   2909  H HG3  . GLN A 1 203 ? 61.866  156.695 104.079 1.00 61.71  ? 269  GLN A HG3  1 
ATOM   2910  H HE21 . GLN A 1 203 ? 59.822  157.545 103.961 1.00 93.84  ? 269  GLN A HE21 1 
ATOM   2911  H HE22 . GLN A 1 203 ? 58.965  157.859 105.138 1.00 93.84  ? 269  GLN A HE22 1 
ATOM   2912  N N    . LYS A 1 204 ? 62.589  153.247 104.505 1.00 51.62  ? 270  LYS A N    1 
ATOM   2913  C CA   . LYS A 1 204 ? 62.355  152.330 103.396 1.00 43.09  ? 270  LYS A CA   1 
ATOM   2914  C C    . LYS A 1 204 ? 61.345  151.239 103.742 1.00 54.05  ? 270  LYS A C    1 
ATOM   2915  O O    . LYS A 1 204 ? 60.469  150.899 102.945 1.00 45.35  ? 270  LYS A O    1 
ATOM   2916  C CB   . LYS A 1 204 ? 63.667  151.641 103.028 1.00 30.60  ? 270  LYS A CB   1 
ATOM   2917  C CG   . LYS A 1 204 ? 63.606  150.889 101.731 1.00 25.90  ? 270  LYS A CG   1 
ATOM   2918  C CD   . LYS A 1 204 ? 64.857  150.122 101.458 1.00 26.31  ? 270  LYS A CD   1 
ATOM   2919  C CE   . LYS A 1 204 ? 64.877  149.656 100.012 1.00 50.93  ? 270  LYS A CE   1 
ATOM   2920  N NZ   . LYS A 1 204 ? 65.363  148.253 99.849  1.00 59.59  ? 270  LYS A NZ   1 
ATOM   2921  H H    . LYS A 1 204 ? 63.408  153.256 104.768 1.00 61.94  ? 270  LYS A H    1 
ATOM   2922  H HA   . LYS A 1 204 ? 62.033  152.821 102.625 1.00 51.71  ? 270  LYS A HA   1 
ATOM   2923  H HB2  . LYS A 1 204 ? 64.363  152.313 102.950 1.00 36.72  ? 270  LYS A HB2  1 
ATOM   2924  H HB3  . LYS A 1 204 ? 63.897  151.009 103.727 1.00 36.72  ? 270  LYS A HB3  1 
ATOM   2925  H HG2  . LYS A 1 204 ? 62.868  150.260 101.763 1.00 31.08  ? 270  LYS A HG2  1 
ATOM   2926  H HG3  . LYS A 1 204 ? 63.475  151.519 101.005 1.00 31.08  ? 270  LYS A HG3  1 
ATOM   2927  H HD2  . LYS A 1 204 ? 65.628  150.692 101.610 1.00 31.57  ? 270  LYS A HD2  1 
ATOM   2928  H HD3  . LYS A 1 204 ? 64.892  149.342 102.034 1.00 31.57  ? 270  LYS A HD3  1 
ATOM   2929  H HE2  . LYS A 1 204 ? 63.977  149.703 99.654  1.00 61.12  ? 270  LYS A HE2  1 
ATOM   2930  H HE3  . LYS A 1 204 ? 65.466  150.236 99.504  1.00 61.12  ? 270  LYS A HE3  1 
ATOM   2931  H HZ1  . LYS A 1 204 ? 65.357  148.027 98.988  1.00 71.51  ? 270  LYS A HZ1  1 
ATOM   2932  H HZ2  . LYS A 1 204 ? 66.194  148.180 100.160 1.00 71.51  ? 270  LYS A HZ2  1 
ATOM   2933  H HZ3  . LYS A 1 204 ? 64.836  147.694 100.298 1.00 71.51  ? 270  LYS A HZ3  1 
ATOM   2934  N N    . ARG A 1 205 ? 61.510  150.657 104.923 1.00 52.68  ? 271  ARG A N    1 
ATOM   2935  C CA   . ARG A 1 205 ? 60.666  149.560 105.350 1.00 43.92  ? 271  ARG A CA   1 
ATOM   2936  C C    . ARG A 1 205 ? 59.251  150.080 105.472 1.00 41.50  ? 271  ARG A C    1 
ATOM   2937  O O    . ARG A 1 205 ? 58.275  149.364 105.264 1.00 49.54  ? 271  ARG A O    1 
ATOM   2938  C CB   . ARG A 1 205 ? 61.191  148.989 106.672 1.00 41.64  ? 271  ARG A CB   1 
ATOM   2939  C CG   . ARG A 1 205 ? 60.195  148.171 107.445 1.00 53.10  ? 271  ARG A CG   1 
ATOM   2940  C CD   . ARG A 1 205 ? 60.845  147.365 108.563 1.00 63.83  ? 271  ARG A CD   1 
ATOM   2941  N NE   . ARG A 1 205 ? 60.823  148.113 109.810 1.00 81.64  ? 271  ARG A NE   1 
ATOM   2942  C CZ   . ARG A 1 205 ? 59.711  148.405 110.481 1.00 93.24  ? 271  ARG A CZ   1 
ATOM   2943  N NH1  . ARG A 1 205 ? 58.526  148.000 110.032 1.00 95.65  ? 271  ARG A NH1  1 
ATOM   2944  N NH2  . ARG A 1 205 ? 59.780  149.103 111.605 1.00 93.72  ? 271  ARG A NH2  1 
ATOM   2945  H H    . ARG A 1 205 ? 62.109  150.883 105.497 1.00 63.22  ? 271  ARG A H    1 
ATOM   2946  H HA   . ARG A 1 205 ? 60.681  148.857 104.682 1.00 52.70  ? 271  ARG A HA   1 
ATOM   2947  H HB2  . ARG A 1 205 ? 61.953  148.421 106.482 1.00 49.97  ? 271  ARG A HB2  1 
ATOM   2948  H HB3  . ARG A 1 205 ? 61.468  149.727 107.238 1.00 49.97  ? 271  ARG A HB3  1 
ATOM   2949  H HG2  . ARG A 1 205 ? 59.539  148.764 107.844 1.00 63.72  ? 271  ARG A HG2  1 
ATOM   2950  H HG3  . ARG A 1 205 ? 59.758  147.550 106.841 1.00 63.72  ? 271  ARG A HG3  1 
ATOM   2951  H HD2  . ARG A 1 205 ? 60.355  146.538 108.693 1.00 76.60  ? 271  ARG A HD2  1 
ATOM   2952  H HD3  . ARG A 1 205 ? 61.769  147.179 108.333 1.00 76.60  ? 271  ARG A HD3  1 
ATOM   2953  H HE   . ARG A 1 205 ? 61.561  148.459 110.085 1.00 97.97  ? 271  ARG A HE   1 
ATOM   2954  H HH11 . ARG A 1 205 ? 58.474  147.549 109.301 1.00 114.78 ? 271  ARG A HH11 1 
ATOM   2955  H HH12 . ARG A 1 205 ? 57.811  148.190 110.471 1.00 114.78 ? 271  ARG A HH12 1 
ATOM   2956  H HH21 . ARG A 1 205 ? 60.543  149.365 111.903 1.00 112.47 ? 271  ARG A HH21 1 
ATOM   2957  H HH22 . ARG A 1 205 ? 59.062  149.286 112.042 1.00 112.47 ? 271  ARG A HH22 1 
ATOM   2958  N N    . LYS A 1 206 ? 59.150  151.356 105.780 1.00 41.55  ? 272  LYS A N    1 
ATOM   2959  C CA   . LYS A 1 206 ? 57.865  152.002 105.928 1.00 54.45  ? 272  LYS A CA   1 
ATOM   2960  C C    . LYS A 1 206 ? 57.281  152.313 104.551 1.00 47.11  ? 272  LYS A C    1 
ATOM   2961  O O    . LYS A 1 206 ? 56.129  151.989 104.283 1.00 46.22  ? 272  LYS A O    1 
ATOM   2962  C CB   . LYS A 1 206 ? 58.067  153.261 106.766 1.00 66.28  ? 272  LYS A CB   1 
ATOM   2963  C CG   . LYS A 1 206 ? 56.816  153.953 107.285 1.00 54.27  ? 272  LYS A CG   1 
ATOM   2964  C CD   . LYS A 1 206 ? 57.175  155.138 108.203 1.00 65.58  ? 272  LYS A CD   1 
ATOM   2965  C CE   . LYS A 1 206 ? 58.060  154.717 109.413 1.00 89.94  ? 272  LYS A CE   1 
ATOM   2966  N NZ   . LYS A 1 206 ? 58.695  155.859 110.161 1.00 84.33  ? 272  LYS A NZ   1 
ATOM   2967  H H    . LYS A 1 206 ? 59.821  151.877 105.910 1.00 49.86  ? 272  LYS A H    1 
ATOM   2968  H HA   . LYS A 1 206 ? 57.255  151.412 106.397 1.00 65.34  ? 272  LYS A HA   1 
ATOM   2969  H HB2  . LYS A 1 206 ? 58.604  153.026 107.539 1.00 79.53  ? 272  LYS A HB2  1 
ATOM   2970  H HB3  . LYS A 1 206 ? 58.549  153.908 106.228 1.00 79.53  ? 272  LYS A HB3  1 
ATOM   2971  H HG2  . LYS A 1 206 ? 56.303  154.292 106.535 1.00 65.13  ? 272  LYS A HG2  1 
ATOM   2972  H HG3  . LYS A 1 206 ? 56.288  153.320 107.796 1.00 65.13  ? 272  LYS A HG3  1 
ATOM   2973  H HD2  . LYS A 1 206 ? 57.665  155.799 107.689 1.00 78.70  ? 272  LYS A HD2  1 
ATOM   2974  H HD3  . LYS A 1 206 ? 56.358  155.528 108.551 1.00 78.70  ? 272  LYS A HD3  1 
ATOM   2975  H HE2  . LYS A 1 206 ? 57.510  154.225 110.042 1.00 107.92 ? 272  LYS A HE2  1 
ATOM   2976  H HE3  . LYS A 1 206 ? 58.774  154.146 109.090 1.00 107.92 ? 272  LYS A HE3  1 
ATOM   2977  H HZ1  . LYS A 1 206 ? 59.183  155.546 110.836 1.00 101.20 ? 272  LYS A HZ1  1 
ATOM   2978  H HZ2  . LYS A 1 206 ? 59.221  156.325 109.615 1.00 101.20 ? 272  LYS A HZ2  1 
ATOM   2979  H HZ3  . LYS A 1 206 ? 58.065  156.397 110.485 1.00 101.20 ? 272  LYS A HZ3  1 
ATOM   2980  N N    . GLU A 1 207 ? 58.076  152.916 103.674 1.00 39.21  ? 273  GLU A N    1 
ATOM   2981  C CA   . GLU A 1 207 ? 57.629  153.164 102.310 1.00 36.11  ? 273  GLU A CA   1 
ATOM   2982  C C    . GLU A 1 207 ? 57.085  151.884 101.695 1.00 46.78  ? 273  GLU A C    1 
ATOM   2983  O O    . GLU A 1 207 ? 56.074  151.919 101.001 1.00 61.51  ? 273  GLU A O    1 
ATOM   2984  C CB   . GLU A 1 207 ? 58.758  153.690 101.420 1.00 26.20  ? 273  GLU A CB   1 
ATOM   2985  C CG   . GLU A 1 207 ? 59.271  155.082 101.742 1.00 42.50  ? 273  GLU A CG   1 
ATOM   2986  C CD   . GLU A 1 207 ? 60.247  155.592 100.686 1.00 74.23  ? 273  GLU A CD   1 
ATOM   2987  O OE1  . GLU A 1 207 ? 60.905  154.760 100.006 1.00 74.97  ? 273  GLU A OE1  1 
ATOM   2988  O OE2  . GLU A 1 207 ? 60.345  156.830 100.533 1.00 79.79  ? 273  GLU A OE2  1 
ATOM   2989  H H    . GLU A 1 207 ? 58.873  153.190 103.843 1.00 47.05  ? 273  GLU A H    1 
ATOM   2990  H HA   . GLU A 1 207 ? 56.918  153.823 102.321 1.00 43.33  ? 273  GLU A HA   1 
ATOM   2991  H HB2  . GLU A 1 207 ? 59.510  153.082 101.491 1.00 31.44  ? 273  GLU A HB2  1 
ATOM   2992  H HB3  . GLU A 1 207 ? 58.441  153.704 100.503 1.00 31.44  ? 273  GLU A HB3  1 
ATOM   2993  H HG2  . GLU A 1 207 ? 58.521  155.696 101.781 1.00 51.00  ? 273  GLU A HG2  1 
ATOM   2994  H HG3  . GLU A 1 207 ? 59.732  155.062 102.595 1.00 51.00  ? 273  GLU A HG3  1 
ATOM   2995  N N    . LEU A 1 208 ? 57.745  150.755 101.954 1.00 35.77  ? 274  LEU A N    1 
ATOM   2996  C CA   . LEU A 1 208 ? 57.371  149.499 101.314 1.00 36.07  ? 274  LEU A CA   1 
ATOM   2997  C C    . LEU A 1 208 ? 56.100  148.924 101.904 1.00 35.74  ? 274  LEU A C    1 
ATOM   2998  O O    . LEU A 1 208 ? 55.332  148.272 101.207 1.00 43.81  ? 274  LEU A O    1 
ATOM   2999  C CB   . LEU A 1 208 ? 58.482  148.459 101.424 1.00 33.23  ? 274  LEU A CB   1 
ATOM   3000  C CG   . LEU A 1 208 ? 59.733  148.626 100.563 1.00 41.98  ? 274  LEU A CG   1 
ATOM   3001  C CD1  . LEU A 1 208 ? 60.749  147.574 100.970 1.00 31.15  ? 274  LEU A CD1  1 
ATOM   3002  C CD2  . LEU A 1 208 ? 59.429  148.555 99.070  1.00 27.26  ? 274  LEU A CD2  1 
ATOM   3003  H H    . LEU A 1 208 ? 58.410  150.692 102.495 1.00 42.92  ? 274  LEU A H    1 
ATOM   3004  H HA   . LEU A 1 208 ? 57.212  149.664 100.372 1.00 43.29  ? 274  LEU A HA   1 
ATOM   3005  H HB2  . LEU A 1 208 ? 58.779  148.440 102.347 1.00 39.88  ? 274  LEU A HB2  1 
ATOM   3006  H HB3  . LEU A 1 208 ? 58.102  147.595 101.199 1.00 39.88  ? 274  LEU A HB3  1 
ATOM   3007  H HG   . LEU A 1 208 ? 60.121  149.497 100.744 1.00 50.38  ? 274  LEU A HG   1 
ATOM   3008  H HD11 . LEU A 1 208 ? 61.545  147.678 100.425 1.00 37.38  ? 274  LEU A HD11 1 
ATOM   3009  H HD12 . LEU A 1 208 ? 60.971  147.695 101.906 1.00 37.38  ? 274  LEU A HD12 1 
ATOM   3010  H HD13 . LEU A 1 208 ? 60.365  146.695 100.831 1.00 37.38  ? 274  LEU A HD13 1 
ATOM   3011  H HD21 . LEU A 1 208 ? 60.256  148.667 98.575  1.00 32.71  ? 274  LEU A HD21 1 
ATOM   3012  H HD22 . LEU A 1 208 ? 59.037  147.691 98.869  1.00 32.71  ? 274  LEU A HD22 1 
ATOM   3013  H HD23 . LEU A 1 208 ? 58.807  149.263 98.841  1.00 32.71  ? 274  LEU A HD23 1 
ATOM   3014  N N    . GLN A 1 209 ? 55.876  149.153 103.188 1.00 45.23  ? 275  GLN A N    1 
ATOM   3015  C CA   . GLN A 1 209 ? 54.636  148.708 103.816 1.00 47.06  ? 275  GLN A CA   1 
ATOM   3016  C C    . GLN A 1 209 ? 53.457  149.505 103.257 1.00 46.31  ? 275  GLN A C    1 
ATOM   3017  O O    . GLN A 1 209 ? 52.357  148.983 103.098 1.00 40.27  ? 275  GLN A O    1 
ATOM   3018  C CB   . GLN A 1 209 ? 54.731  148.871 105.332 1.00 41.49  ? 275  GLN A CB   1 
ATOM   3019  C CG   . GLN A 1 209 ? 53.558  148.309 106.096 1.00 55.72  ? 275  GLN A CG   1 
ATOM   3020  C CD   . GLN A 1 209 ? 53.271  146.868 105.764 1.00 54.82  ? 275  GLN A CD   1 
ATOM   3021  O OE1  . GLN A 1 209 ? 53.929  145.953 106.267 1.00 60.07  ? 275  GLN A OE1  1 
ATOM   3022  N NE2  . GLN A 1 209 ? 52.284  146.653 104.907 1.00 54.20  ? 275  GLN A NE2  1 
ATOM   3023  H H    . GLN A 1 209 ? 56.419  149.560 103.716 1.00 54.28  ? 275  GLN A H    1 
ATOM   3024  H HA   . GLN A 1 209 ? 54.493  147.770 103.618 1.00 56.48  ? 275  GLN A HA   1 
ATOM   3025  H HB2  . GLN A 1 209 ? 55.530  148.416 105.643 1.00 49.79  ? 275  GLN A HB2  1 
ATOM   3026  H HB3  . GLN A 1 209 ? 54.792  149.817 105.539 1.00 49.79  ? 275  GLN A HB3  1 
ATOM   3027  H HG2  . GLN A 1 209 ? 53.745  148.366 107.046 1.00 66.86  ? 275  GLN A HG2  1 
ATOM   3028  H HG3  . GLN A 1 209 ? 52.766  148.828 105.883 1.00 66.86  ? 275  GLN A HG3  1 
ATOM   3029  H HE21 . GLN A 1 209 ? 51.850  147.317 104.576 1.00 65.04  ? 275  GLN A HE21 1 
ATOM   3030  H HE22 . GLN A 1 209 ? 52.077  145.849 104.681 1.00 65.04  ? 275  GLN A HE22 1 
ATOM   3031  N N    . GLU A 1 210 ? 53.703  150.774 102.948 1.00 48.46  ? 276  GLU A N    1 
ATOM   3032  C CA   . GLU A 1 210 ? 52.702  151.620 102.323 1.00 36.41  ? 276  GLU A CA   1 
ATOM   3033  C C    . GLU A 1 210 ? 52.380  151.082 100.937 1.00 37.48  ? 276  GLU A C    1 
ATOM   3034  O O    . GLU A 1 210 ? 51.245  151.119 100.482 1.00 54.68  ? 276  GLU A O    1 
ATOM   3035  C CB   . GLU A 1 210 ? 53.218  153.058 102.205 1.00 43.50  ? 276  GLU A CB   1 
ATOM   3036  C CG   . GLU A 1 210 ? 53.091  153.904 103.461 1.00 48.92  ? 276  GLU A CG   1 
ATOM   3037  C CD   . GLU A 1 210 ? 53.770  155.268 103.316 1.00 86.59  ? 276  GLU A CD   1 
ATOM   3038  O OE1  . GLU A 1 210 ? 54.445  155.487 102.282 1.00 98.79  ? 276  GLU A OE1  1 
ATOM   3039  O OE2  . GLU A 1 210 ? 53.635  156.119 104.230 1.00 87.24  ? 276  GLU A OE2  1 
ATOM   3040  H H    . GLU A 1 210 ? 54.452  151.170 103.092 1.00 58.15  ? 276  GLU A H    1 
ATOM   3041  H HA   . GLU A 1 210 ? 51.891  151.620 102.856 1.00 43.70  ? 276  GLU A HA   1 
ATOM   3042  H HB2  . GLU A 1 210 ? 54.158  153.027 101.969 1.00 52.20  ? 276  GLU A HB2  1 
ATOM   3043  H HB3  . GLU A 1 210 ? 52.722  153.505 101.502 1.00 52.20  ? 276  GLU A HB3  1 
ATOM   3044  H HG2  . GLU A 1 210 ? 52.151  154.054 103.649 1.00 58.71  ? 276  GLU A HG2  1 
ATOM   3045  H HG3  . GLU A 1 210 ? 53.509  153.438 104.202 1.00 58.71  ? 276  GLU A HG3  1 
ATOM   3046  N N    . ASN A 1 211 ? 53.407  150.602 100.260 1.00 46.68  ? 277  ASN A N    1 
ATOM   3047  C CA   . ASN A 1 211 ? 53.255  150.015 98.944  1.00 46.39  ? 277  ASN A CA   1 
ATOM   3048  C C    . ASN A 1 211 ? 52.481  148.682 98.963  1.00 42.95  ? 277  ASN A C    1 
ATOM   3049  O O    . ASN A 1 211 ? 51.739  148.380 98.050  1.00 34.23  ? 277  ASN A O    1 
ATOM   3050  C CB   . ASN A 1 211 ? 54.639  149.797 98.318  1.00 39.49  ? 277  ASN A CB   1 
ATOM   3051  C CG   . ASN A 1 211 ? 55.241  151.070 97.750  1.00 41.25  ? 277  ASN A CG   1 
ATOM   3052  O OD1  . ASN A 1 211 ? 54.587  152.102 97.640  1.00 57.67  ? 277  ASN A OD1  1 
ATOM   3053  N ND2  . ASN A 1 211 ? 56.493  150.988 97.363  1.00 44.33  ? 277  ASN A ND2  1 
ATOM   3054  H H    . ASN A 1 211 ? 54.218  150.606 100.547 1.00 56.02  ? 277  ASN A H    1 
ATOM   3055  H HA   . ASN A 1 211 ? 52.766  150.634 98.379  1.00 55.67  ? 277  ASN A HA   1 
ATOM   3056  H HB2  . ASN A 1 211 ? 55.242  149.458 98.997  1.00 47.39  ? 277  ASN A HB2  1 
ATOM   3057  H HB3  . ASN A 1 211 ? 54.560  149.155 97.595  1.00 47.39  ? 277  ASN A HB3  1 
ATOM   3058  H HD21 . ASN A 1 211 ? 56.887  151.678 97.033  1.00 53.19  ? 277  ASN A HD21 1 
ATOM   3059  H HD22 . ASN A 1 211 ? 56.919  150.245 97.440  1.00 53.19  ? 277  ASN A HD22 1 
ATOM   3060  N N    . GLN A 1 212 ? 52.667  147.863 99.987  1.00 40.55  ? 278  GLN A N    1 
ATOM   3061  C CA   . GLN A 1 212 ? 51.903  146.631 100.060 1.00 38.05  ? 278  GLN A CA   1 
ATOM   3062  C C    . GLN A 1 212 ? 50.453  146.945 100.325 1.00 54.77  ? 278  GLN A C    1 
ATOM   3063  O O    . GLN A 1 212 ? 49.563  146.200 99.919  1.00 54.43  ? 278  GLN A O    1 
ATOM   3064  C CB   . GLN A 1 212 ? 52.367  145.743 101.192 1.00 44.63  ? 278  GLN A CB   1 
ATOM   3065  C CG   . GLN A 1 212 ? 53.785  145.308 101.082 1.00 73.45  ? 278  GLN A CG   1 
ATOM   3066  C CD   . GLN A 1 212 ? 54.065  144.106 101.935 1.00 84.83  ? 278  GLN A CD   1 
ATOM   3067  O OE1  . GLN A 1 212 ? 53.132  143.481 102.474 1.00 76.44  ? 278  GLN A OE1  1 
ATOM   3068  N NE2  . GLN A 1 212 ? 55.354  143.777 102.090 1.00 65.02  ? 278  GLN A NE2  1 
ATOM   3069  H H    . GLN A 1 212 ? 53.216  147.993 100.637 1.00 48.66  ? 278  GLN A H    1 
ATOM   3070  H HA   . GLN A 1 212 ? 51.975  146.144 99.225  1.00 45.66  ? 278  GLN A HA   1 
ATOM   3071  H HB2  . GLN A 1 212 ? 52.271  146.227 102.027 1.00 53.56  ? 278  GLN A HB2  1 
ATOM   3072  H HB3  . GLN A 1 212 ? 51.814  144.946 101.210 1.00 53.56  ? 278  GLN A HB3  1 
ATOM   3073  H HG2  . GLN A 1 212 ? 53.977  145.077 100.159 1.00 88.14  ? 278  GLN A HG2  1 
ATOM   3074  H HG3  . GLN A 1 212 ? 54.364  146.029 101.374 1.00 88.14  ? 278  GLN A HG3  1 
ATOM   3075  H HE21 . GLN A 1 212 ? 55.967  144.246 101.710 1.00 78.02  ? 278  GLN A HE21 1 
ATOM   3076  H HE22 . GLN A 1 212 ? 55.570  143.096 102.569 1.00 78.02  ? 278  GLN A HE22 1 
ATOM   3077  N N    . ASP A 1 213 ? 50.211  148.037 101.041 1.00 52.34  ? 279  ASP A N    1 
ATOM   3078  C CA   . ASP A 1 213 ? 48.849  148.443 101.320 1.00 37.54  ? 279  ASP A CA   1 
ATOM   3079  C C    . ASP A 1 213 ? 48.134  148.842 100.017 1.00 41.97  ? 279  ASP A C    1 
ATOM   3080  O O    . ASP A 1 213 ? 47.044  148.336 99.748  1.00 34.61  ? 279  ASP A O    1 
ATOM   3081  C CB   . ASP A 1 213 ? 48.812  149.554 102.379 1.00 56.62  ? 279  ASP A CB   1 
ATOM   3082  C CG   . ASP A 1 213 ? 49.247  149.064 103.767 1.00 68.36  ? 279  ASP A CG   1 
ATOM   3083  O OD1  . ASP A 1 213 ? 49.169  147.836 104.021 1.00 65.68  ? 279  ASP A OD1  1 
ATOM   3084  O OD2  . ASP A 1 213 ? 49.652  149.914 104.602 1.00 57.11  ? 279  ASP A OD2  1 
ATOM   3085  H H    . ASP A 1 213 ? 50.814  148.554 101.372 1.00 62.81  ? 279  ASP A H    1 
ATOM   3086  H HA   . ASP A 1 213 ? 48.374  147.681 101.686 1.00 45.04  ? 279  ASP A HA   1 
ATOM   3087  H HB2  . ASP A 1 213 ? 49.412  150.267 102.110 1.00 67.94  ? 279  ASP A HB2  1 
ATOM   3088  H HB3  . ASP A 1 213 ? 47.906  149.892 102.451 1.00 67.94  ? 279  ASP A HB3  1 
ATOM   3089  N N    . GLU A 1 214 ? 48.731  149.707 99.193  1.00 16.93  ? 280  GLU A N    1 
ATOM   3090  C CA   . GLU A 1 214 ? 48.092  150.048 97.915  1.00 30.38  ? 280  GLU A CA   1 
ATOM   3091  C C    . GLU A 1 214 ? 47.869  148.802 97.047  1.00 39.12  ? 280  GLU A C    1 
ATOM   3092  O O    . GLU A 1 214 ? 46.882  148.725 96.318  1.00 54.01  ? 280  GLU A O    1 
ATOM   3093  C CB   . GLU A 1 214 ? 48.836  151.150 97.137  1.00 17.99  ? 280  GLU A CB   1 
ATOM   3094  C CG   . GLU A 1 214 ? 48.354  152.575 97.536  1.00 91.07  ? 280  GLU A CG   1 
ATOM   3095  C CD   . GLU A 1 214 ? 49.294  153.743 97.128  1.00 93.30  ? 280  GLU A CD   1 
ATOM   3096  O OE1  . GLU A 1 214 ? 50.483  153.514 96.807  1.00 100.43 ? 280  GLU A OE1  1 
ATOM   3097  O OE2  . GLU A 1 214 ? 48.824  154.907 97.107  1.00 77.63  ? 280  GLU A OE2  1 
ATOM   3098  H H    . GLU A 1 214 ? 49.481  150.100 99.342  1.00 20.32  ? 280  GLU A H    1 
ATOM   3099  H HA   . GLU A 1 214 ? 47.212  150.402 98.117  1.00 36.46  ? 280  GLU A HA   1 
ATOM   3100  H HB2  . GLU A 1 214 ? 49.785  151.089 97.327  1.00 21.59  ? 280  GLU A HB2  1 
ATOM   3101  H HB3  . GLU A 1 214 ? 48.677  151.032 96.188  1.00 21.59  ? 280  GLU A HB3  1 
ATOM   3102  H HG2  . GLU A 1 214 ? 47.494  152.735 97.118  1.00 109.29 ? 280  GLU A HG2  1 
ATOM   3103  H HG3  . GLU A 1 214 ? 48.255  152.605 98.501  1.00 109.29 ? 280  GLU A HG3  1 
ATOM   3104  N N    . ILE A 1 215 ? 48.745  147.807 97.145  1.00 25.67  ? 281  ILE A N    1 
ATOM   3105  C CA   . ILE A 1 215 ? 48.595  146.618 96.319  1.00 24.90  ? 281  ILE A CA   1 
ATOM   3106  C C    . ILE A 1 215 ? 47.528  145.667 96.879  1.00 36.79  ? 281  ILE A C    1 
ATOM   3107  O O    . ILE A 1 215 ? 46.814  145.071 96.084  1.00 31.70  ? 281  ILE A O    1 
ATOM   3108  C CB   . ILE A 1 215 ? 49.937  145.857 96.074  1.00 31.77  ? 281  ILE A CB   1 
ATOM   3109  C CG1  . ILE A 1 215 ? 50.962  146.753 95.391  1.00 34.39  ? 281  ILE A CG1  1 
ATOM   3110  C CG2  . ILE A 1 215 ? 49.723  144.594 95.229  1.00 15.91  ? 281  ILE A CG2  1 
ATOM   3111  C CD1  . ILE A 1 215 ? 50.757  146.961 93.913  1.00 42.45  ? 281  ILE A CD1  1 
ATOM   3112  H H    . ILE A 1 215 ? 49.424  147.796 97.674  1.00 30.80  ? 281  ILE A H    1 
ATOM   3113  H HA   . ILE A 1 215 ? 48.278  146.906 95.449  1.00 29.88  ? 281  ILE A HA   1 
ATOM   3114  H HB   . ILE A 1 215 ? 50.294  145.589 96.934  1.00 38.12  ? 281  ILE A HB   1 
ATOM   3115  H HG12 . ILE A 1 215 ? 50.937  147.626 95.814  1.00 41.26  ? 281  ILE A HG12 1 
ATOM   3116  H HG13 . ILE A 1 215 ? 51.841  146.361 95.511  1.00 41.26  ? 281  ILE A HG13 1 
ATOM   3117  H HG21 . ILE A 1 215 ? 50.577  144.153 95.100  1.00 19.09  ? 281  ILE A HG21 1 
ATOM   3118  H HG22 . ILE A 1 215 ? 49.112  144.002 95.695  1.00 19.09  ? 281  ILE A HG22 1 
ATOM   3119  H HG23 . ILE A 1 215 ? 49.349  144.848 94.371  1.00 19.09  ? 281  ILE A HG23 1 
ATOM   3120  H HD11 . ILE A 1 215 ? 51.457  147.542 93.576  1.00 50.94  ? 281  ILE A HD11 1 
ATOM   3121  H HD12 . ILE A 1 215 ? 50.795  146.101 93.465  1.00 50.94  ? 281  ILE A HD12 1 
ATOM   3122  H HD13 . ILE A 1 215 ? 49.889  147.370 93.769  1.00 50.94  ? 281  ILE A HD13 1 
ATOM   3123  N N    . GLU A 1 216 ? 47.384  145.521 98.204  1.00 22.79  ? 282  GLU A N    1 
ATOM   3124  C CA   . GLU A 1 216 ? 46.277  144.694 98.719  1.00 22.64  ? 282  GLU A CA   1 
ATOM   3125  C C    . GLU A 1 216 ? 44.945  145.323 98.291  1.00 26.08  ? 282  GLU A C    1 
ATOM   3126  O O    . GLU A 1 216 ? 44.020  144.635 97.877  1.00 27.55  ? 282  GLU A O    1 
ATOM   3127  C CB   . GLU A 1 216 ? 46.292  144.523 100.240 1.00 18.71  ? 282  GLU A CB   1 
ATOM   3128  C CG   . GLU A 1 216 ? 47.511  143.800 100.802 1.00 80.94  ? 282  GLU A CG   1 
ATOM   3129  C CD   . GLU A 1 216 ? 47.678  143.961 102.334 1.00 109.45 ? 282  GLU A CD   1 
ATOM   3130  O OE1  . GLU A 1 216 ? 47.108  144.919 102.917 1.00 116.09 ? 282  GLU A OE1  1 
ATOM   3131  O OE2  . GLU A 1 216 ? 48.396  143.134 102.951 1.00 107.52 ? 282  GLU A OE2  1 
ATOM   3132  H H    . GLU A 1 216 ? 47.889  145.874 98.804  1.00 27.34  ? 282  GLU A H    1 
ATOM   3133  H HA   . GLU A 1 216 ? 46.332  143.812 98.319  1.00 27.17  ? 282  GLU A HA   1 
ATOM   3134  H HB2  . GLU A 1 216 ? 46.260  145.402 100.649 1.00 22.45  ? 282  GLU A HB2  1 
ATOM   3135  H HB3  . GLU A 1 216 ? 45.507  144.016 100.500 1.00 22.45  ? 282  GLU A HB3  1 
ATOM   3136  H HG2  . GLU A 1 216 ? 47.429  142.853 100.610 1.00 97.13  ? 282  GLU A HG2  1 
ATOM   3137  H HG3  . GLU A 1 216 ? 48.308  144.154 100.377 1.00 97.13  ? 282  GLU A HG3  1 
ATOM   3138  N N    . ASN A 1 217 ? 44.863  146.641 98.364  1.00 34.24  ? 283  ASN A N    1 
ATOM   3139  C CA   . ASN A 1 217 ? 43.638  147.326 97.989  1.00 44.77  ? 283  ASN A CA   1 
ATOM   3140  C C    . ASN A 1 217 ? 43.235  147.048 96.556  1.00 35.72  ? 283  ASN A C    1 
ATOM   3141  O O    . ASN A 1 217 ? 42.094  146.649 96.305  1.00 39.85  ? 283  ASN A O    1 
ATOM   3142  C CB   . ASN A 1 217 ? 43.729  148.828 98.274  1.00 33.27  ? 283  ASN A CB   1 
ATOM   3143  C CG   . ASN A 1 217 ? 43.786  149.110 99.763  1.00 55.38  ? 283  ASN A CG   1 
ATOM   3144  O OD1  . ASN A 1 217 ? 43.302  148.299 100.569 1.00 44.65  ? 283  ASN A OD1  1 
ATOM   3145  N ND2  . ASN A 1 217 ? 44.389  150.245 100.146 1.00 57.40  ? 283  ASN A ND2  1 
ATOM   3146  H H    . ASN A 1 217 ? 45.497  147.160 98.626  1.00 41.09  ? 283  ASN A H    1 
ATOM   3147  H HA   . ASN A 1 217 ? 42.925  146.980 98.549  1.00 53.73  ? 283  ASN A HA   1 
ATOM   3148  H HB2  . ASN A 1 217 ? 44.535  149.183 97.867  1.00 39.93  ? 283  ASN A HB2  1 
ATOM   3149  H HB3  . ASN A 1 217 ? 42.946  149.271 97.911  1.00 39.93  ? 283  ASN A HB3  1 
ATOM   3150  H HD21 . ASN A 1 217 ? 44.442  150.443 100.981 1.00 68.88  ? 283  ASN A HD21 1 
ATOM   3151  H HD22 . ASN A 1 217 ? 44.722  150.775 99.557  1.00 68.88  ? 283  ASN A HD22 1 
ATOM   3152  N N    . MET A 1 218 ? 44.165  147.228 95.626  1.00 28.14  ? 284  MET A N    1 
ATOM   3153  C CA   . MET A 1 218 ? 43.891  146.962 94.217  1.00 28.12  ? 284  MET A CA   1 
ATOM   3154  C C    . MET A 1 218 ? 43.532  145.499 93.998  1.00 26.59  ? 284  MET A C    1 
ATOM   3155  O O    . MET A 1 218 ? 42.682  145.176 93.190  1.00 32.71  ? 284  MET A O    1 
ATOM   3156  C CB   . MET A 1 218 ? 45.103  147.339 93.373  1.00 23.36  ? 284  MET A CB   1 
ATOM   3157  C CG   . MET A 1 218 ? 45.280  148.809 93.275  1.00 21.97  ? 284  MET A CG   1 
ATOM   3158  S SD   . MET A 1 218 ? 46.658  149.298 92.287  1.00 58.27  ? 284  MET A SD   1 
ATOM   3159  C CE   . MET A 1 218 ? 47.982  148.928 93.402  1.00 43.52  ? 284  MET A CE   1 
ATOM   3160  H H    . MET A 1 218 ? 44.964  147.504 95.784  1.00 33.77  ? 284  MET A H    1 
ATOM   3161  H HA   . MET A 1 218 ? 43.146  147.514 93.932  1.00 33.74  ? 284  MET A HA   1 
ATOM   3162  H HB2  . MET A 1 218 ? 45.901  146.965 93.778  1.00 28.04  ? 284  MET A HB2  1 
ATOM   3163  H HB3  . MET A 1 218 ? 44.988  146.988 92.476  1.00 28.04  ? 284  MET A HB3  1 
ATOM   3164  H HG2  . MET A 1 218 ? 44.481  149.193 92.881  1.00 26.36  ? 284  MET A HG2  1 
ATOM   3165  H HG3  . MET A 1 218 ? 45.411  149.167 94.166  1.00 26.36  ? 284  MET A HG3  1 
ATOM   3166  H HE1  . MET A 1 218 ? 48.824  149.154 92.977  1.00 52.22  ? 284  MET A HE1  1 
ATOM   3167  H HE2  . MET A 1 218 ? 47.868  149.451 94.211  1.00 52.22  ? 284  MET A HE2  1 
ATOM   3168  H HE3  . MET A 1 218 ? 47.961  147.982 93.613  1.00 52.22  ? 284  MET A HE3  1 
ATOM   3169  N N    . MET A 1 219 ? 44.191  144.615 94.729  1.00 29.35  ? 285  MET A N    1 
ATOM   3170  C CA   . MET A 1 219 ? 43.896  143.206 94.628  1.00 32.51  ? 285  MET A CA   1 
ATOM   3171  C C    . MET A 1 219 ? 42.493  142.919 95.149  1.00 44.08  ? 285  MET A C    1 
ATOM   3172  O O    . MET A 1 219 ? 41.757  142.148 94.538  1.00 38.44  ? 285  MET A O    1 
ATOM   3173  C CB   . MET A 1 219 ? 44.926  142.397 95.399  1.00 41.72  ? 285  MET A CB   1 
ATOM   3174  C CG   . MET A 1 219 ? 46.290  142.349 94.722  1.00 56.57  ? 285  MET A CG   1 
ATOM   3175  S SD   . MET A 1 219 ? 47.480  141.425 95.702  1.00 43.08  ? 285  MET A SD   1 
ATOM   3176  C CE   . MET A 1 219 ? 47.380  139.919 94.814  1.00 50.43  ? 285  MET A CE   1 
ATOM   3177  H H    . MET A 1 219 ? 44.813  144.810 95.290  1.00 35.21  ? 285  MET A H    1 
ATOM   3178  H HA   . MET A 1 219 ? 43.945  142.941 93.697  1.00 39.01  ? 285  MET A HA   1 
ATOM   3179  H HB2  . MET A 1 219 ? 45.043  142.794 96.277  1.00 50.06  ? 285  MET A HB2  1 
ATOM   3180  H HB3  . MET A 1 219 ? 44.606  141.486 95.489  1.00 50.06  ? 285  MET A HB3  1 
ATOM   3181  H HG2  . MET A 1 219 ? 46.204  141.914 93.859  1.00 67.88  ? 285  MET A HG2  1 
ATOM   3182  H HG3  . MET A 1 219 ? 46.624  143.253 94.611  1.00 67.88  ? 285  MET A HG3  1 
ATOM   3183  H HE1  . MET A 1 219 ? 47.981  139.274 95.218  1.00 60.52  ? 285  MET A HE1  1 
ATOM   3184  H HE2  . MET A 1 219 ? 46.468  139.591 94.851  1.00 60.52  ? 285  MET A HE2  1 
ATOM   3185  H HE3  . MET A 1 219 ? 47.637  140.079 93.892  1.00 60.52  ? 285  MET A HE3  1 
ATOM   3186  N N    . ASN A 1 220 ? 42.116  143.543 96.265  1.00 38.74  ? 286  ASN A N    1 
ATOM   3187  C CA   . ASN A 1 220 ? 40.781  143.360 96.820  1.00 27.66  ? 286  ASN A CA   1 
ATOM   3188  C C    . ASN A 1 220 ? 39.684  144.004 95.968  1.00 31.77  ? 286  ASN A C    1 
ATOM   3189  O O    . ASN A 1 220 ? 38.594  143.473 95.850  1.00 38.23  ? 286  ASN A O    1 
ATOM   3190  C CB   . ASN A 1 220 ? 40.712  143.883 98.241  1.00 15.00  ? 286  ASN A CB   1 
ATOM   3191  C CG   . ASN A 1 220 ? 39.654  143.166 99.066  1.00 67.60  ? 286  ASN A CG   1 
ATOM   3192  O OD1  . ASN A 1 220 ? 38.614  143.746 99.407  1.00 64.20  ? 286  ASN A OD1  1 
ATOM   3193  N ND2  . ASN A 1 220 ? 39.910  141.887 99.386  1.00 57.09  ? 286  ASN A ND2  1 
ATOM   3194  H H    . ASN A 1 220 ? 42.616  144.077 96.717  1.00 46.49  ? 286  ASN A H    1 
ATOM   3195  H HA   . ASN A 1 220 ? 40.595  142.408 96.854  1.00 33.19  ? 286  ASN A HA   1 
ATOM   3196  H HB2  . ASN A 1 220 ? 41.571  143.750 98.671  1.00 18.00  ? 286  ASN A HB2  1 
ATOM   3197  H HB3  . ASN A 1 220 ? 40.491  144.827 98.222  1.00 18.00  ? 286  ASN A HB3  1 
ATOM   3198  H HD21 . ASN A 1 220 ? 39.342  141.439 99.852  1.00 68.51  ? 286  ASN A HD21 1 
ATOM   3199  H HD22 . ASN A 1 220 ? 40.641  141.516 99.126  1.00 68.51  ? 286  ASN A HD22 1 
ATOM   3200  N N    . ALA A 1 221 ? 39.975  145.137 95.351  1.00 40.31  ? 287  ALA A N    1 
ATOM   3201  C CA   . ALA A 1 221 ? 39.035  145.737 94.416  1.00 21.96  ? 287  ALA A CA   1 
ATOM   3202  C C    . ALA A 1 221 ? 38.697  144.752 93.305  1.00 31.59  ? 287  ALA A C    1 
ATOM   3203  O O    . ALA A 1 221 ? 37.528  144.479 93.051  1.00 37.22  ? 287  ALA A O    1 
ATOM   3204  C CB   . ALA A 1 221 ? 39.612  147.001 93.828  1.00 24.43  ? 287  ALA A CB   1 
ATOM   3205  H H    . ALA A 1 221 ? 40.706  145.578 95.454  1.00 48.38  ? 287  ALA A H    1 
ATOM   3206  H HA   . ALA A 1 221 ? 38.216  145.963 94.884  1.00 26.36  ? 287  ALA A HA   1 
ATOM   3207  H HB1  . ALA A 1 221 ? 38.970  147.383 93.210  1.00 29.32  ? 287  ALA A HB1  1 
ATOM   3208  H HB2  . ALA A 1 221 ? 39.794  147.628 94.546  1.00 29.32  ? 287  ALA A HB2  1 
ATOM   3209  H HB3  . ALA A 1 221 ? 40.434  146.785 93.361  1.00 29.32  ? 287  ALA A HB3  1 
ATOM   3210  N N    . ILE A 1 222 ? 39.720  144.221 92.640  1.00 30.76  ? 288  ILE A N    1 
ATOM   3211  C CA   . ILE A 1 222 ? 39.508  143.272 91.554  1.00 32.35  ? 288  ILE A CA   1 
ATOM   3212  C C    . ILE A 1 222 ? 38.819  142.007 92.053  1.00 25.72  ? 288  ILE A C    1 
ATOM   3213  O O    . ILE A 1 222 ? 37.939  141.494 91.402  1.00 35.08  ? 288  ILE A O    1 
ATOM   3214  C CB   . ILE A 1 222 ? 40.832  142.890 90.842  1.00 31.00  ? 288  ILE A CB   1 
ATOM   3215  C CG1  . ILE A 1 222 ? 41.373  144.097 90.064  1.00 33.39  ? 288  ILE A CG1  1 
ATOM   3216  C CG2  . ILE A 1 222 ? 40.619  141.686 89.899  1.00 22.23  ? 288  ILE A CG2  1 
ATOM   3217  C CD1  . ILE A 1 222 ? 42.665  143.819 89.260  1.00 33.71  ? 288  ILE A CD1  1 
ATOM   3218  H H    . ILE A 1 222 ? 40.547  144.395 92.800  1.00 36.92  ? 288  ILE A H    1 
ATOM   3219  H HA   . ILE A 1 222 ? 38.927  143.682 90.894  1.00 38.82  ? 288  ILE A HA   1 
ATOM   3220  H HB   . ILE A 1 222 ? 41.484  142.642 91.516  1.00 37.20  ? 288  ILE A HB   1 
ATOM   3221  H HG12 . ILE A 1 222 ? 40.694  144.390 89.436  1.00 40.07  ? 288  ILE A HG12 1 
ATOM   3222  H HG13 . ILE A 1 222 ? 41.566  144.810 90.692  1.00 40.07  ? 288  ILE A HG13 1 
ATOM   3223  H HG21 . ILE A 1 222 ? 41.460  141.469 89.468  1.00 26.68  ? 288  ILE A HG21 1 
ATOM   3224  H HG22 . ILE A 1 222 ? 40.309  140.929 90.420  1.00 26.68  ? 288  ILE A HG22 1 
ATOM   3225  H HG23 . ILE A 1 222 ? 39.956  141.922 89.231  1.00 26.68  ? 288  ILE A HG23 1 
ATOM   3226  H HD11 . ILE A 1 222 ? 42.933  144.632 88.803  1.00 40.45  ? 288  ILE A HD11 1 
ATOM   3227  H HD12 . ILE A 1 222 ? 43.363  143.538 89.873  1.00 40.45  ? 288  ILE A HD12 1 
ATOM   3228  H HD13 . ILE A 1 222 ? 42.489  143.118 88.614  1.00 40.45  ? 288  ILE A HD13 1 
ATOM   3229  N N    . PHE A 1 223 ? 39.228  141.488 93.197  1.00 33.43  ? 289  PHE A N    1 
ATOM   3230  C CA   . PHE A 1 223 ? 38.690  140.220 93.664  1.00 37.61  ? 289  PHE A CA   1 
ATOM   3231  C C    . PHE A 1 223 ? 37.223  140.364 94.072  1.00 49.09  ? 289  PHE A C    1 
ATOM   3232  O O    . PHE A 1 223 ? 36.363  139.583 93.653  1.00 38.16  ? 289  PHE A O    1 
ATOM   3233  C CB   . PHE A 1 223 ? 39.507  139.701 94.842  1.00 44.47  ? 289  PHE A CB   1 
ATOM   3234  C CG   . PHE A 1 223 ? 39.110  138.326 95.300  1.00 38.35  ? 289  PHE A CG   1 
ATOM   3235  C CD1  . PHE A 1 223 ? 39.689  137.199 94.737  1.00 33.24  ? 289  PHE A CD1  1 
ATOM   3236  C CD2  . PHE A 1 223 ? 38.175  138.157 96.305  1.00 35.89  ? 289  PHE A CD2  1 
ATOM   3237  C CE1  . PHE A 1 223 ? 39.340  135.927 95.165  1.00 41.51  ? 289  PHE A CE1  1 
ATOM   3238  C CE2  . PHE A 1 223 ? 37.819  136.880 96.739  1.00 39.21  ? 289  PHE A CE2  1 
ATOM   3239  C CZ   . PHE A 1 223 ? 38.400  135.766 96.165  1.00 28.83  ? 289  PHE A CZ   1 
ATOM   3240  H H    . PHE A 1 223 ? 39.811  141.845 93.720  1.00 40.12  ? 289  PHE A H    1 
ATOM   3241  H HA   . PHE A 1 223 ? 38.743  139.568 92.948  1.00 45.13  ? 289  PHE A HA   1 
ATOM   3242  H HB2  . PHE A 1 223 ? 40.441  139.668 94.583  1.00 53.37  ? 289  PHE A HB2  1 
ATOM   3243  H HB3  . PHE A 1 223 ? 39.395  140.307 95.591  1.00 53.37  ? 289  PHE A HB3  1 
ATOM   3244  H HD1  . PHE A 1 223 ? 40.323  137.298 94.063  1.00 39.89  ? 289  PHE A HD1  1 
ATOM   3245  H HD2  . PHE A 1 223 ? 37.780  138.903 96.697  1.00 43.07  ? 289  PHE A HD2  1 
ATOM   3246  H HE1  . PHE A 1 223 ? 39.733  135.181 94.773  1.00 49.81  ? 289  PHE A HE1  1 
ATOM   3247  H HE2  . PHE A 1 223 ? 37.186  136.778 97.413  1.00 47.06  ? 289  PHE A HE2  1 
ATOM   3248  H HZ   . PHE A 1 223 ? 38.162  134.914 96.451  1.00 34.59  ? 289  PHE A HZ   1 
ATOM   3249  N N    . LYS A 1 224 ? 36.943  141.375 94.890  1.00 40.66  ? 290  LYS A N    1 
ATOM   3250  C CA   . LYS A 1 224 ? 35.599  141.571 95.405  1.00 32.95  ? 290  LYS A CA   1 
ATOM   3251  C C    . LYS A 1 224 ? 34.666  142.221 94.374  1.00 37.17  ? 290  LYS A C    1 
ATOM   3252  O O    . LYS A 1 224 ? 33.465  141.956 94.376  1.00 50.96  ? 290  LYS A O    1 
ATOM   3253  C CB   . LYS A 1 224 ? 35.628  142.369 96.707  1.00 22.59  ? 290  LYS A CB   1 
ATOM   3254  C CG   . LYS A 1 224 ? 35.980  141.537 97.942  1.00 32.14  ? 290  LYS A CG   1 
ATOM   3255  C CD   . LYS A 1 224 ? 35.091  141.882 99.159  1.00 74.08  ? 290  LYS A CD   1 
ATOM   3256  C CE   . LYS A 1 224 ? 35.696  142.962 100.073 1.00 75.07  ? 290  LYS A CE   1 
ATOM   3257  N NZ   . LYS A 1 224 ? 36.683  142.386 101.049 1.00 67.54  ? 290  LYS A NZ   1 
ATOM   3258  H H    . LYS A 1 224 ? 37.515  141.958 95.159  1.00 48.79  ? 290  LYS A H    1 
ATOM   3259  H HA   . LYS A 1 224 ? 35.228  140.700 95.614  1.00 39.54  ? 290  LYS A HA   1 
ATOM   3260  H HB2  . LYS A 1 224 ? 36.290  143.073 96.626  1.00 27.11  ? 290  LYS A HB2  1 
ATOM   3261  H HB3  . LYS A 1 224 ? 34.752  142.759 96.853  1.00 27.11  ? 290  LYS A HB3  1 
ATOM   3262  H HG2  . LYS A 1 224 ? 35.857  140.597 97.737  1.00 38.56  ? 290  LYS A HG2  1 
ATOM   3263  H HG3  . LYS A 1 224 ? 36.903  141.707 98.186  1.00 38.56  ? 290  LYS A HG3  1 
ATOM   3264  H HD2  . LYS A 1 224 ? 34.235  142.209 98.839  1.00 88.89  ? 290  LYS A HD2  1 
ATOM   3265  H HD3  . LYS A 1 224 ? 34.960  141.081 99.690  1.00 88.89  ? 290  LYS A HD3  1 
ATOM   3266  H HE2  . LYS A 1 224 ? 36.157  143.619 99.529  1.00 90.08  ? 290  LYS A HE2  1 
ATOM   3267  H HE3  . LYS A 1 224 ? 34.985  143.386 100.579 1.00 90.08  ? 290  LYS A HE3  1 
ATOM   3268  H HZ1  . LYS A 1 224 ? 37.015  143.032 101.562 1.00 81.04  ? 290  LYS A HZ1  1 
ATOM   3269  H HZ2  . LYS A 1 224 ? 36.283  141.782 101.566 1.00 81.04  ? 290  LYS A HZ2  1 
ATOM   3270  H HZ3  . LYS A 1 224 ? 37.351  141.994 100.609 1.00 81.04  ? 290  LYS A HZ3  1 
ATOM   3271  N N    . GLY A 1 225 ? 35.210  143.037 93.479  1.00 31.95  ? 291  GLY A N    1 
ATOM   3272  C CA   . GLY A 1 225 ? 34.408  143.686 92.450  1.00 25.16  ? 291  GLY A CA   1 
ATOM   3273  C C    . GLY A 1 225 ? 34.164  142.883 91.173  1.00 27.35  ? 291  GLY A C    1 
ATOM   3274  O O    . GLY A 1 225 ? 33.161  143.068 90.501  1.00 51.09  ? 291  GLY A O    1 
ATOM   3275  H H    . GLY A 1 225 ? 36.047  143.232 93.446  1.00 38.34  ? 291  GLY A H    1 
ATOM   3276  H HA2  . GLY A 1 225 ? 33.543  143.909 92.827  1.00 30.20  ? 291  GLY A HA2  1 
ATOM   3277  H HA3  . GLY A 1 225 ? 34.843  144.516 92.197  1.00 30.20  ? 291  GLY A HA3  1 
ATOM   3278  N N    . VAL A 1 226 ? 35.085  141.995 90.824  1.00 27.53  ? 292  VAL A N    1 
ATOM   3279  C CA   . VAL A 1 226 ? 34.976  141.187 89.619  1.00 20.46  ? 292  VAL A CA   1 
ATOM   3280  C C    . VAL A 1 226 ? 34.882  139.699 89.983  1.00 37.37  ? 292  VAL A C    1 
ATOM   3281  O O    . VAL A 1 226 ? 33.868  139.056 89.711  1.00 42.89  ? 292  VAL A O    1 
ATOM   3282  C CB   . VAL A 1 226 ? 36.178  141.422 88.682  1.00 14.62  ? 292  VAL A CB   1 
ATOM   3283  C CG1  . VAL A 1 226 ? 36.141  140.492 87.494  1.00 15.50  ? 292  VAL A CG1  1 
ATOM   3284  C CG2  . VAL A 1 226 ? 36.208  142.854 88.202  1.00 17.21  ? 292  VAL A CG2  1 
ATOM   3285  H H    . VAL A 1 226 ? 35.797  141.840 91.280  1.00 33.04  ? 292  VAL A H    1 
ATOM   3286  H HA   . VAL A 1 226 ? 34.168  141.433 89.142  1.00 24.55  ? 292  VAL A HA   1 
ATOM   3287  H HB   . VAL A 1 226 ? 36.998  141.251 89.171  1.00 17.55  ? 292  VAL A HB   1 
ATOM   3288  H HG11 . VAL A 1 226 ? 36.910  140.669 86.930  1.00 18.60  ? 292  VAL A HG11 1 
ATOM   3289  H HG12 . VAL A 1 226 ? 36.166  139.575 87.811  1.00 18.60  ? 292  VAL A HG12 1 
ATOM   3290  H HG13 . VAL A 1 226 ? 35.322  140.648 86.997  1.00 18.60  ? 292  VAL A HG13 1 
ATOM   3291  H HG21 . VAL A 1 226 ? 36.971  142.974 87.616  1.00 20.65  ? 292  VAL A HG21 1 
ATOM   3292  H HG22 . VAL A 1 226 ? 35.387  143.042 87.721  1.00 20.65  ? 292  VAL A HG22 1 
ATOM   3293  H HG23 . VAL A 1 226 ? 36.283  143.442 88.970  1.00 20.65  ? 292  VAL A HG23 1 
ATOM   3294  N N    . PHE A 1 227 ? 35.915  139.155 90.621  1.00 30.26  ? 293  PHE A N    1 
ATOM   3295  C CA   . PHE A 1 227 ? 36.027  137.696 90.757  1.00 41.70  ? 293  PHE A CA   1 
ATOM   3296  C C    . PHE A 1 227 ? 34.821  137.049 91.444  1.00 31.77  ? 293  PHE A C    1 
ATOM   3297  O O    . PHE A 1 227 ? 34.266  136.061 90.969  1.00 32.62  ? 293  PHE A O    1 
ATOM   3298  C CB   . PHE A 1 227 ? 37.317  137.283 91.491  1.00 21.99  ? 293  PHE A CB   1 
ATOM   3299  C CG   . PHE A 1 227 ? 37.466  135.803 91.613  1.00 28.79  ? 293  PHE A CG   1 
ATOM   3300  C CD1  . PHE A 1 227 ? 38.072  135.068 90.610  1.00 30.58  ? 293  PHE A CD1  1 
ATOM   3301  C CD2  . PHE A 1 227 ? 36.942  135.127 92.700  1.00 24.03  ? 293  PHE A CD2  1 
ATOM   3302  C CE1  . PHE A 1 227 ? 38.186  133.677 90.711  1.00 18.57  ? 293  PHE A CE1  1 
ATOM   3303  C CE2  . PHE A 1 227 ? 37.039  133.747 92.788  1.00 25.60  ? 293  PHE A CE2  1 
ATOM   3304  C CZ   . PHE A 1 227 ? 37.665  133.025 91.793  1.00 14.46  ? 293  PHE A CZ   1 
ATOM   3305  H H    . PHE A 1 227 ? 36.559  139.597 90.982  1.00 36.31  ? 293  PHE A H    1 
ATOM   3306  H HA   . PHE A 1 227 ? 36.078  137.319 89.865  1.00 50.04  ? 293  PHE A HA   1 
ATOM   3307  H HB2  . PHE A 1 227 ? 38.082  137.622 90.999  1.00 26.39  ? 293  PHE A HB2  1 
ATOM   3308  H HB3  . PHE A 1 227 ? 37.305  137.659 92.385  1.00 26.39  ? 293  PHE A HB3  1 
ATOM   3309  H HD1  . PHE A 1 227 ? 38.425  135.505 89.869  1.00 36.69  ? 293  PHE A HD1  1 
ATOM   3310  H HD2  . PHE A 1 227 ? 36.513  135.603 93.375  1.00 28.84  ? 293  PHE A HD2  1 
ATOM   3311  H HE1  . PHE A 1 227 ? 38.604  133.194 90.035  1.00 22.28  ? 293  PHE A HE1  1 
ATOM   3312  H HE2  . PHE A 1 227 ? 36.695  133.306 93.531  1.00 30.72  ? 293  PHE A HE2  1 
ATOM   3313  H HZ   . PHE A 1 227 ? 37.742  132.101 91.863  1.00 17.36  ? 293  PHE A HZ   1 
ATOM   3314  N N    . VAL A 1 228 ? 34.437  137.618 92.570  1.00 25.47  ? 294  VAL A N    1 
ATOM   3315  C CA   . VAL A 1 228 ? 33.371  137.066 93.391  1.00 41.11  ? 294  VAL A CA   1 
ATOM   3316  C C    . VAL A 1 228 ? 32.038  136.930 92.630  1.00 45.25  ? 294  VAL A C    1 
ATOM   3317  O O    . VAL A 1 228 ? 31.212  136.075 92.960  1.00 58.76  ? 294  VAL A O    1 
ATOM   3318  C CB   . VAL A 1 228 ? 33.212  137.920 94.669  1.00 14.90  ? 294  VAL A CB   1 
ATOM   3319  C CG1  . VAL A 1 228 ? 31.816  137.886 95.209  1.00 57.30  ? 294  VAL A CG1  1 
ATOM   3320  C CG2  . VAL A 1 228 ? 34.160  137.420 95.710  1.00 55.21  ? 294  VAL A CG2  1 
ATOM   3321  H H    . VAL A 1 228 ? 34.783  138.338 92.889  1.00 30.56  ? 294  VAL A H    1 
ATOM   3322  H HA   . VAL A 1 228 ? 33.634  136.175 93.671  1.00 49.34  ? 294  VAL A HA   1 
ATOM   3323  H HB   . VAL A 1 228 ? 33.439  138.842 94.469  1.00 17.87  ? 294  VAL A HB   1 
ATOM   3324  H HG11 . VAL A 1 228 ? 31.773  138.436 96.007  1.00 68.76  ? 294  VAL A HG11 1 
ATOM   3325  H HG12 . VAL A 1 228 ? 31.209  138.231 94.535  1.00 68.76  ? 294  VAL A HG12 1 
ATOM   3326  H HG13 . VAL A 1 228 ? 31.584  136.970 95.425  1.00 68.76  ? 294  VAL A HG13 1 
ATOM   3327  H HG21 . VAL A 1 228 ? 34.059  137.956 96.512  1.00 66.25  ? 294  VAL A HG21 1 
ATOM   3328  H HG22 . VAL A 1 228 ? 33.953  136.492 95.904  1.00 66.25  ? 294  VAL A HG22 1 
ATOM   3329  H HG23 . VAL A 1 228 ? 35.066  137.494 95.373  1.00 66.25  ? 294  VAL A HG23 1 
ATOM   3330  N N    . HIS A 1 229 ? 31.837  137.760 91.613  1.00 28.26  ? 295  HIS A N    1 
ATOM   3331  C CA   . HIS A 1 229 ? 30.606  137.723 90.848  1.00 35.24  ? 295  HIS A CA   1 
ATOM   3332  C C    . HIS A 1 229 ? 30.789  136.919 89.597  1.00 42.66  ? 295  HIS A C    1 
ATOM   3333  O O    . HIS A 1 229 ? 29.865  136.256 89.173  1.00 66.41  ? 295  HIS A O    1 
ATOM   3334  C CB   . HIS A 1 229 ? 30.180  139.125 90.438  1.00 45.03  ? 295  HIS A CB   1 
ATOM   3335  C CG   . HIS A 1 229 ? 30.000  140.060 91.588  1.00 37.02  ? 295  HIS A CG   1 
ATOM   3336  N ND1  . HIS A 1 229 ? 29.115  139.811 92.614  1.00 40.89  ? 295  HIS A ND1  1 
ATOM   3337  C CD2  . HIS A 1 229 ? 30.578  141.251 91.866  1.00 42.79  ? 295  HIS A CD2  1 
ATOM   3338  C CE1  . HIS A 1 229 ? 29.168  140.800 93.486  1.00 39.97  ? 295  HIS A CE1  1 
ATOM   3339  N NE2  . HIS A 1 229 ? 30.046  141.687 93.055  1.00 58.58  ? 295  HIS A NE2  1 
ATOM   3340  H H    . HIS A 1 229 ? 32.401  138.353 91.347  1.00 33.91  ? 295  HIS A H    1 
ATOM   3341  H HA   . HIS A 1 229 ? 29.900  137.323 91.378  1.00 42.29  ? 295  HIS A HA   1 
ATOM   3342  H HB2  . HIS A 1 229 ? 30.858  139.500 89.854  1.00 54.04  ? 295  HIS A HB2  1 
ATOM   3343  H HB3  . HIS A 1 229 ? 29.334  139.069 89.966  1.00 54.04  ? 295  HIS A HB3  1 
ATOM   3344  H HD1  . HIS A 1 229 ? 28.616  139.113 92.682  1.00 49.07  ? 295  HIS A HD1  1 
ATOM   3345  H HD2  . HIS A 1 229 ? 31.222  141.686 91.355  1.00 51.35  ? 295  HIS A HD2  1 
ATOM   3346  H HE1  . HIS A 1 229 ? 28.666  140.865 94.267  1.00 47.96  ? 295  HIS A HE1  1 
ATOM   3347  H HE2  . HIS A 1 229 ? 30.250  142.422 93.453  1.00 70.30  ? 295  HIS A HE2  1 
ATOM   3348  N N    . ARG A 1 230 ? 31.975  136.985 89.000  1.00 39.34  ? 296  ARG A N    1 
ATOM   3349  C CA   . ARG A 1 230 ? 32.199  136.427 87.677  1.00 19.27  ? 296  ARG A CA   1 
ATOM   3350  C C    . ARG A 1 230 ? 32.605  134.958 87.680  1.00 28.89  ? 296  ARG A C    1 
ATOM   3351  O O    . ARG A 1 230 ? 32.561  134.321 86.643  1.00 29.24  ? 296  ARG A O    1 
ATOM   3352  C CB   . ARG A 1 230 ? 33.296  137.194 86.971  1.00 24.25  ? 296  ARG A CB   1 
ATOM   3353  C CG   . ARG A 1 230 ? 32.942  138.479 86.301  1.00 32.21  ? 296  ARG A CG   1 
ATOM   3354  C CD   . ARG A 1 230 ? 31.667  138.436 85.479  1.00 33.35  ? 296  ARG A CD   1 
ATOM   3355  N NE   . ARG A 1 230 ? 30.667  139.191 86.217  1.00 41.23  ? 296  ARG A NE   1 
ATOM   3356  C CZ   . ARG A 1 230 ? 29.426  138.808 86.452  1.00 39.33  ? 296  ARG A CZ   1 
ATOM   3357  N NH1  . ARG A 1 230 ? 28.952  137.661 85.975  1.00 35.39  ? 296  ARG A NH1  1 
ATOM   3358  N NH2  . ARG A 1 230 ? 28.643  139.613 87.159  1.00 56.74  ? 296  ARG A NH2  1 
ATOM   3359  H H    . ARG A 1 230 ? 32.671  137.353 89.346  1.00 47.21  ? 296  ARG A H    1 
ATOM   3360  H HA   . ARG A 1 230 ? 31.386  136.514 87.155  1.00 23.13  ? 296  ARG A HA   1 
ATOM   3361  H HB2  . ARG A 1 230 ? 33.983  137.397 87.625  1.00 29.10  ? 296  ARG A HB2  1 
ATOM   3362  H HB3  . ARG A 1 230 ? 33.671  136.615 86.289  1.00 29.10  ? 296  ARG A HB3  1 
ATOM   3363  H HG2  . ARG A 1 230 ? 32.830  139.162 86.981  1.00 38.65  ? 296  ARG A HG2  1 
ATOM   3364  H HG3  . ARG A 1 230 ? 33.667  138.727 85.706  1.00 38.65  ? 296  ARG A HG3  1 
ATOM   3365  H HD2  . ARG A 1 230 ? 31.811  138.856 84.616  1.00 40.02  ? 296  ARG A HD2  1 
ATOM   3366  H HD3  . ARG A 1 230 ? 31.364  137.520 85.378  1.00 40.02  ? 296  ARG A HD3  1 
ATOM   3367  H HE   . ARG A 1 230 ? 30.906  139.957 86.528  1.00 49.48  ? 296  ARG A HE   1 
ATOM   3368  H HH11 . ARG A 1 230 ? 29.463  137.141 85.518  1.00 42.47  ? 296  ARG A HH11 1 
ATOM   3369  H HH12 . ARG A 1 230 ? 28.138  137.433 86.134  1.00 42.47  ? 296  ARG A HH12 1 
ATOM   3370  H HH21 . ARG A 1 230 ? 28.951  140.358 87.459  1.00 68.09  ? 296  ARG A HH21 1 
ATOM   3371  H HH22 . ARG A 1 230 ? 27.827  139.391 87.315  1.00 68.09  ? 296  ARG A HH22 1 
ATOM   3372  N N    . TYR A 1 231 ? 33.061  134.407 88.801  1.00 34.05  ? 297  TYR A N    1 
ATOM   3373  C CA   . TYR A 1 231 ? 33.460  133.000 88.777  1.00 32.05  ? 297  TYR A CA   1 
ATOM   3374  C C    . TYR A 1 231 ? 32.177  132.212 88.625  1.00 37.25  ? 297  TYR A C    1 
ATOM   3375  O O    . TYR A 1 231 ? 32.155  131.076 88.164  1.00 37.76  ? 297  TYR A O    1 
ATOM   3376  C CB   . TYR A 1 231 ? 34.214  132.590 90.037  1.00 34.13  ? 297  TYR A CB   1 
ATOM   3377  C CG   . TYR A 1 231 ? 33.336  132.255 91.199  1.00 40.05  ? 297  TYR A CG   1 
ATOM   3378  C CD1  . TYR A 1 231 ? 32.775  133.252 91.996  1.00 45.89  ? 297  TYR A CD1  1 
ATOM   3379  C CD2  . TYR A 1 231 ? 33.071  130.934 91.507  1.00 40.50  ? 297  TYR A CD2  1 
ATOM   3380  C CE1  . TYR A 1 231 ? 31.955  132.935 93.082  1.00 27.53  ? 297  TYR A CE1  1 
ATOM   3381  C CE2  . TYR A 1 231 ? 32.259  130.596 92.582  1.00 46.68  ? 297  TYR A CE2  1 
ATOM   3382  C CZ   . TYR A 1 231 ? 31.696  131.598 93.365  1.00 38.60  ? 297  TYR A CZ   1 
ATOM   3383  O OH   . TYR A 1 231 ? 30.899  131.221 94.420  1.00 36.89  ? 297  TYR A OH   1 
ATOM   3384  H H    . TYR A 1 231 ? 33.148  134.804 89.558  1.00 40.85  ? 297  TYR A H    1 
ATOM   3385  H HA   . TYR A 1 231 ? 34.024  132.831 88.006  1.00 38.46  ? 297  TYR A HA   1 
ATOM   3386  H HB2  . TYR A 1 231 ? 34.750  131.807 89.837  1.00 40.96  ? 297  TYR A HB2  1 
ATOM   3387  H HB3  . TYR A 1 231 ? 34.791  133.322 90.305  1.00 40.96  ? 297  TYR A HB3  1 
ATOM   3388  H HD1  . TYR A 1 231 ? 32.946  134.145 91.799  1.00 55.07  ? 297  TYR A HD1  1 
ATOM   3389  H HD2  . TYR A 1 231 ? 33.440  130.260 90.983  1.00 48.60  ? 297  TYR A HD2  1 
ATOM   3390  H HE1  . TYR A 1 231 ? 31.582  133.608 93.604  1.00 33.03  ? 297  TYR A HE1  1 
ATOM   3391  H HE2  . TYR A 1 231 ? 32.087  129.702 92.773  1.00 56.02  ? 297  TYR A HE2  1 
ATOM   3392  H HH   . TYR A 1 231 ? 30.621  131.902 94.827  1.00 44.27  ? 297  TYR A HH   1 
ATOM   3393  N N    . ARG A 1 232 ? 31.095  132.883 88.984  1.00 44.72  ? 298  ARG A N    1 
ATOM   3394  C CA   . ARG A 1 232 ? 29.772  132.320 89.000  1.00 40.11  ? 298  ARG A CA   1 
ATOM   3395  C C    . ARG A 1 232 ? 28.902  132.805 87.844  1.00 39.20  ? 298  ARG A C    1 
ATOM   3396  O O    . ARG A 1 232 ? 27.678  132.794 87.926  1.00 36.84  ? 298  ARG A O    1 
ATOM   3397  C CB   . ARG A 1 232 ? 29.146  132.777 90.290  1.00 36.44  ? 298  ARG A CB   1 
ATOM   3398  C CG   . ARG A 1 232 ? 28.375  131.720 90.907  1.00 75.19  ? 298  ARG A CG   1 
ATOM   3399  C CD   . ARG A 1 232 ? 27.836  132.113 92.260  1.00 82.15  ? 298  ARG A CD   1 
ATOM   3400  N NE   . ARG A 1 232 ? 27.557  133.540 92.395  1.00 51.47  ? 298  ARG A NE   1 
ATOM   3401  C CZ   . ARG A 1 232 ? 27.051  134.058 93.503  1.00 57.82  ? 298  ARG A CZ   1 
ATOM   3402  N NH1  . ARG A 1 232 ? 26.739  133.255 94.511  1.00 75.46  ? 298  ARG A NH1  1 
ATOM   3403  N NH2  . ARG A 1 232 ? 26.789  135.352 93.575  1.00 61.45  ? 298  ARG A NH2  1 
ATOM   3404  H H    . ARG A 1 232 ? 31.111  133.705 89.234  1.00 53.66  ? 298  ARG A H    1 
ATOM   3405  H HA   . ARG A 1 232 ? 29.815  131.351 88.988  1.00 48.13  ? 298  ARG A HA   1 
ATOM   3406  H HB2  . ARG A 1 232 ? 29.844  133.045 90.907  1.00 43.73  ? 298  ARG A HB2  1 
ATOM   3407  H HB3  . ARG A 1 232 ? 28.551  133.522 90.111  1.00 43.73  ? 298  ARG A HB3  1 
ATOM   3408  H HG2  . ARG A 1 232 ? 27.622  131.501 90.336  1.00 90.23  ? 298  ARG A HG2  1 
ATOM   3409  H HG3  . ARG A 1 232 ? 28.942  130.941 91.024  1.00 90.23  ? 298  ARG A HG3  1 
ATOM   3410  H HD2  . ARG A 1 232 ? 27.009  131.633 92.418  1.00 98.58  ? 298  ARG A HD2  1 
ATOM   3411  H HD3  . ARG A 1 232 ? 28.489  131.874 92.937  1.00 98.58  ? 298  ARG A HD3  1 
ATOM   3412  H HE   . ARG A 1 232 ? 27.920  134.077 91.829  1.00 61.76  ? 298  ARG A HE   1 
ATOM   3413  H HH11 . ARG A 1 232 ? 26.900  132.413 94.455  1.00 90.55  ? 298  ARG A HH11 1 
ATOM   3414  H HH12 . ARG A 1 232 ? 26.401  133.582 95.231  1.00 90.55  ? 298  ARG A HH12 1 
ATOM   3415  H HH21 . ARG A 1 232 ? 26.985  135.868 92.915  1.00 73.74  ? 298  ARG A HH21 1 
ATOM   3416  H HH22 . ARG A 1 232 ? 26.453  135.683 94.294  1.00 73.74  ? 298  ARG A HH22 1 
ATOM   3417  N N    . ASP A 1 233 ? 29.537  133.229 86.767  1.00 32.91  ? 299  ASP A N    1 
ATOM   3418  C CA   . ASP A 1 233 ? 28.816  133.820 85.661  1.00 38.34  ? 299  ASP A CA   1 
ATOM   3419  C C    . ASP A 1 233 ? 27.908  132.781 85.063  1.00 30.10  ? 299  ASP A C    1 
ATOM   3420  O O    . ASP A 1 233 ? 28.212  131.592 85.122  1.00 38.96  ? 299  ASP A O    1 
ATOM   3421  C CB   . ASP A 1 233 ? 29.782  134.298 84.576  1.00 37.52  ? 299  ASP A CB   1 
ATOM   3422  C CG   . ASP A 1 233 ? 29.145  135.286 83.640  1.00 37.71  ? 299  ASP A CG   1 
ATOM   3423  O OD1  . ASP A 1 233 ? 28.529  134.855 82.641  1.00 32.53  ? 299  ASP A OD1  1 
ATOM   3424  O OD2  . ASP A 1 233 ? 29.258  136.495 83.918  1.00 41.32  ? 299  ASP A OD2  1 
ATOM   3425  H H    . ASP A 1 233 ? 30.389  133.185 86.652  1.00 39.49  ? 299  ASP A H    1 
ATOM   3426  H HA   . ASP A 1 233 ? 28.285  134.570 85.969  1.00 46.00  ? 299  ASP A HA   1 
ATOM   3427  H HB2  . ASP A 1 233 ? 30.544  134.728 84.995  1.00 45.02  ? 299  ASP A HB2  1 
ATOM   3428  H HB3  . ASP A 1 233 ? 30.076  133.534 84.054  1.00 45.02  ? 299  ASP A HB3  1 
ATOM   3429  N N    . ALA A 1 234 ? 26.813  133.233 84.467  1.00 31.93  ? 300  ALA A N    1 
ATOM   3430  C CA   . ALA A 1 234 ? 25.905  132.344 83.745  1.00 36.07  ? 300  ALA A CA   1 
ATOM   3431  C C    . ALA A 1 234 ? 26.661  131.587 82.652  1.00 45.63  ? 300  ALA A C    1 
ATOM   3432  O O    . ALA A 1 234 ? 26.459  130.376 82.460  1.00 37.31  ? 300  ALA A O    1 
ATOM   3433  C CB   . ALA A 1 234 ? 24.761  133.143 83.143  1.00 23.65  ? 300  ALA A CB   1 
ATOM   3434  H H    . ALA A 1 234 ? 26.568  134.057 84.465  1.00 38.31  ? 300  ALA A H    1 
ATOM   3435  H HA   . ALA A 1 234 ? 25.532  131.695 84.362  1.00 43.29  ? 300  ALA A HA   1 
ATOM   3436  H HB1  . ALA A 1 234 ? 24.169  132.539 82.668  1.00 28.38  ? 300  ALA A HB1  1 
ATOM   3437  H HB2  . ALA A 1 234 ? 24.277  133.588 83.856  1.00 28.38  ? 300  ALA A HB2  1 
ATOM   3438  H HB3  . ALA A 1 234 ? 25.124  133.801 82.529  1.00 28.38  ? 300  ALA A HB3  1 
ATOM   3439  N N    . ILE A 1 235 ? 27.541  132.311 81.954  1.00 33.72  ? 301  ILE A N    1 
ATOM   3440  C CA   . ILE A 1 235 ? 28.347  131.743 80.881  1.00 29.45  ? 301  ILE A CA   1 
ATOM   3441  C C    . ILE A 1 235 ? 29.505  130.928 81.449  1.00 43.63  ? 301  ILE A C    1 
ATOM   3442  O O    . ILE A 1 235 ? 30.322  131.434 82.228  1.00 34.42  ? 301  ILE A O    1 
ATOM   3443  C CB   . ILE A 1 235 ? 28.900  132.836 79.969  1.00 19.85  ? 301  ILE A CB   1 
ATOM   3444  C CG1  . ILE A 1 235 ? 27.784  133.783 79.567  1.00 37.79  ? 301  ILE A CG1  1 
ATOM   3445  C CG2  . ILE A 1 235 ? 29.558  132.232 78.727  1.00 30.59  ? 301  ILE A CG2  1 
ATOM   3446  C CD1  . ILE A 1 235 ? 26.540  133.085 79.014  1.00 47.31  ? 301  ILE A CD1  1 
ATOM   3447  H H    . ILE A 1 235 ? 27.687  133.147 82.089  1.00 40.46  ? 301  ILE A H    1 
ATOM   3448  H HA   . ILE A 1 235 ? 27.795  131.152 80.346  1.00 35.34  ? 301  ILE A HA   1 
ATOM   3449  H HB   . ILE A 1 235 ? 29.570  133.338 80.460  1.00 23.81  ? 301  ILE A HB   1 
ATOM   3450  H HG12 . ILE A 1 235 ? 27.514  134.295 80.346  1.00 45.35  ? 301  ILE A HG12 1 
ATOM   3451  H HG13 . ILE A 1 235 ? 28.116  134.382 78.881  1.00 45.35  ? 301  ILE A HG13 1 
ATOM   3452  H HG21 . ILE A 1 235 ? 29.898  132.950 78.170  1.00 36.70  ? 301  ILE A HG21 1 
ATOM   3453  H HG22 . ILE A 1 235 ? 30.286  131.655 79.005  1.00 36.70  ? 301  ILE A HG22 1 
ATOM   3454  H HG23 . ILE A 1 235 ? 28.896  131.719 78.238  1.00 36.70  ? 301  ILE A HG23 1 
ATOM   3455  H HD11 . ILE A 1 235 ? 25.879  133.755 78.783  1.00 56.77  ? 301  ILE A HD11 1 
ATOM   3456  H HD12 . ILE A 1 235 ? 26.788  132.577 78.226  1.00 56.77  ? 301  ILE A HD12 1 
ATOM   3457  H HD13 . ILE A 1 235 ? 26.185  132.489 79.693  1.00 56.77  ? 301  ILE A HD13 1 
ATOM   3458  N N    . ALA A 1 236 ? 29.567  129.663 81.046  1.00 25.26  ? 302  ALA A N    1 
ATOM   3459  C CA   . ALA A 1 236 ? 30.565  128.746 81.561  1.00 29.03  ? 302  ALA A CA   1 
ATOM   3460  C C    . ALA A 1 236 ? 32.003  129.135 81.134  1.00 39.41  ? 302  ALA A C    1 
ATOM   3461  O O    . ALA A 1 236 ? 32.969  128.941 81.884  1.00 34.36  ? 302  ALA A O    1 
ATOM   3462  C CB   . ALA A 1 236 ? 30.225  127.348 81.126  1.00 14.52  ? 302  ALA A CB   1 
ATOM   3463  H H    . ALA A 1 236 ? 29.035  129.312 80.469  1.00 30.31  ? 302  ALA A H    1 
ATOM   3464  H HA   . ALA A 1 236 ? 30.532  128.767 82.530  1.00 34.83  ? 302  ALA A HA   1 
ATOM   3465  H HB1  . ALA A 1 236 ? 30.894  126.738 81.473  1.00 17.43  ? 302  ALA A HB1  1 
ATOM   3466  H HB2  . ALA A 1 236 ? 29.350  127.113 81.475  1.00 17.43  ? 302  ALA A HB2  1 
ATOM   3467  H HB3  . ALA A 1 236 ? 30.215  127.313 80.157  1.00 17.43  ? 302  ALA A HB3  1 
ATOM   3468  N N    . GLU A 1 237 ? 32.149  129.697 79.943  1.00 35.91  ? 303  GLU A N    1 
ATOM   3469  C CA   . GLU A 1 237 ? 33.472  130.062 79.476  1.00 39.31  ? 303  GLU A CA   1 
ATOM   3470  C C    . GLU A 1 237 ? 34.068  131.129 80.409  1.00 45.67  ? 303  GLU A C    1 
ATOM   3471  O O    . GLU A 1 237 ? 35.273  131.163 80.648  1.00 46.34  ? 303  GLU A O    1 
ATOM   3472  C CB   . GLU A 1 237 ? 33.433  130.538 78.016  1.00 45.07  ? 303  GLU A CB   1 
ATOM   3473  C CG   . GLU A 1 237 ? 34.814  130.564 77.340  1.00 65.21  ? 303  GLU A CG   1 
ATOM   3474  C CD   . GLU A 1 237 ? 34.768  131.008 75.873  1.00 91.01  ? 303  GLU A CD   1 
ATOM   3475  O OE1  . GLU A 1 237 ? 33.647  131.216 75.345  1.00 103.64 ? 303  GLU A OE1  1 
ATOM   3476  O OE2  . GLU A 1 237 ? 35.855  131.154 75.252  1.00 80.40  ? 303  GLU A OE2  1 
ATOM   3477  H H    . GLU A 1 237 ? 31.509  129.875 79.396  1.00 43.09  ? 303  GLU A H    1 
ATOM   3478  H HA   . GLU A 1 237 ? 34.044  129.280 79.517  1.00 47.18  ? 303  GLU A HA   1 
ATOM   3479  H HB2  . GLU A 1 237 ? 32.863  129.941 77.507  1.00 54.08  ? 303  GLU A HB2  1 
ATOM   3480  H HB3  . GLU A 1 237 ? 33.073  131.439 77.990  1.00 54.08  ? 303  GLU A HB3  1 
ATOM   3481  H HG2  . GLU A 1 237 ? 35.387  131.182 77.820  1.00 78.25  ? 303  GLU A HG2  1 
ATOM   3482  H HG3  . GLU A 1 237 ? 35.193  129.672 77.368  1.00 78.25  ? 303  GLU A HG3  1 
ATOM   3483  N N    . ILE A 1 238 ? 33.222  131.987 80.963  1.00 44.09  ? 304  ILE A N    1 
ATOM   3484  C CA   . ILE A 1 238 ? 33.698  132.978 81.918  1.00 30.69  ? 304  ILE A CA   1 
ATOM   3485  C C    . ILE A 1 238 ? 34.051  132.342 83.242  1.00 26.40  ? 304  ILE A C    1 
ATOM   3486  O O    . ILE A 1 238 ? 34.998  132.745 83.883  1.00 42.37  ? 304  ILE A O    1 
ATOM   3487  C CB   . ILE A 1 238 ? 32.668  134.075 82.138  1.00 28.68  ? 304  ILE A CB   1 
ATOM   3488  C CG1  . ILE A 1 238 ? 32.465  134.823 80.813  1.00 25.49  ? 304  ILE A CG1  1 
ATOM   3489  C CG2  . ILE A 1 238 ? 33.109  135.016 83.274  1.00 20.96  ? 304  ILE A CG2  1 
ATOM   3490  C CD1  . ILE A 1 238 ? 31.647  136.089 80.902  1.00 28.43  ? 304  ILE A CD1  1 
ATOM   3491  H H    . ILE A 1 238 ? 32.377  132.017 80.806  1.00 52.90  ? 304  ILE A H    1 
ATOM   3492  H HA   . ILE A 1 238 ? 34.501  133.392 81.564  1.00 36.82  ? 304  ILE A HA   1 
ATOM   3493  H HB   . ILE A 1 238 ? 31.827  133.661 82.390  1.00 34.42  ? 304  ILE A HB   1 
ATOM   3494  H HG12 . ILE A 1 238 ? 33.336  135.063 80.460  1.00 30.58  ? 304  ILE A HG12 1 
ATOM   3495  H HG13 . ILE A 1 238 ? 32.017  134.229 80.191  1.00 30.58  ? 304  ILE A HG13 1 
ATOM   3496  H HG21 . ILE A 1 238 ? 32.436  135.704 83.393  1.00 25.15  ? 304  ILE A HG21 1 
ATOM   3497  H HG22 . ILE A 1 238 ? 33.204  134.501 84.091  1.00 25.15  ? 304  ILE A HG22 1 
ATOM   3498  H HG23 . ILE A 1 238 ? 33.958  135.420 83.037  1.00 25.15  ? 304  ILE A HG23 1 
ATOM   3499  H HD11 . ILE A 1 238 ? 31.579  136.483 80.018  1.00 34.11  ? 304  ILE A HD11 1 
ATOM   3500  H HD12 . ILE A 1 238 ? 30.763  135.871 81.236  1.00 34.11  ? 304  ILE A HD12 1 
ATOM   3501  H HD13 . ILE A 1 238 ? 32.087  136.707 81.506  1.00 34.11  ? 304  ILE A HD13 1 
ATOM   3502  N N    . ARG A 1 239 ? 33.287  131.347 83.661  1.00 39.77  ? 305  ARG A N    1 
ATOM   3503  C CA   . ARG A 1 239 ? 33.550  130.700 84.936  1.00 35.56  ? 305  ARG A CA   1 
ATOM   3504  C C    . ARG A 1 239 ? 34.899  130.000 84.890  1.00 35.17  ? 305  ARG A C    1 
ATOM   3505  O O    . ARG A 1 239 ? 35.646  130.036 85.855  1.00 37.67  ? 305  ARG A O    1 
ATOM   3506  C CB   . ARG A 1 239 ? 32.436  129.706 85.283  1.00 39.25  ? 305  ARG A CB   1 
ATOM   3507  C CG   . ARG A 1 239 ? 31.062  130.344 85.462  1.00 37.60  ? 305  ARG A CG   1 
ATOM   3508  C CD   . ARG A 1 239 ? 30.161  129.510 86.375  1.00 42.49  ? 305  ARG A CD   1 
ATOM   3509  N NE   . ARG A 1 239 ? 29.856  128.205 85.800  1.00 30.79  ? 305  ARG A NE   1 
ATOM   3510  C CZ   . ARG A 1 239 ? 29.022  128.016 84.787  1.00 32.82  ? 305  ARG A CZ   1 
ATOM   3511  N NH1  . ARG A 1 239 ? 28.395  129.049 84.235  1.00 30.48  ? 305  ARG A NH1  1 
ATOM   3512  N NH2  . ARG A 1 239 ? 28.821  126.790 84.326  1.00 29.72  ? 305  ARG A NH2  1 
ATOM   3513  H H    . ARG A 1 239 ? 32.615  131.028 83.230  1.00 47.72  ? 305  ARG A H    1 
ATOM   3514  H HA   . ARG A 1 239 ? 33.582  131.373 85.633  1.00 42.67  ? 305  ARG A HA   1 
ATOM   3515  H HB2  . ARG A 1 239 ? 32.368  129.053 84.570  1.00 47.10  ? 305  ARG A HB2  1 
ATOM   3516  H HB3  . ARG A 1 239 ? 32.664  129.261 86.114  1.00 47.10  ? 305  ARG A HB3  1 
ATOM   3517  H HG2  . ARG A 1 239 ? 31.168  131.222 85.860  1.00 45.12  ? 305  ARG A HG2  1 
ATOM   3518  H HG3  . ARG A 1 239 ? 30.631  130.418 84.596  1.00 45.12  ? 305  ARG A HG3  1 
ATOM   3519  H HD2  . ARG A 1 239 ? 30.610  129.370 87.223  1.00 50.99  ? 305  ARG A HD2  1 
ATOM   3520  H HD3  . ARG A 1 239 ? 29.325  129.982 86.513  1.00 50.99  ? 305  ARG A HD3  1 
ATOM   3521  H HE   . ARG A 1 239 ? 30.282  127.523 86.103  1.00 36.95  ? 305  ARG A HE   1 
ATOM   3522  H HH11 . ARG A 1 239 ? 28.531  129.844 84.534  1.00 36.58  ? 305  ARG A HH11 1 
ATOM   3523  H HH12 . ARG A 1 239 ? 27.854  128.923 83.579  1.00 36.58  ? 305  ARG A HH12 1 
ATOM   3524  H HH21 . ARG A 1 239 ? 29.226  126.123 84.687  1.00 35.66  ? 305  ARG A HH21 1 
ATOM   3525  H HH22 . ARG A 1 239 ? 28.277  126.660 83.672  1.00 35.66  ? 305  ARG A HH22 1 
ATOM   3526  N N    . ALA A 1 240 ? 35.204  129.371 83.758  1.00 39.10  ? 306  ALA A N    1 
ATOM   3527  C CA   . ALA A 1 240 ? 36.481  128.678 83.575  1.00 36.17  ? 306  ALA A CA   1 
ATOM   3528  C C    . ALA A 1 240 ? 37.677  129.653 83.629  1.00 46.30  ? 306  ALA A C    1 
ATOM   3529  O O    . ALA A 1 240 ? 38.742  129.319 84.170  1.00 42.32  ? 306  ALA A O    1 
ATOM   3530  C CB   . ALA A 1 240 ? 36.477  127.905 82.266  1.00 18.15  ? 306  ALA A CB   1 
ATOM   3531  H H    . ALA A 1 240 ? 34.684  129.329 83.074  1.00 46.91  ? 306  ALA A H    1 
ATOM   3532  H HA   . ALA A 1 240 ? 36.592  128.037 84.295  1.00 43.40  ? 306  ALA A HA   1 
ATOM   3533  H HB1  . ALA A 1 240 ? 37.330  127.454 82.164  1.00 21.78  ? 306  ALA A HB1  1 
ATOM   3534  H HB2  . ALA A 1 240 ? 35.759  127.253 82.286  1.00 21.78  ? 306  ALA A HB2  1 
ATOM   3535  H HB3  . ALA A 1 240 ? 36.341  128.526 81.533  1.00 21.78  ? 306  ALA A HB3  1 
ATOM   3536  N N    . ILE A 1 241 ? 37.502  130.848 83.066  1.00 31.26  ? 307  ILE A N    1 
ATOM   3537  C CA   . ILE A 1 241 ? 38.537  131.862 83.125  1.00 28.58  ? 307  ILE A CA   1 
ATOM   3538  C C    . ILE A 1 241 ? 38.901  132.113 84.582  1.00 29.92  ? 307  ILE A C    1 
ATOM   3539  O O    . ILE A 1 241 ? 40.058  132.023 84.970  1.00 42.82  ? 307  ILE A O    1 
ATOM   3540  C CB   . ILE A 1 241 ? 38.102  133.170 82.407  1.00 29.42  ? 307  ILE A CB   1 
ATOM   3541  C CG1  . ILE A 1 241 ? 38.281  133.004 80.895  1.00 27.43  ? 307  ILE A CG1  1 
ATOM   3542  C CG2  . ILE A 1 241 ? 38.934  134.373 82.884  1.00 33.34  ? 307  ILE A CG2  1 
ATOM   3543  C CD1  . ILE A 1 241 ? 37.842  134.169 80.045  1.00 34.17  ? 307  ILE A CD1  1 
ATOM   3544  H H    . ILE A 1 241 ? 36.792  131.090 82.646  1.00 37.51  ? 307  ILE A H    1 
ATOM   3545  H HA   . ILE A 1 241 ? 39.329  131.527 82.676  1.00 34.29  ? 307  ILE A HA   1 
ATOM   3546  H HB   . ILE A 1 241 ? 37.166  133.339 82.597  1.00 35.30  ? 307  ILE A HB   1 
ATOM   3547  H HG12 . ILE A 1 241 ? 39.222  132.853 80.714  1.00 32.91  ? 307  ILE A HG12 1 
ATOM   3548  H HG13 . ILE A 1 241 ? 37.770  132.231 80.611  1.00 32.91  ? 307  ILE A HG13 1 
ATOM   3549  H HG21 . ILE A 1 241 ? 38.635  135.168 82.416  1.00 40.01  ? 307  ILE A HG21 1 
ATOM   3550  H HG22 . ILE A 1 241 ? 38.807  134.484 83.840  1.00 40.01  ? 307  ILE A HG22 1 
ATOM   3551  H HG23 . ILE A 1 241 ? 39.869  134.206 82.691  1.00 40.01  ? 307  ILE A HG23 1 
ATOM   3552  H HD11 . ILE A 1 241 ? 38.000  133.956 79.112  1.00 41.01  ? 307  ILE A HD11 1 
ATOM   3553  H HD12 . ILE A 1 241 ? 36.897  134.329 80.193  1.00 41.01  ? 307  ILE A HD12 1 
ATOM   3554  H HD13 . ILE A 1 241 ? 38.354  134.954 80.297  1.00 41.01  ? 307  ILE A HD13 1 
ATOM   3555  N N    . CYS A 1 242 ? 37.897  132.402 85.389  1.00 35.70  ? 308  CYS A N    1 
ATOM   3556  C CA   . CYS A 1 242 ? 38.112  132.769 86.776  1.00 42.90  ? 308  CYS A CA   1 
ATOM   3557  C C    . CYS A 1 242 ? 38.853  131.684 87.565  1.00 33.45  ? 308  CYS A C    1 
ATOM   3558  O O    . CYS A 1 242 ? 39.852  131.959 88.236  1.00 34.18  ? 308  CYS A O    1 
ATOM   3559  C CB   . CYS A 1 242 ? 36.763  133.117 87.422  1.00 46.79  ? 308  CYS A CB   1 
ATOM   3560  S SG   . CYS A 1 242 ? 36.100  134.731 86.862  1.00 50.70  ? 308  CYS A SG   1 
ATOM   3561  H H    . CYS A 1 242 ? 37.069  132.392 85.154  1.00 42.84  ? 308  CYS A H    1 
ATOM   3562  H HA   . CYS A 1 242 ? 38.660  133.569 86.800  1.00 51.48  ? 308  CYS A HA   1 
ATOM   3563  H HB2  . CYS A 1 242 ? 36.117  132.431 87.191  1.00 56.15  ? 308  CYS A HB2  1 
ATOM   3564  H HB3  . CYS A 1 242 ? 36.875  133.157 88.385  1.00 56.15  ? 308  CYS A HB3  1 
ATOM   3565  H HG   . CYS A 1 242 ? 35.944  134.698 85.672  1.00 60.84  ? 308  CYS A HG   1 
ATOM   3566  N N    . ILE A 1 243 ? 38.375  130.451 87.459  1.00 32.80  ? 309  ILE A N    1 
ATOM   3567  C CA   . ILE A 1 243 ? 38.944  129.349 88.217  1.00 37.20  ? 309  ILE A CA   1 
ATOM   3568  C C    . ILE A 1 243 ? 40.365  129.012 87.778  1.00 42.09  ? 309  ILE A C    1 
ATOM   3569  O O    . ILE A 1 243 ? 41.195  128.622 88.600  1.00 45.10  ? 309  ILE A O    1 
ATOM   3570  C CB   . ILE A 1 243 ? 38.065  128.100 88.116  1.00 33.06  ? 309  ILE A CB   1 
ATOM   3571  C CG1  . ILE A 1 243 ? 36.760  128.317 88.873  1.00 56.95  ? 309  ILE A CG1  1 
ATOM   3572  C CG2  . ILE A 1 243 ? 38.740  126.866 88.707  1.00 54.33  ? 309  ILE A CG2  1 
ATOM   3573  C CD1  . ILE A 1 243 ? 36.894  128.929 90.285  1.00 64.67  ? 309  ILE A CD1  1 
ATOM   3574  H H    . ILE A 1 243 ? 37.719  130.226 86.952  1.00 39.36  ? 309  ILE A H    1 
ATOM   3575  H HA   . ILE A 1 243 ? 38.980  129.606 89.152  1.00 44.64  ? 309  ILE A HA   1 
ATOM   3576  H HB   . ILE A 1 243 ? 37.863  127.932 87.182  1.00 39.67  ? 309  ILE A HB   1 
ATOM   3577  H HG12 . ILE A 1 243 ? 36.199  128.912 88.352  1.00 68.34  ? 309  ILE A HG12 1 
ATOM   3578  H HG13 . ILE A 1 243 ? 36.317  127.459 88.970  1.00 68.34  ? 309  ILE A HG13 1 
ATOM   3579  H HG21 . ILE A 1 243 ? 38.143  126.107 88.618  1.00 65.20  ? 309  ILE A HG21 1 
ATOM   3580  H HG22 . ILE A 1 243 ? 39.565  126.698 88.227  1.00 65.20  ? 309  ILE A HG22 1 
ATOM   3581  H HG23 . ILE A 1 243 ? 38.929  127.030 89.645  1.00 65.20  ? 309  ILE A HG23 1 
ATOM   3582  H HD11 . ILE A 1 243 ? 36.010  129.023 90.673  1.00 77.61  ? 309  ILE A HD11 1 
ATOM   3583  H HD12 . ILE A 1 243 ? 37.436  128.341 90.834  1.00 77.61  ? 309  ILE A HD12 1 
ATOM   3584  H HD13 . ILE A 1 243 ? 37.318  129.799 90.213  1.00 77.61  ? 309  ILE A HD13 1 
ATOM   3585  N N    . GLU A 1 244 ? 40.654  129.142 86.491  1.00 23.22  ? 310  GLU A N    1 
ATOM   3586  C CA   . GLU A 1 244 ? 42.024  129.028 86.043  1.00 23.83  ? 310  GLU A CA   1 
ATOM   3587  C C    . GLU A 1 244 ? 42.972  129.981 86.780  1.00 30.71  ? 310  GLU A C    1 
ATOM   3588  O O    . GLU A 1 244 ? 43.959  129.537 87.357  1.00 37.86  ? 310  GLU A O    1 
ATOM   3589  C CB   . GLU A 1 244 ? 42.084  129.293 84.567  1.00 35.97  ? 310  GLU A CB   1 
ATOM   3590  C CG   . GLU A 1 244 ? 43.425  129.098 83.990  1.00 40.93  ? 310  GLU A CG   1 
ATOM   3591  C CD   . GLU A 1 244 ? 43.332  128.863 82.514  1.00 48.85  ? 310  GLU A CD   1 
ATOM   3592  O OE1  . GLU A 1 244 ? 42.752  129.726 81.817  1.00 67.98  ? 310  GLU A OE1  1 
ATOM   3593  O OE2  . GLU A 1 244 ? 43.814  127.809 82.060  1.00 46.24  ? 310  GLU A OE2  1 
ATOM   3594  H H    . GLU A 1 244 ? 40.081  129.295 85.869  1.00 27.86  ? 310  GLU A H    1 
ATOM   3595  H HA   . GLU A 1 244 ? 42.331  128.122 86.197  1.00 28.59  ? 310  GLU A HA   1 
ATOM   3596  H HB2  . GLU A 1 244 ? 41.475  128.689 84.115  1.00 43.16  ? 310  GLU A HB2  1 
ATOM   3597  H HB3  . GLU A 1 244 ? 41.820  130.212 84.402  1.00 43.16  ? 310  GLU A HB3  1 
ATOM   3598  H HG2  . GLU A 1 244 ? 43.961  129.893 84.142  1.00 49.12  ? 310  GLU A HG2  1 
ATOM   3599  H HG3  . GLU A 1 244 ? 43.843  128.324 84.399  1.00 49.12  ? 310  GLU A HG3  1 
ATOM   3600  N N    . GLU A 1 245 ? 42.671  131.276 86.790  1.00 32.99  ? 311  GLU A N    1 
ATOM   3601  C CA   . GLU A 1 245 ? 43.593  132.254 87.361  1.00 34.60  ? 311  GLU A CA   1 
ATOM   3602  C C    . GLU A 1 245 ? 43.723  132.133 88.864  1.00 36.62  ? 311  GLU A C    1 
ATOM   3603  O O    . GLU A 1 245 ? 44.806  132.353 89.407  1.00 37.10  ? 311  GLU A O    1 
ATOM   3604  C CB   . GLU A 1 245 ? 43.185  133.675 87.006  1.00 30.65  ? 311  GLU A CB   1 
ATOM   3605  C CG   . GLU A 1 245 ? 43.302  133.982 85.530  1.00 44.79  ? 311  GLU A CG   1 
ATOM   3606  C CD   . GLU A 1 245 ? 44.702  133.797 84.986  1.00 46.93  ? 311  GLU A CD   1 
ATOM   3607  O OE1  . GLU A 1 245 ? 45.635  134.465 85.483  1.00 36.19  ? 311  GLU A OE1  1 
ATOM   3608  O OE2  . GLU A 1 245 ? 44.856  133.014 84.020  1.00 69.10  ? 311  GLU A OE2  1 
ATOM   3609  H H    . GLU A 1 245 ? 41.945  131.613 86.475  1.00 39.59  ? 311  GLU A H    1 
ATOM   3610  H HA   . GLU A 1 245 ? 44.473  132.101 86.982  1.00 41.52  ? 311  GLU A HA   1 
ATOM   3611  H HB2  . GLU A 1 245 ? 42.260  133.810 87.266  1.00 36.78  ? 311  GLU A HB2  1 
ATOM   3612  H HB3  . GLU A 1 245 ? 43.756  134.295 87.486  1.00 36.78  ? 311  GLU A HB3  1 
ATOM   3613  H HG2  . GLU A 1 245 ? 42.711  133.390 85.039  1.00 53.74  ? 311  GLU A HG2  1 
ATOM   3614  H HG3  . GLU A 1 245 ? 43.044  134.905 85.380  1.00 53.74  ? 311  GLU A HG3  1 
ATOM   3615  N N    . ILE A 1 246 ? 42.645  131.787 89.557  1.00 42.57  ? 312  ILE A N    1 
ATOM   3616  C CA   . ILE A 1 246 ? 42.770  131.611 91.002  1.00 33.70  ? 312  ILE A CA   1 
ATOM   3617  C C    . ILE A 1 246 ? 43.668  130.434 91.305  1.00 35.73  ? 312  ILE A C    1 
ATOM   3618  O O    . ILE A 1 246 ? 44.302  130.403 92.345  1.00 39.01  ? 312  ILE A O    1 
ATOM   3619  C CB   . ILE A 1 246 ? 41.424  131.423 91.725  1.00 36.84  ? 312  ILE A CB   1 
ATOM   3620  C CG1  . ILE A 1 246 ? 41.614  131.778 93.197  1.00 38.67  ? 312  ILE A CG1  1 
ATOM   3621  C CG2  . ILE A 1 246 ? 40.888  129.986 91.564  1.00 18.33  ? 312  ILE A CG2  1 
ATOM   3622  C CD1  . ILE A 1 246 ? 40.358  131.854 93.994  1.00 36.76  ? 312  ILE A CD1  1 
ATOM   3623  H H    . ILE A 1 246 ? 41.860  131.652 89.233  1.00 51.09  ? 312  ILE A H    1 
ATOM   3624  H HA   . ILE A 1 246 ? 43.191  132.402 91.372  1.00 40.44  ? 312  ILE A HA   1 
ATOM   3625  H HB   . ILE A 1 246 ? 40.779  132.037 91.341  1.00 44.21  ? 312  ILE A HB   1 
ATOM   3626  H HG12 . ILE A 1 246 ? 42.179  131.104 93.606  1.00 46.40  ? 312  ILE A HG12 1 
ATOM   3627  H HG13 . ILE A 1 246 ? 42.048  132.644 93.252  1.00 46.40  ? 312  ILE A HG13 1 
ATOM   3628  H HG21 . ILE A 1 246 ? 40.042  129.911 92.032  1.00 21.99  ? 312  ILE A HG21 1 
ATOM   3629  H HG22 . ILE A 1 246 ? 40.761  129.801 90.620  1.00 21.99  ? 312  ILE A HG22 1 
ATOM   3630  H HG23 . ILE A 1 246 ? 41.531  129.365 91.939  1.00 21.99  ? 312  ILE A HG23 1 
ATOM   3631  H HD11 . ILE A 1 246 ? 40.579  132.084 94.910  1.00 44.11  ? 312  ILE A HD11 1 
ATOM   3632  H HD12 . ILE A 1 246 ? 39.782  132.535 93.612  1.00 44.11  ? 312  ILE A HD12 1 
ATOM   3633  H HD13 . ILE A 1 246 ? 39.914  130.992 93.967  1.00 44.11  ? 312  ILE A HD13 1 
ATOM   3634  N N    . GLY A 1 247 ? 43.710  129.458 90.400  1.00 31.09  ? 313  GLY A N    1 
ATOM   3635  C CA   . GLY A 1 247 ? 44.628  128.347 90.553  1.00 29.73  ? 313  GLY A CA   1 
ATOM   3636  C C    . GLY A 1 247 ? 46.065  128.840 90.417  1.00 32.42  ? 313  GLY A C    1 
ATOM   3637  O O    . GLY A 1 247 ? 46.964  128.411 91.125  1.00 28.97  ? 313  GLY A O    1 
ATOM   3638  H H    . GLY A 1 247 ? 43.217  129.419 89.696  1.00 37.31  ? 313  GLY A H    1 
ATOM   3639  H HA2  . GLY A 1 247 ? 44.515  127.941 91.426  1.00 35.67  ? 313  GLY A HA2  1 
ATOM   3640  H HA3  . GLY A 1 247 ? 44.457  127.680 89.870  1.00 35.67  ? 313  GLY A HA3  1 
ATOM   3641  N N    . ILE A 1 248 ? 46.267  129.754 89.476  1.00 35.47  ? 314  ILE A N    1 
ATOM   3642  C CA   . ILE A 1 248 ? 47.570  130.328 89.206  1.00 20.97  ? 314  ILE A CA   1 
ATOM   3643  C C    . ILE A 1 248 ? 48.035  131.203 90.370  1.00 28.78  ? 314  ILE A C    1 
ATOM   3644  O O    . ILE A 1 248 ? 49.219  131.214 90.681  1.00 38.05  ? 314  ILE A O    1 
ATOM   3645  C CB   . ILE A 1 248 ? 47.535  131.128 87.899  1.00 23.27  ? 314  ILE A CB   1 
ATOM   3646  C CG1  . ILE A 1 248 ? 47.481  130.170 86.710  1.00 19.67  ? 314  ILE A CG1  1 
ATOM   3647  C CG2  . ILE A 1 248 ? 48.724  132.038 87.771  1.00 14.04  ? 314  ILE A CG2  1 
ATOM   3648  C CD1  . ILE A 1 248 ? 46.964  130.812 85.424  1.00 20.72  ? 314  ILE A CD1  1 
ATOM   3649  H H    . ILE A 1 248 ? 45.645  130.064 88.970  1.00 42.56  ? 314  ILE A H    1 
ATOM   3650  H HA   . ILE A 1 248 ? 48.213  129.609 89.098  1.00 25.17  ? 314  ILE A HA   1 
ATOM   3651  H HB   . ILE A 1 248 ? 46.731  131.670 87.892  1.00 27.92  ? 314  ILE A HB   1 
ATOM   3652  H HG12 . ILE A 1 248 ? 48.376  129.838 86.536  1.00 23.60  ? 314  ILE A HG12 1 
ATOM   3653  H HG13 . ILE A 1 248 ? 46.893  129.431 86.930  1.00 23.60  ? 314  ILE A HG13 1 
ATOM   3654  H HG21 . ILE A 1 248 ? 48.661  132.522 86.933  1.00 16.85  ? 314  ILE A HG21 1 
ATOM   3655  H HG22 . ILE A 1 248 ? 48.725  132.660 88.515  1.00 16.85  ? 314  ILE A HG22 1 
ATOM   3656  H HG23 . ILE A 1 248 ? 49.533  131.503 87.785  1.00 16.85  ? 314  ILE A HG23 1 
ATOM   3657  H HD11 . ILE A 1 248 ? 46.959  130.146 84.719  1.00 24.86  ? 314  ILE A HD11 1 
ATOM   3658  H HD12 . ILE A 1 248 ? 46.064  131.140 85.575  1.00 24.86  ? 314  ILE A HD12 1 
ATOM   3659  H HD13 . ILE A 1 248 ? 47.549  131.547 85.181  1.00 24.86  ? 314  ILE A HD13 1 
ATOM   3660  N N    . TRP A 1 249 ? 47.120  131.928 91.016  1.00 28.56  ? 315  TRP A N    1 
ATOM   3661  C CA   . TRP A 1 249 ? 47.481  132.730 92.181  1.00 18.93  ? 315  TRP A CA   1 
ATOM   3662  C C    . TRP A 1 249 ? 47.941  131.825 93.312  1.00 21.49  ? 315  TRP A C    1 
ATOM   3663  O O    . TRP A 1 249 ? 48.896  132.142 93.996  1.00 26.22  ? 315  TRP A O    1 
ATOM   3664  C CB   . TRP A 1 249 ? 46.325  133.634 92.652  1.00 17.05  ? 315  TRP A CB   1 
ATOM   3665  C CG   . TRP A 1 249 ? 45.730  134.451 91.549  1.00 26.38  ? 315  TRP A CG   1 
ATOM   3666  C CD1  . TRP A 1 249 ? 46.362  134.881 90.418  1.00 34.93  ? 315  TRP A CD1  1 
ATOM   3667  C CD2  . TRP A 1 249 ? 44.386  134.920 91.457  1.00 26.09  ? 315  TRP A CD2  1 
ATOM   3668  N NE1  . TRP A 1 249 ? 45.496  135.592 89.631  1.00 31.11  ? 315  TRP A NE1  1 
ATOM   3669  C CE2  . TRP A 1 249 ? 44.270  135.622 90.240  1.00 30.09  ? 315  TRP A CE2  1 
ATOM   3670  C CE3  . TRP A 1 249 ? 43.259  134.801 92.275  1.00 48.34  ? 315  TRP A CE3  1 
ATOM   3671  C CZ2  . TRP A 1 249 ? 43.064  136.188 89.807  1.00 42.46  ? 315  TRP A CZ2  1 
ATOM   3672  C CZ3  . TRP A 1 249 ? 42.053  135.375 91.850  1.00 51.28  ? 315  TRP A CZ3  1 
ATOM   3673  C CH2  . TRP A 1 249 ? 41.972  136.068 90.630  1.00 36.23  ? 315  TRP A CH2  1 
ATOM   3674  H H    . TRP A 1 249 ? 46.289  131.972 90.800  1.00 34.28  ? 315  TRP A H    1 
ATOM   3675  H HA   . TRP A 1 249 ? 48.225  133.304 91.943  1.00 22.72  ? 315  TRP A HA   1 
ATOM   3676  H HB2  . TRP A 1 249 ? 45.623  133.078 93.025  1.00 20.46  ? 315  TRP A HB2  1 
ATOM   3677  H HB3  . TRP A 1 249 ? 46.659  134.244 93.329  1.00 20.46  ? 315  TRP A HB3  1 
ATOM   3678  H HD1  . TRP A 1 249 ? 47.257  134.727 90.219  1.00 41.91  ? 315  TRP A HD1  1 
ATOM   3679  H HE1  . TRP A 1 249 ? 45.687  135.946 88.870  1.00 37.34  ? 315  TRP A HE1  1 
ATOM   3680  H HE3  . TRP A 1 249 ? 43.302  134.327 93.074  1.00 58.00  ? 315  TRP A HE3  1 
ATOM   3681  H HZ2  . TRP A 1 249 ? 43.015  136.663 89.009  1.00 50.95  ? 315  TRP A HZ2  1 
ATOM   3682  H HZ3  . TRP A 1 249 ? 41.298  135.305 92.388  1.00 61.54  ? 315  TRP A HZ3  1 
ATOM   3683  H HH2  . TRP A 1 249 ? 41.166  136.457 90.379  1.00 43.48  ? 315  TRP A HH2  1 
ATOM   3684  N N    . MET A 1 250 ? 47.286  130.690 93.507  1.00 25.23  ? 316  MET A N    1 
ATOM   3685  C CA   . MET A 1 250 ? 47.615  129.831 94.641  1.00 26.92  ? 316  MET A CA   1 
ATOM   3686  C C    . MET A 1 250 ? 48.949  129.106 94.431  1.00 33.83  ? 316  MET A C    1 
ATOM   3687  O O    . MET A 1 250 ? 49.672  128.827 95.379  1.00 36.24  ? 316  MET A O    1 
ATOM   3688  C CB   . MET A 1 250 ? 46.485  128.839 94.884  1.00 36.78  ? 316  MET A CB   1 
ATOM   3689  C CG   . MET A 1 250 ? 45.204  129.490 95.386  1.00 32.25  ? 316  MET A CG   1 
ATOM   3690  S SD   . MET A 1 250 ? 43.930  128.303 95.847  1.00 43.15  ? 316  MET A SD   1 
ATOM   3691  C CE   . MET A 1 250 ? 43.474  127.694 94.222  1.00 38.11  ? 316  MET A CE   1 
ATOM   3692  H H    . MET A 1 250 ? 46.653  130.394 93.006  1.00 30.28  ? 316  MET A H    1 
ATOM   3693  H HA   . MET A 1 250 ? 47.690  130.386 95.433  1.00 32.30  ? 316  MET A HA   1 
ATOM   3694  H HB2  . MET A 1 250 ? 46.282  128.385 94.051  1.00 44.13  ? 316  MET A HB2  1 
ATOM   3695  H HB3  . MET A 1 250 ? 46.772  128.194 95.550  1.00 44.13  ? 316  MET A HB3  1 
ATOM   3696  H HG2  . MET A 1 250 ? 45.410  130.025 96.168  1.00 38.70  ? 316  MET A HG2  1 
ATOM   3697  H HG3  . MET A 1 250 ? 44.844  130.055 94.685  1.00 38.70  ? 316  MET A HG3  1 
ATOM   3698  H HE1  . MET A 1 250 ? 42.776  127.027 94.320  1.00 45.73  ? 316  MET A HE1  1 
ATOM   3699  H HE2  . MET A 1 250 ? 43.151  128.436 93.687  1.00 45.73  ? 316  MET A HE2  1 
ATOM   3700  H HE3  . MET A 1 250 ? 44.254  127.298 93.803  1.00 45.73  ? 316  MET A HE3  1 
ATOM   3701  N N    . LYS A 1 251 ? 49.281  128.833 93.175  1.00 38.63  ? 317  LYS A N    1 
ATOM   3702  C CA   . LYS A 1 251 ? 50.546  128.197 92.804  1.00 41.44  ? 317  LYS A CA   1 
ATOM   3703  C C    . LYS A 1 251 ? 51.746  129.184 92.765  1.00 33.49  ? 317  LYS A C    1 
ATOM   3704  O O    . LYS A 1 251 ? 52.889  128.803 92.998  1.00 32.30  ? 317  LYS A O    1 
ATOM   3705  C CB   . LYS A 1 251 ? 50.340  127.501 91.460  1.00 24.50  ? 317  LYS A CB   1 
ATOM   3706  C CG   . LYS A 1 251 ? 51.559  127.215 90.665  1.00 25.45  ? 317  LYS A CG   1 
ATOM   3707  C CD   . LYS A 1 251 ? 51.310  126.028 89.746  1.00 41.59  ? 317  LYS A CD   1 
ATOM   3708  C CE   . LYS A 1 251 ? 51.993  126.149 88.381  1.00 56.06  ? 317  LYS A CE   1 
ATOM   3709  N NZ   . LYS A 1 251 ? 51.406  125.147 87.415  1.00 53.23  ? 317  LYS A NZ   1 
ATOM   3710  H H    . LYS A 1 251 ? 48.778  129.009 92.501  1.00 46.35  ? 317  LYS A H    1 
ATOM   3711  H HA   . LYS A 1 251 ? 50.751  127.513 93.461  1.00 49.73  ? 317  LYS A HA   1 
ATOM   3712  H HB2  . LYS A 1 251 ? 49.899  126.652 91.624  1.00 29.40  ? 317  LYS A HB2  1 
ATOM   3713  H HB3  . LYS A 1 251 ? 49.766  128.060 90.914  1.00 29.40  ? 317  LYS A HB3  1 
ATOM   3714  H HG2  . LYS A 1 251 ? 51.781  127.987 90.121  1.00 30.54  ? 317  LYS A HG2  1 
ATOM   3715  H HG3  . LYS A 1 251 ? 52.292  126.996 91.261  1.00 30.54  ? 317  LYS A HG3  1 
ATOM   3716  H HD2  . LYS A 1 251 ? 51.646  125.225 90.175  1.00 49.91  ? 317  LYS A HD2  1 
ATOM   3717  H HD3  . LYS A 1 251 ? 50.356  125.946 89.594  1.00 49.91  ? 317  LYS A HD3  1 
ATOM   3718  H HE2  . LYS A 1 251 ? 51.850  127.040 88.025  1.00 67.27  ? 317  LYS A HE2  1 
ATOM   3719  H HE3  . LYS A 1 251 ? 52.941  125.968 88.475  1.00 67.27  ? 317  LYS A HE3  1 
ATOM   3720  H HZ1  . LYS A 1 251 ? 51.805  125.220 86.623  1.00 63.88  ? 317  LYS A HZ1  1 
ATOM   3721  H HZ2  . LYS A 1 251 ? 51.525  124.321 87.724  1.00 63.88  ? 317  LYS A HZ2  1 
ATOM   3722  H HZ3  . LYS A 1 251 ? 50.534  125.296 87.315  1.00 63.88  ? 317  LYS A HZ3  1 
ATOM   3723  N N    . MET A 1 252 ? 51.472  130.453 92.500  1.00 38.39  ? 318  MET A N    1 
ATOM   3724  C CA   . MET A 1 252 ? 52.501  131.482 92.354  1.00 37.20  ? 318  MET A CA   1 
ATOM   3725  C C    . MET A 1 252 ? 52.933  132.100 93.691  1.00 43.94  ? 318  MET A C    1 
ATOM   3726  O O    . MET A 1 252 ? 54.127  132.281 93.963  1.00 48.66  ? 318  MET A O    1 
ATOM   3727  C CB   . MET A 1 252 ? 51.954  132.565 91.426  1.00 26.07  ? 318  MET A CB   1 
ATOM   3728  C CG   . MET A 1 252 ? 52.782  133.827 91.340  1.00 50.77  ? 318  MET A CG   1 
ATOM   3729  S SD   . MET A 1 252 ? 52.224  134.892 89.989  1.00 66.62  ? 318  MET A SD   1 
ATOM   3730  C CE   . MET A 1 252 ? 50.462  134.735 90.192  1.00 37.44  ? 318  MET A CE   1 
ATOM   3731  H H    . MET A 1 252 ? 50.673  130.755 92.397  1.00 46.07  ? 318  MET A H    1 
ATOM   3732  H HA   . MET A 1 252 ? 53.278  131.088 91.927  1.00 44.65  ? 318  MET A HA   1 
ATOM   3733  H HB2  . MET A 1 252 ? 51.890  132.198 90.530  1.00 31.29  ? 318  MET A HB2  1 
ATOM   3734  H HB3  . MET A 1 252 ? 51.071  132.817 91.737  1.00 31.29  ? 318  MET A HB3  1 
ATOM   3735  H HG2  . MET A 1 252 ? 52.700  134.321 92.171  1.00 60.93  ? 318  MET A HG2  1 
ATOM   3736  H HG3  . MET A 1 252 ? 53.709  133.591 91.179  1.00 60.93  ? 318  MET A HG3  1 
ATOM   3737  H HE1  . MET A 1 252 ? 50.017  135.269 89.515  1.00 44.93  ? 318  MET A HE1  1 
ATOM   3738  H HE2  . MET A 1 252 ? 50.215  133.803 90.093  1.00 44.93  ? 318  MET A HE2  1 
ATOM   3739  H HE3  . MET A 1 252 ? 50.217  135.051 91.076  1.00 44.93  ? 318  MET A HE3  1 
ATOM   3740  N N    . TYR A 1 253 ? 51.950  132.431 94.516  1.00 48.70  ? 319  TYR A N    1 
ATOM   3741  C CA   . TYR A 1 253 ? 52.200  133.052 95.808  1.00 39.69  ? 319  TYR A CA   1 
ATOM   3742  C C    . TYR A 1 253 ? 51.427  132.276 96.859  1.00 25.75  ? 319  TYR A C    1 
ATOM   3743  O O    . TYR A 1 253 ? 50.566  132.824 97.531  1.00 32.16  ? 319  TYR A O    1 
ATOM   3744  C CB   . TYR A 1 253 ? 51.779  134.533 95.772  1.00 39.58  ? 319  TYR A CB   1 
ATOM   3745  C CG   . TYR A 1 253 ? 52.194  135.390 96.972  1.00 40.64  ? 319  TYR A CG   1 
ATOM   3746  C CD1  . TYR A 1 253 ? 52.863  134.847 98.063  1.00 30.21  ? 319  TYR A CD1  1 
ATOM   3747  C CD2  . TYR A 1 253 ? 51.901  136.746 97.005  1.00 31.56  ? 319  TYR A CD2  1 
ATOM   3748  C CE1  . TYR A 1 253 ? 53.229  135.623 99.143  1.00 35.64  ? 319  TYR A CE1  1 
ATOM   3749  C CE2  . TYR A 1 253 ? 52.265  137.534 98.078  1.00 32.17  ? 319  TYR A CE2  1 
ATOM   3750  C CZ   . TYR A 1 253 ? 52.925  136.970 99.151  1.00 43.83  ? 319  TYR A CZ   1 
ATOM   3751  O OH   . TYR A 1 253 ? 53.286  137.753 100.231 1.00 37.87  ? 319  TYR A OH   1 
ATOM   3752  H H    . TYR A 1 253 ? 51.117  132.304 94.348  1.00 58.45  ? 319  TYR A H    1 
ATOM   3753  H HA   . TYR A 1 253 ? 53.146  133.002 96.018  1.00 47.63  ? 319  TYR A HA   1 
ATOM   3754  H HB2  . TYR A 1 253 ? 52.167  134.940 94.981  1.00 47.50  ? 319  TYR A HB2  1 
ATOM   3755  H HB3  . TYR A 1 253 ? 50.812  134.572 95.711  1.00 47.50  ? 319  TYR A HB3  1 
ATOM   3756  H HD1  . TYR A 1 253 ? 53.068  133.939 98.064  1.00 36.25  ? 319  TYR A HD1  1 
ATOM   3757  H HD2  . TYR A 1 253 ? 51.454  137.132 96.287  1.00 37.87  ? 319  TYR A HD2  1 
ATOM   3758  H HE1  . TYR A 1 253 ? 53.675  135.240 99.863  1.00 42.77  ? 319  TYR A HE1  1 
ATOM   3759  H HE2  . TYR A 1 253 ? 52.058  138.440 98.081  1.00 38.60  ? 319  TYR A HE2  1 
ATOM   3760  H HH   . TYR A 1 253 ? 53.042  138.546 100.105 1.00 45.44  ? 319  TYR A HH   1 
ATOM   3761  N N    . SER A 1 254 ? 51.772  131.002 96.997  1.00 32.66  ? 320  SER A N    1 
ATOM   3762  C CA   . SER A 1 254 ? 51.107  130.081 97.920  1.00 43.58  ? 320  SER A CA   1 
ATOM   3763  C C    . SER A 1 254 ? 50.954  130.583 99.375  1.00 44.01  ? 320  SER A C    1 
ATOM   3764  O O    . SER A 1 254 ? 49.907  130.387 100.001 1.00 32.71  ? 320  SER A O    1 
ATOM   3765  C CB   . SER A 1 254 ? 51.838  128.733 97.904  1.00 33.67  ? 320  SER A CB   1 
ATOM   3766  O OG   . SER A 1 254 ? 53.030  128.787 98.669  1.00 54.63  ? 320  SER A OG   1 
ATOM   3767  H H    . SER A 1 254 ? 52.409  130.633 96.552  1.00 39.19  ? 320  SER A H    1 
ATOM   3768  H HA   . SER A 1 254 ? 50.211  129.921 97.585  1.00 52.30  ? 320  SER A HA   1 
ATOM   3769  H HB2  . SER A 1 254 ? 51.255  128.055 98.278  1.00 40.41  ? 320  SER A HB2  1 
ATOM   3770  H HB3  . SER A 1 254 ? 52.062  128.508 96.988  1.00 40.41  ? 320  SER A HB3  1 
ATOM   3771  H HG   . SER A 1 254 ? 53.418  128.042 98.650  1.00 65.55  ? 320  SER A HG   1 
ATOM   3772  N N    . ASP A 1 255 ? 51.989  131.217 99.913  1.00 35.84  ? 321  ASP A N    1 
ATOM   3773  C CA   . ASP A 1 255 ? 51.961  131.675 101.302 1.00 39.27  ? 321  ASP A CA   1 
ATOM   3774  C C    . ASP A 1 255 ? 50.841  132.708 101.566 1.00 49.91  ? 321  ASP A C    1 
ATOM   3775  O O    . ASP A 1 255 ? 50.369  132.869 102.699 1.00 48.90  ? 321  ASP A O    1 
ATOM   3776  C CB   . ASP A 1 255 ? 53.326  132.246 101.681 1.00 39.68  ? 321  ASP A CB   1 
ATOM   3777  C CG   . ASP A 1 255 ? 54.406  131.166 101.809 1.00 63.97  ? 321  ASP A CG   1 
ATOM   3778  O OD1  . ASP A 1 255 ? 54.141  129.975 101.493 1.00 59.72  ? 321  ASP A OD1  1 
ATOM   3779  O OD2  . ASP A 1 255 ? 55.525  131.518 102.251 1.00 66.83  ? 321  ASP A OD2  1 
ATOM   3780  H H    . ASP A 1 255 ? 52.721  131.396 99.498  1.00 43.01  ? 321  ASP A H    1 
ATOM   3781  H HA   . ASP A 1 255 ? 51.794  130.911 101.876 1.00 47.12  ? 321  ASP A HA   1 
ATOM   3782  H HB2  . ASP A 1 255 ? 53.607  132.872 100.995 1.00 47.62  ? 321  ASP A HB2  1 
ATOM   3783  H HB3  . ASP A 1 255 ? 53.252  132.700 102.535 1.00 47.62  ? 321  ASP A HB3  1 
ATOM   3784  N N    . ALA A 1 256 ? 50.406  133.385 100.509 1.00 41.45  ? 322  ALA A N    1 
ATOM   3785  C CA   . ALA A 1 256 ? 49.347  134.388 100.616 1.00 51.34  ? 322  ALA A CA   1 
ATOM   3786  C C    . ALA A 1 256 ? 47.958  133.902 100.123 1.00 46.17  ? 322  ALA A C    1 
ATOM   3787  O O    . ALA A 1 256 ? 46.925  134.386 100.592 1.00 22.35  ? 322  ALA A O    1 
ATOM   3788  C CB   . ALA A 1 256 ? 49.763  135.643 99.855  1.00 41.09  ? 322  ALA A CB   1 
ATOM   3789  H H    . ALA A 1 256 ? 50.710  133.283 99.711  1.00 49.74  ? 322  ALA A H    1 
ATOM   3790  H HA   . ALA A 1 256 ? 49.252  134.633 101.550 1.00 61.61  ? 322  ALA A HA   1 
ATOM   3791  H HB1  . ALA A 1 256 ? 49.057  136.305 99.929  1.00 49.31  ? 322  ALA A HB1  1 
ATOM   3792  H HB2  . ALA A 1 256 ? 50.583  135.988 100.241 1.00 49.31  ? 322  ALA A HB2  1 
ATOM   3793  H HB3  . ALA A 1 256 ? 49.906  135.414 98.923  1.00 49.31  ? 322  ALA A HB3  1 
ATOM   3794  N N    . PHE A 1 257 ? 47.948  132.947 99.190  1.00 36.21  ? 323  PHE A N    1 
ATOM   3795  C CA   . PHE A 1 257 ? 46.722  132.558 98.495  1.00 26.78  ? 323  PHE A CA   1 
ATOM   3796  C C    . PHE A 1 257 ? 46.294  131.100 98.668  1.00 33.72  ? 323  PHE A C    1 
ATOM   3797  O O    . PHE A 1 257 ? 45.145  130.771 98.396  1.00 23.69  ? 323  PHE A O    1 
ATOM   3798  C CB   . PHE A 1 257 ? 46.847  132.877 97.009  1.00 34.06  ? 323  PHE A CB   1 
ATOM   3799  C CG   . PHE A 1 257 ? 46.734  134.337 96.705  1.00 30.12  ? 323  PHE A CG   1 
ATOM   3800  C CD1  . PHE A 1 257 ? 45.499  134.923 96.517  1.00 32.96  ? 323  PHE A CD1  1 
ATOM   3801  C CD2  . PHE A 1 257 ? 47.857  135.132 96.636  1.00 34.97  ? 323  PHE A CD2  1 
ATOM   3802  C CE1  . PHE A 1 257 ? 45.389  136.255 96.250  1.00 21.84  ? 323  PHE A CE1  1 
ATOM   3803  C CE2  . PHE A 1 257 ? 47.746  136.474 96.362  1.00 22.04  ? 323  PHE A CE2  1 
ATOM   3804  C CZ   . PHE A 1 257 ? 46.507  137.030 96.170  1.00 22.04  ? 323  PHE A CZ   1 
ATOM   3805  H H    . PHE A 1 257 ? 48.644  132.507 98.941  1.00 43.46  ? 323  PHE A H    1 
ATOM   3806  H HA   . PHE A 1 257 ? 46.000  133.105 98.841  1.00 32.14  ? 323  PHE A HA   1 
ATOM   3807  H HB2  . PHE A 1 257 ? 47.712  132.573 96.694  1.00 40.88  ? 323  PHE A HB2  1 
ATOM   3808  H HB3  . PHE A 1 257 ? 46.141  132.417 96.529  1.00 40.88  ? 323  PHE A HB3  1 
ATOM   3809  H HD1  . PHE A 1 257 ? 44.732  134.400 96.567  1.00 39.55  ? 323  PHE A HD1  1 
ATOM   3810  H HD2  . PHE A 1 257 ? 48.698  134.755 96.762  1.00 41.96  ? 323  PHE A HD2  1 
ATOM   3811  H HE1  . PHE A 1 257 ? 44.550  136.635 96.119  1.00 26.21  ? 323  PHE A HE1  1 
ATOM   3812  H HE2  . PHE A 1 257 ? 48.508  137.004 96.311  1.00 26.45  ? 323  PHE A HE2  1 
ATOM   3813  H HZ   . PHE A 1 257 ? 46.430  137.939 95.989  1.00 26.45  ? 323  PHE A HZ   1 
ATOM   3814  N N    . LEU A 1 258 ? 47.196  130.239 99.127  1.00 27.37  ? 324  LEU A N    1 
ATOM   3815  C CA   . LEU A 1 258 ? 46.846  128.842 99.367  1.00 28.94  ? 324  LEU A CA   1 
ATOM   3816  C C    . LEU A 1 258 ? 46.347  128.638 100.796 1.00 42.17  ? 324  LEU A C    1 
ATOM   3817  O O    . LEU A 1 258 ? 47.016  128.052 101.635 1.00 62.00  ? 324  LEU A O    1 
ATOM   3818  C CB   . LEU A 1 258 ? 48.027  127.920 99.046  1.00 41.40  ? 324  LEU A CB   1 
ATOM   3819  C CG   . LEU A 1 258 ? 47.813  126.398 99.056  1.00 34.09  ? 324  LEU A CG   1 
ATOM   3820  C CD1  . LEU A 1 258 ? 46.412  125.988 98.695  1.00 36.84  ? 324  LEU A CD1  1 
ATOM   3821  C CD2  . LEU A 1 258 ? 48.787  125.751 98.100  1.00 40.55  ? 324  LEU A CD2  1 
ATOM   3822  H H    . LEU A 1 258 ? 48.014  130.436 99.306  1.00 32.84  ? 324  LEU A H    1 
ATOM   3823  H HA   . LEU A 1 258 ? 46.120  128.602 98.770  1.00 34.72  ? 324  LEU A HA   1 
ATOM   3824  H HB2  . LEU A 1 258 ? 48.347  128.150 98.159  1.00 49.68  ? 324  LEU A HB2  1 
ATOM   3825  H HB3  . LEU A 1 258 ? 48.729  128.106 99.689  1.00 49.68  ? 324  LEU A HB3  1 
ATOM   3826  H HG   . LEU A 1 258 ? 48.001  126.061 99.946  1.00 40.91  ? 324  LEU A HG   1 
ATOM   3827  H HD11 . LEU A 1 258 ? 46.350  125.021 98.721  1.00 44.21  ? 324  LEU A HD11 1 
ATOM   3828  H HD12 . LEU A 1 258 ? 45.795  126.378 99.334  1.00 44.21  ? 324  LEU A HD12 1 
ATOM   3829  H HD13 . LEU A 1 258 ? 46.210  126.309 97.802  1.00 44.21  ? 324  LEU A HD13 1 
ATOM   3830  H HD21 . LEU A 1 258 ? 48.648  124.791 98.109  1.00 48.66  ? 324  LEU A HD21 1 
ATOM   3831  H HD22 . LEU A 1 258 ? 48.632  126.099 97.208  1.00 48.66  ? 324  LEU A HD22 1 
ATOM   3832  H HD23 . LEU A 1 258 ? 49.692  125.957 98.383  1.00 48.66  ? 324  LEU A HD23 1 
ATOM   3833  N N    . ASN A 1 259 ? 45.158  129.156 101.052 1.00 42.15  ? 325  ASN A N    1 
ATOM   3834  C CA   . ASN A 1 259 ? 44.417  128.898 102.270 1.00 45.97  ? 325  ASN A CA   1 
ATOM   3835  C C    . ASN A 1 259 ? 42.976  128.718 101.861 1.00 53.51  ? 325  ASN A C    1 
ATOM   3836  O O    . ASN A 1 259 ? 42.614  129.093 100.751 1.00 49.98  ? 325  ASN A O    1 
ATOM   3837  C CB   . ASN A 1 259 ? 44.482  130.119 103.133 1.00 52.99  ? 325  ASN A CB   1 
ATOM   3838  C CG   . ASN A 1 259 ? 44.277  131.341 102.334 1.00 46.66  ? 325  ASN A CG   1 
ATOM   3839  O OD1  . ASN A 1 259 ? 43.144  131.691 102.016 1.00 57.84  ? 325  ASN A OD1  1 
ATOM   3840  N ND2  . ASN A 1 259 ? 45.372  131.966 101.915 1.00 52.57  ? 325  ASN A ND2  1 
ATOM   3841  H H    . ASN A 1 259 ? 44.745  129.682 100.511 1.00 50.59  ? 325  ASN A H    1 
ATOM   3842  H HA   . ASN A 1 259 ? 44.747  128.117 102.742 1.00 55.17  ? 325  ASN A HA   1 
ATOM   3843  H HB2  . ASN A 1 259 ? 43.785  130.074 103.807 1.00 63.59  ? 325  ASN A HB2  1 
ATOM   3844  H HB3  . ASN A 1 259 ? 45.354  130.170 103.553 1.00 63.59  ? 325  ASN A HB3  1 
ATOM   3845  H HD21 . ASN A 1 259 ? 45.304  132.683 101.446 1.00 63.08  ? 325  ASN A HD21 1 
ATOM   3846  H HD22 . ASN A 1 259 ? 46.148  131.653 102.113 1.00 63.08  ? 325  ASN A HD22 1 
ATOM   3847  N N    . ASP A 1 260 ? 42.153  128.188 102.759 1.00 46.15  ? 326  ASP A N    1 
ATOM   3848  C CA   . ASP A 1 260 ? 40.773  127.860 102.442 1.00 34.40  ? 326  ASP A CA   1 
ATOM   3849  C C    . ASP A 1 260 ? 40.042  129.028 101.777 1.00 47.72  ? 326  ASP A C    1 
ATOM   3850  O O    . ASP A 1 260 ? 39.290  128.837 100.824 1.00 46.81  ? 326  ASP A O    1 
ATOM   3851  C CB   . ASP A 1 260 ? 40.023  127.421 103.705 1.00 57.33  ? 326  ASP A CB   1 
ATOM   3852  C CG   . ASP A 1 260 ? 38.595  126.938 103.406 1.00 79.48  ? 326  ASP A CG   1 
ATOM   3853  O OD1  . ASP A 1 260 ? 38.425  126.066 102.519 1.00 81.60  ? 326  ASP A OD1  1 
ATOM   3854  O OD2  . ASP A 1 260 ? 37.638  127.449 104.038 1.00 81.14  ? 326  ASP A OD2  1 
ATOM   3855  H H    . ASP A 1 260 ? 42.376  128.007 103.570 1.00 55.38  ? 326  ASP A H    1 
ATOM   3856  H HA   . ASP A 1 260 ? 40.766  127.116 101.821 1.00 41.28  ? 326  ASP A HA   1 
ATOM   3857  H HB2  . ASP A 1 260 ? 40.506  126.690 104.122 1.00 68.79  ? 326  ASP A HB2  1 
ATOM   3858  H HB3  . ASP A 1 260 ? 39.965  128.172 104.316 1.00 68.79  ? 326  ASP A HB3  1 
ATOM   3859  N N    . SER A 1 261 ? 40.289  130.245 102.250 1.00 54.39  ? 327  SER A N    1 
ATOM   3860  C CA   . SER A 1 261 ? 39.523  131.411 101.796 1.00 47.53  ? 327  SER A CA   1 
ATOM   3861  C C    . SER A 1 261 ? 39.695  131.732 100.303 1.00 38.68  ? 327  SER A C    1 
ATOM   3862  O O    . SER A 1 261 ? 39.144  132.708 99.801  1.00 41.30  ? 327  SER A O    1 
ATOM   3863  C CB   . SER A 1 261 ? 39.911  132.631 102.619 1.00 39.63  ? 327  SER A CB   1 
ATOM   3864  O OG   . SER A 1 261 ? 40.986  133.316 102.006 1.00 36.80  ? 327  SER A OG   1 
ATOM   3865  H H    . SER A 1 261 ? 40.893  130.427 102.835 1.00 65.26  ? 327  SER A H    1 
ATOM   3866  H HA   . SER A 1 261 ? 38.581  131.239 101.951 1.00 57.03  ? 327  SER A HA   1 
ATOM   3867  H HB2  . SER A 1 261 ? 39.148  133.227 102.681 1.00 47.55  ? 327  SER A HB2  1 
ATOM   3868  H HB3  . SER A 1 261 ? 40.181  132.343 103.505 1.00 47.55  ? 327  SER A HB3  1 
ATOM   3869  H HG   . SER A 1 261 ? 41.652  132.808 101.945 1.00 44.16  ? 327  SER A HG   1 
