data_4PQE
# 
_entry.id   4PQE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4PQE         
RCSB  RCSB085092   
WWPDB D_1000085092 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3LII . unspecified 
PDB 4Ey4 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4PQE 
_pdbx_database_status.recvd_initial_deposition_date   2014-03-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dym, O.'                                    1 
'Unger, T.'                                  2 
'Toker, L.'                                  3 
'Silman, I.'                                 4 
'Sussman, J.L.'                              5 
'Israel Structural Proteomics Center (ISPC)' 6 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Acetylcholinesterase' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dym, O.'                                    1 
primary 'Unger, T.'                                  2 
primary 'Toker, L.'                                  3 
primary 'Silman, I.'                                 4 
primary 'Sussman, J.L.'                              5 
primary 'Israel Structural Proteomics Center (ISPC)' 6 
# 
_cell.entry_id           4PQE 
_cell.length_a           125.307 
_cell.length_b           125.307 
_cell.length_c           131.396 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4PQE 
_symmetry.space_group_name_H-M             'P 31 1 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                151 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Acetylcholinesterase 59576.223 1  3.1.1.7 ? ? ? 
2 water   nat water                18.015    12 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLA
LPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVG
MGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGD
FHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSD
VVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYW
ANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLA
LPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVG
MGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGD
FHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSD
VVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYW
ANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   ALA n 
1 7   GLU n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  THR n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  ARG n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  THR n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  MET n 
1 43  GLY n 
1 44  PRO n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  LEU n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  GLN n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  VAL n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  SER n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 THR n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 VAL n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 SER n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 VAL n 
1 140 GLN n 
1 141 ALA n 
1 142 GLU n 
1 143 ARG n 
1 144 THR n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 ALA n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 VAL n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 THR n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 LEU n 
1 214 LEU n 
1 215 SER n 
1 216 PRO n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 GLY n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 ALA n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 GLY n 
1 241 MET n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 GLN n 
1 251 LEU n 
1 252 ALA n 
1 253 HIS n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 THR n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 VAL n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 VAL n 
1 281 LEU n 
1 282 VAL n 
1 283 ASN n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 VAL n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 ALA n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 HIS n 
1 323 GLY n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 ALA n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLU n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 VAL n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 VAL n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 ALA n 
1 393 ARG n 
1 394 LEU n 
1 395 ARG n 
1 396 GLU n 
1 397 ALA n 
1 398 LEU n 
1 399 SER n 
1 400 ASP n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 VAL n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 SER n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 ILE n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 ARG n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 ALA n 
1 468 GLU n 
1 469 GLU n 
1 470 LYS n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 ARG n 
1 479 TYR n 
1 480 TRP n 
1 481 ALA n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 GLU n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 PRO n 
1 496 LYS n 
1 497 ALA n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 ALA n 
1 506 GLY n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASP n 
1 515 LEU n 
1 516 ARG n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 ALA n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                KIDNEY 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'Human Embryonic Kidney 293 cells' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLA
LPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVG
MGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGD
FHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSD
VVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYW
ANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           32 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4PQE 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P22303 
_struct_ref_seq.db_align_beg                  32 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  574 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4PQE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.00 
_exptl_crystal.density_percent_sol   75.39 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.1M Imidazol pH=7, 12% PEG 20000, 0.5% Ethyl Acetate, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2012-06-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8726 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.8726 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4PQE 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   26326 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.049 
_reflns.pdbx_Rsym_value              0.049 
_reflns.pdbx_netI_over_sigmaI        17.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.050 
_reflns_shell.pdbx_Rsym_value        0.043 
_reflns_shell.meanI_over_sigI_obs    4.4 
_reflns_shell.pdbx_redundancy        10.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4PQE 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     25021 
_refine.ls_number_reflns_all                     24993 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    99.92 
_refine.ls_R_factor_obs                          0.18684 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18525 
_refine.ls_R_factor_R_free                       0.21811 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1288 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.929 
_refine.correlation_coeff_Fo_to_Fc_free          0.911 
_refine.B_iso_mean                               30.226 
_refine.aniso_B[1][1]                            0.54 
_refine.aniso_B[2][2]                            0.54 
_refine.aniso_B[3][3]                            -1.76 
_refine.aniso_B[1][2]                            0.27 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      3LII 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.377 
_refine.pdbx_overall_ESU_R_Free                  0.260 
_refine.overall_SU_ML                            0.170 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.932 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4087 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             12 
_refine_hist.number_atoms_total               4099 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.019  0.019  ? 4215 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.179  1.953  ? 5764 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.764  5.000  ? 525  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.074 22.526 ? 190  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.610 15.000 ? 594  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.122 15.000 ? 36   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.136  0.200  ? 618  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.010  0.022  ? 3325 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.766  3.000  ? 2109 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.401  4.488  ? 2631 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.534  3.050  ? 2106 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.901 
_refine_ls_shell.d_res_low                        2.976 
_refine_ls_shell.number_reflns_R_work             1865 
_refine_ls_shell.R_factor_R_work                  0.223 
_refine_ls_shell.percent_reflns_obs               99.85 
_refine_ls_shell.R_factor_R_free                  0.283 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             80 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4PQE 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4PQE 
_struct.title                     'Crystal Structure of Human Acetylcholinesterase' 
_struct.pdbx_descriptor           'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4PQE 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Structural Genomics, Israel Structural Proteomics Center, ISPC, alpha/beta hydrolase, hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 42  ? ARG A 46  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P2  2  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P3  3  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P4  4  GLY A 135 ? ARG A 143 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P5  5  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P6  6  ASN A 170 ? VAL A 187 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P7  7  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P8  8  SER A 203 ? LEU A 214 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P9  9  SER A 215 ? GLY A 220 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P10 10 GLY A 240 ? VAL A 255 ? GLY A 240 VAL A 255 1 ? 16 
HELX_P HELX_P11 11 ASP A 266 ? ARG A 276 ? ASP A 266 ARG A 276 1 ? 11 
HELX_P HELX_P12 12 PRO A 277 ? ASN A 283 ? PRO A 277 ASN A 283 1 ? 7  
HELX_P HELX_P13 13 HIS A 284 ? LEU A 289 ? HIS A 284 LEU A 289 5 ? 6  
HELX_P HELX_P14 14 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P15 15 SER A 336 ? GLY A 342 ? SER A 336 GLY A 342 5 ? 7  
HELX_P HELX_P16 16 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P17 17 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P18 18 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P19 19 VAL A 407 ? ALA A 420 ? VAL A 407 ALA A 420 1 ? 14 
HELX_P HELX_P20 20 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P21 21 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P22 22 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P23 23 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P24 24 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P25 25 PHE A 535 ? LEU A 540 ? PHE A 535 LEU A 540 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 96  SG ? ? ? 1_555 A CYS 69  SG ? ? A CYS 96  A CYS 69  1_555 ? ? ? ? ? ? ? 2.092 ? 
disulf2 disulf ? ? A CYS 272 SG ? ? ? 1_555 A CYS 257 SG ? ? A CYS 272 A CYS 257 1_555 ? ? ? ? ? ? ? 2.171 ? 
disulf3 disulf ? ? A CYS 529 SG ? ? ? 1_555 A CYS 409 SG ? ? A CYS 529 A CYS 409 1_555 ? ? ? ? ? ? ? 2.137 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 0.89   
2 CYS 257 A . ? CYS 257 A PRO 258 A ? PRO 258 A 1 -16.95 
3 PRO 495 A . ? PRO 495 A LYS 496 A ? LYS 496 A 1 -3.94  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
A 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
A 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
B 1  ILE A 20  ? LEU A 22  ? ILE A 20  LEU A 22  
B 2  VAL A 29  ? PRO A 36  ? VAL A 29  PRO A 36  
B 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
B 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
B 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
B 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
B 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
B 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
B 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
B 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
B 11 VAL A 520 ? ARG A 522 ? VAL A 520 ARG A 522 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
A 2  3  N ARG A 16  ? N ARG A 16  O VAL A 60  ? O VAL A 60  
B 1  2  N ILE A 20  ? N ILE A 20  O ALA A 31  ? O ALA A 31  
B 2  3  N PHE A 32  ? N PHE A 32  O VAL A 101 ? O VAL A 101 
B 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
B 4  5  O VAL A 145 ? O VAL A 145 N LEU A 115 ? N LEU A 115 
B 5  6  N THR A 112 ? N THR A 112 O ASP A 193 ? O ASP A 193 
B 6  7  N GLY A 201 ? N GLY A 201 O GLN A 228 ? O GLN A 228 
B 7  8  N ALA A 225 ? N ALA A 225 O LEU A 327 ? O LEU A 327 
B 8  9  N VAL A 330 ? N VAL A 330 O PHE A 430 ? O PHE A 430 
B 9  10 N VAL A 429 ? N VAL A 429 O LEU A 513 ? O LEU A 513 
B 10 11 N TYR A 510 ? N TYR A 510 O ARG A 521 ? O ARG A 521 
# 
_database_PDB_matrix.entry_id          4PQE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4PQE 
_atom_sites.fract_transf_matrix[1][1]   0.007980 
_atom_sites.fract_transf_matrix[1][2]   0.004607 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009215 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007611 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 5   ? 3.859   6.296   5.991   1.00 52.70  ? 5   ASP A N   1 
ATOM   2    C CA  . ASP A 1 5   ? 3.743   4.895   5.425   1.00 56.02  ? 5   ASP A CA  1 
ATOM   3    C C   . ASP A 1 5   ? 3.206   3.941   6.521   1.00 57.00  ? 5   ASP A C   1 
ATOM   4    O O   . ASP A 1 5   ? 2.407   3.026   6.247   1.00 49.12  ? 5   ASP A O   1 
ATOM   5    C CB  . ASP A 1 5   ? 5.037   4.409   4.696   1.00 47.80  ? 5   ASP A CB  1 
ATOM   6    N N   . ALA A 1 6   ? 3.597   4.207   7.773   1.00 65.06  ? 6   ALA A N   1 
ATOM   7    C CA  . ALA A 1 6   ? 3.011   3.527   8.949   1.00 66.21  ? 6   ALA A CA  1 
ATOM   8    C C   . ALA A 1 6   ? 1.625   4.148   9.183   1.00 70.65  ? 6   ALA A C   1 
ATOM   9    O O   . ALA A 1 6   ? 0.636   3.471   9.571   1.00 70.38  ? 6   ALA A O   1 
ATOM   10   C CB  . ALA A 1 6   ? 3.915   3.692   10.182  1.00 58.51  ? 6   ALA A CB  1 
ATOM   11   N N   . GLU A 1 7   ? 1.553   5.446   8.883   1.00 64.85  ? 7   GLU A N   1 
ATOM   12   C CA  . GLU A 1 7   ? 0.377   6.211   9.189   1.00 55.52  ? 7   GLU A CA  1 
ATOM   13   C C   . GLU A 1 7   ? -0.772  5.888   8.243   1.00 52.07  ? 7   GLU A C   1 
ATOM   14   O O   . GLU A 1 7   ? -1.897  6.245   8.539   1.00 59.89  ? 7   GLU A O   1 
ATOM   15   C CB  . GLU A 1 7   ? 0.700   7.694   9.173   1.00 62.22  ? 7   GLU A CB  1 
ATOM   16   C CG  . GLU A 1 7   ? 1.911   8.065   10.012  1.00 64.15  ? 7   GLU A CG  1 
ATOM   17   C CD  . GLU A 1 7   ? 1.642   9.171   11.018  1.00 65.08  ? 7   GLU A CD  1 
ATOM   18   O OE1 . GLU A 1 7   ? 0.989   10.178  10.657  1.00 80.19  ? 7   GLU A OE1 1 
ATOM   19   O OE2 . GLU A 1 7   ? 2.089   9.033   12.176  1.00 57.95  ? 7   GLU A OE2 1 
ATOM   20   N N   . LEU A 1 8   ? -0.496  5.209   7.126   1.00 42.33  ? 8   LEU A N   1 
ATOM   21   C CA  . LEU A 1 8   ? -1.533  4.782   6.187   1.00 34.71  ? 8   LEU A CA  1 
ATOM   22   C C   . LEU A 1 8   ? -2.293  3.471   6.532   1.00 39.22  ? 8   LEU A C   1 
ATOM   23   O O   . LEU A 1 8   ? -3.139  3.036   5.727   1.00 37.79  ? 8   LEU A O   1 
ATOM   24   C CB  . LEU A 1 8   ? -1.009  4.745   4.742   1.00 28.15  ? 8   LEU A CB  1 
ATOM   25   C CG  . LEU A 1 8   ? -0.202  5.890   4.072   1.00 28.62  ? 8   LEU A CG  1 
ATOM   26   C CD1 . LEU A 1 8   ? 0.032   5.705   2.559   1.00 25.36  ? 8   LEU A CD1 1 
ATOM   27   C CD2 . LEU A 1 8   ? -0.728  7.318   4.360   1.00 30.42  ? 8   LEU A CD2 1 
ATOM   28   N N   . LEU A 1 9   ? -2.025  2.821   7.681   1.00 40.48  ? 9   LEU A N   1 
ATOM   29   C CA  . LEU A 1 9   ? -2.913  1.673   8.092   1.00 39.17  ? 9   LEU A CA  1 
ATOM   30   C C   . LEU A 1 9   ? -3.644  2.115   9.329   1.00 39.33  ? 9   LEU A C   1 
ATOM   31   O O   . LEU A 1 9   ? -3.084  2.848   10.156  1.00 49.17  ? 9   LEU A O   1 
ATOM   32   C CB  . LEU A 1 9   ? -2.189  0.329   8.294   1.00 35.71  ? 9   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 9   ? -1.103  0.043   7.200   1.00 40.77  ? 9   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 9   ? 0.251   -0.585  7.619   1.00 36.82  ? 9   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 9   ? -1.657  -0.692  5.988   1.00 35.05  ? 9   LEU A CD2 1 
ATOM   36   N N   . VAL A 1 10  ? -4.917  1.764   9.406   1.00 32.38  ? 10  VAL A N   1 
ATOM   37   C CA  . VAL A 1 10  ? -5.764  2.164   10.514  1.00 28.72  ? 10  VAL A CA  1 
ATOM   38   C C   . VAL A 1 10  ? -6.812  1.070   10.637  1.00 30.82  ? 10  VAL A C   1 
ATOM   39   O O   . VAL A 1 10  ? -7.269  0.491   9.620   1.00 29.59  ? 10  VAL A O   1 
ATOM   40   C CB  . VAL A 1 10  ? -6.472  3.536   10.282  1.00 28.28  ? 10  VAL A CB  1 
ATOM   41   C CG1 . VAL A 1 10  ? -7.614  3.743   11.266  1.00 26.60  ? 10  VAL A CG1 1 
ATOM   42   C CG2 . VAL A 1 10  ? -5.529  4.719   10.403  1.00 25.14  ? 10  VAL A CG2 1 
ATOM   43   N N   . THR A 1 11  ? -7.175  0.762   11.877  1.00 32.20  ? 11  THR A N   1 
ATOM   44   C CA  . THR A 1 11  ? -8.229  -0.228  12.119  1.00 37.68  ? 11  THR A CA  1 
ATOM   45   C C   . THR A 1 11  ? -9.409  0.562   12.675  1.00 35.71  ? 11  THR A C   1 
ATOM   46   O O   . THR A 1 11  ? -9.186  1.491   13.436  1.00 39.34  ? 11  THR A O   1 
ATOM   47   C CB  . THR A 1 11  ? -7.781  -1.322  13.142  1.00 37.24  ? 11  THR A CB  1 
ATOM   48   O OG1 . THR A 1 11  ? -6.556  -1.931  12.701  1.00 39.86  ? 11  THR A OG1 1 
ATOM   49   C CG2 . THR A 1 11  ? -8.879  -2.402  13.321  1.00 32.69  ? 11  THR A CG2 1 
ATOM   50   N N   . VAL A 1 12  ? -10.631 0.211   12.300  1.00 30.16  ? 12  VAL A N   1 
ATOM   51   C CA  . VAL A 1 12  ? -11.827 0.892   12.780  1.00 30.73  ? 12  VAL A CA  1 
ATOM   52   C C   . VAL A 1 12  ? -12.767 -0.224  13.234  1.00 33.29  ? 12  VAL A C   1 
ATOM   53   O O   . VAL A 1 12  ? -12.474 -1.374  12.949  1.00 37.32  ? 12  VAL A O   1 
ATOM   54   C CB  . VAL A 1 12  ? -12.492 1.730   11.623  1.00 29.69  ? 12  VAL A CB  1 
ATOM   55   C CG1 . VAL A 1 12  ? -11.563 2.806   11.095  1.00 24.18  ? 12  VAL A CG1 1 
ATOM   56   C CG2 . VAL A 1 12  ? -13.021 0.841   10.469  1.00 28.19  ? 12  VAL A CG2 1 
ATOM   57   N N   . ARG A 1 13  ? -13.911 0.062   13.864  1.00 33.21  ? 13  ARG A N   1 
ATOM   58   C CA  . ARG A 1 13  ? -14.796 -1.054  14.268  1.00 34.74  ? 13  ARG A CA  1 
ATOM   59   C C   . ARG A 1 13  ? -14.967 -2.155  13.222  1.00 33.97  ? 13  ARG A C   1 
ATOM   60   O O   . ARG A 1 13  ? -15.007 -3.295  13.611  1.00 34.42  ? 13  ARG A O   1 
ATOM   61   C CB  . ARG A 1 13  ? -16.215 -0.638  14.696  1.00 39.18  ? 13  ARG A CB  1 
ATOM   62   C CG  . ARG A 1 13  ? -16.348 0.290   15.875  1.00 43.13  ? 13  ARG A CG  1 
ATOM   63   C CD  . ARG A 1 13  ? -16.444 -0.353  17.267  1.00 50.68  ? 13  ARG A CD  1 
ATOM   64   N NE  . ARG A 1 13  ? -16.104 0.788   18.130  1.00 61.25  ? 13  ARG A NE  1 
ATOM   65   C CZ  . ARG A 1 13  ? -16.981 1.559   18.794  1.00 60.80  ? 13  ARG A CZ  1 
ATOM   66   N NH1 . ARG A 1 13  ? -18.288 1.243   18.817  1.00 51.31  ? 13  ARG A NH1 1 
ATOM   67   N NH2 . ARG A 1 13  ? -16.533 2.636   19.463  1.00 51.13  ? 13  ARG A NH2 1 
ATOM   68   N N   . GLY A 1 14  ? -15.097 -1.837  11.926  1.00 32.41  ? 14  GLY A N   1 
ATOM   69   C CA  . GLY A 1 14  ? -15.393 -2.872  10.918  1.00 29.02  ? 14  GLY A CA  1 
ATOM   70   C C   . GLY A 1 14  ? -14.173 -3.682  10.416  1.00 32.75  ? 14  GLY A C   1 
ATOM   71   O O   . GLY A 1 14  ? -14.317 -4.782  9.784   1.00 30.53  ? 14  GLY A O   1 
ATOM   72   N N   . GLY A 1 15  ? -12.969 -3.155  10.664  1.00 27.95  ? 15  GLY A N   1 
ATOM   73   C CA  . GLY A 1 15  ? -11.802 -3.853  10.221  1.00 27.15  ? 15  GLY A CA  1 
ATOM   74   C C   . GLY A 1 15  ? -10.760 -2.908  9.749   1.00 30.39  ? 15  GLY A C   1 
ATOM   75   O O   . GLY A 1 15  ? -10.697 -1.759  10.173  1.00 36.36  ? 15  GLY A O   1 
ATOM   76   N N   . ARG A 1 16  ? -9.923  -3.382  8.864   1.00 32.04  ? 16  ARG A N   1 
ATOM   77   C CA  . ARG A 1 16  ? -8.686  -2.663  8.610   1.00 35.07  ? 16  ARG A CA  1 
ATOM   78   C C   . ARG A 1 16  ? -8.805  -1.863  7.311   1.00 30.82  ? 16  ARG A C   1 
ATOM   79   O O   . ARG A 1 16  ? -9.604  -2.240  6.454   1.00 30.27  ? 16  ARG A O   1 
ATOM   80   C CB  . ARG A 1 16  ? -7.513  -3.660  8.537   1.00 41.26  ? 16  ARG A CB  1 
ATOM   81   C CG  . ARG A 1 16  ? -7.370  -4.617  9.721   1.00 44.35  ? 16  ARG A CG  1 
ATOM   82   C CD  . ARG A 1 16  ? -5.886  -4.857  10.054  1.00 49.18  ? 16  ARG A CD  1 
ATOM   83   N NE  . ARG A 1 16  ? -5.166  -5.625  9.026   1.00 48.60  ? 16  ARG A NE  1 
ATOM   84   C CZ  . ARG A 1 16  ? -5.503  -6.866  8.615   1.00 48.50  ? 16  ARG A CZ  1 
ATOM   85   N NH1 . ARG A 1 16  ? -6.565  -7.507  9.133   1.00 44.54  ? 16  ARG A NH1 1 
ATOM   86   N NH2 . ARG A 1 16  ? -4.778  -7.470  7.668   1.00 40.93  ? 16  ARG A NH2 1 
ATOM   87   N N   . LEU A 1 17  ? -8.020  -0.781  7.185   1.00 25.55  ? 17  LEU A N   1 
ATOM   88   C CA  . LEU A 1 17  ? -8.037  0.091   6.031   1.00 24.13  ? 17  LEU A CA  1 
ATOM   89   C C   . LEU A 1 17  ? -6.639  0.496   5.602   1.00 27.17  ? 17  LEU A C   1 
ATOM   90   O O   . LEU A 1 17  ? -5.760  0.691   6.474   1.00 29.33  ? 17  LEU A O   1 
ATOM   91   C CB  . LEU A 1 17  ? -8.705  1.412   6.410   1.00 22.14  ? 17  LEU A CB  1 
ATOM   92   C CG  . LEU A 1 17  ? -10.130 1.360   6.861   1.00 21.78  ? 17  LEU A CG  1 
ATOM   93   C CD1 . LEU A 1 17  ? -10.391 2.679   7.539   1.00 21.29  ? 17  LEU A CD1 1 
ATOM   94   C CD2 . LEU A 1 17  ? -11.085 1.013   5.712   1.00 19.96  ? 17  LEU A CD2 1 
ATOM   95   N N   . ARG A 1 18  ? -6.441  0.714   4.299   1.00 26.28  ? 18  ARG A N   1 
ATOM   96   C CA  . ARG A 1 18  ? -5.230  1.370   3.849   1.00 28.84  ? 18  ARG A CA  1 
ATOM   97   C C   . ARG A 1 18  ? -5.494  2.716   3.126   1.00 32.16  ? 18  ARG A C   1 
ATOM   98   O O   . ARG A 1 18  ? -6.297  2.765   2.177   1.00 33.42  ? 18  ARG A O   1 
ATOM   99   C CB  . ARG A 1 18  ? -4.382  0.441   2.932   1.00 29.57  ? 18  ARG A CB  1 
ATOM   100  C CG  . ARG A 1 18  ? -3.177  1.213   2.389   1.00 31.11  ? 18  ARG A CG  1 
ATOM   101  C CD  . ARG A 1 18  ? -2.337  0.528   1.363   1.00 35.20  ? 18  ARG A CD  1 
ATOM   102  N NE  . ARG A 1 18  ? -2.427  -0.898  1.571   1.00 46.66  ? 18  ARG A NE  1 
ATOM   103  C CZ  . ARG A 1 18  ? -1.550  -1.627  2.254   1.00 47.47  ? 18  ARG A CZ  1 
ATOM   104  N NH1 . ARG A 1 18  ? -0.500  -1.044  2.816   1.00 40.90  ? 18  ARG A NH1 1 
ATOM   105  N NH2 . ARG A 1 18  ? -1.749  -2.946  2.375   1.00 46.69  ? 18  ARG A NH2 1 
ATOM   106  N N   . GLY A 1 19  ? -4.763  3.768   3.525   1.00 32.26  ? 19  GLY A N   1 
ATOM   107  C CA  . GLY A 1 19  ? -4.986  5.149   3.056   1.00 30.99  ? 19  GLY A CA  1 
ATOM   108  C C   . GLY A 1 19  ? -3.971  5.562   2.019   1.00 31.38  ? 19  GLY A C   1 
ATOM   109  O O   . GLY A 1 19  ? -3.233  4.706   1.554   1.00 36.22  ? 19  GLY A O   1 
ATOM   110  N N   . ILE A 1 20  ? -3.911  6.843   1.645   1.00 28.32  ? 20  ILE A N   1 
ATOM   111  C CA  . ILE A 1 20  ? -2.923  7.284   0.662   1.00 29.75  ? 20  ILE A CA  1 
ATOM   112  C C   . ILE A 1 20  ? -2.374  8.606   1.152   1.00 31.68  ? 20  ILE A C   1 
ATOM   113  O O   . ILE A 1 20  ? -3.086  9.334   1.855   1.00 34.02  ? 20  ILE A O   1 
ATOM   114  C CB  . ILE A 1 20  ? -3.571  7.409   -0.735  1.00 32.00  ? 20  ILE A CB  1 
ATOM   115  C CG1 . ILE A 1 20  ? -2.582  7.862   -1.818  1.00 32.05  ? 20  ILE A CG1 1 
ATOM   116  C CG2 . ILE A 1 20  ? -4.731  8.390   -0.696  1.00 33.05  ? 20  ILE A CG2 1 
ATOM   117  C CD1 . ILE A 1 20  ? -3.096  7.712   -3.255  1.00 28.25  ? 20  ILE A CD1 1 
ATOM   118  N N   . ARG A 1 21  ? -1.116  8.903   0.828   1.00 31.86  ? 21  ARG A N   1 
ATOM   119  C CA  . ARG A 1 21  ? -0.490  10.157  1.244   1.00 34.10  ? 21  ARG A CA  1 
ATOM   120  C C   . ARG A 1 21  ? -0.796  11.156  0.118   1.00 34.24  ? 21  ARG A C   1 
ATOM   121  O O   . ARG A 1 21  ? -0.561  10.838  -1.048  1.00 33.52  ? 21  ARG A O   1 
ATOM   122  C CB  . ARG A 1 21  ? 1.043   9.986   1.481   1.00 36.33  ? 21  ARG A CB  1 
ATOM   123  C CG  . ARG A 1 21  ? 1.854   11.272  1.795   1.00 44.10  ? 21  ARG A CG  1 
ATOM   124  C CD  . ARG A 1 21  ? 3.332   11.147  2.294   1.00 56.32  ? 21  ARG A CD  1 
ATOM   125  N NE  . ARG A 1 21  ? 3.649   10.325  3.528   1.00 74.32  ? 21  ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 21  ? 2.850   9.984   4.585   1.00 79.79  ? 21  ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 21  ? 1.583   10.405  4.710   1.00 77.49  ? 21  ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 21  ? 3.328   9.194   5.564   1.00 71.79  ? 21  ARG A NH2 1 
ATOM   129  N N   . LEU A 1 22  ? -1.335  12.338  0.442   1.00 31.46  ? 22  LEU A N   1 
ATOM   130  C CA  . LEU A 1 22  ? -1.557  13.375  -0.586  1.00 31.34  ? 22  LEU A CA  1 
ATOM   131  C C   . LEU A 1 22  ? -0.623  14.524  -0.348  1.00 30.38  ? 22  LEU A C   1 
ATOM   132  O O   . LEU A 1 22  ? -0.294  14.775  0.814   1.00 29.29  ? 22  LEU A O   1 
ATOM   133  C CB  . LEU A 1 22  ? -3.006  13.885  -0.562  1.00 29.28  ? 22  LEU A CB  1 
ATOM   134  C CG  . LEU A 1 22  ? -4.049  12.785  -0.722  1.00 30.00  ? 22  LEU A CG  1 
ATOM   135  C CD1 . LEU A 1 22  ? -5.471  13.218  -0.412  1.00 28.91  ? 22  LEU A CD1 1 
ATOM   136  C CD2 . LEU A 1 22  ? -3.925  12.239  -2.127  1.00 27.96  ? 22  LEU A CD2 1 
ATOM   137  N N   . LYS A 1 23  ? -0.244  15.227  -1.423  1.00 30.05  ? 23  LYS A N   1 
ATOM   138  C CA  . LYS A 1 23  ? 0.649   16.389  -1.351  1.00 32.52  ? 23  LYS A CA  1 
ATOM   139  C C   . LYS A 1 23  ? -0.089  17.696  -1.230  1.00 35.80  ? 23  LYS A C   1 
ATOM   140  O O   . LYS A 1 23  ? -1.273  17.786  -1.600  1.00 36.29  ? 23  LYS A O   1 
ATOM   141  C CB  . LYS A 1 23  ? 1.441   16.540  -2.633  1.00 34.90  ? 23  LYS A CB  1 
ATOM   142  C CG  . LYS A 1 23  ? 2.184   15.327  -3.082  1.00 40.77  ? 23  LYS A CG  1 
ATOM   143  C CD  . LYS A 1 23  ? 3.462   15.824  -3.737  1.00 52.87  ? 23  LYS A CD  1 
ATOM   144  C CE  . LYS A 1 23  ? 4.679   15.181  -3.083  1.00 56.88  ? 23  LYS A CE  1 
ATOM   145  N NZ  . LYS A 1 23  ? 4.546   13.709  -3.222  1.00 58.10  ? 23  LYS A NZ  1 
ATOM   146  N N   . THR A 1 24  ? 0.659   18.731  -0.829  1.00 37.69  ? 24  THR A N   1 
ATOM   147  C CA  . THR A 1 24  ? 0.182   20.111  -0.642  1.00 36.37  ? 24  THR A CA  1 
ATOM   148  C C   . THR A 1 24  ? 1.444   20.870  -0.687  1.00 39.00  ? 24  THR A C   1 
ATOM   149  O O   . THR A 1 24  ? 2.393   20.485  -0.024  1.00 40.60  ? 24  THR A O   1 
ATOM   150  C CB  . THR A 1 24  ? -0.332  20.372  0.803   1.00 36.21  ? 24  THR A CB  1 
ATOM   151  O OG1 . THR A 1 24  ? -1.582  19.668  1.032   1.00 37.06  ? 24  THR A OG1 1 
ATOM   152  C CG2 . THR A 1 24  ? -0.458  21.922  1.129   1.00 35.59  ? 24  THR A CG2 1 
ATOM   153  N N   . PRO A 1 25  ? 1.461   21.997  -1.382  1.00 39.99  ? 25  PRO A N   1 
ATOM   154  C CA  . PRO A 1 25  ? 2.656   22.819  -1.273  1.00 39.39  ? 25  PRO A CA  1 
ATOM   155  C C   . PRO A 1 25  ? 3.216   22.977  0.168   1.00 38.80  ? 25  PRO A C   1 
ATOM   156  O O   . PRO A 1 25  ? 4.426   23.035  0.339   1.00 43.20  ? 25  PRO A O   1 
ATOM   157  C CB  . PRO A 1 25  ? 2.215   24.171  -1.849  1.00 38.35  ? 25  PRO A CB  1 
ATOM   158  C CG  . PRO A 1 25  ? 1.048   23.852  -2.704  1.00 38.97  ? 25  PRO A CG  1 
ATOM   159  C CD  . PRO A 1 25  ? 0.351   22.719  -2.011  1.00 38.93  ? 25  PRO A CD  1 
ATOM   160  N N   . GLY A 1 26  ? 2.383   23.043  1.196   1.00 37.58  ? 26  GLY A N   1 
ATOM   161  C CA  . GLY A 1 26  ? 2.942   23.132  2.552   1.00 34.17  ? 26  GLY A CA  1 
ATOM   162  C C   . GLY A 1 26  ? 3.330   21.793  3.188   1.00 34.35  ? 26  GLY A C   1 
ATOM   163  O O   . GLY A 1 26  ? 3.839   21.765  4.284   1.00 31.32  ? 26  GLY A O   1 
ATOM   164  N N   . GLY A 1 27  ? 3.059   20.668  2.542   1.00 32.65  ? 27  GLY A N   1 
ATOM   165  C CA  . GLY A 1 27  ? 3.458   19.397  3.120   1.00 33.16  ? 27  GLY A CA  1 
ATOM   166  C C   . GLY A 1 27  ? 2.315   18.415  3.091   1.00 36.00  ? 27  GLY A C   1 
ATOM   167  O O   . GLY A 1 27  ? 1.219   18.794  2.749   1.00 38.89  ? 27  GLY A O   1 
ATOM   168  N N   . PRO A 1 28  ? 2.556   17.158  3.487   1.00 36.19  ? 28  PRO A N   1 
ATOM   169  C CA  . PRO A 1 28  ? 1.661   16.078  3.117   1.00 34.39  ? 28  PRO A CA  1 
ATOM   170  C C   . PRO A 1 28  ? 0.525   15.871  4.112   1.00 32.77  ? 28  PRO A C   1 
ATOM   171  O O   . PRO A 1 28  ? 0.519   16.495  5.185   1.00 34.88  ? 28  PRO A O   1 
ATOM   172  C CB  . PRO A 1 28  ? 2.599   14.870  3.124   1.00 33.91  ? 28  PRO A CB  1 
ATOM   173  C CG  . PRO A 1 28  ? 3.493   15.166  4.285   1.00 35.89  ? 28  PRO A CG  1 
ATOM   174  C CD  . PRO A 1 28  ? 3.587   16.676  4.431   1.00 37.51  ? 28  PRO A CD  1 
ATOM   175  N N   . VAL A 1 29  ? -0.412  14.983  3.751   1.00 30.39  ? 29  VAL A N   1 
ATOM   176  C CA  . VAL A 1 29  ? -1.662  14.764  4.500   1.00 30.31  ? 29  VAL A CA  1 
ATOM   177  C C   . VAL A 1 29  ? -2.004  13.292  4.323   1.00 28.07  ? 29  VAL A C   1 
ATOM   178  O O   . VAL A 1 29  ? -1.580  12.708  3.339   1.00 31.07  ? 29  VAL A O   1 
ATOM   179  C CB  . VAL A 1 29  ? -2.797  15.645  3.913   1.00 34.01  ? 29  VAL A CB  1 
ATOM   180  C CG1 . VAL A 1 29  ? -4.140  14.967  4.027   1.00 34.18  ? 29  VAL A CG1 1 
ATOM   181  C CG2 . VAL A 1 29  ? -2.853  17.028  4.574   1.00 34.39  ? 29  VAL A CG2 1 
ATOM   182  N N   . SER A 1 30  ? -2.738  12.675  5.235   1.00 23.81  ? 30  SER A N   1 
ATOM   183  C CA  . SER A 1 30  ? -3.092  11.297  5.013   1.00 25.51  ? 30  SER A CA  1 
ATOM   184  C C   . SER A 1 30  ? -4.568  11.239  4.719   1.00 27.87  ? 30  SER A C   1 
ATOM   185  O O   . SER A 1 30  ? -5.332  11.819  5.487   1.00 31.85  ? 30  SER A O   1 
ATOM   186  C CB  . SER A 1 30  ? -2.844  10.434  6.250   1.00 28.74  ? 30  SER A CB  1 
ATOM   187  O OG  . SER A 1 30  ? -1.533  10.572  6.806   1.00 35.01  ? 30  SER A OG  1 
ATOM   188  N N   . ALA A 1 31  ? -4.996  10.558  3.640   1.00 25.15  ? 31  ALA A N   1 
ATOM   189  C CA  . ALA A 1 31  ? -6.438  10.476  3.331   1.00 24.49  ? 31  ALA A CA  1 
ATOM   190  C C   . ALA A 1 31  ? -6.936  9.079   3.428   1.00 24.07  ? 31  ALA A C   1 
ATOM   191  O O   . ALA A 1 31  ? -6.266  8.181   2.984   1.00 27.42  ? 31  ALA A O   1 
ATOM   192  C CB  . ALA A 1 31  ? -6.738  11.013  1.933   1.00 22.74  ? 31  ALA A CB  1 
ATOM   193  N N   . PHE A 1 32  ? -8.119  8.868   3.963   1.00 23.57  ? 32  PHE A N   1 
ATOM   194  C CA  . PHE A 1 32  ? -8.706  7.564   3.782   1.00 26.32  ? 32  PHE A CA  1 
ATOM   195  C C   . PHE A 1 32  ? -10.000 7.717   3.007   1.00 25.91  ? 32  PHE A C   1 
ATOM   196  O O   . PHE A 1 32  ? -11.025 7.964   3.604   1.00 26.35  ? 32  PHE A O   1 
ATOM   197  C CB  . PHE A 1 32  ? -8.911  6.854   5.107   1.00 27.63  ? 32  PHE A CB  1 
ATOM   198  C CG  . PHE A 1 32  ? -7.666  6.734   5.875   1.00 31.85  ? 32  PHE A CG  1 
ATOM   199  C CD1 . PHE A 1 32  ? -7.004  7.879   6.324   1.00 33.14  ? 32  PHE A CD1 1 
ATOM   200  C CD2 . PHE A 1 32  ? -7.112  5.491   6.132   1.00 34.30  ? 32  PHE A CD2 1 
ATOM   201  C CE1 . PHE A 1 32  ? -5.813  7.782   7.010   1.00 32.09  ? 32  PHE A CE1 1 
ATOM   202  C CE2 . PHE A 1 32  ? -5.923  5.381   6.843   1.00 31.98  ? 32  PHE A CE2 1 
ATOM   203  C CZ  . PHE A 1 32  ? -5.283  6.523   7.273   1.00 32.27  ? 32  PHE A CZ  1 
ATOM   204  N N   . LEU A 1 33  ? -9.926  7.550   1.677   1.00 24.04  ? 33  LEU A N   1 
ATOM   205  C CA  . LEU A 1 33  ? -11.054 7.714   0.761   1.00 21.90  ? 33  LEU A CA  1 
ATOM   206  C C   . LEU A 1 33  ? -11.853 6.426   0.536   1.00 24.14  ? 33  LEU A C   1 
ATOM   207  O O   . LEU A 1 33  ? -11.280 5.370   0.392   1.00 32.50  ? 33  LEU A O   1 
ATOM   208  C CB  . LEU A 1 33  ? -10.523 8.192   -0.558  1.00 18.50  ? 33  LEU A CB  1 
ATOM   209  C CG  . LEU A 1 33  ? -9.555  9.361   -0.445  1.00 17.70  ? 33  LEU A CG  1 
ATOM   210  C CD1 . LEU A 1 33  ? -9.007  9.765   -1.805  1.00 15.64  ? 33  LEU A CD1 1 
ATOM   211  C CD2 . LEU A 1 33  ? -10.172 10.569  0.244   1.00 17.28  ? 33  LEU A CD2 1 
ATOM   212  N N   . GLY A 1 34  ? -13.166 6.473   0.499   1.00 22.77  ? 34  GLY A N   1 
ATOM   213  C CA  . GLY A 1 34  ? -13.876 5.309   0.020   1.00 23.42  ? 34  GLY A CA  1 
ATOM   214  C C   . GLY A 1 34  ? -14.248 4.300   1.089   1.00 26.05  ? 34  GLY A C   1 
ATOM   215  O O   . GLY A 1 34  ? -14.470 3.125   0.763   1.00 28.16  ? 34  GLY A O   1 
ATOM   216  N N   . ILE A 1 35  ? -14.387 4.739   2.348   1.00 24.42  ? 35  ILE A N   1 
ATOM   217  C CA  . ILE A 1 35  ? -14.721 3.810   3.410   1.00 23.39  ? 35  ILE A CA  1 
ATOM   218  C C   . ILE A 1 35  ? -16.195 3.470   3.446   1.00 25.48  ? 35  ILE A C   1 
ATOM   219  O O   . ILE A 1 35  ? -16.994 4.374   3.535   1.00 30.76  ? 35  ILE A O   1 
ATOM   220  C CB  . ILE A 1 35  ? -14.375 4.380   4.773   1.00 22.24  ? 35  ILE A CB  1 
ATOM   221  C CG1 . ILE A 1 35  ? -12.892 4.811   4.813   1.00 22.11  ? 35  ILE A CG1 1 
ATOM   222  C CG2 . ILE A 1 35  ? -14.743 3.370   5.863   1.00 20.35  ? 35  ILE A CG2 1 
ATOM   223  C CD1 . ILE A 1 35  ? -12.465 5.478   6.111   1.00 21.30  ? 35  ILE A CD1 1 
ATOM   224  N N   . PRO A 1 36  ? -16.565 2.169   3.428   1.00 24.77  ? 36  PRO A N   1 
ATOM   225  C CA  . PRO A 1 36  ? -17.983 1.897   3.518   1.00 24.10  ? 36  PRO A CA  1 
ATOM   226  C C   . PRO A 1 36  ? -18.514 2.076   4.908   1.00 25.62  ? 36  PRO A C   1 
ATOM   227  O O   . PRO A 1 36  ? -18.093 1.384   5.815   1.00 33.13  ? 36  PRO A O   1 
ATOM   228  C CB  . PRO A 1 36  ? -18.083 0.400   3.154   1.00 23.61  ? 36  PRO A CB  1 
ATOM   229  C CG  . PRO A 1 36  ? -16.780 -0.176  3.509   1.00 21.16  ? 36  PRO A CG  1 
ATOM   230  C CD  . PRO A 1 36  ? -15.765 0.926   3.355   1.00 22.87  ? 36  PRO A CD  1 
ATOM   231  N N   . PHE A 1 37  ? -19.489 2.941   5.086   1.00 25.58  ? 37  PHE A N   1 
ATOM   232  C CA  . PHE A 1 37  ? -20.249 2.944   6.333   1.00 22.13  ? 37  PHE A CA  1 
ATOM   233  C C   . PHE A 1 37  ? -21.635 2.353   6.337   1.00 21.96  ? 37  PHE A C   1 
ATOM   234  O O   . PHE A 1 37  ? -22.256 2.288   7.386   1.00 23.32  ? 37  PHE A O   1 
ATOM   235  C CB  . PHE A 1 37  ? -20.392 4.353   6.793   1.00 23.18  ? 37  PHE A CB  1 
ATOM   236  C CG  . PHE A 1 37  ? -21.225 5.227   5.883   1.00 23.46  ? 37  PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 37  ? -22.605 5.331   6.085   1.00 21.08  ? 37  PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 37  ? -20.608 6.037   4.897   1.00 22.61  ? 37  PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 37  ? -23.350 6.182   5.319   1.00 19.61  ? 37  PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 37  ? -21.377 6.888   4.126   1.00 21.84  ? 37  PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 37  ? -22.744 6.948   4.332   1.00 20.31  ? 37  PHE A CZ  1 
ATOM   242  N N   . ALA A 1 38  ? -22.171 1.959   5.187   1.00 22.79  ? 38  ALA A N   1 
ATOM   243  C CA  . ALA A 1 38  ? -23.437 1.158   5.185   1.00 22.56  ? 38  ALA A CA  1 
ATOM   244  C C   . ALA A 1 38  ? -23.418 -0.010  4.196   1.00 22.42  ? 38  ALA A C   1 
ATOM   245  O O   . ALA A 1 38  ? -22.617 -0.043  3.267   1.00 21.05  ? 38  ALA A O   1 
ATOM   246  C CB  . ALA A 1 38  ? -24.652 2.043   4.936   1.00 21.65  ? 38  ALA A CB  1 
ATOM   247  N N   . GLU A 1 39  ? -24.276 -0.987  4.436   1.00 24.54  ? 39  GLU A N   1 
ATOM   248  C CA  . GLU A 1 39  ? -24.561 -2.000  3.419   1.00 28.02  ? 39  GLU A CA  1 
ATOM   249  C C   . GLU A 1 39  ? -25.030 -1.317  2.123   1.00 26.89  ? 39  GLU A C   1 
ATOM   250  O O   . GLU A 1 39  ? -25.796 -0.359  2.179   1.00 26.45  ? 39  GLU A O   1 
ATOM   251  C CB  . GLU A 1 39  ? -25.650 -2.982  3.942   1.00 29.80  ? 39  GLU A CB  1 
ATOM   252  C CG  . GLU A 1 39  ? -25.168 -4.041  4.961   1.00 35.86  ? 39  GLU A CG  1 
ATOM   253  C CD  . GLU A 1 39  ? -23.882 -4.810  4.539   1.00 41.46  ? 39  GLU A CD  1 
ATOM   254  O OE1 . GLU A 1 39  ? -23.897 -5.474  3.475   1.00 43.55  ? 39  GLU A OE1 1 
ATOM   255  O OE2 . GLU A 1 39  ? -22.835 -4.742  5.242   1.00 41.20  ? 39  GLU A OE2 1 
ATOM   256  N N   . PRO A 1 40  ? -24.588 -1.796  0.947   1.00 26.21  ? 40  PRO A N   1 
ATOM   257  C CA  . PRO A 1 40  ? -25.211 -1.244  -0.279  1.00 25.67  ? 40  PRO A CA  1 
ATOM   258  C C   . PRO A 1 40  ? -26.773 -1.300  -0.257  1.00 25.23  ? 40  PRO A C   1 
ATOM   259  O O   . PRO A 1 40  ? -27.332 -2.368  -0.027  1.00 27.73  ? 40  PRO A O   1 
ATOM   260  C CB  . PRO A 1 40  ? -24.652 -2.143  -1.389  1.00 23.33  ? 40  PRO A CB  1 
ATOM   261  C CG  . PRO A 1 40  ? -23.332 -2.552  -0.867  1.00 24.70  ? 40  PRO A CG  1 
ATOM   262  C CD  . PRO A 1 40  ? -23.490 -2.718  0.634   1.00 24.39  ? 40  PRO A CD  1 
ATOM   263  N N   . PRO A 1 41  ? -27.462 -0.149  -0.455  1.00 24.86  ? 41  PRO A N   1 
ATOM   264  C CA  . PRO A 1 41  ? -28.930 -0.058  -0.489  1.00 25.89  ? 41  PRO A CA  1 
ATOM   265  C C   . PRO A 1 41  ? -29.499 -0.392  -1.863  1.00 27.62  ? 41  PRO A C   1 
ATOM   266  O O   . PRO A 1 41  ? -30.015 0.473   -2.565  1.00 26.83  ? 41  PRO A O   1 
ATOM   267  C CB  . PRO A 1 41  ? -29.168 1.399   -0.167  1.00 23.92  ? 41  PRO A CB  1 
ATOM   268  C CG  . PRO A 1 41  ? -28.017 2.039   -0.882  1.00 24.99  ? 41  PRO A CG  1 
ATOM   269  C CD  . PRO A 1 41  ? -26.859 1.197   -0.491  1.00 24.49  ? 41  PRO A CD  1 
ATOM   270  N N   . MET A 1 42  ? -29.426 -1.676  -2.194  1.00 30.62  ? 42  MET A N   1 
ATOM   271  C CA  . MET A 1 42  ? -29.686 -2.221  -3.515  1.00 31.00  ? 42  MET A CA  1 
ATOM   272  C C   . MET A 1 42  ? -30.813 -3.220  -3.453  1.00 34.56  ? 42  MET A C   1 
ATOM   273  O O   . MET A 1 42  ? -31.139 -3.730  -2.363  1.00 36.54  ? 42  MET A O   1 
ATOM   274  C CB  . MET A 1 42  ? -28.446 -2.960  -3.886  1.00 27.51  ? 42  MET A CB  1 
ATOM   275  C CG  . MET A 1 42  ? -27.345 -1.975  -3.864  1.00 29.86  ? 42  MET A CG  1 
ATOM   276  S SD  . MET A 1 42  ? -26.451 -2.179  -5.372  1.00 35.98  ? 42  MET A SD  1 
ATOM   277  C CE  . MET A 1 42  ? -27.506 -3.086  -6.533  1.00 33.51  ? 42  MET A CE  1 
ATOM   278  N N   . GLY A 1 43  ? -31.405 -3.539  -4.597  1.00 33.27  ? 43  GLY A N   1 
ATOM   279  C CA  . GLY A 1 43  ? -32.471 -4.542  -4.566  1.00 34.71  ? 43  GLY A CA  1 
ATOM   280  C C   . GLY A 1 43  ? -33.634 -4.151  -3.655  1.00 36.18  ? 43  GLY A C   1 
ATOM   281  O O   . GLY A 1 43  ? -34.175 -3.028  -3.762  1.00 40.18  ? 43  GLY A O   1 
ATOM   282  N N   . PRO A 1 44  ? -34.026 -5.065  -2.745  1.00 33.98  ? 44  PRO A N   1 
ATOM   283  C CA  . PRO A 1 44  ? -35.133 -4.797  -1.793  1.00 31.53  ? 44  PRO A CA  1 
ATOM   284  C C   . PRO A 1 44  ? -34.866 -3.652  -0.827  1.00 30.44  ? 44  PRO A C   1 
ATOM   285  O O   . PRO A 1 44  ? -35.793 -3.238  -0.136  1.00 32.03  ? 44  PRO A O   1 
ATOM   286  C CB  . PRO A 1 44  ? -35.238 -6.093  -0.985  1.00 29.21  ? 44  PRO A CB  1 
ATOM   287  C CG  . PRO A 1 44  ? -33.906 -6.785  -1.192  1.00 28.51  ? 44  PRO A CG  1 
ATOM   288  C CD  . PRO A 1 44  ? -33.434 -6.405  -2.564  1.00 28.95  ? 44  PRO A CD  1 
ATOM   289  N N   . ARG A 1 45  ? -33.613 -3.203  -0.740  1.00 30.02  ? 45  ARG A N   1 
ATOM   290  C CA  . ARG A 1 45  ? -33.195 -2.114  0.175   1.00 34.33  ? 45  ARG A CA  1 
ATOM   291  C C   . ARG A 1 45  ? -33.348 -0.729  -0.483  1.00 33.16  ? 45  ARG A C   1 
ATOM   292  O O   . ARG A 1 45  ? -33.266 0.307   0.209   1.00 32.73  ? 45  ARG A O   1 
ATOM   293  C CB  . ARG A 1 45  ? -31.723 -2.267  0.648   1.00 37.53  ? 45  ARG A CB  1 
ATOM   294  C CG  . ARG A 1 45  ? -31.455 -3.149  1.853   1.00 40.16  ? 45  ARG A CG  1 
ATOM   295  C CD  . ARG A 1 45  ? -30.049 -3.702  1.640   1.00 52.44  ? 45  ARG A CD  1 
ATOM   296  N NE  . ARG A 1 45  ? -29.526 -4.538  2.738   1.00 67.14  ? 45  ARG A NE  1 
ATOM   297  C CZ  . ARG A 1 45  ? -29.715 -5.863  2.898   1.00 71.01  ? 45  ARG A CZ  1 
ATOM   298  N NH1 . ARG A 1 45  ? -30.441 -6.598  2.041   1.00 67.38  ? 45  ARG A NH1 1 
ATOM   299  N NH2 . ARG A 1 45  ? -29.178 -6.467  3.951   1.00 68.18  ? 45  ARG A NH2 1 
ATOM   300  N N   . ARG A 1 46  ? -33.544 -0.720  -1.816  1.00 31.49  ? 46  ARG A N   1 
ATOM   301  C CA  . ARG A 1 46  ? -33.798 0.509   -2.561  1.00 25.51  ? 46  ARG A CA  1 
ATOM   302  C C   . ARG A 1 46  ? -34.947 1.170   -1.874  1.00 24.58  ? 46  ARG A C   1 
ATOM   303  O O   . ARG A 1 46  ? -35.959 0.514   -1.692  1.00 22.39  ? 46  ARG A O   1 
ATOM   304  C CB  . ARG A 1 46  ? -34.160 0.268   -4.013  1.00 23.08  ? 46  ARG A CB  1 
ATOM   305  C CG  . ARG A 1 46  ? -34.343 1.611   -4.685  1.00 22.36  ? 46  ARG A CG  1 
ATOM   306  C CD  . ARG A 1 46  ? -34.832 1.542   -6.104  1.00 21.47  ? 46  ARG A CD  1 
ATOM   307  N NE  . ARG A 1 46  ? -33.776 1.287   -7.084  1.00 21.46  ? 46  ARG A NE  1 
ATOM   308  C CZ  . ARG A 1 46  ? -34.064 0.887   -8.325  1.00 22.04  ? 46  ARG A CZ  1 
ATOM   309  N NH1 . ARG A 1 46  ? -35.357 0.705   -8.667  1.00 21.46  ? 46  ARG A NH1 1 
ATOM   310  N NH2 . ARG A 1 46  ? -33.112 0.692   -9.232  1.00 19.23  ? 46  ARG A NH2 1 
ATOM   311  N N   . PHE A 1 47  ? -34.762 2.435   -1.461  1.00 25.53  ? 47  PHE A N   1 
ATOM   312  C CA  . PHE A 1 47  ? -35.784 3.235   -0.746  1.00 28.59  ? 47  PHE A CA  1 
ATOM   313  C C   . PHE A 1 47  ? -35.882 3.112   0.792   1.00 30.45  ? 47  PHE A C   1 
ATOM   314  O O   . PHE A 1 47  ? -36.576 3.939   1.399   1.00 30.63  ? 47  PHE A O   1 
ATOM   315  C CB  . PHE A 1 47  ? -37.198 3.019   -1.305  1.00 26.08  ? 47  PHE A CB  1 
ATOM   316  C CG  . PHE A 1 47  ? -37.334 3.390   -2.736  1.00 26.15  ? 47  PHE A CG  1 
ATOM   317  C CD1 . PHE A 1 47  ? -37.036 4.671   -3.165  1.00 26.63  ? 47  PHE A CD1 1 
ATOM   318  C CD2 . PHE A 1 47  ? -37.796 2.464   -3.665  1.00 25.46  ? 47  PHE A CD2 1 
ATOM   319  C CE1 . PHE A 1 47  ? -37.173 5.003   -4.511  1.00 25.56  ? 47  PHE A CE1 1 
ATOM   320  C CE2 . PHE A 1 47  ? -37.915 2.802   -5.003  1.00 23.38  ? 47  PHE A CE2 1 
ATOM   321  C CZ  . PHE A 1 47  ? -37.599 4.065   -5.424  1.00 22.10  ? 47  PHE A CZ  1 
ATOM   322  N N   . LEU A 1 48  ? -35.242 2.091   1.395   1.00 30.38  ? 48  LEU A N   1 
ATOM   323  C CA  . LEU A 1 48  ? -35.211 1.899   2.876   1.00 27.40  ? 48  LEU A CA  1 
ATOM   324  C C   . LEU A 1 48  ? -34.082 2.659   3.596   1.00 26.30  ? 48  LEU A C   1 
ATOM   325  O O   . LEU A 1 48  ? -33.084 3.073   2.954   1.00 25.02  ? 48  LEU A O   1 
ATOM   326  C CB  . LEU A 1 48  ? -35.099 0.425   3.230   1.00 26.62  ? 48  LEU A CB  1 
ATOM   327  C CG  . LEU A 1 48  ? -36.157 -0.532  2.654   1.00 27.40  ? 48  LEU A CG  1 
ATOM   328  C CD1 . LEU A 1 48  ? -35.771 -1.994  2.951   1.00 24.24  ? 48  LEU A CD1 1 
ATOM   329  C CD2 . LEU A 1 48  ? -37.585 -0.170  3.056   1.00 25.12  ? 48  LEU A CD2 1 
ATOM   330  N N   . PRO A 1 49  ? -34.247 2.877   4.924   1.00 25.81  ? 49  PRO A N   1 
ATOM   331  C CA  . PRO A 1 49  ? -33.212 3.511   5.771   1.00 24.92  ? 49  PRO A CA  1 
ATOM   332  C C   . PRO A 1 49  ? -31.941 2.743   5.633   1.00 25.25  ? 49  PRO A C   1 
ATOM   333  O O   . PRO A 1 49  ? -31.996 1.611   5.261   1.00 27.77  ? 49  PRO A O   1 
ATOM   334  C CB  . PRO A 1 49  ? -33.766 3.339   7.166   1.00 23.30  ? 49  PRO A CB  1 
ATOM   335  C CG  . PRO A 1 49  ? -35.242 3.369   7.014   1.00 23.96  ? 49  PRO A CG  1 
ATOM   336  C CD  . PRO A 1 49  ? -35.562 2.859   5.612   1.00 26.57  ? 49  PRO A CD  1 
ATOM   337  N N   . PRO A 1 50  ? -30.784 3.351   5.872   1.00 27.19  ? 50  PRO A N   1 
ATOM   338  C CA  . PRO A 1 50  ? -29.593 2.509   5.623   1.00 27.94  ? 50  PRO A CA  1 
ATOM   339  C C   . PRO A 1 50  ? -29.406 1.604   6.798   1.00 33.28  ? 50  PRO A C   1 
ATOM   340  O O   . PRO A 1 50  ? -29.956 1.895   7.886   1.00 35.18  ? 50  PRO A O   1 
ATOM   341  C CB  . PRO A 1 50  ? -28.445 3.491   5.580   1.00 27.02  ? 50  PRO A CB  1 
ATOM   342  C CG  . PRO A 1 50  ? -28.955 4.780   6.162   1.00 27.83  ? 50  PRO A CG  1 
ATOM   343  C CD  . PRO A 1 50  ? -30.456 4.710   6.327   1.00 26.66  ? 50  PRO A CD  1 
ATOM   344  N N   . GLU A 1 51  ? -28.705 0.492   6.584   1.00 35.83  ? 51  GLU A N   1 
ATOM   345  C CA  . GLU A 1 51  ? -28.342 -0.403  7.678   1.00 35.87  ? 51  GLU A CA  1 
ATOM   346  C C   . GLU A 1 51  ? -26.835 -0.289  7.834   1.00 35.71  ? 51  GLU A C   1 
ATOM   347  O O   . GLU A 1 51  ? -26.135 -0.081  6.836   1.00 38.18  ? 51  GLU A O   1 
ATOM   348  C CB  . GLU A 1 51  ? -28.741 -1.825  7.361   1.00 38.40  ? 51  GLU A CB  1 
ATOM   349  C CG  . GLU A 1 51  ? -30.235 -2.092  7.346   1.00 52.17  ? 51  GLU A CG  1 
ATOM   350  C CD  . GLU A 1 51  ? -30.588 -3.074  6.211   1.00 70.27  ? 51  GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 51  ? -29.684 -3.905  5.855   1.00 61.05  ? 51  GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 51  ? -31.738 -3.005  5.643   1.00 75.07  ? 51  GLU A OE2 1 
ATOM   353  N N   . PRO A 1 52  ? -26.299 -0.439  9.075   1.00 35.70  ? 52  PRO A N   1 
ATOM   354  C CA  . PRO A 1 52  ? -24.809 -0.301  9.256   1.00 33.17  ? 52  PRO A CA  1 
ATOM   355  C C   . PRO A 1 52  ? -23.992 -1.381  8.530   1.00 31.59  ? 52  PRO A C   1 
ATOM   356  O O   . PRO A 1 52  ? -24.442 -2.562  8.406   1.00 27.68  ? 52  PRO A O   1 
ATOM   357  C CB  . PRO A 1 52  ? -24.617 -0.408  10.772  1.00 30.73  ? 52  PRO A CB  1 
ATOM   358  C CG  . PRO A 1 52  ? -25.997 -0.247  11.340  1.00 31.67  ? 52  PRO A CG  1 
ATOM   359  C CD  . PRO A 1 52  ? -26.964 -0.797  10.338  1.00 31.24  ? 52  PRO A CD  1 
ATOM   360  N N   . LYS A 1 53  ? -22.841 -0.945  8.017   1.00 29.63  ? 53  LYS A N   1 
ATOM   361  C CA  . LYS A 1 53  ? -21.887 -1.817  7.329   1.00 29.34  ? 53  LYS A CA  1 
ATOM   362  C C   . LYS A 1 53  ? -21.373 -2.938  8.229   1.00 33.26  ? 53  LYS A C   1 
ATOM   363  O O   . LYS A 1 53  ? -20.879 -2.698  9.352   1.00 30.37  ? 53  LYS A O   1 
ATOM   364  C CB  . LYS A 1 53  ? -20.720 -0.974  6.858   1.00 28.39  ? 53  LYS A CB  1 
ATOM   365  C CG  . LYS A 1 53  ? -19.653 -1.669  6.052   1.00 27.73  ? 53  LYS A CG  1 
ATOM   366  C CD  . LYS A 1 53  ? -20.174 -2.620  4.998   1.00 27.33  ? 53  LYS A CD  1 
ATOM   367  C CE  . LYS A 1 53  ? -18.975 -3.223  4.276   1.00 25.42  ? 53  LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 53  ? -19.348 -4.036  3.093   1.00 25.13  ? 53  LYS A NZ  1 
ATOM   369  N N   . GLN A 1 54  ? -21.502 -4.165  7.711   1.00 38.70  ? 54  GLN A N   1 
ATOM   370  C CA  . GLN A 1 54  ? -21.024 -5.427  8.343   1.00 38.03  ? 54  GLN A CA  1 
ATOM   371  C C   . GLN A 1 54  ? -19.517 -5.480  8.413   1.00 33.46  ? 54  GLN A C   1 
ATOM   372  O O   . GLN A 1 54  ? -18.860 -4.946  7.530   1.00 34.84  ? 54  GLN A O   1 
ATOM   373  C CB  . GLN A 1 54  ? -21.523 -6.632  7.540   1.00 43.86  ? 54  GLN A CB  1 
ATOM   374  C CG  . GLN A 1 54  ? -22.985 -6.979  7.792   1.00 47.06  ? 54  GLN A CG  1 
ATOM   375  C CD  . GLN A 1 54  ? -23.232 -7.148  9.283   1.00 57.42  ? 54  GLN A CD  1 
ATOM   376  O OE1 . GLN A 1 54  ? -22.859 -8.164  9.884   1.00 74.41  ? 54  GLN A OE1 1 
ATOM   377  N NE2 . GLN A 1 54  ? -23.814 -6.138  9.900   1.00 56.67  ? 54  GLN A NE2 1 
ATOM   378  N N   . PRO A 1 55  ? -18.947 -6.097  9.471   1.00 33.46  ? 55  PRO A N   1 
ATOM   379  C CA  . PRO A 1 55  ? -17.450 -6.013  9.462   1.00 30.05  ? 55  PRO A CA  1 
ATOM   380  C C   . PRO A 1 55  ? -16.793 -6.864  8.369   1.00 30.43  ? 55  PRO A C   1 
ATOM   381  O O   . PRO A 1 55  ? -17.425 -7.706  7.728   1.00 28.98  ? 55  PRO A O   1 
ATOM   382  C CB  . PRO A 1 55  ? -17.064 -6.454  10.869  1.00 27.37  ? 55  PRO A CB  1 
ATOM   383  C CG  . PRO A 1 55  ? -18.327 -6.189  11.704  1.00 27.72  ? 55  PRO A CG  1 
ATOM   384  C CD  . PRO A 1 55  ? -19.476 -6.529  10.790  1.00 28.65  ? 55  PRO A CD  1 
