data_4Q44
# 
_entry.id   4Q44 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Q44         
NDB   NA2984       
RCSB  RCSB085579   
WWPDB D_1000085579 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4Q43 . unspecified 
PDB 4Q45 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4Q44 
_pdbx_database_status.recvd_initial_deposition_date   2014-04-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nair, D.T.' 1 
'Kottur, J.' 2 
'Sharma, A.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Unique structural features in DNA polymerase IV enable efficient bypass of the N2 adduct induced by the nitrofurazone antibiotic' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            23 
_citation.page_first                56 
_citation.page_last                 67 
_citation.year                      2015 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25497730 
_citation.pdbx_database_id_DOI      10.1016/j.str.2014.10.019 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kottur, J.'         1 
primary 'Sharma, A.'         2 
primary 'Gore, K.R.'         3 
primary 'Narayanan, N.'      4 
primary 'Samanta, B.'        5 
primary 'Pradeepkumar, P.I.' 6 
primary 'Nair, D.T.'         7 
# 
_cell.entry_id           4Q44 
_cell.length_a           86.655 
_cell.length_b           56.934 
_cell.length_c           110.396 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.66 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4Q44 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase IV'                                                                 38304.277 2  2.7.7.7 ? 
'UNP Residues 2-341' ? 
2 polymer     syn 
;DNA (5'-D(*TP*CP*TP*AP*(RDG)P*GP*GP*TP*CP*CP*TP*AP*GP*GP*AP*CP*CP*C)-3')
;
5572.639  4  ?       ? ?                    ? 
3 non-polymer syn "5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]thymidine" 481.184   2  ?       ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                                                     24.305    4  ?       ? ? ? 
5 water       nat water                                                                               18.015    87 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GSRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPGRFDAY
KEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPN
GQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGKFGRILWERSQGIDERDVNSERL
RKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKT
WDERRGGRGVRLVGLHVTLLDP
;
;GSRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPGRFDAY
KEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPN
GQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGKFGRILWERSQGIDERDVNSERL
RKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKT
WDERRGGRGVRLVGLHVTLLDP
;
A,F     ? 
2 polydeoxyribonucleotide no yes '(DT)(DC)(DT)(DA)(RDG)(DG)(DG)(DT)(DC)(DC)(DT)(DA)(DG)(DG)(DA)(DC)(DC)(DC)' TCTAXGGTCCTAGGACCC 
B,C,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ARG n 
1 4   LYS n 
1 5   ILE n 
1 6   ILE n 
1 7   HIS n 
1 8   VAL n 
1 9   ASP n 
1 10  MET n 
1 11  ASP n 
1 12  CYS n 
1 13  PHE n 
1 14  PHE n 
1 15  ALA n 
1 16  ALA n 
1 17  VAL n 
1 18  GLU n 
1 19  MET n 
1 20  ARG n 
1 21  ASP n 
1 22  ASN n 
1 23  PRO n 
1 24  ALA n 
1 25  LEU n 
1 26  ARG n 
1 27  ASP n 
1 28  ILE n 
1 29  PRO n 
1 30  ILE n 
1 31  ALA n 
1 32  ILE n 
1 33  GLY n 
1 34  GLY n 
1 35  SER n 
1 36  ARG n 
1 37  GLU n 
1 38  ARG n 
1 39  ARG n 
1 40  GLY n 
1 41  VAL n 
1 42  ILE n 
1 43  SER n 
1 44  THR n 
1 45  ALA n 
1 46  ASN n 
1 47  TYR n 
1 48  PRO n 
1 49  ALA n 
1 50  ARG n 
1 51  LYS n 
1 52  PHE n 
1 53  GLY n 
1 54  VAL n 
1 55  ARG n 
1 56  SER n 
1 57  ALA n 
1 58  MET n 
1 59  PRO n 
1 60  THR n 
1 61  GLY n 
1 62  MET n 
1 63  ALA n 
1 64  LEU n 
1 65  ALA n 
1 66  LEU n 
1 67  CYS n 
1 68  PRO n 
1 69  HIS n 
1 70  LEU n 
1 71  THR n 
1 72  LEU n 
1 73  LEU n 
1 74  PRO n 
1 75  GLY n 
1 76  ARG n 
1 77  PHE n 
1 78  ASP n 
1 79  ALA n 
1 80  TYR n 
1 81  LYS n 
1 82  GLU n 
1 83  ALA n 
1 84  SER n 
1 85  ASN n 
1 86  HIS n 
1 87  ILE n 
1 88  ARG n 
1 89  GLU n 
1 90  ILE n 
1 91  PHE n 
1 92  SER n 
1 93  ARG n 
1 94  TYR n 
1 95  THR n 
1 96  SER n 
1 97  ARG n 
1 98  ILE n 
1 99  GLU n 
1 100 PRO n 
1 101 LEU n 
1 102 SER n 
1 103 LEU n 
1 104 ASP n 
1 105 GLU n 
1 106 ALA n 
1 107 TYR n 
1 108 LEU n 
1 109 ASP n 
1 110 VAL n 
1 111 THR n 
1 112 ASP n 
1 113 SER n 
1 114 VAL n 
1 115 HIS n 
1 116 CYS n 
1 117 HIS n 
1 118 GLY n 
1 119 SER n 
1 120 ALA n 
1 121 THR n 
1 122 LEU n 
1 123 ILE n 
1 124 ALA n 
1 125 GLN n 
1 126 GLU n 
1 127 ILE n 
1 128 ARG n 
1 129 GLN n 
1 130 THR n 
1 131 ILE n 
1 132 PHE n 
1 133 ASN n 
1 134 GLU n 
1 135 LEU n 
1 136 GLN n 
1 137 LEU n 
1 138 THR n 
1 139 ALA n 
1 140 SER n 
1 141 ALA n 
1 142 GLY n 
1 143 VAL n 
1 144 ALA n 
1 145 PRO n 
1 146 VAL n 
1 147 LYS n 
1 148 PHE n 
1 149 LEU n 
1 150 ALA n 
1 151 LYS n 
1 152 ILE n 
1 153 ALA n 
1 154 SER n 
1 155 ASP n 
1 156 MET n 
1 157 ASN n 
1 158 LYS n 
1 159 PRO n 
1 160 ASN n 
1 161 GLY n 
1 162 GLN n 
1 163 PHE n 
1 164 VAL n 
1 165 ILE n 
1 166 THR n 
1 167 PRO n 
1 168 ALA n 
1 169 GLU n 
1 170 VAL n 
1 171 PRO n 
1 172 ALA n 
1 173 PHE n 
1 174 LEU n 
1 175 GLN n 
1 176 THR n 
1 177 LEU n 
1 178 PRO n 
1 179 LEU n 
1 180 ALA n 
1 181 LYS n 
1 182 ILE n 
1 183 PRO n 
1 184 GLY n 
1 185 VAL n 
1 186 GLY n 
1 187 LYS n 
1 188 VAL n 
1 189 SER n 
1 190 ALA n 
1 191 ALA n 
1 192 LYS n 
1 193 LEU n 
1 194 GLU n 
1 195 ALA n 
1 196 MET n 
1 197 GLY n 
1 198 LEU n 
1 199 ARG n 
1 200 THR n 
1 201 CYS n 
1 202 GLY n 
1 203 ASP n 
1 204 VAL n 
1 205 GLN n 
1 206 ALA n 
1 207 CYS n 
1 208 ASP n 
1 209 LEU n 
1 210 VAL n 
1 211 MET n 
1 212 LEU n 
1 213 LEU n 
1 214 LYS n 
1 215 ARG n 
1 216 PHE n 
1 217 GLY n 
1 218 LYS n 
1 219 PHE n 
1 220 GLY n 
1 221 ARG n 
1 222 ILE n 
1 223 LEU n 
1 224 TRP n 
1 225 GLU n 
1 226 ARG n 
1 227 SER n 
1 228 GLN n 
1 229 GLY n 
1 230 ILE n 
1 231 ASP n 
1 232 GLU n 
1 233 ARG n 
1 234 ASP n 
1 235 VAL n 
1 236 ASN n 
1 237 SER n 
1 238 GLU n 
1 239 ARG n 
1 240 LEU n 
1 241 ARG n 
1 242 LYS n 
1 243 SER n 
1 244 VAL n 
1 245 GLY n 
1 246 VAL n 
1 247 GLU n 
1 248 ARG n 
1 249 THR n 
1 250 MET n 
1 251 ALA n 
1 252 GLU n 
1 253 ASP n 
1 254 ILE n 
1 255 HIS n 
1 256 HIS n 
1 257 TRP n 
1 258 SER n 
1 259 GLU n 
1 260 CYS n 
1 261 GLU n 
1 262 ALA n 
1 263 ILE n 
1 264 ILE n 
1 265 GLU n 
1 266 ARG n 
1 267 LEU n 
1 268 TYR n 
1 269 PRO n 
1 270 GLU n 
1 271 LEU n 
1 272 GLU n 
1 273 ARG n 
1 274 ARG n 
1 275 LEU n 
1 276 ALA n 
1 277 LYS n 
1 278 VAL n 
1 279 LYS n 
1 280 PRO n 
1 281 ASP n 
1 282 LEU n 
1 283 LEU n 
1 284 ILE n 
1 285 ALA n 
1 286 ARG n 
1 287 GLN n 
1 288 GLY n 
1 289 VAL n 
1 290 LYS n 
1 291 LEU n 
1 292 LYS n 
1 293 PHE n 
1 294 ASP n 
1 295 ASP n 
1 296 PHE n 
1 297 GLN n 
1 298 GLN n 
1 299 THR n 
1 300 THR n 
1 301 GLN n 
1 302 GLU n 
1 303 HIS n 
1 304 VAL n 
1 305 TRP n 
1 306 PRO n 
1 307 ARG n 
1 308 LEU n 
1 309 ASN n 
1 310 LYS n 
1 311 ALA n 
1 312 ASP n 
1 313 LEU n 
1 314 ILE n 
1 315 ALA n 
1 316 THR n 
1 317 ALA n 
1 318 ARG n 
1 319 LYS n 
1 320 THR n 
1 321 TRP n 
1 322 ASP n 
1 323 GLU n 
1 324 ARG n 
1 325 ARG n 
1 326 GLY n 
1 327 GLY n 
1 328 ARG n 
1 329 GLY n 
1 330 VAL n 
1 331 ARG n 
1 332 LEU n 
1 333 VAL n 
1 334 GLY n 
1 335 LEU n 
1 336 HIS n 
1 337 VAL n 
1 338 THR n 
1 339 LEU n 
1 340 LEU n 
1 341 ASP n 
1 342 PRO n 
2 1   DT  n 
2 2   DC  n 
2 3   DT  n 
2 4   DA  n 
2 5   RDG n 
2 6   DG  n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DT  n 
2 12  DA  n 
2 13  DG  n 
2 14  DG  n 
2 15  DA  n 
2 16  DC  n 
2 17  DC  n 
2 18  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 b0231 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               C41DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX6P1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                'Chemically Synthesized DNA Oligonucleotide' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO4_ECOLI Q47155 1 
;RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKE
ASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQ
FVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQGIDERDVNSERLRK
SVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWD
ERRGGRGVRLVGLHVTLLDP
;
2 ? 
2 PDB 4Q44       4Q44   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4Q44 A 3 ? 342 ? Q47155 2   ? 341 ? 2   341 
2 1 4Q44 F 3 ? 342 ? Q47155 2   ? 341 ? 2   341 
3 2 4Q44 B 1 ? 18  ? 4Q44   837 ? 854 ? 837 854 
4 2 4Q44 C 1 ? 18  ? 4Q44   856 ? 873 ? 856 873 
5 2 4Q44 G 1 ? 18  ? 4Q44   837 ? 854 ? 837 854 
6 2 4Q44 H 1 ? 18  ? 4Q44   856 ? 873 ? 856 873 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Q44 GLY A 1   ? UNP Q47155 ?   ?   'EXPRESSION TAG' 0   1 
1 4Q44 SER A 2   ? UNP Q47155 ?   ?   'EXPRESSION TAG' 1   2 
1 4Q44 ALA A 65  ? UNP Q47155 LYS 64  CONFLICT         64  3 
1 4Q44 ALA A 206 ? UNP Q47155 LYS 205 CONFLICT         205 4 
2 4Q44 GLY F 1   ? UNP Q47155 ?   ?   'EXPRESSION TAG' 0   5 
2 4Q44 SER F 2   ? UNP Q47155 ?   ?   'EXPRESSION TAG' 1   6 
2 4Q44 ALA F 65  ? UNP Q47155 LYS 64  CONFLICT         64  7 
2 4Q44 ALA F 206 ? UNP Q47155 LYS 205 CONFLICT         205 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1FZ non-polymer         . "5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]thymidine" ? 
'C10 H18 N3 O13 P3' 481.184 
ALA 'L-peptide linking' y ALANINE                                                                             ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                            ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                          ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                     ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                            ? 'C3 H7 N O2 S' 
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                ? 'C10 H14 N5 O6 P' 
331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                 ? 'C9 H14 N3 O7 P' 
307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                ? 'C10 H14 N5 O7 P' 
347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                        ? 'C10 H15 N2 O8 P' 
322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                           ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                     ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                             ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                           ? 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                                               ? 'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                          ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                             ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                              ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                                          ? 'C5 H11 N O2 S' 
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                     ? 'Mg 2' 24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                       ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                             ? 'C5 H9 N O2' 
115.130 
RDG 'DNA linking'       n 
;2'-deoxy-N-(furan-2-ylmethyl)guanosine 5'-(dihydrogen phosphate)
;
"N2-furfuryl-deoxyguanosine-5'-monophosphate" 'C15 H18 N5 O8 P'   427.306 
SER 'L-peptide linking' y SERINE                                                                              ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                           ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                          ? 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                            ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                              ? 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          4Q44 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.74 
_exptl_crystal.density_percent_sol   55.18 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.8 
_exptl_crystal_grow.pdbx_details    '0.1M ACETATE, pH 4.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2012-05-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     4Q44 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.700 
_reflns.number_obs                   29593 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.07300 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.9000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.600 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.70 
_reflns_shell.d_res_low                   2.75 
_reflns_shell.percent_possible_all        99.2 
_reflns_shell.Rmerge_I_obs                0.51600 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         2.200 
_reflns_shell.pdbx_redundancy             3.60 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4Q44 
_refine.ls_number_reflns_obs                     29593 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.21 
_refine.ls_d_res_high                            2.71 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.227 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.225 
_refine.ls_R_factor_R_free                       0.270 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.070 
_refine.ls_number_reflns_R_free                  1501 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               62.40 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4IR1 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.330 
_refine.B_iso_max                                123.530 
_refine.B_iso_min                                35.090 
_refine.pdbx_overall_phase_error                 29.7800 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5372 
_refine_hist.pdbx_number_atoms_nucleic_acid   1383 
_refine_hist.pdbx_number_atoms_ligand         62 
_refine_hist.number_atoms_solvent             87 
_refine_hist.number_atoms_total               6904 
_refine_hist.d_res_high                       2.71 
_refine_hist.d_res_low                        48.21 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.003  ? ? 7082 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.845  ? ? 9865 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 21.015 ? ? 2759 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.057  ? ? 1103 ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.004  ? ? 1037 ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
2.7052 2.7925  11 98.0000  2489 . 0.3156 0.3336 . 100 . 2589 . 'X-RAY DIFFRACTION' . 
2.7925 2.8923  11 99.0000  2538 . 0.3114 0.3880 . 138 . 2676 . 'X-RAY DIFFRACTION' . 
2.8923 3.0081  11 100.0000 2529 . 0.2967 0.3551 . 131 . 2660 . 'X-RAY DIFFRACTION' . 
3.0081 3.1450  11 100.0000 2533 . 0.2812 0.3349 . 151 . 2684 . 'X-RAY DIFFRACTION' . 
3.1450 3.3107  11 100.0000 2525 . 0.2616 0.3335 . 143 . 2668 . 'X-RAY DIFFRACTION' . 
3.3107 3.5181  11 100.0000 2545 . 0.2412 0.3178 . 120 . 2665 . 'X-RAY DIFFRACTION' . 
3.5181 3.7896  11 100.0000 2567 . 0.2253 0.2995 . 150 . 2717 . 'X-RAY DIFFRACTION' . 
3.7896 4.1708  11 100.0000 2572 . 0.2078 0.2435 . 125 . 2697 . 'X-RAY DIFFRACTION' . 
4.1708 4.7739  11 100.0000 2586 . 0.1888 0.2256 . 138 . 2724 . 'X-RAY DIFFRACTION' . 
4.7739 6.0127  11 100.0000 2569 . 0.2100 0.2158 . 143 . 2712 . 'X-RAY DIFFRACTION' . 
6.0127 48.2171 11 99.0000  2639 . 0.1756 0.2127 . 162 . 2801 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4Q44 
_struct.title                     'Polymerase-Damaged DNA Complex' 
_struct.pdbx_descriptor           'DNA polymerase IV (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4Q44 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'POLYMERASE, DNA POLYMERASE, DNA, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 12  ? ASP A 21  ? CYS A 11  ASP A 20  1 ? 10 
HELX_P HELX_P2  2  ASN A 46  ? LYS A 51  ? ASN A 45  LYS A 50  1 ? 6  
HELX_P HELX_P3  3  PRO A 59  ? ALA A 65  ? PRO A 58  ALA A 64  1 ? 7  
HELX_P HELX_P4  4  ARG A 76  ? ARG A 93  ? ARG A 75  ARG A 92  1 ? 18 
HELX_P HELX_P5  5  SER A 119 ? GLN A 136 ? SER A 118 GLN A 135 1 ? 18 
HELX_P HELX_P6  6  VAL A 146 ? ASP A 155 ? VAL A 145 ASP A 154 1 ? 10 
HELX_P HELX_P7  7  GLU A 169 ? THR A 176 ? GLU A 168 THR A 175 1 ? 8  
HELX_P HELX_P8  8  PRO A 178 ? ILE A 182 ? PRO A 177 ILE A 181 5 ? 5  
HELX_P HELX_P9  9  GLY A 186 ? MET A 196 ? GLY A 185 MET A 195 1 ? 11 
HELX_P HELX_P10 10 THR A 200 ? ALA A 206 ? THR A 199 ALA A 205 1 ? 7  
HELX_P HELX_P11 11 ASP A 208 ? GLY A 217 ? ASP A 207 GLY A 216 1 ? 10 
HELX_P HELX_P12 12 GLY A 217 ? GLN A 228 ? GLY A 216 GLN A 227 1 ? 12 
HELX_P HELX_P13 13 HIS A 256 ? ALA A 276 ? HIS A 255 ALA A 275 1 ? 21 
HELX_P HELX_P14 14 ASN A 309 ? ARG A 325 ? ASN A 308 ARG A 324 1 ? 17 
HELX_P HELX_P15 15 CYS B 12  ? ASN B 22  ? CYS F 11  ASN F 21  1 ? 11 
HELX_P HELX_P16 16 PRO B 23  ? ARG B 26  ? PRO F 22  ARG F 25  5 ? 4  
HELX_P HELX_P17 17 ASN B 46  ? LYS B 51  ? ASN F 45  LYS F 50  1 ? 6  
HELX_P HELX_P18 18 PRO B 59  ? CYS B 67  ? PRO F 58  CYS F 66  1 ? 9  
HELX_P HELX_P19 19 ARG B 76  ? THR B 95  ? ARG F 75  THR F 94  1 ? 20 
HELX_P HELX_P20 20 SER B 119 ? GLN B 136 ? SER F 118 GLN F 135 1 ? 18 
HELX_P HELX_P21 21 VAL B 146 ? MET B 156 ? VAL F 145 MET F 155 1 ? 11 
HELX_P HELX_P22 22 GLU B 169 ? THR B 176 ? GLU F 168 THR F 175 1 ? 8  
HELX_P HELX_P23 23 PRO B 178 ? ILE B 182 ? PRO F 177 ILE F 181 5 ? 5  
HELX_P HELX_P24 24 GLY B 186 ? ALA B 195 ? GLY F 185 ALA F 194 1 ? 10 
HELX_P HELX_P25 25 THR B 200 ? ALA B 206 ? THR F 199 ALA F 205 1 ? 7  
HELX_P HELX_P26 26 ASP B 208 ? GLY B 217 ? ASP F 207 GLY F 216 1 ? 10 
HELX_P HELX_P27 27 GLY B 217 ? GLN B 228 ? GLY F 216 GLN F 227 1 ? 12 
HELX_P HELX_P28 28 HIS B 256 ? LYS B 279 ? HIS F 255 LYS F 278 1 ? 24 
HELX_P HELX_P29 29 LYS B 310 ? ARG B 324 ? LYS F 309 ARG F 323 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? C DA  4   "O3'" ? ? ? 1_555 C RDG 5  P  ? ? B DA  840 B RDG 841 1_555 ? ? ? ? ? ? ?            1.606 ? 
covale2  covale ? ? C RDG 5   "O3'" ? ? ? 1_555 C DG  6  P  ? ? B RDG 841 B DG  842 1_555 ? ? ? ? ? ? ?            1.607 ? 
covale3  covale ? ? D DA  4   "O3'" ? ? ? 1_555 D RDG 5  P  ? ? C DA  859 C RDG 860 1_555 ? ? ? ? ? ? ?            1.608 ? 
covale4  covale ? ? D RDG 5   "O3'" ? ? ? 1_555 D DG  6  P  ? ? C RDG 860 C DG  861 1_555 ? ? ? ? ? ? ?            1.608 ? 
covale5  covale ? ? E DA  4   "O3'" ? ? ? 1_555 E RDG 5  P  ? ? G DA  840 G RDG 841 1_555 ? ? ? ? ? ? ?            1.607 ? 
covale6  covale ? ? E RDG 5   "O3'" ? ? ? 1_555 E DG  6  P  ? ? G RDG 841 G DG  842 1_555 ? ? ? ? ? ? ?            1.607 ? 
covale7  covale ? ? F RDG 5   "O3'" ? ? ? 1_555 F DG  6  P  ? ? H RDG 860 H DG  861 1_555 ? ? ? ? ? ? ?            1.608 ? 
metalc1  metalc ? ? A ASP 9   OD1   ? ? ? 1_555 H MG  .  MG ? ? A ASP 8   A MG  402 1_555 ? ? ? ? ? ? ?            1.935 ? 
metalc2  metalc ? ? G 1FZ .   O2B   ? ? ? 1_555 H MG  .  MG ? ? A 1FZ 401 A MG  402 1_555 ? ? ? ? ? ? ?            2.018 ? 
metalc3  metalc ? ? B MET 10  O     ? ? ? 1_555 K MG  .  MG ? ? F MET 9   F MG  402 1_555 ? ? ? ? ? ? ?            2.026 ? 
metalc4  metalc ? ? J 1FZ .   O2B   ? ? ? 1_555 K MG  .  MG ? ? F 1FZ 401 F MG  402 1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc5  metalc ? ? A GLU 105 OE2   ? ? ? 1_555 I MG  .  MG ? ? A GLU 104 A MG  403 1_555 ? ? ? ? ? ? ?            2.043 ? 
metalc6  metalc ? ? G 1FZ .   O1A   ? ? ? 1_555 H MG  .  MG ? ? A 1FZ 401 A MG  402 1_555 ? ? ? ? ? ? ?            2.110 ? 
metalc7  metalc ? ? B ASP 104 OD2   ? ? ? 1_555 K MG  .  MG ? ? F ASP 103 F MG  402 1_555 ? ? ? ? ? ? ?            2.126 ? 
metalc8  metalc ? ? A ASP 9   OD2   ? ? ? 1_555 I MG  .  MG ? ? A ASP 8   A MG  403 1_555 ? ? ? ? ? ? ?            2.176 ? 
metalc9  metalc ? ? B GLU 105 OE2   ? ? ? 1_555 L MG  .  MG ? ? F GLU 104 F MG  403 1_555 ? ? ? ? ? ? ?            2.206 ? 
metalc10 metalc ? ? A ASP 104 OD2   ? ? ? 1_555 H MG  .  MG ? ? A ASP 103 A MG  402 1_555 ? ? ? ? ? ? ?            2.220 ? 
metalc11 metalc ? ? A MET 10  O     ? ? ? 1_555 H MG  .  MG ? ? A MET 9   A MG  402 1_555 ? ? ? ? ? ? ?            2.258 ? 
metalc12 metalc ? ? B ASP 104 OD1   ? ? ? 1_555 L MG  .  MG ? ? F ASP 103 F MG  403 1_555 ? ? ? ? ? ? ?            2.385 ? 
metalc13 metalc ? ? B ASP 104 OD2   ? ? ? 1_555 L MG  .  MG ? ? F ASP 103 F MG  403 1_555 ? ? ? ? ? ? ?            2.407 ? 
metalc14 metalc ? ? J 1FZ .   O2A   ? ? ? 1_555 L MG  .  MG ? ? F 1FZ 401 F MG  403 1_555 ? ? ? ? ? ? ?            2.434 ? 
metalc15 metalc ? ? B ASP 9   OD1   ? ? ? 1_555 K MG  .  MG ? ? F ASP 8   F MG  402 1_555 ? ? ? ? ? ? ?            2.446 ? 
metalc16 metalc ? ? G 1FZ .   O1A   ? ? ? 1_555 I MG  .  MG ? ? A 1FZ 401 A MG  403 1_555 ? ? ? ? ? ? ?            2.584 ? 
metalc17 metalc ? ? J 1FZ .   O2A   ? ? ? 1_555 K MG  .  MG ? ? F 1FZ 401 F MG  402 1_555 ? ? ? ? ? ? ?            2.618 ? 
metalc18 metalc ? ? F DC  18  "O3'" ? ? ? 1_555 L MG  .  MG ? ? H DC  873 F MG  403 1_555 ? ? ? ? ? ? ?            2.680 ? 
metalc19 metalc ? ? G 1FZ .   O1G   ? ? ? 1_555 H MG  .  MG ? ? A 1FZ 401 A MG  402 1_555 ? ? ? ? ? ? ?            2.694 ? 
metalc20 metalc ? ? I MG  .   MG    ? ? ? 1_555 P HOH .  O  ? ? A MG  403 C HOH 901 1_555 ? ? ? ? ? ? ?            2.056 ? 
metalc21 metalc ? ? I MG  .   MG    ? ? ? 1_555 M HOH .  O  ? ? A MG  403 A HOH 502 1_555 ? ? ? ? ? ? ?            2.849 ? 
hydrog1  hydrog ? ? C DG  6   N1    ? ? ? 1_555 D DC  17 N3 ? ? B DG  842 C DC  872 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  6   N2    ? ? ? 1_555 D DC  17 O2 ? ? B DG  842 C DC  872 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  6   O6    ? ? ? 1_555 D DC  17 N4 ? ? B DG  842 C DC  872 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DG  7   N1    ? ? ? 1_555 D DC  16 N3 ? ? B DG  843 C DC  871 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DG  7   N2    ? ? ? 1_555 D DC  16 O2 ? ? B DG  843 C DC  871 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DG  7   O6    ? ? ? 1_555 D DC  16 N4 ? ? B DG  843 C DC  871 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DT  8   N3    ? ? ? 1_555 D DA  15 N1 ? ? B DT  844 C DA  870 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DT  8   O4    ? ? ? 1_555 D DA  15 N6 ? ? B DT  844 C DA  870 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DC  9   N3    ? ? ? 1_555 D DG  14 N1 ? ? B DC  845 C DG  869 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DC  9   N4    ? ? ? 1_555 D DG  14 O6 ? ? B DC  845 C DG  869 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DC  9   O2    ? ? ? 1_555 D DG  14 N2 ? ? B DC  845 C DG  869 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DC  10  N3    ? ? ? 1_555 D DG  13 N1 ? ? B DC  846 C DG  868 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DC  10  N4    ? ? ? 1_555 D DG  13 O6 ? ? B DC  846 C DG  868 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DC  10  O2    ? ? ? 1_555 D DG  13 N2 ? ? B DC  846 C DG  868 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DT  11  N3    ? ? ? 1_555 D DA  12 N1 ? ? B DT  847 C DA  867 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DT  11  O4    ? ? ? 1_555 D DA  12 N6 ? ? B DT  847 C DA  867 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DA  12  N1    ? ? ? 1_555 D DT  11 N3 ? ? B DA  848 C DT  866 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DA  12  N6    ? ? ? 1_555 D DT  11 O4 ? ? B DA  848 C DT  866 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DG  13  N1    ? ? ? 1_555 D DC  10 N3 ? ? B DG  849 C DC  865 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DG  13  N2    ? ? ? 1_555 D DC  10 O2 ? ? B DG  849 C DC  865 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DG  13  O6    ? ? ? 1_555 D DC  10 N4 ? ? B DG  849 C DC  865 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DG  14  N1    ? ? ? 1_555 D DC  9  N3 ? ? B DG  850 C DC  864 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DG  14  N2    ? ? ? 1_555 D DC  9  O2 ? ? B DG  850 C DC  864 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DG  14  O6    ? ? ? 1_555 D DC  9  N4 ? ? B DG  850 C DC  864 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DA  15  N1    ? ? ? 1_555 D DT  8  N3 ? ? B DA  851 C DT  863 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DA  15  N6    ? ? ? 1_555 D DT  8  O4 ? ? B DA  851 C DT  863 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DC  16  N3    ? ? ? 1_555 D DG  7  N1 ? ? B DC  852 C DG  862 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DC  16  N4    ? ? ? 1_555 D DG  7  O6 ? ? B DC  852 C DG  862 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DC  16  O2    ? ? ? 1_555 D DG  7  N2 ? ? B DC  852 C DG  862 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DC  17  N3    ? ? ? 1_555 D DG  6  N1 ? ? B DC  853 C DG  861 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DC  17  N4    ? ? ? 1_555 D DG  6  O6 ? ? B DC  853 C DG  861 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DC  17  O2    ? ? ? 1_555 D DG  6  N2 ? ? B DC  853 C DG  861 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DG  6   N1    ? ? ? 1_555 F DC  17 N3 ? ? G DG  842 H DC  872 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DG  6   N2    ? ? ? 1_555 F DC  17 O2 ? ? G DG  842 H DC  872 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E DG  6   O6    ? ? ? 1_555 F DC  17 N4 ? ? G DG  842 H DC  872 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DG  7   N1    ? ? ? 1_555 F DC  16 N3 ? ? G DG  843 H DC  871 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DG  7   N2    ? ? ? 1_555 F DC  16 O2 ? ? G DG  843 H DC  871 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DG  7   O6    ? ? ? 1_555 F DC  16 N4 ? ? G DG  843 H DC  871 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DT  8   N3    ? ? ? 1_555 F DA  15 N1 ? ? G DT  844 H DA  870 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DT  8   O4    ? ? ? 1_555 F DA  15 N6 ? ? G DT  844 H DA  870 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DC  9   N3    ? ? ? 1_555 F DG  14 N1 ? ? G DC  845 H DG  869 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DC  9   N4    ? ? ? 1_555 F DG  14 O6 ? ? G DC  845 H DG  869 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DC  9   O2    ? ? ? 1_555 F DG  14 N2 ? ? G DC  845 H DG  869 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? E DC  10  N3    ? ? ? 1_555 F DG  13 N1 ? ? G DC  846 H DG  868 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? E DC  10  N4    ? ? ? 1_555 F DG  13 O6 ? ? G DC  846 H DG  868 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? E DC  10  O2    ? ? ? 1_555 F DG  13 N2 ? ? G DC  846 H DG  868 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DT  11  N3    ? ? ? 1_555 F DA  12 N1 ? ? G DT  847 H DA  867 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DT  11  O4    ? ? ? 1_555 F DA  12 N6 ? ? G DT  847 H DA  867 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E DA  12  N1    ? ? ? 1_555 F DT  11 N3 ? ? G DA  848 H DT  866 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? E DA  12  N6    ? ? ? 1_555 F DT  11 O4 ? ? G DA  848 H DT  866 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? E DG  13  N1    ? ? ? 1_555 F DC  10 N3 ? ? G DG  849 H DC  865 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? E DG  13  N2    ? ? ? 1_555 F DC  10 O2 ? ? G DG  849 H DC  865 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? E DG  13  O6    ? ? ? 1_555 F DC  10 N4 ? ? G DG  849 H DC  865 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? E DG  14  N1    ? ? ? 1_555 F DC  9  N3 ? ? G DG  850 H DC  864 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? E DG  14  N2    ? ? ? 1_555 F DC  9  O2 ? ? G DG  850 H DC  864 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? E DG  14  O6    ? ? ? 1_555 F DC  9  N4 ? ? G DG  850 H DC  864 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? E DA  15  N1    ? ? ? 1_555 F DT  8  N3 ? ? G DA  851 H DT  863 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? E DA  15  N6    ? ? ? 1_555 F DT  8  O4 ? ? G DA  851 H DT  863 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? E DC  16  N3    ? ? ? 1_555 F DG  7  N1 ? ? G DC  852 H DG  862 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? E DC  16  N4    ? ? ? 1_555 F DG  7  O6 ? ? G DC  852 H DG  862 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? E DC  16  O2    ? ? ? 1_555 F DG  7  N2 ? ? G DC  852 H DG  862 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? E DC  17  N3    ? ? ? 1_555 F DG  6  N1 ? ? G DC  853 H DG  861 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? E DC  17  N4    ? ? ? 1_555 F DG  6  O6 ? ? G DC  853 H DG  861 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? E DC  17  O2    ? ? ? 1_555 F DG  6  N2 ? ? G DC  853 H DG  861 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 158 A . ? LYS 157 A PRO 159 A ? PRO 158 A 1 0.84  
2 LYS 158 B . ? LYS 157 F PRO 159 B ? PRO 158 F 1 -2.42 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 5 ? 
E ? 3 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 98  ? PRO A 100 ? ILE A 97  PRO A 99  
A 2 GLU A 105 ? ASP A 109 ? GLU A 104 ASP A 108 
A 3 ILE A 5   ? MET A 10  ? ILE A 4   MET A 9   
A 4 ALA A 139 ? ALA A 144 ? ALA A 138 ALA A 143 
A 5 GLN A 162 ? VAL A 164 ? GLN A 161 VAL A 163 
B 1 ILE A 42  ? ALA A 45  ? ILE A 41  ALA A 44  
B 2 ILE A 30  ? GLY A 33  ? ILE A 29  GLY A 32  
B 3 THR A 71  ? LEU A 73  ? THR A 70  LEU A 72  
C 1 VAL A 244 ? THR A 249 ? VAL A 243 THR A 248 
C 2 VAL A 330 ? VAL A 337 ? VAL A 329 VAL A 336 
C 3 ARG A 286 ? PHE A 293 ? ARG A 285 PHE A 292 
C 4 GLN A 298 ? VAL A 304 ? GLN A 297 VAL A 303 
D 1 ILE B 98  ? PRO B 100 ? ILE F 97  PRO F 99  
D 2 GLU B 105 ? ASP B 109 ? GLU F 104 ASP F 108 
D 3 ILE B 5   ? MET B 10  ? ILE F 4   MET F 9   
D 4 ALA B 139 ? ALA B 144 ? ALA F 138 ALA F 143 
D 5 GLN B 162 ? VAL B 164 ? GLN F 161 VAL F 163 
E 1 ILE B 42  ? ALA B 45  ? ILE F 41  ALA F 44  
E 2 ILE B 30  ? GLY B 33  ? ILE F 29  GLY F 32  
E 3 THR B 71  ? LEU B 73  ? THR F 70  LEU F 72  
F 1 SER B 243 ? ILE B 254 ? SER F 242 ILE F 253 
F 2 VAL B 330 ? THR B 338 ? VAL F 329 THR F 337 
F 3 ARG B 286 ? PHE B 293 ? ARG F 285 PHE F 292 
F 4 GLN B 298 ? VAL B 304 ? GLN F 297 VAL F 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 99  ? N GLU A 98  O TYR A 107 ? O TYR A 106 
A 2 3 O ALA A 106 ? O ALA A 105 N VAL A 8   ? N VAL A 7   
A 3 4 N ILE A 5   ? N ILE A 4   O ALA A 144 ? O ALA A 143 
A 4 5 N VAL A 143 ? N VAL A 142 O PHE A 163 ? O PHE A 162 
B 1 2 O SER A 43  ? O SER A 42  N ILE A 32  ? N ILE A 31  
B 2 3 N GLY A 33  ? N GLY A 32  O LEU A 73  ? O LEU A 72  
C 1 2 N VAL A 246 ? N VAL A 245 O LEU A 335 ? O LEU A 334 
C 2 3 O GLY A 334 ? O GLY A 333 N LYS A 290 ? N LYS A 289 
C 3 4 N VAL A 289 ? N VAL A 288 O GLN A 301 ? O GLN A 300 
D 1 2 N GLU B 99  ? N GLU F 98  O TYR B 107 ? O TYR F 106 
D 2 3 O ALA B 106 ? O ALA F 105 N VAL B 8   ? N VAL F 7   
D 3 4 N ILE B 5   ? N ILE F 4   O ALA B 144 ? O ALA F 143 
D 4 5 N VAL B 143 ? N VAL F 142 O PHE B 163 ? O PHE F 162 
E 1 2 O SER B 43  ? O SER F 42  N ILE B 32  ? N ILE F 31  
E 2 3 N ALA B 31  ? N ALA F 30  O LEU B 73  ? O LEU F 72  
F 1 2 N MET B 250 ? N MET F 249 O ARG B 331 ? O ARG F 330 
F 2 3 O HIS B 336 ? O HIS F 335 N GLY B 288 ? N GLY F 287 
F 3 4 N GLN B 287 ? N GLN F 286 O HIS B 303 ? O HIS F 302 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE 1FZ A 401' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 402'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 403'  
AC4 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE 1FZ F 401' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG F 402'  
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG F 403'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 ASP A 9   ? ASP A 8   . ? 1_555 ? 
2  AC1 18 MET A 10  ? MET A 9   . ? 1_555 ? 
3  AC1 18 ASP A 11  ? ASP A 10  . ? 1_555 ? 
4  AC1 18 CYS A 12  ? CYS A 11  . ? 1_555 ? 
5  AC1 18 PHE A 13  ? PHE A 12  . ? 1_555 ? 
6  AC1 18 PHE A 14  ? PHE A 13  . ? 1_555 ? 
7  AC1 18 SER A 43  ? SER A 42  . ? 1_555 ? 
8  AC1 18 THR A 44  ? THR A 43  . ? 1_555 ? 
9  AC1 18 ARG A 50  ? ARG A 49  . ? 1_555 ? 
10 AC1 18 ASP A 104 ? ASP A 103 . ? 1_555 ? 
11 AC1 18 GLU A 105 ? GLU A 104 . ? 1_555 ? 
12 AC1 18 LYS A 158 ? LYS A 157 . ? 1_555 ? 
13 AC1 18 MG  H .   ? MG  A 402 . ? 1_555 ? 
14 AC1 18 MG  I .   ? MG  A 403 . ? 1_555 ? 
15 AC1 18 HOH M .   ? HOH A 507 . ? 1_555 ? 
16 AC1 18 DA  C 4   ? DA  B 840 . ? 1_555 ? 
17 AC1 18 RDG C 5   ? RDG B 841 . ? 1_555 ? 
18 AC1 18 DC  D 18  ? DC  C 873 . ? 1_555 ? 
19 AC2 5  ASP A 9   ? ASP A 8   . ? 1_555 ? 
20 AC2 5  MET A 10  ? MET A 9   . ? 1_555 ? 
21 AC2 5  ASP A 104 ? ASP A 103 . ? 1_555 ? 
22 AC2 5  1FZ G .   ? 1FZ A 401 . ? 1_555 ? 
23 AC2 5  MG  I .   ? MG  A 403 . ? 1_555 ? 
24 AC3 6  ASP A 9   ? ASP A 8   . ? 1_555 ? 
25 AC3 6  GLU A 105 ? GLU A 104 . ? 1_555 ? 
26 AC3 6  1FZ G .   ? 1FZ A 401 . ? 1_555 ? 
27 AC3 6  MG  H .   ? MG  A 402 . ? 1_555 ? 
28 AC3 6  HOH M .   ? HOH A 502 . ? 1_555 ? 
29 AC3 6  HOH P .   ? HOH C 901 . ? 1_555 ? 
30 AC4 19 ASP B 9   ? ASP F 8   . ? 1_555 ? 
31 AC4 19 MET B 10  ? MET F 9   . ? 1_555 ? 
32 AC4 19 ASP B 11  ? ASP F 10  . ? 1_555 ? 
33 AC4 19 CYS B 12  ? CYS F 11  . ? 1_555 ? 
34 AC4 19 PHE B 13  ? PHE F 12  . ? 1_555 ? 
35 AC4 19 PHE B 14  ? PHE F 13  . ? 1_555 ? 
36 AC4 19 SER B 43  ? SER F 42  . ? 1_555 ? 
37 AC4 19 THR B 44  ? THR F 43  . ? 1_555 ? 
38 AC4 19 ARG B 50  ? ARG F 49  . ? 1_555 ? 
39 AC4 19 ASP B 104 ? ASP F 103 . ? 1_555 ? 
40 AC4 19 GLU B 105 ? GLU F 104 . ? 1_555 ? 
41 AC4 19 LYS B 158 ? LYS F 157 . ? 1_555 ? 
42 AC4 19 MG  K .   ? MG  F 402 . ? 1_555 ? 
43 AC4 19 MG  L .   ? MG  F 403 . ? 1_555 ? 
44 AC4 19 HOH N .   ? HOH F 524 . ? 1_555 ? 
45 AC4 19 HOH N .   ? HOH F 529 . ? 1_555 ? 
46 AC4 19 DA  E 4   ? DA  G 840 . ? 1_555 ? 
47 AC4 19 RDG E 5   ? RDG G 841 . ? 1_555 ? 
48 AC4 19 DC  F 18  ? DC  H 873 . ? 1_555 ? 
49 AC5 5  ASP B 9   ? ASP F 8   . ? 1_555 ? 
50 AC5 5  MET B 10  ? MET F 9   . ? 1_555 ? 
51 AC5 5  ASP B 104 ? ASP F 103 . ? 1_555 ? 
52 AC5 5  1FZ J .   ? 1FZ F 401 . ? 1_555 ? 
53 AC5 5  MG  L .   ? MG  F 403 . ? 1_555 ? 
54 AC6 6  ASP B 9   ? ASP F 8   . ? 1_555 ? 
55 AC6 6  ASP B 104 ? ASP F 103 . ? 1_555 ? 
56 AC6 6  GLU B 105 ? GLU F 104 . ? 1_555 ? 
57 AC6 6  1FZ J .   ? 1FZ F 401 . ? 1_555 ? 
58 AC6 6  MG  K .   ? MG  F 402 . ? 1_555 ? 
59 AC6 6  DC  F 18  ? DC  H 873 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4Q44 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4Q44 
_atom_sites.fract_transf_matrix[1][1]   0.011540 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000940 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017564 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009088 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 42.787  3.171   -9.800  1.00 81.35  ? 0   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 42.660  4.081   -10.921 1.00 93.95  ? 0   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 42.547  5.525   -10.478 1.00 97.84  ? 0   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 43.079  5.909   -9.436  1.00 99.87  ? 0   GLY A O     1 
ATOM   5    N  N     . SER A 1 2   ? 41.857  6.329   -11.280 1.00 91.53  ? 1   SER A N     1 
ATOM   6    C  CA    . SER A 1 2   ? 41.656  7.736   -10.958 1.00 89.48  ? 1   SER A CA    1 
ATOM   7    C  C     . SER A 1 2   ? 40.179  8.041   -10.730 1.00 86.45  ? 1   SER A C     1 
ATOM   8    O  O     . SER A 1 2   ? 39.360  7.916   -11.641 1.00 82.46  ? 1   SER A O     1 
ATOM   9    C  CB    . SER A 1 2   ? 42.216  8.630   -12.066 1.00 87.68  ? 1   SER A CB    1 
ATOM   10   O  OG    . SER A 1 2   ? 42.040  9.998   -11.745 1.00 79.19  ? 1   SER A OG    1 
ATOM   11   N  N     . ARG A 1 3   ? 39.845  8.444   -9.510  1.00 79.91  ? 2   ARG A N     1 
ATOM   12   C  CA    . ARG A 1 3   ? 38.456  8.694   -9.157  1.00 73.88  ? 2   ARG A CA    1 
ATOM   13   C  C     . ARG A 1 3   ? 38.046  10.145  -9.366  1.00 67.38  ? 2   ARG A C     1 
ATOM   14   O  O     . ARG A 1 3   ? 38.887  11.036  -9.465  1.00 65.00  ? 2   ARG A O     1 
ATOM   15   C  CB    . ARG A 1 3   ? 38.184  8.277   -7.710  1.00 74.91  ? 2   ARG A CB    1 
ATOM   16   C  CG    . ARG A 1 3   ? 38.397  6.800   -7.444  1.00 71.60  ? 2   ARG A CG    1 
ATOM   17   C  CD    . ARG A 1 3   ? 39.395  6.591   -6.318  1.00 72.12  ? 2   ARG A CD    1 
ATOM   18   N  NE    . ARG A 1 3   ? 38.932  7.177   -5.064  1.00 73.40  ? 2   ARG A NE    1 
ATOM   19   C  CZ    . ARG A 1 3   ? 39.722  7.457   -4.032  1.00 64.25  ? 2   ARG A CZ    1 
ATOM   20   N  NH1   . ARG A 1 3   ? 41.024  7.213   -4.103  1.00 57.47  ? 2   ARG A NH1   1 
ATOM   21   N  NH2   . ARG A 1 3   ? 39.212  7.989   -2.930  1.00 65.99  ? 2   ARG A NH2   1 
ATOM   22   N  N     . LYS A 1 4   ? 36.739  10.363  -9.444  1.00 63.99  ? 3   LYS A N     1 
ATOM   23   C  CA    . LYS A 1 4   ? 36.170  11.698  -9.483  1.00 60.24  ? 3   LYS A CA    1 
ATOM   24   C  C     . LYS A 1 4   ? 35.392  11.906  -8.193  1.00 63.07  ? 3   LYS A C     1 
ATOM   25   O  O     . LYS A 1 4   ? 34.258  11.448  -8.062  1.00 61.80  ? 3   LYS A O     1 
ATOM   26   C  CB    . LYS A 1 4   ? 35.261  11.851  -10.686 1.00 59.99  ? 3   LYS A CB    1 
ATOM   27   N  N     . ILE A 1 5   ? 36.016  12.577  -7.232  1.00 63.33  ? 4   ILE A N     1 
ATOM   28   C  CA    . ILE A 1 5   ? 35.411  12.773  -5.921  1.00 55.50  ? 4   ILE A CA    1 
ATOM   29   C  C     . ILE A 1 5   ? 34.873  14.193  -5.788  1.00 59.61  ? 4   ILE A C     1 
ATOM   30   O  O     . ILE A 1 5   ? 35.492  15.146  -6.264  1.00 57.28  ? 4   ILE A O     1 
ATOM   31   C  CB    . ILE A 1 5   ? 36.428  12.496  -4.794  1.00 56.86  ? 4   ILE A CB    1 
ATOM   32   C  CG1   . ILE A 1 5   ? 37.115  11.149  -5.021  1.00 61.72  ? 4   ILE A CG1   1 
ATOM   33   C  CG2   . ILE A 1 5   ? 35.751  12.531  -3.430  1.00 55.29  ? 4   ILE A CG2   1 
ATOM   34   C  CD1   . ILE A 1 5   ? 36.165  9.969   -5.015  1.00 59.43  ? 4   ILE A CD1   1 
ATOM   35   N  N     . ILE A 1 6   ? 33.715  14.330  -5.151  1.00 61.04  ? 5   ILE A N     1 
ATOM   36   C  CA    . ILE A 1 6   ? 33.113  15.641  -4.943  1.00 61.90  ? 5   ILE A CA    1 
ATOM   37   C  C     . ILE A 1 6   ? 32.811  15.897  -3.473  1.00 62.80  ? 5   ILE A C     1 
ATOM   38   O  O     . ILE A 1 6   ? 32.071  15.144  -2.853  1.00 67.70  ? 5   ILE A O     1 
ATOM   39   C  CB    . ILE A 1 6   ? 31.794  15.781  -5.727  1.00 59.75  ? 5   ILE A CB    1 
ATOM   40   C  CG1   . ILE A 1 6   ? 32.049  15.700  -7.233  1.00 64.40  ? 5   ILE A CG1   1 
ATOM   41   C  CG2   . ILE A 1 6   ? 31.097  17.086  -5.370  1.00 55.47  ? 5   ILE A CG2   1 
ATOM   42   C  CD1   . ILE A 1 6   ? 30.787  15.745  -8.068  1.00 59.79  ? 5   ILE A CD1   1 
ATOM   43   N  N     . HIS A 1 7   ? 33.374  16.960  -2.911  1.00 62.88  ? 6   HIS A N     1 
ATOM   44   C  CA    . HIS A 1 7   ? 32.973  17.364  -1.570  1.00 60.93  ? 6   HIS A CA    1 
ATOM   45   C  C     . HIS A 1 7   ? 31.974  18.513  -1.639  1.00 57.01  ? 6   HIS A C     1 
ATOM   46   O  O     . HIS A 1 7   ? 32.244  19.541  -2.266  1.00 61.56  ? 6   HIS A O     1 
ATOM   47   C  CB    . HIS A 1 7   ? 34.176  17.758  -0.712  1.00 61.59  ? 6   HIS A CB    1 
ATOM   48   C  CG    . HIS A 1 7   ? 33.826  18.012  0.722   1.00 59.95  ? 6   HIS A CG    1 
ATOM   49   N  ND1   . HIS A 1 7   ? 33.575  19.274  1.215   1.00 59.84  ? 6   HIS A ND1   1 
ATOM   50   C  CD2   . HIS A 1 7   ? 33.664  17.162  1.763   1.00 60.29  ? 6   HIS A CD2   1 
ATOM   51   C  CE1   . HIS A 1 7   ? 33.282  19.191  2.501   1.00 61.46  ? 6   HIS A CE1   1 
ATOM   52   N  NE2   . HIS A 1 7   ? 33.331  17.921  2.858   1.00 63.20  ? 6   HIS A NE2   1 
ATOM   53   N  N     . VAL A 1 8   ? 30.818  18.333  -1.006  1.00 57.14  ? 7   VAL A N     1 
ATOM   54   C  CA    . VAL A 1 8   ? 29.808  19.390  -0.969  1.00 58.65  ? 7   VAL A CA    1 
ATOM   55   C  C     . VAL A 1 8   ? 29.756  20.025  0.419   1.00 60.44  ? 7   VAL A C     1 
ATOM   56   O  O     . VAL A 1 8   ? 29.795  19.317  1.428   1.00 62.30  ? 7   VAL A O     1 
ATOM   57   C  CB    . VAL A 1 8   ? 28.414  18.867  -1.379  1.00 55.88  ? 7   VAL A CB    1 
ATOM   58   C  CG1   . VAL A 1 8   ? 27.377  19.961  -1.256  1.00 54.66  ? 7   VAL A CG1   1 
ATOM   59   C  CG2   . VAL A 1 8   ? 28.449  18.363  -2.805  1.00 55.37  ? 7   VAL A CG2   1 
ATOM   60   N  N     . ASP A 1 9   ? 29.696  21.355  0.472   1.00 60.73  ? 8   ASP A N     1 
ATOM   61   C  CA    . ASP A 1 9   ? 29.670  22.065  1.748   1.00 60.35  ? 8   ASP A CA    1 
ATOM   62   C  C     . ASP A 1 9   ? 28.684  23.230  1.708   1.00 58.58  ? 8   ASP A C     1 
ATOM   63   O  O     . ASP A 1 9   ? 28.786  24.107  0.850   1.00 56.52  ? 8   ASP A O     1 
ATOM   64   C  CB    . ASP A 1 9   ? 31.068  22.588  2.093   1.00 58.82  ? 8   ASP A CB    1 
ATOM   65   C  CG    . ASP A 1 9   ? 31.244  22.865  3.576   1.00 59.50  ? 8   ASP A CG    1 
ATOM   66   O  OD1   . ASP A 1 9   ? 30.539  23.746  4.113   1.00 54.37  ? 8   ASP A OD1   1 
ATOM   67   O  OD2   . ASP A 1 9   ? 32.099  22.206  4.203   1.00 61.76  ? 8   ASP A OD2   1 
ATOM   68   N  N     . MET A 1 10  ? 27.736  23.244  2.640   1.00 61.95  ? 9   MET A N     1 
ATOM   69   C  CA    . MET A 1 10  ? 26.789  24.351  2.734   1.00 58.76  ? 9   MET A CA    1 
ATOM   70   C  C     . MET A 1 10  ? 27.487  25.604  3.244   1.00 56.19  ? 9   MET A C     1 
ATOM   71   O  O     . MET A 1 10  ? 28.292  25.542  4.173   1.00 56.65  ? 9   MET A O     1 
ATOM   72   C  CB    . MET A 1 10  ? 25.621  23.999  3.654   1.00 62.72  ? 9   MET A CB    1 
ATOM   73   C  CG    . MET A 1 10  ? 24.734  22.886  3.134   1.00 62.91  ? 9   MET A CG    1 
ATOM   74   S  SD    . MET A 1 10  ? 23.869  23.353  1.628   1.00 62.62  ? 9   MET A SD    1 
ATOM   75   C  CE    . MET A 1 10  ? 24.155  21.893  0.637   1.00 71.57  ? 9   MET A CE    1 
ATOM   76   N  N     . ASP A 1 11  ? 27.174  26.739  2.629   1.00 60.54  ? 10  ASP A N     1 
ATOM   77   C  CA    . ASP A 1 11  ? 27.768  28.009  3.020   1.00 60.97  ? 10  ASP A CA    1 
ATOM   78   C  C     . ASP A 1 11  ? 27.028  28.614  4.208   1.00 62.65  ? 10  ASP A C     1 
ATOM   79   O  O     . ASP A 1 11  ? 25.822  28.853  4.131   1.00 61.60  ? 10  ASP A O     1 
ATOM   80   C  CB    . ASP A 1 11  ? 27.748  28.988  1.845   1.00 61.29  ? 10  ASP A CB    1 
ATOM   81   C  CG    . ASP A 1 11  ? 28.453  28.443  0.619   1.00 59.14  ? 10  ASP A CG    1 
ATOM   82   O  OD1   . ASP A 1 11  ? 27.843  28.454  -0.472  1.00 52.90  ? 10  ASP A OD1   1 
ATOM   83   O  OD2   . ASP A 1 11  ? 29.618  28.010  0.743   1.00 59.22  ? 10  ASP A OD2   1 
ATOM   84   N  N     . CYS A 1 12  ? 27.758  28.854  5.296   1.00 62.12  ? 11  CYS A N     1 
ATOM   85   C  CA    . CYS A 1 12  ? 27.211  29.485  6.499   1.00 62.20  ? 11  CYS A CA    1 
ATOM   86   C  C     . CYS A 1 12  ? 25.930  28.805  6.974   1.00 62.32  ? 11  CYS A C     1 
ATOM   87   O  O     . CYS A 1 12  ? 24.962  29.477  7.330   1.00 62.06  ? 11  CYS A O     1 
ATOM   88   C  CB    . CYS A 1 12  ? 26.956  30.973  6.251   1.00 59.97  ? 11  CYS A CB    1 
ATOM   89   S  SG    . CYS A 1 12  ? 28.395  31.877  5.641   1.00 72.50  ? 11  CYS A SG    1 
ATOM   90   N  N     . PHE A 1 13  ? 25.959  27.474  6.984   1.00 63.01  ? 12  PHE A N     1 
ATOM   91   C  CA    . PHE A 1 13  ? 24.783  26.614  7.166   1.00 66.78  ? 12  PHE A CA    1 
ATOM   92   C  C     . PHE A 1 13  ? 23.669  27.142  8.079   1.00 63.82  ? 12  PHE A C     1 
ATOM   93   O  O     . PHE A 1 13  ? 22.583  27.482  7.600   1.00 68.60  ? 12  PHE A O     1 
ATOM   94   C  CB    . PHE A 1 13  ? 25.226  25.216  7.615   1.00 59.15  ? 12  PHE A CB    1 
ATOM   95   C  CG    . PHE A 1 13  ? 24.141  24.183  7.542   1.00 62.55  ? 12  PHE A CG    1 
ATOM   96   C  CD1   . PHE A 1 13  ? 23.320  24.101  6.431   1.00 60.12  ? 12  PHE A CD1   1 
ATOM   97   C  CD2   . PHE A 1 13  ? 23.956  23.280  8.576   1.00 61.79  ? 12  PHE A CD2   1 
ATOM   98   C  CE1   . PHE A 1 13  ? 22.324  23.148  6.357   1.00 63.71  ? 12  PHE A CE1   1 
ATOM   99   C  CE2   . PHE A 1 13  ? 22.962  22.322  8.507   1.00 63.93  ? 12  PHE A CE2   1 
ATOM   100  C  CZ    . PHE A 1 13  ? 22.145  22.256  7.396   1.00 65.77  ? 12  PHE A CZ    1 
ATOM   101  N  N     . PHE A 1 14  ? 23.940  27.213  9.380   1.00 63.26  ? 13  PHE A N     1 
ATOM   102  C  CA    . PHE A 1 14  ? 22.936  27.654  10.349  1.00 67.69  ? 13  PHE A CA    1 
ATOM   103  C  C     . PHE A 1 14  ? 22.435  29.053  10.015  1.00 67.37  ? 13  PHE A C     1 
ATOM   104  O  O     . PHE A 1 14  ? 21.232  29.275  9.860   1.00 70.64  ? 13  PHE A O     1 
ATOM   105  C  CB    . PHE A 1 14  ? 23.492  27.647  11.777  1.00 67.63  ? 13  PHE A CB    1 
ATOM   106  C  CG    . PHE A 1 14  ? 23.772  26.275  12.328  1.00 68.44  ? 13  PHE A CG    1 
ATOM   107  C  CD1   . PHE A 1 14  ? 23.557  25.137  11.567  1.00 65.11  ? 13  PHE A CD1   1 
ATOM   108  C  CD2   . PHE A 1 14  ? 24.243  26.127  13.622  1.00 65.04  ? 13  PHE A CD2   1 
ATOM   109  C  CE1   . PHE A 1 14  ? 23.819  23.882  12.082  1.00 62.69  ? 13  PHE A CE1   1 
ATOM   110  C  CE2   . PHE A 1 14  ? 24.503  24.875  14.143  1.00 58.53  ? 13  PHE A CE2   1 
ATOM   111  C  CZ    . PHE A 1 14  ? 24.290  23.751  13.372  1.00 63.99  ? 13  PHE A CZ    1 
ATOM   112  N  N     . ALA A 1 15  ? 23.372  29.990  9.900   1.00 64.48  ? 14  ALA A N     1 
ATOM   113  C  CA    . ALA A 1 15  ? 23.047  31.376  9.586   1.00 67.19  ? 14  ALA A CA    1 
ATOM   114  C  C     . ALA A 1 15  ? 22.345  31.495  8.239   1.00 72.55  ? 14  ALA A C     1 
ATOM   115  O  O     . ALA A 1 15  ? 21.515  32.377  8.045   1.00 73.21  ? 14  ALA A O     1 
ATOM   116  C  CB    . ALA A 1 15  ? 24.302  32.235  9.611   1.00 61.57  ? 14  ALA A CB    1 
ATOM   117  N  N     . ALA A 1 16  ? 22.679  30.603  7.312   1.00 71.08  ? 15  ALA A N     1 
ATOM   118  C  CA    . ALA A 1 16  ? 22.040  30.596  6.003   1.00 66.60  ? 15  ALA A CA    1 
ATOM   119  C  C     . ALA A 1 16  ? 20.572  30.204  6.124   1.00 69.59  ? 15  ALA A C     1 
ATOM   120  O  O     . ALA A 1 16  ? 19.705  30.802  5.483   1.00 77.10  ? 15  ALA A O     1 
ATOM   121  C  CB    . ALA A 1 16  ? 22.768  29.655  5.059   1.00 63.35  ? 15  ALA A CB    1 
ATOM   122  N  N     . VAL A 1 17  ? 20.298  29.200  6.952   1.00 65.57  ? 16  VAL A N     1 
ATOM   123  C  CA    . VAL A 1 17  ? 18.924  28.777  7.200   1.00 69.58  ? 16  VAL A CA    1 
ATOM   124  C  C     . VAL A 1 17  ? 18.139  29.890  7.882   1.00 73.64  ? 16  VAL A C     1 
ATOM   125  O  O     . VAL A 1 17  ? 17.039  30.244  7.452   1.00 77.32  ? 16  VAL A O     1 
ATOM   126  C  CB    . VAL A 1 17  ? 18.869  27.519  8.086   1.00 72.81  ? 16  VAL A CB    1 
ATOM   127  C  CG1   . VAL A 1 17  ? 17.430  27.181  8.441   1.00 69.01  ? 16  VAL A CG1   1 
ATOM   128  C  CG2   . VAL A 1 17  ? 19.538  26.349  7.386   1.00 69.29  ? 16  VAL A CG2   1 
ATOM   129  N  N     . GLU A 1 18  ? 18.722  30.441  8.943   1.00 73.84  ? 17  GLU A N     1 
ATOM   130  C  CA    . GLU A 1 18  ? 18.081  31.497  9.719   1.00 77.32  ? 17  GLU A CA    1 
ATOM   131  C  C     . GLU A 1 18  ? 17.804  32.748  8.884   1.00 74.87  ? 17  GLU A C     1 
ATOM   132  O  O     . GLU A 1 18  ? 16.784  33.410  9.071   1.00 77.68  ? 17  GLU A O     1 
ATOM   133  C  CB    . GLU A 1 18  ? 18.936  31.853  10.937  1.00 74.75  ? 17  GLU A CB    1 
ATOM   134  C  CG    . GLU A 1 18  ? 19.235  30.677  11.861  1.00 76.34  ? 17  GLU A CG    1 
ATOM   135  C  CD    . GLU A 1 18  ? 18.022  30.212  12.644  1.00 80.12  ? 17  GLU A CD    1 
ATOM   136  O  OE1   . GLU A 1 18  ? 17.034  30.972  12.727  1.00 83.99  ? 17  GLU A OE1   1 
ATOM   137  O  OE2   . GLU A 1 18  ? 18.058  29.085  13.181  1.00 79.11  ? 17  GLU A OE2   1 
ATOM   138  N  N     . MET A 1 19  ? 18.713  33.068  7.968   1.00 74.25  ? 18  MET A N     1 
ATOM   139  C  CA    . MET A 1 19  ? 18.527  34.207  7.075   1.00 75.07  ? 18  MET A CA    1 
ATOM   140  C  C     . MET A 1 19  ? 17.470  33.896  6.022   1.00 74.87  ? 18  MET A C     1 
ATOM   141  O  O     . MET A 1 19  ? 16.695  34.769  5.632   1.00 79.38  ? 18  MET A O     1 
ATOM   142  C  CB    . MET A 1 19  ? 19.844  34.599  6.399   1.00 65.55  ? 18  MET A CB    1 
ATOM   143  C  CG    . MET A 1 19  ? 20.819  35.334  7.302   1.00 64.38  ? 18  MET A CG    1 
ATOM   144  S  SD    . MET A 1 19  ? 22.333  35.822  6.451   1.00 69.75  ? 18  MET A SD    1 
ATOM   145  C  CE    . MET A 1 19  ? 22.863  34.257  5.762   1.00 68.33  ? 18  MET A CE    1 
ATOM   146  N  N     . ARG A 1 20  ? 17.447  32.648  5.564   1.00 71.73  ? 19  ARG A N     1 
ATOM   147  C  CA    . ARG A 1 20  ? 16.457  32.206  4.588   1.00 75.23  ? 19  ARG A CA    1 
ATOM   148  C  C     . ARG A 1 20  ? 15.051  32.316  5.165   1.00 78.11  ? 19  ARG A C     1 
ATOM   149  O  O     . ARG A 1 20  ? 14.116  32.724  4.474   1.00 79.40  ? 19  ARG A O     1 
ATOM   150  C  CB    . ARG A 1 20  ? 16.729  30.763  4.168   1.00 77.78  ? 19  ARG A CB    1 
ATOM   151  C  CG    . ARG A 1 20  ? 15.729  30.223  3.158   1.00 71.34  ? 19  ARG A CG    1 
ATOM   152  C  CD    . ARG A 1 20  ? 15.645  28.708  3.212   1.00 67.18  ? 19  ARG A CD    1 
ATOM   153  N  NE    . ARG A 1 20  ? 15.149  28.242  4.503   1.00 69.29  ? 19  ARG A NE    1 
ATOM   154  C  CZ    . ARG A 1 20  ? 14.988  26.963  4.824   1.00 67.75  ? 19  ARG A CZ    1 
ATOM   155  N  NH1   . ARG A 1 20  ? 15.283  26.015  3.945   1.00 58.56  ? 19  ARG A NH1   1 
ATOM   156  N  NH2   . ARG A 1 20  ? 14.530  26.632  6.023   1.00 64.93  ? 19  ARG A NH2   1 
ATOM   157  N  N     . ASP A 1 21  ? 14.910  31.958  6.438   1.00 76.48  ? 20  ASP A N     1 
ATOM   158  C  CA    . ASP A 1 21  ? 13.612  31.999  7.106   1.00 76.88  ? 20  ASP A CA    1 
ATOM   159  C  C     . ASP A 1 21  ? 13.284  33.378  7.704   1.00 76.42  ? 20  ASP A C     1 
ATOM   160  O  O     . ASP A 1 21  ? 12.200  33.579  8.263   1.00 75.86  ? 20  ASP A O     1 
ATOM   161  C  CB    . ASP A 1 21  ? 13.527  30.914  8.187   1.00 74.97  ? 20  ASP A CB    1 
ATOM   162  C  CG    . ASP A 1 21  ? 13.655  29.505  7.625   1.00 77.69  ? 20  ASP A CG    1 
ATOM   163  O  OD1   . ASP A 1 21  ? 13.466  29.309  6.407   1.00 72.80  ? 20  ASP A OD1   1 
ATOM   164  O  OD2   . ASP A 1 21  ? 13.925  28.581  8.418   1.00 85.02  ? 20  ASP A OD2   1 
ATOM   165  N  N     . ASN A 1 22  ? 14.212  34.324  7.574   1.00 76.22  ? 21  ASN A N     1 
ATOM   166  C  CA    . ASN A 1 22  ? 14.026  35.671  8.115   1.00 77.37  ? 21  ASN A CA    1 
ATOM   167  C  C     . ASN A 1 22  ? 14.880  36.696  7.362   1.00 87.27  ? 21  ASN A C     1 
ATOM   168  O  O     . ASN A 1 22  ? 15.966  37.053  7.820   1.00 86.99  ? 21  ASN A O     1 
ATOM   169  C  CB    . ASN A 1 22  ? 14.377  35.686  9.611   1.00 74.20  ? 21  ASN A CB    1 
ATOM   170  C  CG    . ASN A 1 22  ? 13.797  36.879  10.348  1.00 78.09  ? 21  ASN A CG    1 
ATOM   171  O  OD1   . ASN A 1 22  ? 13.602  37.947  9.775   1.00 84.28  ? 21  ASN A OD1   1 
ATOM   172  N  ND2   . ASN A 1 22  ? 13.533  36.701  11.635  1.00 80.10  ? 21  ASN A ND2   1 
ATOM   173  N  N     . PRO A 1 23  ? 14.389  37.176  6.204   1.00 89.52  ? 22  PRO A N     1 
ATOM   174  C  CA    . PRO A 1 23  ? 15.099  38.146  5.356   1.00 84.31  ? 22  PRO A CA    1 
ATOM   175  C  C     . PRO A 1 23  ? 15.376  39.481  6.048   1.00 86.94  ? 22  PRO A C     1 
ATOM   176  O  O     . PRO A 1 23  ? 16.134  40.293  5.514   1.00 85.08  ? 22  PRO A O     1 
ATOM   177  C  CB    . PRO A 1 23  ? 14.136  38.357  4.180   1.00 88.36  ? 22  PRO A CB    1 
ATOM   178  C  CG    . PRO A 1 23  ? 13.322  37.114  4.135   1.00 89.51  ? 22  PRO A CG    1 
ATOM   179  C  CD    . PRO A 1 23  ? 13.143  36.712  5.572   1.00 87.25  ? 22  PRO A CD    1 
ATOM   180  N  N     . ALA A 1 24  ? 14.774  39.703  7.213   1.00 87.30  ? 23  ALA A N     1 
ATOM   181  C  CA    . ALA A 1 24  ? 15.062  40.899  7.996   1.00 88.62  ? 23  ALA A CA    1 
ATOM   182  C  C     . ALA A 1 24  ? 16.530  40.903  8.407   1.00 89.57  ? 23  ALA A C     1 
ATOM   183  O  O     . ALA A 1 24  ? 17.125  41.958  8.621   1.00 86.13  ? 23  ALA A O     1 
ATOM   184  C  CB    . ALA A 1 24  ? 14.161  40.976  9.217   1.00 88.23  ? 23  ALA A CB    1 
ATOM   185  N  N     . LEU A 1 25  ? 17.104  39.709  8.514   1.00 92.94  ? 24  LEU A N     1 
ATOM   186  C  CA    . LEU A 1 25  ? 18.532  39.560  8.746   1.00 89.02  ? 24  LEU A CA    1 
ATOM   187  C  C     . LEU A 1 25  ? 19.278  39.799  7.437   1.00 90.28  ? 24  LEU A C     1 
ATOM   188  O  O     . LEU A 1 25  ? 19.318  40.921  6.930   1.00 91.52  ? 24  LEU A O     1 
ATOM   189  C  CB    . LEU A 1 25  ? 18.844  38.161  9.278   1.00 83.21  ? 24  LEU A CB    1 
ATOM   190  C  CG    . LEU A 1 25  ? 17.993  37.655  10.445  1.00 81.49  ? 24  LEU A CG    1 
ATOM   191  C  CD1   . LEU A 1 25  ? 18.402  36.241  10.832  1.00 75.59  ? 24  LEU A CD1   1 
ATOM   192  C  CD2   . LEU A 1 25  ? 18.093  38.589  11.641  1.00 74.22  ? 24  LEU A CD2   1 
ATOM   193  N  N     . ARG A 1 26  ? 19.862  38.732  6.898   1.00 84.49  ? 25  ARG A N     1 
ATOM   194  C  CA    . ARG A 1 26  ? 20.578  38.761  5.620   1.00 84.66  ? 25  ARG A CA    1 
ATOM   195  C  C     . ARG A 1 26  ? 21.712  39.788  5.538   1.00 85.83  ? 25  ARG A C     1 
ATOM   196  O  O     . ARG A 1 26  ? 22.868  39.426  5.323   1.00 86.68  ? 25  ARG A O     1 
ATOM   197  C  CB    . ARG A 1 26  ? 19.614  38.948  4.443   1.00 83.35  ? 25  ARG A CB    1 
ATOM   198  C  CG    . ARG A 1 26  ? 20.267  38.693  3.092   1.00 84.89  ? 25  ARG A CG    1 
ATOM   199  C  CD    . ARG A 1 26  ? 19.428  39.208  1.936   1.00 93.67  ? 25  ARG A CD    1 
ATOM   200  N  NE    . ARG A 1 26  ? 20.113  39.026  0.659   1.00 99.10  ? 25  ARG A NE    1 
ATOM   201  C  CZ    . ARG A 1 26  ? 21.030  39.859  0.178   1.00 97.46  ? 25  ARG A CZ    1 
ATOM   202  N  NH1   . ARG A 1 26  ? 21.377  40.937  0.867   1.00 95.98  ? 25  ARG A NH1   1 
ATOM   203  N  NH2   . ARG A 1 26  ? 21.604  39.615  -0.993  1.00 90.20  ? 25  ARG A NH2   1 
ATOM   204  N  N     . ASP A 1 27  ? 21.375  41.064  5.700   1.00 86.55  ? 26  ASP A N     1 
ATOM   205  C  CA    . ASP A 1 27  ? 22.347  42.141  5.533   1.00 83.81  ? 26  ASP A CA    1 
ATOM   206  C  C     . ASP A 1 27  ? 22.913  42.649  6.856   1.00 79.62  ? 26  ASP A C     1 
ATOM   207  O  O     . ASP A 1 27  ? 23.625  43.653  6.886   1.00 82.41  ? 26  ASP A O     1 
ATOM   208  C  CB    . ASP A 1 27  ? 21.720  43.303  4.759   1.00 92.45  ? 26  ASP A CB    1 
ATOM   209  C  CG    . ASP A 1 27  ? 21.337  42.919  3.345   1.00 94.04  ? 26  ASP A CG    1 
ATOM   210  O  OD1   . ASP A 1 27  ? 22.114  42.188  2.697   1.00 90.35  ? 26  ASP A OD1   1 
ATOM   211  O  OD2   . ASP A 1 27  ? 20.257  43.345  2.883   1.00 87.56  ? 26  ASP A OD2   1 
ATOM   212  N  N     . ILE A 1 28  ? 22.599  41.959  7.947   1.00 79.38  ? 27  ILE A N     1 
ATOM   213  C  CA    . ILE A 1 28  ? 23.074  42.369  9.264   1.00 78.16  ? 27  ILE A CA    1 
ATOM   214  C  C     . ILE A 1 28  ? 23.930  41.284  9.915   1.00 74.34  ? 27  ILE A C     1 
ATOM   215  O  O     . ILE A 1 28  ? 23.772  40.101  9.613   1.00 76.10  ? 27  ILE A O     1 
ATOM   216  C  CB    . ILE A 1 28  ? 21.901  42.739  10.200  1.00 76.92  ? 27  ILE A CB    1 
ATOM   217  C  CG1   . ILE A 1 28  ? 21.021  41.519  10.470  1.00 72.30  ? 27  ILE A CG1   1 
ATOM   218  C  CG2   . ILE A 1 28  ? 21.084  43.877  9.608   1.00 81.32  ? 27  ILE A CG2   1 
ATOM   219  C  CD1   . ILE A 1 28  ? 19.876  41.795  11.416  1.00 74.12  ? 27  ILE A CD1   1 
ATOM   220  N  N     . PRO A 1 29  ? 24.855  41.688  10.801  1.00 65.81  ? 28  PRO A N     1 
ATOM   221  C  CA    . PRO A 1 29  ? 25.695  40.720  11.512  1.00 71.38  ? 28  PRO A CA    1 
ATOM   222  C  C     . PRO A 1 29  ? 24.885  39.811  12.430  1.00 68.48  ? 28  PRO A C     1 
ATOM   223  O  O     . PRO A 1 29  ? 24.407  40.256  13.473  1.00 67.31  ? 28  PRO A O     1 
ATOM   224  C  CB    . PRO A 1 29  ? 26.613  41.610  12.354  1.00 65.47  ? 28  PRO A CB    1 
ATOM   225  C  CG    . PRO A 1 29  ? 26.632  42.918  11.651  1.00 67.87  ? 28  PRO A CG    1 
ATOM   226  C  CD    . PRO A 1 29  ? 25.260  43.077  11.079  1.00 66.06  ? 28  PRO A CD    1 
ATOM   227  N  N     . ILE A 1 30  ? 24.732  38.550  12.040  1.00 69.07  ? 29  ILE A N     1 
ATOM   228  C  CA    . ILE A 1 30  ? 24.066  37.573  12.890  1.00 70.01  ? 29  ILE A CA    1 
ATOM   229  C  C     . ILE A 1 30  ? 25.001  36.416  13.214  1.00 65.57  ? 29  ILE A C     1 
ATOM   230  O  O     . ILE A 1 30  ? 25.988  36.184  12.515  1.00 64.09  ? 29  ILE A O     1 
ATOM   231  C  CB    . ILE A 1 30  ? 22.787  37.010  12.238  1.00 66.28  ? 29  ILE A CB    1 
ATOM   232  C  CG1   . ILE A 1 30  ? 23.143  36.027  11.120  1.00 63.27  ? 29  ILE A CG1   1 
ATOM   233  C  CG2   . ILE A 1 30  ? 21.904  38.137  11.725  1.00 69.11  ? 29  ILE A CG2   1 
ATOM   234  C  CD1   . ILE A 1 30  ? 21.988  35.154  10.691  1.00 68.64  ? 29  ILE A CD1   1 