ATOM   3870  N N    . TYR A 1 262 ? 40.496  130.930 99.617  1.00 44.47  ? 328  TYR A N    1 
ATOM   3871  C CA   . TYR A 1 262 ? 40.610  130.992 98.172  1.00 35.42  ? 328  TYR A CA   1 
ATOM   3872  C C    . TYR A 1 262 ? 40.373  129.596 97.600  1.00 39.80  ? 328  TYR A C    1 
ATOM   3873  O O    . TYR A 1 262 ? 39.892  129.462 96.487  1.00 65.09  ? 328  TYR A O    1 
ATOM   3874  C CB   . TYR A 1 262 ? 41.978  131.513 97.743  1.00 28.96  ? 328  TYR A CB   1 
ATOM   3875  C CG   . TYR A 1 262 ? 42.187  132.989 97.969  1.00 34.60  ? 328  TYR A CG   1 
ATOM   3876  C CD1  . TYR A 1 262 ? 42.692  133.466 99.174  1.00 45.83  ? 328  TYR A CD1  1 
ATOM   3877  C CD2  . TYR A 1 262 ? 41.898  133.913 96.976  1.00 46.24  ? 328  TYR A CD2  1 
ATOM   3878  C CE1  . TYR A 1 262 ? 42.884  134.828 99.389  1.00 45.62  ? 328  TYR A CE1  1 
ATOM   3879  C CE2  . TYR A 1 262 ? 42.090  135.281 97.181  1.00 32.08  ? 328  TYR A CE2  1 
ATOM   3880  C CZ   . TYR A 1 262 ? 42.580  135.728 98.389  1.00 31.86  ? 328  TYR A CZ   1 
ATOM   3881  O OH   . TYR A 1 262 ? 42.765  137.079 98.601  1.00 52.21  ? 328  TYR A OH   1 
ATOM   3882  H H    . TYR A 1 262 ? 40.994  130.329 99.976  1.00 53.36  ? 328  TYR A H    1 
ATOM   3883  H HA   . TYR A 1 262 ? 39.931  131.588 97.820  1.00 42.50  ? 328  TYR A HA   1 
ATOM   3884  H HB2  . TYR A 1 262 ? 42.661  131.039 98.244  1.00 34.75  ? 328  TYR A HB2  1 
ATOM   3885  H HB3  . TYR A 1 262 ? 42.091  131.342 96.795  1.00 34.75  ? 328  TYR A HB3  1 
ATOM   3886  H HD1  . TYR A 1 262 ? 42.893  132.864 99.855  1.00 55.00  ? 328  TYR A HD1  1 
ATOM   3887  H HD2  . TYR A 1 262 ? 41.562  133.616 96.161  1.00 55.48  ? 328  TYR A HD2  1 
ATOM   3888  H HE1  . TYR A 1 262 ? 43.215  135.130 100.203 1.00 54.75  ? 328  TYR A HE1  1 
ATOM   3889  H HE2  . TYR A 1 262 ? 41.883  135.888 96.507  1.00 38.50  ? 328  TYR A HE2  1 
ATOM   3890  H HH   . TYR A 1 262 ? 42.543  137.511 97.916  1.00 62.65  ? 328  TYR A HH   1 
ATOM   3891  N N    . LEU A 1 263 ? 40.692  128.554 98.358  1.00 37.36  ? 329  LEU A N    1 
ATOM   3892  C CA   . LEU A 1 263 ? 40.444  127.185 97.893  1.00 46.87  ? 329  LEU A CA   1 
ATOM   3893  C C    . LEU A 1 263 ? 38.971  126.851 97.744  1.00 53.27  ? 329  LEU A C    1 
ATOM   3894  O O    . LEU A 1 263 ? 38.618  126.166 96.792  1.00 67.34  ? 329  LEU A O    1 
ATOM   3895  C CB   . LEU A 1 263 ? 41.054  126.144 98.829  1.00 39.42  ? 329  LEU A CB   1 
ATOM   3896  C CG   . LEU A 1 263 ? 42.514  125.760 98.625  1.00 40.15  ? 329  LEU A CG   1 
ATOM   3897  C CD1  . LEU A 1 263 ? 42.844  124.658 99.594  1.00 46.80  ? 329  LEU A CD1  1 
ATOM   3898  C CD2  . LEU A 1 263 ? 42.831  125.330 97.199  1.00 23.19  ? 329  LEU A CD2  1 
ATOM   3899  H H    . LEU A 1 263 ? 41.050  128.606 99.138  1.00 44.83  ? 329  LEU A H    1 
ATOM   3900  H HA   . LEU A 1 263 ? 40.859  127.076 97.022  1.00 56.24  ? 329  LEU A HA   1 
ATOM   3901  H HB2  . LEU A 1 263 ? 40.975  126.478 99.736  1.00 47.30  ? 329  LEU A HB2  1 
ATOM   3902  H HB3  . LEU A 1 263 ? 40.535  125.329 98.746  1.00 47.30  ? 329  LEU A HB3  1 
ATOM   3903  H HG   . LEU A 1 263 ? 43.073  126.523 98.838  1.00 48.18  ? 329  LEU A HG   1 
ATOM   3904  H HD11 . LEU A 1 263 ? 43.772  124.402 99.476  1.00 56.15  ? 329  LEU A HD11 1 
ATOM   3905  H HD12 . LEU A 1 263 ? 42.701  124.979 100.498 1.00 56.15  ? 329  LEU A HD12 1 
ATOM   3906  H HD13 . LEU A 1 263 ? 42.266  123.899 99.417  1.00 56.15  ? 329  LEU A HD13 1 
ATOM   3907  H HD21 . LEU A 1 263 ? 43.771  125.101 97.140  1.00 27.83  ? 329  LEU A HD21 1 
ATOM   3908  H HD22 . LEU A 1 263 ? 42.287  124.559 96.974  1.00 27.83  ? 329  LEU A HD22 1 
ATOM   3909  H HD23 . LEU A 1 263 ? 42.630  126.063 96.596  1.00 27.83  ? 329  LEU A HD23 1 
ATOM   3910  N N    . LYS A 1 264 ? 38.135  127.301 98.686  1.00 41.11  ? 330  LYS A N    1 
ATOM   3911  C CA   . LYS A 1 264 ? 36.703  126.974 98.709  1.00 38.24  ? 330  LYS A CA   1 
ATOM   3912  C C    . LYS A 1 264 ? 36.044  127.199 97.358  1.00 44.12  ? 330  LYS A C    1 
ATOM   3913  O O    . LYS A 1 264 ? 35.173  126.431 96.970  1.00 38.64  ? 330  LYS A O    1 
ATOM   3914  C CB   . LYS A 1 264 ? 35.962  127.785 99.783  1.00 36.97  ? 330  LYS A CB   1 
ATOM   3915  C CG   . LYS A 1 264 ? 36.018  129.294 99.575  1.00 42.79  ? 330  LYS A CG   1 
ATOM   3916  C CD   . LYS A 1 264 ? 35.650  130.095 100.832 1.00 39.62  ? 330  LYS A CD   1 
ATOM   3917  C CE   . LYS A 1 264 ? 35.064  131.462 100.454 1.00 41.24  ? 330  LYS A CE   1 
ATOM   3918  N NZ   . LYS A 1 264 ? 35.438  132.572 101.369 1.00 52.94  ? 330  LYS A NZ   1 
ATOM   3919  H H    . LYS A 1 264 ? 38.379  127.807 99.337  1.00 49.34  ? 330  LYS A H    1 
ATOM   3920  H HA   . LYS A 1 264 ? 36.604  126.035 98.930  1.00 45.89  ? 330  LYS A HA   1 
ATOM   3921  H HB2  . LYS A 1 264 ? 35.029  127.522 99.783  1.00 44.37  ? 330  LYS A HB2  1 
ATOM   3922  H HB3  . LYS A 1 264 ? 36.358  127.592 100.647 1.00 44.37  ? 330  LYS A HB3  1 
ATOM   3923  H HG2  . LYS A 1 264 ? 36.919  129.542 99.317  1.00 51.35  ? 330  LYS A HG2  1 
ATOM   3924  H HG3  . LYS A 1 264 ? 35.394  129.538 98.873  1.00 51.35  ? 330  LYS A HG3  1 
ATOM   3925  H HD2  . LYS A 1 264 ? 34.984  129.607 101.342 1.00 47.54  ? 330  LYS A HD2  1 
ATOM   3926  H HD3  . LYS A 1 264 ? 36.446  130.240 101.367 1.00 47.54  ? 330  LYS A HD3  1 
ATOM   3927  H HE2  . LYS A 1 264 ? 35.375  131.697 99.565  1.00 49.49  ? 330  LYS A HE2  1 
ATOM   3928  H HE3  . LYS A 1 264 ? 34.096  131.395 100.454 1.00 49.49  ? 330  LYS A HE3  1 
ATOM   3929  H HZ1  . LYS A 1 264 ? 35.066  133.332 101.093 1.00 63.53  ? 330  LYS A HZ1  1 
ATOM   3930  H HZ2  . LYS A 1 264 ? 35.154  132.395 102.194 1.00 63.53  ? 330  LYS A HZ2  1 
ATOM   3931  H HZ3  . LYS A 1 264 ? 36.322  132.671 101.382 1.00 63.53  ? 330  LYS A HZ3  1 
ATOM   3932  N N    . TYR A 1 265 ? 36.472  128.234 96.638  1.00 35.84  ? 331  TYR A N    1 
ATOM   3933  C CA   . TYR A 1 265 ? 35.923  128.502 95.312  1.00 31.53  ? 331  TYR A CA   1 
ATOM   3934  C C    . TYR A 1 265 ? 36.152  127.314 94.398  1.00 25.02  ? 331  TYR A C    1 
ATOM   3935  O O    . TYR A 1 265 ? 35.224  126.779 93.812  1.00 40.49  ? 331  TYR A O    1 
ATOM   3936  C CB   . TYR A 1 265 ? 36.522  129.781 94.723  1.00 20.69  ? 331  TYR A CB   1 
ATOM   3937  C CG   . TYR A 1 265 ? 36.160  130.966 95.562  1.00 41.64  ? 331  TYR A CG   1 
ATOM   3938  C CD1  . TYR A 1 265 ? 34.932  131.601 95.409  1.00 44.73  ? 331  TYR A CD1  1 
ATOM   3939  C CD2  . TYR A 1 265 ? 37.012  131.428 96.546  1.00 33.31  ? 331  TYR A CD2  1 
ATOM   3940  C CE1  . TYR A 1 265 ? 34.578  132.687 96.202  1.00 42.14  ? 331  TYR A CE1  1 
ATOM   3941  C CE2  . TYR A 1 265 ? 36.670  132.512 97.343  1.00 39.30  ? 331  TYR A CE2  1 
ATOM   3942  C CZ   . TYR A 1 265 ? 35.453  133.140 97.166  1.00 46.76  ? 331  TYR A CZ   1 
ATOM   3943  O OH   . TYR A 1 265 ? 35.119  134.217 97.966  1.00 58.29  ? 331  TYR A OH   1 
ATOM   3944  H H    . TYR A 1 265 ? 37.074  128.793 96.893  1.00 43.01  ? 331  TYR A H    1 
ATOM   3945  H HA   . TYR A 1 265 ? 34.966  128.634 95.392  1.00 37.83  ? 331  TYR A HA   1 
ATOM   3946  H HB2  . TYR A 1 265 ? 37.489  129.704 94.701  1.00 24.83  ? 331  TYR A HB2  1 
ATOM   3947  H HB3  . TYR A 1 265 ? 36.172  129.919 93.829  1.00 24.83  ? 331  TYR A HB3  1 
ATOM   3948  H HD1  . TYR A 1 265 ? 34.340  131.300 94.758  1.00 53.68  ? 331  TYR A HD1  1 
ATOM   3949  H HD2  . TYR A 1 265 ? 37.834  131.012 96.670  1.00 39.97  ? 331  TYR A HD2  1 
ATOM   3950  H HE1  . TYR A 1 265 ? 33.757  133.108 96.080  1.00 50.57  ? 331  TYR A HE1  1 
ATOM   3951  H HE2  . TYR A 1 265 ? 37.260  132.815 97.994  1.00 47.16  ? 331  TYR A HE2  1 
ATOM   3952  H HH   . TYR A 1 265 ? 35.744  134.379 98.504  1.00 69.94  ? 331  TYR A HH   1 
ATOM   3953  N N    . VAL A 1 266 ? 37.398  126.897 94.284  1.00 35.55  ? 332  VAL A N    1 
ATOM   3954  C CA   . VAL A 1 266 ? 37.723  125.730 93.492  1.00 44.08  ? 332  VAL A CA   1 
ATOM   3955  C C    . VAL A 1 266 ? 36.925  124.501 93.967  1.00 36.79  ? 332  VAL A C    1 
ATOM   3956  O O    . VAL A 1 266 ? 36.510  123.676 93.162  1.00 40.87  ? 332  VAL A O    1 
ATOM   3957  C CB   . VAL A 1 266 ? 39.251  125.486 93.516  1.00 49.70  ? 332  VAL A CB   1 
ATOM   3958  C CG1  . VAL A 1 266 ? 39.617  124.074 93.008  1.00 51.52  ? 332  VAL A CG1  1 
ATOM   3959  C CG2  . VAL A 1 266 ? 39.950  126.551 92.683  1.00 49.12  ? 332  VAL A CG2  1 
ATOM   3960  H H    . VAL A 1 266 ? 38.076  127.274 94.655  1.00 42.66  ? 332  VAL A H    1 
ATOM   3961  H HA   . VAL A 1 266 ? 37.470  125.903 92.572  1.00 52.89  ? 332  VAL A HA   1 
ATOM   3962  H HB   . VAL A 1 266 ? 39.568  125.566 94.430  1.00 59.64  ? 332  VAL A HB   1 
ATOM   3963  H HG11 . VAL A 1 266 ? 40.580  123.967 93.041  1.00 61.82  ? 332  VAL A HG11 1 
ATOM   3964  H HG12 . VAL A 1 266 ? 39.191  123.414 93.577  1.00 61.82  ? 332  VAL A HG12 1 
ATOM   3965  H HG13 . VAL A 1 266 ? 39.304  123.977 92.095  1.00 61.82  ? 332  VAL A HG13 1 
ATOM   3966  H HG21 . VAL A 1 266 ? 40.906  126.390 92.704  1.00 58.94  ? 332  VAL A HG21 1 
ATOM   3967  H HG22 . VAL A 1 266 ? 39.625  126.500 91.771  1.00 58.94  ? 332  VAL A HG22 1 
ATOM   3968  H HG23 . VAL A 1 266 ? 39.753  127.423 93.058  1.00 58.94  ? 332  VAL A HG23 1 
ATOM   3969  N N    . GLY A 1 267 ? 36.688  124.402 95.266  1.00 36.02  ? 333  GLY A N    1 
ATOM   3970  C CA   . GLY A 1 267 ? 35.923  123.302 95.811  1.00 39.89  ? 333  GLY A CA   1 
ATOM   3971  C C    . GLY A 1 267 ? 34.500  123.304 95.295  1.00 38.53  ? 333  GLY A C    1 
ATOM   3972  O O    . GLY A 1 267 ? 33.992  122.290 94.818  1.00 32.93  ? 333  GLY A O    1 
ATOM   3973  H H    . GLY A 1 267 ? 36.962  124.966 95.855  1.00 43.22  ? 333  GLY A H    1 
ATOM   3974  H HA2  . GLY A 1 267 ? 36.341  122.462 95.565  1.00 47.87  ? 333  GLY A HA2  1 
ATOM   3975  H HA3  . GLY A 1 267 ? 35.902  123.367 96.778  1.00 47.87  ? 333  GLY A HA3  1 
ATOM   3976  N N    . TRP A 1 268 ? 33.854  124.458 95.390  1.00 46.57  ? 334  TRP A N    1 
ATOM   3977  C CA   . TRP A 1 268 ? 32.487  124.598 94.943  1.00 20.45  ? 334  TRP A CA   1 
ATOM   3978  C C    . TRP A 1 268 ? 32.422  124.341 93.465  1.00 26.14  ? 334  TRP A C    1 
ATOM   3979  O O    . TRP A 1 268 ? 31.539  123.633 92.986  1.00 49.56  ? 334  TRP A O    1 
ATOM   3980  C CB   . TRP A 1 268 ? 31.984  125.993 95.235  1.00 23.37  ? 334  TRP A CB   1 
ATOM   3981  C CG   . TRP A 1 268 ? 31.988  126.327 96.681  1.00 25.88  ? 334  TRP A CG   1 
ATOM   3982  C CD1  . TRP A 1 268 ? 31.930  125.456 97.719  1.00 37.63  ? 334  TRP A CD1  1 
ATOM   3983  C CD2  . TRP A 1 268 ? 32.063  127.631 97.255  1.00 33.82  ? 334  TRP A CD2  1 
ATOM   3984  N NE1  . TRP A 1 268 ? 31.966  126.132 98.914  1.00 41.87  ? 334  TRP A NE1  1 
ATOM   3985  C CE2  . TRP A 1 268 ? 32.048  127.475 98.655  1.00 41.71  ? 334  TRP A CE2  1 
ATOM   3986  C CE3  . TRP A 1 268 ? 32.153  128.921 96.722  1.00 26.97  ? 334  TRP A CE3  1 
ATOM   3987  C CZ2  . TRP A 1 268 ? 32.111  128.552 99.530  1.00 34.43  ? 334  TRP A CZ2  1 
ATOM   3988  C CZ3  . TRP A 1 268 ? 32.222  129.987 97.587  1.00 38.55  ? 334  TRP A CZ3  1 
ATOM   3989  C CH2  . TRP A 1 268 ? 32.196  129.798 98.978  1.00 32.25  ? 334  TRP A CH2  1 
ATOM   3990  H H    . TRP A 1 268 ? 34.193  125.179 95.713  1.00 55.88  ? 334  TRP A H    1 
ATOM   3991  H HA   . TRP A 1 268 ? 31.921  123.956 95.400  1.00 24.54  ? 334  TRP A HA   1 
ATOM   3992  H HB2  . TRP A 1 268 ? 32.553  126.633 94.780  1.00 28.04  ? 334  TRP A HB2  1 
ATOM   3993  H HB3  . TRP A 1 268 ? 31.073  126.072 94.914  1.00 28.04  ? 334  TRP A HB3  1 
ATOM   3994  H HD1  . TRP A 1 268 ? 31.872  124.531 97.634  1.00 45.16  ? 334  TRP A HD1  1 
ATOM   3995  H HE1  . TRP A 1 268 ? 31.935  125.773 99.695  1.00 50.25  ? 334  TRP A HE1  1 
ATOM   3996  H HE3  . TRP A 1 268 ? 32.171  129.054 95.801  1.00 32.36  ? 334  TRP A HE3  1 
ATOM   3997  H HZ2  . TRP A 1 268 ? 32.098  128.430 100.452 1.00 41.31  ? 334  TRP A HZ2  1 
ATOM   3998  H HZ3  . TRP A 1 268 ? 32.275  130.850 97.244  1.00 46.26  ? 334  TRP A HZ3  1 
ATOM   3999  H HH2  . TRP A 1 268 ? 32.239  130.540 99.537  1.00 38.70  ? 334  TRP A HH2  1 
ATOM   4000  N N    . THR A 1 269 ? 33.377  124.894 92.735  1.00 38.36  ? 335  THR A N    1 
ATOM   4001  C CA   . THR A 1 269 ? 33.317  124.851 91.274  1.00 47.54  ? 335  THR A CA   1 
ATOM   4002  C C    . THR A 1 269 ? 33.546  123.434 90.712  1.00 34.91  ? 335  THR A C    1 
ATOM   4003  O O    . THR A 1 269 ? 33.167  123.149 89.585  1.00 31.22  ? 335  THR A O    1 
ATOM   4004  C CB   . THR A 1 269 ? 34.268  125.896 90.616  1.00 41.91  ? 335  THR A CB   1 
ATOM   4005  O OG1  . THR A 1 269 ? 34.132  127.163 91.276  1.00 49.69  ? 335  THR A OG1  1 
ATOM   4006  C CG2  . THR A 1 269 ? 33.909  126.066 89.166  1.00 23.35  ? 335  THR A CG2  1 
ATOM   4007  H H    . THR A 1 269 ? 34.066  125.297 93.053  1.00 46.03  ? 335  THR A H    1 
ATOM   4008  H HA   . THR A 1 269 ? 32.417  125.102 91.016  1.00 57.05  ? 335  THR A HA   1 
ATOM   4009  H HB   . THR A 1 269 ? 35.186  125.590 90.677  1.00 50.29  ? 335  THR A HB   1 
ATOM   4010  H HG1  . THR A 1 269 ? 34.331  127.087 92.089  1.00 59.63  ? 335  THR A HG1  1 
ATOM   4011  H HG21 . THR A 1 269 ? 34.499  126.717 88.753  1.00 28.02  ? 335  THR A HG21 1 
ATOM   4012  H HG22 . THR A 1 269 ? 33.999  125.220 88.701  1.00 28.02  ? 335  THR A HG22 1 
ATOM   4013  H HG23 . THR A 1 269 ? 32.993  126.375 89.085  1.00 28.02  ? 335  THR A HG23 1 
ATOM   4014  N N    . MET A 1 270 ? 34.126  122.539 91.503  1.00 28.45  ? 336  MET A N    1 
ATOM   4015  C CA   . MET A 1 270 ? 34.223  121.133 91.108  1.00 31.32  ? 336  MET A CA   1 
ATOM   4016  C C    . MET A 1 270 ? 32.838  120.508 90.871  1.00 44.75  ? 336  MET A C    1 
ATOM   4017  O O    . MET A 1 270 ? 32.700  119.467 90.219  1.00 34.16  ? 336  MET A O    1 
ATOM   4018  C CB   . MET A 1 270 ? 34.910  120.334 92.204  1.00 30.97  ? 336  MET A CB   1 
ATOM   4019  C CG   . MET A 1 270 ? 36.428  120.344 92.157  1.00 33.20  ? 336  MET A CG   1 
ATOM   4020  S SD   . MET A 1 270 ? 37.185  119.298 93.443  1.00 69.68  ? 336  MET A SD   1 
ATOM   4021  C CE   . MET A 1 270 ? 35.876  119.037 94.618  1.00 37.41  ? 336  MET A CE   1 
ATOM   4022  H H    . MET A 1 270 ? 34.471  122.715 92.270  1.00 34.15  ? 336  MET A H    1 
ATOM   4023  H HA   . MET A 1 270 ? 34.753  121.061 90.298  1.00 37.59  ? 336  MET A HA   1 
ATOM   4024  H HB2  . MET A 1 270 ? 34.643  120.697 93.063  1.00 37.16  ? 336  MET A HB2  1 
ATOM   4025  H HB3  . MET A 1 270 ? 34.623  119.410 92.138  1.00 37.16  ? 336  MET A HB3  1 
ATOM   4026  H HG2  . MET A 1 270 ? 36.719  120.014 91.292  1.00 39.84  ? 336  MET A HG2  1 
ATOM   4027  H HG3  . MET A 1 270 ? 36.742  121.253 92.287  1.00 39.84  ? 336  MET A HG3  1 
ATOM   4028  H HE1  . MET A 1 270 ? 36.208  118.481 95.341  1.00 44.90  ? 336  MET A HE1  1 
ATOM   4029  H HE2  . MET A 1 270 ? 35.589  119.896 94.966  1.00 44.90  ? 336  MET A HE2  1 
ATOM   4030  H HE3  . MET A 1 270 ? 35.136  118.595 94.174  1.00 44.90  ? 336  MET A HE3  1 
ATOM   4031  N N    . HIS A 1 271 ? 31.813  121.139 91.435  1.00 40.79  ? 337  HIS A N    1 
ATOM   4032  C CA   . HIS A 1 271 ? 30.458  120.650 91.323  1.00 26.04  ? 337  HIS A CA   1 
ATOM   4033  C C    . HIS A 1 271 ? 29.694  121.364 90.203  1.00 29.36  ? 337  HIS A C    1 
ATOM   4034  O O    . HIS A 1 271 ? 28.506  121.129 90.010  1.00 47.25  ? 337  HIS A O    1 
ATOM   4035  C CB   . HIS A 1 271 ? 29.756  120.841 92.653  1.00 31.35  ? 337  HIS A CB   1 
ATOM   4036  C CG   . HIS A 1 271 ? 30.386  120.091 93.779  1.00 32.09  ? 337  HIS A CG   1 
ATOM   4037  N ND1  . HIS A 1 271 ? 31.515  120.536 94.427  1.00 40.57  ? 337  HIS A ND1  1 
ATOM   4038  C CD2  . HIS A 1 271 ? 30.040  118.931 94.384  1.00 33.37  ? 337  HIS A CD2  1 
ATOM   4039  C CE1  . HIS A 1 271 ? 31.846  119.680 95.376  1.00 33.67  ? 337  HIS A CE1  1 
ATOM   4040  N NE2  . HIS A 1 271 ? 30.964  118.697 95.373  1.00 47.07  ? 337  HIS A NE2  1 
ATOM   4041  H H    . HIS A 1 271 ? 31.884  121.863 91.894  1.00 48.94  ? 337  HIS A H    1 
ATOM   4042  H HA   . HIS A 1 271 ? 30.476  119.701 91.121  1.00 31.24  ? 337  HIS A HA   1 
ATOM   4043  H HB2  . HIS A 1 271 ? 29.769  121.784 92.881  1.00 37.62  ? 337  HIS A HB2  1 
ATOM   4044  H HB3  . HIS A 1 271 ? 28.839  120.536 92.569  1.00 37.62  ? 337  HIS A HB3  1 
ATOM   4045  H HD1  . HIS A 1 271 ? 31.944  121.257 94.238  1.00 48.69  ? 337  HIS A HD1  1 
ATOM   4046  H HD2  . HIS A 1 271 ? 29.314  118.391 94.169  1.00 40.05  ? 337  HIS A HD2  1 
ATOM   4047  H HE1  . HIS A 1 271 ? 32.572  119.758 95.952  1.00 40.41  ? 337  HIS A HE1  1 
ATOM   4048  H HE2  . HIS A 1 271 ? 30.968  118.020 95.903  1.00 56.49  ? 337  HIS A HE2  1 
ATOM   4049  N N    . ASP A 1 272 ? 30.382  122.238 89.481  1.00 26.53  ? 338  ASP A N    1 
ATOM   4050  C CA   . ASP A 1 272 ? 29.804  122.981 88.378  1.00 24.86  ? 338  ASP A CA   1 
ATOM   4051  C C    . ASP A 1 272 ? 29.251  122.013 87.356  1.00 24.78  ? 338  ASP A C    1 
ATOM   4052  O O    . ASP A 1 272 ? 29.805  120.945 87.137  1.00 37.35  ? 338  ASP A O    1 
ATOM   4053  C CB   . ASP A 1 272 ? 30.872  123.875 87.723  1.00 26.32  ? 338  ASP A CB   1 
ATOM   4054  C CG   . ASP A 1 272 ? 30.275  124.989 86.852  1.00 48.27  ? 338  ASP A CG   1 
ATOM   4055  O OD1  . ASP A 1 272 ? 29.908  126.069 87.404  1.00 47.83  ? 338  ASP A OD1  1 
ATOM   4056  O OD2  . ASP A 1 272 ? 30.184  124.785 85.614  1.00 45.25  ? 338  ASP A OD2  1 
ATOM   4057  H H    . ASP A 1 272 ? 31.211  122.421 89.618  1.00 31.83  ? 338  ASP A H    1 
ATOM   4058  H HA   . ASP A 1 272 ? 29.081  123.542 88.701  1.00 29.83  ? 338  ASP A HA   1 
ATOM   4059  H HB2  . ASP A 1 272 ? 31.404  124.292 88.419  1.00 31.59  ? 338  ASP A HB2  1 
ATOM   4060  H HB3  . ASP A 1 272 ? 31.439  123.326 87.158  1.00 31.59  ? 338  ASP A HB3  1 
ATOM   4061  N N    . LYS A 1 273 ? 28.165  122.405 86.713  1.00 26.62  ? 339  LYS A N    1 
ATOM   4062  C CA   . LYS A 1 273 ? 27.472  121.539 85.788  1.00 20.02  ? 339  LYS A CA   1 
ATOM   4063  C C    . LYS A 1 273 ? 28.147  121.448 84.409  1.00 25.83  ? 339  LYS A C    1 
ATOM   4064  O O    . LYS A 1 273 ? 27.683  120.700 83.563  1.00 42.52  ? 339  LYS A O    1 
ATOM   4065  C CB   . LYS A 1 273 ? 26.034  122.051 85.637  1.00 27.11  ? 339  LYS A CB   1 
ATOM   4066  C CG   . LYS A 1 273 ? 24.932  121.286 86.383  1.00 29.06  ? 339  LYS A CG   1 
ATOM   4067  C CD   . LYS A 1 273 ? 25.283  120.827 87.785  1.00 20.46  ? 339  LYS A CD   1 
ATOM   4068  C CE   . LYS A 1 273 ? 24.252  119.811 88.263  1.00 44.74  ? 339  LYS A CE   1 
ATOM   4069  N NZ   . LYS A 1 273 ? 24.681  119.008 89.459  1.00 36.17  ? 339  LYS A NZ   1 
ATOM   4070  H H    . LYS A 1 273 ? 27.805  123.181 86.799  1.00 31.95  ? 339  LYS A H    1 
ATOM   4071  H HA   . LYS A 1 273 ? 27.434  120.645 86.162  1.00 24.02  ? 339  LYS A HA   1 
ATOM   4072  H HB2  . LYS A 1 273 ? 26.007  122.968 85.952  1.00 32.53  ? 339  LYS A HB2  1 
ATOM   4073  H HB3  . LYS A 1 273 ? 25.806  122.032 84.695  1.00 32.53  ? 339  LYS A HB3  1 
ATOM   4074  H HG2  . LYS A 1 273 ? 24.154  121.861 86.452  1.00 34.88  ? 339  LYS A HG2  1 
ATOM   4075  H HG3  . LYS A 1 273 ? 24.705  120.496 85.868  1.00 34.88  ? 339  LYS A HG3  1 
ATOM   4076  H HD2  . LYS A 1 273 ? 26.156  120.405 87.781  1.00 24.55  ? 339  LYS A HD2  1 
ATOM   4077  H HD3  . LYS A 1 273 ? 25.273  121.586 88.389  1.00 24.55  ? 339  LYS A HD3  1 
ATOM   4078  H HE2  . LYS A 1 273 ? 23.438  120.282 88.501  1.00 53.69  ? 339  LYS A HE2  1 
ATOM   4079  H HE3  . LYS A 1 273 ? 24.071  119.189 87.541  1.00 53.69  ? 339  LYS A HE3  1 
ATOM   4080  H HZ1  . LYS A 1 273 ? 24.038  118.436 89.687  1.00 43.40  ? 339  LYS A HZ1  1 
ATOM   4081  H HZ2  . LYS A 1 273 ? 25.421  118.552 89.269  1.00 43.40  ? 339  LYS A HZ2  1 
ATOM   4082  H HZ3  . LYS A 1 273 ? 24.843  119.550 90.146  1.00 43.40  ? 339  LYS A HZ3  1 
ATOM   4083  N N    . GLN A 1 274 ? 29.216  122.202 84.167  1.00 35.80  ? 340  GLN A N    1 
ATOM   4084  C CA   . GLN A 1 274 ? 29.925  122.162 82.864  1.00 38.57  ? 340  GLN A CA   1 
ATOM   4085  C C    . GLN A 1 274 ? 31.332  121.543 82.929  1.00 35.92  ? 340  GLN A C    1 
ATOM   4086  O O    . GLN A 1 274 ? 32.150  121.886 83.783  1.00 44.35  ? 340  GLN A O    1 
ATOM   4087  C CB   . GLN A 1 274 ? 30.048  123.562 82.271  1.00 36.89  ? 340  GLN A CB   1 
ATOM   4088  C CG   . GLN A 1 274 ? 28.750  124.149 81.820  1.00 41.76  ? 340  GLN A CG   1 
ATOM   4089  C CD   . GLN A 1 274 ? 28.123  123.355 80.713  1.00 45.36  ? 340  GLN A CD   1 
ATOM   4090  O OE1  . GLN A 1 274 ? 28.727  123.153 79.664  1.00 68.59  ? 340  GLN A OE1  1 
ATOM   4091  N NE2  . GLN A 1 274 ? 26.907  122.880 80.941  1.00 59.63  ? 340  GLN A NE2  1 
ATOM   4092  H H    . GLN A 1 274 ? 29.560  122.750 84.734  1.00 42.96  ? 340  GLN A H    1 
ATOM   4093  H HA   . GLN A 1 274 ? 29.400  121.628 82.247  1.00 46.28  ? 340  GLN A HA   1 
ATOM   4094  H HB2  . GLN A 1 274 ? 30.423  124.154 82.942  1.00 44.26  ? 340  GLN A HB2  1 
ATOM   4095  H HB3  . GLN A 1 274 ? 30.638  123.524 81.501  1.00 44.26  ? 340  GLN A HB3  1 
ATOM   4096  H HG2  . GLN A 1 274 ? 28.132  124.165 82.568  1.00 50.11  ? 340  GLN A HG2  1 
ATOM   4097  H HG3  . GLN A 1 274 ? 28.904  125.050 81.496  1.00 50.11  ? 340  GLN A HG3  1 
ATOM   4098  H HE21 . GLN A 1 274 ? 26.519  123.033 81.694  1.00 71.56  ? 340  GLN A HE21 1 
ATOM   4099  H HE22 . GLN A 1 274 ? 26.505  122.419 80.337  1.00 71.56  ? 340  GLN A HE22 1 
ATOM   4100  N N    . GLY A 1 275 ? 31.617  120.650 81.993  1.00 45.36  ? 341  GLY A N    1 
ATOM   4101  C CA   . GLY A 1 275 ? 32.869  119.911 81.990  1.00 34.51  ? 341  GLY A CA   1 
ATOM   4102  C C    . GLY A 1 275 ? 34.100  120.790 81.869  1.00 40.09  ? 341  GLY A C    1 
ATOM   4103  O O    . GLY A 1 275 ? 35.124  120.551 82.509  1.00 33.44  ? 341  GLY A O    1 
ATOM   4104  H H    . GLY A 1 275 ? 31.094  120.451 81.340  1.00 54.43  ? 341  GLY A H    1 
ATOM   4105  H HA2  . GLY A 1 275 ? 32.940  119.402 82.813  1.00 41.41  ? 341  GLY A HA2  1 
ATOM   4106  H HA3  . GLY A 1 275 ? 32.868  119.287 81.247  1.00 41.41  ? 341  GLY A HA3  1 
ATOM   4107  N N    . GLU A 1 276 ? 33.992  121.812 81.027  1.00 45.51  ? 342  GLU A N    1 
ATOM   4108  C CA   . GLU A 1 276 ? 35.072  122.756 80.819  1.00 33.20  ? 342  GLU A CA   1 
ATOM   4109  C C    . GLU A 1 276 ? 35.447  123.360 82.152  1.00 28.62  ? 342  GLU A C    1 
ATOM   4110  O O    . GLU A 1 276 ? 36.614  123.400 82.508  1.00 38.19  ? 342  GLU A O    1 
ATOM   4111  C CB   . GLU A 1 276 ? 34.629  123.843 79.849  1.00 54.78  ? 342  GLU A CB   1 
ATOM   4112  C CG   . GLU A 1 276 ? 35.751  124.730 79.310  1.00 84.24  ? 342  GLU A CG   1 
ATOM   4113  C CD   . GLU A 1 276 ? 35.226  125.880 78.424  1.00 97.64  ? 342  GLU A CD   1 
ATOM   4114  O OE1  . GLU A 1 276 ? 33.988  126.101 78.401  1.00 91.59  ? 342  GLU A OE1  1 
ATOM   4115  O OE2  . GLU A 1 276 ? 36.047  126.548 77.743  1.00 95.04  ? 342  GLU A OE2  1 
ATOM   4116  H H    . GLU A 1 276 ? 33.291  121.978 80.559  1.00 54.61  ? 342  GLU A H    1 
ATOM   4117  H HA   . GLU A 1 276 ? 35.845  122.300 80.450  1.00 39.83  ? 342  GLU A HA   1 
ATOM   4118  H HB2  . GLU A 1 276 ? 34.200  123.421 79.088  1.00 65.74  ? 342  GLU A HB2  1 
ATOM   4119  H HB3  . GLU A 1 276 ? 33.993  124.419 80.301  1.00 65.74  ? 342  GLU A HB3  1 
ATOM   4120  H HG2  . GLU A 1 276 ? 36.231  125.122 80.057  1.00 101.09 ? 342  GLU A HG2  1 
ATOM   4121  H HG3  . GLU A 1 276 ? 36.353  124.190 78.775  1.00 101.09 ? 342  GLU A HG3  1 
ATOM   4122  N N    . VAL A 1 277 ? 34.456  123.803 82.914  1.00 37.37  ? 343  VAL A N    1 
ATOM   4123  C CA   . VAL A 1 277 ? 34.745  124.412 84.208  1.00 37.75  ? 343  VAL A CA   1 
ATOM   4124  C C    . VAL A 1 277 ? 35.301  123.368 85.179  1.00 35.13  ? 343  VAL A C    1 
ATOM   4125  O O    . VAL A 1 277 ? 36.163  123.663 85.983  1.00 51.87  ? 343  VAL A O    1 
ATOM   4126  C CB   . VAL A 1 277 ? 33.501  125.117 84.816  1.00 36.34  ? 343  VAL A CB   1 
ATOM   4127  C CG1  . VAL A 1 277 ? 33.866  125.879 86.083  1.00 19.81  ? 343  VAL A CG1  1 
ATOM   4128  C CG2  . VAL A 1 277 ? 32.878  126.056 83.800  1.00 38.17  ? 343  VAL A CG2  1 
ATOM   4129  H H    . VAL A 1 277 ? 33.621  123.765 82.711  1.00 44.84  ? 343  VAL A H    1 
ATOM   4130  H HA   . VAL A 1 277 ? 35.430  125.088 84.083  1.00 45.30  ? 343  VAL A HA   1 
ATOM   4131  H HB   . VAL A 1 277 ? 32.840  124.446 85.050  1.00 43.60  ? 343  VAL A HB   1 
ATOM   4132  H HG11 . VAL A 1 277 ? 33.069  126.305 86.436  1.00 23.78  ? 343  VAL A HG11 1 
ATOM   4133  H HG12 . VAL A 1 277 ? 34.224  125.255 86.735  1.00 23.78  ? 343  VAL A HG12 1 
ATOM   4134  H HG13 . VAL A 1 277 ? 34.532  126.550 85.867  1.00 23.78  ? 343  VAL A HG13 1 
ATOM   4135  H HG21 . VAL A 1 277 ? 32.104  126.484 84.198  1.00 45.81  ? 343  VAL A HG21 1 
ATOM   4136  H HG22 . VAL A 1 277 ? 33.533  126.724 83.545  1.00 45.81  ? 343  VAL A HG22 1 
ATOM   4137  H HG23 . VAL A 1 277 ? 32.608  125.543 83.021  1.00 45.81  ? 343  VAL A HG23 1 
ATOM   4138  N N    . ARG A 1 278 ? 34.827  122.136 85.085  1.00 42.35  ? 344  ARG A N    1 
ATOM   4139  C CA   . ARG A 1 278 ? 35.226  121.119 86.050  1.00 36.92  ? 344  ARG A CA   1 
ATOM   4140  C C    . ARG A 1 278 ? 36.679  120.715 85.878  1.00 29.10  ? 344  ARG A C    1 
ATOM   4141  O O    . ARG A 1 278 ? 37.363  120.435 86.853  1.00 30.55  ? 344  ARG A O    1 
ATOM   4142  C CB   . ARG A 1 278 ? 34.298  119.891 85.981  1.00 34.08  ? 344  ARG A CB   1 
ATOM   4143  C CG   . ARG A 1 278 ? 33.058  120.064 86.829  1.00 28.58  ? 344  ARG A CG   1 
ATOM   4144  C CD   . ARG A 1 278 ? 32.271  118.794 87.015  1.00 41.25  ? 344  ARG A CD   1 
ATOM   4145  N NE   . ARG A 1 278 ? 32.178  117.977 85.810  1.00 50.43  ? 344  ARG A NE   1 
ATOM   4146  C CZ   . ARG A 1 278 ? 31.253  118.112 84.866  1.00 37.04  ? 344  ARG A CZ   1 
ATOM   4147  N NH1  . ARG A 1 278 ? 30.311  119.040 84.965  1.00 45.73  ? 344  ARG A NH1  1 
ATOM   4148  N NH2  . ARG A 1 278 ? 31.271  117.303 83.820  1.00 27.96  ? 344  ARG A NH2  1 
ATOM   4149  H H    . ARG A 1 278 ? 34.278  121.863 84.482  1.00 50.82  ? 344  ARG A H    1 
ATOM   4150  H HA   . ARG A 1 278 ? 35.138  121.495 86.940  1.00 44.31  ? 344  ARG A HA   1 
ATOM   4151  H HB2  . ARG A 1 278 ? 34.018  119.756 85.062  1.00 40.90  ? 344  ARG A HB2  1 
ATOM   4152  H HB3  . ARG A 1 278 ? 34.777  119.112 86.303  1.00 40.90  ? 344  ARG A HB3  1 
ATOM   4153  H HG2  . ARG A 1 278 ? 33.322  120.381 87.707  1.00 34.30  ? 344  ARG A HG2  1 
ATOM   4154  H HG3  . ARG A 1 278 ? 32.477  120.715 86.405  1.00 34.30  ? 344  ARG A HG3  1 
ATOM   4155  H HD2  . ARG A 1 278 ? 32.698  118.259 87.703  1.00 49.50  ? 344  ARG A HD2  1 
ATOM   4156  H HD3  . ARG A 1 278 ? 31.369  119.022 87.288  1.00 49.50  ? 344  ARG A HD3  1 
ATOM   4157  H HE   . ARG A 1 278 ? 32.767  117.360 85.702  1.00 60.52  ? 344  ARG A HE   1 
ATOM   4158  H HH11 . ARG A 1 278 ? 30.295  119.566 85.645  1.00 54.87  ? 344  ARG A HH11 1 
ATOM   4159  H HH12 . ARG A 1 278 ? 29.717  119.117 84.347  1.00 54.87  ? 344  ARG A HH12 1 
ATOM   4160  H HH21 . ARG A 1 278 ? 31.881  116.700 83.753  1.00 33.56  ? 344  ARG A HH21 1 
ATOM   4161  H HH22 . ARG A 1 278 ? 30.677  117.384 83.204  1.00 33.56  ? 344  ARG A HH22 1 
ATOM   4162  N N    . LEU A 1 279 ? 37.136  120.697 84.632  1.00 30.81  ? 345  LEU A N    1 
ATOM   4163  C CA   . LEU A 1 279 ? 38.536  120.422 84.297  1.00 28.78  ? 345  LEU A CA   1 
ATOM   4164  C C    . LEU A 1 279 ? 39.476  121.439 84.929  1.00 44.03  ? 345  LEU A C    1 
ATOM   4165  O O    . LEU A 1 279 ? 40.454  121.082 85.596  1.00 45.12  ? 345  LEU A O    1 
ATOM   4166  C CB   . LEU A 1 279 ? 38.703  120.496 82.794  1.00 37.07  ? 345  LEU A CB   1 
ATOM   4167  C CG   . LEU A 1 279 ? 39.885  119.790 82.155  1.00 32.04  ? 345  LEU A CG   1 
ATOM   4168  C CD1  . LEU A 1 279 ? 39.881  118.319 82.473  1.00 39.90  ? 345  LEU A CD1  1 
ATOM   4169  C CD2  . LEU A 1 279 ? 39.813  119.989 80.660  1.00 35.13  ? 345  LEU A CD2  1 
ATOM   4170  H H    . LEU A 1 279 ? 36.643  120.845 83.943  1.00 36.97  ? 345  LEU A H    1 
ATOM   4171  H HA   . LEU A 1 279 ? 38.781  119.533 84.599  1.00 34.54  ? 345  LEU A HA   1 
ATOM   4172  H HB2  . LEU A 1 279 ? 37.904  120.124 82.390  1.00 44.48  ? 345  LEU A HB2  1 
ATOM   4173  H HB3  . LEU A 1 279 ? 38.772  121.432 82.551  1.00 44.48  ? 345  LEU A HB3  1 
ATOM   4174  H HG   . LEU A 1 279 ? 40.713  120.177 82.481  1.00 38.45  ? 345  LEU A HG   1 
ATOM   4175  H HD11 . LEU A 1 279 ? 40.648  117.903 82.050  1.00 47.88  ? 345  LEU A HD11 1 
ATOM   4176  H HD12 . LEU A 1 279 ? 39.931  118.205 83.435  1.00 47.88  ? 345  LEU A HD12 1 
ATOM   4177  H HD13 . LEU A 1 279 ? 39.062  117.926 82.135  1.00 47.88  ? 345  LEU A HD13 1 
ATOM   4178  H HD21 . LEU A 1 279 ? 40.566  119.540 80.246  1.00 42.15  ? 345  LEU A HD21 1 
ATOM   4179  H HD22 . LEU A 1 279 ? 38.981  119.612 80.332  1.00 42.15  ? 345  LEU A HD22 1 
ATOM   4180  H HD23 . LEU A 1 279 ? 39.846  120.938 80.466  1.00 42.15  ? 345  LEU A HD23 1 
ATOM   4181  N N    . LYS A 1 280 ? 39.177  122.714 84.711  1.00 35.75  ? 346  LYS A N    1 
ATOM   4182  C CA   . LYS A 1 280 ? 39.948  123.771 85.309  1.00 26.18  ? 346  LYS A CA   1 
ATOM   4183  C C    . LYS A 1 280 ? 40.072  123.638 86.815  1.00 35.76  ? 346  LYS A C    1 
ATOM   4184  O O    . LYS A 1 280 ? 41.100  124.003 87.369  1.00 51.75  ? 346  LYS A O    1 
ATOM   4185  C CB   . LYS A 1 280 ? 39.370  125.138 84.959  1.00 38.82  ? 346  LYS A CB   1 
ATOM   4186  C CG   . LYS A 1 280 ? 39.665  125.633 83.529  1.00 26.44  ? 346  LYS A CG   1 
ATOM   4187  C CD   . LYS A 1 280 ? 40.811  124.875 82.860  1.00 44.00  ? 346  LYS A CD   1 
ATOM   4188  C CE   . LYS A 1 280 ? 41.375  125.651 81.700  1.00 52.63  ? 346  LYS A CE   1 
ATOM   4189  N NZ   . LYS A 1 280 ? 40.325  126.303 80.859  1.00 58.70  ? 346  LYS A NZ   1 
ATOM   4190  H H    . LYS A 1 280 ? 38.527  122.986 84.218  1.00 42.90  ? 346  LYS A H    1 
ATOM   4191  H HA   . LYS A 1 280 ? 40.846  123.736 84.943  1.00 31.41  ? 346  LYS A HA   1 
ATOM   4192  H HB2  . LYS A 1 280 ? 38.406  125.098 85.060  1.00 46.58  ? 346  LYS A HB2  1 
ATOM   4193  H HB3  . LYS A 1 280 ? 39.734  125.793 85.574  1.00 46.58  ? 346  LYS A HB3  1 
ATOM   4194  H HG2  . LYS A 1 280 ? 38.871  125.515 82.984  1.00 31.73  ? 346  LYS A HG2  1 
ATOM   4195  H HG3  . LYS A 1 280 ? 39.907  126.571 83.564  1.00 31.73  ? 346  LYS A HG3  1 
ATOM   4196  H HD2  . LYS A 1 280 ? 41.521  124.732 83.505  1.00 52.79  ? 346  LYS A HD2  1 
ATOM   4197  H HD3  . LYS A 1 280 ? 40.483  124.025 82.527  1.00 52.79  ? 346  LYS A HD3  1 
ATOM   4198  H HE2  . LYS A 1 280 ? 41.959  126.346 82.041  1.00 63.16  ? 346  LYS A HE2  1 
ATOM   4199  H HE3  . LYS A 1 280 ? 41.879  125.046 81.133  1.00 63.16  ? 346  LYS A HE3  1 
ATOM   4200  H HZ1  . LYS A 1 280 ? 40.706  126.748 80.189  1.00 70.44  ? 346  LYS A HZ1  1 
ATOM   4201  H HZ2  . LYS A 1 280 ? 39.778  125.687 80.524  1.00 70.44  ? 346  LYS A HZ2  1 
ATOM   4202  H HZ3  . LYS A 1 280 ? 39.852  126.873 81.352  1.00 70.44  ? 346  LYS A HZ3  1 
ATOM   4203  N N    . CYS A 1 281 ? 39.075  123.117 87.505  1.00 18.92  ? 347  CYS A N    1 
ATOM   4204  C CA   . CYS A 1 281 ? 39.279  122.927 88.939  1.00 47.48  ? 347  CYS A CA   1 
ATOM   4205  C C    . CYS A 1 281 ? 40.332  121.861 89.180  1.00 42.18  ? 347  CYS A C    1 
ATOM   4206  O O    . CYS A 1 281 ? 41.099  121.947 90.138  1.00 62.28  ? 347  CYS A O    1 
ATOM   4207  C CB   . CYS A 1 281 ? 37.992  122.571 89.680  1.00 33.07  ? 347  CYS A CB   1 
ATOM   4208  S SG   . CYS A 1 281 ? 36.717  123.734 89.291  1.00 63.50  ? 347  CYS A SG   1 
ATOM   4209  H H    . CYS A 1 281 ? 38.310  122.876 87.196  1.00 22.70  ? 347  CYS A H    1 
ATOM   4210  H HA   . CYS A 1 281 ? 39.612  123.757 89.315  1.00 56.97  ? 347  CYS A HA   1 
ATOM   4211  H HB2  . CYS A 1 281 ? 37.696  121.688 89.409  1.00 39.69  ? 347  CYS A HB2  1 
ATOM   4212  H HB3  . CYS A 1 281 ? 38.151  122.597 90.636  1.00 39.69  ? 347  CYS A HB3  1 
ATOM   4213  H HG   . CYS A 1 281 ? 36.513  123.709 88.109  1.00 76.20  ? 347  CYS A HG   1 
ATOM   4214  N N    . LEU A 1 282 ? 40.390  120.859 88.315  1.00 31.73  ? 348  LEU A N    1 
ATOM   4215  C CA   . LEU A 1 282 ? 41.356  119.791 88.531  1.00 39.32  ? 348  LEU A CA   1 
ATOM   4216  C C    . LEU A 1 282 ? 42.768  120.233 88.089  1.00 44.52  ? 348  LEU A C    1 
ATOM   4217  O O    . LEU A 1 282 ? 43.755  119.988 88.786  1.00 40.39  ? 348  LEU A O    1 
ATOM   4218  C CB   . LEU A 1 282 ? 40.903  118.493 87.859  1.00 18.32  ? 348  LEU A CB   1 
ATOM   4219  C CG   . LEU A 1 282 ? 39.607  117.938 88.451  1.00 27.09  ? 348  LEU A CG   1 
ATOM   4220  C CD1  . LEU A 1 282 ? 39.204  116.664 87.770  1.00 23.54  ? 348  LEU A CD1  1 
ATOM   4221  C CD2  . LEU A 1 282 ? 39.708  117.692 89.944  1.00 19.20  ? 348  LEU A CD2  1 
ATOM   4222  H H    . LEU A 1 282 ? 39.898  120.774 87.615  1.00 38.08  ? 348  LEU A H    1 
ATOM   4223  H HA   . LEU A 1 282 ? 41.400  119.615 89.484  1.00 47.19  ? 348  LEU A HA   1 
ATOM   4224  H HB2  . LEU A 1 282 ? 40.753  118.661 86.915  1.00 21.98  ? 348  LEU A HB2  1 
ATOM   4225  H HB3  . LEU A 1 282 ? 41.594  117.821 87.969  1.00 21.98  ? 348  LEU A HB3  1 
ATOM   4226  H HG   . LEU A 1 282 ? 38.899  118.585 88.307  1.00 32.50  ? 348  LEU A HG   1 
ATOM   4227  H HD11 . LEU A 1 282 ? 38.381  116.340 88.169  1.00 28.25  ? 348  LEU A HD11 1 
ATOM   4228  H HD12 . LEU A 1 282 ? 39.068  116.840 86.826  1.00 28.25  ? 348  LEU A HD12 1 
ATOM   4229  H HD13 . LEU A 1 282 ? 39.909  116.007 87.886  1.00 28.25  ? 348  LEU A HD13 1 
ATOM   4230  H HD21 . LEU A 1 282 ? 38.862  117.343 90.264  1.00 23.04  ? 348  LEU A HD21 1 
ATOM   4231  H HD22 . LEU A 1 282 ? 40.416  117.050 90.111  1.00 23.04  ? 348  LEU A HD22 1 
ATOM   4232  H HD23 . LEU A 1 282 ? 39.909  118.531 90.389  1.00 23.04  ? 348  LEU A HD23 1 
ATOM   4233  N N    . THR A 1 283 ? 42.867  120.907 86.951  1.00 31.22  ? 349  THR A N    1 
ATOM   4234  C CA   . THR A 1 283 ? 44.144  121.444 86.531  1.00 29.53  ? 349  THR A CA   1 
ATOM   4235  C C    . THR A 1 283 ? 44.739  122.361 87.602  1.00 35.07  ? 349  THR A C    1 
ATOM   4236  O O    . THR A 1 283 ? 45.927  122.255 87.926  1.00 43.24  ? 349  THR A O    1 
ATOM   4237  C CB   . THR A 1 283 ? 43.992  122.189 85.237  1.00 36.99  ? 349  THR A CB   1 
ATOM   4238  O OG1  . THR A 1 283 ? 43.799  121.230 84.196  1.00 39.78  ? 349  THR A OG1  1 
ATOM   4239  C CG2  . THR A 1 283 ? 45.232  123.034 84.930  1.00 48.03  ? 349  THR A CG2  1 
ATOM   4240  H H    . THR A 1 283 ? 42.216  121.063 86.412  1.00 37.46  ? 349  THR A H    1 
ATOM   4241  H HA   . THR A 1 283 ? 44.763  120.712 86.386  1.00 35.43  ? 349  THR A HA   1 
ATOM   4242  H HB   . THR A 1 283 ? 43.222  122.776 85.287  1.00 44.38  ? 349  THR A HB   1 
ATOM   4243  H HG1  . THR A 1 283 ? 43.711  121.621 83.458  1.00 47.73  ? 349  THR A HG1  1 
ATOM   4244  H HG21 . THR A 1 283 ? 45.112  123.505 84.091  1.00 57.64  ? 349  THR A HG21 1 
ATOM   4245  H HG22 . THR A 1 283 ? 45.375  123.682 85.638  1.00 57.64  ? 349  THR A HG22 1 
ATOM   4246  H HG23 . THR A 1 283 ? 46.013  122.463 84.862  1.00 57.64  ? 349  THR A HG23 1 
ATOM   4247  N N    . ALA A 1 284 ? 43.916  123.251 88.151  1.00 41.01  ? 350  ALA A N    1 
ATOM   4248  C CA   . ALA A 1 284 ? 44.336  124.116 89.252  1.00 28.89  ? 350  ALA A CA   1 
ATOM   4249  C C    . ALA A 1 284 ? 44.931  123.323 90.419  1.00 27.60  ? 350  ALA A C    1 
ATOM   4250  O O    . ALA A 1 284 ? 46.005  123.654 90.907  1.00 56.55  ? 350  ALA A O    1 
ATOM   4251  C CB   . ALA A 1 284 ? 43.176  124.956 89.734  1.00 27.73  ? 350  ALA A CB   1 
ATOM   4252  H H    . ALA A 1 284 ? 43.102  123.375 87.901  1.00 49.22  ? 350  ALA A H    1 
ATOM   4253  H HA   . ALA A 1 284 ? 45.022  124.721 88.927  1.00 34.66  ? 350  ALA A HA   1 
ATOM   4254  H HB1  . ALA A 1 284 ? 43.477  125.521 90.463  1.00 33.28  ? 350  ALA A HB1  1 
ATOM   4255  H HB2  . ALA A 1 284 ? 42.857  125.504 89.000  1.00 33.28  ? 350  ALA A HB2  1 
ATOM   4256  H HB3  . ALA A 1 284 ? 42.468  124.368 90.041  1.00 33.28  ? 350  ALA A HB3  1 
ATOM   4257  N N    . LEU A 1 285 ? 44.247  122.279 90.865  1.00 22.51  ? 351  LEU A N    1 
ATOM   4258  C CA   . LEU A 1 285 ? 44.721  121.502 92.003  1.00 29.92  ? 351  LEU A CA   1 
ATOM   4259  C C    . LEU A 1 285 ? 46.002  120.750 91.691  1.00 41.52  ? 351  LEU A C    1 
ATOM   4260  O O    . LEU A 1 285 ? 46.928  120.712 92.508  1.00 55.23  ? 351  LEU A O    1 
ATOM   4261  C CB   . LEU A 1 285 ? 43.671  120.496 92.452  1.00 24.20  ? 351  LEU A CB   1 
ATOM   4262  C CG   . LEU A 1 285 ? 42.455  121.054 93.178  1.00 34.68  ? 351  LEU A CG   1 
ATOM   4263  C CD1  . LEU A 1 285 ? 41.491  119.919 93.494  1.00 32.92  ? 351  LEU A CD1  1 
ATOM   4264  C CD2  . LEU A 1 285 ? 42.852  121.796 94.445  1.00 27.02  ? 351  LEU A CD2  1 
ATOM   4265  H H    . LEU A 1 285 ? 43.507  122.000 90.528  1.00 27.01  ? 351  LEU A H    1 
ATOM   4266  H HA   . LEU A 1 285 ? 44.898  122.103 92.744  1.00 35.90  ? 351  LEU A HA   1 
ATOM   4267  H HB2  . LEU A 1 285 ? 43.346  120.028 91.667  1.00 29.04  ? 351  LEU A HB2  1 
ATOM   4268  H HB3  . LEU A 1 285 ? 44.096  119.861 93.050  1.00 29.04  ? 351  LEU A HB3  1 
ATOM   4269  H HG   . LEU A 1 285 ? 41.999  121.680 92.595  1.00 41.62  ? 351  LEU A HG   1 
ATOM   4270  H HD11 . LEU A 1 285 ? 40.719  120.281 93.956  1.00 39.51  ? 351  LEU A HD11 1 
ATOM   4271  H HD12 . LEU A 1 285 ? 41.214  119.501 92.663  1.00 39.51  ? 351  LEU A HD12 1 
ATOM   4272  H HD13 . LEU A 1 285 ? 41.941  119.270 94.057  1.00 39.51  ? 351  LEU A HD13 1 
ATOM   4273  H HD21 . LEU A 1 285 ? 42.051  122.134 94.876  1.00 32.42  ? 351  LEU A HD21 1 
ATOM   4274  H HD22 . LEU A 1 285 ? 43.313  121.183 95.038  1.00 32.42  ? 351  LEU A HD22 1 
ATOM   4275  H HD23 . LEU A 1 285 ? 43.437  122.533 94.208  1.00 32.42  ? 351  LEU A HD23 1 
ATOM   4276  N N    . GLN A 1 286 ? 46.049  120.130 90.519  1.00 40.94  ? 352  GLN A N    1 
ATOM   4277  C CA   . GLN A 1 286 ? 47.239  119.404 90.107  1.00 34.38  ? 352  GLN A CA   1 
ATOM   4278  C C    . GLN A 1 286 ? 48.456  120.297 90.294  1.00 34.13  ? 352  GLN A C    1 
ATOM   4279  O O    . GLN A 1 286 ? 49.483  119.863 90.813  1.00 35.00  ? 352  GLN A O    1 
ATOM   4280  C CB   . GLN A 1 286 ? 47.098  118.947 88.660  1.00 24.35  ? 352  GLN A CB   1 
ATOM   4281  C CG   . GLN A 1 286 ? 46.241  117.694 88.511  1.00 20.46  ? 352  GLN A CG   1 
ATOM   4282  C CD   . GLN A 1 286 ? 45.860  117.410 87.086  1.00 22.54  ? 352  GLN A CD   1 
ATOM   4283  O OE1  . GLN A 1 286 ? 46.196  118.161 86.180  1.00 47.83  ? 352  GLN A OE1  1 
ATOM   4284  N NE2  . GLN A 1 286 ? 45.143  116.328 86.875  1.00 42.68  ? 352  GLN A NE2  1 
ATOM   4285  H H    . GLN A 1 286 ? 45.408  120.116 89.946  1.00 49.13  ? 352  GLN A H    1 
ATOM   4286  H HA   . GLN A 1 286 ? 47.347  118.619 90.667  1.00 41.26  ? 352  GLN A HA   1 
ATOM   4287  H HB2  . GLN A 1 286 ? 46.683  119.656 88.144  1.00 29.22  ? 352  GLN A HB2  1 
ATOM   4288  H HB3  . GLN A 1 286 ? 47.978  118.750 88.304  1.00 29.22  ? 352  GLN A HB3  1 
ATOM   4289  H HG2  . GLN A 1 286 ? 46.737  116.931 88.847  1.00 24.55  ? 352  GLN A HG2  1 
ATOM   4290  H HG3  . GLN A 1 286 ? 45.424  117.808 89.022  1.00 24.55  ? 352  GLN A HG3  1 
ATOM   4291  H HE21 . GLN A 1 286 ? 44.916  115.826 87.535  1.00 51.22  ? 352  GLN A HE21 1 
ATOM   4292  H HE22 . GLN A 1 286 ? 44.900  116.122 86.076  1.00 51.22  ? 352  GLN A HE22 1 
ATOM   4293  N N    . GLY A 1 287 ? 48.298  121.563 89.925  1.00 32.84  ? 353  GLY A N    1 
ATOM   4294  C CA   . GLY A 1 287 ? 49.354  122.548 90.036  1.00 22.67  ? 353  GLY A CA   1 
ATOM   4295  C C    . GLY A 1 287 ? 49.887  122.785 91.433  1.00 30.33  ? 353  GLY A C    1 
ATOM   4296  O O    . GLY A 1 287 ? 50.946  123.370 91.570  1.00 40.95  ? 353  GLY A O    1 
ATOM   4297  H H    . GLY A 1 287 ? 47.567  121.879 89.600  1.00 39.40  ? 353  GLY A H    1 
ATOM   4298  H HA2  . GLY A 1 287 ? 50.098  122.271 89.479  1.00 27.21  ? 353  GLY A HA2  1 
ATOM   4299  H HA3  . GLY A 1 287 ? 49.027  123.395 89.696  1.00 27.21  ? 353  GLY A HA3  1 
ATOM   4300  N N    . LEU A 1 288 ? 49.165  122.354 92.462  1.00 27.90  ? 354  LEU A N    1 
ATOM   4301  C CA   . LEU A 1 288 ? 49.599  122.559 93.843  1.00 28.24  ? 354  LEU A CA   1 
ATOM   4302  C C    . LEU A 1 288 ? 50.241  121.320 94.445  1.00 36.43  ? 354  LEU A C    1 
ATOM   4303  O O    . LEU A 1 288 ? 50.539  121.288 95.626  1.00 42.64  ? 354  LEU A O    1 
ATOM   4304  C CB   . LEU A 1 288 ? 48.412  122.972 94.701  1.00 27.59  ? 354  LEU A CB   1 
ATOM   4305  C CG   . LEU A 1 288 ? 47.727  124.226 94.178  1.00 40.85  ? 354  LEU A CG   1 
ATOM   4306  C CD1  . LEU A 1 288 ? 46.569  124.628 95.080  1.00 40.78  ? 354  LEU A CD1  1 
ATOM   4307  C CD2  . LEU A 1 288 ? 48.733  125.377 94.039  1.00 46.21  ? 354  LEU A CD2  1 
ATOM   4308  H H    . LEU A 1 288 ? 48.417  121.936 92.388  1.00 33.48  ? 354  LEU A H    1 
ATOM   4309  H HA   . LEU A 1 288 ? 50.251  123.277 93.867  1.00 33.89  ? 354  LEU A HA   1 
ATOM   4310  H HB2  . LEU A 1 288 ? 47.760  122.254 94.707  1.00 33.11  ? 354  LEU A HB2  1 
ATOM   4311  H HB3  . LEU A 1 288 ? 48.720  123.151 95.603  1.00 33.11  ? 354  LEU A HB3  1 
ATOM   4312  H HG   . LEU A 1 288 ? 47.366  124.041 93.297  1.00 49.02  ? 354  LEU A HG   1 
ATOM   4313  H HD11 . LEU A 1 288 ? 46.153  125.428 94.722  1.00 48.93  ? 354  LEU A HD11 1 
ATOM   4314  H HD12 . LEU A 1 288 ? 45.924  123.904 95.107  1.00 48.93  ? 354  LEU A HD12 1 
ATOM   4315  H HD13 . LEU A 1 288 ? 46.909  124.802 95.971  1.00 48.93  ? 354  LEU A HD13 1 
ATOM   4316  H HD21 . LEU A 1 288 ? 48.270  126.161 93.705  1.00 55.45  ? 354  LEU A HD21 1 
ATOM   4317  H HD22 . LEU A 1 288 ? 49.119  125.565 94.908  1.00 55.45  ? 354  LEU A HD22 1 
ATOM   4318  H HD23 . LEU A 1 288 ? 49.429  125.113 93.417  1.00 55.45  ? 354  LEU A HD23 1 
ATOM   4319  N N    . TYR A 1 289 ? 50.420  120.293 93.628  1.00 48.81  ? 355  TYR A N    1 
ATOM   4320  C CA   . TYR A 1 289 ? 51.135  119.091 94.022  1.00 52.26  ? 355  TYR A CA   1 
ATOM   4321  C C    . TYR A 1 289 ? 52.369  118.950 93.135  1.00 62.08  ? 355  TYR A C    1 
ATOM   4322  O O    . TYR A 1 289 ? 53.456  118.630 93.622  1.00 74.75  ? 355  TYR A O    1 
ATOM   4323  C CB   . TYR A 1 289 ? 50.233  117.878 93.875  1.00 38.82  ? 355  TYR A CB   1 
ATOM   4324  C CG   . TYR A 1 289 ? 49.103  117.830 94.870  1.00 33.97  ? 355  TYR A CG   1 
ATOM   4325  C CD1  . TYR A 1 289 ? 47.915  118.507 94.647  1.00 41.32  ? 355  TYR A CD1  1 
ATOM   4326  C CD2  . TYR A 1 289 ? 49.217  117.087 96.027  1.00 40.95  ? 355  TYR A CD2  1 
ATOM   4327  C CE1  . TYR A 1 289 ? 46.869  118.445 95.566  1.00 36.61  ? 355  TYR A CE1  1 
ATOM   4328  C CE2  . TYR A 1 289 ? 48.188  117.021 96.945  1.00 35.92  ? 355  TYR A CE2  1 
ATOM   4329  C CZ   . TYR A 1 289 ? 47.020  117.695 96.712  1.00 36.64  ? 355  TYR A CZ   1 
ATOM   4330  O OH   . TYR A 1 289 ? 46.012  117.600 97.641  1.00 44.25  ? 355  TYR A OH   1 
ATOM   4331  H H    . TYR A 1 289 ? 50.129  120.269 92.819  1.00 58.57  ? 355  TYR A H    1 
ATOM   4332  H HA   . TYR A 1 289 ? 51.418  119.163 94.947  1.00 62.71  ? 355  TYR A HA   1 
ATOM   4333  H HB2  . TYR A 1 289 ? 49.844  117.885 92.986  1.00 46.58  ? 355  TYR A HB2  1 
ATOM   4334  H HB3  . TYR A 1 289 ? 50.766  117.077 93.993  1.00 46.58  ? 355  TYR A HB3  1 
ATOM   4335  H HD1  . TYR A 1 289 ? 47.813  119.010 93.872  1.00 49.59  ? 355  TYR A HD1  1 
ATOM   4336  H HD2  . TYR A 1 289 ? 50.005  116.623 96.193  1.00 49.14  ? 355  TYR A HD2  1 
ATOM   4337  H HE1  . TYR A 1 289 ? 46.076  118.904 95.406  1.00 43.93  ? 355  TYR A HE1  1 
ATOM   4338  H HE2  . TYR A 1 289 ? 48.286  116.513 97.718  1.00 43.11  ? 355  TYR A HE2  1 
ATOM   4339  H HH   . TYR A 1 289 ? 46.255  117.110 98.279  1.00 53.10  ? 355  TYR A HH   1 
ATOM   4340  N N    . TYR A 1 290 ? 52.199  119.230 91.842  1.00 59.98  ? 356  TYR A N    1 
ATOM   4341  C CA   . TYR A 1 290 ? 53.275  119.082 90.860  1.00 72.68  ? 356  TYR A CA   1 
ATOM   4342  C C    . TYR A 1 290 ? 53.935  120.419 90.470  1.00 83.25  ? 356  TYR A C    1 
ATOM   4343  O O    . TYR A 1 290 ? 53.247  121.432 90.278  1.00 74.63  ? 356  TYR A O    1 
ATOM   4344  C CB   . TYR A 1 290 ? 52.747  118.405 89.585  1.00 78.52  ? 356  TYR A CB   1 
ATOM   4345  C CG   . TYR A 1 290 ? 53.786  118.276 88.483  1.00 82.30  ? 356  TYR A CG   1 
ATOM   4346  C CD1  . TYR A 1 290 ? 53.991  119.299 87.558  1.00 79.30  ? 356  TYR A CD1  1 
ATOM   4347  C CD2  . TYR A 1 290 ? 54.562  117.130 88.371  1.00 91.39  ? 356  TYR A CD2  1 
ATOM   4348  C CE1  . TYR A 1 290 ? 54.938  119.182 86.557  1.00 76.32  ? 356  TYR A CE1  1 
ATOM   4349  C CE2  . TYR A 1 290 ? 55.514  117.005 87.379  1.00 99.45  ? 356  TYR A CE2  1 
ATOM   4350  C CZ   . TYR A 1 290 ? 55.700  118.031 86.476  1.00 99.39  ? 356  TYR A CZ   1 
ATOM   4351  O OH   . TYR A 1 290 ? 56.654  117.891 85.492  1.00 106.66 ? 356  TYR A OH   1 
ATOM   4352  H H    . TYR A 1 290 ? 51.460  119.512 91.504  1.00 71.98  ? 356  TYR A H    1 
ATOM   4353  H HA   . TYR A 1 290 ? 53.963  118.511 91.236  1.00 87.21  ? 356  TYR A HA   1 
ATOM   4354  H HB2  . TYR A 1 290 ? 52.440  117.513 89.810  1.00 94.22  ? 356  TYR A HB2  1 
ATOM   4355  H HB3  . TYR A 1 290 ? 52.009  118.929 89.237  1.00 94.22  ? 356  TYR A HB3  1 
ATOM   4356  H HD1  . TYR A 1 290 ? 53.481  120.075 87.615  1.00 95.15  ? 356  TYR A HD1  1 
ATOM   4357  H HD2  . TYR A 1 290 ? 54.443  116.437 88.980  1.00 109.67 ? 356  TYR A HD2  1 
ATOM   4358  H HE1  . TYR A 1 290 ? 55.066  119.874 85.949  1.00 91.59  ? 356  TYR A HE1  1 
ATOM   4359  H HE2  . TYR A 1 290 ? 56.027  116.231 87.319  1.00 119.34 ? 356  TYR A HE2  1 
ATOM   4360  H HH   . TYR A 1 290 ? 57.035  117.146 85.565  1.00 127.99 ? 356  TYR A HH   1 
ATOM   4361  N N    . ASN A 1 291 ? 55.262  120.433 90.337  1.00 98.54  ? 357  ASN A N    1 
ATOM   4362  C CA   . ASN A 1 291 ? 56.117  119.298 90.671  1.00 101.44 ? 357  ASN A CA   1 
ATOM   4363  C C    . ASN A 1 291 ? 56.282  119.241 92.180  1.00 98.82  ? 357  ASN A C    1 
ATOM   4364  O O    . ASN A 1 291 ? 56.499  118.172 92.759  1.00 114.44 ? 357  ASN A O    1 
ATOM   4365  C CB   . ASN A 1 291 ? 57.495  119.417 89.997  1.00 102.51 ? 357  ASN A CB   1 
ATOM   4366  C CG   . ASN A 1 291 ? 58.384  118.201 90.257  1.00 116.01 ? 357  ASN A CG   1 
ATOM   4367  O OD1  . ASN A 1 291 ? 59.587  118.339 90.475  1.00 127.70 ? 357  ASN A OD1  1 
ATOM   4368  N ND2  . ASN A 1 291 ? 57.790  117.006 90.249  1.00 114.16 ? 357  ASN A ND2  1 
ATOM   4369  H H    . ASN A 1 291 ? 55.701  121.112 90.045  1.00 118.25 ? 357  ASN A H    1 
ATOM   4370  H HA   . ASN A 1 291 ? 55.697  118.476 90.374  1.00 121.72 ? 357  ASN A HA   1 
ATOM   4371  H HB2  . ASN A 1 291 ? 57.372  119.500 89.038  1.00 123.02 ? 357  ASN A HB2  1 
ATOM   4372  H HB3  . ASN A 1 291 ? 57.949  120.201 90.343  1.00 123.02 ? 357  ASN A HB3  1 
ATOM   4373  H HD21 . ASN A 1 291 ? 58.253  116.295 90.390  1.00 137.00 ? 357  ASN A HD21 1 
ATOM   4374  H HD22 . ASN A 1 291 ? 56.945  116.947 90.102  1.00 137.00 ? 357  ASN A HD22 1 
ATOM   4375  N N    . LYS A 1 292 ? 56.131  120.400 92.811  1.00 79.46  ? 358  LYS A N    1 
ATOM   4376  C CA   . LYS A 1 292 ? 56.631  120.608 94.157  1.00 81.51  ? 358  LYS A CA   1 
ATOM   4377  C C    . LYS A 1 292 ? 55.528  120.947 95.146  1.00 73.78  ? 358  LYS A C    1 
ATOM   4378  O O    . LYS A 1 292 ? 54.644  121.753 94.842  1.00 70.20  ? 358  LYS A O    1 
ATOM   4379  C CB   . LYS A 1 292 ? 57.661  121.742 94.126  1.00 90.91  ? 358  LYS A CB   1 
ATOM   4380  C CG   . LYS A 1 292 ? 58.770  121.539 93.090  1.00 99.54  ? 358  LYS A CG   1 
ATOM   4381  C CD   . LYS A 1 292 ? 60.028  120.890 93.680  1.00 100.59 ? 358  LYS A CD   1 
ATOM   4382  C CE   . LYS A 1 292 ? 60.636  119.886 92.701  1.00 101.06 ? 358  LYS A CE   1 
ATOM   4383  N NZ   . LYS A 1 292 ? 62.085  119.659 92.928  1.00 92.96  ? 358  LYS A NZ   1 
ATOM   4384  H H    . LYS A 1 292 ? 55.737  121.087 92.475  1.00 95.36  ? 358  LYS A H    1 
ATOM   4385  H HA   . LYS A 1 292 ? 57.075  119.802 94.461  1.00 97.82  ? 358  LYS A HA   1 
ATOM   4386  H HB2  . LYS A 1 292 ? 57.206  122.572 93.915  1.00 109.09 ? 358  LYS A HB2  1 
ATOM   4387  H HB3  . LYS A 1 292 ? 58.079  121.808 94.999  1.00 109.09 ? 358  LYS A HB3  1 
ATOM   4388  H HG2  . LYS A 1 292 ? 58.439  120.963 92.383  1.00 119.45 ? 358  LYS A HG2  1 
ATOM   4389  H HG3  . LYS A 1 292 ? 59.021  122.402 92.724  1.00 119.45 ? 358  LYS A HG3  1 
ATOM   4390  H HD2  . LYS A 1 292 ? 60.689  121.577 93.863  1.00 120.70 ? 358  LYS A HD2  1 
ATOM   4391  H HD3  . LYS A 1 292 ? 59.795  120.419 94.495  1.00 120.70 ? 358  LYS A HD3  1 
ATOM   4392  H HE2  . LYS A 1 292 ? 60.180  119.036 92.799  1.00 121.27 ? 358  LYS A HE2  1 
ATOM   4393  H HE3  . LYS A 1 292 ? 60.524  120.220 91.797  1.00 121.27 ? 358  LYS A HE3  1 
ATOM   4394  H HZ1  . LYS A 1 292 ? 62.396  119.069 92.338  1.00 111.55 ? 358  LYS A HZ1  1 
ATOM   4395  H HZ2  . LYS A 1 292 ? 62.531  120.423 92.836  1.00 111.55 ? 358  LYS A HZ2  1 
ATOM   4396  H HZ3  . LYS A 1 292 ? 62.218  119.343 93.750  1.00 111.55 ? 358  LYS A HZ3  1 
ATOM   4397  N N    . GLU A 1 293 ? 55.588  120.321 96.321  1.00 73.24  ? 359  GLU A N    1 
ATOM   4398  C CA   . GLU A 1 293 ? 54.818  120.776 97.477  1.00 94.74  ? 359  GLU A CA   1 
ATOM   4399  C C    . GLU A 1 293 ? 55.213  120.066 98.757  1.00 75.28  ? 359  GLU A C    1 
ATOM   4400  O O    . GLU A 1 293 ? 56.000  119.133 98.740  1.00 62.12  ? 359  GLU A O    1 
ATOM   4401  C CB   . GLU A 1 293 ? 53.303  120.559 97.274  1.00 110.56 ? 359  GLU A CB   1 
ATOM   4402  C CG   . GLU A 1 293 ? 52.401  121.420 98.202  1.00 92.48  ? 359  GLU A CG   1 
ATOM   4403  C CD   . GLU A 1 293 ? 52.722  122.905 98.096  1.00 95.44  ? 359  GLU A CD   1 
ATOM   4404  O OE1  . GLU A 1 293 ? 52.839  123.396 96.945  1.00 102.59 ? 359  GLU A OE1  1 
ATOM   4405  O OE2  . GLU A 1 293 ? 52.895  123.558 99.152  1.00 102.34 ? 359  GLU A OE2  1 
ATOM   4406  H H    . GLU A 1 293 ? 56.071  119.625 96.474  1.00 87.89  ? 359  GLU A H    1 
ATOM   4407  H HA   . GLU A 1 293 ? 54.971  121.725 97.602  1.00 113.69 ? 359  GLU A HA   1 
ATOM   4408  H HB2  . GLU A 1 293 ? 53.078  120.780 96.357  1.00 132.67 ? 359  GLU A HB2  1 
ATOM   4409  H HB3  . GLU A 1 293 ? 53.097  119.627 97.445  1.00 132.67 ? 359  GLU A HB3  1 
ATOM   4410  H HG2  . GLU A 1 293 ? 51.473  121.292 97.950  1.00 110.97 ? 359  GLU A HG2  1 
ATOM   4411  H HG3  . GLU A 1 293 ? 52.539  121.146 99.122  1.00 110.97 ? 359  GLU A HG3  1 
ATOM   4412  N N    . LEU A 1 294 ? 54.669  120.590 99.851  1.00 61.86  ? 360  LEU A N    1 
ATOM   4413  C CA   . LEU A 1 294 ? 54.355  119.869 101.078 1.00 64.55  ? 360  LEU A CA   1 
ATOM   4414  C C    . LEU A 1 294 ? 53.477  120.835 101.903 1.00 75.58  ? 360  LEU A C    1 
ATOM   4415  O O    . LEU A 1 294 ? 53.999  121.710 102.596 1.00 90.86  ? 360  LEU A O    1 
ATOM   4416  C CB   . LEU A 1 294 ? 55.620  119.481 101.854 1.00 97.90  ? 360  LEU A CB   1 
ATOM   4417  C CG   . LEU A 1 294 ? 56.377  118.182 101.518 1.00 97.56  ? 360  LEU A CG   1 
ATOM   4418  C CD1  . LEU A 1 294 ? 57.808  118.177 102.089 1.00 68.10  ? 360  LEU A CD1  1 
ATOM   4419  C CD2  . LEU A 1 294 ? 55.577  116.971 101.995 1.00 98.03  ? 360  LEU A CD2  1 
ATOM   4420  H H    . LEU A 1 294 ? 54.460  121.422 99.906  1.00 74.23  ? 360  LEU A H    1 
ATOM   4421  H HA   . LEU A 1 294 ? 53.846  119.069 100.875 1.00 77.46  ? 360  LEU A HA   1 
ATOM   4422  H HB2  . LEU A 1 294 ? 56.258  120.203 101.746 1.00 117.48 ? 360  LEU A HB2  1 
ATOM   4423  H HB3  . LEU A 1 294 ? 55.376  119.420 102.791 1.00 117.48 ? 360  LEU A HB3  1 
ATOM   4424  H HG   . LEU A 1 294 ? 56.452  118.115 100.553 1.00 117.07 ? 360  LEU A HG   1 
ATOM   4425  H HD11 . LEU A 1 294 ? 58.240  117.341 101.851 1.00 81.71  ? 360  LEU A HD11 1 
ATOM   4426  H HD12 . LEU A 1 294 ? 58.301  118.923 101.713 1.00 81.71  ? 360  LEU A HD12 1 
ATOM   4427  H HD13 . LEU A 1 294 ? 57.763  118.263 103.055 1.00 81.71  ? 360  LEU A HD13 1 
ATOM   4428  H HD21 . LEU A 1 294 ? 56.068  116.163 101.776 1.00 117.64 ? 360  LEU A HD21 1 
ATOM   4429  H HD22 . LEU A 1 294 ? 55.454  117.033 102.955 1.00 117.64 ? 360  LEU A HD22 1 
ATOM   4430  H HD23 . LEU A 1 294 ? 54.716  116.966 101.550 1.00 117.64 ? 360  LEU A HD23 1 
ATOM   4431  N N    . ASN A 1 295 ? 52.153  120.706 101.809 1.00 64.02  ? 361  ASN A N    1 
ATOM   4432  C CA   . ASN A 1 295 ? 51.251  121.683 102.437 1.00 61.59  ? 361  ASN A CA   1 
ATOM   4433  C C    . ASN A 1 295 ? 50.120  121.088 103.286 1.00 61.21  ? 361  ASN A C    1 
ATOM   4434  O O    . ASN A 1 295 ? 49.322  120.290 102.808 1.00 64.55  ? 361  ASN A O    1 
ATOM   4435  C CB   . ASN A 1 295 ? 50.640  122.596 101.368 1.00 56.46  ? 361  ASN A CB   1 
ATOM   4436  C CG   . ASN A 1 295 ? 49.996  123.848 101.964 1.00 58.98  ? 361  ASN A CG   1 
ATOM   4437  O OD1  . ASN A 1 295 ? 49.172  123.772 102.878 1.00 61.33  ? 361  ASN A OD1  1 
ATOM   4438  N ND2  . ASN A 1 295 ? 50.376  125.003 101.444 1.00 34.20  ? 361  ASN A ND2  1 
ATOM   4439  H H    . ASN A 1 295 ? 51.753  120.069 101.393 1.00 76.82  ? 361  ASN A H    1 
ATOM   4440  H HA   . ASN A 1 295 ? 51.781  122.244 103.024 1.00 73.91  ? 361  ASN A HA   1 
ATOM   4441  H HB2  . ASN A 1 295 ? 51.339  122.880 100.757 1.00 67.75  ? 361  ASN A HB2  1 
ATOM   4442  H HB3  . ASN A 1 295 ? 49.956  122.106 100.885 1.00 67.75  ? 361  ASN A HB3  1 
ATOM   4443  H HD21 . ASN A 1 295 ? 50.045  125.739 101.742 1.00 41.04  ? 361  ASN A HD21 1 
ATOM   4444  H HD22 . ASN A 1 295 ? 50.954  125.019 100.808 1.00 41.04  ? 361  ASN A HD22 1 
ATOM   4445  N N    . SER A 1 296 ? 50.042  121.523 104.539 1.00 53.44  ? 362  SER A N    1 
ATOM   4446  C CA   . SER A 1 296 ? 49.046  121.012 105.473 1.00 65.69  ? 362  SER A CA   1 
ATOM   4447  C C    . SER A 1 296 ? 47.663  121.677 105.290 1.00 68.40  ? 362  SER A C    1 
ATOM   4448  O O    . SER A 1 296 ? 46.632  121.131 105.721 1.00 64.43  ? 362  SER A O    1 
ATOM   4449  C CB   . SER A 1 296 ? 49.567  121.161 106.916 1.00 70.02  ? 362  SER A CB   1 
ATOM   4450  O OG   . SER A 1 296 ? 50.010  122.484 107.195 1.00 66.56  ? 362  SER A OG   1 
ATOM   4451  H H    . SER A 1 296 ? 50.560  122.121 104.877 1.00 64.13  ? 362  SER A H    1 
ATOM   4452  H HA   . SER A 1 296 ? 48.932  120.063 105.306 1.00 78.83  ? 362  SER A HA   1 
ATOM   4453  H HB2  . SER A 1 296 ? 48.851  120.937 107.530 1.00 84.02  ? 362  SER A HB2  1 
ATOM   4454  H HB3  . SER A 1 296 ? 50.310  120.551 107.043 1.00 84.02  ? 362  SER A HB3  1 
ATOM   4455  H HG   . SER A 1 296 ? 50.287  122.533 107.986 1.00 79.88  ? 362  SER A HG   1 
ATOM   4456  N N    . LYS A 1 297 ? 47.644  122.846 104.647 1.00 61.40  ? 363  LYS A N    1 
ATOM   4457  C CA   . LYS A 1 297 ? 46.392  123.534 104.336 1.00 59.81  ? 363  LYS A CA   1 
ATOM   4458  C C    . LYS A 1 297 ? 45.762  122.821 103.155 1.00 49.27  ? 363  LYS A C    1 
ATOM   4459  O O    . LYS A 1 297 ? 44.544  122.685 103.065 1.00 38.72  ? 363  LYS A O    1 
ATOM   4460  C CB   . LYS A 1 297 ? 46.631  125.008 103.963 1.00 65.16  ? 363  LYS A CB   1 
ATOM   4461  C CG   . LYS A 1 297 ? 46.253  126.048 105.016 1.00 68.48  ? 363  LYS A CG   1 
ATOM   4462  C CD   . LYS A 1 297 ? 44.747  126.389 105.048 1.00 76.46  ? 363  LYS A CD   1 
ATOM   4463  C CE   . LYS A 1 297 ? 44.534  127.743 105.754 1.00 72.15  ? 363  LYS A CE   1 
ATOM   4464  N NZ   . LYS A 1 297 ? 43.118  128.079 106.069 1.00 51.17  ? 363  LYS A NZ   1 
ATOM   4465  H H    . LYS A 1 297 ? 48.347  123.263 104.380 1.00 73.68  ? 363  LYS A H    1 
ATOM   4466  H HA   . LYS A 1 297 ? 45.788  123.491 105.094 1.00 71.77  ? 363  LYS A HA   1 
ATOM   4467  H HB2  . LYS A 1 297 ? 47.575  125.123 103.772 1.00 78.20  ? 363  LYS A HB2  1 
ATOM   4468  H HB3  . LYS A 1 297 ? 46.116  125.207 103.165 1.00 78.20  ? 363  LYS A HB3  1 
ATOM   4469  H HG2  . LYS A 1 297 ? 46.499  125.709 105.891 1.00 82.18  ? 363  LYS A HG2  1 
ATOM   4470  H HG3  . LYS A 1 297 ? 46.739  126.867 104.833 1.00 82.18  ? 363  LYS A HG3  1 
ATOM   4471  H HD2  . LYS A 1 297 ? 44.408  126.457 104.142 1.00 91.75  ? 363  LYS A HD2  1 
ATOM   4472  H HD3  . LYS A 1 297 ? 44.268  125.705 105.541 1.00 91.75  ? 363  LYS A HD3  1 
ATOM   4473  H HE2  . LYS A 1 297 ? 45.024  127.734 106.591 1.00 86.58  ? 363  LYS A HE2  1 
ATOM   4474  H HE3  . LYS A 1 297 ? 44.880  128.446 105.182 1.00 86.58  ? 363  LYS A HE3  1 
ATOM   4475  H HZ1  . LYS A 1 297 ? 43.077  128.871 106.473 1.00 61.40  ? 363  LYS A HZ1  1 
ATOM   4476  H HZ2  . LYS A 1 297 ? 42.640  128.112 105.319 1.00 61.40  ? 363  LYS A HZ2  1 
ATOM   4477  H HZ3  . LYS A 1 297 ? 42.771  127.461 106.607 1.00 61.40  ? 363  LYS A HZ3  1 
ATOM   4478  N N    . LEU A 1 298 ? 46.613  122.356 102.247 1.00 50.06  ? 364  LEU A N    1 
ATOM   4479  C CA   . LEU A 1 298 ? 46.135  121.712 101.031 1.00 46.43  ? 364  LEU A CA   1 
ATOM   4480  C C    . LEU A 1 298 ? 45.571  120.343 101.359 1.00 54.10  ? 364  LEU A C    1 
ATOM   4481  O O    . LEU A 1 298 ? 44.507  119.981 100.888 1.00 60.10  ? 364  LEU A O    1 
ATOM   4482  C CB   . LEU A 1 298 ? 47.250  121.568 100.006 1.00 36.49  ? 364  LEU A CB   1 
ATOM   4483  C CG   . LEU A 1 298 ? 46.776  121.076 98.640  1.00 31.96  ? 364  LEU A CG   1 
ATOM   4484  C CD1  . LEU A 1 298 ? 45.659  121.947 98.096  1.00 49.98  ? 364  LEU A CD1  1 
ATOM   4485  C CD2  . LEU A 1 298 ? 47.898  121.043 97.639  1.00 26.02  ? 364  LEU A CD2  1 
ATOM   4486  H H    . LEU A 1 298 ? 47.469  122.401 102.311 1.00 60.07  ? 364  LEU A H    1 
ATOM   4487  H HA   . LEU A 1 298 ? 45.428  122.248 100.640 1.00 55.71  ? 364  LEU A HA   1 
ATOM   4488  H HB2  . LEU A 1 298 ? 47.671  122.433 99.879  1.00 43.79  ? 364  LEU A HB2  1 
ATOM   4489  H HB3  . LEU A 1 298 ? 47.901  120.932 100.340 1.00 43.79  ? 364  LEU A HB3  1 
ATOM   4490  H HG   . LEU A 1 298 ? 46.432  120.174 98.733  1.00 38.35  ? 364  LEU A HG   1 
ATOM   4491  H HD11 . LEU A 1 298 ? 45.384  121.605 97.231  1.00 59.98  ? 364  LEU A HD11 1 
ATOM   4492  H HD12 . LEU A 1 298 ? 44.911  121.923 98.714  1.00 59.98  ? 364  LEU A HD12 1 
ATOM   4493  H HD13 . LEU A 1 298 ? 45.984  122.857 98.005  1.00 59.98  ? 364  LEU A HD13 1 
ATOM   4494  H HD21 . LEU A 1 298 ? 47.553  120.726 96.789  1.00 31.23  ? 364  LEU A HD21 1 
ATOM   4495  H HD22 . LEU A 1 298 ? 48.256  121.938 97.537  1.00 31.23  ? 364  LEU A HD22 1 
ATOM   4496  H HD23 . LEU A 1 298 ? 48.589  120.443 97.960  1.00 31.23  ? 364  LEU A HD23 1 
ATOM   4497  N N    . GLU A 1 299 ? 46.285  119.584 102.179 1.00 61.01  ? 365  GLU A N    1 
ATOM   4498  C CA   . GLU A 1 299 ? 45.868  118.237 102.532 1.00 60.78  ? 365  GLU A CA   1 
ATOM   4499  C C    . GLU A 1 299 ? 44.561  118.240 103.295 1.00 58.17  ? 365  GLU A C    1 
ATOM   4500  O O    . GLU A 1 299 ? 43.766  117.302 103.188 1.00 66.91  ? 365  GLU A O    1 
ATOM   4501  C CB   . GLU A 1 299 ? 46.939  117.565 103.376 1.00 61.91  ? 365  GLU A CB   1 
ATOM   4502  C CG   . GLU A 1 299 ? 47.928  116.777 102.553 1.00 73.27  ? 365  GLU A CG   1 
ATOM   4503  C CD   . GLU A 1 299 ? 48.987  116.121 103.411 1.00 96.19  ? 365  GLU A CD   1 
ATOM   4504  O OE1  . GLU A 1 299 ? 48.799  116.058 104.652 1.00 97.44  ? 365  GLU A OE1  1 
ATOM   4505  O OE2  . GLU A 1 299 ? 50.003  115.667 102.842 1.00 106.40 ? 365  GLU A OE2  1 
ATOM   4506  H H    . GLU A 1 299 ? 47.022  119.829 102.547 1.00 73.21  ? 365  GLU A H    1 
ATOM   4507  H HA   . GLU A 1 299 ? 45.747  117.716 101.723 1.00 72.94  ? 365  GLU A HA   1 
ATOM   4508  H HB2  . GLU A 1 299 ? 47.430  118.246 103.862 1.00 74.29  ? 365  GLU A HB2  1 
ATOM   4509  H HB3  . GLU A 1 299 ? 46.514  116.955 103.998 1.00 74.29  ? 365  GLU A HB3  1 
ATOM   4510  H HG2  . GLU A 1 299 ? 47.457  116.080 102.070 1.00 87.92  ? 365  GLU A HG2  1 
ATOM   4511  H HG3  . GLU A 1 299 ? 48.371  117.374 101.930 1.00 87.92  ? 365  GLU A HG3  1 
ATOM   4512  N N    . LEU A 1 300 ? 44.337  119.291 104.069 1.00 50.79  ? 366  LEU A N    1 
ATOM   4513  C CA   . LEU A 1 300 ? 43.085  119.409 104.795 1.00 59.67  ? 366  LEU A CA   1 
ATOM   4514  C C    . LEU A 1 300 ? 41.929  119.535 103.816 1.00 54.01  ? 366  LEU A C    1 
ATOM   4515  O O    . LEU A 1 300 ? 40.886  118.920 103.987 1.00 47.94  ? 366  LEU A O    1 
ATOM   4516  C CB   . LEU A 1 300 ? 43.093  120.622 105.717 1.00 71.54  ? 366  LEU A CB   1 
ATOM   4517  C CG   . LEU A 1 300 ? 41.868  120.646 106.632 1.00 74.49  ? 366  LEU A CG   1 
ATOM   4518  C CD1  . LEU A 1 300 ? 42.016  119.588 107.723 1.00 64.39  ? 366  LEU A CD1  1 
ATOM   4519  C CD2  . LEU A 1 300 ? 41.642  122.032 107.232 1.00 82.38  ? 366  LEU A CD2  1 
ATOM   4520  H H    . LEU A 1 300 ? 44.886  119.942 104.189 1.00 60.95  ? 366  LEU A H    1 
ATOM   4521  H HA   . LEU A 1 300 ? 42.948  118.614 105.333 1.00 71.61  ? 366  LEU A HA   1 
ATOM   4522  H HB2  . LEU A 1 300 ? 43.887  120.595 106.274 1.00 85.85  ? 366  LEU A HB2  1 
ATOM   4523  H HB3  . LEU A 1 300 ? 43.087  121.431 105.181 1.00 85.85  ? 366  LEU A HB3  1 
ATOM   4524  H HG   . LEU A 1 300 ? 41.084  120.420 106.108 1.00 89.38  ? 366  LEU A HG   1 
ATOM   4525  H HD11 . LEU A 1 300 ? 41.234  119.613 108.296 1.00 77.26  ? 366  LEU A HD11 1 
ATOM   4526  H HD12 . LEU A 1 300 ? 42.094  118.715 107.308 1.00 77.26  ? 366  LEU A HD12 1 
ATOM   4527  H HD13 . LEU A 1 300 ? 42.813  119.779 108.242 1.00 77.26  ? 366  LEU A HD13 1 
ATOM   4528  H HD21 . LEU A 1 300 ? 40.859  122.005 107.804 1.00 98.86  ? 366  LEU A HD21 1 
ATOM   4529  H HD22 . LEU A 1 300 ? 42.423  122.282 107.751 1.00 98.86  ? 366  LEU A HD22 1 
ATOM   4530  H HD23 . LEU A 1 300 ? 41.505  122.668 106.512 1.00 98.86  ? 366  LEU A HD23 1 
ATOM   4531  N N    . PHE A 1 301 ? 42.126  120.346 102.790 1.00 42.41  ? 367  PHE A N    1 
ATOM   4532  C CA   . PHE A 1 301 ? 41.099  120.583 101.795 1.00 40.94  ? 367  PHE A CA   1 
ATOM   4533  C C    . PHE A 1 301 ? 40.809  119.305 101.032 1.00 48.95  ? 367  PHE A C    1 
ATOM   4534  O O    . PHE A 1 301 ? 39.668  118.867 100.904 1.00 51.02  ? 367  PHE A O    1 
ATOM   4535  C CB   . PHE A 1 301 ? 41.600  121.657 100.846 1.00 31.96  ? 367  PHE A CB   1 
ATOM   4536  C CG   . PHE A 1 301 ? 40.803  121.802 99.596  1.00 38.62  ? 367  PHE A CG   1 
ATOM   4537  C CD1  . PHE A 1 301 ? 39.719  122.652 99.547  1.00 52.22  ? 367  PHE A CD1  1 
ATOM   4538  C CD2  . PHE A 1 301 ? 41.176  121.136 98.442  1.00 52.94  ? 367  PHE A CD2  1 
ATOM   4539  C CE1  . PHE A 1 301 ? 38.993  122.815 98.374  1.00 51.73  ? 367  PHE A CE1  1 
ATOM   4540  C CE2  . PHE A 1 301 ? 40.452  121.288 97.268  1.00 52.99  ? 367  PHE A CE2  1 
ATOM   4541  C CZ   . PHE A 1 301 ? 39.367  122.132 97.233  1.00 49.18  ? 367  PHE A CZ   1 
ATOM   4542  H H    . PHE A 1 301 ? 42.857  120.775 102.646 1.00 50.89  ? 367  PHE A H    1 
ATOM   4543  H HA   . PHE A 1 301 ? 40.284  120.890 102.223 1.00 49.13  ? 367  PHE A HA   1 
ATOM   4544  H HB2  . PHE A 1 301 ? 41.581  122.510 101.307 1.00 38.35  ? 367  PHE A HB2  1 
ATOM   4545  H HB3  . PHE A 1 301 ? 42.511  121.443 100.591 1.00 38.35  ? 367  PHE A HB3  1 
ATOM   4546  H HD1  . PHE A 1 301 ? 39.465  123.117 100.312 1.00 62.67  ? 367  PHE A HD1  1 
ATOM   4547  H HD2  . PHE A 1 301 ? 41.911  120.566 98.458  1.00 63.53  ? 367  PHE A HD2  1 
ATOM   4548  H HE1  . PHE A 1 301 ? 38.256  123.383 98.357  1.00 62.08  ? 367  PHE A HE1  1 
ATOM   4549  H HE2  . PHE A 1 301 ? 40.707  120.827 96.502  1.00 63.59  ? 367  PHE A HE2  1 
ATOM   4550  H HZ   . PHE A 1 301 ? 38.879  122.233 96.447  1.00 59.02  ? 367  PHE A HZ   1 
ATOM   4551  N N    . THR A 1 302 ? 41.872  118.709 100.521 1.00 60.40  ? 368  THR A N    1 
ATOM   4552  C CA   . THR A 1 302 ? 41.766  117.494 99.752  1.00 44.80  ? 368  THR A CA   1 
ATOM   4553  C C    . THR A 1 302 ? 41.041  116.438 100.575 1.00 52.06  ? 368  THR A C    1 
ATOM   4554  O O    . THR A 1 302 ? 40.156  115.756 100.062 1.00 65.82  ? 368  THR A O    1 
ATOM   4555  C CB   . THR A 1 302 ? 43.160  117.037 99.305  1.00 57.20  ? 368  THR A CB   1 
ATOM   4556  O OG1  . THR A 1 302 ? 43.688  118.007 98.389  1.00 43.34  ? 368  THR A OG1  1 
ATOM   4557  C CG2  . THR A 1 302 ? 43.111  115.670 98.627  1.00 68.09  ? 368  THR A CG2  1 
ATOM   4558  H H    . THR A 1 302 ? 42.677  118.997 100.609 1.00 72.48  ? 368  THR A H    1 
ATOM   4559  H HA   . THR A 1 302 ? 41.239  117.669 98.957  1.00 53.76  ? 368  THR A HA   1 
ATOM   4560  H HB   . THR A 1 302 ? 43.742  116.975 100.078 1.00 68.64  ? 368  THR A HB   1 
ATOM   4561  H HG1  . THR A 1 302 ? 44.453  117.773 98.132  1.00 52.01  ? 368  THR A HG1  1 
ATOM   4562  H HG21 . THR A 1 302 ? 44.003  115.404 98.354  1.00 81.70  ? 368  THR A HG21 1 
ATOM   4563  H HG22 . THR A 1 302 ? 42.758  115.008 99.242  1.00 81.70  ? 368  THR A HG22 1 
ATOM   4564  H HG23 . THR A 1 302 ? 42.539  115.709 97.844  1.00 81.70  ? 368  THR A HG23 1 
ATOM   4565  N N    . SER A 1 303 ? 41.369  116.317 101.856 1.00 57.39  ? 369  SER A N    1 
ATOM   4566  C CA   . SER A 1 303 ? 40.617  115.389 102.706 1.00 66.26  ? 369  SER A CA   1 
ATOM   4567  C C    . SER A 1 303 ? 39.114  115.748 102.740 1.00 62.89  ? 369  SER A C    1 
ATOM   4568  O O    . SER A 1 303 ? 38.273  114.859 102.793 1.00 53.27  ? 369  SER A O    1 
ATOM   4569  C CB   . SER A 1 303 ? 41.205  115.307 104.125 1.00 51.74  ? 369  SER A CB   1 
ATOM   4570  O OG   . SER A 1 303 ? 40.985  116.497 104.860 1.00 56.63  ? 369  SER A OG   1 
ATOM   4571  H H    . SER A 1 303 ? 42.001  116.744 102.252 1.00 68.87  ? 369  SER A H    1 
ATOM   4572  H HA   . SER A 1 303 ? 40.689  114.503 102.318 1.00 79.51  ? 369  SER A HA   1 
ATOM   4573  H HB2  . SER A 1 303 ? 40.786  114.568 104.594 1.00 62.08  ? 369  SER A HB2  1 
ATOM   4574  H HB3  . SER A 1 303 ? 42.161  115.153 104.059 1.00 62.08  ? 369  SER A HB3  1 
ATOM   4575  H HG   . SER A 1 303 ? 41.345  117.147 104.468 1.00 67.96  ? 369  SER A HG   1 
ATOM   4576  N N    . ARG A 1 304 ? 38.774  117.037 102.689 1.00 67.36  ? 370  ARG A N    1 
ATOM   4577  C CA   . ARG A 1 304 ? 37.363  117.445 102.676 1.00 48.03  ? 370  ARG A CA   1 
ATOM   4578  C C    . ARG A 1 304 ? 36.697  117.085 101.372 1.00 35.95  ? 370  ARG A C    1 
ATOM   4579  O O    . ARG A 1 304 ? 35.513  116.854 101.343 1.00 37.53  ? 370  ARG A O    1 
ATOM   4580  C CB   . ARG A 1 304 ? 37.188  118.957 102.848 1.00 58.81  ? 370  ARG A CB   1 
ATOM   4581  C CG   . ARG A 1 304 ? 37.679  119.526 104.151 1.00 76.92  ? 370  ARG A CG   1 
ATOM   4582  C CD   . ARG A 1 304 ? 37.678  121.048 104.108 1.00 88.91  ? 370  ARG A CD   1 
ATOM   4583  N NE   . ARG A 1 304 ? 38.249  121.620 105.328 1.00 108.17 ? 370  ARG A NE   1 
ATOM   4584  C CZ   . ARG A 1 304 ? 38.325  122.924 105.585 1.00 112.25 ? 370  ARG A CZ   1 
ATOM   4585  N NH1  . ARG A 1 304 ? 37.873  123.810 104.703 1.00 117.04 ? 370  ARG A NH1  1 
ATOM   4586  N NH2  . ARG A 1 304 ? 38.857  123.343 106.728 1.00 108.78 ? 370  ARG A NH2  1 
ATOM   4587  H H    . ARG A 1 304 ? 39.333  117.690 102.662 1.00 80.83  ? 370  ARG A H    1 
ATOM   4588  H HA   . ARG A 1 304 ? 36.891  116.998 103.395 1.00 57.64  ? 370  ARG A HA   1 
ATOM   4589  H HB2  . ARG A 1 304 ? 37.672  119.404 102.136 1.00 70.57  ? 370  ARG A HB2  1 
ATOM   4590  H HB3  . ARG A 1 304 ? 36.244  119.166 102.778 1.00 70.57  ? 370  ARG A HB3  1 
ATOM   4591  H HG2  . ARG A 1 304 ? 37.094  119.239 104.869 1.00 92.31  ? 370  ARG A HG2  1 
ATOM   4592  H HG3  . ARG A 1 304 ? 38.587  119.224 104.313 1.00 92.31  ? 370  ARG A HG3  1 
ATOM   4593  H HD2  . ARG A 1 304 ? 38.210  121.347 103.354 1.00 106.69 ? 370  ARG A HD2  1 
ATOM   4594  H HD3  . ARG A 1 304 ? 36.765  121.365 104.021 1.00 106.69 ? 370  ARG A HD3  1 
ATOM   4595  H HE   . ARG A 1 304 ? 38.556  121.077 105.920 1.00 129.80 ? 370  ARG A HE   1 
ATOM   4596  H HH11 . ARG A 1 304 ? 37.527  123.542 103.963 1.00 140.44 ? 370  ARG A HH11 1 
ATOM   4597  H HH12 . ARG A 1 304 ? 37.926  124.652 104.873 1.00 140.44 ? 370  ARG A HH12 1 
ATOM   4598  H HH21 . ARG A 1 304 ? 39.152  122.772 107.299 1.00 130.54 ? 370  ARG A HH21 1 
ATOM   4599  H HH22 . ARG A 1 304 ? 38.910  124.185 106.894 1.00 130.54 ? 370  ARG A HH22 1 
ATOM   4600  N N    . PHE A 1 305 ? 37.460  117.065 100.285 1.00 46.09  ? 371  PHE A N    1 
ATOM   4601  C CA   . PHE A 1 305 ? 36.885  116.914 98.950  1.00 35.64  ? 371  PHE A CA   1 
ATOM   4602  C C    . PHE A 1 305 ? 37.310  115.648 98.232  1.00 42.13  ? 371  PHE A C    1 
ATOM   4603  O O    . PHE A 1 305 ? 36.991  115.472 97.065  1.00 45.81  ? 371  PHE A O    1 
ATOM   4604  C CB   . PHE A 1 305 ? 37.233  118.115 98.095  1.00 27.82  ? 371  PHE A CB   1 
ATOM   4605  C CG   . PHE A 1 305 ? 36.421  119.324 98.419  1.00 46.26  ? 371  PHE A CG   1 
ATOM   4606  C CD1  . PHE A 1 305 ? 35.144  119.467 97.903  1.00 43.12  ? 371  PHE A CD1  1 
ATOM   4607  C CD2  . PHE A 1 305 ? 36.926  120.317 99.248  1.00 38.97  ? 371  PHE A CD2  1 
ATOM   4608  C CE1  . PHE A 1 305 ? 34.376  120.577 98.202  1.00 40.45  ? 371  PHE A CE1  1 
ATOM   4609  C CE2  . PHE A 1 305 ? 36.177  121.430 99.544  1.00 37.55  ? 371  PHE A CE2  1 
ATOM   4610  C CZ   . PHE A 1 305 ? 34.894  121.563 99.017  1.00 48.85  ? 371  PHE A CZ   1 
ATOM   4611  H H    . PHE A 1 305 ? 38.317  117.138 100.292 1.00 55.30  ? 371  PHE A H    1 
ATOM   4612  H HA   . PHE A 1 305 ? 35.920  116.887 99.035  1.00 42.76  ? 371  PHE A HA   1 
ATOM   4613  H HB2  . PHE A 1 305 ? 38.167  118.338 98.231  1.00 33.38  ? 371  PHE A HB2  1 
ATOM   4614  H HB3  . PHE A 1 305 ? 37.079  117.893 97.164  1.00 33.38  ? 371  PHE A HB3  1 
ATOM   4615  H HD1  . PHE A 1 305 ? 34.796  118.804 97.351  1.00 51.75  ? 371  PHE A HD1  1 
ATOM   4616  H HD2  . PHE A 1 305 ? 37.783  120.232 99.598  1.00 46.76  ? 371  PHE A HD2  1 
ATOM   4617  H HE1  . PHE A 1 305 ? 33.521  120.665 97.846  1.00 48.54  ? 371  PHE A HE1  1 
ATOM   4618  H HE2  . PHE A 1 305 ? 36.524  122.091 100.098 1.00 45.06  ? 371  PHE A HE2  1 
ATOM   4619  H HZ   . PHE A 1 305 ? 34.384  122.314 99.221  1.00 58.61  ? 371  PHE A HZ   1 
ATOM   4620  N N    . LYS A 1 306 ? 38.004  114.760 98.934  1.00 55.56  ? 372  LYS A N    1 
ATOM   4621  C CA   . LYS A 1 306 ? 38.404  113.474 98.368  1.00 49.02  ? 372  LYS A CA   1 
ATOM   4622  C C    . LYS A 1 306 ? 37.218  112.693 97.790  1.00 45.03  ? 372  LYS A C    1 
ATOM   4623  O O    . LYS A 1 306 ? 37.293  112.196 96.673  1.00 48.38  ? 372  LYS A O    1 
ATOM   4624  C CB   . LYS A 1 306 ? 39.128  112.635 99.419  1.00 37.57  ? 372  LYS A CB   1 
ATOM   4625  C CG   . LYS A 1 306 ? 39.518  111.248 98.957  1.00 43.17  ? 372  LYS A CG   1 
ATOM   4626  C CD   . LYS A 1 306 ? 39.080  110.163 99.940  1.00 64.27  ? 372  LYS A CD   1 
ATOM   4627  C CE   . LYS A 1 306 ? 37.558  110.069 100.076 1.00 62.38  ? 372  LYS A CE   1 
ATOM   4628  N NZ   . LYS A 1 306 ? 37.125  108.939 100.969 1.00 60.70  ? 372  LYS A NZ   1 
ATOM   4629  H H    . LYS A 1 306 ? 38.259  114.877 99.747  1.00 66.67  ? 372  LYS A H    1 
ATOM   4630  H HA   . LYS A 1 306 ? 39.027  113.637 97.643  1.00 58.83  ? 372  LYS A HA   1 
ATOM   4631  H HB2  . LYS A 1 306 ? 39.940  113.098 99.679  1.00 45.09  ? 372  LYS A HB2  1 
ATOM   4632  H HB3  . LYS A 1 306 ? 38.548  112.536 100.190 1.00 45.09  ? 372  LYS A HB3  1 
ATOM   4633  H HG2  . LYS A 1 306 ? 39.096  111.067 98.103  1.00 51.81  ? 372  LYS A HG2  1 
ATOM   4634  H HG3  . LYS A 1 306 ? 40.483  111.202 98.869  1.00 51.81  ? 372  LYS A HG3  1 
ATOM   4635  H HD2  . LYS A 1 306 ? 39.407  109.305 99.630  1.00 77.12  ? 372  LYS A HD2  1 
ATOM   4636  H HD3  . LYS A 1 306 ? 39.447  110.363 100.815 1.00 77.12  ? 372  LYS A HD3  1 
ATOM   4637  H HE2  . LYS A 1 306 ? 37.222  110.896 100.455 1.00 74.86  ? 372  LYS A HE2  1 
ATOM   4638  H HE3  . LYS A 1 306 ? 37.171  109.923 99.199  1.00 74.86  ? 372  LYS A HE3  1 
ATOM   4639  H HZ1  . LYS A 1 306 ? 36.237  108.917 101.022 1.00 72.84  ? 372  LYS A HZ1  1 
ATOM   4640  H HZ2  . LYS A 1 306 ? 37.414  108.164 100.640 1.00 72.84  ? 372  LYS A HZ2  1 
ATOM   4641  H HZ3  . LYS A 1 306 ? 37.461  109.051 101.785 1.00 72.84  ? 372  LYS A HZ3  1 
ATOM   4642  N N    . ASP A 1 307 ? 36.130  112.574 98.540  1.00 57.52  ? 373  ASP A N    1 
ATOM   4643  C CA   . ASP A 1 307 ? 34.975  111.838 98.038  1.00 48.37  ? 373  ASP A CA   1 
ATOM   4644  C C    . ASP A 1 307 ? 34.605  112.384 96.670  1.00 40.49  ? 373  ASP A C    1 
ATOM   4645  O O    . ASP A 1 307 ? 34.553  111.650 95.681  1.00 50.40  ? 373  ASP A O    1 
ATOM   4646  C CB   . ASP A 1 307 ? 33.776  111.947 98.987  1.00 58.25  ? 373  ASP A CB   1 
ATOM   4647  C CG   . ASP A 1 307 ? 33.850  110.969 100.157 1.00 73.26  ? 373  ASP A CG   1 
ATOM   4648  O OD1  . ASP A 1 307 ? 34.644  110.002 100.096 1.00 79.05  ? 373  ASP A OD1  1 
ATOM   4649  O OD2  . ASP A 1 307 ? 33.095  111.166 101.139 1.00 75.50  ? 373  ASP A OD2  1 
ATOM   4650  H H    . ASP A 1 307 ? 36.034  112.903 99.329  1.00 69.02  ? 373  ASP A H    1 
ATOM   4651  H HA   . ASP A 1 307 ? 35.206  110.901 97.942  1.00 58.04  ? 373  ASP A HA   1 
ATOM   4652  H HB2  . ASP A 1 307 ? 33.743  112.846 99.351  1.00 69.90  ? 373  ASP A HB2  1 
ATOM   4653  H HB3  . ASP A 1 307 ? 32.964  111.760 98.492  1.00 69.90  ? 373  ASP A HB3  1 
ATOM   4654  N N    . ARG A 1 308 ? 34.384  113.685 96.605  1.00 39.67  ? 374  ARG A N    1 
ATOM   4655  C CA   . ARG A 1 308 ? 33.981  114.299 95.353  1.00 41.69  ? 374  ARG A CA   1 
ATOM   4656  C C    . ARG A 1 308 ? 35.000  114.058 94.227  1.00 44.78  ? 374  ARG A C    1 
ATOM   4657  O O    . ARG A 1 308 ? 34.607  113.883 93.081  1.00 46.97  ? 374  ARG A O    1 
ATOM   4658  C CB   . ARG A 1 308 ? 33.747  115.790 95.559  1.00 40.69  ? 374  ARG A CB   1 
ATOM   4659  C CG   . ARG A 1 308 ? 33.449  116.544 94.287  1.00 37.81  ? 374  ARG A CG   1 
ATOM   4660  C CD   . ARG A 1 308 ? 32.285  115.946 93.507  1.00 29.51  ? 374  ARG A CD   1 
ATOM   4661  N NE   . ARG A 1 308 ? 32.111  116.637 92.230  1.00 49.00  ? 374  ARG A NE   1 
ATOM   4662  C CZ   . ARG A 1 308 ? 31.765  116.057 91.082  1.00 36.68  ? 374  ARG A CZ   1 
ATOM   4663  N NH1  . ARG A 1 308 ? 31.552  114.747 91.010  1.00 37.56  ? 374  ARG A NH1  1 
ATOM   4664  N NH2  . ARG A 1 308 ? 31.639  116.796 89.988  1.00 27.13  ? 374  ARG A NH2  1 
ATOM   4665  H H    . ARG A 1 308 ? 34.460  114.232 97.265  1.00 47.60  ? 374  ARG A H    1 
ATOM   4666  H HA   . ARG A 1 308 ? 33.139  113.906 95.075  1.00 50.02  ? 374  ARG A HA   1 
ATOM   4667  H HB2  . ARG A 1 308 ? 32.992  115.908 96.156  1.00 48.82  ? 374  ARG A HB2  1 
ATOM   4668  H HB3  . ARG A 1 308 ? 34.542  116.180 95.954  1.00 48.82  ? 374  ARG A HB3  1 
ATOM   4669  H HG2  . ARG A 1 308 ? 33.222  117.461 94.509  1.00 45.38  ? 374  ARG A HG2  1 
ATOM   4670  H HG3  . ARG A 1 308 ? 34.233  116.525 93.717  1.00 45.38  ? 374  ARG A HG3  1 
ATOM   4671  H HD2  . ARG A 1 308 ? 32.463  115.010 93.328  1.00 35.41  ? 374  ARG A HD2  1 
ATOM   4672  H HD3  . ARG A 1 308 ? 31.468  116.042 94.022  1.00 35.41  ? 374  ARG A HD3  1 
ATOM   4673  H HE   . ARG A 1 308 ? 32.243  117.487 92.219  1.00 58.79  ? 374  ARG A HE   1 
ATOM   4674  H HH11 . ARG A 1 308 ? 31.632  114.259 91.714  1.00 45.07  ? 374  ARG A HH11 1 
ATOM   4675  H HH12 . ARG A 1 308 ? 31.331  114.388 90.261  1.00 45.07  ? 374  ARG A HH12 1 
ATOM   4676  H HH21 . ARG A 1 308 ? 31.777  117.644 90.025  1.00 32.56  ? 374  ARG A HH21 1 
ATOM   4677  H HH22 . ARG A 1 308 ? 31.418  116.428 89.243  1.00 32.56  ? 374  ARG A HH22 1 
ATOM   4678  N N    . ILE A 1 309 ? 36.296  114.029 94.548  1.00 47.68  ? 375  ILE A N    1 
ATOM   4679  C CA   . ILE A 1 309 ? 37.328  113.794 93.525  1.00 24.38  ? 375  ILE A CA   1 
ATOM   4680  C C    . ILE A 1 309 ? 37.322  112.364 92.965  1.00 35.69  ? 375  ILE A C    1 
ATOM   4681  O O    . ILE A 1 309 ? 37.399  112.194 91.755  1.00 29.42  ? 375  ILE A O    1 
ATOM   4682  C CB   . ILE A 1 309 ? 38.745  114.183 94.010  1.00 26.27  ? 375  ILE A CB   1 
ATOM   4683  C CG1  . ILE A 1 309 ? 38.787  115.688 94.265  1.00 33.23  ? 375  ILE A CG1  1 
ATOM   4684  C CG2  . ILE A 1 309 ? 39.809  113.819 92.966  1.00 19.16  ? 375  ILE A CG2  1 
ATOM   4685  C CD1  . ILE A 1 309 ? 40.107  116.226 94.762  1.00 31.46  ? 375  ILE A CD1  1 
ATOM   4686  H H    . ILE A 1 309 ? 36.605  114.142 95.342  1.00 57.22  ? 375  ILE A H    1 
ATOM   4687  H HA   . ILE A 1 309 ? 37.127  114.378 92.777  1.00 29.26  ? 375  ILE A HA   1 
ATOM   4688  H HB   . ILE A 1 309 ? 38.938  113.715 94.837  1.00 31.52  ? 375  ILE A HB   1 
ATOM   4689  H HG12 . ILE A 1 309 ? 38.580  116.145 93.436  1.00 39.88  ? 375  ILE A HG12 1 
ATOM   4690  H HG13 . ILE A 1 309 ? 38.116  115.905 94.931  1.00 39.88  ? 375  ILE A HG13 1 
ATOM   4691  H HG21 . ILE A 1 309 ? 40.682  114.076 93.302  1.00 22.99  ? 375  ILE A HG21 1 
ATOM   4692  H HG22 . ILE A 1 309 ? 39.783  112.862 92.810  1.00 22.99  ? 375  ILE A HG22 1 
ATOM   4693  H HG23 . ILE A 1 309 ? 39.619  114.294 92.142  1.00 22.99  ? 375  ILE A HG23 1 
ATOM   4694  H HD11 . ILE A 1 309 ? 40.028  117.184 94.892  1.00 37.75  ? 375  ILE A HD11 1 
ATOM   4695  H HD12 . ILE A 1 309 ? 40.328  115.795 95.602  1.00 37.75  ? 375  ILE A HD12 1 
ATOM   4696  H HD13 . ILE A 1 309 ? 40.793  116.036 94.102  1.00 37.75  ? 375  ILE A HD13 1 
ATOM   4697  N N    . VAL A 1 310 ? 37.235  111.338 93.810  1.00 28.42  ? 376  VAL A N    1 
ATOM   4698  C CA   . VAL A 1 310 ? 37.272  109.985 93.273  1.00 35.32  ? 376  VAL A CA   1 
ATOM   4699  C C    . VAL A 1 310 ? 36.016  109.718 92.464  1.00 35.75  ? 376  VAL A C    1 
ATOM   4700  O O    . VAL A 1 310 ? 36.008  108.842 91.617  1.00 44.48  ? 376  VAL A O    1 
ATOM   4701  C CB   . VAL A 1 310 ? 37.490  108.853 94.330  1.00 19.17  ? 376  VAL A CB   1 
ATOM   4702  C CG1  . VAL A 1 310 ? 38.468  109.269 95.404  1.00 19.48  ? 376  VAL A CG1  1 
ATOM   4703  C CG2  . VAL A 1 310 ? 36.190  108.401 94.944  1.00 70.33  ? 376  VAL A CG2  1 
ATOM   4704  H H    . VAL A 1 310 ? 37.157  111.396 94.664  1.00 34.10  ? 376  VAL A H    1 
ATOM   4705  H HA   . VAL A 1 310 ? 38.018  109.934 92.655  1.00 42.39  ? 376  VAL A HA   1 
ATOM   4706  H HB   . VAL A 1 310 ? 37.874  108.086 93.876  1.00 23.00  ? 376  VAL A HB   1 
ATOM   4707  H HG11 . VAL A 1 310 ? 38.573  108.540 96.035  1.00 23.38  ? 376  VAL A HG11 1 
ATOM   4708  H HG12 . VAL A 1 310 ? 39.322  109.475 94.991  1.00 23.38  ? 376  VAL A HG12 1 
ATOM   4709  H HG13 . VAL A 1 310 ? 38.123  110.054 95.859  1.00 23.38  ? 376  VAL A HG13 1 
ATOM   4710  H HG21 . VAL A 1 310 ? 36.373  107.702 95.591  1.00 84.40  ? 376  VAL A HG21 1 
ATOM   4711  H HG22 . VAL A 1 310 ? 35.769  109.157 95.384  1.00 84.40  ? 376  VAL A HG22 1 
ATOM   4712  H HG23 . VAL A 1 310 ? 35.612  108.061 94.244  1.00 84.40  ? 376  VAL A HG23 1 
ATOM   4713  N N    . SER A 1 311 ? 34.955  110.473 92.700  1.00 32.36  ? 377  SER A N    1 
ATOM   4714  C CA   . SER A 1 311 ? 33.720  110.242 91.953  1.00 46.54  ? 377  SER A CA   1 
ATOM   4715  C C    . SER A 1 311 ? 33.834  110.879 90.581  1.00 37.37  ? 377  SER A C    1 
ATOM   4716  O O    . SER A 1 311 ? 33.127  110.520 89.646  1.00 43.91  ? 377  SER A O    1 
ATOM   4717  C CB   . SER A 1 311 ? 32.521  110.816 92.701  1.00 47.01  ? 377  SER A CB   1 
ATOM   4718  O OG   . SER A 1 311 ? 32.434  112.205 92.489  1.00 40.93  ? 377  SER A OG   1 
ATOM   4719  H H    . SER A 1 311 ? 34.919  111.113 93.274  1.00 38.83  ? 377  SER A H    1 
ATOM   4720  H HA   . SER A 1 311 ? 33.584  109.289 91.839  1.00 55.84  ? 377  SER A HA   1 
ATOM   4721  H HB2  . SER A 1 311 ? 31.711  110.394 92.374  1.00 56.41  ? 377  SER A HB2  1 
ATOM   4722  H HB3  . SER A 1 311 ? 32.626  110.646 93.650  1.00 56.41  ? 377  SER A HB3  1 
ATOM   4723  H HG   . SER A 1 311 ? 33.132  112.582 92.766  1.00 49.12  ? 377  SER A HG   1 
ATOM   4724  N N    . MET A 1 312 ? 34.737  111.839 90.482  1.00 47.25  ? 378  MET A N    1 
ATOM   4725  C CA   . MET A 1 312 ? 35.038  112.484 89.216  1.00 48.72  ? 378  MET A CA   1 
ATOM   4726  C C    . MET A 1 312 ? 35.949  111.610 88.346  1.00 48.78  ? 378  MET A C    1 
ATOM   4727  O O    . MET A 1 312 ? 36.322  112.012 87.249  1.00 46.36  ? 378  MET A O    1 
ATOM   4728  C CB   . MET A 1 312 ? 35.697  113.848 89.464  1.00 35.62  ? 378  MET A CB   1 
ATOM   4729  C CG   . MET A 1 312 ? 34.723  114.961 89.762  1.00 35.87  ? 378  MET A CG   1 
ATOM   4730  S SD   . MET A 1 312 ? 35.454  116.591 89.718  1.00 43.50  ? 378  MET A SD   1 
ATOM   4731  C CE   . MET A 1 312 ? 35.687  116.845 91.437  1.00 35.06  ? 378  MET A CE   1 
ATOM   4732  H H    . MET A 1 312 ? 35.197  112.140 91.143  1.00 56.71  ? 378  MET A H    1 
ATOM   4733  H HA   . MET A 1 312 ? 34.208  112.639 88.740  1.00 58.47  ? 378  MET A HA   1 
ATOM   4734  H HB2  . MET A 1 312 ? 36.297  113.771 90.222  1.00 42.74  ? 378  MET A HB2  1 
ATOM   4735  H HB3  . MET A 1 312 ? 36.199  114.100 88.673  1.00 42.74  ? 378  MET A HB3  1 
ATOM   4736  H HG2  . MET A 1 312 ? 34.011  114.937 89.104  1.00 43.04  ? 378  MET A HG2  1 
ATOM   4737  H HG3  . MET A 1 312 ? 34.356  114.825 90.649  1.00 43.04  ? 378  MET A HG3  1 
ATOM   4738  H HE1  . MET A 1 312 ? 36.089  117.716 91.576  1.00 42.07  ? 378  MET A HE1  1 
ATOM   4739  H HE2  . MET A 1 312 ? 34.826  116.802 91.882  1.00 42.07  ? 378  MET A HE2  1 
ATOM   4740  H HE3  . MET A 1 312 ? 36.272  116.152 91.781  1.00 42.07  ? 378  MET A HE3  1 
ATOM   4741  N N    . THR A 1 313 ? 36.317  110.427 88.835  1.00 45.02  ? 379  THR A N    1 
ATOM   4742  C CA   . THR A 1 313 ? 37.027  109.463 88.001  1.00 41.23  ? 379  THR A CA   1 
ATOM   4743  C C    . THR A 1 313 ? 36.048  108.815 87.027  1.00 38.46  ? 379  THR A C    1 
ATOM   4744  O O    . THR A 1 313 ? 36.458  108.151 86.068  1.00 36.13  ? 379  THR A O    1 
ATOM   4745  C CB   . THR A 1 313 ? 37.738  108.369 88.828  1.00 32.73  ? 379  THR A CB   1 
ATOM   4746  O OG1  . THR A 1 313 ? 36.778  107.524 89.472  1.00 40.24  ? 379  THR A OG1  1 
ATOM   4747  C CG2  . THR A 1 313 ? 38.632  108.988 89.868  1.00 33.30  ? 379  THR A CG2  1 
ATOM   4748  H H    . THR A 1 313 ? 36.168  110.161 89.639  1.00 54.02  ? 379  THR A H    1 
ATOM   4749  H HA   . THR A 1 313 ? 37.701  109.930 87.482  1.00 49.47  ? 379  THR A HA   1 
ATOM   4750  H HB   . THR A 1 313 ? 38.289  107.831 88.238  1.00 39.28  ? 379  THR A HB   1 
ATOM   4751  H HG1  . THR A 1 313 ? 36.295  107.980 89.987  1.00 48.29  ? 379  THR A HG1  1 
ATOM   4752  H HG21 . THR A 1 313 ? 39.073  108.293 90.382  1.00 39.96  ? 379  THR A HG21 1 
ATOM   4753  H HG22 . THR A 1 313 ? 39.306  109.539 89.441  1.00 39.96  ? 379  THR A HG22 1 
ATOM   4754  H HG23 . THR A 1 313 ? 38.108  109.540 90.470  1.00 39.96  ? 379  THR A HG23 1 
ATOM   4755  N N    . LEU A 1 314 ? 34.753  109.013 87.286  1.00 26.87  ? 380  LEU A N    1 
ATOM   4756  C CA   . LEU A 1 314 ? 33.704  108.567 86.382  1.00 29.17  ? 380  LEU A CA   1 
ATOM   4757  C C    . LEU A 1 314 ? 32.863  109.754 85.884  1.00 43.12  ? 380  LEU A C    1 
ATOM   4758  O O    . LEU A 1 314 ? 31.685  109.615 85.555  1.00 46.54  ? 380  LEU A O    1 
ATOM   4759  C CB   . LEU A 1 314 ? 32.835  107.507 87.057  1.00 31.47  ? 380  LEU A CB   1 
ATOM   4760  C CG   . LEU A 1 314 ? 33.427  106.101 87.097  1.00 17.72  ? 380  LEU A CG   1 
ATOM   4761  C CD1  . LEU A 1 314 ? 32.669  105.240 88.077  1.00 35.95  ? 380  LEU A CD1  1 
ATOM   4762  C CD2  . LEU A 1 314 ? 33.397  105.480 85.730  1.00 29.79  ? 380  LEU A CD2  1 
ATOM   4763  H H    . LEU A 1 314 ? 34.458  109.410 87.990  1.00 32.25  ? 380  LEU A H    1 
ATOM   4764  H HA   . LEU A 1 314 ? 34.117  108.156 85.607  1.00 35.00  ? 380  LEU A HA   1 
ATOM   4765  H HB2  . LEU A 1 314 ? 32.674  107.781 87.974  1.00 37.76  ? 380  LEU A HB2  1 
ATOM   4766  H HB3  . LEU A 1 314 ? 31.991  107.454 86.582  1.00 37.76  ? 380  LEU A HB3  1 
ATOM   4767  H HG   . LEU A 1 314 ? 34.351  106.151 87.388  1.00 21.26  ? 380  LEU A HG   1 
ATOM   4768  H HD11 . LEU A 1 314 ? 33.062  104.353 88.086  1.00 43.14  ? 380  LEU A HD11 1 
ATOM   4769  H HD12 . LEU A 1 314 ? 32.730  105.638 88.959  1.00 43.14  ? 380  LEU A HD12 1 
ATOM   4770  H HD13 . LEU A 1 314 ? 31.741  105.189 87.800  1.00 43.14  ? 380  LEU A HD13 1 
ATOM   4771  H HD21 . LEU A 1 314 ? 33.777  104.589 85.780  1.00 35.74  ? 380  LEU A HD21 1 
ATOM   4772  H HD22 . LEU A 1 314 ? 32.477  105.432 85.426  1.00 35.74  ? 380  LEU A HD22 1 
ATOM   4773  H HD23 . LEU A 1 314 ? 33.918  106.029 85.123  1.00 35.74  ? 380  LEU A HD23 1 
ATOM   4774  N N    . ASP A 1 315 ? 33.487  110.924 85.807  1.00 34.70  ? 381  ASP A N    1 
ATOM   4775  C CA   . ASP A 1 315 ? 32.826  112.095 85.262  1.00 23.99  ? 381  ASP A CA   1 
ATOM   4776  C C    . ASP A 1 315 ? 32.261  111.750 83.892  1.00 24.31  ? 381  ASP A C    1 
ATOM   4777  O O    . ASP A 1 315 ? 32.841  110.941 83.175  1.00 33.44  ? 381  ASP A O    1 
ATOM   4778  C CB   . ASP A 1 315 ? 33.821  113.243 85.137  1.00 37.61  ? 381  ASP A CB   1 
ATOM   4779  C CG   . ASP A 1 315 ? 33.165  114.560 84.740  1.00 51.65  ? 381  ASP A CG   1 
ATOM   4780  O OD1  . ASP A 1 315 ? 32.738  114.690 83.569  1.00 44.57  ? 381  ASP A OD1  1 
ATOM   4781  O OD2  . ASP A 1 315 ? 33.050  115.457 85.615  1.00 60.90  ? 381  ASP A OD2  1 
ATOM   4782  H H    . ASP A 1 315 ? 34.295  111.063 86.064  1.00 41.64  ? 381  ASP A H    1 
ATOM   4783  H HA   . ASP A 1 315 ? 32.099  112.367 85.844  1.00 28.79  ? 381  ASP A HA   1 
ATOM   4784  H HB2  . ASP A 1 315 ? 34.260  113.373 85.993  1.00 45.14  ? 381  ASP A HB2  1 
ATOM   4785  H HB3  . ASP A 1 315 ? 34.478  113.019 84.459  1.00 45.14  ? 381  ASP A HB3  1 
ATOM   4786  N N    . LYS A 1 316 ? 31.127  112.360 83.548  1.00 37.96  ? 382  LYS A N    1 
ATOM   4787  C CA   . LYS A 1 316 ? 30.499  112.195 82.234  1.00 38.66  ? 382  LYS A CA   1 
ATOM   4788  C C    . LYS A 1 316 ? 31.429  112.598 81.085  1.00 40.65  ? 382  LYS A C    1 
ATOM   4789  O O    . LYS A 1 316 ? 31.458  111.946 80.042  1.00 43.17  ? 382  LYS A O    1 
ATOM   4790  C CB   . LYS A 1 316 ? 29.204  113.018 82.160  1.00 46.02  ? 382  LYS A CB   1 
ATOM   4791  C CG   . LYS A 1 316 ? 27.930  112.257 82.491  1.00 35.47  ? 382  LYS A CG   1 
ATOM   4792  C CD   . LYS A 1 316 ? 26.871  112.547 81.451  1.00 38.29  ? 382  LYS A CD   1 
ATOM   4793  C CE   . LYS A 1 316 ? 25.544  111.851 81.763  1.00 57.07  ? 382  LYS A CE   1 
ATOM   4794  N NZ   . LYS A 1 316 ? 24.879  112.376 82.993  1.00 64.54  ? 382  LYS A NZ   1 
ATOM   4795  H H    . LYS A 1 316 ? 30.692  112.887 84.070  1.00 45.55  ? 382  LYS A H    1 
ATOM   4796  H HA   . LYS A 1 316 ? 30.265  111.262 82.113  1.00 46.39  ? 382  LYS A HA   1 
ATOM   4797  H HB2  . LYS A 1 316 ? 29.273  113.757 82.785  1.00 55.22  ? 382  LYS A HB2  1 
ATOM   4798  H HB3  . LYS A 1 316 ? 29.111  113.365 81.259  1.00 55.22  ? 382  LYS A HB3  1 
ATOM   4799  H HG2  . LYS A 1 316 ? 28.111  111.305 82.490  1.00 42.56  ? 382  LYS A HG2  1 
ATOM   4800  H HG3  . LYS A 1 316 ? 27.598  112.541 83.357  1.00 42.56  ? 382  LYS A HG3  1 
ATOM   4801  H HD2  . LYS A 1 316 ? 26.710  113.503 81.420  1.00 45.95  ? 382  LYS A HD2  1 
ATOM   4802  H HD3  . LYS A 1 316 ? 27.180  112.233 80.587  1.00 45.95  ? 382  LYS A HD3  1 
ATOM   4803  H HE2  . LYS A 1 316 ? 24.938  111.982 81.017  1.00 68.48  ? 382  LYS A HE2  1 
ATOM   4804  H HE3  . LYS A 1 316 ? 25.709  110.904 81.894  1.00 68.48  ? 382  LYS A HE3  1 
ATOM   4805  H HZ1  . LYS A 1 316 ? 24.115  111.943 83.133  1.00 77.45  ? 382  LYS A HZ1  1 
ATOM   4806  H HZ2  . LYS A 1 316 ? 25.410  112.261 83.698  1.00 77.45  ? 382  LYS A HZ2  1 
ATOM   4807  H HZ3  . LYS A 1 316 ? 24.707  113.244 82.898  1.00 77.45  ? 382  LYS A HZ3  1 
ATOM   4808  N N    . GLU A 1 317 ? 32.164  113.688 81.271  1.00 37.97  ? 383  GLU A N    1 
ATOM   4809  C CA   . GLU A 1 317 ? 33.205  114.081 80.328  1.00 41.99  ? 383  GLU A CA   1 
ATOM   4810  C C    . GLU A 1 317 ? 34.456  113.252 80.589  1.00 39.04  ? 383  GLU A C    1 
ATOM   4811  O O    . GLU A 1 317 ? 34.968  113.259 81.700  1.00 31.85  ? 383  GLU A O    1 
ATOM   4812  C CB   . GLU A 1 317 ? 33.536  115.561 80.509  1.00 40.18  ? 383  GLU A CB   1 
ATOM   4813  C CG   . GLU A 1 317 ? 32.520  116.516 79.898  1.00 42.45  ? 383  GLU A CG   1 
ATOM   4814  C CD   . GLU A 1 317 ? 32.987  117.166 78.591  1.00 75.70  ? 383  GLU A CD   1 
ATOM   4815  O OE1  . GLU A 1 317 ? 34.015  116.736 78.013  1.00 65.28  ? 383  GLU A OE1  1 
ATOM   4816  O OE2  . GLU A 1 317 ? 32.301  118.108 78.129  1.00 94.15  ? 383  GLU A OE2  1 
ATOM   4817  H H    . GLU A 1 317 ? 32.079  114.221 81.940  1.00 45.57  ? 383  GLU A H    1 
ATOM   4818  H HA   . GLU A 1 317 ? 32.906  113.930 79.418  1.00 50.38  ? 383  GLU A HA   1 
ATOM   4819  H HB2  . GLU A 1 317 ? 33.587  115.754 81.458  1.00 48.21  ? 383  GLU A HB2  1 
ATOM   4820  H HB3  . GLU A 1 317 ? 34.394  115.740 80.093  1.00 48.21  ? 383  GLU A HB3  1 
ATOM   4821  H HG2  . GLU A 1 317 ? 31.705  116.025 79.710  1.00 50.94  ? 383  GLU A HG2  1 
ATOM   4822  H HG3  . GLU A 1 317 ? 32.338  117.225 80.534  1.00 50.94  ? 383  GLU A HG3  1 
ATOM   4823  N N    . TYR A 1 318 ? 34.949  112.542 79.577  1.00 36.17  ? 384  TYR A N    1 
ATOM   4824  C CA   . TYR A 1 318 ? 36.145  111.708 79.746  1.00 34.43  ? 384  TYR A CA   1 
ATOM   4825  C C    . TYR A 1 318 ? 37.403  112.521 79.996  1.00 29.93  ? 384  TYR A C    1 
ATOM   4826  O O    . TYR A 1 318 ? 38.250  112.107 80.770  1.00 40.03  ? 384  TYR A O    1 
ATOM   4827  C CB   . TYR A 1 318 ? 36.370  110.809 78.531  1.00 43.72  ? 384  TYR A CB   1 
ATOM   4828  C CG   . TYR A 1 318 ? 35.439  109.627 78.489  1.00 71.23  ? 384  TYR A CG   1 
ATOM   4829  C CD1  . TYR A 1 318 ? 35.496  108.647 79.474  1.00 86.39  ? 384  TYR A CD1  1 
ATOM   4830  C CD2  . TYR A 1 318 ? 34.501  109.481 77.466  1.00 74.24  ? 384  TYR A CD2  1 
ATOM   4831  C CE1  . TYR A 1 318 ? 34.646  107.548 79.445  1.00 95.02  ? 384  TYR A CE1  1 