ATOM   385  N N   . TRP A 1 56  ? -15.537 -6.608  8.095   1.00 34.16  ? 56  TRP A N   1 
ATOM   386  C CA  . TRP A 1 56  ? -14.889 -7.310  6.990   1.00 35.11  ? 56  TRP A CA  1 
ATOM   387  C C   . TRP A 1 56  ? -13.526 -7.844  7.448   1.00 38.97  ? 56  TRP A C   1 
ATOM   388  O O   . TRP A 1 56  ? -12.838 -7.249  8.310   1.00 39.01  ? 56  TRP A O   1 
ATOM   389  C CB  . TRP A 1 56  ? -14.706 -6.364  5.807   1.00 29.66  ? 56  TRP A CB  1 
ATOM   390  C CG  . TRP A 1 56  ? -13.872 -5.131  6.135   1.00 29.12  ? 56  TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 56  ? -12.503 -4.982  6.012   1.00 29.71  ? 56  TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 56  ? -14.358 -3.864  6.622   1.00 30.32  ? 56  TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 56  ? -12.102 -3.700  6.406   1.00 29.78  ? 56  TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 56  ? -13.220 -2.997  6.781   1.00 30.31  ? 56  TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 56  ? -15.639 -3.365  6.933   1.00 27.51  ? 56  TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 56  ? -13.344 -1.664  7.239   1.00 26.88  ? 56  TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 56  ? -15.741 -2.045  7.414   1.00 24.83  ? 56  TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 56  ? -14.602 -1.223  7.568   1.00 23.53  ? 56  TRP A CH2 1 
ATOM   399  N N   . SER A 1 57  ? -13.119 -8.966  6.872   1.00 42.12  ? 57  SER A N   1 
ATOM   400  C CA  . SER A 1 57  ? -11.744 -9.429  7.084   1.00 42.29  ? 57  SER A CA  1 
ATOM   401  C C   . SER A 1 57  ? -10.806 -8.793  6.057   1.00 39.18  ? 57  SER A C   1 
ATOM   402  O O   . SER A 1 57  ? -11.204 -8.312  5.010   1.00 40.72  ? 57  SER A O   1 
ATOM   403  C CB  . SER A 1 57  ? -11.716 -10.933 6.978   1.00 42.33  ? 57  SER A CB  1 
ATOM   404  O OG  . SER A 1 57  ? -12.420 -11.304 5.800   1.00 47.01  ? 57  SER A OG  1 
ATOM   405  N N   . GLY A 1 58  ? -9.534  -8.774  6.337   1.00 40.88  ? 58  GLY A N   1 
ATOM   406  C CA  . GLY A 1 58  ? -8.637  -8.256  5.328   1.00 38.36  ? 58  GLY A CA  1 
ATOM   407  C C   . GLY A 1 58  ? -8.567  -6.781  5.489   1.00 38.11  ? 58  GLY A C   1 
ATOM   408  O O   . GLY A 1 58  ? -9.041  -6.228  6.495   1.00 42.24  ? 58  GLY A O   1 
ATOM   409  N N   . VAL A 1 59  ? -7.944  -6.162  4.498   1.00 39.03  ? 59  VAL A N   1 
ATOM   410  C CA  . VAL A 1 59  ? -7.629  -4.721  4.475   1.00 35.35  ? 59  VAL A CA  1 
ATOM   411  C C   . VAL A 1 59  ? -8.420  -4.099  3.310   1.00 34.72  ? 59  VAL A C   1 
ATOM   412  O O   . VAL A 1 59  ? -8.223  -4.494  2.187   1.00 35.11  ? 59  VAL A O   1 
ATOM   413  C CB  . VAL A 1 59  ? -6.145  -4.533  4.178   1.00 30.57  ? 59  VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 59  ? -5.796  -3.049  4.018   1.00 28.96  ? 59  VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 59  ? -5.304  -5.265  5.215   1.00 28.08  ? 59  VAL A CG2 1 
ATOM   416  N N   . VAL A 1 60  ? -9.327  -3.164  3.582   1.00 32.48  ? 60  VAL A N   1 
ATOM   417  C CA  . VAL A 1 60  ? -10.097 -2.515  2.534   1.00 28.85  ? 60  VAL A CA  1 
ATOM   418  C C   . VAL A 1 60  ? -9.256  -1.400  1.896   1.00 30.09  ? 60  VAL A C   1 
ATOM   419  O O   . VAL A 1 60  ? -8.564  -0.613  2.607   1.00 28.79  ? 60  VAL A O   1 
ATOM   420  C CB  . VAL A 1 60  ? -11.399 -1.956  3.104   1.00 26.55  ? 60  VAL A CB  1 
ATOM   421  C CG1 . VAL A 1 60  ? -11.871 -0.815  2.246   1.00 25.25  ? 60  VAL A CG1 1 
ATOM   422  C CG2 . VAL A 1 60  ? -12.456 -3.044  3.188   1.00 23.96  ? 60  VAL A CG2 1 
ATOM   423  N N   . ASP A 1 61  ? -9.257  -1.347  0.561   1.00 29.59  ? 61  ASP A N   1 
ATOM   424  C CA  . ASP A 1 61  ? -8.453  -0.294  -0.074  1.00 31.05  ? 61  ASP A CA  1 
ATOM   425  C C   . ASP A 1 61  ? -9.155  1.049   0.038   1.00 30.68  ? 61  ASP A C   1 
ATOM   426  O O   . ASP A 1 61  ? -10.266 1.165   -0.428  1.00 32.98  ? 61  ASP A O   1 
ATOM   427  C CB  . ASP A 1 61  ? -8.139  -0.587  -1.554  1.00 30.81  ? 61  ASP A CB  1 
ATOM   428  C CG  . ASP A 1 61  ? -7.089  0.380   -2.117  1.00 33.63  ? 61  ASP A CG  1 
ATOM   429  O OD1 . ASP A 1 61  ? -7.349  1.618   -2.126  1.00 35.36  ? 61  ASP A OD1 1 
ATOM   430  O OD2 . ASP A 1 61  ? -5.976  -0.079  -2.496  1.00 33.14  ? 61  ASP A OD2 1 
ATOM   431  N N   . ALA A 1 62  ? -8.518  2.057   0.629   1.00 29.57  ? 62  ALA A N   1 
ATOM   432  C CA  . ALA A 1 62  ? -9.135  3.393   0.733   1.00 27.20  ? 62  ALA A CA  1 
ATOM   433  C C   . ALA A 1 62  ? -8.238  4.456   0.126   1.00 28.64  ? 62  ALA A C   1 
ATOM   434  O O   . ALA A 1 62  ? -7.883  5.468   0.768   1.00 28.21  ? 62  ALA A O   1 
ATOM   435  C CB  . ALA A 1 62  ? -9.400  3.743   2.172   1.00 24.65  ? 62  ALA A CB  1 
ATOM   436  N N   . THR A 1 63  ? -7.855  4.245   -1.116  1.00 27.70  ? 63  THR A N   1 
ATOM   437  C CA  . THR A 1 63  ? -6.862  5.139   -1.691  1.00 30.21  ? 63  THR A CA  1 
ATOM   438  C C   . THR A 1 63  ? -7.512  5.926   -2.839  1.00 29.26  ? 63  THR A C   1 
ATOM   439  O O   . THR A 1 63  ? -6.865  6.692   -3.570  1.00 31.47  ? 63  THR A O   1 
ATOM   440  C CB  . THR A 1 63  ? -5.640  4.332   -2.189  1.00 29.59  ? 63  THR A CB  1 
ATOM   441  O OG1 . THR A 1 63  ? -6.086  3.493   -3.262  1.00 28.48  ? 63  THR A OG1 1 
ATOM   442  C CG2 . THR A 1 63  ? -5.114  3.428   -1.076  1.00 27.06  ? 63  THR A CG2 1 
ATOM   443  N N   . THR A 1 64  ? -8.807  5.747   -2.974  1.00 27.45  ? 64  THR A N   1 
ATOM   444  C CA  . THR A 1 64  ? -9.452  6.231   -4.141  1.00 29.73  ? 64  THR A CA  1 
ATOM   445  C C   . THR A 1 64  ? -10.913 6.464   -3.832  1.00 27.77  ? 64  THR A C   1 
ATOM   446  O O   . THR A 1 64  ? -11.491 5.687   -3.076  1.00 28.72  ? 64  THR A O   1 
ATOM   447  C CB  . THR A 1 64  ? -9.261  5.212   -5.281  1.00 31.03  ? 64  THR A CB  1 
ATOM   448  O OG1 . THR A 1 64  ? -9.524  5.906   -6.472  1.00 39.78  ? 64  THR A OG1 1 
ATOM   449  C CG2 . THR A 1 64  ? -10.197 3.945   -5.181  1.00 29.15  ? 64  THR A CG2 1 
ATOM   450  N N   . PHE A 1 65  ? -11.499 7.518   -4.388  1.00 23.73  ? 65  PHE A N   1 
ATOM   451  C CA  . PHE A 1 65  ? -12.951 7.757   -4.191  1.00 22.66  ? 65  PHE A CA  1 
ATOM   452  C C   . PHE A 1 65  ? -13.841 6.643   -4.687  1.00 21.32  ? 65  PHE A C   1 
ATOM   453  O O   . PHE A 1 65  ? -13.612 6.116   -5.766  1.00 23.05  ? 65  PHE A O   1 
ATOM   454  C CB  . PHE A 1 65  ? -13.420 9.072   -4.854  1.00 21.61  ? 65  PHE A CB  1 
ATOM   455  C CG  . PHE A 1 65  ? -12.926 10.293  -4.141  1.00 22.36  ? 65  PHE A CG  1 
ATOM   456  C CD1 . PHE A 1 65  ? -13.362 10.573  -2.828  1.00 21.98  ? 65  PHE A CD1 1 
ATOM   457  C CD2 . PHE A 1 65  ? -11.986 11.163  -4.750  1.00 21.47  ? 65  PHE A CD2 1 
ATOM   458  C CE1 . PHE A 1 65  ? -12.886 11.714  -2.157  1.00 22.10  ? 65  PHE A CE1 1 
ATOM   459  C CE2 . PHE A 1 65  ? -11.503 12.287  -4.074  1.00 20.14  ? 65  PHE A CE2 1 
ATOM   460  C CZ  . PHE A 1 65  ? -11.974 12.580  -2.798  1.00 21.04  ? 65  PHE A CZ  1 
ATOM   461  N N   . GLN A 1 66  ? -14.880 6.319   -3.937  1.00 19.40  ? 66  GLN A N   1 
ATOM   462  C CA  . GLN A 1 66  ? -15.869 5.394   -4.438  1.00 20.11  ? 66  GLN A CA  1 
ATOM   463  C C   . GLN A 1 66  ? -16.918 5.992   -5.434  1.00 20.66  ? 66  GLN A C   1 
ATOM   464  O O   . GLN A 1 66  ? -16.817 7.141   -5.843  1.00 20.46  ? 66  GLN A O   1 
ATOM   465  C CB  . GLN A 1 66  ? -16.551 4.761   -3.252  1.00 21.01  ? 66  GLN A CB  1 
ATOM   466  C CG  . GLN A 1 66  ? -15.849 3.515   -2.816  1.00 24.90  ? 66  GLN A CG  1 
ATOM   467  C CD  . GLN A 1 66  ? -16.068 2.344   -3.774  1.00 27.56  ? 66  GLN A CD  1 
ATOM   468  O OE1 . GLN A 1 66  ? -17.036 2.311   -4.555  1.00 29.61  ? 66  GLN A OE1 1 
ATOM   469  N NE2 . GLN A 1 66  ? -15.172 1.373   -3.716  1.00 26.97  ? 66  GLN A NE2 1 
ATOM   470  N N   . SER A 1 67  ? -17.913 5.193   -5.833  1.00 21.05  ? 67  SER A N   1 
ATOM   471  C CA  . SER A 1 67  ? -18.977 5.577   -6.756  1.00 20.83  ? 67  SER A CA  1 
ATOM   472  C C   . SER A 1 67  ? -19.882 6.723   -6.282  1.00 23.89  ? 67  SER A C   1 
ATOM   473  O O   . SER A 1 67  ? -20.310 6.774   -5.108  1.00 28.20  ? 67  SER A O   1 
ATOM   474  C CB  . SER A 1 67  ? -19.868 4.368   -6.974  1.00 20.44  ? 67  SER A CB  1 
ATOM   475  O OG  . SER A 1 67  ? -19.292 3.481   -7.895  1.00 20.89  ? 67  SER A OG  1 
ATOM   476  N N   . VAL A 1 68  ? -20.219 7.606   -7.224  1.00 23.13  ? 68  VAL A N   1 
ATOM   477  C CA  . VAL A 1 68  ? -21.268 8.623   -7.087  1.00 20.88  ? 68  VAL A CA  1 
ATOM   478  C C   . VAL A 1 68  ? -22.674 8.020   -7.041  1.00 21.68  ? 68  VAL A C   1 
ATOM   479  O O   . VAL A 1 68  ? -22.970 7.099   -7.814  1.00 23.65  ? 68  VAL A O   1 
ATOM   480  C CB  . VAL A 1 68  ? -21.171 9.591   -8.271  1.00 19.35  ? 68  VAL A CB  1 
ATOM   481  C CG1 . VAL A 1 68  ? -22.239 10.677  -8.211  1.00 18.03  ? 68  VAL A CG1 1 
ATOM   482  C CG2 . VAL A 1 68  ? -19.766 10.185  -8.293  1.00 19.68  ? 68  VAL A CG2 1 
ATOM   483  N N   . CYS A 1 69  ? -23.556 8.535   -6.173  1.00 22.84  ? 69  CYS A N   1 
ATOM   484  C CA  . CYS A 1 69  ? -24.921 7.974   -6.130  1.00 23.04  ? 69  CYS A CA  1 
ATOM   485  C C   . CYS A 1 69  ? -25.677 8.404   -7.340  1.00 22.73  ? 69  CYS A C   1 
ATOM   486  O O   . CYS A 1 69  ? -25.400 9.487   -7.880  1.00 20.67  ? 69  CYS A O   1 
ATOM   487  C CB  . CYS A 1 69  ? -25.701 8.454   -4.931  1.00 24.26  ? 69  CYS A CB  1 
ATOM   488  S SG  . CYS A 1 69  ? -25.054 7.912   -3.345  1.00 24.91  ? 69  CYS A SG  1 
ATOM   489  N N   . TYR A 1 70  ? -26.659 7.593   -7.734  1.00 22.75  ? 70  TYR A N   1 
ATOM   490  C CA  . TYR A 1 70  ? -27.384 7.871   -8.978  1.00 22.17  ? 70  TYR A CA  1 
ATOM   491  C C   . TYR A 1 70  ? -28.012 9.251   -9.043  1.00 21.90  ? 70  TYR A C   1 
ATOM   492  O O   . TYR A 1 70  ? -28.651 9.654   -8.095  1.00 24.02  ? 70  TYR A O   1 
ATOM   493  C CB  . TYR A 1 70  ? -28.454 6.853   -9.184  1.00 21.40  ? 70  TYR A CB  1 
ATOM   494  C CG  . TYR A 1 70  ? -28.000 5.817   -10.156 1.00 24.98  ? 70  TYR A CG  1 
ATOM   495  C CD1 . TYR A 1 70  ? -28.037 6.072   -11.527 1.00 25.62  ? 70  TYR A CD1 1 
ATOM   496  C CD2 . TYR A 1 70  ? -27.530 4.557   -9.718  1.00 25.24  ? 70  TYR A CD2 1 
ATOM   497  C CE1 . TYR A 1 70  ? -27.631 5.128   -12.431 1.00 26.21  ? 70  TYR A CE1 1 
ATOM   498  C CE2 . TYR A 1 70  ? -27.121 3.620   -10.619 1.00 25.56  ? 70  TYR A CE2 1 
ATOM   499  C CZ  . TYR A 1 70  ? -27.187 3.926   -11.967 1.00 26.39  ? 70  TYR A CZ  1 
ATOM   500  O OH  . TYR A 1 70  ? -26.792 3.019   -12.872 1.00 26.83  ? 70  TYR A OH  1 
ATOM   501  N N   . GLN A 1 71  ? -27.853 9.950   -10.167 1.00 20.67  ? 71  GLN A N   1 
ATOM   502  C CA  . GLN A 1 71  ? -28.317 11.313  -10.278 1.00 19.81  ? 71  GLN A CA  1 
ATOM   503  C C   . GLN A 1 71  ? -28.386 11.836  -11.702 1.00 20.93  ? 71  GLN A C   1 
ATOM   504  O O   . GLN A 1 71  ? -27.562 11.467  -12.559 1.00 21.24  ? 71  GLN A O   1 
ATOM   505  C CB  . GLN A 1 71  ? -27.451 12.247  -9.417  1.00 17.67  ? 71  GLN A CB  1 
ATOM   506  C CG  . GLN A 1 71  ? -26.010 12.398  -9.840  1.00 17.17  ? 71  GLN A CG  1 
ATOM   507  C CD  . GLN A 1 71  ? -25.181 13.128  -8.806  1.00 17.67  ? 71  GLN A CD  1 
ATOM   508  O OE1 . GLN A 1 71  ? -24.903 14.314  -8.947  1.00 20.09  ? 71  GLN A OE1 1 
ATOM   509  N NE2 . GLN A 1 71  ? -24.782 12.435  -7.772  1.00 16.61  ? 71  GLN A NE2 1 
ATOM   510  N N   . TYR A 1 72  ? -29.363 12.725  -11.932 1.00 21.01  ? 72  TYR A N   1 
ATOM   511  C CA  . TYR A 1 72  ? -29.428 13.531  -13.127 1.00 19.49  ? 72  TYR A CA  1 
ATOM   512  C C   . TYR A 1 72  ? -28.091 14.276  -13.353 1.00 19.11  ? 72  TYR A C   1 
ATOM   513  O O   . TYR A 1 72  ? -27.454 14.729  -12.419 1.00 19.41  ? 72  TYR A O   1 
ATOM   514  C CB  . TYR A 1 72  ? -30.572 14.517  -13.018 1.00 21.16  ? 72  TYR A CB  1 
ATOM   515  C CG  . TYR A 1 72  ? -30.512 15.479  -14.169 1.00 26.62  ? 72  TYR A CG  1 
ATOM   516  C CD1 . TYR A 1 72  ? -31.157 15.184  -15.429 1.00 24.93  ? 72  TYR A CD1 1 
ATOM   517  C CD2 . TYR A 1 72  ? -29.769 16.677  -14.055 1.00 25.40  ? 72  TYR A CD2 1 
ATOM   518  C CE1 . TYR A 1 72  ? -31.053 16.065  -16.507 1.00 25.34  ? 72  TYR A CE1 1 
ATOM   519  C CE2 . TYR A 1 72  ? -29.683 17.543  -15.136 1.00 28.16  ? 72  TYR A CE2 1 
ATOM   520  C CZ  . TYR A 1 72  ? -30.308 17.232  -16.361 1.00 28.76  ? 72  TYR A CZ  1 
ATOM   521  O OH  . TYR A 1 72  ? -30.144 18.131  -17.416 1.00 34.68  ? 72  TYR A OH  1 
ATOM   522  N N   . VAL A 1 73  ? -27.667 14.388  -14.603 1.00 18.30  ? 73  VAL A N   1 
ATOM   523  C CA  . VAL A 1 73  ? -26.409 15.029  -14.982 1.00 17.34  ? 73  VAL A CA  1 
ATOM   524  C C   . VAL A 1 73  ? -26.767 16.227  -15.777 1.00 19.04  ? 73  VAL A C   1 
ATOM   525  O O   . VAL A 1 73  ? -27.434 16.100  -16.833 1.00 22.28  ? 73  VAL A O   1 
ATOM   526  C CB  . VAL A 1 73  ? -25.563 14.128  -15.946 1.00 15.54  ? 73  VAL A CB  1 
ATOM   527  C CG1 . VAL A 1 73  ? -24.326 14.824  -16.430 1.00 15.44  ? 73  VAL A CG1 1 
ATOM   528  C CG2 . VAL A 1 73  ? -25.117 12.864  -15.265 1.00 14.84  ? 73  VAL A CG2 1 
ATOM   529  N N   . ASP A 1 74  ? -26.294 17.389  -15.354 1.00 21.19  ? 74  ASP A N   1 
ATOM   530  C CA  . ASP A 1 74  ? -26.477 18.578  -16.193 1.00 25.66  ? 74  ASP A CA  1 
ATOM   531  C C   . ASP A 1 74  ? -25.689 18.495  -17.516 1.00 28.25  ? 74  ASP A C   1 
ATOM   532  O O   . ASP A 1 74  ? -24.468 18.226  -17.519 1.00 22.59  ? 74  ASP A O   1 
ATOM   533  C CB  . ASP A 1 74  ? -26.102 19.854  -15.474 1.00 26.91  ? 74  ASP A CB  1 
ATOM   534  C CG  . ASP A 1 74  ? -26.215 21.087  -16.377 1.00 29.44  ? 74  ASP A CG  1 
ATOM   535  O OD1 . ASP A 1 74  ? -25.561 21.148  -17.509 1.00 28.04  ? 74  ASP A OD1 1 
ATOM   536  O OD2 . ASP A 1 74  ? -26.981 21.981  -15.904 1.00 31.27  ? 74  ASP A OD2 1 
ATOM   537  N N   . THR A 1 75  ? -26.395 18.750  -18.632 1.00 31.68  ? 75  THR A N   1 
ATOM   538  C CA  . THR A 1 75  ? -25.747 18.614  -19.943 1.00 33.39  ? 75  THR A CA  1 
ATOM   539  C C   . THR A 1 75  ? -26.140 19.743  -20.878 1.00 37.84  ? 75  THR A C   1 
ATOM   540  O O   . THR A 1 75  ? -25.824 19.676  -22.077 1.00 39.70  ? 75  THR A O   1 
ATOM   541  C CB  . THR A 1 75  ? -25.994 17.250  -20.644 1.00 29.58  ? 75  THR A CB  1 
ATOM   542  O OG1 . THR A 1 75  ? -27.390 17.023  -20.737 1.00 30.71  ? 75  THR A OG1 1 
ATOM   543  C CG2 . THR A 1 75  ? -25.390 16.106  -19.894 1.00 28.60  ? 75  THR A CG2 1 
ATOM   544  N N   . LEU A 1 76  ? -26.781 20.792  -20.348 1.00 39.12  ? 76  LEU A N   1 
ATOM   545  C CA  . LEU A 1 76  ? -26.970 22.026  -21.135 1.00 40.20  ? 76  LEU A CA  1 
ATOM   546  C C   . LEU A 1 76  ? -25.742 22.571  -21.924 1.00 44.18  ? 76  LEU A C   1 
ATOM   547  O O   . LEU A 1 76  ? -25.920 23.314  -22.887 1.00 52.53  ? 76  LEU A O   1 
ATOM   548  C CB  . LEU A 1 76  ? -27.436 23.121  -20.236 1.00 40.34  ? 76  LEU A CB  1 
ATOM   549  C CG  . LEU A 1 76  ? -28.925 23.308  -20.130 1.00 47.97  ? 76  LEU A CG  1 
ATOM   550  C CD1 . LEU A 1 76  ? -29.508 22.114  -19.379 1.00 46.00  ? 76  LEU A CD1 1 
ATOM   551  C CD2 . LEU A 1 76  ? -29.192 24.690  -19.447 1.00 50.40  ? 76  LEU A CD2 1 
ATOM   552  N N   . TYR A 1 77  ? -24.513 22.244  -21.518 1.00 39.71  ? 77  TYR A N   1 
ATOM   553  C CA  . TYR A 1 77  ? -23.383 22.994  -21.985 1.00 33.88  ? 77  TYR A CA  1 
ATOM   554  C C   . TYR A 1 77  ? -22.161 22.141  -21.936 1.00 34.46  ? 77  TYR A C   1 
ATOM   555  O O   . TYR A 1 77  ? -21.230 22.406  -21.184 1.00 34.04  ? 77  TYR A O   1 
ATOM   556  C CB  . TYR A 1 77  ? -23.113 24.173  -21.071 1.00 31.42  ? 77  TYR A CB  1 
ATOM   557  C CG  . TYR A 1 77  ? -24.199 25.176  -20.911 1.00 32.20  ? 77  TYR A CG  1 
ATOM   558  C CD1 . TYR A 1 77  ? -24.434 26.136  -21.873 1.00 33.29  ? 77  TYR A CD1 1 
ATOM   559  C CD2 . TYR A 1 77  ? -24.940 25.225  -19.759 1.00 33.65  ? 77  TYR A CD2 1 
ATOM   560  C CE1 . TYR A 1 77  ? -25.403 27.113  -21.703 1.00 34.09  ? 77  TYR A CE1 1 
ATOM   561  C CE2 . TYR A 1 77  ? -25.919 26.193  -19.564 1.00 37.79  ? 77  TYR A CE2 1 
ATOM   562  C CZ  . TYR A 1 77  ? -26.163 27.131  -20.544 1.00 38.07  ? 77  TYR A CZ  1 
ATOM   563  O OH  . TYR A 1 77  ? -27.147 28.096  -20.343 1.00 38.37  ? 77  TYR A OH  1 
ATOM   564  N N   . PRO A 1 78  ? -22.110 21.128  -22.783 1.00 36.12  ? 78  PRO A N   1 
ATOM   565  C CA  . PRO A 1 78  ? -20.917 20.251  -22.778 1.00 32.89  ? 78  PRO A CA  1 
ATOM   566  C C   . PRO A 1 78  ? -19.635 21.050  -22.751 1.00 29.50  ? 78  PRO A C   1 
ATOM   567  O O   . PRO A 1 78  ? -19.518 22.096  -23.402 1.00 31.79  ? 78  PRO A O   1 
ATOM   568  C CB  . PRO A 1 78  ? -21.019 19.479  -24.118 1.00 31.75  ? 78  PRO A CB  1 
ATOM   569  C CG  . PRO A 1 78  ? -22.459 19.597  -24.504 1.00 31.67  ? 78  PRO A CG  1 
ATOM   570  C CD  . PRO A 1 78  ? -23.027 20.860  -23.906 1.00 33.79  ? 78  PRO A CD  1 
ATOM   571  N N   . GLY A 1 79  ? -18.676 20.551  -22.003 1.00 27.33  ? 79  GLY A N   1 
ATOM   572  C CA  . GLY A 1 79  ? -17.368 21.128  -22.034 1.00 24.98  ? 79  GLY A CA  1 
ATOM   573  C C   . GLY A 1 79  ? -17.240 22.293  -21.096 1.00 25.34  ? 79  GLY A C   1 
ATOM   574  O O   . GLY A 1 79  ? -16.151 22.687  -20.818 1.00 27.47  ? 79  GLY A O   1 
ATOM   575  N N   . PHE A 1 80  ? -18.339 22.817  -20.564 1.00 24.97  ? 80  PHE A N   1 
ATOM   576  C CA  . PHE A 1 80  ? -18.307 24.020  -19.757 1.00 23.24  ? 80  PHE A CA  1 
ATOM   577  C C   . PHE A 1 80  ? -17.870 23.768  -18.302 1.00 24.44  ? 80  PHE A C   1 
ATOM   578  O O   . PHE A 1 80  ? -18.543 22.970  -17.611 1.00 25.79  ? 80  PHE A O   1 
ATOM   579  C CB  . PHE A 1 80  ? -19.716 24.615  -19.798 1.00 22.27  ? 80  PHE A CB  1 
ATOM   580  C CG  . PHE A 1 80  ? -19.846 25.925  -19.078 1.00 21.05  ? 80  PHE A CG  1 
ATOM   581  C CD1 . PHE A 1 80  ? -18.981 27.010  -19.389 1.00 18.44  ? 80  PHE A CD1 1 
ATOM   582  C CD2 . PHE A 1 80  ? -20.841 26.092  -18.084 1.00 19.98  ? 80  PHE A CD2 1 
ATOM   583  C CE1 . PHE A 1 80  ? -19.084 28.235  -18.717 1.00 18.54  ? 80  PHE A CE1 1 
ATOM   584  C CE2 . PHE A 1 80  ? -20.976 27.340  -17.434 1.00 19.60  ? 80  PHE A CE2 1 
ATOM   585  C CZ  . PHE A 1 80  ? -20.077 28.397  -17.730 1.00 19.93  ? 80  PHE A CZ  1 
ATOM   586  N N   . GLU A 1 81  ? -16.799 24.441  -17.811 1.00 23.77  ? 81  GLU A N   1 
ATOM   587  C CA  . GLU A 1 81  ? -16.386 24.235  -16.368 1.00 25.09  ? 81  GLU A CA  1 
ATOM   588  C C   . GLU A 1 81  ? -17.521 24.566  -15.401 1.00 26.74  ? 81  GLU A C   1 
ATOM   589  O O   . GLU A 1 81  ? -17.686 23.842  -14.378 1.00 27.91  ? 81  GLU A O   1 
ATOM   590  C CB  . GLU A 1 81  ? -15.103 24.985  -15.874 1.00 24.50  ? 81  GLU A CB  1 
ATOM   591  C CG  . GLU A 1 81  ? -14.305 24.324  -14.686 1.00 23.89  ? 81  GLU A CG  1 
ATOM   592  N N   . GLY A 1 82  ? -18.290 25.631  -15.715 1.00 23.56  ? 82  GLY A N   1 
ATOM   593  C CA  . GLY A 1 82  ? -19.187 26.260  -14.731 1.00 22.35  ? 82  GLY A CA  1 
ATOM   594  C C   . GLY A 1 82  ? -20.220 25.266  -14.279 1.00 22.22  ? 82  GLY A C   1 
ATOM   595  O O   . GLY A 1 82  ? -20.702 25.297  -13.166 1.00 21.27  ? 82  GLY A O   1 
ATOM   596  N N   . THR A 1 83  ? -20.470 24.323  -15.174 1.00 24.10  ? 83  THR A N   1 
ATOM   597  C CA  . THR A 1 83  ? -21.555 23.369  -15.093 1.00 22.46  ? 83  THR A CA  1 
ATOM   598  C C   . THR A 1 83  ? -20.966 22.016  -14.775 1.00 23.66  ? 83  THR A C   1 
ATOM   599  O O   . THR A 1 83  ? -21.347 21.400  -13.788 1.00 21.84  ? 83  THR A O   1 
ATOM   600  C CB  . THR A 1 83  ? -22.305 23.423  -16.446 1.00 22.84  ? 83  THR A CB  1 
ATOM   601  O OG1 . THR A 1 83  ? -23.700 23.510  -16.174 1.00 22.67  ? 83  THR A OG1 1 
ATOM   602  C CG2 . THR A 1 83  ? -21.960 22.294  -17.461 1.00 21.37  ? 83  THR A CG2 1 
ATOM   603  N N   . GLU A 1 84  ? -19.964 21.598  -15.567 1.00 25.61  ? 84  GLU A N   1 
ATOM   604  C CA  . GLU A 1 84  ? -19.348 20.308  -15.350 1.00 25.22  ? 84  GLU A CA  1 
ATOM   605  C C   . GLU A 1 84  ? -18.680 20.074  -14.007 1.00 24.82  ? 84  GLU A C   1 
ATOM   606  O O   . GLU A 1 84  ? -18.699 18.954  -13.537 1.00 24.66  ? 84  GLU A O   1 
ATOM   607  C CB  . GLU A 1 84  ? -18.507 19.863  -16.513 1.00 26.07  ? 84  GLU A CB  1 
ATOM   608  C CG  . GLU A 1 84  ? -19.201 18.839  -17.397 1.00 28.66  ? 84  GLU A CG  1 
ATOM   609  C CD  . GLU A 1 84  ? -18.894 19.112  -18.859 1.00 36.46  ? 84  GLU A CD  1 
ATOM   610  O OE1 . GLU A 1 84  ? -17.706 19.356  -19.205 1.00 40.46  ? 84  GLU A OE1 1 
ATOM   611  O OE2 . GLU A 1 84  ? -19.832 19.142  -19.692 1.00 40.04  ? 84  GLU A OE2 1 
ATOM   612  N N   . MET A 1 85  ? -18.176 21.105  -13.333 1.00 25.69  ? 85  MET A N   1 
ATOM   613  C CA  . MET A 1 85  ? -17.539 20.868  -12.012 1.00 24.42  ? 85  MET A CA  1 
ATOM   614  C C   . MET A 1 85  ? -18.528 20.343  -10.950 1.00 23.98  ? 85  MET A C   1 
ATOM   615  O O   . MET A 1 85  ? -18.107 19.910  -9.894  1.00 23.83  ? 85  MET A O   1 
ATOM   616  C CB  . MET A 1 85  ? -16.901 22.127  -11.503 1.00 24.87  ? 85  MET A CB  1 
ATOM   617  C CG  . MET A 1 85  ? -17.928 23.160  -11.036 1.00 28.25  ? 85  MET A CG  1 
ATOM   618  S SD  . MET A 1 85  ? -17.267 24.829  -10.856 1.00 30.82  ? 85  MET A SD  1 
ATOM   619  C CE  . MET A 1 85  ? -16.243 24.623  -9.405  1.00 25.95  ? 85  MET A CE  1 
ATOM   620  N N   . TRP A 1 86  ? -19.835 20.406  -11.217 1.00 21.82  ? 86  TRP A N   1 
ATOM   621  C CA  . TRP A 1 86  ? -20.822 19.903  -10.243 1.00 22.66  ? 86  TRP A CA  1 
ATOM   622  C C   . TRP A 1 86  ? -21.281 18.478  -10.554 1.00 23.34  ? 86  TRP A C   1 
ATOM   623  O O   . TRP A 1 86  ? -21.750 17.788  -9.668  1.00 24.79  ? 86  TRP A O   1 
ATOM   624  C CB  . TRP A 1 86  ? -22.019 20.875  -10.075 1.00 21.65  ? 86  TRP A CB  1 
ATOM   625  C CG  . TRP A 1 86  ? -21.537 22.325  -9.762  1.00 22.86  ? 86  TRP A CG  1 
ATOM   626  C CD1 . TRP A 1 86  ? -21.479 23.403  -10.625 1.00 23.91  ? 86  TRP A CD1 1 
ATOM   627  C CD2 . TRP A 1 86  ? -21.000 22.803  -8.521  1.00 22.96  ? 86  TRP A CD2 1 
ATOM   628  N NE1 . TRP A 1 86  ? -20.946 24.511  -10.001 1.00 22.78  ? 86  TRP A NE1 1 
ATOM   629  C CE2 . TRP A 1 86  ? -20.656 24.175  -8.707  1.00 24.03  ? 86  TRP A CE2 1 
ATOM   630  C CE3 . TRP A 1 86  ? -20.782 22.207  -7.264  1.00 21.57  ? 86  TRP A CE3 1 
ATOM   631  C CZ2 . TRP A 1 86  ? -20.094 24.944  -7.684  1.00 23.95  ? 86  TRP A CZ2 1 
ATOM   632  C CZ3 . TRP A 1 86  ? -20.240 22.962  -6.246  1.00 21.80  ? 86  TRP A CZ3 1 
ATOM   633  C CH2 . TRP A 1 86  ? -19.892 24.312  -6.455  1.00 23.70  ? 86  TRP A CH2 1 
ATOM   634  N N   . ASN A 1 87  ? -21.088 18.047  -11.812 1.00 23.04  ? 87  ASN A N   1 
ATOM   635  C CA  . ASN A 1 87  ? -21.433 16.732  -12.334 1.00 19.95  ? 87  ASN A CA  1 
ATOM   636  C C   . ASN A 1 87  ? -20.555 15.576  -11.776 1.00 19.42  ? 87  ASN A C   1 
ATOM   637  O O   . ASN A 1 87  ? -19.377 15.765  -11.355 1.00 18.08  ? 87  ASN A O   1 
ATOM   638  C CB  . ASN A 1 87  ? -21.328 16.769  -13.862 1.00 20.75  ? 87  ASN A CB  1 
ATOM   639  C CG  . ASN A 1 87  ? -22.523 17.437  -14.570 1.00 23.18  ? 87  ASN A CG  1 
ATOM   640  O OD1 . ASN A 1 87  ? -23.647 17.553  -14.068 1.00 26.03  ? 87  ASN A OD1 1 
ATOM   641  N ND2 . ASN A 1 87  ? -22.271 17.857  -15.778 1.00 22.18  ? 87  ASN A ND2 1 
ATOM   642  N N   . PRO A 1 88  ? -21.094 14.355  -11.819 1.00 19.46  ? 88  PRO A N   1 
ATOM   643  C CA  . PRO A 1 88  ? -20.410 13.191  -11.238 1.00 19.31  ? 88  PRO A CA  1 
ATOM   644  C C   . PRO A 1 88  ? -19.054 12.961  -11.902 1.00 19.80  ? 88  PRO A C   1 
ATOM   645  O O   . PRO A 1 88  ? -18.930 13.116  -13.105 1.00 18.81  ? 88  PRO A O   1 
ATOM   646  C CB  . PRO A 1 88  ? -21.362 12.039  -11.573 1.00 18.39  ? 88  PRO A CB  1 
ATOM   647  C CG  . PRO A 1 88  ? -22.684 12.703  -11.734 1.00 18.33  ? 88  PRO A CG  1 
ATOM   648  C CD  . PRO A 1 88  ? -22.351 13.969  -12.476 1.00 18.81  ? 88  PRO A CD  1 
ATOM   649  N N   . ASN A 1 89  ? -18.037 12.642  -11.112 1.00 20.77  ? 89  ASN A N   1 
ATOM   650  C CA  . ASN A 1 89  ? -16.678 12.415  -11.634 1.00 19.66  ? 89  ASN A CA  1 
ATOM   651  C C   . ASN A 1 89  ? -16.210 10.959  -11.334 1.00 20.66  ? 89  ASN A C   1 
ATOM   652  O O   . ASN A 1 89  ? -15.051 10.668  -11.514 1.00 21.42  ? 89  ASN A O   1 
ATOM   653  C CB  . ASN A 1 89  ? -15.701 13.438  -11.065 1.00 18.26  ? 89  ASN A CB  1 
ATOM   654  C CG  . ASN A 1 89  ? -15.609 13.380  -9.514  1.00 20.81  ? 89  ASN A CG  1 
ATOM   655  O OD1 . ASN A 1 89  ? -16.493 12.844  -8.801  1.00 22.32  ? 89  ASN A OD1 1 
ATOM   656  N ND2 . ASN A 1 89  ? -14.546 13.947  -8.982  1.00 20.89  ? 89  ASN A ND2 1 
ATOM   657  N N   . ARG A 1 90  ? -17.101 10.080  -10.852 1.00 20.23  ? 90  ARG A N   1 
ATOM   658  C CA  . ARG A 1 90  ? -16.854 8.639   -10.830 1.00 21.66  ? 90  ARG A CA  1 
ATOM   659  C C   . ARG A 1 90  ? -18.078 7.951   -11.414 1.00 22.56  ? 90  ARG A C   1 
ATOM   660  O O   . ARG A 1 90  ? -19.059 8.597   -11.637 1.00 24.27  ? 90  ARG A O   1 
ATOM   661  C CB  . ARG A 1 90  ? -16.625 8.129   -9.392  1.00 22.07  ? 90  ARG A CB  1 
ATOM   662  C CG  . ARG A 1 90  ? -15.358 8.642   -8.677  1.00 21.37  ? 90  ARG A CG  1 
ATOM   663  C CD  . ARG A 1 90  ? -14.051 8.381   -9.419  1.00 20.36  ? 90  ARG A CD  1 
ATOM   664  N NE  . ARG A 1 90  ? -12.885 8.874   -8.702  1.00 20.76  ? 90  ARG A NE  1 
ATOM   665  C CZ  . ARG A 1 90  ? -12.338 10.091  -8.899  1.00 23.74  ? 90  ARG A CZ  1 
ATOM   666  N NH1 . ARG A 1 90  ? -12.878 10.948  -9.786  1.00 22.58  ? 90  ARG A NH1 1 
ATOM   667  N NH2 . ARG A 1 90  ? -11.244 10.500  -8.201  1.00 22.98  ? 90  ARG A NH2 1 
ATOM   668  N N   . GLU A 1 91  ? -18.022 6.654   -11.674 1.00 23.53  ? 91  GLU A N   1 
ATOM   669  C CA  . GLU A 1 91  ? -19.146 5.908   -12.179 1.00 24.40  ? 91  GLU A CA  1 
ATOM   670  C C   . GLU A 1 91  ? -20.393 6.050   -11.282 1.00 25.60  ? 91  GLU A C   1 
ATOM   671  O O   . GLU A 1 91  ? -20.274 6.078   -10.061 1.00 25.74  ? 91  GLU A O   1 
ATOM   672  C CB  . GLU A 1 91  ? -18.746 4.466   -12.177 1.00 30.25  ? 91  GLU A CB  1 
ATOM   673  C CG  . GLU A 1 91  ? -18.588 3.766   -13.520 1.00 42.75  ? 91  GLU A CG  1 
ATOM   674  C CD  . GLU A 1 91  ? -18.988 2.273   -13.356 1.00 55.64  ? 91  GLU A CD  1 
ATOM   675  O OE1 . GLU A 1 91  ? -18.360 1.574   -12.491 1.00 52.36  ? 91  GLU A OE1 1 
ATOM   676  O OE2 . GLU A 1 91  ? -19.963 1.800   -14.040 1.00 52.88  ? 91  GLU A OE2 1 
ATOM   677  N N   . LEU A 1 92  ? -21.593 6.156   -11.866 1.00 24.25  ? 92  LEU A N   1 
ATOM   678  C CA  . LEU A 1 92  ? -22.813 6.195   -11.051 1.00 22.75  ? 92  LEU A CA  1 
ATOM   679  C C   . LEU A 1 92  ? -23.111 4.785   -10.479 1.00 23.77  ? 92  LEU A C   1 
ATOM   680  O O   . LEU A 1 92  ? -22.862 3.811   -11.155 1.00 26.76  ? 92  LEU A O   1 
ATOM   681  C CB  . LEU A 1 92  ? -23.983 6.608   -11.950 1.00 19.75  ? 92  LEU A CB  1 
ATOM   682  C CG  . LEU A 1 92  ? -24.027 8.035   -12.478 1.00 16.97  ? 92  LEU A CG  1 
ATOM   683  C CD1 . LEU A 1 92  ? -25.368 8.337   -13.095 1.00 14.35  ? 92  LEU A CD1 1 
ATOM   684  C CD2 . LEU A 1 92  ? -23.721 8.971   -11.322 1.00 16.47  ? 92  LEU A CD2 1 
ATOM   685  N N   . SER A 1 93  ? -23.682 4.641   -9.295  1.00 21.49  ? 93  SER A N   1 
ATOM   686  C CA  . SER A 1 93  ? -24.065 3.298   -8.831  1.00 21.38  ? 93  SER A CA  1 
ATOM   687  C C   . SER A 1 93  ? -24.941 3.437   -7.592  1.00 21.57  ? 93  SER A C   1 
ATOM   688  O O   . SER A 1 93  ? -24.782 4.427   -6.891  1.00 22.25  ? 93  SER A O   1 
ATOM   689  C CB  . SER A 1 93  ? -22.809 2.488   -8.467  1.00 22.17  ? 93  SER A CB  1 
ATOM   690  O OG  . SER A 1 93  ? -23.140 1.390   -7.626  1.00 21.60  ? 93  SER A OG  1 
ATOM   691  N N   . GLU A 1 94  ? -25.838 2.489   -7.303  1.00 19.76  ? 94  GLU A N   1 
ATOM   692  C CA  . GLU A 1 94  ? -26.631 2.566   -6.100  1.00 20.21  ? 94  GLU A CA  1 
ATOM   693  C C   . GLU A 1 94  ? -25.781 2.207   -4.876  1.00 24.74  ? 94  GLU A C   1 
ATOM   694  O O   . GLU A 1 94  ? -26.058 2.649   -3.739  1.00 28.91  ? 94  GLU A O   1 
ATOM   695  C CB  . GLU A 1 94  ? -27.798 1.636   -6.209  1.00 20.66  ? 94  GLU A CB  1 
ATOM   696  C CG  . GLU A 1 94  ? -28.764 1.994   -7.323  1.00 23.57  ? 94  GLU A CG  1 
ATOM   697  C CD  . GLU A 1 94  ? -30.144 1.399   -7.099  1.00 27.22  ? 94  GLU A CD  1 
ATOM   698  O OE1 . GLU A 1 94  ? -30.876 1.863   -6.167  1.00 27.20  ? 94  GLU A OE1 1 
ATOM   699  O OE2 . GLU A 1 94  ? -30.483 0.427   -7.824  1.00 28.24  ? 94  GLU A OE2 1 
ATOM   700  N N   . ASP A 1 95  ? -24.758 1.381   -5.123  1.00 26.11  ? 95  ASP A N   1 
ATOM   701  C CA  . ASP A 1 95  ? -23.630 1.145   -4.245  1.00 24.61  ? 95  ASP A CA  1 
ATOM   702  C C   . ASP A 1 95  ? -22.717 2.379   -4.087  1.00 25.08  ? 95  ASP A C   1 
ATOM   703  O O   . ASP A 1 95  ? -21.667 2.542   -4.780  1.00 22.49  ? 95  ASP A O   1 
ATOM   704  C CB  . ASP A 1 95  ? -22.792 -0.004  -4.763  1.00 25.00  ? 95  ASP A CB  1 
ATOM   705  C CG  . ASP A 1 95  ? -21.963 -0.629  -3.671  1.00 28.65  ? 95  ASP A CG  1 
ATOM   706  O OD1 . ASP A 1 95  ? -21.643 0.019   -2.642  1.00 28.72  ? 95  ASP A OD1 1 
ATOM   707  O OD2 . ASP A 1 95  ? -21.652 -1.812  -3.797  1.00 33.95  ? 95  ASP A OD2 1 
ATOM   708  N N   . CYS A 1 96  ? -23.095 3.233   -3.128  1.00 26.83  ? 96  CYS A N   1 
ATOM   709  C CA  . CYS A 1 96  ? -22.417 4.540   -2.987  1.00 25.70  ? 96  CYS A CA  1 
ATOM   710  C C   . CYS A 1 96  ? -22.257 5.079   -1.578  1.00 22.22  ? 96  CYS A C   1 
ATOM   711  O O   . CYS A 1 96  ? -21.723 6.170   -1.410  1.00 23.31  ? 96  CYS A O   1 
ATOM   712  C CB  . CYS A 1 96  ? -23.094 5.600   -3.864  1.00 24.13  ? 96  CYS A CB  1 
ATOM   713  S SG  . CYS A 1 96  ? -24.836 5.832   -3.407  1.00 23.39  ? 96  CYS A SG  1 
ATOM   714  N N   . LEU A 1 97  ? -22.671 4.326   -0.585  1.00 19.56  ? 97  LEU A N   1 
ATOM   715  C CA  . LEU A 1 97  ? -22.546 4.799   0.786   1.00 19.39  ? 97  LEU A CA  1 
ATOM   716  C C   . LEU A 1 97  ? -21.138 4.604   1.397   1.00 20.75  ? 97  LEU A C   1 
ATOM   717  O O   . LEU A 1 97  ? -20.893 3.695   2.194   1.00 22.96  ? 97  LEU A O   1 
ATOM   718  C CB  . LEU A 1 97  ? -23.660 4.207   1.641   1.00 18.11  ? 97  LEU A CB  1 
ATOM   719  C CG  . LEU A 1 97  ? -25.070 4.604   1.146   1.00 18.88  ? 97  LEU A CG  1 
ATOM   720  C CD1 . LEU A 1 97  ? -26.103 3.942   2.011   1.00 17.68  ? 97  LEU A CD1 1 
ATOM   721  C CD2 . LEU A 1 97  ? -25.326 6.136   1.028   1.00 18.84  ? 97  LEU A CD2 1 
ATOM   722  N N   . TYR A 1 98  ? -20.235 5.474   0.975   1.00 19.57  ? 98  TYR A N   1 
ATOM   723  C CA  . TYR A 1 98  ? -18.882 5.522   1.405   1.00 20.43  ? 98  TYR A CA  1 
ATOM   724  C C   . TYR A 1 98  ? -18.616 6.882   2.003   1.00 21.89  ? 98  TYR A C   1 
ATOM   725  O O   . TYR A 1 98  ? -19.330 7.863   1.663   1.00 23.35  ? 98  TYR A O   1 
ATOM   726  C CB  . TYR A 1 98  ? -18.001 5.329   0.184   1.00 20.89  ? 98  TYR A CB  1 
ATOM   727  C CG  . TYR A 1 98  ? -18.255 3.961   -0.330  1.00 24.81  ? 98  TYR A CG  1 
ATOM   728  C CD1 . TYR A 1 98  ? -19.309 3.725   -1.218  1.00 26.17  ? 98  TYR A CD1 1 
ATOM   729  C CD2 . TYR A 1 98  ? -17.508 2.835   0.156   1.00 26.20  ? 98  TYR A CD2 1 
ATOM   730  C CE1 . TYR A 1 98  ? -19.596 2.429   -1.660  1.00 27.26  ? 98  TYR A CE1 1 
ATOM   731  C CE2 . TYR A 1 98  ? -17.800 1.542   -0.268  1.00 24.89  ? 98  TYR A CE2 1 
ATOM   732  C CZ  . TYR A 1 98  ? -18.830 1.349   -1.185  1.00 25.57  ? 98  TYR A CZ  1 
ATOM   733  O OH  . TYR A 1 98  ? -19.159 0.098   -1.617  1.00 24.60  ? 98  TYR A OH  1 
ATOM   734  N N   . LEU A 1 99  ? -17.599 6.984   2.867   1.00 20.47  ? 99  LEU A N   1 
ATOM   735  C CA  . LEU A 1 99  ? -17.193 8.303   3.372   1.00 21.12  ? 99  LEU A CA  1 
ATOM   736  C C   . LEU A 1 99  ? -15.692 8.384   3.274   1.00 21.43  ? 99  LEU A C   1 
ATOM   737  O O   . LEU A 1 99  ? -15.062 7.402   2.977   1.00 24.92  ? 99  LEU A O   1 
ATOM   738  C CB  . LEU A 1 99  ? -17.708 8.591   4.802   1.00 19.05  ? 99  LEU A CB  1 
ATOM   739  C CG  . LEU A 1 99  ? -17.366 7.553   5.880   1.00 18.45  ? 99  LEU A CG  1 
ATOM   740  C CD1 . LEU A 1 99  ? -15.931 7.704   6.374   1.00 18.17  ? 99  LEU A CD1 1 
ATOM   741  C CD2 . LEU A 1 99  ? -18.337 7.490   7.050   1.00 16.42  ? 99  LEU A CD2 1 
ATOM   742  N N   . ASN A 1 100 ? -15.149 9.552   3.538   1.00 20.93  ? 100 ASN A N   1 
ATOM   743  C CA  . ASN A 1 100 ? -13.741 9.841   3.425   1.00 22.18  ? 100 ASN A CA  1 
ATOM   744  C C   . ASN A 1 100 ? -13.298 10.652  4.637   1.00 23.49  ? 100 ASN A C   1 
ATOM   745  O O   . ASN A 1 100 ? -14.110 11.392  5.253   1.00 24.68  ? 100 ASN A O   1 
ATOM   746  C CB  . ASN A 1 100 ? -13.428 10.632  2.132   1.00 22.73  ? 100 ASN A CB  1 
ATOM   747  C CG  . ASN A 1 100 ? -14.407 10.317  0.997   1.00 22.23  ? 100 ASN A CG  1 
ATOM   748  O OD1 . ASN A 1 100 ? -14.385 9.237   0.365   1.00 19.71  ? 100 ASN A OD1 1 
ATOM   749  N ND2 . ASN A 1 100 ? -15.291 11.281  0.740   1.00 22.80  ? 100 ASN A ND2 1 
ATOM   750  N N   . VAL A 1 101 ? -12.020 10.498  4.990   1.00 22.17  ? 101 VAL A N   1 
ATOM   751  C CA  . VAL A 1 101 ? -11.488 11.066  6.220   1.00 21.54  ? 101 VAL A CA  1 
ATOM   752  C C   . VAL A 1 101 ? -10.113 11.575  5.886   1.00 23.23  ? 101 VAL A C   1 
ATOM   753  O O   . VAL A 1 101 ? -9.254  10.755  5.591   1.00 26.50  ? 101 VAL A O   1 
ATOM   754  C CB  . VAL A 1 101 ? -11.331 10.016  7.351   1.00 19.49  ? 101 VAL A CB  1 
ATOM   755  C CG1 . VAL A 1 101 ? -10.649 10.660  8.548   1.00 19.24  ? 101 VAL A CG1 1 
ATOM   756  C CG2 . VAL A 1 101 ? -12.660 9.413   7.784   1.00 19.20  ? 101 VAL A CG2 1 
ATOM   757  N N   . TRP A 1 102 ? -9.893  12.883  5.866   1.00 22.75  ? 102 TRP A N   1 
ATOM   758  C CA  . TRP A 1 102 ? -8.530  13.354  5.822   1.00 25.52  ? 102 TRP A CA  1 
ATOM   759  C C   . TRP A 1 102 ? -8.058  13.673  7.266   1.00 29.00  ? 102 TRP A C   1 
ATOM   760  O O   . TRP A 1 102 ? -8.861  14.038  8.137   1.00 34.27  ? 102 TRP A O   1 
ATOM   761  C CB  . TRP A 1 102 ? -8.433  14.604  4.996   1.00 24.59  ? 102 TRP A CB  1 
ATOM   762  C CG  . TRP A 1 102 ? -8.834  14.542  3.536   1.00 24.17  ? 102 TRP A CG  1 
ATOM   763  C CD1 . TRP A 1 102 ? -7.999  14.686  2.436   1.00 21.93  ? 102 TRP A CD1 1 
ATOM   764  C CD2 . TRP A 1 102 ? -10.162 14.463  3.010   1.00 24.18  ? 102 TRP A CD2 1 
ATOM   765  N NE1 . TRP A 1 102 ? -8.725  14.655  1.289   1.00 22.87  ? 102 TRP A NE1 1 
ATOM   766  C CE2 . TRP A 1 102 ? -10.058 14.510  1.612   1.00 23.20  ? 102 TRP A CE2 1 
ATOM   767  C CE3 . TRP A 1 102 ? -11.432 14.367  3.587   1.00 26.25  ? 102 TRP A CE3 1 
ATOM   768  C CZ2 . TRP A 1 102 ? -11.173 14.451  0.791   1.00 22.97  ? 102 TRP A CZ2 1 
ATOM   769  C CZ3 . TRP A 1 102 ? -12.543 14.272  2.758   1.00 25.07  ? 102 TRP A CZ3 1 
ATOM   770  C CH2 . TRP A 1 102 ? -12.401 14.330  1.384   1.00 24.91  ? 102 TRP A CH2 1 
ATOM   771  N N   . THR A 1 103 ? -6.756  13.528  7.509   1.00 31.11  ? 103 THR A N   1 
ATOM   772  C CA  . THR A 1 103 ? -6.095  13.715  8.834   1.00 30.37  ? 103 THR A CA  1 
ATOM   773  C C   . THR A 1 103 ? -4.642  14.174  8.611   1.00 30.13  ? 103 THR A C   1 
ATOM   774  O O   . THR A 1 103 ? -4.035  13.876  7.556   1.00 27.33  ? 103 THR A O   1 
ATOM   775  C CB  . THR A 1 103 ? -6.151  12.420  9.689   1.00 31.00  ? 103 THR A CB  1 
ATOM   776  O OG1 . THR A 1 103 ? -5.810  12.705  11.041  1.00 30.25  ? 103 THR A OG1 1 
ATOM   777  C CG2 . THR A 1 103 ? -5.232  11.382  9.167   1.00 31.87  ? 103 THR A CG2 1 
ATOM   778  N N   . PRO A 1 104 ? -4.090  14.945  9.555   1.00 29.95  ? 104 PRO A N   1 
ATOM   779  C CA  . PRO A 1 104 ? -2.792  15.497  9.212   1.00 29.76  ? 104 PRO A CA  1 
ATOM   780  C C   . PRO A 1 104 ? -1.702  14.467  9.338   1.00 31.77  ? 104 PRO A C   1 
ATOM   781  O O   . PRO A 1 104 ? -1.901  13.384  9.931   1.00 32.07  ? 104 PRO A O   1 
ATOM   782  C CB  . PRO A 1 104 ? -2.580  16.599  10.236  1.00 28.47  ? 104 PRO A CB  1 
ATOM   783  C CG  . PRO A 1 104 ? -3.934  16.907  10.753  1.00 30.37  ? 104 PRO A CG  1 
ATOM   784  C CD  . PRO A 1 104 ? -4.660  15.589  10.741  1.00 29.87  ? 104 PRO A CD  1 
ATOM   785  N N   . TYR A 1 105 ? -0.589  14.802  8.698   1.00 36.33  ? 105 TYR A N   1 
ATOM   786  C CA  . TYR A 1 105 ? 0.653   14.106  8.821   1.00 41.12  ? 105 TYR A CA  1 
ATOM   787  C C   . TYR A 1 105 ? 1.702   15.029  9.460   1.00 40.32  ? 105 TYR A C   1 
ATOM   788  O O   . TYR A 1 105 ? 1.991   16.092  8.918   1.00 43.33  ? 105 TYR A O   1 
ATOM   789  C CB  . TYR A 1 105 ? 1.146   13.673  7.444   1.00 49.03  ? 105 TYR A CB  1 
ATOM   790  C CG  . TYR A 1 105 ? 2.433   12.892  7.601   1.00 65.67  ? 105 TYR A CG  1 
ATOM   791  C CD1 . TYR A 1 105 ? 2.409   11.522  7.964   1.00 64.14  ? 105 TYR A CD1 1 
ATOM   792  C CD2 . TYR A 1 105 ? 3.684   13.521  7.461   1.00 69.73  ? 105 TYR A CD2 1 
ATOM   793  C CE1 . TYR A 1 105 ? 3.580   10.807  8.142   1.00 64.55  ? 105 TYR A CE1 1 
ATOM   794  C CE2 . TYR A 1 105 ? 4.867   12.803  7.632   1.00 75.22  ? 105 TYR A CE2 1 
ATOM   795  C CZ  . TYR A 1 105 ? 4.804   11.452  7.971   1.00 71.25  ? 105 TYR A CZ  1 
ATOM   796  O OH  . TYR A 1 105 ? 5.964   10.751  8.168   1.00 72.71  ? 105 TYR A OH  1 
ATOM   797  N N   . PRO A 1 106 ? 2.305   14.630  10.574  1.00 41.62  ? 106 PRO A N   1 
ATOM   798  C CA  . PRO A 1 106 ? 2.027   13.320  11.225  1.00 38.36  ? 106 PRO A CA  1 
ATOM   799  C C   . PRO A 1 106 ? 0.682   13.353  11.898  1.00 33.35  ? 106 PRO A C   1 
ATOM   800  O O   . PRO A 1 106 ? 0.219   14.431  12.261  1.00 33.43  ? 106 PRO A O   1 
ATOM   801  C CB  . PRO A 1 106 ? 3.151   13.170  12.293  1.00 36.08  ? 106 PRO A CB  1 
ATOM   802  C CG  . PRO A 1 106 ? 4.101   14.326  12.069  1.00 38.05  ? 106 PRO A CG  1 
ATOM   803  C CD  . PRO A 1 106 ? 3.585   15.257  11.004  1.00 40.81  ? 106 PRO A CD  1 
ATOM   804  N N   . ARG A 1 107 ? 0.079   12.188  12.088  1.00 32.70  ? 107 ARG A N   1 
ATOM   805  C CA  . ARG A 1 107 ? -1.154  12.044  12.868  1.00 35.51  ? 107 ARG A CA  1 
ATOM   806  C C   . ARG A 1 107 ? -1.187  12.906  14.120  1.00 38.97  ? 107 ARG A C   1 
ATOM   807  O O   . ARG A 1 107 ? -0.177  13.104  14.759  1.00 43.74  ? 107 ARG A O   1 
ATOM   808  C CB  . ARG A 1 107 ? -1.253  10.629  13.340  1.00 36.70  ? 107 ARG A CB  1 
ATOM   809  C CG  . ARG A 1 107 ? -2.657  10.173  13.644  1.00 39.76  ? 107 ARG A CG  1 
ATOM   810  C CD  . ARG A 1 107 ? -3.040  9.097   12.645  1.00 42.27  ? 107 ARG A CD  1 
ATOM   811  N NE  . ARG A 1 107 ? -2.905  7.734   13.177  1.00 42.83  ? 107 ARG A NE  1 
ATOM   812  C CZ  . ARG A 1 107 ? -2.885  6.654   12.404  1.00 44.69  ? 107 ARG A CZ  1 
ATOM   813  N NH1 . ARG A 1 107 ? -2.967  6.791   11.080  1.00 52.49  ? 107 ARG A NH1 1 
ATOM   814  N NH2 . ARG A 1 107 ? -2.790  5.452   12.929  1.00 44.12  ? 107 ARG A NH2 1 
ATOM   815  N N   . PRO A 1 108 ? -2.353  13.414  14.517  1.00 44.46  ? 108 PRO A N   1 
ATOM   816  C CA  . PRO A 1 108 ? -2.211  14.249  15.717  1.00 44.75  ? 108 PRO A CA  1 
ATOM   817  C C   . PRO A 1 108 ? -2.181  13.381  16.954  1.00 39.18  ? 108 PRO A C   1 
ATOM   818  O O   . PRO A 1 108 ? -2.670  12.240  16.906  1.00 32.73  ? 108 PRO A O   1 
ATOM   819  C CB  . PRO A 1 108 ? -3.465  15.143  15.687  1.00 42.20  ? 108 PRO A CB  1 
ATOM   820  C CG  . PRO A 1 108 ? -3.921  15.053  14.286  1.00 45.44  ? 108 PRO A CG  1 
ATOM   821  C CD  . PRO A 1 108 ? -3.650  13.638  13.877  1.00 47.00  ? 108 PRO A CD  1 
ATOM   822  N N   . THR A 1 109 ? -1.618  13.916  18.044  1.00 38.07  ? 109 THR A N   1 
ATOM   823  C CA  . THR A 1 109 ? -1.391  13.067  19.221  1.00 39.02  ? 109 THR A CA  1 
ATOM   824  C C   . THR A 1 109 ? -2.363  13.319  20.394  1.00 41.85  ? 109 THR A C   1 
ATOM   825  O O   . THR A 1 109 ? -2.474  12.475  21.282  1.00 38.58  ? 109 THR A O   1 
ATOM   826  C CB  . THR A 1 109 ? 0.104   13.018  19.646  1.00 34.61  ? 109 THR A CB  1 
ATOM   827  O OG1 . THR A 1 109 ? 0.580   14.361  19.787  1.00 37.82  ? 109 THR A OG1 1 
ATOM   828  C CG2 . THR A 1 109 ? 0.959   12.304  18.612  1.00 26.05  ? 109 THR A CG2 1 
ATOM   829  N N   . SER A 1 110 ? -3.077  14.455  20.389  1.00 49.48  ? 110 SER A N   1 
ATOM   830  C CA  . SER A 1 110 ? -4.294  14.627  21.268  1.00 56.00  ? 110 SER A CA  1 
ATOM   831  C C   . SER A 1 110 ? -5.522  14.466  20.391  1.00 51.13  ? 110 SER A C   1 
ATOM   832  O O   . SER A 1 110 ? -5.392  14.647  19.176  1.00 47.68  ? 110 SER A O   1 
ATOM   833  C CB  . SER A 1 110 ? -4.388  16.023  21.897  1.00 51.60  ? 110 SER A CB  1 
ATOM   834  O OG  . SER A 1 110 ? -3.236  16.741  21.546  1.00 51.30  ? 110 SER A OG  1 
ATOM   835  N N   . PRO A 1 111 ? -6.713  14.174  20.992  1.00 48.29  ? 111 PRO A N   1 
ATOM   836  C CA  . PRO A 1 111 ? -7.929  14.309  20.171  1.00 47.24  ? 111 PRO A CA  1 
ATOM   837  C C   . PRO A 1 111 ? -7.959  15.715  19.504  1.00 44.33  ? 111 PRO A C   1 
ATOM   838  O O   . PRO A 1 111 ? -7.699  16.729  20.161  1.00 41.41  ? 111 PRO A O   1 
ATOM   839  C CB  . PRO A 1 111 ? -9.074  14.093  21.189  1.00 46.64  ? 111 PRO A CB  1 
ATOM   840  C CG  . PRO A 1 111 ? -8.470  13.301  22.296  1.00 43.02  ? 111 PRO A CG  1 
ATOM   841  C CD  . PRO A 1 111 ? -7.025  13.728  22.368  1.00 45.68  ? 111 PRO A CD  1 
ATOM   842  N N   . THR A 1 112 ? -8.143  15.760  18.185  1.00 43.78  ? 112 THR A N   1 
ATOM   843  C CA  . THR A 1 112 ? -8.286  17.059  17.510  1.00 40.97  ? 112 THR A CA  1 
ATOM   844  C C   . THR A 1 112 ? -9.695  17.237  16.886  1.00 37.00  ? 112 THR A C   1 
ATOM   845  O O   . THR A 1 112 ? -10.470 16.274  16.722  1.00 32.11  ? 112 THR A O   1 
ATOM   846  C CB  . THR A 1 112 ? -7.110  17.450  16.575  1.00 39.38  ? 112 THR A CB  1 
ATOM   847  O OG1 . THR A 1 112 ? -7.039  16.505  15.539  1.00 39.20  ? 112 THR A OG1 1 
ATOM   848  C CG2 . THR A 1 112 ? -5.723  17.502  17.343  1.00 41.94  ? 112 THR A CG2 1 
ATOM   849  N N   . PRO A 1 113 ? -10.065 18.496  16.646  1.00 34.42  ? 113 PRO A N   1 
ATOM   850  C CA  . PRO A 1 113 ? -11.466 18.734  16.324  1.00 32.12  ? 113 PRO A CA  1 
ATOM   851  C C   . PRO A 1 113 ? -11.816 18.361  14.854  1.00 31.45  ? 113 PRO A C   1 
ATOM   852  O O   . PRO A 1 113 ? -10.988 18.531  13.914  1.00 30.99  ? 113 PRO A O   1 
ATOM   853  C CB  . PRO A 1 113 ? -11.645 20.225  16.630  1.00 31.26  ? 113 PRO A CB  1 
ATOM   854  C CG  . PRO A 1 113 ? -10.445 20.645  17.424  1.00 31.75  ? 113 PRO A CG  1 
ATOM   855  C CD  . PRO A 1 113 ? -9.340  19.743  16.959  1.00 32.86  ? 113 PRO A CD  1 
ATOM   856  N N   . VAL A 1 114 ? -13.027 17.834  14.678  1.00 27.18  ? 114 VAL A N   1 
ATOM   857  C CA  . VAL A 1 114 ? -13.406 17.214  13.438  1.00 27.44  ? 114 VAL A CA  1 
ATOM   858  C C   . VAL A 1 114 ? -14.376 18.099  12.655  1.00 29.77  ? 114 VAL A C   1 
ATOM   859  O O   . VAL A 1 114 ? -15.403 18.515  13.207  1.00 36.28  ? 114 VAL A O   1 
ATOM   860  C CB  . VAL A 1 114 ? -14.106 15.889  13.735  1.00 27.50  ? 114 VAL A CB  1 
ATOM   861  C CG1 . VAL A 1 114 ? -14.517 15.215  12.427  1.00 28.81  ? 114 VAL A CG1 1 
ATOM   862  C CG2 . VAL A 1 114 ? -13.236 14.983  14.579  1.00 23.83  ? 114 VAL A CG2 1 
ATOM   863  N N   . LEU A 1 115 ? -14.072 18.419  11.390  1.00 29.46  ? 115 LEU A N   1 
ATOM   864  C CA  . LEU A 1 115 ? -15.055 19.114  10.516  1.00 24.58  ? 115 LEU A CA  1 
ATOM   865  C C   . LEU A 1 115 ? -15.725 18.107  9.616   1.00 23.45  ? 115 LEU A C   1 
ATOM   866  O O   . LEU A 1 115 ? -15.039 17.453  8.883   1.00 26.15  ? 115 LEU A O   1 
ATOM   867  C CB  . LEU A 1 115 ? -14.365 20.104  9.613   1.00 21.38  ? 115 LEU A CB  1 
ATOM   868  C CG  . LEU A 1 115 ? -14.113 21.496  10.159  1.00 20.61  ? 115 LEU A CG  1 
ATOM   869  C CD1 . LEU A 1 115 ? -12.960 22.164  9.396   1.00 18.94  ? 115 LEU A CD1 1 
ATOM   870  C CD2 . LEU A 1 115 ? -15.381 22.330  10.064  1.00 19.81  ? 115 LEU A CD2 1 
ATOM   871  N N   . VAL A 1 116 ? -17.039 17.984  9.645   1.00 21.12  ? 116 VAL A N   1 
ATOM   872  C CA  . VAL A 1 116 ? -17.729 17.123  8.687   1.00 22.36  ? 116 VAL A CA  1 
ATOM   873  C C   . VAL A 1 116 ? -18.503 17.856  7.560   1.00 24.32  ? 116 VAL A C   1 
ATOM   874  O O   . VAL A 1 116 ? -19.455 18.593  7.873   1.00 26.81  ? 116 VAL A O   1 
ATOM   875  C CB  . VAL A 1 116 ? -18.748 16.365  9.468   1.00 21.60  ? 116 VAL A CB  1 
ATOM   876  C CG1 . VAL A 1 116 ? -19.469 15.333  8.608   1.00 19.02  ? 116 VAL A CG1 1 
ATOM   877  C CG2 . VAL A 1 116 ? -18.024 15.804  10.662  1.00 21.92  ? 116 VAL A CG2 1 
ATOM   878  N N   . TRP A 1 117 ? -18.141 17.645  6.279   1.00 22.21  ? 117 TRP A N   1 
ATOM   879  C CA  . TRP A 1 117 ? -18.789 18.316  5.142   1.00 20.82  ? 117 TRP A CA  1 
ATOM   880  C C   . TRP A 1 117 ? -20.029 17.584  4.675   1.00 22.09  ? 117 TRP A C   1 
ATOM   881  O O   . TRP A 1 117 ? -20.003 16.357  4.498   1.00 26.97  ? 117 TRP A O   1 
ATOM   882  C CB  . TRP A 1 117 ? -17.813 18.406  4.003   1.00 21.54  ? 117 TRP A CB  1 
ATOM   883  C CG  . TRP A 1 117 ? -18.337 19.029  2.771   1.00 24.75  ? 117 TRP A CG  1 
ATOM   884  C CD1 . TRP A 1 117 ? -18.537 18.424  1.554   1.00 24.25  ? 117 TRP A CD1 1 
ATOM   885  C CD2 . TRP A 1 117 ? -18.777 20.373  2.610   1.00 27.51  ? 117 TRP A CD2 1 
ATOM   886  N NE1 . TRP A 1 117 ? -19.049 19.307  0.642   1.00 22.84  ? 117 TRP A NE1 1 
ATOM   887  C CE2 . TRP A 1 117 ? -19.194 20.521  1.253   1.00 26.20  ? 117 TRP A CE2 1 
ATOM   888  C CE3 . TRP A 1 117 ? -18.824 21.493  3.462   1.00 27.42  ? 117 TRP A CE3 1 
ATOM   889  C CZ2 . TRP A 1 117 ? -19.644 21.752  0.730   1.00 26.30  ? 117 TRP A CZ2 1 
ATOM   890  C CZ3 . TRP A 1 117 ? -19.269 22.706  2.938   1.00 27.96  ? 117 TRP A CZ3 1 
ATOM   891  C CH2 . TRP A 1 117 ? -19.693 22.819  1.583   1.00 26.00  ? 117 TRP A CH2 1 
ATOM   892  N N   . ILE A 1 118 ? -21.135 18.293  4.461   1.00 20.41  ? 118 ILE A N   1 
ATOM   893  C CA  . ILE A 1 118 ? -22.277 17.676  3.766   1.00 19.63  ? 118 ILE A CA  1 
ATOM   894  C C   . ILE A 1 118 ? -22.526 18.391  2.437   1.00 21.54  ? 118 ILE A C   1 
ATOM   895  O O   . ILE A 1 118 ? -23.054 19.501  2.477   1.00 22.65  ? 118 ILE A O   1 
ATOM   896  C CB  . ILE A 1 118 ? -23.549 17.776  4.608   1.00 17.59  ? 118 ILE A CB  1 
ATOM   897  C CG1 . ILE A 1 118 ? -23.271 17.201  5.990   1.00 17.42  ? 118 ILE A CG1 1 
ATOM   898  C CG2 . ILE A 1 118 ? -24.736 17.109  3.902   1.00 16.18  ? 118 ILE A CG2 1 
ATOM   899  C CD1 . ILE A 1 118 ? -24.491 17.035  6.889   1.00 16.78  ? 118 ILE A CD1 1 
ATOM   900  N N   . TYR A 1 119 ? -22.167 17.791  1.283   1.00 23.26  ? 119 TYR A N   1 
ATOM   901  C CA  . TYR A 1 119 ? -22.337 18.488  -0.036  1.00 21.29  ? 119 TYR A CA  1 
ATOM   902  C C   . TYR A 1 119 ? -23.808 18.953  -0.301  1.00 22.78  ? 119 TYR A C   1 
ATOM   903  O O   . TYR A 1 119 ? -24.765 18.284  0.158   1.00 21.99  ? 119 TYR A O   1 
ATOM   904  C CB  . TYR A 1 119 ? -21.770 17.686  -1.242  1.00 19.62  ? 119 TYR A CB  1 
ATOM   905  C CG  . TYR A 1 119 ? -22.419 16.314  -1.444  1.00 19.72  ? 119 TYR A CG  1 
ATOM   906  C CD1 . TYR A 1 119 ? -23.729 16.193  -1.867  1.00 19.82  ? 119 TYR A CD1 1 
ATOM   907  C CD2 . TYR A 1 119 ? -21.701 15.130  -1.234  1.00 20.77  ? 119 TYR A CD2 1 
ATOM   908  C CE1 . TYR A 1 119 ? -24.315 14.939  -2.049  1.00 21.59  ? 119 TYR A CE1 1 
ATOM   909  C CE2 . TYR A 1 119 ? -22.273 13.857  -1.410  1.00 19.96  ? 119 TYR A CE2 1 
ATOM   910  C CZ  . TYR A 1 119 ? -23.586 13.763  -1.801  1.00 21.38  ? 119 TYR A CZ  1 
ATOM   911  O OH  . TYR A 1 119 ? -24.206 12.533  -1.961  1.00 22.78  ? 119 TYR A OH  1 
ATOM   912  N N   . GLY A 1 120 ? -23.955 20.102  -1.004  1.00 22.74  ? 120 GLY A N   1 
ATOM   913  C CA  . GLY A 1 120 ? -25.220 20.518  -1.593  1.00 24.50  ? 120 GLY A CA  1 
ATOM   914  C C   . GLY A 1 120 ? -25.542 19.903  -2.957  1.00 27.59  ? 120 GLY A C   1 
ATOM   915  O O   . GLY A 1 120 ? -24.936 18.899  -3.342  1.00 32.45  ? 120 GLY A O   1 
ATOM   916  N N   . GLY A 1 121 ? -26.494 20.492  -3.696  1.00 28.86  ? 121 GLY A N   1 
ATOM   917  C CA  . GLY A 1 121 ? -26.922 19.947  -4.980  1.00 24.51  ? 121 GLY A CA  1 
ATOM   918  C C   . GLY A 1 121 ? -28.421 19.785  -5.114  1.00 25.69  ? 121 GLY A C   1 
ATOM   919  O O   . GLY A 1 121 ? -28.920 18.924  -5.898  1.00 25.12  ? 121 GLY A O   1 
ATOM   920  N N   . GLY A 1 122 ? -29.164 20.609  -4.377  1.00 23.03  ? 122 GLY A N   1 
ATOM   921  C CA  . GLY A 1 122 ? -30.619 20.541  -4.489  1.00 21.26  ? 122 GLY A CA  1 
ATOM   922  C C   . GLY A 1 122 ? -31.254 19.242  -4.054  1.00 22.45  ? 122 GLY A C   1 
ATOM   923  O O   . GLY A 1 122 ? -32.429 19.014  -4.333  1.00 26.80  ? 122 GLY A O   1 
ATOM   924  N N   . PHE A 1 123 ? -30.497 18.379  -3.366  1.00 24.15  ? 123 PHE A N   1 
ATOM   925  C CA  . PHE A 1 123 ? -31.004 17.066  -2.916  1.00 22.46  ? 123 PHE A CA  1 