ATOM   235  N  N     . ALA A 1 31  ? 24.686  35.698  14.284  1.00 72.28  ? 30  ALA A N     1 
ATOM   236  C  CA    . ALA A 1 31  ? 25.454  34.525  14.673  1.00 62.80  ? 30  ALA A CA    1 
ATOM   237  C  C     . ALA A 1 31  ? 24.579  33.563  15.458  1.00 58.95  ? 30  ALA A C     1 
ATOM   238  O  O     . ALA A 1 31  ? 23.655  33.976  16.158  1.00 61.76  ? 30  ALA A O     1 
ATOM   239  C  CB    . ALA A 1 31  ? 26.667  34.928  15.495  1.00 56.58  ? 30  ALA A CB    1 
ATOM   240  N  N     . ILE A 1 32  ? 24.870  32.275  15.330  1.00 63.49  ? 31  ILE A N     1 
ATOM   241  C  CA    . ILE A 1 32  ? 24.175  31.261  16.106  1.00 63.57  ? 31  ILE A CA    1 
ATOM   242  C  C     . ILE A 1 32  ? 25.088  30.806  17.236  1.00 61.01  ? 31  ILE A C     1 
ATOM   243  O  O     . ILE A 1 32  ? 26.235  30.427  17.002  1.00 59.20  ? 31  ILE A O     1 
ATOM   244  C  CB    . ILE A 1 32  ? 23.758  30.052  15.237  1.00 63.81  ? 31  ILE A CB    1 
ATOM   245  C  CG1   . ILE A 1 32  ? 22.491  30.370  14.437  1.00 65.27  ? 31  ILE A CG1   1 
ATOM   246  C  CG2   . ILE A 1 32  ? 23.512  28.828  16.104  1.00 63.31  ? 31  ILE A CG2   1 
ATOM   247  C  CD1   . ILE A 1 32  ? 22.706  31.279  13.243  1.00 62.95  ? 31  ILE A CD1   1 
ATOM   248  N  N     . GLY A 1 33  ? 24.586  30.867  18.465  1.00 63.94  ? 32  GLY A N     1 
ATOM   249  C  CA    . GLY A 1 33  ? 25.370  30.464  19.616  1.00 63.83  ? 32  GLY A CA    1 
ATOM   250  C  C     . GLY A 1 33  ? 24.735  30.847  20.937  1.00 60.74  ? 32  GLY A C     1 
ATOM   251  O  O     . GLY A 1 33  ? 23.675  31.471  20.973  1.00 63.10  ? 32  GLY A O     1 
ATOM   252  N  N     . GLY A 1 34  ? 25.392  30.470  22.029  1.00 63.76  ? 33  GLY A N     1 
ATOM   253  C  CA    . GLY A 1 34  ? 24.889  30.753  23.360  1.00 64.77  ? 33  GLY A CA    1 
ATOM   254  C  C     . GLY A 1 34  ? 25.285  32.129  23.854  1.00 62.32  ? 33  GLY A C     1 
ATOM   255  O  O     . GLY A 1 34  ? 26.295  32.687  23.427  1.00 61.46  ? 33  GLY A O     1 
ATOM   256  N  N     . SER A 1 35  ? 24.483  32.676  24.761  1.00 63.34  ? 34  SER A N     1 
ATOM   257  C  CA    . SER A 1 35  ? 24.743  33.995  25.322  1.00 60.70  ? 34  SER A CA    1 
ATOM   258  C  C     . SER A 1 35  ? 25.914  33.956  26.297  1.00 63.22  ? 34  SER A C     1 
ATOM   259  O  O     . SER A 1 35  ? 26.261  32.896  26.817  1.00 66.64  ? 34  SER A O     1 
ATOM   260  C  CB    . SER A 1 35  ? 23.492  34.520  26.027  1.00 62.16  ? 34  SER A CB    1 
ATOM   261  O  OG    . SER A 1 35  ? 23.090  33.635  27.058  1.00 64.67  ? 34  SER A OG    1 
ATOM   262  N  N     . ARG A 1 36  ? 26.521  35.115  26.538  1.00 62.65  ? 35  ARG A N     1 
ATOM   263  C  CA    . ARG A 1 36  ? 27.591  35.232  27.523  1.00 67.36  ? 35  ARG A CA    1 
ATOM   264  C  C     . ARG A 1 36  ? 26.982  35.016  28.897  1.00 66.70  ? 35  ARG A C     1 
ATOM   265  O  O     . ARG A 1 36  ? 27.654  34.604  29.842  1.00 66.77  ? 35  ARG A O     1 
ATOM   266  C  CB    . ARG A 1 36  ? 28.246  36.609  27.442  1.00 71.43  ? 35  ARG A CB    1 
ATOM   267  C  CG    . ARG A 1 36  ? 29.362  36.819  28.448  1.00 78.27  ? 35  ARG A CG    1 
ATOM   268  C  CD    . ARG A 1 36  ? 30.122  38.096  28.160  1.00 85.07  ? 35  ARG A CD    1 
ATOM   269  N  NE    . ARG A 1 36  ? 29.237  39.247  28.013  1.00 94.00  ? 35  ARG A NE    1 
ATOM   270  C  CZ    . ARG A 1 36  ? 29.662  40.493  27.837  1.00 95.93  ? 35  ARG A CZ    1 
ATOM   271  N  NH1   . ARG A 1 36  ? 30.963  40.749  27.790  1.00 92.67  ? 35  ARG A NH1   1 
ATOM   272  N  NH2   . ARG A 1 36  ? 28.789  41.483  27.711  1.00 94.62  ? 35  ARG A NH2   1 
ATOM   273  N  N     . GLU A 1 37  ? 25.693  35.321  28.985  1.00 72.76  ? 36  GLU A N     1 
ATOM   274  C  CA    . GLU A 1 37  ? 24.867  34.966  30.123  1.00 71.75  ? 36  GLU A CA    1 
ATOM   275  C  C     . GLU A 1 37  ? 25.074  33.501  30.523  1.00 74.18  ? 36  GLU A C     1 
ATOM   276  O  O     . GLU A 1 37  ? 25.452  33.211  31.661  1.00 75.25  ? 36  GLU A O     1 
ATOM   277  C  CB    . GLU A 1 37  ? 23.407  35.223  29.759  1.00 74.73  ? 36  GLU A CB    1 
ATOM   278  C  CG    . GLU A 1 37  ? 22.387  34.399  30.520  1.00 75.87  ? 36  GLU A CG    1 
ATOM   279  C  CD    . GLU A 1 37  ? 21.056  34.401  29.827  1.00 70.45  ? 36  GLU A CD    1 
ATOM   280  O  OE1   . GLU A 1 37  ? 20.809  35.344  29.054  1.00 68.76  ? 36  GLU A OE1   1 
ATOM   281  O  OE2   . GLU A 1 37  ? 20.264  33.464  30.035  1.00 64.20  ? 36  GLU A OE2   1 
ATOM   282  N  N     . ARG A 1 38  ? 24.842  32.586  29.583  1.00 71.55  ? 37  ARG A N     1 
ATOM   283  C  CA    . ARG A 1 38  ? 25.003  31.161  29.855  1.00 68.69  ? 37  ARG A CA    1 
ATOM   284  C  C     . ARG A 1 38  ? 26.324  30.637  29.301  1.00 68.89  ? 37  ARG A C     1 
ATOM   285  O  O     . ARG A 1 38  ? 26.430  29.464  28.943  1.00 67.71  ? 37  ARG A O     1 
ATOM   286  C  CB    . ARG A 1 38  ? 23.826  30.355  29.294  1.00 68.42  ? 37  ARG A CB    1 
ATOM   287  C  CG    . ARG A 1 38  ? 22.467  30.771  29.844  1.00 80.40  ? 37  ARG A CG    1 
ATOM   288  C  CD    . ARG A 1 38  ? 22.485  30.830  31.365  1.00 88.33  ? 37  ARG A CD    1 
ATOM   289  N  NE    . ARG A 1 38  ? 21.258  31.403  31.911  1.00 83.20  ? 37  ARG A NE    1 
ATOM   290  C  CZ    . ARG A 1 38  ? 21.225  32.300  32.891  1.00 75.59  ? 37  ARG A CZ    1 
ATOM   291  N  NH1   . ARG A 1 38  ? 22.354  32.733  33.437  1.00 67.43  ? 37  ARG A NH1   1 
ATOM   292  N  NH2   . ARG A 1 38  ? 20.063  32.768  33.325  1.00 70.07  ? 37  ARG A NH2   1 
ATOM   293  N  N     . ARG A 1 39  ? 27.320  31.520  29.235  1.00 63.58  ? 38  ARG A N     1 
ATOM   294  C  CA    . ARG A 1 39  ? 28.681  31.170  28.813  1.00 66.57  ? 38  ARG A CA    1 
ATOM   295  C  C     . ARG A 1 39  ? 28.735  30.463  27.463  1.00 63.35  ? 38  ARG A C     1 
ATOM   296  O  O     . ARG A 1 39  ? 29.253  29.351  27.354  1.00 64.05  ? 38  ARG A O     1 
ATOM   297  C  CB    . ARG A 1 39  ? 29.371  30.315  29.878  1.00 58.83  ? 38  ARG A CB    1 
ATOM   298  C  CG    . ARG A 1 39  ? 29.636  31.047  31.180  1.00 66.54  ? 38  ARG A CG    1 
ATOM   299  C  CD    . ARG A 1 39  ? 29.473  30.106  32.354  1.00 64.18  ? 38  ARG A CD    1 
ATOM   300  N  NE    . ARG A 1 39  ? 30.693  29.967  33.141  1.00 69.17  ? 38  ARG A NE    1 
ATOM   301  C  CZ    . ARG A 1 39  ? 30.992  28.891  33.861  1.00 63.11  ? 38  ARG A CZ    1 
ATOM   302  N  NH1   . ARG A 1 39  ? 30.164  27.856  33.883  1.00 58.82  ? 38  ARG A NH1   1 
ATOM   303  N  NH2   . ARG A 1 39  ? 32.121  28.848  34.552  1.00 66.73  ? 38  ARG A NH2   1 
ATOM   304  N  N     . GLY A 1 40  ? 28.215  31.121  26.435  1.00 57.95  ? 39  GLY A N     1 
ATOM   305  C  CA    . GLY A 1 40  ? 28.087  30.504  25.130  1.00 60.26  ? 39  GLY A CA    1 
ATOM   306  C  C     . GLY A 1 40  ? 29.298  30.630  24.228  1.00 56.87  ? 39  GLY A C     1 
ATOM   307  O  O     . GLY A 1 40  ? 30.308  31.238  24.582  1.00 58.22  ? 39  GLY A O     1 
ATOM   308  N  N     . VAL A 1 41  ? 29.179  30.033  23.047  1.00 57.47  ? 40  VAL A N     1 
ATOM   309  C  CA    . VAL A 1 41  ? 30.209  30.086  22.023  1.00 53.71  ? 40  VAL A CA    1 
ATOM   310  C  C     . VAL A 1 41  ? 29.510  30.163  20.668  1.00 55.51  ? 40  VAL A C     1 
ATOM   311  O  O     . VAL A 1 41  ? 28.424  29.608  20.494  1.00 64.80  ? 40  VAL A O     1 
ATOM   312  C  CB    . VAL A 1 41  ? 31.146  28.850  22.106  1.00 56.84  ? 40  VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 41  ? 31.209  28.104  20.779  1.00 53.38  ? 40  VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 41  ? 32.538  29.263  22.562  1.00 56.94  ? 40  VAL A CG2   1 
ATOM   315  N  N     . ILE A 1 42  ? 30.113  30.871  19.719  1.00 51.83  ? 41  ILE A N     1 
ATOM   316  C  CA    . ILE A 1 42  ? 29.524  31.008  18.392  1.00 50.99  ? 41  ILE A CA    1 
ATOM   317  C  C     . ILE A 1 42  ? 29.607  29.706  17.599  1.00 52.90  ? 41  ILE A C     1 
ATOM   318  O  O     . ILE A 1 42  ? 30.697  29.185  17.362  1.00 59.64  ? 41  ILE A O     1 
ATOM   319  C  CB    . ILE A 1 42  ? 30.208  32.125  17.583  1.00 51.58  ? 41  ILE A CB    1 
ATOM   320  C  CG1   . ILE A 1 42  ? 30.076  33.465  18.309  1.00 54.59  ? 41  ILE A CG1   1 
ATOM   321  C  CG2   . ILE A 1 42  ? 29.611  32.212  16.187  1.00 51.83  ? 41  ILE A CG2   1 
ATOM   322  C  CD1   . ILE A 1 42  ? 28.645  33.899  18.530  1.00 55.41  ? 41  ILE A CD1   1 
ATOM   323  N  N     . SER A 1 43  ? 28.453  29.184  17.197  1.00 52.00  ? 42  SER A N     1 
ATOM   324  C  CA    . SER A 1 43  ? 28.409  28.008  16.335  1.00 57.35  ? 42  SER A CA    1 
ATOM   325  C  C     . SER A 1 43  ? 28.892  28.386  14.943  1.00 56.57  ? 42  SER A C     1 
ATOM   326  O  O     . SER A 1 43  ? 29.809  27.769  14.402  1.00 56.19  ? 42  SER A O     1 
ATOM   327  C  CB    . SER A 1 43  ? 26.992  27.437  16.262  1.00 55.58  ? 42  SER A CB    1 
ATOM   328  O  OG    . SER A 1 43  ? 26.881  26.242  17.014  1.00 62.03  ? 42  SER A OG    1 
ATOM   329  N  N     . THR A 1 44  ? 28.263  29.408  14.371  1.00 59.89  ? 43  THR A N     1 
ATOM   330  C  CA    . THR A 1 44  ? 28.687  29.970  13.095  1.00 61.80  ? 43  THR A CA    1 
ATOM   331  C  C     . THR A 1 44  ? 28.100  31.366  12.925  1.00 60.03  ? 43  THR A C     1 
ATOM   332  O  O     . THR A 1 44  ? 27.133  31.730  13.595  1.00 59.05  ? 43  THR A O     1 
ATOM   333  C  CB    . THR A 1 44  ? 28.261  29.091  11.902  1.00 58.94  ? 43  THR A CB    1 
ATOM   334  O  OG1   . THR A 1 44  ? 28.825  29.614  10.693  1.00 50.66  ? 43  THR A OG1   1 
ATOM   335  C  CG2   . THR A 1 44  ? 26.750  29.061  11.774  1.00 59.12  ? 43  THR A CG2   1 
ATOM   336  N  N     . ALA A 1 45  ? 28.692  32.145  12.028  1.00 55.53  ? 44  ALA A N     1 
ATOM   337  C  CA    . ALA A 1 45  ? 28.220  33.497  11.766  1.00 60.00  ? 44  ALA A CA    1 
ATOM   338  C  C     . ALA A 1 45  ? 28.027  33.711  10.272  1.00 62.93  ? 44  ALA A C     1 
ATOM   339  O  O     . ALA A 1 45  ? 28.568  32.964  9.456   1.00 63.57  ? 44  ALA A O     1 
ATOM   340  C  CB    . ALA A 1 45  ? 29.199  34.515  12.323  1.00 56.62  ? 44  ALA A CB    1 
ATOM   341  N  N     . ASN A 1 46  ? 27.248  34.727  9.915   1.00 59.53  ? 45  ASN A N     1 
ATOM   342  C  CA    . ASN A 1 46  ? 27.093  35.095  8.515   1.00 60.63  ? 45  ASN A CA    1 
ATOM   343  C  C     . ASN A 1 46  ? 28.227  36.021  8.086   1.00 63.50  ? 45  ASN A C     1 
ATOM   344  O  O     . ASN A 1 46  ? 28.990  36.501  8.923   1.00 62.62  ? 45  ASN A O     1 
ATOM   345  C  CB    . ASN A 1 46  ? 25.724  35.733  8.256   1.00 67.61  ? 45  ASN A CB    1 
ATOM   346  C  CG    . ASN A 1 46  ? 25.598  37.123  8.851   1.00 66.57  ? 45  ASN A CG    1 
ATOM   347  O  OD1   . ASN A 1 46  ? 26.275  37.464  9.820   1.00 66.59  ? 45  ASN A OD1   1 
ATOM   348  N  ND2   . ASN A 1 46  ? 24.719  37.932  8.272   1.00 67.16  ? 45  ASN A ND2   1 
ATOM   349  N  N     . TYR A 1 47  ? 28.334  36.270  6.785   1.00 63.71  ? 46  TYR A N     1 
ATOM   350  C  CA    . TYR A 1 47  ? 29.453  37.042  6.241   1.00 65.07  ? 46  TYR A CA    1 
ATOM   351  C  C     . TYR A 1 47  ? 29.635  38.476  6.769   1.00 61.19  ? 46  TYR A C     1 
ATOM   352  O  O     . TYR A 1 47  ? 30.768  38.885  7.038   1.00 59.11  ? 46  TYR A O     1 
ATOM   353  C  CB    . TYR A 1 47  ? 29.460  37.000  4.708   1.00 59.23  ? 46  TYR A CB    1 
ATOM   354  C  CG    . TYR A 1 47  ? 30.192  35.797  4.163   1.00 63.32  ? 46  TYR A CG    1 
ATOM   355  C  CD1   . TYR A 1 47  ? 29.502  34.705  3.654   1.00 55.80  ? 46  TYR A CD1   1 
ATOM   356  C  CD2   . TYR A 1 47  ? 31.580  35.746  4.180   1.00 60.58  ? 46  TYR A CD2   1 
ATOM   357  C  CE1   . TYR A 1 47  ? 30.175  33.602  3.163   1.00 55.95  ? 46  TYR A CE1   1 
ATOM   358  C  CE2   . TYR A 1 47  ? 32.260  34.649  3.693   1.00 57.36  ? 46  TYR A CE2   1 
ATOM   359  C  CZ    . TYR A 1 47  ? 31.554  33.580  3.186   1.00 60.46  ? 46  TYR A CZ    1 
ATOM   360  O  OH    . TYR A 1 47  ? 32.233  32.486  2.700   1.00 59.89  ? 46  TYR A OH    1 
ATOM   361  N  N     . PRO A 1 48  ? 28.536  39.246  6.910   1.00 66.24  ? 47  PRO A N     1 
ATOM   362  C  CA    . PRO A 1 48  ? 28.684  40.559  7.549   1.00 64.29  ? 47  PRO A CA    1 
ATOM   363  C  C     . PRO A 1 48  ? 29.330  40.465  8.930   1.00 62.27  ? 47  PRO A C     1 
ATOM   364  O  O     . PRO A 1 48  ? 30.106  41.344  9.296   1.00 62.37  ? 47  PRO A O     1 
ATOM   365  C  CB    . PRO A 1 48  ? 27.239  41.043  7.677   1.00 63.50  ? 47  PRO A CB    1 
ATOM   366  C  CG    . PRO A 1 48  ? 26.547  40.419  6.526   1.00 58.91  ? 47  PRO A CG    1 
ATOM   367  C  CD    . PRO A 1 48  ? 27.180  39.064  6.357   1.00 64.57  ? 47  PRO A CD    1 
ATOM   368  N  N     . ALA A 1 49  ? 29.022  39.406  9.673   1.00 61.80  ? 48  ALA A N     1 
ATOM   369  C  CA    . ALA A 1 49  ? 29.606  39.202  10.995  1.00 58.89  ? 48  ALA A CA    1 
ATOM   370  C  C     . ALA A 1 49  ? 31.068  38.780  10.895  1.00 56.75  ? 48  ALA A C     1 
ATOM   371  O  O     . ALA A 1 49  ? 31.904  39.225  11.681  1.00 58.70  ? 48  ALA A O     1 
ATOM   372  C  CB    . ALA A 1 49  ? 28.807  38.173  11.775  1.00 55.96  ? 48  ALA A CB    1 
ATOM   373  N  N     . ARG A 1 50  ? 31.371  37.921  9.925   1.00 58.82  ? 49  ARG A N     1 
ATOM   374  C  CA    . ARG A 1 50  ? 32.737  37.452  9.712   1.00 59.94  ? 49  ARG A CA    1 
ATOM   375  C  C     . ARG A 1 50  ? 33.645  38.603  9.296   1.00 62.22  ? 49  ARG A C     1 
ATOM   376  O  O     . ARG A 1 50  ? 34.859  38.550  9.492   1.00 60.68  ? 49  ARG A O     1 
ATOM   377  C  CB    . ARG A 1 50  ? 32.769  36.351  8.653   1.00 60.82  ? 49  ARG A CB    1 
ATOM   378  C  CG    . ARG A 1 50  ? 31.888  35.165  8.977   1.00 60.66  ? 49  ARG A CG    1 
ATOM   379  C  CD    . ARG A 1 50  ? 32.049  34.059  7.954   1.00 61.87  ? 49  ARG A CD    1 
ATOM   380  N  NE    . ARG A 1 50  ? 31.137  32.952  8.220   1.00 66.29  ? 49  ARG A NE    1 
ATOM   381  C  CZ    . ARG A 1 50  ? 31.217  31.760  7.639   1.00 68.12  ? 49  ARG A CZ    1 
ATOM   382  N  NH1   . ARG A 1 50  ? 32.176  31.511  6.758   1.00 71.37  ? 49  ARG A NH1   1 
ATOM   383  N  NH2   . ARG A 1 50  ? 30.340  30.813  7.945   1.00 59.77  ? 49  ARG A NH2   1 
ATOM   384  N  N     . LYS A 1 51  ? 33.045  39.641  8.716   1.00 64.90  ? 50  LYS A N     1 
ATOM   385  C  CA    . LYS A 1 51  ? 33.772  40.859  8.364   1.00 62.75  ? 50  LYS A CA    1 
ATOM   386  C  C     . LYS A 1 51  ? 34.382  41.499  9.613   1.00 59.23  ? 50  LYS A C     1 
ATOM   387  O  O     . LYS A 1 51  ? 35.456  42.104  9.549   1.00 52.25  ? 50  LYS A O     1 
ATOM   388  C  CB    . LYS A 1 51  ? 32.845  41.850  7.651   1.00 62.73  ? 50  LYS A CB    1 
ATOM   389  C  CG    . LYS A 1 51  ? 33.550  43.056  7.046   1.00 61.31  ? 50  LYS A CG    1 
ATOM   390  C  CD    . LYS A 1 51  ? 32.555  44.049  6.443   1.00 66.31  ? 50  LYS A CD    1 
ATOM   391  C  CE    . LYS A 1 51  ? 31.560  44.556  7.476   1.00 65.24  ? 50  LYS A CE    1 
ATOM   392  N  NZ    . LYS A 1 51  ? 30.523  45.466  6.897   1.00 72.50  ? 50  LYS A NZ    1 
ATOM   393  N  N     . PHE A 1 52  ? 33.703  41.343  10.748  1.00 61.22  ? 51  PHE A N     1 
ATOM   394  C  CA    . PHE A 1 52  ? 34.189  41.875  12.017  1.00 58.51  ? 51  PHE A CA    1 
ATOM   395  C  C     . PHE A 1 52  ? 35.152  40.904  12.692  1.00 62.11  ? 51  PHE A C     1 
ATOM   396  O  O     . PHE A 1 52  ? 35.755  41.226  13.716  1.00 60.64  ? 51  PHE A O     1 
ATOM   397  C  CB    . PHE A 1 52  ? 33.022  42.181  12.957  1.00 57.12  ? 51  PHE A CB    1 
ATOM   398  C  CG    . PHE A 1 52  ? 32.086  43.236  12.440  1.00 62.38  ? 51  PHE A CG    1 
ATOM   399  C  CD1   . PHE A 1 52  ? 30.945  42.884  11.741  1.00 60.21  ? 51  PHE A CD1   1 
ATOM   400  C  CD2   . PHE A 1 52  ? 32.343  44.579  12.661  1.00 56.88  ? 51  PHE A CD2   1 
ATOM   401  C  CE1   . PHE A 1 52  ? 30.081  43.850  11.264  1.00 55.97  ? 51  PHE A CE1   1 
ATOM   402  C  CE2   . PHE A 1 52  ? 31.482  45.550  12.187  1.00 54.68  ? 51  PHE A CE2   1 
ATOM   403  C  CZ    . PHE A 1 52  ? 30.349  45.185  11.487  1.00 57.60  ? 51  PHE A CZ    1 
ATOM   404  N  N     . GLY A 1 53  ? 35.285  39.713  12.118  1.00 58.90  ? 52  GLY A N     1 
ATOM   405  C  CA    . GLY A 1 53  ? 36.191  38.712  12.647  1.00 55.33  ? 52  GLY A CA    1 
ATOM   406  C  C     . GLY A 1 53  ? 35.495  37.687  13.519  1.00 58.80  ? 52  GLY A C     1 
ATOM   407  O  O     . GLY A 1 53  ? 36.147  36.894  14.198  1.00 58.45  ? 52  GLY A O     1 
ATOM   408  N  N     . VAL A 1 54  ? 34.166  37.705  13.506  1.00 55.17  ? 53  VAL A N     1 
ATOM   409  C  CA    . VAL A 1 54  ? 33.387  36.736  14.266  1.00 55.97  ? 53  VAL A CA    1 
ATOM   410  C  C     . VAL A 1 54  ? 33.563  35.342  13.674  1.00 58.22  ? 53  VAL A C     1 
ATOM   411  O  O     . VAL A 1 54  ? 33.214  35.098  12.520  1.00 62.35  ? 53  VAL A O     1 
ATOM   412  C  CB    . VAL A 1 54  ? 31.892  37.097  14.288  1.00 55.62  ? 53  VAL A CB    1 
ATOM   413  C  CG1   . VAL A 1 54  ? 31.104  36.035  15.040  1.00 55.03  ? 53  VAL A CG1   1 
ATOM   414  C  CG2   . VAL A 1 54  ? 31.687  38.466  14.920  1.00 55.53  ? 53  VAL A CG2   1 
ATOM   415  N  N     . ARG A 1 55  ? 34.109  34.434  14.474  1.00 62.51  ? 54  ARG A N     1 
ATOM   416  C  CA    . ARG A 1 55  ? 34.411  33.086  14.010  1.00 59.76  ? 54  ARG A CA    1 
ATOM   417  C  C     . ARG A 1 55  ? 33.605  32.043  14.771  1.00 57.95  ? 54  ARG A C     1 
ATOM   418  O  O     . ARG A 1 55  ? 33.025  32.331  15.818  1.00 57.33  ? 54  ARG A O     1 
ATOM   419  C  CB    . ARG A 1 55  ? 35.902  32.794  14.188  1.00 55.62  ? 54  ARG A CB    1 
ATOM   420  C  CG    . ARG A 1 55  ? 36.823  33.720  13.416  1.00 57.25  ? 54  ARG A CG    1 
ATOM   421  C  CD    . ARG A 1 55  ? 36.852  33.366  11.940  1.00 62.27  ? 54  ARG A CD    1 
ATOM   422  N  NE    . ARG A 1 55  ? 37.852  34.142  11.212  1.00 70.45  ? 54  ARG A NE    1 
ATOM   423  C  CZ    . ARG A 1 55  ? 37.576  35.209  10.468  1.00 71.61  ? 54  ARG A CZ    1 
ATOM   424  N  NH1   . ARG A 1 55  ? 36.323  35.629  10.345  1.00 62.50  ? 54  ARG A NH1   1 
ATOM   425  N  NH2   . ARG A 1 55  ? 38.552  35.853  9.843   1.00 65.90  ? 54  ARG A NH2   1 
ATOM   426  N  N     . SER A 1 56  ? 33.574  30.827  14.235  1.00 54.33  ? 55  SER A N     1 
ATOM   427  C  CA    . SER A 1 56  ? 33.013  29.696  14.957  1.00 48.08  ? 55  SER A CA    1 
ATOM   428  C  C     . SER A 1 56  ? 33.911  29.395  16.148  1.00 51.41  ? 55  SER A C     1 
ATOM   429  O  O     . SER A 1 56  ? 35.106  29.693  16.117  1.00 52.93  ? 55  SER A O     1 
ATOM   430  C  CB    . SER A 1 56  ? 32.913  28.471  14.048  1.00 44.96  ? 55  SER A CB    1 
ATOM   431  O  OG    . SER A 1 56  ? 31.972  28.677  13.009  1.00 47.82  ? 55  SER A OG    1 
ATOM   432  N  N     . ALA A 1 57  ? 33.324  28.824  17.197  1.00 54.22  ? 56  ALA A N     1 
ATOM   433  C  CA    . ALA A 1 57  ? 34.041  28.468  18.425  1.00 59.01  ? 56  ALA A CA    1 
ATOM   434  C  C     . ALA A 1 57  ? 34.588  29.670  19.198  1.00 55.88  ? 56  ALA A C     1 
ATOM   435  O  O     . ALA A 1 57  ? 35.264  29.505  20.214  1.00 60.53  ? 56  ALA A O     1 
ATOM   436  C  CB    . ALA A 1 57  ? 35.152  27.450  18.141  1.00 44.60  ? 56  ALA A CB    1 
ATOM   437  N  N     . MET A 1 58  ? 34.294  30.874  18.721  1.00 59.31  ? 57  MET A N     1 
ATOM   438  C  CA    . MET A 1 58  ? 34.677  32.083  19.437  1.00 59.78  ? 57  MET A CA    1 
ATOM   439  C  C     . MET A 1 58  ? 33.715  32.315  20.594  1.00 58.69  ? 57  MET A C     1 
ATOM   440  O  O     . MET A 1 58  ? 32.501  32.208  20.421  1.00 57.51  ? 57  MET A O     1 
ATOM   441  C  CB    . MET A 1 58  ? 34.675  33.293  18.499  1.00 60.18  ? 57  MET A CB    1 
ATOM   442  C  CG    . MET A 1 58  ? 34.860  34.628  19.207  1.00 62.20  ? 57  MET A CG    1 
ATOM   443  S  SD    . MET A 1 58  ? 35.015  36.015  18.065  1.00 61.07  ? 57  MET A SD    1 
ATOM   444  C  CE    . MET A 1 58  ? 36.553  35.604  17.247  1.00 58.23  ? 57  MET A CE    1 
ATOM   445  N  N     . PRO A 1 59  ? 34.258  32.614  21.785  1.00 56.27  ? 58  PRO A N     1 
ATOM   446  C  CA    . PRO A 1 59  ? 33.421  32.955  22.939  1.00 56.54  ? 58  PRO A CA    1 
ATOM   447  C  C     . PRO A 1 59  ? 32.531  34.144  22.604  1.00 62.75  ? 58  PRO A C     1 
ATOM   448  O  O     . PRO A 1 59  ? 33.016  35.122  22.034  1.00 65.02  ? 58  PRO A O     1 
ATOM   449  C  CB    . PRO A 1 59  ? 34.446  33.344  24.006  1.00 62.75  ? 58  PRO A CB    1 
ATOM   450  C  CG    . PRO A 1 59  ? 35.683  32.609  23.623  1.00 55.46  ? 58  PRO A CG    1 
ATOM   451  C  CD    . PRO A 1 59  ? 35.691  32.600  22.124  1.00 57.68  ? 58  PRO A CD    1 
ATOM   452  N  N     . THR A 1 60  ? 31.249  34.051  22.941  1.00 60.46  ? 59  THR A N     1 
ATOM   453  C  CA    . THR A 1 60  ? 30.279  35.083  22.588  1.00 63.24  ? 59  THR A CA    1 
ATOM   454  C  C     . THR A 1 60  ? 30.682  36.452  23.134  1.00 69.39  ? 59  THR A C     1 
ATOM   455  O  O     . THR A 1 60  ? 30.416  37.481  22.514  1.00 69.25  ? 59  THR A O     1 
ATOM   456  C  CB    . THR A 1 60  ? 28.866  34.718  23.081  1.00 62.53  ? 59  THR A CB    1 
ATOM   457  O  OG1   . THR A 1 60  ? 28.548  33.381  22.673  1.00 63.17  ? 59  THR A OG1   1 
ATOM   458  C  CG2   . THR A 1 60  ? 27.832  35.675  22.509  1.00 56.80  ? 59  THR A CG2   1 
ATOM   459  N  N     . GLY A 1 61  ? 31.338  36.453  24.290  1.00 77.63  ? 60  GLY A N     1 
ATOM   460  C  CA    . GLY A 1 61  ? 31.859  37.679  24.866  1.00 78.52  ? 60  GLY A CA    1 
ATOM   461  C  C     . GLY A 1 61  ? 32.932  38.296  23.989  1.00 72.61  ? 60  GLY A C     1 
ATOM   462  O  O     . GLY A 1 61  ? 33.019  39.517  23.864  1.00 74.81  ? 60  GLY A O     1 
ATOM   463  N  N     . MET A 1 62  ? 33.749  37.444  23.376  1.00 70.49  ? 61  MET A N     1 
ATOM   464  C  CA    . MET A 1 62  ? 34.801  37.904  22.478  1.00 68.96  ? 61  MET A CA    1 
ATOM   465  C  C     . MET A 1 62  ? 34.210  38.398  21.162  1.00 69.60  ? 61  MET A C     1 
ATOM   466  O  O     . MET A 1 62  ? 34.747  39.309  20.533  1.00 72.52  ? 61  MET A O     1 
ATOM   467  C  CB    . MET A 1 62  ? 35.814  36.785  22.218  1.00 70.76  ? 61  MET A CB    1 
ATOM   468  C  CG    . MET A 1 62  ? 36.982  37.190  21.330  1.00 78.34  ? 61  MET A CG    1 
ATOM   469  S  SD    . MET A 1 62  ? 38.266  35.928  21.231  1.00 88.90  ? 61  MET A SD    1 
ATOM   470  C  CE    . MET A 1 62  ? 39.420  36.714  20.109  1.00 91.30  ? 61  MET A CE    1 
ATOM   471  N  N     . ALA A 1 63  ? 33.096  37.798  20.755  1.00 64.77  ? 62  ALA A N     1 
ATOM   472  C  CA    . ALA A 1 63  ? 32.449  38.160  19.499  1.00 64.05  ? 62  ALA A CA    1 
ATOM   473  C  C     . ALA A 1 63  ? 31.663  39.462  19.621  1.00 69.57  ? 62  ALA A C     1 
ATOM   474  O  O     . ALA A 1 63  ? 31.551  40.221  18.659  1.00 72.68  ? 62  ALA A O     1 
ATOM   475  C  CB    . ALA A 1 63  ? 31.544  37.033  19.021  1.00 61.85  ? 62  ALA A CB    1 
ATOM   476  N  N     . LEU A 1 64  ? 31.120  39.715  20.807  1.00 71.05  ? 63  LEU A N     1 
ATOM   477  C  CA    . LEU A 1 64  ? 30.361  40.936  21.052  1.00 66.95  ? 63  LEU A CA    1 
ATOM   478  C  C     . LEU A 1 64  ? 31.280  42.149  21.152  1.00 67.69  ? 63  LEU A C     1 
ATOM   479  O  O     . LEU A 1 64  ? 30.886  43.266  20.821  1.00 65.49  ? 63  LEU A O     1 
ATOM   480  C  CB    . LEU A 1 64  ? 29.514  40.802  22.319  1.00 63.00  ? 63  LEU A CB    1 
ATOM   481  C  CG    . LEU A 1 64  ? 28.266  39.926  22.198  1.00 64.85  ? 63  LEU A CG    1 
ATOM   482  C  CD1   . LEU A 1 64  ? 27.604  39.742  23.554  1.00 68.96  ? 63  LEU A CD1   1 
ATOM   483  C  CD2   . LEU A 1 64  ? 27.288  40.526  21.198  1.00 62.14  ? 63  LEU A CD2   1 
ATOM   484  N  N     . ALA A 1 65  ? 32.508  41.920  21.605  1.00 64.20  ? 64  ALA A N     1 
ATOM   485  C  CA    . ALA A 1 65  ? 33.498  42.987  21.704  1.00 67.26  ? 64  ALA A CA    1 
ATOM   486  C  C     . ALA A 1 65  ? 34.064  43.327  20.330  1.00 67.30  ? 64  ALA A C     1 
ATOM   487  O  O     . ALA A 1 65  ? 34.679  44.377  20.143  1.00 68.35  ? 64  ALA A O     1 
ATOM   488  C  CB    . ALA A 1 65  ? 34.613  42.592  22.660  1.00 64.72  ? 64  ALA A CB    1 
ATOM   489  N  N     . LEU A 1 66  ? 33.857  42.428  19.373  1.00 64.20  ? 65  LEU A N     1 
ATOM   490  C  CA    . LEU A 1 66  ? 34.277  42.660  17.997  1.00 61.24  ? 65  LEU A CA    1 
ATOM   491  C  C     . LEU A 1 66  ? 33.104  43.176  17.178  1.00 62.40  ? 65  LEU A C     1 
ATOM   492  O  O     . LEU A 1 66  ? 33.275  43.970  16.253  1.00 61.14  ? 65  LEU A O     1 
ATOM   493  C  CB    . LEU A 1 66  ? 34.816  41.373  17.374  1.00 60.25  ? 65  LEU A CB    1 
ATOM   494  C  CG    . LEU A 1 66  ? 36.069  40.774  18.013  1.00 61.31  ? 65  LEU A CG    1 
ATOM   495  C  CD1   . LEU A 1 66  ? 36.472  39.494  17.297  1.00 59.26  ? 65  LEU A CD1   1 
ATOM   496  C  CD2   . LEU A 1 66  ? 37.206  41.781  18.006  1.00 61.78  ? 65  LEU A CD2   1 
ATOM   497  N  N     . CYS A 1 67  ? 31.909  42.713  17.525  1.00 59.37  ? 66  CYS A N     1 
ATOM   498  C  CA    . CYS A 1 67  ? 30.699  43.128  16.833  1.00 63.02  ? 66  CYS A CA    1 
ATOM   499  C  C     . CYS A 1 67  ? 29.600  43.449  17.841  1.00 68.81  ? 66  CYS A C     1 
ATOM   500  O  O     . CYS A 1 67  ? 28.766  42.598  18.147  1.00 69.11  ? 66  CYS A O     1 
ATOM   501  C  CB    . CYS A 1 67  ? 30.237  42.033  15.872  1.00 61.27  ? 66  CYS A CB    1 
ATOM   502  S  SG    . CYS A 1 67  ? 28.967  42.561  14.712  1.00 68.20  ? 66  CYS A SG    1 
ATOM   503  N  N     . PRO A 1 68  ? 29.601  44.687  18.361  1.00 70.89  ? 67  PRO A N     1 
ATOM   504  C  CA    . PRO A 1 68  ? 28.656  45.147  19.386  1.00 68.60  ? 67  PRO A CA    1 
ATOM   505  C  C     . PRO A 1 68  ? 27.198  45.037  18.951  1.00 64.54  ? 67  PRO A C     1 
ATOM   506  O  O     . PRO A 1 68  ? 26.307  45.021  19.799  1.00 66.76  ? 67  PRO A O     1 
ATOM   507  C  CB    . PRO A 1 68  ? 29.032  46.621  19.569  1.00 59.23  ? 67  PRO A CB    1 
ATOM   508  C  CG    . PRO A 1 68  ? 30.451  46.705  19.136  1.00 57.17  ? 67  PRO A CG    1 
ATOM   509  C  CD    . PRO A 1 68  ? 30.575  45.733  18.006  1.00 62.48  ? 67  PRO A CD    1 
ATOM   510  N  N     . HIS A 1 69  ? 26.962  44.964  17.646  1.00 60.59  ? 68  HIS A N     1 
ATOM   511  C  CA    . HIS A 1 69  ? 25.604  44.885  17.126  1.00 66.76  ? 68  HIS A CA    1 
ATOM   512  C  C     . HIS A 1 69  ? 25.296  43.506  16.554  1.00 71.34  ? 68  HIS A C     1 
ATOM   513  O  O     . HIS A 1 69  ? 24.371  43.346  15.758  1.00 65.81  ? 68  HIS A O     1 
ATOM   514  C  CB    . HIS A 1 69  ? 25.371  45.974  16.078  1.00 67.87  ? 68  HIS A CB    1 
ATOM   515  C  CG    . HIS A 1 69  ? 25.557  47.362  16.606  1.00 79.63  ? 68  HIS A CG    1 
ATOM   516  N  ND1   . HIS A 1 69  ? 24.602  48.004  17.366  1.00 81.25  ? 68  HIS A ND1   1 
ATOM   517  C  CD2   . HIS A 1 69  ? 26.592  48.229  16.494  1.00 79.84  ? 68  HIS A CD2   1 
ATOM   518  C  CE1   . HIS A 1 69  ? 25.038  49.206  17.695  1.00 90.50  ? 68  HIS A CE1   1 
ATOM   519  N  NE2   . HIS A 1 69  ? 26.245  49.367  17.181  1.00 90.72  ? 68  HIS A NE2   1 
ATOM   520  N  N     . LEU A 1 70  ? 26.076  42.514  16.969  1.00 69.08  ? 69  LEU A N     1 
ATOM   521  C  CA    . LEU A 1 70  ? 25.838  41.134  16.571  1.00 68.45  ? 69  LEU A CA    1 
ATOM   522  C  C     . LEU A 1 70  ? 24.503  40.649  17.118  1.00 65.67  ? 69  LEU A C     1 
ATOM   523  O  O     . LEU A 1 70  ? 24.245  40.743  18.318  1.00 71.48  ? 69  LEU A O     1 
ATOM   524  C  CB    . LEU A 1 70  ? 26.959  40.227  17.083  1.00 68.82  ? 69  LEU A CB    1 
ATOM   525  C  CG    . LEU A 1 70  ? 26.821  38.740  16.754  1.00 59.33  ? 69  LEU A CG    1 
ATOM   526  C  CD1   . LEU A 1 70  ? 26.968  38.516  15.259  1.00 62.15  ? 69  LEU A CD1   1 
ATOM   527  C  CD2   . LEU A 1 70  ? 27.833  37.911  17.533  1.00 59.38  ? 69  LEU A CD2   1 
ATOM   528  N  N     . THR A 1 71  ? 23.652  40.141  16.233  1.00 63.55  ? 70  THR A N     1 
ATOM   529  C  CA    . THR A 1 71  ? 22.397  39.536  16.655  1.00 65.55  ? 70  THR A CA    1 
ATOM   530  C  C     . THR A 1 71  ? 22.633  38.061  16.958  1.00 74.08  ? 70  THR A C     1 
ATOM   531  O  O     . THR A 1 71  ? 23.110  37.311  16.106  1.00 71.50  ? 70  THR A O     1 
ATOM   532  C  CB    . THR A 1 71  ? 21.305  39.680  15.584  1.00 67.10  ? 70  THR A CB    1 
ATOM   533  O  OG1   . THR A 1 71  ? 21.044  41.069  15.350  1.00 72.22  ? 70  THR A OG1   1 
ATOM   534  C  CG2   . THR A 1 71  ? 20.023  39.003  16.039  1.00 68.83  ? 70  THR A CG2   1 
ATOM   535  N  N     . LEU A 1 72  ? 22.304  37.652  18.178  1.00 74.57  ? 71  LEU A N     1 
ATOM   536  C  CA    . LEU A 1 72  ? 22.615  36.305  18.637  1.00 63.71  ? 71  LEU A CA    1 
ATOM   537  C  C     . LEU A 1 72  ? 21.399  35.385  18.596  1.00 69.42  ? 71  LEU A C     1 
ATOM   538  O  O     . LEU A 1 72  ? 20.370  35.670  19.208  1.00 71.71  ? 71  LEU A O     1 
ATOM   539  C  CB    . LEU A 1 72  ? 23.190  36.352  20.051  1.00 63.70  ? 71  LEU A CB    1 
ATOM   540  C  CG    . LEU A 1 72  ? 23.898  35.089  20.535  1.00 69.75  ? 71  LEU A CG    1 
ATOM   541  C  CD1   . LEU A 1 72  ? 25.154  34.831  19.716  1.00 64.22  ? 71  LEU A CD1   1 
ATOM   542  C  CD2   . LEU A 1 72  ? 24.231  35.217  22.006  1.00 67.25  ? 71  LEU A CD2   1 
ATOM   543  N  N     . LEU A 1 73  ? 21.530  34.277  17.872  1.00 71.24  ? 72  LEU A N     1 
ATOM   544  C  CA    . LEU A 1 73  ? 20.448  33.308  17.735  1.00 68.17  ? 72  LEU A CA    1 
ATOM   545  C  C     . LEU A 1 73  ? 20.782  32.009  18.466  1.00 67.79  ? 72  LEU A C     1 
ATOM   546  O  O     . LEU A 1 73  ? 21.942  31.599  18.509  1.00 68.15  ? 72  LEU A O     1 
ATOM   547  C  CB    . LEU A 1 73  ? 20.160  33.034  16.255  1.00 67.98  ? 72  LEU A CB    1 
ATOM   548  C  CG    . LEU A 1 73  ? 19.126  33.926  15.559  1.00 73.42  ? 72  LEU A CG    1 
ATOM   549  C  CD1   . LEU A 1 73  ? 19.469  35.402  15.684  1.00 69.35  ? 72  LEU A CD1   1 
ATOM   550  C  CD2   . LEU A 1 73  ? 18.996  33.540  14.098  1.00 74.15  ? 72  LEU A CD2   1 
ATOM   551  N  N     . PRO A 1 74  ? 19.762  31.359  19.050  1.00 68.21  ? 73  PRO A N     1 
ATOM   552  C  CA    . PRO A 1 74  ? 19.959  30.139  19.842  1.00 67.84  ? 73  PRO A CA    1 
ATOM   553  C  C     . PRO A 1 74  ? 20.247  28.899  18.996  1.00 69.40  ? 73  PRO A C     1 
ATOM   554  O  O     . PRO A 1 74  ? 21.147  28.129  19.332  1.00 69.86  ? 73  PRO A O     1 
ATOM   555  C  CB    . PRO A 1 74  ? 18.625  29.983  20.577  1.00 65.27  ? 73  PRO A CB    1 
ATOM   556  C  CG    . PRO A 1 74  ? 17.632  30.649  19.692  1.00 66.30  ? 73  PRO A CG    1 
ATOM   557  C  CD    . PRO A 1 74  ? 18.355  31.800  19.054  1.00 69.79  ? 73  PRO A CD    1 
ATOM   558  N  N     . GLY A 1 75  ? 19.490  28.706  17.920  1.00 66.55  ? 74  GLY A N     1 
ATOM   559  C  CA    . GLY A 1 75  ? 19.676  27.551  17.061  1.00 73.67  ? 74  GLY A CA    1 
ATOM   560  C  C     . GLY A 1 75  ? 18.426  26.702  16.928  1.00 74.21  ? 74  GLY A C     1 
ATOM   561  O  O     . GLY A 1 75  ? 17.892  26.201  17.919  1.00 75.90  ? 74  GLY A O     1 
ATOM   562  N  N     . ARG A 1 76  ? 17.959  26.542  15.694  1.00 65.41  ? 75  ARG A N     1 
ATOM   563  C  CA    . ARG A 1 76  ? 16.791  25.719  15.411  1.00 70.85  ? 75  ARG A CA    1 
ATOM   564  C  C     . ARG A 1 76  ? 17.235  24.442  14.706  1.00 72.85  ? 75  ARG A C     1 
ATOM   565  O  O     . ARG A 1 76  ? 17.266  24.379  13.477  1.00 73.16  ? 75  ARG A O     1 
ATOM   566  C  CB    . ARG A 1 76  ? 15.793  26.496  14.550  1.00 73.70  ? 75  ARG A CB    1 
ATOM   567  C  CG    . ARG A 1 76  ? 15.507  27.898  15.071  1.00 71.80  ? 75  ARG A CG    1 
ATOM   568  C  CD    . ARG A 1 76  ? 14.414  28.601  14.279  1.00 70.57  ? 75  ARG A CD    1 
ATOM   569  N  NE    . ARG A 1 76  ? 14.748  28.741  12.865  1.00 74.09  ? 75  ARG A NE    1 
ATOM   570  C  CZ    . ARG A 1 76  ? 14.159  28.059  11.888  1.00 81.39  ? 75  ARG A CZ    1 
ATOM   571  N  NH1   . ARG A 1 76  ? 13.199  27.190  12.170  1.00 80.82  ? 75  ARG A NH1   1 
ATOM   572  N  NH2   . ARG A 1 76  ? 14.526  28.250  10.629  1.00 80.47  ? 75  ARG A NH2   1 
ATOM   573  N  N     . PHE A 1 77  ? 17.577  23.429  15.497  1.00 72.84  ? 76  PHE A N     1 
ATOM   574  C  CA    . PHE A 1 77  ? 18.218  22.219  14.982  1.00 75.88  ? 76  PHE A CA    1 
ATOM   575  C  C     . PHE A 1 77  ? 17.399  21.422  13.967  1.00 81.09  ? 76  PHE A C     1 
ATOM   576  O  O     . PHE A 1 77  ? 17.939  20.970  12.959  1.00 83.49  ? 76  PHE A O     1 
ATOM   577  C  CB    . PHE A 1 77  ? 18.658  21.304  16.128  1.00 76.44  ? 76  PHE A CB    1 
ATOM   578  C  CG    . PHE A 1 77  ? 19.022  19.916  15.683  1.00 85.98  ? 76  PHE A CG    1 
ATOM   579  C  CD1   . PHE A 1 77  ? 18.230  18.833  16.031  1.00 88.65  ? 76  PHE A CD1   1 
ATOM   580  C  CD2   . PHE A 1 77  ? 20.144  19.695  14.901  1.00 85.00  ? 76  PHE A CD2   1 
ATOM   581  C  CE1   . PHE A 1 77  ? 18.558  17.555  15.618  1.00 83.79  ? 76  PHE A CE1   1 
ATOM   582  C  CE2   . PHE A 1 77  ? 20.477  18.418  14.484  1.00 86.28  ? 76  PHE A CE2   1 
ATOM   583  C  CZ    . PHE A 1 77  ? 19.682  17.347  14.844  1.00 82.64  ? 76  PHE A CZ    1 
ATOM   584  N  N     . ASP A 1 78  ? 16.110  21.237  14.235  1.00 78.72  ? 77  ASP A N     1 
ATOM   585  C  CA    . ASP A 1 78  ? 15.258  20.460  13.337  1.00 78.48  ? 77  ASP A CA    1 
ATOM   586  C  C     . ASP A 1 78  ? 15.190  21.099  11.952  1.00 76.52  ? 77  ASP A C     1 
ATOM   587  O  O     . ASP A 1 78  ? 15.120  20.406  10.931  1.00 79.97  ? 77  ASP A O     1 
ATOM   588  C  CB    . ASP A 1 78  ? 13.858  20.293  13.931  1.00 78.03  ? 77  ASP A CB    1 
ATOM   589  C  CG    . ASP A 1 78  ? 13.840  19.346  15.115  1.00 79.82  ? 77  ASP A CG    1 
ATOM   590  O  OD1   . ASP A 1 78  ? 14.477  18.276  15.029  1.00 78.75  ? 77  ASP A OD1   1 
ATOM   591  O  OD2   . ASP A 1 78  ? 13.194  19.671  16.133  1.00 82.25  ? 77  ASP A OD2   1 
ATOM   592  N  N     . ALA A 1 79  ? 15.235  22.428  11.931  1.00 71.64  ? 78  ALA A N     1 
ATOM   593  C  CA    . ALA A 1 79  ? 15.259  23.184  10.686  1.00 76.52  ? 78  ALA A CA    1 
ATOM   594  C  C     . ALA A 1 79  ? 16.558  22.943  9.919   1.00 75.60  ? 78  ALA A C     1 
ATOM   595  O  O     . ALA A 1 79  ? 16.636  23.200  8.719   1.00 80.35  ? 78  ALA A O     1 
ATOM   596  C  CB    . ALA A 1 79  ? 15.075  24.666  10.965  1.00 76.44  ? 78  ALA A CB    1 
ATOM   597  N  N     . TYR A 1 80  ? 17.576  22.454  10.620  1.00 74.93  ? 79  TYR A N     1 
ATOM   598  C  CA    . TYR A 1 80  ? 18.848  22.122  9.991   1.00 72.70  ? 79  TYR A CA    1 
ATOM   599  C  C     . TYR A 1 80  ? 18.830  20.664  9.544   1.00 75.46  ? 79  TYR A C     1 
ATOM   600  O  O     . TYR A 1 80  ? 19.435  20.301  8.532   1.00 79.58  ? 79  TYR A O     1 
ATOM   601  C  CB    . TYR A 1 80  ? 20.008  22.350  10.963  1.00 72.12  ? 79  TYR A CB    1 
ATOM   602  C  CG    . TYR A 1 80  ? 20.037  23.723  11.602  1.00 66.97  ? 79  TYR A CG    1 
ATOM   603  C  CD1   . TYR A 1 80  ? 20.536  23.899  12.886  1.00 69.85  ? 79  TYR A CD1   1 
ATOM   604  C  CD2   . TYR A 1 80  ? 19.575  24.842  10.921  1.00 73.70  ? 79  TYR A CD2   1 
ATOM   605  C  CE1   . TYR A 1 80  ? 20.569  25.147  13.477  1.00 72.30  ? 79  TYR A CE1   1 
ATOM   606  C  CE2   . TYR A 1 80  ? 19.603  26.096  11.505  1.00 73.51  ? 79  TYR A CE2   1 
ATOM   607  C  CZ    . TYR A 1 80  ? 20.102  26.242  12.783  1.00 71.71  ? 79  TYR A CZ    1 
ATOM   608  O  OH    . TYR A 1 80  ? 20.134  27.486  13.370  1.00 71.15  ? 79  TYR A OH    1 
ATOM   609  N  N     . LYS A 1 81  ? 18.127  19.835  10.308  1.00 76.47  ? 80  LYS A N     1 
ATOM   610  C  CA    . LYS A 1 81  ? 18.036  18.409  10.023  1.00 72.28  ? 80  LYS A CA    1 
ATOM   611  C  C     . LYS A 1 81  ? 17.206  18.154  8.770   1.00 71.92  ? 80  LYS A C     1 
ATOM   612  O  O     . LYS A 1 81  ? 17.536  17.276  7.969   1.00 70.56  ? 80  LYS A O     1 
ATOM   613  C  CB    . LYS A 1 81  ? 17.446  17.656  11.218  1.00 73.70  ? 80  LYS A CB    1 
ATOM   614  C  CG    . LYS A 1 81  ? 17.519  16.143  11.095  1.00 71.72  ? 80  LYS A CG    1 
ATOM   615  C  CD    . LYS A 1 81  ? 18.951  15.676  10.887  1.00 70.41  ? 80  LYS A CD    1 
ATOM   616  C  CE    . LYS A 1 81  ? 19.030  14.163  10.767  1.00 67.86  ? 80  LYS A CE    1 
ATOM   617  N  NZ    . LYS A 1 81  ? 20.414  13.701  10.466  1.00 67.59  ? 80  LYS A NZ    1 
ATOM   618  N  N     . GLU A 1 82  ? 16.132  18.921  8.599   1.00 72.19  ? 81  GLU A N     1 
ATOM   619  C  CA    . GLU A 1 82  ? 15.321  18.808  7.389   1.00 76.64  ? 81  GLU A CA    1 
ATOM   620  C  C     . GLU A 1 82  ? 16.143  19.151  6.145   1.00 72.25  ? 81  GLU A C     1 
ATOM   621  O  O     . GLU A 1 82  ? 16.085  18.445  5.135   1.00 69.30  ? 81  GLU A O     1 
ATOM   622  C  CB    . GLU A 1 82  ? 14.069  19.690  7.470   1.00 81.45  ? 81  GLU A CB    1 
ATOM   623  C  CG    . GLU A 1 82  ? 14.344  21.148  7.804   1.00 84.96  ? 81  GLU A CG    1 
ATOM   624  C  CD    . GLU A 1 82  ? 13.317  22.090  7.205   1.00 92.46  ? 81  GLU A CD    1 
ATOM   625  O  OE1   . GLU A 1 82  ? 12.159  22.091  7.674   1.00 91.55  ? 81  GLU A OE1   1 
ATOM   626  O  OE2   . GLU A 1 82  ? 13.671  22.828  6.262   1.00 87.42  ? 81  GLU A OE2   1 
ATOM   627  N  N     . ALA A 1 83  ? 16.920  20.227  6.236   1.00 72.48  ? 82  ALA A N     1 
ATOM   628  C  CA    . ALA A 1 83  ? 17.774  20.661  5.137   1.00 69.34  ? 82  ALA A CA    1 
ATOM   629  C  C     . ALA A 1 83  ? 18.840  19.616  4.832   1.00 68.58  ? 82  ALA A C     1 
ATOM   630  O  O     . ALA A 1 83  ? 19.105  19.309  3.669   1.00 70.22  ? 82  ALA A O     1 
ATOM   631  C  CB    . ALA A 1 83  ? 18.419  21.998  5.466   1.00 60.13  ? 82  ALA A CB    1 
ATOM   632  N  N     . SER A 1 84  ? 19.444  19.072  5.886   1.00 66.51  ? 83  SER A N     1 
ATOM   633  C  CA    . SER A 1 84  ? 20.463  18.037  5.747   1.00 66.98  ? 83  SER A CA    1 
ATOM   634  C  C     . SER A 1 84  ? 19.913  16.805  5.031   1.00 70.97  ? 83  SER A C     1 
ATOM   635  O  O     . SER A 1 84  ? 20.497  16.324  4.052   1.00 72.94  ? 83  SER A O     1 
ATOM   636  C  CB    . SER A 1 84  ? 21.009  17.645  7.120   1.00 63.76  ? 83  SER A CB    1 
ATOM   637  O  OG    . SER A 1 84  ? 21.917  16.563  7.019   1.00 67.65  ? 83  SER A OG    1 
ATOM   638  N  N     . ASN A 1 85  ? 18.787  16.297  5.525   1.00 67.10  ? 84  ASN A N     1 
ATOM   639  C  CA    . ASN A 1 85  ? 18.123  15.161  4.895   1.00 73.10  ? 84  ASN A CA    1 
ATOM   640  C  C     . ASN A 1 85  ? 17.782  15.446  3.430   1.00 70.31  ? 84  ASN A C     1 
ATOM   641  O  O     . ASN A 1 85  ? 17.991  14.602  2.553   1.00 68.22  ? 84  ASN A O     1 
ATOM   642  C  CB    . ASN A 1 85  ? 16.857  14.777  5.669   1.00 72.75  ? 84  ASN A CB    1 
ATOM   643  C  CG    . ASN A 1 85  ? 17.146  14.359  7.102   1.00 72.57  ? 84  ASN A CG    1 
ATOM   644  O  OD1   . ASN A 1 85  ? 18.243  13.900  7.419   1.00 68.41  ? 84  ASN A OD1   1 
ATOM   645  N  ND2   . ASN A 1 85  ? 16.153  14.509  7.973   1.00 68.94  ? 84  ASN A ND2   1 
ATOM   646  N  N     . HIS A 1 86  ? 17.269  16.646  3.169   1.00 68.48  ? 85  HIS A N     1 
ATOM   647  C  CA    . HIS A 1 86  ? 16.910  17.048  1.812   1.00 67.14  ? 85  HIS A CA    1 
ATOM   648  C  C     . HIS A 1 86  ? 18.118  17.008  0.871   1.00 72.99  ? 85  HIS A C     1 
ATOM   649  O  O     . HIS A 1 86  ? 18.077  16.348  -0.178  1.00 71.15  ? 85  HIS A O     1 
ATOM   650  C  CB    . HIS A 1 86  ? 16.281  18.445  1.818   1.00 67.28  ? 85  HIS A CB    1 
ATOM   651  C  CG    . HIS A 1 86  ? 15.618  18.821  0.530   1.00 72.64  ? 85  HIS A CG    1 
ATOM   652  N  ND1   . HIS A 1 86  ? 14.751  19.891  0.423   1.00 72.31  ? 85  HIS A ND1   1 
ATOM   653  C  CD2   . HIS A 1 86  ? 15.697  18.281  -0.711  1.00 71.19  ? 85  HIS A CD2   1 
ATOM   654  C  CE1   . HIS A 1 86  ? 14.327  19.989  -0.820  1.00 70.48  ? 85  HIS A CE1   1 
ATOM   655  N  NE2   . HIS A 1 86  ? 14.884  19.026  -1.532  1.00 75.07  ? 85  HIS A NE2   1 
ATOM   656  N  N     . ILE A 1 87  ? 19.190  17.704  1.248   1.00 69.39  ? 86  ILE A N     1 
ATOM   657  C  CA    . ILE A 1 87  ? 20.384  17.749  0.410   1.00 68.36  ? 86  ILE A CA    1 
ATOM   658  C  C     . ILE A 1 87  ? 21.005  16.366  0.241   1.00 66.78  ? 86  ILE A C     1 
ATOM   659  O  O     . ILE A 1 87  ? 21.622  16.087  -0.786  1.00 64.80  ? 86  ILE A O     1 
ATOM   660  C  CB    . ILE A 1 87  ? 21.453  18.742  0.930   1.00 73.32  ? 86  ILE A CB    1 
ATOM   661  C  CG1   . ILE A 1 87  ? 22.055  18.262  2.253   1.00 72.76  ? 86  ILE A CG1   1 
ATOM   662  C  CG2   . ILE A 1 87  ? 20.869  20.135  1.064   1.00 71.27  ? 86  ILE A CG2   1 
ATOM   663  C  CD1   . ILE A 1 87  ? 23.202  19.108  2.753   1.00 69.59  ? 86  ILE A CD1   1 
ATOM   664  N  N     . ARG A 1 88  ? 20.837  15.501  1.239   1.00 67.94  ? 87  ARG A N     1 
ATOM   665  C  CA    . ARG A 1 88  ? 21.304  14.123  1.114   1.00 71.23  ? 87  ARG A CA    1 
ATOM   666  C  C     . ARG A 1 88  ? 20.470  13.338  0.101   1.00 71.40  ? 87  ARG A C     1 
ATOM   667  O  O     . ARG A 1 88  ? 20.998  12.478  -0.612  1.00 67.96  ? 87  ARG A O     1 
ATOM   668  C  CB    . ARG A 1 88  ? 21.316  13.418  2.472   1.00 67.41  ? 87  ARG A CB    1 
ATOM   669  C  CG    . ARG A 1 88  ? 22.421  13.894  3.402   1.00 69.12  ? 87  ARG A CG    1 
ATOM   670  C  CD    . ARG A 1 88  ? 22.390  13.156  4.729   1.00 71.44  ? 87  ARG A CD    1 
ATOM   671  N  NE    . ARG A 1 88  ? 23.412  13.652  5.646   1.00 70.97  ? 87  ARG A NE    1 
ATOM   672  C  CZ    . ARG A 1 88  ? 23.630  13.160  6.861   1.00 70.71  ? 87  ARG A CZ    1 
ATOM   673  N  NH1   . ARG A 1 88  ? 22.902  12.151  7.317   1.00 69.51  ? 87  ARG A NH1   1 
ATOM   674  N  NH2   . ARG A 1 88  ? 24.580  13.677  7.623   1.00 66.92  ? 87  ARG A NH2   1 
ATOM   675  N  N     . GLU A 1 89  ? 19.174  13.632  0.039   1.00 71.33  ? 88  GLU A N     1 
ATOM   676  C  CA    . GLU A 1 89  ? 18.326  13.027  -0.983  1.00 69.27  ? 88  GLU A CA    1 
ATOM   677  C  C     . GLU A 1 89  ? 18.779  13.498  -2.366  1.00 67.90  ? 88  GLU A C     1 
ATOM   678  O  O     . GLU A 1 89  ? 18.894  12.700  -3.313  1.00 65.97  ? 88  GLU A O     1 
ATOM   679  C  CB    . GLU A 1 89  ? 16.858  13.372  -0.737  1.00 71.93  ? 88  GLU A CB    1 
ATOM   680  C  CG    . GLU A 1 89  ? 15.926  12.995  -1.872  1.00 71.28  ? 88  GLU A CG    1 
ATOM   681  C  CD    . GLU A 1 89  ? 15.475  14.196  -2.677  1.00 73.98  ? 88  GLU A CD    1 
ATOM   682  O  OE1   . GLU A 1 89  ? 15.463  15.316  -2.123  1.00 71.23  ? 88  GLU A OE1   1 
ATOM   683  O  OE2   . GLU A 1 89  ? 15.132  14.019  -3.865  1.00 74.35  ? 88  GLU A OE2   1 
ATOM   684  N  N     . ILE A 1 90  ? 19.063  14.795  -2.462  1.00 67.91  ? 89  ILE A N     1 
ATOM   685  C  CA    . ILE A 1 90  ? 19.588  15.380  -3.690  1.00 66.21  ? 89  ILE A CA    1 
ATOM   686  C  C     . ILE A 1 90  ? 20.883  14.688  -4.109  1.00 67.60  ? 89  ILE A C     1 
ATOM   687  O  O     . ILE A 1 90  ? 21.100  14.429  -5.292  1.00 64.31  ? 89  ILE A O     1 
ATOM   688  C  CB    . ILE A 1 90  ? 19.820  16.899  -3.545  1.00 62.23  ? 89  ILE A CB    1 
ATOM   689  C  CG1   . ILE A 1 90  ? 18.498  17.606  -3.240  1.00 65.97  ? 89  ILE A CG1   1 
ATOM   690  C  CG2   . ILE A 1 90  ? 20.455  17.473  -4.804  1.00 63.80  ? 89  ILE A CG2   1 
ATOM   691  C  CD1   . ILE A 1 90  ? 18.568  19.112  -3.342  1.00 64.68  ? 89  ILE A CD1   1 
ATOM   692  N  N     . PHE A 1 91  ? 21.729  14.372  -3.132  1.00 69.43  ? 90  PHE A N     1 
ATOM   693  C  CA    . PHE A 1 91  ? 22.964  13.644  -3.401  1.00 68.87  ? 90  PHE A CA    1 
ATOM   694  C  C     . PHE A 1 91  ? 22.650  12.243  -3.912  1.00 69.72  ? 90  PHE A C     1 
ATOM   695  O  O     . PHE A 1 91  ? 23.300  11.750  -4.834  1.00 69.79  ? 90  PHE A O     1 
ATOM   696  C  CB    . PHE A 1 91  ? 23.827  13.542  -2.142  1.00 67.79  ? 90  PHE A CB    1 
ATOM   697  C  CG    . PHE A 1 91  ? 24.277  14.867  -1.599  1.00 65.71  ? 90  PHE A CG    1 
ATOM   698  C  CD1   . PHE A 1 91  ? 24.312  15.992  -2.406  1.00 65.15  ? 90  PHE A CD1   1 
ATOM   699  C  CD2   . PHE A 1 91  ? 24.671  14.984  -0.277  1.00 66.76  ? 90  PHE A CD2   1 
ATOM   700  C  CE1   . PHE A 1 91  ? 24.726  17.210  -1.901  1.00 64.94  ? 90  PHE A CE1   1 
ATOM   701  C  CE2   . PHE A 1 91  ? 25.087  16.198  0.232   1.00 63.58  ? 90  PHE A CE2   1 
ATOM   702  C  CZ    . PHE A 1 91  ? 25.115  17.312  -0.581  1.00 70.21  ? 90  PHE A CZ    1 
ATOM   703  N  N     . SER A 1 92  ? 21.648  11.606  -3.310  1.00 69.73  ? 91  SER A N     1 
ATOM   704  C  CA    . SER A 1 92  ? 21.273  10.247  -3.692  1.00 65.76  ? 91  SER A CA    1 
ATOM   705  C  C     . SER A 1 92  ? 20.709  10.184  -5.109  1.00 65.59  ? 91  SER A C     1 
ATOM   706  O  O     . SER A 1 92  ? 20.753  9.134   -5.750  1.00 67.48  ? 91  SER A O     1 
ATOM   707  C  CB    . SER A 1 92  ? 20.296  9.632   -2.681  1.00 66.00  ? 91  SER A CB    1 
ATOM   708  O  OG    . SER A 1 92  ? 19.067  10.338  -2.641  1.00 63.01  ? 91  SER A OG    1 
ATOM   709  N  N     . ARG A 1 93  ? 20.189  11.306  -5.599  1.00 67.31  ? 92  ARG A N     1 
ATOM   710  C  CA    . ARG A 1 93  ? 19.733  11.373  -6.989  1.00 68.11  ? 92  ARG A CA    1 
ATOM   711  C  C     . ARG A 1 93  ? 20.858  11.123  -7.996  1.00 64.91  ? 92  ARG A C     1 
ATOM   712  O  O     . ARG A 1 93  ? 20.601  10.721  -9.130  1.00 65.56  ? 92  ARG A O     1 
ATOM   713  C  CB    . ARG A 1 93  ? 19.094  12.727  -7.291  1.00 62.84  ? 92  ARG A CB    1 
ATOM   714  C  CG    . ARG A 1 93  ? 17.856  13.040  -6.485  1.00 59.29  ? 92  ARG A CG    1 
ATOM   715  C  CD    . ARG A 1 93  ? 17.268  14.362  -6.933  1.00 60.61  ? 92  ARG A CD    1 
ATOM   716  N  NE    . ARG A 1 93  ? 16.306  14.887  -5.972  1.00 62.27  ? 92  ARG A NE    1 
ATOM   717  C  CZ    . ARG A 1 93  ? 15.750  16.089  -6.059  1.00 63.19  ? 92  ARG A CZ    1 
ATOM   718  N  NH1   . ARG A 1 93  ? 16.061  16.894  -7.066  1.00 57.32  ? 92  ARG A NH1   1 
ATOM   719  N  NH2   . ARG A 1 93  ? 14.884  16.487  -5.138  1.00 69.76  ? 92  ARG A NH2   1 
ATOM   720  N  N     . TYR A 1 94  ? 22.099  11.366  -7.585  1.00 68.46  ? 93  TYR A N     1 
ATOM   721  C  CA    . TYR A 1 94  ? 23.233  11.296  -8.505  1.00 67.16  ? 93  TYR A CA    1 
ATOM   722  C  C     . TYR A 1 94  ? 24.099  10.048  -8.324  1.00 68.48  ? 93  TYR A C     1 
ATOM   723  O  O     . TYR A 1 94  ? 24.734  9.587   -9.274  1.00 70.83  ? 93  TYR A O     1 
ATOM   724  C  CB    . TYR A 1 94  ? 24.081  12.569  -8.409  1.00 64.10  ? 93  TYR A CB    1 
ATOM   725  C  CG    . TYR A 1 94  ? 23.420  13.771  -9.045  1.00 68.04  ? 93  TYR A CG    1 
ATOM   726  C  CD1   . TYR A 1 94  ? 23.816  14.224  -10.296 1.00 71.13  ? 93  TYR A CD1   1 
ATOM   727  C  CD2   . TYR A 1 94  ? 22.387  14.443  -8.402  1.00 68.53  ? 93  TYR A CD2   1 
ATOM   728  C  CE1   . TYR A 1 94  ? 23.209  15.317  -10.886 1.00 72.06  ? 93  TYR A CE1   1 
ATOM   729  C  CE2   . TYR A 1 94  ? 21.774  15.537  -8.985  1.00 70.76  ? 93  TYR A CE2   1 
ATOM   730  C  CZ    . TYR A 1 94  ? 22.189  15.969  -10.227 1.00 69.85  ? 93  TYR A CZ    1 
ATOM   731  O  OH    . TYR A 1 94  ? 21.582  17.057  -10.811 1.00 67.22  ? 93  TYR A OH    1 
ATOM   732  N  N     . THR A 1 95  ? 24.117  9.506   -7.110  1.00 69.64  ? 94  THR A N     1 
ATOM   733  C  CA    . THR A 1 95  ? 24.860  8.280   -6.828  1.00 69.74  ? 94  THR A CA    1 
ATOM   734  C  C     . THR A 1 95  ? 24.470  7.670   -5.486  1.00 70.70  ? 94  THR A C     1 
ATOM   735  O  O     . THR A 1 95  ? 23.786  8.301   -4.680  1.00 70.34  ? 94  THR A O     1 
ATOM   736  C  CB    . THR A 1 95  ? 26.385  8.515   -6.837  1.00 66.06  ? 94  THR A CB    1 
ATOM   737  O  OG1   . THR A 1 95  ? 27.056  7.321   -6.414  1.00 70.62  ? 94  THR A OG1   1 
ATOM   738  C  CG2   . THR A 1 95  ? 26.754  9.653   -5.901  1.00 65.14  ? 94  THR A CG2   1 
ATOM   739  N  N     . SER A 1 96  ? 24.910  6.437   -5.257  1.00 73.61  ? 95  SER A N     1 
ATOM   740  C  CA    . SER A 1 96  ? 24.698  5.769   -3.980  1.00 72.25  ? 95  SER A CA    1 
ATOM   741  C  C     . SER A 1 96  ? 25.940  5.921   -3.111  1.00 72.03  ? 95  SER A C     1 
ATOM   742  O  O     . SER A 1 96  ? 25.868  5.850   -1.884  1.00 72.02  ? 95  SER A O     1 
ATOM   743  C  CB    . SER A 1 96  ? 24.378  4.288   -4.192  1.00 72.82  ? 95  SER A CB    1 
ATOM   744  O  OG    . SER A 1 96  ? 25.451  3.620   -4.834  1.00 71.18  ? 95  SER A OG    1 
ATOM   745  N  N     . ARG A 1 97  ? 27.080  6.131   -3.762  1.00 69.71  ? 96  ARG A N     1 
ATOM   746  C  CA    . ARG A 1 97  ? 28.343  6.346   -3.066  1.00 68.62  ? 96  ARG A CA    1 
ATOM   747  C  C     . ARG A 1 97  ? 28.324  7.702   -2.367  1.00 69.16  ? 96  ARG A C     1 
ATOM   748  O  O     . ARG A 1 97  ? 28.699  8.718   -2.953  1.00 68.42  ? 96  ARG A O     1 
ATOM   749  C  CB    . ARG A 1 97  ? 29.507  6.284   -4.056  1.00 67.79  ? 96  ARG A CB    1 
ATOM   750  C  CG    . ARG A 1 97  ? 29.496  5.057   -4.957  1.00 67.37  ? 96  ARG A CG    1 
ATOM   751  C  CD    . ARG A 1 97  ? 30.156  3.853   -4.298  1.00 65.07  ? 96  ARG A CD    1 
ATOM   752  N  NE    . ARG A 1 97  ? 31.611  3.890   -4.420  1.00 63.73  ? 96  ARG A NE    1 
ATOM   753  C  CZ    . ARG A 1 97  ? 32.447  4.010   -3.394  1.00 69.12  ? 96  ARG A CZ    1 
ATOM   754  N  NH1   . ARG A 1 97  ? 31.975  4.097   -2.159  1.00 69.61  ? 96  ARG A NH1   1 
ATOM   755  N  NH2   . ARG A 1 97  ? 33.757  4.036   -3.603  1.00 67.97  ? 96  ARG A NH2   1 
ATOM   756  N  N     . ILE A 1 98  ? 27.877  7.713   -1.115  1.00 65.04  ? 97  ILE A N     1 
ATOM   757  C  CA    . ILE A 1 98  ? 27.725  8.954   -0.362  1.00 62.95  ? 97  ILE A CA    1 
ATOM   758  C  C     . ILE A 1 98  ? 28.244  8.822   1.064   1.00 64.04  ? 97  ILE A C     1 
ATOM   759  O  O     . ILE A 1 98  ? 27.761  7.993   1.833   1.00 66.09  ? 97  ILE A O     1 
ATOM   760  C  CB    . ILE A 1 98  ? 26.248  9.384   -0.288  1.00 59.34  ? 97  ILE A CB    1 
ATOM   761  C  CG1   . ILE A 1 98  ? 25.690  9.641   -1.687  1.00 64.10  ? 97  ILE A CG1   1 
ATOM   762  C  CG2   . ILE A 1 98  ? 26.093  10.621  0.585   1.00 58.84  ? 97  ILE A CG2   1 
ATOM   763  C  CD1   . ILE A 1 98  ? 24.218  9.945   -1.697  1.00 66.99  ? 97  ILE A CD1   1 
ATOM   764  N  N     . GLU A 1 99  ? 29.222  9.649   1.420   1.00 64.38  ? 98  GLU A N     1 
ATOM   765  C  CA    . GLU A 1 99  ? 29.726  9.677   2.788   1.00 60.49  ? 98  GLU A CA    1 
ATOM   766  C  C     . GLU A 1 99  ? 29.476  11.030  3.445   1.00 59.33  ? 98  GLU A C     1 
ATOM   767  O  O     . GLU A 1 99  ? 30.259  11.963  3.271   1.00 61.84  ? 98  GLU A O     1 
ATOM   768  C  CB    . GLU A 1 99  ? 31.217  9.335   2.834   1.00 55.04  ? 98  GLU A CB    1 
ATOM   769  C  CG    . GLU A 1 99  ? 31.798  9.322   4.240   1.00 52.73  ? 98  GLU A CG    1 
ATOM   770  C  CD    . GLU A 1 99  ? 33.233  8.837   4.276   1.00 55.80  ? 98  GLU A CD    1 
ATOM   771  O  OE1   . GLU A 1 99  ? 33.777  8.507   3.202   1.00 56.33  ? 98  GLU A OE1   1 
ATOM   772  O  OE2   . GLU A 1 99  ? 33.816  8.784   5.380   1.00 56.80  ? 98  GLU A OE2   1 
ATOM   773  N  N     . PRO A 1 100 ? 28.370  11.142  4.195   1.00 61.24  ? 99  PRO A N     1 
ATOM   774  C  CA    . PRO A 1 100 ? 28.067  12.359  4.955   1.00 60.30  ? 99  PRO A CA    1 
ATOM   775  C  C     . PRO A 1 100 ? 29.060  12.548  6.095   1.00 59.82  ? 99  PRO A C     1 
ATOM   776  O  O     . PRO A 1 100 ? 29.309  11.610  6.852   1.00 60.58  ? 99  PRO A O     1 
ATOM   777  C  CB    . PRO A 1 100 ? 26.670  12.079  5.520   1.00 53.35  ? 99  PRO A CB    1 
ATOM   778  C  CG    . PRO A 1 100 ? 26.103  11.009  4.646   1.00 51.41  ? 99  PRO A CG    1 
ATOM   779  C  CD    . PRO A 1 100 ? 27.273  10.163  4.264   1.00 57.74  ? 99  PRO A CD    1 
ATOM   780  N  N     . LEU A 1 101 ? 29.622  13.746  6.211   1.00 61.73  ? 100 LEU A N     1 
ATOM   781  C  CA    . LEU A 1 101 ? 30.586  14.038  7.264   1.00 59.37  ? 100 LEU A CA    1 
ATOM   782  C  C     . LEU A 1 101 ? 29.921  14.803  8.401   1.00 59.44  ? 100 LEU A C     1 
ATOM   783  O  O     . LEU A 1 101 ? 30.415  14.822  9.528   1.00 61.85  ? 100 LEU A O     1 
ATOM   784  C  CB    . LEU A 1 101 ? 31.760  14.839  6.702   1.00 57.30  ? 100 LEU A CB    1 
ATOM   785  C  CG    . LEU A 1 101 ? 32.504  14.177  5.542   1.00 58.19  ? 100 LEU A CG    1 
ATOM   786  C  CD1   . LEU A 1 101 ? 33.568  15.109  4.993   1.00 56.22  ? 100 LEU A CD1   1 
ATOM   787  C  CD2   . LEU A 1 101 ? 33.115  12.853  5.979   1.00 59.42  ? 100 LEU A CD2   1 
ATOM   788  N  N     . SER A 1 102 ? 28.795  15.435  8.089   1.00 59.83  ? 101 SER A N     1 
ATOM   789  C  CA    . SER A 1 102 ? 28.005  16.149  9.080   1.00 57.05  ? 101 SER A CA    1 
ATOM   790  C  C     . SER A 1 102 ? 26.601  16.338  8.533   1.00 59.17  ? 101 SER A C     1 
ATOM   791  O  O     . SER A 1 102 ? 26.084  15.483  7.817   1.00 68.50  ? 101 SER A O     1 
ATOM   792  C  CB    . SER A 1 102 ? 28.627  17.512  9.391   1.00 61.68  ? 101 SER A CB    1 
ATOM   793  O  OG    . SER A 1 102 ? 28.418  18.422  8.324   1.00 63.12  ? 101 SER A OG    1 
ATOM   794  N  N     . LEU A 1 103 ? 25.989  17.467  8.866   1.00 53.07  ? 102 LEU A N     1 
ATOM   795  C  CA    . LEU A 1 103 ? 24.685  17.803  8.321   1.00 61.36  ? 102 LEU A CA    1 
ATOM   796  C  C     . LEU A 1 103 ? 24.855  18.459  6.961   1.00 65.78  ? 102 LEU A C     1 
ATOM   797  O  O     . LEU A 1 103 ? 24.084  18.208  6.036   1.00 68.15  ? 102 LEU A O     1 
ATOM   798  C  CB    . LEU A 1 103 ? 23.950  18.764  9.253   1.00 63.75  ? 102 LEU A CB    1 
ATOM   799  C  CG    . LEU A 1 103 ? 23.713  18.324  10.695  1.00 59.87  ? 102 LEU A CG    1 
ATOM   800  C  CD1   . LEU A 1 103 ? 23.259  19.512  11.523  1.00 63.06  ? 102 LEU A CD1   1 
ATOM   801  C  CD2   . LEU A 1 103 ? 22.687  17.207  10.753  1.00 60.48  ? 102 LEU A CD2   1 
ATOM   802  N  N     . ASP A 1 104 ? 25.881  19.297  6.846   1.00 63.89  ? 103 ASP A N     1 
ATOM   803  C  CA    . ASP A 1 104 ? 26.047  20.141  5.670   1.00 61.71  ? 103 ASP A CA    1 
ATOM   804  C  C     . ASP A 1 104 ? 27.213  19.718  4.778   1.00 58.16  ? 103 ASP A C     1 
ATOM   805  O  O     . ASP A 1 104 ? 27.620  20.465  3.887   1.00 59.75  ? 103 ASP A O     1 
ATOM   806  C  CB    . ASP A 1 104 ? 26.215  21.603  6.096   1.00 62.49  ? 103 ASP A CB    1 
ATOM   807  C  CG    . ASP A 1 104 ? 27.633  21.933  6.526   1.00 60.12  ? 103 ASP A CG    1 
ATOM   808  O  OD1   . ASP A 1 104 ? 28.266  21.094  7.198   1.00 58.52  ? 103 ASP A OD1   1 
ATOM   809  O  OD2   . ASP A 1 104 ? 28.115  23.033  6.184   1.00 59.90  ? 103 ASP A OD2   1 
ATOM   810  N  N     . GLU A 1 105 ? 27.749  18.525  5.013   1.00 53.69  ? 104 GLU A N     1 
ATOM   811  C  CA    . GLU A 1 105 ? 28.889  18.048  4.235   1.00 54.37  ? 104 GLU A CA    1 
ATOM   812  C  C     . GLU A 1 105 ? 28.736  16.606  3.770   1.00 59.34  ? 104 GLU A C     1 
ATOM   813  O  O     . GLU A 1 105 ? 28.144  15.779  4.464   1.00 59.98  ? 104 GLU A O     1 
ATOM   814  C  CB    . GLU A 1 105 ? 30.184  18.185  5.034   1.00 54.25  ? 104 GLU A CB    1 
ATOM   815  C  CG    . GLU A 1 105 ? 30.573  19.612  5.358   1.00 57.99  ? 104 GLU A CG    1 
ATOM   816  C  CD    . GLU A 1 105 ? 31.943  19.699  5.990   1.00 55.92  ? 104 GLU A CD    1 
ATOM   817  O  OE1   . GLU A 1 105 ? 32.738  18.755  5.805   1.00 58.96  ? 104 GLU A OE1   1 
ATOM   818  O  OE2   . GLU A 1 105 ? 32.223  20.706  6.672   1.00 58.27  ? 104 GLU A OE2   1 
ATOM   819  N  N     . ALA A 1 106 ? 29.286  16.313  2.595   1.00 58.11  ? 105 ALA A N     1 
ATOM   820  C  CA    . ALA A 1 106 ? 29.292  14.954  2.066   1.00 55.70  ? 105 ALA A CA    1 
ATOM   821  C  C     . ALA A 1 106 ? 30.324  14.755  0.956   1.00 60.35  ? 105 ALA A C     1 
ATOM   822  O  O     . ALA A 1 106 ? 30.521  15.628  0.104   1.00 62.08  ? 105 ALA A O     1 
ATOM   823  C  CB    . ALA A 1 106 ? 27.904  14.568  1.571   1.00 61.95  ? 105 ALA A CB    1 
ATOM   824  N  N     . TYR A 1 107 ? 30.982  13.600  0.991   1.00 60.12  ? 106 TYR A N     1 
ATOM   825  C  CA    . TYR A 1 107 ? 31.838  13.141  -0.095  1.00 63.24  ? 106 TYR A CA    1 
ATOM   826  C  C     . TYR A 1 107 ? 31.006  12.293  -1.048  1.00 62.85  ? 106 TYR A C     1 
ATOM   827  O  O     . TYR A 1 107 ? 30.176  11.491  -0.612  1.00 63.88  ? 106 TYR A O     1 
ATOM   828  C  CB    . TYR A 1 107 ? 32.980  12.282  0.449   1.00 67.63  ? 106 TYR A CB    1 
ATOM   829  C  CG    . TYR A 1 107 ? 34.143  13.046  1.049   1.00 65.88  ? 106 TYR A CG    1 
ATOM   830  C  CD1   . TYR A 1 107 ? 34.674  12.679  2.279   1.00 60.84  ? 106 TYR A CD1   1 
ATOM   831  C  CD2   . TYR A 1 107 ? 34.731  14.108  0.373   1.00 62.70  ? 106 TYR A CD2   1 
ATOM   832  C  CE1   . TYR A 1 107 ? 35.742  13.359  2.829   1.00 60.10  ? 106 TYR A CE1   1 
ATOM   833  C  CE2   . TYR A 1 107 ? 35.803  14.794  0.916   1.00 60.91  ? 106 TYR A CE2   1 
ATOM   834  C  CZ    . TYR A 1 107 ? 36.302  14.415  2.145   1.00 59.66  ? 106 TYR A CZ    1 
ATOM   835  O  OH    . TYR A 1 107 ? 37.367  15.092  2.695   1.00 57.31  ? 106 TYR A OH    1 
ATOM   836  N  N     . LEU A 1 108 ? 31.235  12.462  -2.345  1.00 64.75  ? 107 LEU A N     1 
ATOM   837  C  CA    . LEU A 1 108 ? 30.547  11.670  -3.357  1.00 62.96  ? 107 LEU A CA    1 