ATOM   4832  C CE2  . TYR A 1 318 ? 33.645  108.383 77.429  1.00 78.19  ? 384  TYR A CE2  1 
ATOM   4833  C CZ   . TYR A 1 318 ? 33.727  107.421 78.422  1.00 87.32  ? 384  TYR A CZ   1 
ATOM   4834  O OH   . TYR A 1 318 ? 32.888  106.331 78.412  1.00 90.20  ? 384  TYR A OH   1 
ATOM   4835  H H    . TYR A 1 318 ? 34.614  112.523 78.785  1.00 43.41  ? 384  TYR A H    1 
ATOM   4836  H HA   . TYR A 1 318 ? 36.012  111.132 80.515  1.00 41.31  ? 384  TYR A HA   1 
ATOM   4837  H HB2  . TYR A 1 318 ? 36.229  111.329 77.725  1.00 52.47  ? 384  TYR A HB2  1 
ATOM   4838  H HB3  . TYR A 1 318 ? 37.279  110.473 78.553  1.00 52.47  ? 384  TYR A HB3  1 
ATOM   4839  H HD1  . TYR A 1 318 ? 36.116  108.727 80.163  1.00 103.66 ? 384  TYR A HD1  1 
ATOM   4840  H HD2  . TYR A 1 318 ? 34.448  110.125 76.798  1.00 89.09  ? 384  TYR A HD2  1 
ATOM   4841  H HE1  . TYR A 1 318 ? 34.696  106.901 80.111  1.00 114.03 ? 384  TYR A HE1  1 
ATOM   4842  H HE2  . TYR A 1 318 ? 33.023  108.296 76.743  1.00 93.83  ? 384  TYR A HE2  1 
ATOM   4843  H HH   . TYR A 1 318 ? 32.379  106.366 77.745  1.00 108.24 ? 384  TYR A HH   1 
ATOM   4844  N N    . ASP A 1 319 ? 37.520  113.675 79.345  1.00 40.63  ? 385  ASP A N    1 
ATOM   4845  C CA   . ASP A 1 319 ? 38.675  114.541 79.529  1.00 38.00  ? 385  ASP A CA   1 
ATOM   4846  C C    . ASP A 1 319 ? 38.806  114.920 80.990  1.00 38.84  ? 385  ASP A C    1 
ATOM   4847  O O    . ASP A 1 319 ? 39.917  115.033 81.499  1.00 65.62  ? 385  ASP A O    1 
ATOM   4848  C CB   . ASP A 1 319 ? 38.555  115.812 78.687  1.00 51.32  ? 385  ASP A CB   1 
ATOM   4849  C CG   . ASP A 1 319 ? 38.912  115.594 77.223  1.00 71.71  ? 385  ASP A CG   1 
ATOM   4850  O OD1  . ASP A 1 319 ? 39.115  114.431 76.816  1.00 77.91  ? 385  ASP A OD1  1 
ATOM   4851  O OD2  . ASP A 1 319 ? 38.975  116.593 76.472  1.00 86.02  ? 385  ASP A OD2  1 
ATOM   4852  H H    . ASP A 1 319 ? 36.939  113.979 78.789  1.00 48.75  ? 385  ASP A H    1 
ATOM   4853  H HA   . ASP A 1 319 ? 39.479  114.070 79.260  1.00 45.60  ? 385  ASP A HA   1 
ATOM   4854  H HB2  . ASP A 1 319 ? 37.640  116.132 78.727  1.00 61.59  ? 385  ASP A HB2  1 
ATOM   4855  H HB3  . ASP A 1 319 ? 39.156  116.485 79.044  1.00 61.59  ? 385  ASP A HB3  1 
ATOM   4856  N N    . VAL A 1 320 ? 37.672  115.109 81.662  1.00 39.73  ? 386  VAL A N    1 
ATOM   4857  C CA   . VAL A 1 320 ? 37.657  115.512 83.072  1.00 37.96  ? 386  VAL A CA   1 
ATOM   4858  C C    . VAL A 1 320 ? 38.007  114.338 83.971  1.00 39.54  ? 386  VAL A C    1 
ATOM   4859  O O    . VAL A 1 320 ? 38.631  114.503 85.020  1.00 40.22  ? 386  VAL A O    1 
ATOM   4860  C CB   . VAL A 1 320 ? 36.274  116.067 83.494  1.00 30.29  ? 386  VAL A CB   1 
ATOM   4861  C CG1  . VAL A 1 320 ? 36.218  116.324 84.981  1.00 32.29  ? 386  VAL A CG1  1 
ATOM   4862  C CG2  . VAL A 1 320 ? 35.973  117.341 82.750  1.00 34.02  ? 386  VAL A CG2  1 
ATOM   4863  H H    . VAL A 1 320 ? 36.889  115.009 81.322  1.00 47.68  ? 386  VAL A H    1 
ATOM   4864  H HA   . VAL A 1 320 ? 38.318  116.208 83.211  1.00 45.56  ? 386  VAL A HA   1 
ATOM   4865  H HB   . VAL A 1 320 ? 35.589  115.418 83.273  1.00 36.35  ? 386  VAL A HB   1 
ATOM   4866  H HG11 . VAL A 1 320 ? 35.341  116.670 85.208  1.00 38.74  ? 386  VAL A HG11 1 
ATOM   4867  H HG12 . VAL A 1 320 ? 36.377  115.491 85.451  1.00 38.74  ? 386  VAL A HG12 1 
ATOM   4868  H HG13 . VAL A 1 320 ? 36.900  116.973 85.215  1.00 38.74  ? 386  VAL A HG13 1 
ATOM   4869  H HG21 . VAL A 1 320 ? 35.104  117.671 83.029  1.00 40.82  ? 386  VAL A HG21 1 
ATOM   4870  H HG22 . VAL A 1 320 ? 36.658  117.996 82.956  1.00 40.82  ? 386  VAL A HG22 1 
ATOM   4871  H HG23 . VAL A 1 320 ? 35.966  117.156 81.798  1.00 40.82  ? 386  VAL A HG23 1 
ATOM   4872  N N    . ALA A 1 321 ? 37.593  113.147 83.563  1.00 35.53  ? 387  ALA A N    1 
ATOM   4873  C CA   . ALA A 1 321 ? 37.866  111.960 84.350  1.00 34.79  ? 387  ALA A CA   1 
ATOM   4874  C C    . ALA A 1 321 ? 39.358  111.613 84.360  1.00 29.97  ? 387  ALA A C    1 
ATOM   4875  O O    . ALA A 1 321 ? 39.836  111.044 85.329  1.00 29.77  ? 387  ALA A O    1 
ATOM   4876  C CB   . ALA A 1 321 ? 37.033  110.789 83.860  1.00 29.49  ? 387  ALA A CB   1 
ATOM   4877  H H    . ALA A 1 321 ? 37.154  113.001 82.838  1.00 42.63  ? 387  ALA A H    1 
ATOM   4878  H HA   . ALA A 1 321 ? 37.605  112.136 85.268  1.00 41.75  ? 387  ALA A HA   1 
ATOM   4879  H HB1  . ALA A 1 321 ? 37.234  110.010 84.402  1.00 35.39  ? 387  ALA A HB1  1 
ATOM   4880  H HB2  . ALA A 1 321 ? 36.093  111.015 83.942  1.00 35.39  ? 387  ALA A HB2  1 
ATOM   4881  H HB3  . ALA A 1 321 ? 37.252  110.612 82.932  1.00 35.39  ? 387  ALA A HB3  1 
ATOM   4882  N N    . VAL A 1 322 ? 40.095  111.952 83.303  1.00 28.30  ? 388  VAL A N    1 
ATOM   4883  C CA   . VAL A 1 322 ? 41.534  111.667 83.292  1.00 36.90  ? 388  VAL A CA   1 
ATOM   4884  C C    . VAL A 1 322 ? 42.239  112.506 84.359  1.00 31.29  ? 388  VAL A C    1 
ATOM   4885  O O    . VAL A 1 322 ? 42.919  111.988 85.241  1.00 32.22  ? 388  VAL A O    1 
ATOM   4886  C CB   . VAL A 1 322 ? 42.181  111.910 81.908  1.00 32.97  ? 388  VAL A CB   1 
ATOM   4887  C CG1  . VAL A 1 322 ? 43.695  111.918 82.019  1.00 37.86  ? 388  VAL A CG1  1 
ATOM   4888  C CG2  . VAL A 1 322 ? 41.782  110.841 80.936  1.00 25.36  ? 388  VAL A CG2  1 
ATOM   4889  H H    . VAL A 1 322 ? 39.797  112.340 82.595  1.00 33.96  ? 388  VAL A H    1 
ATOM   4890  H HA   . VAL A 1 322 ? 41.666  110.733 83.517  1.00 44.28  ? 388  VAL A HA   1 
ATOM   4891  H HB   . VAL A 1 322 ? 41.892  112.768 81.559  1.00 39.57  ? 388  VAL A HB   1 
ATOM   4892  H HG11 . VAL A 1 322 ? 44.075  112.072 81.140  1.00 45.43  ? 388  VAL A HG11 1 
ATOM   4893  H HG12 . VAL A 1 322 ? 43.963  112.627 82.625  1.00 45.43  ? 388  VAL A HG12 1 
ATOM   4894  H HG13 . VAL A 1 322 ? 43.991  111.060 82.362  1.00 45.43  ? 388  VAL A HG13 1 
ATOM   4895  H HG21 . VAL A 1 322 ? 42.202  111.020 80.080  1.00 30.44  ? 388  VAL A HG21 1 
ATOM   4896  H HG22 . VAL A 1 322 ? 42.076  109.981 81.276  1.00 30.44  ? 388  VAL A HG22 1 
ATOM   4897  H HG23 . VAL A 1 322 ? 40.817  110.847 80.839  1.00 30.44  ? 388  VAL A HG23 1 
ATOM   4898  N N    . GLN A 1 323 ? 42.041  113.808 84.279  1.00 28.30  ? 389  GLN A N    1 
ATOM   4899  C CA   . GLN A 1 323 ? 42.610  114.738 85.233  1.00 32.23  ? 389  GLN A CA   1 
ATOM   4900  C C    . GLN A 1 323 ? 42.222  114.440 86.667  1.00 25.35  ? 389  GLN A C    1 
ATOM   4901  O O    . GLN A 1 323 ? 42.978  114.739 87.560  1.00 48.16  ? 389  GLN A O    1 
ATOM   4902  C CB   . GLN A 1 323 ? 42.181  116.162 84.884  1.00 37.36  ? 389  GLN A CB   1 
ATOM   4903  C CG   . GLN A 1 323 ? 42.558  116.588 83.474  1.00 27.91  ? 389  GLN A CG   1 
ATOM   4904  C CD   . GLN A 1 323 ? 43.967  116.153 83.116  1.00 45.51  ? 389  GLN A CD   1 
ATOM   4905  O OE1  . GLN A 1 323 ? 44.899  116.280 83.922  1.00 41.59  ? 389  GLN A OE1  1 
ATOM   4906  N NE2  . GLN A 1 323 ? 44.123  115.600 81.918  1.00 36.14  ? 389  GLN A NE2  1 
ATOM   4907  H H    . GLN A 1 323 ? 41.569  114.186 83.667  1.00 33.96  ? 389  GLN A H    1 
ATOM   4908  H HA   . GLN A 1 323 ? 43.577  114.695 85.173  1.00 38.68  ? 389  GLN A HA   1 
ATOM   4909  H HB2  . GLN A 1 323 ? 41.216  116.227 84.965  1.00 44.84  ? 389  GLN A HB2  1 
ATOM   4910  H HB3  . GLN A 1 323 ? 42.605  116.777 85.503  1.00 44.84  ? 389  GLN A HB3  1 
ATOM   4911  H HG2  . GLN A 1 323 ? 41.945  116.181 82.842  1.00 33.49  ? 389  GLN A HG2  1 
ATOM   4912  H HG3  . GLN A 1 323 ? 42.513  117.555 83.409  1.00 33.49  ? 389  GLN A HG3  1 
ATOM   4913  H HE21 . GLN A 1 323 ? 43.446  115.506 81.396  1.00 43.37  ? 389  GLN A HE21 1 
ATOM   4914  H HE22 . GLN A 1 323 ? 44.901  115.336 81.665  1.00 43.37  ? 389  GLN A HE22 1 
ATOM   4915  N N    . ALA A 1 324 ? 41.060  113.857 86.918  1.00 31.35  ? 390  ALA A N    1 
ATOM   4916  C CA   . ALA A 1 324 ? 40.747  113.474 88.292  1.00 36.99  ? 390  ALA A CA   1 
ATOM   4917  C C    . ALA A 1 324 ? 41.638  112.301 88.747  1.00 38.18  ? 390  ALA A C    1 
ATOM   4918  O O    . ALA A 1 324 ? 42.008  112.229 89.915  1.00 41.27  ? 390  ALA A O    1 
ATOM   4919  C CB   . ALA A 1 324 ? 39.268  113.130 88.449  1.00 29.26  ? 390  ALA A CB   1 
ATOM   4920  H H    . ALA A 1 324 ? 40.453  113.677 86.336  1.00 37.62  ? 390  ALA A H    1 
ATOM   4921  H HA   . ALA A 1 324 ? 40.935  114.227 88.873  1.00 44.39  ? 390  ALA A HA   1 
ATOM   4922  H HB1  . ALA A 1 324 ? 39.098  112.881 89.371  1.00 35.11  ? 390  ALA A HB1  1 
ATOM   4923  H HB2  . ALA A 1 324 ? 38.737  113.906 88.212  1.00 35.11  ? 390  ALA A HB2  1 
ATOM   4924  H HB3  . ALA A 1 324 ? 39.053  112.389 87.861  1.00 35.11  ? 390  ALA A HB3  1 
ATOM   4925  N N    . ILE A 1 325 ? 41.987  111.388 87.837  1.00 26.58  ? 391  ILE A N    1 
ATOM   4926  C CA   . ILE A 1 325 ? 42.821  110.255 88.212  1.00 23.69  ? 391  ILE A CA   1 
ATOM   4927  C C    . ILE A 1 325 ? 44.250  110.704 88.347  1.00 25.36  ? 391  ILE A C    1 
ATOM   4928  O O    . ILE A 1 325 ? 44.955  110.273 89.252  1.00 42.75  ? 391  ILE A O    1 
ATOM   4929  C CB   . ILE A 1 325 ? 42.782  109.105 87.206  1.00 31.13  ? 391  ILE A CB   1 
ATOM   4930  C CG1  . ILE A 1 325 ? 41.353  108.587 87.036  1.00 44.20  ? 391  ILE A CG1  1 
ATOM   4931  C CG2  . ILE A 1 325 ? 43.641  107.962 87.703  1.00 33.76  ? 391  ILE A CG2  1 
ATOM   4932  C CD1  . ILE A 1 325 ? 41.191  107.563 85.943  1.00 29.24  ? 391  ILE A CD1  1 
ATOM   4933  H H    . ILE A 1 325 ? 41.756  111.405 87.009  1.00 31.89  ? 391  ILE A H    1 
ATOM   4934  H HA   . ILE A 1 325 ? 42.527  109.915 89.072  1.00 28.43  ? 391  ILE A HA   1 
ATOM   4935  H HB   . ILE A 1 325 ? 43.118  109.413 86.349  1.00 37.36  ? 391  ILE A HB   1 
ATOM   4936  H HG12 . ILE A 1 325 ? 41.071  108.176 87.868  1.00 53.04  ? 391  ILE A HG12 1 
ATOM   4937  H HG13 . ILE A 1 325 ? 40.774  109.336 86.827  1.00 53.04  ? 391  ILE A HG13 1 
ATOM   4938  H HG21 . ILE A 1 325 ? 43.609  107.239 87.057  1.00 40.51  ? 391  ILE A HG21 1 
ATOM   4939  H HG22 . ILE A 1 325 ? 44.554  108.275 87.804  1.00 40.51  ? 391  ILE A HG22 1 
ATOM   4940  H HG23 . ILE A 1 325 ? 43.298  107.659 88.558  1.00 40.51  ? 391  ILE A HG23 1 
ATOM   4941  H HD11 . ILE A 1 325 ? 40.261  107.290 85.903  1.00 35.08  ? 391  ILE A HD11 1 
ATOM   4942  H HD12 . ILE A 1 325 ? 41.456  107.960 85.098  1.00 35.08  ? 391  ILE A HD12 1 
ATOM   4943  H HD13 . ILE A 1 325 ? 41.753  106.798 86.141  1.00 35.08  ? 391  ILE A HD13 1 
ATOM   4944  N N    . LYS A 1 326 ? 44.683  111.562 87.435  1.00 38.39  ? 392  LYS A N    1 
ATOM   4945  C CA   . LYS A 1 326 ? 46.024  112.111 87.497  1.00 22.07  ? 392  LYS A CA   1 
ATOM   4946  C C    . LYS A 1 326 ? 46.215  112.874 88.787  1.00 25.13  ? 392  LYS A C    1 
ATOM   4947  O O    . LYS A 1 326 ? 47.256  112.757 89.436  1.00 41.08  ? 392  LYS A O    1 
ATOM   4948  C CB   . LYS A 1 326 ? 46.295  112.979 86.289  1.00 18.21  ? 392  LYS A CB   1 
ATOM   4949  C CG   . LYS A 1 326 ? 46.385  112.140 85.018  1.00 37.18  ? 392  LYS A CG   1 
ATOM   4950  C CD   . LYS A 1 326 ? 47.105  112.847 83.887  1.00 33.18  ? 392  LYS A CD   1 
ATOM   4951  C CE   . LYS A 1 326 ? 47.678  111.836 82.909  1.00 43.98  ? 392  LYS A CE   1 
ATOM   4952  N NZ   . LYS A 1 326 ? 48.595  112.466 81.921  1.00 47.61  ? 392  LYS A NZ   1 
ATOM   4953  H H    . LYS A 1 326 ? 44.218  111.842 86.769  1.00 46.07  ? 392  LYS A H    1 
ATOM   4954  H HA   . LYS A 1 326 ? 46.662  111.380 87.487  1.00 26.48  ? 392  LYS A HA   1 
ATOM   4955  H HB2  . LYS A 1 326 ? 45.572  113.617 86.183  1.00 21.85  ? 392  LYS A HB2  1 
ATOM   4956  H HB3  . LYS A 1 326 ? 47.139  113.442 86.409  1.00 21.85  ? 392  LYS A HB3  1 
ATOM   4957  H HG2  . LYS A 1 326 ? 46.868  111.322 85.214  1.00 44.61  ? 392  LYS A HG2  1 
ATOM   4958  H HG3  . LYS A 1 326 ? 45.488  111.930 84.715  1.00 44.61  ? 392  LYS A HG3  1 
ATOM   4959  H HD2  . LYS A 1 326 ? 46.480  113.415 83.411  1.00 39.82  ? 392  LYS A HD2  1 
ATOM   4960  H HD3  . LYS A 1 326 ? 47.835  113.373 84.248  1.00 39.82  ? 392  LYS A HD3  1 
ATOM   4961  H HE2  . LYS A 1 326 ? 48.178  111.166 83.401  1.00 52.77  ? 392  LYS A HE2  1 
ATOM   4962  H HE3  . LYS A 1 326 ? 46.951  111.418 82.422  1.00 52.77  ? 392  LYS A HE3  1 
ATOM   4963  H HZ1  . LYS A 1 326 ? 48.913  111.849 81.364  1.00 57.13  ? 392  LYS A HZ1  1 
ATOM   4964  H HZ2  . LYS A 1 326 ? 48.158  113.082 81.451  1.00 57.13  ? 392  LYS A HZ2  1 
ATOM   4965  H HZ3  . LYS A 1 326 ? 49.277  112.853 82.343  1.00 57.13  ? 392  LYS A HZ3  1 
ATOM   4966  N N    . LEU A 1 327 ? 45.194  113.610 89.199  1.00 28.31  ? 393  LEU A N    1 
ATOM   4967  C CA   . LEU A 1 327 ? 45.255  114.289 90.487  1.00 33.59  ? 393  LEU A CA   1 
ATOM   4968  C C    . LEU A 1 327 ? 45.277  113.294 91.626  1.00 28.13  ? 393  LEU A C    1 
ATOM   4969  O O    . LEU A 1 327 ? 45.945  113.529 92.616  1.00 35.71  ? 393  LEU A O    1 
ATOM   4970  C CB   . LEU A 1 327 ? 44.086  115.245 90.682  1.00 26.32  ? 393  LEU A CB   1 
ATOM   4971  C CG   . LEU A 1 327 ? 44.079  115.943 92.042  1.00 18.80  ? 393  LEU A CG   1 
ATOM   4972  C CD1  . LEU A 1 327 ? 45.171  116.990 92.110  1.00 30.89  ? 393  LEU A CD1  1 
ATOM   4973  C CD2  . LEU A 1 327 ? 42.729  116.558 92.276  1.00 36.68  ? 393  LEU A CD2  1 
ATOM   4974  H H    . LEU A 1 327 ? 44.464  113.733 88.761  1.00 33.98  ? 393  LEU A H    1 
ATOM   4975  H HA   . LEU A 1 327 ? 46.074  114.807 90.529  1.00 40.31  ? 393  LEU A HA   1 
ATOM   4976  H HB2  . LEU A 1 327 ? 44.125  115.930 89.997  1.00 31.58  ? 393  LEU A HB2  1 
ATOM   4977  H HB3  . LEU A 1 327 ? 43.258  114.746 90.601  1.00 31.58  ? 393  LEU A HB3  1 
ATOM   4978  H HG   . LEU A 1 327 ? 44.241  115.289 92.739  1.00 22.56  ? 393  LEU A HG   1 
ATOM   4979  H HD11 . LEU A 1 327 ? 45.145  117.417 92.981  1.00 37.07  ? 393  LEU A HD11 1 
ATOM   4980  H HD12 . LEU A 1 327 ? 46.030  116.558 91.979  1.00 37.07  ? 393  LEU A HD12 1 
ATOM   4981  H HD13 . LEU A 1 327 ? 45.021  117.648 91.414  1.00 37.07  ? 393  LEU A HD13 1 
ATOM   4982  H HD21 . LEU A 1 327 ? 42.730  117.000 93.139  1.00 44.02  ? 393  LEU A HD21 1 
ATOM   4983  H HD22 . LEU A 1 327 ? 42.550  117.202 91.574  1.00 44.02  ? 393  LEU A HD22 1 
ATOM   4984  H HD23 . LEU A 1 327 ? 42.058  115.858 92.262  1.00 44.02  ? 393  LEU A HD23 1 
ATOM   4985  N N    . LEU A 1 328 ? 44.539  112.196 91.507  1.00 26.41  ? 394  LEU A N    1 
ATOM   4986  C CA   . LEU A 1 328 ? 44.532  111.200 92.579  1.00 39.91  ? 394  LEU A CA   1 
ATOM   4987  C C    . LEU A 1 328 ? 45.859  110.468 92.651  1.00 37.05  ? 394  LEU A C    1 
ATOM   4988  O O    . LEU A 1 328 ? 46.207  109.892 93.675  1.00 36.96  ? 394  LEU A O    1 
ATOM   4989  C CB   . LEU A 1 328 ? 43.401  110.195 92.411  1.00 35.00  ? 394  LEU A CB   1 
ATOM   4990  C CG   . LEU A 1 328 ? 42.018  110.734 92.769  1.00 41.46  ? 394  LEU A CG   1 
ATOM   4991  C CD1  . LEU A 1 328 ? 40.986  109.698 92.403  1.00 52.65  ? 394  LEU A CD1  1 
ATOM   4992  C CD2  . LEU A 1 328 ? 41.905  111.120 94.245  1.00 34.36  ? 394  LEU A CD2  1 
ATOM   4993  H H    . LEU A 1 328 ? 44.042  112.003 90.832  1.00 31.69  ? 394  LEU A H    1 
ATOM   4994  H HA   . LEU A 1 328 ? 44.400  111.655 93.426  1.00 47.90  ? 394  LEU A HA   1 
ATOM   4995  H HB2  . LEU A 1 328 ? 43.375  109.909 91.484  1.00 42.00  ? 394  LEU A HB2  1 
ATOM   4996  H HB3  . LEU A 1 328 ? 43.577  109.432 92.983  1.00 42.00  ? 394  LEU A HB3  1 
ATOM   4997  H HG   . LEU A 1 328 ? 41.844  111.528 92.239  1.00 49.76  ? 394  LEU A HG   1 
ATOM   4998  H HD11 . LEU A 1 328 ? 40.106  110.036 92.629  1.00 63.17  ? 394  LEU A HD11 1 
ATOM   4999  H HD12 . LEU A 1 328 ? 41.040  109.522 91.451  1.00 63.17  ? 394  LEU A HD12 1 
ATOM   5000  H HD13 . LEU A 1 328 ? 41.166  108.885 92.900  1.00 63.17  ? 394  LEU A HD13 1 
ATOM   5001  H HD21 . LEU A 1 328 ? 41.010  111.454 94.416  1.00 41.23  ? 394  LEU A HD21 1 
ATOM   5002  H HD22 . LEU A 1 328 ? 42.075  110.336 94.790  1.00 41.23  ? 394  LEU A HD22 1 
ATOM   5003  H HD23 . LEU A 1 328 ? 42.559  111.809 94.442  1.00 41.23  ? 394  LEU A HD23 1 
ATOM   5004  N N    . THR A 1 329 ? 46.600  110.501 91.554  1.00 41.93  ? 395  THR A N    1 
ATOM   5005  C CA   . THR A 1 329 ? 47.948  109.975 91.553  1.00 49.78  ? 395  THR A CA   1 
ATOM   5006  C C    . THR A 1 329 ? 48.893  110.925 92.305  1.00 54.73  ? 395  THR A C    1 
ATOM   5007  O O    . THR A 1 329 ? 49.646  110.486 93.174  1.00 51.31  ? 395  THR A O    1 
ATOM   5008  C CB   . THR A 1 329 ? 48.441  109.721 90.120  1.00 40.94  ? 395  THR A CB   1 
ATOM   5009  O OG1  . THR A 1 329 ? 47.511  108.864 89.441  1.00 54.28  ? 395  THR A OG1  1 
ATOM   5010  C CG2  . THR A 1 329 ? 49.800  109.053 90.136  1.00 34.15  ? 395  THR A CG2  1 
ATOM   5011  H H    . THR A 1 329 ? 46.344  110.822 90.799  1.00 50.32  ? 395  THR A H    1 
ATOM   5012  H HA   . THR A 1 329 ? 47.951  109.125 92.020  1.00 59.73  ? 395  THR A HA   1 
ATOM   5013  H HB   . THR A 1 329 ? 48.514  110.564 89.646  1.00 49.12  ? 395  THR A HB   1 
ATOM   5014  H HG1  . THR A 1 329 ? 46.754  109.226 89.413  1.00 65.14  ? 395  THR A HG1  1 
ATOM   5015  H HG21 . THR A 1 329 ? 50.103  108.897 89.228  1.00 40.98  ? 395  THR A HG21 1 
ATOM   5016  H HG22 . THR A 1 329 ? 50.442  109.621 90.590  1.00 40.98  ? 395  THR A HG22 1 
ATOM   5017  H HG23 . THR A 1 329 ? 49.746  108.204 90.601  1.00 40.98  ? 395  THR A HG23 1 
ATOM   5018  N N    . LEU A 1 330 ? 48.853  112.216 91.982  1.00 48.74  ? 396  LEU A N    1 
ATOM   5019  C CA   . LEU A 1 330 ? 49.714  113.190 92.654  1.00 30.91  ? 396  LEU A CA   1 
ATOM   5020  C C    . LEU A 1 330 ? 49.443  113.184 94.148  1.00 41.58  ? 396  LEU A C    1 
ATOM   5021  O O    . LEU A 1 330 ? 50.363  113.295 94.959  1.00 54.01  ? 396  LEU A O    1 
ATOM   5022  C CB   . LEU A 1 330 ? 49.472  114.591 92.108  1.00 34.37  ? 396  LEU A CB   1 
ATOM   5023  C CG   . LEU A 1 330 ? 49.979  114.855 90.696  1.00 23.50  ? 396  LEU A CG   1 
ATOM   5024  C CD1  . LEU A 1 330 ? 49.411  116.146 90.173  1.00 37.84  ? 396  LEU A CD1  1 
ATOM   5025  C CD2  . LEU A 1 330 ? 51.468  114.908 90.681  1.00 25.05  ? 396  LEU A CD2  1 
ATOM   5026  H H    . LEU A 1 330 ? 48.340  112.553 91.381  1.00 58.49  ? 396  LEU A H    1 
ATOM   5027  H HA   . LEU A 1 330 ? 50.644  112.957 92.507  1.00 37.09  ? 396  LEU A HA   1 
ATOM   5028  H HB2  . LEU A 1 330 ? 48.517  114.758 92.109  1.00 41.24  ? 396  LEU A HB2  1 
ATOM   5029  H HB3  . LEU A 1 330 ? 49.910  115.227 92.696  1.00 41.24  ? 396  LEU A HB3  1 
ATOM   5030  H HG   . LEU A 1 330 ? 49.692  114.136 90.111  1.00 28.20  ? 396  LEU A HG   1 
ATOM   5031  H HD11 . LEU A 1 330 ? 49.744  116.296 89.275  1.00 45.40  ? 396  LEU A HD11 1 
ATOM   5032  H HD12 . LEU A 1 330 ? 48.443  116.083 90.161  1.00 45.40  ? 396  LEU A HD12 1 
ATOM   5033  H HD13 . LEU A 1 330 ? 49.689  116.871 90.755  1.00 45.40  ? 396  LEU A HD13 1 
ATOM   5034  H HD21 . LEU A 1 330 ? 51.769  115.077 89.775  1.00 30.06  ? 396  LEU A HD21 1 
ATOM   5035  H HD22 . LEU A 1 330 ? 51.764  115.623 91.267  1.00 30.06  ? 396  LEU A HD22 1 
ATOM   5036  H HD23 . LEU A 1 330 ? 51.817  114.059 90.993  1.00 30.06  ? 396  LEU A HD23 1 
ATOM   5037  N N    . VAL A 1 331 ? 48.172  113.061 94.508  1.00 36.52  ? 397  VAL A N    1 
ATOM   5038  C CA   . VAL A 1 331 ? 47.778  112.987 95.911  1.00 41.56  ? 397  VAL A CA   1 
ATOM   5039  C C    . VAL A 1 331 ? 48.479  111.826 96.598  1.00 53.05  ? 397  VAL A C    1 
ATOM   5040  O O    . VAL A 1 331 ? 48.904  111.925 97.741  1.00 54.29  ? 397  VAL A O    1 
ATOM   5041  C CB   . VAL A 1 331 ? 46.272  112.792 96.036  1.00 22.37  ? 397  VAL A CB   1 
ATOM   5042  C CG1  . VAL A 1 331 ? 45.888  112.282 97.430  1.00 43.53  ? 397  VAL A CG1  1 
ATOM   5043  C CG2  . VAL A 1 331 ? 45.571  114.077 95.741  1.00 28.49  ? 397  VAL A CG2  1 
ATOM   5044  H H    . VAL A 1 331 ? 47.514  113.019 93.956  1.00 43.82  ? 397  VAL A H    1 
ATOM   5045  H HA   . VAL A 1 331 ? 48.023  113.809 96.363  1.00 49.88  ? 397  VAL A HA   1 
ATOM   5046  H HB   . VAL A 1 331 ? 45.982  112.135 95.384  1.00 26.85  ? 397  VAL A HB   1 
ATOM   5047  H HG11 . VAL A 1 331 ? 44.925  112.171 97.470  1.00 52.23  ? 397  VAL A HG11 1 
ATOM   5048  H HG12 . VAL A 1 331 ? 46.326  111.431 97.586  1.00 52.23  ? 397  VAL A HG12 1 
ATOM   5049  H HG13 . VAL A 1 331 ? 46.175  112.929 98.092  1.00 52.23  ? 397  VAL A HG13 1 
ATOM   5050  H HG21 . VAL A 1 331 ? 44.614  113.941 95.824  1.00 34.19  ? 397  VAL A HG21 1 
ATOM   5051  H HG22 . VAL A 1 331 ? 45.866  114.750 96.375  1.00 34.19  ? 397  VAL A HG22 1 
ATOM   5052  H HG23 . VAL A 1 331 ? 45.789  114.355 94.837  1.00 34.19  ? 397  VAL A HG23 1 
ATOM   5053  N N    . LEU A 1 332 ? 48.585  110.727 95.866  1.00 68.47  ? 398  LEU A N    1 
ATOM   5054  C CA   . LEU A 1 332 ? 49.172  109.489 96.346  1.00 52.33  ? 398  LEU A CA   1 
ATOM   5055  C C    . LEU A 1 332 ? 50.616  109.675 96.756  1.00 57.74  ? 398  LEU A C    1 
ATOM   5056  O O    . LEU A 1 332 ? 51.074  109.074 97.728  1.00 67.82  ? 398  LEU A O    1 
ATOM   5057  C CB   . LEU A 1 332 ? 49.133  108.475 95.215  1.00 38.43  ? 398  LEU A CB   1 
ATOM   5058  C CG   . LEU A 1 332 ? 49.047  107.004 95.553  1.00 52.48  ? 398  LEU A CG   1 
ATOM   5059  C CD1  . LEU A 1 332 ? 47.777  106.706 96.331  1.00 76.29  ? 398  LEU A CD1  1 
ATOM   5060  C CD2  . LEU A 1 332 ? 49.081  106.236 94.250  1.00 50.33  ? 398  LEU A CD2  1 
ATOM   5061  H H    . LEU A 1 332 ? 48.310  110.674 95.053  1.00 82.17  ? 398  LEU A H    1 
ATOM   5062  H HA   . LEU A 1 332 ? 48.667  109.147 97.099  1.00 62.80  ? 398  LEU A HA   1 
ATOM   5063  H HB2  . LEU A 1 332 ? 48.361  108.680 94.663  1.00 46.12  ? 398  LEU A HB2  1 
ATOM   5064  H HB3  . LEU A 1 332 ? 49.937  108.593 94.686  1.00 46.12  ? 398  LEU A HB3  1 
ATOM   5065  H HG   . LEU A 1 332 ? 49.812  106.744 96.090  1.00 62.97  ? 398  LEU A HG   1 
ATOM   5066  H HD11 . LEU A 1 332 ? 47.747  105.758 96.534  1.00 91.55  ? 398  LEU A HD11 1 
ATOM   5067  H HD12 . LEU A 1 332 ? 47.782  107.221 97.153  1.00 91.55  ? 398  LEU A HD12 1 
ATOM   5068  H HD13 . LEU A 1 332 ? 47.011  106.953 95.790  1.00 91.55  ? 398  LEU A HD13 1 
ATOM   5069  H HD21 . LEU A 1 332 ? 49.027  105.287 94.442  1.00 60.40  ? 398  LEU A HD21 1 
ATOM   5070  H HD22 . LEU A 1 332 ? 48.326  106.507 93.704  1.00 60.40  ? 398  LEU A HD22 1 
ATOM   5071  H HD23 . LEU A 1 332 ? 49.911  106.434 93.788  1.00 60.40  ? 398  LEU A HD23 1 
ATOM   5072  N N    . GLN A 1 333 ? 51.339  110.485 95.989  1.00 73.63  ? 399  GLN A N    1 
ATOM   5073  C CA   . GLN A 1 333 ? 52.764  110.672 96.219  1.00 76.15  ? 399  GLN A CA   1 
ATOM   5074  C C    . GLN A 1 333 ? 52.971  111.358 97.569  1.00 69.80  ? 399  GLN A C    1 
ATOM   5075  O O    . GLN A 1 333 ? 53.593  110.788 98.460  1.00 86.24  ? 399  GLN A O    1 
ATOM   5076  C CB   . GLN A 1 333 ? 53.408  111.461 95.071  1.00 72.15  ? 399  GLN A CB   1 
ATOM   5077  C CG   . GLN A 1 333 ? 53.213  110.816 93.680  1.00 75.21  ? 399  GLN A CG   1 
ATOM   5078  C CD   . GLN A 1 333 ? 53.696  111.689 92.501  1.00 89.02  ? 399  GLN A CD   1 
ATOM   5079  O OE1  . GLN A 1 333 ? 53.364  111.416 91.340  1.00 81.86  ? 399  GLN A OE1  1 
ATOM   5080  N NE2  . GLN A 1 333 ? 54.469  112.736 92.796  1.00 84.27  ? 399  GLN A NE2  1 
ATOM   5081  H H    . GLN A 1 333 ? 51.027  110.937 95.328  1.00 88.36  ? 399  GLN A H    1 
ATOM   5082  H HA   . GLN A 1 333 ? 53.192  109.802 96.259  1.00 91.38  ? 399  GLN A HA   1 
ATOM   5083  H HB2  . GLN A 1 333 ? 53.015  112.348 95.043  1.00 86.58  ? 399  GLN A HB2  1 
ATOM   5084  H HB3  . GLN A 1 333 ? 54.361  111.529 95.235  1.00 86.58  ? 399  GLN A HB3  1 
ATOM   5085  H HG2  . GLN A 1 333 ? 53.709  109.982 93.652  1.00 90.25  ? 399  GLN A HG2  1 
ATOM   5086  H HG3  . GLN A 1 333 ? 52.269  110.639 93.548  1.00 90.25  ? 399  GLN A HG3  1 
ATOM   5087  H HE21 . GLN A 1 333 ? 54.677  112.900 93.614  1.00 101.13 ? 399  GLN A HE21 1 
ATOM   5088  H HE22 . GLN A 1 333 ? 54.758  113.247 92.167  1.00 101.13 ? 399  GLN A HE22 1 
ATOM   5089  N N    . SER A 1 334 ? 52.426  112.559 97.732  1.00 51.35  ? 400  SER A N    1 
ATOM   5090  C CA   . SER A 1 334 ? 52.498  113.262 99.012  1.00 73.65  ? 400  SER A CA   1 
ATOM   5091  C C    . SER A 1 334 ? 52.055  112.430 100.215 1.00 79.60  ? 400  SER A C    1 
ATOM   5092  O O    . SER A 1 334 ? 52.541  112.649 101.319 1.00 89.33  ? 400  SER A O    1 
ATOM   5093  C CB   . SER A 1 334 ? 51.647  114.538 98.972  1.00 89.25  ? 400  SER A CB   1 
ATOM   5094  O OG   . SER A 1 334 ? 50.274  114.245 98.746  1.00 94.00  ? 400  SER A OG   1 
ATOM   5095  H H    . SER A 1 334 ? 52.008  112.990 97.117  1.00 61.62  ? 400  SER A H    1 
ATOM   5096  H HA   . SER A 1 334 ? 53.418  113.529 99.164  1.00 88.38  ? 400  SER A HA   1 
ATOM   5097  H HB2  . SER A 1 334 ? 51.734  114.999 99.821  1.00 107.10 ? 400  SER A HB2  1 
ATOM   5098  H HB3  . SER A 1 334 ? 51.968  115.106 98.254  1.00 107.10 ? 400  SER A HB3  1 
ATOM   5099  H HG   . SER A 1 334 ? 50.182  113.846 98.012  1.00 112.81 ? 400  SER A HG   1 
ATOM   5100  N N    . SER A 1 335 ? 51.137  111.487 100.016 1.00 88.22  ? 401  SER A N    1 
ATOM   5101  C CA   . SER A 1 335 ? 50.630  110.689 101.134 1.00 97.19  ? 401  SER A CA   1 
ATOM   5102  C C    . SER A 1 335 ? 49.555  109.651 100.748 1.00 98.58  ? 401  SER A C    1 
ATOM   5103  O O    . SER A 1 335 ? 48.640  109.944 99.980  1.00 104.03 ? 401  SER A O    1 
ATOM   5104  C CB   . SER A 1 335 ? 50.051  111.635 102.191 1.00 107.19 ? 401  SER A CB   1 
ATOM   5105  O OG   . SER A 1 335 ? 49.459  112.767 101.564 1.00 108.27 ? 401  SER A OG   1 
ATOM   5106  H H    . SER A 1 335 ? 50.793  111.291 99.253  1.00 105.87 ? 401  SER A H    1 
ATOM   5107  H HA   . SER A 1 335 ? 51.371  110.211 101.537 1.00 116.63 ? 401  SER A HA   1 
ATOM   5108  H HB2  . SER A 1 335 ? 49.374  111.164 102.702 1.00 128.63 ? 401  SER A HB2  1 
ATOM   5109  H HB3  . SER A 1 335 ? 50.765  111.932 102.777 1.00 128.63 ? 401  SER A HB3  1 
ATOM   5110  H HG   . SER A 1 335 ? 49.142  113.284 102.145 1.00 129.92 ? 401  SER A HG   1 
ATOM   5111  N N    . GLU A 1 336 ? 49.665  108.441 101.293 1.00 102.82 ? 402  GLU A N    1 
ATOM   5112  C CA   . GLU A 1 336 ? 48.660  107.397 101.075 1.00 102.82 ? 402  GLU A CA   1 
ATOM   5113  C C    . GLU A 1 336 ? 47.533  107.499 102.097 1.00 99.98  ? 402  GLU A C    1 
ATOM   5114  O O    . GLU A 1 336 ? 46.655  106.639 102.153 1.00 112.49 ? 402  GLU A O    1 
ATOM   5115  C CB   . GLU A 1 336 ? 49.280  106.003 101.215 1.00 109.57 ? 402  GLU A CB   1 
ATOM   5116  C CG   . GLU A 1 336 ? 50.393  105.669 100.226 1.00 110.61 ? 402  GLU A CG   1 
ATOM   5117  C CD   . GLU A 1 336 ? 51.781  106.084 100.719 1.00 112.36 ? 402  GLU A CD   1 
ATOM   5118  O OE1  . GLU A 1 336 ? 51.886  107.106 101.431 1.00 116.42 ? 402  GLU A OE1  1 
ATOM   5119  O OE2  . GLU A 1 336 ? 52.766  105.380 100.404 1.00 107.20 ? 402  GLU A OE2  1 
ATOM   5120  H H    . GLU A 1 336 ? 50.317  108.197 101.798 1.00 123.39 ? 402  GLU A H    1 
ATOM   5121  H HA   . GLU A 1 336 ? 48.284  107.484 100.185 1.00 123.39 ? 402  GLU A HA   1 
ATOM   5122  H HB2  . GLU A 1 336 ? 49.651  105.922 102.107 1.00 131.49 ? 402  GLU A HB2  1 
ATOM   5123  H HB3  . GLU A 1 336 ? 48.579  105.344 101.096 1.00 131.49 ? 402  GLU A HB3  1 
ATOM   5124  H HG2  . GLU A 1 336 ? 50.404  104.710 100.077 1.00 132.74 ? 402  GLU A HG2  1 
ATOM   5125  H HG3  . GLU A 1 336 ? 50.222  106.132 99.391  1.00 132.74 ? 402  GLU A HG3  1 
ATOM   5126  N N    . GLU A 1 337 ? 47.572  108.555 102.900 1.00 94.93  ? 403  GLU A N    1 
ATOM   5127  C CA   . GLU A 1 337 ? 46.692  108.709 104.044 1.00 86.56  ? 403  GLU A CA   1 
ATOM   5128  C C    . GLU A 1 337 ? 45.231  108.736 103.592 1.00 81.75  ? 403  GLU A C    1 
ATOM   5129  O O    . GLU A 1 337 ? 44.444  107.866 103.966 1.00 81.18  ? 403  GLU A O    1 
ATOM   5130  C CB   . GLU A 1 337 ? 47.057  110.001 104.787 1.00 87.64  ? 403  GLU A CB   1 
ATOM   5131  C CG   . GLU A 1 337 ? 48.550  110.100 105.170 1.00 91.78  ? 403  GLU A CG   1 
ATOM   5132  C CD   . GLU A 1 337 ? 49.042  111.537 105.385 1.00 103.80 ? 403  GLU A CD   1 
ATOM   5133  O OE1  . GLU A 1 337 ? 48.205  112.444 105.593 1.00 100.88 ? 403  GLU A OE1  1 
ATOM   5134  O OE2  . GLU A 1 337 ? 50.277  111.760 105.332 1.00 107.24 ? 403  GLU A OE2  1 
ATOM   5135  H H    . GLU A 1 337 ? 48.116  109.213 102.797 1.00 113.92 ? 403  GLU A H    1 
ATOM   5136  H HA   . GLU A 1 337 ? 46.813  107.961 104.650 1.00 103.87 ? 403  GLU A HA   1 
ATOM   5137  H HB2  . GLU A 1 337 ? 46.846  110.759 104.218 1.00 105.17 ? 403  GLU A HB2  1 
ATOM   5138  H HB3  . GLU A 1 337 ? 46.538  110.050 105.605 1.00 105.17 ? 403  GLU A HB3  1 
ATOM   5139  H HG2  . GLU A 1 337 ? 48.694  109.611 105.995 1.00 110.14 ? 403  GLU A HG2  1 
ATOM   5140  H HG3  . GLU A 1 337 ? 49.082  109.708 104.460 1.00 110.14 ? 403  GLU A HG3  1 
ATOM   5141  N N    . VAL A 1 338 ? 44.890  109.717 102.756 1.00 77.55  ? 404  VAL A N    1 
ATOM   5142  C CA   . VAL A 1 338 ? 43.497  109.995 102.391 1.00 64.07  ? 404  VAL A CA   1 
ATOM   5143  C C    . VAL A 1 338 ? 42.782  108.852 101.677 1.00 65.50  ? 404  VAL A C    1 
ATOM   5144  O O    . VAL A 1 338 ? 41.603  108.583 101.931 1.00 73.17  ? 404  VAL A O    1 
ATOM   5145  C CB   . VAL A 1 338 ? 43.359  111.281 101.514 1.00 56.26  ? 404  VAL A CB   1 
ATOM   5146  C CG1  . VAL A 1 338 ? 43.172  112.508 102.391 1.00 67.23  ? 404  VAL A CG1  1 
ATOM   5147  C CG2  . VAL A 1 338 ? 44.547  111.472 100.546 1.00 66.89  ? 404  VAL A CG2  1 
ATOM   5148  H H    . VAL A 1 338 ? 45.455  110.245 102.380 1.00 93.06  ? 404  VAL A H    1 
ATOM   5149  H HA   . VAL A 1 338 ? 43.006  110.162 103.211 1.00 76.89  ? 404  VAL A HA   1 
ATOM   5150  H HB   . VAL A 1 338 ? 42.559  111.193 100.972 1.00 67.51  ? 404  VAL A HB   1 
ATOM   5151  H HG11 . VAL A 1 338 ? 43.089  113.291 101.824 1.00 80.67  ? 404  VAL A HG11 1 
ATOM   5152  H HG12 . VAL A 1 338 ? 42.368  112.396 102.922 1.00 80.67  ? 404  VAL A HG12 1 
ATOM   5153  H HG13 . VAL A 1 338 ? 43.943  112.600 102.972 1.00 80.67  ? 404  VAL A HG13 1 
ATOM   5154  H HG21 . VAL A 1 338 ? 44.407  112.282 100.031 1.00 80.27  ? 404  VAL A HG21 1 
ATOM   5155  H HG22 . VAL A 1 338 ? 45.365  111.546 101.063 1.00 80.27  ? 404  VAL A HG22 1 
ATOM   5156  H HG23 . VAL A 1 338 ? 44.597  110.707 99.953  1.00 80.27  ? 404  VAL A HG23 1 
ATOM   5157  N N    . LEU A 1 339 ? 43.489  108.195 100.770 1.00 72.63  ? 405  LEU A N    1 
ATOM   5158  C CA   . LEU A 1 339 ? 42.866  107.186 99.927  1.00 67.50  ? 405  LEU A CA   1 
ATOM   5159  C C    . LEU A 1 339 ? 42.668  105.862 100.654 1.00 63.29  ? 405  LEU A C    1 
ATOM   5160  O O    . LEU A 1 339 ? 43.630  105.192 101.039 1.00 75.88  ? 405  LEU A O    1 
ATOM   5161  C CB   . LEU A 1 339 ? 43.675  107.000 98.647  1.00 53.61  ? 405  LEU A CB   1 
ATOM   5162  C CG   . LEU A 1 339 ? 43.590  108.245 97.752  1.00 46.68  ? 405  LEU A CG   1 
ATOM   5163  C CD1  . LEU A 1 339 ? 44.519  108.174 96.560  1.00 61.41  ? 405  LEU A CD1  1 
ATOM   5164  C CD2  . LEU A 1 339 ? 42.181  108.494 97.263  1.00 66.48  ? 405  LEU A CD2  1 
ATOM   5165  H H    . LEU A 1 339 ? 44.328  108.313 100.623 1.00 87.15  ? 405  LEU A H    1 
ATOM   5166  H HA   . LEU A 1 339 ? 41.988  107.506 99.669  1.00 81.00  ? 405  LEU A HA   1 
ATOM   5167  H HB2  . LEU A 1 339 ? 44.606  106.851 98.874  1.00 64.33  ? 405  LEU A HB2  1 
ATOM   5168  H HB3  . LEU A 1 339 ? 43.323  106.244 98.152  1.00 64.33  ? 405  LEU A HB3  1 
ATOM   5169  H HG   . LEU A 1 339 ? 43.854  109.016 98.277  1.00 56.01  ? 405  LEU A HG   1 
ATOM   5170  H HD11 . LEU A 1 339 ? 44.422  108.983 96.035  1.00 73.69  ? 405  LEU A HD11 1 
ATOM   5171  H HD12 . LEU A 1 339 ? 45.433  108.093 96.877  1.00 73.69  ? 405  LEU A HD12 1 
ATOM   5172  H HD13 . LEU A 1 339 ? 44.285  107.400 96.023  1.00 73.69  ? 405  LEU A HD13 1 
ATOM   5173  H HD21 . LEU A 1 339 ? 42.176  109.287 96.704  1.00 79.78  ? 405  LEU A HD21 1 
ATOM   5174  H HD22 . LEU A 1 339 ? 41.884  107.726 96.750  1.00 79.78  ? 405  LEU A HD22 1 
ATOM   5175  H HD23 . LEU A 1 339 ? 41.600  108.625 98.029  1.00 79.78  ? 405  LEU A HD23 1 
ATOM   5176  N N    . THR A 1 340 ? 41.395  105.514 100.819 1.00 52.13  ? 406  THR A N    1 
ATOM   5177  C CA   . THR A 1 340 ? 40.956  104.294 101.478 1.00 60.15  ? 406  THR A CA   1 
ATOM   5178  C C    . THR A 1 340 ? 41.084  103.111 100.535 1.00 68.44  ? 406  THR A C    1 
ATOM   5179  O O    . THR A 1 340 ? 41.488  103.258 99.382  1.00 57.93  ? 406  THR A O    1 
ATOM   5180  C CB   . THR A 1 340 ? 39.474  104.396 101.871 1.00 66.52  ? 406  THR A CB   1 
ATOM   5181  O OG1  . THR A 1 340 ? 38.682  104.623 100.698 1.00 55.32  ? 406  THR A OG1  1 
ATOM   5182  C CG2  . THR A 1 340 ? 39.247  105.523 102.876 1.00 55.30  ? 406  THR A CG2  1 
ATOM   5183  H H    . THR A 1 340 ? 40.738  105.996 100.543 1.00 62.56  ? 406  THR A H    1 
ATOM   5184  H HA   . THR A 1 340 ? 41.488  104.130 102.272 1.00 72.18  ? 406  THR A HA   1 
ATOM   5185  H HB   . THR A 1 340 ? 39.197  103.563 102.284 1.00 79.82  ? 406  THR A HB   1 
ATOM   5186  H HG1  . THR A 1 340 ? 37.870  104.680 100.905 1.00 66.39  ? 406  THR A HG1  1 
ATOM   5187  H HG21 . THR A 1 340 ? 38.308  105.572 103.112 1.00 66.36  ? 406  THR A HG21 1 
ATOM   5188  H HG22 . THR A 1 340 ? 39.767  105.360 103.679 1.00 66.36  ? 406  THR A HG22 1 
ATOM   5189  H HG23 . THR A 1 340 ? 39.521  106.370 102.490 1.00 66.36  ? 406  THR A HG23 1 
ATOM   5190  N N    . ALA A 1 341 ? 40.721  101.938 101.037 1.00 67.05  ? 407  ALA A N    1 
ATOM   5191  C CA   . ALA A 1 341 ? 40.713  100.716 100.247 1.00 47.58  ? 407  ALA A CA   1 
ATOM   5192  C C    . ALA A 1 341 ? 39.793  100.864 99.059  1.00 44.96  ? 407  ALA A C    1 
ATOM   5193  O O    . ALA A 1 341 ? 40.183  100.676 97.915  1.00 59.46  ? 407  ALA A O    1 
ATOM   5194  C CB   . ALA A 1 341 ? 40.229  99.584  101.100 1.00 65.27  ? 407  ALA A CB   1 
ATOM   5195  H H    . ALA A 1 341 ? 40.469  101.822 101.851 1.00 80.46  ? 407  ALA A H    1 
ATOM   5196  H HA   . ALA A 1 341 ? 41.608  100.516 99.932  1.00 57.09  ? 407  ALA A HA   1 
ATOM   5197  H HB1  . ALA A 1 341 ? 40.224  98.770  100.571 1.00 78.32  ? 407  ALA A HB1  1 
ATOM   5198  H HB2  . ALA A 1 341 ? 40.826  99.483  101.858 1.00 78.32  ? 407  ALA A HB2  1 
ATOM   5199  H HB3  . ALA A 1 341 ? 39.331  99.783  101.409 1.00 78.32  ? 407  ALA A HB3  1 
ATOM   5200  N N    . GLU A 1 342 ? 38.556  101.220 99.358  1.00 63.11  ? 408  GLU A N    1 
ATOM   5201  C CA   . GLU A 1 342 ? 37.497  101.224 98.378  1.00 56.80  ? 408  GLU A CA   1 
ATOM   5202  C C    . GLU A 1 342 ? 37.760  102.293 97.328  1.00 65.40  ? 408  GLU A C    1 
ATOM   5203  O O    . GLU A 1 342 ? 37.465  102.100 96.146  1.00 83.81  ? 408  GLU A O    1 
ATOM   5204  C CB   . GLU A 1 342 ? 36.158  101.434 99.088  1.00 55.30  ? 408  GLU A CB   1 
ATOM   5205  C CG   . GLU A 1 342 ? 35.978  100.480 100.272 1.00 85.73  ? 408  GLU A CG   1 
ATOM   5206  C CD   . GLU A 1 342 ? 34.604  100.556 100.924 1.00 118.59 ? 408  GLU A CD   1 
ATOM   5207  O OE1  . GLU A 1 342 ? 33.962  101.633 100.863 1.00 123.76 ? 408  GLU A OE1  1 
ATOM   5208  O OE2  . GLU A 1 342 ? 34.175  99.531  101.509 1.00 124.12 ? 408  GLU A OE2  1 
ATOM   5209  H H    . GLU A 1 342 ? 38.304  101.468 100.142 1.00 75.74  ? 408  GLU A H    1 
ATOM   5210  H HA   . GLU A 1 342 ? 37.472  100.363 97.933  1.00 68.16  ? 408  GLU A HA   1 
ATOM   5211  H HB2  . GLU A 1 342 ? 36.114  102.343 99.423  1.00 66.36  ? 408  GLU A HB2  1 
ATOM   5212  H HB3  . GLU A 1 342 ? 35.437  101.274 98.459  1.00 66.36  ? 408  GLU A HB3  1 
ATOM   5213  H HG2  . GLU A 1 342 ? 36.108  99.570  99.963  1.00 102.88 ? 408  GLU A HG2  1 
ATOM   5214  H HG3  . GLU A 1 342 ? 36.639  100.694 100.949 1.00 102.88 ? 408  GLU A HG3  1 
ATOM   5215  N N    . ASP A 1 343 ? 38.330  103.414 97.754  1.00 65.74  ? 409  ASP A N    1 
ATOM   5216  C CA   . ASP A 1 343 ? 38.727  104.458 96.813  1.00 64.25  ? 409  ASP A CA   1 
ATOM   5217  C C    . ASP A 1 343 ? 39.629  103.879 95.730  1.00 53.41  ? 409  ASP A C    1 
ATOM   5218  O O    . ASP A 1 343 ? 39.285  103.919 94.552  1.00 61.62  ? 409  ASP A O    1 
ATOM   5219  C CB   . ASP A 1 343 ? 39.445  105.607 97.530  1.00 58.81  ? 409  ASP A CB   1 
ATOM   5220  C CG   . ASP A 1 343 ? 38.512  106.431 98.412  1.00 74.51  ? 409  ASP A CG   1 
ATOM   5221  O OD1  . ASP A 1 343 ? 37.301  106.539 98.089  1.00 81.31  ? 409  ASP A OD1  1 
ATOM   5222  O OD2  . ASP A 1 343 ? 39.001  106.966 99.434  1.00 74.18  ? 409  ASP A OD2  1 
ATOM   5223  H H    . ASP A 1 343 ? 38.497  103.596 98.577  1.00 78.89  ? 409  ASP A H    1 
ATOM   5224  H HA   . ASP A 1 343 ? 37.935  104.818 96.385  1.00 77.10  ? 409  ASP A HA   1 
ATOM   5225  H HB2  . ASP A 1 343 ? 40.143  105.240 98.095  1.00 70.57  ? 409  ASP A HB2  1 
ATOM   5226  H HB3  . ASP A 1 343 ? 39.832  106.200 96.868  1.00 70.57  ? 409  ASP A HB3  1 
ATOM   5227  N N    . CYS A 1 344 ? 40.771  103.331 96.136  1.00 44.14  ? 410  CYS A N    1 
ATOM   5228  C CA   . CYS A 1 344 ? 41.753  102.808 95.196  1.00 39.97  ? 410  CYS A CA   1 
ATOM   5229  C C    . CYS A 1 344 ? 41.161  101.733 94.306  1.00 49.11  ? 410  CYS A C    1 
ATOM   5230  O O    . CYS A 1 344 ? 41.494  101.653 93.120  1.00 41.76  ? 410  CYS A O    1 
ATOM   5231  C CB   . CYS A 1 344 ? 42.934  102.210 95.943  1.00 44.95  ? 410  CYS A CB   1 
ATOM   5232  S SG   . CYS A 1 344 ? 43.863  103.390 96.908  1.00 62.66  ? 410  CYS A SG   1 
ATOM   5233  H H    . CYS A 1 344 ? 41.002  103.251 96.961  1.00 52.97  ? 410  CYS A H    1 
ATOM   5234  H HA   . CYS A 1 344 ? 42.077  103.528 94.634  1.00 47.96  ? 410  CYS A HA   1 
ATOM   5235  H HB2  . CYS A 1 344 ? 42.606  101.527 96.549  1.00 53.93  ? 410  CYS A HB2  1 
ATOM   5236  H HB3  . CYS A 1 344 ? 43.540  101.812 95.299  1.00 53.93  ? 410  CYS A HB3  1 
ATOM   5237  H HG   . CYS A 1 344 ? 43.137  103.885 97.725  1.00 75.19  ? 410  CYS A HG   1 
ATOM   5238  N N    . GLU A 1 345 ? 40.296  100.907 94.896  1.00 52.29  ? 411  GLU A N    1 
ATOM   5239  C CA   . GLU A 1 345 ? 39.667  99.789  94.202  1.00 41.71  ? 411  GLU A CA   1 
ATOM   5240  C C    . GLU A 1 345 ? 38.828  100.310 93.038  1.00 47.28  ? 411  GLU A C    1 
ATOM   5241  O O    . GLU A 1 345 ? 38.787  99.702  91.970  1.00 47.85  ? 411  GLU A O    1 
ATOM   5242  C CB   . GLU A 1 345 ? 38.807  98.991  95.181  1.00 46.47  ? 411  GLU A CB   1 
ATOM   5243  C CG   . GLU A 1 345 ? 38.189  97.723  94.609  1.00 70.77  ? 411  GLU A CG   1 
ATOM   5244  C CD   . GLU A 1 345 ? 39.219  96.659  94.294  1.00 81.65  ? 411  GLU A CD   1 
ATOM   5245  O OE1  . GLU A 1 345 ? 40.353  96.769  94.817  1.00 85.99  ? 411  GLU A OE1  1 
ATOM   5246  O OE2  . GLU A 1 345 ? 38.891  95.719  93.528  1.00 75.62  ? 411  GLU A OE2  1 
ATOM   5247  H H    . GLU A 1 345 ? 40.053  100.979 95.717  1.00 62.74  ? 411  GLU A H    1 
ATOM   5248  H HA   . GLU A 1 345 ? 40.353  99.202  93.847  1.00 50.05  ? 411  GLU A HA   1 
ATOM   5249  H HB2  . GLU A 1 345 ? 39.359  98.732  95.936  1.00 55.76  ? 411  GLU A HB2  1 
ATOM   5250  H HB3  . GLU A 1 345 ? 38.082  99.557  95.487  1.00 55.76  ? 411  GLU A HB3  1 
ATOM   5251  H HG2  . GLU A 1 345 ? 37.567  97.355  95.256  1.00 84.93  ? 411  GLU A HG2  1 
ATOM   5252  H HG3  . GLU A 1 345 ? 37.723  97.941  93.788  1.00 84.93  ? 411  GLU A HG3  1 
ATOM   5253  N N    . ASN A 1 346 ? 38.175  101.449 93.244  1.00 50.21  ? 412  ASN A N    1 
ATOM   5254  C CA   . ASN A 1 346 ? 37.362  102.071 92.203  1.00 53.63  ? 412  ASN A CA   1 
ATOM   5255  C C    . ASN A 1 346 ? 38.195  102.525 91.023  1.00 48.74  ? 412  ASN A C    1 
ATOM   5256  O O    . ASN A 1 346 ? 37.768  102.449 89.877  1.00 73.65  ? 412  ASN A O    1 
ATOM   5257  C CB   . ASN A 1 346 ? 36.633  103.289 92.761  1.00 53.23  ? 412  ASN A CB   1 
ATOM   5258  C CG   . ASN A 1 346 ? 35.458  102.920 93.608  1.00 53.11  ? 412  ASN A CG   1 
ATOM   5259  O OD1  . ASN A 1 346 ? 34.757  101.952 93.317  1.00 60.36  ? 412  ASN A OD1  1 
ATOM   5260  N ND2  . ASN A 1 346 ? 35.219  103.697 94.667  1.00 51.72  ? 412  ASN A ND2  1 
ATOM   5261  H H    . ASN A 1 346 ? 38.186  101.886 93.985  1.00 60.26  ? 412  ASN A H    1 
ATOM   5262  H HA   . ASN A 1 346 ? 36.701  101.436 91.887  1.00 64.35  ? 412  ASN A HA   1 
ATOM   5263  H HB2  . ASN A 1 346 ? 37.247  103.802 93.308  1.00 63.88  ? 412  ASN A HB2  1 
ATOM   5264  H HB3  . ASN A 1 346 ? 36.312  103.831 92.024  1.00 63.88  ? 412  ASN A HB3  1 
ATOM   5265  H HD21 . ASN A 1 346 ? 34.555  103.526 95.185  1.00 62.07  ? 412  ASN A HD21 1 
ATOM   5266  H HD22 . ASN A 1 346 ? 35.731  104.369 94.831  1.00 62.07  ? 412  ASN A HD22 1 
ATOM   5267  N N    . VAL A 1 347 ? 39.380  103.030 91.314  1.00 39.10  ? 413  VAL A N    1 
ATOM   5268  C CA   . VAL A 1 347 ? 40.273  103.503 90.276  1.00 48.86  ? 413  VAL A CA   1 
ATOM   5269  C C    . VAL A 1 347 ? 40.841  102.324 89.496  1.00 54.49  ? 413  VAL A C    1 
ATOM   5270  O O    . VAL A 1 347 ? 41.028  102.398 88.274  1.00 48.75  ? 413  VAL A O    1 
ATOM   5271  C CB   . VAL A 1 347 ? 41.400  104.337 90.891  1.00 45.62  ? 413  VAL A CB   1 
ATOM   5272  C CG1  . VAL A 1 347 ? 42.504  104.600 89.884  1.00 44.99  ? 413  VAL A CG1  1 
ATOM   5273  C CG2  . VAL A 1 347 ? 40.829  105.647 91.410  1.00 31.67  ? 413  VAL A CG2  1 
ATOM   5274  H H    . VAL A 1 347 ? 39.692  103.111 92.111  1.00 46.92  ? 413  VAL A H    1 
ATOM   5275  H HA   . VAL A 1 347 ? 39.779  104.066 89.660  1.00 58.63  ? 413  VAL A HA   1 
ATOM   5276  H HB   . VAL A 1 347 ? 41.782  103.855 91.641  1.00 54.74  ? 413  VAL A HB   1 
ATOM   5277  H HG11 . VAL A 1 347 ? 43.198  105.129 90.308  1.00 53.99  ? 413  VAL A HG11 1 
ATOM   5278  H HG12 . VAL A 1 347 ? 42.869  103.751 89.588  1.00 53.99  ? 413  VAL A HG12 1 
ATOM   5279  H HG13 . VAL A 1 347 ? 42.134  105.083 89.129  1.00 53.99  ? 413  VAL A HG13 1 
ATOM   5280  H HG21 . VAL A 1 347 ? 41.546  106.172 91.798  1.00 38.00  ? 413  VAL A HG21 1 
ATOM   5281  H HG22 . VAL A 1 347 ? 40.427  106.131 90.671  1.00 38.00  ? 413  VAL A HG22 1 
ATOM   5282  H HG23 . VAL A 1 347 ? 40.158  105.454 92.083  1.00 38.00  ? 413  VAL A HG23 1 
ATOM   5283  N N    . TYR A 1 348 ? 41.107  101.232 90.207  1.00 41.96  ? 414  TYR A N    1 
ATOM   5284  C CA   . TYR A 1 348 ? 41.609  100.031 89.568  1.00 34.57  ? 414  TYR A CA   1 
ATOM   5285  C C    . TYR A 1 348 ? 40.623  99.591  88.512  1.00 34.41  ? 414  TYR A C    1 
ATOM   5286  O O    . TYR A 1 348 ? 41.011  99.238  87.418  1.00 48.74  ? 414  TYR A O    1 
ATOM   5287  C CB   . TYR A 1 348 ? 41.815  98.913  90.577  1.00 30.28  ? 414  TYR A CB   1 
ATOM   5288  C CG   . TYR A 1 348 ? 42.859  99.199  91.637  1.00 39.53  ? 414  TYR A CG   1 
ATOM   5289  C CD1  . TYR A 1 348 ? 43.887  100.118 91.428  1.00 41.28  ? 414  TYR A CD1  1 
ATOM   5290  C CD2  . TYR A 1 348 ? 42.820  98.540  92.851  1.00 41.22  ? 414  TYR A CD2  1 
ATOM   5291  C CE1  . TYR A 1 348 ? 44.828  100.370 92.414  1.00 40.03  ? 414  TYR A CE1  1 
ATOM   5292  C CE2  . TYR A 1 348 ? 43.750  98.780  93.825  1.00 30.59  ? 414  TYR A CE2  1 
ATOM   5293  C CZ   . TYR A 1 348 ? 44.740  99.690  93.614  1.00 41.15  ? 414  TYR A CZ   1 
ATOM   5294  O OH   . TYR A 1 348 ? 45.639  99.882  94.631  1.00 46.93  ? 414  TYR A OH   1 
ATOM   5295  H H    . TYR A 1 348 ? 41.005  101.165 91.058  1.00 50.36  ? 414  TYR A H    1 
ATOM   5296  H HA   . TYR A 1 348 ? 42.458  100.221 89.139  1.00 41.48  ? 414  TYR A HA   1 
ATOM   5297  H HB2  . TYR A 1 348 ? 40.974  98.748  91.032  1.00 36.33  ? 414  TYR A HB2  1 
ATOM   5298  H HB3  . TYR A 1 348 ? 42.091  98.114  90.102  1.00 36.33  ? 414  TYR A HB3  1 
ATOM   5299  H HD1  . TYR A 1 348 ? 43.934  100.577 90.621  1.00 49.53  ? 414  TYR A HD1  1 
ATOM   5300  H HD2  . TYR A 1 348 ? 42.144  97.921  93.011  1.00 49.46  ? 414  TYR A HD2  1 
ATOM   5301  H HE1  . TYR A 1 348 ? 45.509  100.987 92.270  1.00 48.04  ? 414  TYR A HE1  1 
ATOM   5302  H HE2  . TYR A 1 348 ? 43.700  98.328  94.636  1.00 36.71  ? 414  TYR A HE2  1 
ATOM   5303  H HH   . TYR A 1 348 ? 45.441  99.393  95.285  1.00 56.32  ? 414  TYR A HH   1 
ATOM   5304  N N    . HIS A 1 349 ? 39.340  99.643  88.826  1.00 32.49  ? 415  HIS A N    1 
ATOM   5305  C CA   . HIS A 1 349 ? 38.325  99.203  87.878  1.00 45.54  ? 415  HIS A CA   1 
ATOM   5306  C C    . HIS A 1 349 ? 38.396  99.925  86.539  1.00 50.31  ? 415  HIS A C    1 
ATOM   5307  O O    . HIS A 1 349 ? 38.020  99.339  85.524  1.00 48.19  ? 415  HIS A O    1 
ATOM   5308  C CB   . HIS A 1 349 ? 36.929  99.369  88.467  1.00 49.64  ? 415  HIS A CB   1 
ATOM   5309  C CG   . HIS A 1 349 ? 36.661  98.466  89.623  1.00 47.48  ? 415  HIS A CG   1 
ATOM   5310  N ND1  . HIS A 1 349 ? 35.587  98.640  90.469  1.00 62.33  ? 415  HIS A ND1  1 
ATOM   5311  C CD2  . HIS A 1 349 ? 37.325  97.375  90.073  1.00 50.70  ? 415  HIS A CD2  1 
ATOM   5312  C CE1  . HIS A 1 349 ? 35.602  97.695  91.394  1.00 70.26  ? 415  HIS A CE1  1 
ATOM   5313  N NE2  . HIS A 1 349 ? 36.647  96.916  91.176  1.00 62.88  ? 415  HIS A NE2  1 
ATOM   5314  H H    . HIS A 1 349 ? 39.029  99.927  89.575  1.00 38.98  ? 415  HIS A H    1 
ATOM   5315  H HA   . HIS A 1 349 ? 38.458  98.258  87.706  1.00 54.65  ? 415  HIS A HA   1 
ATOM   5316  H HB2  . HIS A 1 349 ? 36.824  100.283 88.773  1.00 59.57  ? 415  HIS A HB2  1 
ATOM   5317  H HB3  . HIS A 1 349 ? 36.274  99.174  87.779  1.00 59.57  ? 415  HIS A HB3  1 
ATOM   5318  H HD1  . HIS A 1 349 ? 35.000  99.266  90.405  1.00 74.79  ? 415  HIS A HD1  1 
ATOM   5319  H HD2  . HIS A 1 349 ? 38.096  97.007  89.706  1.00 60.84  ? 415  HIS A HD2  1 
ATOM   5320  H HE1  . HIS A 1 349 ? 34.983  97.596  92.081  1.00 84.32  ? 415  HIS A HE1  1 
ATOM   5321  H HE2  . HIS A 1 349 ? 36.866  96.231  91.648  1.00 75.46  ? 415  HIS A HE2  1 
ATOM   5322  N N    . LEU A 1 350 ? 38.894  101.167 86.527  1.00 42.95  ? 416  LEU A N    1 
ATOM   5323  C CA   . LEU A 1 350 ? 38.890  101.990 85.307  1.00 41.60  ? 416  LEU A CA   1 
ATOM   5324  C C    . LEU A 1 350 ? 39.934  101.556 84.294  1.00 35.82  ? 416  LEU A C    1 
ATOM   5325  O O    . LEU A 1 350 ? 40.012  102.103 83.194  1.00 33.80  ? 416  LEU A O    1 
ATOM   5326  C CB   . LEU A 1 350 ? 39.110  103.454 85.649  1.00 25.32  ? 416  LEU A CB   1 
ATOM   5327  C CG   . LEU A 1 350 ? 38.152  104.024 86.683  1.00 26.78  ? 416  LEU A CG   1 
ATOM   5328  C CD1  . LEU A 1 350 ? 38.539  105.439 86.965  1.00 32.44  ? 416  LEU A CD1  1 
ATOM   5329  C CD2  . LEU A 1 350 ? 36.732  103.971 86.194  1.00 31.49  ? 416  LEU A CD2  1 
ATOM   5330  H H    . LEU A 1 350 ? 39.240  101.557 87.211  1.00 51.54  ? 416  LEU A H    1 
ATOM   5331  H HA   . LEU A 1 350 ? 38.020  101.914 84.885  1.00 49.92  ? 416  LEU A HA   1 
ATOM   5332  H HB2  . LEU A 1 350 ? 40.010  103.558 85.996  1.00 30.39  ? 416  LEU A HB2  1 
ATOM   5333  H HB3  . LEU A 1 350 ? 39.012  103.979 84.839  1.00 30.39  ? 416  LEU A HB3  1 
ATOM   5334  H HG   . LEU A 1 350 ? 38.217  103.514 87.505  1.00 32.14  ? 416  LEU A HG   1 
ATOM   5335  H HD11 . LEU A 1 350 ? 37.930  105.807 87.625  1.00 38.93  ? 416  LEU A HD11 1 
ATOM   5336  H HD12 . LEU A 1 350 ? 39.446  105.455 87.307  1.00 38.93  ? 416  LEU A HD12 1 
ATOM   5337  H HD13 . LEU A 1 350 ? 38.485  105.951 86.143  1.00 38.93  ? 416  LEU A HD13 1 
ATOM   5338  H HD21 . LEU A 1 350 ? 36.150  104.342 86.877  1.00 37.79  ? 416  LEU A HD21 1 
ATOM   5339  H HD22 . LEU A 1 350 ? 36.659  104.492 85.379  1.00 37.79  ? 416  LEU A HD22 1 
ATOM   5340  H HD23 . LEU A 1 350 ? 36.492  103.048 86.020  1.00 37.79  ? 416  LEU A HD23 1 
ATOM   5341  N N    . VAL A 1 351 ? 40.732  100.569 84.685  1.00 41.90  ? 417  VAL A N    1 
ATOM   5342  C CA   . VAL A 1 351 ? 41.747  99.972  83.827  1.00 33.12  ? 417  VAL A CA   1 
ATOM   5343  C C    . VAL A 1 351 ? 41.092  99.237  82.668  1.00 35.74  ? 417  VAL A C    1 
ATOM   5344  O O    . VAL A 1 351 ? 41.679  99.088  81.588  1.00 25.76  ? 417  VAL A O    1 
ATOM   5345  C CB   . VAL A 1 351 ? 42.595  99.010  84.652  1.00 34.59  ? 417  VAL A CB   1 
ATOM   5346  C CG1  . VAL A 1 351 ? 43.509  98.200  83.783  1.00 56.83  ? 417  VAL A CG1  1 
ATOM   5347  C CG2  . VAL A 1 351 ? 43.427  99.802  85.632  1.00 45.58  ? 417  VAL A CG2  1 
ATOM   5348  H H    . VAL A 1 351 ? 40.703  100.218 85.469  1.00 50.28  ? 417  VAL A H    1 
ATOM   5349  H HA   . VAL A 1 351 ? 42.323  100.666 83.470  1.00 39.74  ? 417  VAL A HA   1 
ATOM   5350  H HB   . VAL A 1 351 ? 42.019  98.407  85.147  1.00 41.51  ? 417  VAL A HB   1 
ATOM   5351  H HG11 . VAL A 1 351 ? 44.030  97.603  84.343  1.00 68.20  ? 417  VAL A HG11 1 
ATOM   5352  H HG12 . VAL A 1 351 ? 42.975  97.685  83.157  1.00 68.20  ? 417  VAL A HG12 1 
ATOM   5353  H HG13 . VAL A 1 351 ? 44.099  98.799  83.300  1.00 68.20  ? 417  VAL A HG13 1 
ATOM   5354  H HG21 . VAL A 1 351 ? 43.966  99.189  86.156  1.00 54.69  ? 417  VAL A HG21 1 
ATOM   5355  H HG22 . VAL A 1 351 ? 44.000  100.410 85.140  1.00 54.69  ? 417  VAL A HG22 1 
ATOM   5356  H HG23 . VAL A 1 351 ? 42.835  100.304 86.215  1.00 54.69  ? 417  VAL A HG23 1 
ATOM   5357  N N    . TYR A 1 352 ? 39.856  98.803  82.914  1.00 45.56  ? 418  TYR A N    1 
ATOM   5358  C CA   . TYR A 1 352 ? 39.046  98.099  81.926  1.00 43.99  ? 418  TYR A CA   1 
ATOM   5359  C C    . TYR A 1 352 ? 38.059  99.024  81.229  1.00 33.39  ? 418  TYR A C    1 
ATOM   5360  O O    . TYR A 1 352 ? 37.009  98.597  80.773  1.00 46.34  ? 418  TYR A O    1 
ATOM   5361  C CB   . TYR A 1 352 ? 38.287  96.966  82.603  1.00 29.04  ? 418  TYR A CB   1 
ATOM   5362  C CG   . TYR A 1 352 ? 39.177  96.013  83.356  1.00 29.75  ? 418  TYR A CG   1 
ATOM   5363  C CD1  . TYR A 1 352 ? 39.972  95.101  82.684  1.00 28.58  ? 418  TYR A CD1  1 
ATOM   5364  C CD2  . TYR A 1 352 ? 39.208  96.016  84.737  1.00 35.18  ? 418  TYR A CD2  1 
ATOM   5365  C CE1  . TYR A 1 352 ? 40.783  94.223  83.364  1.00 35.93  ? 418  TYR A CE1  1 
ATOM   5366  C CE2  . TYR A 1 352 ? 40.007  95.141  85.434  1.00 42.67  ? 418  TYR A CE2  1 
ATOM   5367  C CZ   . TYR A 1 352 ? 40.798  94.244  84.744  1.00 58.11  ? 418  TYR A CZ   1 
ATOM   5368  O OH   . TYR A 1 352 ? 41.607  93.373  85.446  1.00 64.23  ? 418  TYR A OH   1 
ATOM   5369  H H    . TYR A 1 352 ? 39.457  98.909  83.669  1.00 54.67  ? 418  TYR A H    1 
ATOM   5370  H HA   . TYR A 1 352 ? 39.628  97.713  81.253  1.00 52.78  ? 418  TYR A HA   1 
ATOM   5371  H HB2  . TYR A 1 352 ? 37.656  97.345  83.234  1.00 34.84  ? 418  TYR A HB2  1 
ATOM   5372  H HB3  . TYR A 1 352 ? 37.813  96.458  81.926  1.00 34.84  ? 418  TYR A HB3  1 
ATOM   5373  H HD1  . TYR A 1 352 ? 39.962  95.086  81.754  1.00 34.30  ? 418  TYR A HD1  1 
ATOM   5374  H HD2  . TYR A 1 352 ? 38.676  96.618  85.204  1.00 42.22  ? 418  TYR A HD2  1 
ATOM   5375  H HE1  . TYR A 1 352 ? 41.314  93.618  82.898  1.00 43.11  ? 418  TYR A HE1  1 
ATOM   5376  H HE2  . TYR A 1 352 ? 40.021  95.159  86.363  1.00 51.21  ? 418  TYR A HE2  1 
ATOM   5377  H HH   . TYR A 1 352 ? 41.515  93.497  86.271  1.00 77.08  ? 418  TYR A HH   1 
ATOM   5378  N N    . SER A 1 353 ? 38.411  100.295 81.145  1.00 38.08  ? 419  SER A N    1 
ATOM   5379  C CA   . SER A 1 353 ? 37.543  101.299 80.552  1.00 37.93  ? 419  SER A CA   1 
ATOM   5380  C C    . SER A 1 353 ? 37.641  101.302 79.028  1.00 36.47  ? 419  SER A C    1 
ATOM   5381  O O    . SER A 1 353 ? 38.687  101.018 78.462  1.00 27.50  ? 419  SER A O    1 
ATOM   5382  C CB   . SER A 1 353 ? 37.901  102.682 81.097  1.00 25.93  ? 419  SER A CB   1 
ATOM   5383  O OG   . SER A 1 353 ? 37.225  103.696 80.371  1.00 51.55  ? 419  SER A OG   1 
ATOM   5384  H H    . SER A 1 353 ? 39.160  100.608 81.428  1.00 45.69  ? 419  SER A H    1 
ATOM   5385  H HA   . SER A 1 353 ? 36.623  101.107 80.795  1.00 45.52  ? 419  SER A HA   1 
ATOM   5386  H HB2  . SER A 1 353 ? 37.639  102.733 82.030  1.00 31.12  ? 419  SER A HB2  1 
ATOM   5387  H HB3  . SER A 1 353 ? 38.858  102.818 81.013  1.00 31.12  ? 419  SER A HB3  1 
ATOM   5388  H HG   . SER A 1 353 ? 37.427  104.452 80.677  1.00 61.86  ? 419  SER A HG   1 
ATOM   5389  N N    . ALA A 1 354 ? 36.535  101.628 78.369  1.00 42.01  ? 420  ALA A N    1 
ATOM   5390  C CA   . ALA A 1 354 ? 36.500  101.668 76.920  1.00 32.96  ? 420  ALA A CA   1 
ATOM   5391  C C    . ALA A 1 354 ? 37.489  102.692 76.412  1.00 35.70  ? 420  ALA A C    1 
ATOM   5392  O O    . ALA A 1 354 ? 38.117  102.486 75.384  1.00 50.36  ? 420  ALA A O    1 
ATOM   5393  C CB   . ALA A 1 354 ? 35.122  102.020 76.453  1.00 41.70  ? 420  ALA A CB   1 
ATOM   5394  H H    . ALA A 1 354 ? 35.788  101.830 78.744  1.00 50.41  ? 420  ALA A H    1 
ATOM   5395  H HA   . ALA A 1 354 ? 36.739  100.799 76.561  1.00 39.56  ? 420  ALA A HA   1 
ATOM   5396  H HB1  . ALA A 1 354 ? 35.114  102.044 75.483  1.00 50.04  ? 420  ALA A HB1  1 
ATOM   5397  H HB2  . ALA A 1 354 ? 34.500  101.349 76.773  1.00 50.04  ? 420  ALA A HB2  1 
ATOM   5398  H HB3  . ALA A 1 354 ? 34.882  102.891 76.807  1.00 50.04  ? 420  ALA A HB3  1 
ATOM   5399  N N    . HIS A 1 355 ? 37.631  103.786 77.157  1.00 36.55  ? 421  HIS A N    1 
ATOM   5400  C CA   . HIS A 1 355 ? 38.419  104.943 76.744  1.00 30.01  ? 421  HIS A CA   1 
ATOM   5401  C C    . HIS A 1 355 ? 39.882  104.838 77.204  1.00 35.78  ? 421  HIS A C    1 
ATOM   5402  O O    . HIS A 1 355 ? 40.167  104.739 78.400  1.00 46.10  ? 421  HIS A O    1 
ATOM   5403  C CB   . HIS A 1 355 ? 37.765  106.193 77.325  1.00 35.21  ? 421  HIS A CB   1 
ATOM   5404  C CG   . HIS A 1 355 ? 38.109  107.455 76.598  1.00 50.91  ? 421  HIS A CG   1 
ATOM   5405  N ND1  . HIS A 1 355 ? 38.878  108.449 77.159  1.00 63.37  ? 421  HIS A ND1  1 
ATOM   5406  C CD2  . HIS A 1 355 ? 37.773  107.889 75.358  1.00 66.15  ? 421  HIS A CD2  1 
ATOM   5407  C CE1  . HIS A 1 355 ? 39.008  109.446 76.296  1.00 68.88  ? 421  HIS A CE1  1 
ATOM   5408  N NE2  . HIS A 1 355 ? 38.353  109.127 75.195  1.00 75.81  ? 421  HIS A NE2  1 
ATOM   5409  H H    . HIS A 1 355 ? 37.268  103.883 77.930  1.00 43.86  ? 421  HIS A H    1 
ATOM   5410  H HA   . HIS A 1 355 ? 38.407  105.012 75.777  1.00 36.02  ? 421  HIS A HA   1 
ATOM   5411  H HB2  . HIS A 1 355 ? 36.802  106.085 77.292  1.00 42.26  ? 421  HIS A HB2  1 
ATOM   5412  H HB3  . HIS A 1 355 ? 38.051  106.296 78.246  1.00 42.26  ? 421  HIS A HB3  1 
ATOM   5413  H HD1  . HIS A 1 355 ? 39.219  108.427 77.948  1.00 76.05  ? 421  HIS A HD1  1 
ATOM   5414  H HD2  . HIS A 1 355 ? 37.256  107.434 74.734  1.00 79.38  ? 421  HIS A HD2  1 
ATOM   5415  H HE1  . HIS A 1 355 ? 39.486  110.231 76.438  1.00 82.66  ? 421  HIS A HE1  1 
ATOM   5416  H HE2  . HIS A 1 355 ? 38.293  109.618 74.492  1.00 90.97  ? 421  HIS A HE2  1 
ATOM   5417  N N    . ARG A 1 356 ? 40.817  104.873 76.260  1.00 38.44  ? 422  ARG A N    1 
ATOM   5418  C CA   . ARG A 1 356 ? 42.208  104.541 76.582  1.00 37.51  ? 422  ARG A CA   1 
ATOM   5419  C C    . ARG A 1 356 ? 42.861  105.569 77.509  1.00 47.12  ? 422  ARG A C    1 
ATOM   5420  O O    . ARG A 1 356 ? 43.523  105.200 78.492  1.00 29.38  ? 422  ARG A O    1 
ATOM   5421  C CB   . ARG A 1 356 ? 43.061  104.343 75.322  1.00 26.87  ? 422  ARG A CB   1 
ATOM   5422  C CG   . ARG A 1 356 ? 44.385  103.666 75.645  1.00 42.92  ? 422  ARG A CG   1 
ATOM   5423  C CD   . ARG A 1 356 ? 45.187  103.202 74.442  1.00 42.28  ? 422  ARG A CD   1 
ATOM   5424  N NE   . ARG A 1 356 ? 46.374  102.483 74.892  1.00 30.18  ? 422  ARG A NE   1 
ATOM   5425  C CZ   . ARG A 1 356 ? 47.561  103.031 75.117  1.00 39.58  ? 422  ARG A CZ   1 
ATOM   5426  N NH1  . ARG A 1 356 ? 47.763  104.322 74.919  1.00 39.78  ? 422  ARG A NH1  1 
ATOM   5427  N NH2  . ARG A 1 356 ? 48.563  102.271 75.545  1.00 49.76  ? 422  ARG A NH2  1 
ATOM   5428  H H    . ARG A 1 356 ? 40.680  105.083 75.437  1.00 46.13  ? 422  ARG A H    1 
ATOM   5429  H HA   . ARG A 1 356 ? 42.207  103.695 77.057  1.00 45.01  ? 422  ARG A HA   1 
ATOM   5430  H HB2  . ARG A 1 356 ? 42.578  103.784 74.693  1.00 32.24  ? 422  ARG A HB2  1 
ATOM   5431  H HB3  . ARG A 1 356 ? 43.250  105.208 74.925  1.00 32.24  ? 422  ARG A HB3  1 
ATOM   5432  H HG2  . ARG A 1 356 ? 44.938  104.292 76.139  1.00 51.51  ? 422  ARG A HG2  1 
ATOM   5433  H HG3  . ARG A 1 356 ? 44.207  102.887 76.194  1.00 51.51  ? 422  ARG A HG3  1 
ATOM   5434  H HD2  . ARG A 1 356 ? 44.647  102.603 73.902  1.00 50.73  ? 422  ARG A HD2  1 
ATOM   5435  H HD3  . ARG A 1 356 ? 45.469  103.970 73.921  1.00 50.73  ? 422  ARG A HD3  1 
ATOM   5436  H HE   . ARG A 1 356 ? 46.299  101.636 75.022  1.00 36.22  ? 422  ARG A HE   1 
ATOM   5437  H HH11 . ARG A 1 356 ? 47.118  104.821 74.646  1.00 47.74  ? 422  ARG A HH11 1 
ATOM   5438  H HH12 . ARG A 1 356 ? 48.539  104.663 75.066  1.00 47.74  ? 422  ARG A HH12 1 
ATOM   5439  H HH21 . ARG A 1 356 ? 48.440  101.429 75.671  1.00 59.71  ? 422  ARG A HH21 1 
ATOM   5440  H HH22 . ARG A 1 356 ? 49.337  102.618 75.684  1.00 59.71  ? 422  ARG A HH22 1 
ATOM   5441  N N    . PRO A 1 357 ? 42.658  106.862 77.221  1.00 30.36  ? 423  PRO A N    1 
ATOM   5442  C CA   . PRO A 1 357 ? 43.304  107.815 78.124  1.00 27.47  ? 423  PRO A CA   1 
ATOM   5443  C C    . PRO A 1 357 ? 42.936  107.648 79.607  1.00 32.65  ? 423  PRO A C    1 
ATOM   5444  O O    . PRO A 1 357 ? 43.810  107.850 80.438  1.00 39.13  ? 423  PRO A O    1 
ATOM   5445  C CB   . PRO A 1 357 ? 42.874  109.164 77.563  1.00 17.78  ? 423  PRO A CB   1 
ATOM   5446  C CG   . PRO A 1 357 ? 42.699  108.909 76.121  1.00 31.88  ? 423  PRO A CG   1 
ATOM   5447  C CD   . PRO A 1 357 ? 42.090  107.529 76.040  1.00 19.86  ? 423  PRO A CD   1 
ATOM   5448  H HA   . PRO A 1 357 ? 44.267  107.739 78.037  1.00 32.97  ? 423  PRO A HA   1 
ATOM   5449  H HB2  . PRO A 1 357 ? 42.037  109.440 77.970  1.00 21.34  ? 423  PRO A HB2  1 
ATOM   5450  H HB3  . PRO A 1 357 ? 43.569  109.823 77.717  1.00 21.34  ? 423  PRO A HB3  1 
ATOM   5451  H HG2  . PRO A 1 357 ? 42.101  109.571 75.741  1.00 38.25  ? 423  PRO A HG2  1 
ATOM   5452  H HG3  . PRO A 1 357 ? 43.562  108.930 75.678  1.00 38.25  ? 423  PRO A HG3  1 
ATOM   5453  H HD2  . PRO A 1 357 ? 41.124  107.579 76.108  1.00 23.84  ? 423  PRO A HD2  1 
ATOM   5454  H HD3  . PRO A 1 357 ? 42.371  107.080 75.227  1.00 23.84  ? 423  PRO A HD3  1 
ATOM   5455  N N    . VAL A 1 358 ? 41.713  107.268 79.955  1.00 31.37  ? 424  VAL A N    1 
ATOM   5456  C CA   . VAL A 1 358 ? 41.441  107.056 81.373  1.00 34.85  ? 424  VAL A CA   1 
ATOM   5457  C C    . VAL A 1 358 ? 42.098  105.769 81.839  1.00 38.95  ? 424  VAL A C    1 
ATOM   5458  O O    . VAL A 1 358 ? 42.572  105.690 82.974  1.00 42.08  ? 424  VAL A O    1 
ATOM   5459  C CB   . VAL A 1 358 ? 39.907  107.087 81.781  1.00 33.99  ? 424  VAL A CB   1 
ATOM   5460  C CG1  . VAL A 1 358 ? 39.102  108.014 80.883  1.00 32.05  ? 424  VAL A CG1  1 
ATOM   5461  C CG2  . VAL A 1 358 ? 39.300  105.707 81.827  1.00 33.53  ? 424  VAL A CG2  1 
ATOM   5462  H H    . VAL A 1 358 ? 41.053  107.131 79.422  1.00 37.65  ? 424  VAL A H    1 
ATOM   5463  H HA   . VAL A 1 358 ? 41.868  107.777 81.861  1.00 41.82  ? 424  VAL A HA   1 
ATOM   5464  H HB   . VAL A 1 358 ? 39.849  107.448 82.679  1.00 40.79  ? 424  VAL A HB   1 
ATOM   5465  H HG11 . VAL A 1 358 ? 38.175  108.002 81.168  1.00 38.46  ? 424  VAL A HG11 1 
ATOM   5466  H HG12 . VAL A 1 358 ? 39.459  108.913 80.957  1.00 38.46  ? 424  VAL A HG12 1 
ATOM   5467  H HG13 . VAL A 1 358 ? 39.171  107.705 79.967  1.00 38.46  ? 424  VAL A HG13 1 
ATOM   5468  H HG21 . VAL A 1 358 ? 38.367  105.782 82.080  1.00 40.24  ? 424  VAL A HG21 1 
ATOM   5469  H HG22 . VAL A 1 358 ? 39.374  105.300 80.950  1.00 40.24  ? 424  VAL A HG22 1 
ATOM   5470  H HG23 . VAL A 1 358 ? 39.779  105.174 82.481  1.00 40.24  ? 424  VAL A HG23 1 
ATOM   5471  N N    . ALA A 1 359 ? 42.138  104.764 80.967  1.00 44.03  ? 425  ALA A N    1 
ATOM   5472  C CA   . ALA A 1 359 ? 42.633  103.445 81.366  1.00 33.16  ? 425  ALA A CA   1 
ATOM   5473  C C    . ALA A 1 359 ? 44.121  103.532 81.673  1.00 33.46  ? 425  ALA A C    1 
ATOM   5474  O O    . ALA A 1 359 ? 44.597  102.983 82.659  1.00 44.35  ? 425  ALA A O    1 
ATOM   5475  C CB   . ALA A 1 359 ? 42.365  102.427 80.291  1.00 32.04  ? 425  ALA A CB   1 
ATOM   5476  H H    . ALA A 1 359 ? 41.887  104.817 80.147  1.00 52.83  ? 425  ALA A H    1 
ATOM   5477  H HA   . ALA A 1 359 ? 42.173  103.162 82.172  1.00 39.79  ? 425  ALA A HA   1 
ATOM   5478  H HB1  . ALA A 1 359 ? 42.702  101.565 80.582  1.00 38.44  ? 425  ALA A HB1  1 
ATOM   5479  H HB2  . ALA A 1 359 ? 41.408  102.374 80.139  1.00 38.44  ? 425  ALA A HB2  1 
ATOM   5480  H HB3  . ALA A 1 359 ? 42.815  102.702 79.477  1.00 38.44  ? 425  ALA A HB3  1 
ATOM   5481  N N    . VAL A 1 360 ? 44.840  104.249 80.826  1.00 34.81  ? 426  VAL A N    1 
ATOM   5482  C CA   . VAL A 1 360 ? 46.274  104.466 81.001  1.00 39.06  ? 426  VAL A CA   1 
ATOM   5483  C C    . VAL A 1 360 ? 46.577  105.289 82.253  1.00 35.41  ? 426  VAL A C    1 
ATOM   5484  O O    . VAL A 1 360 ? 47.601  105.075 82.896  1.00 47.57  ? 426  VAL A O    1 
ATOM   5485  C CB   . VAL A 1 360 ? 46.871  105.155 79.746  1.00 18.89  ? 426  VAL A CB   1 
ATOM   5486  C CG1  . VAL A 1 360 ? 48.192  105.862 80.040  1.00 34.45  ? 426  VAL A CG1  1 
ATOM   5487  C CG2  . VAL A 1 360 ? 47.032  104.139 78.656  1.00 28.90  ? 426  VAL A CG2  1 
ATOM   5488  H H    . VAL A 1 360 ? 44.518  104.630 80.126  1.00 41.77  ? 426  VAL A H    1 
ATOM   5489  H HA   . VAL A 1 360 ? 46.709  103.605 81.101  1.00 46.87  ? 426  VAL A HA   1 
ATOM   5490  H HB   . VAL A 1 360 ? 46.244  105.824 79.432  1.00 22.67  ? 426  VAL A HB   1 
ATOM   5491  H HG11 . VAL A 1 360 ? 48.518  106.273 79.224  1.00 41.34  ? 426  VAL A HG11 1 
ATOM   5492  H HG12 . VAL A 1 360 ? 48.042  106.542 80.715  1.00 41.34  ? 426  VAL A HG12 1 
ATOM   5493  H HG13 . VAL A 1 360 ? 48.834  105.211 80.363  1.00 41.34  ? 426  VAL A HG13 1 
ATOM   5494  H HG21 . VAL A 1 360 ? 47.406  104.573 77.874  1.00 34.68  ? 426  VAL A HG21 1 
ATOM   5495  H HG22 . VAL A 1 360 ? 47.629  103.439 78.964  1.00 34.68  ? 426  VAL A HG22 1 
ATOM   5496  H HG23 . VAL A 1 360 ? 46.163  103.765 78.444  1.00 34.68  ? 426  VAL A HG23 1 
ATOM   5497  N N    . ALA A 1 361 ? 45.706  106.233 82.599  1.00 31.92  ? 427  ALA A N    1 
ATOM   5498  C CA   . ALA A 1 361 ? 45.934  107.059 83.780  1.00 37.08  ? 427  ALA A CA   1 
ATOM   5499  C C    . ALA A 1 361 ? 45.656  106.245 85.041  1.00 35.93  ? 427  ALA A C    1 
ATOM   5500  O O    . ALA A 1 361 ? 46.325  106.405 86.062  1.00 44.35  ? 427  ALA A O    1 
ATOM   5501  C CB   . ALA A 1 361 ? 45.082  108.310 83.736  1.00 23.29  ? 427  ALA A CB   1 
ATOM   5502  H H    . ALA A 1 361 ? 44.983  106.414 82.172  1.00 38.30  ? 427  ALA A H    1 
ATOM   5503  H HA   . ALA A 1 361 ? 46.864  107.332 83.799  1.00 44.50  ? 427  ALA A HA   1 
ATOM   5504  H HB1  . ALA A 1 361 ? 45.255  108.837 84.531  1.00 27.95  ? 427  ALA A HB1  1 
ATOM   5505  H HB2  . ALA A 1 361 ? 45.312  108.820 82.944  1.00 27.95  ? 427  ALA A HB2  1 
ATOM   5506  H HB3  . ALA A 1 361 ? 44.147  108.053 83.705  1.00 27.95  ? 427  ALA A HB3  1 
ATOM   5507  N N    . ALA A 1 362 ? 44.676  105.356 84.961  1.00 37.53  ? 428  ALA A N    1 
ATOM   5508  C CA   . ALA A 1 362 ? 44.383  104.444 86.060  1.00 36.94  ? 428  ALA A CA   1 
ATOM   5509  C C    . ALA A 1 362 ? 45.465  103.373 86.173  1.00 40.12  ? 428  ALA A C    1 
ATOM   5510  O O    . ALA A 1 362 ? 45.793  102.920 87.263  1.00 45.34  ? 428  ALA A O    1 
ATOM   5511  C CB   . ALA A 1 362 ? 43.029  103.806 85.856  1.00 26.21  ? 428  ALA A CB   1 
ATOM   5512  H H    . ALA A 1 362 ? 44.163  105.259 84.278  1.00 45.04  ? 428  ALA A H    1 
ATOM   5513  H HA   . ALA A 1 362 ? 44.362  104.942 86.892  1.00 44.32  ? 428  ALA A HA   1 
ATOM   5514  H HB1  . ALA A 1 362 ? 42.850  103.203 86.595  1.00 31.45  ? 428  ALA A HB1  1 
ATOM   5515  H HB2  . ALA A 1 362 ? 42.354  104.502 85.826  1.00 31.45  ? 428  ALA A HB2  1 
ATOM   5516  H HB3  . ALA A 1 362 ? 43.035  103.314 85.021  1.00 31.45  ? 428  ALA A HB3  1 
ATOM   5517  N N    . GLY A 1 363 ? 46.016  102.970 85.036  1.00 41.26  ? 429  GLY A N    1 
ATOM   5518  C CA   . GLY A 1 363 ? 47.104  102.015 85.021  1.00 36.30  ? 429  GLY A CA   1 
ATOM   5519  C C    . GLY A 1 363 ? 48.327  102.599 85.682  1.00 38.00  ? 429  GLY A C    1 
ATOM   5520  O O    . GLY A 1 363 ? 49.039  101.901 86.391  1.00 39.14  ? 429  GLY A O    1 
ATOM   5521  H H    . GLY A 1 363 ? 45.773  103.238 84.256  1.00 49.51  ? 429  GLY A H    1 
ATOM   5522  H HA2  . GLY A 1 363 ? 46.844  101.211 85.497  1.00 43.56  ? 429  GLY A HA2  1 
ATOM   5523  H HA3  . GLY A 1 363 ? 47.324  101.781 84.106  1.00 43.56  ? 429  GLY A HA3  1 
ATOM   5524  N N    . GLU A 1 364 ? 48.568  103.887 85.455  1.00 45.05  ? 430  GLU A N    1 
ATOM   5525  C CA   . GLU A 1 364 ? 49.699  104.573 86.078  1.00 41.82  ? 430  GLU A CA   1 
ATOM   5526  C C    . GLU A 1 364 ? 49.502  104.633 87.587  1.00 37.68  ? 430  GLU A C    1 
ATOM   5527  O O    . GLU A 1 364 ? 50.424  104.347 88.338  1.00 59.09  ? 430  GLU A O    1 
ATOM   5528  C CB   . GLU A 1 364 ? 49.927  105.951 85.444  1.00 36.95  ? 430  GLU A CB   1 
ATOM   5529  C CG   . GLU A 1 364 ? 50.529  105.831 84.015  1.00 97.77  ? 430  GLU A CG   1 
ATOM   5530  C CD   . GLU A 1 364 ? 50.487  107.123 83.178  1.00 106.86 ? 430  GLU A CD   1 
ATOM   5531  O OE1  . GLU A 1 364 ? 50.082  108.187 83.709  1.00 124.03 ? 430  GLU A OE1  1 
ATOM   5532  O OE2  . GLU A 1 364 ? 50.841  107.058 81.971  1.00 87.68  ? 430  GLU A OE2  1 
ATOM   5533  H H    . GLU A 1 364 ? 48.091  104.389 84.943  1.00 54.06  ? 430  GLU A H    1 
ATOM   5534  H HA   . GLU A 1 364 ? 50.498  104.048 85.914  1.00 50.18  ? 430  GLU A HA   1 
ATOM   5535  H HB2  . GLU A 1 364 ? 49.078  106.417 85.379  1.00 44.34  ? 430  GLU A HB2  1 
ATOM   5536  H HB3  . GLU A 1 364 ? 50.546  106.457 85.993  1.00 44.34  ? 430  GLU A HB3  1 
ATOM   5537  H HG2  . GLU A 1 364 ? 51.458  105.563 84.094  1.00 117.33 ? 430  GLU A HG2  1 
ATOM   5538  H HG3  . GLU A 1 364 ? 50.035  105.152 83.529  1.00 117.33 ? 430  GLU A HG3  1 
ATOM   5539  N N    . PHE A 1 365 ? 48.286  104.947 88.021  1.00 52.90  ? 431  PHE A N    1 
ATOM   5540  C CA   . PHE A 1 365 ? 47.910  104.891 89.437  1.00 36.78  ? 431  PHE A CA   1 
ATOM   5541  C C    . PHE A 1 365 ? 48.094  103.507 90.024  1.00 43.89  ? 431  PHE A C    1 
ATOM   5542  O O    . PHE A 1 365 ? 48.654  103.374 91.109  1.00 43.64  ? 431  PHE A O    1 
ATOM   5543  C CB   . PHE A 1 365 ? 46.448  105.298 89.590  1.00 37.21  ? 431  PHE A CB   1 
ATOM   5544  C CG   . PHE A 1 365 ? 45.940  105.255 91.002  1.00 32.46  ? 431  PHE A CG   1 
ATOM   5545  C CD1  . PHE A 1 365 ? 46.100  106.338 91.842  1.00 39.71  ? 431  PHE A CD1  1 
ATOM   5546  C CD2  . PHE A 1 365 ? 45.275  104.147 91.478  1.00 31.70  ? 431  PHE A CD2  1 
ATOM   5547  C CE1  . PHE A 1 365 ? 45.621  106.304 93.129  1.00 33.89  ? 431  PHE A CE1  1 
ATOM   5548  C CE2  . PHE A 1 365 ? 44.791  104.117 92.750  1.00 33.09  ? 431  PHE A CE2  1 
ATOM   5549  C CZ   . PHE A 1 365 ? 44.968  105.195 93.582  1.00 30.83  ? 431  PHE A CZ   1 
ATOM   5550  H H    . PHE A 1 365 ? 47.646  105.200 87.507  1.00 63.48  ? 431  PHE A H    1 
ATOM   5551  H HA   . PHE A 1 365 ? 48.456  105.513 89.941  1.00 44.14  ? 431  PHE A HA   1 
ATOM   5552  H HB2  . PHE A 1 365 ? 46.342  106.206 89.266  1.00 44.65  ? 431  PHE A HB2  1 
ATOM   5553  H HB3  . PHE A 1 365 ? 45.901  104.696 89.061  1.00 44.65  ? 431  PHE A HB3  1 
ATOM   5554  H HD1  . PHE A 1 365 ? 46.544  107.096 91.536  1.00 47.66  ? 431  PHE A HD1  1 
ATOM   5555  H HD2  . PHE A 1 365 ? 45.149  103.413 90.921  1.00 38.04  ? 431  PHE A HD2  1 
ATOM   5556  H HE1  . PHE A 1 365 ? 45.739  107.036 93.690  1.00 40.66  ? 431  PHE A HE1  1 
ATOM   5557  H HE2  . PHE A 1 365 ? 44.350  103.360 93.061  1.00 39.71  ? 431  PHE A HE2  1 
ATOM   5558  H HZ   . PHE A 1 365 ? 44.643  105.169 94.453  1.00 36.99  ? 431  PHE A HZ   1 
ATOM   5559  N N    . LEU A 1 366 ? 47.602  102.491 89.306  1.00 52.46  ? 432  LEU A N    1 
ATOM   5560  C CA   . LEU A 1 366 ? 47.712  101.079 89.704  1.00 45.78  ? 432  LEU A CA   1 
ATOM   5561  C C    . LEU A 1 366 ? 49.147  100.634 89.890  1.00 44.31  ? 432  LEU A C    1 
ATOM   5562  O O    . LEU A 1 366 ? 49.454  99.853  90.777  1.00 51.93  ? 432  LEU A O    1 
ATOM   5563  C CB   . LEU A 1 366 ? 47.097  100.185 88.633  1.00 51.07  ? 432  LEU A CB   1 
ATOM   5564  C CG   . LEU A 1 366 ? 47.280  98.674  88.809  1.00 37.35  ? 432  LEU A CG   1 
ATOM   5565  C CD1  . LEU A 1 366 ? 46.771  98.221  90.163  1.00 24.36  ? 432  LEU A CD1  1 
ATOM   5566  C CD2  . LEU A 1 366 ? 46.565  97.917  87.688  1.00 33.66  ? 432  LEU A CD2  1 
ATOM   5567  H H    . LEU A 1 366 ? 47.187  102.598 88.560  1.00 62.96  ? 432  LEU A H    1 
ATOM   5568  H HA   . LEU A 1 366 ? 47.234  100.938 90.537  1.00 54.94  ? 432  LEU A HA   1 
ATOM   5569  H HB2  . LEU A 1 366 ? 46.143  100.357 88.606  1.00 61.29  ? 432  LEU A HB2  1 
ATOM   5570  H HB3  . LEU A 1 366 ? 47.490  100.423 87.779  1.00 61.29  ? 432  LEU A HB3  1 
ATOM   5571  H HG   . LEU A 1 366 ? 48.225  98.462  88.758  1.00 44.82  ? 432  LEU A HG   1 
ATOM   5572  H HD11 . LEU A 1 366 ? 46.900  97.263  90.244  1.00 29.23  ? 432  LEU A HD11 1 
ATOM   5573  H HD12 . LEU A 1 366 ? 47.269  98.681  90.857  1.00 29.23  ? 432  LEU A HD12 1 
ATOM   5574  H HD13 . LEU A 1 366 ? 45.828  98.435  90.234  1.00 29.23  ? 432  LEU A HD13 1 
ATOM   5575  H HD21 . LEU A 1 366 ? 46.693  96.964  87.819  1.00 40.39  ? 432  LEU A HD21 1 
ATOM   5576  H HD22 . LEU A 1 366 ? 45.619  98.131  87.716  1.00 40.39  ? 432  LEU A HD22 1 
ATOM   5577  H HD23 . LEU A 1 366 ? 46.940  98.187  86.835  1.00 40.39  ? 432  LEU A HD23 1 
ATOM   5578  N N    . TYR A 1 367 ? 50.016  101.116 89.015  1.00 59.44  ? 433  TYR A N    1 
ATOM   5579  C CA   . TYR A 1 367 ? 51.427  100.786 89.065  1.00 41.79  ? 433  TYR A CA   1 
ATOM   5580  C C    . TYR A 1 367 ? 52.009  101.297 90.365  1.00 47.59  ? 433  TYR A C    1 
ATOM   5581  O O    . TYR A 1 367 ? 52.475  100.516 91.194  1.00 41.41  ? 433  TYR A O    1 
ATOM   5582  C CB   . TYR A 1 367 ? 52.135  101.439 87.884  1.00 44.02  ? 433  TYR A CB   1 
ATOM   5583  C CG   . TYR A 1 367 ? 53.530  100.935 87.634  1.00 48.46  ? 433  TYR A CG   1 
ATOM   5584  C CD1  . TYR A 1 367 ? 53.757  99.607  87.295  1.00 54.87  ? 433  TYR A CD1  1 
ATOM   5585  C CD2  . TYR A 1 367 ? 54.619  101.791 87.707  1.00 47.72  ? 433  TYR A CD2  1 
ATOM   5586  C CE1  . TYR A 1 367 ? 55.029  99.142  87.051  1.00 57.34  ? 433  TYR A CE1  1 
ATOM   5587  C CE2  . TYR A 1 367 ? 55.892  101.341 87.464  1.00 73.66  ? 433  TYR A CE2  1 
ATOM   5588  C CZ   . TYR A 1 367 ? 56.097  100.016 87.137  1.00 78.88  ? 433  TYR A CZ   1 
ATOM   5589  O OH   . TYR A 1 367 ? 57.381  99.575  86.894  1.00 82.07  ? 433  TYR A OH   1 
ATOM   5590  H H    . TYR A 1 367 ? 49.807  101.646 88.371  1.00 71.32  ? 433  TYR A H    1 
ATOM   5591  H HA   . TYR A 1 367 ? 51.547  99.825  89.017  1.00 50.15  ? 433  TYR A HA   1 
ATOM   5592  H HB2  . TYR A 1 367 ? 51.615  101.274 87.081  1.00 52.82  ? 433  TYR A HB2  1 
ATOM   5593  H HB3  . TYR A 1 367 ? 52.192  102.393 88.045  1.00 52.82  ? 433  TYR A HB3  1 
ATOM   5594  H HD1  . TYR A 1 367 ? 53.038  99.021  87.237  1.00 65.84  ? 433  TYR A HD1  1 
ATOM   5595  H HD2  . TYR A 1 367 ? 54.484  102.685 87.927  1.00 57.27  ? 433  TYR A HD2  1 
ATOM   5596  H HE1  . TYR A 1 367 ? 55.169  98.249  86.829  1.00 68.80  ? 433  TYR A HE1  1 
ATOM   5597  H HE2  . TYR A 1 367 ? 56.613  101.926 87.522  1.00 88.39  ? 433  TYR A HE2  1 
ATOM   5598  H HH   . TYR A 1 367 ? 57.924  100.210 86.982  1.00 98.49  ? 433  TYR A HH   1 
ATOM   5599  N N    . LYS A 1 368 ? 51.951  102.615 90.543  1.00 49.69  ? 434  LYS A N    1 
ATOM   5600  C CA   . LYS A 1 368 ? 52.553  103.266 91.698  1.00 43.59  ? 434  LYS A CA   1 
ATOM   5601  C C    . LYS A 1 368 ? 51.977  102.693 92.973  1.00 44.62  ? 434  LYS A C    1 
ATOM   5602  O O    . LYS A 1 368 ? 52.686  102.507 93.943  1.00 66.41  ? 434  LYS A O    1 
ATOM   5603  C CB   . LYS A 1 368 ? 52.344  104.779 91.648  1.00 38.75  ? 434  LYS A CB   1 
ATOM   5604  C CG   . LYS A 1 368 ? 52.623  105.382 90.265  1.00 55.09  ? 434  LYS A CG   1 
ATOM   5605  C CD   . LYS A 1 368 ? 53.403  106.703 90.314  1.00 72.19  ? 434  LYS A CD   1 
ATOM   5606  C CE   . LYS A 1 368 ? 52.724  107.731 91.208  1.00 69.79  ? 434  LYS A CE   1 
ATOM   5607  N NZ   . LYS A 1 368 ? 52.943  109.115 90.706  1.00 75.37  ? 434  LYS A NZ   1 
ATOM   5608  H H    . LYS A 1 368 ? 51.562  103.159 90.002  1.00 59.62  ? 434  LYS A H    1 
ATOM   5609  H HA   . LYS A 1 368 ? 53.508  103.094 91.695  1.00 52.31  ? 434  LYS A HA   1 
ATOM   5610  H HB2  . LYS A 1 368 ? 51.423  104.976 91.880  1.00 46.50  ? 434  LYS A HB2  1 
ATOM   5611  H HB3  . LYS A 1 368 ? 52.942  105.200 92.284  1.00 46.50  ? 434  LYS A HB3  1 
ATOM   5612  H HG2  . LYS A 1 368 ? 53.144  104.749 89.747  1.00 66.11  ? 434  LYS A HG2  1 
ATOM   5613  H HG3  . LYS A 1 368 ? 51.778  105.553 89.821  1.00 66.11  ? 434  LYS A HG3  1 
ATOM   5614  H HD2  . LYS A 1 368 ? 54.292  106.536 90.665  1.00 86.63  ? 434  LYS A HD2  1 
ATOM   5615  H HD3  . LYS A 1 368 ? 53.462  107.072 89.418  1.00 86.63  ? 434  LYS A HD3  1 
ATOM   5616  H HE2  . LYS A 1 368 ? 51.769  107.560 91.224  1.00 83.75  ? 434  LYS A HE2  1 
ATOM   5617  H HE3  . LYS A 1 368 ? 53.092  107.670 92.103  1.00 83.75  ? 434  LYS A HE3  1 
ATOM   5618  H HZ1  . LYS A 1 368 ? 52.539  109.700 91.241  1.00 90.45  ? 434  LYS A HZ1  1 
ATOM   5619  H HZ2  . LYS A 1 368 ? 53.814  109.296 90.684  1.00 90.45  ? 434  LYS A HZ2  1 
ATOM   5620  H HZ3  . LYS A 1 368 ? 52.610  109.196 89.884  1.00 90.45  ? 434  LYS A HZ3  1 
ATOM   5621  N N    . LYS A 1 369 ? 50.696  102.378 92.972  1.00 32.36  ? 435  LYS A N    1 
ATOM   5622  C CA   . LYS A 1 369 ? 50.084  101.868 94.178  1.00 38.63  ? 435  LYS A CA   1 
ATOM   5623  C C    . LYS A 1 369 ? 50.598  100.478 94.543  1.00 35.42  ? 435  LYS A C    1 
ATOM   5624  O O    . LYS A 1 369 ? 50.966  100.254 95.683  1.00 45.53  ? 435  LYS A O    1 
ATOM   5625  C CB   . LYS A 1 369 ? 48.562  101.846 94.043  1.00 50.43  ? 435  LYS A CB   1 
ATOM   5626  C CG   . LYS A 1 369 ? 47.807  101.692 95.360  1.00 47.02  ? 435  LYS A CG   1 
ATOM   5627  C CD   . LYS A 1 369 ? 48.018  102.851 96.301  1.00 45.87  ? 435  LYS A CD   1 
ATOM   5628  C CE   . LYS A 1 369 ? 47.105  102.709 97.521  1.00 76.97  ? 435  LYS A CE   1 
ATOM   5629  N NZ   . LYS A 1 369 ? 47.734  101.938 98.629  1.00 86.86  ? 435  LYS A NZ   1 
ATOM   5630  H H    . LYS A 1 369 ? 50.167  102.448 92.298  1.00 38.83  ? 435  LYS A H    1 
ATOM   5631  H HA   . LYS A 1 369 ? 50.304  102.464 94.912  1.00 46.36  ? 435  LYS A HA   1 
ATOM   5632  H HB2  . LYS A 1 369 ? 48.276  102.678 93.636  1.00 60.51  ? 435  LYS A HB2  1 
ATOM   5633  H HB3  . LYS A 1 369 ? 48.314  101.101 93.473  1.00 60.51  ? 435  LYS A HB3  1 
ATOM   5634  H HG2  . LYS A 1 369 ? 46.857  101.628 95.173  1.00 56.43  ? 435  LYS A HG2  1 
ATOM   5635  H HG3  . LYS A 1 369 ? 48.111  100.886 95.806  1.00 56.43  ? 435  LYS A HG3  1 
ATOM   5636  H HD2  . LYS A 1 369 ? 48.940  102.859 96.605  1.00 55.04  ? 435  LYS A HD2  1 
ATOM   5637  H HD3  . LYS A 1 369 ? 47.802  103.681 95.848  1.00 55.04  ? 435  LYS A HD3  1 
ATOM   5638  H HE2  . LYS A 1 369 ? 46.888  103.593 97.857  1.00 92.37  ? 435  LYS A HE2  1 
ATOM   5639  H HE3  . LYS A 1 369 ? 46.295  102.246 97.256  1.00 92.37  ? 435  LYS A HE3  1 
ATOM   5640  H HZ1  . LYS A 1 369 ? 47.172  101.879 99.316  1.00 104.23 ? 435  LYS A HZ1  1 
ATOM   5641  H HZ2  . LYS A 1 369 ? 47.938  101.117 98.351  1.00 104.23 ? 435  LYS A HZ2  1 
ATOM   5642  H HZ3  . LYS A 1 369 ? 48.479  102.345 98.899  1.00 104.23 ? 435  LYS A HZ3  1 
ATOM   5643  N N    . LEU A 1 370 ? 50.638  99.555  93.583  1.00 52.74  ? 436  LEU A N    1 
ATOM   5644  C CA   . LEU A 1 370 ? 50.905  98.141  93.882  1.00 42.29  ? 436  LEU A CA   1 
ATOM   5645  C C    . LEU A 1 370 ? 52.149  97.506  93.231  1.00 56.81  ? 436  LEU A C    1 
ATOM   5646  O O    . LEU A 1 370 ? 52.349  96.306  93.385  1.00 49.63  ? 436  LEU A O    1 
ATOM   5647  C CB   . LEU A 1 370 ? 49.681  97.298  93.525  1.00 43.43  ? 436  LEU A CB   1 
ATOM   5648  C CG   . LEU A 1 370 ? 48.396  97.675  94.266  1.00 62.54  ? 436  LEU A CG   1 
ATOM   5649  C CD1  . LEU A 1 370 ? 47.230  96.750  93.893  1.00 46.99  ? 436  LEU A CD1  1 
ATOM   5650  C CD2  . LEU A 1 370 ? 48.609  97.663  95.776  1.00 71.88  ? 436  LEU A CD2  1 
ATOM   5651  H H    . LEU A 1 370 ? 50.514  99.718  92.748  1.00 63.29  ? 436  LEU A H    1 
ATOM   5652  H HA   . LEU A 1 370 ? 51.027  98.064  94.842  1.00 50.74  ? 436  LEU A HA   1 
ATOM   5653  H HB2  . LEU A 1 370 ? 49.509  97.391  92.575  1.00 52.12  ? 436  LEU A HB2  1 
ATOM   5654  H HB3  . LEU A 1 370 ? 49.875  96.370  93.731  1.00 52.12  ? 436  LEU A HB3  1 
ATOM   5655  H HG   . LEU A 1 370 ? 48.146  98.578  94.012  1.00 75.05  ? 436  LEU A HG   1 
ATOM   5656  H HD11 . LEU A 1 370 ? 46.440  97.025  94.384  1.00 56.39  ? 436  LEU A HD11 1 
ATOM   5657  H HD12 . LEU A 1 370 ? 47.067  96.816  92.940  1.00 56.39  ? 436  LEU A HD12 1 
ATOM   5658  H HD13 . LEU A 1 370 ? 47.464  95.838  94.127  1.00 56.39  ? 436  LEU A HD13 1 
ATOM   5659  H HD21 . LEU A 1 370 ? 47.778  97.906  96.213  1.00 86.26  ? 436  LEU A HD21 1 
ATOM   5660  H HD22 . LEU A 1 370 ? 48.879  96.773  96.049  1.00 86.26  ? 436  LEU A HD22 1 
ATOM   5661  H HD23 . LEU A 1 370 ? 49.301  98.304  96.001  1.00 86.26  ? 436  LEU A HD23 1 
ATOM   5662  N N    . PHE A 1 371 ? 52.983  98.283  92.534  1.00 54.58  ? 437  PHE A N    1 
ATOM   5663  C CA   . PHE A 1 371 ? 54.195  97.737  91.901  1.00 61.19  ? 437  PHE A CA   1 
ATOM   5664  C C    . PHE A 1 371 ? 55.494  98.451  92.325  1.00 79.43  ? 437  PHE A C    1 
ATOM   5665  O O    . PHE A 1 371 ? 55.957  99.391  91.659  1.00 71.36  ? 437  PHE A O    1 
ATOM   5666  C CB   . PHE A 1 371 ? 54.043  97.738  90.369  1.00 67.98  ? 437  PHE A CB   1 
ATOM   5667  C CG   . PHE A 1 371 ? 52.962  96.819  89.879  1.00 52.03  ? 437  PHE A CG   1 
ATOM   5668  C CD1  . PHE A 1 371 ? 51.629  97.139  90.053  1.00 66.33  ? 437  PHE A CD1  1 
ATOM   5669  C CD2  . PHE A 1 371 ? 53.275  95.626  89.272  1.00 55.49  ? 437  PHE A CD2  1 
ATOM   5670  C CE1  . PHE A 1 371 ? 50.622  96.276  89.623  1.00 61.63  ? 437  PHE A CE1  1 
ATOM   5671  C CE2  . PHE A 1 371 ? 52.281  94.765  88.847  1.00 54.06  ? 437  PHE A CE2  1 
ATOM   5672  C CZ   . PHE A 1 371 ? 50.953  95.095  89.018  1.00 47.52  ? 437  PHE A CZ   1 
ATOM   5673  H H    . PHE A 1 371 ? 52.873  99.127  92.411  1.00 65.49  ? 437  PHE A H    1 
ATOM   5674  H HA   . PHE A 1 371 ? 54.282  96.811  92.176  1.00 73.42  ? 437  PHE A HA   1 
ATOM   5675  H HB2  . PHE A 1 371 ? 53.827  98.637  90.075  1.00 81.58  ? 437  PHE A HB2  1 
ATOM   5676  H HB3  . PHE A 1 371 ? 54.880  97.453  89.970  1.00 81.58  ? 437  PHE A HB3  1 
ATOM   5677  H HD1  . PHE A 1 371 ? 51.399  97.939  90.467  1.00 79.60  ? 437  PHE A HD1  1 
ATOM   5678  H HD2  . PHE A 1 371 ? 54.168  95.391  89.155  1.00 66.59  ? 437  PHE A HD2  1 
ATOM   5679  H HE1  . PHE A 1 371 ? 49.729  96.505  89.741  1.00 73.96  ? 437  PHE A HE1  1 
ATOM   5680  H HE2  . PHE A 1 371 ? 52.509  93.964  88.432  1.00 64.87  ? 437  PHE A HE2  1 
ATOM   5681  H HZ   . PHE A 1 371 ? 50.286  94.519  88.723  1.00 57.02  ? 437  PHE A HZ   1 
ATOM   5682  N N    . SER A 1 372 ? 56.074  97.971  93.431  1.00 93.44  ? 438  SER A N    1 
ATOM   5683  C CA   . SER A 1 372 ? 57.357  98.465  93.953  1.00 90.78  ? 438  SER A CA   1 
ATOM   5684  C C    . SER A 1 372 ? 58.559  97.880  93.193  1.00 83.83  ? 438  SER A C    1 
ATOM   5685  O O    . SER A 1 372 ? 59.245  98.576  92.435  1.00 70.20  ? 438  SER A O    1 
ATOM   5686  C CB   . SER A 1 372 ? 57.478  98.130  95.449  1.00 84.68  ? 438  SER A CB   1 
ATOM   5687  O OG   . SER A 1 372 ? 58.831  98.169  95.888  1.00 83.77  ? 438  SER A OG   1 
ATOM   5688  H H    . SER A 1 372 ? 55.735  97.343  93.910  1.00 112.13 ? 438  SER A H    1 
ATOM   5689  H HA   . SER A 1 372 ? 57.385  99.430  93.859  1.00 108.93 ? 438  SER A HA   1 
ATOM   5690  H HB2  . SER A 1 372 ? 56.966  98.778  95.958  1.00 101.62 ? 438  SER A HB2  1 
ATOM   5691  H HB3  . SER A 1 372 ? 57.125  97.240  95.600  1.00 101.62 ? 438  SER A HB3  1 
ATOM   5692  H HG   . SER A 1 372 ? 58.873  97.983  96.706  1.00 100.53 ? 438  SER A HG   1 
ATOM   5693  N N    . GLY A 1 389 ? 63.978  85.136  89.056  1.00 79.01  ? 455  GLY A N    1 
ATOM   5694  C CA   . GLY A 1 389 ? 64.644  86.383  88.719  1.00 91.83  ? 455  GLY A CA   1 
ATOM   5695  C C    . GLY A 1 389 ? 64.035  87.586  89.432  1.00 105.94 ? 455  GLY A C    1 
ATOM   5696  O O    . GLY A 1 389 ? 63.121  87.427  90.252  1.00 100.92 ? 455  GLY A O    1 
ATOM   5697  H HA2  . GLY A 1 389 ? 65.581  86.325  88.963  1.00 110.20 ? 455  GLY A HA2  1 
ATOM   5698  H HA3  . GLY A 1 389 ? 64.584  86.532  87.762  1.00 110.20 ? 455  GLY A HA3  1 
ATOM   5699  N N    . PRO A 1 390 ? 64.557  88.800  89.151  1.00 102.00 ? 456  PRO A N    1 
ATOM   5700  C CA   . PRO A 1 390 ? 64.055  90.030  89.792  1.00 90.08  ? 456  PRO A CA   1 
ATOM   5701  C C    . PRO A 1 390 ? 62.550  90.335  89.621  1.00 97.08  ? 456  PRO A C    1 
ATOM   5702  O O    . PRO A 1 390 ? 61.798  90.371  90.604  1.00 93.15  ? 456  PRO A O    1 
ATOM   5703  C CB   . PRO A 1 390 ? 64.863  91.145  89.097  1.00 73.26  ? 456  PRO A CB   1 
ATOM   5704  C CG   . PRO A 1 390 ? 65.395  90.531  87.838  1.00 69.54  ? 456  PRO A CG   1 
ATOM   5705  C CD   . PRO A 1 390 ? 65.625  89.089  88.175  1.00 85.60  ? 456  PRO A CD   1 
ATOM   5706  H HA   . PRO A 1 390 ? 64.264  90.025  90.740  1.00 108.09 ? 456  PRO A HA   1 
ATOM   5707  H HB2  . PRO A 1 390 ? 64.279  91.892  88.892  1.00 87.91  ? 456  PRO A HB2  1 
ATOM   5708  H HB3  . PRO A 1 390 ? 65.591  91.427  89.673  1.00 87.91  ? 456  PRO A HB3  1 
ATOM   5709  H HG2  . PRO A 1 390 ? 64.738  90.617  87.129  1.00 83.45  ? 456  PRO A HG2  1 
ATOM   5710  H HG3  . PRO A 1 390 ? 66.227  90.962  87.589  1.00 83.45  ? 456  PRO A HG3  1 
ATOM   5711  H HD2  . PRO A 1 390 ? 65.521  88.535  87.385  1.00 102.72 ? 456  PRO A HD2  1 
ATOM   5712  H HD3  . PRO A 1 390 ? 66.498  88.971  88.582  1.00 102.72 ? 456  PRO A HD3  1 
ATOM   5713  N N    . ASN A 1 391 ? 62.137  90.529  88.369  1.00 93.03  ? 457  ASN A N    1 
ATOM   5714  C CA   . ASN A 1 391 ? 60.764  90.866  87.988  1.00 73.77  ? 457  ASN A CA   1 
ATOM   5715  C C    . ASN A 1 391 ? 59.668  89.869  88.386  1.00 72.61  ? 457  ASN A C    1 
ATOM   5716  O O    . ASN A 1 391 ? 58.492  90.204  88.321  1.00 70.89  ? 457  ASN A O    1 
ATOM   5717  C CB   . ASN A 1 391 ? 60.711  90.999  86.462  1.00 64.62  ? 457  ASN A CB   1 
ATOM   5718  C CG   . ASN A 1 391 ? 61.176  92.347  85.974  1.00 60.71  ? 457  ASN A CG   1 
ATOM   5719  O OD1  . ASN A 1 391 ? 61.585  93.195  86.764  1.00 76.34  ? 457  ASN A OD1  1 
ATOM   5720  N ND2  . ASN A 1 391 ? 61.133  92.550  84.659  1.00 49.42  ? 457  ASN A ND2  1 
ATOM   5721  H H    . ASN A 1 391 ? 62.694  90.646  87.714  1.00 111.64 ? 457  ASN A H    1 
ATOM   5722  H HA   . ASN A 1 391 ? 60.519  91.727  88.363  1.00 88.53  ? 457  ASN A HA   1 
ATOM   5723  H HB2  . ASN A 1 391 ? 61.284  90.323  86.067  1.00 77.54  ? 457  ASN A HB2  1 
ATOM   5724  H HB3  . ASN A 1 391 ? 59.796  90.872  86.166  1.00 77.54  ? 457  ASN A HB3  1 
ATOM   5725  H HD21 . ASN A 1 391 ? 61.388  93.303  84.332  1.00 59.31  ? 457  ASN A HD21 1 
ATOM   5726  H HD22 . ASN A 1 391 ? 60.851  91.928  84.137  1.00 59.31  ? 457  ASN A HD22 1 
ATOM   5727  N N    . ALA A 1 392 ? 60.024  88.648  88.759  1.00 76.07  ? 458  ALA A N    1 
ATOM   5728  C CA   . ALA A 1 392 ? 59.018  87.598  88.937  1.00 59.36  ? 458  ALA A CA   1 
ATOM   5729  C C    . ALA A 1 392 ? 57.904  87.993  89.897  1.00 69.83  ? 458  ALA A C    1 
ATOM   5730  O O    . ALA A 1 392 ? 56.742  87.633  89.692  1.00 68.62  ? 458  ALA A O    1 
ATOM   5731  C CB   . ALA A 1 392 ? 59.667  86.309  89.415  1.00 38.82  ? 458  ALA A CB   1 
ATOM   5732  H H    . ALA A 1 392 ? 60.832  88.398  88.916  1.00 91.29  ? 458  ALA A H    1 
ATOM   5733  H HA   . ALA A 1 392 ? 58.609  87.417  88.076  1.00 71.24  ? 458  ALA A HA   1 
ATOM   5734  H HB1  . ALA A 1 392 ? 58.980  85.633  89.524  1.00 46.59  ? 458  ALA A HB1  1 
ATOM   5735  H HB2  . ALA A 1 392 ? 60.316  86.019  88.755  1.00 46.59  ? 458  ALA A HB2  1 
ATOM   5736  H HB3  . ALA A 1 392 ? 60.107  86.474  90.263  1.00 46.59  ? 458  ALA A HB3  1 
ATOM   5737  N N    . ASN A 1 393 ? 58.253  88.722  90.952  1.00 72.57  ? 459  ASN A N    1 
ATOM   5738  C CA   . ASN A 1 393 ? 57.273  89.036  91.984  1.00 71.71  ? 459  ASN A CA   1 
ATOM   5739  C C    . ASN A 1 393 ? 56.259  90.055  91.464  1.00 63.08  ? 459  ASN A C    1 
ATOM   5740  O O    . ASN A 1 393 ? 55.100  90.074  91.887  1.00 53.39  ? 459  ASN A O    1 
ATOM   5741  C CB   . ASN A 1 393 ? 57.960  89.554  93.249  1.00 83.90  ? 459  ASN A CB   1 
ATOM   5742  C CG   . ASN A 1 393 ? 57.083  89.417  94.481  1.00 97.91  ? 459  ASN A CG   1 
ATOM   5743  O OD1  . ASN A 1 393 ? 56.449  88.379  94.694  1.00 100.69 ? 459  ASN A OD1  1 
ATOM   5744  N ND2  . ASN A 1 393 ? 57.024  90.475  95.290  1.00 96.56  ? 459  ASN A ND2  1 
ATOM   5745  H H    . ASN A 1 393 ? 59.038  89.042  91.093  1.00 87.08  ? 459  ASN A H    1 
ATOM   5746  H HA   . ASN A 1 393 ? 56.791  88.227  92.217  1.00 86.05  ? 459  ASN A HA   1 
ATOM   5747  H HB2  . ASN A 1 393 ? 58.772  89.047  93.399  1.00 100.68 ? 459  ASN A HB2  1 
ATOM   5748  H HB3  . ASN A 1 393 ? 58.171  90.494  93.133  1.00 100.68 ? 459  ASN A HB3  1 
ATOM   5749  H HD21 . ASN A 1 393 ? 56.541  90.446  96.001  1.00 115.87 ? 459  ASN A HD21 1 
ATOM   5750  H HD22 . ASN A 1 393 ? 57.470  91.186  95.102  1.00 115.87 ? 459  ASN A HD22 1 
ATOM   5751  N N    . LEU A 1 394 ? 56.709  90.892  90.534  1.00 50.75  ? 460  LEU A N    1 
ATOM   5752  C CA   . LEU A 1 394 ? 55.844  91.863  89.890  1.00 48.55  ? 460  LEU A CA   1 
ATOM   5753  C C    . LEU A 1 394 ? 54.859  91.176  88.952  1.00 57.75  ? 460  LEU A C    1 
ATOM   5754  O O    . LEU A 1 394 ? 53.714  91.605  88.844  1.00 71.35  ? 460  LEU A O    1 
ATOM   5755  C CB   . LEU A 1 394 ? 56.668  92.888  89.112  1.00 58.23  ? 460  LEU A CB   1 
ATOM   5756  C CG   . LEU A 1 394 ? 57.494  93.894  89.922  1.00 55.06  ? 460  LEU A CG   1 
ATOM   5757  C CD1  . LEU A 1 394 ? 58.315  94.801  88.988  1.00 46.80  ? 460  LEU A CD1  1 
ATOM   5758  C CD2  . LEU A 1 394 ? 56.613  94.728  90.849  1.00 32.40  ? 460  LEU A CD2  1 
ATOM   5759  H H    . LEU A 1 394 ? 57.523  90.913  90.257  1.00 60.90  ? 460  LEU A H    1 
ATOM   5760  H HA   . LEU A 1 394 ? 55.337  92.335  90.568  1.00 58.26  ? 460  LEU A HA   1 
ATOM   5761  H HB2  . LEU A 1 394 ? 57.287  92.405  88.543  1.00 69.87  ? 460  LEU A HB2  1 
ATOM   5762  H HB3  . LEU A 1 394 ? 56.060  93.401  88.557  1.00 69.87  ? 460  LEU A HB3  1 
ATOM   5763  H HG   . LEU A 1 394 ? 58.119  93.403  90.477  1.00 66.07  ? 460  LEU A HG   1 
ATOM   5764  H HD11 . LEU A 1 394 ? 58.827  95.426  89.525  1.00 56.16  ? 460  LEU A HD11 1 
ATOM   5765  H HD12 . LEU A 1 394 ? 58.914  94.250  88.461  1.00 56.16  ? 460  LEU A HD12 1 
ATOM   5766  H HD13 . LEU A 1 394 ? 57.710  95.284  88.404  1.00 56.16  ? 460  LEU A HD13 1 
ATOM   5767  H HD21 . LEU A 1 394 ? 57.172  95.350  91.341  1.00 38.88  ? 460  LEU A HD21 1 
ATOM   5768  H HD22 . LEU A 1 394 ? 55.966  95.216  90.315  1.00 38.88  ? 460  LEU A HD22 1 
ATOM   5769  H HD23 . LEU A 1 394 ? 56.154  94.136  91.465  1.00 38.88  ? 460  LEU A HD23 1 
ATOM   5770  N N    . VAL A 1 395 ? 55.309  90.123  88.270  1.00 55.61  ? 461  VAL A N    1 
ATOM   5771  C CA   . VAL A 1 395 ? 54.442  89.341  87.388  1.00 47.78  ? 461  VAL A CA   1 
ATOM   5772  C C    . VAL A 1 395 ? 53.374  88.568  88.166  1.00 51.92  ? 461  VAL A C    1 
ATOM   5773  O O    . VAL A 1 395 ? 52.218  88.540  87.755  1.00 58.27  ? 461  VAL A O    1 
ATOM   5774  C CB   . VAL A 1 395 ? 55.252  88.371  86.501  1.00 51.73  ? 461  VAL A CB   1 
ATOM   5775  C CG1  . VAL A 1 395 ? 54.359  87.325  85.850  1.00 54.56  ? 461  VAL A CG1  1 
ATOM   5776  C CG2  . VAL A 1 395 ? 55.984  89.137  85.433  1.00 48.59  ? 461  VAL A CG2  1 
ATOM   5777  H H    . VAL A 1 395 ? 56.120  89.838  88.301  1.00 66.73  ? 461  VAL A H    1 
ATOM   5778  H HA   . VAL A 1 395 ? 53.979  89.954  86.796  1.00 57.33  ? 461  VAL A HA   1 
ATOM   5779  H HB   . VAL A 1 395 ? 55.908  87.911  87.048  1.00 62.08  ? 461  VAL A HB   1 
ATOM   5780  H HG11 . VAL A 1 395 ? 54.906  86.739  85.304  1.00 65.47  ? 461  VAL A HG11 1 
ATOM   5781  H HG12 . VAL A 1 395 ? 53.915  86.813  86.544  1.00 65.47  ? 461  VAL A HG12 1 
ATOM   5782  H HG13 . VAL A 1 395 ? 53.700  87.773  85.297  1.00 65.47  ? 461  VAL A HG13 1 
ATOM   5783  H HG21 . VAL A 1 395 ? 56.486  88.513  84.887  1.00 58.31  ? 461  VAL A HG21 1 
ATOM   5784  H HG22 . VAL A 1 395 ? 55.338  89.611  84.887  1.00 58.31  ? 461  VAL A HG22 1 
ATOM   5785  H HG23 . VAL A 1 395 ? 56.587  89.768  85.856  1.00 58.31  ? 461  VAL A HG23 1 
ATOM   5786  N N    . LYS A 1 396 ? 53.739  87.936  89.277  1.00 56.70  ? 462  LYS A N    1 
ATOM   5787  C CA   . LYS A 1 396 ? 52.733  87.247  90.088  1.00 59.18  ? 462  LYS A CA   1 
ATOM   5788  C C    . LYS A 1 396 ? 51.687  88.251  90.570  1.00 63.10  ? 462  LYS A C    1 
ATOM   5789  O O    . LYS A 1 396 ? 50.523  87.908  90.786  1.00 62.28  ? 462  LYS A O    1 
ATOM   5790  C CB   . LYS A 1 396 ? 53.366  86.560  91.297  1.00 53.68  ? 462  LYS A CB   1 
ATOM   5791  C CG   . LYS A 1 396 ? 54.394  85.487  90.969  1.00 74.17  ? 462  LYS A CG   1 
ATOM   5792  C CD   . LYS A 1 396 ? 54.524  84.436  92.089  1.00 90.64  ? 462  LYS A CD   1 