ATOM   926  C C   . PHE A 1 123 ? -31.200 16.087  -4.072  1.00 22.61  ? 123 PHE A C   1 
ATOM   927  O O   . PHE A 1 123 ? -31.647 14.947  -3.840  1.00 21.65  ? 123 PHE A O   1 
ATOM   928  C CB  . PHE A 1 123 ? -32.340 17.153  -2.151  1.00 21.27  ? 123 PHE A CB  1 
ATOM   929  C CG  . PHE A 1 123 ? -32.252 17.798  -0.800  1.00 21.61  ? 123 PHE A CG  1 
ATOM   930  C CD1 . PHE A 1 123 ? -31.718 17.108  0.316   1.00 20.87  ? 123 PHE A CD1 1 
ATOM   931  C CD2 . PHE A 1 123 ? -32.746 19.107  -0.601  1.00 22.56  ? 123 PHE A CD2 1 
ATOM   932  C CE1 . PHE A 1 123 ? -31.648 17.719  1.580   1.00 20.36  ? 123 PHE A CE1 1 
ATOM   933  C CE2 . PHE A 1 123 ? -32.669 19.724  0.676   1.00 22.00  ? 123 PHE A CE2 1 
ATOM   934  C CZ  . PHE A 1 123 ? -32.126 19.022  1.756   1.00 20.93  ? 123 PHE A CZ  1 
ATOM   935  N N   . TYR A 1 124 ? -30.835 16.508  -5.296  1.00 23.03  ? 124 TYR A N   1 
ATOM   936  C CA  . TYR A 1 124 ? -30.997 15.664  -6.511  1.00 21.73  ? 124 TYR A CA  1 
ATOM   937  C C   . TYR A 1 124 ? -29.666 15.286  -7.125  1.00 20.31  ? 124 TYR A C   1 
ATOM   938  O O   . TYR A 1 124 ? -29.648 14.454  -8.040  1.00 21.65  ? 124 TYR A O   1 
ATOM   939  C CB  . TYR A 1 124 ? -31.893 16.366  -7.594  1.00 21.97  ? 124 TYR A CB  1 
ATOM   940  C CG  . TYR A 1 124 ? -31.225 17.494  -8.365  1.00 20.92  ? 124 TYR A CG  1 
ATOM   941  C CD1 . TYR A 1 124 ? -30.380 17.235  -9.461  1.00 21.94  ? 124 TYR A CD1 1 
ATOM   942  C CD2 . TYR A 1 124 ? -31.392 18.824  -7.988  1.00 21.25  ? 124 TYR A CD2 1 
ATOM   943  C CE1 . TYR A 1 124 ? -29.715 18.271  -10.134 1.00 21.07  ? 124 TYR A CE1 1 
ATOM   944  C CE2 . TYR A 1 124 ? -30.743 19.880  -8.682  1.00 19.92  ? 124 TYR A CE2 1 
ATOM   945  C CZ  . TYR A 1 124 ? -29.919 19.582  -9.730  1.00 20.17  ? 124 TYR A CZ  1 
ATOM   946  O OH  . TYR A 1 124 ? -29.299 20.568  -10.401 1.00 20.30  ? 124 TYR A OH  1 
ATOM   947  N N   . SER A 1 125 ? -28.597 15.941  -6.668  1.00 17.41  ? 125 SER A N   1 
ATOM   948  C CA  . SER A 1 125 ? -27.261 15.759  -7.203  1.00 17.80  ? 125 SER A CA  1 
ATOM   949  C C   . SER A 1 125 ? -26.165 15.964  -6.135  1.00 19.61  ? 125 SER A C   1 
ATOM   950  O O   . SER A 1 125 ? -26.471 16.332  -4.984  1.00 20.67  ? 125 SER A O   1 
ATOM   951  C CB  . SER A 1 125 ? -27.043 16.718  -8.367  1.00 16.76  ? 125 SER A CB  1 
ATOM   952  O OG  . SER A 1 125 ? -26.975 18.090  -7.963  1.00 16.84  ? 125 SER A OG  1 
ATOM   953  N N   . GLY A 1 126 ? -24.899 15.742  -6.501  1.00 20.79  ? 126 GLY A N   1 
ATOM   954  C CA  . GLY A 1 126 ? -23.755 16.009  -5.582  1.00 22.50  ? 126 GLY A CA  1 
ATOM   955  C C   . GLY A 1 126 ? -22.893 14.770  -5.229  1.00 22.14  ? 126 GLY A C   1 
ATOM   956  O O   . GLY A 1 126 ? -23.361 13.631  -5.242  1.00 24.99  ? 126 GLY A O   1 
ATOM   957  N N   . ALA A 1 127 ? -21.618 14.968  -4.918  1.00 21.33  ? 127 ALA A N   1 
ATOM   958  C CA  . ALA A 1 127 ? -20.751 13.846  -4.550  1.00 22.46  ? 127 ALA A CA  1 
ATOM   959  C C   . ALA A 1 127 ? -19.630 14.326  -3.659  1.00 23.01  ? 127 ALA A C   1 
ATOM   960  O O   . ALA A 1 127 ? -19.078 15.435  -3.841  1.00 24.98  ? 127 ALA A O   1 
ATOM   961  C CB  . ALA A 1 127 ? -20.172 13.161  -5.786  1.00 20.04  ? 127 ALA A CB  1 
ATOM   962  N N   . SER A 1 128 ? -19.271 13.482  -2.713  1.00 21.75  ? 128 SER A N   1 
ATOM   963  C CA  . SER A 1 128 ? -18.178 13.830  -1.840  1.00 23.04  ? 128 SER A CA  1 
ATOM   964  C C   . SER A 1 128 ? -16.893 13.912  -2.622  1.00 22.27  ? 128 SER A C   1 
ATOM   965  O O   . SER A 1 128 ? -15.973 14.472  -2.109  1.00 23.47  ? 128 SER A O   1 
ATOM   966  C CB  . SER A 1 128 ? -18.022 12.842  -0.672  1.00 23.40  ? 128 SER A CB  1 
ATOM   967  O OG  . SER A 1 128 ? -17.704 11.580  -1.209  1.00 24.34  ? 128 SER A OG  1 
ATOM   968  N N   . SER A 1 129 ? -16.859 13.416  -3.864  1.00 22.25  ? 129 SER A N   1 
ATOM   969  C CA  . SER A 1 129 ? -15.596 13.264  -4.640  1.00 21.70  ? 129 SER A CA  1 
ATOM   970  C C   . SER A 1 129 ? -15.223 14.418  -5.589  1.00 23.22  ? 129 SER A C   1 
ATOM   971  O O   . SER A 1 129 ? -14.203 14.340  -6.324  1.00 24.45  ? 129 SER A O   1 
ATOM   972  C CB  . SER A 1 129 ? -15.595 11.934  -5.422  1.00 19.98  ? 129 SER A CB  1 
ATOM   973  O OG  . SER A 1 129 ? -16.786 11.694  -6.129  1.00 17.26  ? 129 SER A OG  1 
ATOM   974  N N   . LEU A 1 130 ? -16.039 15.477  -5.610  1.00 20.83  ? 130 LEU A N   1 
ATOM   975  C CA  . LEU A 1 130 ? -15.749 16.562  -6.512  1.00 19.21  ? 130 LEU A CA  1 
ATOM   976  C C   . LEU A 1 130 ? -14.447 17.240  -6.152  1.00 20.10  ? 130 LEU A C   1 
ATOM   977  O O   . LEU A 1 130 ? -14.099 17.437  -5.008  1.00 20.85  ? 130 LEU A O   1 
ATOM   978  C CB  . LEU A 1 130 ? -16.883 17.547  -6.543  1.00 19.69  ? 130 LEU A CB  1 
ATOM   979  C CG  . LEU A 1 130 ? -18.289 16.976  -6.894  1.00 20.35  ? 130 LEU A CG  1 
ATOM   980  C CD1 . LEU A 1 130 ? -19.375 18.035  -6.891  1.00 18.65  ? 130 LEU A CD1 1 
ATOM   981  C CD2 . LEU A 1 130 ? -18.289 16.332  -8.257  1.00 19.31  ? 130 LEU A CD2 1 
ATOM   982  N N   . ASP A 1 131 ? -13.706 17.601  -7.168  1.00 23.41  ? 131 ASP A N   1 
ATOM   983  C CA  . ASP A 1 131 ? -12.442 18.318  -7.002  1.00 23.18  ? 131 ASP A CA  1 
ATOM   984  C C   . ASP A 1 131 ? -12.526 19.488  -6.073  1.00 22.83  ? 131 ASP A C   1 
ATOM   985  O O   . ASP A 1 131 ? -11.608 19.770  -5.331  1.00 24.64  ? 131 ASP A O   1 
ATOM   986  C CB  . ASP A 1 131 ? -11.923 18.783  -8.356  1.00 21.91  ? 131 ASP A CB  1 
ATOM   987  C CG  . ASP A 1 131 ? -11.565 17.639  -9.253  1.00 21.98  ? 131 ASP A CG  1 
ATOM   988  O OD1 . ASP A 1 131 ? -11.621 16.476  -8.785  1.00 21.98  ? 131 ASP A OD1 1 
ATOM   989  O OD2 . ASP A 1 131 ? -11.222 17.907  -10.425 1.00 22.73  ? 131 ASP A OD2 1 
ATOM   990  N N   . VAL A 1 132 ? -13.648 20.172  -6.129  1.00 25.14  ? 132 VAL A N   1 
ATOM   991  C CA  . VAL A 1 132 ? -13.857 21.391  -5.366  1.00 23.48  ? 132 VAL A CA  1 
ATOM   992  C C   . VAL A 1 132 ? -14.094 21.127  -3.868  1.00 23.11  ? 132 VAL A C   1 
ATOM   993  O O   . VAL A 1 132 ? -14.108 22.071  -3.107  1.00 22.72  ? 132 VAL A O   1 
ATOM   994  C CB  . VAL A 1 132 ? -15.004 22.221  -5.993  1.00 22.67  ? 132 VAL A CB  1 
ATOM   995  C CG1 . VAL A 1 132 ? -16.407 21.689  -5.656  1.00 19.59  ? 132 VAL A CG1 1 
ATOM   996  C CG2 . VAL A 1 132 ? -14.847 23.658  -5.597  1.00 23.78  ? 132 VAL A CG2 1 
ATOM   997  N N   . TYR A 1 133 ? -14.266 19.855  -3.459  1.00 22.22  ? 133 TYR A N   1 
ATOM   998  C CA  . TYR A 1 133 ? -14.372 19.475  -2.039  1.00 19.85  ? 133 TYR A CA  1 
ATOM   999  C C   . TYR A 1 133 ? -13.167 18.737  -1.461  1.00 21.45  ? 133 TYR A C   1 
ATOM   1000 O O   . TYR A 1 133 ? -13.228 18.166  -0.368  1.00 20.94  ? 133 TYR A O   1 
ATOM   1001 C CB  . TYR A 1 133 ? -15.544 18.603  -1.820  1.00 17.89  ? 133 TYR A CB  1 
ATOM   1002 C CG  . TYR A 1 133 ? -16.823 19.141  -2.331  1.00 17.88  ? 133 TYR A CG  1 
ATOM   1003 C CD1 . TYR A 1 133 ? -17.075 20.517  -2.408  1.00 17.47  ? 133 TYR A CD1 1 
ATOM   1004 C CD2 . TYR A 1 133 ? -17.834 18.256  -2.725  1.00 17.65  ? 133 TYR A CD2 1 
ATOM   1005 C CE1 . TYR A 1 133 ? -18.303 20.990  -2.893  1.00 16.76  ? 133 TYR A CE1 1 
ATOM   1006 C CE2 . TYR A 1 133 ? -19.049 18.724  -3.173  1.00 18.03  ? 133 TYR A CE2 1 
ATOM   1007 C CZ  . TYR A 1 133 ? -19.264 20.082  -3.275  1.00 16.77  ? 133 TYR A CZ  1 
ATOM   1008 O OH  . TYR A 1 133 ? -20.470 20.443  -3.735  1.00 16.93  ? 133 TYR A OH  1 
ATOM   1009 N N   . ASP A 1 134 ? -12.065 18.776  -2.181  1.00 22.21  ? 134 ASP A N   1 
ATOM   1010 C CA  . ASP A 1 134 ? -10.840 18.183  -1.720  1.00 24.95  ? 134 ASP A CA  1 
ATOM   1011 C C   . ASP A 1 134 ? -10.413 18.736  -0.347  1.00 25.04  ? 134 ASP A C   1 
ATOM   1012 O O   . ASP A 1 134 ? -10.129 19.930  -0.159  1.00 26.41  ? 134 ASP A O   1 
ATOM   1013 C CB  . ASP A 1 134 ? -9.785  18.398  -2.830  1.00 28.87  ? 134 ASP A CB  1 
ATOM   1014 C CG  . ASP A 1 134 ? -8.427  17.692  -2.578  1.00 30.59  ? 134 ASP A CG  1 
ATOM   1015 O OD1 . ASP A 1 134 ? -8.238  16.924  -1.566  1.00 30.27  ? 134 ASP A OD1 1 
ATOM   1016 O OD2 . ASP A 1 134 ? -7.573  17.930  -3.482  1.00 29.24  ? 134 ASP A OD2 1 
ATOM   1017 N N   . GLY A 1 135 ? -10.358 17.833  0.617   1.00 25.60  ? 135 GLY A N   1 
ATOM   1018 C CA  . GLY A 1 135 ? -10.026 18.177  1.994   1.00 26.52  ? 135 GLY A CA  1 
ATOM   1019 C C   . GLY A 1 135 ? -8.548  18.375  2.312   1.00 31.37  ? 135 GLY A C   1 
ATOM   1020 O O   . GLY A 1 135 ? -8.167  18.610  3.495   1.00 35.59  ? 135 GLY A O   1 
ATOM   1021 N N   . ARG A 1 136 ? -7.683  18.268  1.302   1.00 27.93  ? 136 ARG A N   1 
ATOM   1022 C CA  . ARG A 1 136 ? -6.291  18.183  1.640   1.00 26.21  ? 136 ARG A CA  1 
ATOM   1023 C C   . ARG A 1 136 ? -5.807  19.542  2.171   1.00 30.50  ? 136 ARG A C   1 
ATOM   1024 O O   . ARG A 1 136 ? -5.080  19.593  3.155   1.00 35.26  ? 136 ARG A O   1 
ATOM   1025 C CB  . ARG A 1 136 ? -5.459  17.620  0.489   1.00 23.22  ? 136 ARG A CB  1 
ATOM   1026 C CG  . ARG A 1 136 ? -5.054  18.638  -0.557  1.00 23.95  ? 136 ARG A CG  1 
ATOM   1027 C CD  . ARG A 1 136 ? -4.321  18.022  -1.712  1.00 24.03  ? 136 ARG A CD  1 
ATOM   1028 N NE  . ARG A 1 136 ? -5.161  17.009  -2.367  1.00 24.59  ? 136 ARG A NE  1 
ATOM   1029 C CZ  . ARG A 1 136 ? -4.705  16.092  -3.216  1.00 23.49  ? 136 ARG A CZ  1 
ATOM   1030 N NH1 . ARG A 1 136 ? -3.422  16.071  -3.490  1.00 24.86  ? 136 ARG A NH1 1 
ATOM   1031 N NH2 . ARG A 1 136 ? -5.515  15.190  -3.767  1.00 21.89  ? 136 ARG A NH2 1 
ATOM   1032 N N   . PHE A 1 137 ? -6.246  20.642  1.556   1.00 31.48  ? 137 PHE A N   1 
ATOM   1033 C CA  . PHE A 1 137 ? -5.628  21.913  1.823   1.00 29.29  ? 137 PHE A CA  1 
ATOM   1034 C C   . PHE A 1 137 ? -6.051  22.425  3.181   1.00 32.93  ? 137 PHE A C   1 
ATOM   1035 O O   . PHE A 1 137 ? -5.291  23.085  3.871   1.00 31.65  ? 137 PHE A O   1 
ATOM   1036 C CB  . PHE A 1 137 ? -6.008  22.863  0.741   1.00 27.22  ? 137 PHE A CB  1 
ATOM   1037 C CG  . PHE A 1 137 ? -5.529  22.426  -0.587  1.00 28.40  ? 137 PHE A CG  1 
ATOM   1038 C CD1 . PHE A 1 137 ? -4.199  22.544  -0.927  1.00 29.68  ? 137 PHE A CD1 1 
ATOM   1039 C CD2 . PHE A 1 137 ? -6.386  21.885  -1.511  1.00 30.20  ? 137 PHE A CD2 1 
ATOM   1040 C CE1 . PHE A 1 137 ? -3.730  22.119  -2.178  1.00 30.61  ? 137 PHE A CE1 1 
ATOM   1041 C CE2 . PHE A 1 137 ? -5.921  21.467  -2.771  1.00 30.27  ? 137 PHE A CE2 1 
ATOM   1042 C CZ  . PHE A 1 137 ? -4.593  21.585  -3.104  1.00 29.49  ? 137 PHE A CZ  1 
ATOM   1043 N N   . LEU A 1 138 ? -7.260  22.071  3.592   1.00 34.60  ? 138 LEU A N   1 
ATOM   1044 C CA  . LEU A 1 138 ? -7.773  22.590  4.825   1.00 30.70  ? 138 LEU A CA  1 
ATOM   1045 C C   . LEU A 1 138 ? -7.174  21.860  6.012   1.00 31.72  ? 138 LEU A C   1 
ATOM   1046 O O   . LEU A 1 138 ? -6.905  22.447  7.090   1.00 35.66  ? 138 LEU A O   1 
ATOM   1047 C CB  . LEU A 1 138 ? -9.274  22.424  4.781   1.00 30.47  ? 138 LEU A CB  1 
ATOM   1048 C CG  . LEU A 1 138 ? -10.198 22.735  5.947   1.00 27.33  ? 138 LEU A CG  1 
ATOM   1049 C CD1 . LEU A 1 138 ? -10.067 24.163  6.438   1.00 27.34  ? 138 LEU A CD1 1 
ATOM   1050 C CD2 . LEU A 1 138 ? -11.586 22.431  5.436   1.00 25.90  ? 138 LEU A CD2 1 
ATOM   1051 N N   . VAL A 1 139 ? -6.981  20.563  5.830   1.00 31.56  ? 139 VAL A N   1 
ATOM   1052 C CA  . VAL A 1 139 ? -6.401  19.718  6.887   1.00 29.98  ? 139 VAL A CA  1 
ATOM   1053 C C   . VAL A 1 139 ? -4.886  20.034  7.051   1.00 28.93  ? 139 VAL A C   1 
ATOM   1054 O O   . VAL A 1 139 ? -4.346  20.178  8.157   1.00 26.56  ? 139 VAL A O   1 
ATOM   1055 C CB  . VAL A 1 139 ? -6.709  18.269  6.542   1.00 29.52  ? 139 VAL A CB  1 
ATOM   1056 C CG1 . VAL A 1 139 ? -5.689  17.306  7.144   1.00 30.13  ? 139 VAL A CG1 1 
ATOM   1057 C CG2 . VAL A 1 139 ? -8.157  17.985  6.920   1.00 28.42  ? 139 VAL A CG2 1 
ATOM   1058 N N   . GLN A 1 140 ? -4.213  20.225  5.935   1.00 29.14  ? 140 GLN A N   1 
ATOM   1059 C CA  . GLN A 1 140 ? -2.841  20.586  6.018   1.00 33.18  ? 140 GLN A CA  1 
ATOM   1060 C C   . GLN A 1 140 ? -2.702  21.890  6.772   1.00 33.95  ? 140 GLN A C   1 
ATOM   1061 O O   . GLN A 1 140 ? -2.004  21.915  7.760   1.00 37.31  ? 140 GLN A O   1 
ATOM   1062 C CB  . GLN A 1 140 ? -2.232  20.701  4.653   1.00 34.20  ? 140 GLN A CB  1 
ATOM   1063 C CG  . GLN A 1 140 ? -0.736  20.603  4.719   1.00 38.24  ? 140 GLN A CG  1 
ATOM   1064 C CD  . GLN A 1 140 ? -0.084  21.889  5.145   1.00 40.82  ? 140 GLN A CD  1 
ATOM   1065 O OE1 . GLN A 1 140 ? -0.745  22.936  5.250   1.00 39.79  ? 140 GLN A OE1 1 
ATOM   1066 N NE2 . GLN A 1 140 ? 1.230   21.826  5.394   1.00 39.17  ? 140 GLN A NE2 1 
ATOM   1067 N N   . ALA A 1 141 ? -3.374  22.944  6.297   1.00 33.88  ? 141 ALA A N   1 
ATOM   1068 C CA  . ALA A 1 141 ? -3.223  24.334  6.792   1.00 29.58  ? 141 ALA A CA  1 
ATOM   1069 C C   . ALA A 1 141 ? -3.738  24.545  8.182   1.00 29.08  ? 141 ALA A C   1 
ATOM   1070 O O   . ALA A 1 141 ? -3.212  25.428  8.832   1.00 26.65  ? 141 ALA A O   1 
ATOM   1071 C CB  . ALA A 1 141 ? -3.858  25.366  5.863   1.00 25.03  ? 141 ALA A CB  1 
ATOM   1072 N N   . GLU A 1 142 ? -4.733  23.781  8.654   1.00 28.74  ? 142 GLU A N   1 
ATOM   1073 C CA  . GLU A 1 142 ? -5.221  24.042  10.016  1.00 32.01  ? 142 GLU A CA  1 
ATOM   1074 C C   . GLU A 1 142 ? -5.246  22.867  10.975  1.00 34.54  ? 142 GLU A C   1 
ATOM   1075 O O   . GLU A 1 142 ? -5.873  22.962  12.042  1.00 36.57  ? 142 GLU A O   1 
ATOM   1076 C CB  . GLU A 1 142 ? -6.613  24.690  10.034  1.00 34.51  ? 142 GLU A CB  1 
ATOM   1077 C CG  . GLU A 1 142 ? -6.773  26.005  9.306   1.00 33.30  ? 142 GLU A CG  1 
ATOM   1078 C CD  . GLU A 1 142 ? -6.199  27.202  10.030  1.00 35.48  ? 142 GLU A CD  1 
ATOM   1079 O OE1 . GLU A 1 142 ? -6.215  27.254  11.283  1.00 42.20  ? 142 GLU A OE1 1 
ATOM   1080 O OE2 . GLU A 1 142 ? -5.751  28.130  9.324   1.00 33.77  ? 142 GLU A OE2 1 
ATOM   1081 N N   . ARG A 1 143 ? -4.554  21.780  10.616  1.00 36.68  ? 143 ARG A N   1 
ATOM   1082 C CA  . ARG A 1 143 ? -4.462  20.538  11.426  1.00 34.45  ? 143 ARG A CA  1 
ATOM   1083 C C   . ARG A 1 143 ? -5.799  20.211  12.038  1.00 30.28  ? 143 ARG A C   1 
ATOM   1084 O O   . ARG A 1 143 ? -5.882  19.942  13.209  1.00 28.74  ? 143 ARG A O   1 
ATOM   1085 C CB  . ARG A 1 143 ? -3.380  20.573  12.548  1.00 39.81  ? 143 ARG A CB  1 
ATOM   1086 C CG  . ARG A 1 143 ? -2.073  21.365  12.308  1.00 47.72  ? 143 ARG A CG  1 
ATOM   1087 C CD  . ARG A 1 143 ? -0.925  20.558  11.703  1.00 49.76  ? 143 ARG A CD  1 
ATOM   1088 N NE  . ARG A 1 143 ? -0.615  19.324  12.448  1.00 58.21  ? 143 ARG A NE  1 
ATOM   1089 C CZ  . ARG A 1 143 ? 0.076   18.287  11.941  1.00 59.31  ? 143 ARG A CZ  1 
ATOM   1090 N NH1 . ARG A 1 143 ? 0.540   18.313  10.690  1.00 52.08  ? 143 ARG A NH1 1 
ATOM   1091 N NH2 . ARG A 1 143 ? 0.298   17.204  12.674  1.00 56.42  ? 143 ARG A NH2 1 
ATOM   1092 N N   . THR A 1 144 ? -6.877  20.257  11.271  1.00 30.72  ? 144 THR A N   1 
ATOM   1093 C CA  . THR A 1 144 ? -8.129  19.620  11.792  1.00 31.24  ? 144 THR A CA  1 
ATOM   1094 C C   . THR A 1 144 ? -8.318  18.273  11.093  1.00 28.55  ? 144 THR A C   1 
ATOM   1095 O O   . THR A 1 144 ? -7.643  17.969  10.127  1.00 25.66  ? 144 THR A O   1 
ATOM   1096 C CB  . THR A 1 144 ? -9.448  20.435  11.634  1.00 28.97  ? 144 THR A CB  1 
ATOM   1097 O OG1 . THR A 1 144 ? -9.854  20.430  10.266  1.00 29.41  ? 144 THR A OG1 1 
ATOM   1098 C CG2 . THR A 1 144 ? -9.285  21.851  12.050  1.00 29.61  ? 144 THR A CG2 1 
ATOM   1099 N N   . VAL A 1 145 ? -9.235  17.483  11.600  1.00 27.83  ? 145 VAL A N   1 
ATOM   1100 C CA  . VAL A 1 145 ? -9.622  16.304  10.910  1.00 29.75  ? 145 VAL A CA  1 
ATOM   1101 C C   . VAL A 1 145 ? -10.867 16.629  10.091  1.00 33.33  ? 145 VAL A C   1 
ATOM   1102 O O   . VAL A 1 145 ? -11.809 17.322  10.588  1.00 33.53  ? 145 VAL A O   1 
ATOM   1103 C CB  . VAL A 1 145 ? -9.958  15.226  11.906  1.00 28.39  ? 145 VAL A CB  1 
ATOM   1104 C CG1 . VAL A 1 145 ? -10.667 14.087  11.209  1.00 27.25  ? 145 VAL A CG1 1 
ATOM   1105 C CG2 . VAL A 1 145 ? -8.668  14.779  12.569  1.00 28.67  ? 145 VAL A CG2 1 
ATOM   1106 N N   . LEU A 1 146 ? -10.864 16.151  8.841   1.00 28.44  ? 146 LEU A N   1 
ATOM   1107 C CA  . LEU A 1 146 ? -11.992 16.395  7.962   1.00 25.80  ? 146 LEU A CA  1 
ATOM   1108 C C   . LEU A 1 146 ? -12.646 15.110  7.523   1.00 24.08  ? 146 LEU A C   1 
ATOM   1109 O O   . LEU A 1 146 ? -11.978 14.200  7.101   1.00 26.18  ? 146 LEU A O   1 
ATOM   1110 C CB  . LEU A 1 146 ? -11.569 17.268  6.766   1.00 23.78  ? 146 LEU A CB  1 
ATOM   1111 C CG  . LEU A 1 146 ? -12.599 17.607  5.682   1.00 22.53  ? 146 LEU A CG  1 
ATOM   1112 C CD1 . LEU A 1 146 ? -13.911 18.129  6.219   1.00 24.12  ? 146 LEU A CD1 1 
ATOM   1113 C CD2 . LEU A 1 146 ? -12.071 18.669  4.782   1.00 22.20  ? 146 LEU A CD2 1 
ATOM   1114 N N   . VAL A 1 147 ? -13.955 15.060  7.605   1.00 22.64  ? 147 VAL A N   1 
ATOM   1115 C CA  . VAL A 1 147 ? -14.725 13.927  7.094   1.00 25.44  ? 147 VAL A CA  1 
ATOM   1116 C C   . VAL A 1 147 ? -15.799 14.356  6.081   1.00 26.62  ? 147 VAL A C   1 
ATOM   1117 O O   . VAL A 1 147 ? -16.459 15.374  6.329   1.00 30.63  ? 147 VAL A O   1 
ATOM   1118 C CB  . VAL A 1 147 ? -15.447 13.274  8.281   1.00 25.47  ? 147 VAL A CB  1 
ATOM   1119 C CG1 . VAL A 1 147 ? -16.377 12.117  7.851   1.00 21.63  ? 147 VAL A CG1 1 
ATOM   1120 C CG2 . VAL A 1 147 ? -14.410 12.909  9.339   1.00 24.11  ? 147 VAL A CG2 1 
ATOM   1121 N N   . SER A 1 148 ? -15.966 13.633  4.954   1.00 25.67  ? 148 SER A N   1 
ATOM   1122 C CA  . SER A 1 148 ? -17.163 13.833  4.038   1.00 23.67  ? 148 SER A CA  1 
ATOM   1123 C C   . SER A 1 148 ? -17.820 12.522  3.725   1.00 23.52  ? 148 SER A C   1 
ATOM   1124 O O   . SER A 1 148 ? -17.128 11.497  3.586   1.00 23.34  ? 148 SER A O   1 
ATOM   1125 C CB  . SER A 1 148 ? -16.901 14.613  2.736   1.00 22.45  ? 148 SER A CB  1 
ATOM   1126 O OG  . SER A 1 148 ? -15.790 14.171  1.954   1.00 23.28  ? 148 SER A OG  1 
ATOM   1127 N N   . MET A 1 149 ? -19.158 12.512  3.709   1.00 23.15  ? 149 MET A N   1 
ATOM   1128 C CA  . MET A 1 149 ? -19.892 11.329  3.232   1.00 21.52  ? 149 MET A CA  1 
ATOM   1129 C C   . MET A 1 149 ? -20.583 11.607  1.904   1.00 20.54  ? 149 MET A C   1 
ATOM   1130 O O   . MET A 1 149 ? -20.748 12.776  1.502   1.00 21.71  ? 149 MET A O   1 
ATOM   1131 C CB  . MET A 1 149 ? -20.893 10.856  4.258   1.00 21.52  ? 149 MET A CB  1 
ATOM   1132 C CG  . MET A 1 149 ? -22.252 11.523  4.198   1.00 22.15  ? 149 MET A CG  1 
ATOM   1133 S SD  . MET A 1 149 ? -22.223 13.202  4.820   1.00 22.23  ? 149 MET A SD  1 
ATOM   1134 C CE  . MET A 1 149 ? -21.878 13.109  6.556   1.00 23.14  ? 149 MET A CE  1 
ATOM   1135 N N   . ASN A 1 150 ? -20.901 10.522  1.212   1.00 20.13  ? 150 ASN A N   1 
ATOM   1136 C CA  . ASN A 1 150 ? -21.938 10.508  0.155   1.00 20.56  ? 150 ASN A CA  1 
ATOM   1137 C C   . ASN A 1 150 ? -23.255 10.136  0.807   1.00 20.07  ? 150 ASN A C   1 
ATOM   1138 O O   . ASN A 1 150 ? -23.237 9.354   1.770   1.00 20.99  ? 150 ASN A O   1 
ATOM   1139 C CB  . ASN A 1 150 ? -21.660 9.415   -0.851  1.00 19.16  ? 150 ASN A CB  1 
ATOM   1140 C CG  . ASN A 1 150 ? -20.715 9.838   -1.922  1.00 19.59  ? 150 ASN A CG  1 
ATOM   1141 O OD1 . ASN A 1 150 ? -20.121 10.927  -1.904  1.00 18.18  ? 150 ASN A OD1 1 
ATOM   1142 N ND2 . ASN A 1 150 ? -20.584 8.966   -2.902  1.00 21.09  ? 150 ASN A ND2 1 
ATOM   1143 N N   . TYR A 1 151 ? -24.370 10.664  0.311   1.00 17.83  ? 151 TYR A N   1 
ATOM   1144 C CA  . TYR A 1 151 ? -25.672 10.286  0.850   1.00 17.25  ? 151 TYR A CA  1 
ATOM   1145 C C   . TYR A 1 151 ? -26.575 10.197  -0.350  1.00 17.24  ? 151 TYR A C   1 
ATOM   1146 O O   . TYR A 1 151 ? -26.366 10.938  -1.299  1.00 17.15  ? 151 TYR A O   1 
ATOM   1147 C CB  . TYR A 1 151 ? -26.193 11.297  1.882   1.00 15.87  ? 151 TYR A CB  1 
ATOM   1148 C CG  . TYR A 1 151 ? -26.375 12.705  1.338   1.00 16.08  ? 151 TYR A CG  1 
ATOM   1149 C CD1 . TYR A 1 151 ? -25.308 13.606  1.327   1.00 14.81  ? 151 TYR A CD1 1 
ATOM   1150 C CD2 . TYR A 1 151 ? -27.619 13.145  0.807   1.00 15.74  ? 151 TYR A CD2 1 
ATOM   1151 C CE1 . TYR A 1 151 ? -25.445 14.904  0.848   1.00 14.01  ? 151 TYR A CE1 1 
ATOM   1152 C CE2 . TYR A 1 151 ? -27.735 14.443  0.309   1.00 14.79  ? 151 TYR A CE2 1 
ATOM   1153 C CZ  . TYR A 1 151 ? -26.636 15.311  0.335   1.00 14.18  ? 151 TYR A CZ  1 
ATOM   1154 O OH  . TYR A 1 151 ? -26.709 16.594  -0.168  1.00 14.05  ? 151 TYR A OH  1 
ATOM   1155 N N   . ARG A 1 152 ? -27.539 9.287   -0.325  1.00 17.04  ? 152 ARG A N   1 
ATOM   1156 C CA  . ARG A 1 152 ? -28.454 9.125   -1.441  1.00 18.61  ? 152 ARG A CA  1 
ATOM   1157 C C   . ARG A 1 152 ? -29.178 10.449  -1.851  1.00 19.59  ? 152 ARG A C   1 
ATOM   1158 O O   . ARG A 1 152 ? -29.558 11.222  -0.981  1.00 23.56  ? 152 ARG A O   1 
ATOM   1159 C CB  . ARG A 1 152 ? -29.476 8.014   -1.124  1.00 19.58  ? 152 ARG A CB  1 
ATOM   1160 C CG  . ARG A 1 152 ? -28.968 6.581   -1.389  1.00 19.78  ? 152 ARG A CG  1 
ATOM   1161 C CD  . ARG A 1 152 ? -29.943 5.509   -0.876  1.00 17.88  ? 152 ARG A CD  1 
ATOM   1162 N NE  . ARG A 1 152 ? -29.966 5.444   0.565   1.00 17.23  ? 152 ARG A NE  1 
ATOM   1163 C CZ  . ARG A 1 152 ? -30.830 4.709   1.265   1.00 18.58  ? 152 ARG A CZ  1 
ATOM   1164 N NH1 . ARG A 1 152 ? -31.760 3.936   0.669   1.00 18.50  ? 152 ARG A NH1 1 
ATOM   1165 N NH2 . ARG A 1 152 ? -30.773 4.747   2.583   1.00 17.90  ? 152 ARG A NH2 1 
ATOM   1166 N N   . VAL A 1 153 ? -29.307 10.705  -3.161  1.00 18.58  ? 153 VAL A N   1 
ATOM   1167 C CA  . VAL A 1 153 ? -30.095 11.807  -3.694  1.00 17.18  ? 153 VAL A CA  1 
ATOM   1168 C C   . VAL A 1 153 ? -31.266 11.368  -4.599  1.00 17.80  ? 153 VAL A C   1 
ATOM   1169 O O   . VAL A 1 153 ? -31.440 10.170  -4.902  1.00 17.83  ? 153 VAL A O   1 
ATOM   1170 C CB  . VAL A 1 153 ? -29.225 12.824  -4.453  1.00 16.62  ? 153 VAL A CB  1 
ATOM   1171 C CG1 . VAL A 1 153 ? -28.180 13.363  -3.526  1.00 17.05  ? 153 VAL A CG1 1 
ATOM   1172 C CG2 . VAL A 1 153 ? -28.547 12.245  -5.678  1.00 15.20  ? 153 VAL A CG2 1 
ATOM   1173 N N   . GLY A 1 154 ? -32.046 12.360  -5.043  1.00 17.51  ? 154 GLY A N   1 
ATOM   1174 C CA  . GLY A 1 154 ? -33.265 12.121  -5.814  1.00 18.31  ? 154 GLY A CA  1 
ATOM   1175 C C   . GLY A 1 154 ? -34.233 11.063  -5.304  1.00 18.69  ? 154 GLY A C   1 
ATOM   1176 O O   . GLY A 1 154 ? -34.456 10.916  -4.101  1.00 18.48  ? 154 GLY A O   1 
ATOM   1177 N N   . ALA A 1 155 ? -34.856 10.333  -6.218  1.00 18.77  ? 155 ALA A N   1 
ATOM   1178 C CA  . ALA A 1 155 ? -35.847 9.370   -5.760  1.00 18.43  ? 155 ALA A CA  1 
ATOM   1179 C C   . ALA A 1 155 ? -35.268 8.386   -4.671  1.00 20.24  ? 155 ALA A C   1 
ATOM   1180 O O   . ALA A 1 155 ? -35.956 8.012   -3.719  1.00 21.80  ? 155 ALA A O   1 
ATOM   1181 C CB  . ALA A 1 155 ? -36.410 8.644   -6.967  1.00 16.24  ? 155 ALA A CB  1 
ATOM   1182 N N   . PHE A 1 156 ? -33.986 8.013   -4.817  1.00 20.94  ? 156 PHE A N   1 
ATOM   1183 C CA  . PHE A 1 156 ? -33.340 6.921   -4.088  1.00 20.71  ? 156 PHE A CA  1 
ATOM   1184 C C   . PHE A 1 156 ? -33.091 7.423   -2.695  1.00 22.88  ? 156 PHE A C   1 
ATOM   1185 O O   . PHE A 1 156 ? -32.931 6.650   -1.776  1.00 24.15  ? 156 PHE A O   1 
ATOM   1186 C CB  . PHE A 1 156 ? -31.970 6.577   -4.743  1.00 20.14  ? 156 PHE A CB  1 
ATOM   1187 C CG  . PHE A 1 156 ? -32.042 6.306   -6.245  1.00 19.85  ? 156 PHE A CG  1 
ATOM   1188 C CD1 . PHE A 1 156 ? -32.448 5.084   -6.735  1.00 20.21  ? 156 PHE A CD1 1 
ATOM   1189 C CD2 . PHE A 1 156 ? -31.731 7.278   -7.169  1.00 19.96  ? 156 PHE A CD2 1 
ATOM   1190 C CE1 . PHE A 1 156 ? -32.538 4.840   -8.105  1.00 20.47  ? 156 PHE A CE1 1 
ATOM   1191 C CE2 . PHE A 1 156 ? -31.792 7.036   -8.546  1.00 19.07  ? 156 PHE A CE2 1 
ATOM   1192 C CZ  . PHE A 1 156 ? -32.222 5.830   -9.022  1.00 19.01  ? 156 PHE A CZ  1 
ATOM   1193 N N   . GLY A 1 157 ? -32.970 8.741   -2.569  1.00 25.30  ? 157 GLY A N   1 
ATOM   1194 C CA  . GLY A 1 157 ? -32.786 9.421   -1.288  1.00 25.50  ? 157 GLY A CA  1 
ATOM   1195 C C   . GLY A 1 157 ? -34.121 9.943   -0.692  1.00 24.96  ? 157 GLY A C   1 
ATOM   1196 O O   . GLY A 1 157 ? -34.307 9.926   0.550   1.00 24.02  ? 157 GLY A O   1 
ATOM   1197 N N   . PHE A 1 158 ? -35.030 10.450  -1.543  1.00 22.75  ? 158 PHE A N   1 
ATOM   1198 C CA  . PHE A 1 158 ? -36.187 11.206  -1.022  1.00 21.69  ? 158 PHE A CA  1 
ATOM   1199 C C   . PHE A 1 158 ? -37.574 10.954  -1.608  1.00 22.84  ? 158 PHE A C   1 
ATOM   1200 O O   . PHE A 1 158 ? -38.508 11.659  -1.275  1.00 26.39  ? 158 PHE A O   1 
ATOM   1201 C CB  . PHE A 1 158 ? -35.892 12.678  -0.946  1.00 18.46  ? 158 PHE A CB  1 
ATOM   1202 C CG  . PHE A 1 158 ? -34.660 12.980  -0.208  1.00 17.89  ? 158 PHE A CG  1 
ATOM   1203 C CD1 . PHE A 1 158 ? -34.693 13.263  1.134   1.00 17.64  ? 158 PHE A CD1 1 
ATOM   1204 C CD2 . PHE A 1 158 ? -33.417 12.999  -0.861  1.00 17.98  ? 158 PHE A CD2 1 
ATOM   1205 C CE1 . PHE A 1 158 ? -33.492 13.559  1.837   1.00 17.81  ? 158 PHE A CE1 1 
ATOM   1206 C CE2 . PHE A 1 158 ? -32.224 13.287  -0.160  1.00 17.12  ? 158 PHE A CE2 1 
ATOM   1207 C CZ  . PHE A 1 158 ? -32.254 13.571  1.194   1.00 16.41  ? 158 PHE A CZ  1 
ATOM   1208 N N   . LEU A 1 159 ? -37.722 9.932   -2.436  1.00 22.71  ? 159 LEU A N   1 
ATOM   1209 C CA  . LEU A 1 159 ? -39.030 9.415   -2.758  1.00 22.44  ? 159 LEU A CA  1 
ATOM   1210 C C   . LEU A 1 159 ? -39.679 9.024   -1.465  1.00 23.03  ? 159 LEU A C   1 
ATOM   1211 O O   . LEU A 1 159 ? -39.046 8.375   -0.657  1.00 28.82  ? 159 LEU A O   1 
ATOM   1212 C CB  . LEU A 1 159 ? -38.913 8.159   -3.627  1.00 21.55  ? 159 LEU A CB  1 
ATOM   1213 C CG  . LEU A 1 159 ? -40.303 7.838   -4.187  1.00 21.15  ? 159 LEU A CG  1 
ATOM   1214 C CD1 . LEU A 1 159 ? -40.349 7.923   -5.713  1.00 19.88  ? 159 LEU A CD1 1 
ATOM   1215 C CD2 . LEU A 1 159 ? -40.761 6.499   -3.674  1.00 20.30  ? 159 LEU A CD2 1 
ATOM   1216 N N   . ALA A 1 160 ? -40.939 9.393   -1.283  1.00 24.49  ? 160 ALA A N   1 
ATOM   1217 C CA  . ALA A 1 160 ? -41.714 9.133   -0.068  1.00 24.44  ? 160 ALA A CA  1 
ATOM   1218 C C   . ALA A 1 160 ? -43.198 8.840   -0.355  1.00 27.87  ? 160 ALA A C   1 
ATOM   1219 O O   . ALA A 1 160 ? -43.872 9.566   -1.092  1.00 29.26  ? 160 ALA A O   1 
ATOM   1220 C CB  . ALA A 1 160 ? -41.606 10.327  0.846   1.00 22.45  ? 160 ALA A CB  1 
ATOM   1221 N N   . LEU A 1 161 ? -43.706 7.756   0.201   1.00 30.88  ? 161 LEU A N   1 
ATOM   1222 C CA  . LEU A 1 161 ? -45.144 7.524   0.243   1.00 32.30  ? 161 LEU A CA  1 
ATOM   1223 C C   . LEU A 1 161 ? -45.476 7.507   1.706   1.00 37.06  ? 161 LEU A C   1 
ATOM   1224 O O   . LEU A 1 161 ? -45.412 6.440   2.353   1.00 39.39  ? 161 LEU A O   1 
ATOM   1225 C CB  . LEU A 1 161 ? -45.494 6.196   -0.386  1.00 30.03  ? 161 LEU A CB  1 
ATOM   1226 C CG  . LEU A 1 161 ? -45.357 6.251   -1.890  1.00 30.31  ? 161 LEU A CG  1 
ATOM   1227 C CD1 . LEU A 1 161 ? -44.791 4.922   -2.302  1.00 31.68  ? 161 LEU A CD1 1 
ATOM   1228 C CD2 . LEU A 1 161 ? -46.703 6.457   -2.540  1.00 28.47  ? 161 LEU A CD2 1 
ATOM   1229 N N   . PRO A 1 162 ? -45.743 8.702   2.262   1.00 40.90  ? 162 PRO A N   1 
ATOM   1230 C CA  . PRO A 1 162 ? -45.914 8.937   3.696   1.00 41.74  ? 162 PRO A CA  1 
ATOM   1231 C C   . PRO A 1 162 ? -46.587 7.810   4.496   1.00 44.50  ? 162 PRO A C   1 
ATOM   1232 O O   . PRO A 1 162 ? -47.635 7.308   4.109   1.00 37.26  ? 162 PRO A O   1 
ATOM   1233 C CB  . PRO A 1 162 ? -46.740 10.204  3.708   1.00 38.60  ? 162 PRO A CB  1 
ATOM   1234 C CG  . PRO A 1 162 ? -46.081 10.993  2.611   1.00 38.71  ? 162 PRO A CG  1 
ATOM   1235 C CD  . PRO A 1 162 ? -45.824 9.977   1.519   1.00 39.78  ? 162 PRO A CD  1 
ATOM   1236 N N   . GLY A 1 163 ? -45.932 7.404   5.588   1.00 52.05  ? 163 GLY A N   1 
ATOM   1237 C CA  . GLY A 1 163 ? -46.438 6.347   6.446   1.00 52.07  ? 163 GLY A CA  1 
ATOM   1238 C C   . GLY A 1 163 ? -46.606 5.014   5.753   1.00 51.21  ? 163 GLY A C   1 
ATOM   1239 O O   . GLY A 1 163 ? -47.593 4.353   5.951   1.00 59.96  ? 163 GLY A O   1 
ATOM   1240 N N   . SER A 1 164 ? -45.671 4.629   4.903   1.00 47.55  ? 164 SER A N   1 
ATOM   1241 C CA  . SER A 1 164 ? -45.584 3.242   4.515   1.00 44.39  ? 164 SER A CA  1 
ATOM   1242 C C   . SER A 1 164 ? -44.224 2.801   5.064   1.00 46.31  ? 164 SER A C   1 
ATOM   1243 O O   . SER A 1 164 ? -43.334 3.641   5.329   1.00 45.44  ? 164 SER A O   1 
ATOM   1244 C CB  . SER A 1 164 ? -45.629 3.094   3.010   1.00 43.77  ? 164 SER A CB  1 
ATOM   1245 O OG  . SER A 1 164 ? -44.386 3.522   2.480   1.00 40.77  ? 164 SER A OG  1 
ATOM   1246 N N   . ARG A 1 165 ? -44.059 1.497   5.267   1.00 43.88  ? 165 ARG A N   1 
ATOM   1247 C CA  . ARG A 1 165 ? -42.811 1.015   5.815   1.00 42.55  ? 165 ARG A CA  1 
ATOM   1248 C C   . ARG A 1 165 ? -41.799 0.874   4.639   1.00 46.20  ? 165 ARG A C   1 
ATOM   1249 O O   . ARG A 1 165 ? -40.584 0.838   4.875   1.00 44.70  ? 165 ARG A O   1 
ATOM   1250 C CB  . ARG A 1 165 ? -43.019 -0.259  6.667   1.00 38.02  ? 165 ARG A CB  1 
ATOM   1251 N N   . GLU A 1 166 ? -42.308 0.895   3.386   1.00 46.74  ? 166 GLU A N   1 
ATOM   1252 C CA  . GLU A 1 166 ? -41.545 0.530   2.152   1.00 44.45  ? 166 GLU A CA  1 
ATOM   1253 C C   . GLU A 1 166 ? -40.844 1.685   1.424   1.00 43.85  ? 166 GLU A C   1 
ATOM   1254 O O   . GLU A 1 166 ? -39.844 1.464   0.710   1.00 45.84  ? 166 GLU A O   1 
ATOM   1255 C CB  . GLU A 1 166 ? -42.422 -0.216  1.133   1.00 44.29  ? 166 GLU A CB  1 
ATOM   1256 C CG  . GLU A 1 166 ? -42.935 -1.580  1.579   1.00 46.74  ? 166 GLU A CG  1 
ATOM   1257 C CD  . GLU A 1 166 ? -44.433 -1.538  1.980   1.00 56.36  ? 166 GLU A CD  1 
ATOM   1258 O OE1 . GLU A 1 166 ? -44.965 -0.447  2.385   1.00 57.83  ? 166 GLU A OE1 1 
ATOM   1259 O OE2 . GLU A 1 166 ? -45.096 -2.604  1.889   1.00 52.54  ? 166 GLU A OE2 1 
ATOM   1260 N N   . ALA A 1 167 ? -41.377 2.895   1.586   1.00 38.02  ? 167 ALA A N   1 
ATOM   1261 C CA  . ALA A 1 167 ? -40.690 4.092   1.160   1.00 35.31  ? 167 ALA A CA  1 
ATOM   1262 C C   . ALA A 1 167 ? -41.068 5.173   2.110   1.00 37.17  ? 167 ALA A C   1 
ATOM   1263 O O   . ALA A 1 167 ? -41.907 6.017   1.810   1.00 40.45  ? 167 ALA A O   1 
ATOM   1264 C CB  . ALA A 1 167 ? -41.101 4.479   -0.232  1.00 31.27  ? 167 ALA A CB  1 
ATOM   1265 N N   . PRO A 1 168 ? -40.460 5.168   3.280   1.00 36.51  ? 168 PRO A N   1 
ATOM   1266 C CA  . PRO A 1 168 ? -40.905 6.179   4.245   1.00 35.34  ? 168 PRO A CA  1 
ATOM   1267 C C   . PRO A 1 168 ? -40.444 7.615   3.947   1.00 33.98  ? 168 PRO A C   1 
ATOM   1268 O O   . PRO A 1 168 ? -40.967 8.503   4.586   1.00 35.47  ? 168 PRO A O   1 
ATOM   1269 C CB  . PRO A 1 168 ? -40.248 5.719   5.547   1.00 32.48  ? 168 PRO A CB  1 
ATOM   1270 C CG  . PRO A 1 168 ? -38.934 5.167   5.058   1.00 34.82  ? 168 PRO A CG  1 
ATOM   1271 C CD  . PRO A 1 168 ? -39.259 4.456   3.735   1.00 35.24  ? 168 PRO A CD  1 
ATOM   1272 N N   . GLY A 1 169 ? -39.473 7.849   3.043   1.00 32.84  ? 169 GLY A N   1 
ATOM   1273 C CA  . GLY A 1 169 ? -38.901 9.204   2.887   1.00 28.40  ? 169 GLY A CA  1 
ATOM   1274 C C   . GLY A 1 169 ? -37.706 9.529   3.798   1.00 28.49  ? 169 GLY A C   1 
ATOM   1275 O O   . GLY A 1 169 ? -37.391 8.794   4.708   1.00 30.06  ? 169 GLY A O   1 
ATOM   1276 N N   . ASN A 1 170 ? -37.030 10.636  3.540   1.00 26.95  ? 170 ASN A N   1 
ATOM   1277 C CA  . ASN A 1 170 ? -35.937 11.095  4.360   1.00 25.57  ? 170 ASN A CA  1 
ATOM   1278 C C   . ASN A 1 170 ? -34.733 10.149  4.563   1.00 27.10  ? 170 ASN A C   1 
ATOM   1279 O O   . ASN A 1 170 ? -33.836 10.381  5.474   1.00 24.97  ? 170 ASN A O   1 
ATOM   1280 C CB  . ASN A 1 170 ? -36.485 11.617  5.666   1.00 27.33  ? 170 ASN A CB  1 
ATOM   1281 C CG  . ASN A 1 170 ? -37.432 12.784  5.464   1.00 28.58  ? 170 ASN A CG  1 
ATOM   1282 O OD1 . ASN A 1 170 ? -37.262 13.570  4.566   1.00 33.03  ? 170 ASN A OD1 1 
ATOM   1283 N ND2 . ASN A 1 170 ? -38.411 12.908  6.316   1.00 31.97  ? 170 ASN A ND2 1 
ATOM   1284 N N   . VAL A 1 171 ? -34.662 9.112   3.704   1.00 23.11  ? 171 VAL A N   1 
ATOM   1285 C CA  . VAL A 1 171 ? -33.552 8.168   3.862   1.00 20.69  ? 171 VAL A CA  1 
ATOM   1286 C C   . VAL A 1 171 ? -32.198 8.775   3.544   1.00 19.64  ? 171 VAL A C   1 
ATOM   1287 O O   . VAL A 1 171 ? -31.237 8.412   4.152   1.00 20.28  ? 171 VAL A O   1 
ATOM   1288 C CB  . VAL A 1 171 ? -33.769 6.854   3.141   1.00 20.88  ? 171 VAL A CB  1 
ATOM   1289 C CG1 . VAL A 1 171 ? -35.009 6.175   3.682   1.00 19.71  ? 171 VAL A CG1 1 
ATOM   1290 C CG2 . VAL A 1 171 ? -33.921 7.089   1.663   1.00 21.23  ? 171 VAL A CG2 1 
ATOM   1291 N N   . GLY A 1 172 ? -32.120 9.730   2.627   1.00 19.09  ? 172 GLY A N   1 
ATOM   1292 C CA  . GLY A 1 172 ? -30.886 10.471  2.437   1.00 18.51  ? 172 GLY A CA  1 
ATOM   1293 C C   . GLY A 1 172 ? -30.447 11.119  3.747   1.00 19.89  ? 172 GLY A C   1 
ATOM   1294 O O   . GLY A 1 172 ? -29.241 11.125  4.080   1.00 20.53  ? 172 GLY A O   1 
ATOM   1295 N N   . LEU A 1 173 ? -31.397 11.694  4.501   1.00 19.82  ? 173 LEU A N   1 
ATOM   1296 C CA  . LEU A 1 173 ? -31.038 12.299  5.796   1.00 19.91  ? 173 LEU A CA  1 
ATOM   1297 C C   . LEU A 1 173 ? -30.559 11.231  6.763   1.00 20.96  ? 173 LEU A C   1 
ATOM   1298 O O   . LEU A 1 173 ? -29.558 11.446  7.454   1.00 21.10  ? 173 LEU A O   1 
ATOM   1299 C CB  . LEU A 1 173 ? -32.177 13.090  6.427   1.00 19.15  ? 173 LEU A CB  1 
ATOM   1300 C CG  . LEU A 1 173 ? -32.428 14.378  5.664   1.00 19.24  ? 173 LEU A CG  1 
ATOM   1301 C CD1 . LEU A 1 173 ? -33.736 15.006  6.040   1.00 18.83  ? 173 LEU A CD1 1 
ATOM   1302 C CD2 . LEU A 1 173 ? -31.306 15.341  5.895   1.00 19.10  ? 173 LEU A CD2 1 
ATOM   1303 N N   . LEU A 1 174 ? -31.232 10.073  6.779   1.00 20.03  ? 174 LEU A N   1 
ATOM   1304 C CA  . LEU A 1 174 ? -30.739 8.977   7.576   1.00 20.06  ? 174 LEU A CA  1 
ATOM   1305 C C   . LEU A 1 174 ? -29.314 8.514   7.199   1.00 22.99  ? 174 LEU A C   1 
ATOM   1306 O O   . LEU A 1 174 ? -28.503 8.209   8.096   1.00 26.81  ? 174 LEU A O   1 
ATOM   1307 C CB  . LEU A 1 174 ? -31.698 7.835   7.496   1.00 18.24  ? 174 LEU A CB  1 
ATOM   1308 C CG  . LEU A 1 174 ? -33.005 8.026   8.232   1.00 17.55  ? 174 LEU A CG  1 
ATOM   1309 C CD1 . LEU A 1 174 ? -33.903 6.799   8.096   1.00 15.99  ? 174 LEU A CD1 1 
ATOM   1310 C CD2 . LEU A 1 174 ? -32.680 8.421   9.675   1.00 17.38  ? 174 LEU A CD2 1 
ATOM   1311 N N   . ASP A 1 175 ? -29.009 8.445   5.899   1.00 23.29  ? 175 ASP A N   1 
ATOM   1312 C CA  . ASP A 1 175 ? -27.656 8.147   5.449   1.00 24.12  ? 175 ASP A CA  1 
ATOM   1313 C C   . ASP A 1 175 ? -26.677 9.057   6.157   1.00 24.09  ? 175 ASP A C   1 
ATOM   1314 O O   . ASP A 1 175 ? -25.708 8.583   6.734   1.00 22.15  ? 175 ASP A O   1 
ATOM   1315 C CB  . ASP A 1 175 ? -27.471 8.358   3.933   1.00 25.53  ? 175 ASP A CB  1 
ATOM   1316 C CG  . ASP A 1 175 ? -28.231 7.330   3.067   1.00 27.12  ? 175 ASP A CG  1 
ATOM   1317 O OD1 . ASP A 1 175 ? -28.732 6.276   3.623   1.00 25.34  ? 175 ASP A OD1 1 
ATOM   1318 O OD2 . ASP A 1 175 ? -28.307 7.614   1.819   1.00 23.89  ? 175 ASP A OD2 1 
ATOM   1319 N N   . GLN A 1 176 ? -26.934 10.369  6.098   1.00 26.64  ? 176 GLN A N   1 
ATOM   1320 C CA  . GLN A 1 176 ? -26.051 11.383  6.728   1.00 26.78  ? 176 GLN A CA  1 
ATOM   1321 C C   . GLN A 1 176 ? -25.867 11.062  8.204   1.00 26.70  ? 176 GLN A C   1 
ATOM   1322 O O   . GLN A 1 176 ? -24.747 11.138  8.726   1.00 26.27  ? 176 GLN A O   1 
ATOM   1323 C CB  . GLN A 1 176 ? -26.627 12.781  6.587   1.00 26.26  ? 176 GLN A CB  1 
ATOM   1324 C CG  . GLN A 1 176 ? -26.686 13.217  5.150   1.00 28.96  ? 176 GLN A CG  1 
ATOM   1325 C CD  . GLN A 1 176 ? -27.183 14.629  4.970   1.00 30.52  ? 176 GLN A CD  1 
ATOM   1326 O OE1 . GLN A 1 176 ? -27.202 15.453  5.895   1.00 32.67  ? 176 GLN A OE1 1 
ATOM   1327 N NE2 . GLN A 1 176 ? -27.600 14.915  3.771   1.00 27.56  ? 176 GLN A NE2 1 
ATOM   1328 N N   . ARG A 1 177 ? -26.969 10.684  8.862   1.00 25.01  ? 177 ARG A N   1 
ATOM   1329 C CA  . ARG A 1 177 ? -26.966 10.407  10.287  1.00 24.36  ? 177 ARG A CA  1 
ATOM   1330 C C   . ARG A 1 177 ? -26.004 9.247   10.565  1.00 26.02  ? 177 ARG A C   1 
ATOM   1331 O O   . ARG A 1 177 ? -25.047 9.379   11.356  1.00 26.30  ? 177 ARG A O   1 
ATOM   1332 C CB  . ARG A 1 177 ? -28.384 10.073  10.767  1.00 23.11  ? 177 ARG A CB  1 
ATOM   1333 C CG  . ARG A 1 177 ? -28.476 9.829   12.262  1.00 22.96  ? 177 ARG A CG  1 
ATOM   1334 C CD  . ARG A 1 177 ? -29.875 9.523   12.728  1.00 21.56  ? 177 ARG A CD  1 
ATOM   1335 N NE  . ARG A 1 177 ? -30.584 10.779  12.910  1.00 22.17  ? 177 ARG A NE  1 
ATOM   1336 C CZ  . ARG A 1 177 ? -31.903 10.839  13.093  1.00 23.16  ? 177 ARG A CZ  1 
ATOM   1337 N NH1 . ARG A 1 177 ? -32.625 9.682   13.113  1.00 18.83  ? 177 ARG A NH1 1 
ATOM   1338 N NH2 . ARG A 1 177 ? -32.485 12.048  13.235  1.00 21.93  ? 177 ARG A NH2 1 
ATOM   1339 N N   . LEU A 1 178 ? -26.254 8.127   9.878   1.00 24.79  ? 178 LEU A N   1 
ATOM   1340 C CA  . LEU A 1 178 ? -25.395 6.967   9.956   1.00 23.24  ? 178 LEU A CA  1 
ATOM   1341 C C   . LEU A 1 178 ? -23.910 7.335   9.818   1.00 23.64  ? 178 LEU A C   1 
ATOM   1342 O O   . LEU A 1 178 ? -23.124 6.875   10.590  1.00 26.55  ? 178 LEU A O   1 
ATOM   1343 C CB  . LEU A 1 178 ? -25.820 5.941   8.936   1.00 22.55  ? 178 LEU A CB  1 
ATOM   1344 C CG  . LEU A 1 178 ? -25.011 4.682   9.105   1.00 21.99  ? 178 LEU A CG  1 
ATOM   1345 C CD1 . LEU A 1 178 ? -25.567 3.993   10.321  1.00 20.98  ? 178 LEU A CD1 1 
ATOM   1346 C CD2 . LEU A 1 178 ? -25.163 3.806   7.863   1.00 22.38  ? 178 LEU A CD2 1 
ATOM   1347 N N   . ALA A 1 179 ? -23.530 8.200   8.883   1.00 23.17  ? 179 ALA A N   1 
ATOM   1348 C CA  . ALA A 1 179 ? -22.159 8.658   8.810   1.00 21.50  ? 179 ALA A CA  1 
ATOM   1349 C C   . ALA A 1 179 ? -21.813 9.421   10.057  1.00 24.15  ? 179 ALA A C   1 
ATOM   1350 O O   . ALA A 1 179 ? -20.679 9.367   10.502  1.00 26.51  ? 179 ALA A O   1 
ATOM   1351 C CB  . ALA A 1 179 ? -21.932 9.518   7.607   1.00 18.40  ? 179 ALA A CB  1 
ATOM   1352 N N   . LEU A 1 180 ? -22.761 10.133  10.661  1.00 25.76  ? 180 LEU A N   1 
ATOM   1353 C CA  . LEU A 1 180 ? -22.380 10.888  11.870  1.00 26.06  ? 180 LEU A CA  1 
ATOM   1354 C C   . LEU A 1 180 ? -22.201 9.988   13.118  1.00 27.48  ? 180 LEU A C   1 
ATOM   1355 O O   . LEU A 1 180 ? -21.285 10.288  13.903  1.00 29.39  ? 180 LEU A O   1 
ATOM   1356 C CB  . LEU A 1 180 ? -23.305 12.063  12.150  1.00 25.29  ? 180 LEU A CB  1 
ATOM   1357 C CG  . LEU A 1 180 ? -23.372 13.221  11.152  1.00 26.97  ? 180 LEU A CG  1 
ATOM   1358 C CD1 . LEU A 1 180 ? -24.326 14.289  11.647  1.00 29.18  ? 180 LEU A CD1 1 
ATOM   1359 C CD2 . LEU A 1 180 ? -22.042 13.865  10.831  1.00 26.17  ? 180 LEU A CD2 1 
ATOM   1360 N N   . GLN A 1 181 ? -23.024 8.919   13.263  1.00 24.44  ? 181 GLN A N   1 
ATOM   1361 C CA  . GLN A 1 181 ? -22.828 7.858   14.254  1.00 26.48  ? 181 GLN A CA  1 
ATOM   1362 C C   . GLN A 1 181 ? -21.483 7.190   14.029  1.00 29.04  ? 181 GLN A C   1 
ATOM   1363 O O   . GLN A 1 181 ? -20.691 6.994   14.961  1.00 29.66  ? 181 GLN A O   1 
ATOM   1364 C CB  . GLN A 1 181 ? -23.882 6.773   14.177  1.00 27.54  ? 181 GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 181 ? -25.214 7.049   14.873  1.00 35.43  ? 181 GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 181 ? -26.421 6.340   14.166  1.00 44.85  ? 181 GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 181 ? -26.252 5.420   13.352  1.00 49.55  ? 181 GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 181 ? -27.633 6.765   14.482  1.00 44.39  ? 181 GLN A NE2 1 
ATOM   1369 N N   . TRP A 1 182 ? -21.201 6.862   12.776  1.00 29.49  ? 182 TRP A N   1 
ATOM   1370 C CA  . TRP A 1 182 ? -19.875 6.380   12.398  1.00 26.73  ? 182 TRP A CA  1 
ATOM   1371 C C   . TRP A 1 182 ? -18.717 7.266   12.883  1.00 27.52  ? 182 TRP A C   1 
ATOM   1372 O O   . TRP A 1 182 ? -17.653 6.747   13.207  1.00 27.64  ? 182 TRP A O   1 
ATOM   1373 C CB  . TRP A 1 182 ? -19.764 6.250   10.898  1.00 23.69  ? 182 TRP A CB  1 
ATOM   1374 C CG  . TRP A 1 182 ? -18.583 5.418   10.435  1.00 24.29  ? 182 TRP A CG  1 
ATOM   1375 C CD1 . TRP A 1 182 ? -18.586 4.072   10.121  1.00 21.91  ? 182 TRP A CD1 1 
ATOM   1376 C CD2 . TRP A 1 182 ? -17.208 5.883   10.217  1.00 23.80  ? 182 TRP A CD2 1 
ATOM   1377 N NE1 . TRP A 1 182 ? -17.303 3.695   9.727   1.00 22.37  ? 182 TRP A NE1 1 
ATOM   1378 C CE2 . TRP A 1 182 ? -16.458 4.778   9.769   1.00 21.64  ? 182 TRP A CE2 1 
ATOM   1379 C CE3 . TRP A 1 182 ? -16.563 7.129   10.340  1.00 22.29  ? 182 TRP A CE3 1 
ATOM   1380 C CZ2 . TRP A 1 182 ? -15.124 4.884   9.434   1.00 21.77  ? 182 TRP A CZ2 1 
ATOM   1381 C CZ3 . TRP A 1 182 ? -15.186 7.225   10.017  1.00 22.02  ? 182 TRP A CZ3 1 
ATOM   1382 C CH2 . TRP A 1 182 ? -14.493 6.118   9.593   1.00 23.07  ? 182 TRP A CH2 1 
ATOM   1383 N N   . VAL A 1 183 ? -18.891 8.589   12.912  1.00 26.93  ? 183 VAL A N   1 
ATOM   1384 C CA  . VAL A 1 183 ? -17.755 9.453   13.191  1.00 25.08  ? 183 VAL A CA  1 
ATOM   1385 C C   . VAL A 1 183 ? -17.528 9.364   14.656  1.00 25.10  ? 183 VAL A C   1 
ATOM   1386 O O   . VAL A 1 183 ? -16.382 9.332   15.109  1.00 23.27  ? 183 VAL A O   1 
ATOM   1387 C CB  . VAL A 1 183 ? -18.020 10.865  12.725  1.00 26.25  ? 183 VAL A CB  1 
ATOM   1388 C CG1 . VAL A 1 183 ? -16.963 11.862  13.204  1.00 25.40  ? 183 VAL A CG1 1 
ATOM   1389 C CG2 . VAL A 1 183 ? -18.026 10.838  11.228  1.00 26.29  ? 183 VAL A CG2 1 
ATOM   1390 N N   . GLN A 1 184 ? -18.647 9.242   15.368  1.00 25.71  ? 184 GLN A N   1 
ATOM   1391 C CA  . GLN A 1 184 ? -18.655 9.017   16.803  1.00 27.77  ? 184 GLN A CA  1 
ATOM   1392 C C   . GLN A 1 184 ? -17.882 7.757   17.155  1.00 28.84  ? 184 GLN A C   1 
ATOM   1393 O O   . GLN A 1 184 ? -17.129 7.725   18.097  1.00 27.33  ? 184 GLN A O   1 
ATOM   1394 C CB  . GLN A 1 184 ? -20.089 8.892   17.324  1.00 28.95  ? 184 GLN A CB  1 
ATOM   1395 C CG  . GLN A 1 184 ? -20.805 10.235  17.504  1.00 31.44  ? 184 GLN A CG  1 
ATOM   1396 C CD  . GLN A 1 184 ? -20.078 11.182  18.443  1.00 32.74  ? 184 GLN A CD  1 
ATOM   1397 O OE1 . GLN A 1 184 ? -20.123 10.983  19.667  1.00 34.05  ? 184 GLN A OE1 1 
ATOM   1398 N NE2 . GLN A 1 184 ? -19.420 12.222  17.889  1.00 31.18  ? 184 GLN A NE2 1 
ATOM   1399 N N   . GLU A 1 185 ? -18.037 6.719   16.367  1.00 30.33  ? 185 GLU A N   1 
ATOM   1400 C CA  . GLU A 1 185 ? -17.417 5.482   16.753  1.00 29.15  ? 185 GLU A CA  1 
ATOM   1401 C C   . GLU A 1 185 ? -15.997 5.336   16.299  1.00 27.55  ? 185 GLU A C   1 
ATOM   1402 O O   . GLU A 1 185 ? -15.296 4.548   16.897  1.00 30.43  ? 185 GLU A O   1 
ATOM   1403 C CB  . GLU A 1 185 ? -18.275 4.279   16.377  1.00 28.03  ? 185 GLU A CB  1 
ATOM   1404 C CG  . GLU A 1 185 ? -19.627 4.384   17.063  1.00 28.77  ? 185 GLU A CG  1 
ATOM   1405 C CD  . GLU A 1 185 ? -20.529 3.211   16.763  1.00 33.11  ? 185 GLU A CD  1 
ATOM   1406 O OE1 . GLU A 1 185 ? -20.030 2.181   16.260  1.00 39.14  ? 185 GLU A OE1 1 
ATOM   1407 O OE2 . GLU A 1 185 ? -21.746 3.290   17.043  1.00 36.80  ? 185 GLU A OE2 1 
ATOM   1408 N N   . ASN A 1 186 ? -15.547 6.112   15.312  1.00 24.57  ? 186 ASN A N   1 
ATOM   1409 C CA  . ASN A 1 186 ? -14.271 5.797   14.664  1.00 23.25  ? 186 ASN A CA  1 
ATOM   1410 C C   . ASN A 1 186 ? -13.368 6.982   14.415  1.00 25.24  ? 186 ASN A C   1 
ATOM   1411 O O   . ASN A 1 186 ? -12.279 6.840   13.907  1.00 28.13  ? 186 ASN A O   1 
ATOM   1412 C CB  . ASN A 1 186 ? -14.477 5.079   13.326  1.00 23.33  ? 186 ASN A CB  1 
ATOM   1413 C CG  . ASN A 1 186 ? -15.333 3.831   13.447  1.00 25.05  ? 186 ASN A CG  1 
ATOM   1414 O OD1 . ASN A 1 186 ? -14.819 2.796   13.828  1.00 30.94  ? 186 ASN A OD1 1 
ATOM   1415 N ND2 . ASN A 1 186 ? -16.628 3.909   13.123  1.00 22.64  ? 186 ASN A ND2 1 
ATOM   1416 N N   . VAL A 1 187 ? -13.766 8.193   14.719  1.00 26.65  ? 187 VAL A N   1 
ATOM   1417 C CA  . VAL A 1 187 ? -12.857 9.241   14.293  1.00 24.45  ? 187 VAL A CA  1 
ATOM   1418 C C   . VAL A 1 187 ? -11.611 9.283   15.222  1.00 26.33  ? 187 VAL A C   1 
ATOM   1419 O O   . VAL A 1 187 ? -10.507 9.811   14.846  1.00 24.59  ? 187 VAL A O   1 
ATOM   1420 C CB  . VAL A 1 187 ? -13.588 10.584  14.125  1.00 22.19  ? 187 VAL A CB  1 
ATOM   1421 C CG1 . VAL A 1 187 ? -14.024 11.144  15.465  1.00 19.79  ? 187 VAL A CG1 1 
ATOM   1422 C CG2 . VAL A 1 187 ? -12.703 11.574  13.336  1.00 22.35  ? 187 VAL A CG2 1 
ATOM   1423 N N   . ALA A 1 188 ? -11.810 8.709   16.423  1.00 25.83  ? 188 ALA A N   1 
ATOM   1424 C CA  . ALA A 1 188 ? -10.772 8.666   17.453  1.00 26.29  ? 188 ALA A CA  1 
ATOM   1425 C C   . ALA A 1 188 ? -9.551  7.989   16.822  1.00 26.61  ? 188 ALA A C   1 
ATOM   1426 O O   . ALA A 1 188 ? -8.430  8.495   16.906  1.00 25.64  ? 188 ALA A O   1 
ATOM   1427 C CB  . ALA A 1 188 ? -11.274 7.930   18.695  1.00 25.84  ? 188 ALA A CB  1 
ATOM   1428 N N   . ALA A 1 189 ? -9.801  6.890   16.104  1.00 27.19  ? 189 ALA A N   1 
ATOM   1429 C CA  . ALA A 1 189 ? -8.754  6.164   15.405  1.00 25.99  ? 189 ALA A CA  1 
ATOM   1430 C C   . ALA A 1 189 ? -7.972  7.015   14.442  1.00 28.51  ? 189 ALA A C   1 
ATOM   1431 O O   . ALA A 1 189 ? -6.878  6.629   14.076  1.00 35.24  ? 189 ALA A O   1 
ATOM   1432 C CB  . ALA A 1 189 ? -9.329  4.963   14.689  1.00 22.35  ? 189 ALA A CB  1 
ATOM   1433 N N   . PHE A 1 190 ? -8.490  8.155   13.984  1.00 29.92  ? 190 PHE A N   1 
ATOM   1434 C CA  . PHE A 1 190 ? -7.664  8.973   13.077  1.00 27.40  ? 190 PHE A CA  1 
ATOM   1435 C C   . PHE A 1 190 ? -7.039  10.147  13.780  1.00 30.77  ? 190 PHE A C   1 
ATOM   1436 O O   . PHE A 1 190 ? -6.377  10.986  13.128  1.00 33.54  ? 190 PHE A O   1 
ATOM   1437 C CB  . PHE A 1 190 ? -8.431  9.429   11.842  1.00 25.69  ? 190 PHE A CB  1 
ATOM   1438 C CG  . PHE A 1 190 ? -9.131  8.297   11.100  1.00 22.65  ? 190 PHE A CG  1 
ATOM   1439 C CD1 . PHE A 1 190 ? -10.288 7.729   11.596  1.00 21.25  ? 190 PHE A CD1 1 
ATOM   1440 C CD2 . PHE A 1 190 ? -8.610  7.803   9.905   1.00 21.51  ? 190 PHE A CD2 1 
ATOM   1441 C CE1 . PHE A 1 190 ? -10.924 6.684   10.914  1.00 21.15  ? 190 PHE A CE1 1 
ATOM   1442 C CE2 . PHE A 1 190 ? -9.230  6.753   9.243   1.00 20.89  ? 190 PHE A CE2 1 
ATOM   1443 C CZ  . PHE A 1 190 ? -10.390 6.186   9.758   1.00 19.50  ? 190 PHE A CZ  1 
ATOM   1444 N N   . GLY A 1 191 ? -7.230  10.196  15.105  1.00 30.41  ? 191 GLY A N   1 
ATOM   1445 C CA  . GLY A 1 191 ? -6.701  11.267  15.945  1.00 31.33  ? 191 GLY A CA  1 
ATOM   1446 C C   . GLY A 1 191 ? -7.743  12.353  16.111  1.00 38.96  ? 191 GLY A C   1 
ATOM   1447 O O   . GLY A 1 191 ? -7.416  13.532  16.398  1.00 40.47  ? 191 GLY A O   1 
ATOM   1448 N N   . GLY A 1 192 ? -9.004  11.961  15.913  1.00 39.02  ? 192 GLY A N   1 
ATOM   1449 C CA  . GLY A 1 192 ? -10.069 12.928  15.845  1.00 37.17  ? 192 GLY A CA  1 
ATOM   1450 C C   . GLY A 1 192 ? -10.843 12.901  17.127  1.00 38.23  ? 192 GLY A C   1 
ATOM   1451 O O   . GLY A 1 192 ? -10.982 11.837  17.719  1.00 39.86  ? 192 GLY A O   1 
ATOM   1452 N N   . ASP A 1 193 ? -11.366 14.068  17.525  1.00 35.17  ? 193 ASP A N   1 
ATOM   1453 C CA  . ASP A 1 193 ? -12.088 14.230  18.756  1.00 30.51  ? 193 ASP A CA  1 
ATOM   1454 C C   . ASP A 1 193 ? -13.607 14.091  18.618  1.00 30.38  ? 193 ASP A C   1 
ATOM   1455 O O   . ASP A 1 193 ? -14.288 15.052  18.248  1.00 31.16  ? 193 ASP A O   1 
ATOM   1456 C CB  . ASP A 1 193 ? -11.754 15.590  19.325  1.00 32.22  ? 193 ASP A CB  1 
ATOM   1457 C CG  . ASP A 1 193 ? -12.209 15.731  20.794  1.00 37.87  ? 193 ASP A CG  1 
ATOM   1458 O OD1 . ASP A 1 193 ? -12.956 14.861  21.350  1.00 32.97  ? 193 ASP A OD1 1 
ATOM   1459 O OD2 . ASP A 1 193 ? -11.825 16.758  21.384  1.00 41.03  ? 193 ASP A OD2 1 
ATOM   1460 N N   . PRO A 1 194 ? -14.175 12.930  18.973  1.00 27.67  ? 194 PRO A N   1 
ATOM   1461 C CA  . PRO A 1 194 ? -15.620 12.837  18.811  1.00 29.22  ? 194 PRO A CA  1 
ATOM   1462 C C   . PRO A 1 194 ? -16.486 13.793  19.682  1.00 32.95  ? 194 PRO A C   1 
ATOM   1463 O O   . PRO A 1 194 ? -17.707 13.749  19.553  1.00 36.83  ? 194 PRO A O   1 
ATOM   1464 C CB  . PRO A 1 194 ? -15.916 11.386  19.210  1.00 26.42  ? 194 PRO A CB  1 
ATOM   1465 C CG  . PRO A 1 194 ? -14.888 11.092  20.219  1.00 25.32  ? 194 PRO A CG  1 
ATOM   1466 C CD  . PRO A 1 194 ? -13.652 11.820  19.765  1.00 25.75  ? 194 PRO A CD  1 
ATOM   1467 N N   . THR A 1 195 ? -15.887 14.601  20.563  1.00 34.62  ? 195 THR A N   1 