ATOM   838  C  C     . LEU A 1 108 ? 31.562  11.040  -4.306  1.00 61.62  ? 107 LEU A C     1 
ATOM   839  O  O     . LEU A 1 108 ? 32.393  11.743  -4.894  1.00 64.30  ? 107 LEU A O     1 
ATOM   840  C  CB    . LEU A 1 108 ? 29.565  12.529  -4.159  1.00 59.54  ? 107 LEU A CB    1 
ATOM   841  C  CG    . LEU A 1 108 ? 28.506  13.359  -3.431  1.00 61.57  ? 107 LEU A CG    1 
ATOM   842  C  CD1   . LEU A 1 108 ? 27.552  13.974  -4.430  1.00 54.16  ? 107 LEU A CD1   1 
ATOM   843  C  CD2   . LEU A 1 108 ? 27.741  12.533  -2.431  1.00 65.16  ? 107 LEU A CD2   1 
ATOM   844  N  N     . ASP A 1 109 ? 31.516  9.716   -4.428  1.00 64.34  ? 108 ASP A N     1 
ATOM   845  C  CA    . ASP A 1 109 ? 32.313  9.018   -5.426  1.00 63.91  ? 108 ASP A CA    1 
ATOM   846  C  C     . ASP A 1 109 ? 31.464  8.923   -6.688  1.00 61.17  ? 108 ASP A C     1 
ATOM   847  O  O     . ASP A 1 109 ? 30.472  8.194   -6.727  1.00 65.58  ? 108 ASP A O     1 
ATOM   848  C  CB    . ASP A 1 109 ? 32.704  7.629   -4.923  1.00 64.39  ? 108 ASP A CB    1 
ATOM   849  C  CG    . ASP A 1 109 ? 33.826  7.008   -5.731  1.00 64.54  ? 108 ASP A CG    1 
ATOM   850  O  OD1   . ASP A 1 109 ? 33.716  6.962   -6.973  1.00 60.22  ? 108 ASP A OD1   1 
ATOM   851  O  OD2   . ASP A 1 109 ? 34.827  6.575   -5.123  1.00 68.58  ? 108 ASP A OD2   1 
ATOM   852  N  N     . VAL A 1 110 ? 31.855  9.666   -7.718  1.00 58.60  ? 109 VAL A N     1 
ATOM   853  C  CA    . VAL A 1 110 ? 30.974  9.898   -8.857  1.00 62.75  ? 109 VAL A CA    1 
ATOM   854  C  C     . VAL A 1 110 ? 31.619  9.487   -10.192 1.00 69.23  ? 109 VAL A C     1 
ATOM   855  O  O     . VAL A 1 110 ? 31.204  9.917   -11.271 1.00 71.74  ? 109 VAL A O     1 
ATOM   856  C  CB    . VAL A 1 110 ? 30.479  11.376  -8.857  1.00 55.32  ? 109 VAL A CB    1 
ATOM   857  C  CG1   . VAL A 1 110 ? 31.523  12.322  -9.457  1.00 58.15  ? 109 VAL A CG1   1 
ATOM   858  C  CG2   . VAL A 1 110 ? 29.137  11.503  -9.554  1.00 57.08  ? 109 VAL A CG2   1 
ATOM   859  N  N     . THR A 1 111 ? 32.623  8.620   -10.097 1.00 67.61  ? 110 THR A N     1 
ATOM   860  C  CA    . THR A 1 111 ? 33.353  8.121   -11.258 1.00 74.85  ? 110 THR A CA    1 
ATOM   861  C  C     . THR A 1 111 ? 32.450  7.372   -12.228 1.00 82.80  ? 110 THR A C     1 
ATOM   862  O  O     . THR A 1 111 ? 32.257  7.792   -13.370 1.00 88.92  ? 110 THR A O     1 
ATOM   863  C  CB    . THR A 1 111 ? 34.428  7.117   -10.832 1.00 73.53  ? 110 THR A CB    1 
ATOM   864  O  OG1   . THR A 1 111 ? 33.805  5.865   -10.523 1.00 80.62  ? 110 THR A OG1   1 
ATOM   865  C  CG2   . THR A 1 111 ? 35.155  7.602   -9.610  1.00 63.96  ? 110 THR A CG2   1 
ATOM   866  N  N     . ASP A 1 112 ? 31.910  6.249   -11.761 1.00 79.44  ? 111 ASP A N     1 
ATOM   867  C  CA    . ASP A 1 112 ? 31.109  5.355   -12.594 1.00 83.87  ? 111 ASP A CA    1 
ATOM   868  C  C     . ASP A 1 112 ? 29.766  5.963   -12.987 1.00 82.09  ? 111 ASP A C     1 
ATOM   869  O  O     . ASP A 1 112 ? 28.967  5.331   -13.682 1.00 82.75  ? 111 ASP A O     1 
ATOM   870  C  CB    . ASP A 1 112 ? 30.894  4.013   -11.886 1.00 85.98  ? 111 ASP A CB    1 
ATOM   871  C  CG    . ASP A 1 112 ? 32.178  3.216   -11.745 1.00 87.67  ? 111 ASP A CG    1 
ATOM   872  O  OD1   . ASP A 1 112 ? 33.097  3.420   -12.565 1.00 85.29  ? 111 ASP A OD1   1 
ATOM   873  O  OD2   . ASP A 1 112 ? 32.267  2.383   -10.818 1.00 85.85  ? 111 ASP A OD2   1 
ATOM   874  N  N     . SER A 1 113 ? 29.523  7.189   -12.539 1.00 77.80  ? 112 SER A N     1 
ATOM   875  C  CA    . SER A 1 113 ? 28.297  7.896   -12.877 1.00 76.08  ? 112 SER A CA    1 
ATOM   876  C  C     . SER A 1 113 ? 28.255  8.242   -14.360 1.00 77.88  ? 112 SER A C     1 
ATOM   877  O  O     . SER A 1 113 ? 29.262  8.636   -14.949 1.00 75.45  ? 112 SER A O     1 
ATOM   878  C  CB    . SER A 1 113 ? 28.153  9.166   -12.036 1.00 72.61  ? 112 SER A CB    1 
ATOM   879  O  OG    . SER A 1 113 ? 26.969  9.869   -12.372 1.00 77.43  ? 112 SER A OG    1 
ATOM   880  N  N     . VAL A 1 114 ? 27.078  8.089   -14.954 1.00 79.20  ? 113 VAL A N     1 
ATOM   881  C  CA    . VAL A 1 114 ? 26.861  8.391   -16.360 1.00 79.48  ? 113 VAL A CA    1 
ATOM   882  C  C     . VAL A 1 114 ? 25.951  9.610   -16.492 1.00 79.87  ? 113 VAL A C     1 
ATOM   883  O  O     . VAL A 1 114 ? 25.236  9.760   -17.481 1.00 83.62  ? 113 VAL A O     1 
ATOM   884  C  CB    . VAL A 1 114 ? 26.189  7.202   -17.067 1.00 74.02  ? 113 VAL A CB    1 
ATOM   885  C  CG1   . VAL A 1 114 ? 27.143  6.024   -17.160 1.00 72.04  ? 113 VAL A CG1   1 
ATOM   886  C  CG2   . VAL A 1 114 ? 24.918  6.797   -16.324 1.00 63.77  ? 113 VAL A CG2   1 
ATOM   887  N  N     . HIS A 1 115 ? 26.001  10.495  -15.502 1.00 75.72  ? 114 HIS A N     1 
ATOM   888  C  CA    . HIS A 1 115 ? 25.013  11.569  -15.384 1.00 74.26  ? 114 HIS A CA    1 
ATOM   889  C  C     . HIS A 1 115 ? 25.213  12.757  -16.328 1.00 79.26  ? 114 HIS A C     1 
ATOM   890  O  O     . HIS A 1 115 ? 24.316  13.091  -17.108 1.00 87.94  ? 114 HIS A O     1 
ATOM   891  C  CB    . HIS A 1 115 ? 24.907  12.039  -13.930 1.00 72.90  ? 114 HIS A CB    1 
ATOM   892  C  CG    . HIS A 1 115 ? 23.699  11.519  -13.216 1.00 79.71  ? 114 HIS A CG    1 
ATOM   893  N  ND1   . HIS A 1 115 ? 23.439  10.171  -13.069 1.00 77.61  ? 114 HIS A ND1   1 
ATOM   894  C  CD2   . HIS A 1 115 ? 22.673  12.165  -12.613 1.00 81.67  ? 114 HIS A CD2   1 
ATOM   895  C  CE1   . HIS A 1 115 ? 22.308  10.013  -12.406 1.00 80.90  ? 114 HIS A CE1   1 
ATOM   896  N  NE2   . HIS A 1 115 ? 21.823  11.208  -12.117 1.00 81.40  ? 114 HIS A NE2   1 
ATOM   897  N  N     . CYS A 1 116 ? 26.368  13.409  -16.245 1.00 70.66  ? 115 CYS A N     1 
ATOM   898  C  CA    . CYS A 1 116 ? 26.643  14.544  -17.120 1.00 70.81  ? 115 CYS A CA    1 
ATOM   899  C  C     . CYS A 1 116 ? 27.848  14.247  -18.000 1.00 77.39  ? 115 CYS A C     1 
ATOM   900  O  O     . CYS A 1 116 ? 28.847  14.974  -17.971 1.00 73.22  ? 115 CYS A O     1 
ATOM   901  C  CB    . CYS A 1 116 ? 26.866  15.823  -16.312 1.00 70.53  ? 115 CYS A CB    1 
ATOM   902  S  SG    . CYS A 1 116 ? 25.474  16.288  -15.268 1.00 62.35  ? 115 CYS A SG    1 
ATOM   903  N  N     . HIS A 1 117 ? 27.734  13.175  -18.782 1.00 80.17  ? 116 HIS A N     1 
ATOM   904  C  CA    . HIS A 1 117 ? 28.807  12.708  -19.657 1.00 75.67  ? 116 HIS A CA    1 
ATOM   905  C  C     . HIS A 1 117 ? 30.072  12.379  -18.871 1.00 78.81  ? 116 HIS A C     1 
ATOM   906  O  O     . HIS A 1 117 ? 31.185  12.567  -19.358 1.00 79.81  ? 116 HIS A O     1 
ATOM   907  C  CB    . HIS A 1 117 ? 29.092  13.727  -20.766 1.00 81.02  ? 116 HIS A CB    1 
ATOM   908  C  CG    . HIS A 1 117 ? 27.915  13.995  -21.653 1.00 81.30  ? 116 HIS A CG    1 
ATOM   909  N  ND1   . HIS A 1 117 ? 27.829  13.513  -22.941 1.00 82.22  ? 116 HIS A ND1   1 
ATOM   910  C  CD2   . HIS A 1 117 ? 26.775  14.693  -21.437 1.00 79.41  ? 116 HIS A CD2   1 
ATOM   911  C  CE1   . HIS A 1 117 ? 26.689  13.904  -23.481 1.00 79.26  ? 116 HIS A CE1   1 
ATOM   912  N  NE2   . HIS A 1 117 ? 26.030  14.621  -22.589 1.00 76.25  ? 116 HIS A NE2   1 
ATOM   913  N  N     . GLY A 1 118 ? 29.887  11.888  -17.649 1.00 76.53  ? 117 GLY A N     1 
ATOM   914  C  CA    . GLY A 1 118 ? 30.998  11.495  -16.803 1.00 74.93  ? 117 GLY A CA    1 
ATOM   915  C  C     . GLY A 1 118 ? 31.794  12.671  -16.270 1.00 73.16  ? 117 GLY A C     1 
ATOM   916  O  O     . GLY A 1 118 ? 32.946  12.518  -15.865 1.00 69.47  ? 117 GLY A O     1 
ATOM   917  N  N     . SER A 1 119 ? 31.178  13.848  -16.267 1.00 73.25  ? 118 SER A N     1 
ATOM   918  C  CA    . SER A 1 119 ? 31.844  15.054  -15.793 1.00 75.00  ? 118 SER A CA    1 
ATOM   919  C  C     . SER A 1 119 ? 31.443  15.392  -14.364 1.00 71.70  ? 118 SER A C     1 
ATOM   920  O  O     . SER A 1 119 ? 30.276  15.661  -14.084 1.00 70.92  ? 118 SER A O     1 
ATOM   921  C  CB    . SER A 1 119 ? 31.534  16.236  -16.711 1.00 73.56  ? 118 SER A CB    1 
ATOM   922  O  OG    . SER A 1 119 ? 32.071  17.437  -16.184 1.00 70.69  ? 118 SER A OG    1 
ATOM   923  N  N     . ALA A 1 120 ? 32.420  15.384  -13.463 1.00 70.58  ? 119 ALA A N     1 
ATOM   924  C  CA    . ALA A 1 120 ? 32.171  15.708  -12.065 1.00 66.20  ? 119 ALA A CA    1 
ATOM   925  C  C     . ALA A 1 120 ? 31.854  17.190  -11.897 1.00 66.09  ? 119 ALA A C     1 
ATOM   926  O  O     . ALA A 1 120 ? 31.154  17.582  -10.962 1.00 71.98  ? 119 ALA A O     1 
ATOM   927  C  CB    . ALA A 1 120 ? 33.364  15.316  -11.210 1.00 67.56  ? 119 ALA A CB    1 
ATOM   928  N  N     . THR A 1 121 ? 32.370  18.008  -12.809 1.00 61.79  ? 120 THR A N     1 
ATOM   929  C  CA    . THR A 1 121 ? 32.132  19.447  -12.775 1.00 67.48  ? 120 THR A CA    1 
ATOM   930  C  C     . THR A 1 121 ? 30.654  19.775  -12.967 1.00 70.73  ? 120 THR A C     1 
ATOM   931  O  O     . THR A 1 121 ? 30.049  20.453  -12.134 1.00 69.33  ? 120 THR A O     1 
ATOM   932  C  CB    . THR A 1 121 ? 32.957  20.186  -13.848 1.00 61.43  ? 120 THR A CB    1 
ATOM   933  O  OG1   . THR A 1 121 ? 34.353  20.064  -13.550 1.00 58.07  ? 120 THR A OG1   1 
ATOM   934  C  CG2   . THR A 1 121 ? 32.582  21.659  -13.887 1.00 63.84  ? 120 THR A CG2   1 
ATOM   935  N  N     . LEU A 1 122 ? 30.077  19.289  -14.062 1.00 67.17  ? 121 LEU A N     1 
ATOM   936  C  CA    . LEU A 1 122 ? 28.667  19.533  -14.351 1.00 69.65  ? 121 LEU A CA    1 
ATOM   937  C  C     . LEU A 1 122 ? 27.754  18.893  -13.308 1.00 71.75  ? 121 LEU A C     1 
ATOM   938  O  O     . LEU A 1 122 ? 26.688  19.426  -12.995 1.00 70.89  ? 121 LEU A O     1 
ATOM   939  C  CB    . LEU A 1 122 ? 28.294  19.039  -15.752 1.00 71.98  ? 121 LEU A CB    1 
ATOM   940  C  CG    . LEU A 1 122 ? 28.683  19.902  -16.958 1.00 72.45  ? 121 LEU A CG    1 
ATOM   941  C  CD1   . LEU A 1 122 ? 28.705  21.381  -16.589 1.00 67.71  ? 121 LEU A CD1   1 
ATOM   942  C  CD2   . LEU A 1 122 ? 30.012  19.468  -17.559 1.00 72.44  ? 121 LEU A CD2   1 
ATOM   943  N  N     . ILE A 1 123 ? 28.177  17.752  -12.773 1.00 68.28  ? 122 ILE A N     1 
ATOM   944  C  CA    . ILE A 1 123 ? 27.412  17.068  -11.737 1.00 68.79  ? 122 ILE A CA    1 
ATOM   945  C  C     . ILE A 1 123 ? 27.364  17.897  -10.455 1.00 66.15  ? 122 ILE A C     1 
ATOM   946  O  O     . ILE A 1 123 ? 26.294  18.102  -9.881  1.00 69.46  ? 122 ILE A O     1 
ATOM   947  C  CB    . ILE A 1 123 ? 27.974  15.660  -11.450 1.00 69.52  ? 122 ILE A CB    1 
ATOM   948  C  CG1   . ILE A 1 123 ? 27.642  14.720  -12.610 1.00 64.12  ? 122 ILE A CG1   1 
ATOM   949  C  CG2   . ILE A 1 123 ? 27.405  15.105  -10.153 1.00 63.89  ? 122 ILE A CG2   1 
ATOM   950  C  CD1   . ILE A 1 123 ? 28.224  13.335  -12.469 1.00 58.32  ? 122 ILE A CD1   1 
ATOM   951  N  N     . ALA A 1 124 ? 28.524  18.385  -10.022 1.00 64.02  ? 123 ALA A N     1 
ATOM   952  C  CA    . ALA A 1 124 ? 28.604  19.233  -8.836  1.00 68.50  ? 123 ALA A CA    1 
ATOM   953  C  C     . ALA A 1 124 ? 27.808  20.521  -9.038  1.00 70.00  ? 123 ALA A C     1 
ATOM   954  O  O     . ALA A 1 124 ? 27.063  20.952  -8.153  1.00 71.36  ? 123 ALA A O     1 
ATOM   955  C  CB    . ALA A 1 124 ? 30.055  19.547  -8.504  1.00 61.56  ? 123 ALA A CB    1 
ATOM   956  N  N     . GLN A 1 125 ? 27.971  21.125  -10.212 1.00 69.38  ? 124 GLN A N     1 
ATOM   957  C  CA    . GLN A 1 125 ? 27.236  22.332  -10.576 1.00 72.35  ? 124 GLN A CA    1 
ATOM   958  C  C     . GLN A 1 125 ? 25.730  22.116  -10.482 1.00 68.92  ? 124 GLN A C     1 
ATOM   959  O  O     . GLN A 1 125 ? 25.007  22.953  -9.933  1.00 68.79  ? 124 GLN A O     1 
ATOM   960  C  CB    . GLN A 1 125 ? 27.610  22.767  -11.993 1.00 74.34  ? 124 GLN A CB    1 
ATOM   961  C  CG    . GLN A 1 125 ? 26.928  24.044  -12.452 1.00 79.94  ? 124 GLN A CG    1 
ATOM   962  C  CD    . GLN A 1 125 ? 27.404  25.261  -11.689 1.00 86.05  ? 124 GLN A CD    1 
ATOM   963  O  OE1   . GLN A 1 125 ? 28.603  25.447  -11.483 1.00 79.68  ? 124 GLN A OE1   1 
ATOM   964  N  NE2   . GLN A 1 125 ? 26.464  26.094  -11.254 1.00 86.73  ? 124 GLN A NE2   1 
ATOM   965  N  N     . GLU A 1 126 ? 25.266  20.986  -11.011 1.00 71.73  ? 125 GLU A N     1 
ATOM   966  C  CA    . GLU A 1 126 ? 23.845  20.649  -10.982 1.00 74.95  ? 125 GLU A CA    1 
ATOM   967  C  C     . GLU A 1 126 ? 23.347  20.359  -9.568  1.00 71.99  ? 125 GLU A C     1 
ATOM   968  O  O     . GLU A 1 126 ? 22.200  20.656  -9.241  1.00 73.63  ? 125 GLU A O     1 
ATOM   969  C  CB    . GLU A 1 126 ? 23.541  19.458  -11.898 1.00 70.67  ? 125 GLU A CB    1 
ATOM   970  C  CG    . GLU A 1 126 ? 23.407  19.806  -13.377 1.00 72.65  ? 125 GLU A CG    1 
ATOM   971  C  CD    . GLU A 1 126 ? 22.698  18.722  -14.162 1.00 72.43  ? 125 GLU A CD    1 
ATOM   972  O  OE1   . GLU A 1 126 ? 21.705  18.167  -13.648 1.00 73.47  ? 125 GLU A OE1   1 
ATOM   973  O  OE2   . GLU A 1 126 ? 23.131  18.424  -15.292 1.00 73.20  ? 125 GLU A OE2   1 
ATOM   974  N  N     . ILE A 1 127 ? 24.199  19.760  -8.741  1.00 65.83  ? 126 ILE A N     1 
ATOM   975  C  CA    . ILE A 1 127 ? 23.834  19.507  -7.352  1.00 68.43  ? 126 ILE A CA    1 
ATOM   976  C  C     . ILE A 1 127 ? 23.657  20.832  -6.610  1.00 68.53  ? 126 ILE A C     1 
ATOM   977  O  O     . ILE A 1 127 ? 22.696  21.008  -5.857  1.00 69.66  ? 126 ILE A O     1 
ATOM   978  C  CB    . ILE A 1 127 ? 24.864  18.610  -6.638  1.00 62.27  ? 126 ILE A CB    1 
ATOM   979  C  CG1   . ILE A 1 127 ? 24.836  17.200  -7.233  1.00 67.89  ? 126 ILE A CG1   1 
ATOM   980  C  CG2   . ILE A 1 127 ? 24.577  18.542  -5.150  1.00 56.85  ? 126 ILE A CG2   1 
ATOM   981  C  CD1   . ILE A 1 127 ? 25.862  16.265  -6.642  1.00 65.83  ? 126 ILE A CD1   1 
ATOM   982  N  N     . ARG A 1 128 ? 24.570  21.770  -6.848  1.00 62.89  ? 127 ARG A N     1 
ATOM   983  C  CA    . ARG A 1 128 ? 24.478  23.093  -6.235  1.00 63.55  ? 127 ARG A CA    1 
ATOM   984  C  C     . ARG A 1 128 ? 23.245  23.859  -6.714  1.00 68.77  ? 127 ARG A C     1 
ATOM   985  O  O     . ARG A 1 128 ? 22.541  24.480  -5.915  1.00 67.01  ? 127 ARG A O     1 
ATOM   986  C  CB    . ARG A 1 128 ? 25.747  23.906  -6.500  1.00 64.41  ? 127 ARG A CB    1 
ATOM   987  C  CG    . ARG A 1 128 ? 27.010  23.276  -5.940  1.00 60.61  ? 127 ARG A CG    1 
ATOM   988  C  CD    . ARG A 1 128 ? 28.156  24.274  -5.868  1.00 56.96  ? 127 ARG A CD    1 
ATOM   989  N  NE    . ARG A 1 128 ? 28.462  24.878  -7.162  1.00 59.79  ? 127 ARG A NE    1 
ATOM   990  C  CZ    . ARG A 1 128 ? 28.161  26.130  -7.493  1.00 62.78  ? 127 ARG A CZ    1 
ATOM   991  N  NH1   . ARG A 1 128 ? 27.543  26.918  -6.623  1.00 57.61  ? 127 ARG A NH1   1 
ATOM   992  N  NH2   . ARG A 1 128 ? 28.480  26.596  -8.692  1.00 64.27  ? 127 ARG A NH2   1 
ATOM   993  N  N     . GLN A 1 129 ? 22.983  23.810  -8.018  1.00 70.28  ? 128 GLN A N     1 
ATOM   994  C  CA    . GLN A 1 129 ? 21.808  24.470  -8.582  1.00 68.66  ? 128 GLN A CA    1 
ATOM   995  C  C     . GLN A 1 129 ? 20.506  23.875  -8.037  1.00 68.63  ? 128 GLN A C     1 
ATOM   996  O  O     . GLN A 1 129 ? 19.590  24.605  -7.653  1.00 68.05  ? 128 GLN A O     1 
ATOM   997  C  CB    . GLN A 1 129 ? 21.825  24.383  -10.108 1.00 72.32  ? 128 GLN A CB    1 
ATOM   998  C  CG    . GLN A 1 129 ? 20.698  25.152  -10.775 1.00 75.07  ? 128 GLN A CG    1 
ATOM   999  C  CD    . GLN A 1 129 ? 20.804  26.646  -10.543 1.00 75.04  ? 128 GLN A CD    1 
ATOM   1000 O  OE1   . GLN A 1 129 ? 19.857  27.286  -10.085 1.00 74.94  ? 128 GLN A OE1   1 
ATOM   1001 N  NE2   . GLN A 1 129 ? 21.962  27.212  -10.862 1.00 72.44  ? 128 GLN A NE2   1 
ATOM   1002 N  N     . THR A 1 130 ? 20.439  22.547  -8.007  1.00 69.66  ? 129 THR A N     1 
ATOM   1003 C  CA    . THR A 1 130 ? 19.273  21.825  -7.500  1.00 68.05  ? 129 THR A CA    1 
ATOM   1004 C  C     . THR A 1 130 ? 19.019  22.157  -6.033  1.00 69.03  ? 129 THR A C     1 
ATOM   1005 O  O     . THR A 1 130 ? 17.874  22.383  -5.627  1.00 68.13  ? 129 THR A O     1 
ATOM   1006 C  CB    . THR A 1 130 ? 19.451  20.299  -7.635  1.00 67.16  ? 129 THR A CB    1 
ATOM   1007 O  OG1   . THR A 1 130 ? 19.951  19.980  -8.941  1.00 67.30  ? 129 THR A OG1   1 
ATOM   1008 C  CG2   . THR A 1 130 ? 18.127  19.586  -7.412  1.00 63.51  ? 129 THR A CG2   1 
ATOM   1009 N  N     . ILE A 1 131 ? 20.093  22.176  -5.247  1.00 70.09  ? 130 ILE A N     1 
ATOM   1010 C  CA    . ILE A 1 131 ? 20.015  22.551  -3.839  1.00 67.64  ? 130 ILE A CA    1 
ATOM   1011 C  C     . ILE A 1 131 ? 19.490  23.977  -3.690  1.00 69.51  ? 130 ILE A C     1 
ATOM   1012 O  O     . ILE A 1 131 ? 18.612  24.240  -2.862  1.00 71.20  ? 130 ILE A O     1 
ATOM   1013 C  CB    . ILE A 1 131 ? 21.384  22.410  -3.139  1.00 61.75  ? 130 ILE A CB    1 
ATOM   1014 C  CG1   . ILE A 1 131 ? 21.701  20.933  -2.896  1.00 64.79  ? 130 ILE A CG1   1 
ATOM   1015 C  CG2   . ILE A 1 131 ? 21.402  23.166  -1.818  1.00 57.86  ? 130 ILE A CG2   1 
ATOM   1016 C  CD1   . ILE A 1 131 ? 23.142  20.666  -2.533  1.00 65.99  ? 130 ILE A CD1   1 
ATOM   1017 N  N     . PHE A 1 132 ? 20.023  24.887  -4.504  1.00 68.93  ? 131 PHE A N     1 
ATOM   1018 C  CA    . PHE A 1 132 ? 19.568  26.274  -4.519  1.00 69.64  ? 131 PHE A CA    1 
ATOM   1019 C  C     . PHE A 1 132 ? 18.068  26.357  -4.768  1.00 68.98  ? 131 PHE A C     1 
ATOM   1020 O  O     . PHE A 1 132 ? 17.354  27.063  -4.059  1.00 70.78  ? 131 PHE A O     1 
ATOM   1021 C  CB    . PHE A 1 132 ? 20.316  27.079  -5.589  1.00 73.11  ? 131 PHE A CB    1 
ATOM   1022 C  CG    . PHE A 1 132 ? 19.934  28.537  -5.637  1.00 78.47  ? 131 PHE A CG    1 
ATOM   1023 C  CD1   . PHE A 1 132 ? 20.670  29.481  -4.941  1.00 80.30  ? 131 PHE A CD1   1 
ATOM   1024 C  CD2   . PHE A 1 132 ? 18.842  28.963  -6.381  1.00 80.43  ? 131 PHE A CD2   1 
ATOM   1025 C  CE1   . PHE A 1 132 ? 20.324  30.821  -4.982  1.00 77.14  ? 131 PHE A CE1   1 
ATOM   1026 C  CE2   . PHE A 1 132 ? 18.490  30.299  -6.422  1.00 78.29  ? 131 PHE A CE2   1 
ATOM   1027 C  CZ    . PHE A 1 132 ? 19.232  31.229  -5.724  1.00 77.05  ? 131 PHE A CZ    1 
ATOM   1028 N  N     . ASN A 1 133 ? 17.594  25.639  -5.780  1.00 66.82  ? 132 ASN A N     1 
ATOM   1029 C  CA    . ASN A 1 133 ? 16.187  25.711  -6.158  1.00 73.58  ? 132 ASN A CA    1 
ATOM   1030 C  C     . ASN A 1 133 ? 15.247  25.089  -5.129  1.00 71.01  ? 132 ASN A C     1 
ATOM   1031 O  O     . ASN A 1 133 ? 14.250  25.696  -4.737  1.00 63.24  ? 132 ASN A O     1 
ATOM   1032 C  CB    . ASN A 1 133 ? 15.965  25.070  -7.529  1.00 67.46  ? 132 ASN A CB    1 
ATOM   1033 C  CG    . ASN A 1 133 ? 16.797  25.722  -8.615  1.00 69.51  ? 132 ASN A CG    1 
ATOM   1034 O  OD1   . ASN A 1 133 ? 17.285  26.840  -8.451  1.00 72.37  ? 132 ASN A OD1   1 
ATOM   1035 N  ND2   . ASN A 1 133 ? 16.958  25.026  -9.734  1.00 63.74  ? 132 ASN A ND2   1 
ATOM   1036 N  N     . GLU A 1 134 ? 15.575  23.879  -4.689  1.00 70.71  ? 133 GLU A N     1 
ATOM   1037 C  CA    . GLU A 1 134 ? 14.690  23.123  -3.811  1.00 71.12  ? 133 GLU A CA    1 
ATOM   1038 C  C     . GLU A 1 134 ? 14.770  23.534  -2.341  1.00 72.94  ? 133 GLU A C     1 
ATOM   1039 O  O     . GLU A 1 134 ? 13.874  23.212  -1.560  1.00 76.15  ? 133 GLU A O     1 
ATOM   1040 C  CB    . GLU A 1 134 ? 14.954  21.621  -3.948  1.00 69.56  ? 133 GLU A CB    1 
ATOM   1041 C  CG    . GLU A 1 134 ? 14.745  21.083  -5.354  1.00 66.01  ? 133 GLU A CG    1 
ATOM   1042 C  CD    . GLU A 1 134 ? 14.856  19.574  -5.421  1.00 64.98  ? 133 GLU A CD    1 
ATOM   1043 O  OE1   . GLU A 1 134 ? 14.928  18.932  -4.351  1.00 62.36  ? 133 GLU A OE1   1 
ATOM   1044 O  OE2   . GLU A 1 134 ? 14.870  19.027  -6.543  1.00 66.55  ? 133 GLU A OE2   1 
ATOM   1045 N  N     . LEU A 1 135 ? 15.831  24.239  -1.959  1.00 71.47  ? 134 LEU A N     1 
ATOM   1046 C  CA    . LEU A 1 135 ? 16.002  24.604  -0.554  1.00 68.39  ? 134 LEU A CA    1 
ATOM   1047 C  C     . LEU A 1 135 ? 16.166  26.100  -0.295  1.00 66.85  ? 134 LEU A C     1 
ATOM   1048 O  O     . LEU A 1 135 ? 16.020  26.544  0.840   1.00 73.38  ? 134 LEU A O     1 
ATOM   1049 C  CB    . LEU A 1 135 ? 17.181  23.848  0.067   1.00 67.20  ? 134 LEU A CB    1 
ATOM   1050 C  CG    . LEU A 1 135 ? 17.021  22.341  0.279   1.00 74.62  ? 134 LEU A CG    1 
ATOM   1051 C  CD1   . LEU A 1 135 ? 17.503  21.565  -0.936  1.00 71.97  ? 134 LEU A CD1   1 
ATOM   1052 C  CD2   . LEU A 1 135 ? 17.750  21.894  1.537   1.00 70.47  ? 134 LEU A CD2   1 
ATOM   1053 N  N     . GLN A 1 136 ? 16.465  26.868  -1.341  1.00 67.25  ? 135 GLN A N     1 
ATOM   1054 C  CA    . GLN A 1 136 ? 16.829  28.283  -1.200  1.00 72.59  ? 135 GLN A CA    1 
ATOM   1055 C  C     . GLN A 1 136 ? 18.096  28.412  -0.341  1.00 69.34  ? 135 GLN A C     1 
ATOM   1056 O  O     . GLN A 1 136 ? 18.362  29.445  0.269   1.00 68.43  ? 135 GLN A O     1 
ATOM   1057 C  CB    . GLN A 1 136 ? 15.657  29.134  -0.668  1.00 71.43  ? 135 GLN A CB    1 
ATOM   1058 C  CG    . GLN A 1 136 ? 15.883  30.656  -0.710  1.00 82.04  ? 135 GLN A CG    1 
ATOM   1059 C  CD    . GLN A 1 136 ? 14.695  31.433  -1.248  1.00 88.78  ? 135 GLN A CD    1 
ATOM   1060 O  OE1   . GLN A 1 136 ? 13.717  30.851  -1.717  1.00 89.88  ? 135 GLN A OE1   1 
ATOM   1061 N  NE2   . GLN A 1 136 ? 14.780  32.761  -1.187  1.00 89.48  ? 135 GLN A NE2   1 
ATOM   1062 N  N     . LEU A 1 137 ? 18.883  27.341  -0.310  1.00 71.04  ? 136 LEU A N     1 
ATOM   1063 C  CA    . LEU A 1 137 ? 20.186  27.368  0.346   1.00 69.41  ? 136 LEU A CA    1 
ATOM   1064 C  C     . LEU A 1 137 ? 21.298  27.376  -0.692  1.00 67.83  ? 136 LEU A C     1 
ATOM   1065 O  O     . LEU A 1 137 ? 21.161  26.792  -1.766  1.00 64.94  ? 136 LEU A O     1 
ATOM   1066 C  CB    . LEU A 1 137 ? 20.361  26.177  1.294   1.00 66.91  ? 136 LEU A CB    1 
ATOM   1067 C  CG    . LEU A 1 137 ? 19.914  26.379  2.744   1.00 65.58  ? 136 LEU A CG    1 
ATOM   1068 C  CD1   . LEU A 1 137 ? 20.372  27.733  3.255   1.00 67.02  ? 136 LEU A CD1   1 
ATOM   1069 C  CD2   . LEU A 1 137 ? 18.412  26.232  2.887   1.00 70.84  ? 136 LEU A CD2   1 
ATOM   1070 N  N     . THR A 1 138 ? 22.399  28.046  -0.374  1.00 65.54  ? 137 THR A N     1 
ATOM   1071 C  CA    . THR A 1 138 ? 23.535  28.086  -1.281  1.00 65.78  ? 137 THR A CA    1 
ATOM   1072 C  C     . THR A 1 138 ? 24.599  27.088  -0.836  1.00 62.84  ? 137 THR A C     1 
ATOM   1073 O  O     . THR A 1 138 ? 24.704  26.766  0.348   1.00 60.99  ? 137 THR A O     1 
ATOM   1074 C  CB    . THR A 1 138 ? 24.135  29.500  -1.389  1.00 62.29  ? 137 THR A CB    1 
ATOM   1075 O  OG1   . THR A 1 138 ? 25.090  29.532  -2.454  1.00 64.79  ? 137 THR A OG1   1 
ATOM   1076 C  CG2   . THR A 1 138 ? 24.808  29.905  -0.087  1.00 59.79  ? 137 THR A CG2   1 
ATOM   1077 N  N     . ALA A 1 139 ? 25.376  26.593  -1.791  1.00 59.33  ? 138 ALA A N     1 
ATOM   1078 C  CA    . ALA A 1 139 ? 26.370  25.568  -1.500  1.00 57.19  ? 138 ALA A CA    1 
ATOM   1079 C  C     . ALA A 1 139 ? 27.633  25.736  -2.334  1.00 57.99  ? 138 ALA A C     1 
ATOM   1080 O  O     . ALA A 1 139 ? 27.608  26.333  -3.411  1.00 62.37  ? 138 ALA A O     1 
ATOM   1081 C  CB    . ALA A 1 139 ? 25.777  24.184  -1.713  1.00 61.90  ? 138 ALA A CB    1 
ATOM   1082 N  N     . SER A 1 140 ? 28.736  25.203  -1.821  1.00 56.75  ? 139 SER A N     1 
ATOM   1083 C  CA    . SER A 1 140 ? 30.010  25.216  -2.525  1.00 57.90  ? 139 SER A CA    1 
ATOM   1084 C  C     . SER A 1 140 ? 30.526  23.792  -2.700  1.00 61.85  ? 139 SER A C     1 
ATOM   1085 O  O     . SER A 1 140 ? 30.131  22.885  -1.963  1.00 56.35  ? 139 SER A O     1 
ATOM   1086 C  CB    . SER A 1 140 ? 31.034  26.067  -1.775  1.00 54.97  ? 139 SER A CB    1 
ATOM   1087 O  OG    . SER A 1 140 ? 30.638  27.427  -1.745  1.00 54.59  ? 139 SER A OG    1 
ATOM   1088 N  N     . ALA A 1 141 ? 31.412  23.596  -3.672  1.00 61.44  ? 140 ALA A N     1 
ATOM   1089 C  CA    . ALA A 1 141 ? 31.866  22.251  -4.006  1.00 55.79  ? 140 ALA A CA    1 
ATOM   1090 C  C     . ALA A 1 141 ? 33.325  22.153  -4.446  1.00 58.44  ? 140 ALA A C     1 
ATOM   1091 O  O     . ALA A 1 141 ? 33.876  23.062  -5.073  1.00 54.45  ? 140 ALA A O     1 
ATOM   1092 C  CB    . ALA A 1 141 ? 30.954  21.635  -5.063  1.00 52.24  ? 140 ALA A CB    1 
ATOM   1093 N  N     . GLY A 1 142 ? 33.943  21.027  -4.109  1.00 61.03  ? 141 GLY A N     1 
ATOM   1094 C  CA    . GLY A 1 142 ? 35.282  20.723  -4.568  1.00 56.90  ? 141 GLY A CA    1 
ATOM   1095 C  C     . GLY A 1 142 ? 35.267  19.460  -5.405  1.00 55.38  ? 141 GLY A C     1 
ATOM   1096 O  O     . GLY A 1 142 ? 34.595  18.489  -5.060  1.00 59.09  ? 141 GLY A O     1 
ATOM   1097 N  N     . VAL A 1 143 ? 35.999  19.478  -6.513  1.00 51.05  ? 142 VAL A N     1 
ATOM   1098 C  CA    . VAL A 1 143 ? 36.102  18.317  -7.387  1.00 53.51  ? 142 VAL A CA    1 
ATOM   1099 C  C     . VAL A 1 143 ? 37.561  17.898  -7.502  1.00 52.23  ? 142 VAL A C     1 
ATOM   1100 O  O     . VAL A 1 143 ? 38.415  18.702  -7.875  1.00 56.66  ? 142 VAL A O     1 
ATOM   1101 C  CB    . VAL A 1 143 ? 35.542  18.619  -8.788  1.00 57.19  ? 142 VAL A CB    1 
ATOM   1102 C  CG1   . VAL A 1 143 ? 35.876  17.490  -9.749  1.00 61.46  ? 142 VAL A CG1   1 
ATOM   1103 C  CG2   . VAL A 1 143 ? 34.039  18.851  -8.719  1.00 55.42  ? 142 VAL A CG2   1 
ATOM   1104 N  N     . ALA A 1 144 ? 37.848  16.641  -7.180  1.00 51.38  ? 143 ALA A N     1 
ATOM   1105 C  CA    . ALA A 1 144 ? 39.231  16.187  -7.098  1.00 58.75  ? 143 ALA A CA    1 
ATOM   1106 C  C     . ALA A 1 144 ? 39.371  14.679  -7.299  1.00 54.89  ? 143 ALA A C     1 
ATOM   1107 O  O     . ALA A 1 144 ? 38.405  13.935  -7.127  1.00 56.72  ? 143 ALA A O     1 
ATOM   1108 C  CB    . ALA A 1 144 ? 39.824  16.599  -5.759  1.00 55.44  ? 143 ALA A CB    1 
ATOM   1109 N  N     . PRO A 1 145 ? 40.580  14.226  -7.675  1.00 53.56  ? 144 PRO A N     1 
ATOM   1110 C  CA    . PRO A 1 145 ? 40.858  12.790  -7.783  1.00 63.01  ? 144 PRO A CA    1 
ATOM   1111 C  C     . PRO A 1 145 ? 40.709  12.078  -6.443  1.00 63.24  ? 144 PRO A C     1 
ATOM   1112 O  O     . PRO A 1 145 ? 40.263  10.932  -6.402  1.00 65.89  ? 144 PRO A O     1 
ATOM   1113 C  CB    . PRO A 1 145 ? 42.322  12.752  -8.231  1.00 61.53  ? 144 PRO A CB    1 
ATOM   1114 C  CG    . PRO A 1 145 ? 42.541  14.050  -8.914  1.00 58.52  ? 144 PRO A CG    1 
ATOM   1115 C  CD    . PRO A 1 145 ? 41.710  15.038  -8.159  1.00 52.49  ? 144 PRO A CD    1 
ATOM   1116 N  N     . VAL A 1 146 ? 41.080  12.758  -5.362  1.00 61.89  ? 145 VAL A N     1 
ATOM   1117 C  CA    . VAL A 1 146 ? 41.025  12.169  -4.029  1.00 57.11  ? 145 VAL A CA    1 
ATOM   1118 C  C     . VAL A 1 146 ? 40.153  12.993  -3.084  1.00 57.09  ? 145 VAL A C     1 
ATOM   1119 O  O     . VAL A 1 146 ? 39.626  14.038  -3.464  1.00 58.09  ? 145 VAL A O     1 
ATOM   1120 C  CB    . VAL A 1 146 ? 42.432  12.022  -3.425  1.00 56.43  ? 145 VAL A CB    1 
ATOM   1121 C  CG1   . VAL A 1 146 ? 43.312  11.170  -4.329  1.00 55.87  ? 145 VAL A CG1   1 
ATOM   1122 C  CG2   . VAL A 1 146 ? 43.057  13.388  -3.204  1.00 58.59  ? 145 VAL A CG2   1 
ATOM   1123 N  N     . LYS A 1 147 ? 40.011  12.518  -1.849  1.00 58.23  ? 146 LYS A N     1 
ATOM   1124 C  CA    . LYS A 1 147 ? 39.134  13.155  -0.869  1.00 53.85  ? 146 LYS A CA    1 
ATOM   1125 C  C     . LYS A 1 147 ? 39.632  14.511  -0.373  1.00 58.36  ? 146 LYS A C     1 
ATOM   1126 O  O     . LYS A 1 147 ? 38.937  15.520  -0.507  1.00 56.37  ? 146 LYS A O     1 
ATOM   1127 C  CB    . LYS A 1 147 ? 38.913  12.236  0.336   1.00 55.62  ? 146 LYS A CB    1 
ATOM   1128 C  CG    . LYS A 1 147 ? 37.854  11.168  0.143   1.00 58.70  ? 146 LYS A CG    1 
ATOM   1129 C  CD    . LYS A 1 147 ? 37.611  10.427  1.449   1.00 58.86  ? 146 LYS A CD    1 
ATOM   1130 C  CE    . LYS A 1 147 ? 36.468  9.435   1.330   1.00 58.92  ? 146 LYS A CE    1 
ATOM   1131 N  NZ    . LYS A 1 147 ? 36.223  8.728   2.618   1.00 55.65  ? 146 LYS A NZ    1 
ATOM   1132 N  N     . PHE A 1 148 ? 40.828  14.526  0.210   1.00 56.14  ? 147 PHE A N     1 
ATOM   1133 C  CA    . PHE A 1 148 ? 41.331  15.721  0.886   1.00 55.38  ? 147 PHE A CA    1 
ATOM   1134 C  C     . PHE A 1 148 ? 41.459  16.918  -0.053  1.00 56.72  ? 147 PHE A C     1 
ATOM   1135 O  O     . PHE A 1 148 ? 41.298  18.062  0.368   1.00 53.18  ? 147 PHE A O     1 
ATOM   1136 C  CB    . PHE A 1 148 ? 42.651  15.437  1.620   1.00 52.88  ? 147 PHE A CB    1 
ATOM   1137 C  CG    . PHE A 1 148 ? 43.880  15.591  0.765   1.00 56.20  ? 147 PHE A CG    1 
ATOM   1138 C  CD1   . PHE A 1 148 ? 44.298  14.565  -0.065  1.00 57.22  ? 147 PHE A CD1   1 
ATOM   1139 C  CD2   . PHE A 1 148 ? 44.632  16.755  0.814   1.00 54.41  ? 147 PHE A CD2   1 
ATOM   1140 C  CE1   . PHE A 1 148 ? 45.433  14.703  -0.843  1.00 57.68  ? 147 PHE A CE1   1 
ATOM   1141 C  CE2   . PHE A 1 148 ? 45.767  16.898  0.039   1.00 47.67  ? 147 PHE A CE2   1 
ATOM   1142 C  CZ    . PHE A 1 148 ? 46.168  15.872  -0.791  1.00 52.83  ? 147 PHE A CZ    1 
ATOM   1143 N  N     . LEU A 1 149 ? 41.730  16.651  -1.326  1.00 54.80  ? 148 LEU A N     1 
ATOM   1144 C  CA    . LEU A 1 149 ? 41.797  17.715  -2.320  1.00 51.18  ? 148 LEU A CA    1 
ATOM   1145 C  C     . LEU A 1 149 ? 40.404  18.217  -2.692  1.00 51.40  ? 148 LEU A C     1 
ATOM   1146 O  O     . LEU A 1 149 ? 40.238  19.373  -3.075  1.00 55.35  ? 148 LEU A O     1 
ATOM   1147 C  CB    . LEU A 1 149 ? 42.561  17.256  -3.563  1.00 52.12  ? 148 LEU A CB    1 
ATOM   1148 C  CG    . LEU A 1 149 ? 44.080  17.175  -3.411  1.00 53.20  ? 148 LEU A CG    1 
ATOM   1149 C  CD1   . LEU A 1 149 ? 44.731  16.736  -4.712  1.00 48.29  ? 148 LEU A CD1   1 
ATOM   1150 C  CD2   . LEU A 1 149 ? 44.639  18.515  -2.956  1.00 49.88  ? 148 LEU A CD2   1 
ATOM   1151 N  N     . ALA A 1 150 ? 39.405  17.347  -2.579  1.00 48.34  ? 149 ALA A N     1 
ATOM   1152 C  CA    . ALA A 1 150 ? 38.024  17.755  -2.808  1.00 52.00  ? 149 ALA A CA    1 
ATOM   1153 C  C     . ALA A 1 150 ? 37.580  18.651  -1.661  1.00 55.43  ? 149 ALA A C     1 
ATOM   1154 O  O     . ALA A 1 150 ? 36.897  19.658  -1.868  1.00 60.13  ? 149 ALA A O     1 
ATOM   1155 C  CB    . ALA A 1 150 ? 37.116  16.541  -2.927  1.00 53.66  ? 149 ALA A CB    1 
ATOM   1156 N  N     . LYS A 1 151 ? 37.986  18.277  -0.451  1.00 56.95  ? 150 LYS A N     1 
ATOM   1157 C  CA    . LYS A 1 151 ? 37.709  19.076  0.736   1.00 57.39  ? 150 LYS A CA    1 
ATOM   1158 C  C     . LYS A 1 151 ? 38.374  20.444  0.638   1.00 54.51  ? 150 LYS A C     1 
ATOM   1159 O  O     . LYS A 1 151 ? 37.746  21.469  0.904   1.00 53.86  ? 150 LYS A O     1 
ATOM   1160 C  CB    . LYS A 1 151 ? 38.196  18.354  1.993   1.00 59.09  ? 150 LYS A CB    1 
ATOM   1161 C  CG    . LYS A 1 151 ? 37.963  19.133  3.277   1.00 55.34  ? 150 LYS A CG    1 
ATOM   1162 C  CD    . LYS A 1 151 ? 36.480  19.265  3.573   1.00 61.17  ? 150 LYS A CD    1 
ATOM   1163 C  CE    . LYS A 1 151 ? 36.219  20.270  4.681   1.00 61.45  ? 150 LYS A CE    1 
ATOM   1164 N  NZ    . LYS A 1 151 ? 36.579  21.654  4.269   1.00 64.98  ? 150 LYS A NZ    1 
ATOM   1165 N  N     . ILE A 1 152 ? 39.648  20.453  0.255   1.00 53.42  ? 151 ILE A N     1 
ATOM   1166 C  CA    . ILE A 1 152 ? 40.398  21.696  0.105   1.00 51.63  ? 151 ILE A CA    1 
ATOM   1167 C  C     . ILE A 1 152 ? 39.788  22.593  -0.971  1.00 53.45  ? 151 ILE A C     1 
ATOM   1168 O  O     . ILE A 1 152 ? 39.579  23.786  -0.751  1.00 58.64  ? 151 ILE A O     1 
ATOM   1169 C  CB    . ILE A 1 152 ? 41.883  21.429  -0.221  1.00 46.65  ? 151 ILE A CB    1 
ATOM   1170 C  CG1   . ILE A 1 152 ? 42.593  20.823  0.990   1.00 49.06  ? 151 ILE A CG1   1 
ATOM   1171 C  CG2   . ILE A 1 152 ? 42.582  22.712  -0.636  1.00 50.15  ? 151 ILE A CG2   1 
ATOM   1172 C  CD1   . ILE A 1 152 ? 44.021  20.402  0.715   1.00 46.62  ? 151 ILE A CD1   1 
ATOM   1173 N  N     . ALA A 1 153 ? 39.491  22.009  -2.128  1.00 49.93  ? 152 ALA A N     1 
ATOM   1174 C  CA    . ALA A 1 153 ? 38.905  22.758  -3.236  1.00 53.54  ? 152 ALA A CA    1 
ATOM   1175 C  C     . ALA A 1 153 ? 37.501  23.253  -2.902  1.00 58.00  ? 152 ALA A C     1 
ATOM   1176 O  O     . ALA A 1 153 ? 37.022  24.224  -3.489  1.00 58.26  ? 152 ALA A O     1 
ATOM   1177 C  CB    . ALA A 1 153 ? 38.883  21.912  -4.500  1.00 53.80  ? 152 ALA A CB    1 
ATOM   1178 N  N     . SER A 1 154 ? 36.847  22.581  -1.959  1.00 57.19  ? 153 SER A N     1 
ATOM   1179 C  CA    . SER A 1 154 ? 35.501  22.962  -1.543  1.00 56.31  ? 153 SER A CA    1 
ATOM   1180 C  C     . SER A 1 154 ? 35.464  24.343  -0.884  1.00 59.56  ? 153 SER A C     1 
ATOM   1181 O  O     . SER A 1 154 ? 34.453  25.041  -0.951  1.00 54.01  ? 153 SER A O     1 
ATOM   1182 C  CB    . SER A 1 154 ? 34.920  21.911  -0.593  1.00 52.45  ? 153 SER A CB    1 
ATOM   1183 O  OG    . SER A 1 154 ? 33.604  22.253  -0.197  1.00 60.44  ? 153 SER A OG    1 
ATOM   1184 N  N     . ASP A 1 155 ? 36.569  24.733  -0.256  1.00 59.34  ? 154 ASP A N     1 
ATOM   1185 C  CA    . ASP A 1 155 ? 36.639  26.008  0.455   1.00 59.94  ? 154 ASP A CA    1 
ATOM   1186 C  C     . ASP A 1 155 ? 37.288  27.119  -0.367  1.00 66.65  ? 154 ASP A C     1 
ATOM   1187 O  O     . ASP A 1 155 ? 37.341  28.270  0.069   1.00 67.54  ? 154 ASP A O     1 
ATOM   1188 C  CB    . ASP A 1 155 ? 37.395  25.846  1.777   1.00 58.27  ? 154 ASP A CB    1 
ATOM   1189 C  CG    . ASP A 1 155 ? 36.534  25.254  2.873   1.00 69.44  ? 154 ASP A CG    1 
ATOM   1190 O  OD1   . ASP A 1 155 ? 35.924  26.034  3.635   1.00 63.32  ? 154 ASP A OD1   1 
ATOM   1191 O  OD2   . ASP A 1 155 ? 36.467  24.011  2.975   1.00 72.77  ? 154 ASP A OD2   1 
ATOM   1192 N  N     . MET A 1 156 ? 37.778  26.777  -1.553  1.00 57.21  ? 155 MET A N     1 
ATOM   1193 C  CA    . MET A 1 156 ? 38.532  27.729  -2.364  1.00 57.89  ? 155 MET A CA    1 
ATOM   1194 C  C     . MET A 1 156 ? 37.660  28.706  -3.150  1.00 65.58  ? 155 MET A C     1 
ATOM   1195 O  O     . MET A 1 156 ? 38.151  29.722  -3.641  1.00 63.15  ? 155 MET A O     1 
ATOM   1196 C  CB    . MET A 1 156 ? 39.478  26.993  -3.314  1.00 55.97  ? 155 MET A CB    1 
ATOM   1197 C  CG    . MET A 1 156 ? 40.647  26.318  -2.623  1.00 55.80  ? 155 MET A CG    1 
ATOM   1198 S  SD    . MET A 1 156 ? 41.793  25.596  -3.808  1.00 67.42  ? 155 MET A SD    1 
ATOM   1199 C  CE    . MET A 1 156 ? 42.132  27.017  -4.845  1.00 59.15  ? 155 MET A CE    1 
ATOM   1200 N  N     . ASN A 1 157 ? 36.373  28.402  -3.271  1.00 60.18  ? 156 ASN A N     1 
ATOM   1201 C  CA    . ASN A 1 157 ? 35.475  29.261  -4.035  1.00 52.68  ? 156 ASN A CA    1 
ATOM   1202 C  C     . ASN A 1 157 ? 34.176  29.584  -3.306  1.00 58.99  ? 156 ASN A C     1 
ATOM   1203 O  O     . ASN A 1 157 ? 33.215  30.057  -3.913  1.00 60.27  ? 156 ASN A O     1 
ATOM   1204 C  CB    . ASN A 1 157 ? 35.175  28.649  -5.403  1.00 59.07  ? 156 ASN A CB    1 
ATOM   1205 C  CG    . ASN A 1 157 ? 35.525  29.581  -6.545  1.00 56.97  ? 156 ASN A CG    1 
ATOM   1206 O  OD1   . ASN A 1 157 ? 36.415  30.423  -6.423  1.00 60.90  ? 156 ASN A OD1   1 
ATOM   1207 N  ND2   . ASN A 1 157 ? 34.822  29.440  -7.662  1.00 58.74  ? 156 ASN A ND2   1 
ATOM   1208 N  N     . LYS A 1 158 ? 34.149  29.326  -2.004  1.00 60.26  ? 157 LYS A N     1 
ATOM   1209 C  CA    . LYS A 1 158 ? 32.981  29.655  -1.198  1.00 60.11  ? 157 LYS A CA    1 
ATOM   1210 C  C     . LYS A 1 158 ? 32.914  31.164  -0.979  1.00 59.56  ? 157 LYS A C     1 
ATOM   1211 O  O     . LYS A 1 158 ? 33.948  31.827  -0.893  1.00 61.88  ? 157 LYS A O     1 
ATOM   1212 C  CB    . LYS A 1 158 ? 33.017  28.912  0.143   1.00 58.30  ? 157 LYS A CB    1 
ATOM   1213 C  CG    . LYS A 1 158 ? 34.189  29.278  1.035   1.00 66.22  ? 157 LYS A CG    1 
ATOM   1214 C  CD    . LYS A 1 158 ? 34.030  28.679  2.421   1.00 65.69  ? 157 LYS A CD    1 
ATOM   1215 C  CE    . LYS A 1 158 ? 35.110  29.186  3.362   1.00 66.17  ? 157 LYS A CE    1 
ATOM   1216 N  NZ    . LYS A 1 158 ? 34.922  28.684  4.751   1.00 62.25  ? 157 LYS A NZ    1 
ATOM   1217 N  N     . PRO A 1 159 ? 31.694  31.717  -0.890  1.00 55.16  ? 158 PRO A N     1 
ATOM   1218 C  CA    . PRO A 1 159 ? 30.409  31.013  -0.965  1.00 56.58  ? 158 PRO A CA    1 
ATOM   1219 C  C     . PRO A 1 159 ? 29.886  30.866  -2.398  1.00 60.30  ? 158 PRO A C     1 
ATOM   1220 O  O     . PRO A 1 159 ? 30.277  31.639  -3.269  1.00 59.22  ? 158 PRO A O     1 
ATOM   1221 C  CB    . PRO A 1 159 ? 29.485  31.931  -0.167  1.00 57.51  ? 158 PRO A CB    1 
ATOM   1222 C  CG    . PRO A 1 159 ? 30.014  33.295  -0.467  1.00 58.52  ? 158 PRO A CG    1 
ATOM   1223 C  CD    . PRO A 1 159 ? 31.514  33.147  -0.577  1.00 52.26  ? 158 PRO A CD    1 
ATOM   1224 N  N     . ASN A 1 160 ? 29.019  29.881  -2.623  1.00 61.36  ? 159 ASN A N     1 
ATOM   1225 C  CA    . ASN A 1 160 ? 28.349  29.685  -3.912  1.00 59.22  ? 159 ASN A CA    1 
ATOM   1226 C  C     . ASN A 1 160 ? 29.301  29.570  -5.102  1.00 63.50  ? 159 ASN A C     1 
ATOM   1227 O  O     . ASN A 1 160 ? 29.059  30.162  -6.160  1.00 67.12  ? 159 ASN A O     1 
ATOM   1228 C  CB    . ASN A 1 160 ? 27.329  30.800  -4.161  1.00 62.61  ? 159 ASN A CB    1 
ATOM   1229 C  CG    . ASN A 1 160 ? 26.316  30.441  -5.236  1.00 62.08  ? 159 ASN A CG    1 
ATOM   1230 O  OD1   . ASN A 1 160 ? 26.205  29.286  -5.655  1.00 58.11  ? 159 ASN A OD1   1 
ATOM   1231 N  ND2   . ASN A 1 160 ? 25.563  31.436  -5.679  1.00 71.19  ? 159 ASN A ND2   1 
ATOM   1232 N  N     . GLY A 1 161 ? 30.376  28.809  -4.924  1.00 61.70  ? 160 GLY A N     1 
ATOM   1233 C  CA    . GLY A 1 161 ? 31.318  28.564  -5.998  1.00 60.50  ? 160 GLY A CA    1 
ATOM   1234 C  C     . GLY A 1 161 ? 31.847  27.147  -5.916  1.00 63.08  ? 160 GLY A C     1 
ATOM   1235 O  O     . GLY A 1 161 ? 31.645  26.453  -4.922  1.00 62.85  ? 160 GLY A O     1 
ATOM   1236 N  N     . GLN A 1 162 ? 32.522  26.703  -6.966  1.00 61.95  ? 161 GLN A N     1 
ATOM   1237 C  CA    . GLN A 1 162 ? 33.143  25.388  -6.934  1.00 58.36  ? 161 GLN A CA    1 
ATOM   1238 C  C     . GLN A 1 162 ? 34.521  25.414  -7.572  1.00 55.08  ? 161 GLN A C     1 
ATOM   1239 O  O     . GLN A 1 162 ? 34.778  26.204  -8.481  1.00 56.61  ? 161 GLN A O     1 
ATOM   1240 C  CB    . GLN A 1 162 ? 32.256  24.338  -7.606  1.00 59.98  ? 161 GLN A CB    1 
ATOM   1241 C  CG    . GLN A 1 162 ? 32.024  24.558  -9.087  1.00 58.71  ? 161 GLN A CG    1 
ATOM   1242 C  CD    . GLN A 1 162 ? 31.007  23.591  -9.658  1.00 64.82  ? 161 GLN A CD    1 
ATOM   1243 O  OE1   . GLN A 1 162 ? 29.903  23.451  -9.130  1.00 66.85  ? 161 GLN A OE1   1 
ATOM   1244 N  NE2   . GLN A 1 162 ? 31.376  22.911  -10.737 1.00 63.76  ? 161 GLN A NE2   1 
ATOM   1245 N  N     . PHE A 1 163 ? 35.413  24.560  -7.086  1.00 57.37  ? 162 PHE A N     1 
ATOM   1246 C  CA    . PHE A 1 163 ? 36.765  24.519  -7.625  1.00 53.03  ? 162 PHE A CA    1 
ATOM   1247 C  C     . PHE A 1 163 ? 37.143  23.101  -8.025  1.00 57.65  ? 162 PHE A C     1 
ATOM   1248 O  O     . PHE A 1 163 ? 36.778  22.140  -7.349  1.00 57.17  ? 162 PHE A O     1 
ATOM   1249 C  CB    . PHE A 1 163 ? 37.769  25.083  -6.619  1.00 53.38  ? 162 PHE A CB    1 
ATOM   1250 C  CG    . PHE A 1 163 ? 39.137  25.310  -7.194  1.00 52.20  ? 162 PHE A CG    1 
ATOM   1251 C  CD1   . PHE A 1 163 ? 40.165  24.414  -6.947  1.00 55.17  ? 162 PHE A CD1   1 
ATOM   1252 C  CD2   . PHE A 1 163 ? 39.394  26.415  -7.989  1.00 48.93  ? 162 PHE A CD2   1 
ATOM   1253 C  CE1   . PHE A 1 163 ? 41.424  24.620  -7.477  1.00 58.10  ? 162 PHE A CE1   1 
ATOM   1254 C  CE2   . PHE A 1 163 ? 40.651  26.625  -8.522  1.00 48.77  ? 162 PHE A CE2   1 
ATOM   1255 C  CZ    . PHE A 1 163 ? 41.667  25.727  -8.266  1.00 48.84  ? 162 PHE A CZ    1 
ATOM   1256 N  N     . VAL A 1 164 ? 37.871  22.977  -9.128  1.00 53.55  ? 163 VAL A N     1 
ATOM   1257 C  CA    . VAL A 1 164 ? 38.223  21.669  -9.663  1.00 53.13  ? 163 VAL A CA    1 
ATOM   1258 C  C     . VAL A 1 164 ? 39.732  21.482  -9.770  1.00 58.17  ? 163 VAL A C     1 
ATOM   1259 O  O     . VAL A 1 164 ? 40.429  22.298  -10.373 1.00 59.08  ? 163 VAL A O     1 
ATOM   1260 C  CB    . VAL A 1 164 ? 37.595  21.445  -11.053 1.00 54.69  ? 163 VAL A CB    1 
ATOM   1261 C  CG1   . VAL A 1 164 ? 38.012  20.095  -11.614 1.00 51.00  ? 163 VAL A CG1   1 
ATOM   1262 C  CG2   . VAL A 1 164 ? 36.080  21.554  -10.975 1.00 52.37  ? 163 VAL A CG2   1 
ATOM   1263 N  N     . ILE A 1 165 ? 40.229  20.402  -9.176  1.00 57.85  ? 164 ILE A N     1 
ATOM   1264 C  CA    . ILE A 1 165 ? 41.632  20.037  -9.303  1.00 54.58  ? 164 ILE A CA    1 
ATOM   1265 C  C     . ILE A 1 165 ? 41.755  18.780  -10.157 1.00 58.71  ? 164 ILE A C     1 
ATOM   1266 O  O     . ILE A 1 165 ? 41.238  17.723  -9.798  1.00 53.65  ? 164 ILE A O     1 
ATOM   1267 C  CB    . ILE A 1 165 ? 42.281  19.784  -7.931  1.00 50.40  ? 164 ILE A CB    1 
ATOM   1268 C  CG1   . ILE A 1 165 ? 42.029  20.968  -6.994  1.00 55.52  ? 164 ILE A CG1   1 
ATOM   1269 C  CG2   . ILE A 1 165 ? 43.772  19.527  -8.087  1.00 48.04  ? 164 ILE A CG2   1 
ATOM   1270 C  CD1   . ILE A 1 165 ? 42.657  20.807  -5.627  1.00 54.50  ? 164 ILE A CD1   1 
ATOM   1271 N  N     . THR A 1 166 ? 42.430  18.903  -11.294 1.00 56.46  ? 165 THR A N     1 
ATOM   1272 C  CA    . THR A 1 166 ? 42.623  17.771  -12.192 1.00 55.42  ? 165 THR A CA    1 
ATOM   1273 C  C     . THR A 1 166 ? 43.937  17.072  -11.857 1.00 55.60  ? 165 THR A C     1 
ATOM   1274 O  O     . THR A 1 166 ? 44.831  17.688  -11.274 1.00 55.15  ? 165 THR A O     1 
ATOM   1275 C  CB    . THR A 1 166 ? 42.639  18.222  -13.668 1.00 55.43  ? 165 THR A CB    1 
ATOM   1276 O  OG1   . THR A 1 166 ? 43.899  18.829  -13.976 1.00 56.03  ? 165 THR A OG1   1 
ATOM   1277 C  CG2   . THR A 1 166 ? 41.513  19.209  -13.940 1.00 53.48  ? 165 THR A CG2   1 
ATOM   1278 N  N     . PRO A 1 167 ? 44.054  15.779  -12.210 1.00 59.13  ? 166 PRO A N     1 
ATOM   1279 C  CA    . PRO A 1 167 ? 45.293  15.020  -12.000 1.00 53.34  ? 166 PRO A CA    1 
ATOM   1280 C  C     . PRO A 1 167 ? 46.533  15.729  -12.543 1.00 53.25  ? 166 PRO A C     1 
ATOM   1281 O  O     . PRO A 1 167 ? 47.617  15.580  -11.982 1.00 58.95  ? 166 PRO A O     1 
ATOM   1282 C  CB    . PRO A 1 167 ? 45.040  13.734  -12.787 1.00 55.15  ? 166 PRO A CB    1 
ATOM   1283 C  CG    . PRO A 1 167 ? 43.572  13.539  -12.691 1.00 54.57  ? 166 PRO A CG    1 
ATOM   1284 C  CD    . PRO A 1 167 ? 42.967  14.918  -12.714 1.00 51.34  ? 166 PRO A CD    1 
ATOM   1285 N  N     . ALA A 1 168 ? 46.368  16.495  -13.617 1.00 54.40  ? 167 ALA A N     1 
ATOM   1286 C  CA    . ALA A 1 168 ? 47.483  17.220  -14.215 1.00 53.51  ? 167 ALA A CA    1 
ATOM   1287 C  C     . ALA A 1 168 ? 47.824  18.484  -13.430 1.00 54.04  ? 167 ALA A C     1 
ATOM   1288 O  O     . ALA A 1 168 ? 48.937  19.002  -13.527 1.00 56.75  ? 167 ALA A O     1 
ATOM   1289 C  CB    . ALA A 1 168 ? 47.177  17.560  -15.666 1.00 51.00  ? 167 ALA A CB    1 
ATOM   1290 N  N     . GLU A 1 169 ? 46.864  18.975  -12.652 1.00 53.80  ? 168 GLU A N     1 
ATOM   1291 C  CA    . GLU A 1 169 ? 47.059  20.190  -11.865 1.00 54.16  ? 168 GLU A CA    1 
ATOM   1292 C  C     . GLU A 1 169 ? 47.577  19.882  -10.462 1.00 56.29  ? 168 GLU A C     1 
ATOM   1293 O  O     . GLU A 1 169 ? 48.071  20.769  -9.767  1.00 58.90  ? 168 GLU A O     1 
ATOM   1294 C  CB    . GLU A 1 169 ? 45.750  20.979  -11.768 1.00 54.46  ? 168 GLU A CB    1 
ATOM   1295 C  CG    . GLU A 1 169 ? 45.255  21.537  -13.092 1.00 55.19  ? 168 GLU A CG    1 
ATOM   1296 C  CD    . GLU A 1 169 ? 43.842  22.079  -13.001 1.00 59.80  ? 168 GLU A CD    1 
ATOM   1297 O  OE1   . GLU A 1 169 ? 43.297  22.503  -14.042 1.00 62.91  ? 168 GLU A OE1   1 
ATOM   1298 O  OE2   . GLU A 1 169 ? 43.274  22.079  -11.888 1.00 61.77  ? 168 GLU A OE2   1 
ATOM   1299 N  N     . VAL A 1 170 ? 47.460  18.621  -10.058 1.00 57.79  ? 169 VAL A N     1 
ATOM   1300 C  CA    . VAL A 1 170 ? 47.832  18.191  -8.708  1.00 61.25  ? 169 VAL A CA    1 
ATOM   1301 C  C     . VAL A 1 170 ? 49.272  18.516  -8.260  1.00 55.92  ? 169 VAL A C     1 
ATOM   1302 O  O     . VAL A 1 170 ? 49.454  19.104  -7.193  1.00 54.83  ? 169 VAL A O     1 
ATOM   1303 C  CB    . VAL A 1 170 ? 47.507  16.688  -8.472  1.00 57.12  ? 169 VAL A CB    1 
ATOM   1304 C  CG1   . VAL A 1 170 ? 48.168  16.183  -7.199  1.00 46.00  ? 169 VAL A CG1   1 
ATOM   1305 C  CG2   . VAL A 1 170 ? 46.002  16.473  -8.424  1.00 51.20  ? 169 VAL A CG2   1 
ATOM   1306 N  N     . PRO A 1 171 ? 50.293  18.145  -9.061  1.00 55.86  ? 170 PRO A N     1 
ATOM   1307 C  CA    . PRO A 1 171 ? 51.664  18.396  -8.595  1.00 57.76  ? 170 PRO A CA    1 
ATOM   1308 C  C     . PRO A 1 171 ? 51.963  19.876  -8.368  1.00 59.29  ? 170 PRO A C     1 
ATOM   1309 O  O     . PRO A 1 171 ? 52.575  20.226  -7.358  1.00 61.94  ? 170 PRO A O     1 
ATOM   1310 C  CB    . PRO A 1 171 ? 52.528  17.861  -9.743  1.00 58.23  ? 170 PRO A CB    1 
ATOM   1311 C  CG    . PRO A 1 171 ? 51.661  16.882  -10.446 1.00 50.93  ? 170 PRO A CG    1 
ATOM   1312 C  CD    . PRO A 1 171 ? 50.286  17.458  -10.366 1.00 52.89  ? 170 PRO A CD    1 
ATOM   1313 N  N     . ALA A 1 172 ? 51.534  20.728  -9.294  1.00 58.50  ? 171 ALA A N     1 
ATOM   1314 C  CA    . ALA A 1 172 ? 51.739  22.166  -9.165  1.00 58.54  ? 171 ALA A CA    1 
ATOM   1315 C  C     . ALA A 1 172 ? 50.958  22.719  -7.979  1.00 59.66  ? 171 ALA A C     1 
ATOM   1316 O  O     . ALA A 1 172 ? 51.406  23.645  -7.302  1.00 59.92  ? 171 ALA A O     1 
ATOM   1317 C  CB    . ALA A 1 172 ? 51.332  22.877  -10.447 1.00 53.02  ? 171 ALA A CB    1 
ATOM   1318 N  N     . PHE A 1 173 ? 49.787  22.138  -7.735  1.00 56.41  ? 172 PHE A N     1 
ATOM   1319 C  CA    . PHE A 1 173 ? 48.928  22.551  -6.631  1.00 54.74  ? 172 PHE A CA    1 
ATOM   1320 C  C     . PHE A 1 173 ? 49.545  22.181  -5.286  1.00 61.15  ? 172 PHE A C     1 
ATOM   1321 O  O     . PHE A 1 173 ? 49.427  22.926  -4.313  1.00 65.62  ? 172 PHE A O     1 
ATOM   1322 C  CB    . PHE A 1 173 ? 47.548  21.901  -6.770  1.00 51.34  ? 172 PHE A CB    1 
ATOM   1323 C  CG    . PHE A 1 173 ? 46.552  22.355  -5.740  1.00 54.65  ? 172 PHE A CG    1 
ATOM   1324 C  CD1   . PHE A 1 173 ? 46.413  21.676  -4.540  1.00 53.09  ? 172 PHE A CD1   1 
ATOM   1325 C  CD2   . PHE A 1 173 ? 45.745  23.456  -5.978  1.00 57.57  ? 172 PHE A CD2   1 
ATOM   1326 C  CE1   . PHE A 1 173 ? 45.496  22.091  -3.594  1.00 54.53  ? 172 PHE A CE1   1 
ATOM   1327 C  CE2   . PHE A 1 173 ? 44.824  23.875  -5.035  1.00 55.28  ? 172 PHE A CE2   1 
ATOM   1328 C  CZ    . PHE A 1 173 ? 44.700  23.192  -3.842  1.00 54.31  ? 172 PHE A CZ    1 
ATOM   1329 N  N     . LEU A 1 174 ? 50.204  21.028  -5.239  1.00 57.11  ? 173 LEU A N     1 
ATOM   1330 C  CA    . LEU A 1 174 ? 50.768  20.513  -3.995  1.00 60.53  ? 173 LEU A CA    1 
ATOM   1331 C  C     . LEU A 1 174 ? 51.980  21.300  -3.506  1.00 57.25  ? 173 LEU A C     1 
ATOM   1332 O  O     . LEU A 1 174 ? 52.163  21.468  -2.302  1.00 59.64  ? 173 LEU A O     1 
ATOM   1333 C  CB    . LEU A 1 174 ? 51.144  19.037  -4.146  1.00 60.51  ? 173 LEU A CB    1 
ATOM   1334 C  CG    . LEU A 1 174 ? 50.000  18.026  -4.191  1.00 57.21  ? 173 LEU A CG    1 
ATOM   1335 C  CD1   . LEU A 1 174 ? 50.552  16.633  -4.427  1.00 56.75  ? 173 LEU A CD1   1 
ATOM   1336 C  CD2   . LEU A 1 174 ? 49.187  18.074  -2.906  1.00 50.34  ? 173 LEU A CD2   1 
ATOM   1337 N  N     . GLN A 1 175 ? 52.802  21.771  -4.439  1.00 61.92  ? 174 GLN A N     1 
ATOM   1338 C  CA    . GLN A 1 175 ? 54.057  22.444  -4.104  1.00 64.73  ? 174 GLN A CA    1 
ATOM   1339 C  C     . GLN A 1 175 ? 53.903  23.578  -3.092  1.00 65.94  ? 174 GLN A C     1 
ATOM   1340 O  O     . GLN A 1 175 ? 54.522  23.556  -2.028  1.00 65.66  ? 174 GLN A O     1 
ATOM   1341 C  CB    . GLN A 1 175 ? 54.750  22.959  -5.369  1.00 63.57  ? 174 GLN A CB    1 
ATOM   1342 C  CG    . GLN A 1 175 ? 55.722  21.967  -5.985  1.00 61.71  ? 174 GLN A CG    1 
ATOM   1343 C  CD    . GLN A 1 175 ? 56.921  21.701  -5.094  1.00 65.12  ? 174 GLN A CD    1 
ATOM   1344 O  OE1   . GLN A 1 175 ? 57.324  22.556  -4.304  1.00 68.05  ? 174 GLN A OE1   1 
ATOM   1345 N  NE2   . GLN A 1 175 ? 57.494  20.510  -5.213  1.00 66.68  ? 174 GLN A NE2   1 
ATOM   1346 N  N     . THR A 1 176 ? 53.075  24.562  -3.423  1.00 64.55  ? 175 THR A N     1 
ATOM   1347 C  CA    . THR A 1 176 ? 52.872  25.711  -2.548  1.00 61.35  ? 175 THR A CA    1 
ATOM   1348 C  C     . THR A 1 176 ? 51.613  25.561  -1.701  1.00 61.29  ? 175 THR A C     1 
ATOM   1349 O  O     . THR A 1 176 ? 50.959  26.549  -1.371  1.00 70.28  ? 175 THR A O     1 
ATOM   1350 C  CB    . THR A 1 176 ? 52.785  27.021  -3.349  1.00 61.60  ? 175 THR A CB    1 
ATOM   1351 O  OG1   . THR A 1 176 ? 51.769  26.902  -4.352  1.00 66.61  ? 175 THR A OG1   1 
ATOM   1352 C  CG2   . THR A 1 176 ? 54.116  27.324  -4.018  1.00 61.79  ? 175 THR A CG2   1 
ATOM   1353 N  N     . LEU A 1 177 ? 51.279  24.323  -1.354  1.00 62.09  ? 176 LEU A N     1 
ATOM   1354 C  CA    . LEU A 1 177 ? 50.110  24.054  -0.526  1.00 61.60  ? 176 LEU A CA    1 
ATOM   1355 C  C     . LEU A 1 177 ? 50.496  23.947  0.943   1.00 60.35  ? 176 LEU A C     1 
ATOM   1356 O  O     . LEU A 1 177 ? 51.173  22.999  1.340   1.00 55.82  ? 176 LEU A O     1 
ATOM   1357 C  CB    . LEU A 1 177 ? 49.415  22.767  -0.975  1.00 57.51  ? 176 LEU A CB    1 
ATOM   1358 C  CG    . LEU A 1 177 ? 48.203  22.346  -0.142  1.00 53.46  ? 176 LEU A CG    1 
ATOM   1359 C  CD1   . LEU A 1 177 ? 47.131  23.425  -0.174  1.00 47.80  ? 176 LEU A CD1   1 
ATOM   1360 C  CD2   . LEU A 1 177 ? 47.648  21.015  -0.627  1.00 52.58  ? 176 LEU A CD2   1 
ATOM   1361 N  N     . PRO A 1 178 ? 50.066  24.925  1.756   1.00 64.12  ? 177 PRO A N     1 
ATOM   1362 C  CA    . PRO A 1 178 ? 50.342  24.926  3.196   1.00 57.26  ? 177 PRO A CA    1 
ATOM   1363 C  C     . PRO A 1 178 ? 49.763  23.685  3.863   1.00 53.70  ? 177 PRO A C     1 
ATOM   1364 O  O     . PRO A 1 178 ? 48.647  23.280  3.540   1.00 55.21  ? 177 PRO A O     1 
ATOM   1365 C  CB    . PRO A 1 178 ? 49.613  26.179  3.692   1.00 55.93  ? 177 PRO A CB    1 
ATOM   1366 C  CG    . PRO A 1 178 ? 49.492  27.052  2.489   1.00 51.76  ? 177 PRO A CG    1 
ATOM   1367 C  CD    . PRO A 1 178 ? 49.298  26.111  1.342   1.00 55.11  ? 177 PRO A CD    1 
ATOM   1368 N  N     . LEU A 1 179 ? 50.519  23.090  4.779   1.00 53.16  ? 178 LEU A N     1 
ATOM   1369 C  CA    . LEU A 1 179 ? 50.095  21.864  5.446   1.00 51.80  ? 178 LEU A CA    1 
ATOM   1370 C  C     . LEU A 1 179 ? 48.852  22.074  6.303   1.00 56.54  ? 178 LEU A C     1 
ATOM   1371 O  O     . LEU A 1 179 ? 48.082  21.142  6.529   1.00 59.41  ? 178 LEU A O     1 
ATOM   1372 C  CB    . LEU A 1 179 ? 51.235  21.302  6.294   1.00 57.05  ? 178 LEU A CB    1 
ATOM   1373 C  CG    . LEU A 1 179 ? 52.464  20.864  5.499   1.00 58.57  ? 178 LEU A CG    1 
ATOM   1374 C  CD1   . LEU A 1 179 ? 53.606  20.512  6.431   1.00 58.53  ? 178 LEU A CD1   1 
ATOM   1375 C  CD2   . LEU A 1 179 ? 52.119  19.687  4.598   1.00 58.93  ? 178 LEU A CD2   1 
ATOM   1376 N  N     . ALA A 1 180 ? 48.655  23.304  6.768   1.00 57.25  ? 179 ALA A N     1 
ATOM   1377 C  CA    . ALA A 1 180 ? 47.493  23.636  7.586   1.00 56.87  ? 179 ALA A CA    1 
ATOM   1378 C  C     . ALA A 1 180 ? 46.204  23.603  6.769   1.00 51.58  ? 179 ALA A C     1 
ATOM   1379 O  O     . ALA A 1 180 ? 45.106  23.598  7.326   1.00 55.95  ? 179 ALA A O     1 
ATOM   1380 C  CB    . ALA A 1 180 ? 47.675  24.996  8.240   1.00 57.53  ? 179 ALA A CB    1 
ATOM   1381 N  N     . LYS A 1 181 ? 46.344  23.582  5.447   1.00 53.75  ? 180 LYS A N     1 
ATOM   1382 C  CA    . LYS A 1 181 ? 45.195  23.503  4.554   1.00 52.88  ? 180 LYS A CA    1 
ATOM   1383 C  C     . LYS A 1 181 ? 44.700  22.064  4.450   1.00 55.23  ? 180 LYS A C     1 
ATOM   1384 O  O     . LYS A 1 181 ? 43.591  21.809  3.980   1.00 54.26  ? 180 LYS A O     1 
ATOM   1385 C  CB    . LYS A 1 181 ? 45.558  24.039  3.168   1.00 54.10  ? 180 LYS A CB    1 
ATOM   1386 C  CG    . LYS A 1 181 ? 44.637  25.138  2.665   1.00 54.05  ? 180 LYS A CG    1 
ATOM   1387 C  CD    . LYS A 1 181 ? 44.588  26.303  3.639   1.00 52.09  ? 180 LYS A CD    1 
ATOM   1388 C  CE    . LYS A 1 181 ? 43.645  27.391  3.149   1.00 61.52  ? 180 LYS A CE    1 
ATOM   1389 N  NZ    . LYS A 1 181 ? 43.449  28.458  4.170   1.00 63.38  ? 180 LYS A NZ    1 
ATOM   1390 N  N     . ILE A 1 182 ? 45.533  21.127  4.894   1.00 53.10  ? 181 ILE A N     1 
ATOM   1391 C  CA    . ILE A 1 182 ? 45.184  19.712  4.874   1.00 51.94  ? 181 ILE A CA    1 
ATOM   1392 C  C     . ILE A 1 182 ? 44.310  19.353  6.070   1.00 49.59  ? 181 ILE A C     1 
ATOM   1393 O  O     . ILE A 1 182 ? 44.664  19.653  7.210   1.00 53.53  ? 181 ILE A O     1 
ATOM   1394 C  CB    . ILE A 1 182 ? 46.443  18.825  4.901   1.00 53.40  ? 181 ILE A CB    1 
ATOM   1395 C  CG1   . ILE A 1 182 ? 47.387  19.199  3.757   1.00 54.81  ? 181 ILE A CG1   1 
ATOM   1396 C  CG2   . ILE A 1 182 ? 46.066  17.352  4.831   1.00 47.39  ? 181 ILE A CG2   1 
ATOM   1397 C  CD1   . ILE A 1 182 ? 48.664  18.389  3.735   1.00 54.77  ? 181 ILE A CD1   1 
ATOM   1398 N  N     . PRO A 1 183 ? 43.158  18.715  5.811   1.00 49.08  ? 182 PRO A N     1 
ATOM   1399 C  CA    . PRO A 1 183 ? 42.259  18.257  6.876   1.00 46.73  ? 182 PRO A CA    1 
ATOM   1400 C  C     . PRO A 1 183 ? 42.970  17.302  7.828   1.00 49.91  ? 182 PRO A C     1 
ATOM   1401 O  O     . PRO A 1 183 ? 43.629  16.364  7.381   1.00 50.50  ? 182 PRO A O     1 
ATOM   1402 C  CB    . PRO A 1 183 ? 41.162  17.516  6.109   1.00 49.78  ? 182 PRO A CB    1 
ATOM   1403 C  CG    . PRO A 1 183 ? 41.167  18.138  4.755   1.00 48.53  ? 182 PRO A CG    1 
ATOM   1404 C  CD    . PRO A 1 183 ? 42.604  18.452  4.471   1.00 49.32  ? 182 PRO A CD    1 
ATOM   1405 N  N     . GLY A 1 184 ? 42.838  17.548  9.127   1.00 54.29  ? 183 GLY A N     1 
ATOM   1406 C  CA    . GLY A 1 184 ? 43.519  16.746  10.126  1.00 47.90  ? 183 GLY A CA    1 
ATOM   1407 C  C     . GLY A 1 184 ? 44.738  17.465  10.667  1.00 54.08  ? 183 GLY A C     1 
ATOM   1408 O  O     . GLY A 1 184 ? 45.325  17.051  11.667  1.00 55.79  ? 183 GLY A O     1 
ATOM   1409 N  N     . VAL A 1 185 ? 45.122  18.546  9.996   1.00 52.66  ? 184 VAL A N     1 
ATOM   1410 C  CA    . VAL A 1 185 ? 46.249  19.359  10.434  1.00 55.71  ? 184 VAL A CA    1 
ATOM   1411 C  C     . VAL A 1 185 ? 45.748  20.660  11.050  1.00 54.59  ? 184 VAL A C     1 
ATOM   1412 O  O     . VAL A 1 185 ? 45.443  21.620  10.340  1.00 57.20  ? 184 VAL A O     1 
ATOM   1413 C  CB    . VAL A 1 185 ? 47.206  19.681  9.270   1.00 53.84  ? 184 VAL A CB    1 
ATOM   1414 C  CG1   . VAL A 1 185 ? 48.411  20.462  9.772   1.00 48.52  ? 184 VAL A CG1   1 
ATOM   1415 C  CG2   . VAL A 1 185 ? 47.648  18.402  8.577   1.00 54.46  ? 184 VAL A CG2   1 
ATOM   1416 N  N     . GLY A 1 186 ? 45.656  20.681  12.375  1.00 47.08  ? 185 GLY A N     1 
ATOM   1417 C  CA    . GLY A 1 186 ? 45.203  21.859  13.091  1.00 54.60  ? 185 GLY A CA    1 
ATOM   1418 C  C     . GLY A 1 186 ? 46.361  22.706  13.580  1.00 55.22  ? 185 GLY A C     1 
ATOM   1419 O  O     . GLY A 1 186 ? 47.469  22.621  13.051  1.00 54.48  ? 185 GLY A O     1 
ATOM   1420 N  N     . LYS A 1 187 ? 46.104  23.517  14.601  1.00 49.86  ? 186 LYS A N     1 
ATOM   1421 C  CA    . LYS A 1 187 ? 47.096  24.458  15.115  1.00 55.62  ? 186 LYS A CA    1 
ATOM   1422 C  C     . LYS A 1 187 ? 48.354  23.783  15.663  1.00 61.92  ? 186 LYS A C     1 
ATOM   1423 O  O     . LYS A 1 187 ? 49.471  24.178  15.328  1.00 61.41  ? 186 LYS A O     1 
ATOM   1424 C  CB    . LYS A 1 187 ? 46.466  25.367  16.176  1.00 64.67  ? 186 LYS A CB    1 
ATOM   1425 C  CG    . LYS A 1 187 ? 45.600  24.637  17.194  1.00 74.56  ? 186 LYS A CG    1 
ATOM   1426 C  CD    . LYS A 1 187 ? 44.857  25.614  18.093  1.00 76.85  ? 186 LYS A CD    1 
ATOM   1427 C  CE    . LYS A 1 187 ? 43.972  24.888  19.095  1.00 62.35  ? 186 LYS A CE    1 
ATOM   1428 N  NZ    . LYS A 1 187 ? 44.764  24.041  20.031  1.00 61.87  ? 186 LYS A NZ    1 
ATOM   1429 N  N     . VAL A 1 188 ? 48.168  22.765  16.498  1.00 58.06  ? 187 VAL A N     1 
ATOM   1430 C  CA    . VAL A 1 188 ? 49.287  22.073  17.131  1.00 59.87  ? 187 VAL A CA    1 
ATOM   1431 C  C     . VAL A 1 188 ? 50.190  21.383  16.109  1.00 63.15  ? 187 VAL A C     1 
ATOM   1432 O  O     . VAL A 1 188 ? 51.412  21.556  16.130  1.00 63.78  ? 187 VAL A O     1 
ATOM   1433 C  CB    . VAL A 1 188 ? 48.794  21.038  18.163  1.00 58.56  ? 187 VAL A CB    1 
ATOM   1434 C  CG1   . VAL A 1 188 ? 49.961  20.226  18.706  1.00 59.08  ? 187 VAL A CG1   1 
ATOM   1435 C  CG2   . VAL A 1 188 ? 48.048  21.734  19.292  1.00 53.62  ? 187 VAL A CG2   1 
ATOM   1436 N  N     . SER A 1 189 ? 49.579  20.609  15.217  1.00 57.88  ? 188 SER A N     1 
ATOM   1437 C  CA    . SER A 1 189 ? 50.319  19.901  14.178  1.00 57.59  ? 188 SER A CA    1 
ATOM   1438 C  C     . SER A 1 189 ? 51.073  20.880  13.288  1.00 58.66  ? 188 SER A C     1 
ATOM   1439 O  O     . SER A 1 189 ? 52.268  20.716  13.046  1.00 64.75  ? 188 SER A O     1 