ATOM   5793  C CE   . LYS A 1 396 ? 53.232  83.612  92.284  1.00 89.29  ? 462  LYS A CE   1 
ATOM   5794  N NZ   . LYS A 1 396 ? 53.355  82.521  93.312  1.00 76.78  ? 462  LYS A NZ   1 
ATOM   5795  H H    . LYS A 1 396 ? 54.542  87.890  89.580  1.00 68.04  ? 462  LYS A H    1 
ATOM   5796  H HA   . LYS A 1 396 ? 52.288  86.574  89.550  1.00 71.01  ? 462  LYS A HA   1 
ATOM   5797  H HB2  . LYS A 1 396 ? 53.810  87.234  91.836  1.00 64.42  ? 462  LYS A HB2  1 
ATOM   5798  H HB3  . LYS A 1 396 ? 52.662  86.142  91.817  1.00 64.42  ? 462  LYS A HB3  1 
ATOM   5799  H HG2  . LYS A 1 396 ? 54.126  85.029  90.156  1.00 89.01  ? 462  LYS A HG2  1 
ATOM   5800  H HG3  . LYS A 1 396 ? 55.260  85.904  90.845  1.00 89.01  ? 462  LYS A HG3  1 
ATOM   5801  H HD2  . LYS A 1 396 ? 55.241  83.822  91.865  1.00 108.77 ? 462  LYS A HD2  1 
ATOM   5802  H HD3  . LYS A 1 396 ? 54.721  84.887  92.925  1.00 108.77 ? 462  LYS A HD3  1 
ATOM   5803  H HE2  . LYS A 1 396 ? 52.522  84.208  92.568  1.00 107.15 ? 462  LYS A HE2  1 
ATOM   5804  H HE3  . LYS A 1 396 ? 52.996  83.197  91.439  1.00 107.15 ? 462  LYS A HE3  1 
ATOM   5805  H HZ1  . LYS A 1 396 ? 52.585  82.081  93.382  1.00 92.13  ? 462  LYS A HZ1  1 
ATOM   5806  H HZ2  . LYS A 1 396 ? 53.994  81.949  93.074  1.00 92.13  ? 462  LYS A HZ2  1 
ATOM   5807  H HZ3  . LYS A 1 396 ? 53.561  82.871  94.104  1.00 92.13  ? 462  LYS A HZ3  1 
ATOM   5808  N N    . THR A 1 397 ? 52.123  89.496  90.743  1.00 61.52  ? 463  THR A N    1 
ATOM   5809  C CA   . THR A 1 397 ? 51.266  90.551  91.274  1.00 63.53  ? 463  THR A CA   1 
ATOM   5810  C C    . THR A 1 397 ? 50.189  90.930  90.262  1.00 59.37  ? 463  THR A C    1 
ATOM   5811  O O    . THR A 1 397 ? 49.025  91.098  90.625  1.00 51.81  ? 463  THR A O    1 
ATOM   5812  C CB   . THR A 1 397 ? 52.097  91.801  91.659  1.00 63.47  ? 463  THR A CB   1 
ATOM   5813  O OG1  . THR A 1 397 ? 52.762  91.577  92.906  1.00 72.38  ? 463  THR A OG1  1 
ATOM   5814  C CG2  . THR A 1 397 ? 51.213  93.027  91.802  1.00 65.68  ? 463  THR A CG2  1 
ATOM   5815  H H    . THR A 1 397 ? 52.921  89.757  90.559  1.00 73.82  ? 463  THR A H    1 
ATOM   5816  H HA   . THR A 1 397 ? 50.824  90.226  92.074  1.00 76.23  ? 463  THR A HA   1 
ATOM   5817  H HB   . THR A 1 397 ? 52.755  91.976  90.969  1.00 76.16  ? 463  THR A HB   1 
ATOM   5818  H HG1  . THR A 1 397 ? 53.275  90.915  92.843  1.00 86.86  ? 463  THR A HG1  1 
ATOM   5819  H HG21 . THR A 1 397 ? 51.752  93.797  92.043  1.00 78.81  ? 463  THR A HG21 1 
ATOM   5820  H HG22 . THR A 1 397 ? 50.760  93.209  90.964  1.00 78.81  ? 463  THR A HG22 1 
ATOM   5821  H HG23 . THR A 1 397 ? 50.549  92.878  92.494  1.00 78.81  ? 463  THR A HG23 1 
ATOM   5822  N N    . LEU A 1 398 ? 50.590  91.073  89.000  1.00 51.55  ? 464  LEU A N    1 
ATOM   5823  C CA   . LEU A 1 398 ? 49.660  91.394  87.924  1.00 41.80  ? 464  LEU A CA   1 
ATOM   5824  C C    . LEU A 1 398 ? 48.619  90.292  87.749  1.00 45.62  ? 464  LEU A C    1 
ATOM   5825  O O    . LEU A 1 398 ? 47.436  90.573  87.560  1.00 39.15  ? 464  LEU A O    1 
ATOM   5826  C CB   . LEU A 1 398 ? 50.412  91.585  86.612  1.00 29.74  ? 464  LEU A CB   1 
ATOM   5827  C CG   . LEU A 1 398 ? 49.523  91.931  85.415  1.00 44.09  ? 464  LEU A CG   1 
ATOM   5828  C CD1  . LEU A 1 398 ? 48.740  93.219  85.644  1.00 35.13  ? 464  LEU A CD1  1 
ATOM   5829  C CD2  . LEU A 1 398 ? 50.353  92.045  84.138  1.00 40.42  ? 464  LEU A CD2  1 
ATOM   5830  H H    . LEU A 1 398 ? 51.406  90.988  88.741  1.00 61.86  ? 464  LEU A H    1 
ATOM   5831  H HA   . LEU A 1 398 ? 49.198  92.221  88.134  1.00 50.16  ? 464  LEU A HA   1 
ATOM   5832  H HB2  . LEU A 1 398 ? 51.050  92.308  86.723  1.00 35.69  ? 464  LEU A HB2  1 
ATOM   5833  H HB3  . LEU A 1 398 ? 50.882  90.764  86.402  1.00 35.69  ? 464  LEU A HB3  1 
ATOM   5834  H HG   . LEU A 1 398 ? 48.882  91.214  85.287  1.00 52.91  ? 464  LEU A HG   1 
ATOM   5835  H HD11 . LEU A 1 398 ? 48.193  93.398  84.863  1.00 42.15  ? 464  LEU A HD11 1 
ATOM   5836  H HD12 . LEU A 1 398 ? 48.176  93.110  86.425  1.00 42.15  ? 464  LEU A HD12 1 
ATOM   5837  H HD13 . LEU A 1 398 ? 49.365  93.947  85.784  1.00 42.15  ? 464  LEU A HD13 1 
ATOM   5838  H HD21 . LEU A 1 398 ? 49.765  92.264  83.398  1.00 48.51  ? 464  LEU A HD21 1 
ATOM   5839  H HD22 . LEU A 1 398 ? 51.015  92.745  84.254  1.00 48.51  ? 464  LEU A HD22 1 
ATOM   5840  H HD23 . LEU A 1 398 ? 50.794  91.197  83.971  1.00 48.51  ? 464  LEU A HD23 1 
ATOM   5841  N N    . VAL A 1 399 ? 49.080  89.045  87.810  1.00 43.76  ? 465  VAL A N    1 
ATOM   5842  C CA   . VAL A 1 399 ? 48.212  87.882  87.675  1.00 41.38  ? 465  VAL A CA   1 
ATOM   5843  C C    . VAL A 1 399 ? 47.212  87.831  88.813  1.00 46.19  ? 465  VAL A C    1 
ATOM   5844  O O    . VAL A 1 399 ? 46.095  87.353  88.651  1.00 51.05  ? 465  VAL A O    1 
ATOM   5845  C CB   . VAL A 1 399 ? 49.021  86.572  87.696  1.00 42.92  ? 465  VAL A CB   1 
ATOM   5846  C CG1  . VAL A 1 399 ? 48.090  85.358  87.697  1.00 29.67  ? 465  VAL A CG1  1 
ATOM   5847  C CG2  . VAL A 1 399 ? 49.990  86.514  86.518  1.00 39.21  ? 465  VAL A CG2  1 
ATOM   5848  H H    . VAL A 1 399 ? 49.907  88.845  87.931  1.00 52.51  ? 465  VAL A H    1 
ATOM   5849  H HA   . VAL A 1 399 ? 47.726  87.933  86.837  1.00 49.65  ? 465  VAL A HA   1 
ATOM   5850  H HB   . VAL A 1 399 ? 49.545  86.543  88.512  1.00 51.51  ? 465  VAL A HB   1 
ATOM   5851  H HG11 . VAL A 1 399 ? 48.625  84.550  87.711  1.00 35.60  ? 465  VAL A HG11 1 
ATOM   5852  H HG12 . VAL A 1 399 ? 47.525  85.395  88.485  1.00 35.60  ? 465  VAL A HG12 1 
ATOM   5853  H HG13 . VAL A 1 399 ? 47.543  85.380  86.896  1.00 35.60  ? 465  VAL A HG13 1 
ATOM   5854  H HG21 . VAL A 1 399 ? 50.485  85.681  86.557  1.00 47.05  ? 465  VAL A HG21 1 
ATOM   5855  H HG22 . VAL A 1 399 ? 49.484  86.561  85.692  1.00 47.05  ? 465  VAL A HG22 1 
ATOM   5856  H HG23 . VAL A 1 399 ? 50.601  87.265  86.575  1.00 47.05  ? 465  VAL A HG23 1 
ATOM   5857  N N    . PHE A 1 400 ? 47.627  88.296  89.981  1.00 45.42  ? 466  PHE A N    1 
ATOM   5858  C CA   . PHE A 1 400 ? 46.736  88.294  91.128  1.00 64.66  ? 466  PHE A CA   1 
ATOM   5859  C C    . PHE A 1 400 ? 45.727  89.406  90.936  1.00 53.24  ? 466  PHE A C    1 
ATOM   5860  O O    . PHE A 1 400 ? 44.548  89.245  91.222  1.00 56.14  ? 466  PHE A O    1 
ATOM   5861  C CB   . PHE A 1 400 ? 47.521  88.457  92.442  1.00 70.54  ? 466  PHE A CB   1 
ATOM   5862  C CG   . PHE A 1 400 ? 48.256  87.201  92.882  1.00 77.60  ? 466  PHE A CG   1 
ATOM   5863  C CD1  . PHE A 1 400 ? 47.765  85.937  92.561  1.00 76.29  ? 466  PHE A CD1  1 
ATOM   5864  C CD2  . PHE A 1 400 ? 49.434  87.286  93.623  1.00 78.67  ? 466  PHE A CD2  1 
ATOM   5865  C CE1  . PHE A 1 400 ? 48.428  84.794  92.957  1.00 69.09  ? 466  PHE A CE1  1 
ATOM   5866  C CE2  . PHE A 1 400 ? 50.106  86.138  94.029  1.00 69.04  ? 466  PHE A CE2  1 
ATOM   5867  C CZ   . PHE A 1 400 ? 49.599  84.893  93.696  1.00 78.29  ? 466  PHE A CZ   1 
ATOM   5868  H H    . PHE A 1 400 ? 48.411  88.614  90.136  1.00 54.50  ? 466  PHE A H    1 
ATOM   5869  H HA   . PHE A 1 400 ? 46.258  87.451  91.161  1.00 77.59  ? 466  PHE A HA   1 
ATOM   5870  H HB2  . PHE A 1 400 ? 48.179  89.160  92.326  1.00 84.65  ? 466  PHE A HB2  1 
ATOM   5871  H HB3  . PHE A 1 400 ? 46.902  88.700  93.147  1.00 84.65  ? 466  PHE A HB3  1 
ATOM   5872  H HD1  . PHE A 1 400 ? 46.980  85.863  92.066  1.00 91.55  ? 466  PHE A HD1  1 
ATOM   5873  H HD2  . PHE A 1 400 ? 49.776  88.121  93.849  1.00 94.40  ? 466  PHE A HD2  1 
ATOM   5874  H HE1  . PHE A 1 400 ? 48.088  83.958  92.735  1.00 82.91  ? 466  PHE A HE1  1 
ATOM   5875  H HE2  . PHE A 1 400 ? 50.891  86.206  94.523  1.00 82.85  ? 466  PHE A HE2  1 
ATOM   5876  H HZ   . PHE A 1 400 ? 50.045  84.123  93.964  1.00 93.95  ? 466  PHE A HZ   1 
ATOM   5877  N N    . PHE A 1 401 ? 46.191  90.526  90.411  1.00 47.20  ? 467  PHE A N    1 
ATOM   5878  C CA   . PHE A 1 401 ? 45.314  91.651  90.198  1.00 43.78  ? 467  PHE A CA   1 
ATOM   5879  C C    . PHE A 1 401 ? 44.240  91.302  89.195  1.00 45.07  ? 467  PHE A C    1 
ATOM   5880  O O    . PHE A 1 401 ? 43.073  91.639  89.387  1.00 48.31  ? 467  PHE A O    1 
ATOM   5881  C CB   . PHE A 1 401 ? 46.092  92.847  89.677  1.00 46.23  ? 467  PHE A CB   1 
ATOM   5882  C CG   . PHE A 1 401 ? 45.221  94.008  89.346  1.00 49.90  ? 467  PHE A CG   1 
ATOM   5883  C CD1  . PHE A 1 401 ? 44.644  94.758  90.352  1.00 43.90  ? 467  PHE A CD1  1 
ATOM   5884  C CD2  . PHE A 1 401 ? 44.955  94.333  88.039  1.00 45.70  ? 467  PHE A CD2  1 
ATOM   5885  C CE1  . PHE A 1 401 ? 43.831  95.807  90.057  1.00 42.74  ? 467  PHE A CE1  1 
ATOM   5886  C CE2  . PHE A 1 401 ? 44.142  95.389  87.742  1.00 54.64  ? 467  PHE A CE2  1 
ATOM   5887  C CZ   . PHE A 1 401 ? 43.580  96.129  88.753  1.00 47.91  ? 467  PHE A CZ   1 
ATOM   5888  H H    . PHE A 1 401 ? 47.007  90.658  90.172  1.00 56.64  ? 467  PHE A H    1 
ATOM   5889  H HA   . PHE A 1 401 ? 44.890  91.897  91.034  1.00 52.53  ? 467  PHE A HA   1 
ATOM   5890  H HB2  . PHE A 1 401 ? 46.724  93.132  90.355  1.00 55.47  ? 467  PHE A HB2  1 
ATOM   5891  H HB3  . PHE A 1 401 ? 46.564  92.589  88.870  1.00 55.47  ? 467  PHE A HB3  1 
ATOM   5892  H HD1  . PHE A 1 401 ? 44.812  94.541  91.240  1.00 52.68  ? 467  PHE A HD1  1 
ATOM   5893  H HD2  . PHE A 1 401 ? 45.333  93.833  87.352  1.00 54.85  ? 467  PHE A HD2  1 
ATOM   5894  H HE1  . PHE A 1 401 ? 43.453  96.310  90.742  1.00 51.29  ? 467  PHE A HE1  1 
ATOM   5895  H HE2  . PHE A 1 401 ? 43.970  95.608  86.855  1.00 65.57  ? 467  PHE A HE2  1 
ATOM   5896  H HZ   . PHE A 1 401 ? 43.028  96.849  88.550  1.00 57.49  ? 467  PHE A HZ   1 
ATOM   5897  N N    . PHE A 1 402 ? 44.660  90.640  88.121  1.00 41.08  ? 468  PHE A N    1 
ATOM   5898  C CA   . PHE A 1 402 ? 43.768  90.210  87.056  1.00 33.16  ? 468  PHE A CA   1 
ATOM   5899  C C    . PHE A 1 402 ? 42.746  89.214  87.577  1.00 39.36  ? 468  PHE A C    1 
ATOM   5900  O O    . PHE A 1 402 ? 41.578  89.244  87.188  1.00 53.20  ? 468  PHE A O    1 
ATOM   5901  C CB   . PHE A 1 402 ? 44.593  89.594  85.925  1.00 43.31  ? 468  PHE A CB   1 
ATOM   5902  C CG   . PHE A 1 402 ? 43.776  89.044  84.792  1.00 54.27  ? 468  PHE A CG   1 
ATOM   5903  C CD1  . PHE A 1 402 ? 42.745  89.775  84.237  1.00 45.01  ? 468  PHE A CD1  1 
ATOM   5904  C CD2  . PHE A 1 402 ? 44.065  87.795  84.262  1.00 56.23  ? 468  PHE A CD2  1 
ATOM   5905  C CE1  . PHE A 1 402 ? 42.003  89.263  83.193  1.00 47.89  ? 468  PHE A CE1  1 
ATOM   5906  C CE2  . PHE A 1 402 ? 43.324  87.286  83.219  1.00 43.38  ? 468  PHE A CE2  1 
ATOM   5907  C CZ   . PHE A 1 402 ? 42.289  88.018  82.691  1.00 37.99  ? 468  PHE A CZ   1 
ATOM   5908  H H    . PHE A 1 402 ? 45.481  90.423  87.986  1.00 49.29  ? 468  PHE A H    1 
ATOM   5909  H HA   . PHE A 1 402 ? 43.293  90.979  86.703  1.00 39.80  ? 468  PHE A HA   1 
ATOM   5910  H HB2  . PHE A 1 402 ? 45.180  90.275  85.562  1.00 51.98  ? 468  PHE A HB2  1 
ATOM   5911  H HB3  . PHE A 1 402 ? 45.121  88.866  86.288  1.00 51.98  ? 468  PHE A HB3  1 
ATOM   5912  H HD1  . PHE A 1 402 ? 42.540  90.615  84.579  1.00 54.01  ? 468  PHE A HD1  1 
ATOM   5913  H HD2  . PHE A 1 402 ? 44.759  87.292  84.622  1.00 67.48  ? 468  PHE A HD2  1 
ATOM   5914  H HE1  . PHE A 1 402 ? 41.304  89.760  82.832  1.00 57.46  ? 468  PHE A HE1  1 
ATOM   5915  H HE2  . PHE A 1 402 ? 43.521  86.444  82.877  1.00 52.06  ? 468  PHE A HE2  1 
ATOM   5916  H HZ   . PHE A 1 402 ? 41.793  87.676  81.983  1.00 45.59  ? 468  PHE A HZ   1 
ATOM   5917  N N    . LEU A 1 403 ? 43.176  88.341  88.478  1.00 35.18  ? 469  LEU A N    1 
ATOM   5918  C CA   . LEU A 1 403 ? 42.279  87.332  89.022  1.00 41.82  ? 469  LEU A CA   1 
ATOM   5919  C C    . LEU A 1 403 ? 41.261  87.911  89.997  1.00 51.06  ? 469  LEU A C    1 
ATOM   5920  O O    . LEU A 1 403 ? 40.102  87.491  90.011  1.00 57.91  ? 469  LEU A O    1 
ATOM   5921  C CB   . LEU A 1 403 ? 43.080  86.221  89.683  1.00 46.69  ? 469  LEU A CB   1 
ATOM   5922  C CG   . LEU A 1 403 ? 43.613  85.185  88.691  1.00 44.23  ? 469  LEU A CG   1 
ATOM   5923  C CD1  . LEU A 1 403 ? 44.724  84.341  89.301  1.00 35.02  ? 469  LEU A CD1  1 
ATOM   5924  C CD2  . LEU A 1 403 ? 42.481  84.297  88.214  1.00 31.43  ? 469  LEU A CD2  1 
ATOM   5925  H H    . LEU A 1 403 ? 43.978  88.311  88.788  1.00 42.22  ? 469  LEU A H    1 
ATOM   5926  H HA   . LEU A 1 403 ? 41.784  86.936  88.288  1.00 50.18  ? 469  LEU A HA   1 
ATOM   5927  H HB2  . LEU A 1 403 ? 43.839  86.612  90.143  1.00 56.03  ? 469  LEU A HB2  1 
ATOM   5928  H HB3  . LEU A 1 403 ? 42.511  85.759  90.319  1.00 56.03  ? 469  LEU A HB3  1 
ATOM   5929  H HG   . LEU A 1 403 ? 43.977  85.646  87.919  1.00 53.07  ? 469  LEU A HG   1 
ATOM   5930  H HD11 . LEU A 1 403 ? 45.032  83.701  88.641  1.00 42.02  ? 469  LEU A HD11 1 
ATOM   5931  H HD12 . LEU A 1 403 ? 45.455  84.924  89.563  1.00 42.02  ? 469  LEU A HD12 1 
ATOM   5932  H HD13 . LEU A 1 403 ? 44.377  83.876  90.078  1.00 42.02  ? 469  LEU A HD13 1 
ATOM   5933  H HD21 . LEU A 1 403 ? 42.834  83.646  87.587  1.00 37.72  ? 469  LEU A HD21 1 
ATOM   5934  H HD22 . LEU A 1 403 ? 42.093  83.843  88.979  1.00 37.72  ? 469  LEU A HD22 1 
ATOM   5935  H HD23 . LEU A 1 403 ? 41.811  84.846  87.779  1.00 37.72  ? 469  LEU A HD23 1 
ATOM   5936  N N    . GLU A 1 404 ? 41.691  88.883  90.796  1.00 52.00  ? 470  GLU A N    1 
ATOM   5937  C CA   . GLU A 1 404 ? 40.818  89.508  91.786  1.00 56.43  ? 470  GLU A CA   1 
ATOM   5938  C C    . GLU A 1 404 ? 39.733  90.365  91.140  1.00 68.36  ? 470  GLU A C    1 
ATOM   5939  O O    . GLU A 1 404 ? 38.585  90.323  91.572  1.00 88.31  ? 470  GLU A O    1 
ATOM   5940  C CB   . GLU A 1 404 ? 41.622  90.350  92.784  1.00 61.04  ? 470  GLU A CB   1 
ATOM   5941  C CG   . GLU A 1 404 ? 42.580  89.559  93.696  1.00 75.80  ? 470  GLU A CG   1 
ATOM   5942  C CD   . GLU A 1 404 ? 41.958  88.284  94.267  1.00 88.15  ? 470  GLU A CD   1 
ATOM   5943  O OE1  . GLU A 1 404 ? 40.875  88.371  94.892  1.00 97.79  ? 470  GLU A OE1  1 
ATOM   5944  O OE2  . GLU A 1 404 ? 42.553  87.192  94.095  1.00 80.00  ? 470  GLU A OE2  1 
ATOM   5945  H H    . GLU A 1 404 ? 42.490  89.201  90.785  1.00 62.40  ? 470  GLU A H    1 
ATOM   5946  H HA   . GLU A 1 404 ? 40.373  88.807  92.288  1.00 67.71  ? 470  GLU A HA   1 
ATOM   5947  H HB2  . GLU A 1 404 ? 42.155  90.990  92.287  1.00 73.25  ? 470  GLU A HB2  1 
ATOM   5948  H HB3  . GLU A 1 404 ? 40.999  90.824  93.358  1.00 73.25  ? 470  GLU A HB3  1 
ATOM   5949  H HG2  . GLU A 1 404 ? 43.363  89.304  93.183  1.00 90.95  ? 470  GLU A HG2  1 
ATOM   5950  H HG3  . GLU A 1 404 ? 42.842  90.122  94.440  1.00 90.95  ? 470  GLU A HG3  1 
ATOM   5951  N N    . SER A 1 405 ? 40.084  91.136  90.114  1.00 65.18  ? 471  SER A N    1 
ATOM   5952  C CA   . SER A 1 405 ? 39.087  91.935  89.405  1.00 79.26  ? 471  SER A CA   1 
ATOM   5953  C C    . SER A 1 405 ? 38.205  91.047  88.524  1.00 67.29  ? 471  SER A C    1 
ATOM   5954  O O    . SER A 1 405 ? 38.693  90.380  87.612  1.00 71.36  ? 471  SER A O    1 
ATOM   5955  C CB   . SER A 1 405 ? 39.745  93.045  88.567  1.00 87.50  ? 471  SER A CB   1 
ATOM   5956  O OG   . SER A 1 405 ? 40.671  92.533  87.626  1.00 68.78  ? 471  SER A OG   1 
ATOM   5957  H H    . SER A 1 405 ? 40.885  91.214  89.811  1.00 78.21  ? 471  SER A H    1 
ATOM   5958  H HA   . SER A 1 405 ? 38.512  92.363  90.058  1.00 95.11  ? 471  SER A HA   1 
ATOM   5959  H HB2  . SER A 1 405 ? 39.051  93.527  88.090  1.00 104.99 ? 471  SER A HB2  1 
ATOM   5960  H HB3  . SER A 1 405 ? 40.211  93.650  89.165  1.00 104.99 ? 471  SER A HB3  1 
ATOM   5961  H HG   . SER A 1 405 ? 41.283  92.116  88.023  1.00 82.54  ? 471  SER A HG   1 
ATOM   5962  N N    . GLU A 1 406 ? 36.904  91.070  88.800  1.00 58.88  ? 472  GLU A N    1 
ATOM   5963  C CA   . GLU A 1 406 ? 35.930  90.222  88.121  1.00 66.55  ? 472  GLU A CA   1 
ATOM   5964  C C    . GLU A 1 406 ? 35.258  90.888  86.912  1.00 65.51  ? 472  GLU A C    1 
ATOM   5965  O O    . GLU A 1 406 ? 34.237  90.411  86.440  1.00 78.98  ? 472  GLU A O    1 
ATOM   5966  C CB   . GLU A 1 406 ? 34.826  89.805  89.112  1.00 83.55  ? 472  GLU A CB   1 
ATOM   5967  C CG   . GLU A 1 406 ? 35.286  88.974  90.327  1.00 95.01  ? 472  GLU A CG   1 
ATOM   5968  C CD   . GLU A 1 406 ? 35.793  87.560  89.978  1.00 96.15  ? 472  GLU A CD   1 
ATOM   5969  O OE1  . GLU A 1 406 ? 35.575  86.652  90.809  1.00 83.93  ? 472  GLU A OE1  1 
ATOM   5970  O OE2  . GLU A 1 406 ? 36.400  87.347  88.897  1.00 94.94  ? 472  GLU A OE2  1 
ATOM   5971  H H    . GLU A 1 406 ? 36.552  91.584  89.394  1.00 70.65  ? 472  GLU A H    1 
ATOM   5972  H HA   . GLU A 1 406 ? 36.375  89.417  87.811  1.00 79.86  ? 472  GLU A HA   1 
ATOM   5973  H HB2  . GLU A 1 406 ? 34.405  90.609  89.455  1.00 100.26 ? 472  GLU A HB2  1 
ATOM   5974  H HB3  . GLU A 1 406 ? 34.169  89.277  88.633  1.00 100.26 ? 472  GLU A HB3  1 
ATOM   5975  H HG2  . GLU A 1 406 ? 36.009  89.445  90.770  1.00 114.02 ? 472  GLU A HG2  1 
ATOM   5976  H HG3  . GLU A 1 406 ? 34.538  88.876  90.938  1.00 114.02 ? 472  GLU A HG3  1 
ATOM   5977  N N    . LEU A 1 407 ? 35.809  91.985  86.410  1.00 63.13  ? 473  LEU A N    1 
ATOM   5978  C CA   . LEU A 1 407 ? 35.188  92.684  85.280  1.00 54.58  ? 473  LEU A CA   1 
ATOM   5979  C C    . LEU A 1 407 ? 35.649  92.198  83.888  1.00 58.87  ? 473  LEU A C    1 
ATOM   5980  O O    . LEU A 1 407 ? 34.948  92.418  82.902  1.00 59.65  ? 473  LEU A O    1 
ATOM   5981  C CB   . LEU A 1 407 ? 35.421  94.193  85.392  1.00 59.57  ? 473  LEU A CB   1 
ATOM   5982  C CG   . LEU A 1 407 ? 34.519  94.955  86.362  1.00 60.01  ? 473  LEU A CG   1 
ATOM   5983  C CD1  . LEU A 1 407 ? 34.892  96.430  86.390  1.00 49.36  ? 473  LEU A CD1  1 
ATOM   5984  C CD2  . LEU A 1 407 ? 33.051  94.789  86.002  1.00 64.15  ? 473  LEU A CD2  1 
ATOM   5985  H H    . LEU A 1 407 ? 36.535  92.346  86.698  1.00 75.76  ? 473  LEU A H    1 
ATOM   5986  H HA   . LEU A 1 407 ? 34.230  92.539  85.329  1.00 65.50  ? 473  LEU A HA   1 
ATOM   5987  H HB2  . LEU A 1 407 ? 36.337  94.338  85.678  1.00 71.49  ? 473  LEU A HB2  1 
ATOM   5988  H HB3  . LEU A 1 407 ? 35.293  94.585  84.514  1.00 71.49  ? 473  LEU A HB3  1 
ATOM   5989  H HG   . LEU A 1 407 ? 34.648  94.598  87.255  1.00 72.01  ? 473  LEU A HG   1 
ATOM   5990  H HD11 . LEU A 1 407 ? 34.307  96.891  87.011  1.00 59.23  ? 473  LEU A HD11 1 
ATOM   5991  H HD12 . LEU A 1 407 ? 35.815  96.517  86.677  1.00 59.23  ? 473  LEU A HD12 1 
ATOM   5992  H HD13 . LEU A 1 407 ? 34.786  96.799  85.499  1.00 59.23  ? 473  LEU A HD13 1 
ATOM   5993  H HD21 . LEU A 1 407 ? 32.512  95.285  86.638  1.00 76.98  ? 473  LEU A HD21 1 
ATOM   5994  H HD22 . LEU A 1 407 ? 32.905  95.132  85.106  1.00 76.98  ? 473  LEU A HD22 1 
ATOM   5995  H HD23 . LEU A 1 407 ? 32.822  93.847  86.037  1.00 76.98  ? 473  LEU A HD23 1 
ATOM   5996  N N    . HIS A 1 408 ? 36.819  91.565  83.800  1.00 54.95  ? 474  HIS A N    1 
ATOM   5997  C CA   . HIS A 1 408 ? 37.316  91.039  82.534  1.00 40.58  ? 474  HIS A CA   1 
ATOM   5998  C C    . HIS A 1 408 ? 37.789  89.607  82.701  1.00 49.20  ? 474  HIS A C    1 
ATOM   5999  O O    . HIS A 1 408 ? 38.328  89.224  83.743  1.00 57.88  ? 474  HIS A O    1 
ATOM   6000  C CB   . HIS A 1 408 ? 38.468  91.884  82.017  1.00 49.73  ? 474  HIS A CB   1 
ATOM   6001  C CG   . HIS A 1 408 ? 38.058  92.942  81.043  1.00 38.12  ? 474  HIS A CG   1 
ATOM   6002  N ND1  . HIS A 1 408 ? 36.873  93.633  81.149  1.00 43.72  ? 474  HIS A ND1  1 
ATOM   6003  C CD2  . HIS A 1 408 ? 38.693  93.448  79.960  1.00 42.34  ? 474  HIS A CD2  1 
ATOM   6004  C CE1  . HIS A 1 408 ? 36.785  94.510  80.164  1.00 35.80  ? 474  HIS A CE1  1 
ATOM   6005  N NE2  . HIS A 1 408 ? 37.874  94.416  79.429  1.00 38.79  ? 474  HIS A NE2  1 
ATOM   6006  H H    . HIS A 1 408 ? 37.346  91.428  84.466  1.00 65.95  ? 474  HIS A H    1 
ATOM   6007  H HA   . HIS A 1 408 ? 36.604  91.053  81.876  1.00 48.70  ? 474  HIS A HA   1 
ATOM   6008  H HB2  . HIS A 1 408 ? 38.895  92.323  82.769  1.00 59.68  ? 474  HIS A HB2  1 
ATOM   6009  H HB3  . HIS A 1 408 ? 39.105  91.303  81.572  1.00 59.68  ? 474  HIS A HB3  1 
ATOM   6010  H HD1  . HIS A 1 408 ? 36.279  93.508  81.758  1.00 52.47  ? 474  HIS A HD1  1 
ATOM   6011  H HD2  . HIS A 1 408 ? 39.521  93.183  79.632  1.00 50.81  ? 474  HIS A HD2  1 
ATOM   6012  H HE1  . HIS A 1 408 ? 36.075  95.092  80.015  1.00 42.96  ? 474  HIS A HE1  1 
ATOM   6013  H HE2  . HIS A 1 408 ? 38.047  94.887  78.730  1.00 46.55  ? 474  HIS A HE2  1 
ATOM   6014  N N    . GLU A 1 409 ? 37.591  88.831  81.647  1.00 48.65  ? 475  GLU A N    1 
ATOM   6015  C CA   . GLU A 1 409 ? 37.909  87.417  81.633  1.00 41.61  ? 475  GLU A CA   1 
ATOM   6016  C C    . GLU A 1 409 ? 39.074  87.153  80.695  1.00 35.85  ? 475  GLU A C    1 
ATOM   6017  O O    . GLU A 1 409 ? 39.474  86.016  80.478  1.00 35.65  ? 475  GLU A O    1 
ATOM   6018  C CB   . GLU A 1 409 ? 36.677  86.636  81.177  1.00 48.93  ? 475  GLU A CB   1 
ATOM   6019  C CG   . GLU A 1 409 ? 35.618  86.437  82.259  1.00 75.93  ? 475  GLU A CG   1 
ATOM   6020  C CD   . GLU A 1 409 ? 34.284  86.001  81.681  1.00 106.87 ? 475  GLU A CD   1 
ATOM   6021  O OE1  . GLU A 1 409 ? 34.275  85.490  80.534  1.00 108.15 ? 475  GLU A OE1  1 
ATOM   6022  O OE2  . GLU A 1 409 ? 33.247  86.190  82.357  1.00 116.70 ? 475  GLU A OE2  1 
ATOM   6023  H H    . GLU A 1 409 ? 37.262  89.113  80.904  1.00 58.37  ? 475  GLU A H    1 
ATOM   6024  H HA   . GLU A 1 409 ? 38.152  87.126  82.525  1.00 49.93  ? 475  GLU A HA   1 
ATOM   6025  H HB2  . GLU A 1 409 ? 36.261  87.113  80.442  1.00 58.72  ? 475  GLU A HB2  1 
ATOM   6026  H HB3  . GLU A 1 409 ? 36.960  85.758  80.877  1.00 58.72  ? 475  GLU A HB3  1 
ATOM   6027  H HG2  . GLU A 1 409 ? 35.918  85.752  82.876  1.00 91.12  ? 475  GLU A HG2  1 
ATOM   6028  H HG3  . GLU A 1 409 ? 35.484  87.275  82.730  1.00 91.12  ? 475  GLU A HG3  1 
ATOM   6029  N N    . HIS A 1 410 ? 39.599  88.219  80.114  1.00 39.07  ? 476  HIS A N    1 
ATOM   6030  C CA   . HIS A 1 410 ? 40.821  88.150  79.327  1.00 40.02  ? 476  HIS A CA   1 
ATOM   6031  C C    . HIS A 1 410 ? 41.619  89.404  79.625  1.00 41.36  ? 476  HIS A C    1 
ATOM   6032  O O    . HIS A 1 410 ? 41.092  90.377  80.168  1.00 45.38  ? 476  HIS A O    1 
ATOM   6033  C CB   . HIS A 1 410 ? 40.530  88.045  77.829  1.00 45.43  ? 476  HIS A CB   1 
ATOM   6034  C CG   . HIS A 1 410 ? 39.793  89.222  77.277  1.00 49.18  ? 476  HIS A CG   1 
ATOM   6035  N ND1  . HIS A 1 410 ? 40.356  90.086  76.365  1.00 38.56  ? 476  HIS A ND1  1 
ATOM   6036  C CD2  . HIS A 1 410 ? 38.540  89.681  77.512  1.00 46.38  ? 476  HIS A CD2  1 
ATOM   6037  C CE1  . HIS A 1 410 ? 39.480  91.030  76.064  1.00 44.21  ? 476  HIS A CE1  1 
ATOM   6038  N NE2  . HIS A 1 410 ? 38.371  90.808  76.746  1.00 41.70  ? 476  HIS A NE2  1 
ATOM   6039  H H    . HIS A 1 410 ? 39.261  89.008  80.160  1.00 46.88  ? 476  HIS A H    1 
ATOM   6040  H HA   . HIS A 1 410 ? 41.342  87.378  79.598  1.00 48.02  ? 476  HIS A HA   1 
ATOM   6041  H HB2  . HIS A 1 410 ? 41.371  87.971  77.351  1.00 54.52  ? 476  HIS A HB2  1 
ATOM   6042  H HB3  . HIS A 1 410 ? 39.990  87.255  77.670  1.00 54.52  ? 476  HIS A HB3  1 
ATOM   6043  H HD1  . HIS A 1 410 ? 41.151  90.024  76.045  1.00 46.27  ? 476  HIS A HD1  1 
ATOM   6044  H HD2  . HIS A 1 410 ? 37.913  89.305  78.088  1.00 55.65  ? 476  HIS A HD2  1 
ATOM   6045  H HE1  . HIS A 1 410 ? 39.621  91.731  75.469  1.00 53.06  ? 476  HIS A HE1  1 
ATOM   6046  H HE2  . HIS A 1 410 ? 37.659  91.288  76.713  1.00 50.04  ? 476  HIS A HE2  1 
ATOM   6047  N N    . ALA A 1 411 ? 42.891  89.386  79.265  1.00 35.28  ? 477  ALA A N    1 
ATOM   6048  C CA   . ALA A 1 411 ? 43.828  90.362  79.791  1.00 35.97  ? 477  ALA A CA   1 
ATOM   6049  C C    . ALA A 1 411 ? 44.116  91.512  78.842  1.00 36.55  ? 477  ALA A C    1 
ATOM   6050  O O    . ALA A 1 411 ? 44.831  92.442  79.210  1.00 47.32  ? 477  ALA A O    1 
ATOM   6051  C CB   . ALA A 1 411 ? 45.119  89.665  80.162  1.00 45.62  ? 477  ALA A CB   1 
ATOM   6052  H H    . ALA A 1 411 ? 43.238  88.820  78.719  1.00 42.34  ? 477  ALA A H    1 
ATOM   6053  H HA   . ALA A 1 411 ? 43.456  90.740  80.603  1.00 43.17  ? 477  ALA A HA   1 
ATOM   6054  H HB1  . ALA A 1 411 ? 45.742  90.320  80.512  1.00 54.74  ? 477  ALA A HB1  1 
ATOM   6055  H HB2  . ALA A 1 411 ? 44.932  88.992  80.835  1.00 54.74  ? 477  ALA A HB2  1 
ATOM   6056  H HB3  . ALA A 1 411 ? 45.490  89.246  79.369  1.00 54.74  ? 477  ALA A HB3  1 
ATOM   6057  N N    . ALA A 1 412 ? 43.548  91.457  77.640  1.00 38.19  ? 478  ALA A N    1 
ATOM   6058  C CA   . ALA A 1 412 ? 43.901  92.377  76.545  1.00 37.98  ? 478  ALA A CA   1 
ATOM   6059  C C    . ALA A 1 412 ? 43.839  93.860  76.902  1.00 38.23  ? 478  ALA A C    1 
ATOM   6060  O O    . ALA A 1 412 ? 44.635  94.656  76.421  1.00 44.59  ? 478  ALA A O    1 
ATOM   6061  C CB   . ALA A 1 412 ? 43.017  92.113  75.331  1.00 25.81  ? 478  ALA A CB   1 
ATOM   6062  H H    . ALA A 1 412 ? 42.942  90.885  77.424  1.00 45.83  ? 478  ALA A H    1 
ATOM   6063  H HA   . ALA A 1 412 ? 44.815  92.188  76.279  1.00 45.58  ? 478  ALA A HA   1 
ATOM   6064  H HB1  . ALA A 1 412 ? 43.264  92.727  74.622  1.00 30.97  ? 478  ALA A HB1  1 
ATOM   6065  H HB2  . ALA A 1 412 ? 43.150  91.198  75.037  1.00 30.97  ? 478  ALA A HB2  1 
ATOM   6066  H HB3  . ALA A 1 412 ? 42.090  92.250  75.580  1.00 30.97  ? 478  ALA A HB3  1 
ATOM   6067  N N    . TYR A 1 413 ? 42.875  94.228  77.731  1.00 45.23  ? 479  TYR A N    1 
ATOM   6068  C CA   . TYR A 1 413 ? 42.670  95.618  78.078  1.00 37.11  ? 479  TYR A CA   1 
ATOM   6069  C C    . TYR A 1 413 ? 43.424  95.968  79.332  1.00 45.15  ? 479  TYR A C    1 
ATOM   6070  O O    . TYR A 1 413 ? 43.994  97.052  79.430  1.00 56.08  ? 479  TYR A O    1 
ATOM   6071  C CB   . TYR A 1 413 ? 41.187  95.878  78.219  1.00 32.73  ? 479  TYR A CB   1 
ATOM   6072  C CG   . TYR A 1 413 ? 40.520  95.768  76.885  1.00 40.81  ? 479  TYR A CG   1 
ATOM   6073  C CD1  . TYR A 1 413 ? 40.630  96.796  75.952  1.00 31.61  ? 479  TYR A CD1  1 
ATOM   6074  C CD2  . TYR A 1 413 ? 39.821  94.624  76.529  1.00 36.68  ? 479  TYR A CD2  1 
ATOM   6075  C CE1  . TYR A 1 413 ? 40.022  96.709  74.718  1.00 29.99  ? 479  TYR A CE1  1 
ATOM   6076  C CE2  . TYR A 1 413 ? 39.207  94.525  75.293  1.00 55.55  ? 479  TYR A CE2  1 
ATOM   6077  C CZ   . TYR A 1 413 ? 39.313  95.571  74.388  1.00 45.81  ? 479  TYR A CZ   1 
ATOM   6078  O OH   . TYR A 1 413 ? 38.705  95.478  73.159  1.00 27.09  ? 479  TYR A OH   1 
ATOM   6079  H H    . TYR A 1 413 ? 42.323  93.686  78.108  1.00 54.28  ? 479  TYR A H    1 
ATOM   6080  H HA   . TYR A 1 413 ? 43.006  96.177  77.359  1.00 44.53  ? 479  TYR A HA   1 
ATOM   6081  H HB2  . TYR A 1 413 ? 40.797  95.220  78.815  1.00 39.27  ? 479  TYR A HB2  1 
ATOM   6082  H HB3  . TYR A 1 413 ? 41.046  96.775  78.562  1.00 39.27  ? 479  TYR A HB3  1 
ATOM   6083  H HD1  . TYR A 1 413 ? 41.099  97.567  76.176  1.00 37.94  ? 479  TYR A HD1  1 
ATOM   6084  H HD2  . TYR A 1 413 ? 39.742  93.926  77.139  1.00 44.01  ? 479  TYR A HD2  1 
ATOM   6085  H HE1  . TYR A 1 413 ? 40.093  97.410  74.110  1.00 35.99  ? 479  TYR A HE1  1 
ATOM   6086  H HE2  . TYR A 1 413 ? 38.729  93.759  75.069  1.00 66.66  ? 479  TYR A HE2  1 
ATOM   6087  H HH   . TYR A 1 413 ? 38.846  96.178  72.716  1.00 32.50  ? 479  TYR A HH   1 
ATOM   6088  N N    . LEU A 1 414 ? 43.442  95.045  80.284  1.00 48.98  ? 480  LEU A N    1 
ATOM   6089  C CA   . LEU A 1 414 ? 44.362  95.143  81.401  1.00 34.45  ? 480  LEU A CA   1 
ATOM   6090  C C    . LEU A 1 414 ? 45.783  95.392  80.873  1.00 44.03  ? 480  LEU A C    1 
ATOM   6091  O O    . LEU A 1 414 ? 46.440  96.333  81.300  1.00 36.10  ? 480  LEU A O    1 
ATOM   6092  C CB   . LEU A 1 414 ? 44.293  93.872  82.242  1.00 29.00  ? 480  LEU A CB   1 
ATOM   6093  C CG   . LEU A 1 414 ? 45.352  93.704  83.326  1.00 32.53  ? 480  LEU A CG   1 
ATOM   6094  C CD1  . LEU A 1 414 ? 45.535  94.969  84.133  1.00 31.26  ? 480  LEU A CD1  1 
ATOM   6095  C CD2  . LEU A 1 414 ? 44.960  92.570  84.233  1.00 36.20  ? 480  LEU A CD2  1 
ATOM   6096  H H    . LEU A 1 414 ? 42.931  94.354  80.305  1.00 58.77  ? 480  LEU A H    1 
ATOM   6097  H HA   . LEU A 1 414 ? 44.109  95.893  81.961  1.00 41.34  ? 480  LEU A HA   1 
ATOM   6098  H HB2  . LEU A 1 414 ? 43.429  93.846  82.681  1.00 34.80  ? 480  LEU A HB2  1 
ATOM   6099  H HB3  . LEU A 1 414 ? 44.371  93.111  81.646  1.00 34.80  ? 480  LEU A HB3  1 
ATOM   6100  H HG   . LEU A 1 414 ? 46.201  93.482  82.912  1.00 39.04  ? 480  LEU A HG   1 
ATOM   6101  H HD11 . LEU A 1 414 ? 46.215  94.817  84.808  1.00 37.51  ? 480  LEU A HD11 1 
ATOM   6102  H HD12 . LEU A 1 414 ? 45.811  95.685  83.540  1.00 37.51  ? 480  LEU A HD12 1 
ATOM   6103  H HD13 . LEU A 1 414 ? 44.692  95.196  84.557  1.00 37.51  ? 480  LEU A HD13 1 
ATOM   6104  H HD21 . LEU A 1 414 ? 45.637  92.467  84.920  1.00 43.44  ? 480  LEU A HD21 1 
ATOM   6105  H HD22 . LEU A 1 414 ? 44.103  92.773  84.640  1.00 43.44  ? 480  LEU A HD22 1 
ATOM   6106  H HD23 . LEU A 1 414 ? 44.893  91.756  83.710  1.00 43.44  ? 480  LEU A HD23 1 
ATOM   6107  N N    . VAL A 1 415 ? 46.234  94.580  79.916  1.00 44.73  ? 481  VAL A N    1 
ATOM   6108  C CA   . VAL A 1 415 ? 47.602  94.684  79.396  1.00 33.72  ? 481  VAL A CA   1 
ATOM   6109  C C    . VAL A 1 415 ? 47.877  96.039  78.785  1.00 32.38  ? 481  VAL A C    1 
ATOM   6110  O O    . VAL A 1 415 ? 48.880  96.660  79.113  1.00 42.63  ? 481  VAL A O    1 
ATOM   6111  C CB   . VAL A 1 415 ? 47.925  93.553  78.370  1.00 40.20  ? 481  VAL A CB   1 
ATOM   6112  C CG1  . VAL A 1 415 ? 49.183  93.863  77.542  1.00 32.11  ? 481  VAL A CG1  1 
ATOM   6113  C CG2  . VAL A 1 415 ? 48.134  92.252  79.105  1.00 45.39  ? 481  VAL A CG2  1 
ATOM   6114  H H    . VAL A 1 415 ? 45.768  93.958  79.549  1.00 53.68  ? 481  VAL A H    1 
ATOM   6115  H HA   . VAL A 1 415 ? 48.215  94.577  80.140  1.00 40.46  ? 481  VAL A HA   1 
ATOM   6116  H HB   . VAL A 1 415 ? 47.177  93.445  77.763  1.00 48.24  ? 481  VAL A HB   1 
ATOM   6117  H HG11 . VAL A 1 415 ? 49.340  93.133  76.923  1.00 38.53  ? 481  VAL A HG11 1 
ATOM   6118  H HG12 . VAL A 1 415 ? 49.042  94.688  77.053  1.00 38.53  ? 481  VAL A HG12 1 
ATOM   6119  H HG13 . VAL A 1 415 ? 49.940  93.958  78.142  1.00 38.53  ? 481  VAL A HG13 1 
ATOM   6120  H HG21 . VAL A 1 415 ? 48.334  91.555  78.460  1.00 54.46  ? 481  VAL A HG21 1 
ATOM   6121  H HG22 . VAL A 1 415 ? 48.874  92.354  79.723  1.00 54.46  ? 481  VAL A HG22 1 
ATOM   6122  H HG23 . VAL A 1 415 ? 47.324  92.031  79.590  1.00 54.46  ? 481  VAL A HG23 1 
ATOM   6123  N N    . ASP A 1 416 ? 46.992  96.487  77.900  1.00 28.05  ? 482  ASP A N    1 
ATOM   6124  C CA   . ASP A 1 416 ? 47.156  97.749  77.186  1.00 30.80  ? 482  ASP A CA   1 
ATOM   6125  C C    . ASP A 1 416 ? 47.222  98.964  78.126  1.00 35.89  ? 482  ASP A C    1 
ATOM   6126  O O    . ASP A 1 416 ? 47.926  99.935  77.855  1.00 37.63  ? 482  ASP A O    1 
ATOM   6127  C CB   . ASP A 1 416 ? 46.019  97.922  76.177  1.00 27.30  ? 482  ASP A CB   1 
ATOM   6128  C CG   . ASP A 1 416 ? 46.086  99.257  75.425  1.00 48.71  ? 482  ASP A CG   1 
ATOM   6129  O OD1  . ASP A 1 416 ? 47.175  99.653  74.953  1.00 47.19  ? 482  ASP A OD1  1 
ATOM   6130  O OD2  . ASP A 1 416 ? 45.039  99.924  75.298  1.00 51.45  ? 482  ASP A OD2  1 
ATOM   6131  H H    . ASP A 1 416 ? 46.272  96.067  77.691  1.00 33.66  ? 482  ASP A H    1 
ATOM   6132  H HA   . ASP A 1 416 ? 47.988  97.717  76.689  1.00 36.97  ? 482  ASP A HA   1 
ATOM   6133  H HB2  . ASP A 1 416 ? 46.066  97.207  75.523  1.00 32.77  ? 482  ASP A HB2  1 
ATOM   6134  H HB3  . ASP A 1 416 ? 45.172  97.886  76.648  1.00 32.77  ? 482  ASP A HB3  1 
ATOM   6135  N N    . SER A 1 417 ? 46.491  98.919  79.229  1.00 31.66  ? 483  SER A N    1 
ATOM   6136  C CA   . SER A 1 417 ? 46.470  100.043 80.160  1.00 37.08  ? 483  SER A CA   1 
ATOM   6137  C C    . SER A 1 417 ? 47.849  100.230 80.769  1.00 43.26  ? 483  SER A C    1 
ATOM   6138  O O    . SER A 1 417 ? 48.289  101.345 81.074  1.00 53.95  ? 483  SER A O    1 
ATOM   6139  C CB   . SER A 1 417 ? 45.457  99.768  81.272  1.00 50.50  ? 483  SER A CB   1 
ATOM   6140  O OG   . SER A 1 417 ? 44.208  99.341  80.745  1.00 56.31  ? 483  SER A OG   1 
ATOM   6141  H H    . SER A 1 417 ? 46.000  98.253  79.464  1.00 38.00  ? 483  SER A H    1 
ATOM   6142  H HA   . SER A 1 417 ? 46.217  100.855 79.694  1.00 44.50  ? 483  SER A HA   1 
ATOM   6143  H HB2  . SER A 1 417 ? 45.807  99.073  81.851  1.00 60.60  ? 483  SER A HB2  1 
ATOM   6144  H HB3  . SER A 1 417 ? 45.321  100.583 81.781  1.00 60.60  ? 483  SER A HB3  1 
ATOM   6145  H HG   . SER A 1 417 ? 44.309  98.634  80.303  1.00 67.58  ? 483  SER A HG   1 
ATOM   6146  N N    . MET A 1 418 ? 48.525  99.105  80.939  1.00 36.07  ? 484  MET A N    1 
ATOM   6147  C CA   . MET A 1 418 ? 49.811  99.056  81.599  1.00 46.31  ? 484  MET A CA   1 
ATOM   6148  C C    . MET A 1 418 ? 50.987  99.190  80.618  1.00 54.30  ? 484  MET A C    1 
ATOM   6149  O O    . MET A 1 418 ? 52.121  99.428  81.030  1.00 41.01  ? 484  MET A O    1 
ATOM   6150  C CB   . MET A 1 418 ? 49.911  97.721  82.310  1.00 43.83  ? 484  MET A CB   1 
ATOM   6151  C CG   . MET A 1 418 ? 48.841  97.501  83.337  1.00 28.64  ? 484  MET A CG   1 
ATOM   6152  S SD   . MET A 1 418 ? 48.970  98.640  84.716  1.00 60.16  ? 484  MET A SD   1 
ATOM   6153  C CE   . MET A 1 418 ? 50.558  98.194  85.398  1.00 57.92  ? 484  MET A CE   1 
ATOM   6154  H H    . MET A 1 418 ? 48.248  98.336  80.672  1.00 43.28  ? 484  MET A H    1 
ATOM   6155  H HA   . MET A 1 418 ? 49.862  99.762  82.262  1.00 55.57  ? 484  MET A HA   1 
ATOM   6156  H HB2  . MET A 1 418 ? 49.841  97.011  81.653  1.00 52.60  ? 484  MET A HB2  1 
ATOM   6157  H HB3  . MET A 1 418 ? 50.768  97.670  82.760  1.00 52.60  ? 484  MET A HB3  1 
ATOM   6158  H HG2  . MET A 1 418 ? 47.973  97.628  82.923  1.00 34.37  ? 484  MET A HG2  1 
ATOM   6159  H HG3  . MET A 1 418 ? 48.915  96.598  83.684  1.00 34.37  ? 484  MET A HG3  1 
ATOM   6160  H HE1  . MET A 1 418 ? 50.740  98.756  86.167  1.00 69.51  ? 484  MET A HE1  1 
ATOM   6161  H HE2  . MET A 1 418 ? 50.534  97.262  85.667  1.00 69.51  ? 484  MET A HE2  1 
ATOM   6162  H HE3  . MET A 1 418 ? 51.240  98.326  84.722  1.00 69.51  ? 484  MET A HE3  1 
ATOM   6163  N N    . TRP A 1 419 ? 50.699  99.026  79.329  1.00 48.67  ? 485  TRP A N    1 
ATOM   6164  C CA   . TRP A 1 419 ? 51.715  99.006  78.288  1.00 40.90  ? 485  TRP A CA   1 
ATOM   6165  C C    . TRP A 1 419 ? 52.667  100.181 78.394  1.00 43.64  ? 485  TRP A C    1 
ATOM   6166  O O    . TRP A 1 419 ? 53.869  100.014 78.236  1.00 52.93  ? 485  TRP A O    1 
ATOM   6167  C CB   . TRP A 1 419 ? 51.043  99.013  76.922  1.00 40.02  ? 485  TRP A CB   1 
ATOM   6168  C CG   . TRP A 1 419 ? 51.920  98.597  75.788  1.00 47.17  ? 485  TRP A CG   1 
ATOM   6169  C CD1  . TRP A 1 419 ? 52.393  99.387  74.793  1.00 63.09  ? 485  TRP A CD1  1 
ATOM   6170  C CD2  . TRP A 1 419 ? 52.414  97.279  75.523  1.00 41.85  ? 485  TRP A CD2  1 
ATOM   6171  N NE1  . TRP A 1 419 ? 53.149  98.644  73.918  1.00 67.37  ? 485  TRP A NE1  1 
ATOM   6172  C CE2  . TRP A 1 419 ? 53.178  97.347  74.352  1.00 53.60  ? 485  TRP A CE2  1 
ATOM   6173  C CE3  . TRP A 1 419 ? 52.280  96.050  76.163  1.00 45.98  ? 485  TRP A CE3  1 
ATOM   6174  C CZ2  . TRP A 1 419 ? 53.806  96.232  73.808  1.00 78.05  ? 485  TRP A CZ2  1 
ATOM   6175  C CZ3  . TRP A 1 419 ? 52.908  94.949  75.626  1.00 61.16  ? 485  TRP A CZ3  1 
ATOM   6176  C CH2  . TRP A 1 419 ? 53.661  95.043  74.464  1.00 59.68  ? 485  TRP A CH2  1 
ATOM   6177  H H    . TRP A 1 419 ? 49.900  98.922  79.028  1.00 58.41  ? 485  TRP A H    1 
ATOM   6178  H HA   . TRP A 1 419 ? 52.233  98.190  78.365  1.00 49.08  ? 485  TRP A HA   1 
ATOM   6179  H HB2  . TRP A 1 419 ? 50.287  98.405  76.947  1.00 48.03  ? 485  TRP A HB2  1 
ATOM   6180  H HB3  . TRP A 1 419 ? 50.730  99.913  76.737  1.00 48.03  ? 485  TRP A HB3  1 
ATOM   6181  H HD1  . TRP A 1 419 ? 52.222  100.298 74.708  1.00 75.70  ? 485  TRP A HD1  1 
ATOM   6182  H HE1  . TRP A 1 419 ? 53.546  98.947  73.218  1.00 80.85  ? 485  TRP A HE1  1 
ATOM   6183  H HE3  . TRP A 1 419 ? 51.777  95.974  76.942  1.00 55.17  ? 485  TRP A HE3  1 
ATOM   6184  H HZ2  . TRP A 1 419 ? 54.315  96.295  73.032  1.00 93.66  ? 485  TRP A HZ2  1 
ATOM   6185  H HZ3  . TRP A 1 419 ? 52.824  94.125  76.049  1.00 73.39  ? 485  TRP A HZ3  1 
ATOM   6186  H HH2  . TRP A 1 419 ? 54.073  94.282  74.125  1.00 71.62  ? 485  TRP A HH2  1 
ATOM   6187  N N    . ASP A 1 420 ? 52.126  101.360 78.684  1.00 51.65  ? 486  ASP A N    1 
ATOM   6188  C CA   . ASP A 1 420 ? 52.919  102.591 78.721  1.00 61.69  ? 486  ASP A CA   1 
ATOM   6189  C C    . ASP A 1 420 ? 53.902  102.657 79.901  1.00 52.60  ? 486  ASP A C    1 
ATOM   6190  O O    . ASP A 1 420 ? 55.070  103.001 79.726  1.00 68.90  ? 486  ASP A O    1 
ATOM   6191  C CB   . ASP A 1 420 ? 51.990  103.817 78.773  1.00 83.08  ? 486  ASP A CB   1 
ATOM   6192  C CG   . ASP A 1 420 ? 51.608  104.344 77.383  1.00 93.39  ? 486  ASP A CG   1 
ATOM   6193  O OD1  . ASP A 1 420 ? 52.292  103.983 76.388  1.00 84.65  ? 486  ASP A OD1  1 
ATOM   6194  O OD2  . ASP A 1 420 ? 50.614  105.120 77.294  1.00 87.42  ? 486  ASP A OD2  1 
ATOM   6195  H H    . ASP A 1 420 ? 51.294  101.477 78.865  1.00 61.98  ? 486  ASP A H    1 
ATOM   6196  H HA   . ASP A 1 420 ? 53.438  102.649 77.903  1.00 74.02  ? 486  ASP A HA   1 
ATOM   6197  H HB2  . ASP A 1 420 ? 51.173  103.573 79.235  1.00 99.70  ? 486  ASP A HB2  1 
ATOM   6198  H HB3  . ASP A 1 420 ? 52.439  104.532 79.251  1.00 99.70  ? 486  ASP A HB3  1 
ATOM   6199  N N    . CYS A 1 421 ? 53.425  102.324 81.096  1.00 41.69  ? 487  CYS A N    1 
ATOM   6200  C CA   . CYS A 1 421 ? 54.181  102.539 82.322  1.00 35.14  ? 487  CYS A CA   1 
ATOM   6201  C C    . CYS A 1 421 ? 54.940  101.316 82.823  1.00 44.31  ? 487  CYS A C    1 
ATOM   6202  O O    . CYS A 1 421 ? 55.740  101.424 83.742  1.00 48.72  ? 487  CYS A O    1 
ATOM   6203  C CB   . CYS A 1 421 ? 53.237  103.013 83.424  1.00 44.15  ? 487  CYS A CB   1 
ATOM   6204  S SG   . CYS A 1 421 ? 51.837  101.921 83.715  1.00 70.76  ? 487  CYS A SG   1 
ATOM   6205  H H    . CYS A 1 421 ? 52.653  101.966 81.223  1.00 50.03  ? 487  CYS A H    1 
ATOM   6206  H HA   . CYS A 1 421 ? 54.829  103.244 82.166  1.00 42.17  ? 487  CYS A HA   1 
ATOM   6207  H HB2  . CYS A 1 421 ? 53.736  103.081 84.253  1.00 52.98  ? 487  CYS A HB2  1 
ATOM   6208  H HB3  . CYS A 1 421 ? 52.886  103.884 83.181  1.00 52.98  ? 487  CYS A HB3  1 
ATOM   6209  H HG   . CYS A 1 421 ? 51.194  101.834 82.706  1.00 84.91  ? 487  CYS A HG   1 
ATOM   6210  N N    . ALA A 1 422 ? 54.676  100.155 82.237  1.00 48.97  ? 488  ALA A N    1 
ATOM   6211  C CA   . ALA A 1 422 ? 55.302  98.905  82.668  1.00 50.11  ? 488  ALA A CA   1 
ATOM   6212  C C    . ALA A 1 422 ? 55.808  98.143  81.463  1.00 53.02  ? 488  ALA A C    1 
ATOM   6213  O O    . ALA A 1 422 ? 55.798  96.912  81.453  1.00 30.99  ? 488  ALA A O    1 
ATOM   6214  C CB   . ALA A 1 422 ? 54.317  98.048  83.458  1.00 37.26  ? 488  ALA A CB   1 
ATOM   6215  H H    . ALA A 1 422 ? 54.131  100.061 81.579  1.00 58.76  ? 488  ALA A H    1 
ATOM   6216  H HA   . ALA A 1 422 ? 56.058  99.106  83.242  1.00 60.13  ? 488  ALA A HA   1 
ATOM   6217  H HB1  . ALA A 1 422 ? 54.759  97.228  83.729  1.00 44.71  ? 488  ALA A HB1  1 
ATOM   6218  H HB2  . ALA A 1 422 ? 54.025  98.542  84.240  1.00 44.71  ? 488  ALA A HB2  1 
ATOM   6219  H HB3  . ALA A 1 422 ? 53.555  97.842  82.893  1.00 44.71  ? 488  ALA A HB3  1 
ATOM   6220  N N    . THR A 1 423 ? 56.264  98.892  80.460  1.00 62.58  ? 489  THR A N    1 
ATOM   6221  C CA   . THR A 1 423 ? 56.723  98.319  79.205  1.00 54.12  ? 489  THR A CA   1 
ATOM   6222  C C    . THR A 1 423 ? 57.742  97.211  79.459  1.00 46.32  ? 489  THR A C    1 
ATOM   6223  O O    . THR A 1 423 ? 57.631  96.137  78.902  1.00 50.05  ? 489  THR A O    1 
ATOM   6224  C CB   . THR A 1 423 ? 57.305  99.411  78.271  1.00 72.42  ? 489  THR A CB   1 
ATOM   6225  O OG1  . THR A 1 423 ? 57.327  98.928  76.923  1.00 59.74  ? 489  THR A OG1  1 
ATOM   6226  C CG2  . THR A 1 423 ? 58.725  99.843  78.690  1.00 82.46  ? 489  THR A CG2  1 
ATOM   6227  H H    . THR A 1 423 ? 56.317  99.750  80.487  1.00 75.10  ? 489  THR A H    1 
ATOM   6228  H HA   . THR A 1 423 ? 55.963  97.920  78.752  1.00 64.94  ? 489  THR A HA   1 
ATOM   6229  H HB   . THR A 1 423 ? 56.734  100.193 78.313  1.00 86.91  ? 489  THR A HB   1 
ATOM   6230  H HG1  . THR A 1 423 ? 57.641  99.516  76.413  1.00 71.69  ? 489  THR A HG1  1 
ATOM   6231  H HG21 . THR A 1 423 ? 59.055  100.525 78.084  1.00 98.96  ? 489  THR A HG21 1 
ATOM   6232  H HG22 . THR A 1 423 ? 58.709  100.202 79.591  1.00 98.96  ? 489  THR A HG22 1 
ATOM   6233  H HG23 . THR A 1 423 ? 59.324  99.081  78.664  1.00 98.96  ? 489  THR A HG23 1 
ATOM   6234  N N    . GLU A 1 424 ? 58.716  97.470  80.325  1.00 75.16  ? 490  GLU A N    1 
ATOM   6235  C CA   . GLU A 1 424 ? 59.803  96.519  80.603  1.00 72.59  ? 490  GLU A CA   1 
ATOM   6236  C C    . GLU A 1 424 ? 59.324  95.206  81.234  1.00 63.01  ? 490  GLU A C    1 
ATOM   6237  O O    . GLU A 1 424 ? 59.744  94.127  80.825  1.00 68.82  ? 490  GLU A O    1 
ATOM   6238  C CB   . GLU A 1 424 ? 60.882  97.170  81.487  1.00 67.30  ? 490  GLU A CB   1 
ATOM   6239  C CG   . GLU A 1 424 ? 60.459  97.531  82.929  1.00 86.71  ? 490  GLU A CG   1 
ATOM   6240  C CD   . GLU A 1 424 ? 59.405  98.632  83.006  1.00 94.39  ? 490  GLU A CD   1 
ATOM   6241  O OE1  . GLU A 1 424 ? 59.261  99.401  82.028  1.00 103.54 ? 490  GLU A OE1  1 
ATOM   6242  O OE2  . GLU A 1 424 ? 58.701  98.707  84.036  1.00 86.14  ? 490  GLU A OE2  1 
ATOM   6243  H H    . GLU A 1 424 ? 58.774  98.200  80.775  1.00 90.19  ? 490  GLU A H    1 
ATOM   6244  H HA   . GLU A 1 424 ? 60.225  96.291  79.760  1.00 87.10  ? 490  GLU A HA   1 
ATOM   6245  H HB2  . GLU A 1 424 ? 61.632  96.557  81.552  1.00 80.76  ? 490  GLU A HB2  1 
ATOM   6246  H HB3  . GLU A 1 424 ? 61.173  97.989  81.058  1.00 80.76  ? 490  GLU A HB3  1 
ATOM   6247  H HG2  . GLU A 1 424 ? 60.093  96.740  83.355  1.00 104.05 ? 490  GLU A HG2  1 
ATOM   6248  H HG3  . GLU A 1 424 ? 61.240  97.835  83.417  1.00 104.05 ? 490  GLU A HG3  1 
ATOM   6249  N N    . LEU A 1 425 ? 58.448  95.306  82.225  1.00 59.82  ? 491  LEU A N    1 
ATOM   6250  C CA   . LEU A 1 425 ? 57.906  94.139  82.913  1.00 60.23  ? 491  LEU A CA   1 
ATOM   6251  C C    . LEU A 1 425 ? 57.021  93.269  82.006  1.00 60.06  ? 491  LEU A C    1 
ATOM   6252  O O    . LEU A 1 425 ? 56.840  92.080  82.256  1.00 50.89  ? 491  LEU A O    1 
ATOM   6253  C CB   . LEU A 1 425 ? 57.089  94.598  84.126  1.00 66.34  ? 491  LEU A CB   1 
ATOM   6254  C CG   . LEU A 1 425 ? 56.225  93.545  84.828  1.00 57.36  ? 491  LEU A CG   1 
ATOM   6255  C CD1  . LEU A 1 425 ? 57.134  92.528  85.479  1.00 59.95  ? 491  LEU A CD1  1 
ATOM   6256  C CD2  . LEU A 1 425 ? 55.281  94.155  85.855  1.00 30.54  ? 491  LEU A CD2  1 
ATOM   6257  H H    . LEU A 1 425 ? 58.145  96.053  82.523  1.00 71.78  ? 491  LEU A H    1 
ATOM   6258  H HA   . LEU A 1 425 ? 58.639  93.591  83.234  1.00 72.28  ? 491  LEU A HA   1 
ATOM   6259  H HB2  . LEU A 1 425 ? 57.705  94.948  84.789  1.00 79.61  ? 491  LEU A HB2  1 
ATOM   6260  H HB3  . LEU A 1 425 ? 56.494  95.307  83.837  1.00 79.61  ? 491  LEU A HB3  1 
ATOM   6261  H HG   . LEU A 1 425 ? 55.688  93.085  84.164  1.00 68.83  ? 491  LEU A HG   1 
ATOM   6262  H HD11 . LEU A 1 425 ? 56.590  91.859  85.925  1.00 71.94  ? 491  LEU A HD11 1 
ATOM   6263  H HD12 . LEU A 1 425 ? 57.679  92.109  84.795  1.00 71.94  ? 491  LEU A HD12 1 
ATOM   6264  H HD13 . LEU A 1 425 ? 57.700  92.978  86.125  1.00 71.94  ? 491  LEU A HD13 1 
ATOM   6265  H HD21 . LEU A 1 425 ? 54.761  93.446  86.266  1.00 36.65  ? 491  LEU A HD21 1 
ATOM   6266  H HD22 . LEU A 1 425 ? 55.803  94.616  86.529  1.00 36.65  ? 491  LEU A HD22 1 
ATOM   6267  H HD23 . LEU A 1 425 ? 54.690  94.781  85.408  1.00 36.65  ? 491  LEU A HD23 1 
ATOM   6268  N N    . LEU A 1 426 ? 56.455  93.862  80.962  1.00 54.40  ? 492  LEU A N    1 
ATOM   6269  C CA   . LEU A 1 426 ? 55.504  93.143  80.121  1.00 58.95  ? 492  LEU A CA   1 
ATOM   6270  C C    . LEU A 1 426 ? 56.202  92.390  78.994  1.00 60.03  ? 492  LEU A C    1 
ATOM   6271  O O    . LEU A 1 426 ? 55.739  91.328  78.571  1.00 72.30  ? 492  LEU A O    1 
ATOM   6272  C CB   . LEU A 1 426 ? 54.440  94.098  79.568  1.00 55.57  ? 492  LEU A CB   1 
ATOM   6273  C CG   . LEU A 1 426 ? 53.491  94.718  80.610  1.00 59.85  ? 492  LEU A CG   1 
ATOM   6274  C CD1  . LEU A 1 426 ? 52.576  95.726  79.939  1.00 52.38  ? 492  LEU A CD1  1 
ATOM   6275  C CD2  . LEU A 1 426 ? 52.664  93.676  81.370  1.00 33.74  ? 492  LEU A CD2  1 
ATOM   6276  H H    . LEU A 1 426 ? 56.601  94.674  80.720  1.00 65.27  ? 492  LEU A H    1 
ATOM   6277  H HA   . LEU A 1 426 ? 55.047  92.485  80.669  1.00 70.74  ? 492  LEU A HA   1 
ATOM   6278  H HB2  . LEU A 1 426 ? 54.890  94.828  79.114  1.00 66.69  ? 492  LEU A HB2  1 
ATOM   6279  H HB3  . LEU A 1 426 ? 53.893  93.611  78.932  1.00 66.69  ? 492  LEU A HB3  1 
ATOM   6280  H HG   . LEU A 1 426 ? 54.025  95.198  81.263  1.00 71.81  ? 492  LEU A HG   1 
ATOM   6281  H HD11 . LEU A 1 426 ? 51.985  96.108  80.606  1.00 62.86  ? 492  LEU A HD11 1 
ATOM   6282  H HD12 . LEU A 1 426 ? 53.116  96.424  79.536  1.00 62.86  ? 492  LEU A HD12 1 
ATOM   6283  H HD13 . LEU A 1 426 ? 52.056  95.274  79.256  1.00 62.86  ? 492  LEU A HD13 1 
ATOM   6284  H HD21 . LEU A 1 426 ? 52.092  94.131  82.007  1.00 40.48  ? 492  LEU A HD21 1 
ATOM   6285  H HD22 . LEU A 1 426 ? 52.125  93.178  80.736  1.00 40.48  ? 492  LEU A HD22 1 
ATOM   6286  H HD23 . LEU A 1 426 ? 53.266  93.075  81.836  1.00 40.48  ? 492  LEU A HD23 1 
ATOM   6287  N N    . LYS A 1 427 ? 57.315  92.937  78.516  1.00 59.48  ? 493  LYS A N    1 
ATOM   6288  C CA   . LYS A 1 427 ? 58.090  92.297  77.456  1.00 63.52  ? 493  LYS A CA   1 
ATOM   6289  C C    . LYS A 1 427 ? 59.156  91.346  78.013  1.00 65.81  ? 493  LYS A C    1 
ATOM   6290  O O    . LYS A 1 427 ? 60.060  90.931  77.280  1.00 62.48  ? 493  LYS A O    1 
ATOM   6291  C CB   . LYS A 1 427 ? 58.751  93.341  76.562  1.00 41.55  ? 493  LYS A CB   1 
ATOM   6292  C CG   . LYS A 1 427 ? 57.793  94.231  75.829  1.00 36.62  ? 493  LYS A CG   1 
ATOM   6293  C CD   . LYS A 1 427 ? 58.556  95.162  74.924  1.00 47.55  ? 493  LYS A CD   1 
ATOM   6294  C CE   . LYS A 1 427 ? 57.661  96.178  74.270  1.00 59.15  ? 493  LYS A CE   1 
ATOM   6295  N NZ   . LYS A 1 427 ? 58.470  97.087  73.428  1.00 73.09  ? 493  LYS A NZ   1 
ATOM   6296  H H    . LYS A 1 427 ? 57.646  93.682  78.790  1.00 71.38  ? 493  LYS A H    1 
ATOM   6297  H HA   . LYS A 1 427 ? 57.488  91.774  76.904  1.00 76.23  ? 493  LYS A HA   1 
ATOM   6298  H HB2  . LYS A 1 427 ? 59.316  93.907  77.112  1.00 49.86  ? 493  LYS A HB2  1 
ATOM   6299  H HB3  . LYS A 1 427 ? 59.293  92.884  75.900  1.00 49.86  ? 493  LYS A HB3  1 
ATOM   6300  H HG2  . LYS A 1 427 ? 57.197  93.691  75.287  1.00 43.95  ? 493  LYS A HG2  1 
ATOM   6301  H HG3  . LYS A 1 427 ? 57.289  94.762  76.466  1.00 43.95  ? 493  LYS A HG3  1 
ATOM   6302  H HD2  . LYS A 1 427 ? 59.222  95.637  75.445  1.00 57.06  ? 493  LYS A HD2  1 
ATOM   6303  H HD3  . LYS A 1 427 ? 58.986  94.644  74.225  1.00 57.06  ? 493  LYS A HD3  1 
ATOM   6304  H HE2  . LYS A 1 427 ? 57.013  95.727  73.706  1.00 70.98  ? 493  LYS A HE2  1 
ATOM   6305  H HE3  . LYS A 1 427 ? 57.213  96.704  74.951  1.00 70.98  ? 493  LYS A HE3  1 
ATOM   6306  H HZ1  . LYS A 1 427 ? 57.943  97.690  73.039  1.00 87.71  ? 493  LYS A HZ1  1 
ATOM   6307  H HZ2  . LYS A 1 427 ? 59.073  97.509  73.928  1.00 87.71  ? 493  LYS A HZ2  1 
ATOM   6308  H HZ3  . LYS A 1 427 ? 58.892  96.621  72.797  1.00 87.71  ? 493  LYS A HZ3  1 
ATOM   6309  N N    . ASP A 1 428 ? 59.041  90.993  79.294  1.00 60.45  ? 494  ASP A N    1 
ATOM   6310  C CA   . ASP A 1 428 ? 59.952  90.020  79.895  1.00 76.72  ? 494  ASP A CA   1 
ATOM   6311  C C    . ASP A 1 428 ? 59.381  88.607  79.754  1.00 60.20  ? 494  ASP A C    1 
ATOM   6312  O O    . ASP A 1 428 ? 58.834  88.033  80.700  1.00 42.71  ? 494  ASP A O    1 
ATOM   6313  C CB   . ASP A 1 428 ? 60.238  90.361  81.364  1.00 74.52  ? 494  ASP A CB   1 
ATOM   6314  C CG   . ASP A 1 428 ? 61.488  89.668  81.898  1.00 61.85  ? 494  ASP A CG   1 
ATOM   6315  O OD1  . ASP A 1 428 ? 62.203  89.004  81.113  1.00 63.28  ? 494  ASP A OD1  1 
ATOM   6316  O OD2  . ASP A 1 428 ? 61.753  89.802  83.110  1.00 68.75  ? 494  ASP A OD2  1 
ATOM   6317  H H    . ASP A 1 428 ? 58.446  91.302  79.834  1.00 72.54  ? 494  ASP A H    1 
ATOM   6318  H HA   . ASP A 1 428 ? 60.795  90.046  79.416  1.00 92.06  ? 494  ASP A HA   1 
ATOM   6319  H HB2  . ASP A 1 428 ? 60.368  91.318  81.447  1.00 89.43  ? 494  ASP A HB2  1 
ATOM   6320  H HB3  . ASP A 1 428 ? 59.484  90.079  81.906  1.00 89.43  ? 494  ASP A HB3  1 
ATOM   6321  N N    . TRP A 1 429 ? 59.538  88.047  78.561  1.00 52.88  ? 495  TRP A N    1 
ATOM   6322  C CA   . TRP A 1 429 ? 58.922  86.769  78.236  1.00 49.63  ? 495  TRP A CA   1 
ATOM   6323  C C    . TRP A 1 429 ? 59.669  85.588  78.846  1.00 58.11  ? 495  TRP A C    1 
ATOM   6324  O O    . TRP A 1 429 ? 59.026  84.628  79.294  1.00 55.50  ? 495  TRP A O    1 
ATOM   6325  C CB   . TRP A 1 429 ? 58.740  86.648  76.715  1.00 57.23  ? 495  TRP A CB   1 
ATOM   6326  C CG   . TRP A 1 429 ? 57.822  87.722  76.227  1.00 50.83  ? 495  TRP A CG   1 
ATOM   6327  C CD1  . TRP A 1 429 ? 56.542  87.930  76.631  1.00 44.66  ? 495  TRP A CD1  1 
ATOM   6328  C CD2  . TRP A 1 429 ? 58.118  88.761  75.284  1.00 50.62  ? 495  TRP A CD2  1 
ATOM   6329  N NE1  . TRP A 1 429 ? 56.016  89.029  76.007  1.00 51.23  ? 495  TRP A NE1  1 
ATOM   6330  C CE2  . TRP A 1 429 ? 56.958  89.552  75.165  1.00 53.43  ? 495  TRP A CE2  1 
ATOM   6331  C CE3  . TRP A 1 429 ? 59.241  89.092  74.528  1.00 58.70  ? 495  TRP A CE3  1 
ATOM   6332  C CZ2  . TRP A 1 429 ? 56.889  90.647  74.312  1.00 54.09  ? 495  TRP A CZ2  1 
ATOM   6333  C CZ3  . TRP A 1 429 ? 59.173  90.181  73.686  1.00 65.55  ? 495  TRP A CZ3  1 
ATOM   6334  C CH2  . TRP A 1 429 ? 58.004  90.947  73.586  1.00 69.24  ? 495  TRP A CH2  1 
ATOM   6335  H H    . TRP A 1 429 ? 59.998  88.388  77.920  1.00 63.45  ? 495  TRP A H    1 
ATOM   6336  H HA   . TRP A 1 429 ? 58.033  86.764  78.624  1.00 59.56  ? 495  TRP A HA   1 
ATOM   6337  H HB2  . TRP A 1 429 ? 59.598  86.751  76.276  1.00 68.68  ? 495  TRP A HB2  1 
ATOM   6338  H HB3  . TRP A 1 429 ? 58.348  85.786  76.502  1.00 68.68  ? 495  TRP A HB3  1 
ATOM   6339  H HD1  . TRP A 1 429 ? 56.092  87.410  77.257  1.00 53.59  ? 495  TRP A HD1  1 
ATOM   6340  H HE1  . TRP A 1 429 ? 55.216  89.327  76.110  1.00 61.47  ? 495  TRP A HE1  1 
ATOM   6341  H HE3  . TRP A 1 429 ? 60.019  88.586  74.587  1.00 70.44  ? 495  TRP A HE3  1 
ATOM   6342  H HZ2  . TRP A 1 429 ? 56.116  91.160  74.246  1.00 64.90  ? 495  TRP A HZ2  1 
ATOM   6343  H HZ3  . TRP A 1 429 ? 59.915  90.411  73.175  1.00 78.65  ? 495  TRP A HZ3  1 
ATOM   6344  H HH2  . TRP A 1 429 ? 57.988  91.677  73.009  1.00 83.08  ? 495  TRP A HH2  1 
ATOM   6345  N N    . GLU A 1 430 ? 61.007  85.679  78.902  1.00 72.02  ? 496  GLU A N    1 
ATOM   6346  C CA   . GLU A 1 430 ? 61.845  84.669  79.581  1.00 66.10  ? 496  GLU A CA   1 
ATOM   6347  C C    . GLU A 1 430 ? 61.424  84.475  81.035  1.00 69.56  ? 496  GLU A C    1 
ATOM   6348  O O    . GLU A 1 430 ? 61.348  83.348  81.532  1.00 71.69  ? 496  GLU A O    1 
ATOM   6349  C CB   . GLU A 1 430 ? 63.326  85.054  79.560  1.00 54.83  ? 496  GLU A CB   1 
ATOM   6350  C CG   . GLU A 1 430 ? 64.009  84.916  78.205  1.00 85.73  ? 496  GLU A CG   1 
ATOM   6351  C CD   . GLU A 1 430 ? 65.527  84.869  78.312  1.00 111.48 ? 496  GLU A CD   1 
ATOM   6352  O OE1  . GLU A 1 430 ? 66.037  84.750  79.447  1.00 117.88 ? 496  GLU A OE1  1 
ATOM   6353  O OE2  . GLU A 1 430 ? 66.213  84.921  77.265  1.00 123.80 ? 496  GLU A OE2  1 
ATOM   6354  H H    . GLU A 1 430 ? 61.458  86.322  78.552  1.00 86.43  ? 496  GLU A H    1 
ATOM   6355  H HA   . GLU A 1 430 ? 61.748  83.819  79.124  1.00 79.32  ? 496  GLU A HA   1 
ATOM   6356  H HB2  . GLU A 1 430 ? 63.408  85.980  79.835  1.00 65.80  ? 496  GLU A HB2  1 
ATOM   6357  H HB3  . GLU A 1 430 ? 63.801  84.486  80.186  1.00 65.80  ? 496  GLU A HB3  1 
ATOM   6358  H HG2  . GLU A 1 430 ? 63.713  84.093  77.784  1.00 102.88 ? 496  GLU A HG2  1 
ATOM   6359  H HG3  . GLU A 1 430 ? 63.771  85.676  77.652  1.00 102.88 ? 496  GLU A HG3  1 
ATOM   6360  N N    . CYS A 1 431 ? 61.152  85.584  81.714  1.00 69.81  ? 497  CYS A N    1 
ATOM   6361  C CA   . CYS A 1 431 ? 60.674  85.530  83.088  1.00 64.38  ? 497  CYS A CA   1 
ATOM   6362  C C    . CYS A 1 431 ? 59.370  84.761  83.185  1.00 55.22  ? 497  CYS A C    1 
ATOM   6363  O O    . CYS A 1 431 ? 59.277  83.780  83.910  1.00 49.55  ? 497  CYS A O    1 
ATOM   6364  C CB   . CYS A 1 431 ? 60.463  86.937  83.643  1.00 68.05  ? 497  CYS A CB   1 
ATOM   6365  S SG   . CYS A 1 431 ? 59.925  86.909  85.353  1.00 64.56  ? 497  CYS A SG   1 
ATOM   6366  H H    . CYS A 1 431 ? 61.236  86.380  81.401  1.00 83.77  ? 497  CYS A H    1 
ATOM   6367  H HA   . CYS A 1 431 ? 61.334  85.081  83.639  1.00 77.26  ? 497  CYS A HA   1 
ATOM   6368  H HB2  . CYS A 1 431 ? 61.299  87.426  83.597  1.00 81.66  ? 497  CYS A HB2  1 
ATOM   6369  H HB3  . CYS A 1 431 ? 59.783  87.388  83.119  1.00 81.66  ? 497  CYS A HB3  1 
ATOM   6370  H HG   . CYS A 1 431 ? 59.776  88.037  85.734  1.00 77.48  ? 497  CYS A HG   1 
ATOM   6371  N N    . MET A 1 432 ? 58.367  85.234  82.451  1.00 67.47  ? 498  MET A N    1 
ATOM   6372  C CA   . MET A 1 432 ? 57.024  84.670  82.487  1.00 64.31  ? 498  MET A CA   1 
ATOM   6373  C C    . MET A 1 432 ? 57.045  83.218  82.075  1.00 67.43  ? 498  MET A C    1 
ATOM   6374  O O    . MET A 1 432 ? 56.326  82.383  82.632  1.00 67.58  ? 498  MET A O    1 
ATOM   6375  C CB   . MET A 1 432 ? 56.123  85.433  81.523  1.00 72.49  ? 498  MET A CB   1 
ATOM   6376  C CG   . MET A 1 432 ? 55.574  86.739  82.077  1.00 76.81  ? 498  MET A CG   1 
ATOM   6377  S SD   . MET A 1 432 ? 54.425  87.565  80.951  1.00 76.16  ? 498  MET A SD   1 
ATOM   6378  C CE   . MET A 1 432 ? 55.425  87.744  79.489  1.00 52.57  ? 498  MET A CE   1 
ATOM   6379  H H    . MET A 1 432 ? 58.443  85.898  81.910  1.00 80.96  ? 498  MET A H    1 
ATOM   6380  H HA   . MET A 1 432 ? 56.660  84.751  83.382  1.00 77.17  ? 498  MET A HA   1 
ATOM   6381  H HB2  . MET A 1 432 ? 56.630  85.642  80.723  1.00 86.99  ? 498  MET A HB2  1 
ATOM   6382  H HB3  . MET A 1 432 ? 55.367  84.870  81.293  1.00 86.99  ? 498  MET A HB3  1 
ATOM   6383  H HG2  . MET A 1 432 ? 55.102  86.556  82.904  1.00 92.18  ? 498  MET A HG2  1 
ATOM   6384  H HG3  . MET A 1 432 ? 56.313  87.345  82.245  1.00 92.18  ? 498  MET A HG3  1 
ATOM   6385  H HE1  . MET A 1 432 ? 54.902  88.184  78.801  1.00 63.08  ? 498  MET A HE1  1 
ATOM   6386  H HE2  . MET A 1 432 ? 56.205  88.278  79.705  1.00 63.08  ? 498  MET A HE2  1 
ATOM   6387  H HE3  . MET A 1 432 ? 55.699  86.865  79.185  1.00 63.08  ? 498  MET A HE3  1 
ATOM   6388  N N    . ASN A 1 433 ? 57.877  82.931  81.082  1.00 63.31  ? 499  ASN A N    1 
ATOM   6389  C CA   . ASN A 1 433 ? 58.024  81.582  80.565  1.00 63.52  ? 499  ASN A CA   1 
ATOM   6390  C C    . ASN A 1 433 ? 58.553  80.624  81.640  1.00 71.88  ? 499  ASN A C    1 
ATOM   6391  O O    . ASN A 1 433 ? 58.155  79.459  81.707  1.00 65.66  ? 499  ASN A O    1 
ATOM   6392  C CB   . ASN A 1 433 ? 58.941  81.633  79.342  1.00 68.07  ? 499  ASN A CB   1 
ATOM   6393  C CG   . ASN A 1 433 ? 59.217  80.269  78.747  1.00 86.10  ? 499  ASN A CG   1 
ATOM   6394  O OD1  . ASN A 1 433 ? 60.319  80.019  78.241  1.00 84.48  ? 499  ASN A OD1  1 
ATOM   6395  N ND2  . ASN A 1 433 ? 58.221  79.381  78.787  1.00 82.21  ? 499  ASN A ND2  1 
ATOM   6396  H H    . ASN A 1 433 ? 58.373  83.511  80.686  1.00 75.97  ? 499  ASN A H    1 
ATOM   6397  H HA   . ASN A 1 433 ? 57.157  81.258  80.275  1.00 76.22  ? 499  ASN A HA   1 
ATOM   6398  H HB2  . ASN A 1 433 ? 58.522  82.179  78.658  1.00 81.69  ? 499  ASN A HB2  1 
ATOM   6399  H HB3  . ASN A 1 433 ? 59.790  82.023  79.602  1.00 81.69  ? 499  ASN A HB3  1 
ATOM   6400  H HD21 . ASN A 1 433 ? 58.333  78.593  78.461  1.00 98.65  ? 499  ASN A HD21 1 
ATOM   6401  H HD22 . ASN A 1 433 ? 57.466  79.596  79.140  1.00 98.65  ? 499  ASN A HD22 1 
ATOM   6402  N N    . SER A 1 434 ? 59.422  81.141  82.505  1.00 69.23  ? 500  SER A N    1 
ATOM   6403  C CA   . SER A 1 434 ? 60.036  80.341  83.558  1.00 66.19  ? 500  SER A CA   1 
ATOM   6404  C C    . SER A 1 434 ? 59.072  79.960  84.677  1.00 64.67  ? 500  SER A C    1 
ATOM   6405  O O    . SER A 1 434 ? 59.274  78.947  85.337  1.00 77.51  ? 500  SER A O    1 
ATOM   6406  C CB   . SER A 1 434 ? 61.228  81.087  84.162  1.00 81.35  ? 500  SER A CB   1 
ATOM   6407  O OG   . SER A 1 434 ? 62.190  81.416  83.170  1.00 95.63  ? 500  SER A OG   1 
ATOM   6408  H H    . SER A 1 434 ? 59.676  81.962  82.501  1.00 83.08  ? 500  SER A H    1 
ATOM   6409  H HA   . SER A 1 434 ? 60.371  79.519  83.167  1.00 79.43  ? 500  SER A HA   1 
ATOM   6410  H HB2  . SER A 1 434 ? 60.909  81.906  84.574  1.00 97.62  ? 500  SER A HB2  1 
ATOM   6411  H HB3  . SER A 1 434 ? 61.646  80.523  84.830  1.00 97.62  ? 500  SER A HB3  1 
ATOM   6412  H HG   . SER A 1 434 ? 61.842  81.907  82.583  1.00 114.75 ? 500  SER A HG   1 
ATOM   6413  N N    . LEU A 1 435 ? 58.033  80.759  84.903  1.00 66.41  ? 501  LEU A N    1 
ATOM   6414  C CA   . LEU A 1 435 ? 57.093  80.484  85.998  1.00 58.97  ? 501  LEU A CA   1 
ATOM   6415  C C    . LEU A 1 435 ? 56.089  79.387  85.655  1.00 62.02  ? 501  LEU A C    1 
ATOM   6416  O O    . LEU A 1 435 ? 55.489  78.778  86.548  1.00 53.90  ? 501  LEU A O    1 
ATOM   6417  C CB   . LEU A 1 435 ? 56.339  81.749  86.410  1.00 50.06  ? 501  LEU A CB   1 
ATOM   6418  C CG   . LEU A 1 435 ? 57.069  82.719  87.341  1.00 53.53  ? 501  LEU A CG   1 
ATOM   6419  C CD1  . LEU A 1 435 ? 58.118  83.491  86.577  1.00 62.51  ? 501  LEU A CD1  1 
ATOM   6420  C CD2  . LEU A 1 435 ? 56.084  83.665  88.001  1.00 63.34  ? 501  LEU A CD2  1 
ATOM   6421  H H    . LEU A 1 435 ? 57.848  81.463  84.444  1.00 79.69  ? 501  LEU A H    1 
ATOM   6422  H HA   . LEU A 1 435 ? 57.600  80.183  86.769  1.00 70.77  ? 501  LEU A HA   1 
ATOM   6423  H HB2  . LEU A 1 435 ? 56.113  82.241  85.606  1.00 60.07  ? 501  LEU A HB2  1 
ATOM   6424  H HB3  . LEU A 1 435 ? 55.523  81.481  86.861  1.00 60.07  ? 501  LEU A HB3  1 
ATOM   6425  H HG   . LEU A 1 435 ? 57.515  82.214  88.038  1.00 64.24  ? 501  LEU A HG   1 
ATOM   6426  H HD11 . LEU A 1 435 ? 58.567  84.099  87.185  1.00 75.02  ? 501  LEU A HD11 1 
ATOM   6427  H HD12 . LEU A 1 435 ? 58.758  82.866  86.200  1.00 75.02  ? 501  LEU A HD12 1 
ATOM   6428  H HD13 . LEU A 1 435 ? 57.687  83.992  85.867  1.00 75.02  ? 501  LEU A HD13 1 
ATOM   6429  H HD21 . LEU A 1 435 ? 56.570  84.269  88.585  1.00 76.01  ? 501  LEU A HD21 1 
ATOM   6430  H HD22 . LEU A 1 435 ? 55.622  84.170  87.314  1.00 76.01  ? 501  LEU A HD22 1 
ATOM   6431  H HD23 . LEU A 1 435 ? 55.447  83.148  88.517  1.00 76.01  ? 501  LEU A HD23 1 
ATOM   6432  N N    . LEU A 1 436 ? 55.905  79.150  84.359  1.00 68.71  ? 502  LEU A N    1 
ATOM   6433  C CA   . LEU A 1 436 ? 55.000  78.109  83.880  1.00 70.67  ? 502  LEU A CA   1 
ATOM   6434  C C    . LEU A 1 436 ? 55.714  76.753  83.747  1.00 87.64  ? 502  LEU A C    1 
ATOM   6435  O O    . LEU A 1 436 ? 55.049  75.717  83.592  1.00 84.92  ? 502  LEU A O    1 
ATOM   6436  C CB   . LEU A 1 436 ? 54.400  78.504  82.522  1.00 74.04  ? 502  LEU A CB   1 
ATOM   6437  C CG   . LEU A 1 436 ? 53.488  79.736  82.417  1.00 56.96  ? 502  LEU A CG   1 
ATOM   6438  C CD1  . LEU A 1 436 ? 53.390  80.149  80.955  1.00 55.20  ? 502  LEU A CD1  1 
ATOM   6439  C CD2  . LEU A 1 436 ? 52.098  79.479  82.980  1.00 34.99  ? 502  LEU A CD2  1 
ATOM   6440  H H    . LEU A 1 436 ? 56.298  79.584  83.729  1.00 82.45  ? 502  LEU A H    1 
ATOM   6441  H HA   . LEU A 1 436 ? 54.272  78.005  84.513  1.00 84.80  ? 502  LEU A HA   1 
ATOM   6442  H HB2  . LEU A 1 436 ? 55.138  78.655  81.911  1.00 88.84  ? 502  LEU A HB2  1 
ATOM   6443  H HB3  . LEU A 1 436 ? 53.881  77.749  82.203  1.00 88.84  ? 502  LEU A HB3  1 
ATOM   6444  H HG   . LEU A 1 436 ? 53.884  80.470  82.913  1.00 68.36  ? 502  LEU A HG   1 
ATOM   6445  H HD11 . LEU A 1 436 ? 52.815  80.927  80.885  1.00 66.23  ? 502  LEU A HD11 1 
ATOM   6446  H HD12 . LEU A 1 436 ? 54.277  80.362  80.628  1.00 66.23  ? 502  LEU A HD12 1 
ATOM   6447  H HD13 . LEU A 1 436 ? 53.016  79.413  80.445  1.00 66.23  ? 502  LEU A HD13 1 
ATOM   6448  H HD21 . LEU A 1 436 ? 51.566  80.285  82.889  1.00 41.99  ? 502  LEU A HD21 1 
ATOM   6449  H HD22 . LEU A 1 436 ? 51.686  78.753  82.485  1.00 41.99  ? 502  LEU A HD22 1 
ATOM   6450  H HD23 . LEU A 1 436 ? 52.176  79.238  83.917  1.00 41.99  ? 502  LEU A HD23 1 
ATOM   6451  N N    . LEU A 1 437 ? 57.054  76.765  83.816  1.00 90.23  ? 503  LEU A N    1 
ATOM   6452  C CA   . LEU A 1 437 ? 57.857  75.552  83.612  1.00 78.09  ? 503  LEU A CA   1 
ATOM   6453  C C    . LEU A 1 437 ? 58.703  75.084  84.819  1.00 85.41  ? 503  LEU A C    1 
ATOM   6454  O O    . LEU A 1 437 ? 58.455  73.999  85.336  1.00 100.20 ? 503  LEU A O    1 
ATOM   6455  C CB   . LEU A 1 437 ? 58.749  75.709  82.366  1.00 73.95  ? 503  LEU A CB   1 
ATOM   6456  C CG   . LEU A 1 437 ? 58.029  75.784  81.004  1.00 62.55  ? 503  LEU A CG   1 
ATOM   6457  C CD1  . LEU A 1 437 ? 58.980  75.926  79.809  1.00 39.88  ? 503  LEU A CD1  1 
ATOM   6458  C CD2  . LEU A 1 437 ? 57.137  74.575  80.797  1.00 66.39  ? 503  LEU A CD2  1 
ATOM   6459  H H    . LEU A 1 437 ? 57.522  77.467  83.980  1.00 108.27 ? 503  LEU A H    1 
ATOM   6460  H HA   . LEU A 1 437 ? 57.240  74.829  83.418  1.00 93.70  ? 503  LEU A HA   1 
ATOM   6461  H HB2  . LEU A 1 437 ? 59.264  76.525  82.464  1.00 88.73  ? 503  LEU A HB2  1 
ATOM   6462  H HB3  . LEU A 1 437 ? 59.354  74.952  82.330  1.00 88.73  ? 503  LEU A HB3  1 
ATOM   6463  H HG   . LEU A 1 437 ? 57.456  76.567  81.008  1.00 75.06  ? 503  LEU A HG   1 
ATOM   6464  H HD11 . LEU A 1 437 ? 58.457  75.967  78.993  1.00 47.86  ? 503  LEU A HD11 1 
ATOM   6465  H HD12 . LEU A 1 437 ? 59.497  76.740  79.912  1.00 47.86  ? 503  LEU A HD12 1 
ATOM   6466  H HD13 . LEU A 1 437 ? 59.573  75.158  79.785  1.00 47.86  ? 503  LEU A HD13 1 
ATOM   6467  H HD21 . LEU A 1 437 ? 56.699  74.650  79.934  1.00 79.66  ? 503  LEU A HD21 1 
ATOM   6468  H HD22 . LEU A 1 437 ? 57.682  73.773  80.822  1.00 79.66  ? 503  LEU A HD22 1 
ATOM   6469  H HD23 . LEU A 1 437 ? 56.473  74.547  81.504  1.00 79.66  ? 503  LEU A HD23 1 
ATOM   6470  N N    . GLU A 1 438 ? 59.665  75.892  85.281  1.00 91.25  ? 504  GLU A N    1 
ATOM   6471  C CA   . GLU A 1 438 ? 60.817  75.376  86.057  1.00 92.79  ? 504  GLU A CA   1 
ATOM   6472  C C    . GLU A 1 438 ? 60.674  75.174  87.582  1.00 104.02 ? 504  GLU A C    1 
ATOM   6473  O O    . GLU A 1 438 ? 61.586  74.639  88.212  1.00 109.35 ? 504  GLU A O    1 
ATOM   6474  C CB   . GLU A 1 438 ? 62.055  76.235  85.781  1.00 97.36  ? 504  GLU A CB   1 
ATOM   6475  C CG   . GLU A 1 438 ? 62.401  76.356  84.297  1.00 111.76 ? 504  GLU A CG   1 
ATOM   6476  C CD   . GLU A 1 438 ? 62.921  77.736  83.911  1.00 101.08 ? 504  GLU A CD   1 
ATOM   6477  O OE1  . GLU A 1 438 ? 63.627  78.356  84.729  1.00 93.93  ? 504  GLU A OE1  1 
ATOM   6478  O OE2  . GLU A 1 438 ? 62.619  78.200  82.787  1.00 101.27 ? 504  GLU A OE2  1 
ATOM   6479  H H    . GLU A 1 438 ? 59.680  76.743  85.161  1.00 109.51 ? 504  GLU A H    1 
ATOM   6480  H HA   . GLU A 1 438 ? 61.018  74.497  85.698  1.00 111.35 ? 504  GLU A HA   1 
ATOM   6481  H HB2  . GLU A 1 438 ? 61.898  77.129  86.122  1.00 116.83 ? 504  GLU A HB2  1 
ATOM   6482  H HB3  . GLU A 1 438 ? 62.817  75.840  86.232  1.00 116.83 ? 504  GLU A HB3  1 
ATOM   6483  H HG2  . GLU A 1 438 ? 63.089  75.707  84.081  1.00 134.11 ? 504  GLU A HG2  1 
ATOM   6484  H HG3  . GLU A 1 438 ? 61.605  76.179  83.772  1.00 134.11 ? 504  GLU A HG3  1 
ATOM   6485  N N    . GLU A 1 439 ? 59.568  75.611  88.176  1.00 104.48 ? 505  GLU A N    1 
ATOM   6486  C CA   . GLU A 1 439 ? 59.223  75.207  89.547  1.00 97.10  ? 505  GLU A CA   1 
ATOM   6487  C C    . GLU A 1 439 ? 60.300  75.495  90.598  1.00 77.34  ? 505  GLU A C    1 
ATOM   6488  O O    . GLU A 1 439 ? 60.034  76.164  91.604  1.00 62.40  ? 505  GLU A O    1 
ATOM   6489  C CB   . GLU A 1 439 ? 58.852  73.720  89.543  1.00 107.04 ? 505  GLU A CB   1 
ATOM   6490  C CG   . GLU A 1 439 ? 57.593  73.457  88.695  1.00 116.16 ? 505  GLU A CG   1 
ATOM   6491  C CD   . GLU A 1 439 ? 57.395  72.000  88.307  1.00 118.02 ? 505  GLU A CD   1 
ATOM   6492  O OE1  . GLU A 1 439 ? 58.225  71.155  88.718  1.00 130.21 ? 505  GLU A OE1  1 
ATOM   6493  O OE2  . GLU A 1 439 ? 56.411  71.709  87.577  1.00 91.19  ? 505  GLU A OE2  1 
ATOM   6494  H H    . GLU A 1 439 ? 58.998  76.142  87.812  1.00 125.38 ? 505  GLU A H    1 
ATOM   6495  H HA   . GLU A 1 439 ? 58.430  75.698  89.813  1.00 116.52 ? 505  GLU A HA   1 
ATOM   6496  H HB2  . GLU A 1 439 ? 59.585  73.208  89.167  1.00 128.45 ? 505  GLU A HB2  1 
ATOM   6497  H HB3  . GLU A 1 439 ? 58.672  73.433  90.452  1.00 128.45 ? 505  GLU A HB3  1 
ATOM   6498  H HG2  . GLU A 1 439 ? 56.814  73.737  89.201  1.00 139.39 ? 505  GLU A HG2  1 
ATOM   6499  H HG3  . GLU A 1 439 ? 57.656  73.975  87.877  1.00 139.39 ? 505  GLU A HG3  1 
ATOM   6500  N N    . ALA A 1 446 ? 54.484  78.035  94.931  1.00 76.24  ? 512  ALA A N    1 
ATOM   6501  C CA   . ALA A 1 446 ? 54.055  77.376  93.694  1.00 89.31  ? 512  ALA A CA   1 
ATOM   6502  C C    . ALA A 1 446 ? 52.925  78.159  93.021  1.00 100.44 ? 512  ALA A C    1 
ATOM   6503  O O    . ALA A 1 446 ? 52.613  79.281  93.423  1.00 109.52 ? 512  ALA A O    1 
ATOM   6504  C CB   . ALA A 1 446 ? 53.619  75.943  93.979  1.00 85.84  ? 512  ALA A CB   1 
ATOM   6505  H HA   . ALA A 1 446 ? 54.804  77.343  93.079  1.00 107.18 ? 512  ALA A HA   1 
ATOM   6506  H HB1  . ALA A 1 446 ? 53.340  75.528  93.148  1.00 103.01 ? 512  ALA A HB1  1 
ATOM   6507  H HB2  . ALA A 1 446 ? 54.367  75.455  94.358  1.00 103.01 ? 512  ALA A HB2  1 
ATOM   6508  H HB3  . ALA A 1 446 ? 52.880  75.957  94.606  1.00 103.01 ? 512  ALA A HB3  1 
ATOM   6509  N N    . LEU A 1 447 ? 52.320  77.569  91.993  1.00 94.58  ? 513  LEU A N    1 
ATOM   6510  C CA   . LEU A 1 447 ? 51.275  78.234  91.211  1.00 86.63  ? 513  LEU A CA   1 
ATOM   6511  C C    . LEU A 1 447 ? 50.039  77.350  91.124  1.00 74.90  ? 513  LEU A C    1 
ATOM   6512  O O    . LEU A 1 447 ? 50.132  76.210  90.677  1.00 91.11  ? 513  LEU A O    1 
ATOM   6513  C CB   . LEU A 1 447 ? 51.793  78.529  89.792  1.00 86.48  ? 513  LEU A CB   1 
ATOM   6514  C CG   . LEU A 1 447 ? 52.446  79.885  89.483  1.00 72.63  ? 513  LEU A CG   1 
ATOM   6515  C CD1  . LEU A 1 447 ? 52.762  80.010  88.002  1.00 53.81  ? 513  LEU A CD1  1 
ATOM   6516  C CD2  . LEU A 1 447 ? 51.564  81.041  89.898  1.00 76.47  ? 513  LEU A CD2  1 
ATOM   6517  H H    . LEU A 1 447 ? 52.498  76.772  91.723  1.00 113.50 ? 513  LEU A H    1 
ATOM   6518  H HA   . LEU A 1 447 ? 51.031  79.072  91.635  1.00 103.96 ? 513  LEU A HA   1 
ATOM   6519  H HB2  . LEU A 1 447 ? 52.452  77.850  89.575  1.00 103.77 ? 513  LEU A HB2  1 
ATOM   6520  H HB3  . LEU A 1 447 ? 51.042  78.439  89.183  1.00 103.77 ? 513  LEU A HB3  1 
ATOM   6521  H HG   . LEU A 1 447 ? 53.279  79.953  89.974  1.00 87.16  ? 513  LEU A HG   1 
ATOM   6522  H HD11 . LEU A 1 447 ? 53.172  80.874  87.839  1.00 64.57  ? 513  LEU A HD11 1 
ATOM   6523  H HD12 . LEU A 1 447 ? 53.373  79.300  87.750  1.00 64.57  ? 513  LEU A HD12 1 
ATOM   6524  H HD13 . LEU A 1 447 ? 51.938  79.933  87.496  1.00 64.57  ? 513  LEU A HD13 1 
ATOM   6525  H HD21 . LEU A 1 447 ? 52.014  81.874  89.685  1.00 91.76  ? 513  LEU A HD21 1 
ATOM   6526  H HD22 . LEU A 1 447 ? 50.724  80.986  89.416  1.00 91.76  ? 513  LEU A HD22 1 
ATOM   6527  H HD23 . LEU A 1 447 ? 51.402  80.987  90.853  1.00 91.76  ? 513  LEU A HD23 1 
ATOM   6528  N N    . THR A 1 448 ? 48.885  77.863  91.551  1.00 59.01  ? 514  THR A N    1 
ATOM   6529  C CA   . THR A 1 448 ? 47.622  77.158  91.335  1.00 68.67  ? 514  THR A CA   1 
ATOM   6530  C C    . THR A 1 448 ? 47.370  77.138  89.834  1.00 71.16  ? 514  THR A C    1 
ATOM   6531  O O    . THR A 1 448 ? 47.902  77.976  89.117  1.00 84.05  ? 514  THR A O    1 
ATOM   6532  C CB   . THR A 1 448 ? 46.436  77.831  92.082  1.00 94.39  ? 514  THR A CB   1 
ATOM   6533  O OG1  . THR A 1 448 ? 46.093  79.077  91.459  1.00 95.85  ? 514  THR A OG1  1 
ATOM   6534  C CG2  . THR A 1 448 ? 46.786  78.064  93.560  1.00 86.66  ? 514  THR A CG2  1 
ATOM   6535  H H    . THR A 1 448 ? 48.807  78.612  91.965  1.00 70.81  ? 514  THR A H    1 
ATOM   6536  H HA   . THR A 1 448 ? 47.703  76.243  91.647  1.00 82.40  ? 514  THR A HA   1 
ATOM   6537  H HB   . THR A 1 448 ? 45.668  77.240  92.047  1.00 113.27 ? 514  THR A HB   1 
ATOM   6538  H HG1  . THR A 1 448 ? 45.452  79.435  91.867  1.00 115.01 ? 514  THR A HG1  1 
ATOM   6539  H HG21 . THR A 1 448 ? 46.040  78.484  94.014  1.00 103.99 ? 514  THR A HG21 1 
ATOM   6540  H HG22 . THR A 1 448 ? 46.983  77.218  93.991  1.00 103.99 ? 514  THR A HG22 1 
ATOM   6541  H HG23 . THR A 1 448 ? 47.563  78.641  93.629  1.00 103.99 ? 514  THR A HG23 1 
ATOM   6542  N N    . ASP A 1 449 ? 46.590  76.187  89.333  1.00 81.66  ? 515  ASP A N    1 
ATOM   6543  C CA   . ASP A 1 449 ? 46.396  76.107  87.878  1.00 85.61  ? 515  ASP A CA   1 
ATOM   6544  C C    . ASP A 1 449 ? 45.540  77.271  87.349  1.00 86.21  ? 515  ASP A C    1 
ATOM   6545  O O    . ASP A 1 449 ? 45.686  77.673  86.194  1.00 92.89  ? 515  ASP A O    1 
ATOM   6546  C CB   . ASP A 1 449 ? 45.831  74.740  87.432  1.00 84.28  ? 515  ASP A CB   1 
ATOM   6547  C CG   . ASP A 1 449 ? 46.939  73.714  87.091  1.00 106.68 ? 515  ASP A CG   1 
ATOM   6548  O OD1  . ASP A 1 449 ? 48.138  74.051  87.194  1.00 104.90 ? 515  ASP A OD1  1 
ATOM   6549  O OD2  . ASP A 1 449 ? 46.610  72.565  86.709  1.00 118.22 ? 515  ASP A OD2  1 
ATOM   6550  H H    . ASP A 1 449 ? 46.172  75.591  89.791  1.00 97.99  ? 515  ASP A H    1 
ATOM   6551  H HA   . ASP A 1 449 ? 47.268  76.195  87.462  1.00 102.74 ? 515  ASP A HA   1 
ATOM   6552  H HB2  . ASP A 1 449 ? 45.292  74.372  88.150  1.00 101.13 ? 515  ASP A HB2  1 
ATOM   6553  H HB3  . ASP A 1 449 ? 45.286  74.867  86.640  1.00 101.13 ? 515  ASP A HB3  1 
ATOM   6554  N N    . ARG A 1 450 ? 44.665  77.825  88.187  1.00 86.38  ? 516  ARG A N    1 
ATOM   6555  C CA   . ARG A 1 450 ? 43.944  79.048  87.825  1.00 67.17  ? 516  ARG A CA   1 
ATOM   6556  C C    . ARG A 1 450 ? 44.950  80.150  87.525  1.00 59.26  ? 516  ARG A C    1 
ATOM   6557  O O    . ARG A 1 450 ? 44.799  80.909  86.572  1.00 61.38  ? 516  ARG A O    1 
ATOM   6558  C CB   . ARG A 1 450 ? 43.028  79.493  88.963  1.00 52.00  ? 516  ARG A CB   1 
ATOM   6559  C CG   . ARG A 1 450 ? 41.963  80.484  88.546  1.00 68.66  ? 516  ARG A CG   1 
ATOM   6560  C CD   . ARG A 1 450 ? 41.097  80.917  89.728  1.00 88.63  ? 516  ARG A CD   1 
ATOM   6561  N NE   . ARG A 1 450 ? 40.397  82.180  89.477  1.00 102.31 ? 516  ARG A NE   1 
ATOM   6562  C CZ   . ARG A 1 450 ? 39.544  82.754  90.322  1.00 94.00  ? 516  ARG A CZ   1 
ATOM   6563  N NH1  . ARG A 1 450 ? 39.261  82.173  91.486  1.00 88.78  ? 516  ARG A NH1  1 
ATOM   6564  N NH2  . ARG A 1 450 ? 38.965  83.909  89.998  1.00 83.19  ? 516  ARG A NH2  1 
ATOM   6565  H H    . ARG A 1 450 ? 44.471  77.517  88.966  1.00 103.65 ? 516  ARG A H    1 
ATOM   6566  H HA   . ARG A 1 450 ? 43.405  78.891  87.033  1.00 80.60  ? 516  ARG A HA   1 
ATOM   6567  H HB2  . ARG A 1 450 ? 42.581  78.713  89.327  1.00 62.40  ? 516  ARG A HB2  1 
ATOM   6568  H HB3  . ARG A 1 450 ? 43.568  79.912  89.652  1.00 62.40  ? 516  ARG A HB3  1 
ATOM   6569  H HG2  . ARG A 1 450 ? 42.388  81.273  88.177  1.00 82.39  ? 516  ARG A HG2  1 
ATOM   6570  H HG3  . ARG A 1 450 ? 41.386  80.072  87.883  1.00 82.39  ? 516  ARG A HG3  1 
ATOM   6571  H HD2  . ARG A 1 450 ? 40.431  80.233  89.901  1.00 106.35 ? 516  ARG A HD2  1 
ATOM   6572  H HD3  . ARG A 1 450 ? 41.661  81.036  90.508  1.00 106.35 ? 516  ARG A HD3  1 
ATOM   6573  H HE   . ARG A 1 450 ? 40.549  82.579  88.730  1.00 122.77 ? 516  ARG A HE   1 
ATOM   6574  H HH11 . ARG A 1 450 ? 39.634  81.428  91.697  1.00 106.53 ? 516  ARG A HH11 1 
ATOM   6575  H HH12 . ARG A 1 450 ? 38.707  82.546  92.029  1.00 106.53 ? 516  ARG A HH12 1 
ATOM   6576  H HH21 . ARG A 1 450 ? 39.145  84.283  89.245  1.00 99.83  ? 516  ARG A HH21 1 
ATOM   6577  H HH22 . ARG A 1 450 ? 38.410  84.279  90.541  1.00 99.83  ? 516  ARG A HH22 1 
ATOM   6578  N N    . GLN A 1 451 ? 45.982  80.224  88.355  1.00 67.72  ? 517  GLN A N    1 
ATOM   6579  C CA   . GLN A 1 451 ? 47.049  81.202  88.189  1.00 58.83  ? 517  GLN A CA   1 
ATOM   6580  C C    . GLN A 1 451 ? 47.933  80.894  86.992  1.00 48.59  ? 517  GLN A C    1 
ATOM   6581  O O    . GLN A 1 451 ? 48.392  81.802  86.306  1.00 60.10  ? 517  GLN A O    1 
ATOM   6582  C CB   . GLN A 1 451 ? 47.885  81.271  89.465  1.00 63.81  ? 517  GLN A CB   1 
ATOM   6583  C CG   . GLN A 1 451 ? 47.093  81.793  90.658  1.00 85.29  ? 517  GLN A CG   1 
ATOM   6584  C CD   . GLN A 1 451 ? 47.748  81.512  91.994  1.00 76.70  ? 517  GLN A CD   1 
ATOM   6585  O OE1  . GLN A 1 451 ? 48.834  80.933  92.063  1.00 66.36  ? 517  GLN A OE1  1 
ATOM   6586  N NE2  . GLN A 1 451 ? 47.087  81.935  93.070  1.00 81.65  ? 517  GLN A NE2  1 
ATOM   6587  H H    . GLN A 1 451 ? 46.089  79.708  89.034  1.00 81.26  ? 517  GLN A H    1 
ATOM   6588  H HA   . GLN A 1 451 ? 46.652  82.075  88.047  1.00 70.60  ? 517  GLN A HA   1 
ATOM   6589  H HB2  . GLN A 1 451 ? 48.205  80.382  89.682  1.00 76.57  ? 517  GLN A HB2  1 
ATOM   6590  H HB3  . GLN A 1 451 ? 48.636  81.868  89.319  1.00 76.57  ? 517  GLN A HB3  1 
ATOM   6591  H HG2  . GLN A 1 451 ? 46.994  82.754  90.573  1.00 102.34 ? 517  GLN A HG2  1 
ATOM   6592  H HG3  . GLN A 1 451 ? 46.219  81.372  90.662  1.00 102.34 ? 517  GLN A HG3  1 
ATOM   6593  H HE21 . GLN A 1 451 ? 46.335  82.342  92.980  1.00 97.98  ? 517  GLN A HE21 1 
ATOM   6594  H HE22 . GLN A 1 451 ? 47.413  81.802  93.855  1.00 97.98  ? 517  GLN A HE22 1 
ATOM   6595  N N    . GLU A 1 452 ? 48.173  79.619  86.728  1.00 46.96  ? 518  GLU A N    1 
ATOM   6596  C CA   . GLU A 1 452 ? 48.925  79.250  85.536  1.00 58.60  ? 518  GLU A CA   1 
ATOM   6597  C C    . GLU A 1 452 ? 48.162  79.660  84.246  1.00 60.49  ? 518  GLU A C    1 
ATOM   6598  O O    . GLU A 1 452 ? 48.768  80.153  83.289  1.00 53.73  ? 518  GLU A O    1 
ATOM   6599  C CB   . GLU A 1 452 ? 49.301  77.756  85.572  1.00 55.25  ? 518  GLU A CB   1 
ATOM   6600  C CG   . GLU A 1 452 ? 50.273  77.409  86.712  1.00 69.68  ? 518  GLU A CG   1 
ATOM   6601  C CD   . GLU A 1 452 ? 50.870  75.998  86.630  1.00 80.80  ? 518  GLU A CD   1 
ATOM   6602  O OE1  . GLU A 1 452 ? 50.241  75.104  86.031  1.00 78.31  ? 518  GLU A OE1  1 
ATOM   6603  O OE2  . GLU A 1 452 ? 51.967  75.776  87.198  1.00 83.92  ? 518  GLU A OE2  1 
ATOM   6604  H H    . GLU A 1 452 ? 47.916  78.956  87.213  1.00 56.36  ? 518  GLU A H    1 
ATOM   6605  H HA   . GLU A 1 452 ? 49.756  79.750  85.542  1.00 70.32  ? 518  GLU A HA   1 
ATOM   6606  H HB2  . GLU A 1 452 ? 48.495  77.231  85.695  1.00 66.30  ? 518  GLU A HB2  1 
ATOM   6607  H HB3  . GLU A 1 452 ? 49.726  77.518  84.733  1.00 66.30  ? 518  GLU A HB3  1 
ATOM   6608  H HG2  . GLU A 1 452 ? 51.008  78.041  86.696  1.00 83.62  ? 518  GLU A HG2  1 
ATOM   6609  H HG3  . GLU A 1 452 ? 49.799  77.480  87.556  1.00 83.62  ? 518  GLU A HG3  1 
ATOM   6610  N N    . SER A 1 453 ? 46.837  79.508  84.231  1.00 49.93  ? 519  SER A N    1 
ATOM   6611  C CA   . SER A 1 453 ? 46.060  79.934  83.064  1.00 49.03  ? 519  SER A CA   1 
ATOM   6612  C C    . SER A 1 453 ? 46.085  81.451  82.879  1.00 47.40  ? 519  SER A C    1 
ATOM   6613  O O    . SER A 1 453 ? 46.339  81.931  81.776  1.00 56.04  ? 519  SER A O    1 
ATOM   6614  C CB   . SER A 1 453 ? 44.613  79.409  83.101  1.00 41.36  ? 519  SER A CB   1 
ATOM   6615  O OG   . SER A 1 453 ? 43.956  79.728  84.306  1.00 52.89  ? 519  SER A OG   1 
ATOM   6616  H H    . SER A 1 453 ? 46.371  79.169  84.869  1.00 59.92  ? 519  SER A H    1 
ATOM   6617  H HA   . SER A 1 453 ? 46.476  79.549  82.277  1.00 58.84  ? 519  SER A HA   1 
ATOM   6618  H HB2  . SER A 1 453 ? 44.121  79.805  82.365  1.00 49.63  ? 519  SER A HB2  1 
ATOM   6619  H HB3  . SER A 1 453 ? 44.630  78.444  83.002  1.00 49.63  ? 519  SER A HB3  1 
ATOM   6620  H HG   . SER A 1 453 ? 43.928  80.561  84.406  1.00 63.46  ? 519  SER A HG   1 
ATOM   6621  N N    . ALA A 1 454 ? 45.831  82.206  83.943  1.00 37.04  ? 520  ALA A N    1 
ATOM   6622  C CA   . ALA A 1 454 ? 45.803  83.660  83.838  1.00 40.37  ? 520  ALA A CA   1 
ATOM   6623  C C    . ALA A 1 454 ? 47.159  84.199  83.383  1.00 46.98  ? 520  ALA A C    1 
ATOM   6624  O O    . ALA A 1 454 ? 47.235  85.093  82.551  1.00 44.39  ? 520  ALA A O    1 
ATOM   6625  C CB   . ALA A 1 454 ? 45.399  84.277  85.147  1.00 42.84  ? 520  ALA A CB   1 
ATOM   6626  H H    . ALA A 1 454 ? 45.671  81.903  84.732  1.00 44.45  ? 520  ALA A H    1 
ATOM   6627  H HA   . ALA A 1 454 ? 45.144  83.914  83.174  1.00 48.44  ? 520  ALA A HA   1 
ATOM   6628  H HB1  . ALA A 1 454 ? 45.388  85.242  85.051  1.00 51.41  ? 520  ALA A HB1  1 
ATOM   6629  H HB2  . ALA A 1 454 ? 44.514  83.959  85.386  1.00 51.41  ? 520  ALA A HB2  1 
ATOM   6630  H HB3  . ALA A 1 454 ? 46.039  84.019  85.829  1.00 51.41  ? 520  ALA A HB3  1 
ATOM   6631  N N    . LEU A 1 455 ? 48.240  83.642  83.909  1.00 49.57  ? 521  LEU A N    1 
ATOM   6632  C CA   . LEU A 1 455 ? 49.563  84.001  83.411  1.00 42.38  ? 521  LEU A CA   1 
ATOM   6633  C C    . LEU A 1 455 ? 49.756  83.576  81.933  1.00 46.76  ? 521  LEU A C    1 
ATOM   6634  O O    . LEU A 1 455 ? 50.444  84.256  81.165  1.00 43.01  ? 521  LEU A O    1 
ATOM   6635  C CB   . LEU A 1 455 ? 50.656  83.414  84.308  1.00 28.73  ? 521  LEU A CB   1 
ATOM   6636  C CG   . LEU A 1 455 ? 52.078  83.488  83.737  1.00 48.52  ? 521  LEU A CG   1 
ATOM   6637  C CD1  . LEU A 1 455 ? 52.506  84.928  83.515  1.00 51.63  ? 521  LEU A CD1  1 
ATOM   6638  C CD2  . LEU A 1 455 ? 53.069  82.784  84.640  1.00 45.29  ? 521  LEU A CD2  1 
ATOM   6639  H H    . LEU A 1 455 ? 48.238  83.063  84.545  1.00 59.48  ? 521  LEU A H    1 
ATOM   6640  H HA   . LEU A 1 455 ? 49.649  84.966  83.446  1.00 50.85  ? 521  LEU A HA   1 
ATOM   6641  H HB2  . LEU A 1 455 ? 50.654  83.896  85.150  1.00 34.47  ? 521  LEU A HB2  1 
ATOM   6642  H HB3  . LEU A 1 455 ? 50.454  82.479  84.469  1.00 34.47  ? 521  LEU A HB3  1 
ATOM   6643  H HG   . LEU A 1 455 ? 52.091  83.040  82.876  1.00 58.23  ? 521  LEU A HG   1 
ATOM   6644  H HD11 . LEU A 1 455 ? 53.406  84.938  83.154  1.00 61.96  ? 521  LEU A HD11 1 
ATOM   6645  H HD12 . LEU A 1 455 ? 51.894  85.346  82.889  1.00 61.96  ? 521  LEU A HD12 1 
ATOM   6646  H HD13 . LEU A 1 455 ? 52.484  85.398  84.364  1.00 61.96  ? 521  LEU A HD13 1 
ATOM   6647  H HD21 . LEU A 1 455 ? 53.954  82.851  84.249  1.00 54.35  ? 521  LEU A HD21 1 
ATOM   6648  H HD22 . LEU A 1 455 ? 53.059  83.210  85.511  1.00 54.35  ? 521  LEU A HD22 1 
ATOM   6649  H HD23 . LEU A 1 455 ? 52.813  81.853  84.723  1.00 54.35  ? 521  LEU A HD23 1 
ATOM   6650  N N    . ILE A 1 456 ? 49.163  82.460  81.521  1.00 42.22  ? 522  ILE A N    1 
ATOM   6651  C CA   . ILE A 1 456 ? 49.261  82.071  80.112  1.00 50.31  ? 522  ILE A CA   1 
ATOM   6652  C C    . ILE A 1 456 ? 48.549  83.121  79.241  1.00 54.11  ? 522  ILE A C    1 
ATOM   6653  O O    . ILE A 1 456 ? 49.064  83.543  78.197  1.00 40.74  ? 522  ILE A O    1 
ATOM   6654  C CB   . ILE A 1 456 ? 48.673  80.661  79.844  1.00 65.09  ? 522  ILE A CB   1 
ATOM   6655  C CG1  . ILE A 1 456 ? 49.651  79.568  80.293  1.00 60.96  ? 522  ILE A CG1  1 
ATOM   6656  C CG2  . ILE A 1 456 ? 48.374  80.474  78.351  1.00 60.64  ? 522  ILE A CG2  1 
ATOM   6657  C CD1  . ILE A 1 456 ? 49.090  78.129  80.199  1.00 58.45  ? 522  ILE A CD1  1 
ATOM   6658  H H    . ILE A 1 456 ? 48.710  81.923  82.017  1.00 50.67  ? 522  ILE A H    1 
ATOM   6659  H HA   . ILE A 1 456 ? 50.197  82.056  79.856  1.00 60.37  ? 522  ILE A HA   1 
ATOM   6660  H HB   . ILE A 1 456 ? 47.847  80.566  80.343  1.00 78.10  ? 522  ILE A HB   1 
ATOM   6661  H HG12 . ILE A 1 456 ? 50.444  79.612  79.736  1.00 73.16  ? 522  ILE A HG12 1 
ATOM   6662  H HG13 . ILE A 1 456 ? 49.893  79.729  81.219  1.00 73.16  ? 522  ILE A HG13 1 
ATOM   6663  H HG21 . ILE A 1 456 ? 48.009  79.587  78.211  1.00 72.77  ? 522  ILE A HG21 1 
ATOM   6664  H HG22 . ILE A 1 456 ? 47.732  81.145  78.072  1.00 72.77  ? 522  ILE A HG22 1 
ATOM   6665  H HG23 . ILE A 1 456 ? 49.198  80.576  77.849  1.00 72.77  ? 522  ILE A HG23 1 
ATOM   6666  H HD11 . ILE A 1 456 ? 49.769  77.505  80.500  1.00 70.14  ? 522  ILE A HD11 1 
ATOM   6667  H HD12 . ILE A 1 456 ? 48.303  78.059  80.762  1.00 70.14  ? 522  ILE A HD12 1 
ATOM   6668  H HD13 . ILE A 1 456 ? 48.855  77.942  79.276  1.00 70.14  ? 522  ILE A HD13 1 
ATOM   6669  N N    . GLU A 1 457 ? 47.362  83.528  79.693  1.00 58.00  ? 523  GLU A N    1 
ATOM   6670  C CA   . GLU A 1 457 ? 46.561  84.565  79.041  1.00 35.60  ? 523  GLU A CA   1 
ATOM   6671  C C    . GLU A 1 457 ? 47.311  85.881  78.934  1.00 46.04  ? 523  GLU A C    1 
ATOM   6672  O O    . GLU A 1 457 ? 47.522  86.395  77.837  1.00 46.66  ? 523  GLU A O    1 
ATOM   6673  C CB   . GLU A 1 457 ? 45.271  84.783  79.833  1.00 39.41  ? 523  GLU A CB   1 
ATOM   6674  C CG   . GLU A 1 457 ? 44.472  86.053  79.493  1.00 54.76  ? 523  GLU A CG   1 
ATOM   6675  C CD   . GLU A 1 457 ? 43.871  86.026  78.106  1.00 57.61  ? 523  GLU A CD   1 
ATOM   6676  O OE1  . GLU A 1 457 ? 43.448  84.927  77.695  1.00 62.97  ? 523  GLU A OE1  1 
ATOM   6677  O OE2  . GLU A 1 457 ? 43.828  87.089  77.434  1.00 55.74  ? 523  GLU A OE2  1 
ATOM   6678  H H    . GLU A 1 457 ? 46.988  83.207  80.398  1.00 69.60  ? 523  GLU A H    1 
ATOM   6679  H HA   . GLU A 1 457 ? 46.325  84.274  78.146  1.00 42.73  ? 523  GLU A HA   1 
ATOM   6680  H HB2  . GLU A 1 457 ? 44.686  84.025  79.678  1.00 47.29  ? 523  GLU A HB2  1 
ATOM   6681  H HB3  . GLU A 1 457 ? 45.497  84.828  80.776  1.00 47.29  ? 523  GLU A HB3  1 
ATOM   6682  H HG2  . GLU A 1 457 ? 43.748  86.149  80.130  1.00 65.71  ? 523  GLU A HG2  1 
ATOM   6683  H HG3  . GLU A 1 457 ? 45.064  86.820  79.546  1.00 65.71  ? 523  GLU A HG3  1 
ATOM   6684  N N    . ILE A 1 458 ? 47.687  86.425  80.089  1.00 41.78  ? 524  ILE A N    1 
ATOM   6685  C CA   . ILE A 1 458 ? 48.459  87.657  80.159  1.00 31.56  ? 524  ILE A CA   1 
ATOM   6686  C C    . ILE A 1 458 ? 49.641  87.608  79.215  1.00 47.83  ? 524  ILE A C    1 
ATOM   6687  O O    . ILE A 1 458 ? 49.869  88.552  78.452  1.00 40.61  ? 524  ILE A O    1 
ATOM   6688  C CB   . ILE A 1 458 ? 48.974  87.912  81.590  1.00 32.96  ? 524  ILE A CB   1 
ATOM   6689  C CG1  . ILE A 1 458 ? 47.795  88.305  82.489  1.00 41.26  ? 524  ILE A CG1  1 
ATOM   6690  C CG2  . ILE A 1 458 ? 50.075  88.991  81.594  1.00 35.85  ? 524  ILE A CG2  1 
ATOM   6691  C CD1  . ILE A 1 458 ? 48.155  88.759  83.876  1.00 36.00  ? 524  ILE A CD1  1 
ATOM   6692  H H    . ILE A 1 458 ? 47.503  86.091  80.860  1.00 50.14  ? 524  ILE A H    1 
ATOM   6693  H HA   . ILE A 1 458 ? 47.895  88.403  79.901  1.00 37.87  ? 524  ILE A HA   1 
ATOM   6694  H HB   . ILE A 1 458 ? 49.354  87.087  81.929  1.00 39.55  ? 524  ILE A HB   1 
ATOM   6695  H HG12 . ILE A 1 458 ? 47.314  89.031  82.063  1.00 49.51  ? 524  ILE A HG12 1 
ATOM   6696  H HG13 . ILE A 1 458 ? 47.209  87.538  82.579  1.00 49.51  ? 524  ILE A HG13 1 
ATOM   6697  H HG21 . ILE A 1 458 ? 50.378  89.129  82.506  1.00 43.02  ? 524  ILE A HG21 1 
ATOM   6698  H HG22 . ILE A 1 458 ? 50.814  88.691  81.042  1.00 43.02  ? 524  ILE A HG22 1 
ATOM   6699  H HG23 . ILE A 1 458 ? 49.710  89.816  81.238  1.00 43.02  ? 524  ILE A HG23 1 
ATOM   6700  H HD11 . ILE A 1 458 ? 47.342  88.982  84.356  1.00 43.20  ? 524  ILE A HD11 1 
ATOM   6701  H HD12 . ILE A 1 458 ? 48.623  88.041  84.331  1.00 43.20  ? 524  ILE A HD12 1 
ATOM   6702  H HD13 . ILE A 1 458 ? 48.728  89.540  83.814  1.00 43.20  ? 524  ILE A HD13 1 
ATOM   6703  N N    . MET A 1 459 ? 50.377  86.497  79.276  1.00 46.88  ? 525  MET A N    1 
ATOM   6704  C CA   . MET A 1 459 ? 51.581  86.306  78.480  1.00 49.16  ? 525  MET A CA   1 
ATOM   6705  C C    . MET A 1 459 ? 51.300  86.497  76.993  1.00 52.26  ? 525  MET A C    1 
ATOM   6706  O O    . MET A 1 459 ? 52.044  87.202  76.294  1.00 38.90  ? 525  MET A O    1 
ATOM   6707  C CB   . MET A 1 459 ? 52.144  84.904  78.713  1.00 58.91  ? 525  MET A CB   1 
ATOM   6708  C CG   . MET A 1 459 ? 53.431  84.610  77.925  1.00 60.00  ? 525  MET A CG   1 
ATOM   6709  S SD   . MET A 1 459 ? 54.311  83.173  78.560  1.00 50.91  ? 525  MET A SD   1 
ATOM   6710  C CE   . MET A 1 459 ? 53.640  81.846  77.579  1.00 30.09  ? 525  MET A CE   1 
ATOM   6711  H H    . MET A 1 459 ? 50.192  85.828  79.784  1.00 56.26  ? 525  MET A H    1 
ATOM   6712  H HA   . MET A 1 459 ? 52.251  86.950  78.760  1.00 58.99  ? 525  MET A HA   1 
ATOM   6713  H HB2  . MET A 1 459 ? 52.345  84.802  79.657  1.00 70.69  ? 525  MET A HB2  1 
ATOM   6714  H HB3  . MET A 1 459 ? 51.478  84.252  78.447  1.00 70.69  ? 525  MET A HB3  1 
ATOM   6715  H HG2  . MET A 1 459 ? 53.202  84.438  76.998  1.00 72.00  ? 525  MET A HG2  1 
ATOM   6716  H HG3  . MET A 1 459 ? 54.022  85.377  77.985  1.00 72.00  ? 525  MET A HG3  1 
ATOM   6717  H HE1  . MET A 1 459 ? 54.057  81.013  77.848  1.00 36.10  ? 525  MET A HE1  1 
ATOM   6718  H HE2  . MET A 1 459 ? 52.682  81.800  77.725  1.00 36.10  ? 525  MET A HE2  1 
ATOM   6719  H HE3  . MET A 1 459 ? 53.825  82.022  76.643  1.00 36.10  ? 525  MET A HE3  1 
ATOM   6720  N N    . LEU A 1 460 ? 50.226  85.867  76.517  1.00 40.26  ? 526  LEU A N    1 
ATOM   6721  C CA   . LEU A 1 460 ? 49.824  85.994  75.117  1.00 42.42  ? 526  LEU A CA   1 
ATOM   6722  C C    . LEU A 1 460 ? 49.473  87.436  74.729  1.00 52.36  ? 526  LEU A C    1 
ATOM   6723  O O    . LEU A 1 460 ? 49.786  87.892  73.620  1.00 44.82  ? 526  LEU A O    1 
ATOM   6724  C CB   . LEU A 1 460 ? 48.650  85.070  74.816  1.00 42.04  ? 526  LEU A CB   1 
ATOM   6725  C CG   . LEU A 1 460 ? 47.750  85.431  73.626  1.00 69.00  ? 526  LEU A CG   1 
ATOM   6726  C CD1  . LEU A 1 460 ? 48.298  84.811  72.358  1.00 55.29  ? 526  LEU A CD1  1 
ATOM   6727  C CD2  . LEU A 1 460 ? 46.282  85.025  73.859  1.00 73.22  ? 526  LEU A CD2  1 
ATOM   6728  H H    . LEU A 1 460 ? 49.713  85.360  76.986  1.00 48.32  ? 526  LEU A H    1 
ATOM   6729  H HA   . LEU A 1 460 ? 50.566  85.715  74.558  1.00 50.90  ? 526  LEU A HA   1 
ATOM   6730  H HB2  . LEU A 1 460 ? 49.003  84.183  74.645  1.00 50.45  ? 526  LEU A HB2  1 
ATOM   6731  H HB3  . LEU A 1 460 ? 48.083  85.040  75.602  1.00 50.45  ? 526  LEU A HB3  1 
ATOM   6732  H HG   . LEU A 1 460 ? 47.769  86.394  73.510  1.00 82.80  ? 526  LEU A HG   1 
ATOM   6733  H HD11 . LEU A 1 460 ? 47.719  85.048  71.616  1.00 66.35  ? 526  LEU A HD11 1 
ATOM   6734  H HD12 . LEU A 1 460 ? 49.193  85.151  72.202  1.00 66.35  ? 526  LEU A HD12 1 
ATOM   6735  H HD13 . LEU A 1 460 ? 48.323  83.847  72.464  1.00 66.35  ? 526  LEU A HD13 1 
ATOM   6736  H HD21 . LEU A 1 460 ? 45.759  85.274  73.082  1.00 87.86  ? 526  LEU A HD21 1 
ATOM   6737  H HD22 . LEU A 1 460 ? 46.239  84.065  73.994  1.00 87.86  ? 526  LEU A HD22 1 
ATOM   6738  H HD23 . LEU A 1 460 ? 45.948  85.485  74.645  1.00 87.86  ? 526  LEU A HD23 1 
ATOM   6739  N N    . CYS A 1 461 ? 48.798  88.148  75.623  1.00 45.54  ? 527  CYS A N    1 
ATOM   6740  C CA   . CYS A 1 461 ? 48.394  89.508  75.311  1.00 46.12  ? 527  CYS A CA   1 
ATOM   6741  C C    . CYS A 1 461 ? 49.628  90.385  75.105  1.00 46.03  ? 527  CYS A C    1 
ATOM   6742  O O    . CYS A 1 461 ? 49.735  91.097  74.096  1.00 42.54  ? 527  CYS A O    1 
ATOM   6743  C CB   . CYS A 1 461 ? 47.490  90.068  76.409  1.00 46.58  ? 527  CYS A CB   1 
ATOM   6744  S SG   . CYS A 1 461 ? 45.859  89.292  76.505  1.00 52.38  ? 527  CYS A SG   1 
ATOM   6745  H H    . CYS A 1 461 ? 48.566  87.872  76.403  1.00 54.65  ? 527  CYS A H    1 
ATOM   6746  H HA   . CYS A 1 461 ? 47.889  89.504  74.483  1.00 55.34  ? 527  CYS A HA   1 
ATOM   6747  H HB2  . CYS A 1 461 ? 47.927  89.940  77.266  1.00 55.90  ? 527  CYS A HB2  1 
ATOM   6748  H HB3  . CYS A 1 461 ? 47.357  91.015  76.248  1.00 55.90  ? 527  CYS A HB3  1 
ATOM   6749  H HG   . CYS A 1 461 ? 45.996  88.119  76.722  1.00 62.86  ? 527  CYS A HG   1 
ATOM   6750  N N    . THR A 1 462 ? 50.556  90.317  76.054  1.00 32.85  ? 528  THR A N    1 
ATOM   6751  C CA   . THR A 1 462 ? 51.843  91.016  75.947  1.00 37.48  ? 528  THR A CA   1 
ATOM   6752  C C    . THR A 1 462 ? 52.477  90.811  74.566  1.00 43.50  ? 528  THR A C    1 
ATOM   6753  O O    . THR A 1 462 ? 52.894  91.757  73.896  1.00 24.88  ? 528  THR A O    1 