ATOM   1468 C CA  . THR A 1 195 ? -16.648 15.481  21.507  1.00 36.20  ? 195 THR A CA  1 
ATOM   1469 C C   . THR A 1 195 ? -16.596 16.939  21.002  1.00 37.26  ? 195 THR A C   1 
ATOM   1470 O O   . THR A 1 195 ? -17.221 17.849  21.594  1.00 39.39  ? 195 THR A O   1 
ATOM   1471 C CB  . THR A 1 195 ? -16.115 15.449  22.990  1.00 32.92  ? 195 THR A CB  1 
ATOM   1472 O OG1 . THR A 1 195 ? -14.805 16.029  23.022  1.00 33.05  ? 195 THR A OG1 1 
ATOM   1473 C CG2 . THR A 1 195 ? -16.067 14.037  23.583  1.00 26.37  ? 195 THR A CG2 1 
ATOM   1474 N N   . SER A 1 196 ? -15.832 17.129  19.916  1.00 35.58  ? 196 SER A N   1 
ATOM   1475 C CA  . SER A 1 196 ? -15.726 18.389  19.147  1.00 32.47  ? 196 SER A CA  1 
ATOM   1476 C C   . SER A 1 196 ? -15.991 18.261  17.605  1.00 33.41  ? 196 SER A C   1 
ATOM   1477 O O   . SER A 1 196 ? -15.073 18.401  16.773  1.00 38.25  ? 196 SER A O   1 
ATOM   1478 C CB  . SER A 1 196 ? -14.363 19.001  19.365  1.00 29.16  ? 196 SER A CB  1 
ATOM   1479 O OG  . SER A 1 196 ? -14.440 20.393  19.178  1.00 32.09  ? 196 SER A OG  1 
ATOM   1480 N N   . VAL A 1 197 ? -17.251 18.037  17.243  1.00 29.92  ? 197 VAL A N   1 
ATOM   1481 C CA  . VAL A 1 197 ? -17.657 17.792  15.850  1.00 29.38  ? 197 VAL A CA  1 
ATOM   1482 C C   . VAL A 1 197 ? -18.556 18.936  15.316  1.00 29.12  ? 197 VAL A C   1 
ATOM   1483 O O   . VAL A 1 197 ? -19.752 19.105  15.730  1.00 27.28  ? 197 VAL A O   1 
ATOM   1484 C CB  . VAL A 1 197 ? -18.428 16.458  15.774  1.00 29.83  ? 197 VAL A CB  1 
ATOM   1485 C CG1 . VAL A 1 197 ? -18.938 16.164  14.384  1.00 27.40  ? 197 VAL A CG1 1 
ATOM   1486 C CG2 . VAL A 1 197 ? -17.558 15.319  16.277  1.00 31.87  ? 197 VAL A CG2 1 
ATOM   1487 N N   . THR A 1 198 ? -17.972 19.690  14.395  1.00 25.40  ? 198 THR A N   1 
ATOM   1488 C CA  . THR A 1 198 ? -18.618 20.791  13.702  1.00 26.91  ? 198 THR A CA  1 
ATOM   1489 C C   . THR A 1 198 ? -19.142 20.385  12.276  1.00 25.37  ? 198 THR A C   1 
ATOM   1490 O O   . THR A 1 198 ? -18.299 20.173  11.391  1.00 25.70  ? 198 THR A O   1 
ATOM   1491 C CB  . THR A 1 198 ? -17.539 21.887  13.501  1.00 29.88  ? 198 THR A CB  1 
ATOM   1492 O OG1 . THR A 1 198 ? -17.008 22.342  14.765  1.00 31.14  ? 198 THR A OG1 1 
ATOM   1493 C CG2 . THR A 1 198 ? -18.083 23.012  12.710  1.00 30.25  ? 198 THR A CG2 1 
ATOM   1494 N N   . LEU A 1 199 ? -20.473 20.287  12.036  1.00 23.12  ? 199 LEU A N   1 
ATOM   1495 C CA  . LEU A 1 199 ? -21.055 20.116  10.652  1.00 22.80  ? 199 LEU A CA  1 
ATOM   1496 C C   . LEU A 1 199 ? -20.939 21.342  9.799   1.00 23.94  ? 199 LEU A C   1 
ATOM   1497 O O   . LEU A 1 199 ? -21.089 22.421  10.299  1.00 29.33  ? 199 LEU A O   1 
ATOM   1498 C CB  . LEU A 1 199 ? -22.522 19.788  10.644  1.00 21.40  ? 199 LEU A CB  1 
ATOM   1499 C CG  . LEU A 1 199 ? -22.934 18.643  11.524  1.00 23.68  ? 199 LEU A CG  1 
ATOM   1500 C CD1 . LEU A 1 199 ? -24.356 18.195  11.293  1.00 23.19  ? 199 LEU A CD1 1 
ATOM   1501 C CD2 . LEU A 1 199 ? -22.020 17.524  11.161  1.00 25.79  ? 199 LEU A CD2 1 
ATOM   1502 N N   . PHE A 1 200 ? -20.653 21.202  8.513   1.00 24.42  ? 200 PHE A N   1 
ATOM   1503 C CA  . PHE A 1 200 ? -20.789 22.329  7.602   1.00 24.00  ? 200 PHE A CA  1 
ATOM   1504 C C   . PHE A 1 200 ? -21.163 21.882  6.204   1.00 23.99  ? 200 PHE A C   1 
ATOM   1505 O O   . PHE A 1 200 ? -20.706 20.831  5.775   1.00 24.55  ? 200 PHE A O   1 
ATOM   1506 C CB  . PHE A 1 200 ? -19.550 23.190  7.599   1.00 23.35  ? 200 PHE A CB  1 
ATOM   1507 C CG  . PHE A 1 200 ? -18.362 22.565  6.937   1.00 26.11  ? 200 PHE A CG  1 
ATOM   1508 C CD1 . PHE A 1 200 ? -18.003 21.216  7.187   1.00 26.45  ? 200 PHE A CD1 1 
ATOM   1509 C CD2 . PHE A 1 200 ? -17.526 23.347  6.104   1.00 25.93  ? 200 PHE A CD2 1 
ATOM   1510 C CE1 . PHE A 1 200 ? -16.857 20.662  6.597   1.00 25.83  ? 200 PHE A CE1 1 
ATOM   1511 C CE2 . PHE A 1 200 ? -16.386 22.795  5.521   1.00 24.79  ? 200 PHE A CE2 1 
ATOM   1512 C CZ  . PHE A 1 200 ? -16.050 21.452  5.774   1.00 25.41  ? 200 PHE A CZ  1 
ATOM   1513 N N   . GLY A 1 201 ? -22.002 22.683  5.523   1.00 23.92  ? 201 GLY A N   1 
ATOM   1514 C CA  . GLY A 1 201 ? -22.632 22.329  4.234   1.00 23.20  ? 201 GLY A CA  1 
ATOM   1515 C C   . GLY A 1 201 ? -23.026 23.574  3.461   1.00 25.10  ? 201 GLY A C   1 
ATOM   1516 O O   . GLY A 1 201 ? -23.141 24.667  4.031   1.00 24.23  ? 201 GLY A O   1 
ATOM   1517 N N   . GLU A 1 202 ? -23.211 23.418  2.148   1.00 24.34  ? 202 GLU A N   1 
ATOM   1518 C CA  . GLU A 1 202 ? -23.706 24.485  1.277   1.00 22.00  ? 202 GLU A CA  1 
ATOM   1519 C C   . GLU A 1 202 ? -25.021 24.064  0.652   1.00 22.01  ? 202 GLU A C   1 
ATOM   1520 O O   . GLU A 1 202 ? -25.316 22.861  0.548   1.00 18.49  ? 202 GLU A O   1 
ATOM   1521 C CB  . GLU A 1 202 ? -22.703 24.720  0.181   1.00 23.03  ? 202 GLU A CB  1 
ATOM   1522 C CG  . GLU A 1 202 ? -22.694 26.077  -0.419  1.00 22.78  ? 202 GLU A CG  1 
ATOM   1523 C CD  . GLU A 1 202 ? -23.429 26.176  -1.712  1.00 24.68  ? 202 GLU A CD  1 
ATOM   1524 O OE1 . GLU A 1 202 ? -23.787 25.095  -2.227  1.00 22.27  ? 202 GLU A OE1 1 
ATOM   1525 O OE2 . GLU A 1 202 ? -23.586 27.380  -2.214  1.00 30.85  ? 202 GLU A OE2 1 
ATOM   1526 N N   . SER A 1 203 ? -25.815 25.067  0.249   1.00 24.73  ? 203 SER A N   1 
ATOM   1527 C CA  . SER A 1 203 ? -27.109 24.841  -0.401  1.00 24.36  ? 203 SER A CA  1 
ATOM   1528 C C   . SER A 1 203 ? -27.868 23.730  0.311   1.00 23.41  ? 203 SER A C   1 
ATOM   1529 O O   . SER A 1 203 ? -28.237 23.893  1.470   1.00 26.02  ? 203 SER A O   1 
ATOM   1530 C CB  . SER A 1 203 ? -26.873 24.490  -1.854  1.00 28.56  ? 203 SER A CB  1 
ATOM   1531 O OG  . SER A 1 203 ? -28.063 24.320  -2.575  1.00 33.64  ? 203 SER A OG  1 
ATOM   1532 N N   . ALA A 1 204 ? -28.093 22.594  -0.332  1.00 21.25  ? 204 ALA A N   1 
ATOM   1533 C CA  . ALA A 1 204 ? -28.939 21.565  0.319   1.00 21.35  ? 204 ALA A CA  1 
ATOM   1534 C C   . ALA A 1 204 ? -28.178 20.848  1.445   1.00 22.59  ? 204 ALA A C   1 
ATOM   1535 O O   . ALA A 1 204 ? -28.778 20.166  2.266   1.00 23.07  ? 204 ALA A O   1 
ATOM   1536 C CB  . ALA A 1 204 ? -29.508 20.574  -0.694  1.00 17.91  ? 204 ALA A CB  1 
ATOM   1537 N N   . GLY A 1 205 ? -26.853 20.991  1.448   1.00 23.43  ? 205 GLY A N   1 
ATOM   1538 C CA  . GLY A 1 205 ? -26.037 20.582  2.570   1.00 26.12  ? 205 GLY A CA  1 
ATOM   1539 C C   . GLY A 1 205 ? -26.317 21.461  3.784   1.00 28.92  ? 205 GLY A C   1 
ATOM   1540 O O   . GLY A 1 205 ? -26.448 20.965  4.915   1.00 30.23  ? 205 GLY A O   1 
ATOM   1541 N N   . ALA A 1 206 ? -26.430 22.771  3.557   1.00 27.95  ? 206 ALA A N   1 
ATOM   1542 C CA  . ALA A 1 206 ? -26.834 23.688  4.612   1.00 25.56  ? 206 ALA A CA  1 
ATOM   1543 C C   . ALA A 1 206 ? -28.244 23.358  5.066   1.00 25.17  ? 206 ALA A C   1 
ATOM   1544 O O   . ALA A 1 206 ? -28.480 23.241  6.232   1.00 26.83  ? 206 ALA A O   1 
ATOM   1545 C CB  . ALA A 1 206 ? -26.754 25.098  4.126   1.00 26.61  ? 206 ALA A CB  1 
ATOM   1546 N N   . ALA A 1 207 ? -29.184 23.135  4.162   1.00 23.84  ? 207 ALA A N   1 
ATOM   1547 C CA  . ALA A 1 207 ? -30.513 22.755  4.627   1.00 23.67  ? 207 ALA A CA  1 
ATOM   1548 C C   . ALA A 1 207 ? -30.450 21.519  5.516   1.00 23.80  ? 207 ALA A C   1 
ATOM   1549 O O   . ALA A 1 207 ? -31.163 21.420  6.529   1.00 23.14  ? 207 ALA A O   1 
ATOM   1550 C CB  . ALA A 1 207 ? -31.466 22.531  3.457   1.00 23.03  ? 207 ALA A CB  1 
ATOM   1551 N N   . SER A 1 208 ? -29.579 20.592  5.110   1.00 24.36  ? 208 SER A N   1 
ATOM   1552 C CA  . SER A 1 208 ? -29.387 19.307  5.773   1.00 23.74  ? 208 SER A CA  1 
ATOM   1553 C C   . SER A 1 208 ? -28.890 19.491  7.194   1.00 23.07  ? 208 SER A C   1 
ATOM   1554 O O   . SER A 1 208 ? -29.512 18.957  8.130   1.00 25.13  ? 208 SER A O   1 
ATOM   1555 C CB  . SER A 1 208 ? -28.398 18.434  5.000   1.00 23.96  ? 208 SER A CB  1 
ATOM   1556 O OG  . SER A 1 208 ? -29.103 17.692  4.050   1.00 23.56  ? 208 SER A OG  1 
ATOM   1557 N N   . VAL A 1 209 ? -27.807 20.256  7.351   1.00 20.37  ? 209 VAL A N   1 
ATOM   1558 C CA  . VAL A 1 209 ? -27.248 20.552  8.650   1.00 19.92  ? 209 VAL A CA  1 
ATOM   1559 C C   . VAL A 1 209 ? -28.370 21.144  9.478   1.00 23.14  ? 209 VAL A C   1 
ATOM   1560 O O   . VAL A 1 209 ? -28.539 20.790  10.650  1.00 25.07  ? 209 VAL A O   1 
ATOM   1561 C CB  . VAL A 1 209 ? -26.216 21.646  8.552   1.00 19.10  ? 209 VAL A CB  1 
ATOM   1562 C CG1 . VAL A 1 209 ? -25.927 22.188  9.928   1.00 19.18  ? 209 VAL A CG1 1 
ATOM   1563 C CG2 . VAL A 1 209 ? -24.964 21.197  7.831   1.00 18.35  ? 209 VAL A CG2 1 
ATOM   1564 N N   . GLY A 1 210 ? -29.164 22.039  8.869   1.00 24.56  ? 210 GLY A N   1 
ATOM   1565 C CA  . GLY A 1 210 ? -30.325 22.638  9.541   1.00 25.39  ? 210 GLY A CA  1 
ATOM   1566 C C   . GLY A 1 210 ? -31.249 21.585  10.119  1.00 27.69  ? 210 GLY A C   1 
ATOM   1567 O O   . GLY A 1 210 ? -31.633 21.631  11.300  1.00 29.06  ? 210 GLY A O   1 
ATOM   1568 N N   . MET A 1 211 ? -31.582 20.603  9.295   1.00 27.30  ? 211 MET A N   1 
ATOM   1569 C CA  . MET A 1 211 ? -32.477 19.579  9.746   1.00 29.11  ? 211 MET A CA  1 
ATOM   1570 C C   . MET A 1 211 ? -31.908 18.720  10.854  1.00 29.69  ? 211 MET A C   1 
ATOM   1571 O O   . MET A 1 211 ? -32.657 18.186  11.662  1.00 30.71  ? 211 MET A O   1 
ATOM   1572 C CB  . MET A 1 211 ? -32.887 18.767  8.572   1.00 30.67  ? 211 MET A CB  1 
ATOM   1573 C CG  . MET A 1 211 ? -33.382 19.725  7.546   1.00 34.53  ? 211 MET A CG  1 
ATOM   1574 S SD  . MET A 1 211 ? -34.491 18.882  6.452   1.00 44.96  ? 211 MET A SD  1 
ATOM   1575 C CE  . MET A 1 211 ? -34.323 19.847  4.942   1.00 37.06  ? 211 MET A CE  1 
ATOM   1576 N N   . HIS A 1 212 ? -30.589 18.597  10.900  1.00 27.76  ? 212 HIS A N   1 
ATOM   1577 C CA  . HIS A 1 212 ? -29.958 17.872  11.990  1.00 28.79  ? 212 HIS A CA  1 
ATOM   1578 C C   . HIS A 1 212 ? -30.135 18.611  13.348  1.00 30.99  ? 212 HIS A C   1 
ATOM   1579 O O   . HIS A 1 212 ? -30.633 18.000  14.298  1.00 33.59  ? 212 HIS A O   1 
ATOM   1580 C CB  . HIS A 1 212 ? -28.500 17.438  11.636  1.00 27.16  ? 212 HIS A CB  1 
ATOM   1581 C CG  . HIS A 1 212 ? -28.440 16.329  10.617  1.00 24.96  ? 212 HIS A CG  1 
ATOM   1582 N ND1 . HIS A 1 212 ? -29.140 15.143  10.759  1.00 25.52  ? 212 HIS A ND1 1 
ATOM   1583 C CD2 . HIS A 1 212 ? -27.803 16.235  9.426   1.00 24.61  ? 212 HIS A CD2 1 
ATOM   1584 C CE1 . HIS A 1 212 ? -28.951 14.370  9.703   1.00 22.88  ? 212 HIS A CE1 1 
ATOM   1585 N NE2 . HIS A 1 212 ? -28.125 15.000  8.886   1.00 25.59  ? 212 HIS A NE2 1 
ATOM   1586 N N   . LEU A 1 213 ? -29.829 19.921  13.428  1.00 29.68  ? 213 LEU A N   1 
ATOM   1587 C CA  . LEU A 1 213 ? -30.232 20.752  14.603  1.00 26.95  ? 213 LEU A CA  1 
ATOM   1588 C C   . LEU A 1 213 ? -31.640 20.467  15.135  1.00 27.24  ? 213 LEU A C   1 
ATOM   1589 O O   . LEU A 1 213 ? -31.813 20.393  16.324  1.00 29.15  ? 213 LEU A O   1 
ATOM   1590 C CB  . LEU A 1 213 ? -30.156 22.229  14.303  1.00 25.86  ? 213 LEU A CB  1 
ATOM   1591 C CG  . LEU A 1 213 ? -28.790 22.705  13.853  1.00 27.54  ? 213 LEU A CG  1 
ATOM   1592 C CD1 . LEU A 1 213 ? -28.893 24.122  13.378  1.00 26.68  ? 213 LEU A CD1 1 
ATOM   1593 C CD2 . LEU A 1 213 ? -27.754 22.618  14.956  1.00 27.71  ? 213 LEU A CD2 1 
ATOM   1594 N N   . LEU A 1 214 ? -32.620 20.275  14.254  1.00 27.01  ? 214 LEU A N   1 
ATOM   1595 C CA  . LEU A 1 214 ? -34.020 20.133  14.619  1.00 26.13  ? 214 LEU A CA  1 
ATOM   1596 C C   . LEU A 1 214 ? -34.464 18.669  14.767  1.00 29.78  ? 214 LEU A C   1 
ATOM   1597 O O   . LEU A 1 214 ? -35.661 18.369  15.035  1.00 29.36  ? 214 LEU A O   1 
ATOM   1598 C CB  . LEU A 1 214 ? -34.873 20.818  13.549  1.00 26.26  ? 214 LEU A CB  1 
ATOM   1599 C CG  . LEU A 1 214 ? -34.486 22.268  13.187  1.00 27.39  ? 214 LEU A CG  1 
ATOM   1600 C CD1 . LEU A 1 214 ? -35.134 22.796  11.909  1.00 24.99  ? 214 LEU A CD1 1 
ATOM   1601 C CD2 . LEU A 1 214 ? -34.777 23.243  14.323  1.00 25.44  ? 214 LEU A CD2 1 
ATOM   1602 N N   . SER A 1 215 ? -33.535 17.732  14.580  1.00 30.84  ? 215 SER A N   1 
ATOM   1603 C CA  . SER A 1 215 ? -33.906 16.322  14.814  1.00 34.59  ? 215 SER A CA  1 
ATOM   1604 C C   . SER A 1 215 ? -33.239 15.810  16.097  1.00 36.40  ? 215 SER A C   1 
ATOM   1605 O O   . SER A 1 215 ? -32.001 15.668  16.144  1.00 32.44  ? 215 SER A O   1 
ATOM   1606 C CB  . SER A 1 215 ? -33.624 15.414  13.613  1.00 33.86  ? 215 SER A CB  1 
ATOM   1607 O OG  . SER A 1 215 ? -34.143 14.117  13.827  1.00 29.09  ? 215 SER A OG  1 
ATOM   1608 N N   . PRO A 1 216 ? -34.067 15.597  17.166  1.00 39.79  ? 216 PRO A N   1 
ATOM   1609 C CA  . PRO A 1 216 ? -33.477 15.174  18.460  1.00 34.60  ? 216 PRO A CA  1 
ATOM   1610 C C   . PRO A 1 216 ? -32.428 14.053  18.285  1.00 30.43  ? 216 PRO A C   1 
ATOM   1611 O O   . PRO A 1 216 ? -31.272 14.291  18.672  1.00 34.37  ? 216 PRO A O   1 
ATOM   1612 C CB  . PRO A 1 216 ? -34.698 14.802  19.320  1.00 33.63  ? 216 PRO A CB  1 
ATOM   1613 C CG  . PRO A 1 216 ? -35.829 15.621  18.744  1.00 34.47  ? 216 PRO A CG  1 
ATOM   1614 C CD  . PRO A 1 216 ? -35.531 15.865  17.275  1.00 35.00  ? 216 PRO A CD  1 
ATOM   1615 N N   . PRO A 1 217 ? -32.754 12.924  17.596  1.00 27.42  ? 217 PRO A N   1 
ATOM   1616 C CA  . PRO A 1 217 ? -31.701 11.875  17.421  1.00 25.44  ? 217 PRO A CA  1 
ATOM   1617 C C   . PRO A 1 217 ? -30.392 12.303  16.729  1.00 28.75  ? 217 PRO A C   1 
ATOM   1618 O O   . PRO A 1 217 ? -29.392 11.658  16.914  1.00 33.32  ? 217 PRO A O   1 
ATOM   1619 C CB  . PRO A 1 217 ? -32.373 10.805  16.593  1.00 22.71  ? 217 PRO A CB  1 
ATOM   1620 C CG  . PRO A 1 217 ? -33.853 11.117  16.625  1.00 25.26  ? 217 PRO A CG  1 
ATOM   1621 C CD  . PRO A 1 217 ? -33.957 12.614  16.795  1.00 26.45  ? 217 PRO A CD  1 
ATOM   1622 N N   . SER A 1 218 ? -30.343 13.400  15.985  1.00 31.23  ? 218 SER A N   1 
ATOM   1623 C CA  . SER A 1 218 ? -29.064 13.817  15.413  1.00 30.14  ? 218 SER A CA  1 
ATOM   1624 C C   . SER A 1 218 ? -28.326 14.817  16.283  1.00 33.88  ? 218 SER A C   1 
ATOM   1625 O O   . SER A 1 218 ? -27.099 14.988  16.107  1.00 31.26  ? 218 SER A O   1 
ATOM   1626 C CB  . SER A 1 218 ? -29.250 14.376  13.989  1.00 30.71  ? 218 SER A CB  1 
ATOM   1627 O OG  . SER A 1 218 ? -30.099 13.528  13.193  1.00 34.42  ? 218 SER A OG  1 
ATOM   1628 N N   . ARG A 1 219 ? -29.048 15.497  17.200  1.00 38.16  ? 219 ARG A N   1 
ATOM   1629 C CA  . ARG A 1 219 ? -28.419 16.554  18.057  1.00 42.36  ? 219 ARG A CA  1 
ATOM   1630 C C   . ARG A 1 219 ? -27.253 15.978  18.917  1.00 43.24  ? 219 ARG A C   1 
ATOM   1631 O O   . ARG A 1 219 ? -26.188 16.631  19.106  1.00 43.67  ? 219 ARG A O   1 
ATOM   1632 C CB  . ARG A 1 219 ? -29.451 17.373  18.881  1.00 42.64  ? 219 ARG A CB  1 
ATOM   1633 C CG  . ARG A 1 219 ? -29.839 18.749  18.275  1.00 43.04  ? 219 ARG A CG  1 
ATOM   1634 C CD  . ARG A 1 219 ? -28.990 19.994  18.702  1.00 44.56  ? 219 ARG A CD  1 
ATOM   1635 N NE  . ARG A 1 219 ? -27.517 19.747  18.790  1.00 52.88  ? 219 ARG A NE  1 
ATOM   1636 C CZ  . ARG A 1 219 ? -26.568 20.558  19.328  1.00 53.49  ? 219 ARG A CZ  1 
ATOM   1637 N NH1 . ARG A 1 219 ? -26.840 21.746  19.873  1.00 48.93  ? 219 ARG A NH1 1 
ATOM   1638 N NH2 . ARG A 1 219 ? -25.292 20.182  19.311  1.00 52.18  ? 219 ARG A NH2 1 
ATOM   1639 N N   . GLY A 1 220 ? -27.424 14.720  19.350  1.00 39.71  ? 220 GLY A N   1 
ATOM   1640 C CA  . GLY A 1 220 ? -26.360 13.989  20.046  1.00 35.54  ? 220 GLY A CA  1 
ATOM   1641 C C   . GLY A 1 220 ? -25.022 13.970  19.315  1.00 35.32  ? 220 GLY A C   1 
ATOM   1642 O O   . GLY A 1 220 ? -23.987 13.861  19.934  1.00 33.82  ? 220 GLY A O   1 
ATOM   1643 N N   . LEU A 1 221 ? -25.023 14.106  17.992  1.00 32.98  ? 221 LEU A N   1 
ATOM   1644 C CA  . LEU A 1 221 ? -23.898 13.618  17.220  1.00 27.03  ? 221 LEU A CA  1 
ATOM   1645 C C   . LEU A 1 221 ? -22.932 14.706  16.753  1.00 26.13  ? 221 LEU A C   1 
ATOM   1646 O O   . LEU A 1 221 ? -21.912 14.409  16.019  1.00 26.72  ? 221 LEU A O   1 
ATOM   1647 C CB  . LEU A 1 221 ? -24.405 12.791  16.050  1.00 26.04  ? 221 LEU A CB  1 
ATOM   1648 C CG  . LEU A 1 221 ? -25.398 11.683  16.371  1.00 27.03  ? 221 LEU A CG  1 
ATOM   1649 C CD1 . LEU A 1 221 ? -26.142 11.172  15.121  1.00 25.44  ? 221 LEU A CD1 1 
ATOM   1650 C CD2 . LEU A 1 221 ? -24.689 10.544  17.102  1.00 27.09  ? 221 LEU A CD2 1 
ATOM   1651 N N   . PHE A 1 222 ? -23.205 15.949  17.177  1.00 23.64  ? 222 PHE A N   1 
ATOM   1652 C CA  . PHE A 1 222 ? -22.293 17.081  16.847  1.00 24.02  ? 222 PHE A CA  1 
ATOM   1653 C C   . PHE A 1 222 ? -22.471 18.238  17.834  1.00 24.67  ? 222 PHE A C   1 
ATOM   1654 O O   . PHE A 1 222 ? -23.408 18.271  18.636  1.00 23.64  ? 222 PHE A O   1 
ATOM   1655 C CB  . PHE A 1 222 ? -22.522 17.575  15.401  1.00 24.16  ? 222 PHE A CB  1 
ATOM   1656 C CG  . PHE A 1 222 ? -23.939 18.086  15.140  1.00 23.53  ? 222 PHE A CG  1 
ATOM   1657 C CD1 . PHE A 1 222 ? -25.021 17.216  15.079  1.00 24.29  ? 222 PHE A CD1 1 
ATOM   1658 C CD2 . PHE A 1 222 ? -24.183 19.443  15.002  1.00 23.52  ? 222 PHE A CD2 1 
ATOM   1659 C CE1 . PHE A 1 222 ? -26.305 17.695  14.859  1.00 26.80  ? 222 PHE A CE1 1 
ATOM   1660 C CE2 . PHE A 1 222 ? -25.458 19.932  14.814  1.00 23.41  ? 222 PHE A CE2 1 
ATOM   1661 C CZ  . PHE A 1 222 ? -26.523 19.064  14.714  1.00 25.68  ? 222 PHE A CZ  1 
ATOM   1662 N N   . HIS A 1 223 ? -21.596 19.219  17.736  1.00 27.36  ? 223 HIS A N   1 
ATOM   1663 C CA  . HIS A 1 223 ? -21.566 20.259  18.743  1.00 30.19  ? 223 HIS A CA  1 
ATOM   1664 C C   . HIS A 1 223 ? -21.818 21.651  18.139  1.00 32.13  ? 223 HIS A C   1 
ATOM   1665 O O   . HIS A 1 223 ? -22.407 22.487  18.801  1.00 35.99  ? 223 HIS A O   1 
ATOM   1666 C CB  . HIS A 1 223 ? -20.270 20.104  19.586  1.00 31.83  ? 223 HIS A CB  1 
ATOM   1667 C CG  . HIS A 1 223 ? -20.023 18.672  19.992  1.00 35.64  ? 223 HIS A CG  1 
ATOM   1668 N ND1 . HIS A 1 223 ? -20.808 18.010  20.919  1.00 36.52  ? 223 HIS A ND1 1 
ATOM   1669 C CD2 . HIS A 1 223 ? -19.192 17.729  19.482  1.00 38.10  ? 223 HIS A CD2 1 
ATOM   1670 C CE1 . HIS A 1 223 ? -20.431 16.746  21.014  1.00 37.10  ? 223 HIS A CE1 1 
ATOM   1671 N NE2 . HIS A 1 223 ? -19.443 16.554  20.157  1.00 39.60  ? 223 HIS A NE2 1 
ATOM   1672 N N   . ARG A 1 224 ? -21.448 21.871  16.872  1.00 29.71  ? 224 ARG A N   1 
ATOM   1673 C CA  . ARG A 1 224 ? -21.597 23.171  16.208  1.00 28.80  ? 224 ARG A CA  1 
ATOM   1674 C C   . ARG A 1 224 ? -22.099 22.994  14.776  1.00 30.56  ? 224 ARG A C   1 
ATOM   1675 O O   . ARG A 1 224 ? -22.213 21.861  14.327  1.00 33.28  ? 224 ARG A O   1 
ATOM   1676 C CB  . ARG A 1 224 ? -20.284 23.885  16.161  1.00 27.43  ? 224 ARG A CB  1 
ATOM   1677 C CG  . ARG A 1 224 ? -19.744 24.074  17.521  1.00 30.27  ? 224 ARG A CG  1 
ATOM   1678 C CD  . ARG A 1 224 ? -18.365 24.632  17.379  1.00 37.53  ? 224 ARG A CD  1 
ATOM   1679 N NE  . ARG A 1 224 ? -17.752 24.690  18.684  1.00 47.22  ? 224 ARG A NE  1 
ATOM   1680 C CZ  . ARG A 1 224 ? -17.150 23.671  19.289  1.00 52.16  ? 224 ARG A CZ  1 
ATOM   1681 N NH1 . ARG A 1 224 ? -17.023 22.458  18.746  1.00 49.87  ? 224 ARG A NH1 1 
ATOM   1682 N NH2 . ARG A 1 224 ? -16.639 23.893  20.466  1.00 69.19  ? 224 ARG A NH2 1 
ATOM   1683 N N   . ALA A 1 225 ? -22.398 24.106  14.077  1.00 27.91  ? 225 ALA A N   1 
ATOM   1684 C CA  . ALA A 1 225 ? -23.010 24.107  12.752  1.00 22.84  ? 225 ALA A CA  1 
ATOM   1685 C C   . ALA A 1 225 ? -22.678 25.345  11.922  1.00 23.50  ? 225 ALA A C   1 
ATOM   1686 O O   . ALA A 1 225 ? -22.466 26.457  12.435  1.00 23.48  ? 225 ALA A O   1 
ATOM   1687 C CB  . ALA A 1 225 ? -24.483 23.942  12.887  1.00 21.69  ? 225 ALA A CB  1 
ATOM   1688 N N   . VAL A 1 226 ? -22.591 25.130  10.619  1.00 23.40  ? 226 VAL A N   1 
ATOM   1689 C CA  . VAL A 1 226 ? -22.241 26.177  9.647   1.00 23.27  ? 226 VAL A CA  1 
ATOM   1690 C C   . VAL A 1 226 ? -23.167 25.945  8.477   1.00 24.06  ? 226 VAL A C   1 
ATOM   1691 O O   . VAL A 1 226 ? -23.135 24.870  7.891   1.00 27.00  ? 226 VAL A O   1 
ATOM   1692 C CB  . VAL A 1 226 ? -20.832 25.989  9.094   1.00 21.66  ? 226 VAL A CB  1 
ATOM   1693 C CG1 . VAL A 1 226 ? -20.445 27.123  8.171   1.00 20.43  ? 226 VAL A CG1 1 
ATOM   1694 C CG2 . VAL A 1 226 ? -19.853 25.870  10.223  1.00 22.90  ? 226 VAL A CG2 1 
ATOM   1695 N N   . LEU A 1 227 ? -23.991 26.931  8.133   1.00 23.00  ? 227 LEU A N   1 
ATOM   1696 C CA  . LEU A 1 227 ? -24.934 26.826  7.006   1.00 20.52  ? 227 LEU A CA  1 
ATOM   1697 C C   . LEU A 1 227 ? -24.540 27.856  5.971   1.00 20.49  ? 227 LEU A C   1 
ATOM   1698 O O   . LEU A 1 227 ? -24.654 29.047  6.229   1.00 23.09  ? 227 LEU A O   1 
ATOM   1699 C CB  . LEU A 1 227 ? -26.371 27.039  7.509   1.00 19.23  ? 227 LEU A CB  1 
ATOM   1700 C CG  . LEU A 1 227 ? -26.880 25.908  8.414   1.00 18.41  ? 227 LEU A CG  1 
ATOM   1701 C CD1 . LEU A 1 227 ? -26.324 26.001  9.804   1.00 17.76  ? 227 LEU A CD1 1 
ATOM   1702 C CD2 . LEU A 1 227 ? -28.374 25.830  8.503   1.00 17.59  ? 227 LEU A CD2 1 
ATOM   1703 N N   . GLN A 1 228 ? -24.017 27.421  4.834   1.00 21.18  ? 228 GLN A N   1 
ATOM   1704 C CA  . GLN A 1 228 ? -23.595 28.349  3.779   1.00 23.73  ? 228 GLN A CA  1 
ATOM   1705 C C   . GLN A 1 228 ? -24.657 28.354  2.675   1.00 24.99  ? 228 GLN A C   1 
ATOM   1706 O O   . GLN A 1 228 ? -25.072 27.293  2.182   1.00 25.36  ? 228 GLN A O   1 
ATOM   1707 C CB  . GLN A 1 228 ? -22.266 27.942  3.191   1.00 24.37  ? 228 GLN A CB  1 
ATOM   1708 C CG  . GLN A 1 228 ? -21.288 27.412  4.208   1.00 27.04  ? 228 GLN A CG  1 
ATOM   1709 C CD  . GLN A 1 228 ? -19.939 27.019  3.643   1.00 30.75  ? 228 GLN A CD  1 
ATOM   1710 O OE1 . GLN A 1 228 ? -19.080 26.617  4.401   1.00 34.54  ? 228 GLN A OE1 1 
ATOM   1711 N NE2 . GLN A 1 228 ? -19.728 27.151  2.315   1.00 33.30  ? 228 GLN A NE2 1 
ATOM   1712 N N   . SER A 1 229 ? -25.104 29.550  2.313   1.00 23.47  ? 229 SER A N   1 
ATOM   1713 C CA  . SER A 1 229 ? -26.164 29.719  1.343   1.00 22.63  ? 229 SER A CA  1 
ATOM   1714 C C   . SER A 1 229 ? -27.302 28.697  1.454   1.00 22.33  ? 229 SER A C   1 
ATOM   1715 O O   . SER A 1 229 ? -27.671 28.165  0.446   1.00 23.15  ? 229 SER A O   1 
ATOM   1716 C CB  . SER A 1 229 ? -25.588 29.701  -0.092  1.00 22.82  ? 229 SER A CB  1 
ATOM   1717 O OG  . SER A 1 229 ? -24.421 30.552  -0.272  1.00 26.02  ? 229 SER A OG  1 
ATOM   1718 N N   . GLY A 1 230 ? -27.870 28.397  2.624   1.00 20.37  ? 230 GLY A N   1 
ATOM   1719 C CA  . GLY A 1 230 ? -29.035 27.455  2.630   1.00 18.71  ? 230 GLY A CA  1 
ATOM   1720 C C   . GLY A 1 230 ? -29.616 27.281  4.048   1.00 20.17  ? 230 GLY A C   1 
ATOM   1721 O O   . GLY A 1 230 ? -28.929 27.535  5.045   1.00 19.64  ? 230 GLY A O   1 
ATOM   1722 N N   . ALA A 1 231 ? -30.858 26.827  4.187   1.00 19.68  ? 231 ALA A N   1 
ATOM   1723 C CA  . ALA A 1 231 ? -31.485 26.682  5.528   1.00 19.31  ? 231 ALA A CA  1 
ATOM   1724 C C   . ALA A 1 231 ? -32.584 25.685  5.413   1.00 19.59  ? 231 ALA A C   1 
ATOM   1725 O O   . ALA A 1 231 ? -33.114 25.500  4.357   1.00 22.88  ? 231 ALA A O   1 
ATOM   1726 C CB  . ALA A 1 231 ? -32.095 27.989  6.000   1.00 18.92  ? 231 ALA A CB  1 
ATOM   1727 N N   . PRO A 1 232 ? -32.994 25.076  6.501   1.00 18.82  ? 232 PRO A N   1 
ATOM   1728 C CA  . PRO A 1 232 ? -34.014 24.081  6.255   1.00 18.81  ? 232 PRO A CA  1 
ATOM   1729 C C   . PRO A 1 232 ? -35.427 24.676  6.115   1.00 20.78  ? 232 PRO A C   1 
ATOM   1730 O O   . PRO A 1 232 ? -36.353 23.988  5.671   1.00 22.36  ? 232 PRO A O   1 
ATOM   1731 C CB  . PRO A 1 232 ? -33.899 23.190  7.475   1.00 18.40  ? 232 PRO A CB  1 
ATOM   1732 C CG  . PRO A 1 232 ? -33.477 24.132  8.576   1.00 18.93  ? 232 PRO A CG  1 
ATOM   1733 C CD  . PRO A 1 232 ? -32.665 25.234  7.925   1.00 19.27  ? 232 PRO A CD  1 
ATOM   1734 N N   . ASN A 1 233 ? -35.611 25.928  6.508   1.00 22.97  ? 233 ASN A N   1 
ATOM   1735 C CA  . ASN A 1 233 ? -36.905 26.566  6.324   1.00 25.16  ? 233 ASN A CA  1 
ATOM   1736 C C   . ASN A 1 233 ? -37.128 27.146  4.891   1.00 27.57  ? 233 ASN A C   1 
ATOM   1737 O O   . ASN A 1 233 ? -38.226 27.605  4.589   1.00 28.58  ? 233 ASN A O   1 
ATOM   1738 C CB  . ASN A 1 233 ? -37.181 27.591  7.412   1.00 22.68  ? 233 ASN A CB  1 
ATOM   1739 C CG  . ASN A 1 233 ? -36.039 28.558  7.566   1.00 24.97  ? 233 ASN A CG  1 
ATOM   1740 O OD1 . ASN A 1 233 ? -34.905 28.148  7.836   1.00 26.99  ? 233 ASN A OD1 1 
ATOM   1741 N ND2 . ASN A 1 233 ? -36.304 29.844  7.348   1.00 24.78  ? 233 ASN A ND2 1 
ATOM   1742 N N   . GLY A 1 234 ? -36.147 27.096  3.984   1.00 30.59  ? 234 GLY A N   1 
ATOM   1743 C CA  . GLY A 1 234 ? -36.468 27.289  2.508   1.00 33.73  ? 234 GLY A CA  1 
ATOM   1744 C C   . GLY A 1 234 ? -37.887 26.862  2.016   1.00 31.82  ? 234 GLY A C   1 
ATOM   1745 O O   . GLY A 1 234 ? -38.449 25.905  2.543   1.00 35.14  ? 234 GLY A O   1 
ATOM   1746 N N   . PRO A 1 235 ? -38.495 27.590  1.045   1.00 27.00  ? 235 PRO A N   1 
ATOM   1747 C CA  . PRO A 1 235 ? -39.618 27.067  0.325   1.00 24.74  ? 235 PRO A CA  1 
ATOM   1748 C C   . PRO A 1 235 ? -39.229 25.951  -0.639  1.00 26.09  ? 235 PRO A C   1 
ATOM   1749 O O   . PRO A 1 235 ? -40.078 25.516  -1.378  1.00 26.19  ? 235 PRO A O   1 
ATOM   1750 C CB  . PRO A 1 235 ? -40.022 28.247  -0.556  1.00 23.63  ? 235 PRO A CB  1 
ATOM   1751 C CG  . PRO A 1 235 ? -38.777 28.992  -0.797  1.00 21.36  ? 235 PRO A CG  1 
ATOM   1752 C CD  . PRO A 1 235 ? -38.152 28.933  0.544   1.00 25.65  ? 235 PRO A CD  1 
ATOM   1753 N N   . TRP A 1 236 ? -37.964 25.508  -0.693  1.00 26.12  ? 236 TRP A N   1 
ATOM   1754 C CA  . TRP A 1 236 ? -37.592 24.439  -1.648  1.00 23.15  ? 236 TRP A CA  1 
ATOM   1755 C C   . TRP A 1 236 ? -37.035 23.260  -0.903  1.00 22.32  ? 236 TRP A C   1 
ATOM   1756 O O   . TRP A 1 236 ? -36.866 22.190  -1.477  1.00 21.09  ? 236 TRP A O   1 
ATOM   1757 C CB  . TRP A 1 236 ? -36.545 24.917  -2.652  1.00 22.98  ? 236 TRP A CB  1 
ATOM   1758 C CG  . TRP A 1 236 ? -35.394 25.523  -1.953  1.00 23.35  ? 236 TRP A CG  1 
ATOM   1759 C CD1 . TRP A 1 236 ? -35.235 26.829  -1.635  1.00 23.08  ? 236 TRP A CD1 1 
ATOM   1760 C CD2 . TRP A 1 236 ? -34.268 24.839  -1.405  1.00 24.54  ? 236 TRP A CD2 1 
ATOM   1761 N NE1 . TRP A 1 236 ? -34.060 27.020  -0.978  1.00 23.35  ? 236 TRP A NE1 1 
ATOM   1762 C CE2 . TRP A 1 236 ? -33.439 25.817  -0.815  1.00 22.92  ? 236 TRP A CE2 1 
ATOM   1763 C CE3 . TRP A 1 236 ? -33.857 23.488  -1.381  1.00 24.84  ? 236 TRP A CE3 1 
ATOM   1764 C CZ2 . TRP A 1 236 ? -32.241 25.505  -0.193  1.00 22.53  ? 236 TRP A CZ2 1 
ATOM   1765 C CZ3 . TRP A 1 236 ? -32.650 23.181  -0.787  1.00 24.34  ? 236 TRP A CZ3 1 
ATOM   1766 C CH2 . TRP A 1 236 ? -31.855 24.191  -0.193  1.00 24.04  ? 236 TRP A CH2 1 
ATOM   1767 N N   . ALA A 1 237 ? -36.735 23.472  0.378   1.00 22.73  ? 237 ALA A N   1 
ATOM   1768 C CA  . ALA A 1 237 ? -36.020 22.483  1.144   1.00 20.32  ? 237 ALA A CA  1 
ATOM   1769 C C   . ALA A 1 237 ? -36.907 21.418  1.703   1.00 21.24  ? 237 ALA A C   1 
ATOM   1770 O O   . ALA A 1 237 ? -36.401 20.379  2.075   1.00 24.60  ? 237 ALA A O   1 
ATOM   1771 C CB  . ALA A 1 237 ? -35.255 23.145  2.233   1.00 20.20  ? 237 ALA A CB  1 
ATOM   1772 N N   . THR A 1 238 ? -38.224 21.608  1.765   1.00 20.54  ? 238 THR A N   1 
ATOM   1773 C CA  . THR A 1 238 ? -39.072 20.500  2.223   1.00 21.11  ? 238 THR A CA  1 
ATOM   1774 C C   . THR A 1 238 ? -40.373 20.459  1.450   1.00 22.50  ? 238 THR A C   1 
ATOM   1775 O O   . THR A 1 238 ? -40.614 21.289  0.572   1.00 23.06  ? 238 THR A O   1 
ATOM   1776 C CB  . THR A 1 238 ? -39.380 20.556  3.733   1.00 21.38  ? 238 THR A CB  1 
ATOM   1777 O OG1 . THR A 1 238 ? -40.145 21.719  3.998   1.00 24.06  ? 238 THR A OG1 1 
ATOM   1778 C CG2 . THR A 1 238 ? -38.130 20.640  4.581   1.00 20.24  ? 238 THR A CG2 1 
ATOM   1779 N N   . VAL A 1 239 ? -41.233 19.500  1.767   1.00 22.92  ? 239 VAL A N   1 
ATOM   1780 C CA  . VAL A 1 239 ? -42.441 19.285  0.962   1.00 23.19  ? 239 VAL A CA  1 
ATOM   1781 C C   . VAL A 1 239 ? -43.503 18.586  1.855   1.00 23.92  ? 239 VAL A C   1 
ATOM   1782 O O   . VAL A 1 239 ? -43.167 17.790  2.778   1.00 25.03  ? 239 VAL A O   1 
ATOM   1783 C CB  . VAL A 1 239 ? -42.071 18.424  -0.298  1.00 23.64  ? 239 VAL A CB  1 
ATOM   1784 C CG1 . VAL A 1 239 ? -42.095 16.912  -0.001  1.00 21.84  ? 239 VAL A CG1 1 
ATOM   1785 C CG2 . VAL A 1 239 ? -42.945 18.736  -1.485  1.00 23.08  ? 239 VAL A CG2 1 
ATOM   1786 N N   . GLY A 1 240 ? -44.770 18.860  1.585   1.00 22.92  ? 240 GLY A N   1 
ATOM   1787 C CA  . GLY A 1 240 ? -45.854 18.261  2.371   1.00 25.60  ? 240 GLY A CA  1 
ATOM   1788 C C   . GLY A 1 240 ? -46.164 16.818  2.003   1.00 29.61  ? 240 GLY A C   1 
ATOM   1789 O O   . GLY A 1 240 ? -45.956 16.387  0.832   1.00 27.74  ? 240 GLY A O   1 
ATOM   1790 N N   . MET A 1 241 ? -46.664 16.063  2.989   1.00 31.48  ? 241 MET A N   1 
ATOM   1791 C CA  . MET A 1 241 ? -47.095 14.686  2.730   1.00 34.54  ? 241 MET A CA  1 
ATOM   1792 C C   . MET A 1 241 ? -47.879 14.476  1.381   1.00 34.37  ? 241 MET A C   1 
ATOM   1793 O O   . MET A 1 241 ? -47.483 13.690  0.523   1.00 36.13  ? 241 MET A O   1 
ATOM   1794 C CB  . MET A 1 241 ? -47.852 14.160  3.930   1.00 35.05  ? 241 MET A CB  1 
ATOM   1795 C CG  . MET A 1 241 ? -46.892 13.823  5.049   1.00 44.38  ? 241 MET A CG  1 
ATOM   1796 S SD  . MET A 1 241 ? -47.654 13.293  6.617   1.00 58.22  ? 241 MET A SD  1 
ATOM   1797 C CE  . MET A 1 241 ? -48.881 11.988  6.266   1.00 54.58  ? 241 MET A CE  1 
ATOM   1798 N N   . GLY A 1 242 ? -48.960 15.194  1.157   1.00 32.42  ? 242 GLY A N   1 
ATOM   1799 C CA  . GLY A 1 242 ? -49.698 14.988  -0.072  1.00 30.85  ? 242 GLY A CA  1 
ATOM   1800 C C   . GLY A 1 242 ? -48.852 15.236  -1.295  1.00 33.20  ? 242 GLY A C   1 
ATOM   1801 O O   . GLY A 1 242 ? -48.981 14.502  -2.302  1.00 32.49  ? 242 GLY A O   1 
ATOM   1802 N N   . GLU A 1 243 ? -47.984 16.262  -1.243  1.00 32.40  ? 243 GLU A N   1 
ATOM   1803 C CA  . GLU A 1 243 ? -47.247 16.619  -2.491  1.00 31.91  ? 243 GLU A CA  1 
ATOM   1804 C C   . GLU A 1 243 ? -46.208 15.534  -2.853  1.00 28.39  ? 243 GLU A C   1 
ATOM   1805 O O   . GLU A 1 243 ? -46.091 15.124  -4.025  1.00 25.02  ? 243 GLU A O   1 
ATOM   1806 C CB  . GLU A 1 243 ? -46.725 18.086  -2.561  1.00 29.83  ? 243 GLU A CB  1 
ATOM   1807 C CG  . GLU A 1 243 ? -47.327 18.867  -3.737  1.00 29.85  ? 243 GLU A CG  1 
ATOM   1808 C CD  . GLU A 1 243 ? -46.628 18.541  -5.072  1.00 35.86  ? 243 GLU A CD  1 
ATOM   1809 O OE1 . GLU A 1 243 ? -45.382 18.473  -5.136  1.00 41.72  ? 243 GLU A OE1 1 
ATOM   1810 O OE2 . GLU A 1 243 ? -47.285 18.321  -6.098  1.00 34.32  ? 243 GLU A OE2 1 
ATOM   1811 N N   . ALA A 1 244 ? -45.533 15.043  -1.816  1.00 25.48  ? 244 ALA A N   1 
ATOM   1812 C CA  . ALA A 1 244 ? -44.641 13.911  -1.941  1.00 25.35  ? 244 ALA A CA  1 
ATOM   1813 C C   . ALA A 1 244 ? -45.326 12.691  -2.539  1.00 27.84  ? 244 ALA A C   1 
ATOM   1814 O O   . ALA A 1 244 ? -44.720 11.949  -3.326  1.00 31.58  ? 244 ALA A O   1 
ATOM   1815 C CB  . ALA A 1 244 ? -44.088 13.541  -0.590  1.00 24.01  ? 244 ALA A CB  1 
ATOM   1816 N N   . ARG A 1 245 ? -46.567 12.453  -2.130  1.00 26.91  ? 245 ARG A N   1 
ATOM   1817 C CA  . ARG A 1 245 ? -47.268 11.287  -2.591  1.00 27.29  ? 245 ARG A CA  1 
ATOM   1818 C C   . ARG A 1 245 ? -47.576 11.487  -4.051  1.00 26.67  ? 245 ARG A C   1 
ATOM   1819 O O   . ARG A 1 245 ? -47.503 10.550  -4.835  1.00 23.97  ? 245 ARG A O   1 
ATOM   1820 C CB  . ARG A 1 245 ? -48.542 11.079  -1.758  1.00 28.67  ? 245 ARG A CB  1 
ATOM   1821 C CG  . ARG A 1 245 ? -49.655 10.212  -2.345  1.00 26.68  ? 245 ARG A CG  1 
ATOM   1822 C CD  . ARG A 1 245 ? -50.438 9.673   -1.159  1.00 28.12  ? 245 ARG A CD  1 
ATOM   1823 N NE  . ARG A 1 245 ? -50.189 8.255   -0.994  1.00 32.62  ? 245 ARG A NE  1 
ATOM   1824 C CZ  . ARG A 1 245 ? -49.552 7.695   0.034   1.00 36.48  ? 245 ARG A CZ  1 
ATOM   1825 N NH1 . ARG A 1 245 ? -49.075 8.459   1.058   1.00 34.25  ? 245 ARG A NH1 1 
ATOM   1826 N NH2 . ARG A 1 245 ? -49.389 6.359   0.009   1.00 31.23  ? 245 ARG A NH2 1 
ATOM   1827 N N   . ARG A 1 246 ? -47.929 12.722  -4.400  1.00 27.64  ? 246 ARG A N   1 
ATOM   1828 C CA  . ARG A 1 246 ? -48.394 12.982  -5.736  1.00 27.71  ? 246 ARG A CA  1 
ATOM   1829 C C   . ARG A 1 246 ? -47.170 12.797  -6.674  1.00 28.25  ? 246 ARG A C   1 
ATOM   1830 O O   . ARG A 1 246 ? -47.283 12.208  -7.788  1.00 28.45  ? 246 ARG A O   1 
ATOM   1831 C CB  . ARG A 1 246 ? -49.079 14.353  -5.834  1.00 27.60  ? 246 ARG A CB  1 
ATOM   1832 C CG  . ARG A 1 246 ? -49.877 14.521  -7.121  1.00 30.91  ? 246 ARG A CG  1 
ATOM   1833 C CD  . ARG A 1 246 ? -50.044 15.961  -7.636  1.00 33.33  ? 246 ARG A CD  1 
ATOM   1834 N NE  . ARG A 1 246 ? -48.773 16.688  -7.890  1.00 37.36  ? 246 ARG A NE  1 
ATOM   1835 C CZ  . ARG A 1 246 ? -47.942 16.516  -8.939  1.00 37.59  ? 246 ARG A CZ  1 
ATOM   1836 N NH1 . ARG A 1 246 ? -48.214 15.602  -9.901  1.00 38.01  ? 246 ARG A NH1 1 
ATOM   1837 N NH2 . ARG A 1 246 ? -46.815 17.242  -9.008  1.00 30.65  ? 246 ARG A NH2 1 
ATOM   1838 N N   . ARG A 1 247 ? -45.996 13.222  -6.175  1.00 25.57  ? 247 ARG A N   1 
ATOM   1839 C CA  . ARG A 1 247 ? -44.767 13.208  -6.970  1.00 24.10  ? 247 ARG A CA  1 
ATOM   1840 C C   . ARG A 1 247 ? -44.279 11.766  -7.168  1.00 25.01  ? 247 ARG A C   1 
ATOM   1841 O O   . ARG A 1 247 ? -43.998 11.351  -8.305  1.00 28.74  ? 247 ARG A O   1 
ATOM   1842 C CB  . ARG A 1 247 ? -43.712 14.079  -6.335  1.00 21.33  ? 247 ARG A CB  1 
ATOM   1843 C CG  . ARG A 1 247 ? -44.014 15.567  -6.361  1.00 20.85  ? 247 ARG A CG  1 
ATOM   1844 C CD  . ARG A 1 247 ? -42.811 16.414  -5.921  1.00 21.10  ? 247 ARG A CD  1 
ATOM   1845 N NE  . ARG A 1 247 ? -43.131 17.847  -5.762  1.00 22.50  ? 247 ARG A NE  1 
ATOM   1846 C CZ  . ARG A 1 247 ? -42.243 18.794  -5.444  1.00 23.69  ? 247 ARG A CZ  1 
ATOM   1847 N NH1 . ARG A 1 247 ? -40.959 18.503  -5.264  1.00 23.98  ? 247 ARG A NH1 1 
ATOM   1848 N NH2 . ARG A 1 247 ? -42.624 20.038  -5.297  1.00 22.47  ? 247 ARG A NH2 1 
ATOM   1849 N N   . ALA A 1 248 ? -44.261 10.988  -6.089  1.00 23.39  ? 248 ALA A N   1 
ATOM   1850 C CA  . ALA A 1 248 ? -44.021 9.548   -6.166  1.00 22.05  ? 248 ALA A CA  1 
ATOM   1851 C C   . ALA A 1 248 ? -44.938 8.832   -7.161  1.00 23.12  ? 248 ALA A C   1 
ATOM   1852 O O   . ALA A 1 248 ? -44.481 7.985   -7.955  1.00 23.35  ? 248 ALA A O   1 
ATOM   1853 C CB  . ALA A 1 248 ? -44.111 8.908   -4.788  1.00 22.92  ? 248 ALA A CB  1 
ATOM   1854 N N   . THR A 1 249 ? -46.219 9.182   -7.163  1.00 23.86  ? 249 THR A N   1 
ATOM   1855 C CA  . THR A 1 249 ? -47.181 8.446   -7.997  1.00 25.03  ? 249 THR A CA  1 
ATOM   1856 C C   . THR A 1 249 ? -46.954 8.735   -9.463  1.00 24.68  ? 249 THR A C   1 
ATOM   1857 O O   . THR A 1 249 ? -47.092 7.885   -10.325 1.00 23.19  ? 249 THR A O   1 
ATOM   1858 C CB  . THR A 1 249 ? -48.616 8.717   -7.529  1.00 23.71  ? 249 THR A CB  1 
ATOM   1859 O OG1 . THR A 1 249 ? -48.649 8.349   -6.144  1.00 24.46  ? 249 THR A OG1 1 
ATOM   1860 C CG2 . THR A 1 249 ? -49.689 7.867   -8.297  1.00 20.32  ? 249 THR A CG2 1 
ATOM   1861 N N   . GLN A 1 250 ? -46.537 9.946   -9.709  1.00 25.21  ? 250 GLN A N   1 
ATOM   1862 C CA  . GLN A 1 250 ? -46.330 10.367  -11.048 1.00 27.10  ? 250 GLN A CA  1 
ATOM   1863 C C   . GLN A 1 250 ? -45.043 9.743   -11.670 1.00 28.83  ? 250 GLN A C   1 
ATOM   1864 O O   . GLN A 1 250 ? -45.056 9.256   -12.847 1.00 26.18  ? 250 GLN A O   1 
ATOM   1865 C CB  . GLN A 1 250 ? -46.259 11.872  -11.027 1.00 26.14  ? 250 GLN A CB  1 
ATOM   1866 C CG  . GLN A 1 250 ? -45.630 12.377  -12.272 1.00 29.72  ? 250 GLN A CG  1 
ATOM   1867 C CD  . GLN A 1 250 ? -46.636 12.777  -13.288 1.00 32.47  ? 250 GLN A CD  1 
ATOM   1868 O OE1 . GLN A 1 250 ? -46.736 13.977  -13.540 1.00 35.55  ? 250 GLN A OE1 1 
ATOM   1869 N NE2 . GLN A 1 250 ? -47.408 11.808  -13.872 1.00 30.18  ? 250 GLN A NE2 1 
ATOM   1870 N N   . LEU A 1 251 ? -43.939 9.790   -10.901 1.00 26.55  ? 251 LEU A N   1 
ATOM   1871 C CA  . LEU A 1 251 ? -42.792 9.014   -11.269 1.00 26.27  ? 251 LEU A CA  1 
ATOM   1872 C C   . LEU A 1 251 ? -43.222 7.555   -11.621 1.00 28.13  ? 251 LEU A C   1 
ATOM   1873 O O   . LEU A 1 251 ? -42.919 7.050   -12.718 1.00 28.22  ? 251 LEU A O   1 
ATOM   1874 C CB  . LEU A 1 251 ? -41.752 9.000   -10.160 1.00 24.53  ? 251 LEU A CB  1 
ATOM   1875 C CG  . LEU A 1 251 ? -40.429 8.379   -10.668 1.00 23.41  ? 251 LEU A CG  1 
ATOM   1876 C CD1 . LEU A 1 251 ? -39.900 9.216   -11.812 1.00 21.88  ? 251 LEU A CD1 1 
ATOM   1877 C CD2 . LEU A 1 251 ? -39.331 8.199   -9.636  1.00 22.24  ? 251 LEU A CD2 1 
ATOM   1878 N N   . ALA A 1 252 ? -43.933 6.887   -10.703 1.00 27.79  ? 252 ALA A N   1 
ATOM   1879 C CA  . ALA A 1 252 ? -44.403 5.515   -10.943 1.00 25.60  ? 252 ALA A CA  1 
ATOM   1880 C C   . ALA A 1 252 ? -45.069 5.425   -12.314 1.00 25.56  ? 252 ALA A C   1 
ATOM   1881 O O   . ALA A 1 252 ? -44.638 4.653   -13.185 1.00 25.74  ? 252 ALA A O   1 
ATOM   1882 C CB  . ALA A 1 252 ? -45.361 5.083   -9.851  1.00 24.20  ? 252 ALA A CB  1 
ATOM   1883 N N   . HIS A 1 253 ? -46.074 6.277   -12.515 1.00 24.95  ? 253 HIS A N   1 
ATOM   1884 C CA  . HIS A 1 253 ? -46.812 6.319   -13.760 1.00 24.82  ? 253 HIS A CA  1 
ATOM   1885 C C   . HIS A 1 253 ? -45.850 6.389   -14.945 1.00 23.26  ? 253 HIS A C   1 
ATOM   1886 O O   . HIS A 1 253 ? -45.962 5.641   -15.891 1.00 22.23  ? 253 HIS A O   1 
ATOM   1887 C CB  . HIS A 1 253 ? -47.846 7.469   -13.806 1.00 25.51  ? 253 HIS A CB  1 
ATOM   1888 C CG  . HIS A 1 253 ? -48.684 7.453   -15.057 1.00 30.50  ? 253 HIS A CG  1 
ATOM   1889 N ND1 . HIS A 1 253 ? -48.500 8.348   -16.108 1.00 32.82  ? 253 HIS A ND1 1 
ATOM   1890 C CD2 . HIS A 1 253 ? -49.660 6.608   -15.462 1.00 30.82  ? 253 HIS A CD2 1 
ATOM   1891 C CE1 . HIS A 1 253 ? -49.336 8.079   -17.096 1.00 29.66  ? 253 HIS A CE1 1 
ATOM   1892 N NE2 . HIS A 1 253 ? -50.054 7.031   -16.724 1.00 36.90  ? 253 HIS A NE2 1 
ATOM   1893 N N   . LEU A 1 254 ? -44.903 7.308   -14.868 1.00 23.19  ? 254 LEU A N   1 
ATOM   1894 C CA  . LEU A 1 254 ? -44.028 7.598   -15.972 1.00 20.68  ? 254 LEU A CA  1 
ATOM   1895 C C   . LEU A 1 254 ? -43.098 6.419   -16.303 1.00 21.85  ? 254 LEU A C   1 
ATOM   1896 O O   . LEU A 1 254 ? -42.596 6.335   -17.431 1.00 23.61  ? 254 LEU A O   1 
ATOM   1897 C CB  . LEU A 1 254 ? -43.238 8.850   -15.658 1.00 17.64  ? 254 LEU A CB  1 
ATOM   1898 C CG  . LEU A 1 254 ? -43.945 10.151  -15.927 1.00 15.83  ? 254 LEU A CG  1 
ATOM   1899 C CD1 . LEU A 1 254 ? -43.176 11.216  -15.192 1.00 15.22  ? 254 LEU A CD1 1 
ATOM   1900 C CD2 . LEU A 1 254 ? -44.028 10.494  -17.406 1.00 14.57  ? 254 LEU A CD2 1 
ATOM   1901 N N   . VAL A 1 255 ? -42.883 5.495   -15.362 1.00 21.09  ? 255 VAL A N   1 
ATOM   1902 C CA  . VAL A 1 255 ? -42.080 4.297   -15.689 1.00 20.43  ? 255 VAL A CA  1 
ATOM   1903 C C   . VAL A 1 255 ? -42.981 3.044   -15.749 1.00 21.72  ? 255 VAL A C   1 
ATOM   1904 O O   . VAL A 1 255 ? -42.526 1.912   -15.707 1.00 20.53  ? 255 VAL A O   1 
ATOM   1905 C CB  . VAL A 1 255 ? -40.925 4.179   -14.733 1.00 19.42  ? 255 VAL A CB  1 
ATOM   1906 C CG1 . VAL A 1 255 ? -40.112 5.460   -14.845 1.00 19.97  ? 255 VAL A CG1 1 
ATOM   1907 C CG2 . VAL A 1 255 ? -41.432 4.044   -13.318 1.00 19.01  ? 255 VAL A CG2 1 
ATOM   1908 N N   . GLY A 1 256 ? -44.281 3.279   -15.896 1.00 22.80  ? 256 GLY A N   1 
ATOM   1909 C CA  . GLY A 1 256 ? -45.238 2.233   -16.097 1.00 24.41  ? 256 GLY A CA  1 
ATOM   1910 C C   . GLY A 1 256 ? -45.562 1.412   -14.876 1.00 28.82  ? 256 GLY A C   1 
ATOM   1911 O O   . GLY A 1 256 ? -45.950 0.271   -15.011 1.00 31.00  ? 256 GLY A O   1 
ATOM   1912 N N   . CYS A 1 257 ? -45.438 1.990   -13.689 1.00 32.94  ? 257 CYS A N   1 
ATOM   1913 C CA  . CYS A 1 257 ? -45.967 1.381   -12.466 1.00 37.61  ? 257 CYS A CA  1 
ATOM   1914 C C   . CYS A 1 257 ? -47.232 2.104   -12.003 1.00 44.37  ? 257 CYS A C   1 
ATOM   1915 O O   . CYS A 1 257 ? -47.242 3.341   -11.995 1.00 41.58  ? 257 CYS A O   1 
ATOM   1916 C CB  . CYS A 1 257 ? -44.930 1.527   -11.376 1.00 37.02  ? 257 CYS A CB  1 
ATOM   1917 S SG  . CYS A 1 257 ? -43.410 0.674   -11.788 1.00 37.14  ? 257 CYS A SG  1 
ATOM   1918 N N   . PRO A 1 258 ? -48.312 1.384   -11.656 1.00 54.52  ? 258 PRO A N   1 
ATOM   1919 C CA  . PRO A 1 258 ? -48.560 -0.054  -11.996 1.00 55.02  ? 258 PRO A CA  1 
ATOM   1920 C C   . PRO A 1 258 ? -48.681 -0.378  -13.546 1.00 51.44  ? 258 PRO A C   1 
ATOM   1921 O O   . PRO A 1 258 ? -48.849 -1.551  -13.979 1.00 47.24  ? 258 PRO A O   1 
ATOM   1922 C CB  . PRO A 1 258 ? -49.913 -0.317  -11.288 1.00 54.37  ? 258 PRO A CB  1 
ATOM   1923 C CG  . PRO A 1 258 ? -50.399 1.017   -10.704 1.00 47.29  ? 258 PRO A CG  1 
ATOM   1924 C CD  . PRO A 1 258 ? -49.180 1.854   -10.542 1.00 48.30  ? 258 PRO A CD  1 
ATOM   1925 N N   . ASN A 1 265 ? -52.306 0.864   -4.444  1.00 49.98  ? 265 ASN A N   1 
ATOM   1926 C CA  . ASN A 1 265 ? -51.781 0.254   -3.227  1.00 53.50  ? 265 ASN A CA  1 
ATOM   1927 C C   . ASN A 1 265 ? -50.208 0.380   -3.153  1.00 50.97  ? 265 ASN A C   1 
ATOM   1928 O O   . ASN A 1 265 ? -49.456 0.008   -4.098  1.00 40.46  ? 265 ASN A O   1 
ATOM   1929 C CB  . ASN A 1 265 ? -52.364 -1.192  -3.066  1.00 60.74  ? 265 ASN A CB  1 
ATOM   1930 C CG  . ASN A 1 265 ? -51.634 -2.056  -2.001  1.00 70.51  ? 265 ASN A CG  1 
ATOM   1931 O OD1 . ASN A 1 265 ? -50.469 -2.481  -2.182  1.00 65.30  ? 265 ASN A OD1 1 
ATOM   1932 N ND2 . ASN A 1 265 ? -52.344 -2.361  -0.905  1.00 62.97  ? 265 ASN A ND2 1 
ATOM   1933 N N   . ASP A 1 266 ? -49.736 0.917   -2.019  1.00 48.24  ? 266 ASP A N   1 
ATOM   1934 C CA  . ASP A 1 266 ? -48.328 1.288   -1.839  1.00 48.47  ? 266 ASP A CA  1 
ATOM   1935 C C   . ASP A 1 266 ? -47.353 0.154   -1.944  1.00 52.77  ? 266 ASP A C   1 
ATOM   1936 O O   . ASP A 1 266 ? -46.303 0.308   -2.569  1.00 54.99  ? 266 ASP A O   1 
ATOM   1937 C CB  . ASP A 1 266 ? -48.071 1.962   -0.508  1.00 47.43  ? 266 ASP A CB  1 
ATOM   1938 C CG  . ASP A 1 266 ? -48.571 3.372   -0.467  1.00 49.49  ? 266 ASP A CG  1 
ATOM   1939 O OD1 . ASP A 1 266 ? -48.863 3.973   -1.515  1.00 50.42  ? 266 ASP A OD1 1 
ATOM   1940 O OD2 . ASP A 1 266 ? -48.685 3.889   0.647   1.00 52.76  ? 266 ASP A OD2 1 
ATOM   1941 N N   . THR A 1 267 ? -47.654 -0.975  -1.317  1.00 51.80  ? 267 THR A N   1 
ATOM   1942 C CA  . THR A 1 267 ? -46.720 -2.103  -1.424  1.00 51.17  ? 267 THR A CA  1 
ATOM   1943 C C   . THR A 1 267 ? -46.407 -2.470  -2.901  1.00 49.96  ? 267 THR A C   1 
ATOM   1944 O O   . THR A 1 267 ? -45.214 -2.653  -3.287  1.00 42.78  ? 267 THR A O   1 
ATOM   1945 C CB  . THR A 1 267 ? -47.219 -3.312  -0.610  1.00 49.71  ? 267 THR A CB  1 
ATOM   1946 O OG1 . THR A 1 267 ? -47.366 -2.897  0.750   1.00 46.07  ? 267 THR A OG1 1 
ATOM   1947 C CG2 . THR A 1 267 ? -46.219 -4.493  -0.678  1.00 47.53  ? 267 THR A CG2 1 
ATOM   1948 N N   . GLU A 1 268 ? -47.488 -2.519  -3.700  1.00 45.56  ? 268 GLU A N   1 
ATOM   1949 C CA  . GLU A 1 268 ? -47.433 -2.855  -5.121  1.00 41.28  ? 268 GLU A CA  1 
ATOM   1950 C C   . GLU A 1 268 ? -46.649 -1.757  -5.896  1.00 39.08  ? 268 GLU A C   1 
ATOM   1951 O O   . GLU A 1 268 ? -45.712 -2.065  -6.661  1.00 41.37  ? 268 GLU A O   1 
ATOM   1952 C CB  . GLU A 1 268 ? -48.854 -3.171  -5.679  1.00 42.89  ? 268 GLU A CB  1 
ATOM   1953 C CG  . GLU A 1 268 ? -49.527 -4.469  -5.150  1.00 41.89  ? 268 GLU A CG  1 
ATOM   1954 N N   . LEU A 1 269 ? -46.964 -0.484  -5.647  1.00 33.28  ? 269 LEU A N   1 
ATOM   1955 C CA  . LEU A 1 269 ? -46.210 0.615   -6.263  1.00 30.34  ? 269 LEU A CA  1 
ATOM   1956 C C   . LEU A 1 269 ? -44.678 0.567   -6.079  1.00 34.07  ? 269 LEU A C   1 
ATOM   1957 O O   . LEU A 1 269 ? -43.937 0.565   -7.073  1.00 36.72  ? 269 LEU A O   1 
ATOM   1958 C CB  . LEU A 1 269 ? -46.675 1.920   -5.670  1.00 30.60  ? 269 LEU A CB  1 
ATOM   1959 C CG  . LEU A 1 269 ? -46.818 3.084   -6.639  1.00 30.31  ? 269 LEU A CG  1 
ATOM   1960 C CD1 . LEU A 1 269 ? -47.373 2.542   -7.953  1.00 33.41  ? 269 LEU A CD1 1 
ATOM   1961 C CD2 . LEU A 1 269 ? -47.728 4.176   -6.072  1.00 27.86  ? 269 LEU A CD2 1 
ATOM   1962 N N   . VAL A 1 270 ? -44.212 0.554   -4.817  1.00 30.17  ? 270 VAL A N   1 
ATOM   1963 C CA  . VAL A 1 270 ? -42.800 0.449   -4.500  1.00 27.37  ? 270 VAL A CA  1 
ATOM   1964 C C   . VAL A 1 270 ? -42.203 -0.880  -4.916  1.00 28.95  ? 270 VAL A C   1 
ATOM   1965 O O   . VAL A 1 270 ? -41.015 -0.940  -5.243  1.00 27.49  ? 270 VAL A O   1 
ATOM   1966 C CB  . VAL A 1 270 ? -42.524 0.687   -3.018  1.00 26.84  ? 270 VAL A CB  1 
ATOM   1967 C CG1 . VAL A 1 270 ? -41.032 0.771   -2.744  1.00 25.45  ? 270 VAL A CG1 1 
ATOM   1968 C CG2 . VAL A 1 270 ? -43.193 1.975   -2.568  1.00 26.39  ? 270 VAL A CG2 1 
ATOM   1969 N N   . ALA A 1 271 ? -43.013 -1.945  -4.943  1.00 31.74  ? 271 ALA A N   1 
ATOM   1970 C CA  . ALA A 1 271 ? -42.534 -3.239  -5.487  1.00 29.80  ? 271 ALA A CA  1 
ATOM   1971 C C   . ALA A 1 271 ? -42.145 -3.088  -6.963  1.00 30.73  ? 271 ALA A C   1 
ATOM   1972 O O   . ALA A 1 271 ? -41.017 -3.459  -7.409  1.00 32.24  ? 271 ALA A O   1 
ATOM   1973 C CB  . ALA A 1 271 ? -43.595 -4.285  -5.341  1.00 27.60  ? 271 ALA A CB  1 
ATOM   1974 N N   . CYS A 1 272 ? -43.074 -2.515  -7.719  1.00 29.06  ? 272 CYS A N   1 
ATOM   1975 C CA  . CYS A 1 272 ? -42.840 -2.272  -9.121  1.00 28.05  ? 272 CYS A CA  1 
ATOM   1976 C C   . CYS A 1 272 ? -41.646 -1.307  -9.326  1.00 26.45  ? 272 CYS A C   1 
ATOM   1977 O O   . CYS A 1 272 ? -40.796 -1.552  -10.159 1.00 25.97  ? 272 CYS A O   1 
ATOM   1978 C CB  . CYS A 1 272 ? -44.143 -1.800  -9.791  1.00 28.75  ? 272 CYS A CB  1 
ATOM   1979 S SG  . CYS A 1 272 ? -43.969 -1.412  -11.562 1.00 39.72  ? 272 CYS A SG  1 
ATOM   1980 N N   . LEU A 1 273 ? -41.574 -0.221  -8.563  1.00 25.75  ? 273 LEU A N   1 
ATOM   1981 C CA  . LEU A 1 273 ? -40.478 0.715   -8.692  1.00 26.53  ? 273 LEU A CA  1 
ATOM   1982 C C   . LEU A 1 273 ? -39.153 0.017   -8.460  1.00 28.91  ? 273 LEU A C   1 
ATOM   1983 O O   . LEU A 1 273 ? -38.163 0.282   -9.144  1.00 29.23  ? 273 LEU A O   1 
ATOM   1984 C CB  . LEU A 1 273 ? -40.615 1.825   -7.644  1.00 28.28  ? 273 LEU A CB  1 
ATOM   1985 C CG  . LEU A 1 273 ? -41.551 2.999   -7.985  1.00 28.61  ? 273 LEU A CG  1 
ATOM   1986 C CD1 . LEU A 1 273 ? -41.442 4.134   -6.993  1.00 26.38  ? 273 LEU A CD1 1 
ATOM   1987 C CD2 . LEU A 1 273 ? -41.286 3.541   -9.381  1.00 27.28  ? 273 LEU A CD2 1 
ATOM   1988 N N   . ARG A 1 274 ? -39.128 -0.872  -7.466  1.00 30.24  ? 274 ARG A N   1 
ATOM   1989 C CA  . ARG A 1 274 ? -37.913 -1.604  -7.116  1.00 28.87  ? 274 ARG A CA  1 
ATOM   1990 C C   . ARG A 1 274 ? -37.348 -2.405  -8.275  1.00 27.80  ? 274 ARG A C   1 
ATOM   1991 O O   . ARG A 1 274 ? -36.173 -2.681  -8.267  1.00 33.64  ? 274 ARG A O   1 
ATOM   1992 C CB  . ARG A 1 274 ? -38.078 -2.445  -5.829  1.00 30.18  ? 274 ARG A CB  1 
ATOM   1993 C CG  . ARG A 1 274 ? -37.957 -1.576  -4.579  1.00 31.42  ? 274 ARG A CG  1 
ATOM   1994 C CD  . ARG A 1 274 ? -37.564 -2.331  -3.330  1.00 35.41  ? 274 ARG A CD  1 
ATOM   1995 N NE  . ARG A 1 274 ? -38.637 -2.388  -2.310  1.00 43.75  ? 274 ARG A NE  1 
ATOM   1996 C CZ  . ARG A 1 274 ? -38.624 -1.771  -1.111  1.00 46.88  ? 274 ARG A CZ  1 
ATOM   1997 N NH1 . ARG A 1 274 ? -37.622 -0.996  -0.713  1.00 52.04  ? 274 ARG A NH1 1 
ATOM   1998 N NH2 . ARG A 1 274 ? -39.633 -1.914  -0.277  1.00 51.37  ? 274 ARG A NH2 1 
ATOM   1999 N N   . THR A 1 275 ? -38.120 -2.705  -9.310  1.00 25.09  ? 275 THR A N   1 
ATOM   2000 C CA  . THR A 1 275 ? -37.605 -3.506  -10.437 1.00 23.42  ? 275 THR A CA  1 
ATOM   2001 C C   . THR A 1 275 ? -37.076 -2.673  -11.594 1.00 24.44  ? 275 THR A C   1 
ATOM   2002 O O   . THR A 1 275 ? -36.469 -3.193  -12.534 1.00 27.40  ? 275 THR A O   1 
ATOM   2003 C CB  . THR A 1 275 ? -38.699 -4.373  -11.054 1.00 22.52  ? 275 THR A CB  1 
ATOM   2004 O OG1 . THR A 1 275 ? -39.510 -3.519  -11.870 1.00 23.46  ? 275 THR A OG1 1 
ATOM   2005 C CG2 . THR A 1 275 ? -39.565 -5.033  -9.984  1.00 21.48  ? 275 THR A CG2 1 
ATOM   2006 N N   . ARG A 1 276 ? -37.342 -1.383  -11.580 1.00 24.04  ? 276 ARG A N   1 
ATOM   2007 C CA  . ARG A 1 276 ? -36.834 -0.525  -12.637 1.00 21.89  ? 276 ARG A CA  1 
ATOM   2008 C C   . ARG A 1 276 ? -35.325 -0.282  -12.531 1.00 19.68  ? 276 ARG A C   1 
ATOM   2009 O O   . ARG A 1 276 ? -34.766 -0.156  -11.446 1.00 18.05  ? 276 ARG A O   1 