ATOM   1440 C  CB    . SER A 1 189 ? 49.372  19.055  13.327  1.00 56.43  ? 188 SER A CB    1 
ATOM   1441 O  OG    . SER A 1 189 ? 48.492  18.300  14.142  1.00 62.79  ? 188 SER A OG    1 
ATOM   1442 N  N     . ALA A 1 190 ? 50.366  21.900  12.810  1.00 53.91  ? 189 ALA A N     1 
ATOM   1443 C  CA    . ALA A 1 190 ? 50.959  22.902  11.932  1.00 57.66  ? 189 ALA A CA    1 
ATOM   1444 C  C     . ALA A 1 190 ? 52.101  23.645  12.615  1.00 60.78  ? 189 ALA A C     1 
ATOM   1445 O  O     . ALA A 1 190 ? 53.061  24.044  11.962  1.00 62.50  ? 189 ALA A O     1 
ATOM   1446 C  CB    . ALA A 1 190 ? 49.903  23.884  11.446  1.00 49.33  ? 189 ALA A CB    1 
ATOM   1447 N  N     . ALA A 1 191 ? 51.993  23.829  13.927  1.00 62.79  ? 190 ALA A N     1 
ATOM   1448 C  CA    . ALA A 1 191 ? 53.041  24.497  14.691  1.00 65.59  ? 190 ALA A CA    1 
ATOM   1449 C  C     . ALA A 1 191 ? 54.253  23.587  14.855  1.00 62.18  ? 190 ALA A C     1 
ATOM   1450 O  O     . ALA A 1 191 ? 55.394  24.050  14.867  1.00 68.48  ? 190 ALA A O     1 
ATOM   1451 C  CB    . ALA A 1 191 ? 52.517  24.936  16.048  1.00 61.65  ? 190 ALA A CB    1 
ATOM   1452 N  N     . LYS A 1 192 ? 53.994  22.291  14.987  1.00 57.30  ? 191 LYS A N     1 
ATOM   1453 C  CA    . LYS A 1 192 ? 55.059  21.300  15.076  1.00 59.10  ? 191 LYS A CA    1 
ATOM   1454 C  C     . LYS A 1 192 ? 55.845  21.282  13.766  1.00 69.11  ? 191 LYS A C     1 
ATOM   1455 O  O     . LYS A 1 192 ? 57.076  21.410  13.759  1.00 74.35  ? 191 LYS A O     1 
ATOM   1456 C  CB    . LYS A 1 192 ? 54.460  19.922  15.354  1.00 61.04  ? 191 LYS A CB    1 
ATOM   1457 C  CG    . LYS A 1 192 ? 55.304  19.028  16.245  1.00 55.93  ? 191 LYS A CG    1 
ATOM   1458 C  CD    . LYS A 1 192 ? 54.449  18.416  17.344  1.00 62.36  ? 191 LYS A CD    1 
ATOM   1459 C  CE    . LYS A 1 192 ? 53.183  17.792  16.774  1.00 66.26  ? 191 LYS A CE    1 
ATOM   1460 N  NZ    . LYS A 1 192 ? 52.221  17.394  17.839  1.00 73.94  ? 191 LYS A NZ    1 
ATOM   1461 N  N     . LEU A 1 193 ? 55.117  21.131  12.662  1.00 62.89  ? 192 LEU A N     1 
ATOM   1462 C  CA    . LEU A 1 193 ? 55.703  21.159  11.325  1.00 66.48  ? 192 LEU A CA    1 
ATOM   1463 C  C     . LEU A 1 193 ? 56.479  22.450  11.089  1.00 70.33  ? 192 LEU A C     1 
ATOM   1464 O  O     . LEU A 1 193 ? 57.601  22.428  10.583  1.00 70.13  ? 192 LEU A O     1 
ATOM   1465 C  CB    . LEU A 1 193 ? 54.613  21.017  10.256  1.00 66.90  ? 192 LEU A CB    1 
ATOM   1466 C  CG    . LEU A 1 193 ? 54.054  19.633  9.904   1.00 69.73  ? 192 LEU A CG    1 
ATOM   1467 C  CD1   . LEU A 1 193 ? 54.727  18.524  10.695  1.00 69.85  ? 192 LEU A CD1   1 
ATOM   1468 C  CD2   . LEU A 1 193 ? 52.541  19.591  10.085  1.00 58.69  ? 192 LEU A CD2   1 
ATOM   1469 N  N     . GLU A 1 194 ? 55.864  23.571  11.459  1.00 71.80  ? 193 GLU A N     1 
ATOM   1470 C  CA    . GLU A 1 194 ? 56.477  24.888  11.327  1.00 69.65  ? 193 GLU A CA    1 
ATOM   1471 C  C     . GLU A 1 194 ? 57.801  24.945  12.076  1.00 70.63  ? 193 GLU A C     1 
ATOM   1472 O  O     . GLU A 1 194 ? 58.796  25.456  11.562  1.00 73.24  ? 193 GLU A O     1 
ATOM   1473 C  CB    . GLU A 1 194 ? 55.535  25.966  11.869  1.00 69.57  ? 193 GLU A CB    1 
ATOM   1474 C  CG    . GLU A 1 194 ? 56.100  27.377  11.828  1.00 74.72  ? 193 GLU A CG    1 
ATOM   1475 C  CD    . GLU A 1 194 ? 56.117  27.960  10.430  1.00 83.60  ? 193 GLU A CD    1 
ATOM   1476 O  OE1   . GLU A 1 194 ? 55.400  27.433  9.553   1.00 83.61  ? 193 GLU A OE1   1 
ATOM   1477 O  OE2   . GLU A 1 194 ? 56.848  28.949  10.207  1.00 89.65  ? 193 GLU A OE2   1 
ATOM   1478 N  N     . ALA A 1 195 ? 57.804  24.411  13.293  1.00 71.23  ? 194 ALA A N     1 
ATOM   1479 C  CA    . ALA A 1 195 ? 59.009  24.369  14.108  1.00 70.98  ? 194 ALA A CA    1 
ATOM   1480 C  C     . ALA A 1 195 ? 60.060  23.464  13.476  1.00 69.35  ? 194 ALA A C     1 
ATOM   1481 O  O     . ALA A 1 195 ? 61.259  23.658  13.679  1.00 75.78  ? 194 ALA A O     1 
ATOM   1482 C  CB    . ALA A 1 195 ? 58.683  23.906  15.519  1.00 66.22  ? 194 ALA A CB    1 
ATOM   1483 N  N     . MET A 1 196 ? 59.609  22.475  12.709  1.00 62.92  ? 195 MET A N     1 
ATOM   1484 C  CA    . MET A 1 196 ? 60.535  21.598  12.000  1.00 67.47  ? 195 MET A CA    1 
ATOM   1485 C  C     . MET A 1 196 ? 60.917  22.151  10.627  1.00 69.03  ? 195 MET A C     1 
ATOM   1486 O  O     . MET A 1 196 ? 61.608  21.488  9.854   1.00 69.06  ? 195 MET A O     1 
ATOM   1487 C  CB    . MET A 1 196 ? 59.954  20.192  11.853  1.00 72.87  ? 195 MET A CB    1 
ATOM   1488 C  CG    . MET A 1 196 ? 59.629  19.512  13.168  1.00 75.46  ? 195 MET A CG    1 
ATOM   1489 S  SD    . MET A 1 196 ? 59.415  17.737  12.955  1.00 82.20  ? 195 MET A SD    1 
ATOM   1490 C  CE    . MET A 1 196 ? 58.510  17.698  11.411  1.00 77.63  ? 195 MET A CE    1 
ATOM   1491 N  N     . GLY A 1 197 ? 60.461  23.364  10.330  1.00 73.18  ? 196 GLY A N     1 
ATOM   1492 C  CA    . GLY A 1 197 ? 60.790  24.015  9.074   1.00 72.27  ? 196 GLY A CA    1 
ATOM   1493 C  C     . GLY A 1 197 ? 59.930  23.561  7.911   1.00 71.53  ? 196 GLY A C     1 
ATOM   1494 O  O     . GLY A 1 197 ? 60.261  23.804  6.751   1.00 70.95  ? 196 GLY A O     1 
ATOM   1495 N  N     . LEU A 1 198 ? 58.819  22.901  8.222   1.00 69.80  ? 197 LEU A N     1 
ATOM   1496 C  CA    . LEU A 1 198 ? 57.906  22.416  7.195   1.00 68.38  ? 197 LEU A CA    1 
ATOM   1497 C  C     . LEU A 1 198 ? 56.631  23.250  7.176   1.00 69.09  ? 197 LEU A C     1 
ATOM   1498 O  O     . LEU A 1 198 ? 55.917  23.332  8.176   1.00 67.13  ? 197 LEU A O     1 
ATOM   1499 C  CB    . LEU A 1 198 ? 57.563  20.944  7.435   1.00 70.54  ? 197 LEU A CB    1 
ATOM   1500 C  CG    . LEU A 1 198 ? 58.735  19.994  7.694   1.00 72.56  ? 197 LEU A CG    1 
ATOM   1501 C  CD1   . LEU A 1 198 ? 58.246  18.556  7.803   1.00 67.39  ? 197 LEU A CD1   1 
ATOM   1502 C  CD2   . LEU A 1 198 ? 59.796  20.125  6.611   1.00 68.38  ? 197 LEU A CD2   1 
ATOM   1503 N  N     . ARG A 1 199 ? 56.348  23.870  6.035   1.00 68.14  ? 198 ARG A N     1 
ATOM   1504 C  CA    . ARG A 1 199 ? 55.157  24.699  5.903   1.00 67.36  ? 198 ARG A CA    1 
ATOM   1505 C  C     . ARG A 1 199 ? 54.256  24.195  4.784   1.00 59.95  ? 198 ARG A C     1 
ATOM   1506 O  O     . ARG A 1 199 ? 53.032  24.210  4.905   1.00 58.23  ? 198 ARG A O     1 
ATOM   1507 C  CB    . ARG A 1 199 ? 55.540  26.158  5.647   1.00 64.83  ? 198 ARG A CB    1 
ATOM   1508 C  CG    . ARG A 1 199 ? 54.392  27.138  5.834   1.00 65.27  ? 198 ARG A CG    1 
ATOM   1509 C  CD    . ARG A 1 199 ? 54.799  28.551  5.454   1.00 65.63  ? 198 ARG A CD    1 
ATOM   1510 N  NE    . ARG A 1 199 ? 54.952  28.705  4.011   1.00 65.52  ? 198 ARG A NE    1 
ATOM   1511 C  CZ    . ARG A 1 199 ? 53.962  29.040  3.190   1.00 66.93  ? 198 ARG A CZ    1 
ATOM   1512 N  NH1   . ARG A 1 199 ? 52.745  29.256  3.671   1.00 70.22  ? 198 ARG A NH1   1 
ATOM   1513 N  NH2   . ARG A 1 199 ? 54.187  29.159  1.889   1.00 60.38  ? 198 ARG A NH2   1 
ATOM   1514 N  N     . THR A 1 200 ? 54.870  23.742  3.696   1.00 66.23  ? 199 THR A N     1 
ATOM   1515 C  CA    . THR A 1 200 ? 54.121  23.306  2.525   1.00 67.44  ? 199 THR A CA    1 
ATOM   1516 C  C     . THR A 1 200 ? 54.239  21.804  2.293   1.00 61.83  ? 199 THR A C     1 
ATOM   1517 O  O     . THR A 1 200 ? 55.070  21.133  2.905   1.00 62.96  ? 199 THR A O     1 
ATOM   1518 C  CB    . THR A 1 200 ? 54.601  24.028  1.255   1.00 62.24  ? 199 THR A CB    1 
ATOM   1519 O  OG1   . THR A 1 200 ? 55.935  23.610  0.942   1.00 61.42  ? 199 THR A OG1   1 
ATOM   1520 C  CG2   . THR A 1 200 ? 54.576  25.535  1.456   1.00 58.52  ? 199 THR A CG2   1 
ATOM   1521 N  N     . CYS A 1 201 ? 53.400  21.283  1.402   1.00 60.67  ? 200 CYS A N     1 
ATOM   1522 C  CA    . CYS A 1 201 ? 53.483  19.886  1.002   1.00 58.73  ? 200 CYS A CA    1 
ATOM   1523 C  C     . CYS A 1 201 ? 54.792  19.642  0.259   1.00 63.26  ? 200 CYS A C     1 
ATOM   1524 O  O     . CYS A 1 201 ? 55.403  18.579  0.387   1.00 65.94  ? 200 CYS A O     1 
ATOM   1525 C  CB    . CYS A 1 201 ? 52.292  19.500  0.121   1.00 59.05  ? 200 CYS A CB    1 
ATOM   1526 S  SG    . CYS A 1 201 ? 50.684  19.561  0.945   1.00 60.80  ? 200 CYS A SG    1 
ATOM   1527 N  N     . GLY A 1 202 ? 55.218  20.640  -0.510  1.00 64.70  ? 201 GLY A N     1 
ATOM   1528 C  CA    . GLY A 1 202 ? 56.477  20.574  -1.229  1.00 66.55  ? 201 GLY A CA    1 
ATOM   1529 C  C     . GLY A 1 202 ? 57.663  20.444  -0.293  1.00 66.77  ? 201 GLY A C     1 
ATOM   1530 O  O     . GLY A 1 202 ? 58.675  19.837  -0.642  1.00 71.80  ? 201 GLY A O     1 
ATOM   1531 N  N     . ASP A 1 203 ? 57.538  21.019  0.900   1.00 64.12  ? 202 ASP A N     1 
ATOM   1532 C  CA    . ASP A 1 203 ? 58.569  20.890  1.923   1.00 65.27  ? 202 ASP A CA    1 
ATOM   1533 C  C     . ASP A 1 203 ? 58.636  19.457  2.437   1.00 63.42  ? 202 ASP A C     1 
ATOM   1534 O  O     . ASP A 1 203 ? 59.701  18.970  2.814   1.00 69.41  ? 202 ASP A O     1 
ATOM   1535 C  CB    . ASP A 1 203 ? 58.297  21.843  3.089   1.00 64.61  ? 202 ASP A CB    1 
ATOM   1536 C  CG    . ASP A 1 203 ? 58.595  23.288  2.744   1.00 66.07  ? 202 ASP A CG    1 
ATOM   1537 O  OD1   . ASP A 1 203 ? 59.476  23.527  1.893   1.00 72.74  ? 202 ASP A OD1   1 
ATOM   1538 O  OD2   . ASP A 1 203 ? 57.951  24.185  3.329   1.00 66.96  ? 202 ASP A OD2   1 
ATOM   1539 N  N     . VAL A 1 204 ? 57.488  18.786  2.444   1.00 62.69  ? 203 VAL A N     1 
ATOM   1540 C  CA    . VAL A 1 204 ? 57.390  17.425  2.956   1.00 65.72  ? 203 VAL A CA    1 
ATOM   1541 C  C     . VAL A 1 204 ? 57.833  16.403  1.910   1.00 68.65  ? 203 VAL A C     1 
ATOM   1542 O  O     . VAL A 1 204 ? 58.331  15.329  2.249   1.00 67.64  ? 203 VAL A O     1 
ATOM   1543 C  CB    . VAL A 1 204 ? 55.952  17.112  3.421   1.00 68.09  ? 203 VAL A CB    1 
ATOM   1544 C  CG1   . VAL A 1 204 ? 55.875  15.736  4.067   1.00 68.03  ? 203 VAL A CG1   1 
ATOM   1545 C  CG2   . VAL A 1 204 ? 55.475  18.176  4.390   1.00 64.17  ? 203 VAL A CG2   1 
ATOM   1546 N  N     . GLN A 1 205 ? 57.661  16.746  0.638   1.00 72.40  ? 204 GLN A N     1 
ATOM   1547 C  CA    . GLN A 1 205 ? 58.067  15.859  -0.449  1.00 69.40  ? 204 GLN A CA    1 
ATOM   1548 C  C     . GLN A 1 205 ? 59.572  15.593  -0.447  1.00 73.01  ? 204 GLN A C     1 
ATOM   1549 O  O     . GLN A 1 205 ? 60.024  14.535  -0.883  1.00 73.88  ? 204 GLN A O     1 
ATOM   1550 C  CB    . GLN A 1 205 ? 57.632  16.431  -1.798  1.00 65.24  ? 204 GLN A CB    1 
ATOM   1551 C  CG    . GLN A 1 205 ? 56.126  16.492  -1.976  1.00 68.60  ? 204 GLN A CG    1 
ATOM   1552 C  CD    . GLN A 1 205 ? 55.716  17.256  -3.216  1.00 68.13  ? 204 GLN A CD    1 
ATOM   1553 O  OE1   . GLN A 1 205 ? 56.557  17.811  -3.924  1.00 69.72  ? 204 GLN A OE1   1 
ATOM   1554 N  NE2   . GLN A 1 205 ? 54.417  17.292  -3.486  1.00 69.22  ? 204 GLN A NE2   1 
ATOM   1555 N  N     . ALA A 1 206 ? 60.340  16.558  0.049   1.00 67.71  ? 205 ALA A N     1 
ATOM   1556 C  CA    . ALA A 1 206 ? 61.786  16.409  0.148   1.00 70.27  ? 205 ALA A CA    1 
ATOM   1557 C  C     . ALA A 1 206 ? 62.199  16.025  1.567   1.00 72.41  ? 205 ALA A C     1 
ATOM   1558 O  O     . ALA A 1 206 ? 63.266  16.416  2.037   1.00 71.15  ? 205 ALA A O     1 
ATOM   1559 C  CB    . ALA A 1 206 ? 62.483  17.693  -0.279  1.00 66.89  ? 205 ALA A CB    1 
ATOM   1560 N  N     . CYS A 1 207 ? 61.349  15.259  2.245   1.00 73.93  ? 206 CYS A N     1 
ATOM   1561 C  CA    . CYS A 1 207 ? 61.617  14.847  3.621   1.00 68.94  ? 206 CYS A CA    1 
ATOM   1562 C  C     . CYS A 1 207 ? 61.780  13.335  3.767   1.00 72.01  ? 206 CYS A C     1 
ATOM   1563 O  O     . CYS A 1 207 ? 61.295  12.564  2.937   1.00 71.82  ? 206 CYS A O     1 
ATOM   1564 C  CB    . CYS A 1 207 ? 60.511  15.342  4.558   1.00 68.46  ? 206 CYS A CB    1 
ATOM   1565 S  SG    . CYS A 1 207 ? 60.962  16.784  5.549   1.00 85.01  ? 206 CYS A SG    1 
ATOM   1566 N  N     . ASP A 1 208 ? 62.462  12.924  4.833   1.00 75.57  ? 207 ASP A N     1 
ATOM   1567 C  CA    . ASP A 1 208 ? 62.646  11.508  5.138   1.00 70.69  ? 207 ASP A CA    1 
ATOM   1568 C  C     . ASP A 1 208 ? 61.396  10.935  5.793   1.00 66.20  ? 207 ASP A C     1 
ATOM   1569 O  O     . ASP A 1 208 ? 60.975  11.407  6.852   1.00 72.69  ? 207 ASP A O     1 
ATOM   1570 C  CB    . ASP A 1 208 ? 63.854  11.323  6.057   1.00 67.27  ? 207 ASP A CB    1 
ATOM   1571 C  CG    . ASP A 1 208 ? 64.019  9.895   6.536   1.00 75.02  ? 207 ASP A CG    1 
ATOM   1572 O  OD1   . ASP A 1 208 ? 64.466  9.718   7.685   1.00 80.53  ? 207 ASP A OD1   1 
ATOM   1573 O  OD2   . ASP A 1 208 ? 63.727  8.951   5.772   1.00 74.72  ? 207 ASP A OD2   1 
ATOM   1574 N  N     . LEU A 1 209 ? 60.813  9.922   5.154   1.00 62.73  ? 208 LEU A N     1 
ATOM   1575 C  CA    . LEU A 1 209 ? 59.602  9.273   5.647   1.00 65.37  ? 208 LEU A CA    1 
ATOM   1576 C  C     . LEU A 1 209 ? 59.815  8.650   7.025   1.00 70.41  ? 208 LEU A C     1 
ATOM   1577 O  O     . LEU A 1 209 ? 58.910  8.645   7.865   1.00 65.39  ? 208 LEU A O     1 
ATOM   1578 C  CB    . LEU A 1 209 ? 59.134  8.209   4.651   1.00 58.70  ? 208 LEU A CB    1 
ATOM   1579 C  CG    . LEU A 1 209 ? 57.912  7.371   5.025   1.00 58.26  ? 208 LEU A CG    1 
ATOM   1580 C  CD1   . LEU A 1 209 ? 56.693  8.260   5.232   1.00 63.32  ? 208 LEU A CD1   1 
ATOM   1581 C  CD2   . LEU A 1 209 ? 57.630  6.310   3.968   1.00 60.44  ? 208 LEU A CD2   1 
ATOM   1582 N  N     . VAL A 1 210 ? 61.019  8.130   7.246   1.00 70.88  ? 209 VAL A N     1 
ATOM   1583 C  CA    . VAL A 1 210 ? 61.372  7.507   8.514   1.00 70.66  ? 209 VAL A CA    1 
ATOM   1584 C  C     . VAL A 1 210 ? 61.259  8.501   9.668   1.00 72.30  ? 209 VAL A C     1 
ATOM   1585 O  O     . VAL A 1 210 ? 60.728  8.171   10.728  1.00 70.41  ? 209 VAL A O     1 
ATOM   1586 C  CB    . VAL A 1 210 ? 62.800  6.927   8.477   1.00 71.11  ? 209 VAL A CB    1 
ATOM   1587 C  CG1   . VAL A 1 210 ? 63.082  6.132   9.740   1.00 71.92  ? 209 VAL A CG1   1 
ATOM   1588 C  CG2   . VAL A 1 210 ? 62.988  6.053   7.248   1.00 66.33  ? 209 VAL A CG2   1 
ATOM   1589 N  N     . MET A 1 211 ? 61.757  9.717   9.455   1.00 72.67  ? 210 MET A N     1 
ATOM   1590 C  CA    . MET A 1 211 ? 61.669  10.781  10.454  1.00 76.14  ? 210 MET A CA    1 
ATOM   1591 C  C     . MET A 1 211 ? 60.216  11.091  10.801  1.00 76.63  ? 210 MET A C     1 
ATOM   1592 O  O     . MET A 1 211 ? 59.854  11.172  11.977  1.00 79.69  ? 210 MET A O     1 
ATOM   1593 C  CB    . MET A 1 211 ? 62.366  12.045  9.943   1.00 73.28  ? 210 MET A CB    1 
ATOM   1594 C  CG    . MET A 1 211 ? 62.152  13.270  10.811  1.00 76.76  ? 210 MET A CG    1 
ATOM   1595 S  SD    . MET A 1 211 ? 61.498  14.681  9.894   1.00 89.63  ? 210 MET A SD    1 
ATOM   1596 C  CE    . MET A 1 211 ? 62.721  14.858  8.594   1.00 82.80  ? 210 MET A CE    1 
ATOM   1597 N  N     . LEU A 1 212 ? 59.392  11.260  9.771   1.00 69.12  ? 211 LEU A N     1 
ATOM   1598 C  CA    . LEU A 1 212 ? 57.973  11.542  9.961   1.00 68.49  ? 211 LEU A CA    1 
ATOM   1599 C  C     . LEU A 1 212 ? 57.283  10.437  10.752  1.00 70.06  ? 211 LEU A C     1 
ATOM   1600 O  O     . LEU A 1 212 ? 56.494  10.714  11.658  1.00 71.32  ? 211 LEU A O     1 
ATOM   1601 C  CB    . LEU A 1 212 ? 57.279  11.745  8.613   1.00 68.62  ? 211 LEU A CB    1 
ATOM   1602 C  CG    . LEU A 1 212 ? 57.065  13.189  8.154   1.00 66.94  ? 211 LEU A CG    1 
ATOM   1603 C  CD1   . LEU A 1 212 ? 58.367  13.978  8.175   1.00 69.40  ? 211 LEU A CD1   1 
ATOM   1604 C  CD2   . LEU A 1 212 ? 56.447  13.216  6.765   1.00 71.52  ? 211 LEU A CD2   1 
ATOM   1605 N  N     . LEU A 1 213 ? 57.588  9.189   10.409  1.00 69.55  ? 212 LEU A N     1 
ATOM   1606 C  CA    . LEU A 1 213 ? 57.056  8.046   11.142  1.00 71.60  ? 212 LEU A CA    1 
ATOM   1607 C  C     . LEU A 1 213 ? 57.506  8.070   12.601  1.00 72.50  ? 212 LEU A C     1 
ATOM   1608 O  O     . LEU A 1 213 ? 56.746  7.708   13.498  1.00 74.50  ? 212 LEU A O     1 
ATOM   1609 C  CB    . LEU A 1 213 ? 57.481  6.737   10.476  1.00 68.20  ? 212 LEU A CB    1 
ATOM   1610 C  CG    . LEU A 1 213 ? 56.802  6.397   9.147   1.00 72.27  ? 212 LEU A CG    1 
ATOM   1611 C  CD1   . LEU A 1 213 ? 57.477  5.203   8.493   1.00 60.07  ? 212 LEU A CD1   1 
ATOM   1612 C  CD2   . LEU A 1 213 ? 55.319  6.126   9.358   1.00 63.10  ? 212 LEU A CD2   1 
ATOM   1613 N  N     . LYS A 1 214 ? 58.744  8.500   12.830  1.00 72.62  ? 213 LYS A N     1 
ATOM   1614 C  CA    . LYS A 1 214 ? 59.284  8.612   14.181  1.00 77.04  ? 213 LYS A CA    1 
ATOM   1615 C  C     . LYS A 1 214 ? 58.525  9.645   15.007  1.00 77.83  ? 213 LYS A C     1 
ATOM   1616 O  O     . LYS A 1 214 ? 57.999  9.336   16.076  1.00 76.16  ? 213 LYS A O     1 
ATOM   1617 C  CB    . LYS A 1 214 ? 60.763  9.001   14.138  1.00 78.15  ? 213 LYS A CB    1 
ATOM   1618 C  CG    . LYS A 1 214 ? 61.724  7.888   13.757  1.00 75.66  ? 213 LYS A CG    1 
ATOM   1619 C  CD    . LYS A 1 214 ? 63.125  8.453   13.561  1.00 84.05  ? 213 LYS A CD    1 
ATOM   1620 C  CE    . LYS A 1 214 ? 64.177  7.641   14.301  1.00 95.10  ? 213 LYS A CE    1 
ATOM   1621 N  NZ    . LYS A 1 214 ? 64.388  6.299   13.695  1.00 85.66  ? 213 LYS A NZ    1 
ATOM   1622 N  N     . ARG A 1 215 ? 58.469  10.873  14.501  1.00 74.67  ? 214 ARG A N     1 
ATOM   1623 C  CA    . ARG A 1 215 ? 57.949  11.997  15.272  1.00 68.03  ? 214 ARG A CA    1 
ATOM   1624 C  C     . ARG A 1 215 ? 56.424  12.081  15.311  1.00 77.69  ? 214 ARG A C     1 
ATOM   1625 O  O     . ARG A 1 215 ? 55.865  12.761  16.171  1.00 86.10  ? 214 ARG A O     1 
ATOM   1626 C  CB    . ARG A 1 215 ? 58.517  13.317  14.746  1.00 71.56  ? 214 ARG A CB    1 
ATOM   1627 C  CG    . ARG A 1 215 ? 60.020  13.321  14.531  1.00 78.32  ? 214 ARG A CG    1 
ATOM   1628 C  CD    . ARG A 1 215 ? 60.561  14.740  14.563  1.00 82.38  ? 214 ARG A CD    1 
ATOM   1629 N  NE    . ARG A 1 215 ? 61.765  14.899  13.753  1.00 91.63  ? 214 ARG A NE    1 
ATOM   1630 C  CZ    . ARG A 1 215 ? 62.508  16.001  13.732  1.00 96.00  ? 214 ARG A CZ    1 
ATOM   1631 N  NH1   . ARG A 1 215 ? 62.176  17.040  14.487  1.00 89.88  ? 214 ARG A NH1   1 
ATOM   1632 N  NH2   . ARG A 1 215 ? 63.586  16.064  12.963  1.00 96.08  ? 214 ARG A NH2   1 
ATOM   1633 N  N     . PHE A 1 216 ? 55.749  11.402  14.389  1.00 72.66  ? 215 PHE A N     1 
ATOM   1634 C  CA    . PHE A 1 216 ? 54.297  11.535  14.292  1.00 67.46  ? 215 PHE A CA    1 
ATOM   1635 C  C     . PHE A 1 216 ? 53.542  10.211  14.240  1.00 70.76  ? 215 PHE A C     1 
ATOM   1636 O  O     . PHE A 1 216 ? 52.334  10.174  14.472  1.00 68.47  ? 215 PHE A O     1 
ATOM   1637 C  CB    . PHE A 1 216 ? 53.921  12.397  13.085  1.00 67.53  ? 215 PHE A CB    1 
ATOM   1638 C  CG    . PHE A 1 216 ? 54.470  13.790  13.145  1.00 68.54  ? 215 PHE A CG    1 
ATOM   1639 C  CD1   . PHE A 1 216 ? 55.666  14.104  12.525  1.00 69.59  ? 215 PHE A CD1   1 
ATOM   1640 C  CD2   . PHE A 1 216 ? 53.794  14.786  13.830  1.00 71.10  ? 215 PHE A CD2   1 
ATOM   1641 C  CE1   . PHE A 1 216 ? 56.175  15.384  12.582  1.00 69.14  ? 215 PHE A CE1   1 
ATOM   1642 C  CE2   . PHE A 1 216 ? 54.298  16.069  13.889  1.00 69.16  ? 215 PHE A CE2   1 
ATOM   1643 C  CZ    . PHE A 1 216 ? 55.492  16.368  13.267  1.00 68.46  ? 215 PHE A CZ    1 
ATOM   1644 N  N     . GLY A 1 217 ? 54.247  9.127   13.936  1.00 74.51  ? 216 GLY A N     1 
ATOM   1645 C  CA    . GLY A 1 217 ? 53.606  7.832   13.807  1.00 69.01  ? 216 GLY A CA    1 
ATOM   1646 C  C     . GLY A 1 217 ? 52.769  7.758   12.546  1.00 70.19  ? 216 GLY A C     1 
ATOM   1647 O  O     . GLY A 1 217 ? 53.259  8.037   11.452  1.00 72.56  ? 216 GLY A O     1 
ATOM   1648 N  N     . LYS A 1 218 ? 51.502  7.387   12.699  1.00 68.01  ? 217 LYS A N     1 
ATOM   1649 C  CA    . LYS A 1 218 ? 50.592  7.280   11.564  1.00 67.06  ? 217 LYS A CA    1 
ATOM   1650 C  C     . LYS A 1 218 ? 50.383  8.634   10.892  1.00 70.25  ? 217 LYS A C     1 
ATOM   1651 O  O     . LYS A 1 218 ? 50.278  8.725   9.665   1.00 70.18  ? 217 LYS A O     1 
ATOM   1652 C  CB    . LYS A 1 218 ? 49.251  6.699   12.010  1.00 60.12  ? 217 LYS A CB    1 
ATOM   1653 C  CG    . LYS A 1 218 ? 48.201  6.668   10.920  1.00 60.60  ? 217 LYS A CG    1 
ATOM   1654 C  CD    . LYS A 1 218 ? 46.957  5.931   11.370  1.00 61.82  ? 217 LYS A CD    1 
ATOM   1655 C  CE    . LYS A 1 218 ? 45.930  5.884   10.256  1.00 59.18  ? 217 LYS A CE    1 
ATOM   1656 N  NZ    . LYS A 1 218 ? 46.475  5.267   9.018   1.00 62.70  ? 217 LYS A NZ    1 
ATOM   1657 N  N     . PHE A 1 219 ? 50.333  9.682   11.710  1.00 68.42  ? 218 PHE A N     1 
ATOM   1658 C  CA    . PHE A 1 219 ? 50.154  11.046  11.225  1.00 65.96  ? 218 PHE A CA    1 
ATOM   1659 C  C     . PHE A 1 219 ? 51.247  11.434  10.236  1.00 64.66  ? 218 PHE A C     1 
ATOM   1660 O  O     . PHE A 1 219 ? 50.992  12.155  9.274   1.00 64.25  ? 218 PHE A O     1 
ATOM   1661 C  CB    . PHE A 1 219 ? 50.135  12.028  12.399  1.00 64.17  ? 218 PHE A CB    1 
ATOM   1662 C  CG    . PHE A 1 219 ? 49.909  13.459  11.995  1.00 63.12  ? 218 PHE A CG    1 
ATOM   1663 C  CD1   . PHE A 1 219 ? 48.625  13.957  11.855  1.00 67.20  ? 218 PHE A CD1   1 
ATOM   1664 C  CD2   . PHE A 1 219 ? 50.980  14.308  11.767  1.00 62.67  ? 218 PHE A CD2   1 
ATOM   1665 C  CE1   . PHE A 1 219 ? 48.412  15.273  11.488  1.00 63.16  ? 218 PHE A CE1   1 
ATOM   1666 C  CE2   . PHE A 1 219 ? 50.775  15.624  11.399  1.00 64.20  ? 218 PHE A CE2   1 
ATOM   1667 C  CZ    . PHE A 1 219 ? 49.489  16.107  11.260  1.00 62.26  ? 218 PHE A CZ    1 
ATOM   1668 N  N     . GLY A 1 220 ? 52.463  10.956  10.480  1.00 64.96  ? 219 GLY A N     1 
ATOM   1669 C  CA    . GLY A 1 220 ? 53.583  11.232  9.600   1.00 61.28  ? 219 GLY A CA    1 
ATOM   1670 C  C     . GLY A 1 220 ? 53.409  10.567  8.249   1.00 64.87  ? 219 GLY A C     1 
ATOM   1671 O  O     . GLY A 1 220 ? 53.651  11.180  7.205   1.00 68.24  ? 219 GLY A O     1 
ATOM   1672 N  N     . ARG A 1 221 ? 52.988  9.306   8.274   1.00 65.96  ? 220 ARG A N     1 
ATOM   1673 C  CA    . ARG A 1 221 ? 52.722  8.563   7.050   1.00 64.91  ? 220 ARG A CA    1 
ATOM   1674 C  C     . ARG A 1 221 ? 51.635  9.237   6.227   1.00 63.22  ? 220 ARG A C     1 
ATOM   1675 O  O     . ARG A 1 221 ? 51.806  9.462   5.032   1.00 65.04  ? 220 ARG A O     1 
ATOM   1676 C  CB    . ARG A 1 221 ? 52.318  7.122   7.362   1.00 64.94  ? 220 ARG A CB    1 
ATOM   1677 C  CG    . ARG A 1 221 ? 51.629  6.422   6.201   1.00 62.13  ? 220 ARG A CG    1 
ATOM   1678 C  CD    . ARG A 1 221 ? 51.659  4.915   6.364   1.00 59.01  ? 220 ARG A CD    1 
ATOM   1679 N  NE    . ARG A 1 221 ? 53.024  4.419   6.506   1.00 56.83  ? 220 ARG A NE    1 
ATOM   1680 C  CZ    . ARG A 1 221 ? 53.871  4.259   5.494   1.00 55.75  ? 220 ARG A CZ    1 
ATOM   1681 N  NH1   . ARG A 1 221 ? 53.496  4.560   4.258   1.00 59.99  ? 220 ARG A NH1   1 
ATOM   1682 N  NH2   . ARG A 1 221 ? 55.095  3.802   5.718   1.00 53.67  ? 220 ARG A NH2   1 
ATOM   1683 N  N     . ILE A 1 222 ? 50.519  9.558   6.873   1.00 56.94  ? 221 ILE A N     1 
ATOM   1684 C  CA    . ILE A 1 222 ? 49.409  10.216  6.194   1.00 60.55  ? 221 ILE A CA    1 
ATOM   1685 C  C     . ILE A 1 222 ? 49.830  11.576  5.631   1.00 60.87  ? 221 ILE A C     1 
ATOM   1686 O  O     . ILE A 1 222 ? 49.448  11.950  4.514   1.00 64.84  ? 221 ILE A O     1 
ATOM   1687 C  CB    . ILE A 1 222 ? 48.199  10.378  7.135   1.00 57.36  ? 221 ILE A CB    1 
ATOM   1688 C  CG1   . ILE A 1 222 ? 47.702  9.005   7.594   1.00 56.87  ? 221 ILE A CG1   1 
ATOM   1689 C  CG2   . ILE A 1 222 ? 47.082  11.138  6.450   1.00 53.45  ? 221 ILE A CG2   1 
ATOM   1690 C  CD1   . ILE A 1 222 ? 46.405  9.051   8.373   1.00 61.07  ? 221 ILE A CD1   1 
ATOM   1691 N  N     . LEU A 1 223 ? 50.637  12.298  6.405   1.00 55.94  ? 222 LEU A N     1 
ATOM   1692 C  CA    . LEU A 1 223 ? 51.131  13.605  5.990   1.00 59.49  ? 222 LEU A CA    1 
ATOM   1693 C  C     . LEU A 1 223 ? 51.967  13.477  4.723   1.00 65.19  ? 222 LEU A C     1 
ATOM   1694 O  O     . LEU A 1 223 ? 51.763  14.218  3.765   1.00 69.13  ? 222 LEU A O     1 
ATOM   1695 C  CB    . LEU A 1 223 ? 51.962  14.252  7.100   1.00 58.45  ? 222 LEU A CB    1 
ATOM   1696 C  CG    . LEU A 1 223 ? 52.117  15.773  7.015   1.00 64.56  ? 222 LEU A CG    1 
ATOM   1697 C  CD1   . LEU A 1 223 ? 50.873  16.472  7.551   1.00 60.11  ? 222 LEU A CD1   1 
ATOM   1698 C  CD2   . LEU A 1 223 ? 53.366  16.244  7.747   1.00 68.73  ? 222 LEU A CD2   1 
ATOM   1699 N  N     . TRP A 1 224 ? 52.898  12.526  4.727   1.00 66.33  ? 223 TRP A N     1 
ATOM   1700 C  CA    . TRP A 1 224 ? 53.760  12.274  3.574   1.00 65.40  ? 223 TRP A CA    1 
ATOM   1701 C  C     . TRP A 1 224 ? 52.941  11.873  2.349   1.00 65.67  ? 223 TRP A C     1 
ATOM   1702 O  O     . TRP A 1 224 ? 53.109  12.431  1.260   1.00 63.81  ? 223 TRP A O     1 
ATOM   1703 C  CB    . TRP A 1 224 ? 54.778  11.179  3.907   1.00 63.88  ? 223 TRP A CB    1 
ATOM   1704 C  CG    . TRP A 1 224 ? 55.762  10.898  2.808   1.00 67.51  ? 223 TRP A CG    1 
ATOM   1705 C  CD1   . TRP A 1 224 ? 56.967  11.508  2.612   1.00 65.50  ? 223 TRP A CD1   1 
ATOM   1706 C  CD2   . TRP A 1 224 ? 55.630  9.928   1.760   1.00 67.68  ? 223 TRP A CD2   1 
ATOM   1707 N  NE1   . TRP A 1 224 ? 57.590  10.983  1.507   1.00 66.84  ? 223 TRP A NE1   1 
ATOM   1708 C  CE2   . TRP A 1 224 ? 56.790  10.011  0.965   1.00 61.82  ? 223 TRP A CE2   1 
ATOM   1709 C  CE3   . TRP A 1 224 ? 54.642  9.000   1.416   1.00 63.50  ? 223 TRP A CE3   1 
ATOM   1710 C  CZ2   . TRP A 1 224 ? 56.990  9.202   -0.152  1.00 62.73  ? 223 TRP A CZ2   1 
ATOM   1711 C  CZ3   . TRP A 1 224 ? 54.842  8.198   0.306   1.00 58.87  ? 223 TRP A CZ3   1 
ATOM   1712 C  CH2   . TRP A 1 224 ? 56.007  8.304   -0.464  1.00 63.79  ? 223 TRP A CH2   1 
ATOM   1713 N  N     . GLU A 1 225 ? 52.050  10.906  2.543   1.00 62.50  ? 224 GLU A N     1 
ATOM   1714 C  CA    . GLU A 1 225 ? 51.198  10.402  1.472   1.00 63.39  ? 224 GLU A CA    1 
ATOM   1715 C  C     . GLU A 1 225 ? 50.372  11.498  0.802   1.00 65.80  ? 224 GLU A C     1 
ATOM   1716 O  O     . GLU A 1 225 ? 50.405  11.643  -0.419  1.00 67.41  ? 224 GLU A O     1 
ATOM   1717 C  CB    . GLU A 1 225 ? 50.270  9.306   1.998   1.00 62.82  ? 224 GLU A CB    1 
ATOM   1718 C  CG    . GLU A 1 225 ? 50.963  7.987   2.300   1.00 67.66  ? 224 GLU A CG    1 
ATOM   1719 C  CD    . GLU A 1 225 ? 49.977  6.850   2.478   1.00 77.43  ? 224 GLU A CD    1 
ATOM   1720 O  OE1   . GLU A 1 225 ? 48.765  7.135   2.575   1.00 76.57  ? 224 GLU A OE1   1 
ATOM   1721 O  OE2   . GLU A 1 225 ? 50.408  5.677   2.519   1.00 83.88  ? 224 GLU A OE2   1 
ATOM   1722 N  N     . ARG A 1 226 ? 49.629  12.268  1.593   1.00 61.04  ? 225 ARG A N     1 
ATOM   1723 C  CA    . ARG A 1 226 ? 48.781  13.314  1.022   1.00 58.03  ? 225 ARG A CA    1 
ATOM   1724 C  C     . ARG A 1 226 ? 49.610  14.479  0.487   1.00 61.66  ? 225 ARG A C     1 
ATOM   1725 O  O     . ARG A 1 226 ? 49.174  15.196  -0.421  1.00 62.14  ? 225 ARG A O     1 
ATOM   1726 C  CB    . ARG A 1 226 ? 47.745  13.804  2.036   1.00 54.23  ? 225 ARG A CB    1 
ATOM   1727 C  CG    . ARG A 1 226 ? 46.722  12.749  2.411   1.00 57.70  ? 225 ARG A CG    1 
ATOM   1728 C  CD    . ARG A 1 226 ? 45.660  13.296  3.341   1.00 58.15  ? 225 ARG A CD    1 
ATOM   1729 N  NE    . ARG A 1 226 ? 45.015  12.214  4.076   1.00 63.01  ? 225 ARG A NE    1 
ATOM   1730 C  CZ    . ARG A 1 226 ? 44.192  12.390  5.104   1.00 66.24  ? 225 ARG A CZ    1 
ATOM   1731 N  NH1   . ARG A 1 226 ? 43.901  13.611  5.531   1.00 56.28  ? 225 ARG A NH1   1 
ATOM   1732 N  NH2   . ARG A 1 226 ? 43.662  11.341  5.712   1.00 64.65  ? 225 ARG A NH2   1 
ATOM   1733 N  N     . SER A 1 227 ? 50.804  14.660  1.051   1.00 59.85  ? 226 SER A N     1 
ATOM   1734 C  CA    . SER A 1 227 ? 51.761  15.622  0.516   1.00 63.50  ? 226 SER A CA    1 
ATOM   1735 C  C     . SER A 1 227 ? 52.175  15.178  -0.879  1.00 68.26  ? 226 SER A C     1 
ATOM   1736 O  O     . SER A 1 227 ? 52.522  15.999  -1.725  1.00 63.19  ? 226 SER A O     1 
ATOM   1737 C  CB    . SER A 1 227 ? 52.992  15.722  1.416   1.00 67.45  ? 226 SER A CB    1 
ATOM   1738 O  OG    . SER A 1 227 ? 53.908  16.689  0.935   1.00 74.47  ? 226 SER A OG    1 
ATOM   1739 N  N     . GLN A 1 228 ? 52.131  13.868  -1.108  1.00 65.05  ? 227 GLN A N     1 
ATOM   1740 C  CA    . GLN A 1 228 ? 52.400  13.304  -2.426  1.00 60.68  ? 227 GLN A CA    1 
ATOM   1741 C  C     . GLN A 1 228 ? 51.149  13.310  -3.301  1.00 60.43  ? 227 GLN A C     1 
ATOM   1742 O  O     . GLN A 1 228 ? 51.213  12.988  -4.486  1.00 66.04  ? 227 GLN A O     1 
ATOM   1743 C  CB    . GLN A 1 228 ? 52.933  11.876  -2.293  1.00 59.71  ? 227 GLN A CB    1 
ATOM   1744 C  CG    . GLN A 1 228 ? 54.370  11.786  -1.810  1.00 64.01  ? 227 GLN A CG    1 
ATOM   1745 C  CD    . GLN A 1 228 ? 55.365  11.811  -2.952  1.00 67.37  ? 227 GLN A CD    1 
ATOM   1746 O  OE1   . GLN A 1 228 ? 55.268  11.021  -3.891  1.00 75.88  ? 227 GLN A OE1   1 
ATOM   1747 N  NE2   . GLN A 1 228 ? 56.328  12.723  -2.880  1.00 66.51  ? 227 GLN A NE2   1 
ATOM   1748 N  N     . GLY A 1 229 ? 50.013  13.676  -2.714  1.00 57.48  ? 228 GLY A N     1 
ATOM   1749 C  CA    . GLY A 1 229 ? 48.750  13.684  -3.432  1.00 55.97  ? 228 GLY A CA    1 
ATOM   1750 C  C     . GLY A 1 229 ? 48.051  12.342  -3.351  1.00 58.52  ? 228 GLY A C     1 
ATOM   1751 O  O     . GLY A 1 229 ? 47.072  12.091  -4.056  1.00 53.68  ? 228 GLY A O     1 
ATOM   1752 N  N     . ILE A 1 230 ? 48.560  11.475  -2.483  1.00 57.67  ? 229 ILE A N     1 
ATOM   1753 C  CA    . ILE A 1 230 ? 47.991  10.148  -2.297  1.00 57.28  ? 229 ILE A CA    1 
ATOM   1754 C  C     . ILE A 1 230 ? 46.952  10.148  -1.184  1.00 56.29  ? 229 ILE A C     1 
ATOM   1755 O  O     . ILE A 1 230 ? 47.237  10.550  -0.057  1.00 57.02  ? 229 ILE A O     1 
ATOM   1756 C  CB    . ILE A 1 230 ? 49.078  9.115   -1.955  1.00 60.28  ? 229 ILE A CB    1 
ATOM   1757 C  CG1   . ILE A 1 230 ? 50.229  9.200   -2.960  1.00 60.79  ? 229 ILE A CG1   1 
ATOM   1758 C  CG2   . ILE A 1 230 ? 48.487  7.712   -1.914  1.00 56.38  ? 229 ILE A CG2   1 
ATOM   1759 C  CD1   . ILE A 1 230 ? 51.400  8.310   -2.621  1.00 54.07  ? 229 ILE A CD1   1 
ATOM   1760 N  N     . ASP A 1 231 ? 45.744  9.703   -1.512  1.00 54.68  ? 230 ASP A N     1 
ATOM   1761 C  CA    . ASP A 1 231 ? 44.680  9.561   -0.527  1.00 52.31  ? 230 ASP A CA    1 
ATOM   1762 C  C     . ASP A 1 231 ? 43.760  8.417   -0.939  1.00 60.41  ? 230 ASP A C     1 
ATOM   1763 O  O     . ASP A 1 231 ? 42.694  8.630   -1.518  1.00 63.35  ? 230 ASP A O     1 
ATOM   1764 C  CB    . ASP A 1 231 ? 43.905  10.871  -0.370  1.00 49.97  ? 230 ASP A CB    1 
ATOM   1765 C  CG    . ASP A 1 231 ? 42.925  10.837  0.785   1.00 56.62  ? 230 ASP A CG    1 
ATOM   1766 O  OD1   . ASP A 1 231 ? 43.094  10.001  1.697   1.00 61.06  ? 230 ASP A OD1   1 
ATOM   1767 O  OD2   . ASP A 1 231 ? 41.984  11.655  0.780   1.00 60.75  ? 230 ASP A OD2   1 
ATOM   1768 N  N     . GLU A 1 232 ? 44.183  7.199   -0.620  1.00 56.89  ? 231 GLU A N     1 
ATOM   1769 C  CA    . GLU A 1 232 ? 43.475  5.995   -1.036  1.00 54.64  ? 231 GLU A CA    1 
ATOM   1770 C  C     . GLU A 1 232 ? 42.156  5.790   -0.304  1.00 63.38  ? 231 GLU A C     1 
ATOM   1771 O  O     . GLU A 1 232 ? 41.465  4.796   -0.547  1.00 65.88  ? 231 GLU A O     1 
ATOM   1772 C  CB    . GLU A 1 232 ? 44.361  4.760   -0.846  1.00 56.83  ? 231 GLU A CB    1 
ATOM   1773 C  CG    . GLU A 1 232 ? 45.522  4.654   -1.824  1.00 64.53  ? 231 GLU A CG    1 
ATOM   1774 C  CD    . GLU A 1 232 ? 45.068  4.352   -3.238  1.00 78.71  ? 231 GLU A CD    1 
ATOM   1775 O  OE1   . GLU A 1 232 ? 44.463  3.283   -3.453  1.00 78.85  ? 231 GLU A OE1   1 
ATOM   1776 O  OE2   . GLU A 1 232 ? 45.321  5.178   -4.138  1.00 79.64  ? 231 GLU A OE2   1 
ATOM   1777 N  N     . ARG A 1 233 ? 41.807  6.721   0.580   1.00 62.42  ? 232 ARG A N     1 
ATOM   1778 C  CA    . ARG A 1 233 ? 40.535  6.657   1.292   1.00 57.90  ? 232 ARG A CA    1 
ATOM   1779 C  C     . ARG A 1 233 ? 39.334  6.578   0.344   1.00 61.72  ? 232 ARG A C     1 
ATOM   1780 O  O     . ARG A 1 233 ? 39.109  7.470   -0.476  1.00 66.60  ? 232 ARG A O     1 
ATOM   1781 C  CB    . ARG A 1 233 ? 40.393  7.847   2.243   1.00 61.56  ? 232 ARG A CB    1 
ATOM   1782 C  CG    . ARG A 1 233 ? 41.390  7.824   3.394   1.00 62.90  ? 232 ARG A CG    1 
ATOM   1783 C  CD    . ARG A 1 233 ? 41.161  8.990   4.329   1.00 61.54  ? 232 ARG A CD    1 
ATOM   1784 N  NE    . ARG A 1 233 ? 41.221  10.266  3.624   1.00 60.30  ? 232 ARG A NE    1 
ATOM   1785 C  CZ    . ARG A 1 233 ? 40.859  11.429  4.156   1.00 57.62  ? 232 ARG A CZ    1 
ATOM   1786 N  NH1   . ARG A 1 233 ? 40.404  11.480  5.400   1.00 56.94  ? 232 ARG A NH1   1 
ATOM   1787 N  NH2   . ARG A 1 233 ? 40.948  12.543  3.441   1.00 58.73  ? 232 ARG A NH2   1 
ATOM   1788 N  N     . ASP A 1 234 ? 38.570  5.497   0.469   1.00 63.50  ? 233 ASP A N     1 
ATOM   1789 C  CA    . ASP A 1 234 ? 37.414  5.252   -0.382  1.00 63.51  ? 233 ASP A CA    1 
ATOM   1790 C  C     . ASP A 1 234 ? 36.155  5.782   0.290   1.00 59.67  ? 233 ASP A C     1 
ATOM   1791 O  O     . ASP A 1 234 ? 36.008  5.666   1.510   1.00 65.58  ? 233 ASP A O     1 
ATOM   1792 C  CB    . ASP A 1 234 ? 37.273  3.751   -0.629  1.00 64.63  ? 233 ASP A CB    1 
ATOM   1793 C  CG    . ASP A 1 234 ? 36.223  3.422   -1.672  1.00 72.32  ? 233 ASP A CG    1 
ATOM   1794 O  OD1   . ASP A 1 234 ? 35.873  4.309   -2.480  1.00 75.01  ? 233 ASP A OD1   1 
ATOM   1795 O  OD2   . ASP A 1 234 ? 35.761  2.262   -1.695  1.00 77.38  ? 233 ASP A OD2   1 
ATOM   1796 N  N     . VAL A 1 235 ? 35.264  6.379   -0.501  1.00 58.40  ? 234 VAL A N     1 
ATOM   1797 C  CA    . VAL A 1 235 ? 33.979  6.846   0.010   1.00 58.19  ? 234 VAL A CA    1 
ATOM   1798 C  C     . VAL A 1 235 ? 33.198  5.647   0.536   1.00 65.43  ? 234 VAL A C     1 
ATOM   1799 O  O     . VAL A 1 235 ? 32.946  4.692   -0.198  1.00 74.30  ? 234 VAL A O     1 
ATOM   1800 C  CB    . VAL A 1 235 ? 33.167  7.573   -1.073  1.00 60.35  ? 234 VAL A CB    1 
ATOM   1801 C  CG1   . VAL A 1 235 ? 31.811  8.008   -0.526  1.00 59.09  ? 234 VAL A CG1   1 
ATOM   1802 C  CG2   . VAL A 1 235 ? 33.943  8.776   -1.591  1.00 56.87  ? 234 VAL A CG2   1 
ATOM   1803 N  N     . ASN A 1 236 ? 32.824  5.703   1.811   1.00 61.10  ? 235 ASN A N     1 
ATOM   1804 C  CA    . ASN A 1 236 ? 32.328  4.525   2.519   1.00 69.02  ? 235 ASN A CA    1 
ATOM   1805 C  C     . ASN A 1 236 ? 30.841  4.230   2.308   1.00 76.91  ? 235 ASN A C     1 
ATOM   1806 O  O     . ASN A 1 236 ? 30.492  3.164   1.801   1.00 81.12  ? 235 ASN A O     1 
ATOM   1807 C  CB    . ASN A 1 236 ? 32.656  4.626   4.014   1.00 68.54  ? 235 ASN A CB    1 
ATOM   1808 C  CG    . ASN A 1 236 ? 32.625  3.277   4.713   1.00 71.51  ? 235 ASN A CG    1 
ATOM   1809 O  OD1   . ASN A 1 236 ? 31.738  2.459   4.475   1.00 68.89  ? 235 ASN A OD1   1 
ATOM   1810 N  ND2   . ASN A 1 236 ? 33.604  3.036   5.577   1.00 73.22  ? 235 ASN A ND2   1 
ATOM   1811 N  N     . SER A 1 237 ? 29.981  5.161   2.721   1.00 66.21  ? 236 SER A N     1 
ATOM   1812 C  CA    . SER A 1 237 ? 28.518  5.018   2.633   1.00 69.40  ? 236 SER A CA    1 
ATOM   1813 C  C     . SER A 1 237 ? 27.914  3.983   3.591   1.00 72.09  ? 236 SER A C     1 
ATOM   1814 O  O     . SER A 1 237 ? 26.688  3.851   3.672   1.00 70.82  ? 236 SER A O     1 
ATOM   1815 C  CB    . SER A 1 237 ? 28.056  4.757   1.190   1.00 69.70  ? 236 SER A CB    1 
ATOM   1816 O  OG    . SER A 1 237 ? 27.274  3.576   1.107   1.00 76.51  ? 236 SER A OG    1 
ATOM   1817 N  N     . GLU A 1 238 ? 28.766  3.262   4.317   1.00 68.48  ? 237 GLU A N     1 
ATOM   1818 C  CA    . GLU A 1 238 ? 28.290  2.298   5.306   1.00 70.99  ? 237 GLU A CA    1 
ATOM   1819 C  C     . GLU A 1 238 ? 28.611  2.765   6.723   1.00 67.82  ? 237 GLU A C     1 
ATOM   1820 O  O     . GLU A 1 238 ? 28.436  2.019   7.686   1.00 71.47  ? 237 GLU A O     1 
ATOM   1821 C  CB    . GLU A 1 238 ? 28.901  0.915   5.066   1.00 73.10  ? 237 GLU A CB    1 
ATOM   1822 C  CG    . GLU A 1 238 ? 28.550  0.289   3.726   1.00 75.52  ? 237 GLU A CG    1 
ATOM   1823 C  CD    . GLU A 1 238 ? 28.577  -1.228  3.769   1.00 81.39  ? 237 GLU A CD    1 
ATOM   1824 O  OE1   . GLU A 1 238 ? 29.400  -1.835  3.053   1.00 83.08  ? 237 GLU A OE1   1 
ATOM   1825 O  OE2   . GLU A 1 238 ? 27.767  -1.813  4.518   1.00 87.11  ? 237 GLU A OE2   1 
ATOM   1826 N  N     . ARG A 1 239 ? 29.074  4.005   6.839   1.00 67.64  ? 238 ARG A N     1 
ATOM   1827 C  CA    . ARG A 1 239 ? 29.507  4.562   8.117   1.00 65.88  ? 238 ARG A CA    1 
ATOM   1828 C  C     . ARG A 1 239 ? 28.362  4.687   9.122   1.00 70.42  ? 238 ARG A C     1 
ATOM   1829 O  O     . ARG A 1 239 ? 27.241  5.040   8.759   1.00 70.12  ? 238 ARG A O     1 
ATOM   1830 C  CB    . ARG A 1 239 ? 30.165  5.923   7.895   1.00 64.44  ? 238 ARG A CB    1 
ATOM   1831 C  CG    . ARG A 1 239 ? 31.560  6.041   8.476   1.00 61.82  ? 238 ARG A CG    1 
ATOM   1832 C  CD    . ARG A 1 239 ? 32.333  7.156   7.796   1.00 66.46  ? 238 ARG A CD    1 
ATOM   1833 N  NE    . ARG A 1 239 ? 33.485  7.578   8.584   1.00 71.26  ? 238 ARG A NE    1 
ATOM   1834 C  CZ    . ARG A 1 239 ? 33.495  8.650   9.369   1.00 64.02  ? 238 ARG A CZ    1 
ATOM   1835 N  NH1   . ARG A 1 239 ? 32.415  9.415   9.463   1.00 61.37  ? 238 ARG A NH1   1 
ATOM   1836 N  NH2   . ARG A 1 239 ? 34.586  8.962   10.055  1.00 63.69  ? 238 ARG A NH2   1 
ATOM   1837 N  N     . LEU A 1 240 ? 28.663  4.407   10.387  1.00 67.74  ? 239 LEU A N     1 
ATOM   1838 C  CA    . LEU A 1 240 ? 27.653  4.383   11.442  1.00 68.21  ? 239 LEU A CA    1 
ATOM   1839 C  C     . LEU A 1 240 ? 28.126  5.126   12.690  1.00 69.37  ? 239 LEU A C     1 
ATOM   1840 O  O     . LEU A 1 240 ? 29.323  5.352   12.871  1.00 65.51  ? 239 LEU A O     1 
ATOM   1841 C  CB    . LEU A 1 240 ? 27.317  2.934   11.803  1.00 70.91  ? 239 LEU A CB    1 
ATOM   1842 C  CG    . LEU A 1 240 ? 25.928  2.382   11.472  1.00 75.37  ? 239 LEU A CG    1 
ATOM   1843 C  CD1   . LEU A 1 240 ? 25.231  3.211   10.406  1.00 71.25  ? 239 LEU A CD1   1 
ATOM   1844 C  CD2   . LEU A 1 240 ? 26.042  0.931   11.028  1.00 65.45  ? 239 LEU A CD2   1 
ATOM   1845 N  N     . ARG A 1 241 ? 27.179  5.501   13.547  1.00 65.92  ? 240 ARG A N     1 
ATOM   1846 C  CA    . ARG A 1 241 ? 27.499  6.144   14.817  1.00 63.49  ? 240 ARG A CA    1 
ATOM   1847 C  C     . ARG A 1 241 ? 28.306  5.205   15.704  1.00 62.13  ? 240 ARG A C     1 
ATOM   1848 O  O     . ARG A 1 241 ? 28.092  3.994   15.696  1.00 66.20  ? 240 ARG A O     1 
ATOM   1849 C  CB    . ARG A 1 241 ? 26.222  6.559   15.552  1.00 65.18  ? 240 ARG A CB    1 
ATOM   1850 C  CG    . ARG A 1 241 ? 25.406  7.634   14.858  1.00 71.29  ? 240 ARG A CG    1 
ATOM   1851 C  CD    . ARG A 1 241 ? 24.097  7.882   15.594  1.00 81.97  ? 240 ARG A CD    1 
ATOM   1852 N  NE    . ARG A 1 241 ? 24.296  8.542   16.882  1.00 88.04  ? 240 ARG A NE    1 
ATOM   1853 C  CZ    . ARG A 1 241 ? 23.988  9.812   17.125  1.00 84.33  ? 240 ARG A CZ    1 
ATOM   1854 N  NH1   . ARG A 1 241 ? 23.459  10.562  16.168  1.00 88.52  ? 240 ARG A NH1   1 
ATOM   1855 N  NH2   . ARG A 1 241 ? 24.203  10.332  18.325  1.00 72.28  ? 240 ARG A NH2   1 
ATOM   1856 N  N     . LYS A 1 242 ? 29.231  5.769   16.472  1.00 60.30  ? 241 LYS A N     1 
ATOM   1857 C  CA    . LYS A 1 242 ? 30.037  4.979   17.394  1.00 59.52  ? 241 LYS A CA    1 
ATOM   1858 C  C     . LYS A 1 242 ? 29.900  5.476   18.826  1.00 59.65  ? 241 LYS A C     1 
ATOM   1859 O  O     . LYS A 1 242 ? 30.633  5.031   19.706  1.00 65.13  ? 241 LYS A O     1 
ATOM   1860 C  CB    . LYS A 1 242 ? 31.511  4.996   16.985  1.00 57.81  ? 241 LYS A CB    1 
ATOM   1861 C  CG    . LYS A 1 242 ? 31.837  4.182   15.745  1.00 54.38  ? 241 LYS A CG    1 
ATOM   1862 C  CD    . LYS A 1 242 ? 33.341  4.114   15.538  1.00 58.85  ? 241 LYS A CD    1 
ATOM   1863 C  CE    . LYS A 1 242 ? 33.704  3.385   14.256  1.00 58.42  ? 241 LYS A CE    1 
ATOM   1864 N  NZ    . LYS A 1 242 ? 35.173  3.420   14.008  1.00 52.78  ? 241 LYS A NZ    1 
ATOM   1865 N  N     . SER A 1 243 ? 28.970  6.403   19.046  1.00 61.68  ? 242 SER A N     1 
ATOM   1866 C  CA    . SER A 1 243 ? 28.724  6.966   20.372  1.00 59.40  ? 242 SER A CA    1 
ATOM   1867 C  C     . SER A 1 243 ? 27.574  7.964   20.370  1.00 59.50  ? 242 SER A C     1 
ATOM   1868 O  O     . SER A 1 243 ? 27.197  8.500   19.328  1.00 61.85  ? 242 SER A O     1 
ATOM   1869 C  CB    . SER A 1 243 ? 29.976  7.665   20.912  1.00 55.50  ? 242 SER A CB    1 
ATOM   1870 O  OG    . SER A 1 243 ? 30.364  8.735   20.069  1.00 64.33  ? 242 SER A OG    1 
ATOM   1871 N  N     . VAL A 1 244 ? 27.023  8.203   21.554  1.00 61.14  ? 243 VAL A N     1 
ATOM   1872 C  CA    . VAL A 1 244 ? 26.085  9.297   21.773  1.00 61.46  ? 243 VAL A CA    1 
ATOM   1873 C  C     . VAL A 1 244 ? 26.202  9.779   23.219  1.00 61.51  ? 243 VAL A C     1 
ATOM   1874 O  O     . VAL A 1 244 ? 26.302  8.974   24.155  1.00 63.72  ? 243 VAL A O     1 
ATOM   1875 C  CB    . VAL A 1 244 ? 24.622  8.918   21.403  1.00 60.36  ? 243 VAL A CB    1 
ATOM   1876 C  CG1   . VAL A 1 244 ? 24.337  7.464   21.719  1.00 62.76  ? 243 VAL A CG1   1 
ATOM   1877 C  CG2   . VAL A 1 244 ? 23.620  9.839   22.095  1.00 61.62  ? 243 VAL A CG2   1 
ATOM   1878 N  N     . GLY A 1 245 ? 26.229  11.098  23.388  1.00 63.65  ? 244 GLY A N     1 
ATOM   1879 C  CA    . GLY A 1 245 ? 26.365  11.694  24.702  1.00 55.38  ? 244 GLY A CA    1 
ATOM   1880 C  C     . GLY A 1 245 ? 25.524  12.941  24.881  1.00 54.89  ? 244 GLY A C     1 
ATOM   1881 O  O     . GLY A 1 245 ? 25.105  13.568  23.909  1.00 58.26  ? 244 GLY A O     1 
ATOM   1882 N  N     . VAL A 1 246 ? 25.272  13.293  26.138  1.00 59.12  ? 245 VAL A N     1 
ATOM   1883 C  CA    . VAL A 1 246 ? 24.521  14.496  26.474  1.00 58.33  ? 245 VAL A CA    1 
ATOM   1884 C  C     . VAL A 1 246 ? 25.247  15.253  27.579  1.00 56.98  ? 245 VAL A C     1 
ATOM   1885 O  O     . VAL A 1 246 ? 25.322  14.783  28.712  1.00 57.90  ? 245 VAL A O     1 
ATOM   1886 C  CB    . VAL A 1 246 ? 23.090  14.161  26.953  1.00 58.30  ? 245 VAL A CB    1 
ATOM   1887 C  CG1   . VAL A 1 246 ? 22.368  15.423  27.397  1.00 63.28  ? 245 VAL A CG1   1 
ATOM   1888 C  CG2   . VAL A 1 246 ? 22.303  13.448  25.860  1.00 63.09  ? 245 VAL A CG2   1 
ATOM   1889 N  N     . GLU A 1 247 ? 25.790  16.420  27.248  1.00 57.63  ? 246 GLU A N     1 
ATOM   1890 C  CA    . GLU A 1 247 ? 26.535  17.215  28.220  1.00 57.30  ? 246 GLU A CA    1 
ATOM   1891 C  C     . GLU A 1 247 ? 26.025  18.652  28.271  1.00 53.09  ? 246 GLU A C     1 
ATOM   1892 O  O     . GLU A 1 247 ? 25.438  19.144  27.308  1.00 55.92  ? 246 GLU A O     1 
ATOM   1893 C  CB    . GLU A 1 247 ? 28.032  17.192  27.898  1.00 48.92  ? 246 GLU A CB    1 
ATOM   1894 C  CG    . GLU A 1 247 ? 28.415  17.937  26.631  1.00 48.14  ? 246 GLU A CG    1 
ATOM   1895 C  CD    . GLU A 1 247 ? 29.763  17.505  26.087  1.00 57.07  ? 246 GLU A CD    1 
ATOM   1896 O  OE1   . GLU A 1 247 ? 30.123  16.323  26.264  1.00 57.83  ? 246 GLU A OE1   1 
ATOM   1897 O  OE2   . GLU A 1 247 ? 30.463  18.346  25.483  1.00 58.70  ? 246 GLU A OE2   1 
ATOM   1898 N  N     . ARG A 1 248 ? 26.248  19.323  29.398  1.00 54.23  ? 247 ARG A N     1 
ATOM   1899 C  CA    . ARG A 1 248 ? 25.780  20.695  29.560  1.00 59.98  ? 247 ARG A CA    1 
ATOM   1900 C  C     . ARG A 1 248 ? 26.708  21.546  30.425  1.00 61.11  ? 247 ARG A C     1 
ATOM   1901 O  O     . ARG A 1 248 ? 27.273  21.065  31.411  1.00 56.56  ? 247 ARG A O     1 
ATOM   1902 C  CB    . ARG A 1 248 ? 24.367  20.718  30.145  1.00 61.42  ? 247 ARG A CB    1 
ATOM   1903 C  CG    . ARG A 1 248 ? 23.653  22.045  29.956  1.00 61.16  ? 247 ARG A CG    1 
ATOM   1904 C  CD    . ARG A 1 248 ? 22.882  22.451  31.197  1.00 70.16  ? 247 ARG A CD    1 
ATOM   1905 N  NE    . ARG A 1 248 ? 22.206  23.731  31.009  1.00 76.69  ? 247 ARG A NE    1 
ATOM   1906 C  CZ    . ARG A 1 248 ? 21.537  24.372  31.961  1.00 79.40  ? 247 ARG A CZ    1 
ATOM   1907 N  NH1   . ARG A 1 248 ? 21.454  23.855  33.179  1.00 76.21  ? 247 ARG A NH1   1 
ATOM   1908 N  NH2   . ARG A 1 248 ? 20.954  25.532  31.695  1.00 81.53  ? 247 ARG A NH2   1 
ATOM   1909 N  N     . THR A 1 249 ? 26.847  22.813  30.037  1.00 58.37  ? 248 THR A N     1 
ATOM   1910 C  CA    . THR A 1 249 ? 27.631  23.790  30.784  1.00 54.26  ? 248 THR A CA    1 
ATOM   1911 C  C     . THR A 1 249 ? 26.704  24.795  31.459  1.00 57.62  ? 248 THR A C     1 
ATOM   1912 O  O     . THR A 1 249 ? 25.767  25.304  30.842  1.00 62.03  ? 248 THR A O     1 
ATOM   1913 C  CB    . THR A 1 249 ? 28.634  24.531  29.871  1.00 52.73  ? 248 THR A CB    1 
ATOM   1914 O  OG1   . THR A 1 249 ? 29.550  23.586  29.306  1.00 47.04  ? 248 THR A OG1   1 
ATOM   1915 C  CG2   . THR A 1 249 ? 29.418  25.577  30.657  1.00 56.21  ? 248 THR A CG2   1 
ATOM   1916 N  N     . MET A 1 250 ? 26.967  25.071  32.732  1.00 60.69  ? 249 MET A N     1 
ATOM   1917 C  CA    . MET A 1 250 ? 26.125  25.962  33.525  1.00 66.26  ? 249 MET A CA    1 
ATOM   1918 C  C     . MET A 1 250 ? 26.769  27.341  33.629  1.00 63.00  ? 249 MET A C     1 
ATOM   1919 O  O     . MET A 1 250 ? 27.904  27.532  33.195  1.00 63.51  ? 249 MET A O     1 
ATOM   1920 C  CB    . MET A 1 250 ? 25.957  25.379  34.931  1.00 63.64  ? 249 MET A CB    1 
ATOM   1921 C  CG    . MET A 1 250 ? 24.714  25.828  35.713  1.00 80.48  ? 249 MET A CG    1 
ATOM   1922 S  SD    . MET A 1 250 ? 23.750  27.169  34.980  1.00 89.28  ? 249 MET A SD    1 
ATOM   1923 C  CE    . MET A 1 250 ? 22.642  27.560  36.335  1.00 63.20  ? 249 MET A CE    1 
ATOM   1924 N  N     . ALA A 1 251 ? 26.037  28.302  34.193  1.00 64.15  ? 250 ALA A N     1 
ATOM   1925 C  CA    . ALA A 1 251 ? 26.608  29.596  34.561  1.00 63.94  ? 250 ALA A CA    1 
ATOM   1926 C  C     . ALA A 1 251 ? 27.750  29.343  35.533  1.00 68.63  ? 250 ALA A C     1 
ATOM   1927 O  O     . ALA A 1 251 ? 28.751  30.062  35.522  1.00 71.72  ? 250 ALA A O     1 
ATOM   1928 C  CB    . ALA A 1 251 ? 25.556  30.483  35.199  1.00 69.16  ? 250 ALA A CB    1 
ATOM   1929 N  N     . GLU A 1 252 ? 27.507  28.368  36.412  1.00 67.98  ? 251 GLU A N     1 
ATOM   1930 C  CA    . GLU A 1 252 ? 28.492  27.516  37.102  1.00 68.91  ? 251 GLU A CA    1 
ATOM   1931 C  C     . GLU A 1 252 ? 28.085  27.130  38.515  1.00 74.07  ? 251 GLU A C     1 
ATOM   1932 O  O     . GLU A 1 252 ? 27.139  26.368  38.716  1.00 80.52  ? 251 GLU A O     1 
ATOM   1933 C  CB    . GLU A 1 252 ? 29.938  28.038  37.105  1.00 66.00  ? 251 GLU A CB    1 
ATOM   1934 C  CG    . GLU A 1 252 ? 30.951  26.926  37.393  1.00 57.87  ? 251 GLU A CG    1 
ATOM   1935 C  CD    . GLU A 1 252 ? 32.393  27.375  37.311  1.00 61.35  ? 251 GLU A CD    1 
ATOM   1936 O  OE1   . GLU A 1 252 ? 32.918  27.504  36.186  1.00 65.77  ? 251 GLU A OE1   1 
ATOM   1937 O  OE2   . GLU A 1 252 ? 33.010  27.582  38.376  1.00 62.06  ? 251 GLU A OE2   1 
ATOM   1938 N  N     . ASP A 1 253 ? 28.810  27.679  39.482  1.00 76.83  ? 252 ASP A N     1 
ATOM   1939 C  CA    . ASP A 1 253 ? 28.899  27.101  40.811  1.00 74.28  ? 252 ASP A CA    1 
ATOM   1940 C  C     . ASP A 1 253 ? 29.075  25.590  40.714  1.00 71.45  ? 252 ASP A C     1 
ATOM   1941 O  O     . ASP A 1 253 ? 30.047  25.116  40.133  1.00 65.32  ? 252 ASP A O     1 
ATOM   1942 C  CB    . ASP A 1 253 ? 27.705  27.478  41.692  1.00 77.71  ? 252 ASP A CB    1 
ATOM   1943 C  CG    . ASP A 1 253 ? 27.941  27.140  43.152  1.00 85.84  ? 252 ASP A CG    1 
ATOM   1944 O  OD1   . ASP A 1 253 ? 29.122  27.071  43.556  1.00 85.13  ? 252 ASP A OD1   1 
ATOM   1945 O  OD2   . ASP A 1 253 ? 26.954  26.934  43.889  1.00 80.70  ? 252 ASP A OD2   1 
ATOM   1946 N  N     . ILE A 1 254 ? 28.091  24.852  41.214  1.00 78.82  ? 253 ILE A N     1 
ATOM   1947 C  CA    . ILE A 1 254 ? 28.243  23.435  41.528  1.00 68.60  ? 253 ILE A CA    1 
ATOM   1948 C  C     . ILE A 1 254 ? 29.609  23.123  42.163  1.00 60.90  ? 253 ILE A C     1 
ATOM   1949 O  O     . ILE A 1 254 ? 30.618  22.905  41.491  1.00 53.46  ? 253 ILE A O     1 
ATOM   1950 C  CB    . ILE A 1 254 ? 27.750  22.466  40.377  1.00 61.62  ? 253 ILE A CB    1 
ATOM   1951 C  CG1   . ILE A 1 254 ? 28.670  21.256  40.191  1.00 55.27  ? 253 ILE A CG1   1 
ATOM   1952 C  CG2   . ILE A 1 254 ? 27.492  23.209  39.060  1.00 55.01  ? 253 ILE A CG2   1 
ATOM   1953 C  CD1   . ILE A 1 254 ? 28.184  20.266  39.149  1.00 52.65  ? 253 ILE A CD1   1 
ATOM   1954 N  N     . HIS A 1 255 ? 29.626  23.200  43.487  1.00 60.36  ? 254 HIS A N     1 
ATOM   1955 C  CA    . HIS A 1 255 ? 30.769  22.794  44.281  1.00 59.17  ? 254 HIS A CA    1 
ATOM   1956 C  C     . HIS A 1 255 ? 30.239  21.752  45.245  1.00 62.42  ? 254 HIS A C     1 
ATOM   1957 O  O     . HIS A 1 255 ? 30.986  21.161  46.021  1.00 62.88  ? 254 HIS A O     1 
ATOM   1958 C  CB    . HIS A 1 255 ? 31.361  23.980  45.043  1.00 65.45  ? 254 HIS A CB    1 
ATOM   1959 C  CG    . HIS A 1 255 ? 32.036  24.988  44.167  1.00 68.42  ? 254 HIS A CG    1 
ATOM   1960 N  ND1   . HIS A 1 255 ? 31.340  25.925  43.434  1.00 62.25  ? 254 HIS A ND1   1 
ATOM   1961 C  CD2   . HIS A 1 255 ? 33.349  25.210  43.910  1.00 59.39  ? 254 HIS A CD2   1 
ATOM   1962 C  CE1   . HIS A 1 255 ? 32.194  26.678  42.763  1.00 58.35  ? 254 HIS A CE1   1 
ATOM   1963 N  NE2   . HIS A 1 255 ? 33.416  26.266  43.034  1.00 64.93  ? 254 HIS A NE2   1 
ATOM   1964 N  N     . HIS A 1 256 ? 28.928  21.538  45.172  1.00 57.91  ? 255 HIS A N     1 
ATOM   1965 C  CA    . HIS A 1 256 ? 28.245  20.514  45.947  1.00 58.15  ? 255 HIS A CA    1 
ATOM   1966 C  C     . HIS A 1 256 ? 27.930  19.331  45.041  1.00 59.87  ? 255 HIS A C     1 
ATOM   1967 O  O     . HIS A 1 256 ? 27.715  19.498  43.840  1.00 60.02  ? 255 HIS A O     1 
ATOM   1968 C  CB    . HIS A 1 256 ? 26.946  21.071  46.529  1.00 57.45  ? 255 HIS A CB    1 
ATOM   1969 C  CG    . HIS A 1 256 ? 27.141  22.241  47.443  1.00 61.31  ? 255 HIS A CG    1 
ATOM   1970 N  ND1   . HIS A 1 256 ? 26.924  22.165  48.802  1.00 62.08  ? 255 HIS A ND1   1 
ATOM   1971 C  CD2   . HIS A 1 256 ? 27.524  23.516  47.194  1.00 63.65  ? 255 HIS A CD2   1 
ATOM   1972 C  CE1   . HIS A 1 256 ? 27.168  23.341  49.351  1.00 67.23  ? 255 HIS A CE1   1 
ATOM   1973 N  NE2   . HIS A 1 256 ? 27.534  24.178  48.398  1.00 63.92  ? 255 HIS A NE2   1 
ATOM   1974 N  N     . TRP A 1 257 ? 27.903  18.136  45.620  1.00 57.61  ? 256 TRP A N     1 
ATOM   1975 C  CA    . TRP A 1 257 ? 27.639  16.921  44.857  1.00 53.53  ? 256 TRP A CA    1 
ATOM   1976 C  C     . TRP A 1 257 ? 26.174  16.794  44.435  1.00 57.63  ? 256 TRP A C     1 
ATOM   1977 O  O     . TRP A 1 257 ? 25.872  16.290  43.347  1.00 58.26  ? 256 TRP A O     1 
ATOM   1978 C  CB    . TRP A 1 257 ? 28.074  15.689  45.654  1.00 50.96  ? 256 TRP A CB    1 
ATOM   1979 C  CG    . TRP A 1 257 ? 27.380  14.436  45.230  1.00 56.98  ? 256 TRP A CG    1 
ATOM   1980 C  CD1   . TRP A 1 257 ? 26.484  13.710  45.958  1.00 56.18  ? 256 TRP A CD1   1 
ATOM   1981 C  CD2   . TRP A 1 257 ? 27.508  13.769  43.969  1.00 60.84  ? 256 TRP A CD2   1 
ATOM   1982 N  NE1   . TRP A 1 257 ? 26.052  12.627  45.233  1.00 59.62  ? 256 TRP A NE1   1 
ATOM   1983 C  CE2   . TRP A 1 257 ? 26.665  12.641  44.008  1.00 63.73  ? 256 TRP A CE2   1 
ATOM   1984 C  CE3   . TRP A 1 257 ? 28.255  14.014  42.813  1.00 56.49  ? 256 TRP A CE3   1 
ATOM   1985 C  CZ2   . TRP A 1 257 ? 26.548  11.759  42.936  1.00 60.01  ? 256 TRP A CZ2   1 
ATOM   1986 C  CZ3   . TRP A 1 257 ? 28.138  13.138  41.750  1.00 61.02  ? 256 TRP A CZ3   1 
ATOM   1987 C  CH2   . TRP A 1 257 ? 27.289  12.025  41.817  1.00 61.47  ? 256 TRP A CH2   1 
ATOM   1988 N  N     . SER A 1 258 ? 25.273  17.256  45.296  1.00 54.28  ? 257 SER A N     1 
ATOM   1989 C  CA    . SER A 1 258 ? 23.839  17.179  45.032  1.00 55.80  ? 257 SER A CA    1 
ATOM   1990 C  C     . SER A 1 258 ? 23.447  17.910  43.751  1.00 52.08  ? 257 SER A C     1 
ATOM   1991 O  O     . SER A 1 258 ? 22.492  17.527  43.075  1.00 49.56  ? 257 SER A O     1 
ATOM   1992 C  CB    . SER A 1 258 ? 23.046  17.732  46.218  1.00 45.85  ? 257 SER A CB    1 
ATOM   1993 O  OG    . SER A 1 258 ? 23.501  19.026  46.574  1.00 46.55  ? 257 SER A OG    1 
ATOM   1994 N  N     . GLU A 1 259 ? 24.191  18.961  43.422  1.00 52.31  ? 258 GLU A N     1 
ATOM   1995 C  CA    . GLU A 1 259 ? 23.945  19.722  42.204  1.00 55.90  ? 258 GLU A CA    1 
ATOM   1996 C  C     . GLU A 1 259 ? 24.345  18.905  40.982  1.00 53.79  ? 258 GLU A C     1 
ATOM   1997 O  O     . GLU A 1 259 ? 23.600  18.826  40.001  1.00 57.78  ? 258 GLU A O     1 
ATOM   1998 C  CB    . GLU A 1 259 ? 24.710  21.044  42.239  1.00 53.01  ? 258 GLU A CB    1 
ATOM   1999 C  CG    . GLU A 1 259 ? 24.326  21.935  43.408  1.00 56.10  ? 258 GLU A CG    1 
ATOM   2000 C  CD    . GLU A 1 259 ? 25.118  23.224  43.446  1.00 63.18  ? 258 GLU A CD    1 
ATOM   2001 O  OE1   . GLU A 1 259 ? 24.631  24.238  42.901  1.00 61.04  ? 258 GLU A OE1   1 
ATOM   2002 O  OE2   . GLU A 1 259 ? 26.225  23.226  44.023  1.00 59.82  ? 258 GLU A OE2   1 
ATOM   2003 N  N     . CYS A 1 260 ? 25.526  18.297  41.052  1.00 53.94  ? 259 CYS A N     1 
ATOM   2004 C  CA    . CYS A 1 260 ? 25.999  17.402  40.004  1.00 51.48  ? 259 CYS A CA    1 
ATOM   2005 C  C     . CYS A 1 260 ? 24.982  16.293  39.753  1.00 53.52  ? 259 CYS A C     1 
ATOM   2006 O  O     . CYS A 1 260 ? 24.615  16.018  38.606  1.00 56.16  ? 259 CYS A O     1 
ATOM   2007 C  CB    . CYS A 1 260 ? 27.352  16.799  40.388  1.00 44.59  ? 259 CYS A CB    1 
ATOM   2008 S  SG    . CYS A 1 260 ? 27.993  15.590  39.207  1.00 49.86  ? 259 CYS A SG    1 
ATOM   2009 N  N     . GLU A 1 261 ? 24.517  15.670  40.834  1.00 54.59  ? 260 GLU A N     1 
ATOM   2010 C  CA    . GLU A 1 261 ? 23.534  14.593  40.733  1.00 52.69  ? 260 GLU A CA    1 
ATOM   2011 C  C     . GLU A 1 261 ? 22.209  15.077  40.144  1.00 52.95  ? 260 GLU A C     1 
ATOM   2012 O  O     . GLU A 1 261 ? 21.622  14.397  39.309  1.00 55.70  ? 260 GLU A O     1 
ATOM   2013 C  CB    . GLU A 1 261 ? 23.301  13.923  42.094  1.00 58.58  ? 260 GLU A CB    1 
ATOM   2014 C  CG    . GLU A 1 261 ? 22.226  12.834  42.061  1.00 60.85  ? 260 GLU A CG    1 
ATOM   2015 C  CD    . GLU A 1 261 ? 21.877  12.288  43.435  1.00 68.98  ? 260 GLU A CD    1 
ATOM   2016 O  OE1   . GLU A 1 261 ? 20.721  12.467  43.872  1.00 67.26  ? 260 GLU A OE1   1 
ATOM   2017 O  OE2   . GLU A 1 261 ? 22.749  11.658  44.068  1.00 63.89  ? 260 GLU A OE2   1 
ATOM   2018 N  N     . ALA A 1 262 ? 21.746  16.248  40.574  1.00 45.73  ? 261 ALA A N     1 
ATOM   2019 C  CA    . ALA A 1 262 ? 20.513  16.818  40.043  1.00 54.42  ? 261 ALA A CA    1 
ATOM   2020 C  C     . ALA A 1 262 ? 20.615  17.026  38.532  1.00 60.65  ? 261 ALA A C     1 
ATOM   2021 O  O     . ALA A 1 262 ? 19.697  16.680  37.775  1.00 61.26  ? 261 ALA A O     1 
ATOM   2022 C  CB    . ALA A 1 262 ? 20.198  18.126  40.739  1.00 50.71  ? 261 ALA A CB    1 
ATOM   2023 N  N     . ILE A 1 263 ? 21.736  17.602  38.107  1.00 59.07  ? 262 ILE A N     1 
ATOM   2024 C  CA    . ILE A 1 263 ? 22.006  17.815  36.692  1.00 54.06  ? 262 ILE A CA    1 
ATOM   2025 C  C     . ILE A 1 263 ? 22.029  16.485  35.936  1.00 55.89  ? 262 ILE A C     1 
ATOM   2026 O  O     . ILE A 1 263 ? 21.534  16.395  34.811  1.00 58.32  ? 262 ILE A O     1 
ATOM   2027 C  CB    . ILE A 1 263 ? 23.325  18.587  36.495  1.00 51.38  ? 262 ILE A CB    1 
ATOM   2028 C  CG1   . ILE A 1 263 ? 23.196  19.995  37.082  1.00 46.01  ? 262 ILE A CG1   1 
ATOM   2029 C  CG2   . ILE A 1 263 ? 23.692  18.666  35.021  1.00 46.24  ? 262 ILE A CG2   1 
ATOM   2030 C  CD1   . ILE A 1 263 ? 24.520  20.681  37.335  1.00 44.90  ? 262 ILE A CD1   1 
ATOM   2031 N  N     . ILE A 1 264 ? 22.592  15.453  36.559  1.00 47.17  ? 263 ILE A N     1 
ATOM   2032 C  CA    . ILE A 1 264 ? 22.570  14.115  35.972  1.00 56.08  ? 263 ILE A CA    1 
ATOM   2033 C  C     . ILE A 1 264 ? 21.139  13.604  35.808  1.00 62.72  ? 263 ILE A C     1 
ATOM   2034 O  O     . ILE A 1 264 ? 20.793  13.005  34.787  1.00 62.80  ? 263 ILE A O     1 
ATOM   2035 C  CB    . ILE A 1 264 ? 23.375  13.116  36.819  1.00 57.17  ? 263 ILE A CB    1 
ATOM   2036 C  CG1   . ILE A 1 264 ? 24.863  13.441  36.735  1.00 47.25  ? 263 ILE A CG1   1 
ATOM   2037 C  CG2   . ILE A 1 264 ? 23.128  11.685  36.357  1.00 50.23  ? 263 ILE A CG2   1 
ATOM   2038 C  CD1   . ILE A 1 264 ? 25.697  12.597  37.640  1.00 44.78  ? 263 ILE A CD1   1 
ATOM   2039 N  N     . GLU A 1 265 ? 20.314  13.854  36.819  1.00 64.40  ? 264 GLU A N     1 
ATOM   2040 C  CA    . GLU A 1 265 ? 18.915  13.455  36.798  1.00 61.54  ? 264 GLU A CA    1 
ATOM   2041 C  C     . GLU A 1 265 ? 18.173  14.160  35.674  1.00 62.33  ? 264 GLU A C     1 
ATOM   2042 O  O     . GLU A 1 265 ? 17.230  13.611  35.107  1.00 64.67  ? 264 GLU A O     1 