ATOM   6754  C CB   . THR A 1 462 ? 52.825  90.506  77.018  1.00 28.33  ? 528  THR A CB   1 
ATOM   6755  O OG1  . THR A 1 462 ? 52.764  89.080  77.062  1.00 59.23  ? 528  THR A OG1  1 
ATOM   6756  C CG2  . THR A 1 462 ? 52.467  91.024  78.382  1.00 33.81  ? 528  THR A CG2  1 
ATOM   6757  H H    . THR A 1 462 ? 50.467  89.868  76.782  1.00 39.42  ? 528  THR A H    1 
ATOM   6758  H HA   . THR A 1 462 ? 51.706  91.966  76.084  1.00 44.98  ? 528  THR A HA   1 
ATOM   6759  H HB   . THR A 1 462 ? 53.727  90.791  76.801  1.00 34.00  ? 528  THR A HB   1 
ATOM   6760  H HG1  . THR A 1 462 ? 52.974  88.760  76.315  1.00 71.08  ? 528  THR A HG1  1 
ATOM   6761  H HG21 . THR A 1 462 ? 53.098  90.692  79.040  1.00 40.57  ? 528  THR A HG21 1 
ATOM   6762  H HG22 . THR A 1 462 ? 52.491  91.994  78.385  1.00 40.57  ? 528  THR A HG22 1 
ATOM   6763  H HG23 . THR A 1 462 ? 51.575  90.730  78.625  1.00 40.57  ? 528  THR A HG23 1 
ATOM   6764  N N    . ILE A 1 463 ? 52.515  89.552  74.152  1.00 35.98  ? 529  ILE A N    1 
ATOM   6765  C CA   . ILE A 1 463 ? 53.125  89.149  72.891  1.00 48.41  ? 529  ILE A CA   1 
ATOM   6766  C C    . ILE A 1 463 ? 52.430  89.749  71.654  1.00 49.02  ? 529  ILE A C    1 
ATOM   6767  O O    . ILE A 1 463 ? 53.074  90.363  70.785  1.00 29.97  ? 529  ILE A O    1 
ATOM   6768  C CB   . ILE A 1 463 ? 53.150  87.605  72.823  1.00 38.42  ? 529  ILE A CB   1 
ATOM   6769  C CG1  . ILE A 1 463 ? 54.286  87.093  73.695  1.00 40.54  ? 529  ILE A CG1  1 
ATOM   6770  C CG2  . ILE A 1 463 ? 53.338  87.092  71.406  1.00 32.46  ? 529  ILE A CG2  1 
ATOM   6771  C CD1  . ILE A 1 463 ? 54.040  85.745  74.275  1.00 44.44  ? 529  ILE A CD1  1 
ATOM   6772  H H    . ILE A 1 463 ? 52.186  88.894  74.597  1.00 43.18  ? 529  ILE A H    1 
ATOM   6773  H HA   . ILE A 1 463 ? 54.045  89.455  72.884  1.00 58.09  ? 529  ILE A HA   1 
ATOM   6774  H HB   . ILE A 1 463 ? 52.311  87.263  73.171  1.00 46.11  ? 529  ILE A HB   1 
ATOM   6775  H HG12 . ILE A 1 463 ? 55.093  87.042  73.158  1.00 48.65  ? 529  ILE A HG12 1 
ATOM   6776  H HG13 . ILE A 1 463 ? 54.420  87.712  74.429  1.00 48.65  ? 529  ILE A HG13 1 
ATOM   6777  H HG21 . ILE A 1 463 ? 53.346  86.122  71.421  1.00 38.95  ? 529  ILE A HG21 1 
ATOM   6778  H HG22 . ILE A 1 463 ? 52.604  87.408  70.856  1.00 38.95  ? 529  ILE A HG22 1 
ATOM   6779  H HG23 . ILE A 1 463 ? 54.180  87.425  71.059  1.00 38.95  ? 529  ILE A HG23 1 
ATOM   6780  H HD11 . ILE A 1 463 ? 54.804  85.490  74.814  1.00 53.33  ? 529  ILE A HD11 1 
ATOM   6781  H HD12 . ILE A 1 463 ? 53.242  85.780  74.826  1.00 53.33  ? 529  ILE A HD12 1 
ATOM   6782  H HD13 . ILE A 1 463 ? 53.916  85.109  73.553  1.00 53.33  ? 529  ILE A HD13 1 
ATOM   6783  N N    . ARG A 1 464 ? 51.117  89.562  71.577  1.00 48.96  ? 530  ARG A N    1 
ATOM   6784  C CA   . ARG A 1 464 ? 50.352  90.071  70.455  1.00 41.69  ? 530  ARG A CA   1 
ATOM   6785  C C    . ARG A 1 464 ? 50.512  91.574  70.340  1.00 40.84  ? 530  ARG A C    1 
ATOM   6786  O O    . ARG A 1 464 ? 50.743  92.097  69.255  1.00 41.36  ? 530  ARG A O    1 
ATOM   6787  C CB   . ARG A 1 464 ? 48.887  89.720  70.622  1.00 43.04  ? 530  ARG A CB   1 
ATOM   6788  C CG   . ARG A 1 464 ? 47.979  90.351  69.579  1.00 49.67  ? 530  ARG A CG   1 
ATOM   6789  C CD   . ARG A 1 464 ? 46.589  89.814  69.721  1.00 41.08  ? 530  ARG A CD   1 
ATOM   6790  N NE   . ARG A 1 464 ? 46.096  90.079  71.062  1.00 54.37  ? 530  ARG A NE   1 
ATOM   6791  C CZ   . ARG A 1 464 ? 45.239  89.304  71.716  1.00 78.03  ? 530  ARG A CZ   1 
ATOM   6792  N NH1  . ARG A 1 464 ? 44.777  88.185  71.163  1.00 77.95  ? 530  ARG A NH1  1 
ATOM   6793  N NH2  . ARG A 1 464 ? 44.862  89.639  72.946  1.00 87.34  ? 530  ARG A NH2  1 
ATOM   6794  H H    . ARG A 1 464 ? 50.648  89.142  72.163  1.00 58.76  ? 530  ARG A H    1 
ATOM   6795  H HA   . ARG A 1 464 ? 50.674  89.665  69.635  1.00 50.03  ? 530  ARG A HA   1 
ATOM   6796  H HB2  . ARG A 1 464 ? 48.788  88.757  70.557  1.00 51.64  ? 530  ARG A HB2  1 
ATOM   6797  H HB3  . ARG A 1 464 ? 48.591  90.023  71.494  1.00 51.64  ? 530  ARG A HB3  1 
ATOM   6798  H HG2  . ARG A 1 464 ? 47.954  91.312  69.708  1.00 59.60  ? 530  ARG A HG2  1 
ATOM   6799  H HG3  . ARG A 1 464 ? 48.305  90.136  68.691  1.00 59.60  ? 530  ARG A HG3  1 
ATOM   6800  H HD2  . ARG A 1 464 ? 46.004  90.252  69.083  1.00 49.29  ? 530  ARG A HD2  1 
ATOM   6801  H HD3  . ARG A 1 464 ? 46.595  88.855  69.577  1.00 49.29  ? 530  ARG A HD3  1 
ATOM   6802  H HE   . ARG A 1 464 ? 46.378  90.787  71.459  1.00 65.24  ? 530  ARG A HE   1 
ATOM   6803  H HH11 . ARG A 1 464 ? 45.023  87.964  70.370  1.00 93.54  ? 530  ARG A HH11 1 
ATOM   6804  H HH12 . ARG A 1 464 ? 44.225  87.688  71.596  1.00 93.54  ? 530  ARG A HH12 1 
ATOM   6805  H HH21 . ARG A 1 464 ? 45.161  90.360  73.306  1.00 104.81 ? 530  ARG A HH21 1 
ATOM   6806  H HH22 . ARG A 1 464 ? 44.309  89.141  73.377  1.00 104.81 ? 530  ARG A HH22 1 
ATOM   6807  N N    . GLN A 1 465 ? 50.397  92.269  71.463  1.00 32.65  ? 531  GLN A N    1 
ATOM   6808  C CA   . GLN A 1 465 ? 50.567  93.711  71.450  1.00 33.05  ? 531  GLN A CA   1 
ATOM   6809  C C    . GLN A 1 465 ? 52.013  94.163  71.172  1.00 53.61  ? 531  GLN A C    1 
ATOM   6810  O O    . GLN A 1 465 ? 52.232  95.294  70.731  1.00 67.16  ? 531  GLN A O    1 
ATOM   6811  C CB   . GLN A 1 465 ? 50.077  94.312  72.759  1.00 30.65  ? 531  GLN A CB   1 
ATOM   6812  C CG   . GLN A 1 465 ? 50.047  95.817  72.710  1.00 30.68  ? 531  GLN A CG   1 
ATOM   6813  C CD   . GLN A 1 465 ? 48.985  96.423  73.585  1.00 39.54  ? 531  GLN A CD   1 
ATOM   6814  O OE1  . GLN A 1 465 ? 48.409  95.762  74.448  1.00 57.92  ? 531  GLN A OE1  1 
ATOM   6815  N NE2  . GLN A 1 465 ? 48.722  97.695  73.374  1.00 39.14  ? 531  GLN A NE2  1 
ATOM   6816  H H    . GLN A 1 465 ? 50.224  91.934  72.236  1.00 39.18  ? 531  GLN A H    1 
ATOM   6817  H HA   . GLN A 1 465 ? 50.012  94.075  70.742  1.00 39.66  ? 531  GLN A HA   1 
ATOM   6818  H HB2  . GLN A 1 465 ? 49.178  93.997  72.938  1.00 36.78  ? 531  GLN A HB2  1 
ATOM   6819  H HB3  . GLN A 1 465 ? 50.675  94.045  73.475  1.00 36.78  ? 531  GLN A HB3  1 
ATOM   6820  H HG2  . GLN A 1 465 ? 50.906  96.158  73.004  1.00 36.81  ? 531  GLN A HG2  1 
ATOM   6821  H HG3  . GLN A 1 465 ? 49.876  96.097  71.797  1.00 36.81  ? 531  GLN A HG3  1 
ATOM   6822  H HE21 . GLN A 1 465 ? 49.148  98.127  72.765  1.00 46.97  ? 531  GLN A HE21 1 
ATOM   6823  H HE22 . GLN A 1 465 ? 48.123  98.095  73.845  1.00 46.97  ? 531  GLN A HE22 1 
ATOM   6824  N N    . ALA A 1 466 ? 52.996  93.304  71.447  1.00 38.56  ? 532  ALA A N    1 
ATOM   6825  C CA   . ALA A 1 466 ? 54.381  93.588  71.082  1.00 35.57  ? 532  ALA A CA   1 
ATOM   6826  C C    . ALA A 1 466 ? 54.560  93.334  69.599  1.00 45.70  ? 532  ALA A C    1 
ATOM   6827  O O    . ALA A 1 466 ? 55.266  94.076  68.908  1.00 49.95  ? 532  ALA A O    1 
ATOM   6828  C CB   . ALA A 1 466 ? 55.335  92.711  71.874  1.00 31.67  ? 532  ALA A CB   1 
ATOM   6829  H H    . ALA A 1 466 ? 52.885  92.549  71.845  1.00 46.27  ? 532  ALA A H    1 
ATOM   6830  H HA   . ALA A 1 466 ? 54.585  94.518  71.267  1.00 42.68  ? 532  ALA A HA   1 
ATOM   6831  H HB1  . ALA A 1 466 ? 56.245  92.920  71.613  1.00 38.01  ? 532  ALA A HB1  1 
ATOM   6832  H HB2  . ALA A 1 466 ? 55.213  92.887  72.820  1.00 38.01  ? 532  ALA A HB2  1 
ATOM   6833  H HB3  . ALA A 1 466 ? 55.140  91.780  71.682  1.00 38.01  ? 532  ALA A HB3  1 
ATOM   6834  N N    . ALA A 1 467 ? 53.900  92.283  69.118  1.00 48.25  ? 533  ALA A N    1 
ATOM   6835  C CA   . ALA A 1 467 ? 54.085  91.796  67.751  1.00 49.05  ? 533  ALA A CA   1 
ATOM   6836  C C    . ALA A 1 467 ? 53.359  92.650  66.721  1.00 53.84  ? 533  ALA A C    1 
ATOM   6837  O O    . ALA A 1 467 ? 53.982  93.160  65.791  1.00 62.40  ? 533  ALA A O    1 
ATOM   6838  C CB   . ALA A 1 467 ? 53.616  90.352  67.650  1.00 61.03  ? 533  ALA A CB   1 
ATOM   6839  H H    . ALA A 1 467 ? 53.329  91.827  69.571  1.00 57.90  ? 533  ALA A H    1 
ATOM   6840  H HA   . ALA A 1 467 ? 55.031  91.815  67.538  1.00 58.86  ? 533  ALA A HA   1 
ATOM   6841  H HB1  . ALA A 1 467 ? 53.743  90.042  66.740  1.00 73.24  ? 533  ALA A HB1  1 
ATOM   6842  H HB2  . ALA A 1 467 ? 54.136  89.808  68.262  1.00 73.24  ? 533  ALA A HB2  1 
ATOM   6843  H HB3  . ALA A 1 467 ? 52.676  90.309  67.886  1.00 73.24  ? 533  ALA A HB3  1 
ATOM   6844  N N    . GLU A 1 468 ? 52.038  92.763  66.871  1.00 58.11  ? 534  GLU A N    1 
ATOM   6845  C CA   . GLU A 1 468 ? 51.249  93.766  66.162  1.00 49.50  ? 534  GLU A CA   1 
ATOM   6846  C C    . GLU A 1 468 ? 51.477  94.999  67.002  1.00 58.03  ? 534  GLU A C    1 
ATOM   6847  O O    . GLU A 1 468 ? 51.633  94.886  68.215  1.00 76.10  ? 534  GLU A O    1 
ATOM   6848  C CB   . GLU A 1 468 ? 49.756  93.408  66.161  1.00 62.95  ? 534  GLU A CB   1 
ATOM   6849  C CG   . GLU A 1 468 ? 49.443  91.919  66.380  1.00 67.66  ? 534  GLU A CG   1 
ATOM   6850  C CD   . GLU A 1 468 ? 47.969  91.562  66.173  1.00 75.80  ? 534  GLU A CD   1 
ATOM   6851  O OE1  . GLU A 1 468 ? 47.094  92.377  66.564  1.00 63.71  ? 534  GLU A OE1  1 
ATOM   6852  O OE2  . GLU A 1 468 ? 47.698  90.449  65.641  1.00 69.85  ? 534  GLU A OE2  1 
ATOM   6853  H H    . GLU A 1 468 ? 51.569  92.260  67.387  1.00 69.74  ? 534  GLU A H    1 
ATOM   6854  H HA   . GLU A 1 468 ? 51.571  93.903  65.258  1.00 59.41  ? 534  GLU A HA   1 
ATOM   6855  H HB2  . GLU A 1 468 ? 49.319  93.905  66.870  1.00 75.54  ? 534  GLU A HB2  1 
ATOM   6856  H HB3  . GLU A 1 468 ? 49.379  93.663  65.305  1.00 75.54  ? 534  GLU A HB3  1 
ATOM   6857  H HG2  . GLU A 1 468 ? 49.966  91.394  65.754  1.00 81.20  ? 534  GLU A HG2  1 
ATOM   6858  H HG3  . GLU A 1 468 ? 49.681  91.680  67.289  1.00 81.20  ? 534  GLU A HG3  1 
ATOM   6859  N N    . CYS A 1 469 ? 51.523  96.177  66.409  1.00 53.20  ? 535  CYS A N    1 
ATOM   6860  C CA   . CYS A 1 469 ? 51.914  97.333  67.211  1.00 65.23  ? 535  CYS A CA   1 
ATOM   6861  C C    . CYS A 1 469 ? 50.779  98.293  67.501  1.00 56.92  ? 535  CYS A C    1 
ATOM   6862  O O    . CYS A 1 469 ? 51.011  99.438  67.877  1.00 67.65  ? 535  CYS A O    1 
ATOM   6863  C CB   . CYS A 1 469 ? 53.058  98.078  66.546  1.00 78.40  ? 535  CYS A CB   1 
ATOM   6864  S SG   . CYS A 1 469 ? 54.627  97.792  67.348  1.00 79.60  ? 535  CYS A SG   1 
ATOM   6865  H H    . CYS A 1 469 ? 51.344  96.337  65.583  1.00 63.84  ? 535  CYS A H    1 
ATOM   6866  H HA   . CYS A 1 469 ? 52.240  97.010  68.066  1.00 78.28  ? 535  CYS A HA   1 
ATOM   6867  H HB2  . CYS A 1 469 ? 53.134  97.783  65.625  1.00 94.08  ? 535  CYS A HB2  1 
ATOM   6868  H HB3  . CYS A 1 469 ? 52.875  99.030  66.576  1.00 94.08  ? 535  CYS A HB3  1 
ATOM   6869  H HG   . CYS A 1 469 ? 55.479  98.409  66.770  1.00 95.52  ? 535  CYS A HG   1 
ATOM   6870  N N    . HIS A 1 470 ? 49.554  97.822  67.324  1.00 59.97  ? 536  HIS A N    1 
ATOM   6871  C CA   . HIS A 1 470 ? 48.378  98.606  67.670  1.00 51.07  ? 536  HIS A CA   1 
ATOM   6872  C C    . HIS A 1 470 ? 47.757  98.097  68.970  1.00 49.89  ? 536  HIS A C    1 
ATOM   6873  O O    . HIS A 1 470 ? 47.982  96.951  69.362  1.00 43.57  ? 536  HIS A O    1 
ATOM   6874  C CB   . HIS A 1 470 ? 47.358  98.524  66.553  1.00 42.69  ? 536  HIS A CB   1 
ATOM   6875  C CG   . HIS A 1 470 ? 46.995  97.128  66.181  1.00 49.10  ? 536  HIS A CG   1 
ATOM   6876  N ND1  . HIS A 1 470 ? 46.257  96.310  67.007  1.00 60.48  ? 536  HIS A ND1  1 
ATOM   6877  C CD2  . HIS A 1 470 ? 47.265  96.400  65.076  1.00 61.60  ? 536  HIS A CD2  1 
ATOM   6878  C CE1  . HIS A 1 470 ? 46.080  95.141  66.422  1.00 58.66  ? 536  HIS A CE1  1 
ATOM   6879  N NE2  . HIS A 1 470 ? 46.687  95.166  65.250  1.00 64.32  ? 536  HIS A NE2  1 
ATOM   6880  H H    . HIS A 1 470 ? 49.374  97.045  67.003  1.00 71.97  ? 536  HIS A H    1 
ATOM   6881  H HA   . HIS A 1 470 ? 48.631  99.534  67.791  1.00 61.28  ? 536  HIS A HA   1 
ATOM   6882  H HB2  . HIS A 1 470 ? 46.548  98.977  66.834  1.00 51.23  ? 536  HIS A HB2  1 
ATOM   6883  H HB3  . HIS A 1 470 ? 47.722  98.957  65.765  1.00 51.23  ? 536  HIS A HB3  1 
ATOM   6884  H HD1  . HIS A 1 470 ? 45.951  96.531  67.780  1.00 72.57  ? 536  HIS A HD1  1 
ATOM   6885  H HD2  . HIS A 1 470 ? 47.751  96.682  64.334  1.00 73.92  ? 536  HIS A HD2  1 
ATOM   6886  H HE1  . HIS A 1 470 ? 45.617  94.418  66.779  1.00 70.39  ? 536  HIS A HE1  1 
ATOM   6887  H HE2  . HIS A 1 470 ? 46.713  94.517  64.687  1.00 77.18  ? 536  HIS A HE2  1 
ATOM   6888  N N    . PRO A 1 471 ? 46.992  98.960  69.657  1.00 54.61  ? 537  PRO A N    1 
ATOM   6889  C CA   . PRO A 1 471 ? 46.198  98.543  70.819  1.00 45.80  ? 537  PRO A CA   1 
ATOM   6890  C C    . PRO A 1 471 ? 45.071  97.597  70.426  1.00 37.62  ? 537  PRO A C    1 
ATOM   6891  O O    . PRO A 1 471 ? 44.793  97.435  69.243  1.00 43.67  ? 537  PRO A O    1 
ATOM   6892  C CB   . PRO A 1 471 ? 45.605  99.862  71.328  1.00 41.89  ? 537  PRO A CB   1 
ATOM   6893  C CG   . PRO A 1 471 ? 46.505  100.919 70.798  1.00 47.37  ? 537  PRO A CG   1 
ATOM   6894  C CD   . PRO A 1 471 ? 46.958  100.422 69.473  1.00 56.98  ? 537  PRO A CD   1 
ATOM   6895  H HA   . PRO A 1 471 ? 46.756  98.139  71.502  1.00 54.96  ? 537  PRO A HA   1 
ATOM   6896  H HB2  . PRO A 1 471 ? 44.706  99.971  70.981  1.00 50.26  ? 537  PRO A HB2  1 
ATOM   6897  H HB3  . PRO A 1 471 ? 45.603  99.867  72.297  1.00 50.26  ? 537  PRO A HB3  1 
ATOM   6898  H HG2  . PRO A 1 471 ? 46.012  101.749 70.702  1.00 56.84  ? 537  PRO A HG2  1 
ATOM   6899  H HG3  . PRO A 1 471 ? 47.260  101.035 71.396  1.00 56.84  ? 537  PRO A HG3  1 
ATOM   6900  H HD2  . PRO A 1 471 ? 46.319  100.662 68.784  1.00 68.37  ? 537  PRO A HD2  1 
ATOM   6901  H HD3  . PRO A 1 471 ? 47.845  100.758 69.270  1.00 68.37  ? 537  PRO A HD3  1 
ATOM   6902  N N    . PRO A 1 472 ? 44.412  96.984  71.411  1.00 27.50  ? 538  PRO A N    1 
ATOM   6903  C CA   . PRO A 1 472 ? 43.254  96.152  71.094  1.00 26.97  ? 538  PRO A CA   1 
ATOM   6904  C C    . PRO A 1 472 ? 42.102  97.008  70.616  1.00 27.24  ? 538  PRO A C    1 
ATOM   6905  O O    . PRO A 1 472 ? 42.102  98.211  70.815  1.00 40.43  ? 538  PRO A O    1 
ATOM   6906  C CB   . PRO A 1 472 ? 42.911  95.492  72.428  1.00 24.54  ? 538  PRO A CB   1 
ATOM   6907  C CG   . PRO A 1 472 ? 43.410  96.430  73.434  1.00 45.27  ? 538  PRO A CG   1 
ATOM   6908  C CD   . PRO A 1 472 ? 44.638  97.087  72.856  1.00 30.67  ? 538  PRO A CD   1 
ATOM   6909  H HA   . PRO A 1 472 ? 43.473  95.478  70.432  1.00 32.36  ? 538  PRO A HA   1 
ATOM   6910  H HB2  . PRO A 1 472 ? 41.951  95.382  72.504  1.00 29.45  ? 538  PRO A HB2  1 
ATOM   6911  H HB3  . PRO A 1 472 ? 43.364  94.637  72.498  1.00 29.45  ? 538  PRO A HB3  1 
ATOM   6912  H HG2  . PRO A 1 472 ? 42.728  97.094  73.620  1.00 54.32  ? 538  PRO A HG2  1 
ATOM   6913  H HG3  . PRO A 1 472 ? 43.637  95.943  74.242  1.00 54.32  ? 538  PRO A HG3  1 
ATOM   6914  H HD2  . PRO A 1 472 ? 44.686  98.017  73.127  1.00 36.81  ? 538  PRO A HD2  1 
ATOM   6915  H HD3  . PRO A 1 472 ? 45.437  96.599  73.111  1.00 36.81  ? 538  PRO A HD3  1 
ATOM   6916  N N    . VAL A 1 473 ? 41.119  96.384  69.993  1.00 40.01  ? 539  VAL A N    1 
ATOM   6917  C CA   . VAL A 1 473 ? 40.075  97.127  69.320  1.00 36.79  ? 539  VAL A CA   1 
ATOM   6918  C C    . VAL A 1 473 ? 39.310  98.009  70.306  1.00 41.55  ? 539  VAL A C    1 
ATOM   6919  O O    . VAL A 1 473 ? 39.029  97.600  71.432  1.00 33.38  ? 539  VAL A O    1 
ATOM   6920  C CB   . VAL A 1 473 ? 39.130  96.171  68.586  1.00 34.99  ? 539  VAL A CB   1 
ATOM   6921  C CG1  . VAL A 1 473 ? 38.298  95.355  69.575  1.00 45.17  ? 539  VAL A CG1  1 
ATOM   6922  C CG2  . VAL A 1 473 ? 38.254  96.935  67.648  1.00 41.87  ? 539  VAL A CG2  1 
ATOM   6923  H H    . VAL A 1 473 ? 41.033  95.529  69.946  1.00 48.01  ? 539  VAL A H    1 
ATOM   6924  H HA   . VAL A 1 473 ? 40.483  97.707  68.658  1.00 44.15  ? 539  VAL A HA   1 
ATOM   6925  H HB   . VAL A 1 473 ? 39.658  95.551  68.060  1.00 41.98  ? 539  VAL A HB   1 
ATOM   6926  H HG11 . VAL A 1 473 ? 37.711  94.762  69.080  1.00 54.20  ? 539  VAL A HG11 1 
ATOM   6927  H HG12 . VAL A 1 473 ? 38.895  94.837  70.137  1.00 54.20  ? 539  VAL A HG12 1 
ATOM   6928  H HG13 . VAL A 1 473 ? 37.772  95.961  70.121  1.00 54.20  ? 539  VAL A HG13 1 
ATOM   6929  H HG21 . VAL A 1 473 ? 37.663  96.314  67.193  1.00 50.25  ? 539  VAL A HG21 1 
ATOM   6930  H HG22 . VAL A 1 473 ? 37.733  97.577  68.155  1.00 50.25  ? 539  VAL A HG22 1 
ATOM   6931  H HG23 . VAL A 1 473 ? 38.811  97.396  67.002  1.00 50.25  ? 539  VAL A HG23 1 
ATOM   6932  N N    . GLY A 1 474 ? 38.994  99.227  69.873  1.00 47.59  ? 540  GLY A N    1 
ATOM   6933  C CA   . GLY A 1 474 ? 38.347  100.205 70.727  1.00 42.70  ? 540  GLY A CA   1 
ATOM   6934  C C    . GLY A 1 474 ? 39.319  101.036 71.550  1.00 33.54  ? 540  GLY A C    1 
ATOM   6935  O O    . GLY A 1 474 ? 38.919  101.982 72.214  1.00 50.34  ? 540  GLY A O    1 
ATOM   6936  H H    . GLY A 1 474 ? 39.148  99.510  69.076  1.00 57.11  ? 540  GLY A H    1 
ATOM   6937  H HA2  . GLY A 1 474 ? 37.822  100.809 70.178  1.00 51.24  ? 540  GLY A HA2  1 
ATOM   6938  H HA3  . GLY A 1 474 ? 37.747  99.749  71.337  1.00 51.24  ? 540  GLY A HA3  1 
ATOM   6939  N N    . ARG A 1 475 ? 40.597  100.682 71.508  1.00 44.19  ? 541  ARG A N    1 
ATOM   6940  C CA   . ARG A 1 475 ? 41.635  101.433 72.198  1.00 43.29  ? 541  ARG A CA   1 
ATOM   6941  C C    . ARG A 1 475 ? 42.516  102.180 71.201  1.00 53.28  ? 541  ARG A C    1 
ATOM   6942  O O    . ARG A 1 475 ? 43.273  103.062 71.599  1.00 60.37  ? 541  ARG A O    1 
ATOM   6943  C CB   . ARG A 1 475 ? 42.486  100.502 73.068  1.00 43.78  ? 541  ARG A CB   1 
ATOM   6944  C CG   . ARG A 1 475 ? 41.806  100.041 74.376  1.00 46.27  ? 541  ARG A CG   1 
ATOM   6945  C CD   . ARG A 1 475 ? 41.956  101.035 75.541  1.00 24.47  ? 541  ARG A CD   1 
ATOM   6946  N NE   . ARG A 1 475 ? 41.324  100.554 76.776  1.00 35.07  ? 541  ARG A NE   1 
ATOM   6947  C CZ   . ARG A 1 475 ? 41.929  99.830  77.726  1.00 48.32  ? 541  ARG A CZ   1 
ATOM   6948  N NH1  . ARG A 1 475 ? 43.210  99.490  77.598  1.00 48.98  ? 541  ARG A NH1  1 
ATOM   6949  N NH2  . ARG A 1 475 ? 41.256  99.444  78.815  1.00 18.01  ? 541  ARG A NH2  1 
ATOM   6950  H H    . ARG A 1 475 ? 40.892  99.998  71.078  1.00 53.03  ? 541  ARG A H    1 
ATOM   6951  H HA   . ARG A 1 475 ? 41.217  102.088 72.779  1.00 51.95  ? 541  ARG A HA   1 
ATOM   6952  H HB2  . ARG A 1 475 ? 42.701  99.708  72.554  1.00 52.54  ? 541  ARG A HB2  1 
ATOM   6953  H HB3  . ARG A 1 475 ? 43.304  100.965 73.310  1.00 52.54  ? 541  ARG A HB3  1 
ATOM   6954  H HG2  . ARG A 1 475 ? 40.858  99.921  74.210  1.00 55.53  ? 541  ARG A HG2  1 
ATOM   6955  H HG3  . ARG A 1 475 ? 42.200  99.199  74.653  1.00 55.53  ? 541  ARG A HG3  1 
ATOM   6956  H HD2  . ARG A 1 475 ? 42.899  101.174 75.720  1.00 29.36  ? 541  ARG A HD2  1 
ATOM   6957  H HD3  . ARG A 1 475 ? 41.536  101.875 75.296  1.00 29.36  ? 541  ARG A HD3  1 
ATOM   6958  H HE   . ARG A 1 475 ? 40.496  100.753 76.899  1.00 42.08  ? 541  ARG A HE   1 
ATOM   6959  H HH11 . ARG A 1 475 ? 43.652  99.734  76.901  1.00 58.78  ? 541  ARG A HH11 1 
ATOM   6960  H HH12 . ARG A 1 475 ? 43.595  99.026  78.211  1.00 58.78  ? 541  ARG A HH12 1 
ATOM   6961  H HH21 . ARG A 1 475 ? 40.429  99.658  78.908  1.00 21.61  ? 541  ARG A HH21 1 
ATOM   6962  H HH22 . ARG A 1 475 ? 41.651  98.979  79.422  1.00 21.61  ? 541  ARG A HH22 1 
ATOM   6963  N N    . GLY A 1 476 ? 42.396  101.839 69.915  1.00 62.54  ? 542  GLY A N    1 
ATOM   6964  C CA   . GLY A 1 476 ? 43.166  102.476 68.852  1.00 63.92  ? 542  GLY A CA   1 
ATOM   6965  C C    . GLY A 1 476 ? 42.800  103.930 68.615  1.00 53.78  ? 542  GLY A C    1 
ATOM   6966  O O    . GLY A 1 476 ? 42.127  104.537 69.437  1.00 54.38  ? 542  GLY A O    1 
ATOM   6967  H H    . GLY A 1 476 ? 41.861  101.228 69.631  1.00 75.04  ? 542  GLY A H    1 
ATOM   6968  H HA2  . GLY A 1 476 ? 44.109  102.433 69.073  1.00 76.70  ? 542  GLY A HA2  1 
ATOM   6969  H HA3  . GLY A 1 476 ? 43.027  101.990 68.024  1.00 76.70  ? 542  GLY A HA3  1 
ATOM   6970  N N    . THR A 1 477 ? 43.261  104.494 67.500  1.00 70.52  ? 543  THR A N    1 
ATOM   6971  C CA   . THR A 1 477 ? 42.940  105.878 67.134  1.00 74.28  ? 543  THR A CA   1 
ATOM   6972  C C    . THR A 1 477 ? 42.383  105.948 65.703  1.00 71.16  ? 543  THR A C    1 
ATOM   6973  O O    . THR A 1 477 ? 43.121  105.890 64.714  1.00 59.02  ? 543  THR A O    1 
ATOM   6974  C CB   . THR A 1 477 ? 44.171  106.830 67.274  1.00 93.08  ? 543  THR A CB   1 
ATOM   6975  O OG1  . THR A 1 477 ? 45.171  106.497 66.296  1.00 100.80 ? 543  THR A OG1  1 
ATOM   6976  C CG2  . THR A 1 477 ? 44.777  106.745 68.680  1.00 73.85  ? 543  THR A CG2  1 
ATOM   6977  H H    . THR A 1 477 ? 43.767  104.093 66.931  1.00 84.62  ? 543  THR A H    1 
ATOM   6978  H HA   . THR A 1 477 ? 42.249  106.203 67.732  1.00 89.14  ? 543  THR A HA   1 
ATOM   6979  H HB   . THR A 1 477 ? 43.880  107.744 67.128  1.00 111.69 ? 543  THR A HB   1 
ATOM   6980  H HG1  . THR A 1 477 ? 44.854  106.576 65.522  1.00 120.97 ? 543  THR A HG1  1 
ATOM   6981  H HG21 . THR A 1 477 ? 45.539  107.342 68.749  1.00 88.62  ? 543  THR A HG21 1 
ATOM   6982  H HG22 . THR A 1 477 ? 44.115  107.001 69.342  1.00 88.62  ? 543  THR A HG22 1 
ATOM   6983  H HG23 . THR A 1 477 ? 45.069  105.838 68.860  1.00 88.62  ? 543  THR A HG23 1 
ATOM   6984  N N    . VAL A 1 481 ? 52.497  106.246 63.931  1.00 97.37  ? 547  VAL A N    1 
ATOM   6985  C CA   . VAL A 1 481 ? 51.760  105.116 63.371  1.00 106.34 ? 547  VAL A CA   1 
ATOM   6986  C C    . VAL A 1 481 ? 52.269  104.848 61.943  1.00 98.02  ? 547  VAL A C    1 
ATOM   6987  O O    . VAL A 1 481 ? 51.538  105.050 60.973  1.00 94.83  ? 547  VAL A O    1 
ATOM   6988  C CB   . VAL A 1 481 ? 50.223  105.378 63.411  1.00 86.96  ? 547  VAL A CB   1 
ATOM   6989  C CG1  . VAL A 1 481 ? 49.432  104.151 62.936  1.00 80.58  ? 547  VAL A CG1  1 
ATOM   6990  C CG2  . VAL A 1 481 ? 49.809  105.755 64.829  1.00 61.61  ? 547  VAL A CG2  1 
ATOM   6991  H HA   . VAL A 1 481 ? 51.941  104.326 63.904  1.00 127.61 ? 547  VAL A HA   1 
ATOM   6992  H HB   . VAL A 1 481 ? 50.011  106.121 62.825  1.00 104.35 ? 547  VAL A HB   1 
ATOM   6993  H HG11 . VAL A 1 481 ? 48.484  104.353 62.976  1.00 96.70  ? 547  VAL A HG11 1 
ATOM   6994  H HG12 . VAL A 1 481 ? 49.689  103.945 62.024  1.00 96.70  ? 547  VAL A HG12 1 
ATOM   6995  H HG13 . VAL A 1 481 ? 49.636  103.401 63.516  1.00 96.70  ? 547  VAL A HG13 1 
ATOM   6996  H HG21 . VAL A 1 481 ? 48.852  105.916 64.846  1.00 73.94  ? 547  VAL A HG21 1 
ATOM   6997  H HG22 . VAL A 1 481 ? 50.032  105.025 65.428  1.00 73.94  ? 547  VAL A HG22 1 
ATOM   6998  H HG23 . VAL A 1 481 ? 50.285  106.558 65.094  1.00 73.94  ? 547  VAL A HG23 1 
ATOM   6999  N N    . LEU A 1 482 ? 53.504  104.356 61.807  1.00 92.10  ? 548  LEU A N    1 
ATOM   7000  C CA   . LEU A 1 482 ? 54.288  103.790 62.908  1.00 90.16  ? 548  LEU A CA   1 
ATOM   7001  C C    . LEU A 1 482 ? 55.776  104.172 62.797  1.00 76.68  ? 548  LEU A C    1 
ATOM   7002  O O    . LEU A 1 482 ? 56.454  103.764 61.862  1.00 68.64  ? 548  LEU A O    1 
ATOM   7003  C CB   . LEU A 1 482 ? 54.120  102.272 62.841  1.00 92.70  ? 548  LEU A CB   1 
ATOM   7004  C CG   . LEU A 1 482 ? 54.567  101.374 63.986  1.00 82.64  ? 548  LEU A CG   1 
ATOM   7005  C CD1  . LEU A 1 482 ? 53.422  100.604 64.550  1.00 90.81  ? 548  LEU A CD1  1 
ATOM   7006  C CD2  . LEU A 1 482 ? 55.572  100.409 63.475  1.00 64.56  ? 548  LEU A CD2  1 
ATOM   7007  H H    . LEU A 1 482 ? 53.923  104.339 61.056  1.00 110.52 ? 548  LEU A H    1 
ATOM   7008  H HA   . LEU A 1 482 ? 53.944  104.108 63.757  1.00 108.19 ? 548  LEU A HA   1 
ATOM   7009  H HB2  . LEU A 1 482 ? 53.175  102.095 62.712  1.00 111.24 ? 548  LEU A HB2  1 
ATOM   7010  H HB3  . LEU A 1 482 ? 54.599  101.966 62.055  1.00 111.24 ? 548  LEU A HB3  1 
ATOM   7011  H HG   . LEU A 1 482 ? 54.968  101.907 64.690  1.00 99.17  ? 548  LEU A HG   1 
ATOM   7012  H HD11 . LEU A 1 482 ? 53.744  100.045 65.274  1.00 108.97 ? 548  LEU A HD11 1 
ATOM   7013  H HD12 . LEU A 1 482 ? 52.756  101.227 64.882  1.00 108.97 ? 548  LEU A HD12 1 
ATOM   7014  H HD13 . LEU A 1 482 ? 53.038  100.052 63.851  1.00 108.97 ? 548  LEU A HD13 1 
ATOM   7015  H HD21 . LEU A 1 482 ? 55.858  99.836  64.204  1.00 77.47  ? 548  LEU A HD21 1 
ATOM   7016  H HD22 . LEU A 1 482 ? 55.169  99.875  62.773  1.00 77.47  ? 548  LEU A HD22 1 
ATOM   7017  H HD23 . LEU A 1 482 ? 56.331  100.901 63.123  1.00 77.47  ? 548  LEU A HD23 1 
ATOM   7018  N N    . THR A 1 483 ? 56.279  104.949 63.758  1.00 78.81  ? 549  THR A N    1 
ATOM   7019  C CA   . THR A 1 483 ? 57.588  105.610 63.624  1.00 75.66  ? 549  THR A CA   1 
ATOM   7020  C C    . THR A 1 483 ? 58.755  104.636 63.482  1.00 82.51  ? 549  THR A C    1 
ATOM   7021  O O    . THR A 1 483 ? 58.594  103.424 63.635  1.00 84.91  ? 549  THR A O    1 
ATOM   7022  C CB   . THR A 1 483 ? 57.911  106.579 64.819  1.00 85.03  ? 549  THR A CB   1 
ATOM   7023  O OG1  . THR A 1 483 ? 58.316  105.838 65.979  1.00 80.95  ? 549  THR A OG1  1 
ATOM   7024  C CG2  . THR A 1 483 ? 56.717  107.465 65.163  1.00 89.00  ? 549  THR A CG2  1 
ATOM   7025  H H    . THR A 1 483 ? 55.883  105.112 64.504  1.00 94.57  ? 549  THR A H    1 
ATOM   7026  H HA   . THR A 1 483 ? 57.569  106.149 62.818  1.00 90.79  ? 549  THR A HA   1 
ATOM   7027  H HB   . THR A 1 483 ? 58.641  107.161 64.555  1.00 102.04 ? 549  THR A HB   1 
ATOM   7028  H HG1  . THR A 1 483 ? 58.486  106.364 66.611  1.00 97.14  ? 549  THR A HG1  1 
ATOM   7029  H HG21 . THR A 1 483 ? 56.942  108.052 65.902  1.00 106.80 ? 549  THR A HG21 1 
ATOM   7030  H HG22 . THR A 1 483 ? 56.472  108.004 64.395  1.00 106.80 ? 549  THR A HG22 1 
ATOM   7031  H HG23 . THR A 1 483 ? 55.959  106.915 65.417  1.00 106.80 ? 549  THR A HG23 1 
ATOM   7032  N N    . ALA A 1 484 ? 59.930  105.194 63.199  1.00 92.93  ? 550  ALA A N    1 
ATOM   7033  C CA   . ALA A 1 484 ? 61.156  104.422 63.016  1.00 82.05  ? 550  ALA A CA   1 
ATOM   7034  C C    . ALA A 1 484 ? 61.460  103.524 64.211  1.00 82.27  ? 550  ALA A C    1 
ATOM   7035  O O    . ALA A 1 484 ? 61.546  102.304 64.071  1.00 81.79  ? 550  ALA A O    1 
ATOM   7036  C CB   . ALA A 1 484 ? 62.306  105.364 62.774  1.00 70.85  ? 550  ALA A CB   1 
ATOM   7037  H H    . ALA A 1 484 ? 60.045  106.041 63.107  1.00 111.52 ? 550  ALA A H    1 
ATOM   7038  H HA   . ALA A 1 484 ? 61.059  103.858 62.233  1.00 98.45  ? 550  ALA A HA   1 
ATOM   7039  H HB1  . ALA A 1 484 ? 63.117  104.846 62.653  1.00 85.02  ? 550  ALA A HB1  1 
ATOM   7040  H HB2  . ALA A 1 484 ? 62.124  105.886 61.977  1.00 85.02  ? 550  ALA A HB2  1 
ATOM   7041  H HB3  . ALA A 1 484 ? 62.399  105.951 63.541  1.00 85.02  ? 550  ALA A HB3  1 
ATOM   7042  N N    . LYS A 1 485 ? 61.620  104.134 65.381  1.00 86.08  ? 551  LYS A N    1 
ATOM   7043  C CA   . LYS A 1 485 ? 62.078  103.414 66.569  1.00 82.08  ? 551  LYS A CA   1 
ATOM   7044  C C    . LYS A 1 485 ? 61.034  102.413 67.061  1.00 88.58  ? 551  LYS A C    1 
ATOM   7045  O O    . LYS A 1 485 ? 61.343  101.531 67.865  1.00 92.01  ? 551  LYS A O    1 
ATOM   7046  C CB   . LYS A 1 485 ? 62.443  104.389 67.695  1.00 76.88  ? 551  LYS A CB   1 
ATOM   7047  C CG   . LYS A 1 485 ? 63.154  105.668 67.224  1.00 100.64 ? 551  LYS A CG   1 
ATOM   7048  C CD   . LYS A 1 485 ? 64.410  105.369 66.397  1.00 113.86 ? 551  LYS A CD   1 
ATOM   7049  C CE   . LYS A 1 485 ? 65.173  106.643 66.043  1.00 107.27 ? 551  LYS A CE   1 
ATOM   7050  N NZ   . LYS A 1 485 ? 65.589  107.412 67.255  1.00 106.45 ? 551  LYS A NZ   1 
ATOM   7051  H H    . LYS A 1 485 ? 61.470  104.971 65.515  1.00 103.30 ? 551  LYS A H    1 
ATOM   7052  H HA   . LYS A 1 485 ? 62.878  102.916 66.340  1.00 98.49  ? 551  LYS A HA   1 
ATOM   7053  H HB2  . LYS A 1 485 ? 61.629  104.656 68.150  1.00 92.25  ? 551  LYS A HB2  1 
ATOM   7054  H HB3  . LYS A 1 485 ? 63.032  103.937 68.318  1.00 92.25  ? 551  LYS A HB3  1 
ATOM   7055  H HG2  . LYS A 1 485 ? 62.546  106.184 66.672  1.00 120.77 ? 551  LYS A HG2  1 
ATOM   7056  H HG3  . LYS A 1 485 ? 63.421  106.186 67.999  1.00 120.77 ? 551  LYS A HG3  1 
ATOM   7057  H HD2  . LYS A 1 485 ? 65.000  104.795 66.909  1.00 136.63 ? 551  LYS A HD2  1 
ATOM   7058  H HD3  . LYS A 1 485 ? 64.151  104.932 65.571  1.00 136.63 ? 551  LYS A HD3  1 
ATOM   7059  H HE2  . LYS A 1 485 ? 65.972  106.406 65.547  1.00 128.73 ? 551  LYS A HE2  1 
ATOM   7060  H HE3  . LYS A 1 485 ? 64.604  107.214 65.504  1.00 128.73 ? 551  LYS A HE3  1 
ATOM   7061  H HZ1  . LYS A 1 485 ? 66.030  108.146 67.013  1.00 127.74 ? 551  LYS A HZ1  1 
ATOM   7062  H HZ2  . LYS A 1 485 ? 64.871  107.647 67.727  1.00 127.74 ? 551  LYS A HZ2  1 
ATOM   7063  H HZ3  . LYS A 1 485 ? 66.119  106.911 67.766  1.00 127.74 ? 551  LYS A HZ3  1 
ATOM   7064  N N    . GLU A 1 486 ? 59.800  102.555 66.583  1.00 74.40  ? 552  GLU A N    1 
ATOM   7065  C CA   . GLU A 1 486 ? 58.759  101.587 66.895  1.00 70.85  ? 552  GLU A CA   1 
ATOM   7066  C C    . GLU A 1 486 ? 58.924  100.333 66.038  1.00 68.19  ? 552  GLU A C    1 
ATOM   7067  O O    . GLU A 1 486 ? 58.773  99.223  66.542  1.00 67.57  ? 552  GLU A O    1 
ATOM   7068  C CB   . GLU A 1 486 ? 57.369  102.209 66.723  1.00 81.86  ? 552  GLU A CB   1 
ATOM   7069  C CG   . GLU A 1 486 ? 56.911  103.034 67.930  1.00 85.56  ? 552  GLU A CG   1 
ATOM   7070  C CD   . GLU A 1 486 ? 56.211  104.323 67.535  1.00 88.42  ? 552  GLU A CD   1 
ATOM   7071  O OE1  . GLU A 1 486 ? 55.220  104.264 66.767  1.00 86.09  ? 552  GLU A OE1  1 
ATOM   7072  O OE2  . GLU A 1 486 ? 56.671  105.397 67.986  1.00 83.48  ? 552  GLU A OE2  1 
ATOM   7073  H H    . GLU A 1 486 ? 59.543  103.202 66.077  1.00 89.28  ? 552  GLU A H    1 
ATOM   7074  H HA   . GLU A 1 486 ? 58.850  101.322 67.823  1.00 85.02  ? 552  GLU A HA   1 
ATOM   7075  H HB2  . GLU A 1 486 ? 57.382  102.795 65.950  1.00 98.24  ? 552  GLU A HB2  1 
ATOM   7076  H HB3  . GLU A 1 486 ? 56.723  101.499 66.586  1.00 98.24  ? 552  GLU A HB3  1 
ATOM   7077  H HG2  . GLU A 1 486 ? 56.291  102.506 68.456  1.00 102.67 ? 552  GLU A HG2  1 
ATOM   7078  H HG3  . GLU A 1 486 ? 57.686  103.266 68.465  1.00 102.67 ? 552  GLU A HG3  1 
ATOM   7079  N N    . LYS A 1 487 ? 59.241  100.511 64.753  1.00 72.41  ? 553  LYS A N    1 
ATOM   7080  C CA   . LYS A 1 487 ? 59.506  99.378  63.852  1.00 67.51  ? 553  LYS A CA   1 
ATOM   7081  C C    . LYS A 1 487 ? 60.703  98.572  64.330  1.00 62.92  ? 553  LYS A C    1 
ATOM   7082  O O    . LYS A 1 487 ? 60.769  97.353  64.151  1.00 60.47  ? 553  LYS A O    1 
ATOM   7083  C CB   . LYS A 1 487 ? 59.791  99.856  62.431  1.00 57.18  ? 553  LYS A CB   1 
ATOM   7084  C CG   . LYS A 1 487 ? 58.586  100.405 61.719  1.00 47.16  ? 553  LYS A CG   1 
ATOM   7085  C CD   . LYS A 1 487 ? 58.897  101.595 60.814  1.00 74.54  ? 553  LYS A CD   1 
ATOM   7086  C CE   . LYS A 1 487 ? 58.659  101.280 59.334  1.00 92.40  ? 553  LYS A CE   1 
ATOM   7087  N NZ   . LYS A 1 487 ? 59.124  102.385 58.435  1.00 87.74  ? 553  LYS A NZ   1 
ATOM   7088  H H    . LYS A 1 487 ? 59.310  101.280 64.374  1.00 86.90  ? 553  LYS A H    1 
ATOM   7089  H HA   . LYS A 1 487 ? 58.732  98.794  63.831  1.00 81.02  ? 553  LYS A HA   1 
ATOM   7090  H HB2  . LYS A 1 487 ? 60.459  100.559 62.466  1.00 68.61  ? 553  LYS A HB2  1 
ATOM   7091  H HB3  . LYS A 1 487 ? 60.127  99.109  61.912  1.00 68.61  ? 553  LYS A HB3  1 
ATOM   7092  H HG2  . LYS A 1 487 ? 58.202  99.705  61.169  1.00 56.59  ? 553  LYS A HG2  1 
ATOM   7093  H HG3  . LYS A 1 487 ? 57.938  100.696 62.380  1.00 56.59  ? 553  LYS A HG3  1 
ATOM   7094  H HD2  . LYS A 1 487 ? 58.325  102.339 61.059  1.00 89.44  ? 553  LYS A HD2  1 
ATOM   7095  H HD3  . LYS A 1 487 ? 59.829  101.841 60.923  1.00 89.44  ? 553  LYS A HD3  1 
ATOM   7096  H HE2  . LYS A 1 487 ? 59.146  100.475 59.099  1.00 110.88 ? 553  LYS A HE2  1 
ATOM   7097  H HE3  . LYS A 1 487 ? 57.709  101.150 59.186  1.00 110.88 ? 553  LYS A HE3  1 
ATOM   7098  H HZ1  . LYS A 1 487 ? 58.971  102.170 57.585  1.00 105.29 ? 553  LYS A HZ1  1 
ATOM   7099  H HZ2  . LYS A 1 487 ? 58.687  103.136 58.626  1.00 105.29 ? 553  LYS A HZ2  1 
ATOM   7100  H HZ3  . LYS A 1 487 ? 59.996  102.521 58.546  1.00 105.29 ? 553  LYS A HZ3  1 
ATOM   7101  N N    . LYS A 1 488 ? 61.662  99.262  64.927  1.00 50.23  ? 554  LYS A N    1 
ATOM   7102  C CA   . LYS A 1 488 ? 62.836  98.579  65.415  1.00 64.84  ? 554  LYS A CA   1 
ATOM   7103  C C    . LYS A 1 488 ? 62.481  97.750  66.646  1.00 65.62  ? 554  LYS A C    1 
ATOM   7104  O O    . LYS A 1 488 ? 62.850  96.576  66.724  1.00 64.49  ? 554  LYS A O    1 
ATOM   7105  C CB   . LYS A 1 488 ? 63.978  99.550  65.720  1.00 67.81  ? 554  LYS A CB   1 
ATOM   7106  C CG   . LYS A 1 488 ? 65.285  98.829  66.042  1.00 69.64  ? 554  LYS A CG   1 
ATOM   7107  C CD   . LYS A 1 488 ? 66.359  99.766  66.552  1.00 85.86  ? 554  LYS A CD   1 
ATOM   7108  C CE   . LYS A 1 488 ? 67.554  98.976  67.079  1.00 106.50 ? 554  LYS A CE   1 
ATOM   7109  N NZ   . LYS A 1 488 ? 68.800  99.802  67.148  1.00 116.12 ? 554  LYS A NZ   1 
ATOM   7110  H H    . LYS A 1 488 ? 61.655  100.112 65.058  1.00 60.27  ? 554  LYS A H    1 
ATOM   7111  H HA   . LYS A 1 488 ? 63.146  97.967  64.729  1.00 77.81  ? 554  LYS A HA   1 
ATOM   7112  H HB2  . LYS A 1 488 ? 64.128  100.116 64.947  1.00 81.37  ? 554  LYS A HB2  1 
ATOM   7113  H HB3  . LYS A 1 488 ? 63.736  100.093 66.488  1.00 81.37  ? 554  LYS A HB3  1 
ATOM   7114  H HG2  . LYS A 1 488 ? 65.119  98.163  66.727  1.00 83.56  ? 554  LYS A HG2  1 
ATOM   7115  H HG3  . LYS A 1 488 ? 65.617  98.403  65.237  1.00 83.56  ? 554  LYS A HG3  1 
ATOM   7116  H HD2  . LYS A 1 488 ? 66.663  100.335 65.827  1.00 103.03 ? 554  LYS A HD2  1 
ATOM   7117  H HD3  . LYS A 1 488 ? 66.002  100.303 67.277  1.00 103.03 ? 554  LYS A HD3  1 
ATOM   7118  H HE2  . LYS A 1 488 ? 67.354  98.657  67.973  1.00 127.80 ? 554  LYS A HE2  1 
ATOM   7119  H HE3  . LYS A 1 488 ? 67.723  98.226  66.488  1.00 127.80 ? 554  LYS A HE3  1 
ATOM   7120  H HZ1  . LYS A 1 488 ? 69.473  99.310  67.458  1.00 139.34 ? 554  LYS A HZ1  1 
ATOM   7121  H HZ2  . LYS A 1 488 ? 69.010  100.102 66.337  1.00 139.34 ? 554  LYS A HZ2  1 
ATOM   7122  H HZ3  . LYS A 1 488 ? 68.674  100.496 67.691  1.00 139.34 ? 554  LYS A HZ3  1 
ATOM   7123  N N    . THR A 1 489 ? 61.769  98.351  67.601  1.00 59.56  ? 555  THR A N    1 
ATOM   7124  C CA   . THR A 1 489 ? 61.392  97.629  68.815  1.00 54.06  ? 555  THR A CA   1 
ATOM   7125  C C    . THR A 1 489 ? 60.484  96.469  68.443  1.00 58.71  ? 555  THR A C    1 
ATOM   7126  O O    . THR A 1 489 ? 60.514  95.416  69.077  1.00 57.69  ? 555  THR A O    1 
ATOM   7127  C CB   . THR A 1 489 ? 60.665  98.512  69.840  1.00 50.31  ? 555  THR A CB   1 
ATOM   7128  O OG1  . THR A 1 489 ? 61.432  99.688  70.106  1.00 55.76  ? 555  THR A OG1  1 
ATOM   7129  C CG2  . THR A 1 489 ? 60.472  97.750  71.141  1.00 52.43  ? 555  THR A CG2  1 
ATOM   7130  H H    . THR A 1 489 ? 61.494  99.166  67.571  1.00 71.48  ? 555  THR A H    1 
ATOM   7131  H HA   . THR A 1 489 ? 62.190  97.270  69.234  1.00 64.88  ? 555  THR A HA   1 
ATOM   7132  H HB   . THR A 1 489 ? 59.793  98.762  69.496  1.00 60.38  ? 555  THR A HB   1 
ATOM   7133  H HG1  . THR A 1 489 ? 61.540  100.126 69.398  1.00 66.91  ? 555  THR A HG1  1 
ATOM   7134  H HG21 . THR A 1 489 ? 60.013  98.309  71.787  1.00 62.92  ? 555  THR A HG21 1 
ATOM   7135  H HG22 . THR A 1 489 ? 59.944  96.952  70.982  1.00 62.92  ? 555  THR A HG22 1 
ATOM   7136  H HG23 . THR A 1 489 ? 61.333  97.491  71.504  1.00 62.92  ? 555  THR A HG23 1 
ATOM   7137  N N    . GLN A 1 490 ? 59.677  96.676  67.410  1.00 53.00  ? 556  GLN A N    1 
ATOM   7138  C CA   . GLN A 1 490 ? 58.822  95.626  66.881  1.00 55.97  ? 556  GLN A CA   1 
ATOM   7139  C C    . GLN A 1 490 ? 59.679  94.451  66.390  1.00 71.48  ? 556  GLN A C    1 
ATOM   7140  O O    . GLN A 1 490 ? 59.528  93.325  66.877  1.00 68.20  ? 556  GLN A O    1 
ATOM   7141  C CB   . GLN A 1 490 ? 57.948  96.181  65.752  1.00 57.23  ? 556  GLN A CB   1 
ATOM   7142  C CG   . GLN A 1 490 ? 56.838  95.250  65.291  1.00 48.75  ? 556  GLN A CG   1 
ATOM   7143  C CD   . GLN A 1 490 ? 56.312  95.620  63.930  1.00 68.95  ? 556  GLN A CD   1 
ATOM   7144  O OE1  . GLN A 1 490 ? 56.825  96.543  63.295  1.00 93.93  ? 556  GLN A OE1  1 
ATOM   7145  N NE2  . GLN A 1 490 ? 55.285  94.902  63.462  1.00 60.19  ? 556  GLN A NE2  1 
ATOM   7146  H H    . GLN A 1 490 ? 59.608  97.425  66.993  1.00 63.60  ? 556  GLN A H    1 
ATOM   7147  H HA   . GLN A 1 490 ? 58.239  95.304  67.586  1.00 67.17  ? 556  GLN A HA   1 
ATOM   7148  H HB2  . GLN A 1 490 ? 57.534  97.004  66.057  1.00 68.68  ? 556  GLN A HB2  1 
ATOM   7149  H HB3  . GLN A 1 490 ? 58.513  96.366  64.985  1.00 68.68  ? 556  GLN A HB3  1 
ATOM   7150  H HG2  . GLN A 1 490 ? 57.181  94.344  65.246  1.00 58.50  ? 556  GLN A HG2  1 
ATOM   7151  H HG3  . GLN A 1 490 ? 56.102  95.297  65.922  1.00 58.50  ? 556  GLN A HG3  1 
ATOM   7152  H HE21 . GLN A 1 490 ? 54.957  94.263  63.934  1.00 72.22  ? 556  GLN A HE21 1 
ATOM   7153  H HE22 . GLN A 1 490 ? 54.954  95.080  62.688  1.00 72.22  ? 556  GLN A HE22 1 
ATOM   7154  N N    . LEU A 1 491 ? 60.588  94.721  65.447  1.00 84.09  ? 557  LEU A N    1 
ATOM   7155  C CA   . LEU A 1 491 ? 61.508  93.695  64.935  1.00 76.12  ? 557  LEU A CA   1 
ATOM   7156  C C    . LEU A 1 491 ? 62.275  93.021  66.062  1.00 62.49  ? 557  LEU A C    1 
ATOM   7157  O O    . LEU A 1 491 ? 62.342  91.794  66.118  1.00 53.33  ? 557  LEU A O    1 
ATOM   7158  C CB   . LEU A 1 491 ? 62.510  94.283  63.942  1.00 68.50  ? 557  LEU A CB   1 
ATOM   7159  C CG   . LEU A 1 491 ? 62.535  93.585  62.581  1.00 78.55  ? 557  LEU A CG   1 
ATOM   7160  C CD1  . LEU A 1 491 ? 61.188  93.774  61.854  1.00 87.78  ? 557  LEU A CD1  1 
ATOM   7161  C CD2  . LEU A 1 491 ? 63.700  94.086  61.721  1.00 64.80  ? 557  LEU A CD2  1 
ATOM   7162  H H    . LEU A 1 491 ? 60.693  95.494  65.085  1.00 100.91 ? 557  LEU A H    1 
ATOM   7163  H HA   . LEU A 1 491 ? 60.994  93.013  64.473  1.00 91.35  ? 557  LEU A HA   1 
ATOM   7164  H HB2  . LEU A 1 491 ? 62.287  95.215  63.790  1.00 82.20  ? 557  LEU A HB2  1 
ATOM   7165  H HB3  . LEU A 1 491 ? 63.400  94.217  64.322  1.00 82.20  ? 557  LEU A HB3  1 
ATOM   7166  H HG   . LEU A 1 491 ? 62.662  92.634  62.722  1.00 94.27  ? 557  LEU A HG   1 
ATOM   7167  H HD11 . LEU A 1 491 ? 61.227  93.324  60.996  1.00 105.33 ? 557  LEU A HD11 1 
ATOM   7168  H HD12 . LEU A 1 491 ? 60.481  93.392  62.397  1.00 105.33 ? 557  LEU A HD12 1 
ATOM   7169  H HD13 . LEU A 1 491 ? 61.031  94.723  61.725  1.00 105.33 ? 557  LEU A HD13 1 
ATOM   7170  H HD21 . LEU A 1 491 ? 63.685  93.624  60.869  1.00 77.76  ? 557  LEU A HD21 1 
ATOM   7171  H HD22 . LEU A 1 491 ? 63.602  95.041  61.582  1.00 77.76  ? 557  LEU A HD22 1 
ATOM   7172  H HD23 . LEU A 1 491 ? 64.534  93.903  62.183  1.00 77.76  ? 557  LEU A HD23 1 
ATOM   7173  N N    . ASP A 1 492 ? 62.850  93.828  66.951  1.00 44.87  ? 558  ASP A N    1 
ATOM   7174  C CA   . ASP A 1 492 ? 63.515  93.317  68.148  1.00 62.12  ? 558  ASP A CA   1 
ATOM   7175  C C    . ASP A 1 492 ? 62.592  92.426  68.963  1.00 54.95  ? 558  ASP A C    1 
ATOM   7176  O O    . ASP A 1 492 ? 63.002  91.373  69.456  1.00 61.71  ? 558  ASP A O    1 
ATOM   7177  C CB   . ASP A 1 492 ? 63.972  94.473  69.041  1.00 78.97  ? 558  ASP A CB   1 
ATOM   7178  C CG   . ASP A 1 492 ? 65.277  95.099  68.579  1.00 77.36  ? 558  ASP A CG   1 
ATOM   7179  O OD1  . ASP A 1 492 ? 66.214  94.343  68.229  1.00 91.26  ? 558  ASP A OD1  1 
ATOM   7180  O OD2  . ASP A 1 492 ? 65.361  96.349  68.574  1.00 65.56  ? 558  ASP A OD2  1 
ATOM   7181  H H    . ASP A 1 492 ? 62.869  94.685  66.883  1.00 53.85  ? 558  ASP A H    1 
ATOM   7182  H HA   . ASP A 1 492 ? 64.294  92.800  67.891  1.00 74.54  ? 558  ASP A HA   1 
ATOM   7183  H HB2  . ASP A 1 492 ? 63.291  95.164  69.037  1.00 94.76  ? 558  ASP A HB2  1 
ATOM   7184  H HB3  . ASP A 1 492 ? 64.102  94.142  69.944  1.00 94.76  ? 558  ASP A HB3  1 
ATOM   7185  N N    . ASP A 1 493 ? 61.345  92.861  69.107  1.00 48.98  ? 559  ASP A N    1 
ATOM   7186  C CA   . ASP A 1 493 ? 60.372  92.128  69.904  1.00 54.37  ? 559  ASP A CA   1 
ATOM   7187  C C    . ASP A 1 493 ? 59.958  90.787  69.288  1.00 61.39  ? 559  ASP A C    1 
ATOM   7188  O O    . ASP A 1 493 ? 59.815  89.801  70.018  1.00 57.63  ? 559  ASP A O    1 
ATOM   7189  C CB   . ASP A 1 493 ? 59.140  92.989  70.168  1.00 56.15  ? 559  ASP A CB   1 
ATOM   7190  C CG   . ASP A 1 493 ? 59.305  93.900  71.376  1.00 72.91  ? 559  ASP A CG   1 
ATOM   7191  O OD1  . ASP A 1 493 ? 60.380  93.866  72.018  1.00 67.95  ? 559  ASP A OD1  1 
ATOM   7192  O OD2  . ASP A 1 493 ? 58.357  94.671  71.671  1.00 85.60  ? 559  ASP A OD2  1 
ATOM   7193  H H    . ASP A 1 493 ? 61.036  93.580  68.751  1.00 58.78  ? 559  ASP A H    1 
ATOM   7194  H HA   . ASP A 1 493 ? 60.774  91.934  70.765  1.00 65.24  ? 559  ASP A HA   1 
ATOM   7195  H HB2  . ASP A 1 493 ? 58.972  93.547  69.392  1.00 67.37  ? 559  ASP A HB2  1 
ATOM   7196  H HB3  . ASP A 1 493 ? 58.378  92.410  70.330  1.00 67.37  ? 559  ASP A HB3  1 
ATOM   7197  N N    . ARG A 1 494 ? 59.771  90.729  67.967  1.00 59.80  ? 560  ARG A N    1 
ATOM   7198  C CA   . ARG A 1 494 ? 59.410  89.462  67.323  1.00 60.21  ? 560  ARG A CA   1 
ATOM   7199  C C    . ARG A 1 494 ? 60.515  88.432  67.469  1.00 62.36  ? 560  ARG A C    1 
ATOM   7200  O O    . ARG A 1 494 ? 60.243  87.262  67.736  1.00 61.07  ? 560  ARG A O    1 
ATOM   7201  C CB   . ARG A 1 494 ? 59.157  89.637  65.836  1.00 57.48  ? 560  ARG A CB   1 
ATOM   7202  C CG   . ARG A 1 494 ? 58.258  90.778  65.478  1.00 76.56  ? 560  ARG A CG   1 
ATOM   7203  C CD   . ARG A 1 494 ? 57.844  90.647  64.034  1.00 91.34  ? 560  ARG A CD   1 
ATOM   7204  N NE   . ARG A 1 494 ? 56.842  89.593  63.870  1.00 85.34  ? 560  ARG A NE   1 
ATOM   7205  C CZ   . ARG A 1 494 ? 55.589  89.782  63.466  1.00 75.03  ? 560  ARG A CZ   1 
ATOM   7206  N NH1  . ARG A 1 494 ? 55.136  90.992  63.153  1.00 66.90  ? 560  ARG A NH1  1 
ATOM   7207  N NH2  . ARG A 1 494 ? 54.781  88.739  63.363  1.00 86.68  ? 560  ARG A NH2  1 
ATOM   7208  H H    . ARG A 1 494 ? 59.844  91.397  67.430  1.00 71.77  ? 560  ARG A H    1 
ATOM   7209  H HA   . ARG A 1 494 ? 58.605  89.110  67.732  1.00 72.25  ? 560  ARG A HA   1 
ATOM   7210  H HB2  . ARG A 1 494 ? 60.007  89.785  65.393  1.00 68.98  ? 560  ARG A HB2  1 
ATOM   7211  H HB3  . ARG A 1 494 ? 58.750  88.826  65.495  1.00 68.98  ? 560  ARG A HB3  1 
ATOM   7212  H HG2  . ARG A 1 494 ? 57.463  90.755  66.033  1.00 91.88  ? 560  ARG A HG2  1 
ATOM   7213  H HG3  . ARG A 1 494 ? 58.732  91.617  65.591  1.00 91.88  ? 560  ARG A HG3  1 
ATOM   7214  H HD2  . ARG A 1 494 ? 57.458  91.485  63.732  1.00 109.61 ? 560  ARG A HD2  1 
ATOM   7215  H HD3  . ARG A 1 494 ? 58.618  90.419  63.496  1.00 109.61 ? 560  ARG A HD3  1 
ATOM   7216  H HE   . ARG A 1 494 ? 57.083  88.787  64.049  1.00 102.41 ? 560  ARG A HE   1 
ATOM   7217  H HH11 . ARG A 1 494 ? 55.654  91.676  63.218  1.00 80.28  ? 560  ARG A HH11 1 
ATOM   7218  H HH12 . ARG A 1 494 ? 54.323  91.093  62.892  1.00 80.28  ? 560  ARG A HH12 1 
ATOM   7219  H HH21 . ARG A 1 494 ? 55.067  87.952  63.560  1.00 104.02 ? 560  ARG A HH21 1 
ATOM   7220  H HH22 . ARG A 1 494 ? 53.970  88.847  63.099  1.00 104.02 ? 560  ARG A HH22 1 
ATOM   7221  N N    . THR A 1 495 ? 61.758  88.871  67.268  1.00 67.26  ? 561  THR A N    1 
ATOM   7222  C CA   . THR A 1 495 ? 62.910  87.967  67.294  1.00 66.33  ? 561  THR A CA   1 
ATOM   7223  C C    . THR A 1 495 ? 63.139  87.369  68.677  1.00 64.23  ? 561  THR A C    1 
ATOM   7224  O O    . THR A 1 495 ? 63.287  86.154  68.806  1.00 57.55  ? 561  THR A O    1 
ATOM   7225  C CB   . THR A 1 495 ? 64.187  88.668  66.829  1.00 53.96  ? 561  THR A CB   1 
ATOM   7226  O OG1  . THR A 1 495 ? 63.994  89.174  65.507  1.00 67.83  ? 561  THR A OG1  1 
ATOM   7227  C CG2  . THR A 1 495 ? 65.351  87.699  66.805  1.00 51.39  ? 561  THR A CG2  1 
ATOM   7228  H H    . THR A 1 495 ? 61.963  89.692  67.115  1.00 80.71  ? 561  THR A H    1 
ATOM   7229  H HA   . THR A 1 495 ? 62.739  87.233  66.682  1.00 79.59  ? 561  THR A HA   1 
ATOM   7230  H HB   . THR A 1 495 ? 64.400  89.397  67.432  1.00 64.76  ? 561  THR A HB   1 
ATOM   7231  H HG1  . THR A 1 495 ? 63.358  89.723  65.500  1.00 81.40  ? 561  THR A HG1  1 
ATOM   7232  H HG21 . THR A 1 495 ? 66.155  88.153  66.510  1.00 61.67  ? 561  THR A HG21 1 
ATOM   7233  H HG22 . THR A 1 495 ? 65.501  87.339  67.694  1.00 61.67  ? 561  THR A HG22 1 
ATOM   7234  H HG23 . THR A 1 495 ? 65.161  86.967  66.198  1.00 61.67  ? 561  THR A HG23 1 
ATOM   7235  N N    . LYS A 1 496 ? 63.174  88.221  69.699  1.00 49.23  ? 562  LYS A N    1 
ATOM   7236  C CA   . LYS A 1 496 ? 63.210  87.764  71.083  1.00 46.54  ? 562  LYS A CA   1 
ATOM   7237  C C    . LYS A 1 496 ? 62.114  86.721  71.306  1.00 51.28  ? 562  LYS A C    1 
ATOM   7238  O O    . LYS A 1 496 ? 62.351  85.649  71.859  1.00 49.57  ? 562  LYS A O    1 
ATOM   7239  C CB   . LYS A 1 496 ? 63.029  88.970  72.017  1.00 48.35  ? 562  LYS A CB   1 
ATOM   7240  C CG   . LYS A 1 496 ? 63.242  88.686  73.511  1.00 64.07  ? 562  LYS A CG   1 
ATOM   7241  C CD   . LYS A 1 496 ? 63.580  89.967  74.281  1.00 78.35  ? 562  LYS A CD   1 
ATOM   7242  C CE   . LYS A 1 496 ? 62.767  90.122  75.571  1.00 80.46  ? 562  LYS A CE   1 
ATOM   7243  N NZ   . LYS A 1 496 ? 62.896  88.967  76.523  1.00 65.92  ? 562  LYS A NZ   1 
ATOM   7244  H H    . LYS A 1 496 ? 63.177  89.077  69.615  1.00 59.08  ? 562  LYS A H    1 
ATOM   7245  H HA   . LYS A 1 496 ? 64.070  87.355  71.269  1.00 55.85  ? 562  LYS A HA   1 
ATOM   7246  H HB2  . LYS A 1 496 ? 63.662  89.657  71.758  1.00 58.02  ? 562  LYS A HB2  1 
ATOM   7247  H HB3  . LYS A 1 496 ? 62.125  89.307  71.912  1.00 58.02  ? 562  LYS A HB3  1 
ATOM   7248  H HG2  . LYS A 1 496 ? 62.429  88.311  73.885  1.00 76.88  ? 562  LYS A HG2  1 
ATOM   7249  H HG3  . LYS A 1 496 ? 63.979  88.064  73.617  1.00 76.88  ? 562  LYS A HG3  1 
ATOM   7250  H HD2  . LYS A 1 496 ? 64.520  89.953  74.519  1.00 94.03  ? 562  LYS A HD2  1 
ATOM   7251  H HD3  . LYS A 1 496 ? 63.393  90.733  73.715  1.00 94.03  ? 562  LYS A HD3  1 
ATOM   7252  H HE2  . LYS A 1 496 ? 63.067  90.920  76.033  1.00 96.56  ? 562  LYS A HE2  1 
ATOM   7253  H HE3  . LYS A 1 496 ? 61.830  90.210  75.339  1.00 96.56  ? 562  LYS A HE3  1 
ATOM   7254  H HZ1  . LYS A 1 496 ? 62.404  89.116  77.249  1.00 79.10  ? 562  LYS A HZ1  1 
ATOM   7255  H HZ2  . LYS A 1 496 ? 62.616  88.218  76.132  1.00 79.10  ? 562  LYS A HZ2  1 
ATOM   7256  H HZ3  . LYS A 1 496 ? 63.747  88.867  76.766  1.00 79.10  ? 562  LYS A HZ3  1 
ATOM   7257  N N    . ILE A 1 497 ? 60.917  87.041  70.829  1.00 56.42  ? 563  ILE A N    1 
ATOM   7258  C CA   . ILE A 1 497 ? 59.761  86.156  70.941  1.00 62.50  ? 563  ILE A CA   1 
ATOM   7259  C C    . ILE A 1 497 ? 59.968  84.846  70.207  1.00 55.36  ? 563  ILE A C    1 
ATOM   7260  O O    . ILE A 1 497 ? 59.814  83.773  70.790  1.00 49.59  ? 563  ILE A O    1 
ATOM   7261  C CB   . ILE A 1 497 ? 58.478  86.836  70.386  1.00 51.66  ? 563  ILE A CB   1 
ATOM   7262  C CG1  . ILE A 1 497 ? 57.888  87.762  71.445  1.00 53.75  ? 563  ILE A CG1  1 
ATOM   7263  C CG2  . ILE A 1 497 ? 57.427  85.797  69.957  1.00 50.64  ? 563  ILE A CG2  1 
ATOM   7264  C CD1  . ILE A 1 497 ? 56.737  88.603  70.953  1.00 66.55  ? 563  ILE A CD1  1 
ATOM   7265  H H    . ILE A 1 497 ? 60.744  87.781  70.427  1.00 67.71  ? 563  ILE A H    1 
ATOM   7266  H HA   . ILE A 1 497 ? 59.611  85.953  71.878  1.00 75.01  ? 563  ILE A HA   1 
ATOM   7267  H HB   . ILE A 1 497 ? 58.721  87.368  69.612  1.00 61.99  ? 563  ILE A HB   1 
ATOM   7268  H HG12 . ILE A 1 497 ? 57.565  87.224  72.185  1.00 64.51  ? 563  ILE A HG12 1 
ATOM   7269  H HG13 . ILE A 1 497 ? 58.582  88.364  71.756  1.00 64.51  ? 563  ILE A HG13 1 
ATOM   7270  H HG21 . ILE A 1 497 ? 56.645  86.260  69.618  1.00 60.77  ? 563  ILE A HG21 1 
ATOM   7271  H HG22 . ILE A 1 497 ? 57.805  85.234  69.263  1.00 60.77  ? 563  ILE A HG22 1 
ATOM   7272  H HG23 . ILE A 1 497 ? 57.185  85.257  70.726  1.00 60.77  ? 563  ILE A HG23 1 
ATOM   7273  H HD11 . ILE A 1 497 ? 56.420  89.160  71.681  1.00 79.86  ? 563  ILE A HD11 1 
ATOM   7274  H HD12 . ILE A 1 497 ? 57.044  89.159  70.220  1.00 79.86  ? 563  ILE A HD12 1 
ATOM   7275  H HD13 . ILE A 1 497 ? 56.026  88.017  70.650  1.00 79.86  ? 563  ILE A HD13 1 
ATOM   7276  N N    . THR A 1 498 ? 60.278  84.949  68.917  1.00 58.30  ? 564  THR A N    1 
ATOM   7277  C CA   . THR A 1 498 ? 60.393  83.782  68.049  1.00 58.76  ? 564  THR A CA   1 
ATOM   7278  C C    . THR A 1 498 ? 61.448  82.804  68.551  1.00 66.73  ? 564  THR A C    1 
ATOM   7279  O O    . THR A 1 498 ? 61.226  81.586  68.606  1.00 47.19  ? 564  THR A O    1 
ATOM   7280  C CB   . THR A 1 498 ? 60.807  84.181  66.640  1.00 59.73  ? 564  THR A CB   1 
ATOM   7281  O OG1  . THR A 1 498 ? 59.988  85.256  66.170  1.00 54.34  ? 564  THR A OG1  1 
ATOM   7282  C CG2  . THR A 1 498 ? 60.678  82.996  65.717  1.00 48.30  ? 564  THR A CG2  1 
ATOM   7283  H H    . THR A 1 498 ? 60.427  85.695  68.516  1.00 69.96  ? 564  THR A H    1 
ATOM   7284  H HA   . THR A 1 498 ? 59.540  83.323  68.004  1.00 70.51  ? 564  THR A HA   1 
ATOM   7285  H HB   . THR A 1 498 ? 61.735  84.463  66.645  1.00 71.68  ? 564  THR A HB   1 
ATOM   7286  H HG1  . THR A 1 498 ? 60.070  85.922  66.675  1.00 65.21  ? 564  THR A HG1  1 
ATOM   7287  H HG21 . THR A 1 498 ? 60.942  83.246  64.818  1.00 57.96  ? 564  THR A HG21 1 
ATOM   7288  H HG22 . THR A 1 498 ? 61.249  82.274  66.023  1.00 57.96  ? 564  THR A HG22 1 
ATOM   7289  H HG23 . THR A 1 498 ? 59.759  82.686  65.702  1.00 57.96  ? 564  THR A HG23 1 
ATOM   7290  N N    . GLU A 1 499 ? 62.607  83.361  68.893  1.00 68.19  ? 565  GLU A N    1 
ATOM   7291  C CA   . GLU A 1 499 ? 63.708  82.603  69.446  1.00 55.08  ? 565  GLU A CA   1 
ATOM   7292  C C    . GLU A 1 499 ? 63.332  81.974  70.766  1.00 62.61  ? 565  GLU A C    1 
ATOM   7293  O O    . GLU A 1 499 ? 63.547  80.782  70.963  1.00 65.95  ? 565  GLU A O    1 
ATOM   7294  C CB   . GLU A 1 499 ? 64.893  83.515  69.669  1.00 54.54  ? 565  GLU A CB   1 
ATOM   7295  C CG   . GLU A 1 499 ? 65.512  84.019  68.393  1.00 59.01  ? 565  GLU A CG   1 
ATOM   7296  C CD   . GLU A 1 499 ? 66.661  84.954  68.663  1.00 75.97  ? 565  GLU A CD   1 
ATOM   7297  O OE1  . GLU A 1 499 ? 66.784  85.428  69.823  1.00 59.94  ? 565  GLU A OE1  1 
ATOM   7298  O OE2  . GLU A 1 499 ? 67.445  85.203  67.718  1.00 94.03  ? 565  GLU A OE2  1 
ATOM   7299  H H    . GLU A 1 499 ? 62.777  84.200  68.809  1.00 81.83  ? 565  GLU A H    1 
ATOM   7300  H HA   . GLU A 1 499 ? 63.966  81.901  68.828  1.00 66.10  ? 565  GLU A HA   1 
ATOM   7301  H HB2  . GLU A 1 499 ? 64.604  84.285  70.184  1.00 65.45  ? 565  GLU A HB2  1 
ATOM   7302  H HB3  . GLU A 1 499 ? 65.575  83.029  70.158  1.00 65.45  ? 565  GLU A HB3  1 
ATOM   7303  H HG2  . GLU A 1 499 ? 65.848  83.267  67.881  1.00 70.81  ? 565  GLU A HG2  1 
ATOM   7304  H HG3  . GLU A 1 499 ? 64.843  84.501  67.881  1.00 70.81  ? 565  GLU A HG3  1 
ATOM   7305  N N    . LEU A 1 500 ? 62.781  82.772  71.675  1.00 60.80  ? 566  LEU A N    1 
ATOM   7306  C CA   . LEU A 1 500 ? 62.402  82.234  72.973  1.00 58.32  ? 566  LEU A CA   1 
ATOM   7307  C C    . LEU A 1 500 ? 61.367  81.129  72.823  1.00 67.44  ? 566  LEU A C    1 
ATOM   7308  O O    . LEU A 1 500 ? 61.500  80.067  73.424  1.00 63.95  ? 566  LEU A O    1 
ATOM   7309  C CB   . LEU A 1 500 ? 61.851  83.304  73.906  1.00 46.75  ? 566  LEU A CB   1 
ATOM   7310  C CG   . LEU A 1 500 ? 61.265  82.703  75.192  1.00 61.78  ? 566  LEU A CG   1 
ATOM   7311  C CD1  . LEU A 1 500 ? 62.258  81.790  75.916  1.00 70.10  ? 566  LEU A CD1  1 
ATOM   7312  C CD2  . LEU A 1 500 ? 60.812  83.794  76.134  1.00 67.58  ? 566  LEU A CD2  1 
ATOM   7313  H H    . LEU A 1 500 ? 62.619  83.610  71.569  1.00 72.96  ? 566  LEU A H    1 
ATOM   7314  H HA   . LEU A 1 500 ? 63.187  81.850  73.394  1.00 69.98  ? 566  LEU A HA   1 
ATOM   7315  H HB2  . LEU A 1 500 ? 62.567  83.909  74.155  1.00 56.10  ? 566  LEU A HB2  1 
ATOM   7316  H HB3  . LEU A 1 500 ? 61.146  83.791  73.451  1.00 56.10  ? 566  LEU A HB3  1 
ATOM   7317  H HG   . LEU A 1 500 ? 60.488  82.170  74.961  1.00 74.14  ? 566  LEU A HG   1 
ATOM   7318  H HD11 . LEU A 1 500 ? 61.837  81.440  76.717  1.00 84.12  ? 566  LEU A HD11 1 
ATOM   7319  H HD12 . LEU A 1 500 ? 62.504  81.061  75.326  1.00 84.12  ? 566  LEU A HD12 1 
ATOM   7320  H HD13 . LEU A 1 500 ? 63.044  82.305  76.154  1.00 84.12  ? 566  LEU A HD13 1 
ATOM   7321  H HD21 . LEU A 1 500 ? 60.447  83.387  76.936  1.00 81.10  ? 566  LEU A HD21 1 
ATOM   7322  H HD22 . LEU A 1 500 ? 61.573  84.350  76.362  1.00 81.10  ? 566  LEU A HD22 1 
ATOM   7323  H HD23 . LEU A 1 500 ? 60.132  84.328  75.695  1.00 81.10  ? 566  LEU A HD23 1 
ATOM   7324  N N    . PHE A 1 501 ? 60.345  81.376  72.005  1.00 79.52  ? 567  PHE A N    1 
ATOM   7325  C CA   . PHE A 1 501 ? 59.166  80.507  71.978  1.00 70.13  ? 567  PHE A CA   1 
ATOM   7326  C C    . PHE A 1 501 ? 59.209  79.400  70.935  1.00 64.42  ? 567  PHE A C    1 
ATOM   7327  O O    . PHE A 1 501 ? 58.368  78.502  70.969  1.00 60.43  ? 567  PHE A O    1 
ATOM   7328  C CB   . PHE A 1 501 ? 57.876  81.335  71.859  1.00 54.93  ? 567  PHE A CB   1 
ATOM   7329  C CG   . PHE A 1 501 ? 57.509  82.029  73.135  1.00 54.75  ? 567  PHE A CG   1 
ATOM   7330  C CD1  . PHE A 1 501 ? 56.953  81.317  74.188  1.00 52.32  ? 567  PHE A CD1  1 
ATOM   7331  C CD2  . PHE A 1 501 ? 57.750  83.383  73.297  1.00 52.03  ? 567  PHE A CD2  1 
ATOM   7332  C CE1  . PHE A 1 501 ? 56.640  81.945  75.375  1.00 58.00  ? 567  PHE A CE1  1 
ATOM   7333  C CE2  . PHE A 1 501 ? 57.437  84.024  74.483  1.00 43.92  ? 567  PHE A CE2  1 
ATOM   7334  C CZ   . PHE A 1 501 ? 56.884  83.308  75.522  1.00 51.06  ? 567  PHE A CZ   1 
ATOM   7335  H H    . PHE A 1 501 ? 60.308  82.038  71.457  1.00 95.43  ? 567  PHE A H    1 
ATOM   7336  H HA   . PHE A 1 501 ? 59.122  80.062  72.839  1.00 84.16  ? 567  PHE A HA   1 
ATOM   7337  H HB2  . PHE A 1 501 ? 57.998  82.011  71.174  1.00 65.92  ? 567  PHE A HB2  1 
ATOM   7338  H HB3  . PHE A 1 501 ? 57.145  80.746  71.617  1.00 65.92  ? 567  PHE A HB3  1 
ATOM   7339  H HD1  . PHE A 1 501 ? 56.795  80.405  74.094  1.00 62.79  ? 567  PHE A HD1  1 
ATOM   7340  H HD2  . PHE A 1 501 ? 58.129  83.868  72.600  1.00 62.43  ? 567  PHE A HD2  1 
ATOM   7341  H HE1  . PHE A 1 501 ? 56.262  81.461  76.074  1.00 69.59  ? 567  PHE A HE1  1 
ATOM   7342  H HE2  . PHE A 1 501 ? 57.599  84.934  74.578  1.00 52.71  ? 567  PHE A HE2  1 
ATOM   7343  H HZ   . PHE A 1 501 ? 56.666  83.737  76.318  1.00 61.27  ? 567  PHE A HZ   1 
ATOM   7344  N N    . ALA A 1 502 ? 60.175  79.458  70.019  1.00 69.37  ? 568  ALA A N    1 
ATOM   7345  C CA   . ALA A 1 502 ? 60.475  78.297  69.185  1.00 73.32  ? 568  ALA A CA   1 
ATOM   7346  C C    . ALA A 1 502 ? 60.870  77.115  70.086  1.00 68.43  ? 568  ALA A C    1 
ATOM   7347  O O    . ALA A 1 502 ? 60.518  75.969  69.816  1.00 65.34  ? 568  ALA A O    1 
ATOM   7348  C CB   . ALA A 1 502 ? 61.585  78.614  68.200  1.00 65.30  ? 568  ALA A CB   1 
ATOM   7349  H H    . ALA A 1 502 ? 60.664  80.148  69.863  1.00 83.24  ? 568  ALA A H    1 
ATOM   7350  H HA   . ALA A 1 502 ? 59.683  78.048  68.683  1.00 87.98  ? 568  ALA A HA   1 
ATOM   7351  H HB1  . ALA A 1 502 ? 61.763  77.827  67.662  1.00 78.35  ? 568  ALA A HB1  1 
ATOM   7352  H HB2  . ALA A 1 502 ? 61.303  79.347  67.632  1.00 78.35  ? 568  ALA A HB2  1 
ATOM   7353  H HB3  . ALA A 1 502 ? 62.382  78.864  68.694  1.00 78.35  ? 568  ALA A HB3  1 
ATOM   7354  N N    . VAL A 1 503 ? 61.577  77.405  71.172  1.00 57.45  ? 569  VAL A N    1 
ATOM   7355  C CA   . VAL A 1 503 ? 62.047  76.357  72.072  1.00 61.75  ? 569  VAL A CA   1 
ATOM   7356  C C    . VAL A 1 503 ? 61.059  76.085  73.206  1.00 55.32  ? 569  VAL A C    1 
ATOM   7357  O O    . VAL A 1 503 ? 60.837  74.932  73.581  1.00 52.87  ? 569  VAL A O    1 
ATOM   7358  C CB   . VAL A 1 503 ? 63.445  76.697  72.671  1.00 55.66  ? 569  VAL A CB   1 
ATOM   7359  C CG1  . VAL A 1 503 ? 63.960  75.556  73.524  1.00 49.44  ? 569  VAL A CG1  1 
ATOM   7360  C CG2  . VAL A 1 503 ? 64.444  77.000  71.570  1.00 56.69  ? 569  VAL A CG2  1 
ATOM   7361  H H    . VAL A 1 503 ? 61.799  78.201  71.411  1.00 68.94  ? 569  VAL A H    1 
ATOM   7362  H HA   . VAL A 1 503 ? 62.141  75.536  71.563  1.00 74.10  ? 569  VAL A HA   1 
ATOM   7363  H HB   . VAL A 1 503 ? 63.367  77.484  73.233  1.00 66.79  ? 569  VAL A HB   1 
ATOM   7364  H HG11 . VAL A 1 503 ? 64.829  75.797  73.882  1.00 59.33  ? 569  VAL A HG11 1 
ATOM   7365  H HG12 . VAL A 1 503 ? 63.336  75.397  74.250  1.00 59.33  ? 569  VAL A HG12 1 
ATOM   7366  H HG13 . VAL A 1 503 ? 64.038  74.761  72.974  1.00 59.33  ? 569  VAL A HG13 1 
ATOM   7367  H HG21 . VAL A 1 503 ? 65.303  77.208  71.971  1.00 68.02  ? 569  VAL A HG21 1 
ATOM   7368  H HG22 . VAL A 1 503 ? 64.527  76.223  70.996  1.00 68.02  ? 569  VAL A HG22 1 
ATOM   7369  H HG23 . VAL A 1 503 ? 64.127  77.759  71.056  1.00 68.02  ? 569  VAL A HG23 1 
ATOM   7370  N N    . ALA A 1 504 ? 60.459  77.133  73.757  1.00 63.48  ? 570  ALA A N    1 
ATOM   7371  C CA   . ALA A 1 504 ? 59.623  76.963  74.950  1.00 52.64  ? 570  ALA A CA   1 
ATOM   7372  C C    . ALA A 1 504 ? 58.240  76.422  74.610  1.00 48.71  ? 570  ALA A C    1 
ATOM   7373  O O    . ALA A 1 504 ? 57.647  75.679  75.401  1.00 47.91  ? 570  ALA A O    1 
ATOM   7374  C CB   . ALA A 1 504 ? 59.499  78.270  75.718  1.00 45.26  ? 570  ALA A CB   1 
ATOM   7375  H H    . ALA A 1 504 ? 60.515  77.942  73.469  1.00 76.17  ? 570  ALA A H    1 
ATOM   7376  H HA   . ALA A 1 504 ? 60.052  76.320  75.537  1.00 63.17  ? 570  ALA A HA   1 
ATOM   7377  H HB1  . ALA A 1 504 ? 58.942  78.125  76.499  1.00 54.32  ? 570  ALA A HB1  1 
ATOM   7378  H HB2  . ALA A 1 504 ? 60.383  78.561  75.991  1.00 54.32  ? 570  ALA A HB2  1 
ATOM   7379  H HB3  . ALA A 1 504 ? 59.094  78.937  75.141  1.00 54.32  ? 570  ALA A HB3  1 
ATOM   7380  N N    . LEU A 1 505 ? 57.731  76.779  73.430  1.00 45.40  ? 571  LEU A N    1 
ATOM   7381  C CA   . LEU A 1 505 ? 56.351  76.436  73.087  1.00 58.60  ? 571  LEU A CA   1 
ATOM   7382  C C    . LEU A 1 505 ? 56.040  74.934  73.079  1.00 61.54  ? 571  LEU A C    1 
ATOM   7383  O O    . LEU A 1 505 ? 54.970  74.535  73.573  1.00 49.49  ? 571  LEU A O    1 
ATOM   7384  C CB   . LEU A 1 505 ? 55.919  77.063  71.760  1.00 44.18  ? 571  LEU A CB   1 
ATOM   7385  C CG   . LEU A 1 505 ? 54.493  76.682  71.347  1.00 48.83  ? 571  LEU A CG   1 
ATOM   7386  C CD1  . LEU A 1 505 ? 53.473  77.031  72.433  1.00 37.14  ? 571  LEU A CD1  1 
ATOM   7387  C CD2  . LEU A 1 505 ? 54.143  77.368  70.041  1.00 58.10  ? 571  LEU A CD2  1 
ATOM   7388  H H    . LEU A 1 505 ? 58.156  77.212  72.821  1.00 54.48  ? 571  LEU A H    1 
ATOM   7389  H HA   . LEU A 1 505 ? 55.782  76.826  73.769  1.00 70.32  ? 571  LEU A HA   1 
ATOM   7390  H HB2  . LEU A 1 505 ? 55.958  78.029  71.841  1.00 53.02  ? 571  LEU A HB2  1 
ATOM   7391  H HB3  . LEU A 1 505 ? 56.522  76.766  71.060  1.00 53.02  ? 571  LEU A HB3  1 
ATOM   7392  H HG   . LEU A 1 505 ? 54.454  75.724  71.200  1.00 58.60  ? 571  LEU A HG   1 
ATOM   7393  H HD11 . LEU A 1 505 ? 52.589  76.773  72.130  1.00 44.57  ? 571  LEU A HD11 1 
ATOM   7394  H HD12 . LEU A 1 505 ? 53.699  76.549  73.244  1.00 44.57  ? 571  LEU A HD12 1 
ATOM   7395  H HD13 . LEU A 1 505 ? 53.502  77.986  72.597  1.00 44.57  ? 571  LEU A HD13 1 
ATOM   7396  H HD21 . LEU A 1 505 ? 53.240  77.121  69.787  1.00 69.72  ? 571  LEU A HD21 1 
ATOM   7397  H HD22 . LEU A 1 505 ? 54.202  78.328  70.164  1.00 69.72  ? 571  LEU A HD22 1 
ATOM   7398  H HD23 . LEU A 1 505 ? 54.769  77.082  69.358  1.00 69.72  ? 571  LEU A HD23 1 
ATOM   7399  N N    . PRO A 1 506 ? 56.939  74.104  72.495  1.00 57.94  ? 572  PRO A N    1 
ATOM   7400  C CA   . PRO A 1 506 ? 56.688  72.659  72.553  1.00 55.57  ? 572  PRO A CA   1 
ATOM   7401  C C    . PRO A 1 506 ? 56.661  72.115  73.975  1.00 50.61  ? 572  PRO A C    1 
ATOM   7402  O O    . PRO A 1 506 ? 55.807  71.272  74.274  1.00 43.55  ? 572  PRO A O    1 
ATOM   7403  C CB   . PRO A 1 506 ? 57.847  72.080  71.755  1.00 52.12  ? 572  PRO A CB   1 
ATOM   7404  C CG   . PRO A 1 506 ? 58.143  73.141  70.748  1.00 49.90  ? 572  PRO A CG   1 
ATOM   7405  C CD   . PRO A 1 506 ? 57.992  74.422  71.508  1.00 48.76  ? 572  PRO A CD   1 
ATOM   7406  H HA   . PRO A 1 506 ? 55.853  72.444  72.109  1.00 66.68  ? 572  PRO A HA   1 
ATOM   7407  H HB2  . PRO A 1 506 ? 58.608  71.931  72.337  1.00 62.54  ? 572  PRO A HB2  1 
ATOM   7408  H HB3  . PRO A 1 506 ? 57.572  71.257  71.322  1.00 62.54  ? 572  PRO A HB3  1 
ATOM   7409  H HG2  . PRO A 1 506 ? 59.050  73.040  70.419  1.00 59.88  ? 572  PRO A HG2  1 
ATOM   7410  H HG3  . PRO A 1 506 ? 57.503  73.093  70.020  1.00 59.88  ? 572  PRO A HG3  1 
ATOM   7411  H HD2  . PRO A 1 506 ? 58.820  74.649  71.958  1.00 58.52  ? 572  PRO A HD2  1 
ATOM   7412  H HD3  . PRO A 1 506 ? 57.699  75.134  70.918  1.00 58.52  ? 572  PRO A HD3  1 
ATOM   7413  N N    . GLN A 1 507 ? 57.550  72.609  74.836  1.00 43.81  ? 573  GLN A N    1 
ATOM   7414  C CA   . GLN A 1 507 ? 57.552  72.206  76.243  1.00 49.67  ? 573  GLN A CA   1 
ATOM   7415  C C    . GLN A 1 507 ? 56.268  72.662  76.909  1.00 53.31  ? 573  GLN A C    1 
ATOM   7416  O O    . GLN A 1 507 ? 55.733  71.980  77.788  1.00 45.95  ? 573  GLN A O    1 
ATOM   7417  C CB   . GLN A 1 507 ? 58.728  72.818  76.996  1.00 51.26  ? 573  GLN A CB   1 
ATOM   7418  C CG   . GLN A 1 507 ? 60.059  72.783  76.259  1.00 62.80  ? 573  GLN A CG   1 
ATOM   7419  C CD   . GLN A 1 507 ? 61.195  73.321  77.116  1.00 75.37  ? 573  GLN A CD   1 
ATOM   7420  O OE1  . GLN A 1 507 ? 61.915  74.250  76.720  1.00 69.22  ? 573  GLN A OE1  1 
ATOM   7421  N NE2  . GLN A 1 507 ? 61.355  72.744  78.308  1.00 73.35  ? 573  GLN A NE2  1 
ATOM   7422  H H    . GLN A 1 507 ? 58.162  73.177  74.631  1.00 52.58  ? 573  GLN A H    1 
ATOM   7423  H HA   . GLN A 1 507 ? 57.609  71.240  76.307  1.00 59.61  ? 573  GLN A HA   1 
ATOM   7424  H HB2  . GLN A 1 507 ? 58.524  73.747  77.184  1.00 61.52  ? 573  GLN A HB2  1 
ATOM   7425  H HB3  . GLN A 1 507 ? 58.844  72.336  77.830  1.00 61.52  ? 573  GLN A HB3  1 
ATOM   7426  H HG2  . GLN A 1 507 ? 60.268  71.866  76.021  1.00 75.37  ? 573  GLN A HG2  1 
ATOM   7427  H HG3  . GLN A 1 507 ? 59.996  73.330  75.461  1.00 75.37  ? 573  GLN A HG3  1 
ATOM   7428  H HE21 . GLN A 1 507 ? 60.830  72.107  78.551  1.00 88.02  ? 573  GLN A HE21 1 
ATOM   7429  H HE22 . GLN A 1 507 ? 61.982  73.009  78.834  1.00 88.02  ? 573  GLN A HE22 1 
ATOM   7430  N N    . LEU A 1 508 ? 55.786  73.826  76.478  1.00 51.51  ? 574  LEU A N    1 
ATOM   7431  C CA   . LEU A 1 508 ? 54.546  74.400  77.003  1.00 51.72  ? 574  LEU A CA   1 
ATOM   7432  C C    . LEU A 1 508 ? 53.311  73.581  76.654  1.00 52.20  ? 574  LEU A C    1 
ATOM   7433  O O    . LEU A 1 508 ? 52.487  73.303  77.528  1.00 43.45  ? 574  LEU A O    1 
ATOM   7434  C CB   . LEU A 1 508 ? 54.365  75.828  76.499  1.00 42.78  ? 574  LEU A CB   1 
ATOM   7435  C CG   . LEU A 1 508 ? 55.131  76.872  77.308  1.00 54.10  ? 574  LEU A CG   1 
ATOM   7436  C CD1  . LEU A 1 508 ? 55.163  78.221  76.591  1.00 54.36  ? 574  LEU A CD1  1 
ATOM   7437  C CD2  . LEU A 1 508 ? 54.516  77.018  78.699  1.00 68.39  ? 574  LEU A CD2  1 
ATOM   7438  H H    . LEU A 1 508 ? 56.163  74.309  75.874  1.00 61.82  ? 574  LEU A H    1 
ATOM   7439  H HA   . LEU A 1 508 ? 54.609  74.436  77.970  1.00 62.06  ? 574  LEU A HA   1 
ATOM   7440  H HB2  . LEU A 1 508 ? 54.676  75.878  75.582  1.00 51.33  ? 574  LEU A HB2  1 
ATOM   7441  H HB3  . LEU A 1 508 ? 53.423  76.056  76.540  1.00 51.33  ? 574  LEU A HB3  1 
ATOM   7442  H HG   . LEU A 1 508 ? 56.047  76.572  77.417  1.00 64.92  ? 574  LEU A HG   1 
ATOM   7443  H HD11 . LEU A 1 508 ? 55.657  78.855  77.135  1.00 65.23  ? 574  LEU A HD11 1 
ATOM   7444  H HD12 . LEU A 1 508 ? 55.599  78.111  75.732  1.00 65.23  ? 574  LEU A HD12 1 
ATOM   7445  H HD13 . LEU A 1 508 ? 54.253  78.532  76.464  1.00 65.23  ? 574  LEU A HD13 1 
ATOM   7446  H HD21 . LEU A 1 508 ? 55.016  77.684  79.196  1.00 82.07  ? 574  LEU A HD21 1 
ATOM   7447  H HD22 . LEU A 1 508 ? 53.592  77.298  78.608  1.00 82.07  ? 574  LEU A HD22 1 
ATOM   7448  H HD23 . LEU A 1 508 ? 54.561  76.163  79.155  1.00 82.07  ? 574  LEU A HD23 1 
ATOM   7449  N N    . LEU A 1 509 ? 53.172  73.210  75.381  1.00 51.69  ? 575  LEU A N    1 
ATOM   7450  C CA   . LEU A 1 509 ? 52.022  72.411  74.964  1.00 59.05  ? 575  LEU A CA   1 
ATOM   7451  C C    . LEU A 1 509 ? 52.048  71.091  75.688  1.00 61.73  ? 575  LEU A C    1 
ATOM   7452  O O    . LEU A 1 509 ? 51.016  70.615  76.142  1.00 53.58  ? 575  LEU A O    1 
ATOM   7453  C CB   . LEU A 1 509 ? 52.017  72.162  73.458  1.00 65.56  ? 575  LEU A CB   1 
ATOM   7454  C CG   . LEU A 1 509 ? 51.686  73.366  72.578  1.00 53.34  ? 575  LEU A CG   1 
ATOM   7455  C CD1  . LEU A 1 509 ? 51.861  72.993  71.115  1.00 45.94  ? 575  LEU A CD1  1 
ATOM   7456  C CD2  . LEU A 1 509 ? 50.281  73.881  72.853  1.00 37.01  ? 575  LEU A CD2  1 
ATOM   7457  H H    . LEU A 1 509 ? 53.721  73.405  74.749  1.00 62.03  ? 575  LEU A H    1 
ATOM   7458  H HA   . LEU A 1 509 ? 51.204  72.876  75.200  1.00 70.86  ? 575  LEU A HA   1 
ATOM   7459  H HB2  . LEU A 1 509 ? 52.898  71.849  73.198  1.00 78.67  ? 575  LEU A HB2  1 
ATOM   7460  H HB3  . LEU A 1 509 ? 51.361  71.474  73.265  1.00 78.67  ? 575  LEU A HB3  1 
ATOM   7461  H HG   . LEU A 1 509 ? 52.309  74.081  72.779  1.00 64.01  ? 575  LEU A HG   1 
ATOM   7462  H HD11 . LEU A 1 509 ? 51.648  73.763  70.565  1.00 55.12  ? 575  LEU A HD11 1 
ATOM   7463  H HD12 . LEU A 1 509 ? 52.781  72.724  70.966  1.00 55.12  ? 575  LEU A HD12 1 
ATOM   7464  H HD13 . LEU A 1 509 ? 51.263  72.259  70.902  1.00 55.12  ? 575  LEU A HD13 1 
ATOM   7465  H HD21 . LEU A 1 509 ? 50.106  74.642  72.279  1.00 44.41  ? 575  LEU A HD21 1 
ATOM   7466  H HD22 . LEU A 1 509 ? 49.643  73.173  72.669  1.00 44.41  ? 575  LEU A HD22 1 
ATOM   7467  H HD23 . LEU A 1 509 ? 50.220  74.147  73.784  1.00 44.41  ? 575  LEU A HD23 1 
ATOM   7468  N N    . ALA A 1 510 ? 53.247  70.520  75.802  1.00 71.75  ? 576  ALA A N    1 
ATOM   7469  C CA   . ALA A 1 510 ? 53.442  69.256  76.491  1.00 52.10  ? 576  ALA A CA   1 
ATOM   7470  C C    . ALA A 1 510 ? 52.851  69.353  77.886  1.00 53.32  ? 576  ALA A C    1 
ATOM   7471  O O    . ALA A 1 510 ? 51.953  68.579  78.239  1.00 55.27  ? 576  ALA A O    1 
ATOM   7472  C CB   . ALA A 1 510 ? 54.909  68.917  76.555  1.00 43.52  ? 576  ALA A CB   1 
ATOM   7473  H H    . ALA A 1 510 ? 53.972  70.854  75.482  1.00 86.10  ? 576  ALA A H    1 
ATOM   7474  H HA   . ALA A 1 510 ? 52.983  68.550  76.010  1.00 62.51  ? 576  ALA A HA   1 
ATOM   7475  H HB1  . ALA A 1 510 ? 55.018  68.071  77.017  1.00 52.22  ? 576  ALA A HB1  1 
ATOM   7476  H HB2  . ALA A 1 510 ? 55.256  68.847  75.651  1.00 52.22  ? 576  ALA A HB2  1 
ATOM   7477  H HB3  . ALA A 1 510 ? 55.375  69.619  77.035  1.00 52.22  ? 576  ALA A HB3  1 
ATOM   7478  N N    . LYS A 1 511 ? 53.325  70.331  78.658  1.00 45.87  ? 577  LYS A N    1 
ATOM   7479  C CA   . LYS A 1 511 ? 52.939  70.451  80.066  1.00 44.80  ? 577  LYS A CA   1 
ATOM   7480  C C    . LYS A 1 511 ? 51.439  70.587  80.272  1.00 47.66  ? 577  LYS A C    1 
ATOM   7481  O O    . LYS A 1 511 ? 50.867  69.927  81.137  1.00 62.73  ? 577  LYS A O    1 
ATOM   7482  C CB   . LYS A 1 511 ? 53.649  71.628  80.743  1.00 37.49  ? 577  LYS A CB   1 
ATOM   7483  C CG   . LYS A 1 511 ? 53.179  71.866  82.178  1.00 44.80  ? 577  LYS A CG   1 
ATOM   7484  C CD   . LYS A 1 511 ? 54.278  72.433  83.094  1.00 57.80  ? 577  LYS A CD   1 
ATOM   7485  C CE   . LYS A 1 511 ? 53.755  72.717  84.519  1.00 69.20  ? 577  LYS A CE   1 
ATOM   7486  N NZ   . LYS A 1 511 ? 52.956  71.591  85.141  1.00 73.79  ? 577  LYS A NZ   1 
ATOM   7487  H H    . LYS A 1 511 ? 53.871  70.939  78.391  1.00 55.04  ? 577  LYS A H    1 
ATOM   7488  H HA   . LYS A 1 511 ? 53.219  69.644  80.525  1.00 53.76  ? 577  LYS A HA   1 
ATOM   7489  H HB2  . LYS A 1 511 ? 54.602  71.449  80.767  1.00 44.99  ? 577  LYS A HB2  1 
ATOM   7490  H HB3  . LYS A 1 511 ? 53.477  72.435  80.234  1.00 44.99  ? 577  LYS A HB3  1 
ATOM   7491  H HG2  . LYS A 1 511 ? 52.444  72.500  82.167  1.00 53.76  ? 577  LYS A HG2  1 
ATOM   7492  H HG3  . LYS A 1 511 ? 52.882  71.024  82.555  1.00 53.76  ? 577  LYS A HG3  1 
ATOM   7493  H HD2  . LYS A 1 511 ? 55.001  71.790  83.160  1.00 69.36  ? 577  LYS A HD2  1 
ATOM   7494  H HD3  . LYS A 1 511 ? 54.605  73.267  82.721  1.00 69.36  ? 577  LYS A HD3  1 
ATOM   7495  H HE2  . LYS A 1 511 ? 54.514  72.891  85.097  1.00 83.04  ? 577  LYS A HE2  1 
ATOM   7496  H HE3  . LYS A 1 511 ? 53.183  73.500  84.488  1.00 83.04  ? 577  LYS A HE3  1 
ATOM   7497  H HZ1  . LYS A 1 511 ? 52.688  71.823  85.957  1.00 88.55  ? 577  LYS A HZ1  1 
ATOM   7498  H HZ2  . LYS A 1 511 ? 52.241  71.414  84.641  1.00 88.55  ? 577  LYS A HZ2  1 
ATOM   7499  H HZ3  . LYS A 1 511 ? 53.457  70.858  85.198  1.00 88.55  ? 577  LYS A HZ3  1 
ATOM   7500  N N    . TYR A 1 512 ? 50.809  71.437  79.463  1.00 72.20  ? 578  TYR A N    1 
ATOM   7501  C CA   . TYR A 1 512 ? 49.415  71.836  79.674  1.00 66.82  ? 578  TYR A CA   1 
ATOM   7502  C C    . TYR A 1 512 ? 48.397  71.207  78.699  1.00 59.58  ? 578  TYR A C    1 
ATOM   7503  O O    . TYR A 1 512 ? 47.191  71.354  78.904  1.00 54.81  ? 578  TYR A O    1 
ATOM   7504  C CB   . TYR A 1 512 ? 49.334  73.368  79.626  1.00 47.57  ? 578  TYR A CB   1 
ATOM   7505  C CG   . TYR A 1 512 ? 50.132  74.029  80.730  1.00 53.86  ? 578  TYR A CG   1 
ATOM   7506  C CD1  . TYR A 1 512 ? 49.728  73.933  82.059  1.00 45.64  ? 578  TYR A CD1  1 
ATOM   7507  C CD2  . TYR A 1 512 ? 51.295  74.743  80.446  1.00 59.06  ? 578  TYR A CD2  1 
ATOM   7508  C CE1  . TYR A 1 512 ? 50.461  74.523  83.070  1.00 50.16  ? 578  TYR A CE1  1 
ATOM   7509  C CE2  . TYR A 1 512 ? 52.038  75.343  81.458  1.00 56.23  ? 578  TYR A CE2  1 
ATOM   7510  C CZ   . TYR A 1 512 ? 51.615  75.235  82.764  1.00 51.62  ? 578  TYR A CZ   1 
ATOM   7511  O OH   . TYR A 1 512 ? 52.358  75.832  83.760  1.00 66.05  ? 578  TYR A OH   1 
ATOM   7512  H H    . TYR A 1 512 ? 51.172  71.802  78.774  1.00 86.64  ? 578  TYR A H    1 
ATOM   7513  H HA   . TYR A 1 512 ? 49.157  71.564  80.569  1.00 80.19  ? 578  TYR A HA   1 
ATOM   7514  H HB2  . TYR A 1 512 ? 49.684  73.677  78.776  1.00 57.08  ? 578  TYR A HB2  1 
ATOM   7515  H HB3  . TYR A 1 512 ? 48.407  73.639  79.721  1.00 57.08  ? 578  TYR A HB3  1 
ATOM   7516  H HD1  . TYR A 1 512 ? 48.957  73.458  82.270  1.00 54.77  ? 578  TYR A HD1  1 
ATOM   7517  H HD2  . TYR A 1 512 ? 51.582  74.816  79.564  1.00 70.87  ? 578  TYR A HD2  1 
ATOM   7518  H HE1  . TYR A 1 512 ? 50.178  74.452  83.953  1.00 60.20  ? 578  TYR A HE1  1 
ATOM   7519  H HE2  . TYR A 1 512 ? 52.812  75.818  81.253  1.00 67.47  ? 578  TYR A HE2  1 
ATOM   7520  H HH   . TYR A 1 512 ? 53.022  76.224  83.427  1.00 79.26  ? 578  TYR A HH   1 
ATOM   7521  N N    . SER A 1 513 ? 48.884  70.477  77.692  1.00 50.00  ? 579  SER A N    1 
ATOM   7522  C CA   . SER A 1 513 ? 48.062  69.940  76.592  1.00 49.64  ? 579  SER A CA   1 
ATOM   7523  C C    . SER A 1 513 ? 46.686  69.327  76.878  1.00 63.37  ? 579  SER A C    1 
ATOM   7524  O O    . SER A 1 513 ? 45.921  69.068  75.949  1.00 66.63  ? 579  SER A O    1 
ATOM   7525  C CB   . SER A 1 513 ? 48.747  68.745  75.931  1.00 58.47  ? 579  SER A CB   1 
ATOM   7526  O OG   . SER A 1 513 ? 48.927  67.701  76.869  1.00 72.26  ? 579  SER A OG   1 
ATOM   7527  H H    . SER A 1 513 ? 49.716  70.270  77.619  1.00 60.00  ? 579  SER A H    1 
ATOM   7528  H HA   . SER A 1 513 ? 47.984  70.632  75.917  1.00 59.56  ? 579  SER A HA   1 
ATOM   7529  H HB2  . SER A 1 513 ? 48.194  68.425  75.202  1.00 70.17  ? 579  SER A HB2  1 
ATOM   7530  H HB3  . SER A 1 513 ? 49.614  69.023  75.596  1.00 70.17  ? 579  SER A HB3  1 
ATOM   7531  H HG   . SER A 1 513 ? 49.403  67.967  77.507  1.00 86.71  ? 579  SER A HG   1 
ATOM   7532  N N    . VAL A 1 514 ? 46.418  68.995  78.142  1.00 56.17  ? 580  VAL A N    1 
ATOM   7533  C CA   . VAL A 1 514 ? 45.123  68.421  78.481  1.00 46.23  ? 580  VAL A CA   1 
ATOM   7534  C C    . VAL A 1 514 ? 44.064  69.463  78.865  1.00 51.57  ? 580  VAL A C    1 
ATOM   7535  O O    . VAL A 1 514 ? 42.896  69.131  79.078  1.00 48.38  ? 580  VAL A O    1 
ATOM   7536  C CB   . VAL A 1 514 ? 45.328  67.367  79.602  1.00 54.80  ? 580  VAL A CB   1 
ATOM   7537  C CG1  . VAL A 1 514 ? 45.721  68.040  80.919  1.00 71.45  ? 580  VAL A CG1  1 
ATOM   7538  C CG2  . VAL A 1 514 ? 44.091  66.483  79.771  1.00 57.60  ? 580  VAL A CG2  1 
ATOM   7539  H H    . VAL A 1 514 ? 46.940  69.121  78.809  1.00 67.41  ? 580  VAL A H    1 
ATOM   7540  H HA   . VAL A 1 514 ? 44.799  67.953  77.696  1.00 55.47  ? 580  VAL A HA   1 
ATOM   7541  H HB   . VAL A 1 514 ? 46.063  66.788  79.344  1.00 65.76  ? 580  VAL A HB   1 
ATOM   7542  H HG11 . VAL A 1 514 ? 45.842  67.358  81.598  1.00 85.74  ? 580  VAL A HG11 1 
ATOM   7543  H HG12 . VAL A 1 514 ? 46.549  68.528  80.789  1.00 85.74  ? 580  VAL A HG12 1 
ATOM   7544  H HG13 . VAL A 1 514 ? 45.015  68.651  81.184  1.00 85.74  ? 580  VAL A HG13 1 
ATOM   7545  H HG21 . VAL A 1 514 ? 44.257  65.840  80.477  1.00 69.12  ? 580  VAL A HG21 1 
ATOM   7546  H HG22 . VAL A 1 514 ? 43.333  67.043  80.003  1.00 69.12  ? 580  VAL A HG22 1 
ATOM   7547  H HG23 . VAL A 1 514 ? 43.917  66.021  78.936  1.00 69.12  ? 580  VAL A HG23 1 
ATOM   7548  N N    . ASP A 1 515 ? 44.478  70.724  78.951  1.00 60.30  ? 581  ASP A N    1 
ATOM   7549  C CA   . ASP A 1 515 ? 43.561  71.815  79.281  1.00 64.31  ? 581  ASP A CA   1 
ATOM   7550  C C    . ASP A 1 515 ? 43.247  72.704  78.068  1.00 67.42  ? 581  ASP A C    1 
ATOM   7551  O O    . ASP A 1 515 ? 44.155  73.247  77.417  1.00 59.84  ? 581  ASP A O    1 
ATOM   7552  C CB   . ASP A 1 515 ? 44.125  72.657  80.428  1.00 63.47  ? 581  ASP A CB   1 
ATOM   7553  C CG   . ASP A 1 515 ? 43.174  73.767  80.864  1.00 87.83  ? 581  ASP A CG   1 
ATOM   7554  O OD1  . ASP A 1 515 ? 41.974  73.715  80.514  1.00 110.35 ? 581  ASP A OD1  1 
ATOM   7555  O OD2  . ASP A 1 515 ? 43.619  74.690  81.575  1.00 97.40  ? 581  ASP A OD2  1 
ATOM   7556  H H    . ASP A 1 515 ? 45.290  70.977  78.822  1.00 72.36  ? 581  ASP A H    1 
ATOM   7557  H HA   . ASP A 1 515 ? 42.723  71.431  79.585  1.00 77.17  ? 581  ASP A HA   1 
ATOM   7558  H HB2  . ASP A 1 515 ? 44.286  72.082  81.193  1.00 76.17  ? 581  ASP A HB2  1 
ATOM   7559  H HB3  . ASP A 1 515 ? 44.955  73.068  80.140  1.00 76.17  ? 581  ASP A HB3  1 
ATOM   7560  N N    . ALA A 1 516 ? 41.949  72.867  77.803  1.00 49.56  ? 582  ALA A N    1 
ATOM   7561  C CA   . ALA A 1 516 ? 41.470  73.549  76.608  1.00 37.23  ? 582  ALA A CA   1 
ATOM   7562  C C    . ALA A 1 516 ? 41.715  75.079  76.581  1.00 52.34  ? 582  ALA A C    1 
ATOM   7563  O O    . ALA A 1 516 ? 42.156  75.615  75.562  1.00 53.10  ? 582  ALA A O    1 
ATOM   7564  C CB   . ALA A 1 516 ? 40.015  73.246  76.410  1.00 34.84  ? 582  ALA A CB   1 
ATOM   7565  H H    . ALA A 1 516 ? 41.317  72.584  78.313  1.00 59.47  ? 582  ALA A H    1 
ATOM   7566  H HA   . ALA A 1 516 ? 41.942  73.177  75.846  1.00 44.68  ? 582  ALA A HA   1 
ATOM   7567  H HB1  . ALA A 1 516 ? 39.703  73.703  75.613  1.00 41.80  ? 582  ALA A HB1  1 
ATOM   7568  H HB2  . ALA A 1 516 ? 39.903  72.288  76.308  1.00 41.80  ? 582  ALA A HB2  1 
ATOM   7569  H HB3  . ALA A 1 516 ? 39.520  73.557  77.185  1.00 41.80  ? 582  ALA A HB3  1 
ATOM   7570  N N    . GLU A 1 517 ? 41.435  75.790  77.672  1.00 42.40  ? 583  GLU A N    1 
ATOM   7571  C CA   . GLU A 1 517 ? 41.657  77.240  77.684  1.00 52.10  ? 583  GLU A CA   1 
ATOM   7572  C C    . GLU A 1 517 ? 43.136  77.557  77.386  1.00 61.95  ? 583  GLU A C    1 
ATOM   7573  O O    . GLU A 1 517 ? 43.458  78.421  76.556  1.00 42.57  ? 583  GLU A O    1 
ATOM   7574  C CB   . GLU A 1 517 ? 41.274  77.862  79.033  1.00 54.58  ? 583  GLU A CB   1 
ATOM   7575  C CG   . GLU A 1 517 ? 39.967  77.378  79.651  1.00 89.76  ? 583  GLU A CG   1 
ATOM   7576  C CD   . GLU A 1 517 ? 39.816  77.806  81.119  1.00 117.49 ? 583  GLU A CD   1 
ATOM   7577  O OE1  . GLU A 1 517 ? 40.587  77.302  81.983  1.00 115.07 ? 583  GLU A OE1  1 
ATOM   7578  O OE2  . GLU A 1 517 ? 38.919  78.640  81.402  1.00 114.19 ? 583  GLU A OE2  1 
ATOM   7579  H H    . GLU A 1 517 ? 41.122  75.467  78.405  1.00 50.88  ? 583  GLU A H    1 
ATOM   7580  H HA   . GLU A 1 517 ? 41.114  77.653  76.994  1.00 62.52  ? 583  GLU A HA   1 
ATOM   7581  H HB2  . GLU A 1 517 ? 41.982  77.671  79.668  1.00 65.50  ? 583  GLU A HB2  1 
ATOM   7582  H HB3  . GLU A 1 517 ? 41.199  78.822  78.915  1.00 65.50  ? 583  GLU A HB3  1 
ATOM   7583  H HG2  . GLU A 1 517 ? 39.224  77.750  79.151  1.00 107.71 ? 583  GLU A HG2  1 
ATOM   7584  H HG3  . GLU A 1 517 ? 39.940  76.409  79.616  1.00 107.71 ? 583  GLU A HG3  1 
ATOM   7585  N N    . LYS A 1 518 ? 44.024  76.831  78.064  1.00 47.26  ? 584  LYS A N    1 
ATOM   7586  C CA   . LYS A 1 518 ? 45.451  77.084  77.998  1.00 42.31  ? 584  LYS A CA   1 
ATOM   7587  C C    . LYS A 1 518 ? 46.023  76.815  76.618  1.00 39.19  ? 584  LYS A C    1 
ATOM   7588  O O    . LYS A 1 518 ? 46.815  77.594  76.085  1.00 43.21  ? 584  LYS A O    1 
ATOM   7589  C CB   . LYS A 1 518 ? 46.168  76.234  79.047  1.00 52.08  ? 584  LYS A CB   1 
ATOM   7590  C CG   . LYS A 1 518 ? 45.814  76.638  80.459  1.00 59.47  ? 584  LYS A CG   1 
ATOM   7591  C CD   . LYS A 1 518 ? 46.523  75.817  81.528  1.00 63.30  ? 584  LYS A CD   1 
ATOM   7592  C CE   . LYS A 1 518 ? 45.986  76.201  82.912  1.00 58.71  ? 584  LYS A CE   1 
ATOM   7593  N NZ   . LYS A 1 518 ? 46.191  75.170  83.958  1.00 70.69  ? 584  LYS A NZ   1 
ATOM   7594  H H    . LYS A 1 518 ? 43.814  76.174  78.577  1.00 56.71  ? 584  LYS A H    1 
ATOM   7595  H HA   . LYS A 1 518 ? 45.613  78.017  78.210  1.00 50.77  ? 584  LYS A HA   1 
ATOM   7596  H HB2  . LYS A 1 518 ? 45.917  75.305  78.928  1.00 62.49  ? 584  LYS A HB2  1 
ATOM   7597  H HB3  . LYS A 1 518 ? 47.126  76.336  78.936  1.00 62.49  ? 584  LYS A HB3  1 
ATOM   7598  H HG2  . LYS A 1 518 ? 46.058  77.567  80.589  1.00 71.36  ? 584  LYS A HG2  1 
ATOM   7599  H HG3  . LYS A 1 518 ? 44.859  76.527  80.585  1.00 71.36  ? 584  LYS A HG3  1 
ATOM   7600  H HD2  . LYS A 1 518 ? 46.354  74.873  81.380  1.00 75.96  ? 584  LYS A HD2  1 
ATOM   7601  H HD3  . LYS A 1 518 ? 47.475  76.001  81.503  1.00 75.96  ? 584  LYS A HD3  1 
ATOM   7602  H HE2  . LYS A 1 518 ? 46.433  77.010  83.205  1.00 70.45  ? 584  LYS A HE2  1 
ATOM   7603  H HE3  . LYS A 1 518 ? 45.032  76.362  82.841  1.00 70.45  ? 584  LYS A HE3  1 
ATOM   7604  H HZ1  . LYS A 1 518 ? 45.858  75.454  84.733  1.00 84.82  ? 584  LYS A HZ1  1 
ATOM   7605  H HZ2  . LYS A 1 518 ? 45.780  74.416  83.726  1.00 84.82  ? 584  LYS A HZ2  1 
ATOM   7606  H HZ3  . LYS A 1 518 ? 47.060  75.008  84.058  1.00 84.82  ? 584  LYS A HZ3  1 
ATOM   7607  N N    . VAL A 1 519 ? 45.613  75.710  76.027  1.00 38.32  ? 585  VAL A N    1 
ATOM   7608  C CA   . VAL A 1 519 ? 46.160  75.330  74.738  1.00 47.66  ? 585  VAL A CA   1 
ATOM   7609  C C    . VAL A 1 519 ? 45.655  76.256  73.643  1.00 44.91  ? 585  VAL A C    1 
ATOM   7610  O O    . VAL A 1 519 ? 46.423  76.634  72.764  1.00 42.00  ? 585  VAL A O    1 
ATOM   7611  C CB   . VAL A 1 519 ? 45.863  73.838  74.429  1.00 58.72  ? 585  VAL A CB   1 
ATOM   7612  C CG1  . VAL A 1 519 ? 45.686  73.584  72.943  1.00 70.20  ? 585  VAL A CG1  1 
ATOM   7613  C CG2  . VAL A 1 519 ? 46.987  72.966  74.967  1.00 47.32  ? 585  VAL A CG2  1 
ATOM   7614  H H    . VAL A 1 519 ? 45.026  75.167  76.345  1.00 45.98  ? 585  VAL A H    1 
ATOM   7615  H HA   . VAL A 1 519 ? 47.124  75.429  74.776  1.00 57.19  ? 585  VAL A HA   1 
ATOM   7616  H HB   . VAL A 1 519 ? 45.042  73.580  74.878  1.00 70.47  ? 585  VAL A HB   1 
ATOM   7617  H HG11 . VAL A 1 519 ? 45.503  72.641  72.804  1.00 84.24  ? 585  VAL A HG11 1 
ATOM   7618  H HG12 . VAL A 1 519 ? 44.944  74.117  72.618  1.00 84.24  ? 585  VAL A HG12 1 
ATOM   7619  H HG13 . VAL A 1 519 ? 46.501  73.835  72.481  1.00 84.24  ? 585  VAL A HG13 1 
ATOM   7620  H HG21 . VAL A 1 519 ? 46.788  72.038  74.768  1.00 56.79  ? 585  VAL A HG21 1 
ATOM   7621  H HG22 . VAL A 1 519 ? 47.819  73.226  74.542  1.00 56.79  ? 585  VAL A HG22 1 
ATOM   7622  H HG23 . VAL A 1 519 ? 47.052  73.092  75.927  1.00 56.79  ? 585  VAL A HG23 1 
ATOM   7623  N N    . THR A 1 520 ? 44.373  76.622  73.707  1.00 37.88  ? 586  THR A N    1 
ATOM   7624  C CA   . THR A 1 520 ? 43.781  77.550  72.748  1.00 35.99  ? 586  THR A CA   1 
ATOM   7625  C C    . THR A 1 520 ? 44.574  78.852  72.762  1.00 37.50  ? 586  THR A C    1 
ATOM   7626  O O    . THR A 1 520 ? 44.758  79.502  71.733  1.00 42.66  ? 586  THR A O    1 
ATOM   7627  C CB   . THR A 1 520 ? 42.280  77.854  73.068  1.00 35.71  ? 586  THR A CB   1 
ATOM   7628  O OG1  . THR A 1 520 ? 41.550  76.636  73.222  1.00 43.30  ? 586  THR A OG1  1 
ATOM   7629  C CG2  . THR A 1 520 ? 41.631  78.656  71.952  1.00 23.36  ? 586  THR A CG2  1 
ATOM   7630  H H    . THR A 1 520 ? 43.821  76.343  74.305  1.00 45.46  ? 586  THR A H    1 
ATOM   7631  H HA   . THR A 1 520 ? 43.833  77.169  71.858  1.00 43.19  ? 586  THR A HA   1 
ATOM   7632  H HB   . THR A 1 520 ? 42.223  78.370  73.887  1.00 42.86  ? 586  THR A HB   1 
ATOM   7633  H HG1  . THR A 1 520 ? 41.875  76.185  73.852  1.00 51.96  ? 586  THR A HG1  1 
ATOM   7634  H HG21 . THR A 1 520 ? 40.702  78.834  72.169  1.00 28.04  ? 586  THR A HG21 1 
ATOM   7635  H HG22 . THR A 1 520 ? 42.095  79.500  71.837  1.00 28.04  ? 586  THR A HG22 1 
ATOM   7636  H HG23 . THR A 1 520 ? 41.671  78.159  71.120  1.00 28.04  ? 586  THR A HG23 1 
ATOM   7637  N N    . ASN A 1 521 ? 45.039  79.223  73.946  1.00 40.91  ? 587  ASN A N    1 
ATOM   7638  C CA   . ASN A 1 521 ? 45.844  80.418  74.108  1.00 46.18  ? 587  ASN A CA   1 
ATOM   7639  C C    . ASN A 1 521 ? 47.258  80.227  73.579  1.00 50.26  ? 587  ASN A C    1 
ATOM   7640  O O    . ASN A 1 521 ? 47.720  81.018  72.757  1.00 55.01  ? 587  ASN A O    1 
ATOM   7641  C CB   . ASN A 1 521 ? 45.889  80.828  75.578  1.00 47.07  ? 587  ASN A CB   1 
ATOM   7642  C CG   . ASN A 1 521 ? 44.821  81.841  75.930  1.00 48.64  ? 587  ASN A CG   1 
ATOM   7643  O OD1  . ASN A 1 521 ? 44.969  83.030  75.659  1.00 58.40  ? 587  ASN A OD1  1 
ATOM   7644  N ND2  . ASN A 1 521 ? 43.745  81.377  76.546  1.00 60.15  ? 587  ASN A ND2  1 
ATOM   7645  H H    . ASN A 1 521 ? 44.899  78.793  74.678  1.00 49.09  ? 587  ASN A H    1 
ATOM   7646  H HA   . ASN A 1 521 ? 45.435  81.142  73.609  1.00 55.41  ? 587  ASN A HA   1 
ATOM   7647  H HB2  . ASN A 1 521 ? 45.753  80.042  76.130  1.00 56.49  ? 587  ASN A HB2  1 
ATOM   7648  H HB3  . ASN A 1 521 ? 46.754  81.223  75.770  1.00 56.49  ? 587  ASN A HB3  1 
ATOM   7649  H HD21 . ASN A 1 521 ? 43.111  81.915  76.767  1.00 72.18  ? 587  ASN A HD21 1 
ATOM   7650  H HD22 . ASN A 1 521 ? 43.681  80.539  76.726  1.00 72.18  ? 587  ASN A HD22 1 
ATOM   7651  N N    . LEU A 1 522 ? 47.943  79.185  74.052  1.00 43.62  ? 588  LEU A N    1 
ATOM   7652  C CA   . LEU A 1 522 ? 49.315  78.901  73.622  1.00 36.57  ? 588  LEU A CA   1 
ATOM   7653  C C    . LEU A 1 522 ? 49.407  78.749  72.112  1.00 54.91  ? 588  LEU A C    1 
ATOM   7654  O O    . LEU A 1 522 ? 50.312  79.292  71.476  1.00 60.45  ? 588  LEU A O    1 
ATOM   7655  C CB   . LEU A 1 522 ? 49.836  77.625  74.279  1.00 44.44  ? 588  LEU A CB   1 
ATOM   7656  C CG   . LEU A 1 522 ? 50.005  77.706  75.795  1.00 47.90  ? 588  LEU A CG   1 
ATOM   7657  C CD1  . LEU A 1 522 ? 50.075  76.324  76.417  1.00 43.20  ? 588  LEU A CD1  1 
ATOM   7658  C CD2  . LEU A 1 522 ? 51.237  78.512  76.125  1.00 34.43  ? 588  LEU A CD2  1 
ATOM   7659  H H    . LEU A 1 522 ? 47.634  78.625  74.627  1.00 52.34  ? 588  LEU A H    1 
ATOM   7660  H HA   . LEU A 1 522 ? 49.891  79.635  73.887  1.00 43.89  ? 588  LEU A HA   1 
ATOM   7661  H HB2  . LEU A 1 522 ? 49.214  76.905  74.092  1.00 53.33  ? 588  LEU A HB2  1 
ATOM   7662  H HB3  . LEU A 1 522 ? 50.703  77.413  73.899  1.00 53.33  ? 588  LEU A HB3  1 
ATOM   7663  H HG   . LEU A 1 522 ? 49.239  78.165  76.173  1.00 57.48  ? 588  LEU A HG   1 
ATOM   7664  H HD11 . LEU A 1 522 ? 50.182  76.415  77.377  1.00 51.84  ? 588  LEU A HD11 1 
ATOM   7665  H HD12 . LEU A 1 522 ? 49.254  75.847  76.219  1.00 51.84  ? 588  LEU A HD12 1 
ATOM   7666  H HD13 . LEU A 1 522 ? 50.833  75.848  76.043  1.00 51.84  ? 588  LEU A HD13 1 
ATOM   7667  H HD21 . LEU A 1 522 ? 51.336  78.558  77.089  1.00 41.31  ? 588  LEU A HD21 1 
ATOM   7668  H HD22 . LEU A 1 522 ? 52.012  78.079  75.733  1.00 41.31  ? 588  LEU A HD22 1 
ATOM   7669  H HD23 . LEU A 1 522 ? 51.137  79.405  75.760  1.00 41.31  ? 588  LEU A HD23 1 
ATOM   7670  N N    . LEU A 1 523 ? 48.455  78.022  71.537  1.00 61.90  ? 589  LEU A N    1 
ATOM   7671  C CA   . LEU A 1 523 ? 48.475  77.731  70.108  1.00 46.38  ? 589  LEU A CA   1 
ATOM   7672  C C    . LEU A 1 523 ? 48.482  78.967  69.228  1.00 52.42  ? 589  LEU A C    1 
ATOM   7673  O O    . LEU A 1 523 ? 48.769  78.864  68.043  1.00 66.82  ? 589  LEU A O    1 
ATOM   7674  C CB   . LEU A 1 523 ? 47.287  76.867  69.723  1.00 44.31  ? 589  LEU A CB   1 
ATOM   7675  C CG   . LEU A 1 523 ? 47.406  75.371  70.036  1.00 52.04  ? 589  LEU A CG   1 
ATOM   7676  C CD1  . LEU A 1 523 ? 46.036  74.729  69.936  1.00 59.95  ? 589  LEU A CD1  1 
ATOM   7677  C CD2  . LEU A 1 523 ? 48.378  74.672  69.100  1.00 32.79  ? 589  LEU A CD2  1 
ATOM   7678  H H    . LEU A 1 523 ? 47.782  77.685  71.954  1.00 74.29  ? 589  LEU A H    1 
ATOM   7679  H HA   . LEU A 1 523 ? 49.280  77.227  69.909  1.00 55.65  ? 589  LEU A HA   1 
ATOM   7680  H HB2  . LEU A 1 523 ? 46.505  77.198  70.193  1.00 53.17  ? 589  LEU A HB2  1 
ATOM   7681  H HB3  . LEU A 1 523 ? 47.147  76.951  68.767  1.00 53.17  ? 589  LEU A HB3  1 
ATOM   7682  H HG   . LEU A 1 523 ? 47.727  75.260  70.944  1.00 62.45  ? 589  LEU A HG   1 
ATOM   7683  H HD11 . LEU A 1 523 ? 46.117  73.783  70.134  1.00 71.95  ? 589  LEU A HD11 1 
ATOM   7684  H HD12 . LEU A 1 523 ? 45.442  75.152  70.575  1.00 71.95  ? 589  LEU A HD12 1 
ATOM   7685  H HD13 . LEU A 1 523 ? 45.695  74.851  69.036  1.00 71.95  ? 589  LEU A HD13 1 
ATOM   7686  H HD21 . LEU A 1 523 ? 48.421  73.732  69.334  1.00 39.35  ? 589  LEU A HD21 1 
ATOM   7687  H HD22 . LEU A 1 523 ? 48.065  74.773  68.187  1.00 39.35  ? 589  LEU A HD22 1 
ATOM   7688  H HD23 . LEU A 1 523 ? 49.254  75.078  69.196  1.00 39.35  ? 589  LEU A HD23 1 
ATOM   7689  N N    . GLN A 1 524 ? 48.194  80.134  69.794  1.00 48.19  ? 590  GLN A N    1 
ATOM   7690  C CA   . GLN A 1 524 ? 48.136  81.355  68.996  1.00 37.86  ? 590  GLN A CA   1 
ATOM   7691  C C    . GLN A 1 524 ? 49.484  82.018  68.831  1.00 48.45  ? 590  GLN A C    1 
ATOM   7692  O O    . GLN A 1 524 ? 49.609  82.948  68.035  1.00 62.51  ? 590  GLN A O    1 
ATOM   7693  C CB   . GLN A 1 524 ? 47.201  82.355  69.637  1.00 35.86  ? 590  GLN A CB   1 
ATOM   7694  C CG   . GLN A 1 524 ? 45.930  81.721  70.092  1.00 48.52  ? 590  GLN A CG   1 
ATOM   7695  C CD   . GLN A 1 524 ? 44.732  82.557  69.827  1.00 61.44  ? 590  GLN A CD   1 
ATOM   7696  O OE1  . GLN A 1 524 ? 44.848  83.718  69.413  1.00 69.71  ? 590  GLN A OE1  1 
ATOM   7697  N NE2  . GLN A 1 524 ? 43.548  81.984  70.082  1.00 58.22  ? 590  GLN A NE2  1 
ATOM   7698  H H    . GLN A 1 524 ? 48.029  80.246  70.630  1.00 57.83  ? 590  GLN A H    1 
ATOM   7699  H HA   . GLN A 1 524 ? 47.793  81.143  68.114  1.00 45.43  ? 590  GLN A HA   1 
ATOM   7700  H HB2  . GLN A 1 524 ? 47.636  82.748  70.410  1.00 43.03  ? 590  GLN A HB2  1 
ATOM   7701  H HB3  . GLN A 1 524 ? 46.981  83.044  68.991  1.00 43.03  ? 590  GLN A HB3  1 
ATOM   7702  H HG2  . GLN A 1 524 ? 45.815  80.878  69.626  1.00 58.22  ? 590  GLN A HG2  1 
ATOM   7703  H HG3  . GLN A 1 524 ? 45.980  81.566  71.048  1.00 58.22  ? 590  GLN A HG3  1 
ATOM   7704  H HE21 . GLN A 1 524 ? 43.516  81.179  70.381  1.00 69.87  ? 590  GLN A HE21 1 
ATOM   7705  H HE22 . GLN A 1 524 ? 42.820  82.422  69.947  1.00 69.87  ? 590  GLN A HE22 1 
ATOM   7706  N N    . LEU A 1 525 ? 50.484  81.540  69.573  1.00 44.28  ? 591  LEU A N    1 
ATOM   7707  C CA   . LEU A 1 525 ? 51.817  82.141  69.585  1.00 41.27  ? 591  LEU A CA   1 
ATOM   7708  C C    . LEU A 1 525 ? 52.520  82.179  68.219  1.00 44.30  ? 591  LEU A C    1 
ATOM   7709  O O    . LEU A 1 525 ? 52.935  83.248  67.767  1.00 46.23  ? 591  LEU A O    1 
ATOM   7710  C CB   . LEU A 1 525 ? 52.683  81.426  70.620  1.00 39.40  ? 591  LEU A CB   1 
ATOM   7711  C CG   . LEU A 1 525 ? 52.334  81.791  72.058  1.00 54.68  ? 591  LEU A CG   1 
ATOM   7712  C CD1  . LEU A 1 525 ? 52.761  80.709  73.028  1.00 54.60  ? 591  LEU A CD1  1 
ATOM   7713  C CD2  . LEU A 1 525 ? 53.009  83.079  72.401  1.00 69.73  ? 591  LEU A CD2  1 
ATOM   7714  H H    . LEU A 1 525 ? 50.413  80.854  70.087  1.00 53.13  ? 591  LEU A H    1 
ATOM   7715  H HA   . LEU A 1 525 ? 51.725  83.061  69.879  1.00 49.53  ? 591  LEU A HA   1 