ATOM   2010 C CB  . ARG A 1 276 ? -37.654 0.737   -12.598 1.00 23.67  ? 276 ARG A CB  1 
ATOM   2011 C CG  . ARG A 1 276 ? -39.137 0.451   -12.862 1.00 28.08  ? 276 ARG A CG  1 
ATOM   2012 C CD  . ARG A 1 276 ? -39.249 0.068   -14.333 1.00 36.28  ? 276 ARG A CD  1 
ATOM   2013 N NE  . ARG A 1 276 ? -40.608 -0.110  -14.822 1.00 43.46  ? 276 ARG A NE  1 
ATOM   2014 C CZ  . ARG A 1 276 ? -41.300 -1.231  -14.660 1.00 48.96  ? 276 ARG A CZ  1 
ATOM   2015 N NH1 . ARG A 1 276 ? -40.731 -2.235  -13.999 1.00 55.75  ? 276 ARG A NH1 1 
ATOM   2016 N NH2 . ARG A 1 276 ? -42.546 -1.357  -15.139 1.00 47.77  ? 276 ARG A NH2 1 
ATOM   2017 N N   . PRO A 1 277 ? -34.631 -0.276  -13.663 1.00 20.11  ? 277 PRO A N   1 
ATOM   2018 C CA  . PRO A 1 277 ? -33.192 0.122   -13.638 1.00 20.46  ? 277 PRO A CA  1 
ATOM   2019 C C   . PRO A 1 277 ? -32.984 1.516   -13.061 1.00 20.19  ? 277 PRO A C   1 
ATOM   2020 O O   . PRO A 1 277 ? -33.762 2.403   -13.374 1.00 22.91  ? 277 PRO A O   1 
ATOM   2021 C CB  . PRO A 1 277 ? -32.797 0.075   -15.117 1.00 17.93  ? 277 PRO A CB  1 
ATOM   2022 C CG  . PRO A 1 277 ? -33.635 -1.026  -15.660 1.00 17.68  ? 277 PRO A CG  1 
ATOM   2023 C CD  . PRO A 1 277 ? -34.968 -0.945  -14.934 1.00 20.22  ? 277 PRO A CD  1 
ATOM   2024 N N   . ALA A 1 278 ? -31.986 1.719   -12.209 1.00 19.48  ? 278 ALA A N   1 
ATOM   2025 C CA  . ALA A 1 278 ? -31.827 3.056   -11.623 1.00 18.63  ? 278 ALA A CA  1 
ATOM   2026 C C   . ALA A 1 278 ? -31.845 4.166   -12.700 1.00 18.32  ? 278 ALA A C   1 
ATOM   2027 O O   . ALA A 1 278 ? -32.454 5.203   -12.499 1.00 19.12  ? 278 ALA A O   1 
ATOM   2028 C CB  . ALA A 1 278 ? -30.595 3.160   -10.746 1.00 16.83  ? 278 ALA A CB  1 
ATOM   2029 N N   . GLN A 1 279 ? -31.246 3.942   -13.856 1.00 17.98  ? 279 GLN A N   1 
ATOM   2030 C CA  . GLN A 1 279 ? -31.195 5.033   -14.830 1.00 18.87  ? 279 GLN A CA  1 
ATOM   2031 C C   . GLN A 1 279 ? -32.611 5.415   -15.340 1.00 20.34  ? 279 GLN A C   1 
ATOM   2032 O O   . GLN A 1 279 ? -32.929 6.627   -15.634 1.00 19.71  ? 279 GLN A O   1 
ATOM   2033 C CB  . GLN A 1 279 ? -30.261 4.689   -16.003 1.00 18.34  ? 279 GLN A CB  1 
ATOM   2034 C CG  . GLN A 1 279 ? -29.944 5.847   -16.915 1.00 19.10  ? 279 GLN A CG  1 
ATOM   2035 C CD  . GLN A 1 279 ? -29.193 6.933   -16.160 1.00 20.29  ? 279 GLN A CD  1 
ATOM   2036 O OE1 . GLN A 1 279 ? -28.167 6.657   -15.518 1.00 21.01  ? 279 GLN A OE1 1 
ATOM   2037 N NE2 . GLN A 1 279 ? -29.712 8.152   -16.192 1.00 18.83  ? 279 GLN A NE2 1 
ATOM   2038 N N   . VAL A 1 280 ? -33.462 4.391   -15.466 1.00 18.76  ? 280 VAL A N   1 
ATOM   2039 C CA  . VAL A 1 280 ? -34.821 4.679   -15.879 1.00 19.13  ? 280 VAL A CA  1 
ATOM   2040 C C   . VAL A 1 280 ? -35.515 5.705   -14.922 1.00 19.69  ? 280 VAL A C   1 
ATOM   2041 O O   . VAL A 1 280 ? -36.078 6.694   -15.400 1.00 19.65  ? 280 VAL A O   1 
ATOM   2042 C CB  . VAL A 1 280 ? -35.660 3.402   -16.154 1.00 17.51  ? 280 VAL A CB  1 
ATOM   2043 C CG1 . VAL A 1 280 ? -37.112 3.786   -16.423 1.00 15.36  ? 280 VAL A CG1 1 
ATOM   2044 C CG2 . VAL A 1 280 ? -35.053 2.674   -17.331 1.00 15.07  ? 280 VAL A CG2 1 
ATOM   2045 N N   . LEU A 1 281 ? -35.446 5.488   -13.607 1.00 18.79  ? 281 LEU A N   1 
ATOM   2046 C CA  . LEU A 1 281 ? -35.924 6.473   -12.645 1.00 18.93  ? 281 LEU A CA  1 
ATOM   2047 C C   . LEU A 1 281 ? -35.268 7.835   -12.900 1.00 21.57  ? 281 LEU A C   1 
ATOM   2048 O O   . LEU A 1 281 ? -35.972 8.859   -13.117 1.00 23.47  ? 281 LEU A O   1 
ATOM   2049 C CB  . LEU A 1 281 ? -35.622 6.024   -11.232 1.00 18.91  ? 281 LEU A CB  1 
ATOM   2050 C CG  . LEU A 1 281 ? -36.378 4.749   -10.800 1.00 20.03  ? 281 LEU A CG  1 
ATOM   2051 C CD1 . LEU A 1 281 ? -36.227 4.450   -9.304  1.00 19.09  ? 281 LEU A CD1 1 
ATOM   2052 C CD2 . LEU A 1 281 ? -37.849 4.773   -11.203 1.00 18.65  ? 281 LEU A CD2 1 
ATOM   2053 N N   . VAL A 1 282 ? -33.936 7.884   -12.890 1.00 20.95  ? 282 VAL A N   1 
ATOM   2054 C CA  . VAL A 1 282 ? -33.309 9.163   -13.090 1.00 22.51  ? 282 VAL A CA  1 
ATOM   2055 C C   . VAL A 1 282 ? -33.882 9.869   -14.342 1.00 25.38  ? 282 VAL A C   1 
ATOM   2056 O O   . VAL A 1 282 ? -34.147 11.051  -14.326 1.00 26.68  ? 282 VAL A O   1 
ATOM   2057 C CB  . VAL A 1 282 ? -31.772 9.060   -13.142 1.00 22.22  ? 282 VAL A CB  1 
ATOM   2058 C CG1 . VAL A 1 282 ? -31.138 10.328  -13.745 1.00 18.60  ? 282 VAL A CG1 1 
ATOM   2059 C CG2 . VAL A 1 282 ? -31.249 8.749   -11.743 1.00 20.93  ? 282 VAL A CG2 1 
ATOM   2060 N N   . ASN A 1 283 ? -34.117 9.144   -15.423 1.00 27.56  ? 283 ASN A N   1 
ATOM   2061 C CA  . ASN A 1 283 ? -34.466 9.818   -16.661 1.00 25.86  ? 283 ASN A CA  1 
ATOM   2062 C C   . ASN A 1 283 ? -35.808 10.480  -16.598 1.00 26.48  ? 283 ASN A C   1 
ATOM   2063 O O   . ASN A 1 283 ? -36.196 11.095  -17.532 1.00 26.23  ? 283 ASN A O   1 
ATOM   2064 C CB  . ASN A 1 283 ? -34.458 8.823   -17.807 1.00 25.64  ? 283 ASN A CB  1 
ATOM   2065 C CG  . ASN A 1 283 ? -33.087 8.331   -18.119 1.00 26.07  ? 283 ASN A CG  1 
ATOM   2066 O OD1 . ASN A 1 283 ? -32.101 8.833   -17.594 1.00 31.83  ? 283 ASN A OD1 1 
ATOM   2067 N ND2 . ASN A 1 283 ? -33.005 7.374   -18.972 1.00 25.27  ? 283 ASN A ND2 1 
ATOM   2068 N N   . HIS A 1 284 ? -36.561 10.327  -15.519 1.00 29.07  ? 284 HIS A N   1 
ATOM   2069 C CA  . HIS A 1 284 ? -37.872 10.930  -15.516 1.00 28.43  ? 284 HIS A CA  1 
ATOM   2070 C C   . HIS A 1 284 ? -38.023 11.826  -14.336 1.00 32.34  ? 284 HIS A C   1 
ATOM   2071 O O   . HIS A 1 284 ? -39.093 12.362  -14.139 1.00 34.15  ? 284 HIS A O   1 
ATOM   2072 C CB  . HIS A 1 284 ? -38.941 9.866   -15.507 1.00 26.00  ? 284 HIS A CB  1 
ATOM   2073 C CG  . HIS A 1 284 ? -39.035 9.113   -16.794 1.00 27.76  ? 284 HIS A CG  1 
ATOM   2074 N ND1 . HIS A 1 284 ? -39.604 9.652   -17.929 1.00 28.73  ? 284 HIS A ND1 1 
ATOM   2075 C CD2 . HIS A 1 284 ? -38.603 7.875   -17.142 1.00 27.52  ? 284 HIS A CD2 1 
ATOM   2076 C CE1 . HIS A 1 284 ? -39.519 8.774   -18.918 1.00 27.60  ? 284 HIS A CE1 1 
ATOM   2077 N NE2 . HIS A 1 284 ? -38.899 7.697   -18.474 1.00 25.49  ? 284 HIS A NE2 1 
ATOM   2078 N N   . GLU A 1 285 ? -36.967 12.001  -13.536 1.00 34.91  ? 285 GLU A N   1 
ATOM   2079 C CA  . GLU A 1 285 ? -37.059 12.852  -12.355 1.00 37.19  ? 285 GLU A CA  1 
ATOM   2080 C C   . GLU A 1 285 ? -37.594 14.251  -12.714 1.00 41.09  ? 285 GLU A C   1 
ATOM   2081 O O   . GLU A 1 285 ? -38.490 14.772  -12.042 1.00 42.39  ? 285 GLU A O   1 
ATOM   2082 C CB  . GLU A 1 285 ? -35.731 12.887  -11.617 1.00 39.33  ? 285 GLU A CB  1 
ATOM   2083 C CG  . GLU A 1 285 ? -35.443 14.163  -10.878 1.00 46.65  ? 285 GLU A CG  1 
ATOM   2084 C CD  . GLU A 1 285 ? -34.435 14.020  -9.753  1.00 52.36  ? 285 GLU A CD  1 
ATOM   2085 O OE1 . GLU A 1 285 ? -33.357 13.459  -10.008 1.00 52.74  ? 285 GLU A OE1 1 
ATOM   2086 O OE2 . GLU A 1 285 ? -34.705 14.529  -8.615  1.00 67.20  ? 285 GLU A OE2 1 
ATOM   2087 N N   . TRP A 1 286 ? -37.120 14.833  -13.806 1.00 42.84  ? 286 TRP A N   1 
ATOM   2088 C CA  . TRP A 1 286 ? -37.450 16.228  -14.032 1.00 47.33  ? 286 TRP A CA  1 
ATOM   2089 C C   . TRP A 1 286 ? -38.883 16.532  -14.424 1.00 49.01  ? 286 TRP A C   1 
ATOM   2090 O O   . TRP A 1 286 ? -39.399 17.580  -14.069 1.00 54.46  ? 286 TRP A O   1 
ATOM   2091 C CB  . TRP A 1 286 ? -36.406 16.944  -14.888 1.00 52.53  ? 286 TRP A CB  1 
ATOM   2092 C CG  . TRP A 1 286 ? -35.152 17.318  -14.017 1.00 64.02  ? 286 TRP A CG  1 
ATOM   2093 C CD1 . TRP A 1 286 ? -33.917 16.675  -13.996 1.00 64.00  ? 286 TRP A CD1 1 
ATOM   2094 C CD2 . TRP A 1 286 ? -35.055 18.369  -13.021 1.00 69.48  ? 286 TRP A CD2 1 
ATOM   2095 N NE1 . TRP A 1 286 ? -33.073 17.271  -13.072 1.00 62.70  ? 286 TRP A NE1 1 
ATOM   2096 C CE2 . TRP A 1 286 ? -33.734 18.307  -12.462 1.00 69.25  ? 286 TRP A CE2 1 
ATOM   2097 C CE3 . TRP A 1 286 ? -35.945 19.355  -12.551 1.00 61.64  ? 286 TRP A CE3 1 
ATOM   2098 C CZ2 . TRP A 1 286 ? -33.288 19.205  -11.470 1.00 63.72  ? 286 TRP A CZ2 1 
ATOM   2099 C CZ3 . TRP A 1 286 ? -35.501 20.234  -11.556 1.00 61.89  ? 286 TRP A CZ3 1 
ATOM   2100 C CH2 . TRP A 1 286 ? -34.183 20.153  -11.027 1.00 61.48  ? 286 TRP A CH2 1 
ATOM   2101 N N   . HIS A 1 287 ? -39.571 15.621  -15.087 1.00 46.54  ? 287 HIS A N   1 
ATOM   2102 C CA  . HIS A 1 287 ? -40.955 15.934  -15.382 1.00 47.30  ? 287 HIS A CA  1 
ATOM   2103 C C   . HIS A 1 287 ? -41.903 15.516  -14.249 1.00 41.84  ? 287 HIS A C   1 
ATOM   2104 O O   . HIS A 1 287 ? -42.895 14.880  -14.509 1.00 42.73  ? 287 HIS A O   1 
ATOM   2105 C CB  . HIS A 1 287 ? -41.489 15.375  -16.745 1.00 54.96  ? 287 HIS A CB  1 
ATOM   2106 C CG  . HIS A 1 287 ? -40.445 14.871  -17.692 1.00 67.87  ? 287 HIS A CG  1 
ATOM   2107 N ND1 . HIS A 1 287 ? -40.514 13.601  -18.249 1.00 64.97  ? 287 HIS A ND1 1 
ATOM   2108 C CD2 . HIS A 1 287 ? -39.324 15.462  -18.200 1.00 73.33  ? 287 HIS A CD2 1 
ATOM   2109 C CE1 . HIS A 1 287 ? -39.463 13.428  -19.039 1.00 79.19  ? 287 HIS A CE1 1 
ATOM   2110 N NE2 . HIS A 1 287 ? -38.726 14.538  -19.024 1.00 78.44  ? 287 HIS A NE2 1 
ATOM   2111 N N   . VAL A 1 288 ? -41.643 15.833  -12.997 1.00 36.58  ? 288 VAL A N   1 
ATOM   2112 C CA  . VAL A 1 288 ? -42.724 15.570  -12.017 1.00 35.88  ? 288 VAL A CA  1 
ATOM   2113 C C   . VAL A 1 288 ? -43.163 16.835  -11.279 1.00 37.53  ? 288 VAL A C   1 
ATOM   2114 O O   . VAL A 1 288 ? -43.853 16.753  -10.292 1.00 37.72  ? 288 VAL A O   1 
ATOM   2115 C CB  . VAL A 1 288 ? -42.456 14.357  -11.016 1.00 33.94  ? 288 VAL A CB  1 
ATOM   2116 C CG1 . VAL A 1 288 ? -41.936 13.152  -11.750 1.00 37.98  ? 288 VAL A CG1 1 
ATOM   2117 C CG2 . VAL A 1 288 ? -41.464 14.645  -9.895  1.00 29.54  ? 288 VAL A CG2 1 
ATOM   2118 N N   . LEU A 1 289 ? -42.778 18.016  -11.738 1.00 42.52  ? 289 LEU A N   1 
ATOM   2119 C CA  . LEU A 1 289 ? -42.938 19.159  -10.856 1.00 45.30  ? 289 LEU A CA  1 
ATOM   2120 C C   . LEU A 1 289 ? -44.266 19.929  -10.977 1.00 50.06  ? 289 LEU A C   1 
ATOM   2121 O O   . LEU A 1 289 ? -44.806 20.011  -12.071 1.00 56.22  ? 289 LEU A O   1 
ATOM   2122 C CB  . LEU A 1 289 ? -41.751 20.070  -11.032 1.00 41.74  ? 289 LEU A CB  1 
ATOM   2123 C CG  . LEU A 1 289 ? -40.519 19.687  -10.237 1.00 41.62  ? 289 LEU A CG  1 
ATOM   2124 C CD1 . LEU A 1 289 ? -39.387 20.674  -10.553 1.00 40.96  ? 289 LEU A CD1 1 
ATOM   2125 C CD2 . LEU A 1 289 ? -40.837 19.661  -8.742  1.00 38.60  ? 289 LEU A CD2 1 
ATOM   2126 N N   . SER A 1 293 ? -41.225 26.763  -13.295 1.00 20.57  ? 293 SER A N   1 
ATOM   2127 C CA  . SER A 1 293 ? -40.338 26.977  -12.113 1.00 22.01  ? 293 SER A CA  1 
ATOM   2128 C C   . SER A 1 293 ? -38.724 26.976  -12.169 1.00 22.38  ? 293 SER A C   1 
ATOM   2129 O O   . SER A 1 293 ? -38.161 26.371  -13.025 1.00 23.31  ? 293 SER A O   1 
ATOM   2130 C CB  . SER A 1 293 ? -40.769 26.024  -10.996 1.00 22.06  ? 293 SER A CB  1 
ATOM   2131 O OG  . SER A 1 293 ? -39.933 24.884  -10.931 1.00 23.27  ? 293 SER A OG  1 
ATOM   2132 N N   . VAL A 1 294 ? -38.020 27.678  -11.252 1.00 19.43  ? 294 VAL A N   1 
ATOM   2133 C CA  . VAL A 1 294 ? -36.603 27.435  -10.937 1.00 18.59  ? 294 VAL A CA  1 
ATOM   2134 C C   . VAL A 1 294 ? -36.328 27.299  -9.425  1.00 18.24  ? 294 VAL A C   1 
ATOM   2135 O O   . VAL A 1 294 ? -37.139 27.690  -8.618  1.00 20.23  ? 294 VAL A O   1 
ATOM   2136 C CB  . VAL A 1 294 ? -35.639 28.517  -11.459 1.00 17.95  ? 294 VAL A CB  1 
ATOM   2137 C CG1 . VAL A 1 294 ? -35.723 28.605  -12.955 1.00 18.33  ? 294 VAL A CG1 1 
ATOM   2138 C CG2 . VAL A 1 294 ? -35.861 29.858  -10.799 1.00 16.83  ? 294 VAL A CG2 1 
ATOM   2139 N N   . PHE A 1 295 ? -35.179 26.780  -9.010  1.00 16.53  ? 295 PHE A N   1 
ATOM   2140 C CA  . PHE A 1 295 ? -34.989 26.546  -7.556  1.00 15.57  ? 295 PHE A CA  1 
ATOM   2141 C C   . PHE A 1 295 ? -36.109 25.682  -6.871  1.00 15.74  ? 295 PHE A C   1 
ATOM   2142 O O   . PHE A 1 295 ? -36.446 25.893  -5.693  1.00 15.75  ? 295 PHE A O   1 
ATOM   2143 C CB  . PHE A 1 295 ? -34.790 27.885  -6.806  1.00 14.55  ? 295 PHE A CB  1 
ATOM   2144 C CG  . PHE A 1 295 ? -33.678 27.884  -5.764  1.00 13.82  ? 295 PHE A CG  1 
ATOM   2145 C CD1 . PHE A 1 295 ? -33.556 26.841  -4.791  1.00 12.99  ? 295 PHE A CD1 1 
ATOM   2146 C CD2 . PHE A 1 295 ? -32.714 28.966  -5.728  1.00 13.09  ? 295 PHE A CD2 1 
ATOM   2147 C CE1 . PHE A 1 295 ? -32.506 26.891  -3.855  1.00 11.63  ? 295 PHE A CE1 1 
ATOM   2148 C CE2 . PHE A 1 295 ? -31.685 28.976  -4.771  1.00 11.46  ? 295 PHE A CE2 1 
ATOM   2149 C CZ  . PHE A 1 295 ? -31.588 27.949  -3.858  1.00 10.96  ? 295 PHE A CZ  1 
ATOM   2150 N N   . ARG A 1 296 ? -36.639 24.706  -7.604  1.00 15.57  ? 296 ARG A N   1 
ATOM   2151 C CA  . ARG A 1 296 ? -37.522 23.674  -7.061  1.00 16.16  ? 296 ARG A CA  1 
ATOM   2152 C C   . ARG A 1 296 ? -37.034 22.309  -7.500  1.00 17.75  ? 296 ARG A C   1 
ATOM   2153 O O   . ARG A 1 296 ? -36.677 22.122  -8.656  1.00 19.29  ? 296 ARG A O   1 
ATOM   2154 C CB  . ARG A 1 296 ? -38.962 23.811  -7.575  1.00 14.69  ? 296 ARG A CB  1 
ATOM   2155 C CG  . ARG A 1 296 ? -39.703 24.996  -7.070  1.00 14.66  ? 296 ARG A CG  1 
ATOM   2156 C CD  . ARG A 1 296 ? -39.479 25.271  -5.598  1.00 15.25  ? 296 ARG A CD  1 
ATOM   2157 N NE  . ARG A 1 296 ? -40.276 26.409  -5.129  1.00 15.87  ? 296 ARG A NE  1 
ATOM   2158 C CZ  . ARG A 1 296 ? -39.778 27.569  -4.674  1.00 16.42  ? 296 ARG A CZ  1 
ATOM   2159 N NH1 . ARG A 1 296 ? -38.471 27.798  -4.583  1.00 15.91  ? 296 ARG A NH1 1 
ATOM   2160 N NH2 . ARG A 1 296 ? -40.608 28.520  -4.275  1.00 17.35  ? 296 ARG A NH2 1 
ATOM   2161 N N   . PHE A 1 297 ? -37.084 21.326  -6.616  1.00 18.57  ? 297 PHE A N   1 
ATOM   2162 C CA  . PHE A 1 297 ? -36.490 20.066  -6.951  1.00 19.51  ? 297 PHE A CA  1 
ATOM   2163 C C   . PHE A 1 297 ? -37.523 18.968  -6.623  1.00 21.25  ? 297 PHE A C   1 
ATOM   2164 O O   . PHE A 1 297 ? -38.221 19.120  -5.653  1.00 23.46  ? 297 PHE A O   1 
ATOM   2165 C CB  . PHE A 1 297 ? -35.220 19.955  -6.108  1.00 18.78  ? 297 PHE A CB  1 
ATOM   2166 C CG  . PHE A 1 297 ? -34.358 21.175  -6.164  1.00 18.36  ? 297 PHE A CG  1 
ATOM   2167 C CD1 . PHE A 1 297 ? -33.741 21.562  -7.340  1.00 18.72  ? 297 PHE A CD1 1 
ATOM   2168 C CD2 . PHE A 1 297 ? -34.162 21.957  -5.048  1.00 18.29  ? 297 PHE A CD2 1 
ATOM   2169 C CE1 . PHE A 1 297 ? -32.905 22.693  -7.408  1.00 17.81  ? 297 PHE A CE1 1 
ATOM   2170 C CE2 . PHE A 1 297 ? -33.368 23.109  -5.119  1.00 17.93  ? 297 PHE A CE2 1 
ATOM   2171 C CZ  . PHE A 1 297 ? -32.722 23.465  -6.298  1.00 17.01  ? 297 PHE A CZ  1 
ATOM   2172 N N   . SER A 1 298 ? -37.618 17.858  -7.364  1.00 21.81  ? 298 SER A N   1 
ATOM   2173 C CA  . SER A 1 298 ? -38.727 16.922  -7.106  1.00 22.85  ? 298 SER A CA  1 
ATOM   2174 C C   . SER A 1 298 ? -38.676 16.093  -5.812  1.00 22.22  ? 298 SER A C   1 
ATOM   2175 O O   . SER A 1 298 ? -39.711 15.857  -5.149  1.00 20.27  ? 298 SER A O   1 
ATOM   2176 C CB  . SER A 1 298 ? -38.971 16.014  -8.323  1.00 24.95  ? 298 SER A CB  1 
ATOM   2177 O OG  . SER A 1 298 ? -38.528 16.673  -9.526  1.00 31.14  ? 298 SER A OG  1 
ATOM   2178 N N   . PHE A 1 299 ? -37.502 15.579  -5.476  1.00 22.09  ? 299 PHE A N   1 
ATOM   2179 C CA  . PHE A 1 299 ? -37.459 14.726  -4.287  1.00 20.05  ? 299 PHE A CA  1 
ATOM   2180 C C   . PHE A 1 299 ? -36.587 15.279  -3.159  1.00 20.70  ? 299 PHE A C   1 
ATOM   2181 O O   . PHE A 1 299 ? -35.327 15.226  -3.170  1.00 21.05  ? 299 PHE A O   1 
ATOM   2182 C CB  . PHE A 1 299 ? -37.114 13.312  -4.689  1.00 19.86  ? 299 PHE A CB  1 
ATOM   2183 C CG  . PHE A 1 299 ? -38.114 12.713  -5.657  1.00 20.05  ? 299 PHE A CG  1 
ATOM   2184 C CD1 . PHE A 1 299 ? -39.384 12.335  -5.224  1.00 19.48  ? 299 PHE A CD1 1 
ATOM   2185 C CD2 . PHE A 1 299 ? -37.785 12.541  -7.008  1.00 18.85  ? 299 PHE A CD2 1 
ATOM   2186 C CE1 . PHE A 1 299 ? -40.283 11.814  -6.120  1.00 19.95  ? 299 PHE A CE1 1 
ATOM   2187 C CE2 . PHE A 1 299 ? -38.675 11.983  -7.908  1.00 18.53  ? 299 PHE A CE2 1 
ATOM   2188 C CZ  . PHE A 1 299 ? -39.931 11.637  -7.472  1.00 19.28  ? 299 PHE A CZ  1 
ATOM   2189 N N   . VAL A 1 300 ? -37.280 15.918  -2.225  1.00 19.70  ? 300 VAL A N   1 
ATOM   2190 C CA  . VAL A 1 300 ? -36.636 16.690  -1.142  1.00 18.23  ? 300 VAL A CA  1 
ATOM   2191 C C   . VAL A 1 300 ? -37.237 16.091  0.147   1.00 17.37  ? 300 VAL A C   1 
ATOM   2192 O O   . VAL A 1 300 ? -38.224 15.354  0.049   1.00 16.59  ? 300 VAL A O   1 
ATOM   2193 C CB  . VAL A 1 300 ? -36.840 18.240  -1.304  1.00 15.81  ? 300 VAL A CB  1 
ATOM   2194 C CG1 . VAL A 1 300 ? -36.465 18.720  -2.671  1.00 13.97  ? 300 VAL A CG1 1 
ATOM   2195 C CG2 . VAL A 1 300 ? -38.278 18.595  -1.078  1.00 15.17  ? 300 VAL A CG2 1 
ATOM   2196 N N   . PRO A 1 301 ? -36.653 16.387  1.322   1.00 17.69  ? 301 PRO A N   1 
ATOM   2197 C CA  . PRO A 1 301 ? -37.198 15.874  2.605   1.00 19.39  ? 301 PRO A CA  1 
ATOM   2198 C C   . PRO A 1 301 ? -38.711 16.141  2.805   1.00 21.99  ? 301 PRO A C   1 
ATOM   2199 O O   . PRO A 1 301 ? -39.183 17.250  2.500   1.00 26.91  ? 301 PRO A O   1 
ATOM   2200 C CB  . PRO A 1 301 ? -36.390 16.637  3.659   1.00 17.87  ? 301 PRO A CB  1 
ATOM   2201 C CG  . PRO A 1 301 ? -35.149 17.121  2.975   1.00 18.05  ? 301 PRO A CG  1 
ATOM   2202 C CD  . PRO A 1 301 ? -35.440 17.216  1.501   1.00 17.79  ? 301 PRO A CD  1 
ATOM   2203 N N   . VAL A 1 302 ? -39.486 15.160  3.262   1.00 23.45  ? 302 VAL A N   1 
ATOM   2204 C CA  . VAL A 1 302 ? -40.908 15.404  3.629   1.00 25.89  ? 302 VAL A CA  1 
ATOM   2205 C C   . VAL A 1 302 ? -41.079 15.712  5.085   1.00 30.25  ? 302 VAL A C   1 
ATOM   2206 O O   . VAL A 1 302 ? -40.208 15.321  5.870   1.00 31.97  ? 302 VAL A O   1 
ATOM   2207 C CB  . VAL A 1 302 ? -41.771 14.161  3.603   1.00 24.68  ? 302 VAL A CB  1 
ATOM   2208 C CG1 . VAL A 1 302 ? -42.607 14.172  2.369   1.00 27.04  ? 302 VAL A CG1 1 
ATOM   2209 C CG2 . VAL A 1 302 ? -40.961 12.897  3.810   1.00 22.32  ? 302 VAL A CG2 1 
ATOM   2210 N N   . VAL A 1 303 ? -42.218 16.328  5.459   1.00 31.81  ? 303 VAL A N   1 
ATOM   2211 C CA  . VAL A 1 303 ? -42.532 16.531  6.883   1.00 35.79  ? 303 VAL A CA  1 
ATOM   2212 C C   . VAL A 1 303 ? -43.422 15.386  7.348   1.00 38.64  ? 303 VAL A C   1 
ATOM   2213 O O   . VAL A 1 303 ? -44.632 15.376  7.137   1.00 42.36  ? 303 VAL A O   1 
ATOM   2214 C CB  . VAL A 1 303 ? -43.157 17.915  7.184   1.00 34.85  ? 303 VAL A CB  1 
ATOM   2215 C CG1 . VAL A 1 303 ? -43.259 18.116  8.686   1.00 34.71  ? 303 VAL A CG1 1 
ATOM   2216 C CG2 . VAL A 1 303 ? -42.324 19.016  6.569   1.00 33.21  ? 303 VAL A CG2 1 
ATOM   2217 N N   . ASP A 1 304 ? -42.813 14.371  7.925   1.00 45.60  ? 304 ASP A N   1 
ATOM   2218 C CA  . ASP A 1 304 ? -43.546 13.108  8.096   1.00 46.73  ? 304 ASP A CA  1 
ATOM   2219 C C   . ASP A 1 304 ? -44.066 12.953  9.501   1.00 43.16  ? 304 ASP A C   1 
ATOM   2220 O O   . ASP A 1 304 ? -44.892 12.099  9.727   1.00 37.62  ? 304 ASP A O   1 
ATOM   2221 C CB  . ASP A 1 304 ? -42.702 11.878  7.707   1.00 44.81  ? 304 ASP A CB  1 
ATOM   2222 C CG  . ASP A 1 304 ? -41.338 11.851  8.384   1.00 55.88  ? 304 ASP A CG  1 
ATOM   2223 O OD1 . ASP A 1 304 ? -40.844 12.866  8.984   1.00 55.94  ? 304 ASP A OD1 1 
ATOM   2224 O OD2 . ASP A 1 304 ? -40.716 10.778  8.273   1.00 71.84  ? 304 ASP A OD2 1 
ATOM   2225 N N   . GLY A 1 305 ? -43.584 13.777  10.440  1.00 45.10  ? 305 GLY A N   1 
ATOM   2226 C CA  . GLY A 1 305 ? -43.836 13.536  11.884  1.00 46.48  ? 305 GLY A CA  1 
ATOM   2227 C C   . GLY A 1 305 ? -42.733 12.743  12.565  1.00 49.73  ? 305 GLY A C   1 
ATOM   2228 O O   . GLY A 1 305 ? -42.654 12.687  13.789  1.00 53.34  ? 305 GLY A O   1 
ATOM   2229 N N   . ASP A 1 306 ? -41.844 12.183  11.750  1.00 47.67  ? 306 ASP A N   1 
ATOM   2230 C CA  . ASP A 1 306 ? -40.859 11.241  12.194  1.00 41.87  ? 306 ASP A CA  1 
ATOM   2231 C C   . ASP A 1 306 ? -39.435 11.896  12.203  1.00 43.78  ? 306 ASP A C   1 
ATOM   2232 O O   . ASP A 1 306 ? -39.064 12.483  13.232  1.00 45.06  ? 306 ASP A O   1 
ATOM   2233 C CB  . ASP A 1 306 ? -41.070 9.973   11.364  1.00 40.97  ? 306 ASP A CB  1 
ATOM   2234 C CG  . ASP A 1 306 ? -39.966 8.936   11.506  1.00 44.26  ? 306 ASP A CG  1 
ATOM   2235 O OD1 . ASP A 1 306 ? -39.103 8.987   12.438  1.00 44.82  ? 306 ASP A OD1 1 
ATOM   2236 O OD2 . ASP A 1 306 ? -39.985 8.049   10.615  1.00 41.48  ? 306 ASP A OD2 1 
ATOM   2237 N N   . PHE A 1 307 ? -38.646 11.857  11.118  1.00 42.84  ? 307 PHE A N   1 
ATOM   2238 C CA  . PHE A 1 307 ? -37.347 12.553  11.173  1.00 36.78  ? 307 PHE A CA  1 
ATOM   2239 C C   . PHE A 1 307 ? -37.520 14.036  11.613  1.00 37.39  ? 307 PHE A C   1 
ATOM   2240 O O   . PHE A 1 307 ? -36.664 14.588  12.320  1.00 37.13  ? 307 PHE A O   1 
ATOM   2241 C CB  . PHE A 1 307 ? -36.596 12.468  9.856   1.00 29.04  ? 307 PHE A CB  1 
ATOM   2242 C CG  . PHE A 1 307 ? -35.200 13.013  9.931   1.00 25.10  ? 307 PHE A CG  1 
ATOM   2243 C CD1 . PHE A 1 307 ? -34.948 14.384  9.910   1.00 25.38  ? 307 PHE A CD1 1 
ATOM   2244 C CD2 . PHE A 1 307 ? -34.115 12.164  10.022  1.00 25.80  ? 307 PHE A CD2 1 
ATOM   2245 C CE1 . PHE A 1 307 ? -33.635 14.899  9.968   1.00 23.71  ? 307 PHE A CE1 1 
ATOM   2246 C CE2 . PHE A 1 307 ? -32.797 12.667  10.085  1.00 25.61  ? 307 PHE A CE2 1 
ATOM   2247 C CZ  . PHE A 1 307 ? -32.556 14.036  10.060  1.00 22.90  ? 307 PHE A CZ  1 
ATOM   2248 N N   . LEU A 1 308 ? -38.617 14.664  11.180  1.00 36.00  ? 308 LEU A N   1 
ATOM   2249 C CA  . LEU A 1 308 ? -39.023 15.991  11.656  1.00 34.86  ? 308 LEU A CA  1 
ATOM   2250 C C   . LEU A 1 308 ? -40.434 15.861  12.213  1.00 36.10  ? 308 LEU A C   1 
ATOM   2251 O O   . LEU A 1 308 ? -41.375 15.518  11.455  1.00 34.21  ? 308 LEU A O   1 
ATOM   2252 C CB  . LEU A 1 308 ? -39.061 16.978  10.487  1.00 33.19  ? 308 LEU A CB  1 
ATOM   2253 C CG  . LEU A 1 308 ? -37.765 17.223  9.714   1.00 31.83  ? 308 LEU A CG  1 
ATOM   2254 C CD1 . LEU A 1 308 ? -37.994 17.585  8.234   1.00 29.36  ? 308 LEU A CD1 1 
ATOM   2255 C CD2 . LEU A 1 308 ? -36.929 18.269  10.449  1.00 28.23  ? 308 LEU A CD2 1 
ATOM   2256 N N   . SER A 1 309 ? -40.575 16.139  13.514  1.00 35.57  ? 309 SER A N   1 
ATOM   2257 C CA  . SER A 1 309 ? -41.861 16.037  14.222  1.00 33.42  ? 309 SER A CA  1 
ATOM   2258 C C   . SER A 1 309 ? -42.879 17.134  13.872  1.00 37.33  ? 309 SER A C   1 
ATOM   2259 O O   . SER A 1 309 ? -44.071 17.008  14.226  1.00 37.34  ? 309 SER A O   1 
ATOM   2260 C CB  . SER A 1 309 ? -41.668 15.959  15.734  1.00 31.02  ? 309 SER A CB  1 
ATOM   2261 O OG  . SER A 1 309 ? -40.973 17.068  16.225  1.00 29.70  ? 309 SER A OG  1 
ATOM   2262 N N   . ASP A 1 310 ? -42.432 18.157  13.127  1.00 38.23  ? 310 ASP A N   1 
ATOM   2263 C CA  . ASP A 1 310 ? -43.269 19.311  12.716  1.00 40.22  ? 310 ASP A CA  1 
ATOM   2264 C C   . ASP A 1 310 ? -42.491 20.053  11.638  1.00 34.76  ? 310 ASP A C   1 
ATOM   2265 O O   . ASP A 1 310 ? -41.371 19.696  11.413  1.00 37.92  ? 310 ASP A O   1 
ATOM   2266 C CB  . ASP A 1 310 ? -43.477 20.245  13.933  1.00 46.72  ? 310 ASP A CB  1 
ATOM   2267 C CG  . ASP A 1 310 ? -44.784 21.015  13.882  1.00 48.15  ? 310 ASP A CG  1 
ATOM   2268 O OD1 . ASP A 1 310 ? -45.171 21.469  12.790  1.00 54.66  ? 310 ASP A OD1 1 
ATOM   2269 O OD2 . ASP A 1 310 ? -45.420 21.175  14.938  1.00 46.06  ? 310 ASP A OD2 1 
ATOM   2270 N N   . THR A 1 311 ? -43.026 21.104  11.017  1.00 30.81  ? 311 THR A N   1 
ATOM   2271 C CA  . THR A 1 311 ? -42.281 21.838  9.980   1.00 29.74  ? 311 THR A CA  1 
ATOM   2272 C C   . THR A 1 311 ? -40.972 22.471  10.483  1.00 31.33  ? 311 THR A C   1 
ATOM   2273 O O   . THR A 1 311 ? -40.869 22.823  11.648  1.00 36.06  ? 311 THR A O   1 
ATOM   2274 C CB  . THR A 1 311 ? -43.056 23.040  9.445   1.00 29.61  ? 311 THR A CB  1 
ATOM   2275 O OG1 . THR A 1 311 ? -43.235 23.950  10.536  1.00 29.44  ? 311 THR A OG1 1 
ATOM   2276 C CG2 . THR A 1 311 ? -44.402 22.641  8.719   1.00 24.54  ? 311 THR A CG2 1 
ATOM   2277 N N   . PRO A 1 312 ? -39.966 22.643  9.599   1.00 30.12  ? 312 PRO A N   1 
ATOM   2278 C CA  . PRO A 1 312 ? -38.751 23.311  10.069  1.00 28.00  ? 312 PRO A CA  1 
ATOM   2279 C C   . PRO A 1 312 ? -39.076 24.620  10.764  1.00 29.01  ? 312 PRO A C   1 
ATOM   2280 O O   . PRO A 1 312 ? -38.477 24.929  11.791  1.00 29.25  ? 312 PRO A O   1 
ATOM   2281 C CB  . PRO A 1 312 ? -37.979 23.576  8.778   1.00 25.59  ? 312 PRO A CB  1 
ATOM   2282 C CG  . PRO A 1 312 ? -38.359 22.425  7.927   1.00 27.46  ? 312 PRO A CG  1 
ATOM   2283 C CD  . PRO A 1 312 ? -39.792 22.089  8.241   1.00 27.64  ? 312 PRO A CD  1 
ATOM   2284 N N   . GLU A 1 313 ? -40.035 25.373  10.217  1.00 33.78  ? 313 GLU A N   1 
ATOM   2285 C CA  . GLU A 1 313 ? -40.443 26.671  10.797  1.00 34.36  ? 313 GLU A CA  1 
ATOM   2286 C C   . GLU A 1 313 ? -40.986 26.536  12.238  1.00 32.38  ? 313 GLU A C   1 
ATOM   2287 O O   . GLU A 1 313 ? -40.430 27.169  13.165  1.00 31.60  ? 313 GLU A O   1 
ATOM   2288 C CB  . GLU A 1 313 ? -41.452 27.331  9.918   1.00 36.91  ? 313 GLU A CB  1 
ATOM   2289 C CG  . GLU A 1 313 ? -41.966 28.600  10.518  1.00 50.11  ? 313 GLU A CG  1 
ATOM   2290 C CD  . GLU A 1 313 ? -42.699 29.415  9.488   1.00 60.27  ? 313 GLU A CD  1 
ATOM   2291 O OE1 . GLU A 1 313 ? -42.030 29.686  8.441   1.00 66.98  ? 313 GLU A OE1 1 
ATOM   2292 O OE2 . GLU A 1 313 ? -43.910 29.739  9.726   1.00 49.32  ? 313 GLU A OE2 1 
ATOM   2293 N N   . ALA A 1 314 ? -42.003 25.677  12.415  1.00 26.95  ? 314 ALA A N   1 
ATOM   2294 C CA  . ALA A 1 314 ? -42.486 25.279  13.729  1.00 28.17  ? 314 ALA A CA  1 
ATOM   2295 C C   . ALA A 1 314 ? -41.326 24.949  14.717  1.00 31.99  ? 314 ALA A C   1 
ATOM   2296 O O   . ALA A 1 314 ? -41.291 25.500  15.842  1.00 36.79  ? 314 ALA A O   1 
ATOM   2297 C CB  . ALA A 1 314 ? -43.480 24.120  13.620  1.00 25.59  ? 314 ALA A CB  1 
ATOM   2298 N N   . LEU A 1 315 ? -40.370 24.102  14.298  1.00 29.88  ? 315 LEU A N   1 
ATOM   2299 C CA  . LEU A 1 315 ? -39.358 23.594  15.224  1.00 29.74  ? 315 LEU A CA  1 
ATOM   2300 C C   . LEU A 1 315 ? -38.356 24.643  15.582  1.00 29.12  ? 315 LEU A C   1 
ATOM   2301 O O   . LEU A 1 315 ? -37.888 24.677  16.720  1.00 30.99  ? 315 LEU A O   1 
ATOM   2302 C CB  . LEU A 1 315 ? -38.669 22.315  14.733  1.00 28.93  ? 315 LEU A CB  1 
ATOM   2303 C CG  . LEU A 1 315 ? -39.570 21.044  14.602  1.00 29.79  ? 315 LEU A CG  1 
ATOM   2304 C CD1 . LEU A 1 315 ? -38.995 19.984  13.630  1.00 28.48  ? 315 LEU A CD1 1 
ATOM   2305 C CD2 . LEU A 1 315 ? -40.041 20.414  15.928  1.00 24.24  ? 315 LEU A CD2 1 
ATOM   2306 N N   . ILE A 1 316 ? -38.067 25.518  14.631  1.00 27.04  ? 316 ILE A N   1 
ATOM   2307 C CA  . ILE A 1 316 ? -37.174 26.639  14.882  1.00 27.84  ? 316 ILE A CA  1 
ATOM   2308 C C   . ILE A 1 316 ? -37.777 27.533  15.943  1.00 32.04  ? 316 ILE A C   1 
ATOM   2309 O O   . ILE A 1 316 ? -37.090 27.962  16.889  1.00 35.10  ? 316 ILE A O   1 
ATOM   2310 C CB  . ILE A 1 316 ? -36.916 27.446  13.596  1.00 26.29  ? 316 ILE A CB  1 
ATOM   2311 C CG1 . ILE A 1 316 ? -36.196 26.539  12.588  1.00 26.68  ? 316 ILE A CG1 1 
ATOM   2312 C CG2 . ILE A 1 316 ? -36.075 28.687  13.876  1.00 24.27  ? 316 ILE A CG2 1 
ATOM   2313 C CD1 . ILE A 1 316 ? -36.005 27.098  11.205  1.00 24.91  ? 316 ILE A CD1 1 
ATOM   2314 N N   . ASN A 1 317 ? -39.077 27.796  15.794  1.00 33.75  ? 317 ASN A N   1 
ATOM   2315 C CA  . ASN A 1 317 ? -39.765 28.729  16.674  1.00 30.55  ? 317 ASN A CA  1 
ATOM   2316 C C   . ASN A 1 317 ? -39.838 28.174  18.079  1.00 31.41  ? 317 ASN A C   1 
ATOM   2317 O O   . ASN A 1 317 ? -39.351 28.822  18.990  1.00 34.64  ? 317 ASN A O   1 
ATOM   2318 C CB  . ASN A 1 317 ? -41.083 29.208  16.064  1.00 28.97  ? 317 ASN A CB  1 
ATOM   2319 C CG  . ASN A 1 317 ? -40.855 30.055  14.782  1.00 30.40  ? 317 ASN A CG  1 
ATOM   2320 O OD1 . ASN A 1 317 ? -39.793 30.710  14.590  1.00 29.70  ? 317 ASN A OD1 1 
ATOM   2321 N ND2 . ASN A 1 317 ? -41.819 29.994  13.870  1.00 27.70  ? 317 ASN A ND2 1 
ATOM   2322 N N   . ALA A 1 318 ? -40.274 26.925  18.226  1.00 29.83  ? 318 ALA A N   1 
ATOM   2323 C CA  . ALA A 1 318 ? -40.311 26.249  19.537  1.00 30.51  ? 318 ALA A CA  1 
ATOM   2324 C C   . ALA A 1 318 ? -38.943 25.998  20.215  1.00 32.29  ? 318 ALA A C   1 
ATOM   2325 O O   . ALA A 1 318 ? -38.893 25.718  21.389  1.00 34.90  ? 318 ALA A O   1 
ATOM   2326 C CB  . ALA A 1 318 ? -41.115 24.923  19.456  1.00 26.38  ? 318 ALA A CB  1 
ATOM   2327 N N   . GLY A 1 319 ? -37.836 26.070  19.497  1.00 34.22  ? 319 GLY A N   1 
ATOM   2328 C CA  . GLY A 1 319 ? -36.660 25.365  19.958  1.00 33.78  ? 319 GLY A CA  1 
ATOM   2329 C C   . GLY A 1 319 ? -35.852 26.128  20.976  1.00 38.17  ? 319 GLY A C   1 
ATOM   2330 O O   . GLY A 1 319 ? -35.897 27.370  21.012  1.00 44.86  ? 319 GLY A O   1 
ATOM   2331 N N   . ASP A 1 320 ? -35.090 25.387  21.783  1.00 35.41  ? 320 ASP A N   1 
ATOM   2332 C CA  . ASP A 1 320 ? -34.115 25.970  22.695  1.00 35.82  ? 320 ASP A CA  1 
ATOM   2333 C C   . ASP A 1 320 ? -32.648 25.792  22.218  1.00 35.20  ? 320 ASP A C   1 
ATOM   2334 O O   . ASP A 1 320 ? -32.143 24.684  22.071  1.00 35.28  ? 320 ASP A O   1 
ATOM   2335 C CB  . ASP A 1 320 ? -34.324 25.323  24.059  1.00 37.21  ? 320 ASP A CB  1 
ATOM   2336 C CG  . ASP A 1 320 ? -33.523 25.987  25.182  1.00 41.84  ? 320 ASP A CG  1 
ATOM   2337 O OD1 . ASP A 1 320 ? -32.552 26.786  24.967  1.00 40.74  ? 320 ASP A OD1 1 
ATOM   2338 O OD2 . ASP A 1 320 ? -33.888 25.648  26.321  1.00 43.50  ? 320 ASP A OD2 1 
ATOM   2339 N N   . PHE A 1 321 ? -31.941 26.876  22.000  1.00 32.40  ? 321 PHE A N   1 
ATOM   2340 C CA  . PHE A 1 321 ? -30.639 26.724  21.392  1.00 31.30  ? 321 PHE A CA  1 
ATOM   2341 C C   . PHE A 1 321 ? -29.538 27.203  22.285  1.00 33.18  ? 321 PHE A C   1 
ATOM   2342 O O   . PHE A 1 321 ? -28.461 27.578  21.811  1.00 31.37  ? 321 PHE A O   1 
ATOM   2343 C CB  . PHE A 1 321 ? -30.605 27.433  20.024  1.00 32.56  ? 321 PHE A CB  1 
ATOM   2344 C CG  . PHE A 1 321 ? -31.612 26.885  19.057  1.00 32.88  ? 321 PHE A CG  1 
ATOM   2345 C CD1 . PHE A 1 321 ? -31.486 25.589  18.557  1.00 33.78  ? 321 PHE A CD1 1 
ATOM   2346 C CD2 . PHE A 1 321 ? -32.713 27.633  18.674  1.00 34.74  ? 321 PHE A CD2 1 
ATOM   2347 C CE1 . PHE A 1 321 ? -32.438 25.063  17.680  1.00 33.93  ? 321 PHE A CE1 1 
ATOM   2348 C CE2 . PHE A 1 321 ? -33.674 27.113  17.802  1.00 35.40  ? 321 PHE A CE2 1 
ATOM   2349 C CZ  . PHE A 1 321 ? -33.538 25.826  17.304  1.00 35.12  ? 321 PHE A CZ  1 
ATOM   2350 N N   . HIS A 1 322 ? -29.789 27.154  23.589  1.00 37.91  ? 322 HIS A N   1 
ATOM   2351 C CA  . HIS A 1 322 ? -28.732 27.470  24.551  1.00 40.61  ? 322 HIS A CA  1 
ATOM   2352 C C   . HIS A 1 322 ? -27.469 26.561  24.375  1.00 39.19  ? 322 HIS A C   1 
ATOM   2353 O O   . HIS A 1 322 ? -27.571 25.384  24.067  1.00 33.27  ? 322 HIS A O   1 
ATOM   2354 C CB  . HIS A 1 322 ? -29.292 27.578  25.991  1.00 42.94  ? 322 HIS A CB  1 
ATOM   2355 C CG  . HIS A 1 322 ? -29.956 28.902  26.255  1.00 47.39  ? 322 HIS A CG  1 
ATOM   2356 N ND1 . HIS A 1 322 ? -31.325 29.100  26.112  1.00 49.84  ? 322 HIS A ND1 1 
ATOM   2357 C CD2 . HIS A 1 322 ? -29.429 30.116  26.562  1.00 43.14  ? 322 HIS A CD2 1 
ATOM   2358 C CE1 . HIS A 1 322 ? -31.615 30.372  26.339  1.00 45.66  ? 322 HIS A CE1 1 
ATOM   2359 N NE2 . HIS A 1 322 ? -30.483 31.011  26.608  1.00 46.31  ? 322 HIS A NE2 1 
ATOM   2360 N N   . GLY A 1 323 ? -26.279 27.144  24.478  1.00 39.54  ? 323 GLY A N   1 
ATOM   2361 C CA  . GLY A 1 323 ? -25.062 26.356  24.349  1.00 40.29  ? 323 GLY A CA  1 
ATOM   2362 C C   . GLY A 1 323 ? -24.860 25.691  23.002  1.00 42.10  ? 323 GLY A C   1 
ATOM   2363 O O   . GLY A 1 323 ? -24.636 24.508  22.921  1.00 48.84  ? 323 GLY A O   1 
ATOM   2364 N N   . LEU A 1 324 ? -24.908 26.479  21.943  1.00 43.57  ? 324 LEU A N   1 
ATOM   2365 C CA  . LEU A 1 324 ? -24.798 26.004  20.582  1.00 36.82  ? 324 LEU A CA  1 
ATOM   2366 C C   . LEU A 1 324 ? -24.211 27.178  19.779  1.00 34.60  ? 324 LEU A C   1 
ATOM   2367 O O   . LEU A 1 324 ? -24.688 28.303  19.869  1.00 33.89  ? 324 LEU A O   1 
ATOM   2368 C CB  . LEU A 1 324 ? -26.201 25.579  20.099  1.00 36.99  ? 324 LEU A CB  1 
ATOM   2369 C CG  . LEU A 1 324 ? -26.512 25.103  18.651  1.00 36.89  ? 324 LEU A CG  1 
ATOM   2370 C CD1 . LEU A 1 324 ? -27.600 25.877  17.918  1.00 33.41  ? 324 LEU A CD1 1 
ATOM   2371 C CD2 . LEU A 1 324 ? -25.273 24.988  17.774  1.00 37.16  ? 324 LEU A CD2 1 
ATOM   2372 N N   . GLN A 1 325 ? -23.133 26.952  19.046  1.00 34.31  ? 325 GLN A N   1 
ATOM   2373 C CA  . GLN A 1 325 ? -22.595 28.045  18.215  1.00 33.38  ? 325 GLN A CA  1 
ATOM   2374 C C   . GLN A 1 325 ? -22.879 27.762  16.736  1.00 32.45  ? 325 GLN A C   1 
ATOM   2375 O O   . GLN A 1 325 ? -22.937 26.608  16.319  1.00 33.83  ? 325 GLN A O   1 
ATOM   2376 C CB  . GLN A 1 325 ? -21.104 28.302  18.465  1.00 33.16  ? 325 GLN A CB  1 
ATOM   2377 C CG  . GLN A 1 325 ? -20.725 28.533  19.919  1.00 33.69  ? 325 GLN A CG  1 
ATOM   2378 C CD  . GLN A 1 325 ? -20.579 27.220  20.630  1.00 34.40  ? 325 GLN A CD  1 
ATOM   2379 O OE1 . GLN A 1 325 ? -19.615 26.515  20.423  1.00 40.89  ? 325 GLN A OE1 1 
ATOM   2380 N NE2 . GLN A 1 325 ? -21.561 26.858  21.426  1.00 37.35  ? 325 GLN A NE2 1 
ATOM   2381 N N   . VAL A 1 326 ? -23.127 28.804  15.957  1.00 29.25  ? 326 VAL A N   1 
ATOM   2382 C CA  . VAL A 1 326 ? -23.530 28.627  14.566  1.00 27.28  ? 326 VAL A CA  1 
ATOM   2383 C C   . VAL A 1 326 ? -22.907 29.693  13.685  1.00 27.59  ? 326 VAL A C   1 
ATOM   2384 O O   . VAL A 1 326 ? -22.875 30.855  14.055  1.00 30.64  ? 326 VAL A O   1 
ATOM   2385 C CB  . VAL A 1 326 ? -25.039 28.723  14.374  1.00 25.71  ? 326 VAL A CB  1 
ATOM   2386 C CG1 . VAL A 1 326 ? -25.338 28.515  12.903  1.00 26.07  ? 326 VAL A CG1 1 
ATOM   2387 C CG2 . VAL A 1 326 ? -25.788 27.676  15.214  1.00 25.70  ? 326 VAL A CG2 1 
ATOM   2388 N N   . LEU A 1 327 ? -22.408 29.307  12.524  1.00 25.87  ? 327 LEU A N   1 
ATOM   2389 C CA  . LEU A 1 327 ? -21.894 30.262  11.581  1.00 23.00  ? 327 LEU A CA  1 
ATOM   2390 C C   . LEU A 1 327 ? -22.852 30.145  10.406  1.00 22.70  ? 327 LEU A C   1 
ATOM   2391 O O   . LEU A 1 327 ? -23.123 29.033  9.964   1.00 23.86  ? 327 LEU A O   1 
ATOM   2392 C CB  . LEU A 1 327 ? -20.501 29.814  11.199  1.00 24.06  ? 327 LEU A CB  1 
ATOM   2393 C CG  . LEU A 1 327 ? -19.866 30.826  10.283  1.00 26.13  ? 327 LEU A CG  1 
ATOM   2394 C CD1 . LEU A 1 327 ? -19.920 32.069  11.077  1.00 29.72  ? 327 LEU A CD1 1 
ATOM   2395 C CD2 . LEU A 1 327 ? -18.399 30.585  9.987   1.00 27.22  ? 327 LEU A CD2 1 
ATOM   2396 N N   . VAL A 1 328 ? -23.410 31.250  9.912   1.00 21.30  ? 328 VAL A N   1 
ATOM   2397 C CA  . VAL A 1 328 ? -24.322 31.233  8.731   1.00 19.82  ? 328 VAL A CA  1 
ATOM   2398 C C   . VAL A 1 328 ? -23.897 32.302  7.745   1.00 21.87  ? 328 VAL A C   1 
ATOM   2399 O O   . VAL A 1 328 ? -23.207 33.255  8.116   1.00 25.47  ? 328 VAL A O   1 
ATOM   2400 C CB  . VAL A 1 328 ? -25.767 31.504  9.111   1.00 18.22  ? 328 VAL A CB  1 
ATOM   2401 C CG1 . VAL A 1 328 ? -26.272 30.427  10.043  1.00 16.69  ? 328 VAL A CG1 1 
ATOM   2402 C CG2 . VAL A 1 328 ? -25.857 32.850  9.780   1.00 18.38  ? 328 VAL A CG2 1 
ATOM   2403 N N   . GLY A 1 329 ? -24.237 32.171  6.470   1.00 23.02  ? 329 GLY A N   1 
ATOM   2404 C CA  . GLY A 1 329 ? -23.819 33.252  5.529   1.00 22.47  ? 329 GLY A CA  1 
ATOM   2405 C C   . GLY A 1 329 ? -24.363 33.014  4.143   1.00 21.84  ? 329 GLY A C   1 
ATOM   2406 O O   . GLY A 1 329 ? -25.022 31.991  3.906   1.00 22.37  ? 329 GLY A O   1 
ATOM   2407 N N   . VAL A 1 330 ? -24.044 33.912  3.218   1.00 19.12  ? 330 VAL A N   1 
ATOM   2408 C CA  . VAL A 1 330 ? -24.618 33.853  1.876   1.00 18.93  ? 330 VAL A CA  1 
ATOM   2409 C C   . VAL A 1 330 ? -23.603 34.469  0.924   1.00 20.23  ? 330 VAL A C   1 
ATOM   2410 O O   . VAL A 1 330 ? -22.622 35.051  1.396   1.00 21.75  ? 330 VAL A O   1 
ATOM   2411 C CB  . VAL A 1 330 ? -25.957 34.632  1.797   1.00 18.42  ? 330 VAL A CB  1 
ATOM   2412 C CG1 . VAL A 1 330 ? -27.027 33.949  2.667   1.00 17.57  ? 330 VAL A CG1 1 
ATOM   2413 C CG2 . VAL A 1 330 ? -25.758 36.129  2.128   1.00 15.86  ? 330 VAL A CG2 1 
ATOM   2414 N N   . VAL A 1 331 ? -23.788 34.307  -0.393  1.00 20.43  ? 331 VAL A N   1 
ATOM   2415 C CA  . VAL A 1 331 ? -22.912 34.956  -1.377  1.00 20.82  ? 331 VAL A CA  1 
ATOM   2416 C C   . VAL A 1 331 ? -23.582 36.222  -1.905  1.00 22.78  ? 331 VAL A C   1 
ATOM   2417 O O   . VAL A 1 331 ? -24.774 36.429  -1.750  1.00 24.53  ? 331 VAL A O   1 
ATOM   2418 C CB  . VAL A 1 331 ? -22.589 34.048  -2.599  1.00 20.03  ? 331 VAL A CB  1 
ATOM   2419 C CG1 . VAL A 1 331 ? -21.725 32.868  -2.234  1.00 19.89  ? 331 VAL A CG1 1 
ATOM   2420 C CG2 . VAL A 1 331 ? -23.846 33.529  -3.240  1.00 19.80  ? 331 VAL A CG2 1 
ATOM   2421 N N   . LYS A 1 332 ? -22.832 37.052  -2.600  1.00 25.46  ? 332 LYS A N   1 
ATOM   2422 C CA  . LYS A 1 332 ? -23.374 38.309  -3.057  1.00 27.42  ? 332 LYS A CA  1 
ATOM   2423 C C   . LYS A 1 332 ? -24.617 38.174  -3.942  1.00 29.75  ? 332 LYS A C   1 
ATOM   2424 O O   . LYS A 1 332 ? -25.582 38.880  -3.753  1.00 36.41  ? 332 LYS A O   1 
ATOM   2425 C CB  . LYS A 1 332 ? -22.307 39.084  -3.775  1.00 27.05  ? 332 LYS A CB  1 
ATOM   2426 C CG  . LYS A 1 332 ? -22.563 40.538  -3.563  1.00 29.51  ? 332 LYS A CG  1 
ATOM   2427 C CD  . LYS A 1 332 ? -21.495 41.409  -4.194  1.00 32.21  ? 332 LYS A CD  1 
ATOM   2428 C CE  . LYS A 1 332 ? -22.027 42.813  -4.274  1.00 32.96  ? 332 LYS A CE  1 
ATOM   2429 N NZ  . LYS A 1 332 ? -21.768 43.100  -5.689  1.00 41.22  ? 332 LYS A NZ  1 
ATOM   2430 N N   . ASP A 1 333 ? -24.594 37.230  -4.869  1.00 28.32  ? 333 ASP A N   1 
ATOM   2431 C CA  . ASP A 1 333 ? -25.590 37.116  -5.905  1.00 26.34  ? 333 ASP A CA  1 
ATOM   2432 C C   . ASP A 1 333 ? -26.225 35.702  -5.926  1.00 24.79  ? 333 ASP A C   1 
ATOM   2433 O O   . ASP A 1 333 ? -26.002 34.932  -6.867  1.00 23.63  ? 333 ASP A O   1 
ATOM   2434 C CB  . ASP A 1 333 ? -24.936 37.439  -7.245  1.00 27.26  ? 333 ASP A CB  1 
ATOM   2435 C CG  . ASP A 1 333 ? -24.468 38.870  -7.334  1.00 29.15  ? 333 ASP A CG  1 
ATOM   2436 O OD1 . ASP A 1 333 ? -25.317 39.742  -7.542  1.00 32.26  ? 333 ASP A OD1 1 
ATOM   2437 O OD2 . ASP A 1 333 ? -23.253 39.145  -7.236  1.00 34.11  ? 333 ASP A OD2 1 
ATOM   2438 N N   . GLU A 1 334 ? -27.029 35.381  -4.903  1.00 22.01  ? 334 GLU A N   1 
ATOM   2439 C CA  . GLU A 1 334 ? -27.533 34.047  -4.746  1.00 20.68  ? 334 GLU A CA  1 
ATOM   2440 C C   . GLU A 1 334 ? -28.374 33.572  -5.905  1.00 22.10  ? 334 GLU A C   1 
ATOM   2441 O O   . GLU A 1 334 ? -28.307 32.404  -6.309  1.00 21.00  ? 334 GLU A O   1 
ATOM   2442 C CB  . GLU A 1 334 ? -28.357 33.930  -3.494  1.00 21.27  ? 334 GLU A CB  1 
ATOM   2443 C CG  . GLU A 1 334 ? -27.579 34.026  -2.197  1.00 23.81  ? 334 GLU A CG  1 
ATOM   2444 C CD  . GLU A 1 334 ? -26.787 32.772  -1.850  1.00 25.39  ? 334 GLU A CD  1 
ATOM   2445 O OE1 . GLU A 1 334 ? -27.010 31.735  -2.541  1.00 27.14  ? 334 GLU A OE1 1 
ATOM   2446 O OE2 . GLU A 1 334 ? -25.940 32.825  -0.895  1.00 24.76  ? 334 GLU A OE2 1 
ATOM   2447 N N   . GLY A 1 335 ? -29.194 34.470  -6.436  1.00 24.09  ? 335 GLY A N   1 
ATOM   2448 C CA  . GLY A 1 335 ? -30.227 34.066  -7.394  1.00 21.91  ? 335 GLY A CA  1 
ATOM   2449 C C   . GLY A 1 335 ? -29.716 33.984  -8.807  1.00 21.63  ? 335 GLY A C   1 
ATOM   2450 O O   . GLY A 1 335 ? -30.355 33.365  -9.632  1.00 23.28  ? 335 GLY A O   1 
ATOM   2451 N N   . SER A 1 336 ? -28.547 34.544  -9.096  1.00 21.04  ? 336 SER A N   1 
ATOM   2452 C CA  . SER A 1 336 ? -28.211 34.788  -10.486 1.00 23.42  ? 336 SER A CA  1 
ATOM   2453 C C   . SER A 1 336 ? -28.115 33.571  -11.382 1.00 26.87  ? 336 SER A C   1 
ATOM   2454 O O   . SER A 1 336 ? -28.645 33.585  -12.475 1.00 30.85  ? 336 SER A O   1 
ATOM   2455 C CB  . SER A 1 336 ? -26.971 35.662  -10.670 1.00 23.88  ? 336 SER A CB  1 
ATOM   2456 O OG  . SER A 1 336 ? -25.885 35.216  -9.896  1.00 25.60  ? 336 SER A OG  1 
ATOM   2457 N N   . TYR A 1 337 ? -27.472 32.499  -10.954 1.00 28.52  ? 337 TYR A N   1 
ATOM   2458 C CA  . TYR A 1 337 ? -27.238 31.455  -11.910 1.00 28.36  ? 337 TYR A CA  1 
ATOM   2459 C C   . TYR A 1 337 ? -28.539 30.679  -12.158 1.00 27.40  ? 337 TYR A C   1 
ATOM   2460 O O   . TYR A 1 337 ? -28.807 30.256  -13.263 1.00 32.89  ? 337 TYR A O   1 
ATOM   2461 C CB  . TYR A 1 337 ? -26.053 30.587  -11.478 1.00 34.04  ? 337 TYR A CB  1 
ATOM   2462 C CG  . TYR A 1 337 ? -26.454 29.214  -11.047 1.00 33.93  ? 337 TYR A CG  1 
ATOM   2463 C CD1 . TYR A 1 337 ? -26.874 28.999  -9.766  1.00 35.82  ? 337 TYR A CD1 1 
ATOM   2464 C CD2 . TYR A 1 337 ? -26.443 28.145  -11.954 1.00 33.06  ? 337 TYR A CD2 1 
ATOM   2465 C CE1 . TYR A 1 337 ? -27.276 27.756  -9.381  1.00 38.03  ? 337 TYR A CE1 1 
ATOM   2466 C CE2 . TYR A 1 337 ? -26.834 26.906  -11.586 1.00 35.45  ? 337 TYR A CE2 1 
ATOM   2467 C CZ  . TYR A 1 337 ? -27.257 26.743  -10.296 1.00 38.14  ? 337 TYR A CZ  1 
ATOM   2468 O OH  . TYR A 1 337 ? -27.692 25.550  -9.870  1.00 47.94  ? 337 TYR A OH  1 
ATOM   2469 N N   . PHE A 1 338 ? -29.399 30.542  -11.181 1.00 24.26  ? 338 PHE A N   1 
ATOM   2470 C CA  . PHE A 1 338 ? -30.707 29.960  -11.485 1.00 22.96  ? 338 PHE A CA  1 
ATOM   2471 C C   . PHE A 1 338 ? -31.548 30.509  -12.628 1.00 23.78  ? 338 PHE A C   1 
ATOM   2472 O O   . PHE A 1 338 ? -32.512 29.831  -13.058 1.00 24.37  ? 338 PHE A O   1 
ATOM   2473 C CB  . PHE A 1 338 ? -31.556 30.090  -10.276 1.00 21.96  ? 338 PHE A CB  1 
ATOM   2474 C CG  . PHE A 1 338 ? -30.978 29.410  -9.136  1.00 22.08  ? 338 PHE A CG  1 
ATOM   2475 C CD1 . PHE A 1 338 ? -31.167 28.044  -8.992  1.00 19.80  ? 338 PHE A CD1 1 
ATOM   2476 C CD2 . PHE A 1 338 ? -30.145 30.113  -8.253  1.00 22.59  ? 338 PHE A CD2 1 
ATOM   2477 C CE1 . PHE A 1 338 ? -30.565 27.376  -7.961  1.00 20.76  ? 338 PHE A CE1 1 
ATOM   2478 C CE2 . PHE A 1 338 ? -29.558 29.445  -7.185  1.00 23.16  ? 338 PHE A CE2 1 
ATOM   2479 C CZ  . PHE A 1 338 ? -29.762 28.071  -7.044  1.00 21.90  ? 338 PHE A CZ  1 
ATOM   2480 N N   . LEU A 1 339 ? -31.254 31.737  -13.065 1.00 21.52  ? 339 LEU A N   1 
ATOM   2481 C CA  . LEU A 1 339 ? -32.111 32.387  -14.018 1.00 20.63  ? 339 LEU A CA  1 
ATOM   2482 C C   . LEU A 1 339 ? -32.029 31.782  -15.394 1.00 21.88  ? 339 LEU A C   1 
ATOM   2483 O O   . LEU A 1 339 ? -33.033 31.777  -16.115 1.00 25.36  ? 339 LEU A O   1 
ATOM   2484 C CB  . LEU A 1 339 ? -31.811 33.866  -14.109 1.00 19.57  ? 339 LEU A CB  1 
ATOM   2485 C CG  . LEU A 1 339 ? -32.053 34.568  -12.788 1.00 18.47  ? 339 LEU A CG  1 
ATOM   2486 C CD1 . LEU A 1 339 ? -31.798 36.072  -12.932 1.00 16.30  ? 339 LEU A CD1 1 
ATOM   2487 C CD2 . LEU A 1 339 ? -33.446 34.214  -12.273 1.00 17.17  ? 339 LEU A CD2 1 
ATOM   2488 N N   . VAL A 1 340 ? -30.859 31.289  -15.793 1.00 21.77  ? 340 VAL A N   1 
ATOM   2489 C CA  . VAL A 1 340 ? -30.724 30.673  -17.142 1.00 21.63  ? 340 VAL A CA  1 
ATOM   2490 C C   . VAL A 1 340 ? -31.275 29.237  -17.132 1.00 22.44  ? 340 VAL A C   1 
ATOM   2491 O O   . VAL A 1 340 ? -30.987 28.438  -18.011 1.00 22.58  ? 340 VAL A O   1 
ATOM   2492 C CB  . VAL A 1 340 ? -29.259 30.610  -17.618 1.00 19.83  ? 340 VAL A CB  1 
ATOM   2493 C CG1 . VAL A 1 340 ? -28.766 31.996  -17.884 1.00 20.09  ? 340 VAL A CG1 1 
ATOM   2494 C CG2 . VAL A 1 340 ? -28.368 29.945  -16.587 1.00 18.30  ? 340 VAL A CG2 1 
ATOM   2495 N N   . TYR A 1 341 ? -32.003 28.882  -16.089 1.00 21.99  ? 341 TYR A N   1 
ATOM   2496 C CA  . TYR A 1 341 ? -32.655 27.609  -16.072 1.00 22.43  ? 341 TYR A CA  1 
ATOM   2497 C C   . TYR A 1 341 ? -34.153 27.718  -16.225 1.00 24.15  ? 341 TYR A C   1 
ATOM   2498 O O   . TYR A 1 341 ? -34.882 26.890  -15.716 1.00 23.14  ? 341 TYR A O   1 
ATOM   2499 C CB  . TYR A 1 341 ? -32.290 26.884  -14.811 1.00 23.03  ? 341 TYR A CB  1 
ATOM   2500 C CG  . TYR A 1 341 ? -30.895 26.321  -14.918 1.00 25.81  ? 341 TYR A CG  1 
ATOM   2501 C CD1 . TYR A 1 341 ? -29.786 27.111  -14.688 1.00 28.58  ? 341 TYR A CD1 1 
ATOM   2502 C CD2 . TYR A 1 341 ? -30.686 25.017  -15.313 1.00 26.33  ? 341 TYR A CD2 1 
ATOM   2503 C CE1 . TYR A 1 341 ? -28.501 26.590  -14.798 1.00 32.39  ? 341 TYR A CE1 1 
ATOM   2504 C CE2 . TYR A 1 341 ? -29.418 24.486  -15.428 1.00 30.00  ? 341 TYR A CE2 1 
ATOM   2505 C CZ  . TYR A 1 341 ? -28.329 25.269  -15.163 1.00 32.70  ? 341 TYR A CZ  1 
ATOM   2506 O OH  . TYR A 1 341 ? -27.071 24.727  -15.255 1.00 33.61  ? 341 TYR A OH  1 
ATOM   2507 N N   . GLY A 1 342 ? -34.644 28.729  -16.948 1.00 27.70  ? 342 GLY A N   1 
ATOM   2508 C CA  . GLY A 1 342 ? -36.093 28.814  -17.055 1.00 26.73  ? 342 GLY A CA  1 
ATOM   2509 C C   . GLY A 1 342 ? -36.685 30.182  -17.176 1.00 26.84  ? 342 GLY A C   1 
ATOM   2510 O O   . GLY A 1 342 ? -37.825 30.299  -17.586 1.00 25.82  ? 342 GLY A O   1 
ATOM   2511 N N   . ALA A 1 343 ? -35.929 31.213  -16.822 1.00 24.83  ? 343 ALA A N   1 
ATOM   2512 C CA  . ALA A 1 343 ? -36.483 32.518  -16.829 1.00 22.73  ? 343 ALA A CA  1 
ATOM   2513 C C   . ALA A 1 343 ? -36.420 33.064  -18.261 1.00 26.44  ? 343 ALA A C   1 
ATOM   2514 O O   . ALA A 1 343 ? -35.333 33.071  -18.887 1.00 26.64  ? 343 ALA A O   1 
ATOM   2515 C CB  . ALA A 1 343 ? -35.702 33.362  -15.895 1.00 21.56  ? 343 ALA A CB  1 
ATOM   2516 N N   . PRO A 1 344 ? -37.578 33.536  -18.823 1.00 28.70  ? 344 PRO A N   1 
ATOM   2517 C CA  . PRO A 1 344 ? -37.430 34.000  -20.232 1.00 26.91  ? 344 PRO A CA  1 
ATOM   2518 C C   . PRO A 1 344 ? -36.541 35.254  -20.320 1.00 30.35  ? 344 PRO A C   1 
ATOM   2519 O O   . PRO A 1 344 ? -36.493 36.090  -19.329 1.00 34.41  ? 344 PRO A O   1 
ATOM   2520 C CB  . PRO A 1 344 ? -38.853 34.286  -20.671 1.00 23.06  ? 344 PRO A CB  1 
ATOM   2521 C CG  . PRO A 1 344 ? -39.632 34.439  -19.424 1.00 23.21  ? 344 PRO A CG  1 
ATOM   2522 C CD  . PRO A 1 344 ? -38.924 33.816  -18.277 1.00 24.49  ? 344 PRO A CD  1 
ATOM   2523 N N   . GLY A 1 345 ? -35.835 35.328  -21.467 1.00 27.74  ? 345 GLY A N   1 
ATOM   2524 C CA  . GLY A 1 345 ? -34.906 36.385  -21.822 1.00 24.13  ? 345 GLY A CA  1 
ATOM   2525 C C   . GLY A 1 345 ? -33.454 36.064  -21.472 1.00 26.43  ? 345 GLY A C   1 
ATOM   2526 O O   . GLY A 1 345 ? -32.567 36.793  -21.881 1.00 27.70  ? 345 GLY A O   1 
ATOM   2527 N N   . PHE A 1 346 ? -33.194 34.982  -20.726 1.00 25.55  ? 346 PHE A N   1 
ATOM   2528 C CA  . PHE A 1 346 ? -31.884 34.720  -20.142 1.00 24.08  ? 346 PHE A CA  1 
ATOM   2529 C C   . PHE A 1 346 ? -31.058 33.702  -20.931 1.00 26.58  ? 346 PHE A C   1 
ATOM   2530 O O   . PHE A 1 346 ? -31.608 32.793  -21.538 1.00 25.20  ? 346 PHE A O   1 
ATOM   2531 C CB  . PHE A 1 346 ? -32.060 34.225  -18.713 1.00 24.86  ? 346 PHE A CB  1 
ATOM   2532 C CG  . PHE A 1 346 ? -32.284 35.334  -17.732 1.00 26.33  ? 346 PHE A CG  1 
ATOM   2533 C CD1 . PHE A 1 346 ? -33.581 35.726  -17.374 1.00 27.60  ? 346 PHE A CD1 1 
ATOM   2534 C CD2 . PHE A 1 346 ? -31.222 36.035  -17.208 1.00 24.44  ? 346 PHE A CD2 1 
ATOM   2535 C CE1 . PHE A 1 346 ? -33.799 36.797  -16.499 1.00 26.20  ? 346 PHE A CE1 1 
ATOM   2536 C CE2 . PHE A 1 346 ? -31.441 37.078  -16.331 1.00 25.22  ? 346 PHE A CE2 1 
ATOM   2537 C CZ  . PHE A 1 346 ? -32.727 37.476  -15.990 1.00 25.12  ? 346 PHE A CZ  1 
ATOM   2538 N N   . SER A 1 347 ? -29.730 33.851  -20.887 1.00 24.42  ? 347 SER A N   1 
ATOM   2539 C CA  . SER A 1 347 ? -28.813 32.972  -21.560 1.00 22.97  ? 347 SER A CA  1 
ATOM   2540 C C   . SER A 1 347 ? -27.461 33.291  -20.921 1.00 23.11  ? 347 SER A C   1 
ATOM   2541 O O   . SER A 1 347 ? -27.229 34.439  -20.617 1.00 24.01  ? 347 SER A O   1 
ATOM   2542 C CB  . SER A 1 347 ? -28.809 33.362  -23.039 1.00 22.58  ? 347 SER A CB  1 
ATOM   2543 O OG  . SER A 1 347 ? -27.573 33.070  -23.672 1.00 23.10  ? 347 SER A OG  1 
ATOM   2544 N N   . LYS A 1 348 ? -26.560 32.326  -20.729 1.00 22.35  ? 348 LYS A N   1 
ATOM   2545 C CA  . LYS A 1 348 ? -25.272 32.683  -20.135 1.00 21.73  ? 348 LYS A CA  1 
ATOM   2546 C C   . LYS A 1 348 ? -24.410 33.292  -21.183 1.00 23.24  ? 348 LYS A C   1 
ATOM   2547 O O   . LYS A 1 348 ? -23.316 33.808  -20.888 1.00 23.03  ? 348 LYS A O   1 
ATOM   2548 C CB  . LYS A 1 348 ? -24.528 31.502  -19.521 1.00 20.41  ? 348 LYS A CB  1 
ATOM   2549 C CG  . LYS A 1 348 ? -24.046 30.457  -20.504 1.00 19.12  ? 348 LYS A CG  1 
ATOM   2550 C CD  . LYS A 1 348 ? -23.380 29.297  -19.750 1.00 18.69  ? 348 LYS A CD  1 
ATOM   2551 C CE  . LYS A 1 348 ? -22.280 28.637  -20.578 1.00 18.72  ? 348 LYS A CE  1 
ATOM   2552 N NZ  . LYS A 1 348 ? -21.343 29.644  -21.178 1.00 17.25  ? 348 LYS A NZ  1 