ATOM   2043 C  CB    . GLU A 1 265 ? 18.245  13.775  38.137  1.00 58.68  ? 264 GLU A CB    1 
ATOM   2044 C  CG    . GLU A 1 265 ? 18.770  12.972  39.317  1.00 62.24  ? 264 GLU A CG    1 
ATOM   2045 C  CD    . GLU A 1 265 ? 18.206  11.565  39.369  1.00 62.89  ? 264 GLU A CD    1 
ATOM   2046 O  OE1   . GLU A 1 265 ? 17.348  11.230  38.526  1.00 63.29  ? 264 GLU A OE1   1 
ATOM   2047 O  OE2   . GLU A 1 265 ? 18.620  10.794  40.261  1.00 64.43  ? 264 GLU A OE2   1 
ATOM   2048 N  N     . ARG A 1 266 ? 18.597  15.381  35.360  1.00 59.64  ? 265 ARG A N     1 
ATOM   2049 C  CA    . ARG A 1 266 ? 17.967  16.132  34.277  1.00 64.87  ? 265 ARG A CA    1 
ATOM   2050 C  C     . ARG A 1 266 ? 18.580  15.813  32.912  1.00 58.25  ? 265 ARG A C     1 
ATOM   2051 O  O     . ARG A 1 266 ? 18.014  16.154  31.874  1.00 62.86  ? 265 ARG A O     1 
ATOM   2052 C  CB    . ARG A 1 266 ? 18.013  17.638  34.557  1.00 62.85  ? 265 ARG A CB    1 
ATOM   2053 C  CG    . ARG A 1 266 ? 17.110  18.081  35.699  1.00 69.50  ? 265 ARG A CG    1 
ATOM   2054 C  CD    . ARG A 1 266 ? 17.123  19.594  35.873  1.00 79.16  ? 265 ARG A CD    1 
ATOM   2055 N  NE    . ARG A 1 266 ? 16.736  20.292  34.650  1.00 86.76  ? 265 ARG A NE    1 
ATOM   2056 C  CZ    . ARG A 1 266 ? 15.479  20.502  34.274  1.00 92.83  ? 265 ARG A CZ    1 
ATOM   2057 N  NH1   . ARG A 1 266 ? 14.478  20.061  35.022  1.00 91.32  ? 265 ARG A NH1   1 
ATOM   2058 N  NH2   . ARG A 1 266 ? 15.224  21.145  33.144  1.00 93.47  ? 265 ARG A NH2   1 
ATOM   2059 N  N     . LEU A 1 267 ? 19.730  15.146  32.918  1.00 61.31  ? 266 LEU A N     1 
ATOM   2060 C  CA    . LEU A 1 267 ? 20.424  14.807  31.678  1.00 63.73  ? 266 LEU A CA    1 
ATOM   2061 C  C     . LEU A 1 267 ? 20.088  13.402  31.183  1.00 67.02  ? 266 LEU A C     1 
ATOM   2062 O  O     . LEU A 1 267 ? 20.101  13.142  29.979  1.00 64.78  ? 266 LEU A O     1 
ATOM   2063 C  CB    . LEU A 1 267 ? 21.938  14.954  31.850  1.00 57.22  ? 266 LEU A CB    1 
ATOM   2064 C  CG    . LEU A 1 267 ? 22.581  16.204  31.244  1.00 63.73  ? 266 LEU A CG    1 
ATOM   2065 C  CD1   . LEU A 1 267 ? 21.851  17.465  31.683  1.00 60.03  ? 266 LEU A CD1   1 
ATOM   2066 C  CD2   . LEU A 1 267 ? 24.051  16.275  31.622  1.00 58.51  ? 266 LEU A CD2   1 
ATOM   2067 N  N     . TYR A 1 268 ? 19.790  12.502  32.114  1.00 65.94  ? 267 TYR A N     1 
ATOM   2068 C  CA    . TYR A 1 268 ? 19.505  11.107  31.771  1.00 64.18  ? 267 TYR A CA    1 
ATOM   2069 C  C     . TYR A 1 268 ? 18.281  10.842  30.878  1.00 69.28  ? 267 TYR A C     1 
ATOM   2070 O  O     . TYR A 1 268 ? 18.353  9.980   30.003  1.00 70.87  ? 267 TYR A O     1 
ATOM   2071 C  CB    . TYR A 1 268 ? 19.443  10.222  33.020  1.00 64.61  ? 267 TYR A CB    1 
ATOM   2072 C  CG    . TYR A 1 268 ? 19.325  8.752   32.687  1.00 67.50  ? 267 TYR A CG    1 
ATOM   2073 C  CD1   . TYR A 1 268 ? 20.438  8.021   32.294  1.00 64.04  ? 267 TYR A CD1   1 
ATOM   2074 C  CD2   . TYR A 1 268 ? 18.100  8.098   32.750  1.00 69.70  ? 267 TYR A CD2   1 
ATOM   2075 C  CE1   . TYR A 1 268 ? 20.338  6.679   31.981  1.00 72.89  ? 267 TYR A CE1   1 
ATOM   2076 C  CE2   . TYR A 1 268 ? 17.990  6.755   32.439  1.00 73.07  ? 267 TYR A CE2   1 
ATOM   2077 C  CZ    . TYR A 1 268 ? 19.113  6.051   32.055  1.00 74.55  ? 267 TYR A CZ    1 
ATOM   2078 O  OH    . TYR A 1 268 ? 19.009  4.714   31.745  1.00 75.17  ? 267 TYR A OH    1 
ATOM   2079 N  N     . PRO A 1 269 ? 17.152  11.548  31.106  1.00 69.68  ? 268 PRO A N     1 
ATOM   2080 C  CA    . PRO A 1 269 ? 15.999  11.300  30.230  1.00 73.71  ? 268 PRO A CA    1 
ATOM   2081 C  C     . PRO A 1 269 ? 16.314  11.511  28.751  1.00 76.43  ? 268 PRO A C     1 
ATOM   2082 O  O     . PRO A 1 269 ? 15.702  10.874  27.895  1.00 81.39  ? 268 PRO A O     1 
ATOM   2083 C  CB    . PRO A 1 269 ? 14.986  12.350  30.690  1.00 69.94  ? 268 PRO A CB    1 
ATOM   2084 C  CG    . PRO A 1 269 ? 15.307  12.572  32.110  1.00 65.60  ? 268 PRO A CG    1 
ATOM   2085 C  CD    . PRO A 1 269 ? 16.801  12.466  32.205  1.00 70.05  ? 268 PRO A CD    1 
ATOM   2086 N  N     . GLU A 1 270 ? 17.263  12.394  28.462  1.00 76.25  ? 269 GLU A N     1 
ATOM   2087 C  CA    . GLU A 1 270 ? 17.607  12.712  27.083  1.00 71.91  ? 269 GLU A CA    1 
ATOM   2088 C  C     . GLU A 1 270 ? 18.633  11.736  26.510  1.00 68.76  ? 269 GLU A C     1 
ATOM   2089 O  O     . GLU A 1 270 ? 18.571  11.398  25.326  1.00 68.64  ? 269 GLU A O     1 
ATOM   2090 C  CB    . GLU A 1 270 ? 18.097  14.157  26.974  1.00 66.37  ? 269 GLU A CB    1 
ATOM   2091 C  CG    . GLU A 1 270 ? 18.003  14.746  25.580  1.00 74.71  ? 269 GLU A CG    1 
ATOM   2092 C  CD    . GLU A 1 270 ? 16.648  14.525  24.933  1.00 84.76  ? 269 GLU A CD    1 
ATOM   2093 O  OE1   . GLU A 1 270 ? 15.612  14.664  25.619  1.00 89.14  ? 269 GLU A OE1   1 
ATOM   2094 O  OE2   . GLU A 1 270 ? 16.622  14.219  23.724  1.00 85.78  ? 269 GLU A OE2   1 
ATOM   2095 N  N     . LEU A 1 271 ? 19.550  11.261  27.352  1.00 67.07  ? 270 LEU A N     1 
ATOM   2096 C  CA    . LEU A 1 271 ? 20.477  10.213  26.938  1.00 65.90  ? 270 LEU A CA    1 
ATOM   2097 C  C     . LEU A 1 271 ? 19.690  8.954   26.591  1.00 74.55  ? 270 LEU A C     1 
ATOM   2098 O  O     . LEU A 1 271 ? 20.122  8.137   25.778  1.00 76.25  ? 270 LEU A O     1 
ATOM   2099 C  CB    . LEU A 1 271 ? 21.496  9.916   28.039  1.00 60.28  ? 270 LEU A CB    1 
ATOM   2100 C  CG    . LEU A 1 271 ? 22.562  8.868   27.713  1.00 60.08  ? 270 LEU A CG    1 
ATOM   2101 C  CD1   . LEU A 1 271 ? 23.350  9.278   26.476  1.00 60.33  ? 270 LEU A CD1   1 
ATOM   2102 C  CD2   . LEU A 1 271 ? 23.497  8.642   28.892  1.00 64.73  ? 270 LEU A CD2   1 
ATOM   2103 N  N     . GLU A 1 272 ? 18.524  8.817   27.216  1.00 77.86  ? 271 GLU A N     1 
ATOM   2104 C  CA    . GLU A 1 272 ? 17.621  7.713   26.937  1.00 77.75  ? 271 GLU A CA    1 
ATOM   2105 C  C     . GLU A 1 272 ? 16.988  7.854   25.557  1.00 80.77  ? 271 GLU A C     1 
ATOM   2106 O  O     . GLU A 1 272 ? 17.219  7.028   24.674  1.00 77.36  ? 271 GLU A O     1 
ATOM   2107 C  CB    . GLU A 1 272 ? 16.524  7.646   27.999  1.00 78.78  ? 271 GLU A CB    1 
ATOM   2108 C  CG    . GLU A 1 272 ? 16.420  6.303   28.694  1.00 85.25  ? 271 GLU A CG    1 
ATOM   2109 C  CD    . GLU A 1 272 ? 15.065  6.085   29.334  1.00 91.22  ? 271 GLU A CD    1 
ATOM   2110 O  OE1   . GLU A 1 272 ? 14.151  6.902   29.091  1.00 94.01  ? 271 GLU A OE1   1 
ATOM   2111 O  OE2   . GLU A 1 272 ? 14.913  5.093   30.077  1.00 88.54  ? 271 GLU A OE2   1 
ATOM   2112 N  N     . ARG A 1 273 ? 16.198  8.909   25.370  1.00 77.62  ? 272 ARG A N     1 
ATOM   2113 C  CA    . ARG A 1 273 ? 15.425  9.070   24.138  1.00 75.65  ? 272 ARG A CA    1 
ATOM   2114 C  C     . ARG A 1 273 ? 16.248  9.526   22.931  1.00 81.53  ? 272 ARG A C     1 
ATOM   2115 O  O     . ARG A 1 273 ? 15.693  9.841   21.879  1.00 84.92  ? 272 ARG A O     1 
ATOM   2116 C  CB    . ARG A 1 273 ? 14.215  9.989   24.351  1.00 77.33  ? 272 ARG A CB    1 
ATOM   2117 C  CG    . ARG A 1 273 ? 14.551  11.407  24.776  1.00 76.53  ? 272 ARG A CG    1 
ATOM   2118 C  CD    . ARG A 1 273 ? 13.947  12.428  23.820  1.00 82.64  ? 272 ARG A CD    1 
ATOM   2119 N  NE    . ARG A 1 273 ? 14.659  12.466  22.545  1.00 87.87  ? 272 ARG A NE    1 
ATOM   2120 C  CZ    . ARG A 1 273 ? 14.492  13.408  21.622  1.00 87.85  ? 272 ARG A CZ    1 
ATOM   2121 N  NH1   . ARG A 1 273 ? 13.632  14.397  21.828  1.00 86.61  ? 272 ARG A NH1   1 
ATOM   2122 N  NH2   . ARG A 1 273 ? 15.186  13.364  20.494  1.00 89.17  ? 272 ARG A NH2   1 
ATOM   2123 N  N     . ARG A 1 274 ? 17.568  9.563   23.087  1.00 81.83  ? 273 ARG A N     1 
ATOM   2124 C  CA    . ARG A 1 274 ? 18.463  9.763   21.953  1.00 79.09  ? 273 ARG A CA    1 
ATOM   2125 C  C     . ARG A 1 274 ? 19.084  8.428   21.577  1.00 76.73  ? 273 ARG A C     1 
ATOM   2126 O  O     . ARG A 1 274 ? 19.362  8.160   20.409  1.00 78.26  ? 273 ARG A O     1 
ATOM   2127 C  CB    . ARG A 1 274 ? 19.558  10.776  22.285  1.00 75.09  ? 273 ARG A CB    1 
ATOM   2128 C  CG    . ARG A 1 274 ? 19.066  12.207  22.370  1.00 79.10  ? 273 ARG A CG    1 
ATOM   2129 C  CD    . ARG A 1 274 ? 20.213  13.182  22.560  1.00 79.85  ? 273 ARG A CD    1 
ATOM   2130 N  NE    . ARG A 1 274 ? 19.725  14.534  22.809  1.00 81.38  ? 273 ARG A NE    1 
ATOM   2131 C  CZ    . ARG A 1 274 ? 20.445  15.636  22.625  1.00 75.87  ? 273 ARG A CZ    1 
ATOM   2132 N  NH1   . ARG A 1 274 ? 21.691  15.550  22.180  1.00 67.17  ? 273 ARG A NH1   1 
ATOM   2133 N  NH2   . ARG A 1 274 ? 19.915  16.825  22.880  1.00 77.36  ? 273 ARG A NH2   1 
ATOM   2134 N  N     . LEU A 1 275 ? 19.294  7.594   22.588  1.00 75.49  ? 274 LEU A N     1 
ATOM   2135 C  CA    . LEU A 1 275 ? 19.840  6.262   22.390  1.00 77.48  ? 274 LEU A CA    1 
ATOM   2136 C  C     . LEU A 1 275 ? 18.742  5.300   21.956  1.00 83.52  ? 274 LEU A C     1 
ATOM   2137 O  O     . LEU A 1 275 ? 18.986  4.363   21.194  1.00 83.07  ? 274 LEU A O     1 
ATOM   2138 C  CB    . LEU A 1 275 ? 20.473  5.769   23.684  1.00 66.43  ? 274 LEU A CB    1 
ATOM   2139 C  CG    . LEU A 1 275 ? 20.927  4.315   23.703  1.00 69.80  ? 274 LEU A CG    1 
ATOM   2140 C  CD1   . LEU A 1 275 ? 22.234  4.153   22.944  1.00 68.34  ? 274 LEU A CD1   1 
ATOM   2141 C  CD2   . LEU A 1 275 ? 21.056  3.856   25.133  1.00 72.37  ? 274 LEU A CD2   1 
ATOM   2142 N  N     . ALA A 1 276 ? 17.531  5.541   22.447  1.00 81.67  ? 275 ALA A N     1 
ATOM   2143 C  CA    . ALA A 1 276 ? 16.381  4.712   22.111  1.00 77.95  ? 275 ALA A CA    1 
ATOM   2144 C  C     . ALA A 1 276 ? 16.091  4.752   20.615  1.00 85.00  ? 275 ALA A C     1 
ATOM   2145 O  O     . ALA A 1 276 ? 15.583  3.786   20.045  1.00 85.58  ? 275 ALA A O     1 
ATOM   2146 C  CB    . ALA A 1 276 ? 15.159  5.159   22.900  1.00 76.02  ? 275 ALA A CB    1 
ATOM   2147 N  N     . LYS A 1 277 ? 16.425  5.873   19.984  1.00 81.06  ? 276 LYS A N     1 
ATOM   2148 C  CA    . LYS A 1 277 ? 16.157  6.067   18.563  1.00 78.88  ? 276 LYS A CA    1 
ATOM   2149 C  C     . LYS A 1 277 ? 16.977  5.156   17.656  1.00 80.90  ? 276 LYS A C     1 
ATOM   2150 O  O     . LYS A 1 277 ? 16.516  4.767   16.584  1.00 84.98  ? 276 LYS A O     1 
ATOM   2151 C  CB    . LYS A 1 277 ? 16.377  7.528   18.168  1.00 70.98  ? 276 LYS A CB    1 
ATOM   2152 C  CG    . LYS A 1 277 ? 15.099  8.342   18.114  1.00 75.18  ? 276 LYS A CG    1 
ATOM   2153 C  CD    . LYS A 1 277 ? 15.385  9.825   17.964  1.00 77.64  ? 276 LYS A CD    1 
ATOM   2154 C  CE    . LYS A 1 277 ? 14.103  10.628  18.080  1.00 78.92  ? 276 LYS A CE    1 
ATOM   2155 N  NZ    . LYS A 1 277 ? 13.335  10.247  19.299  1.00 74.80  ? 276 LYS A NZ    1 
ATOM   2156 N  N     . VAL A 1 278 ? 18.190  4.817   18.077  1.00 77.86  ? 277 VAL A N     1 
ATOM   2157 C  CA    . VAL A 1 278 ? 19.067  4.010   17.234  1.00 80.97  ? 277 VAL A CA    1 
ATOM   2158 C  C     . VAL A 1 278 ? 19.384  2.655   17.855  1.00 84.95  ? 277 VAL A C     1 
ATOM   2159 O  O     . VAL A 1 278 ? 20.169  1.877   17.311  1.00 84.43  ? 277 VAL A O     1 
ATOM   2160 C  CB    . VAL A 1 278 ? 20.359  4.758   16.873  1.00 81.18  ? 277 VAL A CB    1 
ATOM   2161 C  CG1   . VAL A 1 278 ? 20.529  4.793   15.365  1.00 79.87  ? 277 VAL A CG1   1 
ATOM   2162 C  CG2   . VAL A 1 278 ? 20.326  6.170   17.436  1.00 80.45  ? 277 VAL A CG2   1 
ATOM   2163 N  N     . LYS A 1 279 ? 18.772  2.394   19.005  1.00 84.11  ? 278 LYS A N     1 
ATOM   2164 C  CA    . LYS A 1 279 ? 18.710  1.057   19.579  1.00 78.56  ? 278 LYS A CA    1 
ATOM   2165 C  C     . LYS A 1 279 ? 17.704  1.036   20.702  1.00 81.69  ? 278 LYS A C     1 
ATOM   2166 O  O     . LYS A 1 279 ? 18.026  1.388   21.836  1.00 82.86  ? 278 LYS A O     1 
ATOM   2167 C  CB    . LYS A 1 279 ? 20.037  0.613   20.147  1.00 77.95  ? 278 LYS A CB    1 
ATOM   2168 C  CG    . LYS A 1 279 ? 20.050  -0.854  20.569  1.00 84.51  ? 278 LYS A CG    1 
ATOM   2169 C  CD    . LYS A 1 279 ? 20.542  -1.740  19.431  1.00 90.99  ? 278 LYS A CD    1 
ATOM   2170 C  CE    . LYS A 1 279 ? 20.944  -3.124  19.925  1.00 90.27  ? 278 LYS A CE    1 
ATOM   2171 N  NZ    . LYS A 1 279 ? 22.386  -3.423  19.681  1.00 84.63  ? 278 LYS A NZ    1 
ATOM   2172 N  N     . PRO A 1 280 ? 16.484  0.602   20.390  1.00 87.43  ? 279 PRO A N     1 
ATOM   2173 C  CA    . PRO A 1 280 ? 15.349  0.582   21.314  1.00 82.94  ? 279 PRO A CA    1 
ATOM   2174 C  C     . PRO A 1 280 ? 15.615  -0.254  22.565  1.00 79.35  ? 279 PRO A C     1 
ATOM   2175 O  O     . PRO A 1 280 ? 15.002  0.001   23.601  1.00 77.45  ? 279 PRO A O     1 
ATOM   2176 C  CB    . PRO A 1 280 ? 14.235  -0.053  20.477  1.00 83.77  ? 279 PRO A CB    1 
ATOM   2177 C  CG    . PRO A 1 280 ? 14.638  0.199   19.056  1.00 84.33  ? 279 PRO A CG    1 
ATOM   2178 C  CD    . PRO A 1 280 ? 16.123  0.097   19.055  1.00 83.27  ? 279 PRO A CD    1 
ATOM   2179 N  N     . ASP A 1 281 ? 16.516  -1.228  22.473  1.00 76.26  ? 280 ASP A N     1 
ATOM   2180 C  CA    . ASP A 1 281 ? 16.802  -2.107  23.604  1.00 74.24  ? 280 ASP A CA    1 
ATOM   2181 C  C     . ASP A 1 281 ? 17.984  -1.616  24.434  1.00 74.89  ? 280 ASP A C     1 
ATOM   2182 O  O     . ASP A 1 281 ? 18.405  -2.287  25.380  1.00 75.20  ? 280 ASP A O     1 
ATOM   2183 C  CB    . ASP A 1 281 ? 17.046  -3.540  23.129  1.00 82.05  ? 280 ASP A CB    1 
ATOM   2184 C  CG    . ASP A 1 281 ? 18.188  -3.638  22.144  1.00 85.97  ? 280 ASP A CG    1 
ATOM   2185 O  OD1   . ASP A 1 281 ? 17.985  -3.273  20.967  1.00 85.41  ? 280 ASP A OD1   1 
ATOM   2186 O  OD2   . ASP A 1 281 ? 19.284  -4.086  22.544  1.00 86.49  ? 280 ASP A OD2   1 
ATOM   2187 N  N     . LEU A 1 282 ? 18.507  -0.448  24.070  1.00 76.07  ? 281 LEU A N     1 
ATOM   2188 C  CA    . LEU A 1 282 ? 19.584  0.200   24.815  1.00 73.07  ? 281 LEU A CA    1 
ATOM   2189 C  C     . LEU A 1 282 ? 20.817  -0.695  24.863  1.00 76.62  ? 281 LEU A C     1 
ATOM   2190 O  O     . LEU A 1 282 ? 21.065  -1.380  25.850  1.00 76.36  ? 281 LEU A O     1 
ATOM   2191 C  CB    . LEU A 1 282 ? 19.114  0.594   26.223  1.00 68.10  ? 281 LEU A CB    1 
ATOM   2192 C  CG    . LEU A 1 282 ? 18.322  1.899   26.399  1.00 67.97  ? 281 LEU A CG    1 
ATOM   2193 C  CD1   . LEU A 1 282 ? 17.623  2.347   25.119  1.00 68.35  ? 281 LEU A CD1   1 
ATOM   2194 C  CD2   . LEU A 1 282 ? 17.311  1.764   27.525  1.00 66.17  ? 281 LEU A CD2   1 
ATOM   2195 N  N     . LEU A 1 283 ? 21.578  -0.677  23.776  1.00 80.59  ? 282 LEU A N     1 
ATOM   2196 C  CA    . LEU A 1 283 ? 22.707  -1.577  23.590  1.00 79.11  ? 282 LEU A CA    1 
ATOM   2197 C  C     . LEU A 1 283 ? 23.837  -1.397  24.635  1.00 78.86  ? 282 LEU A C     1 
ATOM   2198 O  O     . LEU A 1 283 ? 23.724  -1.901  25.748  1.00 79.53  ? 282 LEU A O     1 
ATOM   2199 C  CB    . LEU A 1 283 ? 23.188  -1.487  22.129  1.00 83.34  ? 282 LEU A CB    1 
ATOM   2200 C  CG    . LEU A 1 283 ? 23.848  -0.238  21.526  1.00 85.40  ? 282 LEU A CG    1 
ATOM   2201 C  CD1   . LEU A 1 283 ? 25.148  -0.748  21.165  1.00 80.93  ? 282 LEU A CD1   1 
ATOM   2202 C  CD2   . LEU A 1 283 ? 23.276  0.333   20.274  1.00 83.60  ? 282 LEU A CD2   1 
ATOM   2203 N  N     . ILE A 1 284 ? 24.921  -0.725  24.250  1.00 79.93  ? 283 ILE A N     1 
ATOM   2204 C  CA    . ILE A 1 284 ? 26.002  -0.263  25.136  1.00 76.35  ? 283 ILE A CA    1 
ATOM   2205 C  C     . ILE A 1 284 ? 27.142  -1.261  25.379  1.00 75.42  ? 283 ILE A C     1 
ATOM   2206 O  O     . ILE A 1 284 ? 26.933  -2.353  25.913  1.00 77.15  ? 283 ILE A O     1 
ATOM   2207 C  CB    . ILE A 1 284 ? 25.484  0.358   26.470  1.00 77.02  ? 283 ILE A CB    1 
ATOM   2208 C  CG1   . ILE A 1 284 ? 25.058  1.806   26.253  1.00 78.38  ? 283 ILE A CG1   1 
ATOM   2209 C  CG2   . ILE A 1 284 ? 26.566  0.374   27.509  1.00 74.96  ? 283 ILE A CG2   1 
ATOM   2210 C  CD1   . ILE A 1 284 ? 23.923  1.975   25.297  1.00 76.76  ? 283 ILE A CD1   1 
ATOM   2211 N  N     . ALA A 1 285 ? 28.343  -0.866  24.957  1.00 72.89  ? 284 ALA A N     1 
ATOM   2212 C  CA    . ALA A 1 285 ? 29.562  -1.609  25.251  1.00 72.41  ? 284 ALA A CA    1 
ATOM   2213 C  C     . ALA A 1 285 ? 30.246  -0.966  26.449  1.00 73.84  ? 284 ALA A C     1 
ATOM   2214 O  O     . ALA A 1 285 ? 30.829  -1.655  27.287  1.00 72.25  ? 284 ALA A O     1 
ATOM   2215 C  CB    . ALA A 1 285 ? 30.486  -1.618  24.047  1.00 69.57  ? 284 ALA A CB    1 
ATOM   2216 N  N     . ARG A 1 286 ? 30.180  0.362   26.511  1.00 74.56  ? 285 ARG A N     1 
ATOM   2217 C  CA    . ARG A 1 286 ? 30.663  1.108   27.669  1.00 71.46  ? 285 ARG A CA    1 
ATOM   2218 C  C     . ARG A 1 286 ? 29.674  2.197   28.075  1.00 68.87  ? 285 ARG A C     1 
ATOM   2219 O  O     . ARG A 1 286 ? 28.838  2.626   27.273  1.00 65.85  ? 285 ARG A O     1 
ATOM   2220 C  CB    . ARG A 1 286 ? 32.020  1.761   27.393  1.00 62.29  ? 285 ARG A CB    1 
ATOM   2221 C  CG    . ARG A 1 286 ? 32.865  1.081   26.337  1.00 66.00  ? 285 ARG A CG    1 
ATOM   2222 C  CD    . ARG A 1 286 ? 34.205  1.780   26.182  1.00 73.80  ? 285 ARG A CD    1 
ATOM   2223 N  NE    . ARG A 1 286 ? 34.872  1.954   27.468  1.00 77.00  ? 285 ARG A NE    1 
ATOM   2224 C  CZ    . ARG A 1 286 ? 35.522  0.982   28.102  1.00 79.14  ? 285 ARG A CZ    1 
ATOM   2225 N  NH1   . ARG A 1 286 ? 35.580  -0.236  27.576  1.00 81.25  ? 285 ARG A NH1   1 
ATOM   2226 N  NH2   . ARG A 1 286 ? 36.107  1.223   29.265  1.00 79.78  ? 285 ARG A NH2   1 
ATOM   2227 N  N     . GLN A 1 287 ? 29.782  2.646   29.322  1.00 71.44  ? 286 GLN A N     1 
ATOM   2228 C  CA    . GLN A 1 287 ? 28.952  3.734   29.823  1.00 66.88  ? 286 GLN A CA    1 
ATOM   2229 C  C     . GLN A 1 287 ? 29.854  4.653   30.634  1.00 69.03  ? 286 GLN A C     1 
ATOM   2230 O  O     . GLN A 1 287 ? 30.852  4.201   31.195  1.00 70.30  ? 286 GLN A O     1 
ATOM   2231 C  CB    . GLN A 1 287 ? 27.845  3.177   30.713  1.00 70.67  ? 286 GLN A CB    1 
ATOM   2232 C  CG    . GLN A 1 287 ? 26.585  4.013   30.770  1.00 72.45  ? 286 GLN A CG    1 
ATOM   2233 C  CD    . GLN A 1 287 ? 25.649  3.554   31.869  1.00 71.94  ? 286 GLN A CD    1 
ATOM   2234 O  OE1   . GLN A 1 287 ? 26.072  2.899   32.821  1.00 68.08  ? 286 GLN A OE1   1 
ATOM   2235 N  NE2   . GLN A 1 287 ? 24.371  3.890   31.741  1.00 66.65  ? 286 GLN A NE2   1 
ATOM   2236 N  N     . GLY A 1 288 ? 29.521  5.937   30.709  1.00 69.76  ? 287 GLY A N     1 
ATOM   2237 C  CA    . GLY A 1 288 ? 30.392  6.849   31.424  1.00 64.57  ? 287 GLY A CA    1 
ATOM   2238 C  C     . GLY A 1 288 ? 29.927  8.271   31.655  1.00 56.94  ? 287 GLY A C     1 
ATOM   2239 O  O     . GLY A 1 288 ? 28.872  8.690   31.179  1.00 56.90  ? 287 GLY A O     1 
ATOM   2240 N  N     . VAL A 1 289 ? 30.741  9.015   32.400  1.00 63.46  ? 288 VAL A N     1 
ATOM   2241 C  CA    . VAL A 1 289 ? 30.427  10.394  32.757  1.00 60.18  ? 288 VAL A CA    1 
ATOM   2242 C  C     . VAL A 1 289 ? 31.593  11.296  32.374  1.00 59.48  ? 288 VAL A C     1 
ATOM   2243 O  O     . VAL A 1 289 ? 32.716  10.826  32.199  1.00 59.48  ? 288 VAL A O     1 
ATOM   2244 C  CB    . VAL A 1 289 ? 30.180  10.536  34.280  1.00 53.12  ? 288 VAL A CB    1 
ATOM   2245 C  CG1   . VAL A 1 289 ? 29.455  11.840  34.606  1.00 62.19  ? 288 VAL A CG1   1 
ATOM   2246 C  CG2   . VAL A 1 289 ? 29.386  9.359   34.805  1.00 58.54  ? 288 VAL A CG2   1 
ATOM   2247 N  N     . LYS A 1 290 ? 31.329  12.591  32.241  1.00 55.29  ? 289 LYS A N     1 
ATOM   2248 C  CA    . LYS A 1 290 ? 32.402  13.553  32.050  1.00 52.37  ? 289 LYS A CA    1 
ATOM   2249 C  C     . LYS A 1 290 ? 32.207  14.777  32.944  1.00 54.54  ? 289 LYS A C     1 
ATOM   2250 O  O     . LYS A 1 290 ? 31.083  15.229  33.166  1.00 55.10  ? 289 LYS A O     1 
ATOM   2251 C  CB    . LYS A 1 290 ? 32.538  13.944  30.575  1.00 55.60  ? 289 LYS A CB    1 
ATOM   2252 C  CG    . LYS A 1 290 ? 31.882  15.251  30.194  1.00 63.39  ? 289 LYS A CG    1 
ATOM   2253 C  CD    . LYS A 1 290 ? 32.754  16.040  29.225  1.00 49.59  ? 289 LYS A CD    1 
ATOM   2254 C  CE    . LYS A 1 290 ? 32.778  15.423  27.838  1.00 58.82  ? 289 LYS A CE    1 
ATOM   2255 N  NZ    . LYS A 1 290 ? 33.477  16.314  26.874  1.00 69.64  ? 289 LYS A NZ    1 
ATOM   2256 N  N     . LEU A 1 291 ? 33.310  15.284  33.485  1.00 51.82  ? 290 LEU A N     1 
ATOM   2257 C  CA    . LEU A 1 291 ? 33.279  16.474  34.327  1.00 53.13  ? 290 LEU A CA    1 
ATOM   2258 C  C     . LEU A 1 291 ? 34.283  17.494  33.813  1.00 50.57  ? 290 LEU A C     1 
ATOM   2259 O  O     . LEU A 1 291 ? 35.418  17.148  33.503  1.00 47.51  ? 290 LEU A O     1 
ATOM   2260 C  CB    . LEU A 1 291 ? 33.606  16.121  35.781  1.00 51.39  ? 290 LEU A CB    1 
ATOM   2261 C  CG    . LEU A 1 291 ? 32.579  15.309  36.573  1.00 52.49  ? 290 LEU A CG    1 
ATOM   2262 C  CD1   . LEU A 1 291 ? 33.120  14.965  37.954  1.00 46.45  ? 290 LEU A CD1   1 
ATOM   2263 C  CD2   . LEU A 1 291 ? 31.264  16.065  36.686  1.00 47.64  ? 290 LEU A CD2   1 
ATOM   2264 N  N     . LYS A 1 292 ? 33.865  18.750  33.716  1.00 49.81  ? 291 LYS A N     1 
ATOM   2265 C  CA    . LYS A 1 292 ? 34.772  19.812  33.303  1.00 49.49  ? 291 LYS A CA    1 
ATOM   2266 C  C     . LYS A 1 292 ? 34.917  20.811  34.441  1.00 50.68  ? 291 LYS A C     1 
ATOM   2267 O  O     . LYS A 1 292 ? 33.923  21.260  35.010  1.00 48.72  ? 291 LYS A O     1 
ATOM   2268 C  CB    . LYS A 1 292 ? 34.259  20.502  32.041  1.00 51.96  ? 291 LYS A CB    1 
ATOM   2269 C  CG    . LYS A 1 292 ? 35.339  21.209  31.240  1.00 54.62  ? 291 LYS A CG    1 
ATOM   2270 C  CD    . LYS A 1 292 ? 34.762  21.843  29.985  1.00 55.20  ? 291 LYS A CD    1 
ATOM   2271 C  CE    . LYS A 1 292 ? 35.860  22.339  29.060  1.00 56.80  ? 291 LYS A CE    1 
ATOM   2272 N  NZ    . LYS A 1 292 ? 36.702  21.225  28.542  1.00 60.46  ? 291 LYS A NZ    1 
ATOM   2273 N  N     . PHE A 1 293 ? 36.156  21.152  34.774  1.00 47.06  ? 292 PHE A N     1 
ATOM   2274 C  CA    . PHE A 1 293 ? 36.425  21.976  35.947  1.00 51.40  ? 292 PHE A CA    1 
ATOM   2275 C  C     . PHE A 1 293 ? 36.677  23.440  35.594  1.00 51.57  ? 292 PHE A C     1 
ATOM   2276 O  O     . PHE A 1 293 ? 36.774  23.797  34.420  1.00 56.29  ? 292 PHE A O     1 
ATOM   2277 C  CB    . PHE A 1 293 ? 37.596  21.394  36.740  1.00 50.25  ? 292 PHE A CB    1 
ATOM   2278 C  CG    . PHE A 1 293 ? 37.490  19.914  36.965  1.00 52.07  ? 292 PHE A CG    1 
ATOM   2279 C  CD1   . PHE A 1 293 ? 38.244  19.029  36.213  1.00 52.82  ? 292 PHE A CD1   1 
ATOM   2280 C  CD2   . PHE A 1 293 ? 36.618  19.405  37.914  1.00 58.12  ? 292 PHE A CD2   1 
ATOM   2281 C  CE1   . PHE A 1 293 ? 38.142  17.664  36.412  1.00 49.46  ? 292 PHE A CE1   1 
ATOM   2282 C  CE2   . PHE A 1 293 ? 36.511  18.042  38.117  1.00 50.38  ? 292 PHE A CE2   1 
ATOM   2283 C  CZ    . PHE A 1 293 ? 37.275  17.171  37.366  1.00 49.90  ? 292 PHE A CZ    1 
ATOM   2284 N  N     . ASP A 1 294 ? 36.780  24.278  36.621  1.00 51.16  ? 293 ASP A N     1 
ATOM   2285 C  CA    . ASP A 1 294 ? 36.927  25.721  36.438  1.00 60.33  ? 293 ASP A CA    1 
ATOM   2286 C  C     . ASP A 1 294 ? 38.204  26.114  35.695  1.00 53.74  ? 293 ASP A C     1 
ATOM   2287 O  O     . ASP A 1 294 ? 38.263  27.173  35.070  1.00 59.27  ? 293 ASP A O     1 
ATOM   2288 C  CB    . ASP A 1 294 ? 36.844  26.444  37.786  1.00 55.70  ? 293 ASP A CB    1 
ATOM   2289 C  CG    . ASP A 1 294 ? 37.659  25.761  38.868  1.00 57.07  ? 293 ASP A CG    1 
ATOM   2290 O  OD1   . ASP A 1 294 ? 38.796  25.331  38.581  1.00 58.54  ? 293 ASP A OD1   1 
ATOM   2291 O  OD2   . ASP A 1 294 ? 37.157  25.650  40.006  1.00 60.18  ? 293 ASP A OD2   1 
ATOM   2292 N  N     . ASP A 1 295 ? 39.219  25.258  35.758  1.00 51.09  ? 294 ASP A N     1 
ATOM   2293 C  CA    . ASP A 1 295 ? 40.459  25.491  35.024  1.00 49.27  ? 294 ASP A CA    1 
ATOM   2294 C  C     . ASP A 1 295 ? 40.339  24.996  33.585  1.00 54.85  ? 294 ASP A C     1 
ATOM   2295 O  O     . ASP A 1 295 ? 41.340  24.853  32.880  1.00 53.48  ? 294 ASP A O     1 
ATOM   2296 C  CB    . ASP A 1 295 ? 41.643  24.818  35.725  1.00 52.58  ? 294 ASP A CB    1 
ATOM   2297 C  CG    . ASP A 1 295 ? 41.378  23.359  36.055  1.00 55.38  ? 294 ASP A CG    1 
ATOM   2298 O  OD1   . ASP A 1 295 ? 40.394  22.789  35.537  1.00 56.17  ? 294 ASP A OD1   1 
ATOM   2299 O  OD2   . ASP A 1 295 ? 42.165  22.776  36.830  1.00 59.09  ? 294 ASP A OD2   1 
ATOM   2300 N  N     . PHE A 1 296 ? 39.102  24.718  33.175  1.00 51.85  ? 295 PHE A N     1 
ATOM   2301 C  CA    . PHE A 1 296 ? 38.774  24.233  31.833  1.00 52.97  ? 295 PHE A CA    1 
ATOM   2302 C  C     . PHE A 1 296 ? 39.345  22.845  31.533  1.00 53.55  ? 295 PHE A C     1 
ATOM   2303 O  O     . PHE A 1 296 ? 39.173  22.321  30.432  1.00 54.31  ? 295 PHE A O     1 
ATOM   2304 C  CB    . PHE A 1 296 ? 39.184  25.245  30.758  1.00 52.93  ? 295 PHE A CB    1 
ATOM   2305 C  CG    . PHE A 1 296 ? 38.207  25.349  29.621  1.00 54.93  ? 295 PHE A CG    1 
ATOM   2306 C  CD1   . PHE A 1 296 ? 38.505  24.809  28.380  1.00 56.29  ? 295 PHE A CD1   1 
ATOM   2307 C  CD2   . PHE A 1 296 ? 36.988  25.982  29.796  1.00 50.13  ? 295 PHE A CD2   1 
ATOM   2308 C  CE1   . PHE A 1 296 ? 37.606  24.905  27.333  1.00 53.01  ? 295 PHE A CE1   1 
ATOM   2309 C  CE2   . PHE A 1 296 ? 36.085  26.081  28.754  1.00 53.18  ? 295 PHE A CE2   1 
ATOM   2310 C  CZ    . PHE A 1 296 ? 36.394  25.541  27.521  1.00 56.79  ? 295 PHE A CZ    1 
ATOM   2311 N  N     . GLN A 1 297 ? 40.018  22.254  32.515  1.00 48.97  ? 296 GLN A N     1 
ATOM   2312 C  CA    . GLN A 1 297 ? 40.489  20.882  32.400  1.00 50.89  ? 296 GLN A CA    1 
ATOM   2313 C  C     . GLN A 1 297 ? 39.295  19.964  32.598  1.00 48.80  ? 296 GLN A C     1 
ATOM   2314 O  O     . GLN A 1 297 ? 38.384  20.282  33.361  1.00 51.69  ? 296 GLN A O     1 
ATOM   2315 C  CB    . GLN A 1 297 ? 41.552  20.590  33.460  1.00 54.32  ? 296 GLN A CB    1 
ATOM   2316 C  CG    . GLN A 1 297 ? 42.722  21.561  33.455  1.00 62.16  ? 296 GLN A CG    1 
ATOM   2317 C  CD    . GLN A 1 297 ? 43.963  20.981  32.808  1.00 63.55  ? 296 GLN A CD    1 
ATOM   2318 O  OE1   . GLN A 1 297 ? 44.545  21.583  31.905  1.00 64.43  ? 296 GLN A OE1   1 
ATOM   2319 N  NE2   . GLN A 1 297 ? 44.381  19.811  33.275  1.00 67.88  ? 296 GLN A NE2   1 
ATOM   2320 N  N     . GLN A 1 298 ? 39.289  18.829  31.912  1.00 49.01  ? 297 GLN A N     1 
ATOM   2321 C  CA    . GLN A 1 298 ? 38.173  17.902  32.038  1.00 51.95  ? 297 GLN A CA    1 
ATOM   2322 C  C     . GLN A 1 298 ? 38.631  16.460  32.200  1.00 54.54  ? 297 GLN A C     1 
ATOM   2323 O  O     . GLN A 1 298 ? 39.755  16.106  31.846  1.00 58.51  ? 297 GLN A O     1 
ATOM   2324 C  CB    . GLN A 1 298 ? 37.223  18.029  30.845  1.00 51.00  ? 297 GLN A CB    1 
ATOM   2325 C  CG    . GLN A 1 298 ? 37.808  17.574  29.522  1.00 55.52  ? 297 GLN A CG    1 
ATOM   2326 C  CD    . GLN A 1 298 ? 36.803  17.653  28.391  1.00 61.69  ? 297 GLN A CD    1 
ATOM   2327 O  OE1   . GLN A 1 298 ? 35.895  18.485  28.408  1.00 61.17  ? 297 GLN A OE1   1 
ATOM   2328 N  NE2   . GLN A 1 298 ? 36.953  16.778  27.403  1.00 65.79  ? 297 GLN A NE2   1 
ATOM   2329 N  N     . THR A 1 299 ? 37.745  15.634  32.745  1.00 56.58  ? 298 THR A N     1 
ATOM   2330 C  CA    . THR A 1 299 ? 38.021  14.218  32.916  1.00 55.82  ? 298 THR A CA    1 
ATOM   2331 C  C     . THR A 1 299 ? 36.815  13.367  32.531  1.00 56.61  ? 298 THR A C     1 
ATOM   2332 O  O     . THR A 1 299 ? 35.665  13.778  32.702  1.00 54.50  ? 298 THR A O     1 
ATOM   2333 C  CB    . THR A 1 299 ? 38.457  13.887  34.360  1.00 55.56  ? 298 THR A CB    1 
ATOM   2334 O  OG1   . THR A 1 299 ? 38.770  12.492  34.459  1.00 59.76  ? 298 THR A OG1   1 
ATOM   2335 C  CG2   . THR A 1 299 ? 37.353  14.227  35.352  1.00 53.62  ? 298 THR A CG2   1 
ATOM   2336 N  N     . THR A 1 300 ? 37.092  12.184  31.994  1.00 58.10  ? 299 THR A N     1 
ATOM   2337 C  CA    . THR A 1 300 ? 36.050  11.242  31.617  1.00 57.54  ? 299 THR A CA    1 
ATOM   2338 C  C     . THR A 1 300 ? 36.247  9.935   32.364  1.00 55.32  ? 299 THR A C     1 
ATOM   2339 O  O     . THR A 1 300 ? 37.380  9.488   32.570  1.00 58.07  ? 299 THR A O     1 
ATOM   2340 C  CB    . THR A 1 300 ? 36.063  10.961  30.104  1.00 56.76  ? 299 THR A CB    1 
ATOM   2341 O  OG1   . THR A 1 300 ? 37.417  10.819  29.659  1.00 52.15  ? 299 THR A OG1   1 
ATOM   2342 C  CG2   . THR A 1 300 ? 35.412  12.103  29.346  1.00 50.86  ? 299 THR A CG2   1 
ATOM   2343 N  N     . GLN A 1 301 ? 35.142  9.333   32.787  1.00 59.80  ? 300 GLN A N     1 
ATOM   2344 C  CA    . GLN A 1 301 ? 35.207  8.036   33.439  1.00 66.48  ? 300 GLN A CA    1 
ATOM   2345 C  C     . GLN A 1 301 ? 34.208  7.076   32.796  1.00 63.92  ? 300 GLN A C     1 
ATOM   2346 O  O     . GLN A 1 301 ? 32.990  7.211   32.979  1.00 58.34  ? 300 GLN A O     1 
ATOM   2347 C  CB    . GLN A 1 301 ? 34.973  8.165   34.949  1.00 62.65  ? 300 GLN A CB    1 
ATOM   2348 C  CG    . GLN A 1 301 ? 35.460  6.953   35.750  1.00 64.44  ? 300 GLN A CG    1 
ATOM   2349 C  CD    . GLN A 1 301 ? 35.507  7.215   37.245  1.00 63.01  ? 300 GLN A CD    1 
ATOM   2350 O  OE1   . GLN A 1 301 ? 35.250  8.328   37.701  1.00 64.70  ? 300 GLN A OE1   1 
ATOM   2351 N  NE2   . GLN A 1 301 ? 35.844  6.190   38.015  1.00 63.19  ? 300 GLN A NE2   1 
ATOM   2352 N  N     . GLU A 1 302 ? 34.734  6.131   32.021  1.00 68.48  ? 301 GLU A N     1 
ATOM   2353 C  CA    . GLU A 1 302 ? 33.911  5.130   31.360  1.00 68.77  ? 301 GLU A CA    1 
ATOM   2354 C  C     . GLU A 1 302 ? 34.291  3.731   31.807  1.00 69.33  ? 301 GLU A C     1 
ATOM   2355 O  O     . GLU A 1 302 ? 35.400  3.494   32.288  1.00 73.56  ? 301 GLU A O     1 
ATOM   2356 C  CB    . GLU A 1 302 ? 34.042  5.229   29.841  1.00 70.24  ? 301 GLU A CB    1 
ATOM   2357 C  CG    . GLU A 1 302 ? 33.238  6.345   29.221  1.00 71.99  ? 301 GLU A CG    1 
ATOM   2358 C  CD    . GLU A 1 302 ? 33.252  6.285   27.713  1.00 79.60  ? 301 GLU A CD    1 
ATOM   2359 O  OE1   . GLU A 1 302 ? 34.355  6.209   27.130  1.00 79.54  ? 301 GLU A OE1   1 
ATOM   2360 O  OE2   . GLU A 1 302 ? 32.158  6.303   27.115  1.00 72.51  ? 301 GLU A OE2   1 
ATOM   2361 N  N     . HIS A 1 303 ? 33.358  2.804   31.643  1.00 67.72  ? 302 HIS A N     1 
ATOM   2362 C  CA    . HIS A 1 303 ? 33.620  1.410   31.957  1.00 70.68  ? 302 HIS A CA    1 
ATOM   2363 C  C     . HIS A 1 303 ? 32.821  0.476   31.060  1.00 72.45  ? 302 HIS A C     1 
ATOM   2364 O  O     . HIS A 1 303 ? 31.775  0.861   30.526  1.00 67.89  ? 302 HIS A O     1 
ATOM   2365 C  CB    . HIS A 1 303 ? 33.325  1.117   33.431  1.00 66.72  ? 302 HIS A CB    1 
ATOM   2366 C  CG    . HIS A 1 303 ? 31.930  1.462   33.855  1.00 69.23  ? 302 HIS A CG    1 
ATOM   2367 N  ND1   . HIS A 1 303 ? 30.903  1.665   32.959  1.00 73.53  ? 302 HIS A ND1   1 
ATOM   2368 C  CD2   . HIS A 1 303 ? 31.395  1.641   35.086  1.00 70.58  ? 302 HIS A CD2   1 
ATOM   2369 C  CE1   . HIS A 1 303 ? 29.795  1.952   33.619  1.00 74.24  ? 302 HIS A CE1   1 
ATOM   2370 N  NE2   . HIS A 1 303 ? 30.067  1.944   34.911  1.00 71.88  ? 302 HIS A NE2   1 
ATOM   2371 N  N     . VAL A 1 304 ? 33.326  -0.743  30.894  1.00 75.83  ? 303 VAL A N     1 
ATOM   2372 C  CA    . VAL A 1 304 ? 32.587  -1.794  30.212  1.00 73.64  ? 303 VAL A CA    1 
ATOM   2373 C  C     . VAL A 1 304 ? 31.250  -1.970  30.911  1.00 71.12  ? 303 VAL A C     1 
ATOM   2374 O  O     . VAL A 1 304 ? 31.197  -2.261  32.107  1.00 71.18  ? 303 VAL A O     1 
ATOM   2375 C  CB    . VAL A 1 304 ? 33.339  -3.137  30.246  1.00 72.40  ? 303 VAL A CB    1 
ATOM   2376 C  CG1   . VAL A 1 304 ? 32.438  -4.265  29.766  1.00 63.42  ? 303 VAL A CG1   1 
ATOM   2377 C  CG2   . VAL A 1 304 ? 34.606  -3.064  29.411  1.00 75.64  ? 303 VAL A CG2   1 
ATOM   2378 N  N     . TRP A 1 305 ? 30.170  -1.772  30.166  1.00 70.46  ? 304 TRP A N     1 
ATOM   2379 C  CA    . TRP A 1 305 ? 28.831  -1.868  30.723  1.00 75.03  ? 304 TRP A CA    1 
ATOM   2380 C  C     . TRP A 1 305 ? 27.898  -2.455  29.670  1.00 77.30  ? 304 TRP A C     1 
ATOM   2381 O  O     . TRP A 1 305 ? 28.032  -2.148  28.484  1.00 76.94  ? 304 TRP A O     1 
ATOM   2382 C  CB    . TRP A 1 305 ? 28.356  -0.490  31.183  1.00 74.12  ? 304 TRP A CB    1 
ATOM   2383 C  CG    . TRP A 1 305 ? 27.283  -0.545  32.209  1.00 77.47  ? 304 TRP A CG    1 
ATOM   2384 C  CD1   . TRP A 1 305 ? 26.003  -0.122  32.067  1.00 79.20  ? 304 TRP A CD1   1 
ATOM   2385 C  CD2   . TRP A 1 305 ? 27.393  -1.072  33.534  1.00 75.76  ? 304 TRP A CD2   1 
ATOM   2386 N  NE1   . TRP A 1 305 ? 25.299  -0.344  33.224  1.00 76.58  ? 304 TRP A NE1   1 
ATOM   2387 C  CE2   . TRP A 1 305 ? 26.129  -0.927  34.143  1.00 74.76  ? 304 TRP A CE2   1 
ATOM   2388 C  CE3   . TRP A 1 305 ? 28.431  -1.650  34.270  1.00 74.41  ? 304 TRP A CE3   1 
ATOM   2389 C  CZ2   . TRP A 1 305 ? 25.879  -1.338  35.448  1.00 72.36  ? 304 TRP A CZ2   1 
ATOM   2390 C  CZ3   . TRP A 1 305 ? 28.182  -2.056  35.565  1.00 67.85  ? 304 TRP A CZ3   1 
ATOM   2391 C  CH2   . TRP A 1 305 ? 26.915  -1.900  36.141  1.00 72.06  ? 304 TRP A CH2   1 
ATOM   2392 N  N     . PRO A 1 306 ? 26.965  -3.325  30.098  1.00 79.82  ? 305 PRO A N     1 
ATOM   2393 C  CA    . PRO A 1 306 ? 26.134  -4.056  29.137  1.00 76.84  ? 305 PRO A CA    1 
ATOM   2394 C  C     . PRO A 1 306 ? 24.873  -3.312  28.698  1.00 76.82  ? 305 PRO A C     1 
ATOM   2395 O  O     . PRO A 1 306 ? 24.331  -3.668  27.651  1.00 76.25  ? 305 PRO A O     1 
ATOM   2396 C  CB    . PRO A 1 306 ? 25.740  -5.311  29.916  1.00 75.65  ? 305 PRO A CB    1 
ATOM   2397 C  CG    . PRO A 1 306 ? 25.678  -4.852  31.339  1.00 75.62  ? 305 PRO A CG    1 
ATOM   2398 C  CD    . PRO A 1 306 ? 26.761  -3.804  31.480  1.00 76.79  ? 305 PRO A CD    1 
ATOM   2399 N  N     . ARG A 1 307 ? 24.413  -2.320  29.461  1.00 75.48  ? 306 ARG A N     1 
ATOM   2400 C  CA    . ARG A 1 307 ? 23.159  -1.639  29.129  1.00 73.47  ? 306 ARG A CA    1 
ATOM   2401 C  C     . ARG A 1 307 ? 22.978  -0.302  29.858  1.00 76.27  ? 306 ARG A C     1 
ATOM   2402 O  O     . ARG A 1 307 ? 23.343  -0.167  31.024  1.00 77.46  ? 306 ARG A O     1 
ATOM   2403 C  CB    . ARG A 1 307 ? 21.968  -2.549  29.443  1.00 79.30  ? 306 ARG A CB    1 
ATOM   2404 C  CG    . ARG A 1 307 ? 20.637  -2.008  28.947  1.00 78.94  ? 306 ARG A CG    1 
ATOM   2405 C  CD    . ARG A 1 307 ? 19.499  -2.364  29.887  1.00 76.68  ? 306 ARG A CD    1 
ATOM   2406 N  NE    . ARG A 1 307 ? 18.234  -1.786  29.441  1.00 82.91  ? 306 ARG A NE    1 
ATOM   2407 C  CZ    . ARG A 1 307 ? 17.106  -1.815  30.144  1.00 95.77  ? 306 ARG A CZ    1 
ATOM   2408 N  NH1   . ARG A 1 307 ? 17.081  -2.393  31.337  1.00 100.71 ? 306 ARG A NH1   1 
ATOM   2409 N  NH2   . ARG A 1 307 ? 16.003  -1.263  29.656  1.00 86.13  ? 306 ARG A NH2   1 
ATOM   2410 N  N     . LEU A 1 308 ? 22.382  0.672   29.172  1.00 76.74  ? 307 LEU A N     1 
ATOM   2411 C  CA    . LEU A 1 308 ? 22.132  1.995   29.748  1.00 77.58  ? 307 LEU A CA    1 
ATOM   2412 C  C     . LEU A 1 308 ? 21.284  1.952   31.019  1.00 78.26  ? 307 LEU A C     1 
ATOM   2413 O  O     . LEU A 1 308 ? 20.155  1.462   31.007  1.00 81.40  ? 307 LEU A O     1 
ATOM   2414 C  CB    . LEU A 1 308 ? 21.447  2.907   28.724  1.00 72.01  ? 307 LEU A CB    1 
ATOM   2415 C  CG    . LEU A 1 308 ? 21.097  4.309   29.237  1.00 72.85  ? 307 LEU A CG    1 
ATOM   2416 C  CD1   . LEU A 1 308 ? 22.348  5.167   29.341  1.00 73.86  ? 307 LEU A CD1   1 
ATOM   2417 C  CD2   . LEU A 1 308 ? 20.042  4.986   28.371  1.00 68.03  ? 307 LEU A CD2   1 
ATOM   2418 N  N     . ASN A 1 309 ? 21.837  2.470   32.113  1.00 73.34  ? 308 ASN A N     1 
ATOM   2419 C  CA    . ASN A 1 309 ? 21.092  2.620   33.361  1.00 76.59  ? 308 ASN A CA    1 
ATOM   2420 C  C     . ASN A 1 309 ? 21.612  3.789   34.201  1.00 71.87  ? 308 ASN A C     1 
ATOM   2421 O  O     . ASN A 1 309 ? 22.820  3.952   34.380  1.00 67.22  ? 308 ASN A O     1 
ATOM   2422 C  CB    . ASN A 1 309 ? 21.088  1.315   34.166  1.00 81.73  ? 308 ASN A CB    1 
ATOM   2423 C  CG    . ASN A 1 309 ? 22.462  0.937   34.679  1.00 75.82  ? 308 ASN A CG    1 
ATOM   2424 O  OD1   . ASN A 1 309 ? 23.341  0.556   33.908  1.00 74.22  ? 308 ASN A OD1   1 
ATOM   2425 N  ND2   . ASN A 1 309 ? 22.649  1.027   35.991  1.00 72.55  ? 308 ASN A ND2   1 
ATOM   2426 N  N     . LYS A 1 310 ? 20.686  4.598   34.709  1.00 71.25  ? 309 LYS A N     1 
ATOM   2427 C  CA    . LYS A 1 310 ? 21.015  5.845   35.400  1.00 59.74  ? 309 LYS A CA    1 
ATOM   2428 C  C     . LYS A 1 310 ? 21.846  5.666   36.672  1.00 62.46  ? 309 LYS A C     1 
ATOM   2429 O  O     . LYS A 1 310 ? 22.806  6.409   36.906  1.00 70.40  ? 309 LYS A O     1 
ATOM   2430 C  CB    . LYS A 1 310 ? 19.734  6.624   35.721  1.00 60.08  ? 309 LYS A CB    1 
ATOM   2431 C  CG    . LYS A 1 310 ? 19.949  7.814   36.644  1.00 62.90  ? 309 LYS A CG    1 
ATOM   2432 C  CD    . LYS A 1 310 ? 18.744  8.745   36.667  1.00 64.41  ? 309 LYS A CD    1 
ATOM   2433 C  CE    . LYS A 1 310 ? 17.542  8.110   37.346  1.00 53.36  ? 309 LYS A CE    1 
ATOM   2434 N  NZ    . LYS A 1 310 ? 16.416  9.080   37.463  1.00 53.47  ? 309 LYS A NZ    1 
ATOM   2435 N  N     . ALA A 1 311 ? 21.468  4.685   37.487  1.00 66.03  ? 310 ALA A N     1 
ATOM   2436 C  CA    . ALA A 1 311 ? 22.095  4.457   38.788  1.00 63.98  ? 310 ALA A CA    1 
ATOM   2437 C  C     . ALA A 1 311 ? 23.616  4.334   38.706  1.00 63.69  ? 310 ALA A C     1 
ATOM   2438 O  O     . ALA A 1 311 ? 24.346  4.949   39.492  1.00 67.26  ? 310 ALA A O     1 
ATOM   2439 C  CB    . ALA A 1 311 ? 21.497  3.220   39.449  1.00 60.37  ? 310 ALA A CB    1 
ATOM   2440 N  N     . ASP A 1 312 ? 24.086  3.545   37.746  1.00 59.55  ? 311 ASP A N     1 
ATOM   2441 C  CA    . ASP A 1 312 ? 25.513  3.308   37.589  1.00 66.89  ? 311 ASP A CA    1 
ATOM   2442 C  C     . ASP A 1 312 ? 26.237  4.586   37.178  1.00 64.45  ? 311 ASP A C     1 
ATOM   2443 O  O     . ASP A 1 312 ? 27.335  4.863   37.656  1.00 57.60  ? 311 ASP A O     1 
ATOM   2444 C  CB    . ASP A 1 312 ? 25.762  2.197   36.571  1.00 62.25  ? 311 ASP A CB    1 
ATOM   2445 C  CG    . ASP A 1 312 ? 27.096  1.513   36.775  1.00 74.52  ? 311 ASP A CG    1 
ATOM   2446 O  OD1   . ASP A 1 312 ? 27.223  0.732   37.742  1.00 80.00  ? 311 ASP A OD1   1 
ATOM   2447 O  OD2   . ASP A 1 312 ? 28.016  1.752   35.969  1.00 76.04  ? 311 ASP A OD2   1 
ATOM   2448 N  N     . LEU A 1 313 ? 25.612  5.358   36.293  1.00 60.58  ? 312 LEU A N     1 
ATOM   2449 C  CA    . LEU A 1 313 ? 26.141  6.655   35.889  1.00 57.77  ? 312 LEU A CA    1 
ATOM   2450 C  C     . LEU A 1 313 ? 26.290  7.575   37.095  1.00 65.76  ? 312 LEU A C     1 
ATOM   2451 O  O     . LEU A 1 313 ? 27.305  8.256   37.245  1.00 59.76  ? 312 LEU A O     1 
ATOM   2452 C  CB    . LEU A 1 313 ? 25.234  7.305   34.841  1.00 57.31  ? 312 LEU A CB    1 
ATOM   2453 C  CG    . LEU A 1 313 ? 25.326  6.724   33.429  1.00 61.98  ? 312 LEU A CG    1 
ATOM   2454 C  CD1   . LEU A 1 313 ? 24.337  7.397   32.488  1.00 58.74  ? 312 LEU A CD1   1 
ATOM   2455 C  CD2   . LEU A 1 313 ? 26.744  6.863   32.907  1.00 61.76  ? 312 LEU A CD2   1 
ATOM   2456 N  N     . ILE A 1 314 ? 25.277  7.583   37.957  1.00 61.92  ? 313 ILE A N     1 
ATOM   2457 C  CA    . ILE A 1 314 ? 25.319  8.393   39.172  1.00 61.71  ? 313 ILE A CA    1 
ATOM   2458 C  C     . ILE A 1 314 ? 26.448  7.951   40.111  1.00 55.41  ? 313 ILE A C     1 
ATOM   2459 O  O     . ILE A 1 314 ? 27.160  8.786   40.679  1.00 60.79  ? 313 ILE A O     1 
ATOM   2460 C  CB    . ILE A 1 314 ? 23.960  8.373   39.910  1.00 58.34  ? 313 ILE A CB    1 
ATOM   2461 C  CG1   . ILE A 1 314 ? 22.879  9.021   39.041  1.00 60.48  ? 313 ILE A CG1   1 
ATOM   2462 C  CG2   . ILE A 1 314 ? 24.059  9.090   41.246  1.00 60.30  ? 313 ILE A CG2   1 
ATOM   2463 C  CD1   . ILE A 1 314 ? 21.553  9.223   39.747  1.00 58.65  ? 313 ILE A CD1   1 
ATOM   2464 N  N     . ALA A 1 315 ? 26.619  6.639   40.255  1.00 55.84  ? 314 ALA A N     1 
ATOM   2465 C  CA    . ALA A 1 315 ? 27.684  6.091   41.095  1.00 59.29  ? 314 ALA A CA    1 
ATOM   2466 C  C     . ALA A 1 315 ? 29.066  6.479   40.569  1.00 61.34  ? 314 ALA A C     1 
ATOM   2467 O  O     . ALA A 1 315 ? 29.913  6.994   41.311  1.00 66.76  ? 314 ALA A O     1 
ATOM   2468 C  CB    . ALA A 1 315 ? 27.557  4.579   41.185  1.00 57.39  ? 314 ALA A CB    1 
ATOM   2469 N  N     . THR A 1 316 ? 29.282  6.227   39.282  1.00 56.15  ? 315 THR A N     1 
ATOM   2470 C  CA    . THR A 1 316 ? 30.535  6.573   38.620  1.00 58.79  ? 315 THR A CA    1 
ATOM   2471 C  C     . THR A 1 316 ? 30.841  8.065   38.724  1.00 60.53  ? 315 THR A C     1 
ATOM   2472 O  O     . THR A 1 316 ? 31.988  8.452   38.947  1.00 60.89  ? 315 THR A O     1 
ATOM   2473 C  CB    . THR A 1 316 ? 30.525  6.167   37.130  1.00 58.51  ? 315 THR A CB    1 
ATOM   2474 O  OG1   . THR A 1 316 ? 29.369  6.719   36.488  1.00 66.07  ? 315 THR A OG1   1 
ATOM   2475 C  CG2   . THR A 1 316 ? 30.506  4.650   36.979  1.00 59.02  ? 315 THR A CG2   1 
ATOM   2476 N  N     . ALA A 1 317 ? 29.812  8.892   38.562  1.00 57.18  ? 316 ALA A N     1 
ATOM   2477 C  CA    . ALA A 1 317 ? 29.969  10.339  38.639  1.00 58.99  ? 316 ALA A CA    1 
ATOM   2478 C  C     . ALA A 1 317 ? 30.316  10.749  40.056  1.00 59.18  ? 316 ALA A C     1 
ATOM   2479 O  O     . ALA A 1 317 ? 31.013  11.742  40.269  1.00 57.21  ? 316 ALA A O     1 
ATOM   2480 C  CB    . ALA A 1 317 ? 28.706  11.023  38.210  1.00 53.86  ? 316 ALA A CB    1 
ATOM   2481 N  N     . ARG A 1 318 ? 29.796  9.990   41.018  1.00 57.41  ? 317 ARG A N     1 
ATOM   2482 C  CA    . ARG A 1 318 ? 30.117  10.193  42.426  1.00 61.51  ? 317 ARG A CA    1 
ATOM   2483 C  C     . ARG A 1 318 ? 31.579  9.890   42.683  1.00 61.55  ? 317 ARG A C     1 
ATOM   2484 O  O     . ARG A 1 318 ? 32.230  10.606  43.436  1.00 60.84  ? 317 ARG A O     1 
ATOM   2485 C  CB    . ARG A 1 318 ? 29.217  9.341   43.338  1.00 57.49  ? 317 ARG A CB    1 
ATOM   2486 C  CG    . ARG A 1 318 ? 29.714  9.192   44.790  1.00 57.91  ? 317 ARG A CG    1 
ATOM   2487 C  CD    . ARG A 1 318 ? 28.738  8.397   45.655  1.00 68.32  ? 317 ARG A CD    1 
ATOM   2488 N  NE    . ARG A 1 318 ? 27.468  9.095   45.868  1.00 67.08  ? 317 ARG A NE    1 
ATOM   2489 C  CZ    . ARG A 1 318 ? 26.328  8.729   45.295  1.00 65.24  ? 317 ARG A CZ    1 
ATOM   2490 N  NH1   . ARG A 1 318 ? 26.309  7.672   44.489  1.00 60.60  ? 317 ARG A NH1   1 
ATOM   2491 N  NH2   . ARG A 1 318 ? 25.213  9.405   45.531  1.00 63.89  ? 317 ARG A NH2   1 
ATOM   2492 N  N     . LYS A 1 319 ? 32.096  8.834   42.061  1.00 60.31  ? 318 LYS A N     1 
ATOM   2493 C  CA    . LYS A 1 319 ? 33.506  8.489   42.233  1.00 60.15  ? 318 LYS A CA    1 
ATOM   2494 C  C     . LYS A 1 319 ? 34.430  9.492   41.537  1.00 58.61  ? 318 LYS A C     1 
ATOM   2495 O  O     . LYS A 1 319 ? 35.496  9.831   42.056  1.00 55.26  ? 318 LYS A O     1 
ATOM   2496 C  CB    . LYS A 1 319 ? 33.776  7.062   41.751  1.00 61.82  ? 318 LYS A CB    1 
ATOM   2497 C  CG    . LYS A 1 319 ? 33.022  6.008   42.552  1.00 67.53  ? 318 LYS A CG    1 
ATOM   2498 C  CD    . LYS A 1 319 ? 33.290  4.599   42.048  1.00 74.49  ? 318 LYS A CD    1 
ATOM   2499 C  CE    . LYS A 1 319 ? 32.455  3.579   42.812  1.00 70.03  ? 318 LYS A CE    1 
ATOM   2500 N  NZ    . LYS A 1 319 ? 32.657  2.195   42.302  1.00 69.62  ? 318 LYS A NZ    1 
ATOM   2501 N  N     . THR A 1 320 ? 34.010  9.968   40.368  1.00 56.53  ? 319 THR A N     1 
ATOM   2502 C  CA    . THR A 1 320 ? 34.769  10.970  39.625  1.00 59.19  ? 319 THR A CA    1 
ATOM   2503 C  C     . THR A 1 320 ? 34.821  12.274  40.411  1.00 57.02  ? 319 THR A C     1 
ATOM   2504 O  O     . THR A 1 320 ? 35.858  12.936  40.479  1.00 51.44  ? 319 THR A O     1 
ATOM   2505 C  CB    . THR A 1 320 ? 34.135  11.253  38.248  1.00 60.57  ? 319 THR A CB    1 
ATOM   2506 O  OG1   . THR A 1 320 ? 33.707  10.023  37.649  1.00 54.08  ? 319 THR A OG1   1 
ATOM   2507 C  CG2   . THR A 1 320 ? 35.134  11.943  37.329  1.00 55.18  ? 319 THR A CG2   1 
ATOM   2508 N  N     . TRP A 1 321 ? 33.683  12.629  40.998  1.00 58.47  ? 320 TRP A N     1 
ATOM   2509 C  CA    . TRP A 1 321 ? 33.560  13.826  41.817  1.00 49.51  ? 320 TRP A CA    1 
ATOM   2510 C  C     . TRP A 1 321 ? 34.403  13.695  43.080  1.00 50.55  ? 320 TRP A C     1 
ATOM   2511 O  O     . TRP A 1 321 ? 35.029  14.657  43.521  1.00 56.12  ? 320 TRP A O     1 
ATOM   2512 C  CB    . TRP A 1 321 ? 32.091  14.048  42.185  1.00 47.03  ? 320 TRP A CB    1 
ATOM   2513 C  CG    . TRP A 1 321 ? 31.838  15.251  43.036  1.00 49.46  ? 320 TRP A CG    1 
ATOM   2514 C  CD1   . TRP A 1 321 ? 31.987  15.346  44.389  1.00 53.79  ? 320 TRP A CD1   1 
ATOM   2515 C  CD2   . TRP A 1 321 ? 31.371  16.530  42.593  1.00 51.04  ? 320 TRP A CD2   1 
ATOM   2516 N  NE1   . TRP A 1 321 ? 31.653  16.608  44.815  1.00 52.66  ? 320 TRP A NE1   1 
ATOM   2517 C  CE2   . TRP A 1 321 ? 31.269  17.354  43.732  1.00 50.50  ? 320 TRP A CE2   1 
ATOM   2518 C  CE3   . TRP A 1 321 ? 31.034  17.061  41.344  1.00 46.34  ? 320 TRP A CE3   1 
ATOM   2519 C  CZ2   . TRP A 1 321 ? 30.847  18.679  43.658  1.00 52.09  ? 320 TRP A CZ2   1 
ATOM   2520 C  CZ3   . TRP A 1 321 ? 30.614  18.375  41.274  1.00 43.86  ? 320 TRP A CZ3   1 
ATOM   2521 C  CH2   . TRP A 1 321 ? 30.525  19.169  42.423  1.00 49.40  ? 320 TRP A CH2   1 
ATOM   2522 N  N     . ASP A 1 322 ? 34.415  12.498  43.656  1.00 57.52  ? 321 ASP A N     1 
ATOM   2523 C  CA    . ASP A 1 322 ? 35.134  12.249  44.902  1.00 56.79  ? 321 ASP A CA    1 
ATOM   2524 C  C     . ASP A 1 322 ? 36.648  12.218  44.712  1.00 62.04  ? 321 ASP A C     1 
ATOM   2525 O  O     . ASP A 1 322 ? 37.399  12.607  45.604  1.00 64.18  ? 321 ASP A O     1 
ATOM   2526 C  CB    . ASP A 1 322 ? 34.680  10.921  45.519  1.00 59.79  ? 321 ASP A CB    1 
ATOM   2527 C  CG    . ASP A 1 322 ? 33.337  11.024  46.216  1.00 58.63  ? 321 ASP A CG    1 
ATOM   2528 O  OD1   . ASP A 1 322 ? 32.688  12.085  46.112  1.00 56.78  ? 321 ASP A OD1   1 
ATOM   2529 O  OD2   . ASP A 1 322 ? 32.930  10.034  46.862  1.00 62.27  ? 321 ASP A OD2   1 
ATOM   2530 N  N     . GLU A 1 323 ? 37.096  11.756  43.548  1.00 55.56  ? 322 GLU A N     1 
ATOM   2531 C  CA    . GLU A 1 323 ? 38.511  11.435  43.359  1.00 56.03  ? 322 GLU A CA    1 
ATOM   2532 C  C     . GLU A 1 323 ? 39.285  12.394  42.446  1.00 59.90  ? 322 GLU A C     1 
ATOM   2533 O  O     . GLU A 1 323 ? 40.495  12.569  42.619  1.00 63.05  ? 322 GLU A O     1 
ATOM   2534 C  CB    . GLU A 1 323 ? 38.659  9.989   42.860  1.00 56.22  ? 322 GLU A CB    1 
ATOM   2535 C  CG    . GLU A 1 323 ? 38.032  8.942   43.783  1.00 66.02  ? 322 GLU A CG    1 
ATOM   2536 C  CD    . GLU A 1 323 ? 37.760  7.627   43.079  1.00 68.89  ? 322 GLU A CD    1 
ATOM   2537 O  OE1   . GLU A 1 323 ? 38.165  7.481   41.908  1.00 75.34  ? 322 GLU A OE1   1 
ATOM   2538 O  OE2   . GLU A 1 323 ? 37.136  6.740   43.698  1.00 71.85  ? 322 GLU A OE2   1 
ATOM   2539 N  N     . ARG A 1 324 ? 38.604  13.008  41.480  1.00 55.16  ? 323 ARG A N     1 
ATOM   2540 C  CA    . ARG A 1 324 ? 39.301  13.807  40.472  1.00 49.72  ? 323 ARG A CA    1 
ATOM   2541 C  C     . ARG A 1 324 ? 38.966  15.296  40.508  1.00 49.70  ? 323 ARG A C     1 
ATOM   2542 O  O     . ARG A 1 324 ? 39.617  16.096  39.837  1.00 53.47  ? 323 ARG A O     1 
ATOM   2543 C  CB    . ARG A 1 324 ? 39.023  13.255  39.074  1.00 53.26  ? 323 ARG A CB    1 
ATOM   2544 C  CG    . ARG A 1 324 ? 39.303  11.771  38.931  1.00 54.38  ? 323 ARG A CG    1 
ATOM   2545 C  CD    . ARG A 1 324 ? 38.985  11.289  37.529  1.00 49.38  ? 323 ARG A CD    1 
ATOM   2546 N  NE    . ARG A 1 324 ? 38.976  9.833   37.442  1.00 63.48  ? 323 ARG A NE    1 
ATOM   2547 C  CZ    . ARG A 1 324 ? 38.675  9.156   36.340  1.00 66.53  ? 323 ARG A CZ    1 
ATOM   2548 N  NH1   . ARG A 1 324 ? 38.360  9.808   35.229  1.00 64.46  ? 323 ARG A NH1   1 
ATOM   2549 N  NH2   . ARG A 1 324 ? 38.688  7.830   36.346  1.00 65.34  ? 323 ARG A NH2   1 
ATOM   2550 N  N     . ARG A 1 325 ? 37.959  15.668  41.289  1.00 51.50  ? 324 ARG A N     1 
ATOM   2551 C  CA    . ARG A 1 325 ? 37.538  17.061  41.349  1.00 47.46  ? 324 ARG A CA    1 
ATOM   2552 C  C     . ARG A 1 325 ? 38.616  17.935  41.977  1.00 53.79  ? 324 ARG A C     1 
ATOM   2553 O  O     . ARG A 1 325 ? 38.884  19.036  41.501  1.00 54.00  ? 324 ARG A O     1 
ATOM   2554 C  CB    . ARG A 1 325 ? 36.219  17.207  42.107  1.00 45.98  ? 324 ARG A CB    1 
ATOM   2555 C  CG    . ARG A 1 325 ? 35.577  18.566  41.928  1.00 53.63  ? 324 ARG A CG    1 
ATOM   2556 C  CD    . ARG A 1 325 ? 34.205  18.642  42.572  1.00 50.23  ? 324 ARG A CD    1 
ATOM   2557 N  NE    . ARG A 1 325 ? 34.271  18.602  44.030  1.00 51.10  ? 324 ARG A NE    1 
ATOM   2558 C  CZ    . ARG A 1 325 ? 34.421  19.676  44.799  1.00 51.95  ? 324 ARG A CZ    1 
ATOM   2559 N  NH1   . ARG A 1 325 ? 34.525  20.878  44.250  1.00 51.52  ? 324 ARG A NH1   1 
ATOM   2560 N  NH2   . ARG A 1 325 ? 34.470  19.548  46.118  1.00 53.18  ? 324 ARG A NH2   1 
ATOM   2561 N  N     . GLY A 1 326 ? 39.235  17.435  43.042  1.00 53.65  ? 325 GLY A N     1 
ATOM   2562 C  CA    . GLY A 1 326 ? 40.318  18.142  43.702  1.00 44.02  ? 325 GLY A CA    1 
ATOM   2563 C  C     . GLY A 1 326 ? 39.915  19.496  44.255  1.00 55.30  ? 325 GLY A C     1 
ATOM   2564 O  O     . GLY A 1 326 ? 40.727  20.420  44.305  1.00 62.92  ? 325 GLY A O     1 
ATOM   2565 N  N     . GLY A 1 327 ? 38.657  19.617  44.665  1.00 52.16  ? 326 GLY A N     1 
ATOM   2566 C  CA    . GLY A 1 327 ? 38.160  20.848  45.251  1.00 49.91  ? 326 GLY A CA    1 
ATOM   2567 C  C     . GLY A 1 327 ? 37.825  21.917  44.228  1.00 55.38  ? 326 GLY A C     1 
ATOM   2568 O  O     . GLY A 1 327 ? 37.437  23.029  44.586  1.00 55.43  ? 326 GLY A O     1 
ATOM   2569 N  N     . ARG A 1 328 ? 37.973  21.581  42.951  1.00 56.29  ? 327 ARG A N     1 
ATOM   2570 C  CA    . ARG A 1 328 ? 37.691  22.523  41.874  1.00 52.91  ? 327 ARG A CA    1 
ATOM   2571 C  C     . ARG A 1 328 ? 36.193  22.633  41.610  1.00 61.23  ? 327 ARG A C     1 
ATOM   2572 O  O     . ARG A 1 328 ? 35.443  21.683  41.829  1.00 55.98  ? 327 ARG A O     1 
ATOM   2573 C  CB    . ARG A 1 328 ? 38.414  22.102  40.593  1.00 50.93  ? 327 ARG A CB    1 
ATOM   2574 C  CG    . ARG A 1 328 ? 39.928  22.110  40.706  1.00 48.91  ? 327 ARG A CG    1 
ATOM   2575 C  CD    . ARG A 1 328 ? 40.589  21.574  39.445  1.00 49.80  ? 327 ARG A CD    1 
ATOM   2576 N  NE    . ARG A 1 328 ? 40.490  20.123  39.331  1.00 50.73  ? 327 ARG A NE    1 
ATOM   2577 C  CZ    . ARG A 1 328 ? 41.050  19.413  38.356  1.00 52.60  ? 327 ARG A CZ    1 
ATOM   2578 N  NH1   . ARG A 1 328 ? 41.750  20.022  37.408  1.00 55.83  ? 327 ARG A NH1   1 
ATOM   2579 N  NH2   . ARG A 1 328 ? 40.910  18.095  38.328  1.00 51.22  ? 327 ARG A NH2   1 
ATOM   2580 N  N     . GLY A 1 329 ? 35.761  23.800  41.146  1.00 59.55  ? 328 GLY A N     1 
ATOM   2581 C  CA    . GLY A 1 329 ? 34.379  23.984  40.748  1.00 54.93  ? 328 GLY A CA    1 
ATOM   2582 C  C     . GLY A 1 329 ? 34.131  23.295  39.421  1.00 54.65  ? 328 GLY A C     1 
ATOM   2583 O  O     . GLY A 1 329 ? 35.058  23.108  38.634  1.00 56.15  ? 328 GLY A O     1 
ATOM   2584 N  N     . VAL A 1 330 ? 32.884  22.912  39.173  1.00 49.33  ? 329 VAL A N     1 
ATOM   2585 C  CA    . VAL A 1 330 ? 32.532  22.223  37.936  1.00 49.95  ? 329 VAL A CA    1 
ATOM   2586 C  C     . VAL A 1 330 ? 31.636  23.086  37.052  1.00 50.95  ? 329 VAL A C     1 
ATOM   2587 O  O     . VAL A 1 330 ? 30.562  23.517  37.473  1.00 51.78  ? 329 VAL A O     1 
ATOM   2588 C  CB    . VAL A 1 330 ? 31.838  20.875  38.220  1.00 54.97  ? 329 VAL A CB    1 
ATOM   2589 C  CG1   . VAL A 1 330 ? 31.254  20.296  36.944  1.00 50.31  ? 329 VAL A CG1   1 
ATOM   2590 C  CG2   . VAL A 1 330 ? 32.816  19.899  38.858  1.00 48.15  ? 329 VAL A CG2   1 
ATOM   2591 N  N     . ARG A 1 331 ? 32.087  23.333  35.826  1.00 48.78  ? 330 ARG A N     1 
ATOM   2592 C  CA    . ARG A 1 331 ? 31.342  24.157  34.881  1.00 53.73  ? 330 ARG A CA    1 
ATOM   2593 C  C     . ARG A 1 331 ? 30.424  23.324  33.987  1.00 51.74  ? 330 ARG A C     1 
ATOM   2594 O  O     . ARG A 1 331 ? 29.422  23.827  33.479  1.00 50.64  ? 330 ARG A O     1 
ATOM   2595 C  CB    . ARG A 1 331 ? 32.301  24.987  34.019  1.00 48.34  ? 330 ARG A CB    1 
ATOM   2596 C  CG    . ARG A 1 331 ? 33.343  24.161  33.274  1.00 50.48  ? 330 ARG A CG    1 
ATOM   2597 C  CD    . ARG A 1 331 ? 34.258  25.028  32.413  1.00 53.36  ? 330 ARG A CD    1 
ATOM   2598 N  NE    . ARG A 1 331 ? 33.547  25.668  31.309  1.00 54.79  ? 330 ARG A NE    1 
ATOM   2599 C  CZ    . ARG A 1 331 ? 33.255  26.964  31.255  1.00 51.84  ? 330 ARG A CZ    1 
ATOM   2600 N  NH1   . ARG A 1 331 ? 33.617  27.769  32.244  1.00 54.33  ? 330 ARG A NH1   1 
ATOM   2601 N  NH2   . ARG A 1 331 ? 32.604  27.456  30.210  1.00 51.76  ? 330 ARG A NH2   1 
ATOM   2602 N  N     . LEU A 1 332 ? 30.766  22.051  33.805  1.00 49.87  ? 331 LEU A N     1 
ATOM   2603 C  CA    . LEU A 1 332 ? 30.034  21.185  32.883  1.00 50.20  ? 331 LEU A CA    1 
ATOM   2604 C  C     . LEU A 1 332 ? 29.851  19.766  33.419  1.00 51.01  ? 331 LEU A C     1 
ATOM   2605 O  O     . LEU A 1 332 ? 30.761  19.201  34.023  1.00 49.23  ? 331 LEU A O     1 
ATOM   2606 C  CB    . LEU A 1 332 ? 30.742  21.151  31.519  1.00 54.65  ? 331 LEU A CB    1 
ATOM   2607 C  CG    . LEU A 1 332 ? 30.386  20.079  30.477  1.00 54.54  ? 331 LEU A CG    1 
ATOM   2608 C  CD1   . LEU A 1 332 ? 30.589  20.612  29.069  1.00 50.41  ? 331 LEU A CD1   1 
ATOM   2609 C  CD2   . LEU A 1 332 ? 31.210  18.810  30.662  1.00 50.77  ? 331 LEU A CD2   1 
ATOM   2610 N  N     . VAL A 1 333 ? 28.677  19.188  33.174  1.00 58.59  ? 332 VAL A N     1 
ATOM   2611 C  CA    . VAL A 1 333 ? 28.427  17.784  33.502  1.00 56.12  ? 332 VAL A CA    1 
ATOM   2612 C  C     . VAL A 1 333 ? 27.987  17.037  32.245  1.00 53.19  ? 332 VAL A C     1 
ATOM   2613 O  O     . VAL A 1 333 ? 27.159  17.537  31.484  1.00 46.97  ? 332 VAL A O     1 
ATOM   2614 C  CB    . VAL A 1 333 ? 27.347  17.632  34.598  1.00 56.50  ? 332 VAL A CB    1 
ATOM   2615 C  CG1   . VAL A 1 333 ? 27.170  16.165  34.976  1.00 45.04  ? 332 VAL A CG1   1 
ATOM   2616 C  CG2   . VAL A 1 333 ? 27.707  18.458  35.825  1.00 49.71  ? 332 VAL A CG2   1 
ATOM   2617 N  N     . GLY A 1 334 ? 28.538  15.846  32.021  1.00 51.75  ? 333 GLY A N     1 
ATOM   2618 C  CA    . GLY A 1 334 ? 28.240  15.105  30.807  1.00 56.18  ? 333 GLY A CA    1 
ATOM   2619 C  C     . GLY A 1 334 ? 28.053  13.607  30.950  1.00 55.23  ? 333 GLY A C     1 
ATOM   2620 O  O     . GLY A 1 334 ? 28.735  12.955  31.737  1.00 53.10  ? 333 GLY A O     1 
ATOM   2621 N  N     . LEU A 1 335 ? 27.127  13.064  30.165  1.00 56.80  ? 334 LEU A N     1 
ATOM   2622 C  CA    . LEU A 1 335 ? 26.888  11.626  30.111  1.00 55.99  ? 334 LEU A CA    1 
ATOM   2623 C  C     . LEU A 1 335 ? 27.274  11.099  28.727  1.00 61.34  ? 334 LEU A C     1 
ATOM   2624 O  O     . LEU A 1 335 ? 27.214  11.840  27.739  1.00 63.29  ? 334 LEU A O     1 
ATOM   2625 C  CB    . LEU A 1 335 ? 25.420  11.316  30.413  1.00 58.81  ? 334 LEU A CB    1 
ATOM   2626 C  CG    . LEU A 1 335 ? 24.895  11.690  31.801  1.00 56.76  ? 334 LEU A CG    1 
ATOM   2627 C  CD1   . LEU A 1 335 ? 23.407  11.429  31.918  1.00 57.25  ? 334 LEU A CD1   1 
ATOM   2628 C  CD2   . LEU A 1 335 ? 25.637  10.916  32.860  1.00 61.93  ? 334 LEU A CD2   1 
ATOM   2629 N  N     . HIS A 1 336 ? 27.680  9.833   28.653  1.00 62.84  ? 335 HIS A N     1 
ATOM   2630 C  CA    . HIS A 1 336 ? 28.193  9.285   27.399  1.00 64.02  ? 335 HIS A CA    1 
ATOM   2631 C  C     . HIS A 1 336 ? 28.066  7.763   27.302  1.00 66.40  ? 335 HIS A C     1 
ATOM   2632 O  O     . HIS A 1 336 ? 28.287  7.053   28.289  1.00 62.75  ? 335 HIS A O     1 
ATOM   2633 C  CB    . HIS A 1 336 ? 29.660  9.688   27.226  1.00 48.09  ? 335 HIS A CB    1 
ATOM   2634 C  CG    . HIS A 1 336 ? 30.275  9.210   25.947  1.00 60.26  ? 335 HIS A CG    1 
ATOM   2635 N  ND1   . HIS A 1 336 ? 31.221  8.208   25.907  1.00 65.65  ? 335 HIS A ND1   1 
ATOM   2636 C  CD2   . HIS A 1 336 ? 30.086  9.601   24.666  1.00 61.48  ? 335 HIS A CD2   1 
ATOM   2637 C  CE1   . HIS A 1 336 ? 31.586  8.001   24.654  1.00 59.10  ? 335 HIS A CE1   1 
ATOM   2638 N  NE2   . HIS A 1 336 ? 30.911  8.833   23.881  1.00 62.12  ? 335 HIS A NE2   1 
ATOM   2639 N  N     . VAL A 1 337 ? 27.697  7.268   26.120  1.00 65.21  ? 336 VAL A N     1 
ATOM   2640 C  CA    . VAL A 1 337 ? 27.746  5.829   25.850  1.00 65.26  ? 336 VAL A CA    1 
ATOM   2641 C  C     . VAL A 1 337 ? 28.585  5.584   24.590  1.00 64.16  ? 336 VAL A C     1 
ATOM   2642 O  O     . VAL A 1 337 ? 28.983  6.538   23.922  1.00 68.77  ? 336 VAL A O     1 
ATOM   2643 C  CB    . VAL A 1 337 ? 26.343  5.215   25.707  1.00 67.73  ? 336 VAL A CB    1 
ATOM   2644 C  CG1   . VAL A 1 337 ? 25.544  5.407   26.993  1.00 68.41  ? 336 VAL A CG1   1 
ATOM   2645 C  CG2   . VAL A 1 337 ? 25.621  5.836   24.538  1.00 64.35  ? 336 VAL A CG2   1 