ATOM   7716  H HB2  . LEU A 1 525 ? 52.565  80.468  70.519  1.00 47.28  ? 591  LEU A HB2  1 
ATOM   7717  H HB3  . LEU A 1 525 ? 53.611  81.662  70.469  1.00 47.28  ? 591  LEU A HB3  1 
ATOM   7718  H HG   . LEU A 1 525 ? 51.375  81.916  72.137  1.00 65.62  ? 591  LEU A HG   1 
ATOM   7719  H HD11 . LEU A 1 525 ? 52.522  80.980  73.928  1.00 65.52  ? 591  LEU A HD11 1 
ATOM   7720  H HD12 . LEU A 1 525 ? 52.306  79.883  72.799  1.00 65.52  ? 591  LEU A HD12 1 
ATOM   7721  H HD13 . LEU A 1 525 ? 53.721  80.587  72.962  1.00 65.52  ? 591  LEU A HD13 1 
ATOM   7722  H HD21 . LEU A 1 525 ? 52.790  83.316  73.316  1.00 83.67  ? 591  LEU A HD21 1 
ATOM   7723  H HD22 . LEU A 1 525 ? 53.968  82.967  72.308  1.00 83.67  ? 591  LEU A HD22 1 
ATOM   7724  H HD23 . LEU A 1 525 ? 52.697  83.770  71.796  1.00 83.67  ? 591  LEU A HD23 1 
ATOM   7725  N N    . PRO A 1 526 ? 52.653  81.020  67.552  1.00 53.42  ? 592  PRO A N    1 
ATOM   7726  C CA   . PRO A 1 526 ? 53.353  80.957  66.258  1.00 54.96  ? 592  PRO A CA   1 
ATOM   7727  C C    . PRO A 1 526 ? 52.893  81.948  65.200  1.00 54.94  ? 592  PRO A C    1 
ATOM   7728  O O    . PRO A 1 526 ? 53.636  82.211  64.250  1.00 44.30  ? 592  PRO A O    1 
ATOM   7729  C CB   . PRO A 1 526 ? 53.054  79.540  65.768  1.00 59.37  ? 592  PRO A CB   1 
ATOM   7730  C CG   . PRO A 1 526 ? 52.862  78.764  67.013  1.00 65.12  ? 592  PRO A CG   1 
ATOM   7731  C CD   . PRO A 1 526 ? 52.199  79.685  67.984  1.00 56.85  ? 592  PRO A CD   1 
ATOM   7732  H HA   . PRO A 1 526 ? 54.310  81.054  66.390  1.00 65.95  ? 592  PRO A HA   1 
ATOM   7733  H HB2  . PRO A 1 526 ? 52.246  79.540  65.231  1.00 71.24  ? 592  PRO A HB2  1 
ATOM   7734  H HB3  . PRO A 1 526 ? 53.808  79.200  65.261  1.00 71.24  ? 592  PRO A HB3  1 
ATOM   7735  H HG2  . PRO A 1 526 ? 52.297  77.997  66.832  1.00 78.14  ? 592  PRO A HG2  1 
ATOM   7736  H HG3  . PRO A 1 526 ? 53.725  78.478  67.352  1.00 78.14  ? 592  PRO A HG3  1 
ATOM   7737  H HD2  . PRO A 1 526 ? 51.234  79.616  67.910  1.00 68.21  ? 592  PRO A HD2  1 
ATOM   7738  H HD3  . PRO A 1 526 ? 52.501  79.501  68.886  1.00 68.21  ? 592  PRO A HD3  1 
ATOM   7739  N N    . GLN A 1 527 ? 51.681  82.471  65.353  1.00 62.87  ? 593  GLN A N    1 
ATOM   7740  C CA   . GLN A 1 527 ? 51.137  83.430  64.404  1.00 51.09  ? 593  GLN A CA   1 
ATOM   7741  C C    . GLN A 1 527 ? 51.867  84.767  64.520  1.00 54.97  ? 593  GLN A C    1 
ATOM   7742  O O    . GLN A 1 527 ? 51.774  85.614  63.629  1.00 65.06  ? 593  GLN A O    1 
ATOM   7743  C CB   . GLN A 1 527 ? 49.647  83.612  64.665  1.00 62.27  ? 593  GLN A CB   1 
ATOM   7744  C CG   . GLN A 1 527 ? 48.890  82.293  64.759  1.00 72.38  ? 593  GLN A CG   1 
ATOM   7745  C CD   . GLN A 1 527 ? 47.392  82.486  64.892  1.00 80.54  ? 593  GLN A CD   1 
ATOM   7746  O OE1  . GLN A 1 527 ? 46.906  83.619  64.933  1.00 94.21  ? 593  GLN A OE1  1 
ATOM   7747  N NE2  . GLN A 1 527 ? 46.654  81.381  64.971  1.00 67.39  ? 593  GLN A NE2  1 
ATOM   7748  H H    . GLN A 1 527 ? 51.151  82.284  66.004  1.00 75.45  ? 593  GLN A H    1 
ATOM   7749  H HA   . GLN A 1 527 ? 51.253  83.093  63.502  1.00 61.31  ? 593  GLN A HA   1 
ATOM   7750  H HB2  . GLN A 1 527 ? 49.530  84.084  65.504  1.00 74.73  ? 593  GLN A HB2  1 
ATOM   7751  H HB3  . GLN A 1 527 ? 49.262  84.126  63.939  1.00 74.73  ? 593  GLN A HB3  1 
ATOM   7752  H HG2  . GLN A 1 527 ? 49.055  81.775  63.956  1.00 86.85  ? 593  GLN A HG2  1 
ATOM   7753  H HG3  . GLN A 1 527 ? 49.199  81.805  65.539  1.00 86.85  ? 593  GLN A HG3  1 
ATOM   7754  H HE21 . GLN A 1 527 ? 47.033  80.609  64.945  1.00 80.87  ? 593  GLN A HE21 1 
ATOM   7755  H HE22 . GLN A 1 527 ? 45.800  81.439  65.047  1.00 80.87  ? 593  GLN A HE22 1 
ATOM   7756  N N    . TYR A 1 528 ? 52.606  84.936  65.616  1.00 50.62  ? 594  TYR A N    1 
ATOM   7757  C CA   . TYR A 1 528 ? 53.348  86.163  65.875  1.00 56.63  ? 594  TYR A CA   1 
ATOM   7758  C C    . TYR A 1 528 ? 54.848  86.058  65.543  1.00 51.04  ? 594  TYR A C    1 
ATOM   7759  O O    . TYR A 1 528 ? 55.569  87.042  65.661  1.00 57.22  ? 594  TYR A O    1 
ATOM   7760  C CB   . TYR A 1 528 ? 53.114  86.598  67.334  1.00 51.98  ? 594  TYR A CB   1 
ATOM   7761  C CG   . TYR A 1 528 ? 51.639  86.728  67.652  1.00 55.85  ? 594  TYR A CG   1 
ATOM   7762  C CD1  . TYR A 1 528 ? 50.879  87.760  67.102  1.00 49.32  ? 594  TYR A CD1  1 
ATOM   7763  C CD2  . TYR A 1 528 ? 50.997  85.803  68.467  1.00 53.39  ? 594  TYR A CD2  1 
ATOM   7764  C CE1  . TYR A 1 528 ? 49.522  87.869  67.361  1.00 44.34  ? 594  TYR A CE1  1 
ATOM   7765  C CE2  . TYR A 1 528 ? 49.638  85.907  68.737  1.00 48.27  ? 594  TYR A CE2  1 
ATOM   7766  C CZ   . TYR A 1 528 ? 48.910  86.939  68.181  1.00 59.16  ? 594  TYR A CZ   1 
ATOM   7767  O OH   . TYR A 1 528 ? 47.565  87.037  68.454  1.00 68.48  ? 594  TYR A OH   1 
ATOM   7768  H H    . TYR A 1 528 ? 52.692  84.344  66.234  1.00 60.74  ? 594  TYR A H    1 
ATOM   7769  H HA   . TYR A 1 528 ? 52.981  86.859  65.308  1.00 67.95  ? 594  TYR A HA   1 
ATOM   7770  H HB2  . TYR A 1 528 ? 53.495  85.934  67.930  1.00 62.38  ? 594  TYR A HB2  1 
ATOM   7771  H HB3  . TYR A 1 528 ? 53.532  87.460  67.481  1.00 62.38  ? 594  TYR A HB3  1 
ATOM   7772  H HD1  . TYR A 1 528 ? 51.289  88.382  66.546  1.00 59.18  ? 594  TYR A HD1  1 
ATOM   7773  H HD2  . TYR A 1 528 ? 51.485  85.104  68.838  1.00 64.07  ? 594  TYR A HD2  1 
ATOM   7774  H HE1  . TYR A 1 528 ? 49.028  88.566  66.992  1.00 53.21  ? 594  TYR A HE1  1 
ATOM   7775  H HE2  . TYR A 1 528 ? 49.222  85.284  69.287  1.00 57.92  ? 594  TYR A HE2  1 
ATOM   7776  H HH   . TYR A 1 528 ? 47.329  86.411  68.961  1.00 82.17  ? 594  TYR A HH   1 
ATOM   7777  N N    . PHE A 1 529 ? 55.307  84.883  65.106  1.00 58.21  ? 595  PHE A N    1 
ATOM   7778  C CA   . PHE A 1 529 ? 56.729  84.661  64.771  1.00 71.13  ? 595  PHE A CA   1 
ATOM   7779  C C    . PHE A 1 529 ? 57.185  85.173  63.400  1.00 74.73  ? 595  PHE A C    1 
ATOM   7780  O O    . PHE A 1 529 ? 56.483  85.035  62.392  1.00 78.36  ? 595  PHE A O    1 
ATOM   7781  C CB   . PHE A 1 529 ? 57.073  83.166  64.740  1.00 56.67  ? 595  PHE A CB   1 
ATOM   7782  C CG   . PHE A 1 529 ? 56.924  82.452  66.047  1.00 56.57  ? 595  PHE A CG   1 
ATOM   7783  C CD1  . PHE A 1 529 ? 56.831  83.132  67.239  1.00 56.39  ? 595  PHE A CD1  1 
ATOM   7784  C CD2  . PHE A 1 529 ? 56.902  81.071  66.067  1.00 48.41  ? 595  PHE A CD2  1 
ATOM   7785  C CE1  . PHE A 1 529 ? 56.698  82.439  68.423  1.00 61.18  ? 595  PHE A CE1  1 
ATOM   7786  C CE2  . PHE A 1 529 ? 56.764  80.382  67.243  1.00 47.61  ? 595  PHE A CE2  1 
ATOM   7787  C CZ   . PHE A 1 529 ? 56.662  81.062  68.421  1.00 58.37  ? 595  PHE A CZ   1 
ATOM   7788  H H    . PHE A 1 529 ? 54.814  84.188  64.992  1.00 69.85  ? 595  PHE A H    1 
ATOM   7789  H HA   . PHE A 1 529 ? 57.282  85.083  65.448  1.00 85.36  ? 595  PHE A HA   1 
ATOM   7790  H HB2  . PHE A 1 529 ? 56.488  82.729  64.101  1.00 68.01  ? 595  PHE A HB2  1 
ATOM   7791  H HB3  . PHE A 1 529 ? 57.995  83.068  64.457  1.00 68.01  ? 595  PHE A HB3  1 
ATOM   7792  H HD1  . PHE A 1 529 ? 56.848  84.062  67.245  1.00 67.66  ? 595  PHE A HD1  1 
ATOM   7793  H HD2  . PHE A 1 529 ? 56.964  80.601  65.267  1.00 58.09  ? 595  PHE A HD2  1 
ATOM   7794  H HE1  . PHE A 1 529 ? 56.629  82.903  69.226  1.00 73.42  ? 595  PHE A HE1  1 
ATOM   7795  H HE2  . PHE A 1 529 ? 56.745  79.452  67.238  1.00 57.13  ? 595  PHE A HE2  1 
ATOM   7796  H HZ   . PHE A 1 529 ? 56.576  80.597  69.222  1.00 70.04  ? 595  PHE A HZ   1 
ATOM   7797  N N    . ASP A 1 530 ? 58.397  85.715  63.378  1.00 77.92  ? 596  ASP A N    1 
ATOM   7798  C CA   . ASP A 1 530 ? 59.226  85.711  62.173  1.00 97.69  ? 596  ASP A CA   1 
ATOM   7799  C C    . ASP A 1 530 ? 59.731  84.270  61.916  1.00 86.35  ? 596  ASP A C    1 
ATOM   7800  O O    . ASP A 1 530 ? 60.533  83.730  62.677  1.00 56.45  ? 596  ASP A O    1 
ATOM   7801  C CB   . ASP A 1 530 ? 60.413  86.659  62.353  1.00 89.34  ? 596  ASP A CB   1 
ATOM   7802  C CG   . ASP A 1 530 ? 61.356  86.649  61.164  1.00 94.09  ? 596  ASP A CG   1 
ATOM   7803  O OD1  . ASP A 1 530 ? 60.940  86.218  60.060  1.00 97.90  ? 596  ASP A OD1  1 
ATOM   7804  O OD2  . ASP A 1 530 ? 62.516  87.083  61.338  1.00 101.95 ? 596  ASP A OD2  1 
ATOM   7805  H H    . ASP A 1 530 ? 58.768  86.096  64.054  1.00 93.50  ? 596  ASP A H    1 
ATOM   7806  H HA   . ASP A 1 530 ? 58.703  86.003  61.410  1.00 117.23 ? 596  ASP A HA   1 
ATOM   7807  H HB2  . ASP A 1 530 ? 60.082  87.563  62.466  1.00 107.20 ? 596  ASP A HB2  1 
ATOM   7808  H HB3  . ASP A 1 530 ? 60.917  86.389  63.137  1.00 107.20 ? 596  ASP A HB3  1 
ATOM   7809  N N    . LEU A 1 531 ? 59.269  83.656  60.832  1.00 82.89  ? 597  LEU A N    1 
ATOM   7810  C CA   . LEU A 1 531 ? 59.491  82.230  60.623  1.00 67.69  ? 597  LEU A CA   1 
ATOM   7811  C C    . LEU A 1 531 ? 60.842  81.869  60.004  1.00 85.63  ? 597  LEU A C    1 
ATOM   7812  O O    . LEU A 1 531 ? 61.303  80.736  60.160  1.00 88.24  ? 597  LEU A O    1 
ATOM   7813  C CB   . LEU A 1 531 ? 58.381  81.669  59.745  1.00 61.16  ? 597  LEU A CB   1 
ATOM   7814  C CG   . LEU A 1 531 ? 56.988  81.727  60.355  1.00 57.25  ? 597  LEU A CG   1 
ATOM   7815  C CD1  . LEU A 1 531 ? 55.970  81.443  59.272  1.00 61.51  ? 597  LEU A CD1  1 
ATOM   7816  C CD2  . LEU A 1 531 ? 56.847  80.740  61.514  1.00 41.70  ? 597  LEU A CD2  1 
ATOM   7817  H H    . LEU A 1 531 ? 58.825  84.041  60.205  1.00 99.47  ? 597  LEU A H    1 
ATOM   7818  H HA   . LEU A 1 531 ? 59.437  81.783  61.482  1.00 81.23  ? 597  LEU A HA   1 
ATOM   7819  H HB2  . LEU A 1 531 ? 58.359  82.172  58.916  1.00 73.40  ? 597  LEU A HB2  1 
ATOM   7820  H HB3  . LEU A 1 531 ? 58.579  80.738  59.555  1.00 73.40  ? 597  LEU A HB3  1 
ATOM   7821  H HG   . LEU A 1 531 ? 56.826  82.621  60.696  1.00 68.69  ? 597  LEU A HG   1 
ATOM   7822  H HD11 . LEU A 1 531 ? 55.081  81.479  59.657  1.00 73.82  ? 597  LEU A HD11 1 
ATOM   7823  H HD12 . LEU A 1 531 ? 56.057  82.112  58.574  1.00 73.82  ? 597  LEU A HD12 1 
ATOM   7824  H HD13 . LEU A 1 531 ? 56.137  80.560  58.906  1.00 73.82  ? 597  LEU A HD13 1 
ATOM   7825  H HD21 . LEU A 1 531 ? 55.949  80.806  61.876  1.00 50.04  ? 597  LEU A HD21 1 
ATOM   7826  H HD22 . LEU A 1 531 ? 57.006  79.842  61.185  1.00 50.04  ? 597  LEU A HD22 1 
ATOM   7827  H HD23 . LEU A 1 531 ? 57.497  80.962  62.199  1.00 50.04  ? 597  LEU A HD23 1 
ATOM   7828  N N    . GLU A 1 532 ? 61.470  82.808  59.297  1.00 86.65  ? 598  GLU A N    1 
ATOM   7829  C CA   . GLU A 1 532 ? 62.806  82.574  58.749  1.00 94.05  ? 598  GLU A CA   1 
ATOM   7830  C C    . GLU A 1 532 ? 63.744  82.024  59.825  1.00 90.12  ? 598  GLU A C    1 
ATOM   7831  O O    . GLU A 1 532 ? 64.652  81.240  59.542  1.00 95.67  ? 598  GLU A O    1 
ATOM   7832  C CB   . GLU A 1 532 ? 63.392  83.870  58.195  1.00 100.71 ? 598  GLU A CB   1 
ATOM   7833  C CG   . GLU A 1 532 ? 62.791  84.317  56.880  1.00 112.95 ? 598  GLU A CG   1 
ATOM   7834  C CD   . GLU A 1 532 ? 63.439  85.583  56.347  1.00 124.34 ? 598  GLU A CD   1 
ATOM   7835  O OE1  . GLU A 1 532 ? 64.323  86.135  57.038  1.00 124.97 ? 598  GLU A OE1  1 
ATOM   7836  O OE2  . GLU A 1 532 ? 63.065  86.025  55.238  1.00 131.87 ? 598  GLU A OE2  1 
ATOM   7837  H H    . GLU A 1 532 ? 61.147  83.586  59.122  1.00 103.98 ? 598  GLU A H    1 
ATOM   7838  H HA   . GLU A 1 532 ? 62.752  81.927  58.028  1.00 112.86 ? 598  GLU A HA   1 
ATOM   7839  H HB2  . GLU A 1 532 ? 63.244  84.578  58.842  1.00 120.85 ? 598  GLU A HB2  1 
ATOM   7840  H HB3  . GLU A 1 532 ? 64.344  83.747  58.058  1.00 120.85 ? 598  GLU A HB3  1 
ATOM   7841  H HG2  . GLU A 1 532 ? 62.914  83.616  56.221  1.00 135.54 ? 598  GLU A HG2  1 
ATOM   7842  H HG3  . GLU A 1 532 ? 61.846  84.494  57.007  1.00 135.54 ? 598  GLU A HG3  1 
ATOM   7843  N N    . ILE A 1 533 ? 63.486  82.429  61.064  1.00 64.80  ? 599  ILE A N    1 
ATOM   7844  C CA   . ILE A 1 533 ? 64.339  82.121  62.201  1.00 61.77  ? 599  ILE A CA   1 
ATOM   7845  C C    . ILE A 1 533 ? 64.324  80.626  62.545  1.00 65.75  ? 599  ILE A C    1 
ATOM   7846  O O    . ILE A 1 533 ? 65.075  80.159  63.398  1.00 70.73  ? 599  ILE A O    1 
ATOM   7847  C CB   . ILE A 1 533 ? 63.925  83.024  63.395  1.00 43.81  ? 599  ILE A CB   1 
ATOM   7848  C CG1  . ILE A 1 533 ? 64.114  84.481  62.965  1.00 46.52  ? 599  ILE A CG1  1 
ATOM   7849  C CG2  . ILE A 1 533 ? 64.692  82.696  64.675  1.00 44.96  ? 599  ILE A CG2  1 
ATOM   7850  C CD1  . ILE A 1 533 ? 64.056  85.511  64.057  1.00 56.51  ? 599  ILE A CD1  1 
ATOM   7851  H H    . ILE A 1 533 ? 62.798  82.901  61.275  1.00 77.76  ? 599  ILE A H    1 
ATOM   7852  H HA   . ILE A 1 533 ? 65.252  82.352  61.968  1.00 74.12  ? 599  ILE A HA   1 
ATOM   7853  H HB   . ILE A 1 533 ? 62.981  82.881  63.567  1.00 52.57  ? 599  ILE A HB   1 
ATOM   7854  H HG12 . ILE A 1 533 ? 64.982  84.562  62.539  1.00 55.82  ? 599  ILE A HG12 1 
ATOM   7855  H HG13 . ILE A 1 533 ? 63.420  84.701  62.324  1.00 55.82  ? 599  ILE A HG13 1 
ATOM   7856  H HG21 . ILE A 1 533 ? 64.392  83.289  65.382  1.00 53.95  ? 599  ILE A HG21 1 
ATOM   7857  H HG22 . ILE A 1 533 ? 64.517  81.774  64.920  1.00 53.95  ? 599  ILE A HG22 1 
ATOM   7858  H HG23 . ILE A 1 533 ? 65.640  82.823  64.516  1.00 53.95  ? 599  ILE A HG23 1 
ATOM   7859  H HD11 . ILE A 1 533 ? 64.188  86.390  63.668  1.00 67.81  ? 599  ILE A HD11 1 
ATOM   7860  H HD12 . ILE A 1 533 ? 63.188  85.465  64.487  1.00 67.81  ? 599  ILE A HD12 1 
ATOM   7861  H HD13 . ILE A 1 533 ? 64.756  85.326  64.702  1.00 67.81  ? 599  ILE A HD13 1 
ATOM   7862  N N    . TYR A 1 534 ? 63.490  79.862  61.853  1.00 71.46  ? 600  TYR A N    1 
ATOM   7863  C CA   . TYR A 1 534 ? 63.447  78.425  62.084  1.00 71.40  ? 600  TYR A CA   1 
ATOM   7864  C C    . TYR A 1 534 ? 64.596  77.763  61.325  1.00 73.72  ? 600  TYR A C    1 
ATOM   7865  O O    . TYR A 1 534 ? 65.228  76.834  61.835  1.00 60.24  ? 600  TYR A O    1 
ATOM   7866  C CB   . TYR A 1 534 ? 62.090  77.850  61.655  1.00 62.69  ? 600  TYR A CB   1 
ATOM   7867  C CG   . TYR A 1 534 ? 61.101  77.624  62.789  1.00 60.14  ? 600  TYR A CG   1 
ATOM   7868  C CD1  . TYR A 1 534 ? 61.439  76.855  63.895  1.00 56.75  ? 600  TYR A CD1  1 
ATOM   7869  C CD2  . TYR A 1 534 ? 59.826  78.179  62.746  1.00 61.61  ? 600  TYR A CD2  1 
ATOM   7870  C CE1  . TYR A 1 534 ? 60.542  76.645  64.927  1.00 53.33  ? 600  TYR A CE1  1 
ATOM   7871  C CE2  . TYR A 1 534 ? 58.916  77.973  63.774  1.00 57.20  ? 600  TYR A CE2  1 
ATOM   7872  C CZ   . TYR A 1 534 ? 59.278  77.202  64.862  1.00 60.21  ? 600  TYR A CZ   1 
ATOM   7873  O OH   . TYR A 1 534 ? 58.375  76.982  65.887  1.00 53.81  ? 600  TYR A OH   1 
ATOM   7874  H H    . TYR A 1 534 ? 62.946  80.146  61.251  1.00 85.76  ? 600  TYR A H    1 
ATOM   7875  H HA   . TYR A 1 534 ? 63.566  78.249  63.030  1.00 85.68  ? 600  TYR A HA   1 
ATOM   7876  H HB2  . TYR A 1 534 ? 61.679  78.463  61.026  1.00 75.23  ? 600  TYR A HB2  1 
ATOM   7877  H HB3  . TYR A 1 534 ? 62.240  76.994  61.223  1.00 75.23  ? 600  TYR A HB3  1 
ATOM   7878  H HD1  . TYR A 1 534 ? 62.286  76.475  63.944  1.00 68.10  ? 600  TYR A HD1  1 
ATOM   7879  H HD2  . TYR A 1 534 ? 59.577  78.696  62.013  1.00 73.94  ? 600  TYR A HD2  1 
ATOM   7880  H HE1  . TYR A 1 534 ? 60.785  76.123  65.657  1.00 63.99  ? 600  TYR A HE1  1 
ATOM   7881  H HE2  . TYR A 1 534 ? 58.066  78.348  63.728  1.00 68.64  ? 600  TYR A HE2  1 
ATOM   7882  H HH   . TYR A 1 534 ? 57.651  77.375  65.721  1.00 64.57  ? 600  TYR A HH   1 
ATOM   7883  N N    . THR A 1 535 ? 64.868  78.267  60.119  1.00 78.47  ? 601  THR A N    1 
ATOM   7884  C CA   . THR A 1 535 ? 65.968  77.768  59.289  1.00 89.34  ? 601  THR A CA   1 
ATOM   7885  C C    . THR A 1 535 ? 67.343  78.371  59.643  1.00 81.41  ? 601  THR A C    1 
ATOM   7886  O O    . THR A 1 535 ? 68.288  77.634  59.945  1.00 76.00  ? 601  THR A O    1 
ATOM   7887  C CB   . THR A 1 535 ? 65.707  78.019  57.780  1.00 78.61  ? 601  THR A CB   1 
ATOM   7888  O OG1  . THR A 1 535 ? 64.941  79.216  57.612  1.00 91.05  ? 601  THR A OG1  1 
ATOM   7889  C CG2  . THR A 1 535 ? 64.958  76.850  57.157  1.00 65.59  ? 601  THR A CG2  1 
ATOM   7890  H H    . THR A 1 535 ? 64.424  78.907  59.755  1.00 94.16  ? 601  THR A H    1 
ATOM   7891  H HA   . THR A 1 535 ? 66.033  76.808  59.415  1.00 107.21 ? 601  THR A HA   1 
ATOM   7892  H HB   . THR A 1 535 ? 66.556  78.115  57.321  1.00 94.33  ? 601  THR A HB   1 
ATOM   7893  H HG1  . THR A 1 535 ? 65.359  79.872  57.930  1.00 109.26 ? 601  THR A HG1  1 
ATOM   7894  H HG21 . THR A 1 535 ? 64.802  77.022  56.215  1.00 78.70  ? 601  THR A HG21 1 
ATOM   7895  H HG22 . THR A 1 535 ? 65.478  76.037  57.248  1.00 78.70  ? 601  THR A HG22 1 
ATOM   7896  H HG23 . THR A 1 535 ? 64.104  76.730  57.601  1.00 78.70  ? 601  THR A HG23 1 
ATOM   7897  N N    . THR A 1 536 ? 67.449  79.701  59.594  1.00 62.84  ? 602  THR A N    1 
ATOM   7898  C CA   . THR A 1 536 ? 68.702  80.392  59.890  1.00 64.43  ? 602  THR A CA   1 
ATOM   7899  C C    . THR A 1 536 ? 69.112  80.278  61.358  1.00 70.68  ? 602  THR A C    1 
ATOM   7900  O O    . THR A 1 536 ? 70.288  80.383  61.692  1.00 71.05  ? 602  THR A O    1 
ATOM   7901  C CB   . THR A 1 536 ? 68.617  81.888  59.572  1.00 60.45  ? 602  THR A CB   1 
ATOM   7902  O OG1  . THR A 1 536 ? 67.813  82.539  60.563  1.00 62.23  ? 602  THR A OG1  1 
ATOM   7903  C CG2  . THR A 1 536 ? 68.049  82.125  58.181  1.00 67.93  ? 602  THR A CG2  1 
ATOM   7904  H H    . THR A 1 536 ? 66.801  80.229  59.389  1.00 75.41  ? 602  THR A H    1 
ATOM   7905  H HA   . THR A 1 536 ? 69.410  80.009  59.349  1.00 77.31  ? 602  THR A HA   1 
ATOM   7906  H HB   . THR A 1 536 ? 69.510  82.265  59.597  1.00 72.54  ? 602  THR A HB   1 
ATOM   7907  H HG1  . THR A 1 536 ? 67.761  83.361  60.397  1.00 74.67  ? 602  THR A HG1  1 
ATOM   7908  H HG21 . THR A 1 536 ? 68.004  83.077  58.000  1.00 81.51  ? 602  THR A HG21 1 
ATOM   7909  H HG22 . THR A 1 536 ? 68.616  81.704  57.516  1.00 81.51  ? 602  THR A HG22 1 
ATOM   7910  H HG23 . THR A 1 536 ? 67.157  81.749  58.119  1.00 81.51  ? 602  THR A HG23 1 
ATOM   7911  N N    . GLY A 1 537 ? 68.139  80.086  62.234  1.00 77.20  ? 603  GLY A N    1 
ATOM   7912  C CA   . GLY A 1 537 ? 68.414  79.850  63.638  1.00 74.73  ? 603  GLY A CA   1 
ATOM   7913  C C    . GLY A 1 537 ? 68.718  78.387  63.906  1.00 76.87  ? 603  GLY A C    1 
ATOM   7914  O O    . GLY A 1 537 ? 69.096  78.024  65.021  1.00 86.27  ? 603  GLY A O    1 
ATOM   7915  H H    . GLY A 1 537 ? 67.302  80.089  62.037  1.00 92.65  ? 603  GLY A H    1 
ATOM   7916  H HA2  . GLY A 1 537 ? 69.176  80.382  63.916  1.00 89.67  ? 603  GLY A HA2  1 
ATOM   7917  H HA3  . GLY A 1 537 ? 67.645  80.110  64.170  1.00 89.67  ? 603  GLY A HA3  1 
ATOM   7918  N N    . ARG A 1 538 ? 68.550  77.551  62.883  1.00 63.44  ? 604  ARG A N    1 
ATOM   7919  C CA   . ARG A 1 538 ? 68.807  76.117  62.993  1.00 70.00  ? 604  ARG A CA   1 
ATOM   7920  C C    . ARG A 1 538 ? 68.017  75.522  64.147  1.00 73.22  ? 604  ARG A C    1 
ATOM   7921  O O    . ARG A 1 538 ? 68.576  74.950  65.090  1.00 68.95  ? 604  ARG A O    1 
ATOM   7922  C CB   . ARG A 1 538 ? 70.306  75.852  63.133  1.00 81.84  ? 604  ARG A CB   1 
ATOM   7923  C CG   . ARG A 1 538 ? 71.080  76.330  61.907  1.00 80.07  ? 604  ARG A CG   1 
ATOM   7924  C CD   . ARG A 1 538 ? 72.345  75.532  61.634  1.00 92.82  ? 604  ARG A CD   1 
ATOM   7925  N NE   . ARG A 1 538 ? 72.691  75.613  60.214  1.00 105.00 ? 604  ARG A NE   1 
ATOM   7926  C CZ   . ARG A 1 538 ? 73.894  75.360  59.705  1.00 108.73 ? 604  ARG A CZ   1 
ATOM   7927  N NH1  . ARG A 1 538 ? 74.905  75.017  60.495  1.00 102.48 ? 604  ARG A NH1  1 
ATOM   7928  N NH2  . ARG A 1 538 ? 74.087  75.465  58.396  1.00 108.98 ? 604  ARG A NH2  1 
ATOM   7929  H H    . ARG A 1 538 ? 68.283  77.794  62.103  1.00 76.13  ? 604  ARG A H    1 
ATOM   7930  H HA   . ARG A 1 538 ? 68.507  75.685  62.178  1.00 84.00  ? 604  ARG A HA   1 
ATOM   7931  H HB2  . ARG A 1 538 ? 70.643  76.327  63.909  1.00 98.20  ? 604  ARG A HB2  1 
ATOM   7932  H HB3  . ARG A 1 538 ? 70.454  74.899  63.233  1.00 98.20  ? 604  ARG A HB3  1 
ATOM   7933  H HG2  . ARG A 1 538 ? 70.508  76.256  61.127  1.00 96.09  ? 604  ARG A HG2  1 
ATOM   7934  H HG3  . ARG A 1 538 ? 71.337  77.256  62.040  1.00 96.09  ? 604  ARG A HG3  1 
ATOM   7935  H HD2  . ARG A 1 538 ? 73.079  75.898  62.152  1.00 111.38 ? 604  ARG A HD2  1 
ATOM   7936  H HD3  . ARG A 1 538 ? 72.197  74.601  61.862  1.00 111.38 ? 604  ARG A HD3  1 
ATOM   7937  H HE   . ARG A 1 538 ? 72.069  75.843  59.667  1.00 126.00 ? 604  ARG A HE   1 
ATOM   7938  H HH11 . ARG A 1 538 ? 74.784  74.948  61.344  1.00 122.97 ? 604  ARG A HH11 1 
ATOM   7939  H HH12 . ARG A 1 538 ? 75.680  74.857  60.157  1.00 122.97 ? 604  ARG A HH12 1 
ATOM   7940  H HH21 . ARG A 1 538 ? 73.435  75.690  57.883  1.00 130.77 ? 604  ARG A HH21 1 
ATOM   7941  H HH22 . ARG A 1 538 ? 74.863  75.307  58.062  1.00 130.77 ? 604  ARG A HH22 1 
ATOM   7942  N N    . LEU A 1 539 ? 66.697  75.669  64.036  1.00 89.22  ? 605  LEU A N    1 
ATOM   7943  C CA   . LEU A 1 539 ? 65.754  75.308  65.089  1.00 75.97  ? 605  LEU A CA   1 
ATOM   7944  C C    . LEU A 1 539 ? 64.762  74.253  64.630  1.00 75.80  ? 605  LEU A C    1 
ATOM   7945  O O    . LEU A 1 539 ? 63.793  73.974  65.337  1.00 72.94  ? 605  LEU A O    1 
ATOM   7946  C CB   . LEU A 1 539 ? 64.987  76.552  65.529  1.00 50.40  ? 605  LEU A CB   1 
ATOM   7947  C CG   . LEU A 1 539 ? 65.769  77.531  66.408  1.00 68.74  ? 605  LEU A CG   1 
ATOM   7948  C CD1  . LEU A 1 539 ? 65.096  78.892  66.416  1.00 66.78  ? 605  LEU A CD1  1 
ATOM   7949  C CD2  . LEU A 1 539 ? 65.902  77.001  67.831  1.00 57.21  ? 605  LEU A CD2  1 
ATOM   7950  H H    . LEU A 1 539 ? 66.314  75.988  63.335  1.00 107.07 ? 605  LEU A H    1 
ATOM   7951  H HA   . LEU A 1 539 ? 66.241  74.961  65.853  1.00 91.17  ? 605  LEU A HA   1 
ATOM   7952  H HB2  . LEU A 1 539 ? 64.704  77.035  64.737  1.00 60.48  ? 605  LEU A HB2  1 
ATOM   7953  H HB3  . LEU A 1 539 ? 64.207  76.270  66.032  1.00 60.48  ? 605  LEU A HB3  1 
ATOM   7954  H HG   . LEU A 1 539 ? 66.662  77.639  66.044  1.00 82.49  ? 605  LEU A HG   1 
ATOM   7955  H HD11 . LEU A 1 539 ? 65.609  79.494  66.978  1.00 80.14  ? 605  LEU A HD11 1 
ATOM   7956  H HD12 . LEU A 1 539 ? 65.064  79.233  65.509  1.00 80.14  ? 605  LEU A HD12 1 
ATOM   7957  H HD13 . LEU A 1 539 ? 64.197  78.796  66.766  1.00 80.14  ? 605  LEU A HD13 1 
ATOM   7958  H HD21 . LEU A 1 539 ? 66.401  77.642  68.361  1.00 68.65  ? 605  LEU A HD21 1 
ATOM   7959  H HD22 . LEU A 1 539 ? 65.016  76.879  68.206  1.00 68.65  ? 605  LEU A HD22 1 
ATOM   7960  H HD23 . LEU A 1 539 ? 66.371  76.152  67.808  1.00 68.65  ? 605  LEU A HD23 1 
ATOM   7961  N N    . GLU A 1 540 ? 65.017  73.653  63.466  1.00 73.09  ? 606  GLU A N    1 
ATOM   7962  C CA   . GLU A 1 540 ? 64.078  72.708  62.860  1.00 69.44  ? 606  GLU A CA   1 
ATOM   7963  C C    . GLU A 1 540 ? 63.754  71.484  63.725  1.00 70.55  ? 606  GLU A C    1 
ATOM   7964  O O    . GLU A 1 540 ? 62.779  70.785  63.457  1.00 83.77  ? 606  GLU A O    1 
ATOM   7965  C CB   . GLU A 1 540 ? 64.584  72.229  61.494  1.00 78.04  ? 606  GLU A CB   1 
ATOM   7966  C CG   . GLU A 1 540 ? 64.696  73.317  60.419  1.00 87.00  ? 606  GLU A CG   1 
ATOM   7967  C CD   . GLU A 1 540 ? 66.116  73.859  60.239  1.00 94.45  ? 606  GLU A CD   1 
ATOM   7968  O OE1  . GLU A 1 540 ? 66.938  73.730  61.182  1.00 90.82  ? 606  GLU A OE1  1 
ATOM   7969  O OE2  . GLU A 1 540 ? 66.400  74.412  59.147  1.00 87.07  ? 606  GLU A OE2  1 
ATOM   7970  H H    . GLU A 1 540 ? 65.731  73.778  63.004  1.00 87.71  ? 606  GLU A H    1 
ATOM   7971  H HA   . GLU A 1 540 ? 63.242  73.175  62.706  1.00 83.33  ? 606  GLU A HA   1 
ATOM   7972  H HB2  . GLU A 1 540 ? 65.467  71.844  61.611  1.00 93.65  ? 606  GLU A HB2  1 
ATOM   7973  H HB3  . GLU A 1 540 ? 63.976  71.551  61.161  1.00 93.65  ? 606  GLU A HB3  1 
ATOM   7974  H HG2  . GLU A 1 540 ? 64.409  72.948  59.569  1.00 104.40 ? 606  GLU A HG2  1 
ATOM   7975  H HG3  . GLU A 1 540 ? 64.123  74.061  60.665  1.00 104.40 ? 606  GLU A HG3  1 
ATOM   7976  N N    . LYS A 1 541 ? 64.565  71.208  64.740  1.00 67.48  ? 607  LYS A N    1 
ATOM   7977  C CA   . LYS A 1 541 ? 64.302  70.070  65.616  1.00 66.54  ? 607  LYS A CA   1 
ATOM   7978  C C    . LYS A 1 541 ? 63.125  70.410  66.522  1.00 60.02  ? 607  LYS A C    1 
ATOM   7979  O O    . LYS A 1 541 ? 62.346  69.539  66.906  1.00 46.06  ? 607  LYS A O    1 
ATOM   7980  C CB   . LYS A 1 541 ? 65.545  69.714  66.455  1.00 72.28  ? 607  LYS A CB   1 
ATOM   7981  C CG   . LYS A 1 541 ? 66.837  69.543  65.644  1.00 83.31  ? 607  LYS A CG   1 
ATOM   7982  C CD   . LYS A 1 541 ? 67.580  68.235  65.965  1.00 84.59  ? 607  LYS A CD   1 
ATOM   7983  C CE   . LYS A 1 541 ? 68.944  68.162  65.254  1.00 84.45  ? 607  LYS A CE   1 
ATOM   7984  N NZ   . LYS A 1 541 ? 69.902  69.249  65.664  1.00 81.98  ? 607  LYS A NZ   1 
ATOM   7985  H H    . LYS A 1 541 ? 65.269  71.659  64.943  1.00 80.98  ? 607  LYS A H    1 
ATOM   7986  H HA   . LYS A 1 541 ? 64.063  69.298  65.080  1.00 79.84  ? 607  LYS A HA   1 
ATOM   7987  H HB2  . LYS A 1 541 ? 65.695  70.421  67.102  1.00 86.73  ? 607  LYS A HB2  1 
ATOM   7988  H HB3  . LYS A 1 541 ? 65.376  68.878  66.918  1.00 86.73  ? 607  LYS A HB3  1 
ATOM   7989  H HG2  . LYS A 1 541 ? 66.618  69.539  64.699  1.00 99.97  ? 607  LYS A HG2  1 
ATOM   7990  H HG3  . LYS A 1 541 ? 67.433  70.282  65.843  1.00 99.97  ? 607  LYS A HG3  1 
ATOM   7991  H HD2  . LYS A 1 541 ? 67.733  68.181  66.921  1.00 101.51 ? 607  LYS A HD2  1 
ATOM   7992  H HD3  . LYS A 1 541 ? 67.043  67.483  65.669  1.00 101.51 ? 607  LYS A HD3  1 
ATOM   7993  H HE2  . LYS A 1 541 ? 69.357  67.309  65.459  1.00 101.34 ? 607  LYS A HE2  1 
ATOM   7994  H HE3  . LYS A 1 541 ? 68.802  68.237  64.297  1.00 101.34 ? 607  LYS A HE3  1 
ATOM   7995  H HZ1  . LYS A 1 541 ? 70.671  69.158  65.225  1.00 98.38  ? 607  LYS A HZ1  1 
ATOM   7996  H HZ2  . LYS A 1 541 ? 69.555  70.047  65.478  1.00 98.38  ? 607  LYS A HZ2  1 
ATOM   7997  H HZ3  . LYS A 1 541 ? 70.061  69.199  66.539  1.00 98.38  ? 607  LYS A HZ3  1 
ATOM   7998  N N    . HIS A 1 542 ? 63.008  71.697  66.846  1.00 72.31  ? 608  HIS A N    1 
ATOM   7999  C CA   . HIS A 1 542 ? 61.960  72.216  67.731  1.00 64.95  ? 608  HIS A CA   1 
ATOM   8000  C C    . HIS A 1 542 ? 60.642  72.352  66.992  1.00 59.38  ? 608  HIS A C    1 
ATOM   8001  O O    . HIS A 1 542 ? 59.564  72.158  67.552  1.00 50.81  ? 608  HIS A O    1 
ATOM   8002  C CB   . HIS A 1 542 ? 62.345  73.609  68.223  1.00 59.05  ? 608  HIS A CB   1 
ATOM   8003  C CG   . HIS A 1 542 ? 63.610  73.651  69.014  1.00 65.22  ? 608  HIS A CG   1 
ATOM   8004  N ND1  . HIS A 1 542 ? 64.810  74.061  68.472  1.00 67.28  ? 608  HIS A ND1  1 
ATOM   8005  C CD2  . HIS A 1 542 ? 63.860  73.355  70.311  1.00 68.71  ? 608  HIS A CD2  1 
ATOM   8006  C CE1  . HIS A 1 542 ? 65.745  74.009  69.404  1.00 74.51  ? 608  HIS A CE1  1 
ATOM   8007  N NE2  . HIS A 1 542 ? 65.196  73.584  70.529  1.00 62.97  ? 608  HIS A NE2  1 
ATOM   8008  H H    . HIS A 1 542 ? 63.539  72.308  66.557  1.00 86.77  ? 608  HIS A H    1 
ATOM   8009  H HA   . HIS A 1 542 ? 61.842  71.628  68.493  1.00 77.94  ? 608  HIS A HA   1 
ATOM   8010  H HB2  . HIS A 1 542 ? 62.457  74.190  67.455  1.00 70.86  ? 608  HIS A HB2  1 
ATOM   8011  H HB3  . HIS A 1 542 ? 61.633  73.946  68.788  1.00 70.86  ? 608  HIS A HB3  1 
ATOM   8012  H HD1  . HIS A 1 542 ? 64.931  74.310  67.658  1.00 80.73  ? 608  HIS A HD1  1 
ATOM   8013  H HD2  . HIS A 1 542 ? 63.243  73.053  70.937  1.00 82.46  ? 608  HIS A HD2  1 
ATOM   8014  H HE1  . HIS A 1 542 ? 66.641  74.231  69.287  1.00 89.41  ? 608  HIS A HE1  1 
ATOM   8015  H HE2  . HIS A 1 542 ? 65.609  73.467  71.274  1.00 75.57  ? 608  HIS A HE2  1 
ATOM   8016  N N    . LEU A 1 543 ? 60.760  72.742  65.733  1.00 55.56  ? 609  LEU A N    1 
ATOM   8017  C CA   . LEU A 1 543 ? 59.632  72.861  64.838  1.00 60.28  ? 609  LEU A CA   1 
ATOM   8018  C C    . LEU A 1 543 ? 58.940  71.521  64.659  1.00 68.07  ? 609  LEU A C    1 
ATOM   8019  O O    . LEU A 1 543 ? 57.720  71.411  64.773  1.00 73.02  ? 609  LEU A O    1 
ATOM   8020  C CB   . LEU A 1 543 ? 60.137  73.363  63.500  1.00 50.56  ? 609  LEU A CB   1 
ATOM   8021  C CG   . LEU A 1 543 ? 59.177  73.276  62.328  1.00 54.23  ? 609  LEU A CG   1 
ATOM   8022  C CD1  . LEU A 1 543 ? 57.855  73.956  62.598  1.00 45.37  ? 609  LEU A CD1  1 
ATOM   8023  C CD2  . LEU A 1 543 ? 59.846  73.914  61.154  1.00 72.46  ? 609  LEU A CD2  1 
ATOM   8024  H H    . LEU A 1 543 ? 61.510  72.949  65.366  1.00 66.67  ? 609  LEU A H    1 
ATOM   8025  H HA   . LEU A 1 543 ? 58.994  73.500  65.194  1.00 72.33  ? 609  LEU A HA   1 
ATOM   8026  H HB2  . LEU A 1 543 ? 60.382  74.296  63.600  1.00 60.67  ? 609  LEU A HB2  1 
ATOM   8027  H HB3  . LEU A 1 543 ? 60.925  72.850  63.263  1.00 60.67  ? 609  LEU A HB3  1 
ATOM   8028  H HG   . LEU A 1 543 ? 59.006  72.344  62.117  1.00 65.08  ? 609  LEU A HG   1 
ATOM   8029  H HD11 . LEU A 1 543 ? 57.288  73.866  61.816  1.00 54.44  ? 609  LEU A HD11 1 
ATOM   8030  H HD12 . LEU A 1 543 ? 57.434  73.534  63.363  1.00 54.44  ? 609  LEU A HD12 1 
ATOM   8031  H HD13 . LEU A 1 543 ? 58.016  74.895  62.784  1.00 54.44  ? 609  LEU A HD13 1 
ATOM   8032  H HD21 . LEU A 1 543 ? 59.250  73.870  60.390  1.00 86.95  ? 609  LEU A HD21 1 
ATOM   8033  H HD22 . LEU A 1 543 ? 60.043  74.839  61.368  1.00 86.95  ? 609  LEU A HD22 1 
ATOM   8034  H HD23 . LEU A 1 543 ? 60.667  73.435  60.961  1.00 86.95  ? 609  LEU A HD23 1 
ATOM   8035  N N    . ASP A 1 544 ? 59.738  70.500  64.374  1.00 73.95  ? 610  ASP A N    1 
ATOM   8036  C CA   . ASP A 1 544 ? 59.254  69.134  64.306  1.00 75.75  ? 610  ASP A CA   1 
ATOM   8037  C C    . ASP A 1 544 ? 58.566  68.766  65.631  1.00 71.73  ? 610  ASP A C    1 
ATOM   8038  O O    . ASP A 1 544 ? 57.496  68.149  65.637  1.00 74.58  ? 610  ASP A O    1 
ATOM   8039  C CB   . ASP A 1 544 ? 60.437  68.205  63.992  1.00 70.27  ? 610  ASP A CB   1 
ATOM   8040  C CG   . ASP A 1 544 ? 60.025  66.754  63.816  1.00 97.40  ? 610  ASP A CG   1 
ATOM   8041  O OD1  . ASP A 1 544 ? 58.827  66.498  63.546  1.00 117.05 ? 610  ASP A OD1  1 
ATOM   8042  O OD2  . ASP A 1 544 ? 60.906  65.871  63.952  1.00 96.93  ? 610  ASP A OD2  1 
ATOM   8043  H H    . ASP A 1 544 ? 60.579  70.578  64.213  1.00 88.74  ? 610  ASP A H    1 
ATOM   8044  H HA   . ASP A 1 544 ? 58.604  69.056  63.590  1.00 90.89  ? 610  ASP A HA   1 
ATOM   8045  H HB2  . ASP A 1 544 ? 60.858  68.499  63.169  1.00 84.32  ? 610  ASP A HB2  1 
ATOM   8046  H HB3  . ASP A 1 544 ? 61.074  68.249  64.723  1.00 84.32  ? 610  ASP A HB3  1 
ATOM   8047  N N    . ALA A 1 545 ? 59.172  69.168  66.746  1.00 67.00  ? 611  ALA A N    1 
ATOM   8048  C CA   . ALA A 1 545 ? 58.633  68.872  68.073  1.00 61.10  ? 611  ALA A CA   1 
ATOM   8049  C C    . ALA A 1 545 ? 57.270  69.529  68.277  1.00 72.46  ? 611  ALA A C    1 
ATOM   8050  O O    . ALA A 1 545 ? 56.366  68.948  68.889  1.00 74.86  ? 611  ALA A O    1 
ATOM   8051  C CB   . ALA A 1 545 ? 59.599  69.338  69.144  1.00 45.18  ? 611  ALA A CB   1 
ATOM   8052  H H    . ALA A 1 545 ? 59.905  69.619  66.761  1.00 80.39  ? 611  ALA A H    1 
ATOM   8053  H HA   . ALA A 1 545 ? 58.522  67.912  68.164  1.00 73.32  ? 611  ALA A HA   1 
ATOM   8054  H HB1  . ALA A 1 545 ? 59.226  69.134  70.016  1.00 54.22  ? 611  ALA A HB1  1 
ATOM   8055  H HB2  . ALA A 1 545 ? 60.444  68.876  69.029  1.00 54.22  ? 611  ALA A HB2  1 
ATOM   8056  H HB3  . ALA A 1 545 ? 59.730  70.295  69.056  1.00 54.22  ? 611  ALA A HB3  1 
ATOM   8057  N N    . LEU A 1 546 ? 57.142  70.750  67.764  1.00 71.65  ? 612  LEU A N    1 
ATOM   8058  C CA   . LEU A 1 546 ? 55.912  71.520  67.877  1.00 64.21  ? 612  LEU A CA   1 
ATOM   8059  C C    . LEU A 1 546 ? 54.783  70.772  67.196  1.00 72.87  ? 612  LEU A C    1 
ATOM   8060  O O    . LEU A 1 546 ? 53.767  70.444  67.823  1.00 85.90  ? 612  LEU A O    1 
ATOM   8061  C CB   . LEU A 1 546 ? 56.084  72.891  67.215  1.00 64.40  ? 612  LEU A CB   1 
ATOM   8062  C CG   . LEU A 1 546 ? 54.820  73.739  67.055  1.00 50.12  ? 612  LEU A CG   1 
ATOM   8063  C CD1  . LEU A 1 546 ? 54.213  74.009  68.408  1.00 64.45  ? 612  LEU A CD1  1 
ATOM   8064  C CD2  . LEU A 1 546 ? 55.114  75.040  66.344  1.00 46.75  ? 612  LEU A CD2  1 
ATOM   8065  H H    . LEU A 1 546 ? 57.767  71.160  67.339  1.00 85.98  ? 612  LEU A H    1 
ATOM   8066  H HA   . LEU A 1 546 ? 55.687  71.647  68.812  1.00 77.05  ? 612  LEU A HA   1 
ATOM   8067  H HB2  . LEU A 1 546 ? 56.710  73.407  67.747  1.00 77.28  ? 612  LEU A HB2  1 
ATOM   8068  H HB3  . LEU A 1 546 ? 56.452  72.755  66.329  1.00 77.28  ? 612  LEU A HB3  1 
ATOM   8069  H HG   . LEU A 1 546 ? 54.172  73.247  66.527  1.00 60.15  ? 612  LEU A HG   1 
ATOM   8070  H HD11 . LEU A 1 546 ? 53.413  74.546  68.293  1.00 77.34  ? 612  LEU A HD11 1 
ATOM   8071  H HD12 . LEU A 1 546 ? 53.986  73.163  68.826  1.00 77.34  ? 612  LEU A HD12 1 
ATOM   8072  H HD13 . LEU A 1 546 ? 54.857  74.486  68.954  1.00 77.34  ? 612  LEU A HD13 1 
ATOM   8073  H HD21 . LEU A 1 546 ? 54.292  75.548  66.262  1.00 56.10  ? 612  LEU A HD21 1 
ATOM   8074  H HD22 . LEU A 1 546 ? 55.763  75.542  66.861  1.00 56.10  ? 612  LEU A HD22 1 
ATOM   8075  H HD23 . LEU A 1 546 ? 55.472  74.844  65.464  1.00 56.10  ? 612  LEU A HD23 1 
ATOM   8076  N N    . LEU A 1 547 ? 54.976  70.509  65.906  1.00 57.07  ? 613  LEU A N    1 
ATOM   8077  C CA   . LEU A 1 547 ? 53.991  69.807  65.107  1.00 54.52  ? 613  LEU A CA   1 
ATOM   8078  C C    . LEU A 1 547 ? 53.510  68.558  65.846  1.00 65.46  ? 613  LEU A C    1 
ATOM   8079  O O    . LEU A 1 547 ? 52.319  68.270  65.865  1.00 73.55  ? 613  LEU A O    1 
ATOM   8080  C CB   . LEU A 1 547 ? 54.583  69.458  63.743  1.00 57.41  ? 613  LEU A CB   1 
ATOM   8081  C CG   . LEU A 1 547 ? 55.179  70.639  62.966  1.00 51.20  ? 613  LEU A CG   1 
ATOM   8082  C CD1  . LEU A 1 547 ? 55.839  70.190  61.660  1.00 53.96  ? 613  LEU A CD1  1 
ATOM   8083  C CD2  . LEU A 1 547 ? 54.138  71.701  62.684  1.00 54.30  ? 613  LEU A CD2  1 
ATOM   8084  H H    . LEU A 1 547 ? 55.681  70.732  65.468  1.00 68.48  ? 613  LEU A H    1 
ATOM   8085  H HA   . LEU A 1 547 ? 53.226  70.386  64.965  1.00 65.43  ? 613  LEU A HA   1 
ATOM   8086  H HB2  . LEU A 1 547 ? 55.290  68.807  63.872  1.00 68.89  ? 613  LEU A HB2  1 
ATOM   8087  H HB3  . LEU A 1 547 ? 53.882  69.071  63.194  1.00 68.89  ? 613  LEU A HB3  1 
ATOM   8088  H HG   . LEU A 1 547 ? 55.868  71.048  63.513  1.00 61.44  ? 613  LEU A HG   1 
ATOM   8089  H HD11 . LEU A 1 547 ? 56.200  70.967  61.205  1.00 64.75  ? 613  LEU A HD11 1 
ATOM   8090  H HD12 . LEU A 1 547 ? 56.552  69.565  61.866  1.00 64.75  ? 613  LEU A HD12 1 
ATOM   8091  H HD13 . LEU A 1 547 ? 55.173  69.759  61.102  1.00 64.75  ? 613  LEU A HD13 1 
ATOM   8092  H HD21 . LEU A 1 547 ? 54.554  72.427  62.194  1.00 65.16  ? 613  LEU A HD21 1 
ATOM   8093  H HD22 . LEU A 1 547 ? 53.425  71.310  62.156  1.00 65.16  ? 613  LEU A HD22 1 
ATOM   8094  H HD23 . LEU A 1 547 ? 53.786  72.029  63.526  1.00 65.16  ? 613  LEU A HD23 1 
ATOM   8095  N N    . ARG A 1 548 ? 54.427  67.844  66.488  1.00 51.10  ? 614  ARG A N    1 
ATOM   8096  C CA   . ARG A 1 548 ? 54.078  66.601  67.159  1.00 54.06  ? 614  ARG A CA   1 
ATOM   8097  C C    . ARG A 1 548 ? 53.078  66.851  68.279  1.00 57.37  ? 614  ARG A C    1 
ATOM   8098  O O    . ARG A 1 548 ? 52.192  66.028  68.543  1.00 56.35  ? 614  ARG A O    1 
ATOM   8099  C CB   . ARG A 1 548 ? 55.331  65.935  67.733  1.00 69.46  ? 614  ARG A CB   1 
ATOM   8100  C CG   . ARG A 1 548 ? 55.554  64.505  67.250  1.00 75.51  ? 614  ARG A CG   1 
ATOM   8101  C CD   . ARG A 1 548 ? 56.464  63.690  68.184  1.00 84.22  ? 614  ARG A CD   1 
ATOM   8102  N NE   . ARG A 1 548 ? 57.629  64.429  68.676  1.00 90.32  ? 614  ARG A NE   1 
ATOM   8103  C CZ   . ARG A 1 548 ? 58.670  64.794  67.927  1.00 80.86  ? 614  ARG A CZ   1 
ATOM   8104  N NH1  . ARG A 1 548 ? 58.705  64.504  66.632  1.00 71.75  ? 614  ARG A NH1  1 
ATOM   8105  N NH2  . ARG A 1 548 ? 59.683  65.455  68.477  1.00 74.06  ? 614  ARG A NH2  1 
ATOM   8106  H H    . ARG A 1 548 ? 55.257  68.059  66.550  1.00 61.32  ? 614  ARG A H    1 
ATOM   8107  H HA   . ARG A 1 548 ? 53.675  65.993  66.519  1.00 64.88  ? 614  ARG A HA   1 
ATOM   8108  H HB2  . ARG A 1 548 ? 56.107  66.458  67.477  1.00 83.35  ? 614  ARG A HB2  1 
ATOM   8109  H HB3  . ARG A 1 548 ? 55.256  65.912  68.700  1.00 83.35  ? 614  ARG A HB3  1 
ATOM   8110  H HG2  . ARG A 1 548 ? 54.698  64.053  67.197  1.00 90.62  ? 614  ARG A HG2  1 
ATOM   8111  H HG3  . ARG A 1 548 ? 55.970  64.530  66.374  1.00 90.62  ? 614  ARG A HG3  1 
ATOM   8112  H HD2  . ARG A 1 548 ? 55.946  63.408  68.955  1.00 101.06 ? 614  ARG A HD2  1 
ATOM   8113  H HD3  . ARG A 1 548 ? 56.788  62.913  67.704  1.00 101.06 ? 614  ARG A HD3  1 
ATOM   8114  H HE   . ARG A 1 548 ? 57.643  64.644  69.509  1.00 108.39 ? 614  ARG A HE   1 
ATOM   8115  H HH11 . ARG A 1 548 ? 58.054  64.074  66.270  1.00 86.11  ? 614  ARG A HH11 1 
ATOM   8116  H HH12 . ARG A 1 548 ? 59.380  64.745  66.156  1.00 86.11  ? 614  ARG A HH12 1 
ATOM   8117  H HH21 . ARG A 1 548 ? 59.666  65.648  69.315  1.00 88.87  ? 614  ARG A HH21 1 
ATOM   8118  H HH22 . ARG A 1 548 ? 60.353  65.695  67.994  1.00 88.87  ? 614  ARG A HH22 1 
ATOM   8119  N N    . GLN A 1 549 ? 53.234  67.987  68.951  1.00 52.67  ? 615  GLN A N    1 
ATOM   8120  C CA   . GLN A 1 549 ? 52.365  68.330  70.076  1.00 65.05  ? 615  GLN A CA   1 
ATOM   8121  C C    . GLN A 1 549 ? 51.001  68.723  69.532  1.00 69.78  ? 615  GLN A C    1 
ATOM   8122  O O    . GLN A 1 549 ? 49.956  68.277  70.029  1.00 65.74  ? 615  GLN A O    1 
ATOM   8123  C CB   . GLN A 1 549 ? 52.967  69.467  70.912  1.00 40.46  ? 615  GLN A CB   1 
ATOM   8124  C CG   . GLN A 1 549 ? 54.229  69.080  71.639  1.00 40.54  ? 615  GLN A CG   1 
ATOM   8125  C CD   . GLN A 1 549 ? 54.023  67.878  72.522  1.00 49.52  ? 615  GLN A CD   1 
ATOM   8126  O OE1  . GLN A 1 549 ? 53.030  67.784  73.245  1.00 52.68  ? 615  GLN A OE1  1 
ATOM   8127  N NE2  . GLN A 1 549 ? 54.951  66.934  72.457  1.00 55.35  ? 615  GLN A NE2  1 
ATOM   8128  H H    . GLN A 1 549 ? 53.835  68.577  68.777  1.00 63.21  ? 615  GLN A H    1 
ATOM   8129  H HA   . GLN A 1 549 ? 52.255  67.554  70.648  1.00 78.06  ? 615  GLN A HA   1 
ATOM   8130  H HB2  . GLN A 1 549 ? 53.178  70.209  70.324  1.00 48.55  ? 615  GLN A HB2  1 
ATOM   8131  H HB3  . GLN A 1 549 ? 52.316  69.747  71.574  1.00 48.55  ? 615  GLN A HB3  1 
ATOM   8132  H HG2  . GLN A 1 549 ? 54.918  68.864  70.991  1.00 48.64  ? 615  GLN A HG2  1 
ATOM   8133  H HG3  . GLN A 1 549 ? 54.515  69.820  72.198  1.00 48.64  ? 615  GLN A HG3  1 
ATOM   8134  H HE21 . GLN A 1 549 ? 55.624  67.028  71.930  1.00 66.42  ? 615  GLN A HE21 1 
ATOM   8135  H HE22 . GLN A 1 549 ? 54.880  66.227  72.941  1.00 66.42  ? 615  GLN A HE22 1 
ATOM   8136  N N    . ILE A 1 550 ? 51.029  69.547  68.490  1.00 53.66  ? 616  ILE A N    1 
ATOM   8137  C CA   . ILE A 1 550 ? 49.813  69.954  67.812  1.00 52.73  ? 616  ILE A CA   1 
ATOM   8138  C C    . ILE A 1 550 ? 49.045  68.724  67.341  1.00 65.34  ? 616  ILE A C    1 
ATOM   8139  O O    . ILE A 1 550 ? 47.866  68.590  67.659  1.00 74.89  ? 616  ILE A O    1 
ATOM   8140  C CB   . ILE A 1 550 ? 50.108  70.872  66.625  1.00 46.98  ? 616  ILE A CB   1 
ATOM   8141  C CG1  . ILE A 1 550 ? 50.884  72.096  67.106  1.00 51.74  ? 616  ILE A CG1  1 
ATOM   8142  C CG2  . ILE A 1 550 ? 48.811  71.288  65.956  1.00 47.74  ? 616  ILE A CG2  1 
ATOM   8143  C CD1  . ILE A 1 550 ? 51.228  73.091  66.036  1.00 48.14  ? 616  ILE A CD1  1 
ATOM   8144  H H    . ILE A 1 550 ? 51.746  69.886  68.158  1.00 64.40  ? 616  ILE A H    1 
ATOM   8145  H HA   . ILE A 1 550 ? 49.250  70.439  68.435  1.00 63.28  ? 616  ILE A HA   1 
ATOM   8146  H HB   . ILE A 1 550 ? 50.651  70.389  65.982  1.00 56.37  ? 616  ILE A HB   1 
ATOM   8147  H HG12 . ILE A 1 550 ? 50.351  72.557  67.773  1.00 62.09  ? 616  ILE A HG12 1 
ATOM   8148  H HG13 . ILE A 1 550 ? 51.716  71.796  67.505  1.00 62.09  ? 616  ILE A HG13 1 
ATOM   8149  H HG21 . ILE A 1 550 ? 49.015  71.869  65.207  1.00 57.29  ? 616  ILE A HG21 1 
ATOM   8150  H HG22 . ILE A 1 550 ? 48.348  70.494  65.644  1.00 57.29  ? 616  ILE A HG22 1 
ATOM   8151  H HG23 . ILE A 1 550 ? 48.261  71.760  66.601  1.00 57.29  ? 616  ILE A HG23 1 
ATOM   8152  H HD11 . ILE A 1 550 ? 51.717  73.828  66.435  1.00 57.77  ? 616  ILE A HD11 1 
ATOM   8153  H HD12 . ILE A 1 550 ? 51.776  72.655  65.364  1.00 57.77  ? 616  ILE A HD12 1 
ATOM   8154  H HD13 . ILE A 1 550 ? 50.408  73.417  65.633  1.00 57.77  ? 616  ILE A HD13 1 
ATOM   8155  N N    . ARG A 1 551 ? 49.700  67.830  66.598  1.00 59.13  ? 617  ARG A N    1 
ATOM   8156  C CA   . ARG A 1 551 ? 49.047  66.595  66.181  1.00 52.13  ? 617  ARG A CA   1 
ATOM   8157  C C    . ARG A 1 551 ? 48.459  65.846  67.380  1.00 56.06  ? 617  ARG A C    1 
ATOM   8158  O O    . ARG A 1 551 ? 47.301  65.444  67.360  1.00 60.57  ? 617  ARG A O    1 
ATOM   8159  C CB   . ARG A 1 551 ? 50.006  65.687  65.418  1.00 53.20  ? 617  ARG A CB   1 
ATOM   8160  C CG   . ARG A 1 551 ? 50.283  66.113  63.996  1.00 52.53  ? 617  ARG A CG   1 
ATOM   8161  C CD   . ARG A 1 551 ? 50.765  64.913  63.184  1.00 68.31  ? 617  ARG A CD   1 
ATOM   8162  N NE   . ARG A 1 551 ? 51.873  65.274  62.302  1.00 102.46 ? 617  ARG A NE   1 
ATOM   8163  C CZ   . ARG A 1 551 ? 52.854  64.452  61.926  1.00 103.57 ? 617  ARG A CZ   1 
ATOM   8164  N NH1  . ARG A 1 551 ? 52.872  63.185  62.331  1.00 108.02 ? 617  ARG A NH1  1 
ATOM   8165  N NH2  . ARG A 1 551 ? 53.816  64.899  61.116  1.00 84.88  ? 617  ARG A NH2  1 
ATOM   8166  H H    . ARG A 1 551 ? 50.511  67.915  66.326  1.00 70.95  ? 617  ARG A H    1 
ATOM   8167  H HA   . ARG A 1 551 ? 48.315  66.817  65.585  1.00 62.55  ? 617  ARG A HA   1 
ATOM   8168  H HB2  . ARG A 1 551 ? 50.854  65.668  65.889  1.00 63.84  ? 617  ARG A HB2  1 
ATOM   8169  H HB3  . ARG A 1 551 ? 49.630  64.794  65.389  1.00 63.84  ? 617  ARG A HB3  1 
ATOM   8170  H HG2  . ARG A 1 551 ? 49.468  66.452  63.593  1.00 63.03  ? 617  ARG A HG2  1 
ATOM   8171  H HG3  . ARG A 1 551 ? 50.976  66.791  63.987  1.00 63.03  ? 617  ARG A HG3  1 
ATOM   8172  H HD2  . ARG A 1 551 ? 51.072  64.220  63.790  1.00 81.97  ? 617  ARG A HD2  1 
ATOM   8173  H HD3  . ARG A 1 551 ? 50.036  64.582  62.637  1.00 81.97  ? 617  ARG A HD3  1 
ATOM   8174  H HE   . ARG A 1 551 ? 51.893  66.079  62.001  1.00 122.95 ? 617  ARG A HE   1 
ATOM   8175  H HH11 . ARG A 1 551 ? 52.254  62.892  62.852  1.00 129.63 ? 617  ARG A HH11 1 
ATOM   8176  H HH12 . ARG A 1 551 ? 53.507  62.663  62.079  1.00 129.63 ? 617  ARG A HH12 1 
ATOM   8177  H HH21 . ARG A 1 551 ? 53.806  65.716  60.847  1.00 101.86 ? 617  ARG A HH21 1 
ATOM   8178  H HH22 . ARG A 1 551 ? 54.447  64.371  60.866  1.00 101.86 ? 617  ARG A HH22 1 
ATOM   8179  N N    . ASN A 1 552 ? 49.243  65.676  68.435  1.00 54.29  ? 618  ASN A N    1 
ATOM   8180  C CA   . ASN A 1 552 ? 48.752  64.956  69.596  1.00 60.70  ? 618  ASN A CA   1 
ATOM   8181  C C    . ASN A 1 552 ? 47.555  65.670  70.211  1.00 63.93  ? 618  ASN A C    1 
ATOM   8182  O O    . ASN A 1 552 ? 46.626  65.022  70.710  1.00 66.72  ? 618  ASN A O    1 
ATOM   8183  C CB   . ASN A 1 552 ? 49.865  64.774  70.637  1.00 79.25  ? 618  ASN A CB   1 
ATOM   8184  C CG   . ASN A 1 552 ? 49.358  64.130  71.930  1.00 84.30  ? 618  ASN A CG   1 
ATOM   8185  O OD1  . ASN A 1 552 ? 49.379  64.748  72.999  1.00 89.93  ? 618  ASN A OD1  1 
ATOM   8186  N ND2  . ASN A 1 552 ? 48.876  62.893  71.828  1.00 78.81  ? 618  ASN A ND2  1 
ATOM   8187  H H    . ASN A 1 552 ? 50.050  65.964  68.503  1.00 65.15  ? 618  ASN A H    1 
ATOM   8188  H HA   . ASN A 1 552 ? 48.460  64.074  69.317  1.00 72.84  ? 618  ASN A HA   1 
ATOM   8189  H HB2  . ASN A 1 552 ? 50.555  64.202  70.267  1.00 95.10  ? 618  ASN A HB2  1 
ATOM   8190  H HB3  . ASN A 1 552 ? 50.236  65.643  70.859  1.00 95.10  ? 618  ASN A HB3  1 
ATOM   8191  H HD21 . ASN A 1 552 ? 48.580  62.488  72.527  1.00 94.57  ? 618  ASN A HD21 1 
ATOM   8192  H HD22 . ASN A 1 552 ? 48.862  62.498  71.064  1.00 94.57  ? 618  ASN A HD22 1 
ATOM   8193  N N    . ILE A 1 553 ? 47.578  67.004  70.161  1.00 72.34  ? 619  ILE A N    1 
ATOM   8194  C CA   . ILE A 1 553 ? 46.456  67.824  70.643  1.00 62.17  ? 619  ILE A CA   1 
ATOM   8195  C C    . ILE A 1 553 ? 45.211  67.680  69.777  1.00 50.46  ? 619  ILE A C    1 
ATOM   8196  O O    . ILE A 1 553 ? 44.118  67.472  70.294  1.00 48.98  ? 619  ILE A O    1 
ATOM   8197  C CB   . ILE A 1 553 ? 46.820  69.328  70.724  1.00 47.78  ? 619  ILE A CB   1 
ATOM   8198  C CG1  . ILE A 1 553 ? 47.719  69.577  71.934  1.00 63.07  ? 619  ILE A CG1  1 
ATOM   8199  C CG2  . ILE A 1 553 ? 45.555  70.203  70.836  1.00 40.17  ? 619  ILE A CG2  1 
ATOM   8200  C CD1  . ILE A 1 553 ? 48.244  70.990  72.044  1.00 76.50  ? 619  ILE A CD1  1 
ATOM   8201  H H    . ILE A 1 553 ? 48.235  67.463  69.850  1.00 86.81  ? 619  ILE A H    1 
ATOM   8202  H HA   . ILE A 1 553 ? 46.224  67.531  71.538  1.00 74.60  ? 619  ILE A HA   1 
ATOM   8203  H HB   . ILE A 1 553 ? 47.303  69.577  69.920  1.00 57.33  ? 619  ILE A HB   1 
ATOM   8204  H HG12 . ILE A 1 553 ? 47.213  69.387  72.740  1.00 75.68  ? 619  ILE A HG12 1 
ATOM   8205  H HG13 . ILE A 1 553 ? 48.483  68.982  71.881  1.00 75.68  ? 619  ILE A HG13 1 
ATOM   8206  H HG21 . ILE A 1 553 ? 45.820  71.135  70.885  1.00 48.21  ? 619  ILE A HG21 1 
ATOM   8207  H HG22 . ILE A 1 553 ? 45.000  70.057  70.054  1.00 48.21  ? 619  ILE A HG22 1 
ATOM   8208  H HG23 . ILE A 1 553 ? 45.070  69.955  71.638  1.00 48.21  ? 619  ILE A HG23 1 
ATOM   8209  H HD11 . ILE A 1 553 ? 48.801  71.059  72.835  1.00 91.80  ? 619  ILE A HD11 1 
ATOM   8210  H HD12 . ILE A 1 553 ? 48.766  71.195  71.252  1.00 91.80  ? 619  ILE A HD12 1 
ATOM   8211  H HD13 . ILE A 1 553 ? 47.494  71.601  72.113  1.00 91.80  ? 619  ILE A HD13 1 
ATOM   8212  N N    . VAL A 1 554 ? 45.376  67.830  68.464  1.00 53.22  ? 620  VAL A N    1 
ATOM   8213  C CA   . VAL A 1 554 ? 44.252  67.730  67.548  1.00 46.28  ? 620  VAL A CA   1 
ATOM   8214  C C    . VAL A 1 554 ? 43.507  66.449  67.813  1.00 47.24  ? 620  VAL A C    1 
ATOM   8215  O O    . VAL A 1 554 ? 42.301  66.400  67.658  1.00 68.96  ? 620  VAL A O    1 
ATOM   8216  C CB   . VAL A 1 554 ? 44.676  67.714  66.070  1.00 50.42  ? 620  VAL A CB   1 
ATOM   8217  C CG1  . VAL A 1 554 ? 43.488  67.375  65.156  1.00 44.59  ? 620  VAL A CG1  1 
ATOM   8218  C CG2  . VAL A 1 554 ? 45.258  69.052  65.664  1.00 49.12  ? 620  VAL A CG2  1 
ATOM   8219  H H    . VAL A 1 554 ? 46.130  67.990  68.082  1.00 63.86  ? 620  VAL A H    1 
ATOM   8220  H HA   . VAL A 1 554 ? 43.648  68.475  67.690  1.00 55.54  ? 620  VAL A HA   1 
ATOM   8221  H HB   . VAL A 1 554 ? 45.358  67.037  65.942  1.00 60.50  ? 620  VAL A HB   1 
ATOM   8222  H HG11 . VAL A 1 554 ? 43.790  67.374  64.234  1.00 53.51  ? 620  VAL A HG11 1 
ATOM   8223  H HG12 . VAL A 1 554 ? 43.148  66.499  65.394  1.00 53.51  ? 620  VAL A HG12 1 
ATOM   8224  H HG13 . VAL A 1 554 ? 42.796  68.044  65.277  1.00 53.51  ? 620  VAL A HG13 1 
ATOM   8225  H HG21 . VAL A 1 554 ? 45.516  69.013  64.730  1.00 58.94  ? 620  VAL A HG21 1 
ATOM   8226  H HG22 . VAL A 1 554 ? 44.587  69.740  65.795  1.00 58.94  ? 620  VAL A HG22 1 
ATOM   8227  H HG23 . VAL A 1 554 ? 46.034  69.238  66.215  1.00 58.94  ? 620  VAL A HG23 1 
ATOM   8228  N N    . GLU A 1 555 ? 44.218  65.417  68.242  1.00 47.92  ? 621  GLU A N    1 
ATOM   8229  C CA   . GLU A 1 555 ? 43.631  64.089  68.276  1.00 67.85  ? 621  GLU A CA   1 
ATOM   8230  C C    . GLU A 1 555 ? 42.968  63.722  69.608  1.00 69.12  ? 621  GLU A C    1 
ATOM   8231  O O    . GLU A 1 555 ? 42.050  62.899  69.618  1.00 68.17  ? 621  GLU A O    1 
ATOM   8232  C CB   . GLU A 1 555 ? 44.671  63.055  67.831  1.00 75.58  ? 621  GLU A CB   1 
ATOM   8233  C CG   . GLU A 1 555 ? 45.174  63.331  66.399  1.00 81.50  ? 621  GLU A CG   1 
ATOM   8234  C CD   . GLU A 1 555 ? 45.721  62.097  65.694  1.00 92.51  ? 621  GLU A CD   1 
ATOM   8235  O OE1  . GLU A 1 555 ? 46.490  61.336  66.335  1.00 91.69  ? 621  GLU A OE1  1 
ATOM   8236  O OE2  . GLU A 1 555 ? 45.376  61.900  64.499  1.00 85.48  ? 621  GLU A OE2  1 
ATOM   8237  H H    . GLU A 1 555 ? 45.033  65.458  68.516  1.00 57.51  ? 621  GLU A H    1 
ATOM   8238  H HA   . GLU A 1 555 ? 42.926  64.070  67.610  1.00 81.42  ? 621  GLU A HA   1 
ATOM   8239  H HB2  . GLU A 1 555 ? 45.432  63.088  68.431  1.00 90.70  ? 621  GLU A HB2  1 
ATOM   8240  H HB3  . GLU A 1 555 ? 44.271  62.172  67.847  1.00 90.70  ? 621  GLU A HB3  1 
ATOM   8241  H HG2  . GLU A 1 555 ? 44.437  63.674  65.870  1.00 97.80  ? 621  GLU A HG2  1 
ATOM   8242  H HG3  . GLU A 1 555 ? 45.885  63.990  66.439  1.00 97.80  ? 621  GLU A HG3  1 
ATOM   8243  N N    . LYS A 1 556 ? 43.405  64.340  70.708  1.00 63.21  ? 622  LYS A N    1 
ATOM   8244  C CA   . LYS A 1 556 ? 42.783  64.119  72.025  1.00 54.27  ? 622  LYS A CA   1 
ATOM   8245  C C    . LYS A 1 556 ? 41.737  65.185  72.401  1.00 62.24  ? 622  LYS A C    1 
ATOM   8246  O O    . LYS A 1 556 ? 41.179  65.143  73.499  1.00 69.75  ? 622  LYS A O    1 
ATOM   8247  C CB   . LYS A 1 556 ? 43.852  64.057  73.129  1.00 64.44  ? 622  LYS A CB   1 
ATOM   8248  C CG   . LYS A 1 556 ? 44.399  65.435  73.570  1.00 85.28  ? 622  LYS A CG   1 
ATOM   8249  C CD   . LYS A 1 556 ? 45.347  65.353  74.771  1.00 82.05  ? 622  LYS A CD   1 
ATOM   8250  C CE   . LYS A 1 556 ? 46.706  65.951  74.430  1.00 84.22  ? 622  LYS A CE   1 
ATOM   8251  N NZ   . LYS A 1 556 ? 47.691  65.852  75.548  1.00 85.57  ? 622  LYS A NZ   1 
ATOM   8252  H H    . LYS A 1 556 ? 44.062  64.895  70.722  1.00 75.85  ? 622  LYS A H    1 
ATOM   8253  H HA   . LYS A 1 556 ? 42.330  63.261  72.010  1.00 65.12  ? 622  LYS A HA   1 
ATOM   8254  H HB2  . LYS A 1 556 ? 43.466  63.631  73.911  1.00 77.32  ? 622  LYS A HB2  1 
ATOM   8255  H HB3  . LYS A 1 556 ? 44.601  63.533  72.807  1.00 77.32  ? 622  LYS A HB3  1 
ATOM   8256  H HG2  . LYS A 1 556 ? 44.888  65.830  72.831  1.00 102.33 ? 622  LYS A HG2  1 
ATOM   8257  H HG3  . LYS A 1 556 ? 43.654  66.005  73.816  1.00 102.33 ? 622  LYS A HG3  1 
ATOM   8258  H HD2  . LYS A 1 556 ? 44.970  65.851  75.513  1.00 98.46  ? 622  LYS A HD2  1 
ATOM   8259  H HD3  . LYS A 1 556 ? 45.474  64.423  75.017  1.00 98.46  ? 622  LYS A HD3  1 
ATOM   8260  H HE2  . LYS A 1 556 ? 47.074  65.481  73.665  1.00 101.06 ? 622  LYS A HE2  1 
ATOM   8261  H HE3  . LYS A 1 556 ? 46.592  66.890  74.216  1.00 101.06 ? 622  LYS A HE3  1 
ATOM   8262  H HZ1  . LYS A 1 556 ? 47.384  66.284  76.263  1.00 102.69 ? 622  LYS A HZ1  1 
ATOM   8263  H HZ2  . LYS A 1 556 ? 47.824  64.998  75.761  1.00 102.69 ? 622  LYS A HZ2  1 
ATOM   8264  H HZ3  . LYS A 1 556 ? 48.467  66.213  75.303  1.00 102.69 ? 622  LYS A HZ3  1 
ATOM   8265  N N    . HIS A 1 557 ? 41.487  66.143  71.509  1.00 57.29  ? 623  HIS A N    1 
ATOM   8266  C CA   . HIS A 1 557 ? 40.553  67.237  71.790  1.00 44.01  ? 623  HIS A CA   1 
ATOM   8267  C C    . HIS A 1 557 ? 39.378  67.287  70.824  1.00 55.13  ? 623  HIS A C    1 
ATOM   8268  O O    . HIS A 1 557 ? 39.515  66.968  69.641  1.00 64.26  ? 623  HIS A O    1 
ATOM   8269  C CB   . HIS A 1 557 ? 41.283  68.579  71.765  1.00 61.21  ? 623  HIS A CB   1 
ATOM   8270  C CG   . HIS A 1 557 ? 41.906  68.947  73.077  1.00 66.55  ? 623  HIS A CG   1 
ATOM   8271  N ND1  . HIS A 1 557 ? 41.158  69.326  74.172  1.00 74.27  ? 623  HIS A ND1  1 
ATOM   8272  C CD2  . HIS A 1 557 ? 43.201  68.995  73.471  1.00 49.66  ? 623  HIS A CD2  1 
ATOM   8273  C CE1  . HIS A 1 557 ? 41.965  69.582  75.187  1.00 58.95  ? 623  HIS A CE1  1 
ATOM   8274  N NE2  . HIS A 1 557 ? 43.208  69.395  74.785  1.00 53.35  ? 623  HIS A NE2  1 
ATOM   8275  H H    . HIS A 1 557 ? 41.847  66.183  70.729  1.00 68.75  ? 623  HIS A H    1 
ATOM   8276  H HA   . HIS A 1 557 ? 40.193  67.114  72.683  1.00 52.81  ? 623  HIS A HA   1 
ATOM   8277  H HB2  . HIS A 1 557 ? 41.990  68.539  71.102  1.00 73.45  ? 623  HIS A HB2  1 
ATOM   8278  H HB3  . HIS A 1 557 ? 40.650  69.276  71.531  1.00 73.45  ? 623  HIS A HB3  1 
ATOM   8279  H HD1  . HIS A 1 557 ? 40.300  69.376  74.194  1.00 89.13  ? 623  HIS A HD1  1 
ATOM   8280  H HD2  . HIS A 1 557 ? 43.945  68.794  72.950  1.00 59.59  ? 623  HIS A HD2  1 
ATOM   8281  H HE1  . HIS A 1 557 ? 41.702  69.859  76.035  1.00 70.74  ? 623  HIS A HE1  1 
ATOM   8282  H HE2  . HIS A 1 557 ? 43.911  69.503  75.269  1.00 64.02  ? 623  HIS A HE2  1 
ATOM   8283  N N    . THR A 1 558 ? 38.222  67.698  71.336  1.00 57.15  ? 624  THR A N    1 
ATOM   8284  C CA   . THR A 1 558 ? 37.033  67.861  70.507  1.00 54.22  ? 624  THR A CA   1 
ATOM   8285  C C    . THR A 1 558 ? 36.321  69.191  70.766  1.00 59.63  ? 624  THR A C    1 
ATOM   8286  O O    . THR A 1 558 ? 35.207  69.408  70.283  1.00 61.55  ? 624  THR A O    1 
ATOM   8287  C CB   . THR A 1 558 ? 36.037  66.711  70.725  1.00 55.57  ? 624  THR A CB   1 
ATOM   8288  O OG1  . THR A 1 558 ? 35.561  66.732  72.079  1.00 58.48  ? 624  THR A OG1  1 
ATOM   8289  C CG2  . THR A 1 558 ? 36.705  65.373  70.426  1.00 64.41  ? 624  THR A CG2  1 
ATOM   8290  H H    . THR A 1 558 ? 38.100  67.890  72.166  1.00 68.58  ? 624  THR A H    1 
ATOM   8291  H HA   . THR A 1 558 ? 37.300  67.847  69.575  1.00 65.06  ? 624  THR A HA   1 
ATOM   8292  H HB   . THR A 1 558 ? 35.287  66.818  70.120  1.00 66.68  ? 624  THR A HB   1 
ATOM   8293  H HG1  . THR A 1 558 ? 35.175  67.462  72.236  1.00 70.18  ? 624  THR A HG1  1 
ATOM   8294  H HG21 . THR A 1 558 ? 36.074  64.649  70.565  1.00 77.29  ? 624  THR A HG21 1 
ATOM   8295  H HG22 . THR A 1 558 ? 37.010  65.353  69.506  1.00 77.29  ? 624  THR A HG22 1 
ATOM   8296  H HG23 . THR A 1 558 ? 37.467  65.244  71.013  1.00 77.29  ? 624  THR A HG23 1 
ATOM   8297  N N    . ASP A 1 559 ? 36.958  70.073  71.532  1.00 53.56  ? 625  ASP A N    1 
ATOM   8298  C CA   . ASP A 1 559 ? 36.445  71.425  71.743  1.00 43.98  ? 625  ASP A CA   1 
ATOM   8299  C C    . ASP A 1 559 ? 36.598  72.230  70.453  1.00 53.59  ? 625  ASP A C    1 
ATOM   8300  O O    . ASP A 1 559 ? 37.586  72.088  69.739  1.00 53.90  ? 625  ASP A O    1 
ATOM   8301  C CB   . ASP A 1 559 ? 37.202  72.099  72.883  1.00 48.74  ? 625  ASP A CB   1 
ATOM   8302  C CG   . ASP A 1 559 ? 36.772  73.535  73.112  1.00 71.37  ? 625  ASP A CG   1 
ATOM   8303  O OD1  . ASP A 1 559 ? 35.814  73.766  73.886  1.00 86.71  ? 625  ASP A OD1  1 
ATOM   8304  O OD2  . ASP A 1 559 ? 37.406  74.438  72.530  1.00 80.57  ? 625  ASP A OD2  1 
ATOM   8305  H H    . ASP A 1 559 ? 37.696  69.913  71.944  1.00 64.27  ? 625  ASP A H    1 
ATOM   8306  H HA   . ASP A 1 559 ? 35.504  71.385  71.976  1.00 52.77  ? 625  ASP A HA   1 
ATOM   8307  H HB2  . ASP A 1 559 ? 37.044  71.604  73.702  1.00 58.49  ? 625  ASP A HB2  1 
ATOM   8308  H HB3  . ASP A 1 559 ? 38.150  72.100  72.674  1.00 58.49  ? 625  ASP A HB3  1 
ATOM   8309  N N    . THR A 1 560 ? 35.621  73.074  70.144  1.00 48.32  ? 626  THR A N    1 
ATOM   8310  C CA   . THR A 1 560 ? 35.650  73.797  68.881  1.00 44.71  ? 626  THR A CA   1 
ATOM   8311  C C    . THR A 1 560 ? 36.828  74.767  68.807  1.00 52.59  ? 626  THR A C    1 
ATOM   8312  O O    . THR A 1 560 ? 37.535  74.823  67.796  1.00 50.24  ? 626  THR A O    1 
ATOM   8313  C CB   . THR A 1 560 ? 34.308  74.524  68.617  1.00 44.48  ? 626  THR A CB   1 
ATOM   8314  O OG1  . THR A 1 560 ? 33.404  73.626  67.952  1.00 53.09  ? 626  THR A OG1  1 
ATOM   8315  C CG2  . THR A 1 560 ? 34.497  75.773  67.746  1.00 34.66  ? 626  THR A CG2  1 
ATOM   8316  H H    . THR A 1 560 ? 34.940  73.244  70.641  1.00 57.98  ? 626  THR A H    1 
ATOM   8317  H HA   . THR A 1 560 ? 35.768  73.151  68.168  1.00 53.65  ? 626  THR A HA   1 
ATOM   8318  H HB   . THR A 1 560 ? 33.920  74.799  69.463  1.00 53.38  ? 626  THR A HB   1 
ATOM   8319  H HG1  . THR A 1 560 ? 32.673  74.012  67.804  1.00 63.71  ? 626  THR A HG1  1 
ATOM   8320  H HG21 . THR A 1 560 ? 33.642  76.206  67.597  1.00 41.59  ? 626  THR A HG21 1 
ATOM   8321  H HG22 . THR A 1 560 ? 35.094  76.397  68.187  1.00 41.59  ? 626  THR A HG22 1 
ATOM   8322  H HG23 . THR A 1 560 ? 34.878  75.524  66.889  1.00 41.59  ? 626  THR A HG23 1 
ATOM   8323  N N    . ASP A 1 561 ? 37.046  75.511  69.886  1.00 55.82  ? 627  ASP A N    1 
ATOM   8324  C CA   . ASP A 1 561 ? 38.073  76.553  69.913  1.00 48.84  ? 627  ASP A CA   1 
ATOM   8325  C C    . ASP A 1 561 ? 39.501  76.002  69.872  1.00 46.41  ? 627  ASP A C    1 
ATOM   8326  O O    . ASP A 1 561 ? 40.403  76.636  69.318  1.00 47.49  ? 627  ASP A O    1 
ATOM   8327  C CB   . ASP A 1 561 ? 37.877  77.437  71.144  1.00 46.65  ? 627  ASP A CB   1 
ATOM   8328  C CG   . ASP A 1 561 ? 36.502  78.064  71.187  1.00 65.89  ? 627  ASP A CG   1 
ATOM   8329  O OD1  . ASP A 1 561 ? 36.094  78.658  70.160  1.00 72.66  ? 627  ASP A OD1  1 
ATOM   8330  O OD2  . ASP A 1 561 ? 35.822  77.948  72.235  1.00 78.72  ? 627  ASP A OD2  1 
ATOM   8331  H H    . ASP A 1 561 ? 36.609  75.434  70.622  1.00 66.98  ? 627  ASP A H    1 
ATOM   8332  H HA   . ASP A 1 561 ? 37.958  77.115  69.131  1.00 58.61  ? 627  ASP A HA   1 
ATOM   8333  H HB2  . ASP A 1 561 ? 37.988  76.899  71.943  1.00 55.98  ? 627  ASP A HB2  1 
ATOM   8334  H HB3  . ASP A 1 561 ? 38.534  78.151  71.129  1.00 55.98  ? 627  ASP A HB3  1 
ATOM   8335  N N    . VAL A 1 562 ? 39.707  74.829  70.461  1.00 52.23  ? 628  VAL A N    1 
ATOM   8336  C CA   . VAL A 1 562 ? 41.005  74.171  70.400  1.00 54.42  ? 628  VAL A CA   1 
ATOM   8337  C C    . VAL A 1 562 ? 41.323  73.817  68.957  1.00 47.97  ? 628  VAL A C    1 
ATOM   8338  O O    . VAL A 1 562 ? 42.401  74.110  68.459  1.00 51.56  ? 628  VAL A O    1 
ATOM   8339  C CB   . VAL A 1 562 ? 41.039  72.883  71.256  1.00 58.85  ? 628  VAL A CB   1 
ATOM   8340  C CG1  . VAL A 1 562 ? 42.414  72.210  71.167  1.00 51.04  ? 628  VAL A CG1  1 
ATOM   8341  C CG2  . VAL A 1 562 ? 40.696  73.196  72.709  1.00 54.17  ? 628  VAL A CG2  1 
ATOM   8342  H H    . VAL A 1 562 ? 39.111  74.394  70.903  1.00 62.68  ? 628  VAL A H    1 
ATOM   8343  H HA   . VAL A 1 562 ? 41.690  74.775  70.727  1.00 65.30  ? 628  VAL A HA   1 
ATOM   8344  H HB   . VAL A 1 562 ? 40.377  72.261  70.918  1.00 70.62  ? 628  VAL A HB   1 
ATOM   8345  H HG11 . VAL A 1 562 ? 42.408  71.407  71.711  1.00 61.25  ? 628  VAL A HG11 1 
ATOM   8346  H HG12 . VAL A 1 562 ? 42.593  71.981  70.241  1.00 61.25  ? 628  VAL A HG12 1 
ATOM   8347  H HG13 . VAL A 1 562 ? 43.089  72.826  71.492  1.00 61.25  ? 628  VAL A HG13 1 
ATOM   8348  H HG21 . VAL A 1 562 ? 40.724  72.375  73.224  1.00 65.01  ? 628  VAL A HG21 1 
ATOM   8349  H HG22 . VAL A 1 562 ? 41.344  73.828  73.058  1.00 65.01  ? 628  VAL A HG22 1 
ATOM   8350  H HG23 . VAL A 1 562 ? 39.806  73.580  72.747  1.00 65.01  ? 628  VAL A HG23 1 
ATOM   8351  N N    . LEU A 1 563 ? 40.368  73.189  68.287  1.00 49.11  ? 629  LEU A N    1 
ATOM   8352  C CA   . LEU A 1 563 ? 40.576  72.720  66.927  1.00 51.76  ? 629  LEU A CA   1 
ATOM   8353  C C    . LEU A 1 563 ? 40.739  73.890  65.973  1.00 52.44  ? 629  LEU A C    1 
ATOM   8354  O O    . LEU A 1 563 ? 41.435  73.776  64.965  1.00 59.28  ? 629  LEU A O    1 
ATOM   8355  C CB   . LEU A 1 563 ? 39.427  71.803  66.490  1.00 38.85  ? 629  LEU A CB   1 
ATOM   8356  C CG   . LEU A 1 563 ? 39.262  70.577  67.396  1.00 47.46  ? 629  LEU A CG   1 
ATOM   8357  C CD1  . LEU A 1 563 ? 38.124  69.701  66.933  1.00 55.69  ? 629  LEU A CD1  1 
ATOM   8358  C CD2  . LEU A 1 563 ? 40.540  69.766  67.493  1.00 32.14  ? 629  LEU A CD2  1 
ATOM   8359  H H    . LEU A 1 563 ? 39.584  73.021  68.601  1.00 58.93  ? 629  LEU A H    1 
ATOM   8360  H HA   . LEU A 1 563 ? 41.395  72.200  66.899  1.00 62.12  ? 629  LEU A HA   1 
ATOM   8361  H HB2  . LEU A 1 563 ? 38.597  72.306  66.512  1.00 46.62  ? 629  LEU A HB2  1 
ATOM   8362  H HB3  . LEU A 1 563 ? 39.599  71.489  65.589  1.00 46.62  ? 629  LEU A HB3  1 
ATOM   8363  H HG   . LEU A 1 563 ? 39.046  70.885  68.290  1.00 56.95  ? 629  LEU A HG   1 
ATOM   8364  H HD11 . LEU A 1 563 ? 38.051  68.939  67.528  1.00 66.83  ? 629  LEU A HD11 1 
ATOM   8365  H HD12 . LEU A 1 563 ? 37.302  70.216  66.952  1.00 66.83  ? 629  LEU A HD12 1 
ATOM   8366  H HD13 . LEU A 1 563 ? 38.306  69.400  66.029  1.00 66.83  ? 629  LEU A HD13 1 
ATOM   8367  H HD21 . LEU A 1 563 ? 40.387  69.005  68.074  1.00 38.57  ? 629  LEU A HD21 1 
ATOM   8368  H HD22 . LEU A 1 563 ? 40.788  69.462  66.606  1.00 38.57  ? 629  LEU A HD22 1 
ATOM   8369  H HD23 . LEU A 1 563 ? 41.242  70.326  67.859  1.00 38.57  ? 629  LEU A HD23 1 
ATOM   8370  N N    . GLU A 1 564 ? 40.111  75.017  66.293  1.00 48.26  ? 630  GLU A N    1 
ATOM   8371  C CA   . GLU A 1 564 ? 40.258  76.210  65.475  1.00 40.04  ? 630  GLU A CA   1 
ATOM   8372  C C    . GLU A 1 564 ? 41.663  76.777  65.601  1.00 45.21  ? 630  GLU A C    1 
ATOM   8373  O O    . GLU A 1 564 ? 42.251  77.204  64.607  1.00 43.77  ? 630  GLU A O    1 
ATOM   8374  C CB   . GLU A 1 564 ? 39.216  77.262  65.854  1.00 42.47  ? 630  GLU A CB   1 
ATOM   8375  C CG   . GLU A 1 564 ? 39.432  78.617  65.174  1.00 58.63  ? 630  GLU A CG   1 
ATOM   8376  C CD   . GLU A 1 564 ? 38.282  79.591  65.388  1.00 58.82  ? 630  GLU A CD   1 
ATOM   8377  O OE1  . GLU A 1 564 ? 37.187  79.154  65.813  1.00 62.58  ? 630  GLU A OE1  1 
ATOM   8378  O OE2  . GLU A 1 564 ? 38.481  80.797  65.133  1.00 51.07  ? 630  GLU A OE2  1 
ATOM   8379  H H    . GLU A 1 564 ? 39.597  75.115  66.975  1.00 57.92  ? 630  GLU A H    1 
ATOM   8380  H HA   . GLU A 1 564 ? 40.116  75.973  64.546  1.00 48.05  ? 630  GLU A HA   1 
ATOM   8381  H HB2  . GLU A 1 564 ? 38.338  76.939  65.598  1.00 50.97  ? 630  GLU A HB2  1 
ATOM   8382  H HB3  . GLU A 1 564 ? 39.248  77.403  66.813  1.00 50.97  ? 630  GLU A HB3  1 
ATOM   8383  H HG2  . GLU A 1 564 ? 40.237  79.023  65.532  1.00 70.35  ? 630  GLU A HG2  1 
ATOM   8384  H HG3  . GLU A 1 564 ? 39.530  78.477  64.219  1.00 70.35  ? 630  GLU A HG3  1 
ATOM   8385  N N    . ALA A 1 565 ? 42.208  76.786  66.815  1.00 41.98  ? 631  ALA A N    1 
ATOM   8386  C CA   . ALA A 1 565 ? 43.561  77.300  67.013  1.00 33.37  ? 631  ALA A CA   1 
ATOM   8387  C C    . ALA A 1 565 ? 44.542  76.451  66.230  1.00 40.25  ? 631  ALA A C    1 
ATOM   8388  O O    . ALA A 1 565 ? 45.342  76.977  65.457  1.00 58.28  ? 631  ALA A O    1 
ATOM   8389  C CB   . ALA A 1 565 ? 43.923  77.305  68.471  1.00 34.18  ? 631  ALA A CB   1 
ATOM   8390  H H    . ALA A 1 565 ? 41.822  76.505  67.530  1.00 50.38  ? 631  ALA A H    1 
ATOM   8391  H HA   . ALA A 1 565 ? 43.611  78.210  66.682  1.00 40.05  ? 631  ALA A HA   1 
ATOM   8392  H HB1  . ALA A 1 565 ? 44.824  77.650  68.571  1.00 41.02  ? 631  ALA A HB1  1 
ATOM   8393  H HB2  . ALA A 1 565 ? 43.297  77.870  68.950  1.00 41.02  ? 631  ALA A HB2  1 
ATOM   8394  H HB3  . ALA A 1 565 ? 43.876  76.397  68.811  1.00 41.02  ? 631  ALA A HB3  1 
ATOM   8395  N N    . CYS A 1 566 ? 44.457  75.138  66.439  1.00 37.67  ? 632  CYS A N    1 
ATOM   8396  C CA   . CYS A 1 566 ? 45.247  74.151  65.714  1.00 33.68  ? 632  CYS A CA   1 
ATOM   8397  C C    . CYS A 1 566 ? 45.246  74.422  64.223  1.00 43.62  ? 632  CYS A C    1 
ATOM   8398  O O    . CYS A 1 566 ? 46.294  74.594  63.598  1.00 60.31  ? 632  CYS A O    1 
ATOM   8399  C CB   . CYS A 1 566 ? 44.651  72.769  65.936  1.00 36.09  ? 632  CYS A CB   1 
ATOM   8400  S SG   . CYS A 1 566 ? 44.991  72.031  67.535  1.00 47.91  ? 632  CYS A SG   1 
ATOM   8401  H H    . CYS A 1 566 ? 43.928  74.785  67.018  1.00 45.21  ? 632  CYS A H    1 
ATOM   8402  H HA   . CYS A 1 566 ? 46.162  74.156  66.036  1.00 40.42  ? 632  CYS A HA   1 
ATOM   8403  H HB2  . CYS A 1 566 ? 43.688  72.831  65.843  1.00 43.31  ? 632  CYS A HB2  1 
ATOM   8404  H HB3  . CYS A 1 566 ? 45.004  72.170  65.259  1.00 43.31  ? 632  CYS A HB3  1 
ATOM   8405  H HG   . CYS A 1 566 ? 44.471  70.951  67.586  1.00 57.50  ? 632  CYS A HG   1 
ATOM   8406  N N    . SER A 1 567 ? 44.049  74.451  63.656  1.00 40.73  ? 633  SER A N    1 
ATOM   8407  C CA   . SER A 1 567 ? 43.887  74.668  62.233  1.00 40.78  ? 633  SER A CA   1 
ATOM   8408  C C    . SER A 1 567 ? 44.511  75.997  61.804  1.00 48.16  ? 633  SER A C    1 
ATOM   8409  O O    . SER A 1 567 ? 45.252  76.066  60.822  1.00 48.34  ? 633  SER A O    1 
ATOM   8410  C CB   . SER A 1 567 ? 42.406  74.635  61.874  1.00 27.00  ? 633  SER A CB   1 
ATOM   8411  O OG   . SER A 1 567 ? 42.229  74.609  60.469  1.00 43.90  ? 633  SER A OG   1 
ATOM   8412  H H    . SER A 1 567 ? 43.309  74.346  64.081  1.00 48.88  ? 633  SER A H    1 
ATOM   8413  H HA   . SER A 1 567 ? 44.332  73.955  61.749  1.00 48.94  ? 633  SER A HA   1 
ATOM   8414  H HB2  . SER A 1 567 ? 42.005  73.840  62.258  1.00 32.40  ? 633  SER A HB2  1 
ATOM   8415  H HB3  . SER A 1 567 ? 41.977  75.429  62.231  1.00 32.40  ? 633  SER A HB3  1 
ATOM   8416  H HG   . SER A 1 567 ? 41.410  74.591  60.283  1.00 52.68  ? 633  SER A HG   1 
ATOM   8417  N N    . LYS A 1 568 ? 44.226  77.050  62.559  1.00 47.74  ? 634  LYS A N    1 
ATOM   8418  C CA   . LYS A 1 568 ? 44.684  78.379  62.187  1.00 52.14  ? 634  LYS A CA   1 
ATOM   8419  C C    . LYS A 1 568 ? 46.209  78.477  62.311  1.00 55.94  ? 634  LYS A C    1 
ATOM   8420  O O    . LYS A 1 568 ? 46.857  79.230  61.569  1.00 50.28  ? 634  LYS A O    1 
ATOM   8421  C CB   . LYS A 1 568 ? 43.977  79.452  63.037  1.00 52.51  ? 634  LYS A CB   1 
ATOM   8422  C CG   . LYS A 1 568 ? 42.729  80.090  62.378  1.00 45.56  ? 634  LYS A CG   1 
ATOM   8423  C CD   . LYS A 1 568 ? 41.809  80.717  63.437  1.00 47.95  ? 634  LYS A CD   1 
ATOM   8424  C CE   . LYS A 1 568 ? 40.583  81.408  62.857  1.00 36.37  ? 634  LYS A CE   1 
ATOM   8425  N NZ   . LYS A 1 568 ? 40.904  82.692  62.180  1.00 54.76  ? 634  LYS A NZ   1 
ATOM   8426  H H    . LYS A 1 568 ? 43.772  77.021  63.288  1.00 57.29  ? 634  LYS A H    1 
ATOM   8427  H HA   . LYS A 1 568 ? 44.453  78.539  61.259  1.00 62.56  ? 634  LYS A HA   1 
ATOM   8428  H HB2  . LYS A 1 568 ? 43.693  79.047  63.871  1.00 63.01  ? 634  LYS A HB2  1 
ATOM   8429  H HB3  . LYS A 1 568 ? 44.608  80.166  63.220  1.00 63.01  ? 634  LYS A HB3  1 
ATOM   8430  H HG2  . LYS A 1 568 ? 43.009  80.787  61.765  1.00 54.67  ? 634  LYS A HG2  1 
ATOM   8431  H HG3  . LYS A 1 568 ? 42.229  79.406  61.906  1.00 54.67  ? 634  LYS A HG3  1 
ATOM   8432  H HD2  . LYS A 1 568 ? 41.500  80.019  64.036  1.00 57.55  ? 634  LYS A HD2  1 
ATOM   8433  H HD3  . LYS A 1 568 ? 42.313  81.378  63.937  1.00 57.55  ? 634  LYS A HD3  1 
ATOM   8434  H HE2  . LYS A 1 568 ? 40.170  80.821  62.205  1.00 43.64  ? 634  LYS A HE2  1 
ATOM   8435  H HE3  . LYS A 1 568 ? 39.959  81.596  63.575  1.00 43.64  ? 634  LYS A HE3  1 
ATOM   8436  H HZ1  . LYS A 1 568 ? 40.160  83.060  61.857  1.00 65.71  ? 634  LYS A HZ1  1 
ATOM   8437  H HZ2  . LYS A 1 568 ? 41.278  83.256  62.758  1.00 65.71  ? 634  LYS A HZ2  1 
ATOM   8438  H HZ3  . LYS A 1 568 ? 41.471  82.549  61.508  1.00 65.71  ? 634  LYS A HZ3  1 
ATOM   8439  N N    . THR A 1 569 ? 46.765  77.696  63.241  1.00 48.94  ? 635  THR A N    1 
ATOM   8440  C CA   . THR A 1 569 ? 48.207  77.685  63.506  1.00 53.28  ? 635  THR A CA   1 
ATOM   8441  C C    . THR A 1 569 ? 48.981  76.896  62.449  1.00 54.13  ? 635  THR A C    1 
ATOM   8442  O O    . THR A 1 569 ? 50.050  77.320  61.996  1.00 51.64  ? 635  THR A O    1 
ATOM   8443  C CB   . THR A 1 569 ? 48.506  77.098  64.900  1.00 49.78  ? 635  THR A CB   1 
ATOM   8444  O OG1  . THR A 1 569 ? 48.067  78.024  65.898  1.00 73.43  ? 635  THR A OG1  1 
ATOM   8445  C CG2  . THR A 1 569 ? 50.001  76.836  65.099  1.00 36.89  ? 635  THR A CG2  1 
ATOM   8446  H H    . THR A 1 569 ? 46.320  77.155  63.740  1.00 58.73  ? 635  THR A H    1 
ATOM   8447  H HA   . THR A 1 569 ? 48.534  78.598  63.492  1.00 63.93  ? 635  THR A HA   1 
ATOM   8448  H HB   . THR A 1 569 ? 48.031  76.259  65.006  1.00 59.73  ? 635  THR A HB   1 
ATOM   8449  H HG1  . THR A 1 569 ? 48.225  77.717  66.664  1.00 88.11  ? 635  THR A HG1  1 
ATOM   8450  H HG21 . THR A 1 569 ? 50.158  76.468  65.982  1.00 44.27  ? 635  THR A HG21 1 
ATOM   8451  H HG22 . THR A 1 569 ? 50.318  76.206  64.433  1.00 44.27  ? 635  THR A HG22 1 
ATOM   8452  H HG23 . THR A 1 569 ? 50.497  77.665  65.009  1.00 44.27  ? 635  THR A HG23 1 
ATOM   8453  N N    . TYR A 1 570 ? 48.448  75.743  62.066  1.00 40.07  ? 636  TYR A N    1 
ATOM   8454  C CA   . TYR A 1 570 ? 48.975  75.028  60.920  1.00 44.99  ? 636  TYR A CA   1 
ATOM   8455  C C    . TYR A 1 570 ? 48.945  75.898  59.646  1.00 55.91  ? 636  TYR A C    1 
ATOM   8456  O O    . TYR A 1 570 ? 49.768  75.729  58.745  1.00 60.43  ? 636  TYR A O    1 
ATOM   8457  C CB   . TYR A 1 570 ? 48.170  73.764  60.696  1.00 41.73  ? 636  TYR A CB   1 
ATOM   8458  C CG   . TYR A 1 570 ? 48.910  72.492  61.021  1.00 52.62  ? 636  TYR A CG   1 
ATOM   8459  C CD1  . TYR A 1 570 ? 49.959  72.043  60.215  1.00 57.25  ? 636  TYR A CD1  1 
ATOM   8460  C CD2  . TYR A 1 570 ? 48.542  71.715  62.113  1.00 44.63  ? 636  TYR A CD2  1 
ATOM   8461  C CE1  . TYR A 1 570 ? 50.631  70.859  60.507  1.00 47.61  ? 636  TYR A CE1  1 
ATOM   8462  C CE2  . TYR A 1 570 ? 49.200  70.534  62.400  1.00 52.53  ? 636  TYR A CE2  1 
ATOM   8463  C CZ   . TYR A 1 570 ? 50.243  70.112  61.599  1.00 46.65  ? 636  TYR A CZ   1 
ATOM   8464  O OH   . TYR A 1 570 ? 50.890  68.938  61.912  1.00 51.58  ? 636  TYR A OH   1 
ATOM   8465  H H    . TYR A 1 570 ? 47.784  75.357  62.452  1.00 48.09  ? 636  TYR A H    1 
ATOM   8466  H HA   . TYR A 1 570 ? 49.895  74.777  61.095  1.00 53.99  ? 636  TYR A HA   1 
ATOM   8467  H HB2  . TYR A 1 570 ? 47.379  73.797  61.257  1.00 50.07  ? 636  TYR A HB2  1 
ATOM   8468  H HB3  . TYR A 1 570 ? 47.909  73.723  59.763  1.00 50.07  ? 636  TYR A HB3  1 
ATOM   8469  H HD1  . TYR A 1 570 ? 50.219  72.547  59.478  1.00 68.70  ? 636  TYR A HD1  1 
ATOM   8470  H HD2  . TYR A 1 570 ? 47.839  71.991  62.655  1.00 53.56  ? 636  TYR A HD2  1 
ATOM   8471  H HE1  . TYR A 1 570 ? 51.332  70.573  59.967  1.00 57.13  ? 636  TYR A HE1  1 
ATOM   8472  H HE2  . TYR A 1 570 ? 48.947  70.028  63.139  1.00 63.04  ? 636  TYR A HE2  1 
ATOM   8473  H HH   . TYR A 1 570 ? 50.546  68.594  62.598  1.00 61.90  ? 636  TYR A HH   1 
ATOM   8474  N N    . HIS A 1 571 ? 48.004  76.834  59.566  1.00 49.05  ? 637  HIS A N    1 
ATOM   8475  C CA   . HIS A 1 571 ? 47.907  77.679  58.378  1.00 61.55  ? 637  HIS A CA   1 
ATOM   8476  C C    . HIS A 1 571 ? 49.058  78.690  58.343  1.00 54.82  ? 637  HIS A C    1 
ATOM   8477  O O    . HIS A 1 571 ? 49.606  78.996  57.276  1.00 58.37  ? 637  HIS A O    1 
ATOM   8478  C CB   . HIS A 1 571 ? 46.533  78.384  58.280  1.00 50.23  ? 637  HIS A CB   1 
ATOM   8479  C CG   . HIS A 1 571 ? 46.377  79.220  57.046  1.00 28.13  ? 637  HIS A CG   1 
ATOM   8480  N ND1  . HIS A 1 571 ? 46.182  80.582  57.086  1.00 59.25  ? 637  HIS A ND1  1 
ATOM   8481  C CD2  . HIS A 1 571 ? 46.440  78.894  55.735  1.00 62.51  ? 637  HIS A CD2  1 
ATOM   8482  C CE1  . HIS A 1 571 ? 46.101  81.057  55.856  1.00 46.19  ? 637  HIS A CE1  1 
ATOM   8483  N NE2  . HIS A 1 571 ? 46.258  80.052  55.017  1.00 58.93  ? 637  HIS A NE2  1 
ATOM   8484  H H    . HIS A 1 571 ? 47.418  76.998  60.174  1.00 58.86  ? 637  HIS A H    1 
ATOM   8485  H HA   . HIS A 1 571 ? 47.997  77.113  57.595  1.00 73.86  ? 637  HIS A HA   1 
ATOM   8486  H HB2  . HIS A 1 571 ? 45.835  77.710  58.274  1.00 60.28  ? 637  HIS A HB2  1 
ATOM   8487  H HB3  . HIS A 1 571 ? 46.423  78.965  59.049  1.00 60.28  ? 637  HIS A HB3  1 
ATOM   8488  H HD1  . HIS A 1 571 ? 46.108  81.050  57.804  1.00 71.10  ? 637  HIS A HD1  1 
ATOM   8489  H HD2  . HIS A 1 571 ? 46.570  78.042  55.385  1.00 75.01  ? 637  HIS A HD2  1 
ATOM   8490  H HE1  . HIS A 1 571 ? 45.963  81.947  55.623  1.00 55.43  ? 637  HIS A HE1  1 
ATOM   8491  H HE2  . HIS A 1 571 ? 46.245  80.111  54.159  1.00 70.71  ? 637  HIS A HE2  1 
ATOM   8492  N N    . ALA A 1 572 ? 49.414  79.202  59.514  1.00 47.94  ? 638  ALA A N    1 
ATOM   8493  C CA   . ALA A 1 572 ? 50.502  80.159  59.630  1.00 53.55  ? 638  ALA A CA   1 
ATOM   8494  C C    . ALA A 1 572 ? 51.830  79.489  59.283  1.00 65.37  ? 638  ALA A C    1 
ATOM   8495  O O    . ALA A 1 572 ? 52.669  80.071  58.584  1.00 68.58  ? 638  ALA A O    1 
ATOM   8496  C CB   . ALA A 1 572 ? 50.551  80.717  61.035  1.00 29.04  ? 638  ALA A CB   1 
ATOM   8497  H H    . ALA A 1 572 ? 49.038  79.008  60.263  1.00 57.52  ? 638  ALA A H    1 
ATOM   8498  H HA   . ALA A 1 572 ? 50.356  80.892  59.012  1.00 64.25  ? 638  ALA A HA   1 
ATOM   8499  H HB1  . ALA A 1 572 ? 51.280  81.354  61.096  1.00 34.85  ? 638  ALA A HB1  1 
ATOM   8500  H HB2  . ALA A 1 572 ? 49.709  81.159  61.228  1.00 34.85  ? 638  ALA A HB2  1 
ATOM   8501  H HB3  . ALA A 1 572 ? 50.693  79.989  61.659  1.00 34.85  ? 638  ALA A HB3  1 
ATOM   8502  N N    . LEU A 1 573 ? 52.005  78.261  59.774  1.00 55.81  ? 639  LEU A N    1 
ATOM   8503  C CA   . LEU A 1 573 ? 53.232  77.505  59.559  1.00 47.34  ? 639  LEU A CA   1 
ATOM   8504  C C    . LEU A 1 573 ? 53.357  76.919  58.143  1.00 56.81  ? 639  LEU A C    1 
ATOM   8505  O O    . LEU A 1 573 ? 54.435  76.506  57.735  1.00 62.40  ? 639  LEU A O    1 
ATOM   8506  C CB   . LEU A 1 573 ? 53.354  76.400  60.613  1.00 43.37  ? 639  LEU A CB   1 
ATOM   8507  C CG   . LEU A 1 573 ? 53.619  76.855  62.060  1.00 50.73  ? 639  LEU A CG   1 
ATOM   8508  C CD1  . LEU A 1 573 ? 53.711  75.672  63.024  1.00 30.89  ? 639  LEU A CD1  1 
ATOM   8509  C CD2  . LEU A 1 573 ? 54.878  77.693  62.168  1.00 30.70  ? 639  LEU A CD2  1 
ATOM   8510  H H    . LEU A 1 573 ? 51.418  77.841  60.241  1.00 66.97  ? 639  LEU A H    1 
ATOM   8511  H HA   . LEU A 1 573 ? 53.983  78.106  59.686  1.00 56.81  ? 639  LEU A HA   1 
ATOM   8512  H HB2  . LEU A 1 573 ? 52.527  75.894  60.618  1.00 52.05  ? 639  LEU A HB2  1 
ATOM   8513  H HB3  . LEU A 1 573 ? 54.085  75.817  60.356  1.00 52.05  ? 639  LEU A HB3  1 
ATOM   8514  H HG   . LEU A 1 573 ? 52.876  77.408  62.349  1.00 60.87  ? 639  LEU A HG   1 
ATOM   8515  H HD11 . LEU A 1 573 ? 53.878  76.006  63.919  1.00 37.07  ? 639  LEU A HD11 1 
ATOM   8516  H HD12 . LEU A 1 573 ? 52.873  75.183  63.004  1.00 37.07  ? 639  LEU A HD12 1 
ATOM   8517  H HD13 . LEU A 1 573 ? 54.438  75.094  62.745  1.00 37.07  ? 639  LEU A HD13 1 
ATOM   8518  H HD21 . LEU A 1 573 ? 55.004  77.955  63.093  1.00 36.84  ? 639  LEU A HD21 1 
ATOM   8519  H HD22 . LEU A 1 573 ? 55.635  77.166  61.867  1.00 36.84  ? 639  LEU A HD22 1 
ATOM   8520  H HD23 . LEU A 1 573 ? 54.781  78.481  61.611  1.00 36.84  ? 639  LEU A HD23 1 
ATOM   8521  N N    . CYS A 1 574 ? 52.260  76.888  57.395  1.00 66.45  ? 640  CYS A N    1 
ATOM   8522  C CA   . CYS A 1 574 ? 52.287  76.457  55.996  1.00 52.74  ? 640  CYS A CA   1 
ATOM   8523  C C    . CYS A 1 574 ? 52.329  77.638  55.045  1.00 55.74  ? 640  CYS A C    1 
ATOM   8524  O O    . CYS A 1 574 ? 51.573  77.686  54.075  1.00 75.12  ? 640  CYS A O    1 
ATOM   8525  C CB   . CYS A 1 574 ? 51.067  75.586  55.686  1.00 50.28  ? 640  CYS A CB   1 
ATOM   8526  S SG   . CYS A 1 574 ? 51.394  73.841  55.869  1.00 76.66  ? 640  CYS A SG   1 
ATOM   8527  H H    . CYS A 1 574 ? 51.479  77.114  57.674  1.00 79.74  ? 640  CYS A H    1 
ATOM   8528  H HA   . CYS A 1 574 ? 53.082  75.923  55.846  1.00 63.29  ? 640  CYS A HA   1 
ATOM   8529  H HB2  . CYS A 1 574 ? 50.349  75.821  56.294  1.00 60.34  ? 640  CYS A HB2  1 
ATOM   8530  H HB3  . CYS A 1 574 ? 50.792  75.744  54.770  1.00 60.34  ? 640  CYS A HB3  1 
ATOM   8531  H HG   . CYS A 1 574 ? 50.396  73.228  55.610  1.00 92.00  ? 640  CYS A HG   1 
ATOM   8532  N N    . ASN A 1 575 ? 53.210  78.592  55.315  1.00 52.49  ? 641  ASN A N    1 
ATOM   8533  C CA   . ASN A 1 575 ? 53.400  79.704  54.394  1.00 63.13  ? 641  ASN A CA   1 
ATOM   8534  C C    . ASN A 1 575 ? 54.534  79.355  53.430  1.00 84.25  ? 641  ASN A C    1 
ATOM   8535  O O    . ASN A 1 575 ? 55.582  78.848  53.839  1.00 79.99  ? 641  ASN A O    1 
ATOM   8536  C CB   . ASN A 1 575 ? 53.665  81.004  55.150  1.00 59.50  ? 641  ASN A CB   1 
ATOM   8537  C CG   . ASN A 1 575 ? 53.695  82.207  54.240  1.00 80.00  ? 641  ASN A CG   1 
ATOM   8538  O OD1  . ASN A 1 575 ? 53.502  82.092  53.032  1.00 96.88  ? 641  ASN A OD1  1 
ATOM   8539  N ND2  . ASN A 1 575 ? 53.928  83.376  54.818  1.00 82.87  ? 641  ASN A ND2  1 
ATOM   8540  H H    . ASN A 1 575 ? 53.705  78.619  56.017  1.00 62.99  ? 641  ASN A H    1 
ATOM   8541  H HA   . ASN A 1 575 ? 52.590  79.822  53.873  1.00 75.76  ? 641  ASN A HA   1 
ATOM   8542  H HB2  . ASN A 1 575 ? 52.962  81.139  55.805  1.00 71.40  ? 641  ASN A HB2  1 
ATOM   8543  H HB3  . ASN A 1 575 ? 54.526  80.942  55.595  1.00 71.40  ? 641  ASN A HB3  1 
ATOM   8544  H HD21 . ASN A 1 575 ? 53.955  84.093  54.343  1.00 99.44  ? 641  ASN A HD21 1 
ATOM   8545  H HD22 . ASN A 1 575 ? 54.053  83.419  55.668  1.00 99.44  ? 641  ASN A HD22 1 
ATOM   8546  N N    . GLU A 1 576 ? 54.305  79.604  52.145  1.00 87.84  ? 642  GLU A N    1 
ATOM   8547  C CA   . GLU A 1 576 ? 55.225  79.175  51.099  1.00 80.73  ? 642  GLU A CA   1 
ATOM   8548  C C    . GLU A 1 576 ? 56.054  80.345  50.590  1.00 85.56  ? 642  GLU A C    1 
ATOM   8549  O O    . GLU A 1 576 ? 56.386  80.412  49.406  1.00 94.25  ? 642  GLU A O    1 
ATOM   8550  C CB   . GLU A 1 576 ? 54.455  78.542  49.940  1.00 85.73  ? 642  GLU A CB   1 
ATOM   8551  C CG   . GLU A 1 576 ? 53.483  77.441  50.354  1.00 105.69 ? 642  GLU A CG   1 
ATOM   8552  C CD   . GLU A 1 576 ? 52.205  77.453  49.522  1.00 117.74 ? 642  GLU A CD   1 
ATOM   8553  O OE1  . GLU A 1 576 ? 52.315  77.435  48.271  1.00 114.75 ? 642  GLU A OE1  1 
ATOM   8554  O OE2  . GLU A 1 576 ? 51.098  77.482  50.121  1.00 107.46 ? 642  GLU A OE2  1 
ATOM   8555  H H    . GLU A 1 576 ? 53.615  80.024  51.850  1.00 105.41 ? 642  GLU A H    1 
ATOM   8556  H HA   . GLU A 1 576 ? 55.830  78.509  51.461  1.00 96.88  ? 642  GLU A HA   1 
ATOM   8557  H HB2  . GLU A 1 576 ? 53.942  79.234  49.493  1.00 102.88 ? 642  GLU A HB2  1 
ATOM   8558  H HB3  . GLU A 1 576 ? 55.091  78.154  49.319  1.00 102.88 ? 642  GLU A HB3  1 
ATOM   8559  H HG2  . GLU A 1 576 ? 53.911  76.579  50.235  1.00 126.83 ? 642  GLU A HG2  1 
ATOM   8560  H HG3  . GLU A 1 576 ? 53.239  77.566  51.284  1.00 126.83 ? 642  GLU A HG3  1 
ATOM   8561  N N    . GLU A 1 577 ? 56.353  81.287  51.480  1.00 78.70  ? 643  GLU A N    1 
ATOM   8562  C CA   . GLU A 1 577 ? 57.459  82.209  51.260  1.00 89.50  ? 643  GLU A CA   1 
ATOM   8563  C C    . GLU A 1 577 ? 58.614  81.822  52.187  1.00 91.23  ? 643  GLU A C    1 
ATOM   8564  O O    . GLU A 1 577 ? 59.629  82.519  52.257  1.00 99.19  ? 643  GLU A O    1 
ATOM   8565  C CB   . GLU A 1 577 ? 57.043  83.659  51.501  1.00 88.48  ? 643  GLU A CB   1 
ATOM   8566  C CG   . GLU A 1 577 ? 57.822  84.649  50.633  1.00 104.06 ? 643  GLU A CG   1 
ATOM   8567  C CD   . GLU A 1 577 ? 57.431  86.102  50.873  1.00 116.72 ? 643  GLU A CD   1 
ATOM   8568  O OE1  . GLU A 1 577 ? 58.074  86.759  51.724  1.00 113.06 ? 643  GLU A OE1  1 
ATOM   8569  O OE2  . GLU A 1 577 ? 56.488  86.588  50.201  1.00 116.77 ? 643  GLU A OE2  1 
ATOM   8570  H H    . GLU A 1 577 ? 55.931  81.411  52.219  1.00 94.44  ? 643  GLU A H    1 
ATOM   8571  H HA   . GLU A 1 577 ? 57.765  82.129  50.342  1.00 107.40 ? 643  GLU A HA   1 
ATOM   8572  H HB2  . GLU A 1 577 ? 56.100  83.757  51.295  1.00 106.17 ? 643  GLU A HB2  1 
ATOM   8573  H HB3  . GLU A 1 577 ? 57.205  83.884  52.431  1.00 106.17 ? 643  GLU A HB3  1 
ATOM   8574  H HG2  . GLU A 1 577 ? 58.769  84.559  50.826  1.00 124.87 ? 643  GLU A HG2  1 
ATOM   8575  H HG3  . GLU A 1 577 ? 57.656  84.446  49.699  1.00 124.87 ? 643  GLU A HG3  1 
ATOM   8576  N N    . PHE A 1 578 ? 58.455  80.695  52.877  1.00 69.01  ? 644  PHE A N    1 
ATOM   8577  C CA   . PHE A 1 578 ? 59.431  80.249  53.863  1.00 71.53  ? 644  PHE A CA   1 
ATOM   8578  C C    . PHE A 1 578 ? 59.896  78.824  53.600  1.00 82.61  ? 644  PHE A C    1 
ATOM   8579  O O    . PHE A 1 578 ? 59.099  77.926  53.320  1.00 81.94  ? 644  PHE A O    1 
ATOM   8580  C CB   . PHE A 1 578 ? 58.859  80.380  55.277  1.00 76.15  ? 644  PHE A CB   1 
ATOM   8581  C CG   . PHE A 1 578 ? 58.499  81.793  55.644  1.00 93.87  ? 644  PHE A CG   1 
ATOM   8582  C CD1  . PHE A 1 578 ? 57.245  82.306  55.338  1.00 95.70  ? 644  PHE A CD1  1 
ATOM   8583  C CD2  . PHE A 1 578 ? 59.421  82.619  56.278  1.00 94.69  ? 644  PHE A CD2  1 
ATOM   8584  C CE1  . PHE A 1 578 ? 56.914  83.614  55.662  1.00 89.09  ? 644  PHE A CE1  1 
ATOM   8585  C CE2  . PHE A 1 578 ? 59.095  83.928  56.604  1.00 85.05  ? 644  PHE A CE2  1 
ATOM   8586  C CZ   . PHE A 1 578 ? 57.840  84.424  56.294  1.00 87.92  ? 644  PHE A CZ   1 
ATOM   8587  H H    . PHE A 1 578 ? 57.782  80.166  52.790  1.00 82.82  ? 644  PHE A H    1 
ATOM   8588  H HA   . PHE A 1 578 ? 60.209  80.825  53.807  1.00 85.83  ? 644  PHE A HA   1 
ATOM   8589  H HB2  . PHE A 1 578 ? 58.056  79.840  55.342  1.00 91.38  ? 644  PHE A HB2  1 
ATOM   8590  H HB3  . PHE A 1 578 ? 59.521  80.065  55.913  1.00 91.38  ? 644  PHE A HB3  1 
ATOM   8591  H HD1  . PHE A 1 578 ? 56.620  81.766  54.910  1.00 114.84 ? 644  PHE A HD1  1 
ATOM   8592  H HD2  . PHE A 1 578 ? 60.266  82.291  56.485  1.00 113.63 ? 644  PHE A HD2  1 
ATOM   8593  H HE1  . PHE A 1 578 ? 56.070  83.946  55.455  1.00 106.91 ? 644  PHE A HE1  1 
ATOM   8594  H HE2  . PHE A 1 578 ? 59.718  84.471  57.031  1.00 102.06 ? 644  PHE A HE2  1 
ATOM   8595  H HZ   . PHE A 1 578 ? 57.617  85.299  56.515  1.00 105.50 ? 644  PHE A HZ   1 
ATOM   8596  N N    . THR A 1 579 ? 61.211  78.649  53.704  1.00 94.08  ? 645  THR A N    1 
ATOM   8597  C CA   . THR A 1 579 ? 61.899  77.373  53.527  1.00 82.72  ? 645  THR A CA   1 
ATOM   8598  C C    . THR A 1 579 ? 61.273  76.258  54.348  1.00 76.33  ? 645  THR A C    1 
ATOM   8599  O O    . THR A 1 579 ? 61.455  75.073  54.080  1.00 75.38  ? 645  THR A O    1 
ATOM   8600  C CB   . THR A 1 579 ? 63.339  77.522  54.018  1.00 70.94  ? 645  THR A CB   1 
ATOM   8601  O OG1  . THR A 1 579 ? 63.815  78.843  53.719  1.00 80.79  ? 645  THR A OG1  1 
ATOM   8602  C CG2  . THR A 1 579 ? 64.237  76.487  53.390  1.00 64.63  ? 645  THR A CG2  1 
ATOM   8603  H H    . THR A 1 579 ? 61.753  79.291  53.887  1.00 112.90 ? 645  THR A H    1 
ATOM   8604  H HA   . THR A 1 579 ? 61.903  77.119  52.591  1.00 99.27  ? 645  THR A HA   1 
ATOM   8605  H HB   . THR A 1 579 ? 63.359  77.390  54.978  1.00 85.12  ? 645  THR A HB   1 
ATOM   8606  H HG1  . THR A 1 579 ? 63.333  79.416  54.101  1.00 96.94  ? 645  THR A HG1  1 
ATOM   8607  H HG21 . THR A 1 579 ? 65.145  76.597  53.712  1.00 77.56  ? 645  THR A HG21 1 
ATOM   8608  H HG22 . THR A 1 579 ? 63.926  75.597  53.618  1.00 77.56  ? 645  THR A HG22 1 
ATOM   8609  H HG23 . THR A 1 579 ? 64.231  76.586  52.425  1.00 77.56  ? 645  THR A HG23 1 
ATOM   8610  N N    . ILE A 1 580 ? 60.535  76.661  55.365  1.00 75.32  ? 646  ILE A N    1 
ATOM   8611  C CA   . ILE A 1 580 ? 59.994  75.745  56.344  1.00 74.94  ? 646  ILE A CA   1 
ATOM   8612  C C    . ILE A 1 580 ? 58.790  74.957  55.811  1.00 70.80  ? 646  ILE A C    1 
ATOM   8613  O O    . ILE A 1 580 ? 58.486  73.867  56.313  1.00 52.97  ? 646  ILE A O    1 
ATOM   8614  C CB   . ILE A 1 580 ? 59.623  76.535  57.605  1.00 69.98  ? 646  ILE A CB   1 
ATOM   8615  C CG1  . ILE A 1 580 ? 60.898  77.023  58.300  1.00 78.69  ? 646  ILE A CG1  1 
ATOM   8616  C CG2  . ILE A 1 580 ? 58.843  75.690  58.560  1.00 73.27  ? 646  ILE A CG2  1 
ATOM   8617  C CD1  . ILE A 1 580 ? 61.521  78.306  57.713  1.00 85.35  ? 646  ILE A CD1  1 
ATOM   8618  H H    . ILE A 1 580 ? 60.328  77.483  55.512  1.00 90.38  ? 646  ILE A H    1 
ATOM   8619  H HA   . ILE A 1 580 ? 60.681  75.105  56.586  1.00 89.93  ? 646  ILE A HA   1 
ATOM   8620  H HB   . ILE A 1 580 ? 59.088  77.303  57.351  1.00 83.98  ? 646  ILE A HB   1 
ATOM   8621  H HG12 . ILE A 1 580 ? 60.692  77.199  59.231  1.00 94.43  ? 646  ILE A HG12 1 
ATOM   8622  H HG13 . ILE A 1 580 ? 61.567  76.322  58.243  1.00 94.43  ? 646  ILE A HG13 1 
ATOM   8623  H HG21 . ILE A 1 580 ? 58.626  76.218  59.344  1.00 87.92  ? 646  ILE A HG21 1 
ATOM   8624  H HG22 . ILE A 1 580 ? 58.029  75.392  58.125  1.00 87.92  ? 646  ILE A HG22 1 
ATOM   8625  H HG23 . ILE A 1 580 ? 59.381  74.924  58.816  1.00 87.92  ? 646  ILE A HG23 1 
ATOM   8626  H HD11 . ILE A 1 580 ? 62.317  78.530  58.219  1.00 102.42 ? 646  ILE A HD11 1 
ATOM   8627  H HD12 . ILE A 1 580 ? 61.752  78.148  56.785  1.00 102.42 ? 646  ILE A HD12 1 
ATOM   8628  H HD13 . ILE A 1 580 ? 60.875  79.027  57.776  1.00 102.42 ? 646  ILE A HD13 1 
ATOM   8629  N N    . PHE A 1 581 ? 58.149  75.508  54.777  1.00 73.45  ? 647  PHE A N    1 
ATOM   8630  C CA   . PHE A 1 581 ? 56.907  74.979  54.209  1.00 72.88  ? 647  PHE A CA   1 
ATOM   8631  C C    . PHE A 1 581 ? 56.906  73.469  54.076  1.00 80.60  ? 647  PHE A C    1 
ATOM   8632  O O    . PHE A 1 581 ? 56.091  72.787  54.691  1.00 92.33  ? 647  PHE A O    1 
ATOM   8633  C CB   . PHE A 1 581 ? 56.658  75.588  52.823  1.00 78.83  ? 647  PHE A CB   1 
ATOM   8634  C CG   . PHE A 1 581 ? 55.445  75.028  52.117  1.00 90.28  ? 647  PHE A CG   1 
ATOM   8635  C CD1  . PHE A 1 581 ? 54.181  75.142  52.681  1.00 83.17  ? 647  PHE A CD1  1 
ATOM   8636  C CD2  . PHE A 1 581 ? 55.565  74.400  50.885  1.00 93.18  ? 647  PHE A CD2  1 
ATOM   8637  C CE1  . PHE A 1 581 ? 53.063  74.627  52.039  1.00 62.45  ? 647  PHE A CE1  1 
ATOM   8638  C CE2  . PHE A 1 581 ? 54.444  73.889  50.236  1.00 92.85  ? 647  PHE A CE2  1 
ATOM   8639  C CZ   . PHE A 1 581 ? 53.193  74.010  50.816  1.00 71.59  ? 647  PHE A CZ   1 
ATOM   8640  H H    . PHE A 1 581 ? 58.426  76.215  54.374  1.00 88.14  ? 647  PHE A H    1 
ATOM   8641  H HA   . PHE A 1 581 ? 56.166  75.228  54.784  1.00 87.46  ? 647  PHE A HA   1 
ATOM   8642  H HB2  . PHE A 1 581 ? 56.528  76.544  52.921  1.00 94.60  ? 647  PHE A HB2  1 
ATOM   8643  H HB3  . PHE A 1 581 ? 57.431  75.417  52.264  1.00 94.60  ? 647  PHE A HB3  1 
ATOM   8644  H HD1  . PHE A 1 581 ? 54.083  75.559  53.506  1.00 99.80  ? 647  PHE A HD1  1 
ATOM   8645  H HD2  . PHE A 1 581 ? 56.403  74.317  50.490  1.00 111.82 ? 647  PHE A HD2  1 
ATOM   8646  H HE1  . PHE A 1 581 ? 52.223  74.711  52.430  1.00 74.94  ? 647  PHE A HE1  1 
ATOM   8647  H HE2  . PHE A 1 581 ? 54.536  73.468  49.411  1.00 111.42 ? 647  PHE A HE2  1 
ATOM   8648  H HZ   . PHE A 1 581 ? 52.444  73.666  50.385  1.00 85.91  ? 647  PHE A HZ   1 
ATOM   8649  N N    . ASN A 1 582 ? 57.843  72.961  53.283  1.00 94.07  ? 648  ASN A N    1 
ATOM   8650  C CA   . ASN A 1 582 ? 57.871  71.550  52.909  1.00 95.50  ? 648  ASN A CA   1 
ATOM   8651  C C    . ASN A 1 582 ? 57.876  70.619  54.117  1.00 77.58  ? 648  ASN A C    1 
ATOM   8652  O O    . ASN A 1 582 ? 57.253  69.566  54.092  1.00 71.26  ? 648  ASN A O    1 
ATOM   8653  C CB   . ASN A 1 582 ? 59.074  71.267  51.995  1.00 90.14  ? 648  ASN A CB   1 
ATOM   8654  C CG   . ASN A 1 582 ? 59.284  72.365  50.952  1.00 92.53  ? 648  ASN A CG   1 
ATOM   8655  O OD1  . ASN A 1 582 ? 59.908  73.395  51.238  1.00 79.87  ? 648  ASN A OD1  1 
ATOM   8656  N ND2  . ASN A 1 582 ? 58.743  72.162  49.746  1.00 87.44  ? 648  ASN A ND2  1 
ATOM   8657  H H    . ASN A 1 582 ? 58.485  73.421  52.942  1.00 112.88 ? 648  ASN A H    1 
ATOM   8658  H HA   . ASN A 1 582 ? 57.069  71.355  52.399  1.00 114.60 ? 648  ASN A HA   1 
ATOM   8659  H HB2  . ASN A 1 582 ? 59.877  71.208  52.537  1.00 108.17 ? 648  ASN A HB2  1 
ATOM   8660  H HB3  . ASN A 1 582 ? 58.927  70.430  51.527  1.00 108.17 ? 648  ASN A HB3  1 
ATOM   8661  H HD21 . ASN A 1 582 ? 58.835  72.752  49.128  1.00 104.92 ? 648  ASN A HD21 1 
ATOM   8662  H HD22 . ASN A 1 582 ? 58.302  71.440  49.589  1.00 104.92 ? 648  ASN A HD22 1 
ATOM   8663  N N    . ARG A 1 583 ? 58.567  71.017  55.176  1.00 68.34  ? 649  ARG A N    1 
ATOM   8664  C CA   . ARG A 1 583 ? 58.613  70.218  56.385  1.00 63.51  ? 649  ARG A CA   1 
ATOM   8665  C C    . ARG A 1 583 ? 57.221  70.122  56.980  1.00 66.45  ? 649  ARG A C    1 
ATOM   8666  O O    . ARG A 1 583 ? 56.810  69.063  57.456  1.00 63.22  ? 649  ARG A O    1 
ATOM   8667  C CB   . ARG A 1 583 ? 59.556  70.861  57.395  1.00 62.31  ? 649  ARG A CB   1 
ATOM   8668  C CG   . ARG A 1 583 ? 59.701  70.095  58.699  1.00 49.80  ? 649  ARG A CG   1 
ATOM   8669  C CD   . ARG A 1 583 ? 60.729  70.773  59.567  1.00 59.94  ? 649  ARG A CD   1 
ATOM   8670  N NE   . ARG A 1 583 ? 62.031  70.839  58.896  1.00 76.19  ? 649  ARG A NE   1 
ATOM   8671  C CZ   . ARG A 1 583 ? 63.083  70.068  59.177  1.00 79.63  ? 649  ARG A CZ   1 
ATOM   8672  N NH1  . ARG A 1 583 ? 63.031  69.143  60.136  1.00 73.90  ? 649  ARG A NH1  1 
ATOM   8673  N NH2  . ARG A 1 583 ? 64.203  70.229  58.485  1.00 90.16  ? 649  ARG A NH2  1 
ATOM   8674  H H    . ARG A 1 583 ? 59.018  71.748  55.218  1.00 82.00  ? 649  ARG A H    1 
ATOM   8675  H HA   . ARG A 1 583 ? 58.931  69.325  56.180  1.00 76.22  ? 649  ARG A HA   1 
ATOM   8676  H HB2  . ARG A 1 583 ? 60.437  70.930  56.995  1.00 74.78  ? 649  ARG A HB2  1 