ATOM   2553 N N   . ASP A 1 349 ? -24.860 33.258  -22.424 1.00 23.29  ? 349 ASP A N   1 
ATOM   2554 C CA  . ASP A 1 349 ? -23.897 33.665  -23.440 1.00 25.55  ? 349 ASP A CA  1 
ATOM   2555 C C   . ASP A 1 349 ? -24.171 35.026  -23.966 1.00 25.49  ? 349 ASP A C   1 
ATOM   2556 O O   . ASP A 1 349 ? -23.710 35.370  -25.041 1.00 27.28  ? 349 ASP A O   1 
ATOM   2557 C CB  . ASP A 1 349 ? -23.746 32.605  -24.543 1.00 26.83  ? 349 ASP A CB  1 
ATOM   2558 C CG  . ASP A 1 349 ? -23.069 31.302  -23.997 1.00 27.14  ? 349 ASP A CG  1 
ATOM   2559 O OD1 . ASP A 1 349 ? -22.030 31.421  -23.328 1.00 23.31  ? 349 ASP A OD1 1 
ATOM   2560 O OD2 . ASP A 1 349 ? -23.588 30.180  -24.195 1.00 28.29  ? 349 ASP A OD2 1 
ATOM   2561 N N   . ASN A 1 350 ? -24.932 35.797  -23.208 1.00 23.74  ? 350 ASN A N   1 
ATOM   2562 C CA  . ASN A 1 350 ? -25.201 37.147  -23.617 1.00 25.30  ? 350 ASN A CA  1 
ATOM   2563 C C   . ASN A 1 350 ? -25.486 37.889  -22.334 1.00 24.56  ? 350 ASN A C   1 
ATOM   2564 O O   . ASN A 1 350 ? -25.464 37.253  -21.303 1.00 24.28  ? 350 ASN A O   1 
ATOM   2565 C CB  . ASN A 1 350 ? -26.325 37.216  -24.697 1.00 25.95  ? 350 ASN A CB  1 
ATOM   2566 C CG  . ASN A 1 350 ? -27.721 37.012  -24.129 1.00 27.30  ? 350 ASN A CG  1 
ATOM   2567 O OD1 . ASN A 1 350 ? -27.920 37.075  -22.913 1.00 30.59  ? 350 ASN A OD1 1 
ATOM   2568 N ND2 . ASN A 1 350 ? -28.700 36.772  -25.006 1.00 25.85  ? 350 ASN A ND2 1 
ATOM   2569 N N   . GLU A 1 351 ? -25.746 39.198  -22.394 1.00 23.87  ? 351 GLU A N   1 
ATOM   2570 C CA  . GLU A 1 351 ? -25.877 40.058  -21.221 1.00 22.95  ? 351 GLU A CA  1 
ATOM   2571 C C   . GLU A 1 351 ? -27.204 39.874  -20.551 1.00 22.01  ? 351 GLU A C   1 
ATOM   2572 O O   . GLU A 1 351 ? -27.486 40.536  -19.544 1.00 21.72  ? 351 GLU A O   1 
ATOM   2573 C CB  . GLU A 1 351 ? -25.895 41.514  -21.669 1.00 29.01  ? 351 GLU A CB  1 
ATOM   2574 C CG  . GLU A 1 351 ? -24.612 42.067  -22.240 1.00 33.88  ? 351 GLU A CG  1 
ATOM   2575 C CD  . GLU A 1 351 ? -23.455 41.513  -21.475 1.00 38.27  ? 351 GLU A CD  1 
ATOM   2576 O OE1 . GLU A 1 351 ? -23.359 41.781  -20.247 1.00 42.02  ? 351 GLU A OE1 1 
ATOM   2577 O OE2 . GLU A 1 351 ? -22.668 40.778  -22.105 1.00 42.22  ? 351 GLU A OE2 1 
ATOM   2578 N N   . SER A 1 352 ? -28.078 39.061  -21.139 1.00 20.59  ? 352 SER A N   1 
ATOM   2579 C CA  . SER A 1 352 ? -29.400 38.867  -20.559 1.00 21.27  ? 352 SER A CA  1 
ATOM   2580 C C   . SER A 1 352 ? -30.125 40.194  -20.167 1.00 22.28  ? 352 SER A C   1 
ATOM   2581 O O   . SER A 1 352 ? -30.727 40.289  -19.090 1.00 23.55  ? 352 SER A O   1 
ATOM   2582 C CB  . SER A 1 352 ? -29.272 37.931  -19.348 1.00 23.28  ? 352 SER A CB  1 
ATOM   2583 O OG  . SER A 1 352 ? -29.162 36.566  -19.755 1.00 24.25  ? 352 SER A OG  1 
ATOM   2584 N N   . LEU A 1 353 ? -30.058 41.218  -21.028 1.00 20.58  ? 353 LEU A N   1 
ATOM   2585 C CA  . LEU A 1 353 ? -30.793 42.464  -20.815 1.00 18.95  ? 353 LEU A CA  1 
ATOM   2586 C C   . LEU A 1 353 ? -32.311 42.310  -21.080 1.00 19.09  ? 353 LEU A C   1 
ATOM   2587 O O   . LEU A 1 353 ? -32.835 42.652  -22.114 1.00 19.46  ? 353 LEU A O   1 
ATOM   2588 C CB  . LEU A 1 353 ? -30.175 43.568  -21.667 1.00 18.69  ? 353 LEU A CB  1 
ATOM   2589 C CG  . LEU A 1 353 ? -28.708 43.888  -21.304 1.00 18.90  ? 353 LEU A CG  1 
ATOM   2590 C CD1 . LEU A 1 353 ? -28.036 44.647  -22.444 1.00 16.42  ? 353 LEU A CD1 1 
ATOM   2591 C CD2 . LEU A 1 353 ? -28.498 44.547  -19.913 1.00 16.86  ? 353 LEU A CD2 1 
ATOM   2592 N N   . ILE A 1 354 ? -33.039 41.786  -20.125 1.00 19.95  ? 354 ILE A N   1 
ATOM   2593 C CA  . ILE A 1 354 ? -34.441 41.523  -20.358 1.00 20.93  ? 354 ILE A CA  1 
ATOM   2594 C C   . ILE A 1 354 ? -35.308 42.779  -20.419 1.00 23.09  ? 354 ILE A C   1 
ATOM   2595 O O   . ILE A 1 354 ? -34.922 43.849  -19.952 1.00 28.10  ? 354 ILE A O   1 
ATOM   2596 C CB  . ILE A 1 354 ? -34.971 40.586  -19.266 1.00 20.70  ? 354 ILE A CB  1 
ATOM   2597 C CG1 . ILE A 1 354 ? -34.592 41.107  -17.854 1.00 19.93  ? 354 ILE A CG1 1 
ATOM   2598 C CG2 . ILE A 1 354 ? -34.388 39.189  -19.490 1.00 20.94  ? 354 ILE A CG2 1 
ATOM   2599 C CD1 . ILE A 1 354 ? -35.347 40.460  -16.698 1.00 17.15  ? 354 ILE A CD1 1 
ATOM   2600 N N   . SER A 1 355 ? -36.473 42.633  -21.024 1.00 23.62  ? 355 SER A N   1 
ATOM   2601 C CA  . SER A 1 355 ? -37.520 43.627  -21.075 1.00 22.15  ? 355 SER A CA  1 
ATOM   2602 C C   . SER A 1 355 ? -38.437 43.414  -19.852 1.00 25.72  ? 355 SER A C   1 
ATOM   2603 O O   . SER A 1 355 ? -38.392 42.369  -19.173 1.00 27.17  ? 355 SER A O   1 
ATOM   2604 C CB  . SER A 1 355 ? -38.311 43.404  -22.358 1.00 19.81  ? 355 SER A CB  1 
ATOM   2605 O OG  . SER A 1 355 ? -39.130 42.231  -22.273 1.00 17.83  ? 355 SER A OG  1 
ATOM   2606 N N   . ARG A 1 356 ? -39.288 44.403  -19.604 1.00 26.32  ? 356 ARG A N   1 
ATOM   2607 C CA  . ARG A 1 356 ? -40.245 44.381  -18.534 1.00 23.39  ? 356 ARG A CA  1 
ATOM   2608 C C   . ARG A 1 356 ? -41.237 43.261  -18.701 1.00 23.59  ? 356 ARG A C   1 
ATOM   2609 O O   . ARG A 1 356 ? -41.659 42.638  -17.716 1.00 24.29  ? 356 ARG A O   1 
ATOM   2610 C CB  . ARG A 1 356 ? -40.980 45.713  -18.546 1.00 24.26  ? 356 ARG A CB  1 
ATOM   2611 C CG  . ARG A 1 356 ? -42.114 45.874  -17.547 1.00 23.44  ? 356 ARG A CG  1 
ATOM   2612 C CD  . ARG A 1 356 ? -41.598 46.649  -16.361 1.00 25.75  ? 356 ARG A CD  1 
ATOM   2613 N NE  . ARG A 1 356 ? -42.475 46.510  -15.212 1.00 29.38  ? 356 ARG A NE  1 
ATOM   2614 C CZ  . ARG A 1 356 ? -42.109 46.760  -13.951 1.00 29.85  ? 356 ARG A CZ  1 
ATOM   2615 N NH1 . ARG A 1 356 ? -40.838 47.177  -13.699 1.00 27.46  ? 356 ARG A NH1 1 
ATOM   2616 N NH2 . ARG A 1 356 ? -43.014 46.577  -12.961 1.00 25.62  ? 356 ARG A NH2 1 
ATOM   2617 N N   . ALA A 1 357 ? -41.678 42.998  -19.924 1.00 24.80  ? 357 ALA A N   1 
ATOM   2618 C CA  . ALA A 1 357 ? -42.689 41.901  -20.049 1.00 26.44  ? 357 ALA A CA  1 
ATOM   2619 C C   . ALA A 1 357 ? -42.026 40.613  -19.491 1.00 27.97  ? 357 ALA A C   1 
ATOM   2620 O O   . ALA A 1 357 ? -42.632 39.838  -18.691 1.00 24.25  ? 357 ALA A O   1 
ATOM   2621 C CB  . ALA A 1 357 ? -43.136 41.693  -21.500 1.00 21.28  ? 357 ALA A CB  1 
ATOM   2622 N N   . GLU A 1 358 ? -40.757 40.457  -19.917 1.00 26.72  ? 358 GLU A N   1 
ATOM   2623 C CA  . GLU A 1 358 ? -39.938 39.336  -19.563 1.00 26.40  ? 358 GLU A CA  1 
ATOM   2624 C C   . GLU A 1 358 ? -39.758 39.254  -18.056 1.00 25.24  ? 358 GLU A C   1 
ATOM   2625 O O   . GLU A 1 358 ? -39.830 38.175  -17.476 1.00 25.06  ? 358 GLU A O   1 
ATOM   2626 C CB  . GLU A 1 358 ? -38.599 39.434  -20.288 1.00 26.79  ? 358 GLU A CB  1 
ATOM   2627 C CG  . GLU A 1 358 ? -38.616 38.749  -21.646 1.00 26.04  ? 358 GLU A CG  1 
ATOM   2628 C CD  . GLU A 1 358 ? -37.377 39.002  -22.487 1.00 27.94  ? 358 GLU A CD  1 
ATOM   2629 O OE1 . GLU A 1 358 ? -36.600 39.944  -22.201 1.00 26.60  ? 358 GLU A OE1 1 
ATOM   2630 O OE2 . GLU A 1 358 ? -37.170 38.239  -23.468 1.00 31.73  ? 358 GLU A OE2 1 
ATOM   2631 N N   . PHE A 1 359 ? -39.560 40.412  -17.437 1.00 23.36  ? 359 PHE A N   1 
ATOM   2632 C CA  . PHE A 1 359 ? -39.421 40.492  -16.005 1.00 22.09  ? 359 PHE A CA  1 
ATOM   2633 C C   . PHE A 1 359 ? -40.693 40.055  -15.333 1.00 24.31  ? 359 PHE A C   1 
ATOM   2634 O O   . PHE A 1 359 ? -40.653 39.269  -14.374 1.00 26.61  ? 359 PHE A O   1 
ATOM   2635 C CB  . PHE A 1 359 ? -39.034 41.896  -15.565 1.00 21.76  ? 359 PHE A CB  1 
ATOM   2636 C CG  . PHE A 1 359 ? -39.055 42.106  -14.058 1.00 21.91  ? 359 PHE A CG  1 
ATOM   2637 C CD1 . PHE A 1 359 ? -37.897 41.867  -13.273 1.00 21.67  ? 359 PHE A CD1 1 
ATOM   2638 C CD2 . PHE A 1 359 ? -40.205 42.555  -13.408 1.00 19.85  ? 359 PHE A CD2 1 
ATOM   2639 C CE1 . PHE A 1 359 ? -37.894 42.096  -11.902 1.00 18.76  ? 359 PHE A CE1 1 
ATOM   2640 C CE2 . PHE A 1 359 ? -40.195 42.767  -12.035 1.00 19.20  ? 359 PHE A CE2 1 
ATOM   2641 C CZ  . PHE A 1 359 ? -39.039 42.555  -11.295 1.00 18.65  ? 359 PHE A CZ  1 
ATOM   2642 N N   . LEU A 1 360 ? -41.842 40.522  -15.800 1.00 24.85  ? 360 LEU A N   1 
ATOM   2643 C CA  . LEU A 1 360 ? -43.053 40.070  -15.103 1.00 24.82  ? 360 LEU A CA  1 
ATOM   2644 C C   . LEU A 1 360 ? -43.321 38.561  -15.247 1.00 23.49  ? 360 LEU A C   1 
ATOM   2645 O O   . LEU A 1 360 ? -43.944 37.951  -14.349 1.00 25.18  ? 360 LEU A O   1 
ATOM   2646 C CB  . LEU A 1 360 ? -44.300 40.882  -15.482 1.00 25.77  ? 360 LEU A CB  1 
ATOM   2647 C CG  . LEU A 1 360 ? -44.297 42.412  -15.474 1.00 25.95  ? 360 LEU A CG  1 
ATOM   2648 C CD1 . LEU A 1 360 ? -45.591 42.791  -16.172 1.00 25.12  ? 360 LEU A CD1 1 
ATOM   2649 C CD2 . LEU A 1 360 ? -44.273 42.939  -14.053 1.00 26.00  ? 360 LEU A CD2 1 
ATOM   2650 N N   . ALA A 1 361 ? -42.857 37.958  -16.341 1.00 21.87  ? 361 ALA A N   1 
ATOM   2651 C CA  . ALA A 1 361 ? -43.227 36.564  -16.591 1.00 23.29  ? 361 ALA A CA  1 
ATOM   2652 C C   . ALA A 1 361 ? -42.278 35.699  -15.754 1.00 24.15  ? 361 ALA A C   1 
ATOM   2653 O O   . ALA A 1 361 ? -42.676 34.635  -15.173 1.00 22.31  ? 361 ALA A O   1 
ATOM   2654 C CB  . ALA A 1 361 ? -43.120 36.218  -18.063 1.00 21.31  ? 361 ALA A CB  1 
ATOM   2655 N N   . GLY A 1 362 ? -41.042 36.203  -15.699 1.00 21.98  ? 362 GLY A N   1 
ATOM   2656 C CA  . GLY A 1 362 ? -39.986 35.678  -14.871 1.00 22.70  ? 362 GLY A CA  1 
ATOM   2657 C C   . GLY A 1 362 ? -40.390 35.667  -13.415 1.00 25.68  ? 362 GLY A C   1 
ATOM   2658 O O   . GLY A 1 362 ? -40.109 34.694  -12.685 1.00 29.67  ? 362 GLY A O   1 
ATOM   2659 N N   . VAL A 1 363 ? -41.098 36.686  -12.951 1.00 23.63  ? 363 VAL A N   1 
ATOM   2660 C CA  . VAL A 1 363 ? -41.470 36.604  -11.553 1.00 22.91  ? 363 VAL A CA  1 
ATOM   2661 C C   . VAL A 1 363 ? -42.349 35.390  -11.287 1.00 24.15  ? 363 VAL A C   1 
ATOM   2662 O O   . VAL A 1 363 ? -42.181 34.752  -10.258 1.00 25.50  ? 363 VAL A O   1 
ATOM   2663 C CB  . VAL A 1 363 ? -42.141 37.873  -11.054 1.00 21.92  ? 363 VAL A CB  1 
ATOM   2664 C CG1 . VAL A 1 363 ? -42.535 37.698  -9.603  1.00 20.12  ? 363 VAL A CG1 1 
ATOM   2665 C CG2 . VAL A 1 363 ? -41.194 39.043  -11.212 1.00 20.39  ? 363 VAL A CG2 1 
ATOM   2666 N N   . ARG A 1 364 ? -43.263 35.032  -12.194 1.00 25.72  ? 364 ARG A N   1 
ATOM   2667 C CA  . ARG A 1 364 ? -44.059 33.791  -11.936 1.00 28.81  ? 364 ARG A CA  1 
ATOM   2668 C C   . ARG A 1 364 ? -43.201 32.541  -11.971 1.00 27.19  ? 364 ARG A C   1 
ATOM   2669 O O   . ARG A 1 364 ? -43.546 31.569  -11.336 1.00 27.28  ? 364 ARG A O   1 
ATOM   2670 C CB  . ARG A 1 364 ? -45.269 33.578  -12.873 1.00 31.11  ? 364 ARG A CB  1 
ATOM   2671 C CG  . ARG A 1 364 ? -46.109 34.815  -13.199 1.00 40.34  ? 364 ARG A CG  1 
ATOM   2672 C CD  . ARG A 1 364 ? -46.629 35.620  -11.992 1.00 42.09  ? 364 ARG A CD  1 
ATOM   2673 N NE  . ARG A 1 364 ? -47.508 34.843  -11.088 1.00 43.24  ? 364 ARG A NE  1 
ATOM   2674 C CZ  . ARG A 1 364 ? -48.839 34.846  -11.160 1.00 41.49  ? 364 ARG A CZ  1 
ATOM   2675 N NH1 . ARG A 1 364 ? -49.405 35.571  -12.078 1.00 41.43  ? 364 ARG A NH1 1 
ATOM   2676 N NH2 . ARG A 1 364 ? -49.603 34.158  -10.314 1.00 40.89  ? 364 ARG A NH2 1 
ATOM   2677 N N   . VAL A 1 365 ? -42.092 32.551  -12.718 1.00 26.03  ? 365 VAL A N   1 
ATOM   2678 C CA  . VAL A 1 365 ? -41.196 31.407  -12.691 1.00 24.00  ? 365 VAL A CA  1 
ATOM   2679 C C   . VAL A 1 365 ? -40.402 31.349  -11.384 1.00 25.29  ? 365 VAL A C   1 
ATOM   2680 O O   . VAL A 1 365 ? -40.295 30.269  -10.777 1.00 22.75  ? 365 VAL A O   1 
ATOM   2681 C CB  . VAL A 1 365 ? -40.295 31.324  -13.922 1.00 23.57  ? 365 VAL A CB  1 
ATOM   2682 C CG1 . VAL A 1 365 ? -39.375 30.088  -13.833 1.00 24.19  ? 365 VAL A CG1 1 
ATOM   2683 C CG2 . VAL A 1 365 ? -41.161 31.199  -15.150 1.00 20.75  ? 365 VAL A CG2 1 
ATOM   2684 N N   . GLY A 1 366 ? -39.886 32.512  -10.947 1.00 25.15  ? 366 GLY A N   1 
ATOM   2685 C CA  . GLY A 1 366 ? -39.080 32.623  -9.724  1.00 25.27  ? 366 GLY A CA  1 
ATOM   2686 C C   . GLY A 1 366 ? -39.850 32.320  -8.442  1.00 27.92  ? 366 GLY A C   1 
ATOM   2687 O O   . GLY A 1 366 ? -39.285 31.723  -7.485  1.00 33.62  ? 366 GLY A O   1 
ATOM   2688 N N   . VAL A 1 367 ? -41.131 32.698  -8.444  1.00 26.01  ? 367 VAL A N   1 
ATOM   2689 C CA  . VAL A 1 367 ? -42.026 32.503  -7.328  1.00 26.97  ? 367 VAL A CA  1 
ATOM   2690 C C   . VAL A 1 367 ? -43.245 31.749  -7.832  1.00 31.03  ? 367 VAL A C   1 
ATOM   2691 O O   . VAL A 1 367 ? -44.306 32.321  -8.099  1.00 37.61  ? 367 VAL A O   1 
ATOM   2692 C CB  . VAL A 1 367 ? -42.475 33.851  -6.733  1.00 26.15  ? 367 VAL A CB  1 
ATOM   2693 C CG1 . VAL A 1 367 ? -43.111 33.653  -5.361  1.00 23.99  ? 367 VAL A CG1 1 
ATOM   2694 C CG2 . VAL A 1 367 ? -41.319 34.868  -6.693  1.00 24.59  ? 367 VAL A CG2 1 
ATOM   2695 N N   . PRO A 1 368 ? -43.103 30.447  -7.992  1.00 32.44  ? 368 PRO A N   1 
ATOM   2696 C CA  . PRO A 1 368 ? -44.148 29.580  -8.565  1.00 31.39  ? 368 PRO A CA  1 
ATOM   2697 C C   . PRO A 1 368 ? -45.370 29.331  -7.682  1.00 32.37  ? 368 PRO A C   1 
ATOM   2698 O O   . PRO A 1 368 ? -45.238 29.247  -6.471  1.00 32.76  ? 368 PRO A O   1 
ATOM   2699 C CB  . PRO A 1 368 ? -43.404 28.267  -8.795  1.00 31.68  ? 368 PRO A CB  1 
ATOM   2700 C CG  . PRO A 1 368 ? -42.248 28.290  -7.834  1.00 30.97  ? 368 PRO A CG  1 
ATOM   2701 C CD  . PRO A 1 368 ? -41.835 29.731  -7.757  1.00 32.71  ? 368 PRO A CD  1 
ATOM   2702 N N   . GLN A 1 369 ? -46.527 29.145  -8.316  1.00 37.96  ? 369 GLN A N   1 
ATOM   2703 C CA  . GLN A 1 369 ? -47.882 29.062  -7.657  1.00 46.57  ? 369 GLN A CA  1 
ATOM   2704 C C   . GLN A 1 369 ? -48.174 29.901  -6.355  1.00 44.41  ? 369 GLN A C   1 
ATOM   2705 O O   . GLN A 1 369 ? -48.271 29.414  -5.213  1.00 39.20  ? 369 GLN A O   1 
ATOM   2706 C CB  . GLN A 1 369 ? -48.384 27.612  -7.553  1.00 52.07  ? 369 GLN A CB  1 
ATOM   2707 C CG  . GLN A 1 369 ? -47.510 26.784  -6.629  1.00 56.97  ? 369 GLN A CG  1 
ATOM   2708 C CD  . GLN A 1 369 ? -47.233 25.398  -7.149  1.00 58.03  ? 369 GLN A CD  1 
ATOM   2709 O OE1 . GLN A 1 369 ? -47.206 24.468  -6.359  1.00 57.87  ? 369 GLN A OE1 1 
ATOM   2710 N NE2 . GLN A 1 369 ? -47.016 25.249  -8.474  1.00 52.95  ? 369 GLN A NE2 1 
ATOM   2711 N N   . VAL A 1 370 ? -48.318 31.190  -6.579  1.00 41.63  ? 370 VAL A N   1 
ATOM   2712 C CA  . VAL A 1 370 ? -48.830 32.075  -5.582  1.00 41.01  ? 370 VAL A CA  1 
ATOM   2713 C C   . VAL A 1 370 ? -49.977 32.844  -6.273  1.00 43.54  ? 370 VAL A C   1 
ATOM   2714 O O   . VAL A 1 370 ? -50.000 32.947  -7.516  1.00 43.23  ? 370 VAL A O   1 
ATOM   2715 C CB  . VAL A 1 370 ? -47.691 32.972  -5.080  1.00 37.52  ? 370 VAL A CB  1 
ATOM   2716 C CG1 . VAL A 1 370 ? -46.605 32.103  -4.462  1.00 32.60  ? 370 VAL A CG1 1 
ATOM   2717 C CG2 . VAL A 1 370 ? -47.111 33.817  -6.212  1.00 33.19  ? 370 VAL A CG2 1 
ATOM   2718 N N   . SER A 1 371 ? -50.933 33.364  -5.502  1.00 42.30  ? 371 SER A N   1 
ATOM   2719 C CA  . SER A 1 371 ? -51.957 34.248  -6.074  1.00 38.63  ? 371 SER A CA  1 
ATOM   2720 C C   . SER A 1 371 ? -51.334 35.358  -6.960  1.00 40.57  ? 371 SER A C   1 
ATOM   2721 O O   . SER A 1 371 ? -50.204 35.827  -6.726  1.00 40.73  ? 371 SER A O   1 
ATOM   2722 C CB  . SER A 1 371 ? -52.735 34.871  -4.941  1.00 39.28  ? 371 SER A CB  1 
ATOM   2723 O OG  . SER A 1 371 ? -51.845 35.563  -4.060  1.00 37.74  ? 371 SER A OG  1 
ATOM   2724 N N   . ASP A 1 372 ? -52.066 35.794  -7.978  1.00 42.64  ? 372 ASP A N   1 
ATOM   2725 C CA  . ASP A 1 372 ? -51.609 36.926  -8.808  1.00 38.41  ? 372 ASP A CA  1 
ATOM   2726 C C   . ASP A 1 372 ? -51.474 38.120  -7.903  1.00 35.16  ? 372 ASP A C   1 
ATOM   2727 O O   . ASP A 1 372 ? -50.632 38.990  -8.119  1.00 36.51  ? 372 ASP A O   1 
ATOM   2728 C CB  . ASP A 1 372 ? -52.602 37.259  -9.916  1.00 42.49  ? 372 ASP A CB  1 
ATOM   2729 C CG  . ASP A 1 372 ? -53.135 36.014  -10.634 1.00 50.07  ? 372 ASP A CG  1 
ATOM   2730 O OD1 . ASP A 1 372 ? -53.419 34.953  -10.016 1.00 55.70  ? 372 ASP A OD1 1 
ATOM   2731 O OD2 . ASP A 1 372 ? -53.290 36.102  -11.851 1.00 54.64  ? 372 ASP A OD2 1 
ATOM   2732 N N   . LEU A 1 373 ? -52.299 38.159  -6.865  1.00 32.66  ? 373 LEU A N   1 
ATOM   2733 C CA  . LEU A 1 373 ? -52.174 39.210  -5.901  1.00 30.53  ? 373 LEU A CA  1 
ATOM   2734 C C   . LEU A 1 373 ? -50.785 39.116  -5.258  1.00 31.60  ? 373 LEU A C   1 
ATOM   2735 O O   . LEU A 1 373 ? -50.095 40.167  -5.065  1.00 31.96  ? 373 LEU A O   1 
ATOM   2736 C CB  . LEU A 1 373 ? -53.290 39.147  -4.853  1.00 31.67  ? 373 LEU A CB  1 
ATOM   2737 C CG  . LEU A 1 373 ? -53.201 40.372  -3.893  1.00 32.24  ? 373 LEU A CG  1 
ATOM   2738 C CD1 . LEU A 1 373 ? -53.169 41.692  -4.651  1.00 31.49  ? 373 LEU A CD1 1 
ATOM   2739 C CD2 . LEU A 1 373 ? -54.256 40.416  -2.810  1.00 28.10  ? 373 LEU A CD2 1 
ATOM   2740 N N   . ALA A 1 374 ? -50.352 37.885  -4.924  1.00 27.96  ? 374 ALA A N   1 
ATOM   2741 C CA  . ALA A 1 374 ? -49.010 37.768  -4.374  1.00 25.38  ? 374 ALA A CA  1 
ATOM   2742 C C   . ALA A 1 374 ? -47.964 38.205  -5.402  1.00 25.08  ? 374 ALA A C   1 
ATOM   2743 O O   . ALA A 1 374 ? -47.072 38.968  -5.076  1.00 26.74  ? 374 ALA A O   1 
ATOM   2744 C CB  . ALA A 1 374 ? -48.743 36.406  -3.845  1.00 22.66  ? 374 ALA A CB  1 
ATOM   2745 N N   . ALA A 1 375 ? -48.097 37.794  -6.649  1.00 23.89  ? 375 ALA A N   1 
ATOM   2746 C CA  . ALA A 1 375 ? -47.120 38.201  -7.663  1.00 25.02  ? 375 ALA A CA  1 
ATOM   2747 C C   . ALA A 1 375 ? -46.957 39.705  -7.846  1.00 28.13  ? 375 ALA A C   1 
ATOM   2748 O O   . ALA A 1 375 ? -45.806 40.223  -7.990  1.00 28.27  ? 375 ALA A O   1 
ATOM   2749 C CB  . ALA A 1 375 ? -47.483 37.580  -8.981  1.00 24.39  ? 375 ALA A CB  1 
ATOM   2750 N N   . GLU A 1 376 ? -48.106 40.398  -7.858  1.00 29.96  ? 376 GLU A N   1 
ATOM   2751 C CA  . GLU A 1 376 ? -48.127 41.859  -8.003  1.00 31.15  ? 376 GLU A CA  1 
ATOM   2752 C C   . GLU A 1 376 ? -47.280 42.436  -6.916  1.00 27.41  ? 376 GLU A C   1 
ATOM   2753 O O   . GLU A 1 376 ? -46.432 43.285  -7.141  1.00 31.08  ? 376 GLU A O   1 
ATOM   2754 C CB  . GLU A 1 376 ? -49.546 42.442  -7.858  1.00 36.76  ? 376 GLU A CB  1 
ATOM   2755 C CG  . GLU A 1 376 ? -50.561 42.154  -8.971  1.00 46.31  ? 376 GLU A CG  1 
ATOM   2756 C CD  . GLU A 1 376 ? -50.184 42.767  -10.315 1.00 58.28  ? 376 GLU A CD  1 
ATOM   2757 O OE1 . GLU A 1 376 ? -49.755 43.958  -10.387 1.00 59.89  ? 376 GLU A OE1 1 
ATOM   2758 O OE2 . GLU A 1 376 ? -50.313 42.030  -11.316 1.00 68.03  ? 376 GLU A OE2 1 
ATOM   2759 N N   . ALA A 1 377 ? -47.515 41.976  -5.706  1.00 25.25  ? 377 ALA A N   1 
ATOM   2760 C CA  . ALA A 1 377 ? -46.853 42.597  -4.597  1.00 23.30  ? 377 ALA A CA  1 
ATOM   2761 C C   . ALA A 1 377 ? -45.333 42.401  -4.736  1.00 23.57  ? 377 ALA A C   1 
ATOM   2762 O O   . ALA A 1 377 ? -44.551 43.342  -4.424  1.00 24.17  ? 377 ALA A O   1 
ATOM   2763 C CB  . ALA A 1 377 ? -47.405 42.081  -3.280  1.00 20.94  ? 377 ALA A CB  1 
ATOM   2764 N N   . VAL A 1 378 ? -44.913 41.234  -5.260  1.00 20.92  ? 378 VAL A N   1 
ATOM   2765 C CA  . VAL A 1 378 ? -43.490 41.003  -5.526  1.00 20.38  ? 378 VAL A CA  1 
ATOM   2766 C C   . VAL A 1 378 ? -42.963 42.031  -6.539  1.00 20.70  ? 378 VAL A C   1 
ATOM   2767 O O   . VAL A 1 378 ? -41.916 42.722  -6.312  1.00 20.33  ? 378 VAL A O   1 
ATOM   2768 C CB  . VAL A 1 378 ? -43.207 39.567  -5.997  1.00 20.75  ? 378 VAL A CB  1 
ATOM   2769 C CG1 . VAL A 1 378 ? -41.743 39.398  -6.374  1.00 17.76  ? 378 VAL A CG1 1 
ATOM   2770 C CG2 . VAL A 1 378 ? -43.643 38.541  -4.932  1.00 20.12  ? 378 VAL A CG2 1 
ATOM   2771 N N   . VAL A 1 379 ? -43.710 42.170  -7.627  1.00 21.15  ? 379 VAL A N   1 
ATOM   2772 C CA  . VAL A 1 379 ? -43.394 43.199  -8.658  1.00 23.74  ? 379 VAL A CA  1 
ATOM   2773 C C   . VAL A 1 379 ? -43.306 44.627  -8.133  1.00 24.55  ? 379 VAL A C   1 
ATOM   2774 O O   . VAL A 1 379 ? -42.370 45.363  -8.526  1.00 23.71  ? 379 VAL A O   1 
ATOM   2775 C CB  . VAL A 1 379 ? -44.442 43.228  -9.800  1.00 24.49  ? 379 VAL A CB  1 
ATOM   2776 C CG1 . VAL A 1 379 ? -44.101 44.365  -10.755 1.00 23.36  ? 379 VAL A CG1 1 
ATOM   2777 C CG2 . VAL A 1 379 ? -44.561 41.857  -10.499 1.00 21.51  ? 379 VAL A CG2 1 
ATOM   2778 N N   . LEU A 1 380 ? -44.271 45.048  -7.292  1.00 25.45  ? 380 LEU A N   1 
ATOM   2779 C CA  . LEU A 1 380 ? -44.122 46.378  -6.710  1.00 29.91  ? 380 LEU A CA  1 
ATOM   2780 C C   . LEU A 1 380 ? -42.830 46.395  -5.937  1.00 29.70  ? 380 LEU A C   1 
ATOM   2781 O O   . LEU A 1 380 ? -42.094 47.348  -5.961  1.00 28.83  ? 380 LEU A O   1 
ATOM   2782 C CB  . LEU A 1 380 ? -45.263 46.816  -5.754  1.00 40.23  ? 380 LEU A CB  1 
ATOM   2783 C CG  . LEU A 1 380 ? -44.930 47.797  -4.514  1.00 43.18  ? 380 LEU A CG  1 
ATOM   2784 C CD1 . LEU A 1 380 ? -45.077 49.302  -4.797  1.00 40.02  ? 380 LEU A CD1 1 
ATOM   2785 C CD2 . LEU A 1 380 ? -45.563 47.459  -3.135  1.00 36.72  ? 380 LEU A CD2 1 
ATOM   2786 N N   . HIS A 1 381 ? -42.544 45.346  -5.200  1.00 30.83  ? 381 HIS A N   1 
ATOM   2787 C CA  . HIS A 1 381 ? -41.546 45.557  -4.200  1.00 31.33  ? 381 HIS A CA  1 
ATOM   2788 C C   . HIS A 1 381 ? -40.194 45.611  -4.839  1.00 31.10  ? 381 HIS A C   1 
ATOM   2789 O O   . HIS A 1 381 ? -39.274 46.254  -4.336  1.00 31.16  ? 381 HIS A O   1 
ATOM   2790 C CB  . HIS A 1 381 ? -41.637 44.461  -3.200  1.00 35.32  ? 381 HIS A CB  1 
ATOM   2791 C CG  . HIS A 1 381 ? -41.030 44.810  -1.889  1.00 41.31  ? 381 HIS A CG  1 
ATOM   2792 N ND1 . HIS A 1 381 ? -41.784 45.256  -0.821  1.00 45.15  ? 381 HIS A ND1 1 
ATOM   2793 C CD2 . HIS A 1 381 ? -39.742 44.756  -1.462  1.00 45.04  ? 381 HIS A CD2 1 
ATOM   2794 C CE1 . HIS A 1 381 ? -40.979 45.464  0.212   1.00 53.65  ? 381 HIS A CE1 1 
ATOM   2795 N NE2 . HIS A 1 381 ? -39.739 45.160  -0.149  1.00 52.66  ? 381 HIS A NE2 1 
ATOM   2796 N N   . TYR A 1 382 ? -40.087 44.955  -5.991  1.00 29.14  ? 382 TYR A N   1 
ATOM   2797 C CA  . TYR A 1 382 ? -38.804 44.839  -6.642  1.00 25.52  ? 382 TYR A CA  1 
ATOM   2798 C C   . TYR A 1 382 ? -38.689 45.751  -7.839  1.00 24.55  ? 382 TYR A C   1 
ATOM   2799 O O   . TYR A 1 382 ? -37.724 45.682  -8.570  1.00 26.81  ? 382 TYR A O   1 
ATOM   2800 C CB  . TYR A 1 382 ? -38.522 43.362  -6.991  1.00 23.03  ? 382 TYR A CB  1 
ATOM   2801 C CG  . TYR A 1 382 ? -38.043 42.576  -5.793  1.00 20.93  ? 382 TYR A CG  1 
ATOM   2802 C CD1 . TYR A 1 382 ? -38.975 42.009  -4.888  1.00 20.24  ? 382 TYR A CD1 1 
ATOM   2803 C CD2 . TYR A 1 382 ? -36.667 42.425  -5.541  1.00 18.69  ? 382 TYR A CD2 1 
ATOM   2804 C CE1 . TYR A 1 382 ? -38.558 41.311  -3.757  1.00 19.71  ? 382 TYR A CE1 1 
ATOM   2805 C CE2 . TYR A 1 382 ? -36.222 41.749  -4.419  1.00 18.90  ? 382 TYR A CE2 1 
ATOM   2806 C CZ  . TYR A 1 382 ? -37.164 41.183  -3.515  1.00 21.10  ? 382 TYR A CZ  1 
ATOM   2807 O OH  . TYR A 1 382 ? -36.716 40.490  -2.357  1.00 21.30  ? 382 TYR A OH  1 
ATOM   2808 N N   . THR A 1 383 ? -39.646 46.614  -8.074  1.00 23.16  ? 383 THR A N   1 
ATOM   2809 C CA  . THR A 1 383 ? -39.418 47.493  -9.181  1.00 25.15  ? 383 THR A CA  1 
ATOM   2810 C C   . THR A 1 383 ? -38.828 48.765  -8.700  1.00 27.66  ? 383 THR A C   1 
ATOM   2811 O O   . THR A 1 383 ? -39.271 49.265  -7.687  1.00 28.11  ? 383 THR A O   1 
ATOM   2812 C CB  . THR A 1 383 ? -40.706 47.849  -9.891  1.00 25.01  ? 383 THR A CB  1 
ATOM   2813 O OG1 . THR A 1 383 ? -41.215 46.671  -10.540 1.00 22.18  ? 383 THR A OG1 1 
ATOM   2814 C CG2 . THR A 1 383 ? -40.441 49.017  -10.885 1.00 22.73  ? 383 THR A CG2 1 
ATOM   2815 N N   . ASP A 1 384 ? -37.842 49.315  -9.415  1.00 33.10  ? 384 ASP A N   1 
ATOM   2816 C CA  . ASP A 1 384 ? -37.502 50.735  -9.174  1.00 31.51  ? 384 ASP A CA  1 
ATOM   2817 C C   . ASP A 1 384 ? -38.380 51.661  -10.068 1.00 32.68  ? 384 ASP A C   1 
ATOM   2818 O O   . ASP A 1 384 ? -38.296 51.620  -11.312 1.00 33.08  ? 384 ASP A O   1 
ATOM   2819 C CB  . ASP A 1 384 ? -36.033 50.998  -9.352  1.00 30.91  ? 384 ASP A CB  1 
ATOM   2820 C CG  . ASP A 1 384 ? -35.678 52.467  -9.198  1.00 39.57  ? 384 ASP A CG  1 
ATOM   2821 O OD1 . ASP A 1 384 ? -36.580 53.347  -9.288  1.00 44.76  ? 384 ASP A OD1 1 
ATOM   2822 O OD2 . ASP A 1 384 ? -34.474 52.767  -8.995  1.00 39.66  ? 384 ASP A OD2 1 
ATOM   2823 N N   . TRP A 1 385 ? -39.210 52.491  -9.427  1.00 29.57  ? 385 TRP A N   1 
ATOM   2824 C CA  . TRP A 1 385 ? -40.152 53.322  -10.168 1.00 28.88  ? 385 TRP A CA  1 
ATOM   2825 C C   . TRP A 1 385 ? -39.573 54.582  -10.852 1.00 29.72  ? 385 TRP A C   1 
ATOM   2826 O O   . TRP A 1 385 ? -40.245 55.237  -11.625 1.00 27.90  ? 385 TRP A O   1 
ATOM   2827 C CB  . TRP A 1 385 ? -41.407 53.563  -9.346  1.00 26.20  ? 385 TRP A CB  1 
ATOM   2828 C CG  . TRP A 1 385 ? -42.045 52.262  -8.983  1.00 26.77  ? 385 TRP A CG  1 
ATOM   2829 C CD1 . TRP A 1 385 ? -41.857 51.502  -7.814  1.00 26.96  ? 385 TRP A CD1 1 
ATOM   2830 C CD2 . TRP A 1 385 ? -42.934 51.505  -9.804  1.00 24.17  ? 385 TRP A CD2 1 
ATOM   2831 N NE1 . TRP A 1 385 ? -42.619 50.332  -7.888  1.00 24.02  ? 385 TRP A NE1 1 
ATOM   2832 C CE2 . TRP A 1 385 ? -43.278 50.318  -9.091  1.00 23.69  ? 385 TRP A CE2 1 
ATOM   2833 C CE3 . TRP A 1 385 ? -43.475 51.710  -11.071 1.00 23.45  ? 385 TRP A CE3 1 
ATOM   2834 C CZ2 . TRP A 1 385 ? -44.129 49.374  -9.614  1.00 23.47  ? 385 TRP A CZ2 1 
ATOM   2835 C CZ3 . TRP A 1 385 ? -44.336 50.763  -11.593 1.00 22.96  ? 385 TRP A CZ3 1 
ATOM   2836 C CH2 . TRP A 1 385 ? -44.671 49.623  -10.859 1.00 23.91  ? 385 TRP A CH2 1 
ATOM   2837 N N   . LEU A 1 386 ? -38.309 54.894  -10.641 1.00 32.71  ? 386 LEU A N   1 
ATOM   2838 C CA  . LEU A 1 386 ? -37.663 55.855  -11.544 1.00 37.39  ? 386 LEU A CA  1 
ATOM   2839 C C   . LEU A 1 386 ? -37.209 55.197  -12.834 1.00 38.04  ? 386 LEU A C   1 
ATOM   2840 O O   . LEU A 1 386 ? -36.968 55.877  -13.826 1.00 41.60  ? 386 LEU A O   1 
ATOM   2841 C CB  . LEU A 1 386 ? -36.447 56.492  -10.886 1.00 39.96  ? 386 LEU A CB  1 
ATOM   2842 C CG  . LEU A 1 386 ? -36.911 57.404  -9.753  1.00 46.01  ? 386 LEU A CG  1 
ATOM   2843 C CD1 . LEU A 1 386 ? -35.817 57.772  -8.742  1.00 44.75  ? 386 LEU A CD1 1 
ATOM   2844 C CD2 . LEU A 1 386 ? -37.537 58.620  -10.421 1.00 49.27  ? 386 LEU A CD2 1 
ATOM   2845 N N   . HIS A 1 387 ? -37.050 53.878  -12.804 1.00 36.75  ? 387 HIS A N   1 
ATOM   2846 C CA  . HIS A 1 387 ? -36.409 53.166  -13.881 1.00 34.12  ? 387 HIS A CA  1 
ATOM   2847 C C   . HIS A 1 387 ? -37.189 51.876  -14.053 1.00 34.11  ? 387 HIS A C   1 
ATOM   2848 O O   . HIS A 1 387 ? -36.641 50.818  -13.982 1.00 31.55  ? 387 HIS A O   1 
ATOM   2849 C CB  . HIS A 1 387 ? -34.941 52.890  -13.518 1.00 34.30  ? 387 HIS A CB  1 
ATOM   2850 C CG  . HIS A 1 387 ? -34.104 54.133  -13.284 1.00 41.60  ? 387 HIS A CG  1 
ATOM   2851 N ND1 . HIS A 1 387 ? -33.591 54.474  -12.039 1.00 44.87  ? 387 HIS A ND1 1 
ATOM   2852 C CD2 . HIS A 1 387 ? -33.673 55.103  -14.135 1.00 39.28  ? 387 HIS A CD2 1 
ATOM   2853 C CE1 . HIS A 1 387 ? -32.895 55.598  -12.127 1.00 39.77  ? 387 HIS A CE1 1 
ATOM   2854 N NE2 . HIS A 1 387 ? -32.936 56.002  -13.387 1.00 39.17  ? 387 HIS A NE2 1 
ATOM   2855 N N   . PRO A 1 388 ? -38.503 51.957  -14.255 1.00 33.73  ? 388 PRO A N   1 
ATOM   2856 C CA  . PRO A 1 388 ? -39.262 50.717  -14.297 1.00 33.39  ? 388 PRO A CA  1 
ATOM   2857 C C   . PRO A 1 388 ? -38.967 49.800  -15.503 1.00 35.79  ? 388 PRO A C   1 
ATOM   2858 O O   . PRO A 1 388 ? -39.523 48.680  -15.581 1.00 37.97  ? 388 PRO A O   1 
ATOM   2859 C CB  . PRO A 1 388 ? -40.719 51.212  -14.369 1.00 31.57  ? 388 PRO A CB  1 
ATOM   2860 C CG  . PRO A 1 388 ? -40.639 52.557  -14.979 1.00 30.55  ? 388 PRO A CG  1 
ATOM   2861 C CD  . PRO A 1 388 ? -39.370 53.133  -14.415 1.00 33.00  ? 388 PRO A CD  1 
ATOM   2862 N N   . GLU A 1 389 ? -38.138 50.253  -16.442 1.00 35.32  ? 389 GLU A N   1 
ATOM   2863 C CA  . GLU A 1 389 ? -37.993 49.501  -17.702 1.00 36.52  ? 389 GLU A CA  1 
ATOM   2864 C C   . GLU A 1 389 ? -36.526 49.287  -18.032 1.00 33.43  ? 389 GLU A C   1 
ATOM   2865 O O   . GLU A 1 389 ? -36.224 48.812  -19.120 1.00 30.25  ? 389 GLU A O   1 
ATOM   2866 C CB  . GLU A 1 389 ? -38.647 50.187  -18.953 1.00 34.97  ? 389 GLU A CB  1 
ATOM   2867 C CG  . GLU A 1 389 ? -39.960 50.930  -18.838 1.00 37.14  ? 389 GLU A CG  1 
ATOM   2868 C CD  . GLU A 1 389 ? -41.211 50.046  -18.963 1.00 41.86  ? 389 GLU A CD  1 
ATOM   2869 O OE1 . GLU A 1 389 ? -41.232 49.143  -19.798 1.00 41.99  ? 389 GLU A OE1 1 
ATOM   2870 O OE2 . GLU A 1 389 ? -42.224 50.272  -18.241 1.00 48.28  ? 389 GLU A OE2 1 
ATOM   2871 N N   . ASP A 1 390 ? -35.617 49.669  -17.140 1.00 30.41  ? 390 ASP A N   1 
ATOM   2872 C CA  . ASP A 1 390 ? -34.180 49.492  -17.400 1.00 29.56  ? 390 ASP A CA  1 
ATOM   2873 C C   . ASP A 1 390 ? -33.783 47.990  -17.473 1.00 32.22  ? 390 ASP A C   1 
ATOM   2874 O O   . ASP A 1 390 ? -33.820 47.261  -16.439 1.00 32.88  ? 390 ASP A O   1 
ATOM   2875 C CB  . ASP A 1 390 ? -33.382 50.155  -16.309 1.00 28.69  ? 390 ASP A CB  1 
ATOM   2876 C CG  . ASP A 1 390 ? -31.987 50.308  -16.677 1.00 32.98  ? 390 ASP A CG  1 
ATOM   2877 O OD1 . ASP A 1 390 ? -31.754 50.376  -17.895 1.00 35.96  ? 390 ASP A OD1 1 
ATOM   2878 O OD2 . ASP A 1 390 ? -31.119 50.401  -15.785 1.00 36.04  ? 390 ASP A OD2 1 
ATOM   2879 N N   . PRO A 1 391 ? -33.434 47.493  -18.688 1.00 30.75  ? 391 PRO A N   1 
ATOM   2880 C CA  . PRO A 1 391 ? -33.079 46.063  -18.719 1.00 28.27  ? 391 PRO A CA  1 
ATOM   2881 C C   . PRO A 1 391 ? -32.031 45.605  -17.637 1.00 24.38  ? 391 PRO A C   1 
ATOM   2882 O O   . PRO A 1 391 ? -32.312 44.688  -16.902 1.00 22.24  ? 391 PRO A O   1 
ATOM   2883 C CB  . PRO A 1 391 ? -32.596 45.877  -20.163 1.00 28.95  ? 391 PRO A CB  1 
ATOM   2884 C CG  . PRO A 1 391 ? -33.299 46.941  -20.956 1.00 26.08  ? 391 PRO A CG  1 
ATOM   2885 C CD  . PRO A 1 391 ? -33.320 48.112  -20.030 1.00 28.17  ? 391 PRO A CD  1 
ATOM   2886 N N   . ALA A 1 392 ? -30.892 46.274  -17.482 1.00 22.79  ? 392 ALA A N   1 
ATOM   2887 C CA  . ALA A 1 392 ? -29.916 45.831  -16.467 1.00 21.75  ? 392 ALA A CA  1 
ATOM   2888 C C   . ALA A 1 392 ? -30.483 45.795  -15.008 1.00 23.47  ? 392 ALA A C   1 
ATOM   2889 O O   . ALA A 1 392 ? -30.185 44.893  -14.200 1.00 24.27  ? 392 ALA A O   1 
ATOM   2890 C CB  . ALA A 1 392 ? -28.631 46.633  -16.551 1.00 17.24  ? 392 ALA A CB  1 
ATOM   2891 N N   . ARG A 1 393 ? -31.312 46.773  -14.669 1.00 24.50  ? 393 ARG A N   1 
ATOM   2892 C CA  . ARG A 1 393 ? -31.922 46.811  -13.335 1.00 22.76  ? 393 ARG A CA  1 
ATOM   2893 C C   . ARG A 1 393 ? -32.939 45.684  -13.208 1.00 22.33  ? 393 ARG A C   1 
ATOM   2894 O O   . ARG A 1 393 ? -32.963 44.971  -12.210 1.00 21.14  ? 393 ARG A O   1 
ATOM   2895 C CB  . ARG A 1 393 ? -32.507 48.193  -13.046 1.00 22.53  ? 393 ARG A CB  1 
ATOM   2896 C CG  . ARG A 1 393 ? -31.427 49.115  -12.502 1.00 25.43  ? 393 ARG A CG  1 
ATOM   2897 C CD  . ARG A 1 393 ? -31.913 50.474  -12.056 1.00 27.73  ? 393 ARG A CD  1 
ATOM   2898 N NE  . ARG A 1 393 ? -31.452 51.537  -12.977 1.00 31.07  ? 393 ARG A NE  1 
ATOM   2899 C CZ  . ARG A 1 393 ? -30.678 52.549  -12.588 1.00 29.86  ? 393 ARG A CZ  1 
ATOM   2900 N NH1 . ARG A 1 393 ? -30.286 52.637  -11.311 1.00 31.61  ? 393 ARG A NH1 1 
ATOM   2901 N NH2 . ARG A 1 393 ? -30.325 53.475  -13.447 1.00 29.63  ? 393 ARG A NH2 1 
ATOM   2902 N N   . LEU A 1 394 ? -33.728 45.474  -14.258 1.00 21.86  ? 394 LEU A N   1 
ATOM   2903 C CA  . LEU A 1 394 ? -34.636 44.356  -14.262 1.00 21.17  ? 394 LEU A CA  1 
ATOM   2904 C C   . LEU A 1 394 ? -33.887 43.009  -14.051 1.00 22.88  ? 394 LEU A C   1 
ATOM   2905 O O   . LEU A 1 394 ? -34.355 42.150  -13.289 1.00 25.86  ? 394 LEU A O   1 
ATOM   2906 C CB  . LEU A 1 394 ? -35.482 44.386  -15.518 1.00 20.15  ? 394 LEU A CB  1 
ATOM   2907 C CG  . LEU A 1 394 ? -36.464 45.567  -15.658 1.00 20.22  ? 394 LEU A CG  1 
ATOM   2908 C CD1 . LEU A 1 394 ? -36.941 45.638  -17.103 1.00 20.28  ? 394 LEU A CD1 1 
ATOM   2909 C CD2 . LEU A 1 394 ? -37.676 45.487  -14.721 1.00 18.04  ? 394 LEU A CD2 1 
ATOM   2910 N N   . ARG A 1 395 ? -32.712 42.830  -14.655 1.00 22.22  ? 395 ARG A N   1 
ATOM   2911 C CA  . ARG A 1 395 ? -31.912 41.597  -14.474 1.00 21.57  ? 395 ARG A CA  1 
ATOM   2912 C C   . ARG A 1 395 ? -31.528 41.396  -12.980 1.00 23.20  ? 395 ARG A C   1 
ATOM   2913 O O   . ARG A 1 395 ? -31.925 40.395  -12.333 1.00 22.81  ? 395 ARG A O   1 
ATOM   2914 C CB  . ARG A 1 395 ? -30.654 41.691  -15.340 1.00 20.20  ? 395 ARG A CB  1 
ATOM   2915 C CG  . ARG A 1 395 ? -29.961 40.385  -15.603 1.00 18.66  ? 395 ARG A CG  1 
ATOM   2916 C CD  . ARG A 1 395 ? -28.629 40.622  -16.267 1.00 19.52  ? 395 ARG A CD  1 
ATOM   2917 N NE  . ARG A 1 395 ? -27.899 41.719  -15.615 1.00 20.19  ? 395 ARG A NE  1 
ATOM   2918 C CZ  . ARG A 1 395 ? -27.013 42.522  -16.222 1.00 20.71  ? 395 ARG A CZ  1 
ATOM   2919 N NH1 . ARG A 1 395 ? -26.701 42.392  -17.515 1.00 20.50  ? 395 ARG A NH1 1 
ATOM   2920 N NH2 . ARG A 1 395 ? -26.449 43.499  -15.538 1.00 20.25  ? 395 ARG A NH2 1 
ATOM   2921 N N   . GLU A 1 396 ? -30.829 42.387  -12.430 1.00 21.79  ? 396 GLU A N   1 
ATOM   2922 C CA  . GLU A 1 396 ? -30.486 42.401  -11.024 1.00 22.72  ? 396 GLU A CA  1 
ATOM   2923 C C   . GLU A 1 396 ? -31.690 42.157  -10.047 1.00 21.05  ? 396 GLU A C   1 
ATOM   2924 O O   . GLU A 1 396 ? -31.572 41.459  -9.012  1.00 20.09  ? 396 GLU A O   1 
ATOM   2925 C CB  . GLU A 1 396 ? -29.685 43.680  -10.703 1.00 25.25  ? 396 GLU A CB  1 
ATOM   2926 C CG  . GLU A 1 396 ? -28.166 43.611  -10.976 1.00 30.28  ? 396 GLU A CG  1 
ATOM   2927 C CD  . GLU A 1 396 ? -27.734 43.202  -12.444 1.00 38.25  ? 396 GLU A CD  1 
ATOM   2928 O OE1 . GLU A 1 396 ? -27.846 41.984  -12.875 1.00 37.85  ? 396 GLU A OE1 1 
ATOM   2929 O OE2 . GLU A 1 396 ? -27.221 44.101  -13.175 1.00 36.00  ? 396 GLU A OE2 1 
ATOM   2930 N N   . ALA A 1 397 ? -32.851 42.686  -10.390 1.00 18.58  ? 397 ALA A N   1 
ATOM   2931 C CA  . ALA A 1 397 ? -33.977 42.597  -9.496  1.00 17.61  ? 397 ALA A CA  1 
ATOM   2932 C C   . ALA A 1 397 ? -34.509 41.205  -9.455  1.00 19.23  ? 397 ALA A C   1 
ATOM   2933 O O   . ALA A 1 397 ? -34.834 40.674  -8.365  1.00 19.40  ? 397 ALA A O   1 
ATOM   2934 C CB  . ALA A 1 397 ? -35.075 43.514  -9.957  1.00 17.20  ? 397 ALA A CB  1 
ATOM   2935 N N   . LEU A 1 398 ? -34.634 40.601  -10.647 1.00 19.96  ? 398 LEU A N   1 
ATOM   2936 C CA  . LEU A 1 398 ? -35.200 39.265  -10.709 1.00 19.06  ? 398 LEU A CA  1 
ATOM   2937 C C   . LEU A 1 398 ? -34.223 38.343  -10.028 1.00 19.55  ? 398 LEU A C   1 
ATOM   2938 O O   . LEU A 1 398 ? -34.599 37.545  -9.193  1.00 20.62  ? 398 LEU A O   1 
ATOM   2939 C CB  . LEU A 1 398 ? -35.432 38.849  -12.126 1.00 18.18  ? 398 LEU A CB  1 
ATOM   2940 C CG  . LEU A 1 398 ? -36.062 37.472  -12.253 1.00 16.97  ? 398 LEU A CG  1 
ATOM   2941 C CD1 . LEU A 1 398 ? -37.421 37.365  -11.590 1.00 16.63  ? 398 LEU A CD1 1 
ATOM   2942 C CD2 . LEU A 1 398 ? -36.121 37.097  -13.703 1.00 16.21  ? 398 LEU A CD2 1 
ATOM   2943 N N   . SER A 1 399 ? -32.942 38.518  -10.319 1.00 19.78  ? 399 SER A N   1 
ATOM   2944 C CA  . SER A 1 399 ? -31.906 37.891  -9.487  1.00 18.31  ? 399 SER A CA  1 
ATOM   2945 C C   . SER A 1 399 ? -32.174 37.974  -7.983  1.00 18.34  ? 399 SER A C   1 
ATOM   2946 O O   . SER A 1 399 ? -32.192 36.960  -7.287  1.00 18.27  ? 399 SER A O   1 
ATOM   2947 C CB  . SER A 1 399 ? -30.572 38.477  -9.839  1.00 17.01  ? 399 SER A CB  1 
ATOM   2948 O OG  . SER A 1 399 ? -29.589 37.979  -9.006  1.00 17.44  ? 399 SER A OG  1 
ATOM   2949 N N   . ASP A 1 400 ? -32.450 39.173  -7.490  1.00 19.61  ? 400 ASP A N   1 
ATOM   2950 C CA  . ASP A 1 400 ? -32.732 39.325  -6.056  1.00 20.44  ? 400 ASP A CA  1 
ATOM   2951 C C   . ASP A 1 400 ? -33.989 38.586  -5.610  1.00 18.27  ? 400 ASP A C   1 
ATOM   2952 O O   . ASP A 1 400 ? -34.052 38.024  -4.532  1.00 17.16  ? 400 ASP A O   1 
ATOM   2953 C CB  . ASP A 1 400 ? -32.901 40.795  -5.690  1.00 23.79  ? 400 ASP A CB  1 
ATOM   2954 C CG  . ASP A 1 400 ? -31.653 41.644  -5.931  1.00 26.04  ? 400 ASP A CG  1 
ATOM   2955 O OD1 . ASP A 1 400 ? -30.533 41.154  -5.994  1.00 27.26  ? 400 ASP A OD1 1 
ATOM   2956 O OD2 . ASP A 1 400 ? -31.792 42.870  -6.055  1.00 31.37  ? 400 ASP A OD2 1 
ATOM   2957 N N   . VAL A 1 401 ? -35.017 38.642  -6.427  1.00 17.61  ? 401 VAL A N   1 
ATOM   2958 C CA  . VAL A 1 401 ? -36.262 37.948  -6.102  1.00 17.98  ? 401 VAL A CA  1 
ATOM   2959 C C   . VAL A 1 401 ? -35.979 36.469  -5.829  1.00 18.26  ? 401 VAL A C   1 
ATOM   2960 O O   . VAL A 1 401 ? -36.424 35.890  -4.798  1.00 18.19  ? 401 VAL A O   1 
ATOM   2961 C CB  . VAL A 1 401 ? -37.225 38.035  -7.295  1.00 17.45  ? 401 VAL A CB  1 
ATOM   2962 C CG1 . VAL A 1 401 ? -38.431 37.128  -7.142  1.00 15.29  ? 401 VAL A CG1 1 
ATOM   2963 C CG2 . VAL A 1 401 ? -37.630 39.481  -7.479  1.00 18.42  ? 401 VAL A CG2 1 
ATOM   2964 N N   . VAL A 1 402 ? -35.266 35.852  -6.762  1.00 16.53  ? 402 VAL A N   1 
ATOM   2965 C CA  . VAL A 1 402 ? -34.953 34.456  -6.635  1.00 16.68  ? 402 VAL A CA  1 
ATOM   2966 C C   . VAL A 1 402 ? -34.013 34.211  -5.434  1.00 17.79  ? 402 VAL A C   1 
ATOM   2967 O O   . VAL A 1 402 ? -34.267 33.307  -4.591  1.00 17.05  ? 402 VAL A O   1 
ATOM   2968 C CB  . VAL A 1 402 ? -34.385 33.933  -7.958  1.00 16.03  ? 402 VAL A CB  1 
ATOM   2969 C CG1 . VAL A 1 402 ? -33.994 32.498  -7.792  1.00 14.29  ? 402 VAL A CG1 1 
ATOM   2970 C CG2 . VAL A 1 402 ? -35.411 34.138  -9.092  1.00 15.11  ? 402 VAL A CG2 1 
ATOM   2971 N N   . GLY A 1 403 ? -32.976 35.053  -5.330  1.00 18.15  ? 403 GLY A N   1 
ATOM   2972 C CA  . GLY A 1 403 ? -32.066 35.041  -4.190  1.00 18.74  ? 403 GLY A CA  1 
ATOM   2973 C C   . GLY A 1 403 ? -32.721 35.199  -2.829  1.00 20.96  ? 403 GLY A C   1 
ATOM   2974 O O   . GLY A 1 403 ? -32.383 34.484  -1.869  1.00 23.16  ? 403 GLY A O   1 
ATOM   2975 N N   . ASP A 1 404 ? -33.649 36.141  -2.707  1.00 21.50  ? 404 ASP A N   1 
ATOM   2976 C CA  . ASP A 1 404 ? -34.066 36.555  -1.384  1.00 22.86  ? 404 ASP A CA  1 
ATOM   2977 C C   . ASP A 1 404 ? -35.026 35.527  -0.869  1.00 23.55  ? 404 ASP A C   1 
ATOM   2978 O O   . ASP A 1 404 ? -34.926 35.023  0.251   1.00 24.72  ? 404 ASP A O   1 
ATOM   2979 C CB  . ASP A 1 404 ? -34.722 37.919  -1.449  1.00 25.07  ? 404 ASP A CB  1 
ATOM   2980 C CG  . ASP A 1 404 ? -33.746 38.983  -1.788  1.00 27.74  ? 404 ASP A CG  1 
ATOM   2981 O OD1 . ASP A 1 404 ? -32.564 38.698  -1.632  1.00 31.16  ? 404 ASP A OD1 1 
ATOM   2982 O OD2 . ASP A 1 404 ? -34.108 40.093  -2.235  1.00 32.33  ? 404 ASP A OD2 1 
ATOM   2983 N N   . HIS A 1 405 ? -35.948 35.211  -1.746  1.00 22.23  ? 405 HIS A N   1 
ATOM   2984 C CA  . HIS A 1 405 ? -37.011 34.283  -1.508  1.00 22.20  ? 405 HIS A CA  1 
ATOM   2985 C C   . HIS A 1 405 ? -36.463 32.895  -1.105  1.00 23.33  ? 405 HIS A C   1 
ATOM   2986 O O   . HIS A 1 405 ? -36.974 32.295  -0.160  1.00 25.09  ? 405 HIS A O   1 
ATOM   2987 C CB  . HIS A 1 405 ? -37.853 34.253  -2.788  1.00 20.11  ? 405 HIS A CB  1 
ATOM   2988 C CG  . HIS A 1 405 ? -38.865 33.168  -2.822  1.00 21.04  ? 405 HIS A CG  1 
ATOM   2989 N ND1 . HIS A 1 405 ? -39.760 32.959  -1.788  1.00 22.09  ? 405 HIS A ND1 1 
ATOM   2990 C CD2 . HIS A 1 405 ? -39.150 32.244  -3.778  1.00 19.93  ? 405 HIS A CD2 1 
ATOM   2991 C CE1 . HIS A 1 405 ? -40.568 31.959  -2.115  1.00 22.58  ? 405 HIS A CE1 1 
ATOM   2992 N NE2 . HIS A 1 405 ? -40.203 31.497  -3.306  1.00 21.30  ? 405 HIS A NE2 1 
ATOM   2993 N N   . ASN A 1 406 ? -35.403 32.427  -1.784  1.00 22.53  ? 406 ASN A N   1 
ATOM   2994 C CA  . ASN A 1 406 ? -34.921 31.052  -1.625  1.00 22.08  ? 406 ASN A CA  1 
ATOM   2995 C C   . ASN A 1 406 ? -33.801 30.925  -0.612  1.00 21.73  ? 406 ASN A C   1 
ATOM   2996 O O   . ASN A 1 406 ? -33.614 29.873  0.017   1.00 23.25  ? 406 ASN A O   1 
ATOM   2997 C CB  . ASN A 1 406 ? -34.425 30.502  -2.970  1.00 21.68  ? 406 ASN A CB  1 
ATOM   2998 C CG  . ASN A 1 406 ? -35.566 30.111  -3.904  1.00 21.20  ? 406 ASN A CG  1 
ATOM   2999 O OD1 . ASN A 1 406 ? -36.415 29.292  -3.546  1.00 22.07  ? 406 ASN A OD1 1 
ATOM   3000 N ND2 . ASN A 1 406 ? -35.604 30.707  -5.100  1.00 21.03  ? 406 ASN A ND2 1 
ATOM   3001 N N   . VAL A 1 407 ? -33.004 31.961  -0.474  1.00 19.07  ? 407 VAL A N   1 
ATOM   3002 C CA  . VAL A 1 407 ? -31.831 31.742  0.310   1.00 18.42  ? 407 VAL A CA  1 
ATOM   3003 C C   . VAL A 1 407 ? -31.680 32.802  1.363   1.00 19.62  ? 407 VAL A C   1 
ATOM   3004 O O   . VAL A 1 407 ? -31.614 32.421  2.543   1.00 19.73  ? 407 VAL A O   1 
ATOM   3005 C CB  . VAL A 1 407 ? -30.518 31.614  -0.530  1.00 17.45  ? 407 VAL A CB  1 
ATOM   3006 C CG1 . VAL A 1 407 ? -29.289 31.443  0.390   1.00 15.72  ? 407 VAL A CG1 1 
ATOM   3007 C CG2 . VAL A 1 407 ? -30.637 30.511  -1.568  1.00 15.96  ? 407 VAL A CG2 1 
ATOM   3008 N N   . VAL A 1 408 ? -31.619 34.098  0.978   1.00 19.74  ? 408 VAL A N   1 
ATOM   3009 C CA  . VAL A 1 408 ? -31.262 35.130  1.980   1.00 21.11  ? 408 VAL A CA  1 
ATOM   3010 C C   . VAL A 1 408 ? -32.333 35.278  3.077   1.00 22.11  ? 408 VAL A C   1 
ATOM   3011 O O   . VAL A 1 408 ? -32.027 35.298  4.284   1.00 21.24  ? 408 VAL A O   1 
ATOM   3012 C CB  . VAL A 1 408 ? -30.974 36.528  1.400   1.00 22.52  ? 408 VAL A CB  1 
ATOM   3013 C CG1 . VAL A 1 408 ? -30.611 37.481  2.517   1.00 21.57  ? 408 VAL A CG1 1 
ATOM   3014 C CG2 . VAL A 1 408 ? -29.861 36.536  0.354   1.00 22.30  ? 408 VAL A CG2 1 
ATOM   3015 N N   . CYS A 1 409 ? -33.591 35.324  2.674   1.00 22.50  ? 409 CYS A N   1 
ATOM   3016 C CA  . CYS A 1 409 ? -34.614 35.443  3.684   1.00 25.49  ? 409 CYS A CA  1 
ATOM   3017 C C   . CYS A 1 409 ? -34.816 34.234  4.561   1.00 26.60  ? 409 CYS A C   1 
ATOM   3018 O O   . CYS A 1 409 ? -35.002 34.395  5.770   1.00 33.49  ? 409 CYS A O   1 
ATOM   3019 C CB  . CYS A 1 409 ? -35.921 36.085  3.149   1.00 27.53  ? 409 CYS A CB  1 
ATOM   3020 S SG  . CYS A 1 409 ? -35.572 37.683  2.326   1.00 27.04  ? 409 CYS A SG  1 
ATOM   3021 N N   . PRO A 1 410 ? -34.744 33.014  3.999   1.00 25.53  ? 410 PRO A N   1 
ATOM   3022 C CA  . PRO A 1 410 ? -34.871 31.952  5.000   1.00 23.05  ? 410 PRO A CA  1 
ATOM   3023 C C   . PRO A 1 410 ? -33.697 31.938  5.985   1.00 22.44  ? 410 PRO A C   1 
ATOM   3024 O O   . PRO A 1 410 ? -33.893 31.706  7.188   1.00 23.05  ? 410 PRO A O   1 
ATOM   3025 C CB  . PRO A 1 410 ? -34.902 30.698  4.150   1.00 22.19  ? 410 PRO A CB  1 
ATOM   3026 C CG  . PRO A 1 410 ? -35.517 31.167  2.842   1.00 22.61  ? 410 PRO A CG  1 
ATOM   3027 C CD  . PRO A 1 410 ? -34.871 32.489  2.619   1.00 23.66  ? 410 PRO A CD  1 
ATOM   3028 N N   . VAL A 1 411 ? -32.488 32.188  5.487   1.00 20.98  ? 411 VAL A N   1 
ATOM   3029 C CA  . VAL A 1 411 ? -31.300 32.170  6.325   1.00 19.86  ? 411 VAL A CA  1 
ATOM   3030 C C   . VAL A 1 411 ? -31.462 33.232  7.414   1.00 20.72  ? 411 VAL A C   1 
ATOM   3031 O O   . VAL A 1 411 ? -31.341 32.929  8.566   1.00 20.06  ? 411 VAL A O   1 
ATOM   3032 C CB  . VAL A 1 411 ? -30.022 32.421  5.489   1.00 18.74  ? 411 VAL A CB  1 
ATOM   3033 C CG1 . VAL A 1 411 ? -28.914 32.993  6.332   1.00 18.38  ? 411 VAL A CG1 1 
ATOM   3034 C CG2 . VAL A 1 411 ? -29.553 31.146  4.884   1.00 17.81  ? 411 VAL A CG2 1 
ATOM   3035 N N   . ALA A 1 412 ? -31.769 34.476  7.044   1.00 23.62  ? 412 ALA A N   1 
ATOM   3036 C CA  . ALA A 1 412 ? -31.951 35.577  8.046   1.00 22.94  ? 412 ALA A CA  1 
ATOM   3037 C C   . ALA A 1 412 ? -32.992 35.251  9.119   1.00 21.50  ? 412 ALA A C   1 
ATOM   3038 O O   . ALA A 1 412 ? -32.768 35.535  10.282  1.00 20.73  ? 412 ALA A O   1 
ATOM   3039 C CB  . ALA A 1 412 ? -32.277 36.896  7.369   1.00 21.00  ? 412 ALA A CB  1 
ATOM   3040 N N   . GLN A 1 413 ? -34.110 34.652  8.725   1.00 21.03  ? 413 GLN A N   1 
ATOM   3041 C CA  . GLN A 1 413 ? -35.103 34.262  9.690   1.00 23.12  ? 413 GLN A CA  1 
ATOM   3042 C C   . GLN A 1 413 ? -34.442 33.299  10.633  1.00 24.63  ? 413 GLN A C   1 
ATOM   3043 O O   . GLN A 1 413 ? -34.423 33.533  11.830  1.00 30.96  ? 413 GLN A O   1 
ATOM   3044 C CB  . GLN A 1 413 ? -36.332 33.628  9.040   1.00 24.42  ? 413 GLN A CB  1 
ATOM   3045 C CG  . GLN A 1 413 ? -37.595 33.805  9.849   1.00 31.66  ? 413 GLN A CG  1 
ATOM   3046 C CD  . GLN A 1 413 ? -38.716 32.985  9.257   1.00 42.67  ? 413 GLN A CD  1 
ATOM   3047 O OE1 . GLN A 1 413 ? -38.928 31.831  9.645   1.00 55.02  ? 413 GLN A OE1 1 
ATOM   3048 N NE2 . GLN A 1 413 ? -39.442 33.557  8.282   1.00 44.81  ? 413 GLN A NE2 1 
ATOM   3049 N N   . LEU A 1 414 ? -33.881 32.218  10.107  1.00 25.08  ? 414 LEU A N   1 
ATOM   3050 C CA  . LEU A 1 414 ? -33.250 31.225  10.943  1.00 25.29  ? 414 LEU A CA  1 
ATOM   3051 C C   . LEU A 1 414 ? -32.216 31.850  11.928  1.00 26.99  ? 414 LEU A C   1 
ATOM   3052 O O   . LEU A 1 414 ? -32.198 31.554  13.131  1.00 26.58  ? 414 LEU A O   1 
ATOM   3053 C CB  . LEU A 1 414 ? -32.577 30.198  10.056  1.00 23.15  ? 414 LEU A CB  1 
ATOM   3054 C CG  . LEU A 1 414 ? -31.781 29.128  10.822  1.00 22.27  ? 414 LEU A CG  1 
ATOM   3055 C CD1 . LEU A 1 414 ? -32.721 28.215  11.615  1.00 18.98  ? 414 LEU A CD1 1 
ATOM   3056 C CD2 . LEU A 1 414 ? -30.938 28.320  9.864   1.00 18.96  ? 414 LEU A CD2 1 
ATOM   3057 N N   . ALA A 1 415 ? -31.392 32.746  11.399  1.00 28.18  ? 415 ALA A N   1 
ATOM   3058 C CA  . ALA A 1 415 ? -30.268 33.313  12.137  1.00 29.92  ? 415 ALA A CA  1 
ATOM   3059 C C   . ALA A 1 415 ? -30.805 34.066  13.333  1.00 33.05  ? 415 ALA A C   1 
ATOM   3060 O O   . ALA A 1 415 ? -30.388 33.815  14.469  1.00 36.42  ? 415 ALA A O   1 
ATOM   3061 C CB  . ALA A 1 415 ? -29.403 34.195  11.238  1.00 23.18  ? 415 ALA A CB  1 
ATOM   3062 N N   . GLY A 1 416 ? -31.764 34.949  13.063  1.00 35.29  ? 416 GLY A N   1 
ATOM   3063 C CA  . GLY A 1 416 ? -32.413 35.754  14.076  1.00 34.42  ? 416 GLY A CA  1 
ATOM   3064 C C   . GLY A 1 416 ? -33.088 34.913  15.139  1.00 33.85  ? 416 GLY A C   1 
ATOM   3065 O O   . GLY A 1 416 ? -32.860 35.137  16.319  1.00 36.04  ? 416 GLY A O   1 
ATOM   3066 N N   . ARG A 1 417 ? -33.907 33.945  14.733  1.00 30.03  ? 417 ARG A N   1 
ATOM   3067 C CA  . ARG A 1 417 ? -34.615 33.112  15.683  1.00 29.22  ? 417 ARG A CA  1 
ATOM   3068 C C   . ARG A 1 417 ? -33.640 32.335  16.593  1.00 33.31  ? 417 ARG A C   1 
ATOM   3069 O O   . ARG A 1 417 ? -33.910 32.168  17.782  1.00 35.83  ? 417 ARG A O   1 
ATOM   3070 C CB  . ARG A 1 417 ? -35.565 32.177  14.941  1.00 28.93  ? 417 ARG A CB  1 
ATOM   3071 C CG  . ARG A 1 417 ? -36.929 32.772  14.653  1.00 28.23  ? 417 ARG A CG  1 
ATOM   3072 C CD  . ARG A 1 417 ? -37.574 33.289  15.944  1.00 30.52  ? 417 ARG A CD  1 
ATOM   3073 N NE  . ARG A 1 417 ? -39.043 33.399  15.916  1.00 32.37  ? 417 ARG A NE  1 
ATOM   3074 C CZ  . ARG A 1 417 ? -39.839 32.813  16.807  1.00 34.20  ? 417 ARG A CZ  1 
ATOM   3075 N NH1 . ARG A 1 417 ? -39.303 32.092  17.772  1.00 37.35  ? 417 ARG A NH1 1 
ATOM   3076 N NH2 . ARG A 1 417 ? -41.162 32.921  16.748  1.00 37.17  ? 417 ARG A NH2 1 
ATOM   3077 N N   . LEU A 1 418 ? -32.502 31.883  16.047  1.00 33.52  ? 418 LEU A N   1 
ATOM   3078 C CA  . LEU A 1 418 ? -31.486 31.210  16.846  1.00 32.93  ? 418 LEU A CA  1 
ATOM   3079 C C   . LEU A 1 418 ? -30.834 32.129  17.899  1.00 36.38  ? 418 LEU A C   1 
ATOM   3080 O O   . LEU A 1 418 ? -30.692 31.733  19.061  1.00 40.54  ? 418 LEU A O   1 
ATOM   3081 C CB  . LEU A 1 418 ? -30.393 30.563  15.980  1.00 31.92  ? 418 LEU A CB  1 
ATOM   3082 C CG  . LEU A 1 418 ? -30.701 29.368  15.039  1.00 33.66  ? 418 LEU A CG  1 
ATOM   3083 C CD1 . LEU A 1 418 ? -29.624 29.121  13.969  1.00 30.63  ? 418 LEU A CD1 1 
ATOM   3084 C CD2 . LEU A 1 418 ? -31.047 28.073  15.762  1.00 30.34  ? 418 LEU A CD2 1 
ATOM   3085 N N   . ALA A 1 419 ? -30.439 33.341  17.509  1.00 33.33  ? 419 ALA A N   1 
ATOM   3086 C CA  . ALA A 1 419 ? -29.735 34.226  18.437  1.00 32.70  ? 419 ALA A CA  1 
ATOM   3087 C C   . ALA A 1 419 ? -30.656 34.588  19.627  1.00 35.14  ? 419 ALA A C   1 
ATOM   3088 O O   . ALA A 1 419 ? -30.255 34.545  20.803  1.00 38.02  ? 419 ALA A O   1 
ATOM   3089 C CB  . ALA A 1 419 ? -29.173 35.460  17.719  1.00 27.08  ? 419 ALA A CB  1 
ATOM   3090 N N   . ALA A 1 420 ? -31.915 34.851  19.289  1.00 36.81  ? 420 ALA A N   1 
ATOM   3091 C CA  . ALA A 1 420 ? -32.958 35.243  20.215  1.00 34.66  ? 420 ALA A CA  1 
ATOM   3092 C C   . ALA A 1 420 ? -33.238 34.130  21.178  1.00 37.52  ? 420 ALA A C   1 
ATOM   3093 O O   . ALA A 1 420 ? -33.894 34.373  22.186  1.00 43.38  ? 420 ALA A O   1 
ATOM   3094 C CB  . ALA A 1 420 ? -34.237 35.576  19.462  1.00 31.74  ? 420 ALA A CB  1 