ATOM   2646 N  N     . THR A 1 338 ? 28.849  4.319   24.263  1.00 68.53  ? 337 THR A N     1 
ATOM   2647 C  CA    . THR A 1 338 ? 29.836  3.983   23.230  1.00 74.23  ? 337 THR A CA    1 
ATOM   2648 C  C     . THR A 1 338 ? 29.329  3.063   22.132  1.00 74.98  ? 337 THR A C     1 
ATOM   2649 O  O     . THR A 1 338 ? 29.979  2.917   21.100  1.00 79.90  ? 337 THR A O     1 
ATOM   2650 C  CB    . THR A 1 338 ? 31.045  3.265   23.831  1.00 71.19  ? 337 THR A CB    1 
ATOM   2651 O  OG1   . THR A 1 338 ? 30.588  2.103   24.535  1.00 75.73  ? 337 THR A OG1   1 
ATOM   2652 C  CG2   . THR A 1 338 ? 31.816  4.197   24.763  1.00 66.07  ? 337 THR A CG2   1 
ATOM   2653 N  N     . LEU A 1 339 ? 28.208  2.399   22.374  1.00 69.65  ? 338 LEU A N     1 
ATOM   2654 C  CA    . LEU A 1 339 ? 27.616  1.516   21.374  1.00 76.01  ? 338 LEU A CA    1 
ATOM   2655 C  C     . LEU A 1 339 ? 28.473  0.299   20.982  1.00 76.10  ? 338 LEU A C     1 
ATOM   2656 O  O     . LEU A 1 339 ? 29.614  0.150   21.419  1.00 80.65  ? 338 LEU A O     1 
ATOM   2657 C  CB    . LEU A 1 339 ? 27.189  2.301   20.125  1.00 69.71  ? 338 LEU A CB    1 
ATOM   2658 C  CG    . LEU A 1 339 ? 25.849  3.043   20.182  1.00 65.07  ? 338 LEU A CG    1 
ATOM   2659 C  CD1   . LEU A 1 339 ? 25.807  4.122   21.260  1.00 71.43  ? 338 LEU A CD1   1 
ATOM   2660 C  CD2   . LEU A 1 339 ? 25.525  3.642   18.824  1.00 59.39  ? 338 LEU A CD2   1 
ATOM   2661 N  N     . LEU A 1 340 ? 27.895  -0.565  20.153  1.00 81.78  ? 339 LEU A N     1 
ATOM   2662 C  CA    . LEU A 1 340 ? 28.504  -1.826  19.752  1.00 86.47  ? 339 LEU A CA    1 
ATOM   2663 C  C     . LEU A 1 340 ? 28.848  -1.749  18.262  1.00 91.24  ? 339 LEU A C     1 
ATOM   2664 O  O     . LEU A 1 340 ? 28.660  -0.708  17.627  1.00 93.40  ? 339 LEU A O     1 
ATOM   2665 C  CB    . LEU A 1 340 ? 27.589  -3.026  20.069  1.00 83.19  ? 339 LEU A CB    1 
ATOM   2666 C  CG    . LEU A 1 340 ? 27.281  -3.407  21.529  1.00 79.57  ? 339 LEU A CG    1 
ATOM   2667 C  CD1   . LEU A 1 340 ? 26.049  -4.290  21.614  1.00 76.75  ? 339 LEU A CD1   1 
ATOM   2668 C  CD2   . LEU A 1 340 ? 28.458  -4.105  22.186  1.00 77.83  ? 339 LEU A CD2   1 
ATOM   2669 N  N     . ASP A 1 341 ? 29.334  -2.851  17.704  1.00 90.22  ? 340 ASP A N     1 
ATOM   2670 C  CA    . ASP A 1 341 ? 30.144  -2.788  16.487  1.00 96.53  ? 340 ASP A CA    1 
ATOM   2671 C  C     . ASP A 1 341 ? 29.434  -2.837  15.121  1.00 98.34  ? 340 ASP A C     1 
ATOM   2672 O  O     . ASP A 1 341 ? 29.741  -2.029  14.246  1.00 95.16  ? 340 ASP A O     1 
ATOM   2673 C  CB    . ASP A 1 341 ? 31.273  -3.816  16.581  1.00 94.18  ? 340 ASP A CB    1 
ATOM   2674 C  CG    . ASP A 1 341 ? 32.010  -3.733  17.906  1.00 89.21  ? 340 ASP A CG    1 
ATOM   2675 O  OD1   . ASP A 1 341 ? 31.371  -3.363  18.915  1.00 90.09  ? 340 ASP A OD1   1 
ATOM   2676 O  OD2   . ASP A 1 341 ? 33.222  -4.025  17.943  1.00 85.83  ? 340 ASP A OD2   1 
ATOM   2677 N  N     . PRO A 1 342 ? 28.497  -3.777  14.920  1.00 102.74 ? 341 PRO A N     1 
ATOM   2678 C  CA    . PRO A 1 342 ? 27.862  -3.748  13.598  1.00 105.13 ? 341 PRO A CA    1 
ATOM   2679 C  C     . PRO A 1 342 ? 26.667  -2.799  13.550  1.00 104.00 ? 341 PRO A C     1 
ATOM   2680 O  O     . PRO A 1 342 ? 26.205  -2.290  14.573  1.00 100.84 ? 341 PRO A O     1 
ATOM   2681 C  CB    . PRO A 1 342 ? 27.398  -5.190  13.414  1.00 96.47  ? 341 PRO A CB    1 
ATOM   2682 C  CG    . PRO A 1 342 ? 27.079  -5.634  14.795  1.00 95.05  ? 341 PRO A CG    1 
ATOM   2683 C  CD    . PRO A 1 342 ? 28.073  -4.950  15.705  1.00 98.77  ? 341 PRO A CD    1 
ATOM   2684 O  OXT   . PRO A 1 342 ? 26.136  -2.517  12.477  1.00 104.14 ? 341 PRO A OXT   1 
ATOM   2685 N  N     . GLY B 1 1   ? -17.504 0.001   56.866  1.00 87.07  ? 0   GLY F N     1 
ATOM   2686 C  CA    . GLY B 1 1   ? -16.230 -0.534  57.307  1.00 84.00  ? 0   GLY F CA    1 
ATOM   2687 C  C     . GLY B 1 1   ? -15.203 0.555   57.545  1.00 80.80  ? 0   GLY F C     1 
ATOM   2688 O  O     . GLY B 1 1   ? -14.015 0.372   57.284  1.00 78.23  ? 0   GLY F O     1 
ATOM   2689 N  N     . SER B 1 2   ? -15.663 1.696   58.046  1.00 84.32  ? 1   SER F N     1 
ATOM   2690 C  CA    . SER B 1 2   ? -14.787 2.836   58.281  1.00 79.95  ? 1   SER F CA    1 
ATOM   2691 C  C     . SER B 1 2   ? -14.244 2.854   59.703  1.00 71.21  ? 1   SER F C     1 
ATOM   2692 O  O     . SER B 1 2   ? -15.004 2.768   60.668  1.00 71.59  ? 1   SER F O     1 
ATOM   2693 C  CB    . SER B 1 2   ? -15.529 4.146   57.998  1.00 72.79  ? 1   SER F CB    1 
ATOM   2694 O  OG    . SER B 1 2   ? -16.001 4.187   56.663  1.00 69.06  ? 1   SER F OG    1 
ATOM   2695 N  N     . ARG B 1 3   ? -12.926 2.969   59.829  1.00 65.03  ? 2   ARG F N     1 
ATOM   2696 C  CA    . ARG B 1 3   ? -12.310 3.159   61.137  1.00 60.15  ? 2   ARG F CA    1 
ATOM   2697 C  C     . ARG B 1 3   ? -12.571 4.579   61.620  1.00 59.91  ? 2   ARG F C     1 
ATOM   2698 O  O     . ARG B 1 3   ? -13.081 5.414   60.867  1.00 60.95  ? 2   ARG F O     1 
ATOM   2699 C  CB    . ARG B 1 3   ? -10.802 2.909   61.082  1.00 60.02  ? 2   ARG F CB    1 
ATOM   2700 C  CG    . ARG B 1 3   ? -10.409 1.444   60.963  1.00 57.26  ? 2   ARG F CG    1 
ATOM   2701 C  CD    . ARG B 1 3   ? -9.817  1.138   59.598  1.00 51.36  ? 2   ARG F CD    1 
ATOM   2702 N  NE    . ARG B 1 3   ? -8.544  1.826   59.389  1.00 49.98  ? 2   ARG F NE    1 
ATOM   2703 C  CZ    . ARG B 1 3   ? -8.047  2.126   58.192  1.00 52.99  ? 2   ARG F CZ    1 
ATOM   2704 N  NH1   . ARG B 1 3   ? -8.715  1.809   57.092  1.00 55.37  ? 2   ARG F NH1   1 
ATOM   2705 N  NH2   . ARG B 1 3   ? -6.889  2.758   58.086  1.00 54.63  ? 2   ARG F NH2   1 
ATOM   2706 N  N     . LYS B 1 4   ? -12.251 4.843   62.883  1.00 56.45  ? 3   LYS F N     1 
ATOM   2707 C  CA    . LYS B 1 4   ? -12.324 6.193   63.417  1.00 51.59  ? 3   LYS F CA    1 
ATOM   2708 C  C     . LYS B 1 4   ? -10.966 6.562   64.003  1.00 57.34  ? 3   LYS F C     1 
ATOM   2709 O  O     . LYS B 1 4   ? -10.634 6.188   65.131  1.00 52.63  ? 3   LYS F O     1 
ATOM   2710 C  CB    . LYS B 1 4   ? -13.433 6.304   64.462  1.00 55.20  ? 3   LYS F CB    1 
ATOM   2711 C  CG    . LYS B 1 4   ? -14.821 6.048   63.895  1.00 56.29  ? 3   LYS F CG    1 
ATOM   2712 C  CD    . LYS B 1 4   ? -15.901 6.247   64.936  1.00 56.02  ? 3   LYS F CD    1 
ATOM   2713 C  CE    . LYS B 1 4   ? -15.666 5.343   66.126  1.00 58.88  ? 3   LYS F CE    1 
ATOM   2714 N  NZ    . LYS B 1 4   ? -16.607 5.629   67.235  1.00 64.81  ? 3   LYS F NZ    1 
ATOM   2715 N  N     . ILE B 1 5   ? -10.183 7.296   63.218  1.00 53.45  ? 4   ILE F N     1 
ATOM   2716 C  CA    . ILE B 1 5   ? -8.803  7.607   63.568  1.00 54.58  ? 4   ILE F CA    1 
ATOM   2717 C  C     . ILE B 1 5   ? -8.674  9.018   64.129  1.00 53.50  ? 4   ILE F C     1 
ATOM   2718 O  O     . ILE B 1 5   ? -9.246  9.965   63.589  1.00 50.15  ? 4   ILE F O     1 
ATOM   2719 C  CB    . ILE B 1 5   ? -7.881  7.471   62.339  1.00 50.59  ? 4   ILE F CB    1 
ATOM   2720 C  CG1   . ILE B 1 5   ? -8.182  6.173   61.585  1.00 52.41  ? 4   ILE F CG1   1 
ATOM   2721 C  CG2   . ILE B 1 5   ? -6.418  7.536   62.752  1.00 46.77  ? 4   ILE F CG2   1 
ATOM   2722 C  CD1   . ILE B 1 5   ? -7.974  4.921   62.411  1.00 53.17  ? 4   ILE F CD1   1 
ATOM   2723 N  N     . ILE B 1 6   ? -7.922  9.148   65.217  1.00 53.36  ? 5   ILE F N     1 
ATOM   2724 C  CA    . ILE B 1 6   ? -7.675  10.443  65.835  1.00 52.82  ? 5   ILE F CA    1 
ATOM   2725 C  C     . ILE B 1 6   ? -6.183  10.736  65.903  1.00 55.06  ? 5   ILE F C     1 
ATOM   2726 O  O     . ILE B 1 6   ? -5.432  10.008  66.548  1.00 52.03  ? 5   ILE F O     1 
ATOM   2727 C  CB    . ILE B 1 6   ? -8.230  10.503  67.269  1.00 53.58  ? 5   ILE F CB    1 
ATOM   2728 C  CG1   . ILE B 1 6   ? -9.743  10.279  67.275  1.00 53.07  ? 5   ILE F CG1   1 
ATOM   2729 C  CG2   . ILE B 1 6   ? -7.884  11.836  67.917  1.00 55.42  ? 5   ILE F CG2   1 
ATOM   2730 C  CD1   . ILE B 1 6   ? -10.362 10.389  68.651  1.00 49.50  ? 5   ILE F CD1   1 
ATOM   2731 N  N     . HIS B 1 7   ? -5.752  11.802  65.240  1.00 53.21  ? 6   HIS F N     1 
ATOM   2732 C  CA    . HIS B 1 7   ? -4.364  12.226  65.344  1.00 50.25  ? 6   HIS F CA    1 
ATOM   2733 C  C     . HIS B 1 7   ? -4.231  13.372  66.337  1.00 47.55  ? 6   HIS F C     1 
ATOM   2734 O  O     . HIS B 1 7   ? -4.740  14.470  66.104  1.00 49.68  ? 6   HIS F O     1 
ATOM   2735 C  CB    . HIS B 1 7   ? -3.805  12.640  63.984  1.00 48.94  ? 6   HIS F CB    1 
ATOM   2736 C  CG    . HIS B 1 7   ? -2.343  12.961  64.012  1.00 54.80  ? 6   HIS F CG    1 
ATOM   2737 N  ND1   . HIS B 1 7   ? -1.865  14.238  64.209  1.00 55.73  ? 6   HIS F ND1   1 
ATOM   2738 C  CD2   . HIS B 1 7   ? -1.254  12.166  63.885  1.00 54.86  ? 6   HIS F CD2   1 
ATOM   2739 C  CE1   . HIS B 1 7   ? -0.544  14.218  64.195  1.00 52.36  ? 6   HIS F CE1   1 
ATOM   2740 N  NE2   . HIS B 1 7   ? -0.148  12.974  63.999  1.00 53.60  ? 6   HIS F NE2   1 
ATOM   2741 N  N     . VAL B 1 8   ? -3.550  13.105  67.447  1.00 52.39  ? 7   VAL F N     1 
ATOM   2742 C  CA    . VAL B 1 8   ? -3.325  14.122  68.467  1.00 46.37  ? 7   VAL F CA    1 
ATOM   2743 C  C     . VAL B 1 8   ? -1.933  14.721  68.309  1.00 52.56  ? 7   VAL F C     1 
ATOM   2744 O  O     . VAL B 1 8   ? -0.945  13.995  68.152  1.00 56.80  ? 7   VAL F O     1 
ATOM   2745 C  CB    . VAL B 1 8   ? -3.489  13.554  69.887  1.00 49.10  ? 7   VAL F CB    1 
ATOM   2746 C  CG1   . VAL B 1 8   ? -3.412  14.672  70.917  1.00 39.68  ? 7   VAL F CG1   1 
ATOM   2747 C  CG2   . VAL B 1 8   ? -4.809  12.812  70.006  1.00 51.24  ? 7   VAL F CG2   1 
ATOM   2748 N  N     . ASP B 1 9   ? -1.867  16.049  68.354  1.00 51.59  ? 8   ASP F N     1 
ATOM   2749 C  CA    . ASP B 1 9   ? -0.639  16.777  68.063  1.00 54.19  ? 8   ASP F CA    1 
ATOM   2750 C  C     . ASP B 1 9   ? -0.504  18.014  68.949  1.00 48.39  ? 8   ASP F C     1 
ATOM   2751 O  O     . ASP B 1 9   ? -1.250  18.979  68.795  1.00 49.63  ? 8   ASP F O     1 
ATOM   2752 C  CB    . ASP B 1 9   ? -0.623  17.181  66.587  1.00 48.94  ? 8   ASP F CB    1 
ATOM   2753 C  CG    . ASP B 1 9   ? 0.634   17.930  66.196  1.00 58.59  ? 8   ASP F CG    1 
ATOM   2754 O  OD1   . ASP B 1 9   ? 1.655   17.804  66.905  1.00 61.24  ? 8   ASP F OD1   1 
ATOM   2755 O  OD2   . ASP B 1 9   ? 0.601   18.644  65.173  1.00 69.95  ? 8   ASP F OD2   1 
ATOM   2756 N  N     . MET B 1 10  ? 0.458   17.980  69.867  1.00 51.57  ? 9   MET F N     1 
ATOM   2757 C  CA    . MET B 1 10  ? 0.684   19.090  70.788  1.00 51.58  ? 9   MET F CA    1 
ATOM   2758 C  C     . MET B 1 10  ? 1.094   20.363  70.048  1.00 53.88  ? 9   MET F C     1 
ATOM   2759 O  O     . MET B 1 10  ? 1.849   20.313  69.077  1.00 53.11  ? 9   MET F O     1 
ATOM   2760 C  CB    . MET B 1 10  ? 1.747   18.719  71.824  1.00 43.30  ? 9   MET F CB    1 
ATOM   2761 C  CG    . MET B 1 10  ? 1.434   17.459  72.617  1.00 47.42  ? 9   MET F CG    1 
ATOM   2762 S  SD    . MET B 1 10  ? -0.009  17.635  73.681  1.00 48.99  ? 9   MET F SD    1 
ATOM   2763 C  CE    . MET B 1 10  ? 0.534   18.951  74.764  1.00 42.86  ? 9   MET F CE    1 
ATOM   2764 N  N     . ASP B 1 11  ? 0.588   21.501  70.514  1.00 49.09  ? 10  ASP F N     1 
ATOM   2765 C  CA    . ASP B 1 11  ? 0.857   22.786  69.877  1.00 51.69  ? 10  ASP F CA    1 
ATOM   2766 C  C     . ASP B 1 11  ? 2.199   23.353  70.321  1.00 46.91  ? 10  ASP F C     1 
ATOM   2767 O  O     . ASP B 1 11  ? 2.451   23.465  71.521  1.00 49.43  ? 10  ASP F O     1 
ATOM   2768 C  CB    . ASP B 1 11  ? -0.252  23.784  70.214  1.00 49.44  ? 10  ASP F CB    1 
ATOM   2769 C  CG    . ASP B 1 11  ? -1.630  23.267  69.856  1.00 48.82  ? 10  ASP F CG    1 
ATOM   2770 O  OD1   . ASP B 1 11  ? -2.541  23.366  70.704  1.00 46.25  ? 10  ASP F OD1   1 
ATOM   2771 O  OD2   . ASP B 1 11  ? -1.803  22.765  68.725  1.00 51.08  ? 10  ASP F OD2   1 
ATOM   2772 N  N     . CYS B 1 12  ? 3.034   23.721  69.346  1.00 48.39  ? 11  CYS F N     1 
ATOM   2773 C  CA    . CYS B 1 12  ? 4.381   24.268  69.577  1.00 58.62  ? 11  CYS F CA    1 
ATOM   2774 C  C     . CYS B 1 12  ? 5.068   23.660  70.797  1.00 53.81  ? 11  CYS F C     1 
ATOM   2775 O  O     . CYS B 1 12  ? 5.554   24.375  71.673  1.00 49.33  ? 11  CYS F O     1 
ATOM   2776 C  CB    . CYS B 1 12  ? 4.351   25.799  69.668  1.00 56.53  ? 11  CYS F CB    1 
ATOM   2777 S  SG    . CYS B 1 12  ? 3.222   26.488  70.902  1.00 72.89  ? 11  CYS F SG    1 
ATOM   2778 N  N     . PHE B 1 13  ? 5.099   22.330  70.813  1.00 56.56  ? 12  PHE F N     1 
ATOM   2779 C  CA    . PHE B 1 13  ? 5.415   21.516  71.990  1.00 52.58  ? 12  PHE F CA    1 
ATOM   2780 C  C     . PHE B 1 13  ? 6.509   22.038  72.927  1.00 50.59  ? 12  PHE F C     1 
ATOM   2781 O  O     . PHE B 1 13  ? 6.230   22.383  74.080  1.00 50.46  ? 12  PHE F O     1 
ATOM   2782 C  CB    . PHE B 1 13  ? 5.728   20.081  71.553  1.00 53.46  ? 12  PHE F CB    1 
ATOM   2783 C  CG    . PHE B 1 13  ? 5.877   19.122  72.693  1.00 49.88  ? 12  PHE F CG    1 
ATOM   2784 C  CD1   . PHE B 1 13  ? 4.998   19.157  73.763  1.00 49.24  ? 12  PHE F CD1   1 
ATOM   2785 C  CD2   . PHE B 1 13  ? 6.885   18.174  72.690  1.00 48.06  ? 12  PHE F CD2   1 
ATOM   2786 C  CE1   . PHE B 1 13  ? 5.130   18.273  74.815  1.00 55.77  ? 12  PHE F CE1   1 
ATOM   2787 C  CE2   . PHE B 1 13  ? 7.022   17.285  73.737  1.00 49.39  ? 12  PHE F CE2   1 
ATOM   2788 C  CZ    . PHE B 1 13  ? 6.143   17.334  74.801  1.00 49.42  ? 12  PHE F CZ    1 
ATOM   2789 N  N     . PHE B 1 14  ? 7.744   22.087  72.437  1.00 50.89  ? 13  PHE F N     1 
ATOM   2790 C  CA    . PHE B 1 14  ? 8.876   22.512  73.258  1.00 55.42  ? 13  PHE F CA    1 
ATOM   2791 C  C     . PHE B 1 14  ? 8.636   23.916  73.802  1.00 55.06  ? 13  PHE F C     1 
ATOM   2792 O  O     . PHE B 1 14  ? 8.740   24.159  75.010  1.00 53.93  ? 13  PHE F O     1 
ATOM   2793 C  CB    . PHE B 1 14  ? 10.184  22.479  72.460  1.00 55.41  ? 13  PHE F CB    1 
ATOM   2794 C  CG    . PHE B 1 14  ? 10.627  21.096  72.054  1.00 53.27  ? 13  PHE F CG    1 
ATOM   2795 C  CD1   . PHE B 1 14  ? 9.900   19.973  72.420  1.00 51.86  ? 13  PHE F CD1   1 
ATOM   2796 C  CD2   . PHE B 1 14  ? 11.785  20.922  71.313  1.00 55.49  ? 13  PHE F CD2   1 
ATOM   2797 C  CE1   . PHE B 1 14  ? 10.313  18.708  72.044  1.00 57.55  ? 13  PHE F CE1   1 
ATOM   2798 C  CE2   . PHE B 1 14  ? 12.205  19.659  70.937  1.00 56.47  ? 13  PHE F CE2   1 
ATOM   2799 C  CZ    . PHE B 1 14  ? 11.469  18.551  71.303  1.00 57.10  ? 13  PHE F CZ    1 
ATOM   2800 N  N     . ALA B 1 15  ? 8.297   24.831  72.898  1.00 55.40  ? 14  ALA F N     1 
ATOM   2801 C  CA    . ALA B 1 15  ? 8.001   26.211  73.260  1.00 51.94  ? 14  ALA F CA    1 
ATOM   2802 C  C     . ALA B 1 15  ? 6.823   26.294  74.225  1.00 51.59  ? 14  ALA F C     1 
ATOM   2803 O  O     . ALA B 1 15  ? 6.791   27.158  75.099  1.00 55.38  ? 14  ALA F O     1 
ATOM   2804 C  CB    . ALA B 1 15  ? 7.726   27.035  72.013  1.00 53.49  ? 14  ALA F CB    1 
ATOM   2805 N  N     . ALA B 1 16  ? 5.858   25.393  74.061  1.00 52.73  ? 15  ALA F N     1 
ATOM   2806 C  CA    . ALA B 1 16  ? 4.697   25.346  74.943  1.00 53.23  ? 15  ALA F CA    1 
ATOM   2807 C  C     . ALA B 1 16  ? 5.109   25.006  76.372  1.00 57.68  ? 15  ALA F C     1 
ATOM   2808 O  O     . ALA B 1 16  ? 4.664   25.649  77.325  1.00 59.63  ? 15  ALA F O     1 
ATOM   2809 C  CB    . ALA B 1 16  ? 3.676   24.343  74.428  1.00 49.89  ? 15  ALA F CB    1 
ATOM   2810 N  N     . VAL B 1 17  ? 5.960   23.994  76.514  1.00 53.33  ? 16  VAL F N     1 
ATOM   2811 C  CA    . VAL B 1 17  ? 6.483   23.617  77.823  1.00 56.10  ? 16  VAL F CA    1 
ATOM   2812 C  C     . VAL B 1 17  ? 7.282   24.763  78.440  1.00 61.27  ? 16  VAL F C     1 
ATOM   2813 O  O     . VAL B 1 17  ? 7.064   25.141  79.599  1.00 59.65  ? 16  VAL F O     1 
ATOM   2814 C  CB    . VAL B 1 17  ? 7.381   22.367  77.734  1.00 62.00  ? 16  VAL F CB    1 
ATOM   2815 C  CG1   . VAL B 1 17  ? 8.100   22.129  79.054  1.00 62.11  ? 16  VAL F CG1   1 
ATOM   2816 C  CG2   . VAL B 1 17  ? 6.560   21.150  77.335  1.00 62.48  ? 16  VAL F CG2   1 
ATOM   2817 N  N     . GLU B 1 18  ? 8.198   25.318  77.651  1.00 58.72  ? 17  GLU F N     1 
ATOM   2818 C  CA    . GLU B 1 18  ? 9.058   26.403  78.115  1.00 57.36  ? 17  GLU F CA    1 
ATOM   2819 C  C     . GLU B 1 18  ? 8.268   27.643  78.535  1.00 58.99  ? 17  GLU F C     1 
ATOM   2820 O  O     . GLU B 1 18  ? 8.679   28.375  79.435  1.00 61.81  ? 17  GLU F O     1 
ATOM   2821 C  CB    . GLU B 1 18  ? 10.079  26.774  77.038  1.00 55.95  ? 17  GLU F CB    1 
ATOM   2822 C  CG    . GLU B 1 18  ? 11.013  25.640  76.635  1.00 55.86  ? 17  GLU F CG    1 
ATOM   2823 C  CD    . GLU B 1 18  ? 11.995  25.259  77.727  1.00 58.41  ? 17  GLU F CD    1 
ATOM   2824 O  OE1   . GLU B 1 18  ? 12.151  26.035  78.694  1.00 61.32  ? 17  GLU F OE1   1 
ATOM   2825 O  OE2   . GLU B 1 18  ? 12.615  24.181  77.616  1.00 58.05  ? 17  GLU F OE2   1 
ATOM   2826 N  N     . MET B 1 19  ? 7.135   27.874  77.880  1.00 57.90  ? 18  MET F N     1 
ATOM   2827 C  CA    . MET B 1 19  ? 6.284   29.014  78.202  1.00 61.10  ? 18  MET F CA    1 
ATOM   2828 C  C     . MET B 1 19  ? 5.400   28.728  79.408  1.00 62.30  ? 18  MET F C     1 
ATOM   2829 O  O     . MET B 1 19  ? 5.069   29.635  80.173  1.00 63.51  ? 18  MET F O     1 
ATOM   2830 C  CB    . MET B 1 19  ? 5.428   29.407  76.998  1.00 57.96  ? 18  MET F CB    1 
ATOM   2831 C  CG    . MET B 1 19  ? 6.158   30.257  75.975  1.00 58.82  ? 18  MET F CG    1 
ATOM   2832 S  SD    . MET B 1 19  ? 5.258   30.380  74.421  1.00 61.10  ? 18  MET F SD    1 
ATOM   2833 C  CE    . MET B 1 19  ? 3.614   30.762  75.012  1.00 65.38  ? 18  MET F CE    1 
ATOM   2834 N  N     . ARG B 1 20  ? 5.014   27.467  79.572  1.00 60.27  ? 19  ARG F N     1 
ATOM   2835 C  CA    . ARG B 1 20  ? 4.257   27.061  80.747  1.00 58.42  ? 19  ARG F CA    1 
ATOM   2836 C  C     . ARG B 1 20  ? 5.104   27.238  81.998  1.00 64.99  ? 19  ARG F C     1 
ATOM   2837 O  O     . ARG B 1 20  ? 4.633   27.757  83.011  1.00 67.60  ? 19  ARG F O     1 
ATOM   2838 C  CB    . ARG B 1 20  ? 3.816   25.603  80.637  1.00 60.24  ? 19  ARG F CB    1 
ATOM   2839 C  CG    . ARG B 1 20  ? 3.178   25.069  81.912  1.00 60.15  ? 19  ARG F CG    1 
ATOM   2840 C  CD    . ARG B 1 20  ? 3.046   23.558  81.884  1.00 65.09  ? 19  ARG F CD    1 
ATOM   2841 N  NE    . ARG B 1 20  ? 4.336   22.898  81.709  1.00 64.18  ? 19  ARG F NE    1 
ATOM   2842 C  CZ    . ARG B 1 20  ? 4.511   21.581  81.748  1.00 61.64  ? 19  ARG F CZ    1 
ATOM   2843 N  NH1   . ARG B 1 20  ? 3.478   20.779  81.962  1.00 60.85  ? 19  ARG F NH1   1 
ATOM   2844 N  NH2   . ARG B 1 20  ? 5.721   21.065  81.578  1.00 58.19  ? 19  ARG F NH2   1 
ATOM   2845 N  N     . ASP B 1 21  ? 6.359   26.807  81.920  1.00 64.48  ? 20  ASP F N     1 
ATOM   2846 C  CA    . ASP B 1 21  ? 7.250   26.864  83.076  1.00 65.21  ? 20  ASP F CA    1 
ATOM   2847 C  C     . ASP B 1 21  ? 7.685   28.288  83.431  1.00 69.36  ? 20  ASP F C     1 
ATOM   2848 O  O     . ASP B 1 21  ? 7.697   28.662  84.604  1.00 73.29  ? 20  ASP F O     1 
ATOM   2849 C  CB    . ASP B 1 21  ? 8.461   25.952  82.870  1.00 63.48  ? 20  ASP F CB    1 
ATOM   2850 C  CG    . ASP B 1 21  ? 8.085   24.482  82.871  1.00 64.38  ? 20  ASP F CG    1 
ATOM   2851 O  OD1   . ASP B 1 21  ? 7.056   24.134  83.488  1.00 59.87  ? 20  ASP F OD1   1 
ATOM   2852 O  OD2   . ASP B 1 21  ? 8.815   23.676  82.258  1.00 58.79  ? 20  ASP F OD2   1 
ATOM   2853 N  N     . ASN B 1 22  ? 8.041   29.076  82.422  1.00 63.24  ? 21  ASN F N     1 
ATOM   2854 C  CA    . ASN B 1 22  ? 8.380   30.479  82.642  1.00 65.87  ? 21  ASN F CA    1 
ATOM   2855 C  C     . ASN B 1 22  ? 7.456   31.403  81.856  1.00 68.09  ? 21  ASN F C     1 
ATOM   2856 O  O     . ASN B 1 22  ? 7.711   31.695  80.688  1.00 72.59  ? 21  ASN F O     1 
ATOM   2857 C  CB    . ASN B 1 22  ? 9.843   30.753  82.285  1.00 74.82  ? 21  ASN F CB    1 
ATOM   2858 C  CG    . ASN B 1 22  ? 10.282  32.158  82.660  1.00 73.44  ? 21  ASN F CG    1 
ATOM   2859 O  OD1   . ASN B 1 22  ? 9.628   32.835  83.454  1.00 73.59  ? 21  ASN F OD1   1 
ATOM   2860 N  ND2   . ASN B 1 22  ? 11.396  32.602  82.090  1.00 68.64  ? 21  ASN F ND2   1 
ATOM   2861 N  N     . PRO B 1 23  ? 6.377   31.869  82.506  1.00 68.49  ? 22  PRO F N     1 
ATOM   2862 C  CA    . PRO B 1 23  ? 5.318   32.694  81.909  1.00 68.67  ? 22  PRO F CA    1 
ATOM   2863 C  C     . PRO B 1 23  ? 5.827   33.956  81.214  1.00 75.04  ? 22  PRO F C     1 
ATOM   2864 O  O     . PRO B 1 23  ? 5.118   34.515  80.378  1.00 74.12  ? 22  PRO F O     1 
ATOM   2865 C  CB    . PRO B 1 23  ? 4.458   33.077  83.117  1.00 70.80  ? 22  PRO F CB    1 
ATOM   2866 C  CG    . PRO B 1 23  ? 4.666   31.971  84.084  1.00 71.49  ? 22  PRO F CG    1 
ATOM   2867 C  CD    . PRO B 1 23  ? 6.102   31.568  83.922  1.00 71.64  ? 22  PRO F CD    1 
ATOM   2868 N  N     . ALA B 1 24  ? 7.038   34.392  81.549  1.00 74.56  ? 23  ALA F N     1 
ATOM   2869 C  CA    . ALA B 1 24  ? 7.611   35.598  80.958  1.00 71.00  ? 23  ALA F CA    1 
ATOM   2870 C  C     . ALA B 1 24  ? 7.972   35.411  79.485  1.00 68.95  ? 23  ALA F C     1 
ATOM   2871 O  O     . ALA B 1 24  ? 8.346   36.366  78.804  1.00 72.98  ? 23  ALA F O     1 
ATOM   2872 C  CB    . ALA B 1 24  ? 8.830   36.047  81.751  1.00 70.90  ? 23  ALA F CB    1 
ATOM   2873 N  N     . LEU B 1 25  ? 7.856   34.179  79.000  1.00 69.44  ? 24  LEU F N     1 
ATOM   2874 C  CA    . LEU B 1 25  ? 8.189   33.856  77.617  1.00 69.96  ? 24  LEU F CA    1 
ATOM   2875 C  C     . LEU B 1 25  ? 6.937   33.789  76.748  1.00 65.12  ? 24  LEU F C     1 
ATOM   2876 O  O     . LEU B 1 25  ? 7.012   33.482  75.558  1.00 60.76  ? 24  LEU F O     1 
ATOM   2877 C  CB    . LEU B 1 25  ? 8.931   32.520  77.557  1.00 65.65  ? 24  LEU F CB    1 
ATOM   2878 C  CG    . LEU B 1 25  ? 10.201  32.415  78.403  1.00 66.61  ? 24  LEU F CG    1 
ATOM   2879 C  CD1   . LEU B 1 25  ? 10.624  30.963  78.556  1.00 64.83  ? 24  LEU F CD1   1 
ATOM   2880 C  CD2   . LEU B 1 25  ? 11.320  33.238  77.786  1.00 62.48  ? 24  LEU F CD2   1 
ATOM   2881 N  N     . ARG B 1 26  ? 5.791   34.084  77.353  1.00 66.40  ? 25  ARG F N     1 
ATOM   2882 C  CA    . ARG B 1 26  ? 4.498   33.947  76.690  1.00 62.80  ? 25  ARG F CA    1 
ATOM   2883 C  C     . ARG B 1 26  ? 4.351   34.848  75.466  1.00 62.71  ? 25  ARG F C     1 
ATOM   2884 O  O     . ARG B 1 26  ? 4.027   34.379  74.374  1.00 61.85  ? 25  ARG F O     1 
ATOM   2885 C  CB    . ARG B 1 26  ? 3.367   34.247  77.677  1.00 65.75  ? 25  ARG F CB    1 
ATOM   2886 C  CG    . ARG B 1 26  ? 1.985   33.828  77.201  1.00 70.23  ? 25  ARG F CG    1 
ATOM   2887 C  CD    . ARG B 1 26  ? 1.684   32.392  77.598  1.00 76.74  ? 25  ARG F CD    1 
ATOM   2888 N  NE    . ARG B 1 26  ? 1.732   32.211  79.046  1.00 79.46  ? 25  ARG F NE    1 
ATOM   2889 C  CZ    . ARG B 1 26  ? 1.557   31.047  79.662  1.00 78.24  ? 25  ARG F CZ    1 
ATOM   2890 N  NH1   . ARG B 1 26  ? 1.320   29.950  78.957  1.00 78.01  ? 25  ARG F NH1   1 
ATOM   2891 N  NH2   . ARG B 1 26  ? 1.619   30.980  80.985  1.00 75.00  ? 25  ARG F NH2   1 
ATOM   2892 N  N     . ASP B 1 27  ? 4.592   36.141  75.652  1.00 64.68  ? 26  ASP F N     1 
ATOM   2893 C  CA    . ASP B 1 27  ? 4.290   37.126  74.619  1.00 65.06  ? 26  ASP F CA    1 
ATOM   2894 C  C     . ASP B 1 27  ? 5.528   37.694  73.930  1.00 63.65  ? 26  ASP F C     1 
ATOM   2895 O  O     . ASP B 1 27  ? 5.442   38.682  73.201  1.00 66.19  ? 26  ASP F O     1 
ATOM   2896 C  CB    . ASP B 1 27  ? 3.439   38.252  75.207  1.00 60.98  ? 26  ASP F CB    1 
ATOM   2897 C  CG    . ASP B 1 27  ? 2.163   37.739  75.845  1.00 66.94  ? 26  ASP F CG    1 
ATOM   2898 O  OD1   . ASP B 1 27  ? 1.514   36.853  75.249  1.00 65.93  ? 26  ASP F OD1   1 
ATOM   2899 O  OD2   . ASP B 1 27  ? 1.814   38.212  76.948  1.00 73.08  ? 26  ASP F OD2   1 
ATOM   2900 N  N     . ILE B 1 28  ? 6.676   37.069  74.163  1.00 54.99  ? 27  ILE F N     1 
ATOM   2901 C  CA    . ILE B 1 28  ? 7.898   37.435  73.457  1.00 55.88  ? 27  ILE F CA    1 
ATOM   2902 C  C     . ILE B 1 28  ? 8.306   36.309  72.514  1.00 55.59  ? 27  ILE F C     1 
ATOM   2903 O  O     . ILE B 1 28  ? 8.044   35.139  72.791  1.00 56.19  ? 27  ILE F O     1 
ATOM   2904 C  CB    . ILE B 1 28  ? 9.057   37.737  74.428  1.00 60.25  ? 27  ILE F CB    1 
ATOM   2905 C  CG1   . ILE B 1 28  ? 9.225   36.596  75.432  1.00 61.90  ? 27  ILE F CG1   1 
ATOM   2906 C  CG2   . ILE B 1 28  ? 8.820   39.057  75.146  1.00 65.00  ? 27  ILE F CG2   1 
ATOM   2907 C  CD1   . ILE B 1 28  ? 10.457  36.721  76.298  1.00 62.81  ? 27  ILE F CD1   1 
ATOM   2908 N  N     . PRO B 1 29  ? 8.937   36.661  71.384  1.00 52.81  ? 28  PRO F N     1 
ATOM   2909 C  CA    . PRO B 1 29  ? 9.384   35.648  70.424  1.00 52.99  ? 28  PRO F CA    1 
ATOM   2910 C  C     . PRO B 1 29  ? 10.481  34.759  71.000  1.00 58.87  ? 28  PRO F C     1 
ATOM   2911 O  O     . PRO B 1 29  ? 11.604  35.222  71.198  1.00 63.55  ? 28  PRO F O     1 
ATOM   2912 C  CB    . PRO B 1 29  ? 9.952   36.484  69.274  1.00 52.84  ? 28  PRO F CB    1 
ATOM   2913 C  CG    . PRO B 1 29  ? 9.320   37.824  69.416  1.00 55.50  ? 28  PRO F CG    1 
ATOM   2914 C  CD    . PRO B 1 29  ? 9.162   38.029  70.886  1.00 54.86  ? 28  PRO F CD    1 
ATOM   2915 N  N     . ILE B 1 30  ? 10.155  33.498  71.267  1.00 55.55  ? 29  ILE F N     1 
ATOM   2916 C  CA    . ILE B 1 30  ? 11.146  32.545  71.748  1.00 56.58  ? 29  ILE F CA    1 
ATOM   2917 C  C     . ILE B 1 30  ? 11.282  31.385  70.772  1.00 57.83  ? 29  ILE F C     1 
ATOM   2918 O  O     . ILE B 1 30  ? 10.434  31.191  69.900  1.00 59.10  ? 29  ILE F O     1 
ATOM   2919 C  CB    . ILE B 1 30  ? 10.784  31.981  73.137  1.00 58.42  ? 29  ILE F CB    1 
ATOM   2920 C  CG1   . ILE B 1 30  ? 9.693   30.915  73.016  1.00 52.33  ? 29  ILE F CG1   1 
ATOM   2921 C  CG2   . ILE B 1 30  ? 10.365  33.100  74.080  1.00 58.18  ? 29  ILE F CG2   1 
ATOM   2922 C  CD1   . ILE B 1 30  ? 9.417   30.179  74.305  1.00 53.28  ? 29  ILE F CD1   1 
ATOM   2923 N  N     . ALA B 1 31  ? 12.353  30.615  70.925  1.00 56.47  ? 30  ALA F N     1 
ATOM   2924 C  CA    . ALA B 1 31  ? 12.583  29.455  70.077  1.00 52.24  ? 30  ALA F CA    1 
ATOM   2925 C  C     . ALA B 1 31  ? 13.570  28.484  70.710  1.00 56.90  ? 30  ALA F C     1 
ATOM   2926 O  O     . ALA B 1 31  ? 14.549  28.893  71.334  1.00 58.49  ? 30  ALA F O     1 
ATOM   2927 C  CB    . ALA B 1 31  ? 13.078  29.886  68.703  1.00 53.42  ? 30  ALA F CB    1 
ATOM   2928 N  N     . ILE B 1 32  ? 13.292  27.195  70.554  1.00 59.80  ? 31  ILE F N     1 
ATOM   2929 C  CA    . ILE B 1 32  ? 14.236  26.156  70.929  1.00 57.85  ? 31  ILE F CA    1 
ATOM   2930 C  C     . ILE B 1 32  ? 15.064  25.793  69.704  1.00 54.36  ? 31  ILE F C     1 
ATOM   2931 O  O     . ILE B 1 32  ? 14.515  25.473  68.639  1.00 53.47  ? 31  ILE F O     1 
ATOM   2932 C  CB    . ILE B 1 32  ? 13.536  24.896  71.479  1.00 57.86  ? 31  ILE F CB    1 
ATOM   2933 C  CG1   . ILE B 1 32  ? 13.005  25.144  72.894  1.00 59.59  ? 31  ILE F CG1   1 
ATOM   2934 C  CG2   . ILE B 1 32  ? 14.498  23.718  71.499  1.00 52.85  ? 31  ILE F CG2   1 
ATOM   2935 C  CD1   . ILE B 1 32  ? 11.686  25.887  72.951  1.00 54.37  ? 31  ILE F CD1   1 
ATOM   2936 N  N     . GLY B 1 33  ? 16.382  25.868  69.869  1.00 53.61  ? 32  GLY F N     1 
ATOM   2937 C  CA    . GLY B 1 33  ? 17.332  25.586  68.810  1.00 54.29  ? 32  GLY F CA    1 
ATOM   2938 C  C     . GLY B 1 33  ? 18.737  25.991  69.220  1.00 58.99  ? 32  GLY F C     1 
ATOM   2939 O  O     . GLY B 1 33  ? 18.921  26.677  70.225  1.00 63.91  ? 32  GLY F O     1 
ATOM   2940 N  N     . GLY B 1 34  ? 19.729  25.568  68.443  1.00 58.35  ? 33  GLY F N     1 
ATOM   2941 C  CA    . GLY B 1 34  ? 21.117  25.860  68.755  1.00 55.37  ? 33  GLY F CA    1 
ATOM   2942 C  C     . GLY B 1 34  ? 21.521  27.274  68.386  1.00 62.89  ? 33  GLY F C     1 
ATOM   2943 O  O     . GLY B 1 34  ? 20.922  27.889  67.502  1.00 65.77  ? 33  GLY F O     1 
ATOM   2944 N  N     . SER B 1 35  ? 22.544  27.790  69.063  1.00 65.83  ? 34  SER F N     1 
ATOM   2945 C  CA    . SER B 1 35  ? 23.027  29.144  68.804  1.00 54.34  ? 34  SER F CA    1 
ATOM   2946 C  C     . SER B 1 35  ? 23.646  29.244  67.410  1.00 59.40  ? 34  SER F C     1 
ATOM   2947 O  O     . SER B 1 35  ? 23.988  28.231  66.799  1.00 58.15  ? 34  SER F O     1 
ATOM   2948 C  CB    . SER B 1 35  ? 24.052  29.574  69.861  1.00 56.07  ? 34  SER F CB    1 
ATOM   2949 O  OG    . SER B 1 35  ? 25.287  28.902  69.677  1.00 61.11  ? 34  SER F OG    1 
ATOM   2950 N  N     . ARG B 1 36  ? 23.789  30.468  66.911  1.00 58.60  ? 35  ARG F N     1 
ATOM   2951 C  CA    . ARG B 1 36  ? 24.433  30.701  65.621  1.00 57.67  ? 35  ARG F CA    1 
ATOM   2952 C  C     . ARG B 1 36  ? 25.916  30.350  65.692  1.00 60.50  ? 35  ARG F C     1 
ATOM   2953 O  O     . ARG B 1 36  ? 26.485  29.831  64.731  1.00 48.06  ? 35  ARG F O     1 
ATOM   2954 C  CB    . ARG B 1 36  ? 24.246  32.157  65.188  1.00 61.37  ? 35  ARG F CB    1 
ATOM   2955 C  CG    . ARG B 1 36  ? 24.839  32.497  63.832  1.00 68.84  ? 35  ARG F CG    1 
ATOM   2956 C  CD    . ARG B 1 36  ? 24.223  33.770  63.258  1.00 76.25  ? 35  ARG F CD    1 
ATOM   2957 N  NE    . ARG B 1 36  ? 24.413  34.941  64.111  1.00 88.01  ? 35  ARG F NE    1 
ATOM   2958 C  CZ    . ARG B 1 36  ? 25.244  35.941  63.832  1.00 92.86  ? 35  ARG F CZ    1 
ATOM   2959 N  NH1   . ARG B 1 36  ? 25.969  35.913  62.722  1.00 89.12  ? 35  ARG F NH1   1 
ATOM   2960 N  NH2   . ARG B 1 36  ? 25.353  36.972  64.659  1.00 93.98  ? 35  ARG F NH2   1 
ATOM   2961 N  N     . GLU B 1 37  ? 26.530  30.625  66.841  1.00 66.22  ? 36  GLU F N     1 
ATOM   2962 C  CA    . GLU B 1 37  ? 27.932  30.290  67.069  1.00 62.20  ? 36  GLU F CA    1 
ATOM   2963 C  C     . GLU B 1 37  ? 28.138  28.791  66.901  1.00 65.18  ? 36  GLU F C     1 
ATOM   2964 O  O     . GLU B 1 37  ? 29.115  28.351  66.288  1.00 65.77  ? 36  GLU F O     1 
ATOM   2965 C  CB    . GLU B 1 37  ? 28.371  30.723  68.471  1.00 64.33  ? 36  GLU F CB    1 
ATOM   2966 C  CG    . GLU B 1 37  ? 29.879  30.637  68.712  1.00 78.72  ? 36  GLU F CG    1 
ATOM   2967 C  CD    . GLU B 1 37  ? 30.680  31.498  67.746  1.00 92.09  ? 36  GLU F CD    1 
ATOM   2968 O  OE1   . GLU B 1 37  ? 30.644  32.740  67.876  1.00 98.77  ? 36  GLU F OE1   1 
ATOM   2969 O  OE2   . GLU B 1 37  ? 31.349  30.936  66.853  1.00 93.92  ? 36  GLU F OE2   1 
ATOM   2970 N  N     . ARG B 1 38  ? 27.197  28.017  67.434  1.00 62.08  ? 37  ARG F N     1 
ATOM   2971 C  CA    . ARG B 1 38  ? 27.234  26.563  67.330  1.00 61.15  ? 37  ARG F CA    1 
ATOM   2972 C  C     . ARG B 1 38  ? 26.759  26.073  65.967  1.00 55.90  ? 37  ARG F C     1 
ATOM   2973 O  O     . ARG B 1 38  ? 26.706  24.867  65.723  1.00 59.10  ? 37  ARG F O     1 
ATOM   2974 C  CB    . ARG B 1 38  ? 26.375  25.934  68.428  1.00 56.58  ? 37  ARG F CB    1 
ATOM   2975 C  CG    . ARG B 1 38  ? 26.957  26.056  69.823  1.00 58.21  ? 37  ARG F CG    1 
ATOM   2976 C  CD    . ARG B 1 38  ? 27.944  24.939  70.109  1.00 63.88  ? 37  ARG F CD    1 
ATOM   2977 N  NE    . ARG B 1 38  ? 27.434  24.009  71.114  1.00 63.29  ? 37  ARG F NE    1 
ATOM   2978 C  CZ    . ARG B 1 38  ? 26.864  22.840  70.837  1.00 67.87  ? 37  ARG F CZ    1 
ATOM   2979 N  NH1   . ARG B 1 38  ? 26.730  22.444  69.578  1.00 63.36  ? 37  ARG F NH1   1 
ATOM   2980 N  NH2   . ARG B 1 38  ? 26.431  22.064  71.821  1.00 73.36  ? 37  ARG F NH2   1 
ATOM   2981 N  N     . ARG B 1 39  ? 26.423  27.016  65.088  1.00 56.64  ? 38  ARG F N     1 
ATOM   2982 C  CA    . ARG B 1 39  ? 25.904  26.712  63.756  1.00 60.20  ? 38  ARG F CA    1 
ATOM   2983 C  C     . ARG B 1 39  ? 24.650  25.848  63.826  1.00 58.94  ? 38  ARG F C     1 
ATOM   2984 O  O     . ARG B 1 39  ? 24.528  24.851  63.116  1.00 61.17  ? 38  ARG F O     1 
ATOM   2985 C  CB    . ARG B 1 39  ? 26.978  26.055  62.883  1.00 52.20  ? 38  ARG F CB    1 
ATOM   2986 C  CG    . ARG B 1 39  ? 28.213  26.919  62.689  1.00 60.06  ? 38  ARG F CG    1 
ATOM   2987 C  CD    . ARG B 1 39  ? 29.108  26.388  61.582  1.00 61.95  ? 38  ARG F CD    1 
ATOM   2988 N  NE    . ARG B 1 39  ? 29.754  25.131  61.942  1.00 63.72  ? 38  ARG F NE    1 
ATOM   2989 C  CZ    . ARG B 1 39  ? 30.647  24.508  61.180  1.00 65.73  ? 38  ARG F CZ    1 
ATOM   2990 N  NH1   . ARG B 1 39  ? 31.002  25.029  60.013  1.00 63.60  ? 38  ARG F NH1   1 
ATOM   2991 N  NH2   . ARG B 1 39  ? 31.188  23.367  61.584  1.00 62.33  ? 38  ARG F NH2   1 
ATOM   2992 N  N     . GLY B 1 40  ? 23.717  26.247  64.683  1.00 58.71  ? 39  GLY F N     1 
ATOM   2993 C  CA    . GLY B 1 40  ? 22.515  25.471  64.910  1.00 59.51  ? 39  GLY F CA    1 
ATOM   2994 C  C     . GLY B 1 40  ? 21.331  25.906  64.072  1.00 58.39  ? 39  GLY F C     1 
ATOM   2995 O  O     . GLY B 1 40  ? 21.422  26.839  63.273  1.00 57.97  ? 39  GLY F O     1 
ATOM   2996 N  N     . VAL B 1 41  ? 20.214  25.210  64.252  1.00 56.50  ? 40  VAL F N     1 
ATOM   2997 C  CA    . VAL B 1 41  ? 18.972  25.550  63.577  1.00 51.62  ? 40  VAL F CA    1 
ATOM   2998 C  C     . VAL B 1 41  ? 17.881  25.729  64.617  1.00 49.39  ? 40  VAL F C     1 
ATOM   2999 O  O     . VAL B 1 41  ? 18.135  25.612  65.813  1.00 48.36  ? 40  VAL F O     1 
ATOM   3000 C  CB    . VAL B 1 41  ? 18.534  24.443  62.607  1.00 49.26  ? 40  VAL F CB    1 
ATOM   3001 C  CG1   . VAL B 1 41  ? 19.631  24.154  61.601  1.00 55.49  ? 40  VAL F CG1   1 
ATOM   3002 C  CG2   . VAL B 1 41  ? 18.168  23.186  63.377  1.00 45.25  ? 40  VAL F CG2   1 
ATOM   3003 N  N     . ILE B 1 42  ? 16.668  26.011  64.159  1.00 49.90  ? 41  ILE F N     1 
ATOM   3004 C  CA    . ILE B 1 42  ? 15.526  26.118  65.053  1.00 47.78  ? 41  ILE F CA    1 
ATOM   3005 C  C     . ILE B 1 42  ? 14.825  24.772  65.172  1.00 48.13  ? 41  ILE F C     1 
ATOM   3006 O  O     . ILE B 1 42  ? 14.412  24.192  64.167  1.00 49.44  ? 41  ILE F O     1 
ATOM   3007 C  CB    . ILE B 1 42  ? 14.511  27.157  64.544  1.00 48.42  ? 41  ILE F CB    1 
ATOM   3008 C  CG1   . ILE B 1 42  ? 15.162  28.537  64.445  1.00 46.45  ? 41  ILE F CG1   1 
ATOM   3009 C  CG2   . ILE B 1 42  ? 13.291  27.202  65.450  1.00 44.87  ? 41  ILE F CG2   1 
ATOM   3010 C  CD1   . ILE B 1 42  ? 15.675  29.066  65.765  1.00 44.91  ? 41  ILE F CD1   1 
ATOM   3011 N  N     . SER B 1 43  ? 14.703  24.265  66.395  1.00 48.11  ? 42  SER F N     1 
ATOM   3012 C  CA    . SER B 1 43  ? 13.895  23.076  66.628  1.00 56.28  ? 42  SER F CA    1 
ATOM   3013 C  C     . SER B 1 43  ? 12.431  23.471  66.521  1.00 52.56  ? 42  SER F C     1 
ATOM   3014 O  O     . SER B 1 43  ? 11.659  22.831  65.808  1.00 47.36  ? 42  SER F O     1 
ATOM   3015 C  CB    . SER B 1 43  ? 14.186  22.456  67.997  1.00 51.47  ? 42  SER F CB    1 
ATOM   3016 O  OG    . SER B 1 43  ? 15.053  21.342  67.880  1.00 53.52  ? 42  SER F OG    1 
ATOM   3017 N  N     . THR B 1 44  ? 12.057  24.537  67.224  1.00 48.85  ? 43  THR F N     1 
ATOM   3018 C  CA    . THR B 1 44  ? 10.701  25.075  67.097  1.00 52.32  ? 43  THR F CA    1 
ATOM   3019 C  C     . THR B 1 44  ? 10.605  26.493  67.641  1.00 54.27  ? 43  THR F C     1 
ATOM   3020 O  O     . THR B 1 44  ? 11.512  26.967  68.314  1.00 56.54  ? 43  THR F O     1 
ATOM   3021 C  CB    . THR B 1 44  ? 9.655   24.191  67.807  1.00 49.58  ? 43  THR F CB    1 
ATOM   3022 O  OG1   . THR B 1 44  ? 8.337   24.655  67.486  1.00 49.21  ? 43  THR F OG1   1 
ATOM   3023 C  CG2   . THR B 1 44  ? 9.851   24.234  69.311  1.00 49.47  ? 43  THR F CG2   1 
ATOM   3024 N  N     . ALA B 1 45  ? 9.502   27.169  67.341  1.00 50.63  ? 44  ALA F N     1 
ATOM   3025 C  CA    . ALA B 1 45  ? 9.294   28.530  67.818  1.00 53.25  ? 44  ALA F CA    1 
ATOM   3026 C  C     . ALA B 1 45  ? 7.849   28.732  68.247  1.00 50.10  ? 44  ALA F C     1 
ATOM   3027 O  O     . ALA B 1 45  ? 6.943   28.099  67.710  1.00 51.71  ? 44  ALA F O     1 
ATOM   3028 C  CB    . ALA B 1 45  ? 9.669   29.531  66.739  1.00 52.50  ? 44  ALA F CB    1 
ATOM   3029 N  N     . ASN B 1 46  ? 7.635   29.611  69.220  1.00 45.31  ? 45  ASN F N     1 
ATOM   3030 C  CA    . ASN B 1 46  ? 6.278   29.958  69.619  1.00 50.66  ? 45  ASN F CA    1 
ATOM   3031 C  C     . ASN B 1 46  ? 5.657   30.902  68.597  1.00 52.31  ? 45  ASN F C     1 
ATOM   3032 O  O     . ASN B 1 46  ? 6.342   31.385  67.695  1.00 50.82  ? 45  ASN F O     1 
ATOM   3033 C  CB    . ASN B 1 46  ? 6.247   30.560  71.027  1.00 51.85  ? 45  ASN F CB    1 
ATOM   3034 C  CG    . ASN B 1 46  ? 6.947   31.904  71.112  1.00 56.02  ? 45  ASN F CG    1 
ATOM   3035 O  OD1   . ASN B 1 46  ? 7.749   32.259  70.250  1.00 54.42  ? 45  ASN F OD1   1 
ATOM   3036 N  ND2   . ASN B 1 46  ? 6.649   32.657  72.165  1.00 53.13  ? 45  ASN F ND2   1 
ATOM   3037 N  N     . TYR B 1 47  ? 4.362   31.162  68.733  1.00 50.69  ? 46  TYR F N     1 
ATOM   3038 C  CA    . TYR B 1 47  ? 3.641   31.969  67.747  1.00 54.28  ? 46  TYR F CA    1 
ATOM   3039 C  C     . TYR B 1 47  ? 4.115   33.421  67.545  1.00 50.06  ? 46  TYR F C     1 
ATOM   3040 O  O     . TYR B 1 47  ? 4.187   33.880  66.402  1.00 50.42  ? 46  TYR F O     1 
ATOM   3041 C  CB    . TYR B 1 47  ? 2.125   31.888  67.964  1.00 49.08  ? 46  TYR F CB    1 
ATOM   3042 C  CG    . TYR B 1 47  ? 1.512   30.672  67.308  1.00 48.77  ? 46  TYR F CG    1 
ATOM   3043 C  CD1   . TYR B 1 47  ? 1.158   29.555  68.053  1.00 44.44  ? 46  TYR F CD1   1 
ATOM   3044 C  CD2   . TYR B 1 47  ? 1.311   30.635  65.934  1.00 53.66  ? 46  TYR F CD2   1 
ATOM   3045 C  CE1   . TYR B 1 47  ? 0.606   28.439  67.447  1.00 41.09  ? 46  TYR F CE1   1 
ATOM   3046 C  CE2   . TYR B 1 47  ? 0.763   29.527  65.321  1.00 52.11  ? 46  TYR F CE2   1 
ATOM   3047 C  CZ    . TYR B 1 47  ? 0.412   28.432  66.080  1.00 45.41  ? 46  TYR F CZ    1 
ATOM   3048 O  OH    . TYR B 1 47  ? -0.136  27.329  65.468  1.00 51.46  ? 46  TYR F OH    1 
ATOM   3049 N  N     . PRO B 1 48  ? 4.430   34.149  68.637  1.00 50.33  ? 47  PRO F N     1 
ATOM   3050 C  CA    . PRO B 1 48  ? 5.012   35.484  68.447  1.00 50.68  ? 47  PRO F CA    1 
ATOM   3051 C  C     . PRO B 1 48  ? 6.275   35.450  67.586  1.00 57.66  ? 47  PRO F C     1 
ATOM   3052 O  O     . PRO B 1 48  ? 6.510   36.376  66.811  1.00 61.52  ? 47  PRO F O     1 
ATOM   3053 C  CB    . PRO B 1 48  ? 5.360   35.913  69.872  1.00 46.65  ? 47  PRO F CB    1 
ATOM   3054 C  CG    . PRO B 1 48  ? 4.353   35.226  70.711  1.00 51.59  ? 47  PRO F CG    1 
ATOM   3055 C  CD    . PRO B 1 48  ? 4.119   33.893  70.056  1.00 50.49  ? 47  PRO F CD    1 
ATOM   3056 N  N     . ALA B 1 49  ? 7.069   34.391  67.718  1.00 54.61  ? 48  ALA F N     1 
ATOM   3057 C  CA    . ALA B 1 49  ? 8.277   34.233  66.915  1.00 51.49  ? 48  ALA F CA    1 
ATOM   3058 C  C     . ALA B 1 49  ? 7.937   33.805  65.488  1.00 54.79  ? 48  ALA F C     1 
ATOM   3059 O  O     . ALA B 1 49  ? 8.560   34.265  64.531  1.00 54.02  ? 48  ALA F O     1 
ATOM   3060 C  CB    . ALA B 1 49  ? 9.220   33.229  67.562  1.00 53.09  ? 48  ALA F CB    1 
ATOM   3061 N  N     . ARG B 1 50  ? 6.950   32.920  65.352  1.00 58.49  ? 49  ARG F N     1 
ATOM   3062 C  CA    . ARG B 1 50  ? 6.495   32.455  64.041  1.00 57.22  ? 49  ARG F CA    1 
ATOM   3063 C  C     . ARG B 1 50  ? 5.958   33.606  63.189  1.00 55.07  ? 49  ARG F C     1 
ATOM   3064 O  O     . ARG B 1 50  ? 6.054   33.573  61.959  1.00 52.32  ? 49  ARG F O     1 
ATOM   3065 C  CB    . ARG B 1 50  ? 5.413   31.381  64.193  1.00 53.08  ? 49  ARG F CB    1 
ATOM   3066 C  CG    . ARG B 1 50  ? 5.907   30.038  64.708  1.00 58.33  ? 49  ARG F CG    1 
ATOM   3067 C  CD    . ARG B 1 50  ? 4.816   28.982  64.621  1.00 55.95  ? 49  ARG F CD    1 
ATOM   3068 N  NE    . ARG B 1 50  ? 5.343   27.634  64.809  1.00 56.21  ? 49  ARG F NE    1 
ATOM   3069 C  CZ    . ARG B 1 50  ? 5.011   26.834  65.818  1.00 60.63  ? 49  ARG F CZ    1 
ATOM   3070 N  NH1   . ARG B 1 50  ? 4.151   27.233  66.745  1.00 61.45  ? 49  ARG F NH1   1 
ATOM   3071 N  NH2   . ARG B 1 50  ? 5.545   25.629  65.906  1.00 55.63  ? 49  ARG F NH2   1 
ATOM   3072 N  N     . LYS B 1 51  ? 5.394   34.617  63.848  1.00 54.45  ? 50  LYS F N     1 
ATOM   3073 C  CA    . LYS B 1 51  ? 4.925   35.824  63.166  1.00 52.81  ? 50  LYS F CA    1 
ATOM   3074 C  C     . LYS B 1 51  ? 6.041   36.476  62.353  1.00 51.40  ? 50  LYS F C     1 
ATOM   3075 O  O     . LYS B 1 51  ? 5.794   37.014  61.271  1.00 48.26  ? 50  LYS F O     1 
ATOM   3076 C  CB    . LYS B 1 51  ? 4.358   36.819  64.182  1.00 50.86  ? 50  LYS F CB    1 
ATOM   3077 C  CG    . LYS B 1 51  ? 4.100   38.219  63.653  1.00 53.14  ? 50  LYS F CG    1 
ATOM   3078 C  CD    . LYS B 1 51  ? 3.572   39.141  64.761  1.00 63.68  ? 50  LYS F CD    1 
ATOM   3079 C  CE    . LYS B 1 51  ? 4.458   39.113  66.002  1.00 58.37  ? 50  LYS F CE    1 
ATOM   3080 N  NZ    . LYS B 1 51  ? 3.861   39.810  67.176  1.00 63.98  ? 50  LYS F NZ    1 
ATOM   3081 N  N     . PHE B 1 52  ? 7.268   36.401  62.865  1.00 60.25  ? 51  PHE F N     1 
ATOM   3082 C  CA    . PHE B 1 52  ? 8.421   36.948  62.158  1.00 55.49  ? 51  PHE F CA    1 
ATOM   3083 C  C     . PHE B 1 52  ? 8.856   36.043  61.010  1.00 54.03  ? 51  PHE F C     1 
ATOM   3084 O  O     . PHE B 1 52  ? 9.693   36.424  60.190  1.00 50.55  ? 51  PHE F O     1 
ATOM   3085 C  CB    . PHE B 1 52  ? 9.588   37.176  63.121  1.00 47.92  ? 51  PHE F CB    1 
ATOM   3086 C  CG    . PHE B 1 52  ? 9.369   38.314  64.076  1.00 52.08  ? 51  PHE F CG    1 
ATOM   3087 C  CD1   . PHE B 1 52  ? 8.715   38.108  65.279  1.00 50.03  ? 51  PHE F CD1   1 
ATOM   3088 C  CD2   . PHE B 1 52  ? 9.818   39.590  63.772  1.00 47.02  ? 51  PHE F CD2   1 
ATOM   3089 C  CE1   . PHE B 1 52  ? 8.508   39.152  66.160  1.00 47.24  ? 51  PHE F CE1   1 
ATOM   3090 C  CE2   . PHE B 1 52  ? 9.614   40.639  64.649  1.00 44.42  ? 51  PHE F CE2   1 
ATOM   3091 C  CZ    . PHE B 1 52  ? 8.958   40.419  65.845  1.00 43.98  ? 51  PHE F CZ    1 
ATOM   3092 N  N     . GLY B 1 53  ? 8.284   34.843  60.963  1.00 50.32  ? 52  GLY F N     1 
ATOM   3093 C  CA    . GLY B 1 53  ? 8.616   33.873  59.934  1.00 54.95  ? 52  GLY F CA    1 
ATOM   3094 C  C     . GLY B 1 53  ? 9.603   32.823  60.408  1.00 59.01  ? 52  GLY F C     1 
ATOM   3095 O  O     . GLY B 1 53  ? 10.319  32.222  59.602  1.00 55.96  ? 52  GLY F O     1 
ATOM   3096 N  N     . VAL B 1 54  ? 9.646   32.601  61.719  1.00 59.58  ? 53  VAL F N     1 
ATOM   3097 C  CA    . VAL B 1 54  ? 10.559  31.613  62.290  1.00 56.87  ? 53  VAL F CA    1 
ATOM   3098 C  C     . VAL B 1 54  ? 9.969   30.204  62.223  1.00 61.85  ? 53  VAL F C     1 
ATOM   3099 O  O     . VAL B 1 54  ? 9.016   29.886  62.944  1.00 63.98  ? 53  VAL F O     1 
ATOM   3100 C  CB    . VAL B 1 54  ? 10.954  31.956  63.742  1.00 59.75  ? 53  VAL F CB    1 
ATOM   3101 C  CG1   . VAL B 1 54  ? 11.943  30.936  64.272  1.00 51.16  ? 53  VAL F CG1   1 
ATOM   3102 C  CG2   . VAL B 1 54  ? 11.567  33.338  63.796  1.00 57.62  ? 53  VAL F CG2   1 
ATOM   3103 N  N     . ARG B 1 55  ? 10.534  29.374  61.347  1.00 54.91  ? 54  ARG F N     1 
ATOM   3104 C  CA    . ARG B 1 55  ? 10.060  28.009  61.152  1.00 50.60  ? 54  ARG F CA    1 
ATOM   3105 C  C     . ARG B 1 55  ? 11.028  27.014  61.781  1.00 54.13  ? 54  ARG F C     1 
ATOM   3106 O  O     . ARG B 1 55  ? 12.148  27.372  62.144  1.00 56.13  ? 54  ARG F O     1 
ATOM   3107 C  CB    . ARG B 1 55  ? 9.926   27.709  59.659  1.00 52.19  ? 54  ARG F CB    1 
ATOM   3108 C  CG    . ARG B 1 55  ? 9.119   28.737  58.888  1.00 60.19  ? 54  ARG F CG    1 
ATOM   3109 C  CD    . ARG B 1 55  ? 7.625   28.551  59.101  1.00 71.24  ? 54  ARG F CD    1 
ATOM   3110 N  NE    . ARG B 1 55  ? 6.858   29.703  58.635  1.00 77.79  ? 54  ARG F NE    1 
ATOM   3111 C  CZ    . ARG B 1 55  ? 6.221   30.551  59.437  1.00 70.95  ? 54  ARG F CZ    1 
ATOM   3112 N  NH1   . ARG B 1 55  ? 6.249   30.371  60.751  1.00 67.56  ? 54  ARG F NH1   1 
ATOM   3113 N  NH2   . ARG B 1 55  ? 5.549   31.574  58.927  1.00 74.31  ? 54  ARG F NH2   1 
ATOM   3114 N  N     . SER B 1 56  ? 10.589  25.766  61.914  1.00 54.09  ? 55  SER F N     1 
ATOM   3115 C  CA    . SER B 1 56  ? 11.475  24.693  62.343  1.00 45.19  ? 55  SER F CA    1 
ATOM   3116 C  C     . SER B 1 56  ? 12.450  24.385  61.218  1.00 47.84  ? 55  SER F C     1 
ATOM   3117 O  O     . SER B 1 56  ? 12.203  24.740  60.064  1.00 46.45  ? 55  SER F O     1 
ATOM   3118 C  CB    . SER B 1 56  ? 10.675  23.441  62.708  1.00 41.37  ? 55  SER F CB    1 
ATOM   3119 O  OG    . SER B 1 56  ? 9.933   23.641  63.898  1.00 52.79  ? 55  SER F OG    1 
ATOM   3120 N  N     . ALA B 1 57  ? 13.562  23.743  61.567  1.00 49.06  ? 56  ALA F N     1 
ATOM   3121 C  CA    . ALA B 1 57  ? 14.606  23.372  60.611  1.00 51.93  ? 56  ALA F CA    1 
ATOM   3122 C  C     . ALA B 1 57  ? 15.270  24.567  59.923  1.00 51.24  ? 56  ALA F C     1 
ATOM   3123 O  O     . ALA B 1 57  ? 16.050  24.394  58.987  1.00 59.92  ? 56  ALA F O     1 
ATOM   3124 C  CB    . ALA B 1 57  ? 14.073  22.378  59.576  1.00 39.20  ? 56  ALA F CB    1 
ATOM   3125 N  N     . MET B 1 58  ? 14.968  25.774  60.389  1.00 48.78  ? 57  MET F N     1 
ATOM   3126 C  CA    . MET B 1 58  ? 15.592  26.970  59.840  1.00 54.20  ? 57  MET F CA    1 
ATOM   3127 C  C     . MET B 1 58  ? 16.843  27.323  60.633  1.00 56.22  ? 57  MET F C     1 
ATOM   3128 O  O     . MET B 1 58  ? 16.822  27.302  61.864  1.00 52.25  ? 57  MET F O     1 
ATOM   3129 C  CB    . MET B 1 58  ? 14.616  28.150  59.839  1.00 56.33  ? 57  MET F CB    1 
ATOM   3130 C  CG    . MET B 1 58  ? 15.189  29.417  59.216  1.00 59.65  ? 57  MET F CG    1 
ATOM   3131 S  SD    . MET B 1 58  ? 13.948  30.655  58.798  1.00 72.73  ? 57  MET F SD    1 
ATOM   3132 C  CE    . MET B 1 58  ? 13.501  31.246  60.420  1.00 49.00  ? 57  MET F CE    1 
ATOM   3133 N  N     . PRO B 1 59  ? 17.941  27.631  59.925  1.00 55.84  ? 58  PRO F N     1 
ATOM   3134 C  CA    . PRO B 1 59  ? 19.195  28.057  60.553  1.00 55.39  ? 58  PRO F CA    1 
ATOM   3135 C  C     . PRO B 1 59  ? 18.968  29.238  61.488  1.00 57.98  ? 58  PRO F C     1 
ATOM   3136 O  O     . PRO B 1 59  ? 18.232  30.162  61.139  1.00 61.99  ? 58  PRO F O     1 
ATOM   3137 C  CB    . PRO B 1 59  ? 20.048  28.491  59.361  1.00 57.20  ? 58  PRO F CB    1 
ATOM   3138 C  CG    . PRO B 1 59  ? 19.538  27.682  58.228  1.00 59.16  ? 58  PRO F CG    1 
ATOM   3139 C  CD    . PRO B 1 59  ? 18.064  27.533  58.460  1.00 56.13  ? 58  PRO F CD    1 
ATOM   3140 N  N     . THR B 1 60  ? 19.591  29.198  62.662  1.00 57.63  ? 59  THR F N     1 
ATOM   3141 C  CA    . THR B 1 60  ? 19.410  30.234  63.673  1.00 60.61  ? 59  THR F CA    1 
ATOM   3142 C  C     . THR B 1 60  ? 19.808  31.612  63.146  1.00 64.79  ? 59  THR F C     1 
ATOM   3143 O  O     . THR B 1 60  ? 19.269  32.632  63.578  1.00 67.24  ? 59  THR F O     1 
ATOM   3144 C  CB    . THR B 1 60  ? 20.209  29.912  64.953  1.00 59.61  ? 59  THR F CB    1 
ATOM   3145 O  OG1   . THR B 1 60  ? 19.944  28.563  65.357  1.00 54.89  ? 59  THR F OG1   1 
ATOM   3146 C  CG2   . THR B 1 60  ? 19.825  30.856  66.080  1.00 53.17  ? 59  THR F CG2   1 
ATOM   3147 N  N     . GLY B 1 61  ? 20.746  31.632  62.204  1.00 64.46  ? 60  GLY F N     1 
ATOM   3148 C  CA    . GLY B 1 61  ? 21.168  32.870  61.574  1.00 70.56  ? 60  GLY F CA    1 
ATOM   3149 C  C     . GLY B 1 61  ? 20.022  33.571  60.871  1.00 71.54  ? 60  GLY F C     1 
ATOM   3150 O  O     . GLY B 1 61  ? 19.788  34.762  61.083  1.00 74.41  ? 60  GLY F O     1 
ATOM   3151 N  N     . MET B 1 62  ? 19.299  32.830  60.036  1.00 67.08  ? 61  MET F N     1 
ATOM   3152 C  CA    . MET B 1 62  ? 18.150  33.378  59.323  1.00 68.60  ? 61  MET F CA    1 
ATOM   3153 C  C     . MET B 1 62  ? 17.028  33.739  60.294  1.00 67.09  ? 61  MET F C     1 
ATOM   3154 O  O     . MET B 1 62  ? 16.337  34.745  60.115  1.00 71.00  ? 61  MET F O     1 
ATOM   3155 C  CB    . MET B 1 62  ? 17.650  32.385  58.270  1.00 68.05  ? 61  MET F CB    1 
ATOM   3156 C  CG    . MET B 1 62  ? 16.455  32.874  57.467  1.00 72.79  ? 61  MET F CG    1 
ATOM   3157 S  SD    . MET B 1 62  ? 15.983  31.735  56.151  1.00 97.89  ? 61  MET F SD    1 
ATOM   3158 C  CE    . MET B 1 62  ? 14.446  32.472  55.598  1.00 90.50  ? 61  MET F CE    1 
ATOM   3159 N  N     . ALA B 1 63  ? 16.858  32.913  61.323  1.00 60.00  ? 62  ALA F N     1 
ATOM   3160 C  CA    . ALA B 1 63  ? 15.833  33.141  62.336  1.00 62.68  ? 62  ALA F CA    1 
ATOM   3161 C  C     . ALA B 1 63  ? 16.065  34.459  63.068  1.00 63.53  ? 62  ALA F C     1 
ATOM   3162 O  O     . ALA B 1 63  ? 15.118  35.190  63.363  1.00 62.47  ? 62  ALA F O     1 
ATOM   3163 C  CB    . ALA B 1 63  ? 15.791  31.979  63.319  1.00 56.41  ? 62  ALA F CB    1 
ATOM   3164 N  N     . LEU B 1 64  ? 17.329  34.761  63.346  1.00 67.18  ? 63  LEU F N     1 
ATOM   3165 C  CA    . LEU B 1 64  ? 17.696  36.001  64.022  1.00 65.80  ? 63  LEU F CA    1 
ATOM   3166 C  C     . LEU B 1 64  ? 17.790  37.174  63.045  1.00 68.93  ? 63  LEU F C     1 
ATOM   3167 O  O     . LEU B 1 64  ? 17.760  38.339  63.451  1.00 67.78  ? 63  LEU F O     1 
ATOM   3168 C  CB    . LEU B 1 64  ? 19.004  35.824  64.796  1.00 59.73  ? 63  LEU F CB    1 
ATOM   3169 C  CG    . LEU B 1 64  ? 18.855  35.133  66.152  1.00 57.23  ? 63  LEU F CG    1 
ATOM   3170 C  CD1   . LEU B 1 64  ? 20.178  34.608  66.656  1.00 52.80  ? 63  LEU F CD1   1 
ATOM   3171 C  CD2   . LEU B 1 64  ? 18.278  36.097  67.153  1.00 58.15  ? 63  LEU F CD2   1 
ATOM   3172 N  N     . ALA B 1 65  ? 17.896  36.863  61.758  1.00 66.97  ? 64  ALA F N     1 
ATOM   3173 C  CA    . ALA B 1 65  ? 17.838  37.892  60.731  1.00 66.14  ? 64  ALA F CA    1 
ATOM   3174 C  C     . ALA B 1 65  ? 16.396  38.352  60.582  1.00 71.46  ? 64  ALA F C     1 
ATOM   3175 O  O     . ALA B 1 65  ? 16.131  39.507  60.251  1.00 74.99  ? 64  ALA F O     1 
ATOM   3176 C  CB    . ALA B 1 65  ? 18.365  37.360  59.417  1.00 67.88  ? 64  ALA F CB    1 
ATOM   3177 N  N     . LEU B 1 66  ? 15.470  37.431  60.828  1.00 67.01  ? 65  LEU F N     1 
ATOM   3178 C  CA    . LEU B 1 66  ? 14.045  37.726  60.768  1.00 57.47  ? 65  LEU F CA    1 
ATOM   3179 C  C     . LEU B 1 66  ? 13.531  38.246  62.105  1.00 57.69  ? 65  LEU F C     1 
ATOM   3180 O  O     . LEU B 1 66  ? 12.611  39.062  62.151  1.00 63.06  ? 65  LEU F O     1 
ATOM   3181 C  CB    . LEU B 1 66  ? 13.264  36.474  60.361  1.00 60.79  ? 65  LEU F CB    1 
ATOM   3182 C  CG    . LEU B 1 66  ? 12.934  36.262  58.882  1.00 62.73  ? 65  LEU F CG    1 
ATOM   3183 C  CD1   . LEU B 1 66  ? 13.997  36.857  57.970  1.00 67.26  ? 65  LEU F CD1   1 
ATOM   3184 C  CD2   . LEU B 1 66  ? 12.768  34.777  58.602  1.00 64.79  ? 65  LEU F CD2   1 
ATOM   3185 N  N     . CYS B 1 67  ? 14.130  37.774  63.194  1.00 61.53  ? 66  CYS F N     1 
ATOM   3186 C  CA    . CYS B 1 67  ? 13.680  38.151  64.529  1.00 61.10  ? 66  CYS F CA    1 
ATOM   3187 C  C     . CYS B 1 67  ? 14.852  38.446  65.463  1.00 64.21  ? 66  CYS F C     1 
ATOM   3188 O  O     . CYS B 1 67  ? 15.242  37.589  66.257  1.00 66.01  ? 66  CYS F O     1 
ATOM   3189 C  CB    . CYS B 1 67  ? 12.802  37.042  65.110  1.00 52.16  ? 66  CYS F CB    1 
ATOM   3190 S  SG    . CYS B 1 67  ? 12.024  37.432  66.687  1.00 55.03  ? 66  CYS F SG    1 
ATOM   3191 N  N     . PRO B 1 68  ? 15.420  39.662  65.365  1.00 64.03  ? 67  PRO F N     1 
ATOM   3192 C  CA    . PRO B 1 68  ? 16.568  40.089  66.176  1.00 63.82  ? 67  PRO F CA    1 
ATOM   3193 C  C     . PRO B 1 68  ? 16.364  39.958  67.685  1.00 60.80  ? 67  PRO F C     1 
ATOM   3194 O  O     . PRO B 1 68  ? 17.343  39.858  68.424  1.00 61.83  ? 67  PRO F O     1 
ATOM   3195 C  CB    . PRO B 1 68  ? 16.719  41.564  65.800  1.00 68.11  ? 67  PRO F CB    1 
ATOM   3196 C  CG    . PRO B 1 68  ? 16.238  41.628  64.398  1.00 63.24  ? 67  PRO F CG    1 
ATOM   3197 C  CD    . PRO B 1 68  ? 15.084  40.664  64.335  1.00 62.98  ? 67  PRO F CD    1 
ATOM   3198 N  N     . HIS B 1 69  ? 15.113  39.963  68.132  1.00 58.28  ? 68  HIS F N     1 
ATOM   3199 C  CA    . HIS B 1 69  ? 14.810  39.869  69.557  1.00 58.47  ? 68  HIS F CA    1 
ATOM   3200 C  C     . HIS B 1 69  ? 14.463  38.441  69.974  1.00 59.93  ? 68  HIS F C     1 
ATOM   3201 O  O     . HIS B 1 69  ? 13.871  38.224  71.029  1.00 57.11  ? 68  HIS F O     1 
ATOM   3202 C  CB    . HIS B 1 69  ? 13.661  40.811  69.925  1.00 56.26  ? 68  HIS F CB    1 
ATOM   3203 C  CG    . HIS B 1 69  ? 13.979  42.262  69.738  1.00 71.81  ? 68  HIS F CG    1 
ATOM   3204 N  ND1   . HIS B 1 69  ? 15.185  42.707  69.238  1.00 76.71  ? 68  HIS F ND1   1 
ATOM   3205 C  CD2   . HIS B 1 69  ? 13.244  43.373  69.985  1.00 69.71  ? 68  HIS F CD2   1 
ATOM   3206 C  CE1   . HIS B 1 69  ? 15.180  44.026  69.187  1.00 74.54  ? 68  HIS F CE1   1 
ATOM   3207 N  NE2   . HIS B 1 69  ? 14.013  44.456  69.634  1.00 75.66  ? 68  HIS F NE2   1 
ATOM   3208 N  N     . LEU B 1 70  ? 14.832  37.471  69.146  1.00 59.01  ? 69  LEU F N     1 
ATOM   3209 C  CA    . LEU B 1 70  ? 14.528  36.071  69.426  1.00 57.70  ? 69  LEU F CA    1 
ATOM   3210 C  C     . LEU B 1 70  ? 15.238  35.572  70.686  1.00 55.67  ? 69  LEU F C     1 
ATOM   3211 O  O     . LEU B 1 70  ? 16.468  35.557  70.751  1.00 63.65  ? 69  LEU F O     1 
ATOM   3212 C  CB    . LEU B 1 70  ? 14.899  35.200  68.222  1.00 55.54  ? 69  LEU F CB    1 
ATOM   3213 C  CG    . LEU B 1 70  ? 14.562  33.712  68.308  1.00 55.91  ? 69  LEU F CG    1 
ATOM   3214 C  CD1   . LEU B 1 70  ? 13.065  33.520  68.477  1.00 53.42  ? 69  LEU F CD1   1 
ATOM   3215 C  CD2   . LEU B 1 70  ? 15.071  32.961  67.082  1.00 51.04  ? 69  LEU F CD2   1 
ATOM   3216 N  N     . THR B 1 71  ? 14.456  35.179  71.689  1.00 54.28  ? 70  THR F N     1 
ATOM   3217 C  CA    . THR B 1 71  ? 15.007  34.590  72.906  1.00 57.34  ? 70  THR F CA    1 
ATOM   3218 C  C     . THR B 1 71  ? 15.272  33.106  72.665  1.00 57.13  ? 70  THR F C     1 
ATOM   3219 O  O     . THR B 1 71  ? 14.335  32.302  72.607  1.00 60.79  ? 70  THR F O     1 
ATOM   3220 C  CB    . THR B 1 71  ? 14.054  34.768  74.109  1.00 63.14  ? 70  THR F CB    1 
ATOM   3221 O  OG1   . THR B 1 71  ? 13.777  36.163  74.298  1.00 65.74  ? 70  THR F OG1   1 
ATOM   3222 C  CG2   . THR B 1 71  ? 14.683  34.200  75.374  1.00 57.10  ? 70  THR F CG2   1 
ATOM   3223 N  N     . LEU B 1 72  ? 16.547  32.750  72.519  1.00 54.06  ? 71  LEU F N     1 
ATOM   3224 C  CA    . LEU B 1 72  ? 16.923  31.392  72.138  1.00 51.02  ? 71  LEU F CA    1 
ATOM   3225 C  C     . LEU B 1 72  ? 17.114  30.482  73.349  1.00 53.73  ? 71  LEU F C     1 
ATOM   3226 O  O     . LEU B 1 72  ? 17.958  30.742  74.208  1.00 60.93  ? 71  LEU F O     1 
ATOM   3227 C  CB    . LEU B 1 72  ? 18.192  31.410  71.286  1.00 44.26  ? 71  LEU F CB    1 
ATOM   3228 C  CG    . LEU B 1 72  ? 18.466  30.162  70.450  1.00 55.90  ? 71  LEU F CG    1 
ATOM   3229 C  CD1   . LEU B 1 72  ? 17.306  29.887  69.502  1.00 57.81  ? 71  LEU F CD1   1 
ATOM   3230 C  CD2   . LEU B 1 72  ? 19.757  30.328  69.677  1.00 55.99  ? 71  LEU F CD2   1 
ATOM   3231 N  N     . LEU B 1 73  ? 16.328  29.412  73.403  1.00 53.67  ? 72  LEU F N     1 
ATOM   3232 C  CA    . LEU B 1 73  ? 16.390  28.454  74.503  1.00 50.40  ? 72  LEU F CA    1 
ATOM   3233 C  C     . LEU B 1 73  ? 17.096  27.177  74.056  1.00 56.23  ? 72  LEU F C     1 
ATOM   3234 O  O     . LEU B 1 73  ? 16.956  26.759  72.907  1.00 55.39  ? 72  LEU F O     1 
ATOM   3235 C  CB    . LEU B 1 73  ? 14.981  28.143  75.021  1.00 55.48  ? 72  LEU F CB    1 
ATOM   3236 C  CG    . LEU B 1 73  ? 14.445  28.996  76.177  1.00 60.82  ? 72  LEU F CG    1 
ATOM   3237 C  CD1   . LEU B 1 73  ? 14.708  30.480  75.966  1.00 55.16  ? 72  LEU F CD1   1 
ATOM   3238 C  CD2   . LEU B 1 73  ? 12.961  28.751  76.364  1.00 54.46  ? 72  LEU F CD2   1 
ATOM   3239 N  N     . PRO B 1 74  ? 17.867  26.557  74.964  1.00 59.54  ? 73  PRO F N     1 
ATOM   3240 C  CA    . PRO B 1 74  ? 18.666  25.374  74.626  1.00 53.21  ? 73  PRO F CA    1 
ATOM   3241 C  C     . PRO B 1 74  ? 17.833  24.097  74.535  1.00 48.43  ? 73  PRO F C     1 
ATOM   3242 O  O     . PRO B 1 74  ? 18.143  23.221  73.729  1.00 52.33  ? 73  PRO F O     1 
ATOM   3243 C  CB    . PRO B 1 74  ? 19.646  25.278  75.795  1.00 48.45  ? 73  PRO F CB    1 
ATOM   3244 C  CG    . PRO B 1 74  ? 18.902  25.868  76.943  1.00 48.17  ? 73  PRO F CG    1 
ATOM   3245 C  CD    . PRO B 1 74  ? 18.060  26.973  76.365  1.00 52.84  ? 73  PRO F CD    1 
ATOM   3246 N  N     . GLY B 1 75  ? 16.793  23.996  75.355  1.00 44.92  ? 74  GLY F N     1 
ATOM   3247 C  CA    . GLY B 1 75  ? 15.951  22.817  75.365  1.00 51.76  ? 74  GLY F CA    1 
ATOM   3248 C  C     . GLY B 1 75  ? 16.150  21.971  76.607  1.00 58.11  ? 74  GLY F C     1 