ATOM   8677  H HB3  . ARG A 1 583 ? 59.224  71.746  57.609  1.00 74.78  ? 649  ARG A HB3  1 
ATOM   8678  H HG2  . ARG A 1 583 ? 58.853  70.088  59.170  1.00 59.76  ? 649  ARG A HG2  1 
ATOM   8679  H HG3  . ARG A 1 583 ? 59.999  69.190  58.515  1.00 59.76  ? 649  ARG A HG3  1 
ATOM   8680  H HD2  . ARG A 1 583 ? 60.439  71.678  59.760  1.00 71.93  ? 649  ARG A HD2  1 
ATOM   8681  H HD3  . ARG A 1 583 ? 60.835  70.270  60.390  1.00 71.93  ? 649  ARG A HD3  1 
ATOM   8682  H HE   . ARG A 1 583 ? 62.124  71.423  58.271  1.00 91.43  ? 649  ARG A HE   1 
ATOM   8683  H HH11 . ARG A 1 583 ? 62.308  69.031  60.587  1.00 88.68  ? 649  ARG A HH11 1 
ATOM   8684  H HH12 . ARG A 1 583 ? 63.721  68.657  60.302  1.00 88.68  ? 649  ARG A HH12 1 
ATOM   8685  H HH21 . ARG A 1 583 ? 64.246  70.824  57.867  1.00 108.19 ? 649  ARG A HH21 1 
ATOM   8686  H HH22 . ARG A 1 583 ? 64.889  69.740  58.659  1.00 108.19 ? 649  ARG A HH22 1 
ATOM   8687  N N    . VAL A 1 584 ? 56.500  71.240  56.932  1.00 65.05  ? 650  VAL A N    1 
ATOM   8688  C CA   . VAL A 1 584 ? 55.194  71.346  57.574  1.00 64.44  ? 650  VAL A CA   1 
ATOM   8689  C C    . VAL A 1 584 ? 54.105  70.758  56.692  1.00 55.51  ? 650  VAL A C    1 
ATOM   8690  O O    . VAL A 1 584 ? 53.163  70.166  57.193  1.00 56.13  ? 650  VAL A O    1 
ATOM   8691  C CB   . VAL A 1 584 ? 54.815  72.816  57.906  1.00 59.42  ? 650  VAL A CB   1 
ATOM   8692  C CG1  . VAL A 1 584 ? 53.720  72.846  58.953  1.00 66.04  ? 650  VAL A CG1  1 
ATOM   8693  C CG2  . VAL A 1 584 ? 55.993  73.576  58.435  1.00 74.77  ? 650  VAL A CG2  1 
ATOM   8694  H H    . VAL A 1 584 ? 56.748  71.958  56.529  1.00 78.06  ? 650  VAL A H    1 
ATOM   8695  H HA   . VAL A 1 584 ? 55.210  70.845  58.405  1.00 77.33  ? 650  VAL A HA   1 
ATOM   8696  H HB   . VAL A 1 584 ? 54.493  73.259  57.106  1.00 71.31  ? 650  VAL A HB   1 
ATOM   8697  H HG11 . VAL A 1 584 ? 53.496  73.769  59.148  1.00 79.25  ? 650  VAL A HG11 1 
ATOM   8698  H HG12 . VAL A 1 584 ? 52.941  72.382  58.608  1.00 79.25  ? 650  VAL A HG12 1 
ATOM   8699  H HG13 . VAL A 1 584 ? 54.039  72.405  59.756  1.00 79.25  ? 650  VAL A HG13 1 
ATOM   8700  H HG21 . VAL A 1 584 ? 55.719  74.486  58.631  1.00 89.73  ? 650  VAL A HG21 1 
ATOM   8701  H HG22 . VAL A 1 584 ? 56.309  73.145  59.244  1.00 89.73  ? 650  VAL A HG22 1 
ATOM   8702  H HG23 . VAL A 1 584 ? 56.694  73.578  57.765  1.00 89.73  ? 650  VAL A HG23 1 
ATOM   8703  N N    . ASP A 1 585 ? 54.241  70.932  55.382  1.00 55.61  ? 651  ASP A N    1 
ATOM   8704  C CA   . ASP A 1 585 ? 53.277  70.411  54.418  1.00 65.31  ? 651  ASP A CA   1 
ATOM   8705  C C    . ASP A 1 585 ? 53.151  68.896  54.558  1.00 72.40  ? 651  ASP A C    1 
ATOM   8706  O O    . ASP A 1 585 ? 52.057  68.328  54.425  1.00 61.47  ? 651  ASP A O    1 
ATOM   8707  C CB   . ASP A 1 585 ? 53.722  70.754  52.992  1.00 76.30  ? 651  ASP A CB   1 
ATOM   8708  C CG   . ASP A 1 585 ? 52.613  70.551  51.962  1.00 89.00  ? 651  ASP A CG   1 
ATOM   8709  O OD1  . ASP A 1 585 ? 51.508  70.079  52.329  1.00 85.66  ? 651  ASP A OD1  1 
ATOM   8710  O OD2  . ASP A 1 585 ? 52.853  70.863  50.777  1.00 97.68  ? 651  ASP A OD2  1 
ATOM   8711  H H    . ASP A 1 585 ? 54.895  71.357  55.019  1.00 66.73  ? 651  ASP A H    1 
ATOM   8712  H HA   . ASP A 1 585 ? 52.408  70.811  54.577  1.00 78.37  ? 651  ASP A HA   1 
ATOM   8713  H HB2  . ASP A 1 585 ? 53.992  71.685  52.961  1.00 91.56  ? 651  ASP A HB2  1 
ATOM   8714  H HB3  . ASP A 1 585 ? 54.467  70.184  52.747  1.00 91.56  ? 651  ASP A HB3  1 
ATOM   8715  N N    . ILE A 1 586 ? 54.286  68.254  54.819  1.00 64.99  ? 652  ILE A N    1 
ATOM   8716  C CA   . ILE A 1 586 ? 54.330  66.822  55.019  1.00 65.10  ? 652  ILE A CA   1 
ATOM   8717  C C    . ILE A 1 586 ? 53.627  66.518  56.324  1.00 66.40  ? 652  ILE A C    1 
ATOM   8718  O O    . ILE A 1 586 ? 52.845  65.573  56.419  1.00 64.16  ? 652  ILE A O    1 
ATOM   8719  C CB   . ILE A 1 586 ? 55.793  66.313  55.056  1.00 61.52  ? 652  ILE A CB   1 
ATOM   8720  C CG1  . ILE A 1 586 ? 56.448  66.558  53.694  1.00 67.21  ? 652  ILE A CG1  1 
ATOM   8721  C CG2  . ILE A 1 586 ? 55.854  64.824  55.432  1.00 38.47  ? 652  ILE A CG2  1 
ATOM   8722  C CD1  . ILE A 1 586 ? 57.926  66.252  53.633  1.00 74.33  ? 652  ILE A CD1  1 
ATOM   8723  H H    . ILE A 1 586 ? 55.052  68.638  54.886  1.00 77.99  ? 652  ILE A H    1 
ATOM   8724  H HA   . ILE A 1 586 ? 53.861  66.374  54.298  1.00 78.12  ? 652  ILE A HA   1 
ATOM   8725  H HB   . ILE A 1 586 ? 56.278  66.819  55.727  1.00 73.82  ? 652  ILE A HB   1 
ATOM   8726  H HG12 . ILE A 1 586 ? 56.007  66.001  53.034  1.00 80.66  ? 652  ILE A HG12 1 
ATOM   8727  H HG13 . ILE A 1 586 ? 56.333  67.493  53.460  1.00 80.66  ? 652  ILE A HG13 1 
ATOM   8728  H HG21 . ILE A 1 586 ? 56.781  64.540  55.446  1.00 46.17  ? 652  ILE A HG21 1 
ATOM   8729  H HG22 . ILE A 1 586 ? 55.457  64.704  56.309  1.00 46.17  ? 652  ILE A HG22 1 
ATOM   8730  H HG23 . ILE A 1 586 ? 55.361  64.312  54.772  1.00 46.17  ? 652  ILE A HG23 1 
ATOM   8731  H HD11 . ILE A 1 586 ? 58.250  66.437  52.737  1.00 89.19  ? 652  ILE A HD11 1 
ATOM   8732  H HD12 . ILE A 1 586 ? 58.391  66.811  54.274  1.00 89.19  ? 652  ILE A HD12 1 
ATOM   8733  H HD13 . ILE A 1 586 ? 58.064  65.316  53.848  1.00 89.19  ? 652  ILE A HD13 1 
ATOM   8734  N N    . SER A 1 587 ? 53.901  67.333  57.333  1.00 60.23  ? 653  SER A N    1 
ATOM   8735  C CA   . SER A 1 587 ? 53.306  67.108  58.636  1.00 60.15  ? 653  SER A CA   1 
ATOM   8736  C C    . SER A 1 587 ? 51.781  67.230  58.534  1.00 74.02  ? 653  SER A C    1 
ATOM   8737  O O    . SER A 1 587 ? 51.048  66.423  59.122  1.00 68.90  ? 653  SER A O    1 
ATOM   8738  C CB   . SER A 1 587 ? 53.893  68.079  59.659  1.00 56.19  ? 653  SER A CB   1 
ATOM   8739  O OG   . SER A 1 587 ? 53.481  67.754  60.976  1.00 68.19  ? 653  SER A OG   1 
ATOM   8740  H H    . SER A 1 587 ? 54.422  68.016  57.289  1.00 72.28  ? 653  SER A H    1 
ATOM   8741  H HA   . SER A 1 587 ? 53.515  66.207  58.926  1.00 72.18  ? 653  SER A HA   1 
ATOM   8742  H HB2  . SER A 1 587 ? 54.861  68.036  59.613  1.00 67.43  ? 653  SER A HB2  1 
ATOM   8743  H HB3  . SER A 1 587 ? 53.592  68.977  59.448  1.00 67.43  ? 653  SER A HB3  1 
ATOM   8744  H HG   . SER A 1 587 ? 52.643  67.788  61.031  1.00 81.83  ? 653  SER A HG   1 
ATOM   8745  N N    . ARG A 1 588 ? 51.316  68.224  57.768  1.00 81.74  ? 654  ARG A N    1 
ATOM   8746  C CA   . ARG A 1 588 ? 49.886  68.435  57.512  1.00 60.92  ? 654  ARG A CA   1 
ATOM   8747  C C    . ARG A 1 588 ? 49.308  67.209  56.830  1.00 54.75  ? 654  ARG A C    1 
ATOM   8748  O O    . ARG A 1 588 ? 48.375  66.600  57.360  1.00 48.83  ? 654  ARG A O    1 
ATOM   8749  C CB   . ARG A 1 588 ? 49.660  69.700  56.656  1.00 59.12  ? 654  ARG A CB   1 
ATOM   8750  C CG   . ARG A 1 588 ? 48.220  69.919  56.143  1.00 55.71  ? 654  ARG A CG   1 
ATOM   8751  C CD   . ARG A 1 588 ? 47.960  71.356  55.631  1.00 63.17  ? 654  ARG A CD   1 
ATOM   8752  N NE   . ARG A 1 588 ? 48.710  71.715  54.417  1.00 79.04  ? 654  ARG A NE   1 
ATOM   8753  C CZ   . ARG A 1 588 ? 48.766  72.945  53.896  1.00 75.75  ? 654  ARG A CZ   1 
ATOM   8754  N NH1  . ARG A 1 588 ? 48.106  73.943  54.467  1.00 73.26  ? 654  ARG A NH1  1 
ATOM   8755  N NH2  . ARG A 1 588 ? 49.461  73.184  52.787  1.00 67.85  ? 654  ARG A NH2  1 
ATOM   8756  H H    . ARG A 1 588 ? 51.821  68.801  57.378  1.00 98.09  ? 654  ARG A H    1 
ATOM   8757  H HA   . ARG A 1 588 ? 49.426  68.556  58.357  1.00 73.11  ? 654  ARG A HA   1 
ATOM   8758  H HB2  . ARG A 1 588 ? 49.898  70.476  57.187  1.00 70.94  ? 654  ARG A HB2  1 
ATOM   8759  H HB3  . ARG A 1 588 ? 50.239  69.651  55.879  1.00 70.94  ? 654  ARG A HB3  1 
ATOM   8760  H HG2  . ARG A 1 588 ? 48.052  69.307  55.409  1.00 66.85  ? 654  ARG A HG2  1 
ATOM   8761  H HG3  . ARG A 1 588 ? 47.599  69.743  56.867  1.00 66.85  ? 654  ARG A HG3  1 
ATOM   8762  H HD2  . ARG A 1 588 ? 47.015  71.449  55.432  1.00 75.80  ? 654  ARG A HD2  1 
ATOM   8763  H HD3  . ARG A 1 588 ? 48.210  71.984  56.328  1.00 75.80  ? 654  ARG A HD3  1 
ATOM   8764  H HE   . ARG A 1 588 ? 49.142  71.090  54.015  1.00 94.85  ? 654  ARG A HE   1 
ATOM   8765  H HH11 . ARG A 1 588 ? 47.649  73.803  55.182  1.00 87.91  ? 654  ARG A HH11 1 
ATOM   8766  H HH12 . ARG A 1 588 ? 48.142  74.733  54.128  1.00 87.91  ? 654  ARG A HH12 1 
ATOM   8767  H HH21 . ARG A 1 588 ? 49.893  72.546  52.404  1.00 81.42  ? 654  ARG A HH21 1 
ATOM   8768  H HH22 . ARG A 1 588 ? 49.489  73.978  52.460  1.00 81.42  ? 654  ARG A HH22 1 
ATOM   8769  N N    . SER A 1 589 ? 49.888  66.844  55.679  1.00 47.84  ? 655  SER A N    1 
ATOM   8770  C CA   . SER A 1 589 ? 49.401  65.735  54.850  1.00 50.30  ? 655  SER A CA   1 
ATOM   8771  C C    . SER A 1 589 ? 49.225  64.452  55.627  1.00 52.18  ? 655  SER A C    1 
ATOM   8772  O O    . SER A 1 589 ? 48.377  63.642  55.300  1.00 76.74  ? 655  SER A O    1 
ATOM   8773  C CB   . SER A 1 589 ? 50.361  65.434  53.702  1.00 52.78  ? 655  SER A CB   1 
ATOM   8774  O OG   . SER A 1 589 ? 50.056  66.182  52.548  1.00 72.37  ? 655  SER A OG   1 
ATOM   8775  H H    . SER A 1 589 ? 50.581  67.234  55.351  1.00 57.41  ? 655  SER A H    1 
ATOM   8776  H HA   . SER A 1 589 ? 48.543  65.977  54.470  1.00 60.36  ? 655  SER A HA   1 
ATOM   8777  H HB2  . SER A 1 589 ? 51.263  65.650  53.984  1.00 63.34  ? 655  SER A HB2  1 
ATOM   8778  H HB3  . SER A 1 589 ? 50.302  64.490  53.486  1.00 63.34  ? 655  SER A HB3  1 
ATOM   8779  H HG   . SER A 1 589 ? 50.598  65.997  51.934  1.00 86.85  ? 655  SER A HG   1 
ATOM   8780  N N    . GLN A 1 590 ? 50.040  64.251  56.644  1.00 54.29  ? 656  GLN A N    1 
ATOM   8781  C CA   . GLN A 1 590 ? 50.022  62.993  57.361  1.00 63.52  ? 656  GLN A CA   1 
ATOM   8782  C C    . GLN A 1 590 ? 48.906  62.979  58.401  1.00 58.72  ? 656  GLN A C    1 
ATOM   8783  O O    . GLN A 1 590 ? 48.240  61.969  58.580  1.00 47.00  ? 656  GLN A O    1 
ATOM   8784  C CB   . GLN A 1 590 ? 51.396  62.731  57.987  1.00 64.35  ? 656  GLN A CB   1 
ATOM   8785  C CG   . GLN A 1 590 ? 52.479  62.487  56.941  1.00 70.75  ? 656  GLN A CG   1 
ATOM   8786  C CD   . GLN A 1 590 ? 53.872  62.350  57.538  1.00 92.85  ? 656  GLN A CD   1 
ATOM   8787  O OE1  . GLN A 1 590 ? 54.050  62.374  58.762  1.00 100.22 ? 656  GLN A OE1  1 
ATOM   8788  N NE2  . GLN A 1 590 ? 54.874  62.206  56.668  1.00 88.80  ? 656  GLN A NE2  1 
ATOM   8789  H H    . GLN A 1 590 ? 50.611  64.823  56.938  1.00 65.15  ? 656  GLN A H    1 
ATOM   8790  H HA   . GLN A 1 590 ? 49.845  62.278  56.730  1.00 76.23  ? 656  GLN A HA   1 
ATOM   8791  H HB2  . GLN A 1 590 ? 51.656  63.502  58.515  1.00 77.22  ? 656  GLN A HB2  1 
ATOM   8792  H HB3  . GLN A 1 590 ? 51.341  61.944  58.552  1.00 77.22  ? 656  GLN A HB3  1 
ATOM   8793  H HG2  . GLN A 1 590 ? 52.277  61.667  56.464  1.00 84.90  ? 656  GLN A HG2  1 
ATOM   8794  H HG3  . GLN A 1 590 ? 52.492  63.234  56.322  1.00 84.90  ? 656  GLN A HG3  1 
ATOM   8795  H HE21 . GLN A 1 590 ? 54.712  62.194  55.824  1.00 106.56 ? 656  GLN A HE21 1 
ATOM   8796  H HE22 . GLN A 1 590 ? 55.681  62.124  56.952  1.00 106.56 ? 656  GLN A HE22 1 
ATOM   8797  N N    . LEU A 1 591 ? 48.699  64.107  59.074  1.00 67.65  ? 657  LEU A N    1 
ATOM   8798  C CA   . LEU A 1 591 ? 47.619  64.229  60.052  1.00 64.90  ? 657  LEU A CA   1 
ATOM   8799  C C    . LEU A 1 591 ? 46.259  64.093  59.376  1.00 62.75  ? 657  LEU A C    1 
ATOM   8800  O O    . LEU A 1 591 ? 45.338  63.486  59.925  1.00 65.10  ? 657  LEU A O    1 
ATOM   8801  C CB   . LEU A 1 591 ? 47.694  65.571  60.779  1.00 60.86  ? 657  LEU A CB   1 
ATOM   8802  C CG   . LEU A 1 591 ? 46.443  66.033  61.534  1.00 54.09  ? 657  LEU A CG   1 
ATOM   8803  C CD1  . LEU A 1 591 ? 46.139  65.137  62.739  1.00 55.54  ? 657  LEU A CD1  1 
ATOM   8804  C CD2  . LEU A 1 591 ? 46.615  67.477  61.952  1.00 38.30  ? 657  LEU A CD2  1 
ATOM   8805  H H    . LEU A 1 591 ? 49.171  64.820  58.982  1.00 81.18  ? 657  LEU A H    1 
ATOM   8806  H HA   . LEU A 1 591 ? 47.703  63.522  60.710  1.00 77.88  ? 657  LEU A HA   1 
ATOM   8807  H HB2  . LEU A 1 591 ? 48.415  65.522  61.426  1.00 73.03  ? 657  LEU A HB2  1 
ATOM   8808  H HB3  . LEU A 1 591 ? 47.901  66.257  60.125  1.00 73.03  ? 657  LEU A HB3  1 
ATOM   8809  H HG   . LEU A 1 591 ? 45.683  65.988  60.934  1.00 64.91  ? 657  LEU A HG   1 
ATOM   8810  H HD11 . LEU A 1 591 ? 45.342  65.466  63.184  1.00 66.65  ? 657  LEU A HD11 1 
ATOM   8811  H HD12 . LEU A 1 591 ? 45.993  64.230  62.429  1.00 66.65  ? 657  LEU A HD12 1 
ATOM   8812  H HD13 . LEU A 1 591 ? 46.893  65.162  63.349  1.00 66.65  ? 657  LEU A HD13 1 
ATOM   8813  H HD21 . LEU A 1 591 ? 45.821  67.764  62.429  1.00 45.97  ? 657  LEU A HD21 1 
ATOM   8814  H HD22 . LEU A 1 591 ? 47.392  67.547  62.529  1.00 45.97  ? 657  LEU A HD22 1 
ATOM   8815  H HD23 . LEU A 1 591 ? 46.740  68.021  61.159  1.00 45.97  ? 657  LEU A HD23 1 
ATOM   8816  N N    . ILE A 1 592 ? 46.134  64.672  58.188  1.00 50.65  ? 658  ILE A N    1 
ATOM   8817  C CA   . ILE A 1 592 ? 44.888  64.599  57.441  1.00 58.59  ? 658  ILE A CA   1 
ATOM   8818  C C    . ILE A 1 592 ? 44.613  63.173  56.947  1.00 65.11  ? 658  ILE A C    1 
ATOM   8819  O O    . ILE A 1 592 ? 43.471  62.709  57.021  1.00 62.95  ? 658  ILE A O    1 
ATOM   8820  C CB   . ILE A 1 592 ? 44.876  65.597  56.263  1.00 60.09  ? 658  ILE A CB   1 
ATOM   8821  C CG1  . ILE A 1 592 ? 45.031  67.033  56.785  1.00 66.48  ? 658  ILE A CG1  1 
ATOM   8822  C CG2  . ILE A 1 592 ? 43.586  65.460  55.452  1.00 50.62  ? 658  ILE A CG2  1 
ATOM   8823  C CD1  . ILE A 1 592 ? 43.708  67.749  57.136  1.00 67.15  ? 658  ILE A CD1  1 
ATOM   8824  H H    . ILE A 1 592 ? 46.758  65.113  57.793  1.00 60.78  ? 658  ILE A H    1 
ATOM   8825  H HA   . ILE A 1 592 ? 44.162  64.843  58.035  1.00 70.31  ? 658  ILE A HA   1 
ATOM   8826  H HB   . ILE A 1 592 ? 45.627  65.397  55.683  1.00 72.11  ? 658  ILE A HB   1 
ATOM   8827  H HG12 . ILE A 1 592 ? 45.574  67.013  57.588  1.00 79.78  ? 658  ILE A HG12 1 
ATOM   8828  H HG13 . ILE A 1 592 ? 45.477  67.562  56.104  1.00 79.78  ? 658  ILE A HG13 1 
ATOM   8829  H HG21 . ILE A 1 592 ? 43.604  66.097  54.720  1.00 60.74  ? 658  ILE A HG21 1 
ATOM   8830  H HG22 . ILE A 1 592 ? 43.527  64.557  55.103  1.00 60.74  ? 658  ILE A HG22 1 
ATOM   8831  H HG23 . ILE A 1 592 ? 42.829  65.641  56.030  1.00 60.74  ? 658  ILE A HG23 1 
ATOM   8832  H HD11 . ILE A 1 592 ? 43.908  68.643  57.454  1.00 80.59  ? 658  ILE A HD11 1 
ATOM   8833  H HD12 . ILE A 1 592 ? 43.154  67.796  56.341  1.00 80.59  ? 658  ILE A HD12 1 
ATOM   8834  H HD13 . ILE A 1 592 ? 43.251  67.245  57.828  1.00 80.59  ? 658  ILE A HD13 1 
ATOM   8835  N N    . ASP A 1 593 ? 45.646  62.488  56.448  1.00 66.56  ? 659  ASP A N    1 
ATOM   8836  C CA   . ASP A 1 593 ? 45.516  61.088  56.031  1.00 70.24  ? 659  ASP A CA   1 
ATOM   8837  C C    . ASP A 1 593 ? 44.862  60.303  57.161  1.00 69.03  ? 659  ASP A C    1 
ATOM   8838  O O    . ASP A 1 593 ? 43.949  59.512  56.932  1.00 69.39  ? 659  ASP A O    1 
ATOM   8839  C CB   . ASP A 1 593 ? 46.881  60.452  55.697  1.00 75.19  ? 659  ASP A CB   1 
ATOM   8840  C CG   . ASP A 1 593 ? 47.432  60.865  54.316  1.00 72.77  ? 659  ASP A CG   1 
ATOM   8841  O OD1  . ASP A 1 593 ? 46.648  61.273  53.431  1.00 74.57  ? 659  ASP A OD1  1 
ATOM   8842  O OD2  . ASP A 1 593 ? 48.666  60.775  54.113  1.00 59.05  ? 659  ASP A OD2  1 
ATOM   8843  H H    . ASP A 1 593 ? 46.435  62.812  56.341  1.00 79.87  ? 659  ASP A H    1 
ATOM   8844  H HA   . ASP A 1 593 ? 44.949  61.033  55.246  1.00 84.28  ? 659  ASP A HA   1 
ATOM   8845  H HB2  . ASP A 1 593 ? 47.527  60.725  56.368  1.00 90.23  ? 659  ASP A HB2  1 
ATOM   8846  H HB3  . ASP A 1 593 ? 46.788  59.487  55.704  1.00 90.23  ? 659  ASP A HB3  1 
ATOM   8847  N N    . GLU A 1 594 ? 45.318  60.545  58.385  1.00 61.12  ? 660  GLU A N    1 
ATOM   8848  C CA   . GLU A 1 594 ? 44.814  59.816  59.545  1.00 60.66  ? 660  GLU A CA   1 
ATOM   8849  C C    . GLU A 1 594 ? 43.365  60.169  59.821  1.00 64.09  ? 660  GLU A C    1 
ATOM   8850  O O    . GLU A 1 594 ? 42.566  59.299  60.138  1.00 62.93  ? 660  GLU A O    1 
ATOM   8851  C CB   . GLU A 1 594 ? 45.666  60.115  60.783  1.00 57.63  ? 660  GLU A CB   1 
ATOM   8852  C CG   . GLU A 1 594 ? 47.128  59.734  60.611  1.00 65.50  ? 660  GLU A CG   1 
ATOM   8853  C CD   . GLU A 1 594 ? 47.959  59.975  61.850  1.00 89.61  ? 660  GLU A CD   1 
ATOM   8854  O OE1  . GLU A 1 594 ? 47.362  60.143  62.936  1.00 109.66 ? 660  GLU A OE1  1 
ATOM   8855  O OE2  . GLU A 1 594 ? 49.208  60.007  61.738  1.00 94.34  ? 660  GLU A OE2  1 
ATOM   8856  H H    . GLU A 1 594 ? 45.921  61.129  58.572  1.00 73.35  ? 660  GLU A H    1 
ATOM   8857  H HA   . GLU A 1 594 ? 44.864  58.864  59.368  1.00 72.79  ? 660  GLU A HA   1 
ATOM   8858  H HB2  . GLU A 1 594 ? 45.625  61.066  60.971  1.00 69.15  ? 660  GLU A HB2  1 
ATOM   8859  H HB3  . GLU A 1 594 ? 45.313  59.615  61.536  1.00 69.15  ? 660  GLU A HB3  1 
ATOM   8860  H HG2  . GLU A 1 594 ? 47.184  58.790  60.394  1.00 78.60  ? 660  GLU A HG2  1 
ATOM   8861  H HG3  . GLU A 1 594 ? 47.508  60.261  59.891  1.00 78.60  ? 660  GLU A HG3  1 
ATOM   8862  N N    . LEU A 1 595 ? 43.031  61.449  59.698  1.00 66.02  ? 661  LEU A N    1 
ATOM   8863  C CA   . LEU A 1 595 ? 41.679  61.913  59.976  1.00 55.35  ? 661  LEU A CA   1 
ATOM   8864  C C    . LEU A 1 595 ? 40.682  61.379  58.951  1.00 52.53  ? 661  LEU A C    1 
ATOM   8865  O O    . LEU A 1 595 ? 39.633  60.847  59.316  1.00 52.67  ? 661  LEU A O    1 
ATOM   8866  C CB   . LEU A 1 595 ? 41.641  63.445  60.041  1.00 47.35  ? 661  LEU A CB   1 
ATOM   8867  C CG   . LEU A 1 595 ? 42.135  64.037  61.370  1.00 41.19  ? 661  LEU A CG   1 
ATOM   8868  C CD1  . LEU A 1 595 ? 42.315  65.531  61.250  1.00 37.64  ? 661  LEU A CD1  1 
ATOM   8869  C CD2  . LEU A 1 595 ? 41.180  63.710  62.526  1.00 48.70  ? 661  LEU A CD2  1 
ATOM   8870  H H    . LEU A 1 595 ? 43.573  62.070  59.454  1.00 79.22  ? 661  LEU A H    1 
ATOM   8871  H HA   . LEU A 1 595 ? 41.411  61.577  60.846  1.00 66.42  ? 661  LEU A HA   1 
ATOM   8872  H HB2  . LEU A 1 595 ? 42.204  63.800  59.334  1.00 56.82  ? 661  LEU A HB2  1 
ATOM   8873  H HB3  . LEU A 1 595 ? 40.727  63.739  59.909  1.00 56.82  ? 661  LEU A HB3  1 
ATOM   8874  H HG   . LEU A 1 595 ? 42.999  63.650  61.581  1.00 49.43  ? 661  LEU A HG   1 
ATOM   8875  H HD11 . LEU A 1 595 ? 42.626  65.880  62.100  1.00 45.16  ? 661  LEU A HD11 1 
ATOM   8876  H HD12 . LEU A 1 595 ? 42.968  65.715  60.557  1.00 45.16  ? 661  LEU A HD12 1 
ATOM   8877  H HD13 . LEU A 1 595 ? 41.463  65.933  61.018  1.00 45.16  ? 661  LEU A HD13 1 
ATOM   8878  H HD21 . LEU A 1 595 ? 41.529  64.101  63.343  1.00 58.44  ? 661  LEU A HD21 1 
ATOM   8879  H HD22 . LEU A 1 595 ? 40.306  64.081  62.328  1.00 58.44  ? 661  LEU A HD22 1 
ATOM   8880  H HD23 . LEU A 1 595 ? 41.117  62.747  62.621  1.00 58.44  ? 661  LEU A HD23 1 
ATOM   8881  N N    . ALA A 1 596 ? 41.017  61.504  57.672  1.00 59.99  ? 662  ALA A N    1 
ATOM   8882  C CA   . ALA A 1 596 ? 40.146  61.017  56.600  1.00 54.57  ? 662  ALA A CA   1 
ATOM   8883  C C    . ALA A 1 596 ? 39.917  59.510  56.691  1.00 58.59  ? 662  ALA A C    1 
ATOM   8884  O O    . ALA A 1 596 ? 38.788  59.035  56.601  1.00 69.67  ? 662  ALA A O    1 
ATOM   8885  C CB   . ALA A 1 596 ? 40.740  61.374  55.252  1.00 48.57  ? 662  ALA A CB   1 
ATOM   8886  H H    . ALA A 1 596 ? 41.745  61.868  57.395  1.00 71.98  ? 662  ALA A H    1 
ATOM   8887  H HA   . ALA A 1 596 ? 39.284  61.455  56.672  1.00 65.49  ? 662  ALA A HA   1 
ATOM   8888  H HB1  . ALA A 1 596 ? 40.154  61.045  54.552  1.00 58.29  ? 662  ALA A HB1  1 
ATOM   8889  H HB2  . ALA A 1 596 ? 40.823  62.338  55.189  1.00 58.29  ? 662  ALA A HB2  1 
ATOM   8890  H HB3  . ALA A 1 596 ? 41.614  60.960  55.173  1.00 58.29  ? 662  ALA A HB3  1 
ATOM   8891  N N    . ASP A 1 597 ? 40.999  58.762  56.871  1.00 72.41  ? 663  ASP A N    1 
ATOM   8892  C CA   . ASP A 1 597 ? 40.927  57.310  56.928  1.00 73.13  ? 663  ASP A CA   1 
ATOM   8893  C C    . ASP A 1 597 ? 40.081  56.844  58.106  1.00 68.92  ? 663  ASP A C    1 
ATOM   8894  O O    . ASP A 1 597 ? 39.330  55.886  57.970  1.00 87.64  ? 663  ASP A O    1 
ATOM   8895  C CB   . ASP A 1 597 ? 42.335  56.690  57.000  1.00 79.81  ? 663  ASP A CB   1 
ATOM   8896  C CG   . ASP A 1 597 ? 43.096  56.773  55.666  1.00 96.09  ? 663  ASP A CG   1 
ATOM   8897  O OD1  . ASP A 1 597 ? 43.057  57.827  54.981  1.00 83.81  ? 663  ASP A OD1  1 
ATOM   8898  O OD2  . ASP A 1 597 ? 43.738  55.765  55.295  1.00 113.08 ? 663  ASP A OD2  1 
ATOM   8899  H H    . ASP A 1 597 ? 41.794  59.076  56.965  1.00 86.90  ? 663  ASP A H    1 
ATOM   8900  H HA   . ASP A 1 597 ? 40.505  56.988  56.117  1.00 87.75  ? 663  ASP A HA   1 
ATOM   8901  H HB2  . ASP A 1 597 ? 42.853  57.161  57.671  1.00 95.77  ? 663  ASP A HB2  1 
ATOM   8902  H HB3  . ASP A 1 597 ? 42.254  55.753  57.241  1.00 95.77  ? 663  ASP A HB3  1 
ATOM   8903  N N    . LYS A 1 598 ? 40.195  57.512  59.253  1.00 58.93  ? 664  LYS A N    1 
ATOM   8904  C CA   . LYS A 1 598 ? 39.391  57.152  60.421  1.00 49.22  ? 664  LYS A CA   1 
ATOM   8905  C C    . LYS A 1 598 ? 37.938  57.548  60.205  1.00 68.86  ? 664  LYS A C    1 
ATOM   8906  O O    . LYS A 1 598 ? 37.024  56.968  60.802  1.00 73.78  ? 664  LYS A O    1 
ATOM   8907  C CB   . LYS A 1 598 ? 39.914  57.828  61.688  1.00 35.15  ? 664  LYS A CB   1 
ATOM   8908  C CG   . LYS A 1 598 ? 38.995  57.644  62.902  1.00 63.22  ? 664  LYS A CG   1 
ATOM   8909  C CD   . LYS A 1 598 ? 39.692  57.954  64.230  1.00 81.12  ? 664  LYS A CD   1 
ATOM   8910  C CE   . LYS A 1 598 ? 38.686  58.074  65.384  1.00 83.03  ? 664  LYS A CE   1 
ATOM   8911  N NZ   . LYS A 1 598 ? 39.300  58.502  66.683  1.00 90.59  ? 664  LYS A NZ   1 
ATOM   8912  H H    . LYS A 1 598 ? 40.728  58.174  59.382  1.00 70.72  ? 664  LYS A H    1 
ATOM   8913  H HA   . LYS A 1 598 ? 39.429  56.191  60.552  1.00 59.06  ? 664  LYS A HA   1 
ATOM   8914  H HB2  . LYS A 1 598 ? 40.780  57.452  61.910  1.00 42.18  ? 664  LYS A HB2  1 
ATOM   8915  H HB3  . LYS A 1 598 ? 40.000  58.780  61.522  1.00 42.18  ? 664  LYS A HB3  1 
ATOM   8916  H HG2  . LYS A 1 598 ? 38.235  58.240  62.816  1.00 75.86  ? 664  LYS A HG2  1 
ATOM   8917  H HG3  . LYS A 1 598 ? 38.692  56.723  62.931  1.00 75.86  ? 664  LYS A HG3  1 
ATOM   8918  H HD2  . LYS A 1 598 ? 40.311  57.238  64.441  1.00 97.35  ? 664  LYS A HD2  1 
ATOM   8919  H HD3  . LYS A 1 598 ? 40.167  58.796  64.153  1.00 97.35  ? 664  LYS A HD3  1 
ATOM   8920  H HE2  . LYS A 1 598 ? 38.013  58.730  65.144  1.00 99.64  ? 664  LYS A HE2  1 
ATOM   8921  H HE3  . LYS A 1 598 ? 38.268  57.210  65.524  1.00 99.64  ? 664  LYS A HE3  1 
ATOM   8922  H HZ1  . LYS A 1 598 ? 38.673  58.554  67.313  1.00 108.70 ? 664  LYS A HZ1  1 
ATOM   8923  H HZ2  . LYS A 1 598 ? 39.916  57.912  66.937  1.00 108.70 ? 664  LYS A HZ2  1 
ATOM   8924  H HZ3  . LYS A 1 598 ? 39.684  59.299  66.590  1.00 108.70 ? 664  LYS A HZ3  1 
ATOM   8925  N N    . PHE A 1 599 ? 37.729  58.543  59.349  1.00 70.05  ? 665  PHE A N    1 
ATOM   8926  C CA   . PHE A 1 599 ? 36.397  59.073  59.117  1.00 61.21  ? 665  PHE A CA   1 
ATOM   8927  C C    . PHE A 1 599 ? 35.578  58.103  58.283  1.00 58.97  ? 665  PHE A C    1 
ATOM   8928  O O    . PHE A 1 599 ? 34.396  57.911  58.552  1.00 74.26  ? 665  PHE A O    1 
ATOM   8929  C CB   . PHE A 1 599 ? 36.480  60.447  58.442  1.00 68.97  ? 665  PHE A CB   1 
ATOM   8930  C CG   . PHE A 1 599 ? 35.205  61.246  58.511  1.00 60.40  ? 665  PHE A CG   1 
ATOM   8931  C CD1  . PHE A 1 599 ? 34.477  61.324  59.687  1.00 80.16  ? 665  PHE A CD1  1 
ATOM   8932  C CD2  . PHE A 1 599 ? 34.751  61.939  57.407  1.00 39.37  ? 665  PHE A CD2  1 
ATOM   8933  C CE1  . PHE A 1 599 ? 33.301  62.059  59.751  1.00 70.25  ? 665  PHE A CE1  1 
ATOM   8934  C CE2  . PHE A 1 599 ? 33.580  62.671  57.464  1.00 57.05  ? 665  PHE A CE2  1 
ATOM   8935  C CZ   . PHE A 1 599 ? 32.854  62.732  58.638  1.00 59.62  ? 665  PHE A CZ   1 
ATOM   8936  H H    . PHE A 1 599 ? 38.346  58.929  58.890  1.00 84.06  ? 665  PHE A H    1 
ATOM   8937  H HA   . PHE A 1 599 ? 35.949  59.185  59.970  1.00 73.45  ? 665  PHE A HA   1 
ATOM   8938  H HB2  . PHE A 1 599 ? 37.177  60.965  58.875  1.00 82.77  ? 665  PHE A HB2  1 
ATOM   8939  H HB3  . PHE A 1 599 ? 36.699  60.321  57.506  1.00 82.77  ? 665  PHE A HB3  1 
ATOM   8940  H HD1  . PHE A 1 599 ? 34.772  60.865  60.440  1.00 96.20  ? 665  PHE A HD1  1 
ATOM   8941  H HD2  . PHE A 1 599 ? 35.228  61.898  56.610  1.00 47.24  ? 665  PHE A HD2  1 
ATOM   8942  H HE1  . PHE A 1 599 ? 32.818  62.097  60.545  1.00 84.30  ? 665  PHE A HE1  1 
ATOM   8943  H HE2  . PHE A 1 599 ? 33.282  63.128  56.710  1.00 68.46  ? 665  PHE A HE2  1 
ATOM   8944  H HZ   . PHE A 1 599 ? 32.070  63.230  58.677  1.00 71.55  ? 665  PHE A HZ   1 
ATOM   8945  N N    . ASN A 1 600 ? 36.202  57.484  57.284  1.00 53.43  ? 666  ASN A N    1 
ATOM   8946  C CA   . ASN A 1 600 ? 35.517  56.487  56.467  1.00 67.46  ? 666  ASN A CA   1 
ATOM   8947  C C    . ASN A 1 600 ? 35.088  55.286  57.301  1.00 70.32  ? 666  ASN A C    1 
ATOM   8948  O O    . ASN A 1 600 ? 34.003  54.743  57.110  1.00 81.74  ? 666  ASN A O    1 
ATOM   8949  C CB   . ASN A 1 600 ? 36.401  56.014  55.308  1.00 76.68  ? 666  ASN A CB   1 
ATOM   8950  C CG   . ASN A 1 600 ? 36.618  57.091  54.252  1.00 91.07  ? 666  ASN A CG   1 
ATOM   8951  O OD1  . ASN A 1 600 ? 35.659  57.630  53.697  1.00 104.19 ? 666  ASN A OD1  1 
ATOM   8952  N ND2  . ASN A 1 600 ? 37.884  57.405  53.967  1.00 77.33  ? 666  ASN A ND2  1 
ATOM   8953  H H    . ASN A 1 600 ? 37.020  57.623  57.059  1.00 64.11  ? 666  ASN A H    1 
ATOM   8954  H HA   . ASN A 1 600 ? 34.718  56.887  56.088  1.00 80.95  ? 666  ASN A HA   1 
ATOM   8955  H HB2  . ASN A 1 600 ? 37.269  55.758  55.657  1.00 92.01  ? 666  ASN A HB2  1 
ATOM   8956  H HB3  . ASN A 1 600 ? 35.979  55.254  54.878  1.00 92.01  ? 666  ASN A HB3  1 
ATOM   8957  H HD21 . ASN A 1 600 ? 38.055  58.007  53.377  1.00 92.79  ? 666  ASN A HD21 1 
ATOM   8958  H HD22 . ASN A 1 600 ? 38.528  57.004  54.372  1.00 92.79  ? 666  ASN A HD22 1 
ATOM   8959  N N    . ARG A 1 601 ? 35.942  54.877  58.229  1.00 71.41  ? 667  ARG A N    1 
ATOM   8960  C CA   . ARG A 1 601 ? 35.698  53.675  59.015  1.00 73.64  ? 667  ARG A CA   1 
ATOM   8961  C C    . ARG A 1 601 ? 34.570  53.880  60.006  1.00 71.99  ? 667  ARG A C    1 
ATOM   8962  O O    . ARG A 1 601 ? 33.796  52.967  60.277  1.00 78.50  ? 667  ARG A O    1 
ATOM   8963  C CB   . ARG A 1 601 ? 36.953  53.285  59.781  1.00 74.40  ? 667  ARG A CB   1 
ATOM   8964  C CG   . ARG A 1 601 ? 38.123  52.897  58.902  1.00 79.74  ? 667  ARG A CG   1 
ATOM   8965  C CD   . ARG A 1 601 ? 39.437  52.966  59.673  1.00 87.23  ? 667  ARG A CD   1 
ATOM   8966  N NE   . ARG A 1 601 ? 40.549  53.290  58.781  1.00 107.77 ? 667  ARG A NE   1 
ATOM   8967  C CZ   . ARG A 1 601 ? 41.393  52.404  58.252  1.00 120.32 ? 667  ARG A CZ   1 
ATOM   8968  N NH1  . ARG A 1 601 ? 41.278  51.106  58.513  1.00 127.57 ? 667  ARG A NH1  1 
ATOM   8969  N NH2  . ARG A 1 601 ? 42.360  52.822  57.444  1.00 118.10 ? 667  ARG A NH2  1 
ATOM   8970  H H    . ARG A 1 601 ? 36.676  55.280  58.425  1.00 85.69  ? 667  ARG A H    1 
ATOM   8971  H HA   . ARG A 1 601 ? 35.459  52.944  58.424  1.00 88.37  ? 667  ARG A HA   1 
ATOM   8972  H HB2  . ARG A 1 601 ? 37.231  54.037  60.326  1.00 89.29  ? 667  ARG A HB2  1 
ATOM   8973  H HB3  . ARG A 1 601 ? 36.748  52.526  60.349  1.00 89.29  ? 667  ARG A HB3  1 
ATOM   8974  H HG2  . ARG A 1 601 ? 38.001  51.988  58.587  1.00 95.68  ? 667  ARG A HG2  1 
ATOM   8975  H HG3  . ARG A 1 601 ? 38.178  53.509  58.151  1.00 95.68  ? 667  ARG A HG3  1 
ATOM   8976  H HD2  . ARG A 1 601 ? 39.377  53.658  60.350  1.00 104.67 ? 667  ARG A HD2  1 
ATOM   8977  H HD3  . ARG A 1 601 ? 39.615  52.106  60.084  1.00 104.67 ? 667  ARG A HD3  1 
ATOM   8978  H HE   . ARG A 1 601 ? 40.668  54.118  58.582  1.00 129.32 ? 667  ARG A HE   1 
ATOM   8979  H HH11 . ARG A 1 601 ? 40.652  50.825  59.033  1.00 153.09 ? 667  ARG A HH11 1 
ATOM   8980  H HH12 . ARG A 1 601 ? 41.830  50.546  58.165  1.00 153.09 ? 667  ARG A HH12 1 
ATOM   8981  H HH21 . ARG A 1 601 ? 42.443  53.660  57.270  1.00 141.72 ? 667  ARG A HH21 1 
ATOM   8982  H HH22 . ARG A 1 601 ? 42.909  52.255  57.102  1.00 141.72 ? 667  ARG A HH22 1 
ATOM   8983  N N    . LEU A 1 602 ? 34.489  55.079  60.562  1.00 73.17  ? 668  LEU A N    1 
ATOM   8984  C CA   . LEU A 1 602 ? 33.403  55.403  61.470  1.00 74.33  ? 668  LEU A CA   1 
ATOM   8985  C C    . LEU A 1 602 ? 32.108  55.445  60.674  1.00 68.90  ? 668  LEU A C    1 
ATOM   8986  O O    . LEU A 1 602 ? 31.053  55.020  61.144  1.00 56.05  ? 668  LEU A O    1 
ATOM   8987  C CB   . LEU A 1 602 ? 33.671  56.738  62.155  1.00 68.41  ? 668  LEU A CB   1 
ATOM   8988  C CG   . LEU A 1 602 ? 34.770  56.652  63.210  1.00 51.20  ? 668  LEU A CG   1 
ATOM   8989  C CD1  . LEU A 1 602 ? 35.387  58.011  63.444  1.00 68.82  ? 668  LEU A CD1  1 
ATOM   8990  C CD2  . LEU A 1 602 ? 34.212  56.098  64.498  1.00 40.01  ? 668  LEU A CD2  1 
ATOM   8991  H H    . LEU A 1 602 ? 35.047  55.719  60.431  1.00 87.81  ? 668  LEU A H    1 
ATOM   8992  H HA   . LEU A 1 602 ? 33.329  54.715  62.150  1.00 89.19  ? 668  LEU A HA   1 
ATOM   8993  H HB2  . LEU A 1 602 ? 33.946  57.386  61.487  1.00 82.09  ? 668  LEU A HB2  1 
ATOM   8994  H HB3  . LEU A 1 602 ? 32.858  57.037  62.592  1.00 82.09  ? 668  LEU A HB3  1 
ATOM   8995  H HG   . LEU A 1 602 ? 35.466  56.052  62.898  1.00 61.44  ? 668  LEU A HG   1 
ATOM   8996  H HD11 . LEU A 1 602 ? 36.081  57.931  64.116  1.00 82.59  ? 668  LEU A HD11 1 
ATOM   8997  H HD12 . LEU A 1 602 ? 35.768  58.332  62.611  1.00 82.59  ? 668  LEU A HD12 1 
ATOM   8998  H HD13 . LEU A 1 602 ? 34.698  58.622  63.750  1.00 82.59  ? 668  LEU A HD13 1 
ATOM   8999  H HD21 . LEU A 1 602 ? 34.924  56.050  65.155  1.00 48.01  ? 668  LEU A HD21 1 
ATOM   9000  H HD22 . LEU A 1 602 ? 33.508  56.685  64.814  1.00 48.01  ? 668  LEU A HD22 1 
ATOM   9001  H HD23 . LEU A 1 602 ? 33.855  55.211  64.332  1.00 48.01  ? 668  LEU A HD23 1 
ATOM   9002  N N    . LEU A 1 603 ? 32.210  55.922  59.441  1.00 61.88  ? 669  LEU A N    1 
ATOM   9003  C CA   . LEU A 1 603 ? 31.043  56.069  58.592  1.00 58.83  ? 669  LEU A CA   1 
ATOM   9004  C C    . LEU A 1 603 ? 30.541  54.729  58.043  1.00 74.11  ? 669  LEU A C    1 
ATOM   9005  O O    . LEU A 1 603 ? 29.421  54.659  57.552  1.00 77.36  ? 669  LEU A O    1 
ATOM   9006  C CB   . LEU A 1 603 ? 31.345  57.027  57.443  1.00 63.02  ? 669  LEU A CB   1 
ATOM   9007  C CG   . LEU A 1 603 ? 30.664  58.404  57.403  1.00 51.72  ? 669  LEU A CG   1 
ATOM   9008  C CD1  . LEU A 1 603 ? 30.057  58.872  58.722  1.00 50.51  ? 669  LEU A CD1  1 
ATOM   9009  C CD2  . LEU A 1 603 ? 31.675  59.426  56.921  1.00 58.05  ? 669  LEU A CD2  1 
ATOM   9010  H H    . LEU A 1 603 ? 32.947  56.168  59.073  1.00 74.26  ? 669  LEU A H    1 
ATOM   9011  H HA   . LEU A 1 603 ? 30.326  56.458  59.117  1.00 70.60  ? 669  LEU A HA   1 
ATOM   9012  H HB2  . LEU A 1 603 ? 32.301  57.191  57.444  1.00 75.63  ? 669  LEU A HB2  1 
ATOM   9013  H HB3  . LEU A 1 603 ? 31.106  56.576  56.618  1.00 75.63  ? 669  LEU A HB3  1 
ATOM   9014  H HG   . LEU A 1 603 ? 29.949  58.372  56.749  1.00 62.07  ? 669  LEU A HG   1 
ATOM   9015  H HD11 . LEU A 1 603 ? 29.655  59.745  58.591  1.00 60.62  ? 669  LEU A HD11 1 
ATOM   9016  H HD12 . LEU A 1 603 ? 29.381  58.235  59.002  1.00 60.62  ? 669  LEU A HD12 1 
ATOM   9017  H HD13 . LEU A 1 603 ? 30.758  58.926  59.390  1.00 60.62  ? 669  LEU A HD13 1 
ATOM   9018  H HD21 . LEU A 1 603 ? 31.252  60.299  56.894  1.00 69.65  ? 669  LEU A HD21 1 
ATOM   9019  H HD22 . LEU A 1 603 ? 32.425  59.441  57.536  1.00 69.65  ? 669  LEU A HD22 1 
ATOM   9020  H HD23 . LEU A 1 603 ? 31.978  59.177  56.034  1.00 69.65  ? 669  LEU A HD23 1 
ATOM   9021  N N    . GLU A 1 604 ? 31.349  53.671  58.125  1.00 90.67  ? 670  GLU A N    1 
ATOM   9022  C CA   . GLU A 1 604 ? 30.866  52.328  57.800  1.00 81.94  ? 670  GLU A CA   1 
ATOM   9023  C C    . GLU A 1 604 ? 29.914  51.799  58.884  1.00 84.99  ? 670  GLU A C    1 
ATOM   9024  O O    . GLU A 1 604 ? 28.720  51.673  58.619  1.00 92.28  ? 670  GLU A O    1 
ATOM   9025  C CB   . GLU A 1 604 ? 32.032  51.371  57.557  1.00 93.96  ? 670  GLU A CB   1 
ATOM   9026  C CG   . GLU A 1 604 ? 32.672  51.539  56.174  1.00 101.14 ? 670  GLU A CG   1 
ATOM   9027  C CD   . GLU A 1 604 ? 34.121  51.055  56.116  1.00 113.52 ? 670  GLU A CD   1 
ATOM   9028  O OE1  . GLU A 1 604 ? 34.588  50.434  57.102  1.00 108.95 ? 670  GLU A OE1  1 
ATOM   9029  O OE2  . GLU A 1 604 ? 34.792  51.298  55.083  1.00 113.08 ? 670  GLU A OE2  1 
ATOM   9030  H H    . GLU A 1 604 ? 32.174  53.703  58.364  1.00 108.81 ? 670  GLU A H    1 
ATOM   9031  H HA   . GLU A 1 604 ? 30.360  52.380  56.974  1.00 98.33  ? 670  GLU A HA   1 
ATOM   9032  H HB2  . GLU A 1 604 ? 32.717  51.533  58.225  1.00 112.75 ? 670  GLU A HB2  1 
ATOM   9033  H HB3  . GLU A 1 604 ? 31.710  50.458  57.628  1.00 112.75 ? 670  GLU A HB3  1 
ATOM   9034  H HG2  . GLU A 1 604 ? 32.161  51.029  55.526  1.00 121.37 ? 670  GLU A HG2  1 
ATOM   9035  H HG3  . GLU A 1 604 ? 32.662  52.480  55.935  1.00 121.37 ? 670  GLU A HG3  1 
ATOM   9036  N N    . ASP A 1 605 ? 30.405  51.522  60.097  1.00 76.38  ? 671  ASP A N    1 
ATOM   9037  C CA   . ASP A 1 605 ? 29.534  50.967  61.149  1.00 88.83  ? 671  ASP A CA   1 
ATOM   9038  C C    . ASP A 1 605 ? 28.328  51.881  61.419  1.00 91.19  ? 671  ASP A C    1 
ATOM   9039  O O    . ASP A 1 605 ? 27.249  51.409  61.785  1.00 84.19  ? 671  ASP A O    1 
ATOM   9040  C CB   . ASP A 1 605 ? 30.308  50.716  62.461  1.00 94.08  ? 671  ASP A CB   1 
ATOM   9041  C CG   . ASP A 1 605 ? 29.635  49.655  63.366  1.00 107.13 ? 671  ASP A CG   1 
ATOM   9042  O OD1  . ASP A 1 605 ? 29.408  48.517  62.891  1.00 119.76 ? 671  ASP A OD1  1 
ATOM   9043  O OD2  . ASP A 1 605 ? 29.335  49.955  64.550  1.00 90.85  ? 671  ASP A OD2  1 
ATOM   9044  H H    . ASP A 1 605 ? 31.222  51.642  60.335  1.00 91.66  ? 671  ASP A H    1 
ATOM   9045  H HA   . ASP A 1 605 ? 29.190  50.112  60.845  1.00 106.59 ? 671  ASP A HA   1 
ATOM   9046  H HB2  . ASP A 1 605 ? 31.200  50.403  62.245  1.00 112.90 ? 671  ASP A HB2  1 
ATOM   9047  H HB3  . ASP A 1 605 ? 30.359  51.546  62.960  1.00 112.90 ? 671  ASP A HB3  1 
ATOM   9048  N N    . PHE A 1 606 ? 28.516  53.184  61.220  1.00 90.18  ? 672  PHE A N    1 
ATOM   9049  C CA   . PHE A 1 606 ? 27.510  54.182  61.589  1.00 86.58  ? 672  PHE A CA   1 
ATOM   9050  C C    . PHE A 1 606 ? 26.312  54.182  60.637  1.00 80.15  ? 672  PHE A C    1 
ATOM   9051  O O    . PHE A 1 606 ? 25.169  54.401  61.061  1.00 69.05  ? 672  PHE A O    1 
ATOM   9052  C CB   . PHE A 1 606 ? 28.155  55.578  61.637  1.00 74.30  ? 672  PHE A CB   1 
ATOM   9053  C CG   . PHE A 1 606 ? 27.269  56.648  62.216  1.00 60.39  ? 672  PHE A CG   1 
ATOM   9054  C CD1  . PHE A 1 606 ? 26.792  56.545  63.507  1.00 52.88  ? 672  PHE A CD1  1 
ATOM   9055  C CD2  . PHE A 1 606 ? 26.935  57.766  61.476  1.00 59.25  ? 672  PHE A CD2  1 
ATOM   9056  C CE1  . PHE A 1 606 ? 25.990  57.526  64.048  1.00 44.26  ? 672  PHE A CE1  1 
ATOM   9057  C CE2  . PHE A 1 606 ? 26.123  58.753  62.014  1.00 57.74  ? 672  PHE A CE2  1 
ATOM   9058  C CZ   . PHE A 1 606 ? 25.656  58.630  63.305  1.00 43.93  ? 672  PHE A CZ   1 
ATOM   9059  H H    . PHE A 1 606 ? 29.225  53.520  60.868  1.00 108.22 ? 672  PHE A H    1 
ATOM   9060  H HA   . PHE A 1 606 ? 27.180  53.977  62.478  1.00 103.90 ? 672  PHE A HA   1 
ATOM   9061  H HB2  . PHE A 1 606 ? 28.956  55.531  62.182  1.00 89.16  ? 672  PHE A HB2  1 
ATOM   9062  H HB3  . PHE A 1 606 ? 28.389  55.844  60.734  1.00 89.16  ? 672  PHE A HB3  1 
ATOM   9063  H HD1  . PHE A 1 606 ? 27.014  55.801  64.019  1.00 63.45  ? 672  PHE A HD1  1 
ATOM   9064  H HD2  . PHE A 1 606 ? 27.249  57.852  60.605  1.00 71.10  ? 672  PHE A HD2  1 
ATOM   9065  H HE1  . PHE A 1 606 ? 25.673  57.439  64.918  1.00 53.11  ? 672  PHE A HE1  1 
ATOM   9066  H HE2  . PHE A 1 606 ? 25.901  59.500  61.507  1.00 69.29  ? 672  PHE A HE2  1 
ATOM   9067  H HZ   . PHE A 1 606 ? 25.112  59.291  63.669  1.00 52.72  ? 672  PHE A HZ   1 
ATOM   9068  N N    . LEU A 1 607 ? 26.581  53.923  59.359  1.00 82.80  ? 673  LEU A N    1 
ATOM   9069  C CA   . LEU A 1 607 ? 25.570  54.033  58.310  1.00 74.16  ? 673  LEU A CA   1 
ATOM   9070  C C    . LEU A 1 607 ? 25.109  52.684  57.749  1.00 80.68  ? 673  LEU A C    1 
ATOM   9071  O O    . LEU A 1 607 ? 24.389  52.651  56.755  1.00 83.83  ? 673  LEU A O    1 
ATOM   9072  C CB   . LEU A 1 607 ? 26.097  54.910  57.168  1.00 61.05  ? 673  LEU A CB   1 
ATOM   9073  C CG   . LEU A 1 607 ? 26.470  56.352  57.524  1.00 65.98  ? 673  LEU A CG   1 
ATOM   9074  C CD1  . LEU A 1 607 ? 27.016  57.080  56.310  1.00 49.91  ? 673  LEU A CD1  1 
ATOM   9075  C CD2  . LEU A 1 607 ? 25.280  57.113  58.100  1.00 66.37  ? 673  LEU A CD2  1 
ATOM   9076  H H    . LEU A 1 607 ? 27.353  53.678  59.070  1.00 99.36  ? 673  LEU A H    1 
ATOM   9077  H HA   . LEU A 1 607 ? 24.790  54.475  58.681  1.00 88.99  ? 673  LEU A HA   1 
ATOM   9078  H HB2  . LEU A 1 607 ? 26.892  54.489  56.806  1.00 73.26  ? 673  LEU A HB2  1 
ATOM   9079  H HB3  . LEU A 1 607 ? 25.415  54.952  56.480  1.00 73.26  ? 673  LEU A HB3  1 
ATOM   9080  H HG   . LEU A 1 607 ? 27.167  56.337  58.198  1.00 79.18  ? 673  LEU A HG   1 
ATOM   9081  H HD11 . LEU A 1 607 ? 27.244  57.988  56.563  1.00 59.89  ? 673  LEU A HD11 1 
ATOM   9082  H HD12 . LEU A 1 607 ? 27.807  56.616  55.993  1.00 59.89  ? 673  LEU A HD12 1 
ATOM   9083  H HD13 . LEU A 1 607 ? 26.338  57.089  55.616  1.00 59.89  ? 673  LEU A HD13 1 
ATOM   9084  H HD21 . LEU A 1 607 ? 25.556  58.018  58.311  1.00 79.64  ? 673  LEU A HD21 1 
ATOM   9085  H HD22 . LEU A 1 607 ? 24.567  57.129  57.442  1.00 79.64  ? 673  LEU A HD22 1 
ATOM   9086  H HD23 . LEU A 1 607 ? 24.977  56.663  58.904  1.00 79.64  ? 673  LEU A HD23 1 
ATOM   9087  N N    . GLN A 1 608 ? 25.525  51.576  58.360  1.00 87.38  ? 674  GLN A N    1 
ATOM   9088  C CA   . GLN A 1 608 ? 24.918  50.282  58.046  1.00 91.92  ? 674  GLN A CA   1 
ATOM   9089  C C    . GLN A 1 608 ? 23.538  50.267  58.691  1.00 108.52 ? 674  GLN A C    1 
ATOM   9090  O O    . GLN A 1 608 ? 23.296  50.987  59.668  1.00 104.70 ? 674  GLN A O    1 
ATOM   9091  C CB   . GLN A 1 608 ? 25.758  49.107  58.560  1.00 88.65  ? 674  GLN A CB   1 
ATOM   9092  C CG   . GLN A 1 608 ? 27.065  48.889  57.808  1.00 100.48 ? 674  GLN A CG   1 
ATOM   9093  C CD   . GLN A 1 608 ? 27.964  47.850  58.468  1.00 115.85 ? 674  GLN A CD   1 
ATOM   9094  O OE1  . GLN A 1 608 ? 27.653  47.327  59.546  1.00 121.63 ? 674  GLN A OE1  1 
ATOM   9095  N NE2  . GLN A 1 608 ? 29.094  47.556  57.825  1.00 118.17 ? 674  GLN A NE2  1 
ATOM   9096  H H    . GLN A 1 608 ? 26.148  51.545  58.952  1.00 104.86 ? 674  GLN A H    1 
ATOM   9097  H HA   . GLN A 1 608 ? 24.814  50.194  57.086  1.00 110.30 ? 674  GLN A HA   1 
ATOM   9098  H HB2  . GLN A 1 608 ? 25.977  49.266  59.491  1.00 106.38 ? 674  GLN A HB2  1 
ATOM   9099  H HB3  . GLN A 1 608 ? 25.234  48.294  58.481  1.00 106.38 ? 674  GLN A HB3  1 
ATOM   9100  H HG2  . GLN A 1 608 ? 26.865  48.584  56.909  1.00 120.58 ? 674  GLN A HG2  1 
ATOM   9101  H HG3  . GLN A 1 608 ? 27.552  49.727  57.773  1.00 120.58 ? 674  GLN A HG3  1 
ATOM   9102  H HE21 . GLN A 1 608 ? 29.280  47.946  57.082  1.00 141.81 ? 674  GLN A HE21 1 
ATOM   9103  H HE22 . GLN A 1 608 ? 29.637  46.976  58.154  1.00 141.81 ? 674  GLN A HE22 1 
ATOM   9104  N N    . GLU A 1 609 ? 22.637  49.453  58.143  1.00 113.31 ? 675  GLU A N    1 
ATOM   9105  C CA   . GLU A 1 609 ? 21.241  49.448  58.573  1.00 112.99 ? 675  GLU A CA   1 
ATOM   9106  C C    . GLU A 1 609 ? 21.038  48.698  59.878  1.00 104.28 ? 675  GLU A C    1 
ATOM   9107  O O    . GLU A 1 609 ? 20.254  49.111  60.735  1.00 92.41  ? 675  GLU A O    1 
ATOM   9108  C CB   . GLU A 1 609 ? 20.370  48.806  57.501  1.00 123.99 ? 675  GLU A CB   1 
ATOM   9109  C CG   . GLU A 1 609 ? 19.900  49.763  56.426  1.00 127.67 ? 675  GLU A CG   1 
ATOM   9110  C CD   . GLU A 1 609 ? 19.723  49.072  55.086  1.00 137.37 ? 675  GLU A CD   1 
ATOM   9111  O OE1  . GLU A 1 609 ? 19.313  47.888  55.074  1.00 136.32 ? 675  GLU A OE1  1 
ATOM   9112  O OE2  . GLU A 1 609 ? 20.007  49.710  54.048  1.00 138.21 ? 675  GLU A OE2  1 
ATOM   9113  H H    . GLU A 1 609 ? 22.811  48.891  57.516  1.00 135.97 ? 675  GLU A H    1 
ATOM   9114  H HA   . GLU A 1 609 ? 20.942  50.362  58.699  1.00 135.59 ? 675  GLU A HA   1 
ATOM   9115  H HB2  . GLU A 1 609 ? 20.877  48.102  57.067  1.00 148.79 ? 675  GLU A HB2  1 
ATOM   9116  H HB3  . GLU A 1 609 ? 19.583  48.429  57.924  1.00 148.79 ? 675  GLU A HB3  1 
ATOM   9117  H HG2  . GLU A 1 609 ? 19.045  50.139  56.687  1.00 153.20 ? 675  GLU A HG2  1 
ATOM   9118  H HG3  . GLU A 1 609 ? 20.557  50.468  56.319  1.00 153.20 ? 675  GLU A HG3  1 
ATOM   9119  N N    . GLY A 1 610 ? 21.739  47.581  60.014  1.00 114.95 ? 676  GLY A N    1 
ATOM   9120  C CA   . GLY A 1 610 ? 21.586  46.737  61.181  1.00 123.62 ? 676  GLY A CA   1 
ATOM   9121  C C    . GLY A 1 610 ? 21.773  47.520  62.474  1.00 121.50 ? 676  GLY A C    1 
ATOM   9122  O O    . GLY A 1 610 ? 20.951  47.424  63.391  1.00 115.60 ? 676  GLY A O    1 
ATOM   9123  H H    . GLY A 1 610 ? 22.312  47.291  59.441  1.00 137.94 ? 676  GLY A H    1 
ATOM   9124  H HA2  . GLY A 1 610 ? 20.699  46.344  61.184  1.00 148.34 ? 676  GLY A HA2  1 
ATOM   9125  H HA3  . GLY A 1 610 ? 22.241  46.023  61.155  1.00 148.34 ? 676  GLY A HA3  1 
ATOM   9126  N N    . GLU A 1 611 ? 22.841  48.319  62.538  1.00 120.16 ? 677  GLU A N    1 
ATOM   9127  C CA   . GLU A 1 611 ? 23.179  49.032  63.769  1.00 109.67 ? 677  GLU A CA   1 
ATOM   9128  C C    . GLU A 1 611 ? 22.562  50.412  63.782  1.00 99.29  ? 677  GLU A C    1 
ATOM   9129  O O    . GLU A 1 611 ? 22.973  51.302  63.034  1.00 98.94  ? 677  GLU A O    1 
ATOM   9130  C CB   . GLU A 1 611 ? 24.691  49.176  63.982  1.00 99.57  ? 677  GLU A CB   1 
ATOM   9131  C CG   . GLU A 1 611 ? 25.028  49.658  65.414  1.00 88.10  ? 677  GLU A CG   1 
ATOM   9132  C CD   . GLU A 1 611 ? 25.063  48.525  66.394  1.00 86.83  ? 677  GLU A CD   1 
ATOM   9133  O OE1  . GLU A 1 611 ? 25.750  47.527  66.088  1.00 96.95  ? 677  GLU A OE1  1 
ATOM   9134  O OE2  . GLU A 1 611 ? 24.377  48.613  67.434  1.00 78.90  ? 677  GLU A OE2  1 
ATOM   9135  H H    . GLU A 1 611 ? 23.382  48.463  61.885  1.00 144.19 ? 677  GLU A H    1 
ATOM   9136  H HA   . GLU A 1 611 ? 22.819  48.539  64.524  1.00 131.60 ? 677  GLU A HA   1 
ATOM   9137  H HB2  . GLU A 1 611 ? 25.116  48.314  63.845  1.00 119.48 ? 677  GLU A HB2  1 
ATOM   9138  H HB3  . GLU A 1 611 ? 25.042  49.826  63.354  1.00 119.48 ? 677  GLU A HB3  1 
ATOM   9139  H HG2  . GLU A 1 611 ? 25.900  50.082  65.411  1.00 105.72 ? 677  GLU A HG2  1 
ATOM   9140  H HG3  . GLU A 1 611 ? 24.351  50.289  65.705  1.00 105.72 ? 677  GLU A HG3  1 
ATOM   9141  N N    . GLU A 1 612 ? 21.558  50.562  64.634  1.00 90.89  ? 678  GLU A N    1 
ATOM   9142  C CA   . GLU A 1 612 ? 21.052  51.861  65.002  1.00 94.20  ? 678  GLU A CA   1 
ATOM   9143  C C    . GLU A 1 612 ? 22.011  52.453  66.035  1.00 95.21  ? 678  GLU A C    1 
ATOM   9144  O O    . GLU A 1 612 ? 21.992  52.048  67.197  1.00 111.76 ? 678  GLU A O    1 
ATOM   9145  C CB   . GLU A 1 612 ? 19.637  51.703  65.562  1.00 102.63 ? 678  GLU A CB   1 
ATOM   9146  C CG   . GLU A 1 612 ? 18.610  51.446  64.453  1.00 110.84 ? 678  GLU A CG   1 
ATOM   9147  C CD   . GLU A 1 612 ? 17.430  50.582  64.869  1.00 109.44 ? 678  GLU A CD   1 
ATOM   9148  O OE1  . GLU A 1 612 ? 17.393  50.087  66.017  1.00 95.55  ? 678  GLU A OE1  1 
ATOM   9149  O OE2  . GLU A 1 612 ? 16.535  50.392  64.019  1.00 116.57 ? 678  GLU A OE2  1 
ATOM   9150  H H    . GLU A 1 612 ? 21.149  49.909  65.016  1.00 109.07 ? 678  GLU A H    1 
ATOM   9151  H HA   . GLU A 1 612 ? 21.024  52.441  64.225  1.00 113.04 ? 678  GLU A HA   1 
ATOM   9152  H HB2  . GLU A 1 612 ? 19.619  50.950  66.173  1.00 123.15 ? 678  GLU A HB2  1 
ATOM   9153  H HB3  . GLU A 1 612 ? 19.385  52.517  66.025  1.00 123.15 ? 678  GLU A HB3  1 
ATOM   9154  H HG2  . GLU A 1 612 ? 18.258  52.298  64.153  1.00 133.01 ? 678  GLU A HG2  1 
ATOM   9155  H HG3  . GLU A 1 612 ? 19.055  50.999  63.716  1.00 133.01 ? 678  GLU A HG3  1 
ATOM   9156  N N    . PRO A 1 613 ? 22.848  53.424  65.621  1.00 65.93  ? 679  PRO A N    1 
ATOM   9157  C CA   . PRO A 1 613 ? 23.895  53.945  66.503  1.00 65.46  ? 679  PRO A CA   1 
ATOM   9158  C C    . PRO A 1 613 ? 23.387  54.909  67.587  1.00 73.77  ? 679  PRO A C    1 
ATOM   9159  O O    . PRO A 1 613 ? 22.684  55.880  67.300  1.00 87.41  ? 679  PRO A O    1 
ATOM   9160  C CB   . PRO A 1 613 ? 24.830  54.656  65.528  1.00 72.62  ? 679  PRO A CB   1 
ATOM   9161  C CG   . PRO A 1 613 ? 23.954  55.111  64.438  1.00 68.25  ? 679  PRO A CG   1 
ATOM   9162  C CD   . PRO A 1 613 ? 22.815  54.146  64.340  1.00 71.51  ? 679  PRO A CD   1 
ATOM   9163  H HA   . PRO A 1 613 ? 24.371  53.214  66.925  1.00 78.56  ? 679  PRO A HA   1 
ATOM   9164  H HB2  . PRO A 1 613 ? 25.253  55.410  65.968  1.00 87.14  ? 679  PRO A HB2  1 
ATOM   9165  H HB3  . PRO A 1 613 ? 25.496  54.032  65.198  1.00 87.14  ? 679  PRO A HB3  1 
ATOM   9166  H HG2  . PRO A 1 613 ? 23.624  55.999  64.643  1.00 81.90  ? 679  PRO A HG2  1 
ATOM   9167  H HG3  . PRO A 1 613 ? 24.456  55.122  63.608  1.00 81.90  ? 679  PRO A HG3  1 
ATOM   9168  H HD2  . PRO A 1 613 ? 21.976  54.624  64.244  1.00 85.81  ? 679  PRO A HD2  1 
ATOM   9169  H HD3  . PRO A 1 613 ? 22.957  53.531  63.603  1.00 85.81  ? 679  PRO A HD3  1 
ATOM   9170  N N    . ASP A 1 614 ? 23.770  54.614  68.829  1.00 72.92  ? 680  ASP A N    1 
ATOM   9171  C CA   . ASP A 1 614 ? 23.388  55.377  70.022  1.00 78.25  ? 680  ASP A CA   1 
ATOM   9172  C C    . ASP A 1 614 ? 24.167  56.687  70.203  1.00 82.71  ? 680  ASP A C    1 
ATOM   9173  O O    . ASP A 1 614 ? 25.014  57.041  69.380  1.00 83.98  ? 680  ASP A O    1 
ATOM   9174  C CB   . ASP A 1 614 ? 23.585  54.504  71.273  1.00 85.41  ? 680  ASP A CB   1 
ATOM   9175  C CG   . ASP A 1 614 ? 24.991  53.905  71.365  1.00 77.63  ? 680  ASP A CG   1 
ATOM   9176  O OD1  . ASP A 1 614 ? 25.667  53.774  70.322  1.00 80.23  ? 680  ASP A OD1  1 
ATOM   9177  O OD2  . ASP A 1 614 ? 25.418  53.548  72.482  1.00 77.04  ? 680  ASP A OD2  1 
ATOM   9178  H H    . ASP A 1 614 ? 24.275  53.943  69.014  1.00 87.50  ? 680  ASP A H    1 
ATOM   9179  H HA   . ASP A 1 614 ? 22.446  55.599  69.961  1.00 93.90  ? 680  ASP A HA   1 
ATOM   9180  H HB2  . ASP A 1 614 ? 23.438  55.047  72.063  1.00 102.50 ? 680  ASP A HB2  1 
ATOM   9181  H HB3  . ASP A 1 614 ? 22.948  53.772  71.250  1.00 102.50 ? 680  ASP A HB3  1 
ATOM   9182  N N    . GLU A 1 615 ? 23.868  57.393  71.294  1.00 78.30  ? 681  GLU A N    1 
ATOM   9183  C CA   . GLU A 1 615 ? 24.489  58.677  71.610  1.00 69.57  ? 681  GLU A CA   1 
ATOM   9184  C C    . GLU A 1 615 ? 26.018  58.587  71.606  1.00 74.64  ? 681  GLU A C    1 
ATOM   9185  O O    . GLU A 1 615 ? 26.716  59.565  71.322  1.00 72.41  ? 681  GLU A O    1 
ATOM   9186  C CB   . GLU A 1 615 ? 23.988  59.142  72.978  1.00 88.82  ? 681  GLU A CB   1 
ATOM   9187  C CG   . GLU A 1 615 ? 24.493  60.501  73.436  1.00 101.54 ? 681  GLU A CG   1 
ATOM   9188  C CD   . GLU A 1 615 ? 23.963  60.884  74.814  1.00 107.26 ? 681  GLU A CD   1 
ATOM   9189  O OE1  . GLU A 1 615 ? 23.450  59.996  75.534  1.00 115.49 ? 681  GLU A OE1  1 
ATOM   9190  O OE2  . GLU A 1 615 ? 24.053  62.076  75.174  1.00 100.46 ? 681  GLU A OE2  1 
ATOM   9191  H H    . GLU A 1 615 ? 23.293  57.140  71.881  1.00 93.96  ? 681  GLU A H    1 
ATOM   9192  H HA   . GLU A 1 615 ? 24.221  59.334  70.949  1.00 83.48  ? 681  GLU A HA   1 
ATOM   9193  H HB2  . GLU A 1 615 ? 23.019  59.187  72.950  1.00 106.58 ? 681  GLU A HB2  1 
ATOM   9194  H HB3  . GLU A 1 615 ? 24.262  58.491  73.642  1.00 106.58 ? 681  GLU A HB3  1 
ATOM   9195  H HG2  . GLU A 1 615 ? 25.462  60.480  73.481  1.00 121.85 ? 681  GLU A HG2  1 
ATOM   9196  H HG3  . GLU A 1 615 ? 24.204  61.177  72.803  1.00 121.85 ? 681  GLU A HG3  1 
ATOM   9197  N N    . ASP A 1 616 ? 26.530  57.399  71.899  1.00 73.85  ? 682  ASP A N    1 
ATOM   9198  C CA   . ASP A 1 616 ? 27.969  57.180  71.976  1.00 60.97  ? 682  ASP A CA   1 
ATOM   9199  C C    . ASP A 1 616 ? 28.610  56.997  70.601  1.00 68.07  ? 682  ASP A C    1 
ATOM   9200  O O    . ASP A 1 616 ? 29.571  57.692  70.270  1.00 75.00  ? 682  ASP A O    1 
ATOM   9201  C CB   . ASP A 1 616 ? 28.257  55.969  72.859  1.00 76.95  ? 682  ASP A CB   1 
ATOM   9202  C CG   . ASP A 1 616 ? 27.919  56.220  74.320  1.00 84.96  ? 682  ASP A CG   1 
ATOM   9203  O OD1  . ASP A 1 616 ? 27.382  57.310  74.636  1.00 94.40  ? 682  ASP A OD1  1 
ATOM   9204  O OD2  . ASP A 1 616 ? 28.168  55.315  75.146  1.00 67.79  ? 682  ASP A OD2  1 
ATOM   9205  H H    . ASP A 1 616 ? 26.061  56.696  72.060  1.00 88.62  ? 682  ASP A H    1 
ATOM   9206  H HA   . ASP A 1 616 ? 28.379  57.954  72.392  1.00 73.17  ? 682  ASP A HA   1 
ATOM   9207  H HB2  . ASP A 1 616 ? 27.723  55.219  72.552  1.00 92.33  ? 682  ASP A HB2  1 
ATOM   9208  H HB3  . ASP A 1 616 ? 29.200  55.752  72.801  1.00 92.33  ? 682  ASP A HB3  1 
ATOM   9209  N N    . ASP A 1 617 ? 28.089  56.056  69.812  1.00 83.68  ? 683  ASP A N    1 
ATOM   9210  C CA   . ASP A 1 617 ? 28.562  55.839  68.442  1.00 68.10  ? 683  ASP A CA   1 
ATOM   9211  C C    . ASP A 1 617 ? 28.576  57.156  67.670  1.00 59.91  ? 683  ASP A C    1 
ATOM   9212  O O    . ASP A 1 617 ? 29.390  57.342  66.773  1.00 70.76  ? 683  ASP A O    1 
ATOM   9213  C CB   . ASP A 1 617 ? 27.673  54.836  67.688  1.00 65.36  ? 683  ASP A CB   1 
ATOM   9214  C CG   . ASP A 1 617 ? 27.816  53.397  68.189  1.00 69.06  ? 683  ASP A CG   1 
ATOM   9215  O OD1  . ASP A 1 617 ? 28.884  53.021  68.707  1.00 58.58  ? 683  ASP A OD1  1 
ATOM   9216  O OD2  . ASP A 1 617 ? 26.844  52.627  68.045  1.00 81.40  ? 683  ASP A OD2  1 
ATOM   9217  H H    . ASP A 1 617 ? 27.455  55.525  70.049  1.00 100.42 ? 683  ASP A H    1 
ATOM   9218  H HA   . ASP A 1 617 ? 29.466  55.489  68.466  1.00 81.72  ? 683  ASP A HA   1 
ATOM   9219  H HB2  . ASP A 1 617 ? 26.745  55.097  67.794  1.00 78.43  ? 683  ASP A HB2  1 
ATOM   9220  H HB3  . ASP A 1 617 ? 27.913  54.849  66.748  1.00 78.43  ? 683  ASP A HB3  1 
ATOM   9221  N N    . ALA A 1 618 ? 27.667  58.063  68.022  1.00 40.26  ? 684  ALA A N    1 
ATOM   9222  C CA   . ALA A 1 618 ? 27.536  59.341  67.331  1.00 54.19  ? 684  ALA A CA   1 
ATOM   9223  C C    . ALA A 1 618 ? 28.694  60.288  67.637  1.00 59.08  ? 684  ALA A C    1 
ATOM   9224  O O    . ALA A 1 618 ? 29.346  60.793  66.726  1.00 53.15  ? 684  ALA A O    1 
ATOM   9225  C CB   . ALA A 1 618 ? 26.207  59.999  67.693  1.00 46.93  ? 684  ALA A CB   1 
ATOM   9226  H H    . ALA A 1 618 ? 27.108  57.959  68.667  1.00 48.31  ? 684  ALA A H    1 
ATOM   9227  H HA   . ALA A 1 618 ? 27.534  59.178  66.375  1.00 65.03  ? 684  ALA A HA   1 
ATOM   9228  H HB1  . ALA A 1 618 ? 26.136  60.846  67.226  1.00 56.31  ? 684  ALA A HB1  1 
ATOM   9229  H HB2  . ALA A 1 618 ? 25.482  59.412  67.426  1.00 56.31  ? 684  ALA A HB2  1 
ATOM   9230  H HB3  . ALA A 1 618 ? 26.178  60.146  68.651  1.00 56.31  ? 684  ALA A HB3  1 
ATOM   9231  N N    . TYR A 1 619 ? 28.936  60.527  68.922  1.00 53.99  ? 685  TYR A N    1 
ATOM   9232  C CA   . TYR A 1 619 ? 30.019  61.397  69.370  1.00 52.01  ? 685  TYR A CA   1 
ATOM   9233  C C    . TYR A 1 619 ? 31.350  60.959  68.788  1.00 49.11  ? 685  TYR A C    1 
ATOM   9234  O O    . TYR A 1 619 ? 32.207  61.790  68.493  1.00 58.21  ? 685  TYR A O    1 
ATOM   9235  C CB   . TYR A 1 619 ? 30.086  61.371  70.897  1.00 63.04  ? 685  TYR A CB   1 
ATOM   9236  C CG   . TYR A 1 619 ? 31.058  62.344  71.536  1.00 58.42  ? 685  TYR A CG   1 
ATOM   9237  C CD1  . TYR A 1 619 ? 30.667  63.644  71.849  1.00 65.27  ? 685  TYR A CD1  1 
ATOM   9238  C CD2  . TYR A 1 619 ? 32.351  61.950  71.866  1.00 54.92  ? 685  TYR A CD2  1 
ATOM   9239  C CE1  . TYR A 1 619 ? 31.545  64.532  72.452  1.00 73.20  ? 685  TYR A CE1  1 
ATOM   9240  C CE2  . TYR A 1 619 ? 33.235  62.830  72.472  1.00 62.24  ? 685  TYR A CE2  1 
ATOM   9241  C CZ   . TYR A 1 619 ? 32.827  64.121  72.758  1.00 71.05  ? 685  TYR A CZ   1 
ATOM   9242  O OH   . TYR A 1 619 ? 33.698  65.003  73.354  1.00 77.86  ? 685  TYR A OH   1 
ATOM   9243  H H    . TYR A 1 619 ? 28.476  60.190  69.567  1.00 64.79  ? 685  TYR A H    1 
ATOM   9244  H HA   . TYR A 1 619 ? 29.843  62.307  69.085  1.00 62.42  ? 685  TYR A HA   1 
ATOM   9245  H HB2  . TYR A 1 619 ? 29.203  61.574  71.245  1.00 75.65  ? 685  TYR A HB2  1 
ATOM   9246  H HB3  . TYR A 1 619 ? 30.345  60.479  71.176  1.00 75.65  ? 685  TYR A HB3  1 
ATOM   9247  H HD1  . TYR A 1 619 ? 29.805  63.924  71.643  1.00 78.33  ? 685  TYR A HD1  1 
ATOM   9248  H HD2  . TYR A 1 619 ? 32.628  61.083  71.673  1.00 65.91  ? 685  TYR A HD2  1 
ATOM   9249  H HE1  . TYR A 1 619 ? 31.273  65.400  72.646  1.00 87.84  ? 685  TYR A HE1  1 
ATOM   9250  H HE2  . TYR A 1 619 ? 34.100  62.557  72.678  1.00 74.69  ? 685  TYR A HE2  1 
ATOM   9251  H HH   . TYR A 1 619 ? 34.439  64.630  73.486  1.00 93.43  ? 685  TYR A HH   1 
ATOM   9252  N N    . GLN A 1 620 ? 31.520  59.649  68.633  1.00 55.63  ? 686  GLN A N    1 
ATOM   9253  C CA   . GLN A 1 620 ? 32.694  59.097  67.976  1.00 56.15  ? 686  GLN A CA   1 
ATOM   9254  C C    . GLN A 1 620 ? 32.872  59.756  66.625  1.00 52.23  ? 686  GLN A C    1 
ATOM   9255  O O    . GLN A 1 620 ? 33.975  60.143  66.250  1.00 57.71  ? 686  GLN A O    1 
ATOM   9256  C CB   . GLN A 1 620 ? 32.521  57.594  67.757  1.00 71.85  ? 686  GLN A CB   1 
ATOM   9257  C CG   . GLN A 1 620 ? 33.076  56.712  68.845  1.00 74.85  ? 686  GLN A CG   1 
ATOM   9258  C CD   . GLN A 1 620 ? 34.532  56.992  69.114  1.00 79.25  ? 686  GLN A CD   1 
ATOM   9259  O OE1  . GLN A 1 620 ? 35.399  56.709  68.280  1.00 76.91  ? 686  GLN A OE1  1 
ATOM   9260  N NE2  . GLN A 1 620 ? 34.813  57.577  70.279  1.00 76.71  ? 686  GLN A NE2  1 
ATOM   9261  H H    . GLN A 1 620 ? 30.961  59.054  68.904  1.00 66.76  ? 686  GLN A H    1 
ATOM   9262  H HA   . GLN A 1 620 ? 33.486  59.253  68.515  1.00 67.38  ? 686  GLN A HA   1 
ATOM   9263  H HB2  . GLN A 1 620 ? 31.573  57.403  67.683  1.00 86.22  ? 686  GLN A HB2  1 
ATOM   9264  H HB3  . GLN A 1 620 ? 32.966  57.352  66.931  1.00 86.22  ? 686  GLN A HB3  1 
ATOM   9265  H HG2  . GLN A 1 620 ? 32.582  56.869  69.665  1.00 89.82  ? 686  GLN A HG2  1 
ATOM   9266  H HG3  . GLN A 1 620 ? 32.991  55.784  68.576  1.00 89.82  ? 686  GLN A HG3  1 
ATOM   9267  H HE21 . GLN A 1 620 ? 34.178  57.773  70.826  1.00 92.05  ? 686  GLN A HE21 1 
ATOM   9268  H HE22 . GLN A 1 620 ? 35.628  57.759  70.483  1.00 92.05  ? 686  GLN A HE22 1 
ATOM   9269  N N    . VAL A 1 621 ? 31.764  59.883  65.902  1.00 48.60  ? 687  VAL A N    1 
ATOM   9270  C CA   . VAL A 1 621 ? 31.766  60.476  64.569  1.00 51.47  ? 687  VAL A CA   1 
ATOM   9271  C C    . VAL A 1 621 ? 31.924  61.986  64.652  1.00 51.71  ? 687  VAL A C    1 
ATOM   9272  O O    . VAL A 1 621 ? 32.732  62.584  63.940  1.00 51.47  ? 687  VAL A O    1 
ATOM   9273  C CB   . VAL A 1 621 ? 30.454  60.200  63.836  1.00 44.09  ? 687  VAL A CB   1 
ATOM   9274  C CG1  . VAL A 1 621 ? 30.535  60.709  62.414  1.00 51.67  ? 687  VAL A CG1  1 
ATOM   9275  C CG2  . VAL A 1 621 ? 30.127  58.723  63.854  1.00 48.46  ? 687  VAL A CG2  1 
ATOM   9276  H H    . VAL A 1 621 ? 30.986  59.629  66.166  1.00 58.32  ? 687  VAL A H    1 
ATOM   9277  H HA   . VAL A 1 621 ? 32.499  60.112  64.047  1.00 61.77  ? 687  VAL A HA   1 
ATOM   9278  H HB   . VAL A 1 621 ? 29.735  60.673  64.285  1.00 52.91  ? 687  VAL A HB   1 
ATOM   9279  H HG11 . VAL A 1 621 ? 29.695  60.526  61.965  1.00 62.00  ? 687  VAL A HG11 1 
ATOM   9280  H HG12 . VAL A 1 621 ? 30.701  61.665  62.430  1.00 62.00  ? 687  VAL A HG12 1 
ATOM   9281  H HG13 . VAL A 1 621 ? 31.260  60.255  61.957  1.00 62.00  ? 687  VAL A HG13 1 
ATOM   9282  H HG21 . VAL A 1 621 ? 29.291  58.579  63.383  1.00 58.15  ? 687  VAL A HG21 1 
ATOM   9283  H HG22 . VAL A 1 621 ? 30.842  58.236  63.414  1.00 58.15  ? 687  VAL A HG22 1 
ATOM   9284  H HG23 . VAL A 1 621 ? 30.043  58.429  64.774  1.00 58.15  ? 687  VAL A HG23 1 
ATOM   9285  N N    . LEU A 1 622 ? 31.123  62.597  65.515  1.00 57.38  ? 688  LEU A N    1 
ATOM   9286  C CA   . LEU A 1 622 ? 31.178  64.030  65.716  1.00 44.00  ? 688  LEU A CA   1 
ATOM   9287  C C    . LEU A 1 622 ? 32.596  64.464  66.028  1.00 44.42  ? 688  LEU A C    1 
ATOM   9288  O O    . LEU A 1 622 ? 33.144  65.345  65.365  1.00 40.41  ? 688  LEU A O    1 
ATOM   9289  C CB   . LEU A 1 622 ? 30.266  64.440  66.861  1.00 37.07  ? 688  LEU A CB   1 
ATOM   9290  C CG   . LEU A 1 622 ? 30.399  65.907  67.270  1.00 44.56  ? 688  LEU A CG   1 
ATOM   9291  C CD1  . LEU A 1 622 ? 30.169  66.817  66.074  1.00 44.69  ? 688  LEU A CD1  1 
ATOM   9292  C CD2  . LEU A 1 622 ? 29.442  66.240  68.413  1.00 45.01  ? 688  LEU A CD2  1 
ATOM   9293  H H    . LEU A 1 622 ? 30.534  62.197  65.998  1.00 68.85  ? 688  LEU A H    1 
ATOM   9294  H HA   . LEU A 1 622 ? 30.885  64.484  64.910  1.00 52.80  ? 688  LEU A HA   1 
ATOM   9295  H HB2  . LEU A 1 622 ? 29.346  64.289  66.595  1.00 44.48  ? 688  LEU A HB2  1 
ATOM   9296  H HB3  . LEU A 1 622 ? 30.477  63.896  67.636  1.00 44.48  ? 688  LEU A HB3  1 
ATOM   9297  H HG   . LEU A 1 622 ? 31.303  66.060  67.587  1.00 53.47  ? 688  LEU A HG   1 
ATOM   9298  H HD11 . LEU A 1 622 ? 30.259  67.740  66.358  1.00 53.63  ? 688  LEU A HD11 1 
ATOM   9299  H HD12 . LEU A 1 622 ? 30.829  66.615  65.392  1.00 53.63  ? 688  LEU A HD12 1 
ATOM   9300  H HD13 . LEU A 1 622 ? 29.277  66.662  65.727  1.00 53.63  ? 688  LEU A HD13 1 
ATOM   9301  H HD21 . LEU A 1 622 ? 29.548  67.174  68.651  1.00 54.01  ? 688  LEU A HD21 1 
ATOM   9302  H HD22 . LEU A 1 622 ? 28.532  66.073  68.121  1.00 54.01  ? 688  LEU A HD22 1 
ATOM   9303  H HD23 . LEU A 1 622 ? 29.653  65.678  69.175  1.00 54.01  ? 688  LEU A HD23 1 
ATOM   9304  N N    . SER A 1 623 ? 33.179  63.836  67.042  1.00 42.60  ? 689  SER A N    1 
ATOM   9305  C CA   . SER A 1 623 ? 34.541  64.145  67.456  1.00 55.64  ? 689  SER A CA   1 
ATOM   9306  C C    . SER A 1 623 ? 35.475  64.157  66.257  1.00 55.38  ? 689  SER A C    1 
ATOM   9307  O O    . SER A 1 623 ? 36.259  65.082  66.081  1.00 54.00  ? 689  SER A O    1 
ATOM   9308  C CB   . SER A 1 623 ? 35.038  63.115  68.471  1.00 57.00  ? 689  SER A CB   1 
ATOM   9309  O OG   . SER A 1 623 ? 34.197  63.062  69.607  1.00 55.70  ? 689  SER A OG   1 
ATOM   9310  H H    . SER A 1 623 ? 32.803  63.221  67.511  1.00 51.13  ? 689  SER A H    1 
ATOM   9311  H HA   . SER A 1 623 ? 34.562  65.021  67.872  1.00 66.77  ? 689  SER A HA   1 
ATOM   9312  H HB2  . SER A 1 623 ? 35.052  62.242  68.049  1.00 68.40  ? 689  SER A HB2  1 
ATOM   9313  H HB3  . SER A 1 623 ? 35.932  63.360  68.754  1.00 68.40  ? 689  SER A HB3  1 
ATOM   9314  H HG   . SER A 1 623 ? 33.418  62.849  69.377  1.00 66.84  ? 689  SER A HG   1 
ATOM   9315  N N    . THR A 1 624 ? 35.374  63.133  65.419  1.00 37.89  ? 690  THR A N    1 
ATOM   9316  C CA   . THR A 1 624 ? 36.271  63.009  64.286  1.00 37.40  ? 690  THR A CA   1 
ATOM   9317  C C    . THR A 1 624 ? 35.926  64.013  63.206  1.00 45.77  ? 690  THR A C    1 
ATOM   9318  O O    . THR A 1 624 ? 36.821  64.624  62.632  1.00 56.32  ? 690  THR A O    1 
ATOM   9319  C CB   . THR A 1 624 ? 36.247  61.582  63.716  1.00 54.11  ? 690  THR A CB   1 
ATOM   9320  O OG1  . THR A 1 624 ? 36.808  60.683  64.683  1.00 54.41  ? 690  THR A OG1  1 
ATOM   9321  C CG2  . THR A 1 624 ? 37.046  61.485  62.412  1.00 56.33  ? 690  THR A CG2  1 
ATOM   9322  H H    . THR A 1 624 ? 34.795  62.500  65.486  1.00 45.47  ? 690  THR A H    1 
ATOM   9323  H HA   . THR A 1 624 ? 37.175  63.194  64.583  1.00 44.87  ? 690  THR A HA   1 
ATOM   9324  H HB   . THR A 1 624 ? 35.330  61.325  63.532  1.00 64.94  ? 690  THR A HB   1 
ATOM   9325  H HG1  . THR A 1 624 ? 37.600  60.903  64.854  1.00 65.30  ? 690  THR A HG1  1 
ATOM   9326  H HG21 . THR A 1 624 ? 37.016  60.577  62.072  1.00 67.60  ? 690  THR A HG21 1 
ATOM   9327  H HG22 . THR A 1 624 ? 36.669  62.083  61.748  1.00 67.60  ? 690  THR A HG22 1 
ATOM   9328  H HG23 . THR A 1 624 ? 37.970  61.732  62.571  1.00 67.60  ? 690  THR A HG23 1 
ATOM   9329  N N    . LEU A 1 625 ? 34.631  64.184  62.939  1.00 43.59  ? 691  LEU A N    1 
ATOM   9330  C CA   . LEU A 1 625 ? 34.157  65.119  61.923  1.00 33.66  ? 691  LEU A CA   1 
ATOM   9331  C C    . LEU A 1 625 ? 34.563  66.572  62.209  1.00 48.18  ? 691  LEU A C    1 
ATOM   9332  O O    . LEU A 1 625 ? 35.006  67.278  61.309  1.00 54.09  ? 691  LEU A O    1 
ATOM   9333  C CB   . LEU A 1 625 ? 32.639  65.016  61.810  1.00 40.29  ? 691  LEU A CB   1 
ATOM   9334  C CG   . LEU A 1 625 ? 31.870  66.128  61.083  1.00 44.66  ? 691  LEU A CG   1 
ATOM   9335  C CD1  . LEU A 1 625 ? 32.299  66.244  59.630  1.00 37.14  ? 691  LEU A CD1  1 
ATOM   9336  C CD2  . LEU A 1 625 ? 30.385  65.867  61.195  1.00 29.35  ? 691  LEU A CD2  1 
ATOM   9337  H H    . LEU A 1 625 ? 33.998  63.761  63.340  1.00 52.30  ? 691  LEU A H    1 
ATOM   9338  H HA   . LEU A 1 625 ? 34.537  64.868  61.066  1.00 40.40  ? 691  LEU A HA   1 
ATOM   9339  H HB2  . LEU A 1 625 ? 32.434  64.188  61.348  1.00 48.35  ? 691  LEU A HB2  1 
ATOM   9340  H HB3  . LEU A 1 625 ? 32.279  64.971  62.710  1.00 48.35  ? 691  LEU A HB3  1 
ATOM   9341  H HG   . LEU A 1 625 ? 32.058  66.974  61.518  1.00 53.59  ? 691  LEU A HG   1 
ATOM   9342  H HD11 . LEU A 1 625 ? 31.792  66.955  59.208  1.00 44.57  ? 691  LEU A HD11 1 
ATOM   9343  H HD12 . LEU A 1 625 ? 33.246  66.448  59.597  1.00 44.57  ? 691  LEU A HD12 1 
ATOM   9344  H HD13 . LEU A 1 625 ? 32.125  65.402  59.182  1.00 44.57  ? 691  LEU A HD13 1 
ATOM   9345  H HD21 . LEU A 1 625 ? 29.905  66.573  60.734  1.00 35.21  ? 691  LEU A HD21 1 
ATOM   9346  H HD22 . LEU A 1 625 ? 30.184  65.010  60.789  1.00 35.21  ? 691  LEU A HD22 1 
ATOM   9347  H HD23 . LEU A 1 625 ? 30.137  65.856  62.133  1.00 35.21  ? 691  LEU A HD23 1 
ATOM   9348  N N    . LYS A 1 626 ? 34.390  67.017  63.454  1.00 52.17  ? 692  LYS A N    1 
ATOM   9349  C CA   . LYS A 1 626 ? 34.826  68.348  63.880  1.00 45.02  ? 692  LYS A CA   1 
ATOM   9350  C C    . LYS A 1 626 ? 36.269  68.644  63.468  1.00 53.78  ? 692  LYS A C    1 
ATOM   9351  O O    . LYS A 1 626 ? 36.554  69.712  62.922  1.00 54.62  ? 692  LYS A O    1 
ATOM   9352  C CB   . LYS A 1 626 ? 34.720  68.475  65.396  1.00 32.98  ? 692  LYS A CB   1 
ATOM   9353  C CG   . LYS A 1 626 ? 33.330  68.284  65.933  1.00 46.29  ? 692  LYS A CG   1 
ATOM   9354  C CD   . LYS A 1 626 ? 32.783  69.528  66.574  1.00 47.39  ? 692  LYS A CD   1 
ATOM   9355  C CE   . LYS A 1 626 ? 33.196  69.643  68.016  1.00 56.63  ? 692  LYS A CE   1 
ATOM   9356  N NZ   . LYS A 1 626 ? 32.647  70.890  68.641  1.00 75.99  ? 692  LYS A NZ   1 
ATOM   9357  H H    . LYS A 1 626 ? 34.018  66.559  64.080  1.00 62.60  ? 692  LYS A H    1 
ATOM   9358  H HA   . LYS A 1 626 ? 34.251  69.017  63.477  1.00 54.03  ? 692  LYS A HA   1 
ATOM   9359  H HB2  . LYS A 1 626 ? 35.289  67.805  65.805  1.00 39.58  ? 692  LYS A HB2  1 
ATOM   9360  H HB3  . LYS A 1 626 ? 35.018  69.361  65.656  1.00 39.58  ? 692  LYS A HB3  1 
ATOM   9361  H HG2  . LYS A 1 626 ? 32.740  68.038  65.203  1.00 55.55  ? 692  LYS A HG2  1 
ATOM   9362  H HG3  . LYS A 1 626 ? 33.342  67.582  66.602  1.00 55.55  ? 692  LYS A HG3  1 
ATOM   9363  H HD2  . LYS A 1 626 ? 33.118  70.305  66.100  1.00 56.87  ? 692  LYS A HD2  1 
ATOM   9364  H HD3  . LYS A 1 626 ? 31.814  69.506  66.537  1.00 56.87  ? 692  LYS A HD3  1 
ATOM   9365  H HE2  . LYS A 1 626 ? 32.856  68.880  68.509  1.00 67.96  ? 692  LYS A HE2  1 
ATOM   9366  H HE3  . LYS A 1 626 ? 34.164  69.675  68.070  1.00 67.96  ? 692  LYS A HE3  1 
ATOM   9367  H HZ1  . LYS A 1 626 ? 32.902  70.941  69.492  1.00 91.19  ? 692  LYS A HZ1  1 
ATOM   9368  H HZ2  . LYS A 1 626 ? 32.948  71.606  68.205  1.00 91.19  ? 692  LYS A HZ2  1 
ATOM   9369  H HZ3  . LYS A 1 626 ? 31.758  70.883  68.604  1.00 91.19  ? 692  LYS A HZ3  1 
ATOM   9370  N N    . ARG A 1 627 ? 37.174  67.702  63.738  1.00 39.43  ? 693  ARG A N    1 
ATOM   9371  C CA   . ARG A 1 627 ? 38.592  67.887  63.428  1.00 42.18  ? 693  ARG A CA   1 
ATOM   9372  C C    . ARG A 1 627 ? 38.792  68.069  61.949  1.00 40.58  ? 693  ARG A C    1 
ATOM   9373  O O    . ARG A 1 627 ? 39.645  68.833  61.513  1.00 37.69  ? 693  ARG A O    1 
ATOM   9374  C CB   . ARG A 1 627 ? 39.414  66.680  63.884  1.00 44.11  ? 693  ARG A CB   1 
ATOM   9375  C CG   . ARG A 1 627 ? 39.039  66.194  65.262  1.00 50.83  ? 693  ARG A CG   1 
ATOM   9376  C CD   . ARG A 1 627 ? 40.071  65.283  65.857  1.00 45.43  ? 693  ARG A CD   1 
ATOM   9377  N NE   . ARG A 1 627 ? 39.680  64.901  67.209  1.00 39.15  ? 693  ARG A NE   1 
ATOM   9378  C CZ   . ARG A 1 627 ? 39.268  63.688  67.573  1.00 61.39  ? 693  ARG A CZ   1 
ATOM   9379  N NH1  . ARG A 1 627 ? 39.207  62.682  66.697  1.00 74.00  ? 693  ARG A NH1  1 
ATOM   9380  N NH2  . ARG A 1 627 ? 38.931  63.471  68.841  1.00 56.83  ? 693  ARG A NH2  1 
ATOM   9381  H H    . ARG A 1 627 ? 36.992  66.945  64.103  1.00 47.32  ? 693  ARG A H    1 
ATOM   9382  H HA   . ARG A 1 627 ? 38.925  68.676  63.884  1.00 50.62  ? 693  ARG A HA   1 
ATOM   9383  H HB2  . ARG A 1 627 ? 39.272  65.949  63.261  1.00 52.94  ? 693  ARG A HB2  1 
ATOM   9384  H HB3  . ARG A 1 627 ? 40.352  66.925  63.898  1.00 52.94  ? 693  ARG A HB3  1 
ATOM   9385  H HG2  . ARG A 1 627 ? 38.939  66.959  65.850  1.00 61.00  ? 693  ARG A HG2  1 
ATOM   9386  H HG3  . ARG A 1 627 ? 38.202  65.706  65.208  1.00 61.00  ? 693  ARG A HG3  1 
ATOM   9387  H HD2  . ARG A 1 627 ? 40.144  64.480  65.318  1.00 54.52  ? 693  ARG A HD2  1 
ATOM   9388  H HD3  . ARG A 1 627 ? 40.923  65.743  65.900  1.00 54.52  ? 693  ARG A HD3  1 
ATOM   9389  H HE   . ARG A 1 627 ? 39.718  65.506  67.819  1.00 46.99  ? 693  ARG A HE   1 
ATOM   9390  H HH11 . ARG A 1 627 ? 39.423  62.814  65.875  1.00 88.80  ? 693  ARG A HH11 1 
ATOM   9391  H HH12 . ARG A 1 627 ? 38.943  61.904  66.953  1.00 88.80  ? 693  ARG A HH12 1 
ATOM   9392  H HH21 . ARG A 1 627 ? 38.973  64.112  69.413  1.00 68.19  ? 693  ARG A HH21 1 
ATOM   9393  H HH22 . ARG A 1 627 ? 38.672  62.690  69.089  1.00 68.19  ? 693  ARG A HH22 1 
ATOM   9394  N N    . ILE A 1 628 ? 38.001  67.346  61.173  1.00 43.40  ? 694  ILE A N    1 
ATOM   9395  C CA   . ILE A 1 628 ? 38.079  67.450  59.725  1.00 45.29  ? 694  ILE A CA   1 
ATOM   9396  C C    . ILE A 1 628 ? 37.482  68.778  59.254  1.00 52.82  ? 694  ILE A C    1 
ATOM   9397  O O    . ILE A 1 628 ? 38.047  69.470  58.398  1.00 67.64  ? 694  ILE A O    1 
ATOM   9398  C CB   . ILE A 1 628 ? 37.386  66.243  59.043  1.00 48.23  ? 694  ILE A CB   1 
ATOM   9399  C CG1  . ILE A 1 628 ? 38.287  65.010  59.190  1.00 57.04  ? 694  ILE A CG1  1 
ATOM   9400  C CG2  . ILE A 1 628 ? 37.038  66.550  57.566  1.00 40.39  ? 694  ILE A CG2  1 
ATOM   9401  C CD1  . ILE A 1 628 ? 38.040  63.895  58.199  1.00 59.76  ? 694  ILE A CD1  1 
ATOM   9402  H H    . ILE A 1 628 ? 37.411  66.789  61.458  1.00 52.08  ? 694  ILE A H    1 
ATOM   9403  H HA   . ILE A 1 628 ? 39.013  67.439  59.464  1.00 54.34  ? 694  ILE A HA   1 
ATOM   9404  H HB   . ILE A 1 628 ? 36.558  66.066  59.515  1.00 57.88  ? 694  ILE A HB   1 
ATOM   9405  H HG12 . ILE A 1 628 ? 39.210  65.291  59.086  1.00 68.45  ? 694  ILE A HG12 1 
ATOM   9406  H HG13 . ILE A 1 628 ? 38.160  64.642  60.078  1.00 68.45  ? 694  ILE A HG13 1 
ATOM   9407  H HG21 . ILE A 1 628 ? 36.608  65.774  57.175  1.00 48.47  ? 694  ILE A HG21 1 
ATOM   9408  H HG22 . ILE A 1 628 ? 36.438  67.312  57.535  1.00 48.47  ? 694  ILE A HG22 1 
ATOM   9409  H HG23 . ILE A 1 628 ? 37.856  66.753  57.085  1.00 48.47  ? 694  ILE A HG23 1 
ATOM   9410  H HD11 . ILE A 1 628 ? 38.658  63.170  58.380  1.00 71.71  ? 694  ILE A HD11 1 
ATOM   9411  H HD12 . ILE A 1 628 ? 37.126  63.583  58.297  1.00 71.71  ? 694  ILE A HD12 1 
ATOM   9412  H HD13 . ILE A 1 628 ? 38.180  64.234  57.301  1.00 71.71  ? 694  ILE A HD13 1 
ATOM   9413  N N    . THR A 1 629 ? 36.336  69.136  59.812  1.00 44.59  ? 695  THR A N    1 
ATOM   9414  C CA   . THR A 1 629 ? 35.703  70.381  59.427  1.00 56.14  ? 695  THR A CA   1 
ATOM   9415  C C    . THR A 1 629 ? 36.620  71.562  59.768  1.00 57.36  ? 695  THR A C    1 
ATOM   9416  O O    . THR A 1 629 ? 36.862  72.429  58.930  1.00 59.03  ? 695  THR A O    1 
ATOM   9417  C CB   . THR A 1 629 ? 34.336  70.539  60.094  1.00 50.77  ? 695  THR A CB   1 
ATOM   9418  O OG1  . THR A 1 629 ? 33.552  69.361  59.849  1.00 49.65  ? 695  THR A OG1  1 
ATOM   9419  C CG2  . THR A 1 629 ? 33.621  71.754  59.538  1.00 40.36  ? 695  THR A CG2  1 
ATOM   9420  H H    . THR A 1 629 ? 35.912  68.683  60.407  1.00 53.50  ? 695  THR A H    1 
ATOM   9421  H HA   . THR A 1 629 ? 35.566  70.378  58.466  1.00 67.37  ? 695  THR A HA   1 
ATOM   9422  H HB   . THR A 1 629 ? 34.453  70.660  61.049  1.00 60.92  ? 695  THR A HB   1 
ATOM   9423  H HG1  . THR A 1 629 ? 33.939  68.687  60.166  1.00 59.58  ? 695  THR A HG1  1 
ATOM   9424  H HG21 . THR A 1 629 ? 32.754  71.851  59.963  1.00 48.43  ? 695  THR A HG21 1 
ATOM   9425  H HG22 . THR A 1 629 ? 34.146  72.552  59.704  1.00 48.43  ? 695  THR A HG22 1 
ATOM   9426  H HG23 . THR A 1 629 ? 33.493  71.654  58.581  1.00 48.43  ? 695  THR A HG23 1 
ATOM   9427  N N    . ALA A 1 630 ? 37.154  71.579  60.985  1.00 61.34  ? 696  ALA A N    1 
ATOM   9428  C CA   . ALA A 1 630 ? 38.046  72.659  61.404  1.00 51.19  ? 696  ALA A CA   1 
ATOM   9429  C C    . ALA A 1 630 ? 39.204  72.836  60.436  1.00 51.16  ? 696  ALA A C    1 
ATOM   9430  O O    . ALA A 1 630 ? 39.606  73.963  60.135  1.00 47.27  ? 696  ALA A O    1 
ATOM   9431  C CB   . ALA A 1 630 ? 38.577  72.401  62.799  1.00 55.54  ? 696  ALA A CB   1 
ATOM   9432  H H    . ALA A 1 630 ? 37.017  70.980  61.586  1.00 73.61  ? 696  ALA A H    1 
ATOM   9433  H HA   . ALA A 1 630 ? 37.545  73.489  61.425  1.00 61.43  ? 696  ALA A HA   1 
ATOM   9434  H HB1  . ALA A 1 630 ? 39.164  73.131  63.052  1.00 66.65  ? 696  ALA A HB1  1 
ATOM   9435  H HB2  . ALA A 1 630 ? 37.830  72.348  63.416  1.00 66.65  ? 696  ALA A HB2  1 
ATOM   9436  H HB3  . ALA A 1 630 ? 39.068  71.565  62.800  1.00 66.65  ? 696  ALA A HB3  1 
ATOM   9437  N N    . PHE A 1 631 ? 39.734  71.725  59.940  1.00 51.55  ? 697  PHE A N    1 
ATOM   9438  C CA   . PHE A 1 631 ? 40.913  71.779  59.077  1.00 55.94  ? 697  PHE A CA   1 
ATOM   9439  C C    . PHE A 1 631 ? 40.580  72.127  57.616  1.00 56.53  ? 697  PHE A C    1 
ATOM   9440  O O    . PHE A 1 631 ? 41.344  72.835  56.953  1.00 50.74  ? 697  PHE A O    1 
ATOM   9441  C CB   . PHE A 1 631 ? 41.733  70.483  59.196  1.00 44.08  ? 697  PHE A CB   1 
ATOM   9442  C CG   . PHE A 1 631 ? 42.836  70.570  60.220  1.00 49.14  ? 697  PHE A CG   1 
ATOM   9443  C CD1  . PHE A 1 631 ? 44.055  71.127  59.881  1.00 51.70  ? 697  PHE A CD1  1 
ATOM   9444  C CD2  . PHE A 1 631 ? 42.649  70.116  61.522  1.00 58.58  ? 697  PHE A CD2  1 
ATOM   9445  C CE1  . PHE A 1 631 ? 45.060  71.233  60.800  1.00 38.74  ? 697  PHE A CE1  1 
ATOM   9446  C CE2  . PHE A 1 631 ? 43.664  70.219  62.467  1.00 43.50  ? 697  PHE A CE2  1 
ATOM   9447  C CZ   . PHE A 1 631 ? 44.865  70.776  62.103  1.00 53.93  ? 697  PHE A CZ   1 
ATOM   9448  H H    . PHE A 1 631 ? 39.435  70.931  60.085  1.00 61.87  ? 697  PHE A H    1 
ATOM   9449  H HA   . PHE A 1 631 ? 41.480  72.494  59.405  1.00 67.13  ? 697  PHE A HA   1 
ATOM   9450  H HB2  . PHE A 1 631 ? 41.141  69.759  59.455  1.00 52.90  ? 697  PHE A HB2  1 
ATOM   9451  H HB3  . PHE A 1 631 ? 42.138  70.287  58.337  1.00 52.90  ? 697  PHE A HB3  1 
ATOM   9452  H HD1  . PHE A 1 631 ? 44.191  71.439  59.015  1.00 62.04  ? 697  PHE A HD1  1 
ATOM   9453  H HD2  . PHE A 1 631 ? 41.831  69.744  61.766  1.00 70.29  ? 697  PHE A HD2  1 
ATOM   9454  H HE1  . PHE A 1 631 ? 45.876  71.608  60.556  1.00 46.49  ? 697  PHE A HE1  1 
ATOM   9455  H HE2  . PHE A 1 631 ? 43.533  69.910  63.334  1.00 52.20  ? 697  PHE A HE2  1 
ATOM   9456  H HZ   . PHE A 1 631 ? 45.553  70.842  62.726  1.00 64.72  ? 697  PHE A HZ   1 
ATOM   9457  N N    . HIS A 1 632 ? 39.432  71.662  57.128  1.00 45.03  ? 698  HIS A N    1 
ATOM   9458  C CA   . HIS A 1 632 ? 39.030  71.924  55.751  1.00 45.64  ? 698  HIS A CA   1 
ATOM   9459  C C    . HIS A 1 632 ? 38.743  73.405  55.480  1.00 47.94  ? 698  HIS A C    1 
ATOM   9460  O O    . HIS A 1 632 ? 38.848  73.877  54.346  1.00 55.00  ? 698  HIS A O    1 
ATOM   9461  C CB   . HIS A 1 632 ? 37.807  71.081  55.398  1.00 56.17  ? 698  HIS A CB   1 
ATOM   9462  C CG   . HIS A 1 632 ? 37.773  70.650  53.960  1.00 57.96  ? 698  HIS A CG   1 
ATOM   9463  N ND1  . HIS A 1 632 ? 38.233  71.447  52.939  1.00 50.54  ? 698  HIS A ND1  1 
ATOM   9464  C CD2  . HIS A 1 632 ? 37.350  69.497  53.390  1.00 51.70  ? 698  HIS A CD2  1 
ATOM   9465  C CE1  . HIS A 1 632 ? 38.082  70.809  51.786  1.00 53.79  ? 698  HIS A CE1  1 
ATOM   9466  N NE2  . HIS A 1 632 ? 37.555  69.629  52.035  1.00 65.33  ? 698  HIS A NE2  1 
ATOM   9467  H H    . HIS A 1 632 ? 38.868  71.192  57.576  1.00 54.04  ? 698  HIS A H    1 
ATOM   9468  H HA   . HIS A 1 632 ? 39.752  71.653  55.162  1.00 54.77  ? 698  HIS A HA   1 
ATOM   9469  H HB2  . HIS A 1 632 ? 37.807  70.282  55.948  1.00 67.40  ? 698  HIS A HB2  1 
ATOM   9470  H HB3  . HIS A 1 632 ? 37.007  71.601  55.572  1.00 67.40  ? 698  HIS A HB3  1 
ATOM   9471  H HD1  . HIS A 1 632 ? 38.558  72.238  53.032  1.00 60.65  ? 698  HIS A HD1  1 
ATOM   9472  H HD2  . HIS A 1 632 ? 36.987  68.762  53.829  1.00 62.05  ? 698  HIS A HD2  1 
ATOM   9473  H HE1  . HIS A 1 632 ? 38.316  71.135  50.947  1.00 64.55  ? 698  HIS A HE1  1 
ATOM   9474  H HE2  . HIS A 1 632 ? 37.365  69.035  51.443  1.00 78.39  ? 698  HIS A HE2  1 
ATOM   9475  N N    . ASN A 1 633 ? 38.373  74.135  56.521  1.00 45.46  ? 699  ASN A N    1 
ATOM   9476  C CA   . ASN A 1 633 ? 38.165  75.573  56.416  1.00 49.14  ? 699  ASN A CA   1 
ATOM   9477  C C    . ASN A 1 633 ? 39.453  76.274  55.988  1.00 47.98  ? 699  ASN A C    1 
ATOM   9478  O O    . ASN A 1 633 ? 39.493  76.964  54.969  1.00 60.27  ? 699  ASN A O    1 
ATOM   9479  C CB   . ASN A 1 633 ? 37.710  76.105  57.777  1.00 45.72  ? 699  ASN A CB   1 
ATOM   9480  C CG   . ASN A 1 633 ? 37.051  77.482  57.712  1.00 48.23  ? 699  ASN A CG   1 
ATOM   9481  O OD1  . ASN A 1 633 ? 36.113  77.734  58.453  1.00 53.33  ? 699  ASN A OD1  1 
ATOM   9482  N ND2  . ASN A 1 633 ? 37.548  78.376  56.860  1.00 52.14  ? 699  ASN A ND2  1 
ATOM   9483  H H    . ASN A 1 633 ? 38.235  73.819  57.309  1.00 54.56  ? 699  ASN A H    1 
ATOM   9484  H HA   . ASN A 1 633 ? 37.474  75.758  55.760  1.00 58.96  ? 699  ASN A HA   1 
ATOM   9485  H HB2  . ASN A 1 633 ? 37.067  75.486  58.156  1.00 54.86  ? 699  ASN A HB2  1 
ATOM   9486  H HB3  . ASN A 1 633 ? 38.483  76.173  58.360  1.00 54.86  ? 699  ASN A HB3  1 
ATOM   9487  H HD21 . ASN A 1 633 ? 37.195  79.158  56.803  1.00 62.56  ? 699  ASN A HD21 1 
ATOM   9488  H HD22 . ASN A 1 633 ? 38.221  78.171  56.366  1.00 62.56  ? 699  ASN A HD22 1 
ATOM   9489  N N    . ALA A 1 634 ? 40.502  76.082  56.780  1.00 54.80  ? 700  ALA A N    1 
ATOM   9490  C CA   . ALA A 1 634 ? 41.744  76.825  56.626  1.00 44.96  ? 700  ALA A CA   1 
ATOM   9491  C C    . ALA A 1 634 ? 42.668  76.185  55.607  1.00 46.17  ? 700  ALA A C    1 
ATOM   9492  O O    . ALA A 1 634 ? 43.508  76.869  55.030  1.00 45.13  ? 700  ALA A O    1 
ATOM   9493  C CB   . ALA A 1 634 ? 42.450  76.936  57.970  1.00 41.38  ? 700  ALA A CB   1 
ATOM   9494  H H    . ALA A 1 634 ? 40.518  75.515  57.426  1.00 65.76  ? 700  ALA A H    1 
ATOM   9495  H HA   . ALA A 1 634 ? 41.538  77.722  56.321  1.00 53.95  ? 700  ALA A HA   1 
ATOM   9496  H HB1  . ALA A 1 634 ? 43.275  77.433  57.853  1.00 49.66  ? 700  ALA A HB1  1 
ATOM   9497  H HB2  . ALA A 1 634 ? 41.869  77.401  58.593  1.00 49.66  ? 700  ALA A HB2  1 
ATOM   9498  H HB3  . ALA A 1 634 ? 42.644  76.045  58.299  1.00 49.66  ? 700  ALA A HB3  1 
ATOM   9499  N N    . HIS A 1 635 ? 42.493  74.884  55.378  1.00 42.86  ? 701  HIS A N    1 
ATOM   9500  C CA   . HIS A 1 635 ? 43.381  74.126  54.499  1.00 51.43  ? 701  HIS A CA   1 
ATOM   9501  C C    . HIS A 1 635 ? 42.715  73.466  53.287  1.00 61.38  ? 701  HIS A C    1 
ATOM   9502  O O    . HIS A 1 635 ? 41.610  72.938  53.381  1.00 58.64  ? 701  HIS A O    1 
ATOM   9503  C CB   . HIS A 1 635 ? 44.098  73.074  55.324  1.00 53.28  ? 701  HIS A CB   1 
ATOM   9504  C CG   . HIS A 1 635 ? 44.785  73.637  56.520  1.00 53.70  ? 701  HIS A CG   1 
ATOM   9505  N ND1  . HIS A 1 635 ? 45.867  74.485  56.428  1.00 54.91  ? 701  HIS A ND1  1 
ATOM   9506  C CD2  . HIS A 1 635 ? 44.536  73.487  57.840  1.00 57.68  ? 701  HIS A CD2  1 
ATOM   9507  C CE1  . HIS A 1 635 ? 46.257  74.829  57.641  1.00 61.48  ? 701  HIS A CE1  1 
ATOM   9508  N NE2  . HIS A 1 635 ? 45.466  74.235  58.516  1.00 55.41  ? 701  HIS A NE2  1 
ATOM   9509  H H    . HIS A 1 635 ? 41.862  74.414  55.724  1.00 51.43  ? 701  HIS A H    1 
ATOM   9510  H HA   . HIS A 1 635 ? 44.056  74.733  54.157  1.00 61.71  ? 701  HIS A HA   1 
ATOM   9511  H HB2  . HIS A 1 635 ? 43.450  72.420  55.631  1.00 63.94  ? 701  HIS A HB2  1 
ATOM   9512  H HB3  . HIS A 1 635 ? 44.767  72.642  54.770  1.00 63.94  ? 701  HIS A HB3  1 
ATOM   9513  H HD1  . HIS A 1 635 ? 46.231  74.749  55.695  1.00 65.89  ? 701  HIS A HD1  1 
ATOM   9514  H HD2  . HIS A 1 635 ? 43.862  72.971  58.219  1.00 69.21  ? 701  HIS A HD2  1 
ATOM   9515  H HE1  . HIS A 1 635 ? 46.969  75.391  57.845  1.00 73.78  ? 701  HIS A HE1  1 
ATOM   9516  H HE2  . HIS A 1 635 ? 45.524  74.306  59.371  1.00 66.50  ? 701  HIS A HE2  1 
ATOM   9517  N N    . ASP A 1 636 ? 43.439  73.476  52.167  1.00 72.65  ? 702  ASP A N    1 
ATOM   9518  C CA   . ASP A 1 636 ? 42.911  73.060  50.871  1.00 58.36  ? 702  ASP A CA   1 
ATOM   9519  C C    . ASP A 1 636 ? 42.286  71.663  50.848  1.00 72.57  ? 702  ASP A C    1 
ATOM   9520  O O    . ASP A 1 636 ? 41.131  71.549  50.455  1.00 108.43 ? 702  ASP A O    1 
ATOM   9521  C CB   . ASP A 1 636 ? 43.959  73.223  49.772  1.00 62.94  ? 702  ASP A CB   1 
ATOM   9522  C CG   . ASP A 1 636 ? 43.355  73.164  48.377  1.00 78.92  ? 702  ASP A CG   1 
ATOM   9523  O OD1  . ASP A 1 636 ? 42.237  72.624  48.228  1.00 69.61  ? 702  ASP A OD1  1 
ATOM   9524  O OD2  . ASP A 1 636 ? 44.001  73.673  47.427  1.00 94.08  ? 702  ASP A OD2  1 
ATOM   9525  H H    . ASP A 1 636 ? 44.261  73.726  52.134  1.00 87.18  ? 702  ASP A H    1 
ATOM   9526  H HA   . ASP A 1 636 ? 42.194  73.674  50.649  1.00 70.03  ? 702  ASP A HA   1 
ATOM   9527  H HB2  . ASP A 1 636 ? 44.394  74.083  49.876  1.00 75.53  ? 702  ASP A HB2  1 
ATOM   9528  H HB3  . ASP A 1 636 ? 44.611  72.508  49.848  1.00 75.53  ? 702  ASP A HB3  1 
ATOM   9529  N N    . LEU A 1 637 ? 42.989  70.606  51.245  1.00 44.87  ? 703  LEU A N    1 
ATOM   9530  C CA   . LEU A 1 637 ? 42.309  69.303  51.405  1.00 58.84  ? 703  LEU A CA   1 
ATOM   9531  C C    . LEU A 1 637 ? 41.502  68.795  50.183  1.00 75.21  ? 703  LEU A C    1 
ATOM   9532  O O    . LEU A 1 637 ? 40.572  68.001  50.331  1.00 56.03  ? 703  LEU A O    1 
ATOM   9533  C CB   . LEU A 1 637 ? 41.348  69.364  52.600  1.00 43.45  ? 703  LEU A CB   1 
ATOM   9534  C CG   . LEU A 1 637 ? 41.871  68.929  53.960  1.00 62.26  ? 703  LEU A CG   1 
ATOM   9535  C CD1  . LEU A 1 637 ? 42.893  69.944  54.447  1.00 69.89  ? 703  LEU A CD1  1 
ATOM   9536  C CD2  . LEU A 1 637 ? 40.696  68.781  54.918  1.00 61.85  ? 703  LEU A CD2  1 
ATOM   9537  H H    . LEU A 1 637 ? 43.830  70.605  51.425  1.00 53.85  ? 703  LEU A H    1 
ATOM   9538  H HA   . LEU A 1 637 ? 42.981  68.633  51.606  1.00 70.61  ? 703  LEU A HA   1 
ATOM   9539  H HB2  . LEU A 1 637 ? 41.048  70.281  52.694  1.00 52.14  ? 703  LEU A HB2  1 
ATOM   9540  H HB3  . LEU A 1 637 ? 40.585  68.801  52.398  1.00 52.14  ? 703  LEU A HB3  1 
ATOM   9541  H HG   . LEU A 1 637 ? 42.310  68.067  53.876  1.00 74.71  ? 703  LEU A HG   1 
ATOM   9542  H HD11 . LEU A 1 637 ? 43.226  69.666  55.314  1.00 83.87  ? 703  LEU A HD11 1 
ATOM   9543  H HD12 . LEU A 1 637 ? 43.623  69.987  53.810  1.00 83.87  ? 703  LEU A HD12 1 
ATOM   9544  H HD13 . LEU A 1 637 ? 42.465  70.812  54.519  1.00 83.87  ? 703  LEU A HD13 1 
ATOM   9545  H HD21 . LEU A 1 637 ? 41.029  68.503  55.785  1.00 74.22  ? 703  LEU A HD21 1 
ATOM   9546  H HD22 . LEU A 1 637 ? 40.243  69.635  54.995  1.00 74.22  ? 703  LEU A HD22 1 
ATOM   9547  H HD23 . LEU A 1 637 ? 40.086  68.113  54.568  1.00 74.22  ? 703  LEU A HD23 1 
ATOM   9548  N N    . SER A 1 638 ? 41.842  69.237  48.979  1.00 88.14  ? 704  SER A N    1 
ATOM   9549  C CA   . SER A 1 638 ? 41.110  68.775  47.805  1.00 76.14  ? 704  SER A CA   1 
ATOM   9550  C C    . SER A 1 638 ? 41.386  67.289  47.562  1.00 82.55  ? 704  SER A C    1 
ATOM   9551  O O    . SER A 1 638 ? 40.469  66.537  47.239  1.00 50.96  ? 704  SER A O    1 
ATOM   9552  C CB   . SER A 1 638 ? 41.497  69.592  46.578  1.00 88.84  ? 704  SER A CB   1 
ATOM   9553  O OG   . SER A 1 638 ? 41.182  70.951  46.783  1.00 92.29  ? 704  SER A OG   1 
ATOM   9554  H H    . SER A 1 638 ? 42.478  69.793  48.815  1.00 105.77 ? 704  SER A H    1 
ATOM   9555  H HA   . SER A 1 638 ? 40.159  68.886  47.956  1.00 91.37  ? 704  SER A HA   1 
ATOM   9556  H HB2  . SER A 1 638 ? 42.451  69.506  46.426  1.00 106.61 ? 704  SER A HB2  1 
ATOM   9557  H HB3  . SER A 1 638 ? 41.005  69.264  45.809  1.00 106.61 ? 704  SER A HB3  1 
ATOM   9558  H HG   . SER A 1 638 ? 41.601  71.245  47.449  1.00 110.75 ? 704  SER A HG   1 
ATOM   9559  N N    . LYS A 1 639 ? 42.647  66.880  47.749  1.00 87.95  ? 705  LYS A N    1 
ATOM   9560  C CA   . LYS A 1 639 ? 43.108  65.523  47.446  1.00 59.21  ? 705  LYS A CA   1 
ATOM   9561  C C    . LYS A 1 639 ? 42.209  64.447  48.034  1.00 46.75  ? 705  LYS A C    1 
ATOM   9562  O O    . LYS A 1 639 ? 42.141  63.343  47.510  1.00 83.24  ? 705  LYS A O    1 
ATOM   9563  C CB   . LYS A 1 639 ? 44.521  65.305  47.975  1.00 78.48  ? 705  LYS A CB   1 
ATOM   9564  C CG   . LYS A 1 639 ? 45.626  65.849  47.088  1.00 86.79  ? 705  LYS A CG   1 
ATOM   9565  C CD   . LYS A 1 639 ? 46.949  66.023  47.853  1.00 87.31  ? 705  LYS A CD   1 
ATOM   9566  C CE   . LYS A 1 639 ? 46.803  66.994  49.023  1.00 78.89  ? 705  LYS A CE   1 
ATOM   9567  N NZ   . LYS A 1 639 ? 47.856  68.047  49.062  1.00 75.41  ? 705  LYS A NZ   1 
ATOM   9568  H H    . LYS A 1 639 ? 43.269  67.387  48.059  1.00 105.54 ? 705  LYS A H    1 
ATOM   9569  H HA   . LYS A 1 639 ? 43.127  65.405  46.483  1.00 71.05  ? 705  LYS A HA   1 
ATOM   9570  H HB2  . LYS A 1 639 ? 44.597  65.739  48.839  1.00 94.17  ? 705  LYS A HB2  1 
ATOM   9571  H HB3  . LYS A 1 639 ? 44.669  64.351  48.075  1.00 94.17  ? 705  LYS A HB3  1 
ATOM   9572  H HG2  . LYS A 1 639 ? 45.779  65.233  46.356  1.00 104.15 ? 705  LYS A HG2  1 
ATOM   9573  H HG3  . LYS A 1 639 ? 45.360  66.717  46.745  1.00 104.15 ? 705  LYS A HG3  1 
ATOM   9574  H HD2  . LYS A 1 639 ? 47.230  65.164  48.205  1.00 104.77 ? 705  LYS A HD2  1 
ATOM   9575  H HD3  . LYS A 1 639 ? 47.622  66.375  47.250  1.00 104.77 ? 705  LYS A HD3  1 
ATOM   9576  H HE2  . LYS A 1 639 ? 45.942  67.436  48.956  1.00 94.67  ? 705  LYS A HE2  1 
ATOM   9577  H HE3  . LYS A 1 639 ? 46.852  66.493  49.852  1.00 94.67  ? 705  LYS A HE3  1 
ATOM   9578  H HZ1  . LYS A 1 639 ? 47.724  68.583  49.760  1.00 90.49  ? 705  LYS A HZ1  1 
ATOM   9579  H HZ2  . LYS A 1 639 ? 48.659  67.671  49.133  1.00 90.49  ? 705  LYS A HZ2  1 
ATOM   9580  H HZ3  . LYS A 1 639 ? 47.829  68.531  48.316  1.00 90.49  ? 705  LYS A HZ3  1 
ATOM   9581  N N    . TRP A 1 640 ? 41.526  64.768  49.120  1.00 33.10  ? 706  TRP A N    1 
ATOM   9582  C CA   . TRP A 1 640 ? 40.561  63.850  49.712  1.00 60.30  ? 706  TRP A CA   1 
ATOM   9583  C C    . TRP A 1 640 ? 39.141  64.218  49.217  1.00 72.67  ? 706  TRP A C    1 
ATOM   9584  O O    . TRP A 1 640 ? 38.589  65.238  49.625  1.00 90.61  ? 706  TRP A O    1 
ATOM   9585  C CB   . TRP A 1 640 ? 40.642  63.916  51.251  1.00 70.13  ? 706  TRP A CB   1 
ATOM   9586  C CG   . TRP A 1 640 ? 42.035  63.670  51.857  1.00 79.74  ? 706  TRP A CG   1 
ATOM   9587  C CD1  . TRP A 1 640 ? 42.449  62.544  52.514  1.00 72.11  ? 706  TRP A CD1  1 
ATOM   9588  C CD2  . TRP A 1 640 ? 43.166  64.572  51.872  1.00 78.16  ? 706  TRP A CD2  1 
ATOM   9589  N NE1  . TRP A 1 640 ? 43.754  62.680  52.924  1.00 55.93  ? 706  TRP A NE1  1 
ATOM   9590  C CE2  . TRP A 1 640 ? 44.219  63.910  52.541  1.00 59.86  ? 706  TRP A CE2  1 
ATOM   9591  C CE3  . TRP A 1 640 ? 43.388  65.865  51.383  1.00 81.06  ? 706  TRP A CE3  1 
ATOM   9592  C CZ2  . TRP A 1 640 ? 45.471  64.497  52.733  1.00 48.25  ? 706  TRP A CZ2  1 
ATOM   9593  C CZ3  . TRP A 1 640 ? 44.639  66.447  51.579  1.00 60.09  ? 706  TRP A CZ3  1 
ATOM   9594  C CH2  . TRP A 1 640 ? 45.661  65.759  52.242  1.00 46.02  ? 706  TRP A CH2  1 
ATOM   9595  H H    . TRP A 1 640 ? 41.602  65.516  49.538  1.00 39.72  ? 706  TRP A H    1 
ATOM   9596  H HA   . TRP A 1 640 ? 40.761  62.944  49.432  1.00 72.36  ? 706  TRP A HA   1 
ATOM   9597  H HB2  . TRP A 1 640 ? 40.353  64.798  51.535  1.00 84.15  ? 706  TRP A HB2  1 
ATOM   9598  H HB3  . TRP A 1 640 ? 40.043  63.246  51.617  1.00 84.15  ? 706  TRP A HB3  1 
ATOM   9599  H HD1  . TRP A 1 640 ? 41.924  61.790  52.656  1.00 86.53  ? 706  TRP A HD1  1 
ATOM   9600  H HE1  . TRP A 1 640 ? 44.208  62.086  53.348  1.00 67.11  ? 706  TRP A HE1  1 
ATOM   9601  H HE3  . TRP A 1 640 ? 42.716  66.325  50.935  1.00 97.27  ? 706  TRP A HE3  1 
ATOM   9602  H HZ2  . TRP A 1 640 ? 46.151  64.046  53.180  1.00 57.90  ? 706  TRP A HZ2  1 
ATOM   9603  H HZ3  . TRP A 1 640 ? 44.801  67.303  51.254  1.00 72.10  ? 706  TRP A HZ3  1 
ATOM   9604  H HH2  . TRP A 1 640 ? 46.485  66.173  52.360  1.00 55.22  ? 706  TRP A HH2  1 
ATOM   9605  N N    . ASP A 1 641 ? 38.557  63.413  48.329  1.00 70.61  ? 707  ASP A N    1 
ATOM   9606  C CA   . ASP A 1 641 ? 37.185  63.666  47.877  1.00 85.14  ? 707  ASP A CA   1 
ATOM   9607  C C    . ASP A 1 641 ? 36.195  63.267  48.975  1.00 81.57  ? 707  ASP A C    1 
ATOM   9608  O O    . ASP A 1 641 ? 35.515  62.236  48.892  1.00 88.11  ? 707  ASP A O    1 
ATOM   9609  C CB   . ASP A 1 641 ? 36.861  62.926  46.568  1.00 89.45  ? 707  ASP A CB   1 
ATOM   9610  C CG   . ASP A 1 641 ? 35.479  63.310  46.004  1.00 102.98 ? 707  ASP A CG   1 
ATOM   9611  O OD1  . ASP A 1 641 ? 35.190  64.526  45.874  1.00 102.37 ? 707  ASP A OD1  1 
ATOM   9612  O OD2  . ASP A 1 641 ? 34.677  62.396  45.700  1.00 100.63 ? 707  ASP A OD2  1 
ATOM   9613  H H    . ASP A 1 641 ? 38.928  62.722  47.975  1.00 84.73  ? 707  ASP A H    1 
ATOM   9614  H HA   . ASP A 1 641 ? 37.080  64.616  47.713  1.00 102.16 ? 707  ASP A HA   1 
ATOM   9615  H HB2  . ASP A 1 641 ? 37.530  63.149  45.903  1.00 107.34 ? 707  ASP A HB2  1 
ATOM   9616  H HB3  . ASP A 1 641 ? 36.863  61.970  46.736  1.00 107.34 ? 707  ASP A HB3  1 
ATOM   9617  N N    . LEU A 1 642 ? 36.121  64.096  50.007  1.00 63.58  ? 708  LEU A N    1 
ATOM   9618  C CA   . LEU A 1 642 ? 35.232  63.827  51.126  1.00 66.46  ? 708  LEU A CA   1 
ATOM   9619  C C    . LEU A 1 642 ? 33.862  64.488  50.977  1.00 71.99  ? 708  LEU A C    1 
ATOM   9620  O O    . LEU A 1 642 ? 33.071  64.487  51.927  1.00 69.99  ? 708  LEU A O    1 
ATOM   9621  C CB   . LEU A 1 642 ? 35.885  64.215  52.462  1.00 56.72  ? 708  LEU A CB   1 
ATOM   9622  C CG   . LEU A 1 642 ? 37.074  65.171  52.470  1.00 58.29  ? 708  LEU A CG   1 
ATOM   9623  C CD1  . LEU A 1 642 ? 36.725  66.549  51.915  1.00 71.88  ? 708  LEU A CD1  1 
ATOM   9624  C CD2  . LEU A 1 642 ? 37.594  65.301  53.872  1.00 45.07  ? 708  LEU A CD2  1 
ATOM   9625  H H    . LEU A 1 642 ? 36.576  64.821  50.084  1.00 76.30  ? 708  LEU A H    1 
ATOM   9626  H HA   . LEU A 1 642 ? 35.078  62.870  51.158  1.00 79.76  ? 708  LEU A HA   1 
ATOM   9627  H HB2  . LEU A 1 642 ? 35.200  64.622  53.015  1.00 68.07  ? 708  LEU A HB2  1 
ATOM   9628  H HB3  . LEU A 1 642 ? 36.186  63.398  52.889  1.00 68.07  ? 708  LEU A HB3  1 
ATOM   9629  H HG   . LEU A 1 642 ? 37.782  64.799  51.922  1.00 69.94  ? 708  LEU A HG   1 
ATOM   9630  H HD11 . LEU A 1 642 ? 37.516  67.110  51.945  1.00 86.25  ? 708  LEU A HD11 1 
ATOM   9631  H HD12 . LEU A 1 642 ? 36.422  66.452  50.999  1.00 86.25  ? 708  LEU A HD12 1 
ATOM   9632  H HD13 . LEU A 1 642 ? 36.022  66.938  52.457  1.00 86.25  ? 708  LEU A HD13 1 
ATOM   9633  H HD21 . LEU A 1 642 ? 38.349  65.910  53.874  1.00 54.09  ? 708  LEU A HD21 1 
ATOM   9634  H HD22 . LEU A 1 642 ? 36.888  65.649  54.440  1.00 54.09  ? 708  LEU A HD22 1 
ATOM   9635  H HD23 . LEU A 1 642 ? 37.872  64.427  54.188  1.00 54.09  ? 708  LEU A HD23 1 
ATOM   9636  N N    . PHE A 1 643 ? 33.567  65.033  49.794  1.00 66.69  ? 709  PHE A N    1 
ATOM   9637  C CA   . PHE A 1 643 ? 32.193  65.428  49.495  1.00 61.71  ? 709  PHE A CA   1 