ATOM   3095 N N   . GLN A 1 421 ? -32.787 32.906  20.884  1.00 35.89  ? 421 GLN A N   1 
ATOM   3096 C CA  . GLN A 1 421 ? -33.239 31.760  21.688  1.00 32.37  ? 421 GLN A CA  1 
ATOM   3097 C C   . GLN A 1 421 ? -32.088 30.990  22.262  1.00 32.51  ? 421 GLN A C   1 
ATOM   3098 O O   . GLN A 1 421 ? -32.202 29.791  22.490  1.00 32.83  ? 421 GLN A O   1 
ATOM   3099 C CB  . GLN A 1 421 ? -34.125 30.840  20.881  1.00 30.96  ? 421 GLN A CB  1 
ATOM   3100 C CG  . GLN A 1 421 ? -35.570 31.242  20.855  1.00 30.76  ? 421 GLN A CG  1 
ATOM   3101 C CD  . GLN A 1 421 ? -36.322 30.793  19.586  1.00 33.75  ? 421 GLN A CD  1 
ATOM   3102 O OE1 . GLN A 1 421 ? -36.917 31.627  18.898  1.00 33.84  ? 421 GLN A OE1 1 
ATOM   3103 N NE2 . GLN A 1 421 ? -36.323 29.474  19.285  1.00 34.57  ? 421 GLN A NE2 1 
ATOM   3104 N N   . GLY A 1 422 ? -30.971 31.680  22.489  1.00 35.20  ? 422 GLY A N   1 
ATOM   3105 C CA  . GLY A 1 422 ? -29.849 31.070  23.191  1.00 37.20  ? 422 GLY A CA  1 
ATOM   3106 C C   . GLY A 1 422 ? -28.578 30.721  22.453  1.00 37.96  ? 422 GLY A C   1 
ATOM   3107 O O   . GLY A 1 422 ? -27.599 30.347  23.073  1.00 41.58  ? 422 GLY A O   1 
ATOM   3108 N N   . ALA A 1 423 ? -28.573 30.846  21.135  1.00 35.77  ? 423 ALA A N   1 
ATOM   3109 C CA  . ALA A 1 423 ? -27.455 30.382  20.366  1.00 31.53  ? 423 ALA A CA  1 
ATOM   3110 C C   . ALA A 1 423 ? -26.508 31.523  20.107  1.00 30.38  ? 423 ALA A C   1 
ATOM   3111 O O   . ALA A 1 423 ? -26.932 32.643  19.952  1.00 37.93  ? 423 ALA A O   1 
ATOM   3112 C CB  . ALA A 1 423 ? -27.965 29.810  19.078  1.00 30.40  ? 423 ALA A CB  1 
ATOM   3113 N N   . ARG A 1 424 ? -25.224 31.255  20.078  1.00 27.92  ? 424 ARG A N   1 
ATOM   3114 C CA  . ARG A 1 424 ? -24.248 32.236  19.641  1.00 29.20  ? 424 ARG A CA  1 
ATOM   3115 C C   . ARG A 1 424 ? -24.084 32.058  18.103  1.00 31.19  ? 424 ARG A C   1 
ATOM   3116 O O   . ARG A 1 424 ? -23.835 30.928  17.636  1.00 33.51  ? 424 ARG A O   1 
ATOM   3117 C CB  . ARG A 1 424 ? -22.959 31.958  20.391  1.00 31.44  ? 424 ARG A CB  1 
ATOM   3118 C CG  . ARG A 1 424 ? -21.768 32.820  20.064  1.00 41.35  ? 424 ARG A CG  1 
ATOM   3119 C CD  . ARG A 1 424 ? -20.589 32.462  21.006  1.00 54.95  ? 424 ARG A CD  1 
ATOM   3120 N NE  . ARG A 1 424 ? -19.936 33.709  21.397  1.00 65.62  ? 424 ARG A NE  1 
ATOM   3121 C CZ  . ARG A 1 424 ? -20.548 34.725  22.037  1.00 66.21  ? 424 ARG A CZ  1 
ATOM   3122 N NH1 . ARG A 1 424 ? -21.824 34.656  22.410  1.00 67.87  ? 424 ARG A NH1 1 
ATOM   3123 N NH2 . ARG A 1 424 ? -19.884 35.833  22.316  1.00 66.10  ? 424 ARG A NH2 1 
ATOM   3124 N N   . VAL A 1 425 ? -24.238 33.135  17.319  1.00 25.97  ? 425 VAL A N   1 
ATOM   3125 C CA  . VAL A 1 425 ? -24.390 33.035  15.871  1.00 23.68  ? 425 VAL A CA  1 
ATOM   3126 C C   . VAL A 1 425 ? -23.454 34.053  15.188  1.00 25.48  ? 425 VAL A C   1 
ATOM   3127 O O   . VAL A 1 425 ? -23.431 35.212  15.582  1.00 28.98  ? 425 VAL A O   1 
ATOM   3128 C CB  . VAL A 1 425 ? -25.872 33.345  15.491  1.00 24.18  ? 425 VAL A CB  1 
ATOM   3129 C CG1 . VAL A 1 425 ? -26.108 33.295  13.994  1.00 25.76  ? 425 VAL A CG1 1 
ATOM   3130 C CG2 . VAL A 1 425 ? -26.877 32.436  16.194  1.00 23.07  ? 425 VAL A CG2 1 
ATOM   3131 N N   . TYR A 1 426 ? -22.644 33.654  14.206  1.00 24.45  ? 426 TYR A N   1 
ATOM   3132 C CA  . TYR A 1 426 ? -21.919 34.649  13.400  1.00 25.12  ? 426 TYR A CA  1 
ATOM   3133 C C   . TYR A 1 426 ? -22.412 34.635  11.950  1.00 27.06  ? 426 TYR A C   1 
ATOM   3134 O O   . TYR A 1 426 ? -22.951 33.635  11.514  1.00 28.96  ? 426 TYR A O   1 
ATOM   3135 C CB  . TYR A 1 426 ? -20.419 34.483  13.450  1.00 25.03  ? 426 TYR A CB  1 
ATOM   3136 C CG  . TYR A 1 426 ? -19.869 34.473  14.841  1.00 29.86  ? 426 TYR A CG  1 
ATOM   3137 C CD1 . TYR A 1 426 ? -20.037 33.358  15.655  1.00 30.15  ? 426 TYR A CD1 1 
ATOM   3138 C CD2 . TYR A 1 426 ? -19.157 35.572  15.352  1.00 33.23  ? 426 TYR A CD2 1 
ATOM   3139 C CE1 . TYR A 1 426 ? -19.541 33.318  16.928  1.00 33.21  ? 426 TYR A CE1 1 
ATOM   3140 C CE2 . TYR A 1 426 ? -18.651 35.553  16.655  1.00 35.49  ? 426 TYR A CE2 1 
ATOM   3141 C CZ  . TYR A 1 426 ? -18.843 34.407  17.427  1.00 37.39  ? 426 TYR A CZ  1 
ATOM   3142 O OH  . TYR A 1 426 ? -18.353 34.309  18.712  1.00 43.78  ? 426 TYR A OH  1 
ATOM   3143 N N   . ALA A 1 427 ? -22.272 35.742  11.207  1.00 27.32  ? 427 ALA A N   1 
ATOM   3144 C CA  . ALA A 1 427 ? -22.889 35.804  9.900   1.00 23.68  ? 427 ALA A CA  1 
ATOM   3145 C C   . ALA A 1 427 ? -22.022 36.501  8.880   1.00 23.84  ? 427 ALA A C   1 
ATOM   3146 O O   . ALA A 1 427 ? -21.316 37.452  9.246   1.00 26.80  ? 427 ALA A O   1 
ATOM   3147 C CB  . ALA A 1 427 ? -24.206 36.499  10.035  1.00 24.22  ? 427 ALA A CB  1 
ATOM   3148 N N   . TYR A 1 428 ? -22.058 36.062  7.616   1.00 21.87  ? 428 TYR A N   1 
ATOM   3149 C CA  . TYR A 1 428 ? -21.223 36.723  6.585   1.00 23.85  ? 428 TYR A CA  1 
ATOM   3150 C C   . TYR A 1 428 ? -21.979 36.917  5.286   1.00 23.66  ? 428 TYR A C   1 
ATOM   3151 O O   . TYR A 1 428 ? -22.995 36.266  5.051   1.00 25.55  ? 428 TYR A O   1 
ATOM   3152 C CB  . TYR A 1 428 ? -19.914 35.930  6.268   1.00 24.62  ? 428 TYR A CB  1 
ATOM   3153 C CG  . TYR A 1 428 ? -20.216 34.567  5.681   1.00 27.72  ? 428 TYR A CG  1 
ATOM   3154 C CD1 . TYR A 1 428 ? -20.360 34.389  4.301   1.00 28.28  ? 428 TYR A CD1 1 
ATOM   3155 C CD2 . TYR A 1 428 ? -20.448 33.460  6.520   1.00 29.21  ? 428 TYR A CD2 1 
ATOM   3156 C CE1 . TYR A 1 428 ? -20.703 33.142  3.769   1.00 28.25  ? 428 TYR A CE1 1 
ATOM   3157 C CE2 . TYR A 1 428 ? -20.773 32.213  5.998   1.00 28.17  ? 428 TYR A CE2 1 
ATOM   3158 C CZ  . TYR A 1 428 ? -20.891 32.048  4.626   1.00 27.47  ? 428 TYR A CZ  1 
ATOM   3159 O OH  . TYR A 1 428 ? -21.241 30.799  4.121   1.00 26.25  ? 428 TYR A OH  1 
ATOM   3160 N N   . VAL A 1 429 ? -21.450 37.792  4.452   1.00 22.36  ? 429 VAL A N   1 
ATOM   3161 C CA  . VAL A 1 429 ? -21.750 37.806  3.047   1.00 25.47  ? 429 VAL A CA  1 
ATOM   3162 C C   . VAL A 1 429 ? -20.423 37.623  2.322   1.00 26.79  ? 429 VAL A C   1 
ATOM   3163 O O   . VAL A 1 429 ? -19.415 38.322  2.630   1.00 29.46  ? 429 VAL A O   1 
ATOM   3164 C CB  . VAL A 1 429 ? -22.372 39.175  2.610   1.00 27.62  ? 429 VAL A CB  1 
ATOM   3165 C CG1 . VAL A 1 429 ? -22.221 39.448  1.126   1.00 24.32  ? 429 VAL A CG1 1 
ATOM   3166 C CG2 . VAL A 1 429 ? -23.843 39.212  2.932   1.00 31.06  ? 429 VAL A CG2 1 
ATOM   3167 N N   . PHE A 1 430 ? -20.417 36.729  1.341   1.00 25.07  ? 430 PHE A N   1 
ATOM   3168 C CA  . PHE A 1 430 ? -19.177 36.417  0.644   1.00 26.56  ? 430 PHE A CA  1 
ATOM   3169 C C   . PHE A 1 430 ? -19.160 37.258  -0.621  1.00 26.51  ? 430 PHE A C   1 
ATOM   3170 O O   . PHE A 1 430 ? -20.063 37.145  -1.448  1.00 28.06  ? 430 PHE A O   1 
ATOM   3171 C CB  . PHE A 1 430 ? -19.057 34.880  0.381   1.00 26.54  ? 430 PHE A CB  1 
ATOM   3172 C CG  . PHE A 1 430 ? -17.764 34.484  -0.266  1.00 27.31  ? 430 PHE A CG  1 
ATOM   3173 C CD1 . PHE A 1 430 ? -17.564 34.660  -1.639  1.00 26.59  ? 430 PHE A CD1 1 
ATOM   3174 C CD2 . PHE A 1 430 ? -16.726 33.992  0.495   1.00 29.29  ? 430 PHE A CD2 1 
ATOM   3175 C CE1 . PHE A 1 430 ? -16.360 34.361  -2.239  1.00 27.38  ? 430 PHE A CE1 1 
ATOM   3176 C CE2 . PHE A 1 430 ? -15.499 33.694  -0.107  1.00 31.70  ? 430 PHE A CE2 1 
ATOM   3177 C CZ  . PHE A 1 430 ? -15.321 33.875  -1.481  1.00 29.26  ? 430 PHE A CZ  1 
ATOM   3178 N N   . GLU A 1 431 ? -18.171 38.124  -0.780  1.00 26.23  ? 431 GLU A N   1 
ATOM   3179 C CA  . GLU A 1 431 ? -18.273 39.144  -1.846  1.00 25.86  ? 431 GLU A CA  1 
ATOM   3180 C C   . GLU A 1 431 ? -17.155 39.171  -2.869  1.00 28.03  ? 431 GLU A C   1 
ATOM   3181 O O   . GLU A 1 431 ? -17.144 40.126  -3.616  1.00 29.03  ? 431 GLU A O   1 
ATOM   3182 C CB  . GLU A 1 431 ? -18.470 40.568  -1.308  1.00 25.69  ? 431 GLU A CB  1 
ATOM   3183 C CG  . GLU A 1 431 ? -19.799 40.806  -0.583  1.00 30.71  ? 431 GLU A CG  1 
ATOM   3184 C CD  . GLU A 1 431 ? -20.068 42.276  -0.204  1.00 34.50  ? 431 GLU A CD  1 
ATOM   3185 O OE1 . GLU A 1 431 ? -19.259 42.877  0.532   1.00 41.69  ? 431 GLU A OE1 1 
ATOM   3186 O OE2 . GLU A 1 431 ? -21.103 42.840  -0.612  1.00 34.08  ? 431 GLU A OE2 1 
ATOM   3187 N N   . HIS A 1 432 ? -16.257 38.156  -2.925  1.00 28.56  ? 432 HIS A N   1 
ATOM   3188 C CA  . HIS A 1 432 ? -15.213 38.009  -3.977  1.00 25.50  ? 432 HIS A CA  1 
ATOM   3189 C C   . HIS A 1 432 ? -15.610 37.133  -5.192  1.00 26.50  ? 432 HIS A C   1 
ATOM   3190 O O   . HIS A 1 432 ? -15.958 35.946  -5.053  1.00 29.44  ? 432 HIS A O   1 
ATOM   3191 C CB  . HIS A 1 432 ? -13.944 37.420  -3.379  1.00 27.34  ? 432 HIS A CB  1 
ATOM   3192 C CG  . HIS A 1 432 ? -12.824 37.272  -4.367  1.00 28.55  ? 432 HIS A CG  1 
ATOM   3193 N ND1 . HIS A 1 432 ? -12.198 38.354  -4.963  1.00 29.01  ? 432 HIS A ND1 1 
ATOM   3194 C CD2 . HIS A 1 432 ? -12.205 36.170  -4.856  1.00 29.53  ? 432 HIS A CD2 1 
ATOM   3195 C CE1 . HIS A 1 432 ? -11.249 37.928  -5.781  1.00 27.41  ? 432 HIS A CE1 1 
ATOM   3196 N NE2 . HIS A 1 432 ? -11.240 36.605  -5.745  1.00 31.90  ? 432 HIS A NE2 1 
ATOM   3197 N N   . ARG A 1 433 ? -15.536 37.701  -6.393  1.00 25.25  ? 433 ARG A N   1 
ATOM   3198 C CA  . ARG A 1 433 ? -15.687 36.917  -7.606  1.00 23.53  ? 433 ARG A CA  1 
ATOM   3199 C C   . ARG A 1 433 ? -14.363 36.220  -7.889  1.00 23.88  ? 433 ARG A C   1 
ATOM   3200 O O   . ARG A 1 433 ? -13.371 36.895  -8.141  1.00 24.81  ? 433 ARG A O   1 
ATOM   3201 C CB  . ARG A 1 433 ? -16.021 37.818  -8.786  1.00 21.61  ? 433 ARG A CB  1 
ATOM   3202 C CG  . ARG A 1 433 ? -16.468 37.023  -9.984  1.00 22.77  ? 433 ARG A CG  1 
ATOM   3203 C CD  . ARG A 1 433 ? -16.979 37.895  -11.087 1.00 22.49  ? 433 ARG A CD  1 
ATOM   3204 N NE  . ARG A 1 433 ? -16.798 37.342  -12.428 1.00 23.33  ? 433 ARG A NE  1 
ATOM   3205 C CZ  . ARG A 1 433 ? -17.721 36.634  -13.063 1.00 25.91  ? 433 ARG A CZ  1 
ATOM   3206 N NH1 . ARG A 1 433 ? -18.867 36.348  -12.465 1.00 27.87  ? 433 ARG A NH1 1 
ATOM   3207 N NH2 . ARG A 1 433 ? -17.512 36.200  -14.289 1.00 25.34  ? 433 ARG A NH2 1 
ATOM   3208 N N   . ALA A 1 434 ? -14.318 34.890  -7.865  1.00 23.97  ? 434 ALA A N   1 
ATOM   3209 C CA  . ALA A 1 434 ? -13.072 34.215  -8.295  1.00 25.33  ? 434 ALA A CA  1 
ATOM   3210 C C   . ALA A 1 434 ? -12.520 34.755  -9.625  1.00 27.55  ? 434 ALA A C   1 
ATOM   3211 O O   . ALA A 1 434 ? -13.284 34.917  -10.595 1.00 28.80  ? 434 ALA A O   1 
ATOM   3212 C CB  . ALA A 1 434 ? -13.272 32.711  -8.403  1.00 24.56  ? 434 ALA A CB  1 
ATOM   3213 N N   . SER A 1 435 ? -11.210 35.031  -9.677  1.00 27.65  ? 435 SER A N   1 
ATOM   3214 C CA  . SER A 1 435 ? -10.561 35.439  -10.931 1.00 27.57  ? 435 SER A CA  1 
ATOM   3215 C C   . SER A 1 435 ? -10.703 34.347  -11.982 1.00 28.84  ? 435 SER A C   1 
ATOM   3216 O O   . SER A 1 435 ? -10.559 34.610  -13.148 1.00 29.17  ? 435 SER A O   1 
ATOM   3217 C CB  . SER A 1 435 ? -9.089  35.724  -10.729 1.00 25.50  ? 435 SER A CB  1 
ATOM   3218 O OG  . SER A 1 435 ? -8.474  34.524  -10.326 1.00 26.87  ? 435 SER A OG  1 
ATOM   3219 N N   . THR A 1 436 ? -10.978 33.114  -11.584 1.00 29.32  ? 436 THR A N   1 
ATOM   3220 C CA  . THR A 1 436 ? -11.068 32.056  -12.595 1.00 30.15  ? 436 THR A CA  1 
ATOM   3221 C C   . THR A 1 436 ? -12.498 31.699  -13.042 1.00 29.34  ? 436 THR A C   1 
ATOM   3222 O O   . THR A 1 436 ? -12.646 30.730  -13.781 1.00 30.81  ? 436 THR A O   1 
ATOM   3223 C CB  . THR A 1 436 ? -10.477 30.732  -12.085 1.00 30.30  ? 436 THR A CB  1 
ATOM   3224 O OG1 . THR A 1 436 ? -10.991 30.493  -10.769 1.00 33.24  ? 436 THR A OG1 1 
ATOM   3225 C CG2 . THR A 1 436 ? -8.950  30.720  -12.087 1.00 29.48  ? 436 THR A CG2 1 
ATOM   3226 N N   . LEU A 1 437 ? -13.537 32.430  -12.621 1.00 27.69  ? 437 LEU A N   1 
ATOM   3227 C CA  . LEU A 1 437 ? -14.949 31.967  -12.840 1.00 27.71  ? 437 LEU A CA  1 
ATOM   3228 C C   . LEU A 1 437 ? -15.358 31.957  -14.307 1.00 28.40  ? 437 LEU A C   1 
ATOM   3229 O O   . LEU A 1 437 ? -14.979 32.827  -15.052 1.00 30.46  ? 437 LEU A O   1 
ATOM   3230 C CB  . LEU A 1 437 ? -15.976 32.797  -12.062 1.00 26.44  ? 437 LEU A CB  1 
ATOM   3231 C CG  . LEU A 1 437 ? -16.969 32.082  -11.123 1.00 25.32  ? 437 LEU A CG  1 
ATOM   3232 C CD1 . LEU A 1 437 ? -17.717 33.173  -10.389 1.00 26.83  ? 437 LEU A CD1 1 
ATOM   3233 C CD2 . LEU A 1 437 ? -17.987 31.188  -11.800 1.00 25.68  ? 437 LEU A CD2 1 
ATOM   3234 N N   . SER A 1 438 ? -16.125 30.971  -14.743 1.00 28.63  ? 438 SER A N   1 
ATOM   3235 C CA  . SER A 1 438 ? -16.447 30.919  -16.161 1.00 27.27  ? 438 SER A CA  1 
ATOM   3236 C C   . SER A 1 438 ? -17.896 31.319  -16.399 1.00 27.01  ? 438 SER A C   1 
ATOM   3237 O O   . SER A 1 438 ? -18.316 31.503  -17.546 1.00 30.90  ? 438 SER A O   1 
ATOM   3238 C CB  . SER A 1 438 ? -16.193 29.515  -16.683 1.00 25.15  ? 438 SER A CB  1 
ATOM   3239 O OG  . SER A 1 438 ? -16.829 28.605  -15.795 1.00 26.20  ? 438 SER A OG  1 
ATOM   3240 N N   . TRP A 1 439 ? -18.702 31.417  -15.354 1.00 23.83  ? 439 TRP A N   1 
ATOM   3241 C CA  . TRP A 1 439 ? -20.019 32.004  -15.597 1.00 23.03  ? 439 TRP A CA  1 
ATOM   3242 C C   . TRP A 1 439 ? -19.884 33.483  -16.034 1.00 23.09  ? 439 TRP A C   1 
ATOM   3243 O O   . TRP A 1 439 ? -18.841 34.131  -15.783 1.00 25.54  ? 439 TRP A O   1 
ATOM   3244 C CB  . TRP A 1 439 ? -20.868 31.867  -14.381 1.00 20.61  ? 439 TRP A CB  1 
ATOM   3245 C CG  . TRP A 1 439 ? -21.240 30.464  -14.052 1.00 18.69  ? 439 TRP A CG  1 
ATOM   3246 C CD1 . TRP A 1 439 ? -20.656 29.664  -13.118 1.00 17.81  ? 439 TRP A CD1 1 
ATOM   3247 C CD2 . TRP A 1 439 ? -22.332 29.708  -14.615 1.00 17.20  ? 439 TRP A CD2 1 
ATOM   3248 N NE1 . TRP A 1 439 ? -21.327 28.455  -13.043 1.00 17.39  ? 439 TRP A NE1 1 
ATOM   3249 C CE2 . TRP A 1 439 ? -22.341 28.444  -13.966 1.00 17.31  ? 439 TRP A CE2 1 
ATOM   3250 C CE3 . TRP A 1 439 ? -23.273 29.959  -15.628 1.00 15.90  ? 439 TRP A CE3 1 
ATOM   3251 C CZ2 . TRP A 1 439 ? -23.246 27.423  -14.317 1.00 16.02  ? 439 TRP A CZ2 1 
ATOM   3252 C CZ3 . TRP A 1 439 ? -24.205 28.973  -15.946 1.00 14.88  ? 439 TRP A CZ3 1 
ATOM   3253 C CH2 . TRP A 1 439 ? -24.192 27.720  -15.280 1.00 15.28  ? 439 TRP A CH2 1 
ATOM   3254 N N   . PRO A 1 440 ? -20.902 34.038  -16.704 1.00 21.53  ? 440 PRO A N   1 
ATOM   3255 C CA  . PRO A 1 440 ? -20.674 35.451  -17.172 1.00 20.45  ? 440 PRO A CA  1 
ATOM   3256 C C   . PRO A 1 440 ? -20.487 36.521  -16.052 1.00 23.12  ? 440 PRO A C   1 
ATOM   3257 O O   . PRO A 1 440 ? -21.036 36.407  -14.920 1.00 22.18  ? 440 PRO A O   1 
ATOM   3258 C CB  . PRO A 1 440 ? -21.910 35.763  -17.982 1.00 18.47  ? 440 PRO A CB  1 
ATOM   3259 C CG  . PRO A 1 440 ? -22.952 34.830  -17.468 1.00 20.01  ? 440 PRO A CG  1 
ATOM   3260 C CD  . PRO A 1 440 ? -22.269 33.563  -16.952 1.00 20.61  ? 440 PRO A CD  1 
ATOM   3261 N N   . LEU A 1 441 ? -19.744 37.581  -16.378 1.00 25.25  ? 441 LEU A N   1 
ATOM   3262 C CA  . LEU A 1 441 ? -19.646 38.738  -15.471 1.00 25.16  ? 441 LEU A CA  1 
ATOM   3263 C C   . LEU A 1 441 ? -20.988 39.078  -14.818 1.00 24.56  ? 441 LEU A C   1 
ATOM   3264 O O   . LEU A 1 441 ? -21.087 39.161  -13.579 1.00 24.11  ? 441 LEU A O   1 
ATOM   3265 C CB  . LEU A 1 441 ? -19.151 39.968  -16.223 1.00 25.83  ? 441 LEU A CB  1 
ATOM   3266 C CG  . LEU A 1 441 ? -18.448 41.124  -15.495 1.00 25.18  ? 441 LEU A CG  1 
ATOM   3267 C CD1 . LEU A 1 441 ? -17.876 40.735  -14.126 1.00 25.63  ? 441 LEU A CD1 1 
ATOM   3268 C CD2 . LEU A 1 441 ? -17.353 41.635  -16.432 1.00 23.90  ? 441 LEU A CD2 1 
ATOM   3269 N N   . TRP A 1 442 ? -22.028 39.249  -15.636 1.00 22.24  ? 442 TRP A N   1 
ATOM   3270 C CA  . TRP A 1 442 ? -23.243 39.735  -15.050 1.00 20.44  ? 442 TRP A CA  1 
ATOM   3271 C C   . TRP A 1 442 ? -23.776 38.939  -13.876 1.00 21.10  ? 442 TRP A C   1 
ATOM   3272 O O   . TRP A 1 442 ? -24.431 39.518  -13.054 1.00 23.65  ? 442 TRP A O   1 
ATOM   3273 C CB  . TRP A 1 442 ? -24.307 40.023  -16.089 1.00 19.52  ? 442 TRP A CB  1 
ATOM   3274 C CG  . TRP A 1 442 ? -24.868 38.838  -16.763 1.00 21.04  ? 442 TRP A CG  1 
ATOM   3275 C CD1 . TRP A 1 442 ? -24.560 38.336  -18.076 1.00 20.76  ? 442 TRP A CD1 1 
ATOM   3276 C CD2 . TRP A 1 442 ? -25.876 37.954  -16.228 1.00 19.15  ? 442 TRP A CD2 1 
ATOM   3277 N NE1 . TRP A 1 442 ? -25.348 37.198  -18.335 1.00 18.40  ? 442 TRP A NE1 1 
ATOM   3278 C CE2 . TRP A 1 442 ? -26.156 36.952  -17.242 1.00 18.73  ? 442 TRP A CE2 1 
ATOM   3279 C CE3 . TRP A 1 442 ? -26.596 37.930  -15.031 1.00 17.15  ? 442 TRP A CE3 1 
ATOM   3280 C CZ2 . TRP A 1 442 ? -27.122 35.962  -17.058 1.00 17.66  ? 442 TRP A CZ2 1 
ATOM   3281 C CZ3 . TRP A 1 442 ? -27.548 36.913  -14.850 1.00 17.40  ? 442 TRP A CZ3 1 
ATOM   3282 C CH2 . TRP A 1 442 ? -27.774 35.928  -15.853 1.00 17.35  ? 442 TRP A CH2 1 
ATOM   3283 N N   . MET A 1 443 ? -23.494 37.638  -13.763 1.00 21.18  ? 443 MET A N   1 
ATOM   3284 C CA  . MET A 1 443 ? -23.947 36.847  -12.594 1.00 19.90  ? 443 MET A CA  1 
ATOM   3285 C C   . MET A 1 443 ? -23.279 37.147  -11.230 1.00 20.73  ? 443 MET A C   1 
ATOM   3286 O O   . MET A 1 443 ? -23.686 36.567  -10.204 1.00 20.66  ? 443 MET A O   1 
ATOM   3287 C CB  . MET A 1 443 ? -23.758 35.387  -12.877 1.00 20.90  ? 443 MET A CB  1 
ATOM   3288 C CG  . MET A 1 443 ? -24.805 34.865  -13.799 1.00 25.34  ? 443 MET A CG  1 
ATOM   3289 S SD  . MET A 1 443 ? -24.656 33.110  -14.070 1.00 30.55  ? 443 MET A SD  1 
ATOM   3290 C CE  . MET A 1 443 ? -25.738 32.761  -15.454 1.00 28.94  ? 443 MET A CE  1 
ATOM   3291 N N   . GLY A 1 444 ? -22.242 38.003  -11.206 1.00 19.29  ? 444 GLY A N   1 
ATOM   3292 C CA  . GLY A 1 444 ? -21.609 38.396  -9.967  1.00 18.99  ? 444 GLY A CA  1 
ATOM   3293 C C   . GLY A 1 444 ? -20.911 37.232  -9.281  1.00 20.53  ? 444 GLY A C   1 
ATOM   3294 O O   . GLY A 1 444 ? -19.981 36.625  -9.837  1.00 23.05  ? 444 GLY A O   1 
ATOM   3295 N N   . VAL A 1 445 ? -21.348 36.936  -8.061  1.00 18.65  ? 445 VAL A N   1 
ATOM   3296 C CA  . VAL A 1 445 ? -20.769 35.898  -7.265  1.00 17.86  ? 445 VAL A CA  1 
ATOM   3297 C C   . VAL A 1 445 ? -21.893 34.873  -7.056  1.00 19.13  ? 445 VAL A C   1 
ATOM   3298 O O   . VAL A 1 445 ? -22.710 34.988  -6.159  1.00 18.91  ? 445 VAL A O   1 
ATOM   3299 C CB  . VAL A 1 445 ? -20.251 36.458  -5.932  1.00 17.90  ? 445 VAL A CB  1 
ATOM   3300 C CG1 . VAL A 1 445 ? -19.801 35.329  -4.995  1.00 16.60  ? 445 VAL A CG1 1 
ATOM   3301 C CG2 . VAL A 1 445 ? -19.094 37.420  -6.172  1.00 17.25  ? 445 VAL A CG2 1 
ATOM   3302 N N   . PRO A 1 446 ? -21.946 33.857  -7.908  1.00 20.14  ? 446 PRO A N   1 
ATOM   3303 C CA  . PRO A 1 446 ? -23.154 33.037  -7.851  1.00 18.85  ? 446 PRO A CA  1 
ATOM   3304 C C   . PRO A 1 446 ? -23.117 31.968  -6.753  1.00 19.20  ? 446 PRO A C   1 
ATOM   3305 O O   . PRO A 1 446 ? -22.098 31.771  -6.066  1.00 17.68  ? 446 PRO A O   1 
ATOM   3306 C CB  . PRO A 1 446 ? -23.220 32.399  -9.248  1.00 20.24  ? 446 PRO A CB  1 
ATOM   3307 C CG  . PRO A 1 446 ? -22.045 32.987  -10.054 1.00 21.28  ? 446 PRO A CG  1 
ATOM   3308 C CD  . PRO A 1 446 ? -21.073 33.557  -9.069  1.00 20.00  ? 446 PRO A CD  1 
ATOM   3309 N N   . HIS A 1 447 ? -24.282 31.345  -6.544  1.00 19.54  ? 447 HIS A N   1 
ATOM   3310 C CA  . HIS A 1 447 ? -24.470 30.238  -5.639  1.00 19.99  ? 447 HIS A CA  1 
ATOM   3311 C C   . HIS A 1 447 ? -23.326 29.240  -5.765  1.00 21.64  ? 447 HIS A C   1 
ATOM   3312 O O   . HIS A 1 447 ? -23.023 28.808  -6.898  1.00 21.19  ? 447 HIS A O   1 
ATOM   3313 C CB  . HIS A 1 447 ? -25.697 29.511  -6.064  1.00 19.55  ? 447 HIS A CB  1 
ATOM   3314 C CG  . HIS A 1 447 ? -26.335 28.742  -4.978  1.00 21.50  ? 447 HIS A CG  1 
ATOM   3315 N ND1 . HIS A 1 447 ? -26.701 29.318  -3.779  1.00 23.97  ? 447 HIS A ND1 1 
ATOM   3316 C CD2 . HIS A 1 447 ? -26.742 27.453  -4.915  1.00 23.70  ? 447 HIS A CD2 1 
ATOM   3317 C CE1 . HIS A 1 447 ? -27.305 28.411  -3.019  1.00 25.22  ? 447 HIS A CE1 1 
ATOM   3318 N NE2 . HIS A 1 447 ? -27.338 27.264  -3.680  1.00 23.94  ? 447 HIS A NE2 1 
ATOM   3319 N N   . GLY A 1 448 ? -22.720 28.841  -4.630  1.00 23.26  ? 448 GLY A N   1 
ATOM   3320 C CA  . GLY A 1 448 ? -21.634 27.824  -4.649  1.00 22.82  ? 448 GLY A CA  1 
ATOM   3321 C C   . GLY A 1 448 ? -20.199 28.314  -4.828  1.00 23.48  ? 448 GLY A C   1 
ATOM   3322 O O   . GLY A 1 448 ? -19.234 27.610  -4.528  1.00 26.75  ? 448 GLY A O   1 
ATOM   3323 N N   . TYR A 1 449 ? -20.032 29.546  -5.279  1.00 22.43  ? 449 TYR A N   1 
ATOM   3324 C CA  . TYR A 1 449 ? -18.707 30.025  -5.601  1.00 20.53  ? 449 TYR A CA  1 
ATOM   3325 C C   . TYR A 1 449 ? -17.882 30.575  -4.406  1.00 21.71  ? 449 TYR A C   1 
ATOM   3326 O O   . TYR A 1 449 ? -16.841 31.240  -4.597  1.00 22.16  ? 449 TYR A O   1 
ATOM   3327 C CB  . TYR A 1 449 ? -18.770 30.898  -6.872  1.00 19.24  ? 449 TYR A CB  1 
ATOM   3328 C CG  . TYR A 1 449 ? -19.039 29.975  -8.028  1.00 19.36  ? 449 TYR A CG  1 
ATOM   3329 C CD1 . TYR A 1 449 ? -17.999 29.348  -8.660  1.00 19.83  ? 449 TYR A CD1 1 
ATOM   3330 C CD2 . TYR A 1 449 ? -20.336 29.626  -8.422  1.00 19.57  ? 449 TYR A CD2 1 
ATOM   3331 C CE1 . TYR A 1 449 ? -18.213 28.420  -9.671  1.00 19.63  ? 449 TYR A CE1 1 
ATOM   3332 C CE2 . TYR A 1 449 ? -20.557 28.692  -9.434  1.00 19.23  ? 449 TYR A CE2 1 
ATOM   3333 C CZ  . TYR A 1 449 ? -19.473 28.103  -10.059 1.00 19.55  ? 449 TYR A CZ  1 
ATOM   3334 O OH  . TYR A 1 449 ? -19.589 27.164  -11.083 1.00 22.20  ? 449 TYR A OH  1 
ATOM   3335 N N   . GLU A 1 450 ? -18.323 30.272  -3.179  1.00 22.84  ? 450 GLU A N   1 
ATOM   3336 C CA  . GLU A 1 450 ? -17.455 30.466  -2.008  1.00 24.49  ? 450 GLU A CA  1 
ATOM   3337 C C   . GLU A 1 450 ? -16.699 29.182  -1.676  1.00 25.25  ? 450 GLU A C   1 
ATOM   3338 O O   . GLU A 1 450 ? -15.579 29.219  -1.181  1.00 26.58  ? 450 GLU A O   1 
ATOM   3339 C CB  . GLU A 1 450 ? -18.242 30.949  -0.805  1.00 23.65  ? 450 GLU A CB  1 
ATOM   3340 C CG  . GLU A 1 450 ? -18.848 29.864  0.051   1.00 25.99  ? 450 GLU A CG  1 
ATOM   3341 C CD  . GLU A 1 450 ? -20.230 29.349  -0.396  1.00 30.24  ? 450 GLU A CD  1 
ATOM   3342 O OE1 . GLU A 1 450 ? -20.654 29.494  -1.594  1.00 36.25  ? 450 GLU A OE1 1 
ATOM   3343 O OE2 . GLU A 1 450 ? -20.919 28.749  0.480   1.00 27.32  ? 450 GLU A OE2 1 
ATOM   3344 N N   . ILE A 1 451 ? -17.317 28.044  -1.990  1.00 24.84  ? 451 ILE A N   1 
ATOM   3345 C CA  . ILE A 1 451 ? -16.851 26.737  -1.540  1.00 23.34  ? 451 ILE A CA  1 
ATOM   3346 C C   . ILE A 1 451 ? -15.377 26.509  -1.792  1.00 24.59  ? 451 ILE A C   1 
ATOM   3347 O O   . ILE A 1 451 ? -14.665 26.011  -0.882  1.00 23.82  ? 451 ILE A O   1 
ATOM   3348 C CB  . ILE A 1 451 ? -17.682 25.581  -2.114  1.00 21.70  ? 451 ILE A CB  1 
ATOM   3349 C CG1 . ILE A 1 451 ? -19.157 25.852  -1.840  1.00 22.05  ? 451 ILE A CG1 1 
ATOM   3350 C CG2 . ILE A 1 451 ? -17.243 24.301  -1.484  1.00 20.38  ? 451 ILE A CG2 1 
ATOM   3351 C CD1 . ILE A 1 451 ? -20.163 24.772  -2.196  1.00 22.73  ? 451 ILE A CD1 1 
ATOM   3352 N N   . GLU A 1 452 ? -14.920 26.873  -2.990  1.00 26.76  ? 452 GLU A N   1 
ATOM   3353 C CA  . GLU A 1 452 ? -13.498 26.625  -3.326  1.00 30.88  ? 452 GLU A CA  1 
ATOM   3354 C C   . GLU A 1 452 ? -12.487 27.413  -2.474  1.00 31.36  ? 452 GLU A C   1 
ATOM   3355 O O   . GLU A 1 452 ? -11.313 26.991  -2.320  1.00 35.16  ? 452 GLU A O   1 
ATOM   3356 C CB  . GLU A 1 452 ? -13.202 26.873  -4.795  1.00 31.71  ? 452 GLU A CB  1 
ATOM   3357 C CG  . GLU A 1 452 ? -13.508 28.290  -5.222  1.00 34.18  ? 452 GLU A CG  1 
ATOM   3358 C CD  . GLU A 1 452 ? -14.214 28.319  -6.552  1.00 38.53  ? 452 GLU A CD  1 
ATOM   3359 O OE1 . GLU A 1 452 ? -15.291 27.651  -6.652  1.00 44.08  ? 452 GLU A OE1 1 
ATOM   3360 O OE2 . GLU A 1 452 ? -13.692 29.008  -7.459  1.00 37.00  ? 452 GLU A OE2 1 
ATOM   3361 N N   . PHE A 1 453 ? -12.926 28.563  -1.967  1.00 26.12  ? 453 PHE A N   1 
ATOM   3362 C CA  . PHE A 1 453 ? -12.091 29.354  -1.101  1.00 22.84  ? 453 PHE A CA  1 
ATOM   3363 C C   . PHE A 1 453 ? -12.038 28.765  0.304   1.00 25.01  ? 453 PHE A C   1 
ATOM   3364 O O   . PHE A 1 453 ? -10.975 28.732  0.888   1.00 26.44  ? 453 PHE A O   1 
ATOM   3365 C CB  . PHE A 1 453 ? -12.568 30.781  -1.114  1.00 20.19  ? 453 PHE A CB  1 
ATOM   3366 C CG  . PHE A 1 453 ? -12.241 31.474  -2.375  1.00 19.10  ? 453 PHE A CG  1 
ATOM   3367 C CD1 . PHE A 1 453 ? -10.970 32.028  -2.574  1.00 19.11  ? 453 PHE A CD1 1 
ATOM   3368 C CD2 . PHE A 1 453 ? -13.144 31.516  -3.400  1.00 18.36  ? 453 PHE A CD2 1 
ATOM   3369 C CE1 . PHE A 1 453 ? -10.643 32.648  -3.768  1.00 19.17  ? 453 PHE A CE1 1 
ATOM   3370 C CE2 . PHE A 1 453 ? -12.805 32.125  -4.611  1.00 17.75  ? 453 PHE A CE2 1 
ATOM   3371 C CZ  . PHE A 1 453 ? -11.572 32.696  -4.797  1.00 17.64  ? 453 PHE A CZ  1 
ATOM   3372 N N   . ILE A 1 454 ? -13.168 28.273  0.831   1.00 25.05  ? 454 ILE A N   1 
ATOM   3373 C CA  . ILE A 1 454 ? -13.178 27.601  2.112   1.00 23.97  ? 454 ILE A CA  1 
ATOM   3374 C C   . ILE A 1 454 ? -12.333 26.348  2.049   1.00 26.45  ? 454 ILE A C   1 
ATOM   3375 O O   . ILE A 1 454 ? -11.644 26.030  2.998   1.00 29.36  ? 454 ILE A O   1 
ATOM   3376 C CB  . ILE A 1 454 ? -14.601 27.209  2.530   1.00 23.11  ? 454 ILE A CB  1 
ATOM   3377 C CG1 . ILE A 1 454 ? -15.567 28.391  2.353   1.00 23.73  ? 454 ILE A CG1 1 
ATOM   3378 C CG2 . ILE A 1 454 ? -14.656 26.620  3.948   1.00 20.73  ? 454 ILE A CG2 1 
ATOM   3379 C CD1 . ILE A 1 454 ? -15.359 29.592  3.268   1.00 23.76  ? 454 ILE A CD1 1 
ATOM   3380 N N   . PHE A 1 455 ? -12.396 25.609  0.951   1.00 26.02  ? 455 PHE A N   1 
ATOM   3381 C CA  . PHE A 1 455 ? -11.629 24.381  0.880   1.00 24.09  ? 455 PHE A CA  1 
ATOM   3382 C C   . PHE A 1 455 ? -10.135 24.582  0.497   1.00 24.97  ? 455 PHE A C   1 
ATOM   3383 O O   . PHE A 1 455 ? -9.353  23.622  0.493   1.00 30.16  ? 455 PHE A O   1 
ATOM   3384 C CB  . PHE A 1 455 ? -12.333 23.377  -0.017  1.00 22.28  ? 455 PHE A CB  1 
ATOM   3385 C CG  . PHE A 1 455 ? -13.399 22.573  0.682   1.00 22.29  ? 455 PHE A CG  1 
ATOM   3386 C CD1 . PHE A 1 455 ? -13.086 21.345  1.289   1.00 21.47  ? 455 PHE A CD1 1 
ATOM   3387 C CD2 . PHE A 1 455 ? -14.732 23.016  0.722   1.00 21.52  ? 455 PHE A CD2 1 
ATOM   3388 C CE1 . PHE A 1 455 ? -14.063 20.560  1.914   1.00 21.28  ? 455 PHE A CE1 1 
ATOM   3389 C CE2 . PHE A 1 455 ? -15.721 22.217  1.346   1.00 21.20  ? 455 PHE A CE2 1 
ATOM   3390 C CZ  . PHE A 1 455 ? -15.392 20.980  1.945   1.00 20.58  ? 455 PHE A CZ  1 
ATOM   3391 N N   . GLY A 1 456 ? -9.720  25.813  0.245   1.00 22.09  ? 456 GLY A N   1 
ATOM   3392 C CA  . GLY A 1 456 ? -8.321  26.099  0.104   1.00 21.95  ? 456 GLY A CA  1 
ATOM   3393 C C   . GLY A 1 456 ? -7.887  25.815  -1.313  1.00 26.30  ? 456 GLY A C   1 
ATOM   3394 O O   . GLY A 1 456 ? -6.698  25.713  -1.614  1.00 28.65  ? 456 GLY A O   1 
ATOM   3395 N N   . ILE A 1 457 ? -8.829  25.729  -2.239  1.00 26.09  ? 457 ILE A N   1 
ATOM   3396 C CA  . ILE A 1 457 ? -8.437  25.256  -3.550  1.00 23.72  ? 457 ILE A CA  1 
ATOM   3397 C C   . ILE A 1 457 ? -7.439  26.179  -4.240  1.00 25.55  ? 457 ILE A C   1 
ATOM   3398 O O   . ILE A 1 457 ? -6.613  25.717  -5.003  1.00 30.37  ? 457 ILE A O   1 
ATOM   3399 C CB  . ILE A 1 457 ? -9.631  24.956  -4.469  1.00 21.49  ? 457 ILE A CB  1 
ATOM   3400 C CG1 . ILE A 1 457 ? -10.637 24.039  -3.796  1.00 20.23  ? 457 ILE A CG1 1 
ATOM   3401 C CG2 . ILE A 1 457 ? -9.138  24.302  -5.729  1.00 19.93  ? 457 ILE A CG2 1 
ATOM   3402 C CD1 . ILE A 1 457 ? -10.094 22.671  -3.455  1.00 19.11  ? 457 ILE A CD1 1 
ATOM   3403 N N   . PRO A 1 458 ? -7.501  27.484  -4.004  1.00 26.36  ? 458 PRO A N   1 
ATOM   3404 C CA  . PRO A 1 458 ? -6.533  28.309  -4.721  1.00 26.72  ? 458 PRO A CA  1 
ATOM   3405 C C   . PRO A 1 458 ? -5.027  28.030  -4.413  1.00 32.57  ? 458 PRO A C   1 
ATOM   3406 O O   . PRO A 1 458 ? -4.169  28.604  -5.112  1.00 39.01  ? 458 PRO A O   1 
ATOM   3407 C CB  . PRO A 1 458 ? -6.875  29.704  -4.271  1.00 24.71  ? 458 PRO A CB  1 
ATOM   3408 C CG  . PRO A 1 458 ? -8.308  29.643  -3.982  1.00 27.73  ? 458 PRO A CG  1 
ATOM   3409 C CD  . PRO A 1 458 ? -8.557  28.291  -3.379  1.00 27.50  ? 458 PRO A CD  1 
ATOM   3410 N N   . LEU A 1 459 ? -4.708  27.197  -3.402  1.00 31.08  ? 459 LEU A N   1 
ATOM   3411 C CA  . LEU A 1 459 ? -3.324  26.743  -3.113  1.00 29.65  ? 459 LEU A CA  1 
ATOM   3412 C C   . LEU A 1 459 ? -2.741  25.678  -4.070  1.00 36.15  ? 459 LEU A C   1 
ATOM   3413 O O   . LEU A 1 459 ? -1.522  25.571  -4.245  1.00 42.42  ? 459 LEU A O   1 
ATOM   3414 C CB  . LEU A 1 459 ? -3.261  26.193  -1.723  1.00 25.18  ? 459 LEU A CB  1 
ATOM   3415 C CG  . LEU A 1 459 ? -3.734  27.194  -0.688  1.00 24.30  ? 459 LEU A CG  1 
ATOM   3416 C CD1 . LEU A 1 459 ? -3.824  26.522  0.666   1.00 23.81  ? 459 LEU A CD1 1 
ATOM   3417 C CD2 . LEU A 1 459 ? -2.798  28.368  -0.647  1.00 22.17  ? 459 LEU A CD2 1 
ATOM   3418 N N   . ASP A 1 460 ? -3.611  24.892  -4.687  1.00 39.36  ? 460 ASP A N   1 
ATOM   3419 C CA  . ASP A 1 460 ? -3.230  23.953  -5.721  1.00 41.97  ? 460 ASP A CA  1 
ATOM   3420 C C   . ASP A 1 460 ? -2.492  24.704  -6.839  1.00 42.47  ? 460 ASP A C   1 
ATOM   3421 O O   . ASP A 1 460 ? -3.095  25.544  -7.526  1.00 39.04  ? 460 ASP A O   1 
ATOM   3422 C CB  . ASP A 1 460 ? -4.496  23.270  -6.244  1.00 43.96  ? 460 ASP A CB  1 
ATOM   3423 C CG  . ASP A 1 460 ? -4.215  22.242  -7.337  1.00 47.50  ? 460 ASP A CG  1 
ATOM   3424 O OD1 . ASP A 1 460 ? -3.068  22.198  -7.899  1.00 43.68  ? 460 ASP A OD1 1 
ATOM   3425 O OD2 . ASP A 1 460 ? -5.184  21.495  -7.627  1.00 41.94  ? 460 ASP A OD2 1 
ATOM   3426 N N   . PRO A 1 461 ? -1.184  24.398  -7.021  1.00 46.49  ? 461 PRO A N   1 
ATOM   3427 C CA  . PRO A 1 461 ? -0.350  25.190  -7.982  1.00 46.09  ? 461 PRO A CA  1 
ATOM   3428 C C   . PRO A 1 461 ? -0.775  24.947  -9.438  1.00 46.50  ? 461 PRO A C   1 
ATOM   3429 O O   . PRO A 1 461 ? -0.782  25.886  -10.234 1.00 50.72  ? 461 PRO A O   1 
ATOM   3430 C CB  . PRO A 1 461 ? 1.087   24.712  -7.719  1.00 40.19  ? 461 PRO A CB  1 
ATOM   3431 C CG  . PRO A 1 461 ? 0.923   23.355  -7.051  1.00 43.66  ? 461 PRO A CG  1 
ATOM   3432 C CD  . PRO A 1 461 ? -0.476  23.197  -6.503  1.00 42.96  ? 461 PRO A CD  1 
ATOM   3433 N N   . SER A 1 462 ? -1.189  23.718  -9.763  1.00 42.12  ? 462 SER A N   1 
ATOM   3434 C CA  . SER A 1 462 ? -1.759  23.420  -11.078 1.00 40.73  ? 462 SER A CA  1 
ATOM   3435 C C   . SER A 1 462 ? -2.966  24.298  -11.467 1.00 41.51  ? 462 SER A C   1 
ATOM   3436 O O   . SER A 1 462 ? -3.380  24.232  -12.583 1.00 37.14  ? 462 SER A O   1 
ATOM   3437 C CB  . SER A 1 462 ? -2.191  21.961  -11.155 1.00 41.20  ? 462 SER A CB  1 
ATOM   3438 O OG  . SER A 1 462 ? -3.493  21.820  -10.617 1.00 43.40  ? 462 SER A OG  1 
ATOM   3439 N N   . ARG A 1 463 ? -3.544  25.080  -10.546 1.00 44.08  ? 463 ARG A N   1 
ATOM   3440 C CA  . ARG A 1 463 ? -4.673  25.962  -10.854 1.00 39.12  ? 463 ARG A CA  1 
ATOM   3441 C C   . ARG A 1 463 ? -4.199  27.384  -10.905 1.00 40.12  ? 463 ARG A C   1 
ATOM   3442 O O   . ARG A 1 463 ? -3.118  27.693  -10.413 1.00 41.29  ? 463 ARG A O   1 
ATOM   3443 C CB  . ARG A 1 463 ? -5.803  25.771  -9.857  1.00 36.64  ? 463 ARG A CB  1 
ATOM   3444 C CG  . ARG A 1 463 ? -6.477  24.429  -10.042 1.00 36.32  ? 463 ARG A CG  1 
ATOM   3445 C CD  . ARG A 1 463 ? -7.451  24.100  -8.924  1.00 41.40  ? 463 ARG A CD  1 
ATOM   3446 N NE  . ARG A 1 463 ? -8.128  22.808  -9.105  1.00 42.23  ? 463 ARG A NE  1 
ATOM   3447 C CZ  . ARG A 1 463 ? -9.145  22.624  -9.947  1.00 43.79  ? 463 ARG A CZ  1 
ATOM   3448 N NH1 . ARG A 1 463 ? -9.588  23.669  -10.656 1.00 42.76  ? 463 ARG A NH1 1 
ATOM   3449 N NH2 . ARG A 1 463 ? -9.693  21.407  -10.109 1.00 40.40  ? 463 ARG A NH2 1 
ATOM   3450 N N   . ASN A 1 464 ? -4.980  28.260  -11.518 1.00 41.19  ? 464 ASN A N   1 
ATOM   3451 C CA  . ASN A 1 464 ? -4.410  29.556  -11.878 1.00 42.78  ? 464 ASN A CA  1 
ATOM   3452 C C   . ASN A 1 464 ? -4.816  30.747  -11.004 1.00 40.99  ? 464 ASN A C   1 
ATOM   3453 O O   . ASN A 1 464 ? -4.803  31.869  -11.459 1.00 43.19  ? 464 ASN A O   1 
ATOM   3454 C CB  . ASN A 1 464 ? -4.554  29.820  -13.405 1.00 46.49  ? 464 ASN A CB  1 
ATOM   3455 C CG  . ASN A 1 464 ? -3.383  29.224  -14.212 1.00 53.92  ? 464 ASN A CG  1 
ATOM   3456 O OD1 . ASN A 1 464 ? -3.558  28.559  -15.264 1.00 56.86  ? 464 ASN A OD1 1 
ATOM   3457 N ND2 . ASN A 1 464 ? -2.164  29.454  -13.707 1.00 54.35  ? 464 ASN A ND2 1 
ATOM   3458 N N   . TYR A 1 465 ? -5.138  30.522  -9.734  1.00 39.76  ? 465 TYR A N   1 
ATOM   3459 C CA  . TYR A 1 465 ? -5.558  31.621  -8.856  1.00 34.84  ? 465 TYR A CA  1 
ATOM   3460 C C   . TYR A 1 465 ? -4.497  32.703  -8.696  1.00 36.51  ? 465 TYR A C   1 
ATOM   3461 O O   . TYR A 1 465 ? -3.341  32.440  -8.976  1.00 41.26  ? 465 TYR A O   1 
ATOM   3462 C CB  . TYR A 1 465 ? -5.919  31.035  -7.528  1.00 34.02  ? 465 TYR A CB  1 
ATOM   3463 C CG  . TYR A 1 465 ? -7.271  30.348  -7.597  1.00 37.22  ? 465 TYR A CG  1 
ATOM   3464 C CD1 . TYR A 1 465 ? -7.390  28.966  -7.919  1.00 34.43  ? 465 TYR A CD1 1 
ATOM   3465 C CD2 . TYR A 1 465 ? -8.453  31.082  -7.350  1.00 34.86  ? 465 TYR A CD2 1 
ATOM   3466 C CE1 . TYR A 1 465 ? -8.648  28.346  -7.975  1.00 33.52  ? 465 TYR A CE1 1 
ATOM   3467 C CE2 . TYR A 1 465 ? -9.713  30.473  -7.416  1.00 33.82  ? 465 TYR A CE2 1 
ATOM   3468 C CZ  . TYR A 1 465 ? -9.820  29.122  -7.744  1.00 33.53  ? 465 TYR A CZ  1 
ATOM   3469 O OH  . TYR A 1 465 ? -11.090 28.594  -7.810  1.00 27.64  ? 465 TYR A OH  1 
ATOM   3470 N N   . THR A 1 466 ? -4.856  33.921  -8.278  1.00 35.79  ? 466 THR A N   1 
ATOM   3471 C CA  . THR A 1 466 ? -3.821  34.937  -7.984  1.00 33.08  ? 466 THR A CA  1 
ATOM   3472 C C   . THR A 1 466 ? -3.210  34.809  -6.587  1.00 33.37  ? 466 THR A C   1 
ATOM   3473 O O   . THR A 1 466 ? -3.723  34.094  -5.707  1.00 31.66  ? 466 THR A O   1 
ATOM   3474 C CB  . THR A 1 466 ? -4.337  36.379  -7.999  1.00 32.88  ? 466 THR A CB  1 
ATOM   3475 O OG1 . THR A 1 466 ? -5.196  36.571  -6.860  1.00 39.05  ? 466 THR A OG1 1 
ATOM   3476 C CG2 . THR A 1 466 ? -5.000  36.765  -9.310  1.00 27.26  ? 466 THR A CG2 1 
ATOM   3477 N N   . ALA A 1 467 ? -2.144  35.577  -6.365  1.00 35.75  ? 467 ALA A N   1 
ATOM   3478 C CA  . ALA A 1 467 ? -1.518  35.650  -5.033  1.00 34.89  ? 467 ALA A CA  1 
ATOM   3479 C C   . ALA A 1 467 ? -2.493  36.040  -3.882  1.00 34.83  ? 467 ALA A C   1 
ATOM   3480 O O   . ALA A 1 467 ? -2.432  35.397  -2.810  1.00 32.26  ? 467 ALA A O   1 
ATOM   3481 C CB  . ALA A 1 467 ? -0.330  36.579  -5.072  1.00 29.02  ? 467 ALA A CB  1 
ATOM   3482 N N   . GLU A 1 468 ? -3.373  37.054  -4.103  1.00 32.74  ? 468 GLU A N   1 
ATOM   3483 C CA  . GLU A 1 468 ? -4.176  37.645  -2.982  1.00 36.72  ? 468 GLU A CA  1 
ATOM   3484 C C   . GLU A 1 468 ? -5.259  36.651  -2.693  1.00 37.21  ? 468 GLU A C   1 
ATOM   3485 O O   . GLU A 1 468 ? -5.669  36.432  -1.501  1.00 34.83  ? 468 GLU A O   1 
ATOM   3486 C CB  . GLU A 1 468 ? -4.807  39.067  -3.209  1.00 41.01  ? 468 GLU A CB  1 
ATOM   3487 C CG  . GLU A 1 468 ? -3.950  40.169  -3.842  1.00 49.47  ? 468 GLU A CG  1 
ATOM   3488 C CD  . GLU A 1 468 ? -3.912  40.042  -5.383  1.00 64.76  ? 468 GLU A CD  1 
ATOM   3489 O OE1 . GLU A 1 468 ? -4.824  40.664  -6.018  1.00 66.73  ? 468 GLU A OE1 1 
ATOM   3490 O OE2 . GLU A 1 468 ? -3.025  39.288  -5.957  1.00 55.28  ? 468 GLU A OE2 1 
ATOM   3491 N N   . GLU A 1 469 ? -5.694  36.038  -3.805  1.00 33.49  ? 469 GLU A N   1 
ATOM   3492 C CA  . GLU A 1 469 ? -6.601  34.917  -3.736  1.00 31.92  ? 469 GLU A CA  1 
ATOM   3493 C C   . GLU A 1 469 ? -6.063  33.834  -2.790  1.00 30.02  ? 469 GLU A C   1 
ATOM   3494 O O   . GLU A 1 469 ? -6.765  33.424  -1.865  1.00 31.15  ? 469 GLU A O   1 
ATOM   3495 C CB  . GLU A 1 469 ? -6.945  34.410  -5.129  1.00 30.60  ? 469 GLU A CB  1 
ATOM   3496 C CG  . GLU A 1 469 ? -8.230  35.058  -5.611  1.00 30.35  ? 469 GLU A CG  1 
ATOM   3497 C CD  . GLU A 1 469 ? -8.595  34.788  -7.078  1.00 31.47  ? 469 GLU A CD  1 
ATOM   3498 O OE1 . GLU A 1 469 ? -7.717  34.428  -7.940  1.00 25.91  ? 469 GLU A OE1 1 
ATOM   3499 O OE2 . GLU A 1 469 ? -9.811  34.971  -7.352  1.00 29.95  ? 469 GLU A OE2 1 
ATOM   3500 N N   . LYS A 1 470 ? -4.812  33.426  -2.973  1.00 28.23  ? 470 LYS A N   1 
ATOM   3501 C CA  . LYS A 1 470 ? -4.193  32.491  -2.032  1.00 31.09  ? 470 LYS A CA  1 
ATOM   3502 C C   . LYS A 1 470 ? -4.252  32.923  -0.524  1.00 32.76  ? 470 LYS A C   1 
ATOM   3503 O O   . LYS A 1 470 ? -4.693  32.133  0.373   1.00 31.00  ? 470 LYS A O   1 
ATOM   3504 C CB  . LYS A 1 470 ? -2.759  32.139  -2.483  1.00 33.77  ? 470 LYS A CB  1 
ATOM   3505 C CG  . LYS A 1 470 ? -2.677  31.023  -3.543  1.00 35.79  ? 470 LYS A CG  1 
ATOM   3506 C CD  . LYS A 1 470 ? -1.416  31.148  -4.404  1.00 34.62  ? 470 LYS A CD  1 
ATOM   3507 C CE  . LYS A 1 470 ? -1.235  30.040  -5.436  1.00 32.60  ? 470 LYS A CE  1 
ATOM   3508 N NZ  . LYS A 1 470 ? -0.252  30.523  -6.454  1.00 33.86  ? 470 LYS A NZ  1 
ATOM   3509 N N   . ILE A 1 471 ? -3.855  34.177  -0.251  1.00 32.00  ? 471 ILE A N   1 
ATOM   3510 C CA  . ILE A 1 471 ? -3.898  34.690  1.121   1.00 30.92  ? 471 ILE A CA  1 
ATOM   3511 C C   . ILE A 1 471 ? -5.315  34.646  1.712   1.00 30.53  ? 471 ILE A C   1 
ATOM   3512 O O   . ILE A 1 471 ? -5.532  34.105  2.822   1.00 28.56  ? 471 ILE A O   1 
ATOM   3513 C CB  . ILE A 1 471 ? -3.310  36.108  1.224   1.00 30.80  ? 471 ILE A CB  1 
ATOM   3514 C CG1 . ILE A 1 471 ? -1.763  36.042  1.060   1.00 28.08  ? 471 ILE A CG1 1 
ATOM   3515 C CG2 . ILE A 1 471 ? -3.802  36.761  2.532   1.00 26.56  ? 471 ILE A CG2 1 
ATOM   3516 C CD1 . ILE A 1 471 ? -1.170  37.189  0.245   1.00 27.21  ? 471 ILE A CD1 1 
ATOM   3517 N N   . PHE A 1 472 ? -6.263  35.196  0.939   1.00 30.13  ? 472 PHE A N   1 
ATOM   3518 C CA  . PHE A 1 472 ? -7.693  35.215  1.275   1.00 26.68  ? 472 PHE A CA  1 
ATOM   3519 C C   . PHE A 1 472 ? -8.213  33.815  1.662   1.00 28.11  ? 472 PHE A C   1 
ATOM   3520 O O   . PHE A 1 472 ? -8.897  33.643  2.723   1.00 28.79  ? 472 PHE A O   1 
ATOM   3521 C CB  . PHE A 1 472 ? -8.422  35.793  0.077   1.00 25.42  ? 472 PHE A CB  1 
ATOM   3522 C CG  . PHE A 1 472 ? -9.895  35.856  0.223   1.00 23.38  ? 472 PHE A CG  1 
ATOM   3523 C CD1 . PHE A 1 472 ? -10.472 36.296  1.382   1.00 24.22  ? 472 PHE A CD1 1 
ATOM   3524 C CD2 . PHE A 1 472 ? -10.699 35.496  -0.820  1.00 22.86  ? 472 PHE A CD2 1 
ATOM   3525 C CE1 . PHE A 1 472 ? -11.841 36.359  1.508   1.00 23.80  ? 472 PHE A CE1 1 
ATOM   3526 C CE2 . PHE A 1 472 ? -12.066 35.550  -0.719  1.00 22.98  ? 472 PHE A CE2 1 
ATOM   3527 C CZ  . PHE A 1 472 ? -12.635 35.974  0.444   1.00 24.23  ? 472 PHE A CZ  1 
ATOM   3528 N N   . ALA A 1 473 ? -7.853  32.813  0.848   1.00 25.94  ? 473 ALA A N   1 
ATOM   3529 C CA  . ALA A 1 473 ? -8.290  31.431  1.113   1.00 28.68  ? 473 ALA A CA  1 
ATOM   3530 C C   . ALA A 1 473 ? -7.833  30.964  2.493   1.00 29.44  ? 473 ALA A C   1 
ATOM   3531 O O   . ALA A 1 473 ? -8.568  30.290  3.247   1.00 25.84  ? 473 ALA A O   1 
ATOM   3532 C CB  . ALA A 1 473 ? -7.743  30.503  0.050   1.00 30.63  ? 473 ALA A CB  1 
ATOM   3533 N N   . GLN A 1 474 ? -6.591  31.342  2.804   1.00 30.59  ? 474 GLN A N   1 
ATOM   3534 C CA  . GLN A 1 474 ? -6.011  31.051  4.087   1.00 30.32  ? 474 GLN A CA  1 
ATOM   3535 C C   . GLN A 1 474 ? -6.808  31.735  5.217   1.00 32.04  ? 474 GLN A C   1 
ATOM   3536 O O   . GLN A 1 474 ? -7.025  31.101  6.270   1.00 31.61  ? 474 GLN A O   1 
ATOM   3537 C CB  . GLN A 1 474 ? -4.539  31.453  4.093   1.00 30.49  ? 474 GLN A CB  1 
ATOM   3538 C CG  . GLN A 1 474 ? -3.546  30.433  3.514   1.00 31.11  ? 474 GLN A CG  1 
ATOM   3539 C CD  . GLN A 1 474 ? -2.296  31.100  2.939   1.00 30.31  ? 474 GLN A CD  1 
ATOM   3540 O OE1 . GLN A 1 474 ? -1.965  32.202  3.280   1.00 32.80  ? 474 GLN A OE1 1 
ATOM   3541 N NE2 . GLN A 1 474 ? -1.630  30.440  2.052   1.00 29.92  ? 474 GLN A NE2 1 
ATOM   3542 N N   . ARG A 1 475 ? -7.281  32.985  5.017   1.00 31.45  ? 475 ARG A N   1 
ATOM   3543 C CA  . ARG A 1 475 ? -7.991  33.670  6.126   1.00 32.24  ? 475 ARG A CA  1 
ATOM   3544 C C   . ARG A 1 475 ? -9.279  32.928  6.337   1.00 31.22  ? 475 ARG A C   1 
ATOM   3545 O O   . ARG A 1 475 ? -9.722  32.666  7.477   1.00 34.26  ? 475 ARG A O   1 
ATOM   3546 C CB  . ARG A 1 475 ? -8.320  35.124  5.834   1.00 33.26  ? 475 ARG A CB  1 
ATOM   3547 C CG  . ARG A 1 475 ? -7.158  36.103  5.714   1.00 34.89  ? 475 ARG A CG  1 
ATOM   3548 C CD  . ARG A 1 475 ? -7.637  37.476  5.187   1.00 33.51  ? 475 ARG A CD  1 
ATOM   3549 N NE  . ARG A 1 475 ? -8.939  37.825  5.779   1.00 31.19  ? 475 ARG A NE  1 
ATOM   3550 C CZ  . ARG A 1 475 ? -9.854  38.588  5.178   1.00 28.21  ? 475 ARG A CZ  1 
ATOM   3551 N NH1 . ARG A 1 475 ? -9.608  39.105  3.975   1.00 25.13  ? 475 ARG A NH1 1 
ATOM   3552 N NH2 . ARG A 1 475 ? -11.016 38.840  5.787   1.00 26.77  ? 475 ARG A NH2 1 
ATOM   3553 N N   . LEU A 1 476 ? -9.873  32.577  5.214   1.00 27.60  ? 476 LEU A N   1 
ATOM   3554 C CA  . LEU A 1 476 ? -11.123 31.856  5.257   1.00 27.47  ? 476 LEU A CA  1 
ATOM   3555 C C   . LEU A 1 476 ? -10.995 30.515  6.018   1.00 25.19  ? 476 LEU A C   1 
ATOM   3556 O O   . LEU A 1 476 ? -11.859 30.147  6.868   1.00 20.99  ? 476 LEU A O   1 
ATOM   3557 C CB  . LEU A 1 476 ? -11.670 31.715  3.823   1.00 28.16  ? 476 LEU A CB  1 
ATOM   3558 C CG  . LEU A 1 476 ? -12.054 33.040  3.128   1.00 26.43  ? 476 LEU A CG  1 
ATOM   3559 C CD1 . LEU A 1 476 ? -12.576 32.887  1.721   1.00 25.29  ? 476 LEU A CD1 1 
ATOM   3560 C CD2 . LEU A 1 476 ? -13.149 33.620  3.960   1.00 24.69  ? 476 LEU A CD2 1 
ATOM   3561 N N   . MET A 1 477 ? -9.894  29.799  5.749   1.00 25.24  ? 477 MET A N   1 
ATOM   3562 C CA  . MET A 1 477 ? -9.713  28.496  6.391   1.00 24.35  ? 477 MET A CA  1 
ATOM   3563 C C   . MET A 1 477 ? -9.491  28.684  7.893   1.00 25.03  ? 477 MET A C   1 
ATOM   3564 O O   . MET A 1 477 ? -10.018 27.906  8.724   1.00 25.94  ? 477 MET A O   1 
ATOM   3565 C CB  . MET A 1 477 ? -8.597  27.737  5.761   1.00 23.12  ? 477 MET A CB  1 
ATOM   3566 C CG  . MET A 1 477 ? -8.893  27.271  4.360   1.00 25.33  ? 477 MET A CG  1 
ATOM   3567 S SD  . MET A 1 477 ? -7.676  26.060  3.731   1.00 27.78  ? 477 MET A SD  1 
ATOM   3568 C CE  . MET A 1 477 ? -6.267  27.156  3.356   1.00 22.14  ? 477 MET A CE  1 
ATOM   3569 N N   . ARG A 1 478 ? -8.774  29.751  8.234   1.00 23.13  ? 478 ARG A N   1 
ATOM   3570 C CA  . ARG A 1 478 ? -8.594  30.070  9.611   1.00 25.72  ? 478 ARG A CA  1 
ATOM   3571 C C   . ARG A 1 478 ? -9.908  30.391  10.315  1.00 27.82  ? 478 ARG A C   1 
ATOM   3572 O O   . ARG A 1 478 ? -10.168 29.756  11.367  1.00 27.32  ? 478 ARG A O   1 
ATOM   3573 C CB  . ARG A 1 478 ? -7.600  31.186  9.867   1.00 27.62  ? 478 ARG A CB  1 
ATOM   3574 C CG  . ARG A 1 478 ? -7.225  31.075  11.335  1.00 33.89  ? 478 ARG A CG  1 
ATOM   3575 C CD  . ARG A 1 478 ? -5.960  31.833  11.709  1.00 44.53  ? 478 ARG A CD  1 
ATOM   3576 N NE  . ARG A 1 478 ? -4.754  31.254  11.145  1.00 44.34  ? 478 ARG A NE  1 
ATOM   3577 C CZ  . ARG A 1 478 ? -4.056  30.317  11.734  1.00 43.20  ? 478 ARG A CZ  1 
ATOM   3578 N NH1 . ARG A 1 478 ? -4.430  29.866  12.914  1.00 45.69  ? 478 ARG A NH1 1 
ATOM   3579 N NH2 . ARG A 1 478 ? -2.993  29.841  11.126  1.00 45.59  ? 478 ARG A NH2 1 
ATOM   3580 N N   . TYR A 1 479 ? -10.730 31.324  9.763   1.00 25.38  ? 479 TYR A N   1 
ATOM   3581 C CA  . TYR A 1 479 ? -12.065 31.570  10.347  1.00 24.37  ? 479 TYR A CA  1 
ATOM   3582 C C   . TYR A 1 479 ? -12.821 30.265  10.580  1.00 22.29  ? 479 TYR A C   1 
ATOM   3583 O O   . TYR A 1 479 ? -13.309 29.989  11.690  1.00 22.03  ? 479 TYR A O   1 
ATOM   3584 C CB  . TYR A 1 479 ? -12.932 32.515  9.511   1.00 27.36  ? 479 TYR A CB  1 
ATOM   3585 C CG  . TYR A 1 479 ? -12.408 33.956  9.322   1.00 31.81  ? 479 TYR A CG  1 
ATOM   3586 C CD1 . TYR A 1 479 ? -12.026 34.787  10.427  1.00 28.58  ? 479 TYR A CD1 1 
ATOM   3587 C CD2 . TYR A 1 479 ? -12.356 34.516  8.035   1.00 31.53  ? 479 TYR A CD2 1 
ATOM   3588 C CE1 . TYR A 1 479 ? -11.582 36.094  10.225  1.00 27.44  ? 479 TYR A CE1 1 
ATOM   3589 C CE2 . TYR A 1 479 ? -11.913 35.829  7.838   1.00 33.97  ? 479 TYR A CE2 1 
ATOM   3590 C CZ  . TYR A 1 479 ? -11.527 36.598  8.928   1.00 31.77  ? 479 TYR A CZ  1 
ATOM   3591 O OH  . TYR A 1 479 ? -11.105 37.854  8.632   1.00 32.12  ? 479 TYR A OH  1 
ATOM   3592 N N   . TRP A 1 480 ? -12.902 29.435  9.545   1.00 20.93  ? 480 TRP A N   1 
ATOM   3593 C CA  . TRP A 1 480 ? -13.675 28.212  9.684   1.00 20.51  ? 480 TRP A CA  1 
ATOM   3594 C C   . TRP A 1 480 ? -13.130 27.291  10.776  1.00 20.95  ? 480 TRP A C   1 
ATOM   3595 O O   . TRP A 1 480 ? -13.903 26.735  11.605  1.00 19.07  ? 480 TRP A O   1 
ATOM   3596 C CB  . TRP A 1 480 ? -13.758 27.493  8.340   1.00 20.17  ? 480 TRP A CB  1 
ATOM   3597 C CG  . TRP A 1 480 ? -15.090 27.725  7.616   1.00 19.60  ? 480 TRP A CG  1 
ATOM   3598 C CD1 . TRP A 1 480 ? -16.001 26.785  7.266   1.00 19.26  ? 480 TRP A CD1 1 
ATOM   3599 C CD2 . TRP A 1 480 ? -15.647 28.994  7.180   1.00 19.76  ? 480 TRP A CD2 1 
ATOM   3600 N NE1 . TRP A 1 480 ? -17.074 27.368  6.634   1.00 19.58  ? 480 TRP A NE1 1 
ATOM   3601 C CE2 . TRP A 1 480 ? -16.868 28.721  6.562   1.00 19.16  ? 480 TRP A CE2 1 
ATOM   3602 C CE3 . TRP A 1 480 ? -15.212 30.339  7.252   1.00 19.96  ? 480 TRP A CE3 1 
ATOM   3603 C CZ2 . TRP A 1 480 ? -17.663 29.722  6.036   1.00 19.51  ? 480 TRP A CZ2 1 
ATOM   3604 C CZ3 . TRP A 1 480 ? -15.997 31.340  6.699   1.00 18.91  ? 480 TRP A CZ3 1 
ATOM   3605 C CH2 . TRP A 1 480 ? -17.207 31.026  6.098   1.00 19.13  ? 480 TRP A CH2 1 
ATOM   3606 N N   . ALA A 1 481 ? -11.800 27.133  10.759  1.00 20.58  ? 481 ALA A N   1 
ATOM   3607 C CA  . ALA A 1 481 ? -11.116 26.284  11.739  1.00 21.38  ? 481 ALA A CA  1 
ATOM   3608 C C   . ALA A 1 481 ? -11.204 26.794  13.197  1.00 21.82  ? 481 ALA A C   1 
ATOM   3609 O O   . ALA A 1 481 ? -11.432 25.986  14.108  1.00 20.36  ? 481 ALA A O   1 
ATOM   3610 C CB  . ALA A 1 481 ? -9.682  26.013  11.311  1.00 22.15  ? 481 ALA A CB  1 
ATOM   3611 N N   . ASN A 1 482 ? -11.066 28.120  13.401  1.00 23.44  ? 482 ASN A N   1 
ATOM   3612 C CA  . ASN A 1 482 ? -11.320 28.776  14.702  1.00 22.88  ? 482 ASN A CA  1 
ATOM   3613 C C   . ASN A 1 482 ? -12.731 28.521  15.110  1.00 25.60  ? 482 ASN A C   1 
ATOM   3614 O O   . ASN A 1 482 ? -12.963 28.146  16.273  1.00 27.02  ? 482 ASN A O   1 
ATOM   3615 C CB  . ASN A 1 482 ? -11.129 30.278  14.646  1.00 24.46  ? 482 ASN A CB  1 
ATOM   3616 C CG  . ASN A 1 482 ? -9.677  30.679  14.491  1.00 28.91  ? 482 ASN A CG  1 
ATOM   3617 O OD1 . ASN A 1 482 ? -8.770  29.921  14.796  1.00 35.10  ? 482 ASN A OD1 1 
ATOM   3618 N ND2 . ASN A 1 482 ? -9.449  31.874  14.017  1.00 28.75  ? 482 ASN A ND2 1 
ATOM   3619 N N   . PHE A 1 483 ? -13.694 28.700  14.183  1.00 26.02  ? 483 PHE A N   1 
ATOM   3620 C CA  . PHE A 1 483 ? -15.069 28.366  14.566  1.00 27.45  ? 483 PHE A CA  1 
ATOM   3621 C C   . PHE A 1 483 ? -15.153 26.905  15.046  1.00 27.99  ? 483 PHE A C   1 
ATOM   3622 O O   . PHE A 1 483 ? -15.745 26.587  16.106  1.00 26.31  ? 483 PHE A O   1 
ATOM   3623 C CB  . PHE A 1 483 ? -16.147 28.698  13.510  1.00 25.36  ? 483 PHE A CB  1 
ATOM   3624 C CG  . PHE A 1 483 ? -17.567 28.347  13.954  1.00 22.06  ? 483 PHE A CG  1 
ATOM   3625 C CD1 . PHE A 1 483 ? -18.298 29.201  14.767  1.00 21.97  ? 483 PHE A CD1 1 
ATOM   3626 C CD2 . PHE A 1 483 ? -18.155 27.148  13.579  1.00 23.02  ? 483 PHE A CD2 1 
ATOM   3627 C CE1 . PHE A 1 483 ? -19.604 28.883  15.177  1.00 23.52  ? 483 PHE A CE1 1 
ATOM   3628 C CE2 . PHE A 1 483 ? -19.461 26.790  13.998  1.00 23.85  ? 483 PHE A CE2 1 
ATOM   3629 C CZ  . PHE A 1 483 ? -20.184 27.663  14.805  1.00 24.49  ? 483 PHE A CZ  1 
ATOM   3630 N N   . ALA A 1 484 ? -14.515 26.023  14.294  1.00 29.89  ? 484 ALA A N   1 
ATOM   3631 C CA  . ALA A 1 484 ? -14.614 24.605  14.637  1.00 33.12  ? 484 ALA A CA  1 
ATOM   3632 C C   . ALA A 1 484 ? -14.005 24.309  16.011  1.00 32.21  ? 484 ALA A C   1 
ATOM   3633 O O   . ALA A 1 484 ? -14.651 23.608  16.832  1.00 34.23  ? 484 ALA A O   1 
ATOM   3634 C CB  . ALA A 1 484 ? -14.003 23.733  13.559  1.00 32.24  ? 484 ALA A CB  1 
ATOM   3635 N N   . ARG A 1 485 ? -12.816 24.870  16.267  1.00 27.22  ? 485 ARG A N   1 
ATOM   3636 C CA  . ARG A 1 485 ? -12.129 24.638  17.537  1.00 29.10  ? 485 ARG A CA  1 