ATOM   3249 O  O     . GLY B 1 75  ? 17.279  21.734  77.039  1.00 61.18  ? 74  GLY F O     1 
ATOM   3250 N  N     . ARG B 1 76  ? 15.043  21.521  77.185  1.00 55.09  ? 75  ARG F N     1 
ATOM   3251 C  CA    . ARG B 1 76  ? 15.077  20.651  78.352  1.00 54.72  ? 75  ARG F CA    1 
ATOM   3252 C  C     . ARG B 1 76  ? 14.315  19.365  78.048  1.00 55.35  ? 75  ARG F C     1 
ATOM   3253 O  O     . ARG B 1 76  ? 13.135  19.246  78.379  1.00 58.82  ? 75  ARG F O     1 
ATOM   3254 C  CB    . ARG B 1 76  ? 14.466  21.362  79.560  1.00 56.25  ? 75  ARG F CB    1 
ATOM   3255 C  CG    . ARG B 1 76  ? 15.128  22.690  79.890  1.00 54.10  ? 75  ARG F CG    1 
ATOM   3256 C  CD    . ARG B 1 76  ? 14.415  23.408  81.023  1.00 59.78  ? 75  ARG F CD    1 
ATOM   3257 N  NE    . ARG B 1 76  ? 13.021  23.697  80.697  1.00 65.19  ? 75  ARG F NE    1 
ATOM   3258 C  CZ    . ARG B 1 76  ? 11.983  23.243  81.390  1.00 62.65  ? 75  ARG F CZ    1 
ATOM   3259 N  NH1   . ARG B 1 76  ? 12.176  22.482  82.458  1.00 59.83  ? 75  ARG F NH1   1 
ATOM   3260 N  NH2   . ARG B 1 76  ? 10.749  23.556  81.018  1.00 63.71  ? 75  ARG F NH2   1 
ATOM   3261 N  N     . PHE B 1 77  ? 15.001  18.411  77.418  1.00 51.60  ? 76  PHE F N     1 
ATOM   3262 C  CA    . PHE B 1 77  ? 14.376  17.186  76.913  1.00 57.90  ? 76  PHE F CA    1 
ATOM   3263 C  C     . PHE B 1 77  ? 13.513  16.438  77.926  1.00 62.81  ? 76  PHE F C     1 
ATOM   3264 O  O     . PHE B 1 77  ? 12.396  16.038  77.612  1.00 67.48  ? 76  PHE F O     1 
ATOM   3265 C  CB    . PHE B 1 77  ? 15.425  16.229  76.343  1.00 61.65  ? 76  PHE F CB    1 
ATOM   3266 C  CG    . PHE B 1 77  ? 14.933  14.818  76.202  1.00 63.28  ? 76  PHE F CG    1 
ATOM   3267 C  CD1   . PHE B 1 77  ? 14.084  14.469  75.168  1.00 71.38  ? 76  PHE F CD1   1 
ATOM   3268 C  CD2   . PHE B 1 77  ? 15.301  13.845  77.116  1.00 70.32  ? 76  PHE F CD2   1 
ATOM   3269 C  CE1   . PHE B 1 77  ? 13.621  13.172  75.038  1.00 72.36  ? 76  PHE F CE1   1 
ATOM   3270 C  CE2   . PHE B 1 77  ? 14.841  12.548  76.993  1.00 74.99  ? 76  PHE F CE2   1 
ATOM   3271 C  CZ    . PHE B 1 77  ? 14.001  12.212  75.952  1.00 76.43  ? 76  PHE F CZ    1 
ATOM   3272 N  N     . ASP B 1 78  ? 14.035  16.246  79.134  1.00 59.98  ? 77  ASP F N     1 
ATOM   3273 C  CA    . ASP B 1 78  ? 13.345  15.444  80.146  1.00 63.84  ? 77  ASP F CA    1 
ATOM   3274 C  C     . ASP B 1 78  ? 11.956  15.981  80.503  1.00 62.54  ? 77  ASP F C     1 
ATOM   3275 O  O     . ASP B 1 78  ? 11.057  15.216  80.855  1.00 69.45  ? 77  ASP F O     1 
ATOM   3276 C  CB    . ASP B 1 78  ? 14.206  15.297  81.406  1.00 70.58  ? 77  ASP F CB    1 
ATOM   3277 C  CG    . ASP B 1 78  ? 15.313  14.277  81.241  1.00 74.80  ? 77  ASP F CG    1 
ATOM   3278 O  OD1   . ASP B 1 78  ? 15.300  13.545  80.232  1.00 71.22  ? 77  ASP F OD1   1 
ATOM   3279 O  OD2   . ASP B 1 78  ? 16.188  14.200  82.129  1.00 78.56  ? 77  ASP F OD2   1 
ATOM   3280 N  N     . ALA B 1 79  ? 11.781  17.295  80.405  1.00 56.61  ? 78  ALA F N     1 
ATOM   3281 C  CA    . ALA B 1 79  ? 10.472  17.897  80.631  1.00 63.81  ? 78  ALA F CA    1 
ATOM   3282 C  C     . ALA B 1 79  ? 9.518   17.516  79.504  1.00 56.89  ? 78  ALA F C     1 
ATOM   3283 O  O     . ALA B 1 79  ? 8.343   17.218  79.738  1.00 60.89  ? 78  ALA F O     1 
ATOM   3284 C  CB    . ALA B 1 79  ? 10.590  19.410  80.742  1.00 60.46  ? 78  ALA F CB    1 
ATOM   3285 N  N     . TYR B 1 80  ? 10.038  17.519  78.281  1.00 52.31  ? 79  TYR F N     1 
ATOM   3286 C  CA    . TYR B 1 80  ? 9.253   17.178  77.101  1.00 52.97  ? 79  TYR F CA    1 
ATOM   3287 C  C     . TYR B 1 80  ? 8.872   15.700  77.133  1.00 61.38  ? 79  TYR F C     1 
ATOM   3288 O  O     . TYR B 1 80  ? 7.798   15.313  76.671  1.00 63.49  ? 79  TYR F O     1 
ATOM   3289 C  CB    . TYR B 1 80  ? 10.043  17.489  75.825  1.00 48.75  ? 79  TYR F CB    1 
ATOM   3290 C  CG    . TYR B 1 80  ? 10.697  18.858  75.802  1.00 51.99  ? 79  TYR F CG    1 
ATOM   3291 C  CD1   . TYR B 1 80  ? 11.901  19.059  75.140  1.00 48.34  ? 79  TYR F CD1   1 
ATOM   3292 C  CD2   . TYR B 1 80  ? 10.107  19.949  76.432  1.00 53.60  ? 79  TYR F CD2   1 
ATOM   3293 C  CE1   . TYR B 1 80  ? 12.505  20.302  75.112  1.00 51.90  ? 79  TYR F CE1   1 
ATOM   3294 C  CE2   . TYR B 1 80  ? 10.705  21.195  76.411  1.00 55.05  ? 79  TYR F CE2   1 
ATOM   3295 C  CZ    . TYR B 1 80  ? 11.902  21.366  75.749  1.00 56.11  ? 79  TYR F CZ    1 
ATOM   3296 O  OH    . TYR B 1 80  ? 12.500  22.605  75.724  1.00 57.04  ? 79  TYR F OH    1 
ATOM   3297 N  N     . LYS B 1 81  ? 9.764   14.881  77.684  1.00 60.69  ? 80  LYS F N     1 
ATOM   3298 C  CA    . LYS B 1 81  ? 9.537   13.446  77.805  1.00 58.56  ? 80  LYS F CA    1 
ATOM   3299 C  C     . LYS B 1 81  ? 8.522   13.166  78.904  1.00 61.64  ? 80  LYS F C     1 
ATOM   3300 O  O     . LYS B 1 81  ? 7.696   12.263  78.783  1.00 60.29  ? 80  LYS F O     1 
ATOM   3301 C  CB    . LYS B 1 81  ? 10.850  12.722  78.108  1.00 64.75  ? 80  LYS F CB    1 
ATOM   3302 C  CG    . LYS B 1 81  ? 10.723  11.209  78.192  1.00 59.03  ? 80  LYS F CG    1 
ATOM   3303 C  CD    . LYS B 1 81  ? 10.168  10.637  76.899  1.00 57.25  ? 80  LYS F CD    1 
ATOM   3304 C  CE    . LYS B 1 81  ? 10.234  9.119   76.890  1.00 61.42  ? 80  LYS F CE    1 
ATOM   3305 N  NZ    . LYS B 1 81  ? 9.737   8.557   75.603  1.00 57.95  ? 80  LYS F NZ    1 
ATOM   3306 N  N     . GLU B 1 82  ? 8.600   13.944  79.980  1.00 56.96  ? 81  GLU F N     1 
ATOM   3307 C  CA    . GLU B 1 82  ? 7.625   13.870  81.060  1.00 59.39  ? 81  GLU F CA    1 
ATOM   3308 C  C     . GLU B 1 82  ? 6.234   14.176  80.516  1.00 63.73  ? 81  GLU F C     1 
ATOM   3309 O  O     . GLU B 1 82  ? 5.278   13.420  80.738  1.00 67.14  ? 81  GLU F O     1 
ATOM   3310 C  CB    . GLU B 1 82  ? 7.992   14.863  82.165  1.00 55.16  ? 81  GLU F CB    1 
ATOM   3311 C  CG    . GLU B 1 82  ? 6.866   15.179  83.135  1.00 69.95  ? 81  GLU F CG    1 
ATOM   3312 C  CD    . GLU B 1 82  ? 6.507   14.007  84.027  1.00 86.45  ? 81  GLU F CD    1 
ATOM   3313 O  OE1   . GLU B 1 82  ? 7.362   13.116  84.218  1.00 91.53  ? 81  GLU F OE1   1 
ATOM   3314 O  OE2   . GLU B 1 82  ? 5.367   13.979  84.538  1.00 86.79  ? 81  GLU F OE2   1 
ATOM   3315 N  N     . ALA B 1 83  ? 6.139   15.286  79.789  1.00 58.76  ? 82  ALA F N     1 
ATOM   3316 C  CA    . ALA B 1 83  ? 4.891   15.687  79.153  1.00 56.88  ? 82  ALA F CA    1 
ATOM   3317 C  C     . ALA B 1 83  ? 4.377   14.598  78.216  1.00 53.96  ? 82  ALA F C     1 
ATOM   3318 O  O     . ALA B 1 83  ? 3.199   14.241  78.253  1.00 57.77  ? 82  ALA F O     1 
ATOM   3319 C  CB    . ALA B 1 83  ? 5.081   16.993  78.396  1.00 54.61  ? 82  ALA F CB    1 
ATOM   3320 N  N     . SER B 1 84  ? 5.273   14.066  77.390  1.00 51.92  ? 83  SER F N     1 
ATOM   3321 C  CA    . SER B 1 84  ? 4.925   13.023  76.428  1.00 56.87  ? 83  SER F CA    1 
ATOM   3322 C  C     . SER B 1 84  ? 4.351   11.780  77.105  1.00 59.79  ? 83  SER F C     1 
ATOM   3323 O  O     . SER B 1 84  ? 3.300   11.271  76.706  1.00 55.72  ? 83  SER F O     1 
ATOM   3324 C  CB    . SER B 1 84  ? 6.148   12.639  75.597  1.00 53.87  ? 83  SER F CB    1 
ATOM   3325 O  OG    . SER B 1 84  ? 5.810   11.675  74.616  1.00 57.16  ? 83  SER F OG    1 
ATOM   3326 N  N     . ASN B 1 85  ? 5.051   11.293  78.124  1.00 61.82  ? 84  ASN F N     1 
ATOM   3327 C  CA    . ASN B 1 85  ? 4.590   10.137  78.881  1.00 60.23  ? 84  ASN F CA    1 
ATOM   3328 C  C     . ASN B 1 85  ? 3.238   10.404  79.525  1.00 56.81  ? 84  ASN F C     1 
ATOM   3329 O  O     . ASN B 1 85  ? 2.380   9.520   79.585  1.00 63.89  ? 84  ASN F O     1 
ATOM   3330 C  CB    . ASN B 1 85  ? 5.615   9.742   79.946  1.00 58.13  ? 84  ASN F CB    1 
ATOM   3331 C  CG    . ASN B 1 85  ? 6.902   9.215   79.346  1.00 51.35  ? 84  ASN F CG    1 
ATOM   3332 O  OD1   . ASN B 1 85  ? 6.910   8.679   78.238  1.00 57.78  ? 84  ASN F OD1   1 
ATOM   3333 N  ND2   . ASN B 1 85  ? 8.000   9.363   80.078  1.00 54.72  ? 84  ASN F ND2   1 
ATOM   3334 N  N     . HIS B 1 86  ? 3.050   11.634  79.997  1.00 56.41  ? 85  HIS F N     1 
ATOM   3335 C  CA    . HIS B 1 86  ? 1.778   12.025  80.591  1.00 55.35  ? 85  HIS F CA    1 
ATOM   3336 C  C     . HIS B 1 86  ? 0.640   11.945  79.569  1.00 61.59  ? 85  HIS F C     1 
ATOM   3337 O  O     . HIS B 1 86  ? -0.404  11.347  79.842  1.00 63.19  ? 85  HIS F O     1 
ATOM   3338 C  CB    . HIS B 1 86  ? 1.874   13.431  81.186  1.00 59.44  ? 85  HIS F CB    1 
ATOM   3339 C  CG    . HIS B 1 86  ? 0.799   13.744  82.179  1.00 60.17  ? 85  HIS F CG    1 
ATOM   3340 N  ND1   . HIS B 1 86  ? 1.012   14.553  83.275  1.00 64.09  ? 85  HIS F ND1   1 
ATOM   3341 C  CD2   . HIS B 1 86  ? -0.499  13.361  82.242  1.00 58.22  ? 85  HIS F CD2   1 
ATOM   3342 C  CE1   . HIS B 1 86  ? -0.106  14.653  83.971  1.00 64.50  ? 85  HIS F CE1   1 
ATOM   3343 N  NE2   . HIS B 1 86  ? -1.039  13.939  83.366  1.00 64.77  ? 85  HIS F NE2   1 
ATOM   3344 N  N     . ILE B 1 87  ? 0.844   12.532  78.392  1.00 59.44  ? 86  ILE F N     1 
ATOM   3345 C  CA    . ILE B 1 87  ? -0.204  12.538  77.371  1.00 57.53  ? 86  ILE F CA    1 
ATOM   3346 C  C     . ILE B 1 87  ? -0.474  11.146  76.799  1.00 55.97  ? 86  ILE F C     1 
ATOM   3347 O  O     . ILE B 1 87  ? -1.598  10.846  76.397  1.00 57.16  ? 86  ILE F O     1 
ATOM   3348 C  CB    . ILE B 1 87  ? 0.072   13.548  76.222  1.00 55.28  ? 86  ILE F CB    1 
ATOM   3349 C  CG1   . ILE B 1 87  ? 1.134   13.018  75.256  1.00 56.89  ? 86  ILE F CG1   1 
ATOM   3350 C  CG2   . ILE B 1 87  ? 0.458   14.910  76.780  1.00 54.08  ? 86  ILE F CG2   1 
ATOM   3351 C  CD1   . ILE B 1 87  ? 1.325   13.877  74.025  1.00 58.03  ? 86  ILE F CD1   1 
ATOM   3352 N  N     . ARG B 1 88  ? 0.549   10.296  76.766  1.00 59.38  ? 87  ARG F N     1 
ATOM   3353 C  CA    . ARG B 1 88  ? 0.361   8.921   76.313  1.00 58.33  ? 87  ARG F CA    1 
ATOM   3354 C  C     . ARG B 1 88  ? -0.415  8.134   77.360  1.00 59.08  ? 87  ARG F C     1 
ATOM   3355 O  O     . ARG B 1 88  ? -1.235  7.273   77.029  1.00 62.76  ? 87  ARG F O     1 
ATOM   3356 C  CB    . ARG B 1 88  ? 1.703   8.250   76.019  1.00 52.84  ? 87  ARG F CB    1 
ATOM   3357 C  CG    . ARG B 1 88  ? 2.396   8.776   74.775  1.00 54.03  ? 87  ARG F CG    1 
ATOM   3358 C  CD    . ARG B 1 88  ? 3.741   8.102   74.574  1.00 52.59  ? 87  ARG F CD    1 
ATOM   3359 N  NE    . ARG B 1 88  ? 4.443   8.613   73.400  1.00 53.55  ? 87  ARG F NE    1 
ATOM   3360 C  CZ    . ARG B 1 88  ? 5.684   8.273   73.067  1.00 57.25  ? 87  ARG F CZ    1 
ATOM   3361 N  NH1   . ARG B 1 88  ? 6.364   7.422   73.823  1.00 62.51  ? 87  ARG F NH1   1 
ATOM   3362 N  NH2   . ARG B 1 88  ? 6.246   8.786   71.982  1.00 50.85  ? 87  ARG F NH2   1 
ATOM   3363 N  N     . GLU B 1 89  ? -0.153  8.439   78.628  1.00 53.35  ? 88  GLU F N     1 
ATOM   3364 C  CA    . GLU B 1 89  ? -0.921  7.861   79.722  1.00 57.74  ? 88  GLU F CA    1 
ATOM   3365 C  C     . GLU B 1 89  ? -2.375  8.307   79.611  1.00 61.56  ? 88  GLU F C     1 
ATOM   3366 O  O     . GLU B 1 89  ? -3.292  7.560   79.953  1.00 60.86  ? 88  GLU F O     1 
ATOM   3367 C  CB    . GLU B 1 89  ? -0.328  8.267   81.075  1.00 59.51  ? 88  GLU F CB    1 
ATOM   3368 C  CG    . GLU B 1 89  ? -1.049  7.686   82.286  1.00 60.95  ? 88  GLU F CG    1 
ATOM   3369 C  CD    . GLU B 1 89  ? -2.202  8.554   82.757  1.00 62.54  ? 88  GLU F CD    1 
ATOM   3370 O  OE1   . GLU B 1 89  ? -2.011  9.782   82.880  1.00 64.46  ? 88  GLU F OE1   1 
ATOM   3371 O  OE2   . GLU B 1 89  ? -3.302  8.009   82.994  1.00 60.01  ? 88  GLU F OE2   1 
ATOM   3372 N  N     . ILE B 1 90  ? -2.579  9.530   79.128  1.00 58.61  ? 89  ILE F N     1 
ATOM   3373 C  CA    . ILE B 1 90  ? -3.927  10.039  78.897  1.00 54.64  ? 89  ILE F CA    1 
ATOM   3374 C  C     . ILE B 1 90  ? -4.605  9.297   77.745  1.00 55.66  ? 89  ILE F C     1 
ATOM   3375 O  O     . ILE B 1 90  ? -5.786  8.957   77.826  1.00 61.28  ? 89  ILE F O     1 
ATOM   3376 C  CB    . ILE B 1 90  ? -3.923  11.557  78.626  1.00 53.73  ? 89  ILE F CB    1 
ATOM   3377 C  CG1   . ILE B 1 90  ? -3.485  12.314  79.881  1.00 59.69  ? 89  ILE F CG1   1 
ATOM   3378 C  CG2   . ILE B 1 90  ? -5.300  12.033  78.187  1.00 49.42  ? 89  ILE F CG2   1 
ATOM   3379 C  CD1   . ILE B 1 90  ? -3.578  13.815  79.750  1.00 55.89  ? 89  ILE F CD1   1 
ATOM   3380 N  N     . PHE B 1 91  ? -3.851  9.037   76.680  1.00 58.63  ? 90  PHE F N     1 
ATOM   3381 C  CA    . PHE B 1 91  ? -4.370  8.285   75.541  1.00 57.10  ? 90  PHE F CA    1 
ATOM   3382 C  C     . PHE B 1 91  ? -4.756  6.874   75.968  1.00 58.18  ? 90  PHE F C     1 
ATOM   3383 O  O     . PHE B 1 91  ? -5.718  6.301   75.456  1.00 57.35  ? 90  PHE F O     1 
ATOM   3384 C  CB    . PHE B 1 91  ? -3.331  8.195   74.420  1.00 56.59  ? 90  PHE F CB    1 
ATOM   3385 C  CG    . PHE B 1 91  ? -2.898  9.524   73.872  1.00 59.68  ? 90  PHE F CG    1 
ATOM   3386 C  CD1   . PHE B 1 91  ? -1.694  9.641   73.199  1.00 58.52  ? 90  PHE F CD1   1 
ATOM   3387 C  CD2   . PHE B 1 91  ? -3.688  10.651  74.018  1.00 60.94  ? 90  PHE F CD2   1 
ATOM   3388 C  CE1   . PHE B 1 91  ? -1.283  10.855  72.690  1.00 56.21  ? 90  PHE F CE1   1 
ATOM   3389 C  CE2   . PHE B 1 91  ? -3.279  11.869  73.510  1.00 55.70  ? 90  PHE F CE2   1 
ATOM   3390 C  CZ    . PHE B 1 91  ? -2.076  11.970  72.844  1.00 57.05  ? 90  PHE F CZ    1 
ATOM   3391 N  N     . SER B 1 92  ? -3.993  6.321   76.908  1.00 58.50  ? 91  SER F N     1 
ATOM   3392 C  CA    . SER B 1 92  ? -4.211  4.957   77.380  1.00 58.74  ? 91  SER F CA    1 
ATOM   3393 C  C     . SER B 1 92  ? -5.589  4.780   78.011  1.00 61.25  ? 91  SER F C     1 
ATOM   3394 O  O     . SER B 1 92  ? -6.161  3.691   77.976  1.00 63.43  ? 91  SER F O     1 
ATOM   3395 C  CB    . SER B 1 92  ? -3.129  4.561   78.386  1.00 55.15  ? 91  SER F CB    1 
ATOM   3396 O  OG    . SER B 1 92  ? -3.259  5.299   79.588  1.00 61.61  ? 91  SER F OG    1 
ATOM   3397 N  N     . ARG B 1 93  ? -6.114  5.856   78.587  1.00 59.08  ? 92  ARG F N     1 
ATOM   3398 C  CA    . ARG B 1 93  ? -7.410  5.813   79.253  1.00 54.39  ? 92  ARG F CA    1 
ATOM   3399 C  C     . ARG B 1 93  ? -8.538  5.529   78.268  1.00 55.13  ? 92  ARG F C     1 
ATOM   3400 O  O     . ARG B 1 93  ? -9.558  4.952   78.634  1.00 58.31  ? 92  ARG F O     1 
ATOM   3401 C  CB    . ARG B 1 93  ? -7.683  7.133   79.975  1.00 52.13  ? 92  ARG F CB    1 
ATOM   3402 C  CG    . ARG B 1 93  ? -6.551  7.602   80.871  1.00 52.43  ? 92  ARG F CG    1 
ATOM   3403 C  CD    . ARG B 1 93  ? -6.882  8.942   81.505  1.00 49.00  ? 92  ARG F CD    1 
ATOM   3404 N  NE    . ARG B 1 93  ? -5.738  9.517   82.205  1.00 55.77  ? 92  ARG F NE    1 
ATOM   3405 C  CZ    . ARG B 1 93  ? -5.760  10.686  82.835  1.00 56.87  ? 92  ARG F CZ    1 
ATOM   3406 N  NH1   . ARG B 1 93  ? -6.872  11.409  82.855  1.00 56.97  ? 92  ARG F NH1   1 
ATOM   3407 N  NH2   . ARG B 1 93  ? -4.672  11.134  83.446  1.00 52.18  ? 92  ARG F NH2   1 
ATOM   3408 N  N     . TYR B 1 94  ? -8.343  5.931   77.016  1.00 57.29  ? 93  TYR F N     1 
ATOM   3409 C  CA    . TYR B 1 94  ? -9.392  5.841   76.004  1.00 57.03  ? 93  TYR F CA    1 
ATOM   3410 C  C     . TYR B 1 94  ? -9.237  4.638   75.082  1.00 60.73  ? 93  TYR F C     1 
ATOM   3411 O  O     . TYR B 1 94  ? -10.226 4.073   74.617  1.00 62.28  ? 93  TYR F O     1 
ATOM   3412 C  CB    . TYR B 1 94  ? -9.449  7.133   75.187  1.00 60.47  ? 93  TYR F CB    1 
ATOM   3413 C  CG    . TYR B 1 94  ? -9.982  8.305   75.973  1.00 61.13  ? 93  TYR F CG    1 
ATOM   3414 C  CD1   . TYR B 1 94  ? -11.310 8.690   75.864  1.00 57.70  ? 93  TYR F CD1   1 
ATOM   3415 C  CD2   . TYR B 1 94  ? -9.161  9.016   76.839  1.00 57.88  ? 93  TYR F CD2   1 
ATOM   3416 C  CE1   . TYR B 1 94  ? -11.804 9.755   76.586  1.00 61.72  ? 93  TYR F CE1   1 
ATOM   3417 C  CE2   . TYR B 1 94  ? -9.647  10.081  77.566  1.00 60.39  ? 93  TYR F CE2   1 
ATOM   3418 C  CZ    . TYR B 1 94  ? -10.969 10.447  77.436  1.00 58.67  ? 93  TYR F CZ    1 
ATOM   3419 O  OH    . TYR B 1 94  ? -11.455 11.508  78.160  1.00 59.99  ? 93  TYR F OH    1 
ATOM   3420 N  N     . THR B 1 95  ? -7.994  4.251   74.817  1.00 60.27  ? 94  THR F N     1 
ATOM   3421 C  CA    . THR B 1 95  ? -7.721  3.106   73.959  1.00 55.53  ? 94  THR F CA    1 
ATOM   3422 C  C     . THR B 1 95  ? -6.324  2.552   74.208  1.00 63.44  ? 94  THR F C     1 
ATOM   3423 O  O     . THR B 1 95  ? -5.459  3.241   74.750  1.00 65.30  ? 94  THR F O     1 
ATOM   3424 C  CB    . THR B 1 95  ? -7.852  3.473   72.468  1.00 58.23  ? 94  THR F CB    1 
ATOM   3425 O  OG1   . THR B 1 95  ? -7.596  2.315   71.663  1.00 60.40  ? 94  THR F OG1   1 
ATOM   3426 C  CG2   . THR B 1 95  ? -6.864  4.569   72.098  1.00 60.32  ? 94  THR F CG2   1 
ATOM   3427 N  N     . SER B 1 96  ? -6.114  1.300   73.818  1.00 59.69  ? 95  SER F N     1 
ATOM   3428 C  CA    . SER B 1 96  ? -4.795  0.688   73.888  1.00 54.84  ? 95  SER F CA    1 
ATOM   3429 C  C     . SER B 1 96  ? -4.169  0.702   72.501  1.00 56.45  ? 95  SER F C     1 
ATOM   3430 O  O     . SER B 1 96  ? -3.035  0.264   72.311  1.00 64.40  ? 95  SER F O     1 
ATOM   3431 C  CB    . SER B 1 96  ? -4.890  -0.746  74.411  1.00 61.72  ? 95  SER F CB    1 
ATOM   3432 O  OG    . SER B 1 96  ? -5.629  -1.566  73.522  1.00 58.01  ? 95  SER F OG    1 
ATOM   3433 N  N     . ARG B 1 97  ? -4.926  1.212   71.534  1.00 54.98  ? 96  ARG F N     1 
ATOM   3434 C  CA    . ARG B 1 97  ? -4.470  1.299   70.153  1.00 57.90  ? 96  ARG F CA    1 
ATOM   3435 C  C     . ARG B 1 97  ? -3.813  2.652   69.910  1.00 61.51  ? 96  ARG F C     1 
ATOM   3436 O  O     . ARG B 1 97  ? -4.407  3.545   69.303  1.00 55.97  ? 96  ARG F O     1 
ATOM   3437 C  CB    . ARG B 1 97  ? -5.649  1.103   69.200  1.00 60.15  ? 96  ARG F CB    1 
ATOM   3438 C  CG    . ARG B 1 97  ? -6.490  -0.124  69.518  1.00 58.84  ? 96  ARG F CG    1 
ATOM   3439 C  CD    . ARG B 1 97  ? -6.194  -1.281  68.577  1.00 55.90  ? 96  ARG F CD    1 
ATOM   3440 N  NE    . ARG B 1 97  ? -7.171  -1.359  67.494  1.00 60.16  ? 96  ARG F NE    1 
ATOM   3441 C  CZ    . ARG B 1 97  ? -6.892  -1.148  66.212  1.00 61.05  ? 96  ARG F CZ    1 
ATOM   3442 N  NH1   . ARG B 1 97  ? -5.654  -0.854  65.837  1.00 58.22  ? 96  ARG F NH1   1 
ATOM   3443 N  NH2   . ARG B 1 97  ? -7.852  -1.241  65.302  1.00 62.05  ? 96  ARG F NH2   1 
ATOM   3444 N  N     . ILE B 1 98  ? -2.582  2.794   70.390  1.00 54.96  ? 97  ILE F N     1 
ATOM   3445 C  CA    . ILE B 1 98  ? -1.872  4.064   70.332  1.00 56.67  ? 97  ILE F CA    1 
ATOM   3446 C  C     . ILE B 1 98  ? -0.561  3.932   69.572  1.00 57.20  ? 97  ILE F C     1 
ATOM   3447 O  O     . ILE B 1 98  ? 0.349   3.240   70.022  1.00 58.39  ? 97  ILE F O     1 
ATOM   3448 C  CB    . ILE B 1 98  ? -1.539  4.569   71.746  1.00 54.17  ? 97  ILE F CB    1 
ATOM   3449 C  CG1   . ILE B 1 98  ? -2.800  4.616   72.610  1.00 50.55  ? 97  ILE F CG1   1 
ATOM   3450 C  CG2   . ILE B 1 98  ? -0.858  5.930   71.683  1.00 50.70  ? 97  ILE F CG2   1 
ATOM   3451 C  CD1   . ILE B 1 98  ? -2.515  4.711   74.090  1.00 54.00  ? 97  ILE F CD1   1 
ATOM   3452 N  N     . GLU B 1 99  ? -0.460  4.598   68.426  1.00 54.31  ? 98  GLU F N     1 
ATOM   3453 C  CA    . GLU B 1 99  ? 0.793   4.617   67.679  1.00 59.05  ? 98  GLU F CA    1 
ATOM   3454 C  C     . GLU B 1 99  ? 1.464   5.984   67.770  1.00 54.74  ? 98  GLU F C     1 
ATOM   3455 O  O     . GLU B 1 99  ? 1.133   6.895   67.011  1.00 52.45  ? 98  GLU F O     1 
ATOM   3456 C  CB    . GLU B 1 99  ? 0.571   4.234   66.214  1.00 55.14  ? 98  GLU F CB    1 
ATOM   3457 C  CG    . GLU B 1 99  ? 1.849   4.206   65.385  1.00 53.21  ? 98  GLU F CG    1 
ATOM   3458 C  CD    . GLU B 1 99  ? 1.618   3.732   63.964  1.00 59.07  ? 98  GLU F CD    1 
ATOM   3459 O  OE1   . GLU B 1 99  ? 0.475   3.345   63.644  1.00 56.33  ? 98  GLU F OE1   1 
ATOM   3460 O  OE2   . GLU B 1 99  ? 2.580   3.745   63.167  1.00 62.47  ? 98  GLU F OE2   1 
ATOM   3461 N  N     . PRO B 1 100 ? 2.405   6.132   68.714  1.00 55.61  ? 99  PRO F N     1 
ATOM   3462 C  CA    . PRO B 1 100 ? 3.160   7.379   68.851  1.00 52.98  ? 99  PRO F CA    1 
ATOM   3463 C  C     . PRO B 1 100 ? 4.187   7.494   67.735  1.00 55.12  ? 99  PRO F C     1 
ATOM   3464 O  O     . PRO B 1 100 ? 4.806   6.496   67.368  1.00 56.53  ? 99  PRO F O     1 
ATOM   3465 C  CB    . PRO B 1 100 ? 3.872   7.215   70.202  1.00 50.81  ? 99  PRO F CB    1 
ATOM   3466 C  CG    . PRO B 1 100 ? 3.198   6.051   70.877  1.00 53.92  ? 99  PRO F CG    1 
ATOM   3467 C  CD    . PRO B 1 100 ? 2.763   5.165   69.762  1.00 48.28  ? 99  PRO F CD    1 
ATOM   3468 N  N     . LEU B 1 101 ? 4.357   8.697   67.201  1.00 58.97  ? 100 LEU F N     1 
ATOM   3469 C  CA    . LEU B 1 101 ? 5.306   8.929   66.122  1.00 55.79  ? 100 LEU F CA    1 
ATOM   3470 C  C     . LEU B 1 101 ? 6.449   9.790   66.632  1.00 54.06  ? 100 LEU F C     1 
ATOM   3471 O  O     . LEU B 1 101 ? 7.494   9.910   65.990  1.00 59.06  ? 100 LEU F O     1 
ATOM   3472 C  CB    . LEU B 1 101 ? 4.608   9.624   64.957  1.00 56.91  ? 100 LEU F CB    1 
ATOM   3473 C  CG    . LEU B 1 101 ? 3.318   8.951   64.487  1.00 60.34  ? 100 LEU F CG    1 
ATOM   3474 C  CD1   . LEU B 1 101 ? 2.441   9.953   63.761  1.00 63.10  ? 100 LEU F CD1   1 
ATOM   3475 C  CD2   . LEU B 1 101 ? 3.630   7.758   63.596  1.00 56.85  ? 100 LEU F CD2   1 
ATOM   3476 N  N     . SER B 1 102 ? 6.233   10.386  67.799  1.00 45.62  ? 101 SER F N     1 
ATOM   3477 C  CA    . SER B 1 102 ? 7.213   11.252  68.436  1.00 43.58  ? 101 SER F CA    1 
ATOM   3478 C  C     . SER B 1 102 ? 6.766   11.521  69.864  1.00 49.26  ? 101 SER F C     1 
ATOM   3479 O  O     . SER B 1 102 ? 5.891   10.831  70.387  1.00 51.05  ? 101 SER F O     1 
ATOM   3480 C  CB    . SER B 1 102 ? 7.340   12.568  67.671  1.00 55.14  ? 101 SER F CB    1 
ATOM   3481 O  OG    . SER B 1 102 ? 6.085   13.219  67.566  1.00 56.92  ? 101 SER F OG    1 
ATOM   3482 N  N     . LEU B 1 103 ? 7.362   12.527  70.494  1.00 49.24  ? 102 LEU F N     1 
ATOM   3483 C  CA    . LEU B 1 103 ? 6.980   12.894  71.850  1.00 49.72  ? 102 LEU F CA    1 
ATOM   3484 C  C     . LEU B 1 103 ? 5.570   13.477  71.900  1.00 56.13  ? 102 LEU F C     1 
ATOM   3485 O  O     . LEU B 1 103 ? 4.801   13.182  72.814  1.00 59.31  ? 102 LEU F O     1 
ATOM   3486 C  CB    . LEU B 1 103 ? 7.974   13.895  72.444  1.00 51.08  ? 102 LEU F CB    1 
ATOM   3487 C  CG    . LEU B 1 103 ? 9.391   13.397  72.738  1.00 56.51  ? 102 LEU F CG    1 
ATOM   3488 C  CD1   . LEU B 1 103 ? 10.185  14.464  73.477  1.00 56.37  ? 102 LEU F CD1   1 
ATOM   3489 C  CD2   . LEU B 1 103 ? 9.353   12.104  73.537  1.00 57.65  ? 102 LEU F CD2   1 
ATOM   3490 N  N     . ASP B 1 104 ? 5.229   14.291  70.907  1.00 52.20  ? 103 ASP F N     1 
ATOM   3491 C  CA    . ASP B 1 104 ? 3.999   15.077  70.960  1.00 51.26  ? 103 ASP F CA    1 
ATOM   3492 C  C     . ASP B 1 104 ? 2.850   14.531  70.111  1.00 49.27  ? 103 ASP F C     1 
ATOM   3493 O  O     . ASP B 1 104 ? 1.691   14.869  70.347  1.00 51.51  ? 103 ASP F O     1 
ATOM   3494 C  CB    . ASP B 1 104 ? 4.288   16.525  70.561  1.00 50.63  ? 103 ASP F CB    1 
ATOM   3495 C  CG    . ASP B 1 104 ? 4.678   16.659  69.105  1.00 51.87  ? 103 ASP F CG    1 
ATOM   3496 O  OD1   . ASP B 1 104 ? 5.287   15.713  68.562  1.00 54.07  ? 103 ASP F OD1   1 
ATOM   3497 O  OD2   . ASP B 1 104 ? 4.373   17.709  68.504  1.00 59.22  ? 103 ASP F OD2   1 
ATOM   3498 N  N     . GLU B 1 105 ? 3.166   13.697  69.126  1.00 50.50  ? 104 GLU F N     1 
ATOM   3499 C  CA    . GLU B 1 105 ? 2.149   13.212  68.194  1.00 50.61  ? 104 GLU F CA    1 
ATOM   3500 C  C     . GLU B 1 105 ? 1.751   11.764  68.446  1.00 51.43  ? 104 GLU F C     1 
ATOM   3501 O  O     . GLU B 1 105 ? 2.558   10.968  68.928  1.00 53.70  ? 104 GLU F O     1 
ATOM   3502 C  CB    . GLU B 1 105 ? 2.635   13.356  66.752  1.00 48.74  ? 104 GLU F CB    1 
ATOM   3503 C  CG    . GLU B 1 105 ? 2.863   14.786  66.311  1.00 59.25  ? 104 GLU F CG    1 
ATOM   3504 C  CD    . GLU B 1 105 ? 3.317   14.876  64.870  1.00 63.81  ? 104 GLU F CD    1 
ATOM   3505 O  OE1   . GLU B 1 105 ? 3.251   13.848  64.162  1.00 62.48  ? 104 GLU F OE1   1 
ATOM   3506 O  OE2   . GLU B 1 105 ? 3.743   15.971  64.447  1.00 61.16  ? 104 GLU F OE2   1 
ATOM   3507 N  N     . ALA B 1 106 ? 0.507   11.425  68.109  1.00 52.94  ? 105 ALA F N     1 
ATOM   3508 C  CA    . ALA B 1 106 ? 0.054   10.036  68.201  1.00 50.83  ? 105 ALA F CA    1 
ATOM   3509 C  C     . ALA B 1 106 ? -1.207  9.736   67.391  1.00 51.01  ? 105 ALA F C     1 
ATOM   3510 O  O     . ALA B 1 106 ? -2.090  10.586  67.249  1.00 50.14  ? 105 ALA F O     1 
ATOM   3511 C  CB    . ALA B 1 106 ? -0.152  9.634   69.656  1.00 51.88  ? 105 ALA F CB    1 
ATOM   3512 N  N     . TYR B 1 107 ? -1.272  8.515   66.864  1.00 50.15  ? 106 TYR F N     1 
ATOM   3513 C  CA    . TYR B 1 107 ? -2.481  7.999   66.232  1.00 46.66  ? 106 TYR F CA    1 
ATOM   3514 C  C     . TYR B 1 107 ? -3.274  7.173   67.237  1.00 49.42  ? 106 TYR F C     1 
ATOM   3515 O  O     . TYR B 1 107 ? -2.702  6.405   68.011  1.00 51.74  ? 106 TYR F O     1 
ATOM   3516 C  CB    . TYR B 1 107 ? -2.143  7.117   65.028  1.00 55.71  ? 106 TYR F CB    1 
ATOM   3517 C  CG    . TYR B 1 107 ? -1.756  7.865   63.772  1.00 54.35  ? 106 TYR F CG    1 
ATOM   3518 C  CD1   . TYR B 1 107 ? -0.497  7.707   63.210  1.00 51.99  ? 106 TYR F CD1   1 
ATOM   3519 C  CD2   . TYR B 1 107 ? -2.652  8.718   63.142  1.00 46.89  ? 106 TYR F CD2   1 
ATOM   3520 C  CE1   . TYR B 1 107 ? -0.139  8.379   62.059  1.00 48.74  ? 106 TYR F CE1   1 
ATOM   3521 C  CE2   . TYR B 1 107 ? -2.302  9.397   61.990  1.00 49.90  ? 106 TYR F CE2   1 
ATOM   3522 C  CZ    . TYR B 1 107 ? -1.043  9.224   61.454  1.00 45.91  ? 106 TYR F CZ    1 
ATOM   3523 O  OH    . TYR B 1 107 ? -0.685  9.896   60.307  1.00 50.12  ? 106 TYR F OH    1 
ATOM   3524 N  N     . LEU B 1 108 ? -4.592  7.334   67.217  1.00 54.61  ? 107 LEU F N     1 
ATOM   3525 C  CA    . LEU B 1 108 ? -5.482  6.571   68.082  1.00 55.58  ? 107 LEU F CA    1 
ATOM   3526 C  C     . LEU B 1 108 ? -6.603  5.946   67.264  1.00 57.99  ? 107 LEU F C     1 
ATOM   3527 O  O     . LEU B 1 108 ? -7.319  6.644   66.547  1.00 62.85  ? 107 LEU F O     1 
ATOM   3528 C  CB    . LEU B 1 108 ? -6.085  7.466   69.169  1.00 55.46  ? 107 LEU F CB    1 
ATOM   3529 C  CG    . LEU B 1 108 ? -5.328  7.674   70.484  1.00 53.72  ? 107 LEU F CG    1 
ATOM   3530 C  CD1   . LEU B 1 108 ? -4.047  8.465   70.281  1.00 55.29  ? 107 LEU F CD1   1 
ATOM   3531 C  CD2   . LEU B 1 108 ? -6.227  8.364   71.499  1.00 55.98  ? 107 LEU F CD2   1 
ATOM   3532 N  N     . ASP B 1 109 ? -6.751  4.630   67.366  1.00 59.00  ? 108 ASP F N     1 
ATOM   3533 C  CA    . ASP B 1 109 ? -7.860  3.944   66.718  1.00 57.54  ? 108 ASP F CA    1 
ATOM   3534 C  C     . ASP B 1 109 ? -8.980  3.742   67.730  1.00 60.74  ? 108 ASP F C     1 
ATOM   3535 O  O     . ASP B 1 109 ? -8.939  2.819   68.543  1.00 69.29  ? 108 ASP F O     1 
ATOM   3536 C  CB    . ASP B 1 109 ? -7.410  2.600   66.138  1.00 59.51  ? 108 ASP F CB    1 
ATOM   3537 C  CG    . ASP B 1 109 ? -8.417  2.014   65.159  1.00 61.42  ? 108 ASP F CG    1 
ATOM   3538 O  OD1   . ASP B 1 109 ? -9.635  2.200   65.360  1.00 57.86  ? 108 ASP F OD1   1 
ATOM   3539 O  OD2   . ASP B 1 109 ? -7.987  1.365   64.181  1.00 59.09  ? 108 ASP F OD2   1 
ATOM   3540 N  N     . VAL B 1 110 ? -9.978  4.617   67.677  1.00 57.69  ? 109 VAL F N     1 
ATOM   3541 C  CA    . VAL B 1 110 ? -11.106 4.546   68.597  1.00 64.80  ? 109 VAL F CA    1 
ATOM   3542 C  C     . VAL B 1 110 ? -12.361 4.036   67.897  1.00 62.51  ? 109 VAL F C     1 
ATOM   3543 O  O     . VAL B 1 110 ? -13.477 4.413   68.251  1.00 61.55  ? 109 VAL F O     1 
ATOM   3544 C  CB    . VAL B 1 110 ? -11.392 5.914   69.246  1.00 64.56  ? 109 VAL F CB    1 
ATOM   3545 C  CG1   . VAL B 1 110 ? -10.273 6.289   70.205  1.00 60.02  ? 109 VAL F CG1   1 
ATOM   3546 C  CG2   . VAL B 1 110 ? -11.570 6.983   68.178  1.00 57.88  ? 109 VAL F CG2   1 
ATOM   3547 N  N     . THR B 1 111 ? -12.168 3.176   66.901  1.00 65.26  ? 110 THR F N     1 
ATOM   3548 C  CA    . THR B 1 111 ? -13.281 2.575   66.176  1.00 62.62  ? 110 THR F CA    1 
ATOM   3549 C  C     . THR B 1 111 ? -14.132 1.733   67.119  1.00 68.76  ? 110 THR F C     1 
ATOM   3550 O  O     . THR B 1 111 ? -15.359 1.838   67.128  1.00 71.84  ? 110 THR F O     1 
ATOM   3551 C  CB    . THR B 1 111 ? -12.787 1.686   65.020  1.00 63.24  ? 110 THR F CB    1 
ATOM   3552 O  OG1   . THR B 1 111 ? -11.806 2.395   64.253  1.00 59.62  ? 110 THR F OG1   1 
ATOM   3553 C  CG2   . THR B 1 111 ? -13.946 1.288   64.119  1.00 70.41  ? 110 THR F CG2   1 
ATOM   3554 N  N     . ASP B 1 112 ? -13.469 0.903   67.916  1.00 70.90  ? 111 ASP F N     1 
ATOM   3555 C  CA    . ASP B 1 112 ? -14.149 0.072   68.900  1.00 72.80  ? 111 ASP F CA    1 
ATOM   3556 C  C     . ASP B 1 112 ? -14.145 0.725   70.275  1.00 72.55  ? 111 ASP F C     1 
ATOM   3557 O  O     . ASP B 1 112 ? -13.968 0.052   71.289  1.00 74.71  ? 111 ASP F O     1 
ATOM   3558 C  CB    . ASP B 1 112 ? -13.495 -1.308  68.982  1.00 76.00  ? 111 ASP F CB    1 
ATOM   3559 C  CG    . ASP B 1 112 ? -13.933 -2.226  67.862  1.00 83.89  ? 111 ASP F CG    1 
ATOM   3560 O  OD1   . ASP B 1 112 ? -15.146 -2.265  67.569  1.00 86.52  ? 111 ASP F OD1   1 
ATOM   3561 O  OD2   . ASP B 1 112 ? -13.067 -2.907  67.275  1.00 81.92  ? 111 ASP F OD2   1 
ATOM   3562 N  N     . SER B 1 113 ? -14.338 2.039   70.305  1.00 70.80  ? 112 SER F N     1 
ATOM   3563 C  CA    . SER B 1 113 ? -14.378 2.769   71.566  1.00 70.50  ? 112 SER F CA    1 
ATOM   3564 C  C     . SER B 1 113 ? -15.780 2.738   72.165  1.00 70.24  ? 112 SER F C     1 
ATOM   3565 O  O     . SER B 1 113 ? -16.725 2.268   71.530  1.00 72.43  ? 112 SER F O     1 
ATOM   3566 C  CB    . SER B 1 113 ? -13.909 4.212   71.375  1.00 72.82  ? 112 SER F CB    1 
ATOM   3567 O  OG    . SER B 1 113 ? -13.797 4.879   72.620  1.00 79.52  ? 112 SER F OG    1 
ATOM   3568 N  N     . VAL B 1 114 ? -15.910 3.247   73.385  1.00 78.07  ? 113 VAL F N     1 
ATOM   3569 C  CA    . VAL B 1 114 ? -17.159 3.147   74.131  1.00 80.88  ? 113 VAL F CA    1 
ATOM   3570 C  C     . VAL B 1 114 ? -17.371 4.384   75.005  1.00 78.79  ? 113 VAL F C     1 
ATOM   3571 O  O     . VAL B 1 114 ? -18.454 4.599   75.552  1.00 80.60  ? 113 VAL F O     1 
ATOM   3572 C  CB    . VAL B 1 114 ? -17.153 1.883   75.023  1.00 79.54  ? 113 VAL F CB    1 
ATOM   3573 C  CG1   . VAL B 1 114 ? -16.207 2.069   76.202  1.00 80.08  ? 113 VAL F CG1   1 
ATOM   3574 C  CG2   . VAL B 1 114 ? -18.558 1.537   75.500  1.00 71.69  ? 113 VAL F CG2   1 
ATOM   3575 N  N     . HIS B 1 115 ? -16.332 5.206   75.111  1.00 78.80  ? 114 HIS F N     1 
ATOM   3576 C  CA    . HIS B 1 115 ? -16.321 6.334   76.038  1.00 75.12  ? 114 HIS F CA    1 
ATOM   3577 C  C     . HIS B 1 115 ? -17.386 7.393   75.753  1.00 75.36  ? 114 HIS F C     1 
ATOM   3578 O  O     . HIS B 1 115 ? -18.369 7.507   76.487  1.00 80.88  ? 114 HIS F O     1 
ATOM   3579 C  CB    . HIS B 1 115 ? -14.928 6.967   76.075  1.00 66.81  ? 114 HIS F CB    1 
ATOM   3580 C  CG    . HIS B 1 115 ? -13.871 6.048   76.600  1.00 75.47  ? 114 HIS F CG    1 
ATOM   3581 N  ND1   . HIS B 1 115 ? -13.280 6.222   77.833  1.00 73.29  ? 114 HIS F ND1   1 
ATOM   3582 C  CD2   . HIS B 1 115 ? -13.314 4.934   76.070  1.00 75.17  ? 114 HIS F CD2   1 
ATOM   3583 C  CE1   . HIS B 1 115 ? -12.398 5.260   78.035  1.00 71.15  ? 114 HIS F CE1   1 
ATOM   3584 N  NE2   . HIS B 1 115 ? -12.399 4.465   76.981  1.00 74.24  ? 114 HIS F NE2   1 
ATOM   3585 N  N     . CYS B 1 116 ? -17.187 8.167   74.691  1.00 69.11  ? 115 CYS F N     1 
ATOM   3586 C  CA    . CYS B 1 116 ? -18.106 9.250   74.354  1.00 71.84  ? 115 CYS F CA    1 
ATOM   3587 C  C     . CYS B 1 116 ? -19.157 8.809   73.337  1.00 73.84  ? 115 CYS F C     1 
ATOM   3588 O  O     . CYS B 1 116 ? -19.373 9.489   72.336  1.00 72.53  ? 115 CYS F O     1 
ATOM   3589 C  CB    . CYS B 1 116 ? -17.333 10.461  73.818  1.00 64.22  ? 115 CYS F CB    1 
ATOM   3590 S  SG    . CYS B 1 116 ? -16.220 11.264  75.010  1.00 75.04  ? 115 CYS F SG    1 
ATOM   3591 N  N     . HIS B 1 117 ? -19.799 7.672   73.596  1.00 70.88  ? 116 HIS F N     1 
ATOM   3592 C  CA    . HIS B 1 117 ? -20.820 7.127   72.702  1.00 69.12  ? 116 HIS F CA    1 
ATOM   3593 C  C     . HIS B 1 117 ? -20.278 6.905   71.290  1.00 73.97  ? 116 HIS F C     1 
ATOM   3594 O  O     . HIS B 1 117 ? -20.993 7.095   70.305  1.00 75.87  ? 116 HIS F O     1 
ATOM   3595 C  CB    . HIS B 1 117 ? -22.057 8.033   72.663  1.00 75.01  ? 116 HIS F CB    1 
ATOM   3596 C  CG    . HIS B 1 117 ? -22.608 8.368   74.015  1.00 80.86  ? 116 HIS F CG    1 
ATOM   3597 N  ND1   . HIS B 1 117 ? -22.411 9.593   74.616  1.00 83.23  ? 116 HIS F ND1   1 
ATOM   3598 C  CD2   . HIS B 1 117 ? -23.358 7.643   74.878  1.00 80.39  ? 116 HIS F CD2   1 
ATOM   3599 C  CE1   . HIS B 1 117 ? -23.010 9.605   75.793  1.00 87.62  ? 116 HIS F CE1   1 
ATOM   3600 N  NE2   . HIS B 1 117 ? -23.592 8.433   75.976  1.00 85.87  ? 116 HIS F NE2   1 
ATOM   3601 N  N     . GLY B 1 118 ? -19.011 6.510   71.202  1.00 70.67  ? 117 GLY F N     1 
ATOM   3602 C  CA    . GLY B 1 118 ? -18.374 6.261   69.922  1.00 62.06  ? 117 GLY F CA    1 
ATOM   3603 C  C     . GLY B 1 118 ? -18.164 7.515   69.096  1.00 59.03  ? 117 GLY F C     1 
ATOM   3604 O  O     . GLY B 1 118 ? -17.958 7.443   67.883  1.00 63.71  ? 117 GLY F O     1 
ATOM   3605 N  N     . SER B 1 119 ? -18.223 8.669   69.749  1.00 62.30  ? 118 SER F N     1 
ATOM   3606 C  CA    . SER B 1 119 ? -17.993 9.936   69.070  1.00 65.08  ? 118 SER F CA    1 
ATOM   3607 C  C     . SER B 1 119 ? -16.515 10.300  69.107  1.00 60.87  ? 118 SER F C     1 
ATOM   3608 O  O     . SER B 1 119 ? -16.009 10.764  70.128  1.00 58.45  ? 118 SER F O     1 
ATOM   3609 C  CB    . SER B 1 119 ? -18.822 11.051  69.708  1.00 62.59  ? 118 SER F CB    1 
ATOM   3610 O  OG    . SER B 1 119 ? -18.469 12.313  69.172  1.00 62.71  ? 118 SER F OG    1 
ATOM   3611 N  N     . ALA B 1 120 ? -15.831 10.083  67.988  1.00 59.36  ? 119 ALA F N     1 
ATOM   3612 C  CA    . ALA B 1 120 ? -14.409 10.390  67.880  1.00 61.18  ? 119 ALA F CA    1 
ATOM   3613 C  C     . ALA B 1 120 ? -14.144 11.872  68.133  1.00 60.59  ? 119 ALA F C     1 
ATOM   3614 O  O     . ALA B 1 120 ? -13.121 12.240  68.715  1.00 63.26  ? 119 ALA F O     1 
ATOM   3615 C  CB    . ALA B 1 120 ? -13.883 9.977   66.516  1.00 56.57  ? 119 ALA F CB    1 
ATOM   3616 N  N     . THR B 1 121 ? -15.076 12.714  67.695  1.00 53.53  ? 120 THR F N     1 
ATOM   3617 C  CA    . THR B 1 121 ? -15.001 14.151  67.928  1.00 52.06  ? 120 THR F CA    1 
ATOM   3618 C  C     . THR B 1 121 ? -14.976 14.453  69.422  1.00 54.28  ? 120 THR F C     1 
ATOM   3619 O  O     . THR B 1 121 ? -14.080 15.141  69.918  1.00 57.28  ? 120 THR F O     1 
ATOM   3620 C  CB    . THR B 1 121 ? -16.205 14.879  67.298  1.00 53.83  ? 120 THR F CB    1 
ATOM   3621 O  OG1   . THR B 1 121 ? -16.201 14.681  65.878  1.00 52.25  ? 120 THR F OG1   1 
ATOM   3622 C  CG2   . THR B 1 121 ? -16.149 16.368  67.601  1.00 44.82  ? 120 THR F CG2   1 
ATOM   3623 N  N     . LEU B 1 122 ? -15.968 13.924  70.132  1.00 55.65  ? 121 LEU F N     1 
ATOM   3624 C  CA    . LEU B 1 122 ? -16.086 14.122  71.572  1.00 57.29  ? 121 LEU F CA    1 
ATOM   3625 C  C     . LEU B 1 122 ? -14.893 13.539  72.323  1.00 57.38  ? 121 LEU F C     1 
ATOM   3626 O  O     . LEU B 1 122 ? -14.460 14.089  73.335  1.00 60.27  ? 121 LEU F O     1 
ATOM   3627 C  CB    . LEU B 1 122 ? -17.389 13.505  72.087  1.00 59.56  ? 121 LEU F CB    1 
ATOM   3628 C  CG    . LEU B 1 122 ? -18.588 14.426  72.329  1.00 59.00  ? 121 LEU F CG    1 
ATOM   3629 C  CD1   . LEU B 1 122 ? -18.441 15.161  73.651  1.00 62.10  ? 121 LEU F CD1   1 
ATOM   3630 C  CD2   . LEU B 1 122 ? -18.761 15.413  71.183  1.00 54.26  ? 121 LEU F CD2   1 
ATOM   3631 N  N     . ILE B 1 123 ? -14.364 12.426  71.823  1.00 59.77  ? 122 ILE F N     1 
ATOM   3632 C  CA    . ILE B 1 123 ? -13.196 11.795  72.430  1.00 60.36  ? 122 ILE F CA    1 
ATOM   3633 C  C     . ILE B 1 123 ? -11.963 12.685  72.305  1.00 56.23  ? 122 ILE F C     1 
ATOM   3634 O  O     . ILE B 1 123 ? -11.293 12.967  73.299  1.00 56.95  ? 122 ILE F O     1 
ATOM   3635 C  CB    . ILE B 1 123 ? -12.898 10.416  71.809  1.00 66.18  ? 122 ILE F CB    1 
ATOM   3636 C  CG1   . ILE B 1 123 ? -14.012 9.426   72.151  1.00 64.36  ? 122 ILE F CG1   1 
ATOM   3637 C  CG2   . ILE B 1 123 ? -11.562 9.885   72.305  1.00 53.16  ? 122 ILE F CG2   1 
ATOM   3638 C  CD1   . ILE B 1 123 ? -13.868 8.085   71.467  1.00 58.69  ? 122 ILE F CD1   1 
ATOM   3639 N  N     . ALA B 1 124 ? -11.672 13.125  71.083  1.00 52.17  ? 123 ALA F N     1 
ATOM   3640 C  CA    . ALA B 1 124 ? -10.541 14.014  70.835  1.00 55.25  ? 123 ALA F CA    1 
ATOM   3641 C  C     . ALA B 1 124 ? -10.669 15.287  71.664  1.00 55.39  ? 123 ALA F C     1 
ATOM   3642 O  O     . ALA B 1 124 ? -9.687  15.787  72.218  1.00 54.47  ? 123 ALA F O     1 
ATOM   3643 C  CB    . ALA B 1 124 ? -10.444 14.350  69.355  1.00 51.79  ? 123 ALA F CB    1 
ATOM   3644 N  N     . GLN B 1 125 ? -11.895 15.796  71.747  1.00 55.59  ? 124 GLN F N     1 
ATOM   3645 C  CA    . GLN B 1 125 ? -12.203 16.953  72.578  1.00 57.36  ? 124 GLN F CA    1 
ATOM   3646 C  C     . GLN B 1 125 ? -11.819 16.678  74.025  1.00 61.12  ? 124 GLN F C     1 
ATOM   3647 O  O     . GLN B 1 125 ? -11.170 17.496  74.686  1.00 55.98  ? 124 GLN F O     1 
ATOM   3648 C  CB    . GLN B 1 125 ? -13.698 17.261  72.493  1.00 61.65  ? 124 GLN F CB    1 
ATOM   3649 C  CG    . GLN B 1 125 ? -14.097 18.614  73.052  1.00 57.93  ? 124 GLN F CG    1 
ATOM   3650 C  CD    . GLN B 1 125 ? -13.802 19.745  72.090  1.00 65.91  ? 124 GLN F CD    1 
ATOM   3651 O  OE1   . GLN B 1 125 ? -13.036 20.656  72.401  1.00 65.81  ? 124 GLN F OE1   1 
ATOM   3652 N  NE2   . GLN B 1 125 ? -14.414 19.694  70.911  1.00 61.40  ? 124 GLN F NE2   1 
ATOM   3653 N  N     . GLU B 1 126 ? -12.210 15.501  74.498  1.00 60.68  ? 125 GLU F N     1 
ATOM   3654 C  CA    . GLU B 1 126 ? -12.026 15.118  75.889  1.00 60.74  ? 125 GLU F CA    1 
ATOM   3655 C  C     . GLU B 1 126 ? -10.598 14.663  76.170  1.00 62.16  ? 125 GLU F C     1 
ATOM   3656 O  O     . GLU B 1 126 ? -10.251 14.337  77.306  1.00 68.13  ? 125 GLU F O     1 
ATOM   3657 C  CB    . GLU B 1 126 ? -13.021 14.020  76.254  1.00 65.20  ? 125 GLU F CB    1 
ATOM   3658 C  CG    . GLU B 1 126 ? -13.332 13.932  77.731  1.00 69.96  ? 125 GLU F CG    1 
ATOM   3659 C  CD    . GLU B 1 126 ? -14.606 13.165  78.003  1.00 79.85  ? 125 GLU F CD    1 
ATOM   3660 O  OE1   . GLU B 1 126 ? -15.573 13.336  77.230  1.00 74.56  ? 125 GLU F OE1   1 
ATOM   3661 O  OE2   . GLU B 1 126 ? -14.637 12.387  78.981  1.00 82.84  ? 125 GLU F OE2   1 
ATOM   3662 N  N     . ILE B 1 127 ? -9.772  14.635  75.131  1.00 61.97  ? 126 ILE F N     1 
ATOM   3663 C  CA    . ILE B 1 127 ? -8.350  14.373  75.307  1.00 58.70  ? 126 ILE F CA    1 
ATOM   3664 C  C     . ILE B 1 127 ? -7.590  15.695  75.339  1.00 57.51  ? 126 ILE F C     1 
ATOM   3665 O  O     . ILE B 1 127 ? -6.733  15.911  76.205  1.00 59.48  ? 126 ILE F O     1 
ATOM   3666 C  CB    . ILE B 1 127 ? -7.788  13.463  74.201  1.00 54.11  ? 126 ILE F CB    1 
ATOM   3667 C  CG1   . ILE B 1 127 ? -8.429  12.077  74.281  1.00 53.74  ? 126 ILE F CG1   1 
ATOM   3668 C  CG2   . ILE B 1 127 ? -6.284  13.341  74.334  1.00 47.60  ? 126 ILE F CG2   1 
ATOM   3669 C  CD1   . ILE B 1 127 ? -7.994  11.137  73.180  1.00 53.37  ? 126 ILE F CD1   1 
ATOM   3670 N  N     . ARG B 1 128 ? -7.929  16.589  74.412  1.00 52.76  ? 127 ARG F N     1 
ATOM   3671 C  CA    . ARG B 1 128 ? -7.341  17.925  74.399  1.00 51.65  ? 127 ARG F CA    1 
ATOM   3672 C  C     . ARG B 1 128 ? -7.630  18.639  75.712  1.00 55.76  ? 127 ARG F C     1 
ATOM   3673 O  O     . ARG B 1 128 ? -6.715  19.153  76.357  1.00 62.32  ? 127 ARG F O     1 
ATOM   3674 C  CB    . ARG B 1 128 ? -7.845  18.740  73.213  1.00 48.21  ? 127 ARG F CB    1 
ATOM   3675 C  CG    . ARG B 1 128 ? -7.493  18.122  71.875  1.00 45.92  ? 127 ARG F CG    1 
ATOM   3676 C  CD    . ARG B 1 128 ? -7.799  19.057  70.723  1.00 46.78  ? 127 ARG F CD    1 
ATOM   3677 N  NE    . ARG B 1 128 ? -9.136  19.632  70.818  1.00 54.55  ? 127 ARG F NE    1 
ATOM   3678 C  CZ    . ARG B 1 128 ? -9.385  20.903  71.117  1.00 53.13  ? 127 ARG F CZ    1 
ATOM   3679 N  NH1   . ARG B 1 128 ? -8.384  21.739  71.356  1.00 47.05  ? 127 ARG F NH1   1 
ATOM   3680 N  NH2   . ARG B 1 128 ? -10.636 21.336  71.178  1.00 56.94  ? 127 ARG F NH2   1 
ATOM   3681 N  N     . GLN B 1 129 ? -8.898  18.669  76.112  1.00 55.61  ? 128 GLN F N     1 
ATOM   3682 C  CA    . GLN B 1 129 ? -9.213  18.993  77.494  1.00 58.55  ? 128 GLN F CA    1 
ATOM   3683 C  C     . GLN B 1 129 ? -8.796  17.733  78.224  1.00 65.22  ? 128 GLN F C     1 
ATOM   3684 O  O     . GLN B 1 129 ? -8.969  16.652  77.677  1.00 62.79  ? 128 GLN F O     1 
ATOM   3685 C  CB    . GLN B 1 129 ? -10.708 19.245  77.677  1.00 55.85  ? 128 GLN F CB    1 
ATOM   3686 C  CG    . GLN B 1 129 ? -11.061 19.993  78.956  1.00 61.00  ? 128 GLN F CG    1 
ATOM   3687 C  CD    . GLN B 1 129 ? -10.841 21.490  78.839  1.00 71.40  ? 128 GLN F CD    1 
ATOM   3688 O  OE1   . GLN B 1 129 ? -11.086 22.085  77.789  1.00 69.23  ? 128 GLN F OE1   1 
ATOM   3689 N  NE2   . GLN B 1 129 ? -10.374 22.108  79.919  1.00 69.00  ? 128 GLN F NE2   1 
ATOM   3690 N  N     . THR B 1 130 ? -8.262  17.879  79.438  1.00 62.68  ? 129 THR F N     1 
ATOM   3691 C  CA    . THR B 1 130 ? -7.565  16.812  80.183  1.00 65.86  ? 129 THR F CA    1 
ATOM   3692 C  C     . THR B 1 130 ? -6.063  16.784  79.857  1.00 63.72  ? 129 THR F C     1 
ATOM   3693 O  O     . THR B 1 130 ? -5.253  16.390  80.694  1.00 68.38  ? 129 THR F O     1 
ATOM   3694 C  CB    . THR B 1 130 ? -8.227  15.395  80.069  1.00 57.45  ? 129 THR F CB    1 
ATOM   3695 O  OG1   . THR B 1 130 ? -9.549  15.431  80.622  1.00 71.65  ? 129 THR F OG1   1 
ATOM   3696 C  CG2   . THR B 1 130 ? -7.416  14.331  80.787  1.00 60.74  ? 129 THR F CG2   1 
ATOM   3697 N  N     . ILE B 1 131 ? -5.693  17.203  78.648  1.00 60.20  ? 130 ILE F N     1 
ATOM   3698 C  CA    . ILE B 1 131 ? -4.295  17.539  78.377  1.00 62.45  ? 130 ILE F CA    1 
ATOM   3699 C  C     . ILE B 1 131 ? -4.015  18.958  78.875  1.00 65.40  ? 130 ILE F C     1 
ATOM   3700 O  O     . ILE B 1 131 ? -3.039  19.189  79.604  1.00 65.37  ? 130 ILE F O     1 
ATOM   3701 C  CB    . ILE B 1 131 ? -3.924  17.400  76.883  1.00 60.32  ? 130 ILE F CB    1 
ATOM   3702 C  CG1   . ILE B 1 131 ? -3.662  15.933  76.531  1.00 54.07  ? 130 ILE F CG1   1 
ATOM   3703 C  CG2   . ILE B 1 131 ? -2.683  18.220  76.558  1.00 53.30  ? 130 ILE F CG2   1 
ATOM   3704 C  CD1   . ILE B 1 131 ? -3.381  15.703  75.068  1.00 49.29  ? 130 ILE F CD1   1 
ATOM   3705 N  N     . PHE B 1 132 ? -4.877  19.900  78.492  1.00 63.90  ? 131 PHE F N     1 
ATOM   3706 C  CA    . PHE B 1 132 ? -4.813  21.249  79.036  1.00 63.67  ? 131 PHE F CA    1 
ATOM   3707 C  C     . PHE B 1 132 ? -4.981  21.203  80.557  1.00 66.88  ? 131 PHE F C     1 
ATOM   3708 O  O     . PHE B 1 132 ? -4.361  21.969  81.269  1.00 69.38  ? 131 PHE F O     1 
ATOM   3709 C  CB    . PHE B 1 132 ? -5.864  22.166  78.390  1.00 57.59  ? 131 PHE F CB    1 
ATOM   3710 C  CG    . PHE B 1 132 ? -5.771  23.591  78.845  1.00 64.28  ? 131 PHE F CG    1 
ATOM   3711 C  CD1   . PHE B 1 132 ? -4.822  24.443  78.305  1.00 64.78  ? 131 PHE F CD1   1 
ATOM   3712 C  CD2   . PHE B 1 132 ? -6.602  24.068  79.844  1.00 68.22  ? 131 PHE F CD2   1 
ATOM   3713 C  CE1   . PHE B 1 132 ? -4.718  25.754  78.737  1.00 64.15  ? 131 PHE F CE1   1 
ATOM   3714 C  CE2   . PHE B 1 132 ? -6.505  25.377  80.282  1.00 65.62  ? 131 PHE F CE2   1 
ATOM   3715 C  CZ    . PHE B 1 132 ? -5.561  26.222  79.726  1.00 63.11  ? 131 PHE F CZ    1 
ATOM   3716 N  N     . ASN B 1 133 ? -5.864  20.328  81.026  1.00 65.24  ? 132 ASN F N     1 
ATOM   3717 C  CA    . ASN B 1 133 ? -5.988  20.010  82.432  1.00 65.37  ? 132 ASN F CA    1 
ATOM   3718 C  C     . ASN B 1 133 ? -4.810  19.089  82.720  1.00 70.23  ? 132 ASN F C     1 
ATOM   3719 O  O     . ASN B 1 133 ? -4.269  18.525  81.783  1.00 70.58  ? 132 ASN F O     1 
ATOM   3720 C  CB    . ASN B 1 133 ? -7.308  19.284  82.667  1.00 64.62  ? 132 ASN F CB    1 
ATOM   3721 C  CG    . ASN B 1 133 ? -8.504  20.157  82.350  1.00 65.94  ? 132 ASN F CG    1 
ATOM   3722 O  OD1   . ASN B 1 133 ? -8.338  21.293  81.911  1.00 72.85  ? 132 ASN F OD1   1 
ATOM   3723 N  ND2   . ASN B 1 133 ? -9.706  19.639  82.554  1.00 66.41  ? 132 ASN F ND2   1 
ATOM   3724 N  N     . GLU B 1 134 ? -4.394  18.924  83.973  1.00 68.40  ? 133 GLU F N     1 
ATOM   3725 C  CA    . GLU B 1 134 ? -3.198  18.121  84.263  1.00 69.92  ? 133 GLU F CA    1 
ATOM   3726 C  C     . GLU B 1 134 ? -1.874  18.658  83.673  1.00 69.11  ? 133 GLU F C     1 
ATOM   3727 O  O     . GLU B 1 134 ? -0.899  18.836  84.413  1.00 70.27  ? 133 GLU F O     1 
ATOM   3728 C  CB    . GLU B 1 134 ? -3.398  16.645  83.874  1.00 67.69  ? 133 GLU F CB    1 
ATOM   3729 C  CG    . GLU B 1 134 ? -4.656  15.996  84.446  1.00 64.15  ? 133 GLU F CG    1 
ATOM   3730 C  CD    . GLU B 1 134 ? -4.805  14.538  84.044  1.00 63.21  ? 133 GLU F CD    1 
ATOM   3731 O  OE1   . GLU B 1 134 ? -3.828  13.954  83.526  1.00 54.04  ? 133 GLU F OE1   1 
ATOM   3732 O  OE2   . GLU B 1 134 ? -5.902  13.976  84.250  1.00 64.17  ? 133 GLU F OE2   1 
ATOM   3733 N  N     . LEU B 1 135 ? -1.808  18.894  82.360  1.00 66.45  ? 134 LEU F N     1 
ATOM   3734 C  CA    . LEU B 1 135 ? -0.524  19.321  81.797  1.00 61.62  ? 134 LEU F CA    1 
ATOM   3735 C  C     . LEU B 1 135 ? -0.352  20.826  81.582  1.00 62.17  ? 134 LEU F C     1 
ATOM   3736 O  O     . LEU B 1 135 ? 0.774   21.320  81.577  1.00 63.75  ? 134 LEU F O     1 
ATOM   3737 C  CB    . LEU B 1 135 ? -0.200  18.555  80.514  1.00 62.17  ? 134 LEU F CB    1 
ATOM   3738 C  CG    . LEU B 1 135 ? 0.210   17.095  80.694  1.00 61.32  ? 134 LEU F CG    1 
ATOM   3739 C  CD1   . LEU B 1 135 ? -0.826  16.171  80.082  1.00 62.69  ? 134 LEU F CD1   1 
ATOM   3740 C  CD2   . LEU B 1 135 ? 1.575   16.862  80.076  1.00 62.62  ? 134 LEU F CD2   1 
ATOM   3741 N  N     . GLN B 1 136 ? -1.460  21.541  81.406  1.00 66.35  ? 135 GLN F N     1 
ATOM   3742 C  CA    . GLN B 1 136 ? -1.432  22.979  81.123  1.00 67.51  ? 135 GLN F CA    1 
ATOM   3743 C  C     . GLN B 1 136 ? -0.721  23.322  79.813  1.00 66.82  ? 135 GLN F C     1 
ATOM   3744 O  O     . GLN B 1 136 ? -0.239  24.441  79.631  1.00 64.75  ? 135 GLN F O     1 
ATOM   3745 C  CB    . GLN B 1 136 ? -0.856  23.776  82.299  1.00 66.95  ? 135 GLN F CB    1 
ATOM   3746 C  CG    . GLN B 1 136 ? -1.725  23.741  83.545  1.00 71.90  ? 135 GLN F CG    1 
ATOM   3747 C  CD    . GLN B 1 136 ? -0.978  23.238  84.764  1.00 85.80  ? 135 GLN F CD    1 
ATOM   3748 O  OE1   . GLN B 1 136 ? 0.199   23.543  84.954  1.00 83.21  ? 135 GLN F OE1   1 
ATOM   3749 N  NE2   . GLN B 1 136 ? -1.659  22.455  85.593  1.00 84.64  ? 135 GLN F NE2   1 
ATOM   3750 N  N     . LEU B 1 137 ? -0.656  22.348  78.909  1.00 59.94  ? 136 LEU F N     1 
ATOM   3751 C  CA    . LEU B 1 137 ? -0.271  22.601  77.527  1.00 57.69  ? 136 LEU F CA    1 
ATOM   3752 C  C     . LEU B 1 137 ? -1.501  22.360  76.669  1.00 52.76  ? 136 LEU F C     1 
ATOM   3753 O  O     . LEU B 1 137 ? -2.428  21.677  77.093  1.00 53.04  ? 136 LEU F O     1 
ATOM   3754 C  CB    . LEU B 1 137 ? 0.854   21.667  77.074  1.00 54.98  ? 136 LEU F CB    1 
ATOM   3755 C  CG    . LEU B 1 137 ? 2.219   21.696  77.764  1.00 59.40  ? 136 LEU F CG    1 
ATOM   3756 C  CD1   . LEU B 1 137 ? 2.554   23.089  78.278  1.00 59.58  ? 136 LEU F CD1   1 
ATOM   3757 C  CD2   . LEU B 1 137 ? 2.291   20.660  78.874  1.00 57.79  ? 136 LEU F CD2   1 
ATOM   3758 N  N     . THR B 1 138 ? -1.516  22.910  75.462  1.00 52.98  ? 137 THR F N     1 
ATOM   3759 C  CA    . THR B 1 138 ? -2.655  22.711  74.576  1.00 52.93  ? 137 THR F CA    1 
ATOM   3760 C  C     . THR B 1 138 ? -2.332  21.705  73.480  1.00 52.61  ? 137 THR F C     1 
ATOM   3761 O  O     . THR B 1 138 ? -1.168  21.489  73.142  1.00 54.63  ? 137 THR F O     1 
ATOM   3762 C  CB    . THR B 1 138 ? -3.121  24.029  73.934  1.00 50.64  ? 137 THR F CB    1 
ATOM   3763 O  OG1   . THR B 1 138 ? -2.106  24.519  73.048  1.00 50.29  ? 137 THR F OG1   1 
ATOM   3764 C  CG2   . THR B 1 138 ? -3.409  25.070  75.005  1.00 47.35  ? 137 THR F CG2   1 
ATOM   3765 N  N     . ALA B 1 139 ? -3.372  21.091  72.931  1.00 50.97  ? 138 ALA F N     1 
ATOM   3766 C  CA    . ALA B 1 139 ? -3.206  20.131  71.853  1.00 47.46  ? 138 ALA F CA    1 
ATOM   3767 C  C     . ALA B 1 139 ? -4.212  20.399  70.742  1.00 49.13  ? 138 ALA F C     1 
ATOM   3768 O  O     . ALA B 1 139 ? -5.292  20.935  70.985  1.00 51.95  ? 138 ALA F O     1 
ATOM   3769 C  CB    . ALA B 1 139 ? -3.359  18.711  72.378  1.00 48.36  ? 138 ALA F CB    1 
ATOM   3770 N  N     . SER B 1 140 ? -3.839  20.037  69.521  1.00 44.15  ? 139 SER F N     1 
ATOM   3771 C  CA    . SER B 1 140 ? -4.752  20.087  68.390  1.00 46.83  ? 139 SER F CA    1 
ATOM   3772 C  C     . SER B 1 140 ? -5.013  18.661  67.927  1.00 47.16  ? 139 SER F C     1 
ATOM   3773 O  O     . SER B 1 140 ? -4.201  17.769  68.172  1.00 44.50  ? 139 SER F O     1 
ATOM   3774 C  CB    . SER B 1 140 ? -4.164  20.923  67.254  1.00 46.92  ? 139 SER F CB    1 
ATOM   3775 O  OG    . SER B 1 140 ? -3.984  22.270  67.656  1.00 50.75  ? 139 SER F OG    1 
ATOM   3776 N  N     . ALA B 1 141 ? -6.143  18.439  67.266  1.00 46.41  ? 140 ALA F N     1 
ATOM   3777 C  CA    . ALA B 1 141 ? -6.513  17.083  66.880  1.00 44.25  ? 140 ALA F CA    1 
ATOM   3778 C  C     . ALA B 1 141 ? -7.223  16.985  65.533  1.00 46.37  ? 140 ALA F C     1 
ATOM   3779 O  O     . ALA B 1 141 ? -7.969  17.883  65.128  1.00 45.97  ? 140 ALA F O     1 
ATOM   3780 C  CB    . ALA B 1 141 ? -7.353  16.432  67.972  1.00 40.97  ? 140 ALA F CB    1 
ATOM   3781 N  N     . GLY B 1 142 ? -6.978  15.875  64.846  1.00 45.39  ? 141 GLY F N     1 
ATOM   3782 C  CA    . GLY B 1 142 ? -7.662  15.581  63.603  1.00 45.95  ? 141 GLY F CA    1 
ATOM   3783 C  C     . GLY B 1 142 ? -8.458  14.297  63.726  1.00 49.31  ? 141 GLY F C     1 
ATOM   3784 O  O     . GLY B 1 142 ? -8.028  13.357  64.390  1.00 54.79  ? 141 GLY F O     1 
ATOM   3785 N  N     . VAL B 1 143 ? -9.627  14.260  63.097  1.00 50.36  ? 142 VAL F N     1 
ATOM   3786 C  CA    . VAL B 1 143 ? -10.451 13.057  63.099  1.00 46.09  ? 142 VAL F CA    1 
ATOM   3787 C  C     . VAL B 1 143 ? -10.827 12.677  61.672  1.00 44.32  ? 142 VAL F C     1 
ATOM   3788 O  O     . VAL B 1 143 ? -11.326 13.507  60.912  1.00 47.46  ? 142 VAL F O     1 
ATOM   3789 C  CB    . VAL B 1 143 ? -11.726 13.237  63.944  1.00 47.75  ? 142 VAL F CB    1 
ATOM   3790 C  CG1   . VAL B 1 143 ? -12.653 12.045  63.767  1.00 49.54  ? 142 VAL F CG1   1 
ATOM   3791 C  CG2   . VAL B 1 143 ? -11.366 13.427  65.411  1.00 45.84  ? 142 VAL F CG2   1 
ATOM   3792 N  N     . ALA B 1 144 ? -10.583 11.420  61.315  1.00 42.13  ? 143 ALA F N     1 
ATOM   3793 C  CA    . ALA B 1 144 ? -10.791 10.961  59.948  1.00 44.35  ? 143 ALA F CA    1 
ATOM   3794 C  C     . ALA B 1 144 ? -10.910 9.439   59.893  1.00 47.72  ? 143 ALA F C     1 
ATOM   3795 O  O     . ALA B 1 144 ? -10.510 8.752   60.832  1.00 53.63  ? 143 ALA F O     1 
ATOM   3796 C  CB    . ALA B 1 144 ? -9.647  11.440  59.068  1.00 40.73  ? 143 ALA F CB    1 
ATOM   3797 N  N     . PRO B 1 145 ? -11.479 8.908   58.798  1.00 49.95  ? 144 PRO F N     1 
ATOM   3798 C  CA    . PRO B 1 145 ? -11.552 7.452   58.628  1.00 53.88  ? 144 PRO F CA    1 
ATOM   3799 C  C     . PRO B 1 145 ? -10.173 6.803   58.535  1.00 51.40  ? 144 PRO F C     1 
ATOM   3800 O  O     . PRO B 1 145 ? -10.022 5.639   58.906  1.00 56.51  ? 144 PRO F O     1 
ATOM   3801 C  CB    . PRO B 1 145 ? -12.291 7.296   57.296  1.00 53.54  ? 144 PRO F CB    1 
ATOM   3802 C  CG    . PRO B 1 145 ? -13.098 8.535   57.168  1.00 53.60  ? 144 PRO F CG    1 
ATOM   3803 C  CD    . PRO B 1 145 ? -12.253 9.618   57.764  1.00 53.48  ? 144 PRO F CD    1 
ATOM   3804 N  N     . VAL B 1 146 ? -9.185  7.544   58.044  1.00 46.99  ? 145 VAL F N     1 
ATOM   3805 C  CA    . VAL B 1 146 ? -7.842  6.999   57.864  1.00 46.14  ? 145 VAL F CA    1 
ATOM   3806 C  C     . VAL B 1 146 ? -6.758  7.870   58.504  1.00 48.17  ? 145 VAL F C     1 
ATOM   3807 O  O     . VAL B 1 146 ? -7.042  8.947   59.029  1.00 50.51  ? 145 VAL F O     1 
ATOM   3808 C  CB    . VAL B 1 146 ? -7.516  6.780   56.374  1.00 46.25  ? 145 VAL F CB    1 
ATOM   3809 C  CG1   . VAL B 1 146 ? -8.416  5.705   55.786  1.00 48.34  ? 145 VAL F CG1   1 
ATOM   3810 C  CG2   . VAL B 1 146 ? -7.654  8.081   55.601  1.00 50.55  ? 145 VAL F CG2   1 
ATOM   3811 N  N     . LYS B 1 147 ? -5.518  7.394   58.447  1.00 54.39  ? 146 LYS F N     1 
ATOM   3812 C  CA    . LYS B 1 147 ? -4.392  8.046   59.117  1.00 47.57  ? 146 LYS F CA    1 
ATOM   3813 C  C     . LYS B 1 147 ? -4.044  9.430   58.575  1.00 44.16  ? 146 LYS F C     1 
ATOM   3814 O  O     . LYS B 1 147 ? -4.161  10.428  59.288  1.00 48.27  ? 146 LYS F O     1 
ATOM   3815 C  CB    . LYS B 1 147 ? -3.146  7.160   59.050  1.00 46.34  ? 146 LYS F CB    1 
ATOM   3816 C  CG    . LYS B 1 147 ? -3.082  6.058   60.091  1.00 53.84  ? 146 LYS F CG    1 
ATOM   3817 C  CD    . LYS B 1 147 ? -1.742  5.341   60.016  1.00 55.46  ? 146 LYS F CD    1 
ATOM   3818 C  CE    . LYS B 1 147 ? -1.501  4.469   61.235  1.00 54.52  ? 146 LYS F CE    1 
ATOM   3819 N  NZ    . LYS B 1 147 ? -0.144  3.857   61.210  1.00 54.72  ? 146 LYS F NZ    1 
ATOM   3820 N  N     . PHE B 1 148 ? -3.603  9.479   57.320  1.00 41.41  ? 147 PHE F N     1 
ATOM   3821 C  CA    . PHE B 1 148 ? -3.054  10.707  56.748  1.00 47.02  ? 147 PHE F CA    1 
ATOM   3822 C  C     . PHE B 1 148 ? -4.057  11.858  56.747  1.00 48.06  ? 147 PHE F C     1 
ATOM   3823 O  O     . PHE B 1 148 ? -3.675  13.017  56.899  1.00 47.34  ? 147 PHE F O     1 
ATOM   3824 C  CB    . PHE B 1 148 ? -2.492  10.457  55.342  1.00 43.57  ? 147 PHE F CB    1 
ATOM   3825 C  CG    . PHE B 1 148 ? -3.518  10.538  54.246  1.00 44.54  ? 147 PHE F CG    1 
ATOM   3826 C  CD1   . PHE B 1 148 ? -4.465  9.540   54.085  1.00 52.04  ? 147 PHE F CD1   1 
ATOM   3827 C  CD2   . PHE B 1 148 ? -3.518  11.604  53.361  1.00 46.64  ? 147 PHE F CD2   1 
ATOM   3828 C  CE1   . PHE B 1 148 ? -5.403  9.612   53.070  1.00 49.43  ? 147 PHE F CE1   1 
ATOM   3829 C  CE2   . PHE B 1 148 ? -4.453  11.682  52.344  1.00 45.96  ? 147 PHE F CE2   1 
ATOM   3830 C  CZ    . PHE B 1 148 ? -5.396  10.684  52.198  1.00 53.30  ? 147 PHE F CZ    1 
ATOM   3831 N  N     . LEU B 1 149 ? -5.337  11.533  56.597  1.00 45.29  ? 148 LEU F N     1 
ATOM   3832 C  CA    . LEU B 1 149 ? -6.384  12.546  56.639  1.00 43.75  ? 148 LEU F CA    1 
ATOM   3833 C  C     . LEU B 1 149 ? -6.544  13.113  58.047  1.00 46.99  ? 148 LEU F C     1 
ATOM   3834 O  O     . LEU B 1 149 ? -6.800  14.305  58.216  1.00 49.12  ? 148 LEU F O     1 
ATOM   3835 C  CB    . LEU B 1 149 ? -7.713  11.979  56.137  1.00 40.31  ? 148 LEU F CB    1 
ATOM   3836 C  CG    . LEU B 1 149 ? -7.834  11.784  54.626  1.00 41.18  ? 148 LEU F CG    1 
ATOM   3837 C  CD1   . LEU B 1 149 ? -9.235  11.330  54.257  1.00 42.34  ? 148 LEU F CD1   1 
ATOM   3838 C  CD2   . LEU B 1 149 ? -7.472  13.065  53.891  1.00 40.59  ? 148 LEU F CD2   1 
ATOM   3839 N  N     . ALA B 1 150 ? -6.397  12.258  59.055  1.00 41.42  ? 149 ALA F N     1 
ATOM   3840 C  CA    . ALA B 1 150 ? -6.455  12.702  60.443  1.00 45.47  ? 149 ALA F CA    1 
ATOM   3841 C  C     . ALA B 1 150 ? -5.242  13.579  60.752  1.00 50.61  ? 149 ALA F C     1 
ATOM   3842 O  O     . ALA B 1 150 ? -5.359  14.604  61.435  1.00 52.23  ? 149 ALA F O     1 
ATOM   3843 C  CB    . ALA B 1 150 ? -6.517  11.505  61.387  1.00 43.95  ? 149 ALA F CB    1 
ATOM   3844 N  N     . LYS B 1 151 ? -4.084  13.171  60.235  1.00 49.97  ? 150 LYS F N     1 
ATOM   3845 C  CA    . LYS B 1 151 ? -2.848  13.945  60.355  1.00 50.83  ? 150 LYS F CA    1 
ATOM   3846 C  C     . LYS B 1 151 ? -3.014  15.349  59.783  1.00 47.90  ? 150 LYS F C     1 
ATOM   3847 O  O     . LYS B 1 151 ? -2.728  16.348  60.455  1.00 46.18  ? 150 LYS F O     1 
ATOM   3848 C  CB    . LYS B 1 151 ? -1.701  13.234  59.633  1.00 50.06  ? 150 LYS F CB    1 
ATOM   3849 C  CG    . LYS B 1 151 ? -0.428  14.063  59.545  1.00 44.84  ? 150 LYS F CG    1 
ATOM   3850 C  CD    . LYS B 1 151 ? 0.255   14.162  60.897  1.00 57.40  ? 150 LYS F CD    1 