ATOM   9638  C C    . PHE A 1 643 ? 31.280  64.219  49.644  1.00 71.46  ? 709  PHE A C    1 
ATOM   9639  O O    . PHE A 1 643 ? 30.157  64.329  50.144  1.00 61.96  ? 709  PHE A O    1 
ATOM   9640  C CB   . PHE A 1 643 ? 32.026  65.964  48.081  1.00 45.60  ? 709  PHE A CB   1 
ATOM   9641  C CG   . PHE A 1 643 ? 30.605  66.312  47.755  1.00 50.61  ? 709  PHE A CG   1 
ATOM   9642  C CD1  . PHE A 1 643 ? 30.066  67.528  48.139  1.00 60.60  ? 709  PHE A CD1  1 
ATOM   9643  C CD2  . PHE A 1 643 ? 29.794  65.412  47.106  1.00 57.61  ? 709  PHE A CD2  1 
ATOM   9644  C CE1  . PHE A 1 643 ? 28.755  67.841  47.855  1.00 45.17  ? 709  PHE A CE1  1 
ATOM   9645  C CE2  . PHE A 1 643 ? 28.482  65.722  46.828  1.00 55.46  ? 709  PHE A CE2  1 
ATOM   9646  C CZ   . PHE A 1 643 ? 27.968  66.937  47.199  1.00 46.02  ? 709  PHE A CZ   1 
ATOM   9647  H H    . PHE A 1 643 ? 34.131  65.181  49.162  1.00 80.03  ? 709  PHE A H    1 
ATOM   9648  H HA   . PHE A 1 643 ? 31.907  66.111  50.121  1.00 74.06  ? 709  PHE A HA   1 
ATOM   9649  H HB2  . PHE A 1 643 ? 32.562  66.767  47.983  1.00 54.72  ? 709  PHE A HB2  1 
ATOM   9650  H HB3  . PHE A 1 643 ? 32.321  65.289  47.451  1.00 54.72  ? 709  PHE A HB3  1 
ATOM   9651  H HD1  . PHE A 1 643 ? 30.599  68.147  48.583  1.00 72.72  ? 709  PHE A HD1  1 
ATOM   9652  H HD2  . PHE A 1 643 ? 30.135  64.585  46.849  1.00 69.13  ? 709  PHE A HD2  1 
ATOM   9653  H HE1  . PHE A 1 643 ? 28.406  68.665  48.109  1.00 54.20  ? 709  PHE A HE1  1 
ATOM   9654  H HE2  . PHE A 1 643 ? 27.945  65.109  46.379  1.00 66.55  ? 709  PHE A HE2  1 
ATOM   9655  H HZ   . PHE A 1 643 ? 27.082  67.146  47.007  1.00 55.22  ? 709  PHE A HZ   1 
ATOM   9656  N N    . ALA A 1 644 ? 31.771  63.072  49.184  1.00 80.54  ? 710  ALA A N    1 
ATOM   9657  C CA   . ALA A 1 644 ? 31.040  61.818  49.284  1.00 68.69  ? 710  ALA A CA   1 
ATOM   9658  C C    . ALA A 1 644 ? 30.609  61.564  50.728  1.00 73.28  ? 710  ALA A C    1 
ATOM   9659  O O    . ALA A 1 644 ? 29.424  61.435  51.006  1.00 71.14  ? 710  ALA A O    1 
ATOM   9660  C CB   . ALA A 1 644 ? 31.895  60.668  48.763  1.00 55.46  ? 710  ALA A CB   1 
ATOM   9661  H H    . ALA A 1 644 ? 32.538  62.995  48.804  1.00 96.65  ? 710  ALA A H    1 
ATOM   9662  H HA   . ALA A 1 644 ? 30.241  61.872  48.736  1.00 82.43  ? 710  ALA A HA   1 
ATOM   9663  H HB1  . ALA A 1 644 ? 31.392  59.842  48.838  1.00 66.56  ? 710  ALA A HB1  1 
ATOM   9664  H HB2  . ALA A 1 644 ? 32.118  60.837  47.834  1.00 66.56  ? 710  ALA A HB2  1 
ATOM   9665  H HB3  . ALA A 1 644 ? 32.705  60.612  49.294  1.00 66.56  ? 710  ALA A HB3  1 
ATOM   9666  N N    . CYS A 1 645 ? 31.575  61.538  51.642  1.00 82.91  ? 711  CYS A N    1 
ATOM   9667  C CA   . CYS A 1 645 ? 31.333  61.188  53.045  1.00 74.53  ? 711  CYS A CA   1 
ATOM   9668  C C    . CYS A 1 645 ? 30.366  62.147  53.730  1.00 66.81  ? 711  CYS A C    1 
ATOM   9669  O O    . CYS A 1 645 ? 29.507  61.723  54.500  1.00 59.94  ? 711  CYS A O    1 
ATOM   9670  C CB   . CYS A 1 645 ? 32.659  61.189  53.812  1.00 68.79  ? 711  CYS A CB   1 
ATOM   9671  S SG   . CYS A 1 645 ? 34.102  60.917  52.754  1.00 96.66  ? 711  CYS A SG   1 
ATOM   9672  H H    . CYS A 1 645 ? 32.398  61.723  51.473  1.00 99.50  ? 711  CYS A H    1 
ATOM   9673  H HA   . CYS A 1 645 ? 30.958  60.295  53.091  1.00 89.43  ? 711  CYS A HA   1 
ATOM   9674  H HB2  . CYS A 1 645 ? 32.768  62.049  54.249  1.00 82.55  ? 711  CYS A HB2  1 
ATOM   9675  H HB3  . CYS A 1 645 ? 32.638  60.482  54.475  1.00 82.55  ? 711  CYS A HB3  1 
ATOM   9676  H HG   . CYS A 1 645 ? 35.092  60.933  53.433  1.00 116.00 ? 711  CYS A HG   1 
ATOM   9677  N N    . ASN A 1 646 ? 30.524  63.440  53.465  1.00 67.37  ? 712  ASN A N    1 
ATOM   9678  C CA   . ASN A 1 646 ? 29.643  64.450  54.040  1.00 65.38  ? 712  ASN A CA   1 
ATOM   9679  C C    . ASN A 1 646 ? 28.259  64.376  53.428  1.00 67.58  ? 712  ASN A C    1 
ATOM   9680  O O    . ASN A 1 646 ? 27.248  64.424  54.132  1.00 63.06  ? 712  ASN A O    1 
ATOM   9681  C CB   . ASN A 1 646 ? 30.215  65.851  53.815  1.00 72.35  ? 712  ASN A CB   1 
ATOM   9682  C CG   . ASN A 1 646 ? 31.186  66.264  54.895  1.00 67.59  ? 712  ASN A CG   1 
ATOM   9683  O OD1  . ASN A 1 646 ? 30.913  66.110  56.089  1.00 75.90  ? 712  ASN A OD1  1 
ATOM   9684  N ND2  . ASN A 1 646 ? 32.331  66.784  54.482  1.00 48.34  ? 712  ASN A ND2  1 
ATOM   9685  H H    . ASN A 1 646 ? 31.137  63.760  52.954  1.00 80.84  ? 712  ASN A H    1 
ATOM   9686  H HA   . ASN A 1 646 ? 29.564  64.302  54.995  1.00 78.45  ? 712  ASN A HA   1 
ATOM   9687  H HB2  . ASN A 1 646 ? 30.684  65.869  52.966  1.00 86.82  ? 712  ASN A HB2  1 
ATOM   9688  H HB3  . ASN A 1 646 ? 29.487  66.492  53.805  1.00 86.82  ? 712  ASN A HB3  1 
ATOM   9689  H HD21 . ASN A 1 646 ? 32.921  67.036  55.056  1.00 58.01  ? 712  ASN A HD21 1 
ATOM   9690  H HD22 . ASN A 1 646 ? 32.486  66.870  53.641  1.00 58.01  ? 712  ASN A HD22 1 
ATOM   9691  N N    . TYR A 1 647 ? 28.225  64.277  52.105  1.00 78.48  ? 713  TYR A N    1 
ATOM   9692  C CA   . TYR A 1 647 ? 26.971  64.181  51.384  1.00 70.61  ? 713  TYR A CA   1 
ATOM   9693  C C    . TYR A 1 647 ? 26.187  62.978  51.902  1.00 67.51  ? 713  TYR A C    1 
ATOM   9694  O O    . TYR A 1 647 ? 25.047  63.120  52.334  1.00 59.73  ? 713  TYR A O    1 
ATOM   9695  C CB   . TYR A 1 647 ? 27.230  64.072  49.882  1.00 71.06  ? 713  TYR A CB   1 
ATOM   9696  C CG   . TYR A 1 647 ? 25.985  63.771  49.107  1.00 77.81  ? 713  TYR A CG   1 
ATOM   9697  C CD1  . TYR A 1 647 ? 24.928  64.668  49.087  1.00 77.57  ? 713  TYR A CD1  1 
ATOM   9698  C CD2  . TYR A 1 647 ? 25.852  62.581  48.408  1.00 82.05  ? 713  TYR A CD2  1 
ATOM   9699  C CE1  . TYR A 1 647 ? 23.770  64.391  48.388  1.00 79.59  ? 713  TYR A CE1  1 
ATOM   9700  C CE2  . TYR A 1 647 ? 24.701  62.294  47.705  1.00 86.79  ? 713  TYR A CE2  1 
ATOM   9701  C CZ   . TYR A 1 647 ? 23.662  63.204  47.699  1.00 84.82  ? 713  TYR A CZ   1 
ATOM   9702  O OH   . TYR A 1 647 ? 22.512  62.922  47.000  1.00 91.07  ? 713  TYR A OH   1 
ATOM   9703  H H    . TYR A 1 647 ? 28.922  64.263  51.600  1.00 94.17  ? 713  TYR A H    1 
ATOM   9704  H HA   . TYR A 1 647 ? 26.445  64.980  51.546  1.00 84.73  ? 713  TYR A HA   1 
ATOM   9705  H HB2  . TYR A 1 647 ? 27.588  64.915  49.561  1.00 85.27  ? 713  TYR A HB2  1 
ATOM   9706  H HB3  . TYR A 1 647 ? 27.865  63.357  49.721  1.00 85.27  ? 713  TYR A HB3  1 
ATOM   9707  H HD1  . TYR A 1 647 ? 24.999  65.469  49.555  1.00 93.08  ? 713  TYR A HD1  1 
ATOM   9708  H HD2  . TYR A 1 647 ? 26.550  61.966  48.414  1.00 98.46  ? 713  TYR A HD2  1 
ATOM   9709  H HE1  . TYR A 1 647 ? 23.069  65.002  48.381  1.00 95.51  ? 713  TYR A HE1  1 
ATOM   9710  H HE2  . TYR A 1 647 ? 24.625  61.493  47.239  1.00 104.14 ? 713  TYR A HE2  1 
ATOM   9711  H HH   . TYR A 1 647 ? 22.578  62.171  46.628  1.00 109.28 ? 713  TYR A HH   1 
ATOM   9712  N N    . LYS A 1 648 ? 26.833  61.813  51.894  1.00 71.45  ? 714  LYS A N    1 
ATOM   9713  C CA   . LYS A 1 648 ? 26.274  60.563  52.427  1.00 70.27  ? 714  LYS A CA   1 
ATOM   9714  C C    . LYS A 1 648 ? 25.747  60.689  53.866  1.00 76.15  ? 714  LYS A C    1 
ATOM   9715  O O    . LYS A 1 648 ? 24.934  59.876  54.313  1.00 77.65  ? 714  LYS A O    1 
ATOM   9716  C CB   . LYS A 1 648 ? 27.356  59.476  52.392  1.00 51.61  ? 714  LYS A CB   1 
ATOM   9717  C CG   . LYS A 1 648 ? 26.857  58.051  52.208  1.00 54.61  ? 714  LYS A CG   1 
ATOM   9718  C CD   . LYS A 1 648 ? 27.994  57.012  52.340  1.00 83.54  ? 714  LYS A CD   1 
ATOM   9719  C CE   . LYS A 1 648 ? 29.137  57.212  51.322  1.00 92.96  ? 714  LYS A CE   1 
ATOM   9720  N NZ   . LYS A 1 648 ? 30.399  56.477  51.685  1.00 83.21  ? 714  LYS A NZ   1 
ATOM   9721  H H    . LYS A 1 648 ? 27.625  61.715  51.575  1.00 85.74  ? 714  LYS A H    1 
ATOM   9722  H HA   . LYS A 1 648 ? 25.540  60.276  51.861  1.00 84.32  ? 714  LYS A HA   1 
ATOM   9723  H HB2  . LYS A 1 648 ? 27.960  59.668  51.658  1.00 61.93  ? 714  LYS A HB2  1 
ATOM   9724  H HB3  . LYS A 1 648 ? 27.846  59.505  53.229  1.00 61.93  ? 714  LYS A HB3  1 
ATOM   9725  H HG2  . LYS A 1 648 ? 26.192  57.858  52.887  1.00 65.53  ? 714  LYS A HG2  1 
ATOM   9726  H HG3  . LYS A 1 648 ? 26.469  57.963  51.324  1.00 65.53  ? 714  LYS A HG3  1 
ATOM   9727  H HD2  . LYS A 1 648 ? 28.375  57.075  53.230  1.00 100.25 ? 714  LYS A HD2  1 
ATOM   9728  H HD3  . LYS A 1 648 ? 27.625  56.125  52.202  1.00 100.25 ? 714  LYS A HD3  1 
ATOM   9729  H HE2  . LYS A 1 648 ? 28.844  56.890  50.455  1.00 111.56 ? 714  LYS A HE2  1 
ATOM   9730  H HE3  . LYS A 1 648 ? 29.347  58.157  51.269  1.00 111.56 ? 714  LYS A HE3  1 
ATOM   9731  H HZ1  . LYS A 1 648 ? 31.025  56.625  51.069  1.00 99.86  ? 714  LYS A HZ1  1 
ATOM   9732  H HZ2  . LYS A 1 648 ? 30.699  56.759  52.475  1.00 99.86  ? 714  LYS A HZ2  1 
ATOM   9733  H HZ3  . LYS A 1 648 ? 30.240  55.603  51.732  1.00 99.86  ? 714  LYS A HZ3  1 
ATOM   9734  N N    . LEU A 1 649 ? 26.215  61.704  54.585  1.00 74.19  ? 715  LEU A N    1 
ATOM   9735  C CA   . LEU A 1 649 ? 25.890  61.878  55.997  1.00 61.61  ? 715  LEU A CA   1 
ATOM   9736  C C    . LEU A 1 649 ? 24.779  62.919  56.170  1.00 64.09  ? 715  LEU A C    1 
ATOM   9737  O O    . LEU A 1 649 ? 24.083  62.929  57.186  1.00 60.05  ? 715  LEU A O    1 
ATOM   9738  C CB   . LEU A 1 649 ? 27.158  62.265  56.768  1.00 55.36  ? 715  LEU A CB   1 
ATOM   9739  C CG   . LEU A 1 649 ? 27.077  62.584  58.261  1.00 49.75  ? 715  LEU A CG   1 
ATOM   9740  C CD1  . LEU A 1 649 ? 26.511  61.427  59.059  1.00 64.68  ? 715  LEU A CD1  1 
ATOM   9741  C CD2  . LEU A 1 649 ? 28.464  62.947  58.746  1.00 55.71  ? 715  LEU A CD2  1 
ATOM   9742  H H    . LEU A 1 649 ? 26.732  62.316  54.272  1.00 89.03  ? 715  LEU A H    1 
ATOM   9743  H HA   . LEU A 1 649 ? 25.569  61.034  56.353  1.00 73.93  ? 715  LEU A HA   1 
ATOM   9744  H HB2  . LEU A 1 649 ? 27.789  61.533  56.677  1.00 66.43  ? 715  LEU A HB2  1 
ATOM   9745  H HB3  . LEU A 1 649 ? 27.531  63.051  56.339  1.00 66.43  ? 715  LEU A HB3  1 
ATOM   9746  H HG   . LEU A 1 649 ? 26.500  63.353  58.391  1.00 59.70  ? 715  LEU A HG   1 
ATOM   9747  H HD11 . LEU A 1 649 ? 26.480  61.676  59.996  1.00 77.62  ? 715  LEU A HD11 1 
ATOM   9748  H HD12 . LEU A 1 649 ? 25.617  61.230  58.738  1.00 77.62  ? 715  LEU A HD12 1 
ATOM   9749  H HD13 . LEU A 1 649 ? 27.084  60.652  58.941  1.00 77.62  ? 715  LEU A HD13 1 
ATOM   9750  H HD21 . LEU A 1 649 ? 28.423  63.152  59.694  1.00 66.85  ? 715  LEU A HD21 1 
ATOM   9751  H HD22 . LEU A 1 649 ? 29.058  62.195  58.595  1.00 66.85  ? 715  LEU A HD22 1 
ATOM   9752  H HD23 . LEU A 1 649 ? 28.778  63.722  58.253  1.00 66.85  ? 715  LEU A HD23 1 
ATOM   9753  N N    . LEU A 1 650 ? 24.603  63.773  55.164  1.00 53.14  ? 716  LEU A N    1 
ATOM   9754  C CA   . LEU A 1 650 ? 23.561  64.796  55.183  1.00 48.19  ? 716  LEU A CA   1 
ATOM   9755  C C    . LEU A 1 650 ? 22.268  64.269  54.579  1.00 60.98  ? 716  LEU A C    1 
ATOM   9756  O O    . LEU A 1 650 ? 21.166  64.583  55.030  1.00 56.14  ? 716  LEU A O    1 
ATOM   9757  C CB   . LEU A 1 650 ? 24.015  66.014  54.386  1.00 48.28  ? 716  LEU A CB   1 
ATOM   9758  C CG   . LEU A 1 650 ? 24.925  67.016  55.084  1.00 41.99  ? 716  LEU A CG   1 
ATOM   9759  C CD1  . LEU A 1 650 ? 25.379  68.054  54.088  1.00 49.76  ? 716  LEU A CD1  1 
ATOM   9760  C CD2  . LEU A 1 650 ? 24.221  67.680  56.260  1.00 42.85  ? 716  LEU A CD2  1 
ATOM   9761  H H    . LEU A 1 650 ? 25.082  63.780  54.450  1.00 63.76  ? 716  LEU A H    1 
ATOM   9762  H HA   . LEU A 1 650 ? 23.388  65.070  56.097  1.00 57.83  ? 716  LEU A HA   1 
ATOM   9763  H HB2  . LEU A 1 650 ? 24.490  65.698  53.601  1.00 57.93  ? 716  LEU A HB2  1 
ATOM   9764  H HB3  . LEU A 1 650 ? 23.223  66.498  54.103  1.00 57.93  ? 716  LEU A HB3  1 
ATOM   9765  H HG   . LEU A 1 650 ? 25.710  66.556  55.420  1.00 50.39  ? 716  LEU A HG   1 
ATOM   9766  H HD11 . LEU A 1 650 ? 25.958  68.690  54.536  1.00 59.72  ? 716  LEU A HD11 1 
ATOM   9767  H HD12 . LEU A 1 650 ? 25.862  67.614  53.371  1.00 59.72  ? 716  LEU A HD12 1 
ATOM   9768  H HD13 . LEU A 1 650 ? 24.600  68.510  53.730  1.00 59.72  ? 716  LEU A HD13 1 
ATOM   9769  H HD21 . LEU A 1 650 ? 24.830  68.309  56.677  1.00 51.42  ? 716  LEU A HD21 1 
ATOM   9770  H HD22 . LEU A 1 650 ? 23.435  68.145  55.935  1.00 51.42  ? 716  LEU A HD22 1 
ATOM   9771  H HD23 . LEU A 1 650 ? 23.962  66.997  56.898  1.00 51.42  ? 716  LEU A HD23 1 
ATOM   9772  N N    . LYS A 1 651 ? 22.416  63.472  53.533  1.00 75.19  ? 717  LYS A N    1 
ATOM   9773  C CA   . LYS A 1 651 ? 21.269  62.897  52.863  1.00 65.97  ? 717  LYS A CA   1 
ATOM   9774  C C    . LYS A 1 651 ? 20.689  61.814  53.754  1.00 61.86  ? 717  LYS A C    1 
ATOM   9775  O O    . LYS A 1 651 ? 19.497  61.553  53.716  1.00 86.51  ? 717  LYS A O    1 
ATOM   9776  C CB   . LYS A 1 651 ? 21.658  62.339  51.488  1.00 56.41  ? 717  LYS A CB   1 
ATOM   9777  C CG   . LYS A 1 651 ? 21.934  60.849  51.456  1.00 60.83  ? 717  LYS A CG   1 
ATOM   9778  C CD   . LYS A 1 651 ? 22.373  60.394  50.071  1.00 70.91  ? 717  LYS A CD   1 
ATOM   9779  C CE   . LYS A 1 651 ? 22.502  58.869  50.009  1.00 84.59  ? 717  LYS A CE   1 
ATOM   9780  N NZ   . LYS A 1 651 ? 22.544  58.338  48.610  1.00 80.17  ? 717  LYS A NZ   1 
ATOM   9781  H H    . LYS A 1 651 ? 23.173  63.249  53.192  1.00 90.23  ? 717  LYS A H    1 
ATOM   9782  H HA   . LYS A 1 651 ? 20.594  63.582  52.736  1.00 79.16  ? 717  LYS A HA   1 
ATOM   9783  H HB2  . LYS A 1 651 ? 20.934  62.516  50.867  1.00 67.69  ? 717  LYS A HB2  1 
ATOM   9784  H HB3  . LYS A 1 651 ? 22.462  62.792  51.188  1.00 67.69  ? 717  LYS A HB3  1 
ATOM   9785  H HG2  . LYS A 1 651 ? 22.643  60.641  52.084  1.00 72.99  ? 717  LYS A HG2  1 
ATOM   9786  H HG3  . LYS A 1 651 ? 21.124  60.368  51.692  1.00 72.99  ? 717  LYS A HG3  1 
ATOM   9787  H HD2  . LYS A 1 651 ? 21.713  60.672  49.417  1.00 85.09  ? 717  LYS A HD2  1 
ATOM   9788  H HD3  . LYS A 1 651 ? 23.238  60.783  49.864  1.00 85.09  ? 717  LYS A HD3  1 
ATOM   9789  H HE2  . LYS A 1 651 ? 23.323  58.605  50.454  1.00 101.50 ? 717  LYS A HE2  1 
ATOM   9790  H HE3  . LYS A 1 651 ? 21.740  58.471  50.458  1.00 101.50 ? 717  LYS A HE3  1 
ATOM   9791  H HZ1  . LYS A 1 651 ? 22.619  57.451  48.623  1.00 96.21  ? 717  LYS A HZ1  1 
ATOM   9792  H HZ2  . LYS A 1 651 ? 21.797  58.559  48.178  1.00 96.21  ? 717  LYS A HZ2  1 
ATOM   9793  H HZ3  . LYS A 1 651 ? 23.241  58.681  48.175  1.00 96.21  ? 717  LYS A HZ3  1 
ATOM   9794  N N    . THR A 1 652 ? 21.531  61.194  54.570  1.00 62.13  ? 718  THR A N    1 
ATOM   9795  C CA   . THR A 1 652 ? 21.059  60.154  55.478  1.00 69.70  ? 718  THR A CA   1 
ATOM   9796  C C    . THR A 1 652 ? 20.365  60.765  56.703  1.00 74.73  ? 718  THR A C    1 
ATOM   9797  O O    . THR A 1 652 ? 19.649  60.077  57.424  1.00 65.90  ? 718  THR A O    1 
ATOM   9798  C CB   . THR A 1 652 ? 22.212  59.217  55.920  1.00 52.98  ? 718  THR A CB   1 
ATOM   9799  O OG1  . THR A 1 652 ? 21.693  58.129  56.689  1.00 56.96  ? 718  THR A OG1  1 
ATOM   9800  C CG2  . THR A 1 652 ? 23.194  59.963  56.747  1.00 75.63  ? 718  THR A CG2  1 
ATOM   9801  H H    . THR A 1 652 ? 22.375  61.353  54.618  1.00 74.56  ? 718  THR A H    1 
ATOM   9802  H HA   . THR A 1 652 ? 20.404  59.611  55.012  1.00 83.64  ? 718  THR A HA   1 
ATOM   9803  H HB   . THR A 1 652 ? 22.667  58.872  55.136  1.00 63.57  ? 718  THR A HB   1 
ATOM   9804  H HG1  . THR A 1 652 ? 21.303  58.421  57.373  1.00 68.35  ? 718  THR A HG1  1 
ATOM   9805  H HG21 . THR A 1 652 ? 23.913  59.372  57.020  1.00 90.76  ? 718  THR A HG21 1 
ATOM   9806  H HG22 . THR A 1 652 ? 23.567  60.698  56.236  1.00 90.76  ? 718  THR A HG22 1 
ATOM   9807  H HG23 . THR A 1 652 ? 22.759  60.318  57.538  1.00 90.76  ? 718  THR A HG23 1 
ATOM   9808  N N    . GLY A 1 653 ? 20.591  62.057  56.935  1.00 82.48  ? 719  GLY A N    1 
ATOM   9809  C CA   . GLY A 1 653 ? 19.915  62.769  58.006  1.00 72.31  ? 719  GLY A CA   1 
ATOM   9810  C C    . GLY A 1 653 ? 18.520  63.142  57.551  1.00 70.43  ? 719  GLY A C    1 
ATOM   9811  O O    . GLY A 1 653 ? 17.552  63.093  58.318  1.00 75.86  ? 719  GLY A O    1 
ATOM   9812  H H    . GLY A 1 653 ? 21.135  62.544  56.480  1.00 98.97  ? 719  GLY A H    1 
ATOM   9813  H HA2  . GLY A 1 653 ? 19.853  62.206  58.794  1.00 86.77  ? 719  GLY A HA2  1 
ATOM   9814  H HA3  . GLY A 1 653 ? 20.403  63.576  58.231  1.00 86.77  ? 719  GLY A HA3  1 
ATOM   9815  N N    . ILE A 1 654 ? 18.426  63.501  56.277  1.00 61.11  ? 720  ILE A N    1 
ATOM   9816  C CA   . ILE A 1 654 ? 17.161  63.861  55.660  1.00 67.70  ? 720  ILE A CA   1 
ATOM   9817  C C    . ILE A 1 654 ? 16.167  62.689  55.697  1.00 82.15  ? 720  ILE A C    1 
ATOM   9818  O O    . ILE A 1 654 ? 15.083  62.824  56.258  1.00 86.80  ? 720  ILE A O    1 
ATOM   9819  C CB   . ILE A 1 654 ? 17.403  64.395  54.227  1.00 57.71  ? 720  ILE A CB   1 
ATOM   9820  C CG1  . ILE A 1 654 ? 17.797  65.874  54.311  1.00 66.13  ? 720  ILE A CG1  1 
ATOM   9821  C CG2  . ILE A 1 654 ? 16.177  64.236  53.341  1.00 64.94  ? 720  ILE A CG2  1 
ATOM   9822  C CD1  . ILE A 1 654 ? 18.310  66.498  53.014  1.00 51.11  ? 720  ILE A CD1  1 
ATOM   9823  H H    . ILE A 1 654 ? 19.096  63.544  55.739  1.00 73.33  ? 720  ILE A H    1 
ATOM   9824  H HA   . ILE A 1 654 ? 16.769  64.584  56.173  1.00 81.23  ? 720  ILE A HA   1 
ATOM   9825  H HB   . ILE A 1 654 ? 18.138  63.901  53.832  1.00 69.25  ? 720  ILE A HB   1 
ATOM   9826  H HG12 . ILE A 1 654 ? 17.020  66.382  54.591  1.00 79.36  ? 720  ILE A HG12 1 
ATOM   9827  H HG13 . ILE A 1 654 ? 18.499  65.966  54.975  1.00 79.36  ? 720  ILE A HG13 1 
ATOM   9828  H HG21 . ILE A 1 654 ? 16.378  64.584  52.458  1.00 77.93  ? 720  ILE A HG21 1 
ATOM   9829  H HG22 . ILE A 1 654 ? 15.951  63.294  53.282  1.00 77.93  ? 720  ILE A HG22 1 
ATOM   9830  H HG23 . ILE A 1 654 ? 15.439  64.730  53.732  1.00 77.93  ? 720  ILE A HG23 1 
ATOM   9831  H HD11 . ILE A 1 654 ? 18.529  67.428  53.177  1.00 61.34  ? 720  ILE A HD11 1 
ATOM   9832  H HD12 . ILE A 1 654 ? 19.100  66.017  52.723  1.00 61.34  ? 720  ILE A HD12 1 
ATOM   9833  H HD13 . ILE A 1 654 ? 17.617  66.434  52.338  1.00 61.34  ? 720  ILE A HD13 1 
ATOM   9834  N N    . GLU A 1 655 ? 16.555  61.541  55.143  1.00 80.05  ? 721  GLU A N    1 
ATOM   9835  C CA   . GLU A 1 655 ? 15.681  60.363  55.052  1.00 75.04  ? 721  GLU A CA   1 
ATOM   9836  C C    . GLU A 1 655 ? 15.280  59.759  56.400  1.00 83.03  ? 721  GLU A C    1 
ATOM   9837  O O    . GLU A 1 655 ? 14.176  59.238  56.554  1.00 93.99  ? 721  GLU A O    1 
ATOM   9838  C CB   . GLU A 1 655 ? 16.369  59.266  54.239  1.00 84.46  ? 721  GLU A CB   1 
ATOM   9839  C CG   . GLU A 1 655 ? 16.785  59.676  52.839  1.00 99.94  ? 721  GLU A CG   1 
ATOM   9840  C CD   . GLU A 1 655 ? 15.599  59.844  51.905  1.00 113.77 ? 721  GLU A CD   1 
ATOM   9841  O OE1  . GLU A 1 655 ? 14.438  59.631  52.334  1.00 126.25 ? 721  GLU A OE1  1 
ATOM   9842  O OE2  . GLU A 1 655 ? 15.834  60.224  50.743  1.00 116.54 ? 721  GLU A OE2  1 
ATOM   9843  H H    . GLU A 1 655 ? 17.336  61.414  54.805  1.00 96.06  ? 721  GLU A H    1 
ATOM   9844  H HA   . GLU A 1 655 ? 14.868  60.614  54.586  1.00 90.05  ? 721  GLU A HA   1 
ATOM   9845  H HB2  . GLU A 1 655 ? 17.168  58.986  54.712  1.00 101.35 ? 721  GLU A HB2  1 
ATOM   9846  H HB3  . GLU A 1 655 ? 15.760  58.515  54.156  1.00 101.35 ? 721  GLU A HB3  1 
ATOM   9847  H HG2  . GLU A 1 655 ? 17.255  60.523  52.883  1.00 119.93 ? 721  GLU A HG2  1 
ATOM   9848  H HG3  . GLU A 1 655 ? 17.365  58.993  52.468  1.00 119.93 ? 721  GLU A HG3  1 
ATOM   9849  N N    . ASN A 1 656 ? 16.191  59.805  57.360  1.00 91.35  ? 722  ASN A N    1 
ATOM   9850  C CA   . ASN A 1 656 ? 15.974  59.191  58.658  1.00 80.96  ? 722  ASN A CA   1 
ATOM   9851  C C    . ASN A 1 656 ? 15.393  60.196  59.634  1.00 65.94  ? 722  ASN A C    1 
ATOM   9852  O O    . ASN A 1 656 ? 14.763  59.808  60.611  1.00 58.75  ? 722  ASN A O    1 
ATOM   9853  C CB   . ASN A 1 656 ? 17.301  58.650  59.205  1.00 93.20  ? 722  ASN A CB   1 
ATOM   9854  C CG   . ASN A 1 656 ? 17.236  57.183  59.563  1.00 99.41  ? 722  ASN A CG   1 
ATOM   9855  O OD1  . ASN A 1 656 ? 16.483  56.418  58.959  1.00 106.28 ? 722  ASN A OD1  1 
ATOM   9856  N ND2  . ASN A 1 656 ? 18.042  56.776  60.546  1.00 104.52 ? 722  ASN A ND2  1 
ATOM   9857  H H    . ASN A 1 656 ? 16.954  60.193  57.283  1.00 109.62 ? 722  ASN A H    1 
ATOM   9858  H HA   . ASN A 1 656 ? 15.353  58.452  58.569  1.00 97.15  ? 722  ASN A HA   1 
ATOM   9859  H HB2  . ASN A 1 656 ? 17.989  58.763  58.531  1.00 111.84 ? 722  ASN A HB2  1 
ATOM   9860  H HB3  . ASN A 1 656 ? 17.536  59.143  60.006  1.00 111.84 ? 722  ASN A HB3  1 
ATOM   9861  H HD21 . ASN A 1 656 ? 18.043  55.951  60.788  1.00 125.42 ? 722  ASN A HD21 1 
ATOM   9862  H HD22 . ASN A 1 656 ? 18.560  57.340  60.938  1.00 125.42 ? 722  ASN A HD22 1 
ATOM   9863  N N    . GLY A 1 657 ? 15.624  61.484  59.385  1.00 63.43  ? 723  GLY A N    1 
ATOM   9864  C CA   . GLY A 1 657 ? 15.052  62.534  60.213  1.00 77.38  ? 723  GLY A CA   1 
ATOM   9865  C C    . GLY A 1 657 ? 15.550  62.550  61.649  1.00 78.44  ? 723  GLY A C    1 
ATOM   9866  O O    . GLY A 1 657 ? 15.080  63.338  62.473  1.00 74.69  ? 723  GLY A O    1 
ATOM   9867  H H    . GLY A 1 657 ? 16.111  61.773  58.738  1.00 76.12  ? 723  GLY A H    1 
ATOM   9868  H HA2  . GLY A 1 657 ? 15.256  63.396  59.816  1.00 92.86  ? 723  GLY A HA2  1 
ATOM   9869  H HA3  . GLY A 1 657 ? 14.087  62.432  60.232  1.00 92.86  ? 723  GLY A HA3  1 
ATOM   9870  N N    . ASP A 1 658 ? 16.493  61.665  61.956  1.00 81.04  ? 724  ASP A N    1 
ATOM   9871  C CA   . ASP A 1 658 ? 17.167  61.673  63.248  1.00 82.83  ? 724  ASP A CA   1 
ATOM   9872  C C    . ASP A 1 658 ? 18.679  61.619  63.023  1.00 94.37  ? 724  ASP A C    1 
ATOM   9873  O O    . ASP A 1 658 ? 19.256  60.601  62.639  1.00 97.49  ? 724  ASP A O    1 
ATOM   9874  C CB   . ASP A 1 658 ? 16.665  60.554  64.176  1.00 86.05  ? 724  ASP A CB   1 
ATOM   9875  C CG   . ASP A 1 658 ? 16.613  59.178  63.504  1.00 101.50 ? 724  ASP A CG   1 
ATOM   9876  O OD1  . ASP A 1 658 ? 17.644  58.683  62.991  1.00 91.62  ? 724  ASP A OD1  1 
ATOM   9877  O OD2  . ASP A 1 658 ? 15.520  58.568  63.519  1.00 115.77 ? 724  ASP A OD2  1 
ATOM   9878  H H    . ASP A 1 658 ? 16.763  61.043  61.426  1.00 97.24  ? 724  ASP A H    1 
ATOM   9879  H HA   . ASP A 1 658 ? 16.973  62.517  63.686  1.00 99.40  ? 724  ASP A HA   1 
ATOM   9880  H HB2  . ASP A 1 658 ? 17.259  60.490  64.940  1.00 103.26 ? 724  ASP A HB2  1 
ATOM   9881  H HB3  . ASP A 1 658 ? 15.768  60.773  64.474  1.00 103.26 ? 724  ASP A HB3  1 
ATOM   9882  N N    . MET A 1 659 ? 19.301  62.768  63.217  1.00 80.90  ? 725  MET A N    1 
ATOM   9883  C CA   . MET A 1 659 ? 20.729  62.911  63.083  1.00 56.96  ? 725  MET A CA   1 
ATOM   9884  C C    . MET A 1 659 ? 21.073  64.012  64.061  1.00 60.31  ? 725  MET A C    1 
ATOM   9885  O O    . MET A 1 659 ? 20.537  65.113  63.958  1.00 64.31  ? 725  MET A O    1 
ATOM   9886  C CB   . MET A 1 659 ? 21.086  63.336  61.663  1.00 68.00  ? 725  MET A CB   1 
ATOM   9887  C CG   . MET A 1 659 ? 22.584  63.403  61.383  1.00 74.32  ? 725  MET A CG   1 
ATOM   9888  S SD   . MET A 1 659 ? 23.409  61.804  61.260  1.00 64.98  ? 725  MET A SD   1 
ATOM   9889  C CE   . MET A 1 659 ? 22.462  61.032  59.952  1.00 64.20  ? 725  MET A CE   1 
ATOM   9890  H H    . MET A 1 659 ? 18.901  63.498  63.434  1.00 97.08  ? 725  MET A H    1 
ATOM   9891  H HA   . MET A 1 659 ? 21.186  62.086  63.310  1.00 68.35  ? 725  MET A HA   1 
ATOM   9892  H HB2  . MET A 1 659 ? 20.698  62.700  61.042  1.00 81.60  ? 725  MET A HB2  1 
ATOM   9893  H HB3  . MET A 1 659 ? 20.716  64.218  61.501  1.00 81.60  ? 725  MET A HB3  1 
ATOM   9894  H HG2  . MET A 1 659 ? 22.721  63.868  60.543  1.00 89.19  ? 725  MET A HG2  1 
ATOM   9895  H HG3  . MET A 1 659 ? 23.010  63.897  62.101  1.00 89.19  ? 725  MET A HG3  1 
ATOM   9896  H HE1  . MET A 1 659 ? 22.816  60.144  59.788  1.00 77.04  ? 725  MET A HE1  1 
ATOM   9897  H HE2  . MET A 1 659 ? 21.534  60.972  60.228  1.00 77.04  ? 725  MET A HE2  1 
ATOM   9898  H HE3  . MET A 1 659 ? 22.535  61.571  59.149  1.00 77.04  ? 725  MET A HE3  1 
ATOM   9899  N N    . PRO A 1 660 ? 21.935  63.720  65.042  1.00 65.31  ? 726  PRO A N    1 
ATOM   9900  C CA   . PRO A 1 660 ? 22.255  64.740  66.045  1.00 65.97  ? 726  PRO A CA   1 
ATOM   9901  C C    . PRO A 1 660 ? 22.697  66.066  65.420  1.00 63.44  ? 726  PRO A C    1 
ATOM   9902  O O    . PRO A 1 660 ? 23.553  66.083  64.518  1.00 52.79  ? 726  PRO A O    1 
ATOM   9903  C CB   . PRO A 1 660 ? 23.387  64.090  66.838  1.00 75.78  ? 726  PRO A CB   1 
ATOM   9904  C CG   . PRO A 1 660 ? 23.107  62.636  66.726  1.00 60.98  ? 726  PRO A CG   1 
ATOM   9905  C CD   . PRO A 1 660 ? 22.600  62.439  65.337  1.00 59.26  ? 726  PRO A CD   1 
ATOM   9906  H HA   . PRO A 1 660 ? 21.496  64.893  66.629  1.00 79.16  ? 726  PRO A HA   1 
ATOM   9907  H HB2  . PRO A 1 660 ? 24.242  64.311  66.436  1.00 90.94  ? 726  PRO A HB2  1 
ATOM   9908  H HB3  . PRO A 1 660 ? 23.352  64.380  67.763  1.00 90.94  ? 726  PRO A HB3  1 
ATOM   9909  H HG2  . PRO A 1 660 ? 23.925  62.134  66.866  1.00 73.18  ? 726  PRO A HG2  1 
ATOM   9910  H HG3  . PRO A 1 660 ? 22.433  62.382  67.376  1.00 73.18  ? 726  PRO A HG3  1 
ATOM   9911  H HD2  . PRO A 1 660 ? 23.337  62.290  64.724  1.00 71.11  ? 726  PRO A HD2  1 
ATOM   9912  H HD3  . PRO A 1 660 ? 21.960  61.710  65.310  1.00 71.11  ? 726  PRO A HD3  1 
ATOM   9913  N N    . GLU A 1 661 ? 22.094  67.151  65.900  1.00 49.06  ? 727  GLU A N    1 
ATOM   9914  C CA   . GLU A 1 661 ? 22.313  68.476  65.344  1.00 38.06  ? 727  GLU A CA   1 
ATOM   9915  C C    . GLU A 1 661 ? 23.768  68.771  65.072  1.00 49.17  ? 727  GLU A C    1 
ATOM   9916  O O    . GLU A 1 661 ? 24.104  69.249  63.988  1.00 61.52  ? 727  GLU A O    1 
ATOM   9917  C CB   . GLU A 1 661 ? 21.740  69.550  66.265  1.00 44.18  ? 727  GLU A CB   1 
ATOM   9918  C CG   . GLU A 1 661 ? 22.263  69.523  67.686  1.00 65.67  ? 727  GLU A CG   1 
ATOM   9919  C CD   . GLU A 1 661 ? 22.008  70.818  68.409  1.00 67.85  ? 727  GLU A CD   1 
ATOM   9920  O OE1  . GLU A 1 661 ? 21.231  70.819  69.383  1.00 77.51  ? 727  GLU A OE1  1 
ATOM   9921  O OE2  . GLU A 1 661 ? 22.600  71.834  68.004  1.00 63.52  ? 727  GLU A OE2  1 
ATOM   9922  H H    . GLU A 1 661 ? 21.544  67.142  66.561  1.00 58.87  ? 727  GLU A H    1 
ATOM   9923  H HA   . GLU A 1 661 ? 21.841  68.536  64.499  1.00 45.67  ? 727  GLU A HA   1 
ATOM   9924  H HB2  . GLU A 1 661 ? 21.952  70.420  65.892  1.00 53.01  ? 727  GLU A HB2  1 
ATOM   9925  H HB3  . GLU A 1 661 ? 20.777  69.439  66.305  1.00 53.01  ? 727  GLU A HB3  1 
ATOM   9926  H HG2  . GLU A 1 661 ? 21.819  68.812  68.175  1.00 78.80  ? 727  GLU A HG2  1 
ATOM   9927  H HG3  . GLU A 1 661 ? 23.220  69.370  67.670  1.00 78.80  ? 727  GLU A HG3  1 
ATOM   9928  N N    . GLN A 1 662 ? 24.632  68.462  66.033  1.00 43.71  ? 728  GLN A N    1 
ATOM   9929  C CA   . GLN A 1 662 ? 26.023  68.878  65.934  1.00 51.20  ? 728  GLN A CA   1 
ATOM   9930  C C    . GLN A 1 662 ? 26.704  68.243  64.737  1.00 46.07  ? 728  GLN A C    1 
ATOM   9931  O O    . GLN A 1 662 ? 27.522  68.886  64.083  1.00 48.74  ? 728  GLN A O    1 
ATOM   9932  C CB   . GLN A 1 662 ? 26.787  68.566  67.220  1.00 66.81  ? 728  GLN A CB   1 
ATOM   9933  C CG   . GLN A 1 662 ? 26.545  69.565  68.353  1.00 68.11  ? 728  GLN A CG   1 
ATOM   9934  C CD   . GLN A 1 662 ? 26.683  71.009  67.898  1.00 75.64  ? 728  GLN A CD   1 
ATOM   9935  O OE1  . GLN A 1 662 ? 27.607  71.360  67.165  1.00 79.61  ? 728  GLN A OE1  1 
ATOM   9936  N NE2  . GLN A 1 662 ? 25.744  71.845  68.309  1.00 77.00  ? 728  GLN A NE2  1 
ATOM   9937  H H    . GLN A 1 662 ? 24.440  68.018  66.744  1.00 52.45  ? 728  GLN A H    1 
ATOM   9938  H HA   . GLN A 1 662 ? 26.048  69.839  65.807  1.00 61.44  ? 728  GLN A HA   1 
ATOM   9939  H HB2  . GLN A 1 662 ? 26.518  67.690  67.538  1.00 80.17  ? 728  GLN A HB2  1 
ATOM   9940  H HB3  . GLN A 1 662 ? 27.737  68.565  67.025  1.00 80.17  ? 728  GLN A HB3  1 
ATOM   9941  H HG2  . GLN A 1 662 ? 25.646  69.443  68.696  1.00 81.73  ? 728  GLN A HG2  1 
ATOM   9942  H HG3  . GLN A 1 662 ? 27.194  69.408  69.057  1.00 81.73  ? 728  GLN A HG3  1 
ATOM   9943  H HE21 . GLN A 1 662 ? 25.102  71.561  68.805  1.00 92.40  ? 728  GLN A HE21 1 
ATOM   9944  H HE22 . GLN A 1 662 ? 25.775  72.674  68.079  1.00 92.40  ? 728  GLN A HE22 1 
ATOM   9945  N N    . ILE A 1 663 ? 26.345  66.996  64.443  1.00 52.34  ? 729  ILE A N    1 
ATOM   9946  C CA   . ILE A 1 663 ? 26.822  66.328  63.235  1.00 55.54  ? 729  ILE A CA   1 
ATOM   9947  C C    . ILE A 1 663 ? 26.315  67.035  61.983  1.00 46.15  ? 729  ILE A C    1 
ATOM   9948  O O    . ILE A 1 663 ? 27.084  67.251  61.049  1.00 42.96  ? 729  ILE A O    1 
ATOM   9949  C CB   . ILE A 1 663 ? 26.415  64.829  63.200  1.00 56.86  ? 729  ILE A CB   1 
ATOM   9950  C CG1  . ILE A 1 663 ? 27.144  64.083  64.327  1.00 54.17  ? 729  ILE A CG1  1 
ATOM   9951  C CG2  . ILE A 1 663 ? 26.713  64.208  61.824  1.00 40.05  ? 729  ILE A CG2  1 
ATOM   9952  C CD1  . ILE A 1 663 ? 27.052  62.564  64.278  1.00 51.91  ? 729  ILE A CD1  1 
ATOM   9953  H H    . ILE A 1 663 ? 25.825  66.513  64.928  1.00 62.81  ? 729  ILE A H    1 
ATOM   9954  H HA   . ILE A 1 663 ? 27.791  66.369  63.222  1.00 66.65  ? 729  ILE A HA   1 
ATOM   9955  H HB   . ILE A 1 663 ? 25.461  64.769  63.362  1.00 68.23  ? 729  ILE A HB   1 
ATOM   9956  H HG12 . ILE A 1 663 ? 28.085  64.318  64.291  1.00 65.01  ? 729  ILE A HG12 1 
ATOM   9957  H HG13 . ILE A 1 663 ? 26.772  64.370  65.175  1.00 65.01  ? 729  ILE A HG13 1 
ATOM   9958  H HG21 . ILE A 1 663 ? 26.448  63.274  61.836  1.00 48.06  ? 729  ILE A HG21 1 
ATOM   9959  H HG22 . ILE A 1 663 ? 26.211  64.686  61.146  1.00 48.06  ? 729  ILE A HG22 1 
ATOM   9960  H HG23 . ILE A 1 663 ? 27.664  64.280  61.645  1.00 48.06  ? 729  ILE A HG23 1 
ATOM   9961  H HD11 . ILE A 1 663 ? 27.543  62.194  65.029  1.00 62.30  ? 729  ILE A HD11 1 
ATOM   9962  H HD12 . ILE A 1 663 ? 26.120  62.302  64.332  1.00 62.30  ? 729  ILE A HD12 1 
ATOM   9963  H HD13 . ILE A 1 663 ? 27.437  62.251  63.445  1.00 62.30  ? 729  ILE A HD13 1 
ATOM   9964  N N    . VAL A 1 664 ? 25.029  67.384  61.964  1.00 43.18  ? 730  VAL A N    1 
ATOM   9965  C CA   . VAL A 1 664 ? 24.428  68.071  60.812  1.00 53.40  ? 730  VAL A CA   1 
ATOM   9966  C C    . VAL A 1 664 ? 25.180  69.377  60.539  1.00 55.70  ? 730  VAL A C    1 
ATOM   9967  O O    . VAL A 1 664 ? 25.705  69.631  59.438  1.00 39.42  ? 730  VAL A O    1 
ATOM   9968  C CB   . VAL A 1 664 ? 22.913  68.376  61.061  1.00 45.38  ? 730  VAL A CB   1 
ATOM   9969  C CG1  . VAL A 1 664 ? 22.308  69.224  59.941  1.00 47.47  ? 730  VAL A CG1  1 
ATOM   9970  C CG2  . VAL A 1 664 ? 22.120  67.095  61.195  1.00 47.44  ? 730  VAL A CG2  1 
ATOM   9971  H H    . VAL A 1 664 ? 24.478  67.235  62.607  1.00 51.81  ? 730  VAL A H    1 
ATOM   9972  H HA   . VAL A 1 664 ? 24.501  67.506  60.027  1.00 64.08  ? 730  VAL A HA   1 
ATOM   9973  H HB   . VAL A 1 664 ? 22.824  68.871  61.891  1.00 54.46  ? 730  VAL A HB   1 
ATOM   9974  H HG11 . VAL A 1 664 ? 21.373  69.387  60.138  1.00 56.96  ? 730  VAL A HG11 1 
ATOM   9975  H HG12 . VAL A 1 664 ? 22.787  70.066  59.889  1.00 56.96  ? 730  VAL A HG12 1 
ATOM   9976  H HG13 . VAL A 1 664 ? 22.391  68.743  59.102  1.00 56.96  ? 730  VAL A HG13 1 
ATOM   9977  H HG21 . VAL A 1 664 ? 21.188  67.316  61.348  1.00 56.92  ? 730  VAL A HG21 1 
ATOM   9978  H HG22 . VAL A 1 664 ? 22.209  66.583  60.376  1.00 56.92  ? 730  VAL A HG22 1 
ATOM   9979  H HG23 . VAL A 1 664 ? 22.467  66.586  61.944  1.00 56.92  ? 730  VAL A HG23 1 
ATOM   9980  N N    . ILE A 1 665 ? 25.216  70.203  61.571  1.00 51.91  ? 731  ILE A N    1 
ATOM   9981  C CA   . ILE A 1 665 ? 25.906  71.473  61.515  1.00 48.19  ? 731  ILE A CA   1 
ATOM   9982  C C    . ILE A 1 665 ? 27.286  71.341  60.893  1.00 41.83  ? 731  ILE A C    1 
ATOM   9983  O O    . ILE A 1 665 ? 27.590  72.042  59.943  1.00 51.11  ? 731  ILE A O    1 
ATOM   9984  C CB   . ILE A 1 665 ? 25.992  72.077  62.914  1.00 52.64  ? 731  ILE A CB   1 
ATOM   9985  C CG1  . ILE A 1 665 ? 24.600  72.574  63.307  1.00 43.39  ? 731  ILE A CG1  1 
ATOM   9986  C CG2  . ILE A 1 665 ? 27.023  73.192  62.971  1.00 55.32  ? 731  ILE A CG2  1 
ATOM   9987  C CD1  . ILE A 1 665 ? 24.524  73.263  64.665  1.00 65.59  ? 731  ILE A CD1  1 
ATOM   9988  H H    . ILE A 1 665 ? 24.840  70.045  62.329  1.00 62.29  ? 731  ILE A H    1 
ATOM   9989  H HA   . ILE A 1 665 ? 25.391  72.081  60.962  1.00 57.83  ? 731  ILE A HA   1 
ATOM   9990  H HB   . ILE A 1 665 ? 26.257  71.381  63.535  1.00 63.17  ? 731  ILE A HB   1 
ATOM   9991  H HG12 . ILE A 1 665 ? 24.300  73.210  62.639  1.00 52.07  ? 731  ILE A HG12 1 
ATOM   9992  H HG13 . ILE A 1 665 ? 23.996  71.815  63.329  1.00 52.07  ? 731  ILE A HG13 1 
ATOM   9993  H HG21 . ILE A 1 665 ? 27.050  73.551  63.872  1.00 66.39  ? 731  ILE A HG21 1 
ATOM   9994  H HG22 . ILE A 1 665 ? 27.891  72.831  62.732  1.00 66.39  ? 731  ILE A HG22 1 
ATOM   9995  H HG23 . ILE A 1 665 ? 26.770  73.888  62.345  1.00 66.39  ? 731  ILE A HG23 1 
ATOM   9996  H HD11 . ILE A 1 665 ? 23.609  73.541  64.826  1.00 78.71  ? 731  ILE A HD11 1 
ATOM   9997  H HD12 . ILE A 1 665 ? 24.806  72.638  65.351  1.00 78.71  ? 731  ILE A HD12 1 
ATOM   9998  H HD13 . ILE A 1 665 ? 25.110  74.036  64.660  1.00 78.71  ? 731  ILE A HD13 1 
ATOM   9999  N N    . HIS A 1 666 ? 28.114  70.436  61.403  1.00 46.41  ? 732  HIS A N    1 
ATOM   10000 C CA   . HIS A 1 666 ? 29.493  70.333  60.919  1.00 40.96  ? 732  HIS A CA   1 
ATOM   10001 C C    . HIS A 1 666 ? 29.591  69.703  59.556  1.00 46.91  ? 732  HIS A C    1 
ATOM   10002 O O    . HIS A 1 666 ? 30.421  70.119  58.752  1.00 51.15  ? 732  HIS A O    1 
ATOM   10003 C CB   . HIS A 1 666 ? 30.383  69.621  61.931  1.00 34.90  ? 732  HIS A CB   1 
ATOM   10004 C CG   . HIS A 1 666 ? 30.639  70.449  63.147  1.00 45.93  ? 732  HIS A CG   1 
ATOM   10005 N ND1  . HIS A 1 666 ? 29.932  70.293  64.320  1.00 37.56  ? 732  HIS A ND1  1 
ATOM   10006 C CD2  . HIS A 1 666 ? 31.471  71.497  63.346  1.00 37.70  ? 732  HIS A CD2  1 
ATOM   10007 C CE1  . HIS A 1 666 ? 30.345  71.186  65.199  1.00 44.56  ? 732  HIS A CE1  1 
ATOM   10008 N NE2  . HIS A 1 666 ? 31.279  71.928  64.632  1.00 40.63  ? 732  HIS A NE2  1 
ATOM   10009 H H    . HIS A 1 666 ? 27.909  69.875  62.022  1.00 55.69  ? 732  HIS A H    1 
ATOM   10010 H HA   . HIS A 1 666 ? 29.840  71.235  60.831  1.00 49.15  ? 732  HIS A HA   1 
ATOM   10011 H HB2  . HIS A 1 666 ? 29.950  68.799  62.211  1.00 41.88  ? 732  HIS A HB2  1 
ATOM   10012 H HB3  . HIS A 1 666 ? 31.238  69.422  61.517  1.00 41.88  ? 732  HIS A HB3  1 
ATOM   10013 H HD1  . HIS A 1 666 ? 29.327  69.699  64.461  1.00 45.08  ? 732  HIS A HD1  1 
ATOM   10014 H HD2  . HIS A 1 666 ? 32.073  71.848  62.730  1.00 45.24  ? 732  HIS A HD2  1 
ATOM   10015 H HE1  . HIS A 1 666 ? 30.033  71.275  66.071  1.00 53.48  ? 732  HIS A HE1  1 
ATOM   10016 H HE2  . HIS A 1 666 ? 31.701  72.576  65.010  1.00 48.76  ? 732  HIS A HE2  1 
ATOM   10017 N N    . ALA A 1 667 ? 28.734  68.722  59.283  1.00 48.88  ? 733  ALA A N    1 
ATOM   10018 C CA   . ALA A 1 667 ? 28.578  68.221  57.919  1.00 52.04  ? 733  ALA A CA   1 
ATOM   10019 C C    . ALA A 1 667 ? 28.314  69.400  56.975  1.00 48.84  ? 733  ALA A C    1 
ATOM   10020 O O    . ALA A 1 667 ? 29.106  69.662  56.076  1.00 52.97  ? 733  ALA A O    1 
ATOM   10021 C CB   . ALA A 1 667 ? 27.449  67.210  57.847  1.00 48.13  ? 733  ALA A CB   1 
ATOM   10022 H H    . ALA A 1 667 ? 28.234  68.332  59.864  1.00 58.65  ? 733  ALA A H    1 
ATOM   10023 H HA   . ALA A 1 667 ? 29.398  67.784  57.641  1.00 62.45  ? 733  ALA A HA   1 
ATOM   10024 H HB1  . ALA A 1 667 ? 27.367  66.894  56.933  1.00 57.76  ? 733  ALA A HB1  1 
ATOM   10025 H HB2  . ALA A 1 667 ? 27.653  66.468  58.437  1.00 57.76  ? 733  ALA A HB2  1 
ATOM   10026 H HB3  . ALA A 1 667 ? 26.624  67.638  58.125  1.00 57.76  ? 733  ALA A HB3  1 
ATOM   10027 N N    . LEU A 1 668 ? 27.222  70.120  57.209  1.00 40.87  ? 734  LEU A N    1 
ATOM   10028 C CA   . LEU A 1 668 ? 26.896  71.310  56.431  1.00 43.61  ? 734  LEU A CA   1 
ATOM   10029 C C    . LEU A 1 668 ? 28.092  72.222  56.199  1.00 42.17  ? 734  LEU A C    1 
ATOM   10030 O O    . LEU A 1 668 ? 28.384  72.611  55.065  1.00 34.39  ? 734  LEU A O    1 
ATOM   10031 C CB   . LEU A 1 668 ? 25.815  72.126  57.142  1.00 50.42  ? 734  LEU A CB   1 
ATOM   10032 C CG   . LEU A 1 668 ? 24.364  71.738  56.896  1.00 52.48  ? 734  LEU A CG   1 
ATOM   10033 C CD1  . LEU A 1 668 ? 23.461  72.567  57.800  1.00 54.74  ? 734  LEU A CD1  1 
ATOM   10034 C CD2  . LEU A 1 668 ? 24.010  71.934  55.435  1.00 42.32  ? 734  LEU A CD2  1 
ATOM   10035 H H    . LEU A 1 668 ? 26.646  69.938  57.821  1.00 49.04  ? 734  LEU A H    1 
ATOM   10036 H HA   . LEU A 1 668 ? 26.551  71.040  55.566  1.00 52.33  ? 734  LEU A HA   1 
ATOM   10037 H HB2  . LEU A 1 668 ? 25.969  72.058  58.098  1.00 60.50  ? 734  LEU A HB2  1 
ATOM   10038 H HB3  . LEU A 1 668 ? 25.911  73.052  56.870  1.00 60.50  ? 734  LEU A HB3  1 
ATOM   10039 H HG   . LEU A 1 668 ? 24.241  70.802  57.117  1.00 62.98  ? 734  LEU A HG   1 
ATOM   10040 H HD11 . LEU A 1 668 ? 22.538  72.316  57.639  1.00 65.68  ? 734  LEU A HD11 1 
ATOM   10041 H HD12 . LEU A 1 668 ? 23.695  72.394  58.725  1.00 65.68  ? 734  LEU A HD12 1 
ATOM   10042 H HD13 . LEU A 1 668 ? 23.588  73.507  57.597  1.00 65.68  ? 734  LEU A HD13 1 
ATOM   10043 H HD21 . LEU A 1 668 ? 23.083  71.682  55.299  1.00 50.78  ? 734  LEU A HD21 1 
ATOM   10044 H HD22 . LEU A 1 668 ? 24.137  72.867  55.202  1.00 50.78  ? 734  LEU A HD22 1 
ATOM   10045 H HD23 . LEU A 1 668 ? 24.588  71.376  54.893  1.00 50.78  ? 734  LEU A HD23 1 
ATOM   10046 N N    . GLN A 1 669 ? 28.764  72.581  57.288  1.00 47.34  ? 735  GLN A N    1 
ATOM   10047 C CA   . GLN A 1 669 ? 29.931  73.445  57.218  1.00 46.89  ? 735  GLN A CA   1 
ATOM   10048 C C    . GLN A 1 669 ? 30.995  72.834  56.361  1.00 45.15  ? 735  GLN A C    1 
ATOM   10049 O O    . GLN A 1 669 ? 31.578  73.494  55.508  1.00 33.31  ? 735  GLN A O    1 
ATOM   10050 C CB   . GLN A 1 669 ? 30.507  73.661  58.604  1.00 39.91  ? 735  GLN A CB   1 
ATOM   10051 C CG   . GLN A 1 669 ? 30.057  74.951  59.224  1.00 52.12  ? 735  GLN A CG   1 
ATOM   10052 C CD   . GLN A 1 669 ? 30.473  75.107  60.665  1.00 53.52  ? 735  GLN A CD   1 
ATOM   10053 O OE1  . GLN A 1 669 ? 30.592  76.233  61.149  1.00 68.82  ? 735  GLN A OE1  1 
ATOM   10054 N NE2  . GLN A 1 669 ? 30.673  73.992  61.372  1.00 35.55  ? 735  GLN A NE2  1 
ATOM   10055 H H    . GLN A 1 669 ? 28.561  72.333  58.086  1.00 56.81  ? 735  GLN A H    1 
ATOM   10056 H HA   . GLN A 1 669 ? 29.683  74.305  56.844  1.00 56.26  ? 735  GLN A HA   1 
ATOM   10057 H HB2  . GLN A 1 669 ? 30.222  72.935  59.181  1.00 47.89  ? 735  GLN A HB2  1 
ATOM   10058 H HB3  . GLN A 1 669 ? 31.475  73.678  58.545  1.00 47.89  ? 735  GLN A HB3  1 
ATOM   10059 H HG2  . GLN A 1 669 ? 30.438  75.689  58.723  1.00 62.54  ? 735  GLN A HG2  1 
ATOM   10060 H HG3  . GLN A 1 669 ? 29.088  74.995  59.188  1.00 62.54  ? 735  GLN A HG3  1 
ATOM   10061 H HE21 . GLN A 1 669 ? 30.563  73.223  61.003  1.00 42.66  ? 735  GLN A HE21 1 
ATOM   10062 H HE22 . GLN A 1 669 ? 30.911  74.043  62.197  1.00 42.66  ? 735  GLN A HE22 1 
ATOM   10063 N N    . CYS A 1 670 ? 31.234  71.552  56.592  1.00 39.17  ? 736  CYS A N    1 
ATOM   10064 C CA   . CYS A 1 670 ? 32.326  70.883  55.933  1.00 50.08  ? 736  CYS A CA   1 
ATOM   10065 C C    . CYS A 1 670 ? 32.105  70.864  54.421  1.00 48.75  ? 736  CYS A C    1 
ATOM   10066 O O    . CYS A 1 670 ? 32.980  71.267  53.657  1.00 62.19  ? 736  CYS A O    1 
ATOM   10067 C CB   . CYS A 1 670 ? 32.513  69.468  56.472  1.00 44.11  ? 736  CYS A CB   1 
ATOM   10068 S SG   . CYS A 1 670 ? 34.082  68.749  55.954  1.00 64.89  ? 736  CYS A SG   1 
ATOM   10069 H H    . CYS A 1 670 ? 30.777  71.054  57.124  1.00 47.01  ? 736  CYS A H    1 
ATOM   10070 H HA   . CYS A 1 670 ? 33.144  71.375  56.106  1.00 60.10  ? 736  CYS A HA   1 
ATOM   10071 H HB2  . CYS A 1 670 ? 32.497  69.492  57.442  1.00 52.93  ? 736  CYS A HB2  1 
ATOM   10072 H HB3  . CYS A 1 670 ? 31.797  68.903  56.140  1.00 52.93  ? 736  CYS A HB3  1 
ATOM   10073 H HG   . CYS A 1 670 ? 34.172  67.641  56.406  1.00 77.86  ? 736  CYS A HG   1 
ATOM   10074 N N    . THR A 1 671 ? 30.935  70.413  53.981  1.00 52.73  ? 737  THR A N    1 
ATOM   10075 C CA   . THR A 1 671 ? 30.683  70.330  52.541  1.00 57.39  ? 737  THR A CA   1 
ATOM   10076 C C    . THR A 1 671 ? 30.702  71.725  51.896  1.00 46.32  ? 737  THR A C    1 
ATOM   10077 O O    . THR A 1 671 ? 31.000  71.867  50.713  1.00 33.73  ? 737  THR A O    1 
ATOM   10078 C CB   . THR A 1 671 ? 29.380  69.521  52.191  1.00 50.98  ? 737  THR A CB   1 
ATOM   10079 O OG1  . THR A 1 671 ? 28.774  70.064  51.013  1.00 65.64  ? 737  THR A OG1  1 
ATOM   10080 C CG2  . THR A 1 671 ? 28.358  69.541  53.302  1.00 43.24  ? 737  THR A CG2  1 
ATOM   10081 H H    . THR A 1 671 ? 30.284  70.154  54.479  1.00 63.28  ? 737  THR A H    1 
ATOM   10082 H HA   . THR A 1 671 ? 31.421  69.839  52.148  1.00 68.86  ? 737  THR A HA   1 
ATOM   10083 H HB   . THR A 1 671 ? 29.620  68.597  52.023  1.00 61.18  ? 737  THR A HB   1 
ATOM   10084 H HG1  . THR A 1 671 ? 28.078  69.633  50.824  1.00 78.77  ? 737  THR A HG1  1 
ATOM   10085 H HG21 . THR A 1 671 ? 27.576  69.031  53.041  1.00 51.89  ? 737  THR A HG21 1 
ATOM   10086 H HG22 . THR A 1 671 ? 28.735  69.150  54.106  1.00 51.89  ? 737  THR A HG22 1 
ATOM   10087 H HG23 . THR A 1 671 ? 28.091  70.454  53.490  1.00 51.89  ? 737  THR A HG23 1 
ATOM   10088 N N    . HIS A 1 672 ? 30.432  72.750  52.694  1.00 39.81  ? 738  HIS A N    1 
ATOM   10089 C CA   . HIS A 1 672 ? 30.536  74.128  52.235  1.00 44.03  ? 738  HIS A CA   1 
ATOM   10090 C C    . HIS A 1 672 ? 31.979  74.436  51.844  1.00 52.27  ? 738  HIS A C    1 
ATOM   10091 O O    . HIS A 1 672 ? 32.228  74.991  50.777  1.00 57.52  ? 738  HIS A O    1 
ATOM   10092 C CB   . HIS A 1 672 ? 30.043  75.070  53.335  1.00 58.91  ? 738  HIS A CB   1 
ATOM   10093 C CG   . HIS A 1 672 ? 30.164  76.529  53.016  1.00 42.90  ? 738  HIS A CG   1 
ATOM   10094 N ND1  . HIS A 1 672 ? 29.729  77.080  51.833  1.00 42.55  ? 738  HIS A ND1  1 
ATOM   10095 C CD2  . HIS A 1 672 ? 30.632  77.561  53.755  1.00 45.08  ? 738  HIS A CD2  1 
ATOM   10096 C CE1  . HIS A 1 672 ? 29.944  78.384  51.848  1.00 53.00  ? 738  HIS A CE1  1 
ATOM   10097 N NE2  . HIS A 1 672 ? 30.493  78.702  53.005  1.00 38.67  ? 738  HIS A NE2  1 
ATOM   10098 H H    . HIS A 1 672 ? 30.184  72.673  53.514  1.00 47.77  ? 738  HIS A H    1 
ATOM   10099 H HA   . HIS A 1 672 ? 29.975  74.251  51.453  1.00 52.84  ? 738  HIS A HA   1 
ATOM   10100 H HB2  . HIS A 1 672 ? 29.106  74.883  53.505  1.00 70.69  ? 738  HIS A HB2  1 
ATOM   10101 H HB3  . HIS A 1 672 ? 30.559  74.902  54.139  1.00 70.69  ? 738  HIS A HB3  1 
ATOM   10102 H HD1  . HIS A 1 672 ? 29.378  76.642  51.181  1.00 51.06  ? 738  HIS A HD1  1 
ATOM   10103 H HD2  . HIS A 1 672 ? 30.993  77.506  54.611  1.00 54.09  ? 738  HIS A HD2  1 
ATOM   10104 H HE1  . HIS A 1 672 ? 29.744  78.976  51.159  1.00 63.60  ? 738  HIS A HE1  1 
ATOM   10105 H HE2  . HIS A 1 672 ? 30.726  79.493  53.248  1.00 46.40  ? 738  HIS A HE2  1 
ATOM   10106 N N    . TYR A 1 673 ? 32.929  74.048  52.693  1.00 45.35  ? 739  TYR A N    1 
ATOM   10107 C CA   . TYR A 1 673 ? 34.358  74.253  52.406  1.00 45.32  ? 739  TYR A CA   1 
ATOM   10108 C C    . TYR A 1 673 ? 34.878  73.380  51.249  1.00 53.53  ? 739  TYR A C    1 
ATOM   10109 O O    . TYR A 1 673 ? 35.735  73.814  50.477  1.00 44.41  ? 739  TYR A O    1 
ATOM   10110 C CB   . TYR A 1 673 ? 35.207  73.980  53.656  1.00 52.80  ? 739  TYR A CB   1 
ATOM   10111 C CG   . TYR A 1 673 ? 34.770  74.744  54.885  1.00 44.15  ? 739  TYR A CG   1 
ATOM   10112 C CD1  . TYR A 1 673 ? 34.482  76.101  54.821  1.00 36.67  ? 739  TYR A CD1  1 
ATOM   10113 C CD2  . TYR A 1 673 ? 34.633  74.100  56.105  1.00 36.37  ? 739  TYR A CD2  1 
ATOM   10114 C CE1  . TYR A 1 673 ? 34.072  76.788  55.939  1.00 49.04  ? 739  TYR A CE1  1 
ATOM   10115 C CE2  . TYR A 1 673 ? 34.221  74.779  57.225  1.00 31.54  ? 739  TYR A CE2  1 
ATOM   10116 C CZ   . TYR A 1 673 ? 33.941  76.119  57.142  1.00 43.91  ? 739  TYR A CZ   1 
ATOM   10117 O OH   . TYR A 1 673 ? 33.520  76.793  58.265  1.00 46.15  ? 739  TYR A OH   1 
ATOM   10118 H H    . TYR A 1 673 ? 32.777  73.662  53.446  1.00 54.42  ? 739  TYR A H    1 
ATOM   10119 H HA   . TYR A 1 673 ? 34.492  75.181  52.157  1.00 54.38  ? 739  TYR A HA   1 
ATOM   10120 H HB2  . TYR A 1 673 ? 35.158  73.033  53.864  1.00 63.36  ? 739  TYR A HB2  1 
ATOM   10121 H HB3  . TYR A 1 673 ? 36.126  74.226  53.467  1.00 63.36  ? 739  TYR A HB3  1 
ATOM   10122 H HD1  . TYR A 1 673 ? 34.565  76.550  54.011  1.00 44.01  ? 739  TYR A HD1  1 
ATOM   10123 H HD2  . TYR A 1 673 ? 34.817  73.191  56.164  1.00 43.64  ? 739  TYR A HD2  1 
ATOM   10124 H HE1  . TYR A 1 673 ? 33.878  77.696  55.886  1.00 58.85  ? 739  TYR A HE1  1 
ATOM   10125 H HE2  . TYR A 1 673 ? 34.132  74.332  58.035  1.00 37.85  ? 739  TYR A HE2  1 
ATOM   10126 H HH   . TYR A 1 673 ? 33.377  77.600  58.079  1.00 55.38  ? 739  TYR A HH   1 
ATOM   10127 N N    . VAL A 1 674 ? 34.374  72.148  51.156  1.00 56.99  ? 740  VAL A N    1 
ATOM   10128 C CA   . VAL A 1 674 ? 34.651  71.257  50.029  1.00 49.06  ? 740  VAL A CA   1 
ATOM   10129 C C    . VAL A 1 674 ? 34.299  71.917  48.709  1.00 48.65  ? 740  VAL A C    1 
ATOM   10130 O O    . VAL A 1 674 ? 35.106  71.944  47.778  1.00 57.28  ? 740  VAL A O    1 
ATOM   10131 C CB   . VAL A 1 674 ? 33.807  69.983  50.114  1.00 54.04  ? 740  VAL A CB   1 
ATOM   10132 C CG1  . VAL A 1 674 ? 33.968  69.134  48.861  1.00 37.80  ? 740  VAL A CG1  1 
ATOM   10133 C CG2  . VAL A 1 674 ? 34.190  69.177  51.335  1.00 53.46  ? 740  VAL A CG2  1 
ATOM   10134 H H    . VAL A 1 674 ? 33.857  71.799  51.748  1.00 68.38  ? 740  VAL A H    1 
ATOM   10135 H HA   . VAL A 1 674 ? 35.590  71.014  50.020  1.00 58.87  ? 740  VAL A HA   1 
ATOM   10136 H HB   . VAL A 1 674 ? 32.871  70.227  50.196  1.00 64.84  ? 740  VAL A HB   1 
ATOM   10137 H HG11 . VAL A 1 674 ? 33.421  68.337  48.947  1.00 45.36  ? 740  VAL A HG11 1 
ATOM   10138 H HG12 . VAL A 1 674 ? 33.681  69.650  48.091  1.00 45.36  ? 740  VAL A HG12 1 
ATOM   10139 H HG13 . VAL A 1 674 ? 34.901  68.887  48.765  1.00 45.36  ? 740  VAL A HG13 1 
ATOM   10140 H HG21 . VAL A 1 674 ? 33.643  68.376  51.368  1.00 64.15  ? 740  VAL A HG21 1 
ATOM   10141 H HG22 . VAL A 1 674 ? 35.127  68.936  51.271  1.00 64.15  ? 740  VAL A HG22 1 
ATOM   10142 H HG23 . VAL A 1 674 ? 34.039  69.715  52.128  1.00 64.15  ? 740  VAL A HG23 1 
ATOM   10143 N N    . ILE A 1 675 ? 33.077  72.429  48.626  1.00 42.01  ? 741  ILE A N    1 
ATOM   10144 C CA   . ILE A 1 675 ? 32.639  73.132  47.431  1.00 54.80  ? 741  ILE A CA   1 
ATOM   10145 C C    . ILE A 1 675 ? 33.551  74.322  47.183  1.00 52.42  ? 741  ILE A C    1 
ATOM   10146 O O    . ILE A 1 675 ? 34.111  74.468  46.098  1.00 62.02  ? 741  ILE A O    1 
ATOM   10147 C CB   . ILE A 1 675 ? 31.158  73.583  47.529  1.00 30.00  ? 741  ILE A CB   1 
ATOM   10148 C CG1  . ILE A 1 675 ? 30.244  72.362  47.408  1.00 28.89  ? 741  ILE A CG1  1 
ATOM   10149 C CG2  . ILE A 1 675 ? 30.815  74.584  46.442  1.00 28.77  ? 741  ILE A CG2  1 
ATOM   10150 C CD1  . ILE A 1 675 ? 28.795  72.625  47.719  1.00 40.99  ? 741  ILE A CD1  1 
ATOM   10151 H H    . ILE A 1 675 ? 32.484  72.383  49.247  1.00 50.42  ? 741  ILE A H    1 
ATOM   10152 H HA   . ILE A 1 675 ? 32.717  72.535  46.670  1.00 65.76  ? 741  ILE A HA   1 
ATOM   10153 H HB   . ILE A 1 675 ? 31.013  73.998  48.394  1.00 36.00  ? 741  ILE A HB   1 
ATOM   10154 H HG12 . ILE A 1 675 ? 30.293  72.028  46.499  1.00 34.66  ? 741  ILE A HG12 1 
ATOM   10155 H HG13 . ILE A 1 675 ? 30.557  71.680  48.023  1.00 34.66  ? 741  ILE A HG13 1 
ATOM   10156 H HG21 . ILE A 1 675 ? 29.885  74.843  46.534  1.00 34.52  ? 741  ILE A HG21 1 
ATOM   10157 H HG22 . ILE A 1 675 ? 31.387  75.362  46.539  1.00 34.52  ? 741  ILE A HG22 1 
ATOM   10158 H HG23 . ILE A 1 675 ? 30.961  74.172  45.576  1.00 34.52  ? 741  ILE A HG23 1 
ATOM   10159 H HD11 . ILE A 1 675 ? 28.296  71.800  47.617  1.00 49.19  ? 741  ILE A HD11 1 
ATOM   10160 H HD12 . ILE A 1 675 ? 28.721  72.946  48.631  1.00 49.19  ? 741  ILE A HD12 1 
ATOM   10161 H HD13 . ILE A 1 675 ? 28.457  73.295  47.104  1.00 49.19  ? 741  ILE A HD13 1 
ATOM   10162 N N    . LEU A 1 676 ? 33.717  75.156  48.202  1.00 54.86  ? 742  LEU A N    1 
ATOM   10163 C CA   . LEU A 1 676 ? 34.488  76.385  48.069  1.00 49.55  ? 742  LEU A CA   1 
ATOM   10164 C C    . LEU A 1 676 ? 35.948  76.169  47.656  1.00 52.95  ? 742  LEU A C    1 
ATOM   10165 O O    . LEU A 1 676 ? 36.518  76.990  46.938  1.00 53.00  ? 742  LEU A O    1 
ATOM   10166 C CB   . LEU A 1 676 ? 34.453  77.158  49.380  1.00 46.31  ? 742  LEU A CB   1 
ATOM   10167 C CG   . LEU A 1 676 ? 33.173  77.886  49.762  1.00 40.79  ? 742  LEU A CG   1 
ATOM   10168 C CD1  . LEU A 1 676 ? 33.501  78.896  50.847  1.00 28.56  ? 742  LEU A CD1  1 
ATOM   10169 C CD2  . LEU A 1 676 ? 32.499  78.566  48.577  1.00 41.42  ? 742  LEU A CD2  1 
ATOM   10170 H H    . LEU A 1 676 ? 33.389  75.031  48.987  1.00 65.83  ? 742  LEU A H    1 
ATOM   10171 H HA   . LEU A 1 676 ? 34.071  76.939  47.391  1.00 59.46  ? 742  LEU A HA   1 
ATOM   10172 H HB2  . LEU A 1 676 ? 34.644  76.533  50.096  1.00 55.57  ? 742  LEU A HB2  1 
ATOM   10173 H HB3  . LEU A 1 676 ? 35.156  77.825  49.348  1.00 55.57  ? 742  LEU A HB3  1 
ATOM   10174 H HG   . LEU A 1 676 ? 32.546  77.244  50.132  1.00 48.95  ? 742  LEU A HG   1 
ATOM   10175 H HD11 . LEU A 1 676 ? 32.689  79.365  51.097  1.00 34.27  ? 742  LEU A HD11 1 
ATOM   10176 H HD12 . LEU A 1 676 ? 33.862  78.426  51.616  1.00 34.27  ? 742  LEU A HD12 1 
ATOM   10177 H HD13 . LEU A 1 676 ? 34.155  79.525  50.506  1.00 34.27  ? 742  LEU A HD13 1 
ATOM   10178 H HD21 . LEU A 1 676 ? 31.693  79.010  48.884  1.00 49.70  ? 742  LEU A HD21 1 
ATOM   10179 H HD22 . LEU A 1 676 ? 33.110  79.215  48.197  1.00 49.70  ? 742  LEU A HD22 1 
ATOM   10180 H HD23 . LEU A 1 676 ? 32.275  77.894  47.914  1.00 49.70  ? 742  LEU A HD23 1 
ATOM   10181 N N    . TRP A 1 677 ? 36.568  75.087  48.106  1.00 28.64  ? 743  TRP A N    1 
ATOM   10182 C CA   . TRP A 1 677 ? 37.971  74.880  47.767  1.00 63.12  ? 743  TRP A CA   1 
ATOM   10183 C C    . TRP A 1 677 ? 38.100  74.445  46.318  1.00 60.35  ? 743  TRP A C    1 
ATOM   10184 O O    . TRP A 1 677 ? 39.059  74.792  45.640  1.00 72.79  ? 743  TRP A O    1 
ATOM   10185 C CB   . TRP A 1 677 ? 38.636  73.871  48.701  1.00 53.84  ? 743  TRP A CB   1 
ATOM   10186 C CG   . TRP A 1 677 ? 39.185  74.491  49.951  1.00 55.27  ? 743  TRP A CG   1 
ATOM   10187 C CD1  . TRP A 1 677 ? 38.736  74.304  51.230  1.00 49.48  ? 743  TRP A CD1  1 
ATOM   10188 C CD2  . TRP A 1 677 ? 40.280  75.408  50.041  1.00 56.07  ? 743  TRP A CD2  1 
ATOM   10189 N NE1  . TRP A 1 677 ? 39.491  75.043  52.110  1.00 54.90  ? 743  TRP A NE1  1 
ATOM   10190 C CE2  . TRP A 1 677 ? 40.448  75.727  51.404  1.00 59.93  ? 743  TRP A CE2  1 
ATOM   10191 C CE3  . TRP A 1 677 ? 41.146  75.981  49.103  1.00 57.51  ? 743  TRP A CE3  1 
ATOM   10192 C CZ2  . TRP A 1 677 ? 41.448  76.594  51.852  1.00 68.33  ? 743  TRP A CZ2  1 
ATOM   10193 C CZ3  . TRP A 1 677 ? 42.143  76.843  49.551  1.00 59.46  ? 743  TRP A CZ3  1 
ATOM   10194 C CH2  . TRP A 1 677 ? 42.284  77.139  50.910  1.00 60.83  ? 743  TRP A CH2  1 
ATOM   10195 H H    . TRP A 1 677 ? 36.214  74.474  48.594  1.00 34.37  ? 743  TRP A H    1 
ATOM   10196 H HA   . TRP A 1 677 ? 38.441  75.723  47.863  1.00 75.74  ? 743  TRP A HA   1 
ATOM   10197 H HB2  . TRP A 1 677 ? 37.980  73.205  48.961  1.00 64.61  ? 743  TRP A HB2  1 
ATOM   10198 H HB3  . TRP A 1 677 ? 39.370  73.445  48.231  1.00 64.61  ? 743  TRP A HB3  1 
ATOM   10199 H HD1  . TRP A 1 677 ? 38.022  73.759  51.470  1.00 59.38  ? 743  TRP A HD1  1 
ATOM   10200 H HE1  . TRP A 1 677 ? 39.382  75.070  52.962  1.00 65.88  ? 743  TRP A HE1  1 
ATOM   10201 H HE3  . TRP A 1 677 ? 41.064  75.781  48.198  1.00 69.02  ? 743  TRP A HE3  1 
ATOM   10202 H HZ2  . TRP A 1 677 ? 41.542  76.796  52.755  1.00 82.00  ? 743  TRP A HZ2  1 
ATOM   10203 H HZ3  . TRP A 1 677 ? 42.723  77.231  48.936  1.00 71.35  ? 743  TRP A HZ3  1 
ATOM   10204 H HH2  . TRP A 1 677 ? 42.953  77.726  51.181  1.00 73.00  ? 743  TRP A HH2  1 
ATOM   10205 N N    . GLN A 1 678 ? 37.123  73.689  45.843  1.00 57.63  ? 744  GLN A N    1 
ATOM   10206 C CA   . GLN A 1 678 ? 37.094  73.295  44.444  1.00 64.27  ? 744  GLN A CA   1 
ATOM   10207 C C    . GLN A 1 678 ? 36.960  74.516  43.542  1.00 59.71  ? 744  GLN A C    1 
ATOM   10208 O O    . GLN A 1 678 ? 37.636  74.628  42.520  1.00 68.91  ? 744  GLN A O    1 
ATOM   10209 C CB   . GLN A 1 678 ? 35.945  72.326  44.198  1.00 67.85  ? 744  GLN A CB   1 
ATOM   10210 C CG   . GLN A 1 678 ? 36.310  70.885  44.457  1.00 67.12  ? 744  GLN A CG   1 
ATOM   10211 C CD   . GLN A 1 678 ? 35.231  69.935  44.009  1.00 81.32  ? 744  GLN A CD   1 
ATOM   10212 O OE1  . GLN A 1 678 ? 34.990  69.768  42.808  1.00 96.08  ? 744  GLN A OE1  1 
ATOM   10213 N NE2  . GLN A 1 678 ? 34.565  69.306  44.970  1.00 80.05  ? 744  GLN A NE2  1 
ATOM   10214 H H    . GLN A 1 678 ? 36.464  73.390  46.309  1.00 69.16  ? 744  GLN A H    1 
ATOM   10215 H HA   . GLN A 1 678 ? 37.924  72.844  44.223  1.00 77.12  ? 744  GLN A HA   1 
ATOM   10216 H HB2  . GLN A 1 678 ? 35.209  72.556  44.786  1.00 81.42  ? 744  GLN A HB2  1 
ATOM   10217 H HB3  . GLN A 1 678 ? 35.665  72.400  43.273  1.00 81.42  ? 744  GLN A HB3  1 
ATOM   10218 H HG2  . GLN A 1 678 ? 37.122  70.670  43.971  1.00 80.54  ? 744  GLN A HG2  1 
ATOM   10219 H HG3  . GLN A 1 678 ? 36.448  70.758  45.409  1.00 80.54  ? 744  GLN A HG3  1 
ATOM   10220 H HE21 . GLN A 1 678 ? 34.760  69.451  45.795  1.00 96.05  ? 744  GLN A HE21 1 
ATOM   10221 H HE22 . GLN A 1 678 ? 33.938  68.752  44.768  1.00 96.05  ? 744  GLN A HE22 1 
ATOM   10222 N N    . LEU A 1 679 ? 36.088  75.434  43.934  1.00 61.26  ? 745  LEU A N    1 
ATOM   10223 C CA   . LEU A 1 679 ? 35.913  76.691  43.214  1.00 68.55  ? 745  LEU A CA   1 
ATOM   10224 C C    . LEU A 1 679 ? 37.209  77.519  43.150  1.00 65.22  ? 745  LEU A C    1 
ATOM   10225 O O    . LEU A 1 679 ? 37.333  78.431  42.327  1.00 54.41  ? 745  LEU A O    1 
ATOM   10226 C CB   . LEU A 1 679 ? 34.802  77.516  43.871  1.00 45.54  ? 745  LEU A CB   1 
ATOM   10227 C CG   . LEU A 1 679 ? 34.516  78.871  43.229  1.00 44.79  ? 745  LEU A CG   1 
ATOM   10228 C CD1  . LEU A 1 679 ? 34.152  78.708  41.762  1.00 47.16  ? 745  LEU A CD1  1 
ATOM   10229 C CD2  . LEU A 1 679 ? 33.409  79.584  43.967  1.00 58.91  ? 745  LEU A CD2  1 
ATOM   10230 H H    . LEU A 1 679 ? 35.578  75.354  44.621  1.00 73.51  ? 745  LEU A H    1 
ATOM   10231 H HA   . LEU A 1 679 ? 35.641  76.496  42.304  1.00 82.26  ? 745  LEU A HA   1 
ATOM   10232 H HB2  . LEU A 1 679 ? 33.981  77.001  43.841  1.00 54.65  ? 745  LEU A HB2  1 
ATOM   10233 H HB3  . LEU A 1 679 ? 35.048  77.679  44.795  1.00 54.65  ? 745  LEU A HB3  1 
ATOM   10234 H HG   . LEU A 1 679 ? 35.314  79.421  43.280  1.00 53.74  ? 745  LEU A HG   1 
ATOM   10235 H HD11 . LEU A 1 679 ? 33.976  79.583  41.382  1.00 56.60  ? 745  LEU A HD11 1 
ATOM   10236 H HD12 . LEU A 1 679 ? 34.893  78.288  41.298  1.00 56.60  ? 745  LEU A HD12 1 
ATOM   10237 H HD13 . LEU A 1 679 ? 33.360  78.151  41.694  1.00 56.60  ? 745  LEU A HD13 1 
ATOM   10238 H HD21 . LEU A 1 679 ? 33.246  80.440  43.540  1.00 70.69  ? 745  LEU A HD21 1 
ATOM   10239 H HD22 . LEU A 1 679 ? 32.607  79.039  43.934  1.00 70.69  ? 745  LEU A HD22 1 
ATOM   10240 H HD23 . LEU A 1 679 ? 33.680  79.719  44.888  1.00 70.69  ? 745  LEU A HD23 1 
ATOM   10241 N N    . ALA A 1 680 ? 38.164  77.210  44.021  1.00 59.04  ? 746  ALA A N    1 
ATOM   10242 C CA   . ALA A 1 680 ? 39.430  77.929  44.027  1.00 51.46  ? 746  ALA A CA   1 
ATOM   10243 C C    . ALA A 1 680 ? 40.367  77.446  42.911  1.00 61.43  ? 746  ALA A C    1 
ATOM   10244 O O    . ALA A 1 680 ? 41.010  78.265  42.252  1.00 71.98  ? 746  ALA A O    1 
ATOM   10245 C CB   . ALA A 1 680 ? 40.101  77.808  45.378  1.00 67.51  ? 746  ALA A CB   1 
ATOM   10246 H H    . ALA A 1 680 ? 38.104  76.591  44.615  1.00 70.84  ? 746  ALA A H    1 
ATOM   10247 H HA   . ALA A 1 680 ? 39.251  78.870  43.872  1.00 61.75  ? 746  ALA A HA   1 
ATOM   10248 H HB1  . ALA A 1 680 ? 40.940  78.294  45.357  1.00 81.01  ? 746  ALA A HB1  1 
ATOM   10249 H HB2  . ALA A 1 680 ? 39.517  78.184  46.055  1.00 81.01  ? 746  ALA A HB2  1 
ATOM   10250 H HB3  . ALA A 1 680 ? 40.266  76.871  45.566  1.00 81.01  ? 746  ALA A HB3  1 
ATOM   10251 N N    . LYS A 1 681 ? 40.439  76.129  42.686  1.00 58.02  ? 747  LYS A N    1 
ATOM   10252 C CA   . LYS A 1 681 ? 41.339  75.577  41.660  1.00 76.59  ? 747  LYS A CA   1 
ATOM   10253 C C    . LYS A 1 681 ? 40.715  75.557  40.251  1.00 85.56  ? 747  LYS A C    1 
ATOM   10254 O O    . LYS A 1 681 ? 40.629  74.508  39.603  1.00 94.54  ? 747  LYS A O    1 
ATOM   10255 C CB   . LYS A 1 681 ? 41.878  74.185  42.063  1.00 73.99  ? 747  LYS A CB   1 
ATOM   10256 C CG   . LYS A 1 681 ? 40.878  73.027  42.138  1.00 76.61  ? 747  LYS A CG   1 
ATOM   10257 C CD   . LYS A 1 681 ? 41.635  71.714  42.369  1.00 84.84  ? 747  LYS A CD   1 
ATOM   10258 C CE   . LYS A 1 681 ? 40.915  70.776  43.336  1.00 96.21  ? 747  LYS A CE   1 
ATOM   10259 N NZ   . LYS A 1 681 ? 39.925  69.851  42.699  1.00 97.99  ? 747  LYS A NZ   1 
ATOM   10260 H H    . LYS A 1 681 ? 39.981  75.537  43.110  1.00 69.62  ? 747  LYS A H    1 
ATOM   10261 H HA   . LYS A 1 681 ? 42.110  76.163  41.608  1.00 91.91  ? 747  LYS A HA   1 
ATOM   10262 H HB2  . LYS A 1 681 ? 42.558  73.931  41.420  1.00 88.79  ? 747  LYS A HB2  1 
ATOM   10263 H HB3  . LYS A 1 681 ? 42.285  74.265  42.940  1.00 88.79  ? 747  LYS A HB3  1 
ATOM   10264 H HG2  . LYS A 1 681 ? 40.269  73.168  42.879  1.00 91.93  ? 747  LYS A HG2  1 
ATOM   10265 H HG3  . LYS A 1 681 ? 40.391  72.961  41.302  1.00 91.93  ? 747  LYS A HG3  1 
ATOM   10266 H HD2  . LYS A 1 681 ? 41.733  71.253  41.521  1.00 101.81 ? 747  LYS A HD2  1 
ATOM   10267 H HD3  . LYS A 1 681 ? 42.508  71.915  42.740  1.00 101.81 ? 747  LYS A HD3  1 
ATOM   10268 H HE2  . LYS A 1 681 ? 41.577  70.230  43.787  1.00 115.46 ? 747  LYS A HE2  1 
ATOM   10269 H HE3  . LYS A 1 681 ? 40.437  71.312  43.988  1.00 115.46 ? 747  LYS A HE3  1 
ATOM   10270 H HZ1  . LYS A 1 681 ? 39.546  69.337  43.319  1.00 117.59 ? 747  LYS A HZ1  1 
ATOM   10271 H HZ2  . LYS A 1 681 ? 39.291  70.321  42.286  1.00 117.59 ? 747  LYS A HZ2  1 
ATOM   10272 H HZ3  . LYS A 1 681 ? 40.334  69.332  42.103  1.00 117.59 ? 747  LYS A HZ3  1 
ATOM   10273 N N    . ILE A 1 682 ? 40.335  76.739  39.767  1.00 75.81  ? 748  ILE A N    1 
ATOM   10274 C CA   . ILE A 1 682 ? 39.656  76.880  38.481  1.00 75.01  ? 748  ILE A CA   1 
ATOM   10275 C C    . ILE A 1 682 ? 40.094  78.162  37.762  1.00 77.78  ? 748  ILE A C    1 
ATOM   10276 O O    . ILE A 1 682 ? 40.390  79.180  38.393  1.00 68.25  ? 748  ILE A O    1 
ATOM   10277 C CB   . ILE A 1 682 ? 38.110  76.843  38.675  1.00 72.75  ? 748  ILE A CB   1 
ATOM   10278 C CG1  . ILE A 1 682 ? 37.648  75.386  38.810  1.00 64.28  ? 748  ILE A CG1  1 
ATOM   10279 C CG2  . ILE A 1 682 ? 37.369  77.558  37.531  1.00 70.91  ? 748  ILE A CG2  1 
ATOM   10280 C CD1  . ILE A 1 682 ? 36.157  75.191  39.001  1.00 66.34  ? 748  ILE A CD1  1 
ATOM   10281 H H    . ILE A 1 682 ? 40.461  77.487  40.173  1.00 90.97  ? 748  ILE A H    1 
ATOM   10282 H HA   . ILE A 1 682 ? 39.900  76.129  37.917  1.00 90.02  ? 748  ILE A HA   1 
ATOM   10283 H HB   . ILE A 1 682 ? 37.900  77.303  39.503  1.00 87.30  ? 748  ILE A HB   1 
ATOM   10284 H HG12 . ILE A 1 682 ? 37.903  74.907  38.006  1.00 77.14  ? 748  ILE A HG12 1 
ATOM   10285 H HG13 . ILE A 1 682 ? 38.094  74.992  39.576  1.00 77.14  ? 748  ILE A HG13 1 
ATOM   10286 H HG21 . ILE A 1 682 ? 36.415  77.509  37.695  1.00 85.09  ? 748  ILE A HG21 1 
ATOM   10287 H HG22 . ILE A 1 682 ? 37.654  78.485  37.502  1.00 85.09  ? 748  ILE A HG22 1 
ATOM   10288 H HG23 . ILE A 1 682 ? 37.585  77.119  36.693  1.00 85.09  ? 748  ILE A HG23 1 
ATOM   10289 H HD11 . ILE A 1 682 ? 35.969  74.242  39.075  1.00 79.61  ? 748  ILE A HD11 1 
ATOM   10290 H HD12 . ILE A 1 682 ? 35.881  75.648  39.811  1.00 79.61  ? 748  ILE A HD12 1 
ATOM   10291 H HD13 . ILE A 1 682 ? 35.690  75.563  38.236  1.00 79.61  ? 748  ILE A HD13 1 
ATOM   10292 N N    . SER A 1 686 ? 44.419  72.746  34.932  1.00 98.85  ? 752  SER A N    1 
ATOM   10293 C CA   . SER A 1 686 ? 44.660  74.190  34.905  1.00 110.66 ? 752  SER A CA   1 
ATOM   10294 C C    . SER A 1 686 ? 43.784  74.934  33.875  1.00 120.18 ? 752  SER A C    1 
ATOM   10295 O O    . SER A 1 686 ? 44.318  75.619  32.997  1.00 112.89 ? 752  SER A O    1 
ATOM   10296 C CB   . SER A 1 686 ? 46.147  74.439  34.609  1.00 104.85 ? 752  SER A CB   1 
ATOM   10297 O OG   . SER A 1 686 ? 46.609  73.552  33.603  1.00 94.56  ? 752  SER A OG   1 
ATOM   10298 H HA   . SER A 1 686 ? 44.465  74.557  35.782  1.00 132.79 ? 752  SER A HA   1 
ATOM   10299 H HB2  . SER A 1 686 ? 46.260  75.353  34.302  1.00 125.82 ? 752  SER A HB2  1 
ATOM   10300 H HB3  . SER A 1 686 ? 46.660  74.294  35.419  1.00 125.82 ? 752  SER A HB3  1 
ATOM   10301 H HG   . SER A 1 686 ? 46.515  72.757  33.855  1.00 113.47 ? 752  SER A HG   1 
ATOM   10302 N N    . SER A 1 687 ? 42.455  74.805  33.946  1.00 123.82 ? 753  SER A N    1 
ATOM   10303 C CA   . SER A 1 687 ? 41.740  73.958  34.902  1.00 116.56 ? 753  SER A CA   1 
ATOM   10304 C C    . SER A 1 687 ? 40.695  73.155  34.120  1.00 115.87 ? 753  SER A C    1 
ATOM   10305 O O    . SER A 1 687 ? 40.143  73.639  33.124  1.00 114.10 ? 753  SER A O    1 
ATOM   10306 C CB   . SER A 1 687 ? 41.097  74.809  36.005  1.00 113.09 ? 753  SER A CB   1 
ATOM   10307 O OG   . SER A 1 687 ? 39.821  75.301  35.630  1.00 111.10 ? 753  SER A OG   1 
ATOM   10308 H H    . SER A 1 687 ? 41.921  75.225  33.419  1.00 148.58 ? 753  SER A H    1 
ATOM   10309 H HA   . SER A 1 687 ? 42.362  73.338  35.314  1.00 139.87 ? 753  SER A HA   1 
ATOM   10310 H HB2  . SER A 1 687 ? 40.998  74.263  36.801  1.00 135.71 ? 753  SER A HB2  1 
ATOM   10311 H HB3  . SER A 1 687 ? 41.677  75.562  36.196  1.00 135.71 ? 753  SER A HB3  1 
ATOM   10312 H HG   . SER A 1 687 ? 39.303  74.661  35.466  1.00 133.32 ? 753  SER A HG   1 
ATOM   10313 N N    . THR A 1 688 ? 40.444  71.928  34.569  1.00 112.35 ? 754  THR A N    1 
ATOM   10314 C CA   . THR A 1 688 ? 39.583  70.976  33.857  1.00 116.37 ? 754  THR A CA   1 
ATOM   10315 C C    . THR A 1 688 ? 38.118  71.424  33.748  1.00 114.99 ? 754  THR A C    1 
ATOM   10316 O O    . THR A 1 688 ? 37.692  72.355  34.434  1.00 119.95 ? 754  THR A O    1 
ATOM   10317 C CB   . THR A 1 688 ? 39.628  69.605  34.553  1.00 117.89 ? 754  THR A CB   1 
ATOM   10318 O OG1  . THR A 1 688 ? 39.750  69.802  35.968  1.00 123.88 ? 754  THR A OG1  1 
ATOM   10319 C CG2  . THR A 1 688 ? 40.820  68.795  34.077  1.00 110.74 ? 754  THR A CG2  1 
ATOM   10320 H H    . THR A 1 688 ? 40.766  71.613  35.302  1.00 134.82 ? 754  THR A H    1 
ATOM   10321 H HA   . THR A 1 688 ? 39.925  70.862  32.956  1.00 139.64 ? 754  THR A HA   1 
ATOM   10322 H HB   . THR A 1 688 ? 38.816  69.111  34.359  1.00 141.47 ? 754  THR A HB   1 
ATOM   10323 H HG1  . THR A 1 688 ? 39.775  69.059  36.360  1.00 148.66 ? 754  THR A HG1  1 
ATOM   10324 H HG21 . THR A 1 688 ? 40.836  67.934  34.524  1.00 132.89 ? 754  THR A HG21 1 
ATOM   10325 H HG22 . THR A 1 688 ? 40.762  68.652  33.119  1.00 132.89 ? 754  THR A HG22 1 
ATOM   10326 H HG23 . THR A 1 688 ? 41.643  69.268  34.275  1.00 132.89 ? 754  THR A HG23 1 
ATOM   10327 N N    . LYS A 1 689 ? 37.359  70.752  32.883  1.00 105.36 ? 755  LYS A N    1 
ATOM   10328 C CA   . LYS A 1 689 ? 35.940  71.049  32.675  1.00 112.17 ? 755  LYS A CA   1 
ATOM   10329 C C    . LYS A 1 689 ? 35.050  69.906  33.154  1.00 118.82 ? 755  LYS A C    1 
ATOM   10330 O O    . LYS A 1 689 ? 33.818  69.989  33.088  1.00 107.47 ? 755  LYS A O    1 
ATOM   10331 C CB   . LYS A 1 689 ? 35.671  71.290  31.192  1.00 106.59 ? 755  LYS A CB   1 
ATOM   10332 C CG   . LYS A 1 689 ? 34.835  72.539  30.895  1.00 93.94  ? 755  LYS A CG   1 
ATOM   10333 C CD   . LYS A 1 689 ? 34.684  72.826  29.398  1.00 98.75  ? 755  LYS A CD   1 
ATOM   10334 C CE   . LYS A 1 689 ? 36.022  72.992  28.669  1.00 103.83 ? 755  LYS A CE   1 
ATOM   10335 N NZ   . LYS A 1 689 ? 35.931  72.650  27.219  1.00 101.51 ? 755  LYS A NZ   1 
ATOM   10336 H H    . LYS A 1 689 ? 37.649  70.107  32.393  1.00 126.43 ? 755  LYS A H    1 
ATOM   10337 H HA   . LYS A 1 689 ? 35.702  71.851  33.166  1.00 134.60 ? 755  LYS A HA   1 
ATOM   10338 H HB2  . LYS A 1 689 ? 36.520  71.389  30.735  1.00 127.91 ? 755  LYS A HB2  1 
ATOM   10339 H HB3  . LYS A 1 689 ? 35.194  70.525  30.835  1.00 127.91 ? 755  LYS A HB3  1 
ATOM   10340 H HG2  . LYS A 1 689 ? 33.947  72.419  31.267  1.00 112.73 ? 755  LYS A HG2  1 
ATOM   10341 H HG3  . LYS A 1 689 ? 35.263  73.308  31.304  1.00 112.73 ? 755  LYS A HG3  1 
ATOM   10342 H HD2  . LYS A 1 689 ? 34.209  72.089  28.984  1.00 118.50 ? 755  LYS A HD2  1 
ATOM   10343 H HD3  . LYS A 1 689 ? 34.180  73.647  29.286  1.00 118.50 ? 755  LYS A HD3  1 
ATOM   10344 H HE2  . LYS A 1 689 ? 36.311  73.915  28.742  1.00 124.60 ? 755  LYS A HE2  1 
ATOM   10345 H HE3  . LYS A 1 689 ? 36.679  72.405  29.075  1.00 124.60 ? 755  LYS A HE3  1 
ATOM   10346 H HZ1  . LYS A 1 689 ? 36.724  72.758  26.831  1.00 121.81 ? 755  LYS A HZ1  1 
ATOM   10347 H HZ2  . LYS A 1 689 ? 35.674  71.803  27.122  1.00 121.81 ? 755  LYS A HZ2  1 
ATOM   10348 H HZ3  . LYS A 1 689 ? 35.338  73.180  26.819  1.00 121.81 ? 755  LYS A HZ3  1 
ATOM   10349 N N    . GLU A 1 690 ? 35.687  68.832  33.612  1.00 128.83 ? 756  GLU A N    1 
ATOM   10350 C CA   . GLU A 1 690 ? 34.986  67.686  34.181  1.00 124.79 ? 756  GLU A CA   1 
ATOM   10351 C C    . GLU A 1 690 ? 35.011  67.817  35.699  1.00 120.49 ? 756  GLU A C    1 
ATOM   10352 O O    . GLU A 1 690 ? 34.213  67.194  36.399  1.00 118.96 ? 756  GLU A O    1 
ATOM   10353 C CB   . GLU A 1 690 ? 35.638  66.373  33.734  1.00 127.76 ? 756  GLU A CB   1 
ATOM   10354 C CG   . GLU A 1 690 ? 35.562  66.110  32.218  1.00 136.36 ? 756  GLU A CG   1 
ATOM   10355 C CD   . GLU A 1 690 ? 36.493  67.002  31.397  1.00 137.07 ? 756  GLU A CD   1 
ATOM   10356 O OE1  . GLU A 1 690 ? 36.727  66.679  30.210  1.00 128.75 ? 756  GLU A OE1  1 
ATOM   10357 O OE2  . GLU A 1 690 ? 37.014  68.002  31.942  1.00 139.88 ? 756  GLU A OE2  1 
ATOM   10358 H H    . GLU A 1 690 ? 36.542  68.743  33.603  1.00 154.60 ? 756  GLU A H    1 
ATOM   10359 H HA   . GLU A 1 690 ? 34.062  67.690  33.885  1.00 149.74 ? 756  GLU A HA   1 
ATOM   10360 H HB2  . GLU A 1 690 ? 36.575  66.391  33.983  1.00 153.31 ? 756  GLU A HB2  1 
ATOM   10361 H HB3  . GLU A 1 690 ? 35.194  65.637  34.183  1.00 153.31 ? 756  GLU A HB3  1 
ATOM   10362 H HG2  . GLU A 1 690 ? 35.807  65.187  32.048  1.00 163.64 ? 756  GLU A HG2  1 
ATOM   10363 H HG3  . GLU A 1 690 ? 34.654  66.271  31.917  1.00 163.64 ? 756  GLU A HG3  1 
ATOM   10364 N N    . ASP A 1 691 ? 35.949  68.623  36.198  1.00 120.42 ? 757  ASP A N    1 
ATOM   10365 C CA   . ASP A 1 691 ? 35.910  69.083  37.583  1.00 124.69 ? 757  ASP A CA   1 
ATOM   10366 C C    . ASP A 1 691 ? 34.924  70.255  37.679  1.00 124.84 ? 757  ASP A C    1 
ATOM   10367 O O    . ASP A 1 691 ? 34.273  70.447  38.711  1.00 127.66 ? 757  ASP A O    1 
ATOM   10368 C CB   . ASP A 1 691 ? 37.300  69.527  38.074  1.00 127.36 ? 757  ASP A CB   1 
ATOM   10369 C CG   . ASP A 1 691 ? 38.300  68.365  38.202  1.00 125.92 ? 757  ASP A CG   1 
ATOM   10370 O OD1  . ASP A 1 691 ? 37.877  67.208  38.424  1.00 124.17 ? 757  ASP A OD1  1 
ATOM   10371 O OD2  . ASP A 1 691 ? 39.524  68.618  38.090  1.00 119.50 ? 757  ASP A OD2  1 
ATOM   10372 H H    . ASP A 1 691 ? 36.621  68.918  35.750  1.00 144.51 ? 757  ASP A H    1 
ATOM   10373 H HA   . ASP A 1 691 ? 35.595  68.366  38.155  1.00 149.63 ? 757  ASP A HA   1 
ATOM   10374 H HB2  . ASP A 1 691 ? 37.666  70.168  37.445  1.00 152.83 ? 757  ASP A HB2  1 
ATOM   10375 H HB3  . ASP A 1 691 ? 37.208  69.939  38.948  1.00 152.83 ? 757  ASP A HB3  1 
ATOM   10376 N N    . LEU A 1 692 ? 34.810  71.024  36.594  1.00 114.18 ? 758  LEU A N    1 
ATOM   10377 C CA   . LEU A 1 692 ? 33.931  72.195  36.558  1.00 95.61  ? 758  LEU A CA   1 
ATOM   10378 C C    . LEU A 1 692 ? 32.464  71.808  36.462  1.00 88.52  ? 758  LEU A C    1 
ATOM   10379 O O    . LEU A 1 692 ? 31.610  72.434  37.086  1.00 92.51  ? 758  LEU A O    1 
ATOM   10380 C CB   . LEU A 1 692 ? 34.286  73.117  35.384  1.00 89.98  ? 758  LEU A CB   1 
ATOM   10381 C CG   . LEU A 1 692 ? 33.379  74.340  35.180  1.00 76.63  ? 758  LEU A CG   1 
ATOM   10382 C CD1  . LEU A 1 692 ? 33.205  75.121  36.464  1.00 92.68  ? 758  LEU A CD1  1 
ATOM   10383 C CD2  . LEU A 1 692 ? 33.926  75.272  34.118  1.00 69.80  ? 758  LEU A CD2  1 
ATOM   10384 H H    . LEU A 1 692 ? 35.237  70.888  35.859  1.00 137.02 ? 758  LEU A H    1 
ATOM   10385 H HA   . LEU A 1 692 ? 34.051  72.700  37.377  1.00 114.73 ? 758  LEU A HA   1 
ATOM   10386 H HB2  . LEU A 1 692 ? 35.188  73.446  35.519  1.00 107.97 ? 758  LEU A HB2  1 
ATOM   10387 H HB3  . LEU A 1 692 ? 34.253  72.594  34.568  1.00 107.97 ? 758  LEU A HB3  1 
ATOM   10388 H HG   . LEU A 1 692 ? 32.503  74.039  34.891  1.00 91.96  ? 758  LEU A HG   1 
ATOM   10389 H HD11 . LEU A 1 692 ? 32.629  75.883  36.294  1.00 111.22 ? 758  LEU A HD11 1 
ATOM   10390 H HD12 . LEU A 1 692 ? 32.803  74.544  37.132  1.00 111.22 ? 758  LEU A HD12 1 
ATOM   10391 H HD13 . LEU A 1 692 ? 34.074  75.425  36.768  1.00 111.22 ? 758  LEU A HD13 1 
ATOM   10392 H HD21 . LEU A 1 692 ? 33.325  76.027  34.022  1.00 83.76  ? 758  LEU A HD21 1 
ATOM   10393 H HD22 . LEU A 1 692 ? 34.804  75.580  34.391  1.00 83.76  ? 758  LEU A HD22 1 
ATOM   10394 H HD23 . LEU A 1 692 ? 33.990  74.790  33.279  1.00 83.76  ? 758  LEU A HD23 1 
ATOM   10395 N N    . LEU A 1 693 ? 32.158  70.793  35.666  1.00 96.56  ? 759  LEU A N    1 
ATOM   10396 C CA   . LEU A 1 693 ? 30.768  70.382  35.507  1.00 102.52 ? 759  LEU A CA   1 
ATOM   10397 C C    . LEU A 1 693 ? 30.336  69.544  36.694  1.00 90.00  ? 759  LEU A C    1 
ATOM   10398 O O    . LEU A 1 693 ? 29.152  69.476  37.015  1.00 84.18  ? 759  LEU A O    1 
ATOM   10399 C CB   . LEU A 1 693 ? 30.557  69.631  34.187  1.00 117.97 ? 759  LEU A CB   1 
ATOM   10400 C CG   . LEU A 1 693 ? 30.431  70.569  32.977  1.00 115.45 ? 759  LEU A CG   1 
ATOM   10401 C CD1  . LEU A 1 693 ? 30.611  69.827  31.659  1.00 109.71 ? 759  LEU A CD1  1 
ATOM   10402 C CD2  . LEU A 1 693 ? 29.089  71.298  32.990  1.00 101.38 ? 759  LEU A CD2  1 
ATOM   10403 H H    . LEU A 1 693 ? 32.725  70.331  35.213  1.00 115.87 ? 759  LEU A H    1 
ATOM   10404 H HA   . LEU A 1 693 ? 30.210  71.175  35.487  1.00 123.02 ? 759  LEU A HA   1 
ATOM   10405 H HB2  . LEU A 1 693 ? 31.315  69.045  34.034  1.00 141.57 ? 759  LEU A HB2  1 
ATOM   10406 H HB3  . LEU A 1 693 ? 29.742  69.109  34.248  1.00 141.57 ? 759  LEU A HB3  1 
ATOM   10407 H HG   . LEU A 1 693 ? 31.129  71.240  33.032  1.00 138.54 ? 759  LEU A HG   1 
ATOM   10408 H HD11 . LEU A 1 693 ? 30.523  70.458  30.927  1.00 131.66 ? 759  LEU A HD11 1 
ATOM   10409 H HD12 . LEU A 1 693 ? 31.493  69.423  31.643  1.00 131.66 ? 759  LEU A HD12 1 
ATOM   10410 H HD13 . LEU A 1 693 ? 29.930  69.140  31.588  1.00 131.66 ? 759  LEU A HD13 1 
ATOM   10411 H HD21 . LEU A 1 693 ? 29.039  71.881  32.216  1.00 121.66 ? 759  LEU A HD21 1 
ATOM   10412 H HD22 . LEU A 1 693 ? 28.374  70.644  32.959  1.00 121.66 ? 759  LEU A HD22 1 
ATOM   10413 H HD23 . LEU A 1 693 ? 29.023  71.822  33.804  1.00 121.66 ? 759  LEU A HD23 1 
ATOM   10414 N N    . ARG A 1 694 ? 31.307  68.926  37.357  1.00 88.40  ? 760  ARG A N    1 
ATOM   10415 C CA   . ARG A 1 694 ? 31.040  68.178  38.577  1.00 92.55  ? 760  ARG A CA   1 
ATOM   10416 C C    . ARG A 1 694 ? 30.822  69.123  39.752  1.00 96.64  ? 760  ARG A C    1 
ATOM   10417 O O    . ARG A 1 694 ? 29.989  68.860  40.622  1.00 92.38  ? 760  ARG A O    1 
ATOM   10418 C CB   . ARG A 1 694 ? 32.200  67.245  38.892  1.00 91.56  ? 760  ARG A CB   1 
ATOM   10419 C CG   . ARG A 1 694 ? 31.916  66.276  40.028  1.00 90.10  ? 760  ARG A CG   1 
ATOM   10420 C CD   . ARG A 1 694 ? 33.117  65.387  40.259  1.00 108.97 ? 760  ARG A CD   1 
ATOM   10421 N NE   . ARG A 1 694 ? 34.325  66.193  40.432  1.00 109.58 ? 760  ARG A NE   1 
ATOM   10422 C CZ   . ARG A 1 694 ? 34.929  66.438  41.592  1.00 99.87  ? 760  ARG A CZ   1 
ATOM   10423 N NH1  . ARG A 1 694 ? 34.491  65.904  42.732  1.00 81.96  ? 760  ARG A NH1  1 
ATOM   10424 N NH2  . ARG A 1 694 ? 36.016  67.196  41.599  1.00 109.54 ? 760  ARG A NH2  1 
ATOM   10425 H H    . ARG A 1 694 ? 32.134  68.925  37.118  1.00 106.08 ? 760  ARG A H    1 
ATOM   10426 H HA   . ARG A 1 694 ? 30.239  67.644  38.459  1.00 111.06 ? 760  ARG A HA   1 
ATOM   10427 H HB2  . ARG A 1 694 ? 32.405  66.723  38.100  1.00 109.87 ? 760  ARG A HB2  1 
ATOM   10428 H HB3  . ARG A 1 694 ? 32.970  67.778  39.142  1.00 109.87 ? 760  ARG A HB3  1 
ATOM   10429 H HG2  . ARG A 1 694 ? 31.738  66.772  40.842  1.00 108.12 ? 760  ARG A HG2  1 
ATOM   10430 H HG3  . ARG A 1 694 ? 31.158  65.717  39.796  1.00 108.12 ? 760  ARG A HG3  1 
ATOM   10431 H HD2  . ARG A 1 694 ? 32.981  64.862  41.063  1.00 130.77 ? 760  ARG A HD2  1 
ATOM   10432 H HD3  . ARG A 1 694 ? 33.242  64.806  39.492  1.00 130.77 ? 760  ARG A HD3  1 
ATOM   10433 H HE   . ARG A 1 694 ? 34.674  66.536  39.725  1.00 131.49 ? 760  ARG A HE   1 
ATOM   10434 H HH11 . ARG A 1 694 ? 33.787  65.411  42.734  1.00 98.35  ? 760  ARG A HH11 1 
ATOM   10435 H HH12 . ARG A 1 694 ? 34.902  66.070  43.470  1.00 98.35  ? 760  ARG A HH12 1 
ATOM   10436 H HH21 . ARG A 1 694 ? 36.309  67.535  40.865  1.00 131.45 ? 760  ARG A HH21 1 
ATOM   10437 H HH22 . ARG A 1 694 ? 36.426  67.353  42.339  1.00 131.45 ? 760  ARG A HH22 1 
ATOM   10438 N N    . LEU A 1 695 ? 31.585  70.214  39.785  1.00 98.51  ? 761  LEU A N    1 
ATOM   10439 C CA   . LEU A 1 695 ? 31.401  71.232  40.817  1.00 87.29  ? 761  LEU A CA   1 
ATOM   10440 C C    . LEU A 1 695 ? 29.964  71.726  40.802  1.00 76.77  ? 761  LEU A C    1 
ATOM   10441 O O    . LEU A 1 695 ? 29.308  71.780  41.850  1.00 58.97  ? 761  LEU A O    1 
ATOM   10442 C CB   . LEU A 1 695 ? 32.347  72.416  40.608  1.00 72.89  ? 761  LEU A CB   1 
ATOM   10443 C CG   . LEU A 1 695 ? 32.146  73.598  41.564  1.00 54.91  ? 761  LEU A CG   1 
ATOM   10444 C CD1  . LEU A 1 695 ? 32.714  73.268  42.922  1.00 61.06  ? 761  LEU A CD1  1 
ATOM   10445 C CD2  . LEU A 1 695 ? 32.771  74.853  41.017  1.00 61.71  ? 761  LEU A CD2  1 
ATOM   10446 H H    . LEU A 1 695 ? 32.213  70.388  39.224  1.00 118.21 ? 761  LEU A H    1 
ATOM   10447 H HA   . LEU A 1 695 ? 31.583  70.845  41.688  1.00 104.75 ? 761  LEU A HA   1 
ATOM   10448 H HB2  . LEU A 1 695 ? 33.259  72.104  40.719  1.00 87.47  ? 761  LEU A HB2  1 
ATOM   10449 H HB3  . LEU A 1 695 ? 32.227  72.750  39.705  1.00 87.47  ? 761  LEU A HB3  1 
ATOM   10450 H HG   . LEU A 1 695 ? 31.196  73.759  41.670  1.00 65.89  ? 761  LEU A HG   1 
ATOM   10451 H HD11 . LEU A 1 695 ? 32.579  74.026  43.513  1.00 73.27  ? 761  LEU A HD11 1 
ATOM   10452 H HD12 . LEU A 1 695 ? 32.258  72.488  43.274  1.00 73.27  ? 761  LEU A HD12 1 
ATOM   10453 H HD13 . LEU A 1 695 ? 33.662  73.085  42.831  1.00 73.27  ? 761  LEU A HD13 1 
ATOM   10454 H HD21 . LEU A 1 695 ? 32.626  75.578  41.645  1.00 74.06  ? 761  LEU A HD21 1 
ATOM   10455 H HD22 . LEU A 1 695 ? 33.722  74.706  40.896  1.00 74.06  ? 761  LEU A HD22 1 
ATOM   10456 H HD23 . LEU A 1 695 ? 32.358  75.066  40.165  1.00 74.06  ? 761  LEU A HD23 1 
ATOM   10457 N N    . LYS A 1 696 ? 29.489  72.098  39.613  1.00 75.48  ? 762  LYS A N    1 
ATOM   10458 C CA   . LYS A 1 696 ? 28.117  72.559  39.455  1.00 71.39  ? 762  LYS A CA   1 
ATOM   10459 C C    . LYS A 1 696 ? 27.160  71.534  40.033  1.00 61.03  ? 762  LYS A C    1 
ATOM   10460 O O    . LYS A 1 696 ? 26.238  71.906  40.721  1.00 54.53  ? 762  LYS A O    1 
ATOM   10461 C CB   . LYS A 1 696 ? 27.766  72.839  37.991  1.00 81.22  ? 762  LYS A CB   1 
ATOM   10462 C CG   . LYS A 1 696 ? 26.433  73.575  37.818  1.00 83.95  ? 762  LYS A CG   1 
ATOM   10463 C CD   . LYS A 1 696 ? 25.984  73.639  36.354  1.00 75.49  ? 762  LYS A CD   1 
ATOM   10464 C CE   . LYS A 1 696 ? 24.533  74.110  36.217  1.00 80.94  ? 762  LYS A CE   1 
ATOM   10465 N NZ   . LYS A 1 696 ? 24.299  75.480  36.768  1.00 91.41  ? 762  LYS A NZ   1 
ATOM   10466 H H    . LYS A 1 696 ? 29.945  72.092  38.883  1.00 90.57  ? 762  LYS A H    1 
ATOM   10467 H HA   . LYS A 1 696 ? 28.004  73.385  39.950  1.00 85.67  ? 762  LYS A HA   1 
ATOM   10468 H HB2  . LYS A 1 696 ? 28.463  73.388  37.600  1.00 97.46  ? 762  LYS A HB2  1 
ATOM   10469 H HB3  . LYS A 1 696 ? 27.704  71.995  37.516  1.00 97.46  ? 762  LYS A HB3  1 
ATOM   10470 H HG2  . LYS A 1 696 ? 25.747  73.111  38.323  1.00 100.74 ? 762  LYS A HG2  1 
ATOM   10471 H HG3  . LYS A 1 696 ? 26.529  74.484  38.143  1.00 100.74 ? 762  LYS A HG3  1 
ATOM   10472 H HD2  . LYS A 1 696 ? 26.551  74.263  35.874  1.00 90.59  ? 762  LYS A HD2  1 
ATOM   10473 H HD3  . LYS A 1 696 ? 26.053  72.755  35.961  1.00 90.59  ? 762  LYS A HD3  1 
ATOM   10474 H HE2  . LYS A 1 696 ? 24.294  74.122  35.277  1.00 97.13  ? 762  LYS A HE2  1 
ATOM   10475 H HE3  . LYS A 1 696 ? 23.956  73.494  36.695  1.00 97.13  ? 762  LYS A HE3  1 
ATOM   10476 H HZ1  . LYS A 1 696 ? 23.445  75.708  36.666  1.00 109.69 ? 762  LYS A HZ1  1 
ATOM   10477 H HZ2  . LYS A 1 696 ? 24.501  75.498  37.635  1.00 109.69 ? 762  LYS A HZ2  1 
ATOM   10478 H HZ3  . LYS A 1 696 ? 24.810  76.071  36.341  1.00 109.69 ? 762  LYS A HZ3  1 
ATOM   10479 N N    . LYS A 1 697 ? 27.386  70.247  39.782  1.00 65.85  ? 763  LYS A N    1 
ATOM   10480 C CA   . LYS A 1 697 ? 26.539  69.216  40.381  1.00 71.60  ? 763  LYS A CA   1 
ATOM   10481 C C    . LYS A 1 697 ? 26.478  69.395  41.900  1.00 75.09  ? 763  LYS A C    1 
ATOM   10482 O O    . LYS A 1 697 ? 25.414  69.688  42.439  1.00 70.95  ? 763  LYS A O    1 
ATOM   10483 C CB   . LYS A 1 697 ? 27.027  67.800  40.036  1.00 86.83  ? 763  LYS A CB   1 
ATOM   10484 C CG   . LYS A 1 697 ? 26.165  66.671  40.633  1.00 92.32  ? 763  LYS A CG   1 
ATOM   10485 C CD   . LYS A 1 697 ? 26.754  65.271  40.380  1.00 104.90 ? 763  LYS A CD   1 
ATOM   10486 C CE   . LYS A 1 697 ? 28.096  65.028  41.097  1.00 104.92 ? 763  LYS A CE   1 
ATOM   10487 N NZ   . LYS A 1 697 ? 27.959  64.766  42.565  1.00 97.33  ? 763  LYS A NZ   1 
ATOM   10488 H H    . LYS A 1 697 ? 28.014  69.946  39.276  1.00 79.01  ? 763  LYS A H    1 
ATOM   10489 H HA   . LYS A 1 697 ? 25.638  69.311  40.034  1.00 85.92  ? 763  LYS A HA   1 
ATOM   10490 H HB2  . LYS A 1 697 ? 27.024  67.696  39.071  1.00 104.20 ? 763  LYS A HB2  1 
ATOM   10491 H HB3  . LYS A 1 697 ? 27.930  67.692  40.373  1.00 104.20 ? 763  LYS A HB3  1 
ATOM   10492 H HG2  . LYS A 1 697 ? 26.097  66.799  41.592  1.00 110.78 ? 763  LYS A HG2  1 
ATOM   10493 H HG3  . LYS A 1 697 ? 25.283  66.701  40.231  1.00 110.78 ? 763  LYS A HG3  1 
ATOM   10494 H HD2  . LYS A 1 697 ? 26.124  64.605  40.695  1.00 125.88 ? 763  LYS A HD2  1 
ATOM   10495 H HD3  . LYS A 1 697 ? 26.902  65.161  39.428  1.00 125.88 ? 763  LYS A HD3  1 
ATOM   10496 H HE2  . LYS A 1 697 ? 28.528  64.257  40.698  1.00 125.90 ? 763  LYS A HE2  1 
ATOM   10497 H HE3  . LYS A 1 697 ? 28.656  65.812  40.987  1.00 125.90 ? 763  LYS A HE3  1 
ATOM   10498 H HZ1  . LYS A 1 697 ? 28.761  64.633  42.927  1.00 116.80 ? 763  LYS A HZ1  1 
ATOM   10499 H HZ2  . LYS A 1 697 ? 27.574  65.463  42.964  1.00 116.80 ? 763  LYS A HZ2  1 
ATOM   10500 H HZ3  . LYS A 1 697 ? 27.457  64.043  42.700  1.00 116.80 ? 763  LYS A HZ3  1 
ATOM   10501 N N    . GLN A 1 698 ? 27.623  69.243  42.572  1.00 73.52  ? 764  GLN A N    1 
ATOM   10502 C CA   . GLN A 1 698 ? 27.701  69.334  44.032  1.00 60.11  ? 764  GLN A CA   1 
ATOM   10503 C C    . GLN A 1 698 ? 27.058  70.614  44.546  1.00 59.43  ? 764  GLN A C    1 
ATOM   10504 O O    . GLN A 1 698 ? 26.247  70.584  45.464  1.00 60.14  ? 764  GLN A O    1 
ATOM   10505 C CB   . GLN A 1 698 ? 29.159  69.279  44.494  1.00 57.31  ? 764  GLN A CB   1 
ATOM   10506 C CG   . GLN A 1 698 ? 29.830  67.925  44.293  1.00 62.36  ? 764  GLN A CG   1 
ATOM   10507 C CD   . GLN A 1 698 ? 31.336  67.971  44.494  1.00 60.96  ? 764  GLN A CD   1 
ATOM   10508 O OE1  . GLN A 1 698 ? 31.957  69.018  44.352  1.00 66.60  ? 764  GLN A OE1  1 
ATOM   10509 N NE2  . GLN A 1 698 ? 31.926  66.830  44.830  1.00 67.40  ? 764  GLN A NE2  1 
ATOM   10510 H H    . GLN A 1 698 ? 28.381  69.083  42.197  1.00 88.23  ? 764  GLN A H    1 
ATOM   10511 H HA   . GLN A 1 698 ? 27.232  68.581  44.424  1.00 72.13  ? 764  GLN A HA   1 
ATOM   10512 H HB2  . GLN A 1 698 ? 29.668  69.937  43.995  1.00 68.77  ? 764  GLN A HB2  1 
ATOM   10513 H HB3  . GLN A 1 698 ? 29.194  69.488  45.440  1.00 68.77  ? 764  GLN A HB3  1 
ATOM   10514 H HG2  . GLN A 1 698 ? 29.463  67.294  44.931  1.00 74.84  ? 764  GLN A HG2  1 
ATOM   10515 H HG3  . GLN A 1 698 ? 29.658  67.619  43.389  1.00 74.84  ? 764  GLN A HG3  1 
ATOM   10516 H HE21 . GLN A 1 698 ? 31.458  66.115  44.924  1.00 80.88  ? 764  GLN A HE21 1 
ATOM   10517 H HE22 . GLN A 1 698 ? 32.777  66.806  44.955  1.00 80.88  ? 764  GLN A HE22 1 
ATOM   10518 N N    . MET A 1 699 ? 27.420  71.737  43.940  1.00 64.29  ? 765  MET A N    1 
ATOM   10519 C CA   . MET A 1 699 ? 26.855  73.030  44.311  1.00 60.03  ? 765  MET A CA   1 
ATOM   10520 C C    . MET A 1 699 ? 25.320  73.033  44.262  1.00 58.55  ? 765  MET A C    1 
ATOM   10521 O O    . MET A 1 699 ? 24.669  73.313  45.275  1.00 52.43  ? 765  MET A O    1 
ATOM   10522 C CB   . MET A 1 699 ? 27.420  74.121  43.399  1.00 53.68  ? 765  MET A CB   1 
ATOM   10523 C CG   . MET A 1 699 ? 27.276  75.509  43.968  1.00 40.02  ? 765  MET A CG   1 
ATOM   10524 S SD   . MET A 1 699 ? 25.593  76.107  43.820  1.00 66.19  ? 765  MET A SD   1 
ATOM   10525 C CE   . MET A 1 699 ? 25.749  76.862  42.202  1.00 92.57  ? 765  MET A CE   1 
ATOM   10526 H H    . MET A 1 699 ? 27.998  71.778  43.305  1.00 77.15  ? 765  MET A H    1 
ATOM   10527 H HA   . MET A 1 699 ? 27.133  73.236  45.218  1.00 72.03  ? 765  MET A HA   1 
ATOM   10528 H HB2  . MET A 1 699 ? 28.364  73.954  43.257  1.00 64.41  ? 765  MET A HB2  1 
ATOM   10529 H HB3  . MET A 1 699 ? 26.949  74.096  42.551  1.00 64.41  ? 765  MET A HB3  1 
ATOM   10530 H HG2  . MET A 1 699 ? 27.511  75.495  44.909  1.00 48.03  ? 765  MET A HG2  1 
ATOM   10531 H HG3  . MET A 1 699 ? 27.858  76.115  43.485  1.00 48.03  ? 765  MET A HG3  1 
ATOM   10532 H HE1  . MET A 1 699 ? 24.896  77.252  41.953  1.00 111.09 ? 765  MET A HE1  1 
ATOM   10533 H HE2  . MET A 1 699 ? 26.430  77.552  42.241  1.00 111.09 ? 765  MET A HE2  1 
ATOM   10534 H HE3  . MET A 1 699 ? 26.003  76.182  41.560  1.00 111.09 ? 765  MET A HE3  1 
ATOM   10535 N N    . ARG A 1 700 ? 24.756  72.731  43.087  1.00 69.90  ? 766  ARG A N    1 
ATOM   10536 C CA   . ARG A 1 700 ? 23.300  72.669  42.898  1.00 58.52  ? 766  ARG A CA   1 
ATOM   10537 C C    . ARG A 1 700 ? 22.670  71.721  43.911  1.00 48.31  ? 766  ARG A C    1 
ATOM   10538 O O    . ARG A 1 700 ? 21.614  72.005  44.449  1.00 48.84  ? 766  ARG A O    1 
ATOM   10539 C CB   . ARG A 1 700 ? 22.908  72.196  41.485  1.00 56.50  ? 766  ARG A CB   1 
ATOM   10540 C CG   . ARG A 1 700 ? 23.594  72.902  40.312  1.00 56.54  ? 766  ARG A CG   1 
ATOM   10541 C CD   . ARG A 1 700 ? 22.946  74.184  39.862  1.00 70.28  ? 766  ARG A CD   1 
ATOM   10542 N NE   . ARG A 1 700 ? 21.521  74.076  39.578  1.00 82.44  ? 766  ARG A NE   1 
ATOM   10543 C CZ   . ARG A 1 700 ? 20.813  75.057  39.029  1.00 90.94  ? 766  ARG A CZ   1 
ATOM   10544 N NH1  . ARG A 1 700 ? 21.416  76.190  38.682  1.00 95.96  ? 766  ARG A NH1  1 
ATOM   10545 N NH2  . ARG A 1 700 ? 19.515  74.903  38.808  1.00 92.03  ? 766  ARG A NH2  1 
ATOM   10546 H H    . ARG A 1 700 ? 25.203  72.555  42.374  1.00 83.89  ? 766  ARG A H    1 
ATOM   10547 H HA   . ARG A 1 700 ? 22.924  73.553  43.035  1.00 70.23  ? 766  ARG A HA   1 
ATOM   10548 H HB2  . ARG A 1 700 ? 23.117  71.251  41.414  1.00 67.80  ? 766  ARG A HB2  1 
ATOM   10549 H HB3  . ARG A 1 700 ? 21.953  72.322  41.377  1.00 67.80  ? 766  ARG A HB3  1 
ATOM   10550 H HG2  . ARG A 1 700 ? 24.506  73.112  40.570  1.00 67.85  ? 766  ARG A HG2  1 
ATOM   10551 H HG3  . ARG A 1 700 ? 23.603  72.298  39.553  1.00 67.85  ? 766  ARG A HG3  1 
ATOM   10552 H HD2  . ARG A 1 700 ? 23.057  74.849  40.560  1.00 84.33  ? 766  ARG A HD2  1 
ATOM   10553 H HD3  . ARG A 1 700 ? 23.385  74.486  39.051  1.00 84.33  ? 766  ARG A HD3  1 
ATOM   10554 H HE   . ARG A 1 700 ? 21.159  73.296  39.624  1.00 98.93  ? 766  ARG A HE   1 
ATOM   10555 H HH11 . ARG A 1 700 ? 22.258  76.291  38.828  1.00 115.15 ? 766  ARG A HH11 1 
ATOM   10556 H HH12 . ARG A 1 700 ? 20.963  76.826  38.322  1.00 115.15 ? 766  ARG A HH12 1 
ATOM   10557 H HH21 . ARG A 1 700 ? 19.126  74.167  39.025  1.00 110.44 ? 766  ARG A HH21 1 
ATOM   10558 H HH22 . ARG A 1 700 ? 19.063  75.536  38.442  1.00 110.44 ? 766  ARG A HH22 1 
ATOM   10559 N N    . VAL A 1 701 ? 23.316  70.593  44.173  1.00 46.00  ? 767  VAL A N    1 
ATOM   10560 C CA   . VAL A 1 701 ? 22.775  69.621  45.123  1.00 52.36  ? 767  VAL A CA   1 
ATOM   10561 C C    . VAL A 1 701 ? 22.873  70.102  46.570  1.00 52.01  ? 767  VAL A C    1 
ATOM   10562 O O    . VAL A 1 701 ? 21.963  69.884  47.360  1.00 52.57  ? 767  VAL A O    1 
ATOM   10563 C CB   . VAL A 1 701 ? 23.483  68.261  45.015  1.00 59.48  ? 767  VAL A CB   1 
ATOM   10564 C CG1  . VAL A 1 701 ? 22.971  67.298  46.077  1.00 62.20  ? 767  VAL A CG1  1 
ATOM   10565 C CG2  . VAL A 1 701 ? 23.268  67.662  43.642  1.00 68.23  ? 767  VAL A CG2  1 
ATOM   10566 H H    . VAL A 1 701 ? 24.066  70.364  43.819  1.00 55.20  ? 767  VAL A H    1 
ATOM   10567 H HA   . VAL A 1 701 ? 21.836  69.482  44.922  1.00 62.83  ? 767  VAL A HA   1 
ATOM   10568 H HB   . VAL A 1 701 ? 24.436  68.384  45.149  1.00 71.37  ? 767  VAL A HB   1 
ATOM   10569 H HG11 . VAL A 1 701 ? 23.435  66.451  45.984  1.00 74.64  ? 767  VAL A HG11 1 
ATOM   10570 H HG12 . VAL A 1 701 ? 23.143  67.676  46.954  1.00 74.64  ? 767  VAL A HG12 1 
ATOM   10571 H HG13 . VAL A 1 701 ? 22.018  67.169  45.953  1.00 74.64  ? 767  VAL A HG13 1 
ATOM   10572 H HG21 . VAL A 1 701 ? 23.723  66.807  43.597  1.00 81.87  ? 767  VAL A HG21 1 
ATOM   10573 H HG22 . VAL A 1 701 ? 22.317  67.540  43.497  1.00 81.87  ? 767  VAL A HG22 1 
ATOM   10574 H HG23 . VAL A 1 701 ? 23.631  68.266  42.975  1.00 81.87  ? 767  VAL A HG23 1 
ATOM   10575 N N    . PHE A 1 702 ? 23.978  70.747  46.924  1.00 57.71  ? 768  PHE A N    1 
ATOM   10576 C CA   . PHE A 1 702 ? 24.154  71.208  48.295  1.00 53.16  ? 768  PHE A CA   1 
ATOM   10577 C C    . PHE A 1 702 ? 23.129  72.286  48.653  1.00 55.80  ? 768  PHE A C    1 
ATOM   10578 O O    . PHE A 1 702 ? 22.635  72.308  49.784  1.00 57.97  ? 768  PHE A O    1 
ATOM   10579 C CB   . PHE A 1 702 ? 25.592  71.700  48.539  1.00 52.93  ? 768  PHE A CB   1 
ATOM   10580 C CG   . PHE A 1 702 ? 25.848  72.162  49.955  1.00 47.45  ? 768  PHE A CG   1 
ATOM   10581 C CD1  . PHE A 1 702 ? 25.673  71.297  51.024  1.00 51.14  ? 768  PHE A CD1  1 
ATOM   10582 C CD2  . PHE A 1 702 ? 26.269  73.455  50.210  1.00 44.65  ? 768  PHE A CD2  1 
ATOM   10583 C CE1  . PHE A 1 702 ? 25.891  71.719  52.318  1.00 47.97  ? 768  PHE A CE1  1 
ATOM   10584 C CE2  . PHE A 1 702 ? 26.499  73.880  51.502  1.00 58.08  ? 768  PHE A CE2  1 
ATOM   10585 C CZ   . PHE A 1 702 ? 26.312  73.013  52.555  1.00 56.23  ? 768  PHE A CZ   1 
ATOM   10586 H H    . PHE A 1 702 ? 24.633  70.929  46.397  1.00 69.25  ? 768  PHE A H    1 
ATOM   10587 H HA   . PHE A 1 702 ? 24.002  70.457  48.890  1.00 63.79  ? 768  PHE A HA   1 
ATOM   10588 H HB2  . PHE A 1 702 ? 26.206  70.974  48.348  1.00 63.52  ? 768  PHE A HB2  1 
ATOM   10589 H HB3  . PHE A 1 702 ? 25.771  72.446  47.946  1.00 63.52  ? 768  PHE A HB3  1 
ATOM   10590 H HD1  . PHE A 1 702 ? 25.385  70.427  50.868  1.00 61.37  ? 768  PHE A HD1  1 
ATOM   10591 H HD2  . PHE A 1 702 ? 26.394  74.046  49.503  1.00 53.58  ? 768  PHE A HD2  1 
ATOM   10592 H HE1  . PHE A 1 702 ? 25.769  71.130  53.027  1.00 57.56  ? 768  PHE A HE1  1 
ATOM   10593 H HE2  . PHE A 1 702 ? 26.780  74.753  51.662  1.00 69.70  ? 768  PHE A HE2  1 
ATOM   10594 H HZ   . PHE A 1 702 ? 26.468  73.299  53.426  1.00 67.48  ? 768  PHE A HZ   1 
ATOM   10595 N N    . CYS A 1 703 ? 22.800  73.159  47.698  1.00 42.11  ? 769  CYS A N    1 
ATOM   10596 C CA   . CYS A 1 703 ? 21.758  74.174  47.906  1.00 54.72  ? 769  CYS A CA   1 
ATOM   10597 C C    . CYS A 1 703 ? 20.394  73.561  48.213  1.00 58.01  ? 769  CYS A C    1 
ATOM   10598 O O    . CYS A 1 703 ? 19.573  74.174  48.891  1.00 62.24  ? 769  CYS A O    1 
ATOM   10599 C CB   . CYS A 1 703 ? 21.610  75.067  46.678