ATOM   3637 C C   . ARG A 1 485 ? -12.819 25.220  18.775  1.00 33.40  ? 485 ARG A C   1 
ATOM   3638 O O   . ARG A 1 485 ? -12.863 24.560  19.799  1.00 35.66  ? 485 ARG A O   1 
ATOM   3639 C CB  . ARG A 1 485 ? -10.717 25.162  17.518  1.00 27.06  ? 485 ARG A CB  1 
ATOM   3640 C CG  . ARG A 1 485 ? -9.669  24.305  16.841  1.00 24.59  ? 485 ARG A CG  1 
ATOM   3641 C CD  . ARG A 1 485 ? -8.537  25.276  16.672  1.00 23.08  ? 485 ARG A CD  1 
ATOM   3642 N NE  . ARG A 1 485 ? -7.888  25.173  15.392  1.00 26.85  ? 485 ARG A NE  1 
ATOM   3643 C CZ  . ARG A 1 485 ? -7.757  26.187  14.535  1.00 29.96  ? 485 ARG A CZ  1 
ATOM   3644 N NH1 . ARG A 1 485 ? -8.291  27.351  14.840  1.00 35.18  ? 485 ARG A NH1 1 
ATOM   3645 N NH2 . ARG A 1 485 ? -7.100  26.056  13.378  1.00 28.01  ? 485 ARG A NH2 1 
ATOM   3646 N N   . THR A 1 486 ? -13.385 26.425  18.685  1.00 34.51  ? 486 THR A N   1 
ATOM   3647 C CA  . THR A 1 486 ? -13.727 27.188  19.887  1.00 31.11  ? 486 THR A CA  1 
ATOM   3648 C C   . THR A 1 486 ? -15.112 27.787  19.854  1.00 33.60  ? 486 THR A C   1 
ATOM   3649 O O   . THR A 1 486 ? -15.476 28.489  20.780  1.00 33.02  ? 486 THR A O   1 
ATOM   3650 C CB  . THR A 1 486 ? -12.778 28.380  20.016  1.00 29.65  ? 486 THR A CB  1 
ATOM   3651 O OG1 . THR A 1 486 ? -13.155 29.380  19.050  1.00 29.40  ? 486 THR A OG1 1 
ATOM   3652 C CG2 . THR A 1 486 ? -11.354 27.958  19.725  1.00 27.77  ? 486 THR A CG2 1 
ATOM   3653 N N   . GLY A 1 487 ? -15.871 27.567  18.779  1.00 34.36  ? 487 GLY A N   1 
ATOM   3654 C CA  . GLY A 1 487 ? -17.194 28.190  18.647  1.00 29.44  ? 487 GLY A CA  1 
ATOM   3655 C C   . GLY A 1 487 ? -17.121 29.697  18.339  1.00 31.02  ? 487 GLY A C   1 
ATOM   3656 O O   . GLY A 1 487 ? -18.154 30.390  18.448  1.00 30.94  ? 487 GLY A O   1 
ATOM   3657 N N   . ASP A 1 488 ? -15.937 30.206  17.947  1.00 28.34  ? 488 ASP A N   1 
ATOM   3658 C CA  . ASP A 1 488 ? -15.772 31.619  17.596  1.00 30.18  ? 488 ASP A CA  1 
ATOM   3659 C C   . ASP A 1 488 ? -14.706 31.878  16.498  1.00 31.46  ? 488 ASP A C   1 
ATOM   3660 O O   . ASP A 1 488 ? -13.535 31.628  16.692  1.00 31.75  ? 488 ASP A O   1 
ATOM   3661 C CB  . ASP A 1 488 ? -15.480 32.405  18.879  1.00 33.15  ? 488 ASP A CB  1 
ATOM   3662 C CG  . ASP A 1 488 ? -14.987 33.856  18.653  1.00 38.78  ? 488 ASP A CG  1 
ATOM   3663 O OD1 . ASP A 1 488 ? -14.736 34.406  17.541  1.00 38.51  ? 488 ASP A OD1 1 
ATOM   3664 O OD2 . ASP A 1 488 ? -14.831 34.485  19.704  1.00 45.12  ? 488 ASP A OD2 1 
ATOM   3665 N N   . PRO A 1 489 ? -15.120 32.429  15.345  1.00 32.16  ? 489 PRO A N   1 
ATOM   3666 C CA  . PRO A 1 489 ? -14.220 32.583  14.210  1.00 32.62  ? 489 PRO A CA  1 
ATOM   3667 C C   . PRO A 1 489 ? -13.065 33.479  14.482  1.00 34.89  ? 489 PRO A C   1 
ATOM   3668 O O   . PRO A 1 489 ? -12.094 33.480  13.724  1.00 36.19  ? 489 PRO A O   1 
ATOM   3669 C CB  . PRO A 1 489 ? -15.068 33.311  13.161  1.00 32.02  ? 489 PRO A CB  1 
ATOM   3670 C CG  . PRO A 1 489 ? -16.281 33.801  13.875  1.00 30.88  ? 489 PRO A CG  1 
ATOM   3671 C CD  . PRO A 1 489 ? -16.498 32.864  15.026  1.00 31.01  ? 489 PRO A CD  1 
ATOM   3672 N N   . ASN A 1 490 ? -13.183 34.290  15.512  1.00 37.15  ? 490 ASN A N   1 
ATOM   3673 C CA  . ASN A 1 490 ? -12.181 35.309  15.754  1.00 38.90  ? 490 ASN A CA  1 
ATOM   3674 C C   . ASN A 1 490 ? -10.884 34.749  16.263  1.00 42.62  ? 490 ASN A C   1 
ATOM   3675 O O   . ASN A 1 490 ? -10.883 33.736  17.028  1.00 37.75  ? 490 ASN A O   1 
ATOM   3676 C CB  . ASN A 1 490 ? -12.759 36.287  16.716  1.00 35.11  ? 490 ASN A CB  1 
ATOM   3677 C CG  . ASN A 1 490 ? -13.628 37.256  16.014  1.00 35.50  ? 490 ASN A CG  1 
ATOM   3678 O OD1 . ASN A 1 490 ? -13.141 38.077  15.246  1.00 39.41  ? 490 ASN A OD1 1 
ATOM   3679 N ND2 . ASN A 1 490 ? -14.911 37.148  16.216  1.00 32.16  ? 490 ASN A ND2 1 
ATOM   3680 N N   . GLU A 1 491 ? -9.795  35.414  15.852  1.00 49.44  ? 491 GLU A N   1 
ATOM   3681 C CA  . GLU A 1 491 ? -8.416  34.892  16.084  1.00 69.22  ? 491 GLU A CA  1 
ATOM   3682 C C   . GLU A 1 491 ? -8.029  34.653  17.610  1.00 73.55  ? 491 GLU A C   1 
ATOM   3683 O O   . GLU A 1 491 ? -7.622  35.613  18.296  1.00 68.14  ? 491 GLU A O   1 
ATOM   3684 C CB  . GLU A 1 491 ? -7.368  35.669  15.218  1.00 68.51  ? 491 GLU A CB  1 
ATOM   3685 C CG  . GLU A 1 491 ? -6.023  34.948  14.952  1.00 73.36  ? 491 GLU A CG  1 
ATOM   3686 C CD  . GLU A 1 491 ? -6.109  33.409  14.822  1.00 77.73  ? 491 GLU A CD  1 
ATOM   3687 O OE1 . GLU A 1 491 ? -6.639  32.931  13.812  1.00 86.11  ? 491 GLU A OE1 1 
ATOM   3688 O OE2 . GLU A 1 491 ? -5.646  32.646  15.707  1.00 66.19  ? 491 GLU A OE2 1 
ATOM   3689 N N   . PRO A 1 492 ? -8.163  33.365  18.117  1.00 76.89  ? 492 PRO A N   1 
ATOM   3690 C CA  . PRO A 1 492 ? -8.437  33.104  19.518  1.00 79.46  ? 492 PRO A CA  1 
ATOM   3691 C C   . PRO A 1 492 ? -8.180  34.247  20.502  1.00 90.86  ? 492 PRO A C   1 
ATOM   3692 O O   . PRO A 1 492 ? -9.149  34.817  20.992  1.00 95.96  ? 492 PRO A O   1 
ATOM   3693 C CB  . PRO A 1 492 ? -7.652  31.816  19.755  1.00 68.04  ? 492 PRO A CB  1 
ATOM   3694 C CG  . PRO A 1 492 ? -8.085  31.035  18.557  1.00 58.98  ? 492 PRO A CG  1 
ATOM   3695 C CD  . PRO A 1 492 ? -7.962  32.056  17.443  1.00 68.10  ? 492 PRO A CD  1 
ATOM   3696 N N   . ARG A 1 493 ? -6.927  34.619  20.762  1.00 100.80 ? 493 ARG A N   1 
ATOM   3697 C CA  . ARG A 1 493 ? -6.625  35.866  21.503  1.00 103.27 ? 493 ARG A CA  1 
ATOM   3698 C C   . ARG A 1 493 ? -5.772  36.818  20.607  1.00 105.85 ? 493 ARG A C   1 
ATOM   3699 O O   . ARG A 1 493 ? -4.564  36.610  20.441  1.00 98.34  ? 493 ARG A O   1 
ATOM   3700 C CB  . ARG A 1 493 ? -5.980  35.564  22.879  1.00 82.69  ? 493 ARG A CB  1 
ATOM   3701 N N   . ASP A 1 494 ? -6.413  37.831  20.006  1.00 110.26 ? 494 ASP A N   1 
ATOM   3702 C CA  . ASP A 1 494 ? -5.744  38.732  19.036  1.00 109.66 ? 494 ASP A CA  1 
ATOM   3703 C C   . ASP A 1 494 ? -6.612  39.883  18.418  1.00 122.41 ? 494 ASP A C   1 
ATOM   3704 O O   . ASP A 1 494 ? -7.146  39.697  17.311  1.00 116.44 ? 494 ASP A O   1 
ATOM   3705 C CB  . ASP A 1 494 ? -5.072  37.890  17.909  1.00 88.07  ? 494 ASP A CB  1 
ATOM   3706 C CG  . ASP A 1 494 ? -4.565  38.738  16.725  1.00 85.73  ? 494 ASP A CG  1 
ATOM   3707 O OD1 . ASP A 1 494 ? -4.242  39.940  16.875  1.00 82.81  ? 494 ASP A OD1 1 
ATOM   3708 O OD2 . ASP A 1 494 ? -4.487  38.192  15.614  1.00 84.72  ? 494 ASP A OD2 1 
ATOM   3709 N N   . PRO A 1 495 ? -6.787  41.045  19.139  1.00 132.89 ? 495 PRO A N   1 
ATOM   3710 C CA  . PRO A 1 495 ? -6.864  42.363  18.413  1.00 128.79 ? 495 PRO A CA  1 
ATOM   3711 C C   . PRO A 1 495 ? -5.424  42.863  17.975  1.00 119.31 ? 495 PRO A C   1 
ATOM   3712 O O   . PRO A 1 495 ? -4.453  42.330  18.523  1.00 108.36 ? 495 PRO A O   1 
ATOM   3713 C CB  . PRO A 1 495 ? -7.559  43.296  19.442  1.00 113.70 ? 495 PRO A CB  1 
ATOM   3714 C CG  . PRO A 1 495 ? -8.276  42.376  20.395  1.00 104.83 ? 495 PRO A CG  1 
ATOM   3715 C CD  . PRO A 1 495 ? -7.394  41.148  20.491  1.00 119.04 ? 495 PRO A CD  1 
ATOM   3716 N N   . LYS A 1 496 ? -5.217  43.786  17.007  1.00 104.37 ? 496 LYS A N   1 
ATOM   3717 C CA  . LYS A 1 496 ? -6.197  44.443  16.130  1.00 103.21 ? 496 LYS A CA  1 
ATOM   3718 C C   . LYS A 1 496 ? -7.030  43.447  15.307  1.00 122.63 ? 496 LYS A C   1 
ATOM   3719 O O   . LYS A 1 496 ? -8.251  43.364  15.541  1.00 128.70 ? 496 LYS A O   1 
ATOM   3720 C CB  . LYS A 1 496 ? -5.506  45.467  15.203  1.00 81.49  ? 496 LYS A CB  1 
ATOM   3721 N N   . ALA A 1 497 ? -6.370  42.681  14.401  1.00 129.14 ? 497 ALA A N   1 
ATOM   3722 C CA  . ALA A 1 497 ? -7.010  41.771  13.369  1.00 110.30 ? 497 ALA A CA  1 
ATOM   3723 C C   . ALA A 1 497 ? -8.570  41.903  13.306  1.00 108.94 ? 497 ALA A C   1 
ATOM   3724 O O   . ALA A 1 497 ? -9.277  41.159  14.005  1.00 107.08 ? 497 ALA A O   1 
ATOM   3725 C CB  . ALA A 1 497 ? -6.548  40.303  13.527  1.00 76.73  ? 497 ALA A CB  1 
ATOM   3726 N N   . PRO A 1 498 ? -9.101  42.851  12.467  1.00 98.44  ? 498 PRO A N   1 
ATOM   3727 C CA  . PRO A 1 498 ? -10.414 43.488  12.822  1.00 84.04  ? 498 PRO A CA  1 
ATOM   3728 C C   . PRO A 1 498 ? -11.468 42.479  13.319  1.00 69.70  ? 498 PRO A C   1 
ATOM   3729 O O   . PRO A 1 498 ? -11.549 41.386  12.778  1.00 65.13  ? 498 PRO A O   1 
ATOM   3730 C CB  . PRO A 1 498 ? -10.828 44.213  11.522  1.00 83.65  ? 498 PRO A CB  1 
ATOM   3731 C CG  . PRO A 1 498 ? -9.544  44.380  10.738  1.00 83.25  ? 498 PRO A CG  1 
ATOM   3732 C CD  . PRO A 1 498 ? -8.645  43.228  11.103  1.00 80.00  ? 498 PRO A CD  1 
ATOM   3733 N N   . GLN A 1 499 ? -12.243 42.831  14.342  1.00 58.59  ? 499 GLN A N   1 
ATOM   3734 C CA  . GLN A 1 499 ? -13.128 41.863  15.013  1.00 51.39  ? 499 GLN A CA  1 
ATOM   3735 C C   . GLN A 1 499 ? -14.435 41.525  14.281  1.00 49.63  ? 499 GLN A C   1 
ATOM   3736 O O   . GLN A 1 499 ? -14.981 42.351  13.566  1.00 47.79  ? 499 GLN A O   1 
ATOM   3737 C CB  . GLN A 1 499 ? -13.467 42.338  16.436  1.00 54.15  ? 499 GLN A CB  1 
ATOM   3738 C CG  . GLN A 1 499 ? -12.361 42.079  17.453  1.00 61.16  ? 499 GLN A CG  1 
ATOM   3739 C CD  . GLN A 1 499 ? -11.897 40.604  17.532  1.00 61.48  ? 499 GLN A CD  1 
ATOM   3740 O OE1 . GLN A 1 499 ? -12.663 39.715  17.946  1.00 53.21  ? 499 GLN A OE1 1 
ATOM   3741 N NE2 . GLN A 1 499 ? -10.618 40.352  17.176  1.00 51.58  ? 499 GLN A NE2 1 
ATOM   3742 N N   . TRP A 1 500 ? -14.956 40.319  14.519  1.00 45.87  ? 500 TRP A N   1 
ATOM   3743 C CA  . TRP A 1 500 ? -16.183 39.816  13.889  1.00 37.47  ? 500 TRP A CA  1 
ATOM   3744 C C   . TRP A 1 500 ? -17.223 39.556  14.979  1.00 34.48  ? 500 TRP A C   1 
ATOM   3745 O O   . TRP A 1 500 ? -17.150 38.524  15.651  1.00 33.42  ? 500 TRP A O   1 
ATOM   3746 C CB  . TRP A 1 500 ? -15.883 38.501  13.113  1.00 33.99  ? 500 TRP A CB  1 
ATOM   3747 C CG  . TRP A 1 500 ? -17.057 37.783  12.371  1.00 33.48  ? 500 TRP A CG  1 
ATOM   3748 C CD1 . TRP A 1 500 ? -18.395 38.005  12.513  1.00 36.42  ? 500 TRP A CD1 1 
ATOM   3749 C CD2 . TRP A 1 500 ? -16.950 36.715  11.435  1.00 33.43  ? 500 TRP A CD2 1 
ATOM   3750 N NE1 . TRP A 1 500 ? -19.119 37.168  11.711  1.00 34.03  ? 500 TRP A NE1 1 
ATOM   3751 C CE2 . TRP A 1 500 ? -18.250 36.372  11.033  1.00 33.62  ? 500 TRP A CE2 1 
ATOM   3752 C CE3 . TRP A 1 500 ? -15.874 36.017  10.882  1.00 32.64  ? 500 TRP A CE3 1 
ATOM   3753 C CZ2 . TRP A 1 500 ? -18.498 35.367  10.112  1.00 35.26  ? 500 TRP A CZ2 1 
ATOM   3754 C CZ3 . TRP A 1 500 ? -16.121 35.033  9.954   1.00 30.82  ? 500 TRP A CZ3 1 
ATOM   3755 C CH2 . TRP A 1 500 ? -17.418 34.704  9.584   1.00 31.55  ? 500 TRP A CH2 1 
ATOM   3756 N N   . PRO A 1 501 ? -18.215 40.462  15.121  1.00 29.99  ? 501 PRO A N   1 
ATOM   3757 C CA  . PRO A 1 501 ? -19.234 40.457  16.189  1.00 28.31  ? 501 PRO A CA  1 
ATOM   3758 C C   . PRO A 1 501 ? -20.354 39.454  16.005  1.00 28.70  ? 501 PRO A C   1 
ATOM   3759 O O   . PRO A 1 501 ? -20.716 39.150  14.863  1.00 32.72  ? 501 PRO A O   1 
ATOM   3760 C CB  . PRO A 1 501 ? -19.803 41.863  16.130  1.00 27.88  ? 501 PRO A CB  1 
ATOM   3761 C CG  . PRO A 1 501 ? -19.596 42.296  14.715  1.00 30.25  ? 501 PRO A CG  1 
ATOM   3762 C CD  . PRO A 1 501 ? -18.316 41.649  14.254  1.00 30.48  ? 501 PRO A CD  1 
ATOM   3763 N N   . PRO A 1 502 ? -20.914 38.916  17.112  1.00 28.05  ? 502 PRO A N   1 
ATOM   3764 C CA  . PRO A 1 502 ? -22.055 37.993  16.902  1.00 29.35  ? 502 PRO A CA  1 
ATOM   3765 C C   . PRO A 1 502 ? -23.247 38.691  16.256  1.00 32.51  ? 502 PRO A C   1 
ATOM   3766 O O   . PRO A 1 502 ? -23.370 39.911  16.353  1.00 40.59  ? 502 PRO A O   1 
ATOM   3767 C CB  . PRO A 1 502 ? -22.413 37.483  18.316  1.00 26.42  ? 502 PRO A CB  1 
ATOM   3768 C CG  . PRO A 1 502 ? -21.209 37.765  19.134  1.00 26.30  ? 502 PRO A CG  1 
ATOM   3769 C CD  . PRO A 1 502 ? -20.378 38.847  18.481  1.00 25.69  ? 502 PRO A CD  1 
ATOM   3770 N N   . TYR A 1 503 ? -24.095 37.923  15.586  1.00 32.68  ? 503 TYR A N   1 
ATOM   3771 C CA  . TYR A 1 503 ? -25.298 38.440  14.964  1.00 30.21  ? 503 TYR A CA  1 
ATOM   3772 C C   . TYR A 1 503 ? -26.410 38.224  15.955  1.00 30.73  ? 503 TYR A C   1 
ATOM   3773 O O   . TYR A 1 503 ? -26.636 37.105  16.440  1.00 26.42  ? 503 TYR A O   1 
ATOM   3774 C CB  . TYR A 1 503 ? -25.565 37.744  13.603  1.00 29.30  ? 503 TYR A CB  1 
ATOM   3775 C CG  . TYR A 1 503 ? -26.949 37.942  13.014  1.00 27.43  ? 503 TYR A CG  1 
ATOM   3776 C CD1 . TYR A 1 503 ? -28.055 37.260  13.548  1.00 28.27  ? 503 TYR A CD1 1 
ATOM   3777 C CD2 . TYR A 1 503 ? -27.166 38.771  11.895  1.00 26.55  ? 503 TYR A CD2 1 
ATOM   3778 C CE1 . TYR A 1 503 ? -29.348 37.428  13.021  1.00 27.05  ? 503 TYR A CE1 1 
ATOM   3779 C CE2 . TYR A 1 503 ? -28.461 38.969  11.351  1.00 24.32  ? 503 TYR A CE2 1 
ATOM   3780 C CZ  . TYR A 1 503 ? -29.554 38.304  11.919  1.00 26.74  ? 503 TYR A CZ  1 
ATOM   3781 O OH  . TYR A 1 503 ? -30.873 38.433  11.443  1.00 26.46  ? 503 TYR A OH  1 
ATOM   3782 N N   . THR A 1 504 ? -27.092 39.321  16.281  1.00 35.61  ? 504 THR A N   1 
ATOM   3783 C CA  . THR A 1 504 ? -28.270 39.261  17.182  1.00 35.10  ? 504 THR A CA  1 
ATOM   3784 C C   . THR A 1 504 ? -29.505 39.676  16.430  1.00 35.65  ? 504 THR A C   1 
ATOM   3785 O O   . THR A 1 504 ? -29.405 40.266  15.321  1.00 34.43  ? 504 THR A O   1 
ATOM   3786 C CB  . THR A 1 504 ? -28.129 40.199  18.384  1.00 35.64  ? 504 THR A CB  1 
ATOM   3787 O OG1 . THR A 1 504 ? -27.949 41.553  17.910  1.00 37.84  ? 504 THR A OG1 1 
ATOM   3788 C CG2 . THR A 1 504 ? -26.941 39.771  19.282  1.00 29.74  ? 504 THR A CG2 1 
ATOM   3789 N N   . ALA A 1 505 ? -30.663 39.379  17.023  1.00 36.11  ? 505 ALA A N   1 
ATOM   3790 C CA  . ALA A 1 505 ? -31.946 39.747  16.413  1.00 35.33  ? 505 ALA A CA  1 
ATOM   3791 C C   . ALA A 1 505 ? -32.055 41.277  16.300  1.00 40.35  ? 505 ALA A C   1 
ATOM   3792 O O   . ALA A 1 505 ? -32.468 41.767  15.236  1.00 45.73  ? 505 ALA A O   1 
ATOM   3793 C CB  . ALA A 1 505 ? -33.105 39.175  17.207  1.00 36.02  ? 505 ALA A CB  1 
ATOM   3794 N N   . GLY A 1 506 ? -31.643 42.016  17.357  1.00 35.47  ? 506 GLY A N   1 
ATOM   3795 C CA  . GLY A 1 506 ? -31.667 43.472  17.362  1.00 29.99  ? 506 GLY A CA  1 
ATOM   3796 C C   . GLY A 1 506 ? -30.691 44.141  16.409  1.00 32.05  ? 506 GLY A C   1 
ATOM   3797 O O   . GLY A 1 506 ? -31.081 44.827  15.473  1.00 35.09  ? 506 GLY A O   1 
ATOM   3798 N N   . ALA A 1 507 ? -29.392 43.964  16.614  1.00 32.44  ? 507 ALA A N   1 
ATOM   3799 C CA  . ALA A 1 507 ? -28.405 44.719  15.816  1.00 27.04  ? 507 ALA A CA  1 
ATOM   3800 C C   . ALA A 1 507 ? -28.072 44.092  14.430  1.00 27.12  ? 507 ALA A C   1 
ATOM   3801 O O   . ALA A 1 507 ? -27.473 44.767  13.542  1.00 25.09  ? 507 ALA A O   1 
ATOM   3802 C CB  . ALA A 1 507 ? -27.149 44.933  16.638  1.00 24.53  ? 507 ALA A CB  1 
ATOM   3803 N N   . GLN A 1 508 ? -28.413 42.802  14.285  1.00 26.65  ? 508 GLN A N   1 
ATOM   3804 C CA  . GLN A 1 508 ? -28.295 42.080  13.045  1.00 28.72  ? 508 GLN A CA  1 
ATOM   3805 C C   . GLN A 1 508 ? -26.969 42.344  12.349  1.00 31.54  ? 508 GLN A C   1 
ATOM   3806 O O   . GLN A 1 508 ? -26.924 42.721  11.169  1.00 34.85  ? 508 GLN A O   1 
ATOM   3807 C CB  . GLN A 1 508 ? -29.419 42.484  12.131  1.00 30.89  ? 508 GLN A CB  1 
ATOM   3808 C CG  . GLN A 1 508 ? -30.801 42.256  12.717  1.00 34.58  ? 508 GLN A CG  1 
ATOM   3809 C CD  . GLN A 1 508 ? -31.843 42.963  11.874  1.00 39.15  ? 508 GLN A CD  1 
ATOM   3810 O OE1 . GLN A 1 508 ? -32.193 42.500  10.791  1.00 43.03  ? 508 GLN A OE1 1 
ATOM   3811 N NE2 . GLN A 1 508 ? -32.284 44.132  12.323  1.00 43.70  ? 508 GLN A NE2 1 
ATOM   3812 N N   . GLN A 1 509 ? -25.882 42.149  13.081  1.00 32.36  ? 509 GLN A N   1 
ATOM   3813 C CA  . GLN A 1 509 ? -24.565 42.413  12.555  1.00 31.83  ? 509 GLN A CA  1 
ATOM   3814 C C   . GLN A 1 509 ? -23.868 41.218  11.877  1.00 32.99  ? 509 GLN A C   1 
ATOM   3815 O O   . GLN A 1 509 ? -23.947 40.033  12.350  1.00 34.88  ? 509 GLN A O   1 
ATOM   3816 C CB  . GLN A 1 509 ? -23.734 42.867  13.718  1.00 35.13  ? 509 GLN A CB  1 
ATOM   3817 C CG  . GLN A 1 509 ? -23.764 44.363  13.975  1.00 34.02  ? 509 GLN A CG  1 
ATOM   3818 C CD  . GLN A 1 509 ? -23.006 44.717  15.234  1.00 29.42  ? 509 GLN A CD  1 
ATOM   3819 O OE1 . GLN A 1 509 ? -23.317 44.164  16.286  1.00 28.31  ? 509 GLN A OE1 1 
ATOM   3820 N NE2 . GLN A 1 509 ? -21.977 45.587  15.124  1.00 25.11  ? 509 GLN A NE2 1 
ATOM   3821 N N   . TYR A 1 510 ? -23.154 41.536  10.788  1.00 31.37  ? 510 TYR A N   1 
ATOM   3822 C CA  . TYR A 1 510 ? -22.511 40.513  9.934   1.00 29.34  ? 510 TYR A CA  1 
ATOM   3823 C C   . TYR A 1 510 ? -21.267 41.089  9.239   1.00 29.88  ? 510 TYR A C   1 
ATOM   3824 O O   . TYR A 1 510 ? -21.036 42.328  9.298   1.00 32.01  ? 510 TYR A O   1 
ATOM   3825 C CB  . TYR A 1 510 ? -23.558 39.983  8.929   1.00 29.79  ? 510 TYR A CB  1 
ATOM   3826 C CG  . TYR A 1 510 ? -23.880 40.940  7.801   1.00 30.91  ? 510 TYR A CG  1 
ATOM   3827 C CD1 . TYR A 1 510 ? -24.977 41.817  7.838   1.00 30.72  ? 510 TYR A CD1 1 
ATOM   3828 C CD2 . TYR A 1 510 ? -23.081 40.953  6.678   1.00 30.30  ? 510 TYR A CD2 1 
ATOM   3829 C CE1 . TYR A 1 510 ? -25.219 42.690  6.763   1.00 29.44  ? 510 TYR A CE1 1 
ATOM   3830 C CE2 . TYR A 1 510 ? -23.313 41.799  5.627   1.00 28.90  ? 510 TYR A CE2 1 
ATOM   3831 C CZ  . TYR A 1 510 ? -24.355 42.665  5.663   1.00 29.01  ? 510 TYR A CZ  1 
ATOM   3832 O OH  . TYR A 1 510 ? -24.429 43.463  4.555   1.00 27.74  ? 510 TYR A OH  1 
ATOM   3833 N N   . VAL A 1 511 ? -20.465 40.251  8.572   1.00 26.59  ? 511 VAL A N   1 
ATOM   3834 C CA  . VAL A 1 511 ? -19.221 40.783  7.951   1.00 26.38  ? 511 VAL A CA  1 
ATOM   3835 C C   . VAL A 1 511 ? -19.085 40.523  6.472   1.00 27.54  ? 511 VAL A C   1 
ATOM   3836 O O   . VAL A 1 511 ? -19.707 39.591  5.959   1.00 28.71  ? 511 VAL A O   1 
ATOM   3837 C CB  . VAL A 1 511 ? -17.952 40.287  8.655   1.00 26.34  ? 511 VAL A CB  1 
ATOM   3838 C CG1 . VAL A 1 511 ? -17.961 40.750  10.093  1.00 26.51  ? 511 VAL A CG1 1 
ATOM   3839 C CG2 . VAL A 1 511 ? -17.856 38.769  8.607   1.00 26.33  ? 511 VAL A CG2 1 
ATOM   3840 N N   . SER A 1 512 ? -18.301 41.327  5.754   1.00 29.50  ? 512 SER A N   1 
ATOM   3841 C CA  . SER A 1 512 ? -18.081 41.000  4.327   1.00 32.62  ? 512 SER A CA  1 
ATOM   3842 C C   . SER A 1 512 ? -16.753 40.260  4.162   1.00 33.52  ? 512 SER A C   1 
ATOM   3843 O O   . SER A 1 512 ? -15.698 40.765  4.551   1.00 36.23  ? 512 SER A O   1 
ATOM   3844 C CB  . SER A 1 512 ? -18.050 42.241  3.484   1.00 32.82  ? 512 SER A CB  1 
ATOM   3845 O OG  . SER A 1 512 ? -17.071 43.088  4.038   1.00 38.78  ? 512 SER A OG  1 
ATOM   3846 N N   . LEU A 1 513 ? -16.818 39.046  3.614   1.00 29.66  ? 513 LEU A N   1 
ATOM   3847 C CA  . LEU A 1 513 ? -15.644 38.275  3.307   1.00 24.09  ? 513 LEU A CA  1 
ATOM   3848 C C   . LEU A 1 513 ? -15.219 38.649  1.885   1.00 26.62  ? 513 LEU A C   1 
ATOM   3849 O O   . LEU A 1 513 ? -15.977 38.519  0.941   1.00 28.65  ? 513 LEU A O   1 
ATOM   3850 C CB  . LEU A 1 513 ? -15.973 36.808  3.452   1.00 20.01  ? 513 LEU A CB  1 
ATOM   3851 C CG  . LEU A 1 513 ? -16.310 36.370  4.873   1.00 18.34  ? 513 LEU A CG  1 
ATOM   3852 C CD1 . LEU A 1 513 ? -16.582 34.881  4.941   1.00 16.36  ? 513 LEU A CD1 1 
ATOM   3853 C CD2 . LEU A 1 513 ? -15.213 36.725  5.850   1.00 16.27  ? 513 LEU A CD2 1 
ATOM   3854 N N   . ASP A 1 514 ? -13.984 39.070  1.717   1.00 29.64  ? 514 ASP A N   1 
ATOM   3855 C CA  . ASP A 1 514 ? -13.629 39.857  0.602   1.00 32.11  ? 514 ASP A CA  1 
ATOM   3856 C C   . ASP A 1 514 ? -12.123 39.956  0.595   1.00 33.15  ? 514 ASP A C   1 
ATOM   3857 O O   . ASP A 1 514 ? -11.482 39.645  1.612   1.00 31.62  ? 514 ASP A O   1 
ATOM   3858 C CB  . ASP A 1 514 ? -14.094 41.217  1.026   1.00 43.26  ? 514 ASP A CB  1 
ATOM   3859 C CG  . ASP A 1 514 ? -14.225 42.148  -0.095  1.00 51.43  ? 514 ASP A CG  1 
ATOM   3860 O OD1 . ASP A 1 514 ? -14.156 41.682  -1.271  1.00 55.80  ? 514 ASP A OD1 1 
ATOM   3861 O OD2 . ASP A 1 514 ? -14.411 43.343  0.248   1.00 52.44  ? 514 ASP A OD2 1 
ATOM   3862 N N   . LEU A 1 515 ? -11.514 40.455  -0.479  1.00 30.73  ? 515 LEU A N   1 
ATOM   3863 C CA  . LEU A 1 515 ? -10.051 40.621  -0.370  1.00 30.17  ? 515 LEU A CA  1 
ATOM   3864 C C   . LEU A 1 515 ? -9.655  41.678  0.651   1.00 33.64  ? 515 LEU A C   1 
ATOM   3865 O O   . LEU A 1 515 ? -8.575  41.607  1.206   1.00 37.57  ? 515 LEU A O   1 
ATOM   3866 C CB  . LEU A 1 515 ? -9.376  40.894  -1.699  1.00 24.43  ? 515 LEU A CB  1 
ATOM   3867 C CG  . LEU A 1 515 ? -9.504  39.752  -2.691  1.00 22.75  ? 515 LEU A CG  1 
ATOM   3868 C CD1 . LEU A 1 515 ? -8.768  40.149  -3.970  1.00 19.22  ? 515 LEU A CD1 1 
ATOM   3869 C CD2 . LEU A 1 515 ? -9.026  38.435  -2.061  1.00 20.82  ? 515 LEU A CD2 1 
ATOM   3870 N N   . ARG A 1 516 ? -10.541 42.644  0.885   1.00 37.22  ? 516 ARG A N   1 
ATOM   3871 C CA  . ARG A 1 516 ? -10.354 43.693  1.876   1.00 37.72  ? 516 ARG A CA  1 
ATOM   3872 C C   . ARG A 1 516 ? -10.541 43.137  3.301   1.00 37.07  ? 516 ARG A C   1 
ATOM   3873 O O   . ARG A 1 516 ? -11.125 42.048  3.512   1.00 38.25  ? 516 ARG A O   1 
ATOM   3874 C CB  . ARG A 1 516 ? -11.309 44.866  1.587   1.00 39.44  ? 516 ARG A CB  1 
ATOM   3875 C CG  . ARG A 1 516 ? -11.064 45.639  0.260   1.00 43.37  ? 516 ARG A CG  1 
ATOM   3876 C CD  . ARG A 1 516 ? -12.014 46.855  0.052   1.00 53.83  ? 516 ARG A CD  1 
ATOM   3877 N NE  . ARG A 1 516 ? -13.459 46.483  0.081   1.00 62.49  ? 516 ARG A NE  1 
ATOM   3878 C CZ  . ARG A 1 516 ? -14.330 46.662  1.099   1.00 61.83  ? 516 ARG A CZ  1 
ATOM   3879 N NH1 . ARG A 1 516 ? -13.999 47.276  2.240   1.00 59.51  ? 516 ARG A NH1 1 
ATOM   3880 N NH2 . ARG A 1 516 ? -15.577 46.231  0.971   1.00 62.86  ? 516 ARG A NH2 1 
ATOM   3881 N N   . PRO A 1 517 ? -9.998  43.852  4.293   1.00 38.80  ? 517 PRO A N   1 
ATOM   3882 C CA  . PRO A 1 517 ? -10.201 43.375  5.674   1.00 36.46  ? 517 PRO A CA  1 
ATOM   3883 C C   . PRO A 1 517 ? -11.684 43.373  6.053   1.00 34.65  ? 517 PRO A C   1 
ATOM   3884 O O   . PRO A 1 517 ? -12.480 44.082  5.441   1.00 35.03  ? 517 PRO A O   1 
ATOM   3885 C CB  . PRO A 1 517 ? -9.414  44.399  6.513   1.00 36.27  ? 517 PRO A CB  1 
ATOM   3886 C CG  . PRO A 1 517 ? -8.352  44.922  5.587   1.00 37.39  ? 517 PRO A CG  1 
ATOM   3887 C CD  . PRO A 1 517 ? -8.981  44.933  4.207   1.00 37.94  ? 517 PRO A CD  1 
ATOM   3888 N N   . LEU A 1 518 ? -12.069 42.573  7.040   1.00 34.90  ? 518 LEU A N   1 
ATOM   3889 C CA  . LEU A 1 518 ? -13.462 42.557  7.531   1.00 35.50  ? 518 LEU A CA  1 
ATOM   3890 C C   . LEU A 1 518 ? -14.105 43.945  7.683   1.00 38.48  ? 518 LEU A C   1 
ATOM   3891 O O   . LEU A 1 518 ? -13.520 44.805  8.301   1.00 44.23  ? 518 LEU A O   1 
ATOM   3892 C CB  . LEU A 1 518 ? -13.524 41.864  8.894   1.00 34.13  ? 518 LEU A CB  1 
ATOM   3893 C CG  . LEU A 1 518 ? -13.210 40.371  8.925   1.00 36.37  ? 518 LEU A CG  1 
ATOM   3894 C CD1 . LEU A 1 518 ? -13.606 39.698  10.233  1.00 37.92  ? 518 LEU A CD1 1 
ATOM   3895 C CD2 . LEU A 1 518 ? -13.923 39.647  7.806   1.00 35.17  ? 518 LEU A CD2 1 
ATOM   3896 N N   . GLU A 1 519 ? -15.300 44.154  7.148   1.00 38.98  ? 519 GLU A N   1 
ATOM   3897 C CA  . GLU A 1 519 ? -16.121 45.333  7.439   1.00 36.59  ? 519 GLU A CA  1 
ATOM   3898 C C   . GLU A 1 519 ? -17.428 44.883  8.150   1.00 33.49  ? 519 GLU A C   1 
ATOM   3899 O O   . GLU A 1 519 ? -18.020 43.870  7.802   1.00 33.19  ? 519 GLU A O   1 
ATOM   3900 C CB  . GLU A 1 519 ? -16.422 46.007  6.132   1.00 41.49  ? 519 GLU A CB  1 
ATOM   3901 C CG  . GLU A 1 519 ? -16.827 47.472  6.155   1.00 54.12  ? 519 GLU A CG  1 
ATOM   3902 C CD  . GLU A 1 519 ? -17.358 47.892  4.768   1.00 60.36  ? 519 GLU A CD  1 
ATOM   3903 O OE1 . GLU A 1 519 ? -16.644 47.681  3.733   1.00 56.07  ? 519 GLU A OE1 1 
ATOM   3904 O OE2 . GLU A 1 519 ? -18.512 48.380  4.707   1.00 52.57  ? 519 GLU A OE2 1 
ATOM   3905 N N   . VAL A 1 520 ? -17.865 45.596  9.177   1.00 30.81  ? 520 VAL A N   1 
ATOM   3906 C CA  . VAL A 1 520 ? -19.089 45.184  9.860   1.00 28.33  ? 520 VAL A CA  1 
ATOM   3907 C C   . VAL A 1 520 ? -20.294 45.923  9.261   1.00 30.82  ? 520 VAL A C   1 
ATOM   3908 O O   . VAL A 1 520 ? -20.175 47.057  8.821   1.00 30.27  ? 520 VAL A O   1 
ATOM   3909 C CB  . VAL A 1 520 ? -19.020 45.316  11.407  1.00 25.94  ? 520 VAL A CB  1 
ATOM   3910 C CG1 . VAL A 1 520 ? -20.268 44.696  12.051  1.00 23.42  ? 520 VAL A CG1 1 
ATOM   3911 C CG2 . VAL A 1 520 ? -17.757 44.630  11.971  1.00 22.85  ? 520 VAL A CG2 1 
ATOM   3912 N N   . ARG A 1 521 ? -21.433 45.237  9.168   1.00 30.64  ? 521 ARG A N   1 
ATOM   3913 C CA  . ARG A 1 521 ? -22.618 45.809  8.575   1.00 27.60  ? 521 ARG A CA  1 
ATOM   3914 C C   . ARG A 1 521 ? -23.790 45.267  9.330   1.00 32.63  ? 521 ARG A C   1 
ATOM   3915 O O   . ARG A 1 521 ? -23.657 44.254  10.086  1.00 34.38  ? 521 ARG A O   1 
ATOM   3916 C CB  . ARG A 1 521 ? -22.777 45.417  7.138   1.00 25.31  ? 521 ARG A CB  1 
ATOM   3917 C CG  . ARG A 1 521 ? -21.758 46.009  6.226   1.00 24.60  ? 521 ARG A CG  1 
ATOM   3918 C CD  . ARG A 1 521 ? -21.992 45.566  4.799   1.00 23.81  ? 521 ARG A CD  1 
ATOM   3919 N NE  . ARG A 1 521 ? -20.768 45.827  4.058   1.00 25.66  ? 521 ARG A NE  1 
ATOM   3920 C CZ  . ARG A 1 521 ? -20.452 45.330  2.865   1.00 25.18  ? 521 ARG A CZ  1 
ATOM   3921 N NH1 . ARG A 1 521 ? -21.277 44.571  2.190   1.00 23.05  ? 521 ARG A NH1 1 
ATOM   3922 N NH2 . ARG A 1 521 ? -19.281 45.636  2.336   1.00 28.09  ? 521 ARG A NH2 1 
ATOM   3923 N N   . ARG A 1 522 ? -24.930 45.940  9.108   1.00 33.86  ? 522 ARG A N   1 
ATOM   3924 C CA  . ARG A 1 522 ? -26.141 45.741  9.884   1.00 34.79  ? 522 ARG A CA  1 
ATOM   3925 C C   . ARG A 1 522 ? -27.247 45.356  8.903   1.00 32.43  ? 522 ARG A C   1 
ATOM   3926 O O   . ARG A 1 522 ? -27.452 46.041  7.908   1.00 32.64  ? 522 ARG A O   1 
ATOM   3927 C CB  . ARG A 1 522 ? -26.508 47.031  10.676  1.00 39.65  ? 522 ARG A CB  1 
ATOM   3928 C CG  . ARG A 1 522 ? -25.464 47.593  11.682  1.00 41.13  ? 522 ARG A CG  1 
ATOM   3929 C CD  . ARG A 1 522 ? -26.096 48.117  13.003  1.00 47.72  ? 522 ARG A CD  1 
ATOM   3930 N NE  . ARG A 1 522 ? -27.384 47.453  13.371  1.00 56.41  ? 522 ARG A NE  1 
ATOM   3931 C CZ  . ARG A 1 522 ? -28.579 48.060  13.619  1.00 56.78  ? 522 ARG A CZ  1 
ATOM   3932 N NH1 . ARG A 1 522 ? -28.698 49.373  13.574  1.00 55.30  ? 522 ARG A NH1 1 
ATOM   3933 N NH2 . ARG A 1 522 ? -29.689 47.360  13.929  1.00 50.57  ? 522 ARG A NH2 1 
ATOM   3934 N N   . GLY A 1 523 ? -27.935 44.247  9.166   1.00 29.24  ? 523 GLY A N   1 
ATOM   3935 C CA  . GLY A 1 523 ? -29.154 43.900  8.430   1.00 28.05  ? 523 GLY A CA  1 
ATOM   3936 C C   . GLY A 1 523 ? -28.849 43.120  7.172   1.00 30.43  ? 523 GLY A C   1 
ATOM   3937 O O   . GLY A 1 523 ? -28.140 43.610  6.286   1.00 33.76  ? 523 GLY A O   1 
ATOM   3938 N N   . LEU A 1 524 ? -29.333 41.877  7.122   1.00 30.43  ? 524 LEU A N   1 
ATOM   3939 C CA  . LEU A 1 524 ? -29.129 41.006  5.971   1.00 29.36  ? 524 LEU A CA  1 
ATOM   3940 C C   . LEU A 1 524 ? -30.324 41.212  5.112   1.00 31.23  ? 524 LEU A C   1 
ATOM   3941 O O   . LEU A 1 524 ? -31.358 40.485  5.292   1.00 33.30  ? 524 LEU A O   1 
ATOM   3942 C CB  . LEU A 1 524 ? -29.080 39.526  6.359   1.00 27.91  ? 524 LEU A CB  1 
ATOM   3943 C CG  . LEU A 1 524 ? -27.790 38.978  6.965   1.00 28.24  ? 524 LEU A CG  1 
ATOM   3944 C CD1 . LEU A 1 524 ? -28.073 37.612  7.551   1.00 28.94  ? 524 LEU A CD1 1 
ATOM   3945 C CD2 . LEU A 1 524 ? -26.607 38.879  6.017   1.00 27.65  ? 524 LEU A CD2 1 
ATOM   3946 N N   . ARG A 1 525 ? -30.218 42.223  4.232   1.00 30.41  ? 525 ARG A N   1 
ATOM   3947 C CA  . ARG A 1 525 ? -31.322 42.570  3.351   1.00 30.42  ? 525 ARG A CA  1 
ATOM   3948 C C   . ARG A 1 525 ? -32.621 42.761  4.191   1.00 30.82  ? 525 ARG A C   1 
ATOM   3949 O O   . ARG A 1 525 ? -33.674 42.145  3.907   1.00 33.80  ? 525 ARG A O   1 
ATOM   3950 C CB  . ARG A 1 525 ? -31.505 41.436  2.333   1.00 29.65  ? 525 ARG A CB  1 
ATOM   3951 C CG  . ARG A 1 525 ? -31.228 41.833  0.923   1.00 32.49  ? 525 ARG A CG  1 
ATOM   3952 C CD  . ARG A 1 525 ? -29.990 41.253  0.296   1.00 35.03  ? 525 ARG A CD  1 
ATOM   3953 N NE  . ARG A 1 525 ? -30.486 40.883  -1.022  1.00 43.96  ? 525 ARG A NE  1 
ATOM   3954 C CZ  . ARG A 1 525 ? -29.800 40.777  -2.169  1.00 43.50  ? 525 ARG A CZ  1 
ATOM   3955 N NH1 . ARG A 1 525 ? -28.481 41.024  -2.241  1.00 37.55  ? 525 ARG A NH1 1 
ATOM   3956 N NH2 . ARG A 1 525 ? -30.485 40.411  -3.268  1.00 42.41  ? 525 ARG A NH2 1 
ATOM   3957 N N   . ALA A 1 526 ? -32.545 43.570  5.247   1.00 27.44  ? 526 ALA A N   1 
ATOM   3958 C CA  . ALA A 1 526 ? -33.684 43.687  6.171   1.00 25.18  ? 526 ALA A CA  1 
ATOM   3959 C C   . ALA A 1 526 ? -35.043 44.155  5.588   1.00 26.00  ? 526 ALA A C   1 
ATOM   3960 O O   . ALA A 1 526 ? -36.090 43.552  5.895   1.00 27.05  ? 526 ALA A O   1 
ATOM   3961 C CB  . ALA A 1 526 ? -33.302 44.537  7.349   1.00 23.48  ? 526 ALA A CB  1 
ATOM   3962 N N   . GLN A 1 527 ? -35.048 45.214  4.766   1.00 25.22  ? 527 GLN A N   1 
ATOM   3963 C CA  . GLN A 1 527 ? -36.306 45.653  4.156   1.00 23.81  ? 527 GLN A CA  1 
ATOM   3964 C C   . GLN A 1 527 ? -36.944 44.536  3.351   1.00 23.36  ? 527 GLN A C   1 
ATOM   3965 O O   . GLN A 1 527 ? -38.123 44.234  3.531   1.00 26.61  ? 527 GLN A O   1 
ATOM   3966 C CB  . GLN A 1 527 ? -36.167 46.964  3.341   1.00 26.22  ? 527 GLN A CB  1 
ATOM   3967 C CG  . GLN A 1 527 ? -35.865 48.222  4.185   1.00 28.26  ? 527 GLN A CG  1 
ATOM   3968 C CD  . GLN A 1 527 ? -36.758 48.344  5.452   1.00 31.59  ? 527 GLN A CD  1 
ATOM   3969 O OE1 . GLN A 1 527 ? -36.285 48.245  6.624   1.00 33.14  ? 527 GLN A OE1 1 
ATOM   3970 N NE2 . GLN A 1 527 ? -38.061 48.550  5.223   1.00 28.00  ? 527 GLN A NE2 1 
ATOM   3971 N N   . ALA A 1 528 ? -36.184 43.878  2.488   1.00 23.10  ? 528 ALA A N   1 
ATOM   3972 C CA  . ALA A 1 528 ? -36.777 42.820  1.654   1.00 21.44  ? 528 ALA A CA  1 
ATOM   3973 C C   . ALA A 1 528 ? -37.207 41.613  2.500   1.00 22.99  ? 528 ALA A C   1 
ATOM   3974 O O   . ALA A 1 528 ? -38.291 40.988  2.253   1.00 22.92  ? 528 ALA A O   1 
ATOM   3975 C CB  . ALA A 1 528 ? -35.817 42.410  0.550   1.00 19.68  ? 528 ALA A CB  1 
ATOM   3976 N N   . CYS A 1 529 ? -36.399 41.274  3.515   1.00 22.68  ? 529 CYS A N   1 
ATOM   3977 C CA  . CYS A 1 529 ? -36.802 40.119  4.321   1.00 24.77  ? 529 CYS A CA  1 
ATOM   3978 C C   . CYS A 1 529 ? -38.102 40.290  5.065   1.00 25.28  ? 529 CYS A C   1 
ATOM   3979 O O   . CYS A 1 529 ? -38.925 39.365  5.105   1.00 26.28  ? 529 CYS A O   1 
ATOM   3980 C CB  . CYS A 1 529 ? -35.661 39.423  5.072   1.00 25.87  ? 529 CYS A CB  1 
ATOM   3981 S SG  . CYS A 1 529 ? -34.489 38.804  3.788   1.00 32.11  ? 529 CYS A SG  1 
ATOM   3982 N N   . ALA A 1 530 ? -38.362 41.526  5.503   1.00 26.11  ? 530 ALA A N   1 
ATOM   3983 C CA  . ALA A 1 530 ? -39.629 41.848  6.146   1.00 24.10  ? 530 ALA A CA  1 
ATOM   3984 C C   . ALA A 1 530 ? -40.813 41.562  5.214   1.00 23.85  ? 530 ALA A C   1 
ATOM   3985 O O   . ALA A 1 530 ? -41.851 40.992  5.635   1.00 23.42  ? 530 ALA A O   1 
ATOM   3986 C CB  . ALA A 1 530 ? -39.599 43.265  6.624   1.00 24.13  ? 530 ALA A CB  1 
ATOM   3987 N N   . PHE A 1 531 ? -40.623 41.882  3.933   1.00 22.38  ? 531 PHE A N   1 
ATOM   3988 C CA  . PHE A 1 531 ? -41.615 41.544  2.942   1.00 21.82  ? 531 PHE A CA  1 
ATOM   3989 C C   . PHE A 1 531 ? -41.810 40.065  2.826   1.00 21.83  ? 531 PHE A C   1 
ATOM   3990 O O   . PHE A 1 531 ? -42.936 39.608  2.915   1.00 22.79  ? 531 PHE A O   1 
ATOM   3991 C CB  . PHE A 1 531 ? -41.248 42.100  1.590   1.00 24.39  ? 531 PHE A CB  1 
ATOM   3992 C CG  . PHE A 1 531 ? -42.121 41.604  0.460   1.00 25.79  ? 531 PHE A CG  1 
ATOM   3993 C CD1 . PHE A 1 531 ? -43.335 42.180  0.206   1.00 25.78  ? 531 PHE A CD1 1 
ATOM   3994 C CD2 . PHE A 1 531 ? -41.701 40.576  -0.363  1.00 27.11  ? 531 PHE A CD2 1 
ATOM   3995 C CE1 . PHE A 1 531 ? -44.148 41.728  -0.832  1.00 28.61  ? 531 PHE A CE1 1 
ATOM   3996 C CE2 . PHE A 1 531 ? -42.495 40.122  -1.406  1.00 29.71  ? 531 PHE A CE2 1 
ATOM   3997 C CZ  . PHE A 1 531 ? -43.727 40.707  -1.651  1.00 30.68  ? 531 PHE A CZ  1 
ATOM   3998 N N   . TRP A 1 532 ? -40.741 39.302  2.616   1.00 21.45  ? 532 TRP A N   1 
ATOM   3999 C CA  . TRP A 1 532 ? -40.947 37.852  2.451   1.00 21.24  ? 532 TRP A CA  1 
ATOM   4000 C C   . TRP A 1 532 ? -41.408 37.229  3.712   1.00 21.22  ? 532 TRP A C   1 
ATOM   4001 O O   . TRP A 1 532 ? -42.356 36.491  3.686   1.00 23.64  ? 532 TRP A O   1 
ATOM   4002 C CB  . TRP A 1 532 ? -39.696 37.125  1.965   1.00 20.25  ? 532 TRP A CB  1 
ATOM   4003 C CG  . TRP A 1 532 ? -39.338 37.531  0.623   1.00 18.60  ? 532 TRP A CG  1 
ATOM   4004 C CD1 . TRP A 1 532 ? -38.371 38.454  0.265   1.00 18.78  ? 532 TRP A CD1 1 
ATOM   4005 C CD2 . TRP A 1 532 ? -39.945 37.089  -0.571  1.00 16.62  ? 532 TRP A CD2 1 
ATOM   4006 N NE1 . TRP A 1 532 ? -38.346 38.599  -1.099  1.00 17.37  ? 532 TRP A NE1 1 
ATOM   4007 C CE2 . TRP A 1 532 ? -39.314 37.786  -1.643  1.00 17.15  ? 532 TRP A CE2 1 
ATOM   4008 C CE3 . TRP A 1 532 ? -40.965 36.186  -0.852  1.00 16.49  ? 532 TRP A CE3 1 
ATOM   4009 C CZ2 . TRP A 1 532 ? -39.675 37.592  -2.998  1.00 16.64  ? 532 TRP A CZ2 1 
ATOM   4010 C CZ3 . TRP A 1 532 ? -41.331 35.983  -2.198  1.00 16.84  ? 532 TRP A CZ3 1 
ATOM   4011 C CH2 . TRP A 1 532 ? -40.677 36.687  -3.258  1.00 16.90  ? 532 TRP A CH2 1 
ATOM   4012 N N   . ASN A 1 533 ? -40.756 37.560  4.816   1.00 22.36  ? 533 ASN A N   1 
ATOM   4013 C CA  . ASN A 1 533 ? -41.028 36.930  6.119   1.00 25.86  ? 533 ASN A CA  1 
ATOM   4014 C C   . ASN A 1 533 ? -42.280 37.376  6.906   1.00 28.19  ? 533 ASN A C   1 
ATOM   4015 O O   . ASN A 1 533 ? -42.775 36.601  7.715   1.00 25.44  ? 533 ASN A O   1 
ATOM   4016 C CB  . ASN A 1 533 ? -39.809 37.060  7.049   1.00 26.04  ? 533 ASN A CB  1 
ATOM   4017 C CG  . ASN A 1 533 ? -38.595 36.264  6.547   1.00 29.08  ? 533 ASN A CG  1 
ATOM   4018 O OD1 . ASN A 1 533 ? -38.703 35.425  5.638   1.00 33.56  ? 533 ASN A OD1 1 
ATOM   4019 N ND2 . ASN A 1 533 ? -37.430 36.536  7.117   1.00 27.38  ? 533 ASN A ND2 1 
ATOM   4020 N N   . ARG A 1 534 ? -42.745 38.626  6.738   1.00 30.85  ? 534 ARG A N   1 
ATOM   4021 C CA  . ARG A 1 534 ? -43.825 39.143  7.585   1.00 28.13  ? 534 ARG A CA  1 
ATOM   4022 C C   . ARG A 1 534 ? -44.958 39.501  6.761   1.00 28.78  ? 534 ARG A C   1 
ATOM   4023 O O   . ARG A 1 534 ? -46.068 39.209  7.132   1.00 30.51  ? 534 ARG A O   1 
ATOM   4024 C CB  . ARG A 1 534 ? -43.437 40.380  8.339   1.00 28.38  ? 534 ARG A CB  1 
ATOM   4025 C CG  . ARG A 1 534 ? -42.283 40.143  9.266   1.00 31.04  ? 534 ARG A CG  1 
ATOM   4026 C CD  . ARG A 1 534 ? -41.511 41.418  9.484   1.00 36.11  ? 534 ARG A CD  1 
ATOM   4027 N NE  . ARG A 1 534 ? -40.775 41.398  10.756  1.00 41.60  ? 534 ARG A NE  1 
ATOM   4028 C CZ  . ARG A 1 534 ? -41.346 41.320  11.970  1.00 37.78  ? 534 ARG A CZ  1 
ATOM   4029 N NH1 . ARG A 1 534 ? -42.682 41.212  12.122  1.00 31.92  ? 534 ARG A NH1 1 
ATOM   4030 N NH2 . ARG A 1 534 ? -40.552 41.336  13.033  1.00 34.50  ? 534 ARG A NH2 1 
ATOM   4031 N N   . PHE A 1 535 ? -44.725 40.136  5.622   1.00 29.89  ? 535 PHE A N   1 
ATOM   4032 C CA  . PHE A 1 535 ? -45.912 40.557  4.891   1.00 29.22  ? 535 PHE A CA  1 
ATOM   4033 C C   . PHE A 1 535 ? -46.576 39.465  4.036   1.00 30.76  ? 535 PHE A C   1 
ATOM   4034 O O   . PHE A 1 535 ? -47.715 39.073  4.268   1.00 32.80  ? 535 PHE A O   1 
ATOM   4035 C CB  . PHE A 1 535 ? -45.692 41.837  4.104   1.00 30.27  ? 535 PHE A CB  1 
ATOM   4036 C CG  . PHE A 1 535 ? -46.956 42.308  3.442   1.00 34.04  ? 535 PHE A CG  1 
ATOM   4037 C CD1 . PHE A 1 535 ? -48.099 42.593  4.220   1.00 32.44  ? 535 PHE A CD1 1 
ATOM   4038 C CD2 . PHE A 1 535 ? -47.066 42.373  2.037   1.00 34.43  ? 535 PHE A CD2 1 
ATOM   4039 C CE1 . PHE A 1 535 ? -49.293 42.986  3.622   1.00 31.67  ? 535 PHE A CE1 1 
ATOM   4040 C CE2 . PHE A 1 535 ? -48.266 42.745  1.434   1.00 32.55  ? 535 PHE A CE2 1 
ATOM   4041 C CZ  . PHE A 1 535 ? -49.373 43.063  2.227   1.00 33.02  ? 535 PHE A CZ  1 
ATOM   4042 N N   . LEU A 1 536 ? -45.835 38.970  3.052   1.00 31.88  ? 536 LEU A N   1 
ATOM   4043 C CA  . LEU A 1 536 ? -46.309 38.015  2.097   1.00 28.55  ? 536 LEU A CA  1 
ATOM   4044 C C   . LEU A 1 536 ? -47.179 36.876  2.595   1.00 31.58  ? 536 LEU A C   1 
ATOM   4045 O O   . LEU A 1 536 ? -48.150 36.547  1.895   1.00 30.60  ? 536 LEU A O   1 
ATOM   4046 C CB  . LEU A 1 536 ? -45.124 37.452  1.376   1.00 28.21  ? 536 LEU A CB  1 
ATOM   4047 C CG  . LEU A 1 536 ? -45.650 36.957  0.046   1.00 28.82  ? 536 LEU A CG  1 
ATOM   4048 C CD1 . LEU A 1 536 ? -46.130 38.183  -0.699  1.00 29.58  ? 536 LEU A CD1 1 
ATOM   4049 C CD2 . LEU A 1 536 ? -44.516 36.320  -0.710  1.00 27.00  ? 536 LEU A CD2 1 
ATOM   4050 N N   . PRO A 1 537 ? -46.808 36.217  3.753   1.00 35.32  ? 537 PRO A N   1 
ATOM   4051 C CA  . PRO A 1 537 ? -47.653 35.142  4.314   1.00 37.98  ? 537 PRO A CA  1 
ATOM   4052 C C   . PRO A 1 537 ? -49.138 35.506  4.423   1.00 47.17  ? 537 PRO A C   1 
ATOM   4053 O O   . PRO A 1 537 ? -49.978 34.774  3.891   1.00 53.93  ? 537 PRO A O   1 
ATOM   4054 C CB  . PRO A 1 537 ? -47.024 34.895  5.699   1.00 33.63  ? 537 PRO A CB  1 
ATOM   4055 C CG  . PRO A 1 537 ? -45.578 35.086  5.452   1.00 30.92  ? 537 PRO A CG  1 
ATOM   4056 C CD  . PRO A 1 537 ? -45.505 36.255  4.476   1.00 33.43  ? 537 PRO A CD  1 
ATOM   4057 N N   . LYS A 1 538 ? -49.436 36.647  5.065   1.00 56.89  ? 538 LYS A N   1 
ATOM   4058 C CA  . LYS A 1 538 ? -50.813 37.219  5.212   1.00 56.16  ? 538 LYS A CA  1 
ATOM   4059 C C   . LYS A 1 538 ? -51.678 37.196  3.946   1.00 55.64  ? 538 LYS A C   1 
ATOM   4060 O O   . LYS A 1 538 ? -52.904 37.295  4.018   1.00 55.32  ? 538 LYS A O   1 
ATOM   4061 C CB  . LYS A 1 538 ? -50.751 38.650  5.792   1.00 48.35  ? 538 LYS A CB  1 
ATOM   4062 C CG  . LYS A 1 538 ? -50.351 38.693  7.271   1.00 45.18  ? 538 LYS A CG  1 
ATOM   4063 C CD  . LYS A 1 538 ? -49.717 40.021  7.640   1.00 43.63  ? 538 LYS A CD  1 
ATOM   4064 C CE  . LYS A 1 538 ? -49.901 40.329  9.127   1.00 51.87  ? 538 LYS A CE  1 
ATOM   4065 N NZ  . LYS A 1 538 ? -48.655 40.277  9.968   1.00 47.97  ? 538 LYS A NZ  1 
ATOM   4066 N N   . LEU A 1 539 ? -51.042 36.977  2.807   1.00 52.23  ? 539 LEU A N   1 
ATOM   4067 C CA  . LEU A 1 539 ? -51.627 37.334  1.556   1.00 54.76  ? 539 LEU A CA  1 
ATOM   4068 C C   . LEU A 1 539 ? -51.523 36.197  0.553   1.00 68.51  ? 539 LEU A C   1 
ATOM   4069 O O   . LEU A 1 539 ? -51.864 36.338  -0.633  1.00 68.93  ? 539 LEU A O   1 
ATOM   4070 C CB  . LEU A 1 539 ? -50.928 38.615  1.109   1.00 51.73  ? 539 LEU A CB  1 
ATOM   4071 C CG  . LEU A 1 539 ? -50.877 39.283  -0.248  1.00 46.17  ? 539 LEU A CG  1 
ATOM   4072 C CD1 . LEU A 1 539 ? -50.471 40.709  -0.028  1.00 47.04  ? 539 LEU A CD1 1 
ATOM   4073 C CD2 . LEU A 1 539 ? -49.815 38.655  -1.105  1.00 51.81  ? 539 LEU A CD2 1 
ATOM   4074 N N   . LEU A 1 540 ? -51.038 35.057  1.030   1.00 86.84  ? 540 LEU A N   1 
ATOM   4075 C CA  . LEU A 1 540 ? -51.263 33.778  0.342   1.00 94.07  ? 540 LEU A CA  1 
ATOM   4076 C C   . LEU A 1 540 ? -52.553 33.287  0.972   1.00 97.76  ? 540 LEU A C   1 
ATOM   4077 O O   . LEU A 1 540 ? -53.534 32.962  0.274   1.00 84.95  ? 540 LEU A O   1 
ATOM   4078 C CB  . LEU A 1 540 ? -50.094 32.823  0.605   1.00 88.97  ? 540 LEU A CB  1 
ATOM   4079 C CG  . LEU A 1 540 ? -48.826 33.368  -0.076  1.00 90.56  ? 540 LEU A CG  1 
ATOM   4080 C CD1 . LEU A 1 540 ? -47.501 32.815  0.478   1.00 73.47  ? 540 LEU A CD1 1 
ATOM   4081 C CD2 . LEU A 1 540 ? -48.969 33.221  -1.600  1.00 84.67  ? 540 LEU A CD2 1 
ATOM   4082 N N   . SER A 1 541 ? -52.490 33.275  2.312   1.00 94.77  ? 541 SER A N   1 
ATOM   4083 C CA  . SER A 1 541 ? -53.597 33.392  3.272   1.00 87.29  ? 541 SER A CA  1 
ATOM   4084 C C   . SER A 1 541 ? -54.432 34.691  3.059   1.00 89.21  ? 541 SER A C   1 
ATOM   4085 O O   . SER A 1 541 ? -55.519 34.888  3.632   1.00 79.97  ? 541 SER A O   1 
ATOM   4086 C CB  . SER A 1 541 ? -52.973 33.332  4.686   1.00 73.94  ? 541 SER A CB  1 
ATOM   4087 O OG  . SER A 1 541 ? -53.821 33.838  5.684   1.00 66.97  ? 541 SER A OG  1 
HETATM 4088 O O   . HOH B 2 .   ? -32.963 -3.547  -10.457 1.00 23.79  ? 601 HOH A O   1 
HETATM 4089 O O   . HOH B 2 .   ? -28.062 5.935   -5.587  1.00 39.43  ? 602 HOH A O   1 
HETATM 4090 O O   . HOH B 2 .   ? -23.933 26.355  -9.416  1.00 18.98  ? 603 HOH A O   1 
HETATM 4091 O O   . HOH B 2 .   ? -22.232 2.905   13.094  1.00 15.39  ? 604 HOH A O   1 
HETATM 4092 O O   . HOH B 2 .   ? -26.844 0.058   -9.213  1.00 16.36  ? 605 HOH A O   1 
HETATM 4093 O O   . HOH B 2 .   ? -24.152 23.570  -5.412  1.00 2.00   ? 606 HOH A O   1 
HETATM 4094 O O   . HOH B 2 .   ? -23.288 41.986  -11.058 1.00 10.87  ? 607 HOH A O   1 
HETATM 4095 O O   . HOH B 2 .   ? -14.391 19.288  -14.014 1.00 15.51  ? 608 HOH A O   1 
HETATM 4096 O O   . HOH B 2 .   ? -26.397 32.493  -8.151  1.00 17.55  ? 609 HOH A O   1 
HETATM 4097 O O   . HOH B 2 .   ? -22.188 30.990  1.579   1.00 11.02  ? 610 HOH A O   1 
HETATM 4098 O O   . HOH B 2 .   ? -29.923 3.031   -3.806  1.00 34.91  ? 611 HOH A O   1 
HETATM 4099 O O   . HOH B 2 .   ? -32.619 3.767   -2.290  1.00 32.28  ? 612 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   ?   ?   ?   A . n 
A 1 3   ARG 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  MET 42  42  42  MET MET A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 VAL 187 187 187 VAL VAL A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 PRO 216 216 216 PRO PRO A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 MET 241 241 241 MET MET A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 GLN 250 250 250 GLN GLN A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 HIS 253 253 253 HIS HIS A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 THR 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASN 283 283 283 ASN ASN A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 ?   ?   ?   A . n 
A 1 291 GLN 291 291 ?   ?   ?   A . n 
A 1 292 GLU 292 292 ?   ?   ?   A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 VAL 294 294 294 VAL VAL A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 ALA 318 318 318 ALA ALA A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 HIS 322 322 322 HIS HIS A . n 
A 1 323 GLY 323 323 323 GLY GLY A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLU 358 358 358 GLU GLU A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 VAL 370 370 370 VAL VAL A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 ALA 392 392 392 ALA ALA A . n 
A 1 393 ARG 393 393 393 ARG ARG A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 LEU 398 398 398 LEU LEU A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ASP 400 400 400 ASP ASP A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 VAL 429 429 429 VAL VAL A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 SER 438 438 438 SER SER A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 ILE 457 457 457 ILE ILE A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 ARG 463 463 463 ARG ARG A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 ALA 467 467 467 ALA ALA A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 LYS 470 470 470 LYS LYS A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 ARG 478 478 478 ARG ARG A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 ALA 481 481 481 ALA ALA A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 GLU 491 491 491 GLU GLU A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 PRO 495 495 495 PRO PRO A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 ALA 497 497 497 ALA ALA A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 ALA 505 505 505 ALA ALA A . n 
A 1 506 GLY 506 506 506 GLY GLY A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASP 514 514 514 ASP ASP A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 ARG 516 516 516 ARG ARG A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 ALA 528 528 528 ALA ALA A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 ?   ?   ?   A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Israel Structural Proteomics Center' 
_pdbx_SG_project.initial_of_center     ISPC 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1890  ? 
1 MORE         -15   ? 
1 'SSA (A^2)'  37900 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z      1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 6_565 x,x-y+1,-z 0.5000000000 0.8660254038 0.0000000000 -62.6535000000 0.8660254038 -0.5000000000 
0.0000000000 108.5190452720 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-04-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .        ? 1 
PHASER    phasing           .        ? 2 
REFMAC    refinement        5.7.0029 ? 3 
HKL-2000  'data reduction'  .        ? 4 
SCALEPACK 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 134 ? ? CG A ASP 134 ? ? OD2 A ASP 134 ? ? 112.89 118.30 -5.41  0.90 N 
2 1 NE A ARG 219 ? ? CZ A ARG 219 ? ? NH1 A ARG 219 ? ? 123.38 120.30 3.08   0.50 N 
3 1 NE A ARG 224 ? ? CZ A ARG 224 ? ? NH1 A ARG 224 ? ? 123.68 120.30 3.38   0.50 N 
4 1 NE A ARG 224 ? ? CZ A ARG 224 ? ? NH2 A ARG 224 ? ? 117.29 120.30 -3.01  0.50 N 
5 1 CB A VAL 302 ? ? CA A VAL 302 ? ? C   A VAL 302 ? ? 96.92  111.40 -14.48 1.90 N 
6 1 CB A ASP 488 ? ? CG A ASP 488 ? ? OD1 A ASP 488 ? ? 126.75 118.30 8.45   0.90 N 
7 1 CA A LEU 539 ? ? CB A LEU 539 ? ? CG  A LEU 539 ? ? 130.43 115.30 15.13  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 86.22   -13.76  
2  1 TYR A 77  ? ? -154.52 68.20   
3  1 ASP A 95  ? ? -67.19  86.36   
4  1 ARG A 107 ? ? -39.95  145.80  
5  1 PRO A 162 ? ? -35.00  128.47  
6  1 ASN A 170 ? ? 57.72   15.28   
7  1 SER A 203 ? ? 42.95   -113.73 
8  1 SER A 229 ? ? 39.36   47.30   
9  1 HIS A 287 ? ? -87.74  48.50   
10 1 ASP A 306 ? ? -107.51 -89.35  
11 1 GLN A 369 ? ? 32.65   73.21   
12 1 HIS A 387 ? ? -140.94 54.99   
13 1 VAL A 407 ? ? -129.51 -57.56  
14 1 GLU A 491 ? ? -58.91  96.70   
15 1 PRO A 492 ? ? -17.22  -70.16  
16 1 ASP A 494 ? ? -179.52 82.17   
17 1 ALA A 497 ? ? 6.90    88.52   
18 1 LYS A 538 ? ? -44.01  -15.29  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    494 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    495 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            144.74 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 5   ? CG  ? A ASP 5   CG  
2  1 Y 1 A ASP 5   ? OD1 ? A ASP 5   OD1 
3  1 Y 1 A ASP 5   ? OD2 ? A ASP 5   OD2 
4  1 Y 1 A GLU 81  ? CD  ? A GLU 81  CD  
5  1 Y 1 A GLU 81  ? OE1 ? A GLU 81  OE1 
6  1 Y 1 A GLU 81  ? OE2 ? A GLU 81  OE2 
7  1 Y 1 A ARG 165 ? CG  ? A ARG 165 CG  
8  1 Y 1 A ARG 165 ? CD  ? A ARG 165 CD  
9  1 Y 1 A ARG 165 ? NE  ? A ARG 165 NE  
10 1 Y 1 A ARG 165 ? CZ  ? A ARG 165 CZ  
11 1 Y 1 A ARG 165 ? NH1 ? A ARG 165 NH1 
12 1 Y 1 A ARG 165 ? NH2 ? A ARG 165 NH2 
13 1 Y 1 A GLU 268 ? CD  ? A GLU 268 CD  
14 1 Y 1 A GLU 268 ? OE1 ? A GLU 268 OE1 
15 1 Y 1 A GLU 268 ? OE2 ? A GLU 268 OE2 
16 1 Y 1 A ARG 493 ? CG  ? A ARG 493 CG  
17 1 Y 1 A ARG 493 ? CD  ? A ARG 493 CD  
18 1 Y 1 A ARG 493 ? NE  ? A ARG 493 NE  
19 1 Y 1 A ARG 493 ? CZ  ? A ARG 493 CZ  
20 1 Y 1 A ARG 493 ? NH1 ? A ARG 493 NH1 
21 1 Y 1 A ARG 493 ? NH2 ? A ARG 493 NH2 
22 1 Y 1 A LYS 496 ? CG  ? A LYS 496 CG  
23 1 Y 1 A LYS 496 ? CD  ? A LYS 496 CD  
24 1 Y 1 A LYS 496 ? CE  ? A LYS 496 CE  
25 1 Y 1 A LYS 496 ? NZ  ? A LYS 496 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 1   ? A GLU 1   
2  1 Y 1 A GLY 2   ? A GLY 2   
3  1 Y 1 A ARG 3   ? A ARG 3   
4  1 Y 1 A GLU 4   ? A GLU 4   
5  1 Y 1 A PRO 259 ? A PRO 259 
6  1 Y 1 A GLY 260 ? A GLY 260 
7  1 Y 1 A GLY 261 ? A GLY 261 
8  1 Y 1 A THR 262 ? A THR 262 
9  1 Y 1 A GLY 263 ? A GLY 263 
10 1 Y 1 A GLY 264 ? A GLY 264 
11 1 Y 1 A PRO 290 ? A PRO 290 
12 1 Y 1 A GLN 291 ? A GLN 291 
13 1 Y 1 A GLU 292 ? A GLU 292 
14 1 Y 1 A ALA 542 ? A ALA 542 
15 1 Y 1 A THR 543 ? A THR 543 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  601 601 HOH HOH A . 
B 2 HOH 2  602 602 HOH HOH A . 
B 2 HOH 3  603 603 HOH HOH A . 
B 2 HOH 4  604 604 HOH HOH A . 
B 2 HOH 5  605 605 HOH HOH A . 
B 2 HOH 6  606 606 HOH HOH A . 
B 2 HOH 7  607 607 HOH HOH A . 
B 2 HOH 8  608 608 HOH HOH A . 
B 2 HOH 9  609 609 HOH HOH A . 
B 2 HOH 10 610 610 HOH HOH A . 
B 2 HOH 11 611 611 HOH HOH A . 
B 2 HOH 12 612 612 HOH HOH A . 
#