ATOM   3851 C  CE    . LYS B 1 151 ? 1.264   15.310  60.949  1.00 60.82  ? 150 LYS F CE    1 
ATOM   3852 N  NZ    . LYS B 1 151 ? 0.628   16.653  61.008  1.00 61.25  ? 150 LYS F NZ    1 
ATOM   3853 N  N     . ILE B 1 152 ? -3.487  15.410  58.542  1.00 44.19  ? 151 ILE F N     1 
ATOM   3854 C  CA    . ILE B 1 152 ? -3.722  16.677  57.866  1.00 43.58  ? 151 ILE F CA    1 
ATOM   3855 C  C     . ILE B 1 152 ? -4.742  17.516  58.634  1.00 47.54  ? 151 ILE F C     1 
ATOM   3856 O  O     . ILE B 1 152 ? -4.571  18.727  58.795  1.00 51.44  ? 151 ILE F O     1 
ATOM   3857 C  CB    . ILE B 1 152 ? -4.209  16.452  56.420  1.00 43.43  ? 151 ILE F CB    1 
ATOM   3858 C  CG1   . ILE B 1 152 ? -3.105  15.805  55.576  1.00 35.09  ? 151 ILE F CG1   1 
ATOM   3859 C  CG2   . ILE B 1 152 ? -4.657  17.765  55.789  1.00 45.75  ? 151 ILE F CG2   1 
ATOM   3860 C  CD1   . ILE B 1 152 ? -3.581  15.292  54.236  1.00 37.73  ? 151 ILE F CD1   1 
ATOM   3861 N  N     . ALA B 1 153 ? -5.791  16.859  59.118  1.00 43.09  ? 152 ALA F N     1 
ATOM   3862 C  CA    . ALA B 1 153 ? -6.857  17.534  59.848  1.00 48.05  ? 152 ALA F CA    1 
ATOM   3863 C  C     . ALA B 1 153 ? -6.365  18.159  61.151  1.00 50.35  ? 152 ALA F C     1 
ATOM   3864 O  O     . ALA B 1 153 ? -6.858  19.210  61.563  1.00 52.57  ? 152 ALA F O     1 
ATOM   3865 C  CB    . ALA B 1 153 ? -8.007  16.572  60.117  1.00 46.87  ? 152 ALA F CB    1 
ATOM   3866 N  N     . SER B 1 154 ? -5.400  17.512  61.799  1.00 50.34  ? 153 SER F N     1 
ATOM   3867 C  CA    . SER B 1 154 ? -4.854  18.029  63.052  1.00 49.46  ? 153 SER F CA    1 
ATOM   3868 C  C     . SER B 1 154 ? -4.153  19.371  62.846  1.00 49.76  ? 153 SER F C     1 
ATOM   3869 O  O     . SER B 1 154 ? -4.175  20.232  63.724  1.00 51.02  ? 153 SER F O     1 
ATOM   3870 C  CB    . SER B 1 154 ? -3.891  17.020  63.681  1.00 46.91  ? 153 SER F CB    1 
ATOM   3871 O  OG    . SER B 1 154 ? -2.780  16.781  62.836  1.00 50.74  ? 153 SER F OG    1 
ATOM   3872 N  N     . ASP B 1 155 ? -3.539  19.543  61.679  1.00 47.98  ? 154 ASP F N     1 
ATOM   3873 C  CA    . ASP B 1 155 ? -2.836  20.779  61.344  1.00 53.14  ? 154 ASP F CA    1 
ATOM   3874 C  C     . ASP B 1 155 ? -3.788  21.923  61.007  1.00 56.01  ? 154 ASP F C     1 
ATOM   3875 O  O     . ASP B 1 155 ? -3.407  23.093  61.066  1.00 61.42  ? 154 ASP F O     1 
ATOM   3876 C  CB    . ASP B 1 155 ? -1.910  20.547  60.148  1.00 54.74  ? 154 ASP F CB    1 
ATOM   3877 C  CG    . ASP B 1 155 ? -0.498  20.192  60.558  1.00 57.36  ? 154 ASP F CG    1 
ATOM   3878 O  OD1   . ASP B 1 155 ? -0.291  19.808  61.727  1.00 64.55  ? 154 ASP F OD1   1 
ATOM   3879 O  OD2   . ASP B 1 155 ? 0.407   20.295  59.704  1.00 68.43  ? 154 ASP F OD2   1 
ATOM   3880 N  N     . MET B 1 156 ? -5.024  21.579  60.654  1.00 57.62  ? 155 MET F N     1 
ATOM   3881 C  CA    . MET B 1 156 ? -5.946  22.540  60.047  1.00 54.75  ? 155 MET F CA    1 
ATOM   3882 C  C     . MET B 1 156 ? -6.642  23.500  61.021  1.00 54.36  ? 155 MET F C     1 
ATOM   3883 O  O     . MET B 1 156 ? -7.237  24.495  60.588  1.00 53.96  ? 155 MET F O     1 
ATOM   3884 C  CB    . MET B 1 156 ? -6.993  21.816  59.194  1.00 48.10  ? 155 MET F CB    1 
ATOM   3885 C  CG    . MET B 1 156 ? -6.439  21.196  57.926  1.00 42.85  ? 155 MET F CG    1 
ATOM   3886 S  SD    . MET B 1 156 ? -7.740  20.682  56.783  1.00 67.20  ? 155 MET F SD    1 
ATOM   3887 C  CE    . MET B 1 156 ? -8.759  22.156  56.809  1.00 57.49  ? 155 MET F CE    1 
ATOM   3888 N  N     . ASN B 1 157 ? -6.574  23.216  62.321  1.00 56.12  ? 156 ASN F N     1 
ATOM   3889 C  CA    . ASN B 1 157 ? -7.200  24.096  63.308  1.00 47.12  ? 156 ASN F CA    1 
ATOM   3890 C  C     . ASN B 1 157 ? -6.289  24.418  64.484  1.00 48.98  ? 156 ASN F C     1 
ATOM   3891 O  O     . ASN B 1 157 ? -6.754  24.590  65.608  1.00 54.69  ? 156 ASN F O     1 
ATOM   3892 C  CB    . ASN B 1 157 ? -8.518  23.499  63.813  1.00 55.72  ? 156 ASN F CB    1 
ATOM   3893 C  CG    . ASN B 1 157 ? -9.668  24.489  63.759  1.00 54.37  ? 156 ASN F CG    1 
ATOM   3894 O  OD1   . ASN B 1 157 ? -9.764  25.294  62.833  1.00 57.97  ? 156 ASN F OD1   1 
ATOM   3895 N  ND2   . ASN B 1 157 ? -10.539 24.443  64.762  1.00 53.27  ? 156 ASN F ND2   1 
ATOM   3896 N  N     . LYS B 1 158 ? -4.992  24.513  64.214  1.00 50.54  ? 157 LYS F N     1 
ATOM   3897 C  CA    . LYS B 1 158 ? -4.017  24.849  65.242  1.00 51.84  ? 157 LYS F CA    1 
ATOM   3898 C  C     . LYS B 1 158 ? -4.002  26.354  65.480  1.00 48.33  ? 157 LYS F C     1 
ATOM   3899 O  O     . LYS B 1 158 ? -4.225  27.132  64.551  1.00 53.00  ? 157 LYS F O     1 
ATOM   3900 C  CB    . LYS B 1 158 ? -2.623  24.373  64.827  1.00 50.64  ? 157 LYS F CB    1 
ATOM   3901 C  CG    . LYS B 1 158 ? -2.574  22.927  64.376  1.00 55.01  ? 157 LYS F CG    1 
ATOM   3902 C  CD    . LYS B 1 158 ? -1.146  22.490  64.095  1.00 62.68  ? 157 LYS F CD    1 
ATOM   3903 C  CE    . LYS B 1 158 ? -0.427  22.100  65.373  1.00 62.29  ? 157 LYS F CE    1 
ATOM   3904 N  NZ    . LYS B 1 158 ? -0.935  20.811  65.921  1.00 59.84  ? 157 LYS F NZ    1 
ATOM   3905 N  N     . PRO B 1 159 ? -3.741  26.774  66.728  1.00 51.65  ? 158 PRO F N     1 
ATOM   3906 C  CA    . PRO B 1 159 ? -3.520  25.903  67.885  1.00 52.23  ? 158 PRO F CA    1 
ATOM   3907 C  C     . PRO B 1 159 ? -4.803  25.669  68.672  1.00 51.54  ? 158 PRO F C     1 
ATOM   3908 O  O     . PRO B 1 159 ? -5.774  26.406  68.492  1.00 54.02  ? 158 PRO F O     1 
ATOM   3909 C  CB    . PRO B 1 159 ? -2.547  26.718  68.729  1.00 48.83  ? 158 PRO F CB    1 
ATOM   3910 C  CG    . PRO B 1 159 ? -2.970  28.128  68.481  1.00 47.97  ? 158 PRO F CG    1 
ATOM   3911 C  CD    . PRO B 1 159 ? -3.456  28.184  67.048  1.00 47.70  ? 158 PRO F CD    1 
ATOM   3912 N  N     . ASN B 1 160 ? -4.797  24.650  69.529  1.00 48.61  ? 159 ASN F N     1 
ATOM   3913 C  CA    . ASN B 1 160 ? -5.904  24.385  70.445  1.00 49.85  ? 159 ASN F CA    1 
ATOM   3914 C  C     . ASN B 1 160 ? -7.251  24.211  69.739  1.00 54.00  ? 159 ASN F C     1 
ATOM   3915 O  O     . ASN B 1 160 ? -8.258  24.790  70.146  1.00 55.34  ? 159 ASN F O     1 
ATOM   3916 C  CB    . ASN B 1 160 ? -5.986  25.492  71.504  1.00 53.61  ? 159 ASN F CB    1 
ATOM   3917 C  CG    . ASN B 1 160 ? -6.785  25.079  72.725  1.00 53.76  ? 159 ASN F CG    1 
ATOM   3918 O  OD1   . ASN B 1 160 ? -7.211  23.931  72.846  1.00 55.48  ? 159 ASN F OD1   1 
ATOM   3919 N  ND2   . ASN B 1 160 ? -6.984  26.017  73.645  1.00 48.77  ? 159 ASN F ND2   1 
ATOM   3920 N  N     . GLY B 1 161 ? -7.263  23.409  68.678  1.00 47.36  ? 160 GLY F N     1 
ATOM   3921 C  CA    . GLY B 1 161 ? -8.482  23.174  67.926  1.00 51.24  ? 160 GLY F CA    1 
ATOM   3922 C  C     . GLY B 1 161 ? -8.532  21.815  67.256  1.00 53.94  ? 160 GLY F C     1 
ATOM   3923 O  O     . GLY B 1 161 ? -7.518  21.128  67.139  1.00 51.38  ? 160 GLY F O     1 
ATOM   3924 N  N     . GLN B 1 162 ? -9.723  21.426  66.816  1.00 54.32  ? 161 GLN F N     1 
ATOM   3925 C  CA    . GLN B 1 162 ? -9.914  20.153  66.133  1.00 48.76  ? 161 GLN F CA    1 
ATOM   3926 C  C     . GLN B 1 162 ? -10.387 20.353  64.707  1.00 47.48  ? 161 GLN F C     1 
ATOM   3927 O  O     . GLN B 1 162 ? -10.890 21.418  64.350  1.00 55.52  ? 161 GLN F O     1 
ATOM   3928 C  CB    . GLN B 1 162 ? -10.951 19.302  66.862  1.00 45.31  ? 161 GLN F CB    1 
ATOM   3929 C  CG    . GLN B 1 162 ? -10.455 18.651  68.124  1.00 45.82  ? 161 GLN F CG    1 
ATOM   3930 C  CD    . GLN B 1 162 ? -11.567 18.437  69.125  1.00 55.79  ? 161 GLN F CD    1 
ATOM   3931 O  OE1   . GLN B 1 162 ? -11.495 18.915  70.255  1.00 58.25  ? 161 GLN F OE1   1 
ATOM   3932 N  NE2   . GLN B 1 162 ? -12.608 17.723  68.713  1.00 54.80  ? 161 GLN F NE2   1 
ATOM   3933 N  N     . PHE B 1 163 ? -10.228 19.317  63.894  1.00 46.01  ? 162 PHE F N     1 
ATOM   3934 C  CA    . PHE B 1 163 ? -10.883 19.289  62.593  1.00 46.83  ? 162 PHE F CA    1 
ATOM   3935 C  C     . PHE B 1 163 ? -11.306 17.870  62.245  1.00 51.68  ? 162 PHE F C     1 
ATOM   3936 O  O     . PHE B 1 163 ? -10.532 16.924  62.397  1.00 50.39  ? 162 PHE F O     1 
ATOM   3937 C  CB    . PHE B 1 163 ? -9.991  19.873  61.498  1.00 50.43  ? 162 PHE F CB    1 
ATOM   3938 C  CG    . PHE B 1 163 ? -10.674 19.986  60.166  1.00 53.12  ? 162 PHE F CG    1 
ATOM   3939 C  CD1   . PHE B 1 163 ? -10.385 19.097  59.145  1.00 52.13  ? 162 PHE F CD1   1 
ATOM   3940 C  CD2   . PHE B 1 163 ? -11.619 20.973  59.941  1.00 57.44  ? 162 PHE F CD2   1 
ATOM   3941 C  CE1   . PHE B 1 163 ? -11.017 19.198  57.920  1.00 54.69  ? 162 PHE F CE1   1 
ATOM   3942 C  CE2   . PHE B 1 163 ? -12.255 21.079  58.719  1.00 52.91  ? 162 PHE F CE2   1 
ATOM   3943 C  CZ    . PHE B 1 163 ? -11.954 20.189  57.707  1.00 58.87  ? 162 PHE F CZ    1 
ATOM   3944 N  N     . VAL B 1 164 ? -12.544 17.727  61.786  1.00 51.90  ? 163 VAL F N     1 
ATOM   3945 C  CA    . VAL B 1 164 ? -13.100 16.414  61.498  1.00 47.24  ? 163 VAL F CA    1 
ATOM   3946 C  C     . VAL B 1 164 ? -13.434 16.253  60.020  1.00 48.73  ? 163 VAL F C     1 
ATOM   3947 O  O     . VAL B 1 164 ? -14.045 17.131  59.410  1.00 56.09  ? 163 VAL F O     1 
ATOM   3948 C  CB    . VAL B 1 164 ? -14.371 16.151  62.328  1.00 44.07  ? 163 VAL F CB    1 
ATOM   3949 C  CG1   . VAL B 1 164 ? -14.862 14.727  62.113  1.00 43.80  ? 163 VAL F CG1   1 
ATOM   3950 C  CG2   . VAL B 1 164 ? -14.102 16.406  63.803  1.00 40.78  ? 163 VAL F CG2   1 
ATOM   3951 N  N     . ILE B 1 165 ? -13.017 15.128  59.449  1.00 51.22  ? 164 ILE F N     1 
ATOM   3952 C  CA    . ILE B 1 165 ? -13.399 14.770  58.092  1.00 48.70  ? 164 ILE F CA    1 
ATOM   3953 C  C     . ILE B 1 165 ? -14.219 13.487  58.124  1.00 53.36  ? 164 ILE F C     1 
ATOM   3954 O  O     . ILE B 1 165 ? -13.746 12.450  58.587  1.00 50.56  ? 164 ILE F O     1 
ATOM   3955 C  CB    . ILE B 1 165 ? -12.172 14.554  57.190  1.00 47.18  ? 164 ILE F CB    1 
ATOM   3956 C  CG1   . ILE B 1 165 ? -11.239 15.764  57.253  1.00 48.49  ? 164 ILE F CG1   1 
ATOM   3957 C  CG2   . ILE B 1 165 ? -12.607 14.281  55.757  1.00 41.03  ? 164 ILE F CG2   1 
ATOM   3958 C  CD1   . ILE B 1 165 ? -10.006 15.630  56.386  1.00 48.41  ? 164 ILE F CD1   1 
ATOM   3959 N  N     . THR B 1 166 ? -15.454 13.567  57.642  1.00 53.50  ? 165 THR F N     1 
ATOM   3960 C  CA    . THR B 1 166 ? -16.325 12.402  57.573  1.00 47.51  ? 165 THR F CA    1 
ATOM   3961 C  C     . THR B 1 166 ? -16.218 11.786  56.181  1.00 49.44  ? 165 THR F C     1 
ATOM   3962 O  O     . THR B 1 166 ? -15.840 12.475  55.233  1.00 46.95  ? 165 THR F O     1 
ATOM   3963 C  CB    . THR B 1 166 ? -17.790 12.785  57.863  1.00 52.38  ? 165 THR F CB    1 
ATOM   3964 O  OG1   . THR B 1 166 ? -18.357 13.429  56.716  1.00 51.56  ? 165 THR F OG1   1 
ATOM   3965 C  CG2   . THR B 1 166 ? -17.871 13.716  59.066  1.00 50.28  ? 165 THR F CG2   1 
ATOM   3966 N  N     . PRO B 1 167 ? -16.535 10.483  56.054  1.00 56.02  ? 166 PRO F N     1 
ATOM   3967 C  CA    . PRO B 1 167 ? -16.493 9.788   54.761  1.00 48.22  ? 166 PRO F CA    1 
ATOM   3968 C  C     . PRO B 1 167 ? -17.243 10.515  53.645  1.00 45.93  ? 166 PRO F C     1 
ATOM   3969 O  O     . PRO B 1 167 ? -16.891 10.364  52.475  1.00 49.54  ? 166 PRO F O     1 
ATOM   3970 C  CB    . PRO B 1 167 ? -17.173 8.454   55.071  1.00 50.27  ? 166 PRO F CB    1 
ATOM   3971 C  CG    . PRO B 1 167 ? -16.827 8.202   56.492  1.00 42.40  ? 166 PRO F CG    1 
ATOM   3972 C  CD    . PRO B 1 167 ? -16.826 9.551   57.161  1.00 47.51  ? 166 PRO F CD    1 
ATOM   3973 N  N     . ALA B 1 168 ? -18.257 11.296  54.005  1.00 50.59  ? 167 ALA F N     1 
ATOM   3974 C  CA    . ALA B 1 168 ? -19.022 12.059  53.025  1.00 51.95  ? 167 ALA F CA    1 
ATOM   3975 C  C     . ALA B 1 168 ? -18.269 13.308  52.571  1.00 50.54  ? 167 ALA F C     1 
ATOM   3976 O  O     . ALA B 1 168 ? -18.451 13.778  51.448  1.00 50.39  ? 167 ALA F O     1 
ATOM   3977 C  CB    . ALA B 1 168 ? -20.384 12.434  53.593  1.00 50.34  ? 167 ALA F CB    1 
ATOM   3978 N  N     . GLU B 1 169 ? -17.421 13.838  53.447  1.00 51.78  ? 168 GLU F N     1 
ATOM   3979 C  CA    . GLU B 1 169 ? -16.668 15.054  53.154  1.00 47.90  ? 168 GLU F CA    1 
ATOM   3980 C  C     . GLU B 1 169 ? -15.368 14.757  52.411  1.00 48.71  ? 168 GLU F C     1 
ATOM   3981 O  O     . GLU B 1 169 ? -14.711 15.669  51.907  1.00 51.63  ? 168 GLU F O     1 
ATOM   3982 C  CB    . GLU B 1 169 ? -16.346 15.806  54.447  1.00 49.82  ? 168 GLU F CB    1 
ATOM   3983 C  CG    . GLU B 1 169 ? -17.553 16.133  55.305  1.00 45.24  ? 168 GLU F CG    1 
ATOM   3984 C  CD    . GLU B 1 169 ? -17.165 16.747  56.636  1.00 58.12  ? 168 GLU F CD    1 
ATOM   3985 O  OE1   . GLU B 1 169 ? -17.983 16.694  57.579  1.00 67.00  ? 168 GLU F OE1   1 
ATOM   3986 O  OE2   . GLU B 1 169 ? -16.042 17.284  56.740  1.00 67.14  ? 168 GLU F OE2   1 
ATOM   3987 N  N     . VAL B 1 170 ? -15.003 13.481  52.350  1.00 44.86  ? 169 VAL F N     1 
ATOM   3988 C  CA    . VAL B 1 170 ? -13.715 13.067  51.787  1.00 46.91  ? 169 VAL F CA    1 
ATOM   3989 C  C     . VAL B 1 170 ? -13.426 13.497  50.335  1.00 48.85  ? 169 VAL F C     1 
ATOM   3990 O  O     . VAL B 1 170 ? -12.380 14.092  50.082  1.00 50.12  ? 169 VAL F O     1 
ATOM   3991 C  CB    . VAL B 1 170 ? -13.462 11.546  51.971  1.00 45.92  ? 169 VAL F CB    1 
ATOM   3992 C  CG1   . VAL B 1 170 ? -12.202 11.120  51.237  1.00 40.68  ? 169 VAL F CG1   1 
ATOM   3993 C  CG2   . VAL B 1 170 ? -13.362 11.201  53.448  1.00 38.76  ? 169 VAL F CG2   1 
ATOM   3994 N  N     . PRO B 1 171 ? -14.338 13.209  49.382  1.00 47.93  ? 170 PRO F N     1 
ATOM   3995 C  CA    . PRO B 1 171 ? -14.014 13.526  47.981  1.00 49.06  ? 170 PRO F CA    1 
ATOM   3996 C  C     . PRO B 1 171 ? -13.765 15.014  47.724  1.00 53.38  ? 170 PRO F C     1 
ATOM   3997 O  O     . PRO B 1 171 ? -12.789 15.371  47.053  1.00 53.31  ? 170 PRO F O     1 
ATOM   3998 C  CB    . PRO B 1 171 ? -15.265 13.069  47.221  1.00 47.92  ? 170 PRO F CB    1 
ATOM   3999 C  CG    . PRO B 1 171 ? -15.907 12.066  48.110  1.00 42.72  ? 170 PRO F CG    1 
ATOM   4000 C  CD    . PRO B 1 171 ? -15.659 12.564  49.496  1.00 44.25  ? 170 PRO F CD    1 
ATOM   4001 N  N     . ALA B 1 172 ? -14.641 15.865  48.251  1.00 52.54  ? 171 ALA F N     1 
ATOM   4002 C  CA    . ALA B 1 172 ? -14.505 17.308  48.092  1.00 47.16  ? 171 ALA F CA    1 
ATOM   4003 C  C     . ALA B 1 172 ? -13.207 17.806  48.720  1.00 49.50  ? 171 ALA F C     1 
ATOM   4004 O  O     . ALA B 1 172 ? -12.550 18.700  48.186  1.00 52.13  ? 171 ALA F O     1 
ATOM   4005 C  CB    . ALA B 1 172 ? -15.701 18.023  48.702  1.00 45.36  ? 171 ALA F CB    1 
ATOM   4006 N  N     . PHE B 1 173 ? -12.845 17.218  49.856  1.00 45.47  ? 172 PHE F N     1 
ATOM   4007 C  CA    . PHE B 1 173 ? -11.600 17.551  50.535  1.00 50.06  ? 172 PHE F CA    1 
ATOM   4008 C  C     . PHE B 1 173 ? -10.403 17.159  49.674  1.00 53.44  ? 172 PHE F C     1 
ATOM   4009 O  O     . PHE B 1 173 ? -9.413  17.886  49.602  1.00 61.46  ? 172 PHE F O     1 
ATOM   4010 C  CB    . PHE B 1 173 ? -11.530 16.839  51.890  1.00 47.15  ? 172 PHE F CB    1 
ATOM   4011 C  CG    . PHE B 1 173 ? -10.312 17.188  52.701  1.00 52.90  ? 172 PHE F CG    1 
ATOM   4012 C  CD1   . PHE B 1 173 ? -9.153  16.435  52.597  1.00 48.21  ? 172 PHE F CD1   1 
ATOM   4013 C  CD2   . PHE B 1 173 ? -10.330 18.263  53.575  1.00 62.70  ? 172 PHE F CD2   1 
ATOM   4014 C  CE1   . PHE B 1 173 ? -8.032  16.753  53.344  1.00 52.11  ? 172 PHE F CE1   1 
ATOM   4015 C  CE2   . PHE B 1 173 ? -9.213  18.585  54.325  1.00 54.19  ? 172 PHE F CE2   1 
ATOM   4016 C  CZ    . PHE B 1 173 ? -8.063  17.828  54.209  1.00 50.24  ? 172 PHE F CZ    1 
ATOM   4017 N  N     . LEU B 1 174 ? -10.506 16.007  49.020  1.00 49.41  ? 173 LEU F N     1 
ATOM   4018 C  CA    . LEU B 1 174 ? -9.418  15.478  48.206  1.00 53.57  ? 173 LEU F CA    1 
ATOM   4019 C  C     . LEU B 1 174 ? -9.214  16.265  46.918  1.00 56.03  ? 173 LEU F C     1 
ATOM   4020 O  O     . LEU B 1 174 ? -8.086  16.401  46.445  1.00 54.73  ? 173 LEU F O     1 
ATOM   4021 C  CB    . LEU B 1 174 ? -9.667  14.008  47.865  1.00 53.94  ? 173 LEU F CB    1 
ATOM   4022 C  CG    . LEU B 1 174 ? -9.570  12.983  48.993  1.00 54.84  ? 173 LEU F CG    1 
ATOM   4023 C  CD1   . LEU B 1 174 ? -9.899  11.599  48.460  1.00 55.95  ? 173 LEU F CD1   1 
ATOM   4024 C  CD2   . LEU B 1 174 ? -8.188  13.004  49.625  1.00 50.92  ? 173 LEU F CD2   1 
ATOM   4025 N  N     . GLN B 1 175 ? -10.308 16.769  46.351  1.00 54.64  ? 174 GLN F N     1 
ATOM   4026 C  CA    . GLN B 1 175 ? -10.257 17.467  45.065  1.00 57.89  ? 174 GLN F CA    1 
ATOM   4027 C  C     . GLN B 1 175 ? -9.238  18.606  45.012  1.00 53.31  ? 174 GLN F C     1 
ATOM   4028 O  O     . GLN B 1 175 ? -8.523  18.758  44.022  1.00 55.67  ? 174 GLN F O     1 
ATOM   4029 C  CB    . GLN B 1 175 ? -11.642 17.986  44.668  1.00 57.70  ? 174 GLN F CB    1 
ATOM   4030 C  CG    . GLN B 1 175 ? -12.410 17.050  43.750  1.00 48.98  ? 174 GLN F CG    1 
ATOM   4031 C  CD    . GLN B 1 175 ? -11.668 16.765  42.457  1.00 50.56  ? 174 GLN F CD    1 
ATOM   4032 O  OE1   . GLN B 1 175 ? -11.021 17.646  41.891  1.00 55.41  ? 174 GLN F OE1   1 
ATOM   4033 N  NE2   . GLN B 1 175 ? -11.753 15.526  41.987  1.00 61.30  ? 174 GLN F NE2   1 
ATOM   4034 N  N     . THR B 1 176 ? -9.171  19.396  46.078  1.00 53.69  ? 175 THR F N     1 
ATOM   4035 C  CA    . THR B 1 176 ? -8.271  20.545  46.115  1.00 57.89  ? 175 THR F CA    1 
ATOM   4036 C  C     . THR B 1 176 ? -7.104  20.352  47.079  1.00 59.53  ? 175 THR F C     1 
ATOM   4037 O  O     . THR B 1 176 ? -6.342  21.284  47.329  1.00 66.21  ? 175 THR F O     1 
ATOM   4038 C  CB    . THR B 1 176 ? -9.022  21.837  46.488  1.00 60.11  ? 175 THR F CB    1 
ATOM   4039 O  OG1   . THR B 1 176 ? -9.835  21.601  47.644  1.00 58.29  ? 175 THR F OG1   1 
ATOM   4040 C  CG2   . THR B 1 176 ? -9.907  22.289  45.337  1.00 58.53  ? 175 THR F CG2   1 
ATOM   4041 N  N     . LEU B 1 177 ? -6.969  19.143  47.615  1.00 58.24  ? 176 LEU F N     1 
ATOM   4042 C  CA    . LEU B 1 177 ? -5.894  18.832  48.551  1.00 54.83  ? 176 LEU F CA    1 
ATOM   4043 C  C     . LEU B 1 177 ? -4.562  18.736  47.812  1.00 54.37  ? 176 LEU F C     1 
ATOM   4044 O  O     . LEU B 1 177 ? -4.370  17.840  46.992  1.00 51.61  ? 176 LEU F O     1 
ATOM   4045 C  CB    . LEU B 1 177 ? -6.196  17.521  49.285  1.00 55.96  ? 176 LEU F CB    1 
ATOM   4046 C  CG    . LEU B 1 177 ? -5.458  17.196  50.589  1.00 51.49  ? 176 LEU F CG    1 
ATOM   4047 C  CD1   . LEU B 1 177 ? -4.078  16.604  50.335  1.00 51.58  ? 176 LEU F CD1   1 
ATOM   4048 C  CD2   . LEU B 1 177 ? -5.359  18.433  51.471  1.00 54.50  ? 176 LEU F CD2   1 
ATOM   4049 N  N     . PRO B 1 178 ? -3.636  19.664  48.104  1.00 57.82  ? 177 PRO F N     1 
ATOM   4050 C  CA    . PRO B 1 178 ? -2.321  19.675  47.456  1.00 54.55  ? 177 PRO F CA    1 
ATOM   4051 C  C     . PRO B 1 178 ? -1.509  18.455  47.865  1.00 49.81  ? 177 PRO F C     1 
ATOM   4052 O  O     . PRO B 1 178 ? -1.520  18.092  49.042  1.00 45.95  ? 177 PRO F O     1 
ATOM   4053 C  CB    . PRO B 1 178 ? -1.663  20.943  48.013  1.00 49.22  ? 177 PRO F CB    1 
ATOM   4054 C  CG    . PRO B 1 178 ? -2.792  21.767  48.555  1.00 54.92  ? 177 PRO F CG    1 
ATOM   4055 C  CD    . PRO B 1 178 ? -3.782  20.772  49.061  1.00 50.27  ? 177 PRO F CD    1 
ATOM   4056 N  N     . LEU B 1 179 ? -0.822  17.838  46.908  1.00 45.21  ? 178 LEU F N     1 
ATOM   4057 C  CA    . LEU B 1 179 ? -0.018  16.650  47.179  1.00 46.44  ? 178 LEU F CA    1 
ATOM   4058 C  C     . LEU B 1 179 ? 0.981   16.893  48.310  1.00 49.98  ? 178 LEU F C     1 
ATOM   4059 O  O     . LEU B 1 179 ? 1.153   16.049  49.190  1.00 46.42  ? 178 LEU F O     1 
ATOM   4060 C  CB    . LEU B 1 179 ? 0.704   16.187  45.910  1.00 46.61  ? 178 LEU F CB    1 
ATOM   4061 C  CG    . LEU B 1 179 ? -0.227  15.799  44.758  1.00 53.20  ? 178 LEU F CG    1 
ATOM   4062 C  CD1   . LEU B 1 179 ? 0.559   15.357  43.535  1.00 49.03  ? 178 LEU F CD1   1 
ATOM   4063 C  CD2   . LEU B 1 179 ? -1.196  14.712  45.204  1.00 50.04  ? 178 LEU F CD2   1 
ATOM   4064 N  N     . ALA B 1 180 ? 1.610   18.065  48.292  1.00 52.87  ? 179 ALA F N     1 
ATOM   4065 C  CA    . ALA B 1 180 ? 2.606   18.447  49.293  1.00 46.06  ? 179 ALA F CA    1 
ATOM   4066 C  C     . ALA B 1 180 ? 2.106   18.340  50.736  1.00 48.33  ? 179 ALA F C     1 
ATOM   4067 O  O     . ALA B 1 180 ? 2.902   18.240  51.670  1.00 50.94  ? 179 ALA F O     1 
ATOM   4068 C  CB    . ALA B 1 180 ? 3.114   19.855  49.013  1.00 44.06  ? 179 ALA F CB    1 
ATOM   4069 N  N     . LYS B 1 181 ? 0.789   18.362  50.913  1.00 51.47  ? 180 LYS F N     1 
ATOM   4070 C  CA    . LYS B 1 181 ? 0.188   18.265  52.239  1.00 48.36  ? 180 LYS F CA    1 
ATOM   4071 C  C     . LYS B 1 181 ? 0.134   16.824  52.741  1.00 47.20  ? 180 LYS F C     1 
ATOM   4072 O  O     . LYS B 1 181 ? -0.077  16.579  53.928  1.00 45.20  ? 180 LYS F O     1 
ATOM   4073 C  CB    . LYS B 1 181 ? -1.216  18.873  52.234  1.00 51.76  ? 180 LYS F CB    1 
ATOM   4074 C  CG    . LYS B 1 181 ? -1.296  20.287  52.790  1.00 57.54  ? 180 LYS F CG    1 
ATOM   4075 C  CD    . LYS B 1 181 ? -1.799  20.283  54.227  1.00 63.01  ? 180 LYS F CD    1 
ATOM   4076 C  CE    . LYS B 1 181 ? -2.005  21.697  54.753  1.00 73.16  ? 180 LYS F CE    1 
ATOM   4077 N  NZ    . LYS B 1 181 ? -2.631  21.708  56.107  1.00 65.88  ? 180 LYS F NZ    1 
ATOM   4078 N  N     . ILE B 1 182 ? 0.324   15.875  51.830  1.00 43.55  ? 181 ILE F N     1 
ATOM   4079 C  CA    . ILE B 1 182 ? 0.328   14.460  52.187  1.00 49.10  ? 181 ILE F CA    1 
ATOM   4080 C  C     . ILE B 1 182 ? 1.640   14.078  52.861  1.00 47.84  ? 181 ILE F C     1 
ATOM   4081 O  O     . ILE B 1 182 ? 2.715   14.342  52.322  1.00 53.53  ? 181 ILE F O     1 
ATOM   4082 C  CB    . ILE B 1 182 ? 0.131   13.563  50.949  1.00 44.85  ? 181 ILE F CB    1 
ATOM   4083 C  CG1   . ILE B 1 182 ? -1.159  13.934  50.216  1.00 41.96  ? 181 ILE F CG1   1 
ATOM   4084 C  CG2   . ILE B 1 182 ? 0.121   12.094  51.344  1.00 43.21  ? 181 ILE F CG2   1 
ATOM   4085 C  CD1   . ILE B 1 182 ? -1.376  13.149  48.942  1.00 47.33  ? 181 ILE F CD1   1 
ATOM   4086 N  N     . PRO B 1 183 ? 1.555   13.460  54.050  1.00 44.16  ? 182 PRO F N     1 
ATOM   4087 C  CA    . PRO B 1 183 ? 2.744   12.989  54.766  1.00 46.55  ? 182 PRO F CA    1 
ATOM   4088 C  C     . PRO B 1 183 ? 3.534   11.996  53.926  1.00 51.14  ? 182 PRO F C     1 
ATOM   4089 O  O     . PRO B 1 183 ? 3.000   10.957  53.536  1.00 51.42  ? 182 PRO F O     1 
ATOM   4090 C  CB    . PRO B 1 183 ? 2.157   12.279  55.987  1.00 37.78  ? 182 PRO F CB    1 
ATOM   4091 C  CG    . PRO B 1 183 ? 0.834   12.918  56.194  1.00 49.40  ? 182 PRO F CG    1 
ATOM   4092 C  CD    . PRO B 1 183 ? 0.321   13.226  54.819  1.00 44.51  ? 182 PRO F CD    1 
ATOM   4093 N  N     . GLY B 1 184 ? 4.791   12.318  53.647  1.00 49.37  ? 183 GLY F N     1 
ATOM   4094 C  CA    . GLY B 1 184 ? 5.632   11.440  52.859  1.00 51.89  ? 183 GLY F CA    1 
ATOM   4095 C  C     . GLY B 1 184 ? 6.111   12.071  51.570  1.00 46.67  ? 183 GLY F C     1 
ATOM   4096 O  O     . GLY B 1 184 ? 7.040   11.571  50.941  1.00 50.57  ? 183 GLY F O     1 
ATOM   4097 N  N     . VAL B 1 185 ? 5.473   13.162  51.160  1.00 50.37  ? 184 VAL F N     1 
ATOM   4098 C  CA    . VAL B 1 185 ? 5.939   13.892  49.988  1.00 59.66  ? 184 VAL F CA    1 
ATOM   4099 C  C     . VAL B 1 185 ? 6.455   15.272  50.397  1.00 58.25  ? 184 VAL F C     1 
ATOM   4100 O  O     . VAL B 1 185 ? 5.797   16.019  51.127  1.00 55.52  ? 184 VAL F O     1 
ATOM   4101 C  CB    . VAL B 1 185 ? 4.888   13.918  48.829  1.00 53.90  ? 184 VAL F CB    1 
ATOM   4102 C  CG1   . VAL B 1 185 ? 3.844   12.826  49.037  1.00 53.70  ? 184 VAL F CG1   1 
ATOM   4103 C  CG2   . VAL B 1 185 ? 4.231   15.288  48.667  1.00 44.16  ? 184 VAL F CG2   1 
ATOM   4104 N  N     . GLY B 1 186 ? 7.673   15.570  49.962  1.00 53.24  ? 185 GLY F N     1 
ATOM   4105 C  CA    . GLY B 1 186 ? 8.332   16.806  50.332  1.00 54.98  ? 185 GLY F CA    1 
ATOM   4106 C  C     . GLY B 1 186 ? 8.706   17.614  49.110  1.00 57.12  ? 185 GLY F C     1 
ATOM   4107 O  O     . GLY B 1 186 ? 8.198   17.363  48.019  1.00 54.34  ? 185 GLY F O     1 
ATOM   4108 N  N     . LYS B 1 187 ? 9.607   18.574  49.300  1.00 58.84  ? 186 LYS F N     1 
ATOM   4109 C  CA    . LYS B 1 187 ? 10.003  19.504  48.246  1.00 51.39  ? 186 LYS F CA    1 
ATOM   4110 C  C     . LYS B 1 187 ? 10.414  18.810  46.952  1.00 53.47  ? 186 LYS F C     1 
ATOM   4111 O  O     . LYS B 1 187 ? 9.954   19.177  45.872  1.00 57.73  ? 186 LYS F O     1 
ATOM   4112 C  CB    . LYS B 1 187 ? 11.139  20.405  48.735  1.00 56.15  ? 186 LYS F CB    1 
ATOM   4113 C  CG    . LYS B 1 187 ? 10.813  21.171  50.003  1.00 70.81  ? 186 LYS F CG    1 
ATOM   4114 C  CD    . LYS B 1 187 ? 11.929  22.133  50.368  1.00 87.26  ? 186 LYS F CD    1 
ATOM   4115 C  CE    . LYS B 1 187 ? 12.129  23.178  49.282  1.00 81.53  ? 186 LYS F CE    1 
ATOM   4116 N  NZ    . LYS B 1 187 ? 13.191  24.158  49.641  1.00 75.33  ? 186 LYS F NZ    1 
ATOM   4117 N  N     . VAL B 1 188 ? 11.274  17.803  47.070  1.00 51.67  ? 187 VAL F N     1 
ATOM   4118 C  CA    . VAL B 1 188 ? 11.781  17.089  45.904  1.00 59.15  ? 187 VAL F CA    1 
ATOM   4119 C  C     . VAL B 1 188 ? 10.654  16.433  45.113  1.00 51.05  ? 187 VAL F C     1 
ATOM   4120 O  O     . VAL B 1 188 ? 10.513  16.660  43.910  1.00 58.87  ? 187 VAL F O     1 
ATOM   4121 C  CB    . VAL B 1 188 ? 12.816  16.018  46.299  1.00 53.99  ? 187 VAL F CB    1 
ATOM   4122 C  CG1   . VAL B 1 188 ? 13.226  15.199  45.083  1.00 43.40  ? 187 VAL F CG1   1 
ATOM   4123 C  CG2   . VAL B 1 188 ? 14.030  16.668  46.947  1.00 45.37  ? 187 VAL F CG2   1 
ATOM   4124 N  N     . SER B 1 189 ? 9.849   15.629  45.799  1.00 55.04  ? 188 SER F N     1 
ATOM   4125 C  CA    . SER B 1 189 ? 8.747   14.927  45.153  1.00 57.63  ? 188 SER F CA    1 
ATOM   4126 C  C     . SER B 1 189 ? 7.637   15.875  44.711  1.00 52.51  ? 188 SER F C     1 
ATOM   4127 O  O     . SER B 1 189 ? 7.049   15.684  43.652  1.00 56.79  ? 188 SER F O     1 
ATOM   4128 C  CB    . SER B 1 189 ? 8.181   13.841  46.071  1.00 56.16  ? 188 SER F CB    1 
ATOM   4129 O  OG    . SER B 1 189 ? 9.166   12.871  46.378  1.00 54.15  ? 188 SER F OG    1 
ATOM   4130 N  N     . ALA B 1 190 ? 7.352   16.894  45.517  1.00 49.74  ? 189 ALA F N     1 
ATOM   4131 C  CA    . ALA B 1 190 ? 6.288   17.840  45.186  1.00 56.41  ? 189 ALA F CA    1 
ATOM   4132 C  C     . ALA B 1 190 ? 6.640   18.685  43.966  1.00 61.20  ? 189 ALA F C     1 
ATOM   4133 O  O     . ALA B 1 190 ? 5.763   19.054  43.186  1.00 59.56  ? 189 ALA F O     1 
ATOM   4134 C  CB    . ALA B 1 190 ? 5.965   18.733  46.375  1.00 43.40  ? 189 ALA F CB    1 
ATOM   4135 N  N     . ALA B 1 191 ? 7.924   18.991  43.808  1.00 60.03  ? 190 ALA F N     1 
ATOM   4136 C  CA    . ALA B 1 191 ? 8.386   19.770  42.664  1.00 59.62  ? 190 ALA F CA    1 
ATOM   4137 C  C     . ALA B 1 191 ? 8.558   18.879  41.438  1.00 65.67  ? 190 ALA F C     1 
ATOM   4138 O  O     . ALA B 1 191 ? 8.390   19.329  40.304  1.00 68.19  ? 190 ALA F O     1 
ATOM   4139 C  CB    . ALA B 1 191 ? 9.684   20.487  42.992  1.00 61.23  ? 190 ALA F CB    1 
ATOM   4140 N  N     . LYS B 1 192 ? 8.900   17.616  41.676  1.00 66.56  ? 191 LYS F N     1 
ATOM   4141 C  CA    . LYS B 1 192 ? 8.950   16.617  40.615  1.00 63.33  ? 191 LYS F CA    1 
ATOM   4142 C  C     . LYS B 1 192 ? 7.551   16.436  40.038  1.00 58.09  ? 191 LYS F C     1 
ATOM   4143 O  O     . LYS B 1 192 ? 7.375   16.284  38.829  1.00 62.40  ? 191 LYS F O     1 
ATOM   4144 C  CB    . LYS B 1 192 ? 9.464   15.287  41.171  1.00 59.39  ? 191 LYS F CB    1 
ATOM   4145 C  CG    . LYS B 1 192 ? 9.458   14.125  40.184  1.00 63.16  ? 191 LYS F CG    1 
ATOM   4146 C  CD    . LYS B 1 192 ? 10.679  14.145  39.279  1.00 74.95  ? 191 LYS F CD    1 
ATOM   4147 C  CE    . LYS B 1 192 ? 10.860  12.811  38.564  1.00 78.47  ? 191 LYS F CE    1 
ATOM   4148 N  NZ    . LYS B 1 192 ? 9.680   12.451  37.729  1.00 77.62  ? 191 LYS F NZ    1 
ATOM   4149 N  N     . LEU B 1 193 ? 6.560   16.468  40.924  1.00 57.34  ? 192 LEU F N     1 
ATOM   4150 C  CA    . LEU B 1 193 ? 5.161   16.284  40.556  1.00 59.09  ? 192 LEU F CA    1 
ATOM   4151 C  C     . LEU B 1 193 ? 4.568   17.540  39.936  1.00 64.42  ? 192 LEU F C     1 
ATOM   4152 O  O     . LEU B 1 193 ? 3.708   17.464  39.058  1.00 68.40  ? 192 LEU F O     1 
ATOM   4153 C  CB    . LEU B 1 193 ? 4.345   15.891  41.787  1.00 58.38  ? 192 LEU F CB    1 
ATOM   4154 C  CG    . LEU B 1 193 ? 4.479   14.445  42.259  1.00 58.09  ? 192 LEU F CG    1 
ATOM   4155 C  CD1   . LEU B 1 193 ? 4.060   14.320  43.714  1.00 53.64  ? 192 LEU F CD1   1 
ATOM   4156 C  CD2   . LEU B 1 193 ? 3.639   13.542  41.377  1.00 63.93  ? 192 LEU F CD2   1 
ATOM   4157 N  N     . GLU B 1 194 ? 5.023   18.697  40.406  1.00 70.38  ? 193 GLU F N     1 
ATOM   4158 C  CA    . GLU B 1 194 ? 4.528   19.973  39.909  1.00 66.26  ? 193 GLU F CA    1 
ATOM   4159 C  C     . GLU B 1 194 ? 4.921   20.164  38.450  1.00 71.16  ? 193 GLU F C     1 
ATOM   4160 O  O     . GLU B 1 194 ? 4.200   20.798  37.680  1.00 79.64  ? 193 GLU F O     1 
ATOM   4161 C  CB    . GLU B 1 194 ? 5.087   21.122  40.748  1.00 69.73  ? 193 GLU F CB    1 
ATOM   4162 C  CG    . GLU B 1 194 ? 4.370   22.446  40.551  1.00 75.03  ? 193 GLU F CG    1 
ATOM   4163 C  CD    . GLU B 1 194 ? 3.211   22.630  41.511  1.00 81.83  ? 193 GLU F CD    1 
ATOM   4164 O  OE1   . GLU B 1 194 ? 3.366   22.290  42.703  1.00 76.99  ? 193 GLU F OE1   1 
ATOM   4165 O  OE2   . GLU B 1 194 ? 2.145   23.114  41.076  1.00 83.09  ? 193 GLU F OE2   1 
ATOM   4166 N  N     . ALA B 1 195 ? 6.068   19.605  38.076  1.00 68.26  ? 194 ALA F N     1 
ATOM   4167 C  CA    . ALA B 1 195 ? 6.603   19.771  36.730  1.00 66.69  ? 194 ALA F CA    1 
ATOM   4168 C  C     . ALA B 1 195 ? 6.102   18.706  35.755  1.00 67.88  ? 194 ALA F C     1 
ATOM   4169 O  O     . ALA B 1 195 ? 6.546   18.647  34.609  1.00 77.08  ? 194 ALA F O     1 
ATOM   4170 C  CB    . ALA B 1 195 ? 8.125   19.795  36.762  1.00 72.05  ? 194 ALA F CB    1 
ATOM   4171 N  N     . MET B 1 196 ? 5.189   17.859  36.216  1.00 61.43  ? 195 MET F N     1 
ATOM   4172 C  CA    . MET B 1 196 ? 4.492   16.943  35.320  1.00 63.92  ? 195 MET F CA    1 
ATOM   4173 C  C     . MET B 1 196 ? 2.995   17.232  35.344  1.00 68.38  ? 195 MET F C     1 
ATOM   4174 O  O     . MET B 1 196 ? 2.192   16.477  34.796  1.00 69.90  ? 195 MET F O     1 
ATOM   4175 C  CB    . MET B 1 196 ? 4.782   15.477  35.663  1.00 65.90  ? 195 MET F CB    1 
ATOM   4176 C  CG    . MET B 1 196 ? 4.770   15.150  37.143  1.00 67.45  ? 195 MET F CG    1 
ATOM   4177 S  SD    . MET B 1 196 ? 4.928   13.381  37.456  1.00 76.06  ? 195 MET F SD    1 
ATOM   4178 C  CE    . MET B 1 196 ? 6.258   12.954  36.336  1.00 67.07  ? 195 MET F CE    1 
ATOM   4179 N  N     . GLY B 1 197 ? 2.632   18.340  35.984  1.00 68.56  ? 196 GLY F N     1 
ATOM   4180 C  CA    . GLY B 1 197 ? 1.260   18.811  35.987  1.00 65.75  ? 196 GLY F CA    1 
ATOM   4181 C  C     . GLY B 1 197 ? 0.474   18.473  37.239  1.00 66.09  ? 196 GLY F C     1 
ATOM   4182 O  O     . GLY B 1 197 ? -0.666  18.911  37.394  1.00 67.48  ? 196 GLY F O     1 
ATOM   4183 N  N     . LEU B 1 198 ? 1.075   17.697  38.135  1.00 66.06  ? 197 LEU F N     1 
ATOM   4184 C  CA    . LEU B 1 198 ? 0.372   17.259  39.339  1.00 64.28  ? 197 LEU F CA    1 
ATOM   4185 C  C     . LEU B 1 198 ? 0.599   18.196  40.522  1.00 64.66  ? 197 LEU F C     1 
ATOM   4186 O  O     . LEU B 1 198 ? 1.737   18.461  40.908  1.00 64.64  ? 197 LEU F O     1 
ATOM   4187 C  CB    . LEU B 1 198 ? 0.761   15.826  39.715  1.00 62.82  ? 197 LEU F CB    1 
ATOM   4188 C  CG    . LEU B 1 198 ? 0.250   14.685  38.827  1.00 70.99  ? 197 LEU F CG    1 
ATOM   4189 C  CD1   . LEU B 1 198 ? -0.865  15.153  37.896  1.00 66.59  ? 197 LEU F CD1   1 
ATOM   4190 C  CD2   . LEU B 1 198 ? 1.387   14.049  38.041  1.00 63.45  ? 197 LEU F CD2   1 
ATOM   4191 N  N     . ARG B 1 199 ? -0.494  18.688  41.094  1.00 61.89  ? 198 ARG F N     1 
ATOM   4192 C  CA    . ARG B 1 199 ? -0.419  19.583  42.241  1.00 54.79  ? 198 ARG F CA    1 
ATOM   4193 C  C     . ARG B 1 199 ? -1.367  19.133  43.347  1.00 52.93  ? 198 ARG F C     1 
ATOM   4194 O  O     . ARG B 1 199 ? -1.034  19.207  44.529  1.00 48.61  ? 198 ARG F O     1 
ATOM   4195 C  CB    . ARG B 1 199 ? -0.748  21.018  41.827  1.00 59.58  ? 198 ARG F CB    1 
ATOM   4196 C  CG    . ARG B 1 199 ? -0.402  22.055  42.882  1.00 60.45  ? 198 ARG F CG    1 
ATOM   4197 C  CD    . ARG B 1 199 ? -0.914  23.435  42.504  1.00 57.84  ? 198 ARG F CD    1 
ATOM   4198 N  NE    . ARG B 1 199 ? -2.368  23.526  42.607  1.00 54.89  ? 198 ARG F NE    1 
ATOM   4199 C  CZ    . ARG B 1 199 ? -3.020  23.758  43.742  1.00 60.30  ? 198 ARG F CZ    1 
ATOM   4200 N  NH1   . ARG B 1 199 ? -2.348  23.918  44.874  1.00 56.92  ? 198 ARG F NH1   1 
ATOM   4201 N  NH2   . ARG B 1 199 ? -4.345  23.827  43.747  1.00 51.30  ? 198 ARG F NH2   1 
ATOM   4202 N  N     . THR B 1 200 ? -2.548  18.668  42.955  1.00 59.58  ? 199 THR F N     1 
ATOM   4203 C  CA    . THR B 1 200 ? -3.554  18.223  43.913  1.00 57.43  ? 199 THR F CA    1 
ATOM   4204 C  C     . THR B 1 200 ? -3.825  16.730  43.790  1.00 53.94  ? 199 THR F C     1 
ATOM   4205 O  O     . THR B 1 200 ? -3.388  16.087  42.835  1.00 53.44  ? 199 THR F O     1 
ATOM   4206 C  CB    . THR B 1 200 ? -4.883  18.977  43.727  1.00 56.23  ? 199 THR F CB    1 
ATOM   4207 O  OG1   . THR B 1 200 ? -5.344  18.810  42.380  1.00 65.62  ? 199 THR F OG1   1 
ATOM   4208 C  CG2   . THR B 1 200 ? -4.703  20.457  44.017  1.00 51.62  ? 199 THR F CG2   1 
ATOM   4209 N  N     . CYS B 1 201 ? -4.548  16.184  44.763  1.00 54.73  ? 200 CYS F N     1 
ATOM   4210 C  CA    . CYS B 1 201 ? -4.952  14.786  44.718  1.00 54.89  ? 200 CYS F CA    1 
ATOM   4211 C  C     . CYS B 1 201 ? -5.902  14.564  43.550  1.00 58.70  ? 200 CYS F C     1 
ATOM   4212 O  O     . CYS B 1 201 ? -5.887  13.508  42.918  1.00 61.65  ? 200 CYS F O     1 
ATOM   4213 C  CB    . CYS B 1 201 ? -5.623  14.373  46.029  1.00 58.28  ? 200 CYS F CB    1 
ATOM   4214 S  SG    . CYS B 1 201 ? -4.531  14.394  47.469  1.00 57.87  ? 200 CYS F SG    1 
ATOM   4215 N  N     . GLY B 1 202 ? -6.721  15.573  43.267  1.00 60.55  ? 201 GLY F N     1 
ATOM   4216 C  CA    . GLY B 1 202 ? -7.654  15.522  42.158  1.00 54.45  ? 201 GLY F CA    1 
ATOM   4217 C  C     . GLY B 1 202 ? -6.958  15.335  40.823  1.00 56.85  ? 201 GLY F C     1 
ATOM   4218 O  O     . GLY B 1 202 ? -7.483  14.675  39.928  1.00 61.39  ? 201 GLY F O     1 
ATOM   4219 N  N     . ASP B 1 203 ? -5.771  15.919  40.691  1.00 57.86  ? 202 ASP F N     1 
ATOM   4220 C  CA    . ASP B 1 203 ? -4.977  15.766  39.478  1.00 59.83  ? 202 ASP F CA    1 
ATOM   4221 C  C     . ASP B 1 203 ? -4.475  14.334  39.333  1.00 63.97  ? 202 ASP F C     1 
ATOM   4222 O  O     . ASP B 1 203 ? -4.426  13.792  38.229  1.00 70.49  ? 202 ASP F O     1 
ATOM   4223 C  CB    . ASP B 1 203 ? -3.796  16.738  39.476  1.00 64.43  ? 202 ASP F CB    1 
ATOM   4224 C  CG    . ASP B 1 203 ? -4.227  18.181  39.307  1.00 65.84  ? 202 ASP F CG    1 
ATOM   4225 O  OD1   . ASP B 1 203 ? -5.301  18.417  38.715  1.00 71.78  ? 202 ASP F OD1   1 
ATOM   4226 O  OD2   . ASP B 1 203 ? -3.488  19.079  39.763  1.00 64.01  ? 202 ASP F OD2   1 
ATOM   4227 N  N     . VAL B 1 204 ? -4.104  13.726  40.456  1.00 62.92  ? 203 VAL F N     1 
ATOM   4228 C  CA    . VAL B 1 204 ? -3.611  12.353  40.463  1.00 64.00  ? 203 VAL F CA    1 
ATOM   4229 C  C     . VAL B 1 204 ? -4.750  11.372  40.193  1.00 65.15  ? 203 VAL F C     1 
ATOM   4230 O  O     . VAL B 1 204 ? -4.545  10.311  39.599  1.00 65.51  ? 203 VAL F O     1 
ATOM   4231 C  CB    . VAL B 1 204 ? -2.914  12.020  41.800  1.00 57.36  ? 203 VAL F CB    1 
ATOM   4232 C  CG1   . VAL B 1 204 ? -2.441  10.574  41.825  1.00 59.66  ? 203 VAL F CG1   1 
ATOM   4233 C  CG2   . VAL B 1 204 ? -1.745  12.961  42.027  1.00 58.24  ? 203 VAL F CG2   1 
ATOM   4234 N  N     . GLN B 1 205 ? -5.956  11.745  40.613  1.00 60.94  ? 204 GLN F N     1 
ATOM   4235 C  CA    . GLN B 1 205 ? -7.145  10.938  40.354  1.00 60.64  ? 204 GLN F CA    1 
ATOM   4236 C  C     . GLN B 1 205 ? -7.396  10.781  38.856  1.00 60.79  ? 204 GLN F C     1 
ATOM   4237 O  O     . GLN B 1 205 ? -8.043  9.829   38.422  1.00 63.40  ? 204 GLN F O     1 
ATOM   4238 C  CB    . GLN B 1 205 ? -8.370  11.555  41.031  1.00 52.11  ? 204 GLN F CB    1 
ATOM   4239 C  CG    . GLN B 1 205 ? -8.323  11.518  42.550  1.00 53.65  ? 204 GLN F CG    1 
ATOM   4240 C  CD    . GLN B 1 205 ? -9.498  12.231  43.191  1.00 61.60  ? 204 GLN F CD    1 
ATOM   4241 O  OE1   . GLN B 1 205 ? -10.376 12.750  42.502  1.00 61.76  ? 204 GLN F OE1   1 
ATOM   4242 N  NE2   . GLN B 1 205 ? -9.518  12.260  44.519  1.00 59.74  ? 204 GLN F NE2   1 
ATOM   4243 N  N     . ALA B 1 206 ? -6.877  11.719  38.071  1.00 58.78  ? 205 ALA F N     1 
ATOM   4244 C  CA    . ALA B 1 206 ? -7.010  11.668  36.620  1.00 61.40  ? 205 ALA F CA    1 
ATOM   4245 C  C     . ALA B 1 206 ? -5.750  11.106  35.968  1.00 66.54  ? 205 ALA F C     1 
ATOM   4246 O  O     . ALA B 1 206 ? -5.525  11.294  34.773  1.00 68.80  ? 205 ALA F O     1 
ATOM   4247 C  CB    . ALA B 1 206 ? -7.320  13.052  36.068  1.00 54.94  ? 205 ALA F CB    1 
ATOM   4248 N  N     . CYS B 1 207 ? -4.933  10.413  36.756  1.00 67.46  ? 206 CYS F N     1 
ATOM   4249 C  CA    . CYS B 1 207 ? -3.680  9.857   36.254  1.00 68.73  ? 206 CYS F CA    1 
ATOM   4250 C  C     . CYS B 1 207 ? -3.677  8.333   36.218  1.00 74.79  ? 206 CYS F C     1 
ATOM   4251 O  O     . CYS B 1 207 ? -4.420  7.678   36.951  1.00 71.72  ? 206 CYS F O     1 
ATOM   4252 C  CB    . CYS B 1 207 ? -2.494  10.358  37.080  1.00 71.40  ? 206 CYS F CB    1 
ATOM   4253 S  SG    . CYS B 1 207 ? -2.037  12.069  36.748  1.00 84.75  ? 206 CYS F SG    1 
ATOM   4254 N  N     . ASP B 1 208 ? -2.829  7.779   35.358  1.00 73.35  ? 207 ASP F N     1 
ATOM   4255 C  CA    . ASP B 1 208 ? -2.699  6.335   35.217  1.00 65.99  ? 207 ASP F CA    1 
ATOM   4256 C  C     . ASP B 1 208 ? -1.771  5.773   36.288  1.00 67.87  ? 207 ASP F C     1 
ATOM   4257 O  O     . ASP B 1 208 ? -0.667  6.279   36.495  1.00 69.16  ? 207 ASP F O     1 
ATOM   4258 C  CB    . ASP B 1 208 ? -2.173  5.985   33.823  1.00 65.21  ? 207 ASP F CB    1 
ATOM   4259 C  CG    . ASP B 1 208 ? -2.066  4.490   33.597  1.00 74.44  ? 207 ASP F CG    1 
ATOM   4260 O  OD1   . ASP B 1 208 ? -2.854  3.734   34.205  1.00 74.07  ? 207 ASP F OD1   1 
ATOM   4261 O  OD2   . ASP B 1 208 ? -1.196  4.070   32.805  1.00 76.55  ? 207 ASP F OD2   1 
ATOM   4262 N  N     . LEU B 1 209 ? -2.229  4.725   36.967  1.00 65.96  ? 208 LEU F N     1 
ATOM   4263 C  CA    . LEU B 1 209 ? -1.452  4.088   38.023  1.00 58.75  ? 208 LEU F CA    1 
ATOM   4264 C  C     . LEU B 1 209 ? -0.163  3.483   37.479  1.00 63.28  ? 208 LEU F C     1 
ATOM   4265 O  O     . LEU B 1 209 ? 0.870   3.500   38.147  1.00 61.07  ? 208 LEU F O     1 
ATOM   4266 C  CB    . LEU B 1 209 ? -2.282  3.005   38.717  1.00 58.83  ? 208 LEU F CB    1 
ATOM   4267 C  CG    . LEU B 1 209 ? -1.578  2.186   39.803  1.00 55.96  ? 208 LEU F CG    1 
ATOM   4268 C  CD1   . LEU B 1 209 ? -1.280  3.044   41.024  1.00 56.36  ? 208 LEU F CD1   1 
ATOM   4269 C  CD2   . LEU B 1 209 ? -2.404  0.967   40.185  1.00 53.71  ? 208 LEU F CD2   1 
ATOM   4270 N  N     . VAL B 1 210 ? -0.230  2.953   36.262  1.00 65.26  ? 209 VAL F N     1 
ATOM   4271 C  CA    . VAL B 1 210 ? 0.915   2.293   35.645  1.00 62.90  ? 209 VAL F CA    1 
ATOM   4272 C  C     . VAL B 1 210 ? 2.065   3.269   35.415  1.00 68.48  ? 209 VAL F C     1 
ATOM   4273 O  O     . VAL B 1 210 ? 3.229   2.933   35.635  1.00 71.05  ? 209 VAL F O     1 
ATOM   4274 C  CB    . VAL B 1 210 ? 0.530   1.632   34.309  1.00 65.41  ? 209 VAL F CB    1 
ATOM   4275 C  CG1   . VAL B 1 210 ? 1.583   0.615   33.900  1.00 60.09  ? 209 VAL F CG1   1 
ATOM   4276 C  CG2   . VAL B 1 210 ? -0.833  0.968   34.424  1.00 66.95  ? 209 VAL F CG2   1 
ATOM   4277 N  N     . MET B 1 211 ? 1.732   4.479   34.974  1.00 69.09  ? 210 MET F N     1 
ATOM   4278 C  CA    . MET B 1 211 ? 2.735   5.518   34.776  1.00 72.63  ? 210 MET F CA    1 
ATOM   4279 C  C     . MET B 1 211 ? 3.326   5.940   36.112  1.00 73.71  ? 210 MET F C     1 
ATOM   4280 O  O     . MET B 1 211 ? 4.534   6.137   36.234  1.00 73.30  ? 210 MET F O     1 
ATOM   4281 C  CB    . MET B 1 211 ? 2.124   6.736   34.085  1.00 72.16  ? 210 MET F CB    1 
ATOM   4282 C  CG    . MET B 1 211 ? 3.140   7.814   33.740  1.00 74.03  ? 210 MET F CG    1 
ATOM   4283 S  SD    . MET B 1 211 ? 2.436   9.474   33.741  1.00 106.35 ? 210 MET F SD    1 
ATOM   4284 C  CE    . MET B 1 211 ? 2.186   9.733   35.495  1.00 71.81  ? 210 MET F CE    1 
ATOM   4285 N  N     . LEU B 1 212 ? 2.457   6.079   37.109  1.00 69.51  ? 211 LEU F N     1 
ATOM   4286 C  CA    . LEU B 1 212 ? 2.863   6.470   38.453  1.00 70.27  ? 211 LEU F CA    1 
ATOM   4287 C  C     . LEU B 1 212 ? 3.840   5.459   39.046  1.00 70.55  ? 211 LEU F C     1 
ATOM   4288 O  O     . LEU B 1 212 ? 4.772   5.827   39.763  1.00 67.14  ? 211 LEU F O     1 
ATOM   4289 C  CB    . LEU B 1 212 ? 1.630   6.608   39.348  1.00 65.48  ? 211 LEU F CB    1 
ATOM   4290 C  CG    . LEU B 1 212 ? 1.358   7.971   39.989  1.00 70.50  ? 211 LEU F CG    1 
ATOM   4291 C  CD1   . LEU B 1 212 ? 2.001   9.093   39.190  1.00 66.29  ? 211 LEU F CD1   1 
ATOM   4292 C  CD2   . LEU B 1 212 ? -0.141  8.196   40.107  1.00 64.77  ? 211 LEU F CD2   1 
ATOM   4293 N  N     . LEU B 1 213 ? 3.621   4.186   38.736  1.00 66.74  ? 212 LEU F N     1 
ATOM   4294 C  CA    . LEU B 1 213 ? 4.495   3.113   39.194  1.00 65.12  ? 212 LEU F CA    1 
ATOM   4295 C  C     . LEU B 1 213 ? 5.803   3.107   38.408  1.00 67.28  ? 212 LEU F C     1 
ATOM   4296 O  O     . LEU B 1 213 ? 6.879   2.919   38.977  1.00 64.54  ? 212 LEU F O     1 
ATOM   4297 C  CB    . LEU B 1 213 ? 3.789   1.762   39.060  1.00 59.64  ? 212 LEU F CB    1 
ATOM   4298 C  CG    . LEU B 1 213 ? 2.606   1.525   40.003  1.00 60.01  ? 212 LEU F CG    1 
ATOM   4299 C  CD1   . LEU B 1 213 ? 1.842   0.270   39.615  1.00 49.82  ? 212 LEU F CD1   1 
ATOM   4300 C  CD2   . LEU B 1 213 ? 3.079   1.435   41.444  1.00 62.92  ? 212 LEU F CD2   1 
ATOM   4301 N  N     . LYS B 1 214 ? 5.706   3.324   37.100  1.00 68.54  ? 213 LYS F N     1 
ATOM   4302 C  CA    . LYS B 1 214 ? 6.889   3.381   36.247  1.00 69.49  ? 213 LYS F CA    1 
ATOM   4303 C  C     . LYS B 1 214 ? 7.762   4.593   36.550  1.00 71.51  ? 213 LYS F C     1 
ATOM   4304 O  O     . LYS B 1 214 ? 8.936   4.625   36.173  1.00 76.37  ? 213 LYS F O     1 
ATOM   4305 C  CB    . LYS B 1 214 ? 6.490   3.402   34.773  1.00 72.81  ? 213 LYS F CB    1 
ATOM   4306 C  CG    . LYS B 1 214 ? 6.120   2.048   34.221  1.00 73.05  ? 213 LYS F CG    1 
ATOM   4307 C  CD    . LYS B 1 214 ? 5.684   2.152   32.766  1.00 74.43  ? 213 LYS F CD    1 
ATOM   4308 C  CE    . LYS B 1 214 ? 4.495   3.093   32.590  1.00 78.52  ? 213 LYS F CE    1 
ATOM   4309 N  NZ    . LYS B 1 214 ? 3.939   3.048   31.205  1.00 73.17  ? 213 LYS F NZ    1 
ATOM   4310 N  N     . ARG B 1 215 ? 7.190   5.581   37.233  1.00 70.98  ? 214 ARG F N     1 
ATOM   4311 C  CA    . ARG B 1 215 ? 7.888   6.835   37.488  1.00 66.59  ? 214 ARG F CA    1 
ATOM   4312 C  C     . ARG B 1 215 ? 8.396   6.942   38.923  1.00 68.55  ? 214 ARG F C     1 
ATOM   4313 O  O     . ARG B 1 215 ? 9.488   7.454   39.163  1.00 75.93  ? 214 ARG F O     1 
ATOM   4314 C  CB    . ARG B 1 215 ? 6.972   8.023   37.182  1.00 67.43  ? 214 ARG F CB    1 
ATOM   4315 C  CG    . ARG B 1 215 ? 7.669   9.184   36.486  1.00 75.38  ? 214 ARG F CG    1 
ATOM   4316 C  CD    . ARG B 1 215 ? 7.728   8.963   34.982  1.00 83.61  ? 214 ARG F CD    1 
ATOM   4317 N  NE    . ARG B 1 215 ? 6.565   9.528   34.303  1.00 92.14  ? 214 ARG F NE    1 
ATOM   4318 C  CZ    . ARG B 1 215 ? 6.569   10.695  33.667  1.00 89.51  ? 214 ARG F CZ    1 
ATOM   4319 N  NH1   . ARG B 1 215 ? 7.678   11.421  33.615  1.00 92.51  ? 214 ARG F NH1   1 
ATOM   4320 N  NH2   . ARG B 1 215 ? 5.466   11.136  33.078  1.00 82.36  ? 214 ARG F NH2   1 
ATOM   4321 N  N     . PHE B 1 216 ? 7.602   6.460   39.875  1.00 63.58  ? 215 PHE F N     1 
ATOM   4322 C  CA    . PHE B 1 216 ? 7.905   6.662   41.289  1.00 63.54  ? 215 PHE F CA    1 
ATOM   4323 C  C     . PHE B 1 216 ? 7.995   5.365   42.087  1.00 63.49  ? 215 PHE F C     1 
ATOM   4324 O  O     . PHE B 1 216 ? 8.329   5.385   43.272  1.00 61.56  ? 215 PHE F O     1 
ATOM   4325 C  CB    . PHE B 1 216 ? 6.859   7.583   41.921  1.00 64.89  ? 215 PHE F CB    1 
ATOM   4326 C  CG    . PHE B 1 216 ? 6.808   8.950   41.307  1.00 67.91  ? 215 PHE F CG    1 
ATOM   4327 C  CD1   . PHE B 1 216 ? 7.973   9.651   41.047  1.00 74.11  ? 215 PHE F CD1   1 
ATOM   4328 C  CD2   . PHE B 1 216 ? 5.595   9.532   40.980  1.00 66.13  ? 215 PHE F CD2   1 
ATOM   4329 C  CE1   . PHE B 1 216 ? 7.930   10.910  40.480  1.00 74.97  ? 215 PHE F CE1   1 
ATOM   4330 C  CE2   . PHE B 1 216 ? 5.545   10.788  40.411  1.00 64.59  ? 215 PHE F CE2   1 
ATOM   4331 C  CZ    . PHE B 1 216 ? 6.713   11.479  40.162  1.00 73.85  ? 215 PHE F CZ    1 
ATOM   4332 N  N     . GLY B 1 217 ? 7.698   4.242   41.442  1.00 59.07  ? 216 GLY F N     1 
ATOM   4333 C  CA    . GLY B 1 217 ? 7.710   2.961   42.125  1.00 52.10  ? 216 GLY F CA    1 
ATOM   4334 C  C     . GLY B 1 217 ? 6.559   2.844   43.105  1.00 56.12  ? 216 GLY F C     1 
ATOM   4335 O  O     . GLY B 1 217 ? 5.448   3.289   42.818  1.00 61.06  ? 216 GLY F O     1 
ATOM   4336 N  N     . LYS B 1 218 ? 6.826   2.250   44.265  1.00 54.39  ? 217 LYS F N     1 
ATOM   4337 C  CA    . LYS B 1 218 ? 5.803   2.081   45.296  1.00 60.07  ? 217 LYS F CA    1 
ATOM   4338 C  C     . LYS B 1 218 ? 5.252   3.428   45.765  1.00 57.88  ? 217 LYS F C     1 
ATOM   4339 O  O     . LYS B 1 218 ? 4.084   3.535   46.149  1.00 58.99  ? 217 LYS F O     1 
ATOM   4340 C  CB    . LYS B 1 218 ? 6.350   1.264   46.474  1.00 51.91  ? 217 LYS F CB    1 
ATOM   4341 C  CG    . LYS B 1 218 ? 6.076   1.861   47.847  1.00 54.13  ? 217 LYS F CG    1 
ATOM   4342 C  CD    . LYS B 1 218 ? 5.946   0.782   48.913  1.00 62.02  ? 217 LYS F CD    1 
ATOM   4343 C  CE    . LYS B 1 218 ? 7.188   -0.090  48.989  1.00 61.26  ? 217 LYS F CE    1 
ATOM   4344 N  NZ    . LYS B 1 218 ? 7.053   -1.137  50.041  1.00 59.57  ? 217 LYS F NZ    1 
ATOM   4345 N  N     . PHE B 1 219 ? 6.097   4.453   45.710  1.00 61.10  ? 218 PHE F N     1 
ATOM   4346 C  CA    . PHE B 1 219 ? 5.694   5.815   46.046  1.00 58.35  ? 218 PHE F CA    1 
ATOM   4347 C  C     . PHE B 1 219 ? 4.550   6.288   45.154  1.00 54.40  ? 218 PHE F C     1 
ATOM   4348 O  O     . PHE B 1 219 ? 3.674   7.031   45.598  1.00 54.87  ? 218 PHE F O     1 
ATOM   4349 C  CB    . PHE B 1 219 ? 6.887   6.767   45.923  1.00 51.84  ? 218 PHE F CB    1 
ATOM   4350 C  CG    . PHE B 1 219 ? 6.538   8.211   46.153  1.00 55.88  ? 218 PHE F CG    1 
ATOM   4351 C  CD1   . PHE B 1 219 ? 6.418   8.712   47.438  1.00 52.52  ? 218 PHE F CD1   1 
ATOM   4352 C  CD2   . PHE B 1 219 ? 6.341   9.069   45.083  1.00 57.20  ? 218 PHE F CD2   1 
ATOM   4353 C  CE1   . PHE B 1 219 ? 6.100   10.040  47.652  1.00 53.36  ? 218 PHE F CE1   1 
ATOM   4354 C  CE2   . PHE B 1 219 ? 6.023   10.397  45.290  1.00 57.29  ? 218 PHE F CE2   1 
ATOM   4355 C  CZ    . PHE B 1 219 ? 5.903   10.884  46.576  1.00 57.40  ? 218 PHE F CZ    1 
ATOM   4356 N  N     . GLY B 1 220 ? 4.565   5.856   43.897  1.00 49.57  ? 219 GLY F N     1 
ATOM   4357 C  CA    . GLY B 1 220 ? 3.508   6.190   42.960  1.00 57.50  ? 219 GLY F CA    1 
ATOM   4358 C  C     . GLY B 1 220 ? 2.184   5.567   43.357  1.00 58.80  ? 219 GLY F C     1 
ATOM   4359 O  O     . GLY B 1 220 ? 1.137   6.215   43.293  1.00 58.53  ? 219 GLY F O     1 
ATOM   4360 N  N     . ARG B 1 221 ? 2.232   4.303   43.768  1.00 54.87  ? 220 ARG F N     1 
ATOM   4361 C  CA    . ARG B 1 221 ? 1.041   3.604   44.232  1.00 54.11  ? 220 ARG F CA    1 
ATOM   4362 C  C     . ARG B 1 221 ? 0.485   4.263   45.485  1.00 52.00  ? 220 ARG F C     1 
ATOM   4363 O  O     . ARG B 1 221 ? -0.721  4.495   45.587  1.00 57.34  ? 220 ARG F O     1 
ATOM   4364 C  CB    . ARG B 1 221 ? 1.345   2.132   44.517  1.00 55.68  ? 220 ARG F CB    1 
ATOM   4365 C  CG    . ARG B 1 221 ? 0.233   1.414   45.266  1.00 52.97  ? 220 ARG F CG    1 
ATOM   4366 C  CD    . ARG B 1 221 ? 0.510   -0.072  45.391  1.00 55.25  ? 220 ARG F CD    1 
ATOM   4367 N  NE    . ARG B 1 221 ? 0.579   -0.721  44.085  1.00 56.75  ? 220 ARG F NE    1 
ATOM   4368 C  CZ    . ARG B 1 221 ? -0.482  -1.134  43.400  1.00 52.90  ? 220 ARG F CZ    1 
ATOM   4369 N  NH1   . ARG B 1 221 ? -1.700  -0.962  43.894  1.00 52.56  ? 220 ARG F NH1   1 
ATOM   4370 N  NH2   . ARG B 1 221 ? -0.326  -1.715  42.219  1.00 52.61  ? 220 ARG F NH2   1 
ATOM   4371 N  N     . ILE B 1 222 ? 1.370   4.553   46.434  1.00 47.21  ? 221 ILE F N     1 
ATOM   4372 C  CA    . ILE B 1 222 ? 0.985   5.238   47.663  1.00 50.91  ? 221 ILE F CA    1 
ATOM   4373 C  C     . ILE B 1 222 ? 0.284   6.546   47.328  1.00 54.67  ? 221 ILE F C     1 
ATOM   4374 O  O     . ILE B 1 222 ? -0.812  6.816   47.813  1.00 54.89  ? 221 ILE F O     1 
ATOM   4375 C  CB    . ILE B 1 222 ? 2.208   5.545   48.548  1.00 51.80  ? 221 ILE F CB    1 
ATOM   4376 C  CG1   . ILE B 1 222 ? 2.841   4.249   49.058  1.00 57.44  ? 221 ILE F CG1   1 
ATOM   4377 C  CG2   . ILE B 1 222 ? 1.807   6.428   49.720  1.00 51.24  ? 221 ILE F CG2   1 
ATOM   4378 C  CD1   . ILE B 1 222 ? 1.972   3.490   50.036  1.00 56.90  ? 221 ILE F CD1   1 
ATOM   4379 N  N     . LEU B 1 223 ? 0.927   7.338   46.477  1.00 51.11  ? 222 LEU F N     1 
ATOM   4380 C  CA    . LEU B 1 223 ? 0.403   8.624   46.036  1.00 50.26  ? 222 LEU F CA    1 
ATOM   4381 C  C     . LEU B 1 223 ? -1.002  8.480   45.453  1.00 52.66  ? 222 LEU F C     1 
ATOM   4382 O  O     . LEU B 1 223 ? -1.927  9.198   45.843  1.00 51.30  ? 222 LEU F O     1 
ATOM   4383 C  CB    . LEU B 1 223 ? 1.346   9.216   44.989  1.00 51.85  ? 222 LEU F CB    1 
ATOM   4384 C  CG    . LEU B 1 223 ? 1.298   10.716  44.713  1.00 59.90  ? 222 LEU F CG    1 
ATOM   4385 C  CD1   . LEU B 1 223 ? 1.503   11.501  45.996  1.00 58.36  ? 222 LEU F CD1   1 
ATOM   4386 C  CD2   . LEU B 1 223 ? 2.362   11.069  43.692  1.00 58.70  ? 222 LEU F CD2   1 
ATOM   4387 N  N     . TRP B 1 224 ? -1.146  7.539   44.526  1.00 54.00  ? 223 TRP F N     1 
ATOM   4388 C  CA    . TRP B 1 224 ? -2.422  7.260   43.874  1.00 53.17  ? 223 TRP F CA    1 
ATOM   4389 C  C     . TRP B 1 224 ? -3.509  6.918   44.894  1.00 53.13  ? 223 TRP F C     1 
ATOM   4390 O  O     . TRP B 1 224 ? -4.607  7.482   44.862  1.00 48.83  ? 223 TRP F O     1 
ATOM   4391 C  CB    . TRP B 1 224 ? -2.246  6.111   42.879  1.00 55.15  ? 223 TRP F CB    1 
ATOM   4392 C  CG    . TRP B 1 224 ? -3.424  5.870   41.987  1.00 59.62  ? 223 TRP F CG    1 
ATOM   4393 C  CD1   . TRP B 1 224 ? -3.706  6.506   40.813  1.00 59.09  ? 223 TRP F CD1   1 
ATOM   4394 C  CD2   . TRP B 1 224 ? -4.469  4.911   42.185  1.00 57.53  ? 223 TRP F CD2   1 
ATOM   4395 N  NE1   . TRP B 1 224 ? -4.867  6.009   40.273  1.00 61.84  ? 223 TRP F NE1   1 
ATOM   4396 C  CE2   . TRP B 1 224 ? -5.355  5.028   41.095  1.00 56.91  ? 223 TRP F CE2   1 
ATOM   4397 C  CE3   . TRP B 1 224 ? -4.744  3.968   43.179  1.00 50.31  ? 223 TRP F CE3   1 
ATOM   4398 C  CZ2   . TRP B 1 224 ? -6.496  4.238   40.973  1.00 50.02  ? 223 TRP F CZ2   1 
ATOM   4399 C  CZ3   . TRP B 1 224 ? -5.877  3.186   43.057  1.00 54.33  ? 223 TRP F CZ3   1 
ATOM   4400 C  CH2   . TRP B 1 224 ? -6.738  3.325   41.961  1.00 49.65  ? 223 TRP F CH2   1 
ATOM   4401 N  N     . GLU B 1 225 ? -3.190  6.004   45.805  1.00 49.13  ? 224 GLU F N     1 
ATOM   4402 C  CA    . GLU B 1 225 ? -4.134  5.569   46.830  1.00 52.85  ? 224 GLU F CA    1 
ATOM   4403 C  C     . GLU B 1 225 ? -4.563  6.703   47.758  1.00 56.00  ? 224 GLU F C     1 
ATOM   4404 O  O     . GLU B 1 225 ? -5.749  6.852   48.052  1.00 52.66  ? 224 GLU F O     1 
ATOM   4405 C  CB    . GLU B 1 225 ? -3.546  4.415   47.644  1.00 54.93  ? 224 GLU F CB    1 
ATOM   4406 C  CG    . GLU B 1 225 ? -3.344  3.144   46.841  1.00 61.48  ? 224 GLU F CG    1 
ATOM   4407 C  CD    . GLU B 1 225 ? -2.742  2.025   47.665  1.00 67.73  ? 224 GLU F CD    1 
ATOM   4408 O  OE1   . GLU B 1 225 ? -2.456  2.252   48.859  1.00 64.13  ? 224 GLU F OE1   1 
ATOM   4409 O  OE2   . GLU B 1 225 ? -2.556  0.918   47.116  1.00 69.19  ? 224 GLU F OE2   1 
ATOM   4410 N  N     . ARG B 1 226 ? -3.600  7.497   48.218  1.00 57.77  ? 225 ARG F N     1 
ATOM   4411 C  CA    . ARG B 1 226 ? -3.904  8.644   49.067  1.00 59.77  ? 225 ARG F CA    1 
ATOM   4412 C  C     . ARG B 1 226 ? -4.798  9.624   48.320  1.00 52.52  ? 225 ARG F C     1 
ATOM   4413 O  O     . ARG B 1 226 ? -5.711  10.211  48.899  1.00 51.89  ? 225 ARG F O     1 
ATOM   4414 C  CB    . ARG B 1 226 ? -2.624  9.351   49.515  1.00 56.19  ? 225 ARG F CB    1 
ATOM   4415 C  CG    . ARG B 1 226 ? -1.646  8.472   50.267  1.00 48.56  ? 225 ARG F CG    1 
ATOM   4416 C  CD    . ARG B 1 226 ? -2.221  7.956   51.570  1.00 49.30  ? 225 ARG F CD    1 
ATOM   4417 N  NE    . ARG B 1 226 ? -1.252  7.119   52.269  1.00 60.10  ? 225 ARG F NE    1 
ATOM   4418 C  CZ    . ARG B 1 226 ? -1.164  5.801   52.125  1.00 64.05  ? 225 ARG F CZ    1 
ATOM   4419 N  NH1   . ARG B 1 226 ? -1.997  5.164   51.313  1.00 60.62  ? 225 ARG F NH1   1 
ATOM   4420 N  NH2   . ARG B 1 226 ? -0.247  5.119   52.797  1.00 61.42  ? 225 ARG F NH2   1 
ATOM   4421 N  N     . SER B 1 227 ? -4.529  9.791   47.029  1.00 50.95  ? 226 SER F N     1 
ATOM   4422 C  CA    . SER B 1 227 ? -5.348  10.653  46.185  1.00 51.08  ? 226 SER F CA    1 
ATOM   4423 C  C     . SER B 1 227 ? -6.763  10.099  46.051  1.00 58.64  ? 226 SER F C     1 
ATOM   4424 O  O     . SER B 1 227 ? -7.719  10.852  45.862  1.00 61.16  ? 226 SER F O     1 
ATOM   4425 C  CB    . SER B 1 227 ? -4.710  10.818  44.807  1.00 51.60  ? 226 SER F CB    1 
ATOM   4426 O  OG    . SER B 1 227 ? -3.421  11.393  44.916  1.00 56.38  ? 226 SER F OG    1 
ATOM   4427 N  N     . GLN B 1 228 ? -6.890  8.779   46.147  1.00 55.88  ? 227 GLN F N     1 
ATOM   4428 C  CA    . GLN B 1 228 ? -8.201  8.141   46.146  1.00 50.83  ? 227 GLN F CA    1 
ATOM   4429 C  C     . GLN B 1 228 ? -8.809  8.174   47.545  1.00 52.93  ? 227 GLN F C     1 
ATOM   4430 O  O     . GLN B 1 228 ? -9.968  7.808   47.739  1.00 55.42  ? 227 GLN F O     1 
ATOM   4431 C  CB    . GLN B 1 228 ? -8.096  6.693   45.662  1.00 52.81  ? 227 GLN F CB    1 
ATOM   4432 C  CG    . GLN B 1 228 ? -7.556  6.537   44.250  1.00 50.94  ? 227 GLN F CG    1 
ATOM   4433 C  CD    . GLN B 1 228 ? -8.543  6.983   43.191  1.00 58.63  ? 227 GLN F CD    1 
ATOM   4434 O  OE1   . GLN B 1 228 ? -9.754  6.834   43.353  1.00 58.18  ? 227 GLN F OE1   1 
ATOM   4435 N  NE2   . GLN B 1 228 ? -8.029  7.537   42.099  1.00 59.67  ? 227 GLN F NE2   1 
ATOM   4436 N  N     . GLY B 1 229 ? -8.017  8.616   48.518  1.00 49.68  ? 228 GLY F N     1 
ATOM   4437 C  CA    . GLY B 1 229 ? -8.449  8.643   49.904  1.00 46.42  ? 228 GLY F CA    1 
ATOM   4438 C  C     . GLY B 1 229 ? -8.216  7.309   50.584  1.00 54.90  ? 228 GLY F C     1 
ATOM   4439 O  O     . GLY B 1 229 ? -8.693  7.071   51.694  1.00 53.37  ? 228 GLY F O     1 
ATOM   4440 N  N     . ILE B 1 230 ? -7.471  6.439   49.910  1.00 55.36  ? 229 ILE F N     1 
ATOM   4441 C  CA    . ILE B 1 230 ? -7.200  5.100   50.416  1.00 53.84  ? 229 ILE F CA    1 
ATOM   4442 C  C     . ILE B 1 230 ? -5.953  5.069   51.291  1.00 51.75  ? 229 ILE F C     1 
ATOM   4443 O  O     . ILE B 1 230 ? -4.856  5.401   50.842  1.00 50.71  ? 229 ILE F O     1 
ATOM   4444 C  CB    . ILE B 1 230 ? -7.017  4.094   49.266  1.00 53.93  ? 229 ILE F CB    1 
ATOM   4445 C  CG1   . ILE B 1 230 ? -8.212  4.150   48.314  1.00 46.03  ? 229 ILE F CG1   1 
ATOM   4446 C  CG2   . ILE B 1 230 ? -6.820  2.688   49.813  1.00 47.31  ? 229 ILE F CG2   1 
ATOM   4447 C  CD1   . ILE B 1 230 ? -8.046  3.292   47.080  1.00 47.08  ? 229 ILE F CD1   1 
ATOM   4448 N  N     . ASP B 1 231 ? -6.136  4.665   52.542  1.00 50.87  ? 230 ASP F N     1 
ATOM   4449 C  CA    . ASP B 1 231 ? -5.033  4.521   53.481  1.00 54.71  ? 230 ASP F CA    1 
ATOM   4450 C  C     . ASP B 1 231 ? -5.361  3.396   54.456  1.00 53.24  ? 230 ASP F C     1 
ATOM   4451 O  O     . ASP B 1 231 ? -5.902  3.630   55.537  1.00 52.41  ? 230 ASP F O     1 
ATOM   4452 C  CB    . ASP B 1 231 ? -4.791  5.837   54.223  1.00 49.32  ? 230 ASP F CB    1 
ATOM   4453 C  CG    . ASP B 1 231 ? -3.549  5.801   55.095  1.00 57.51  ? 230 ASP F CG    1 
ATOM   4454 O  OD1   . ASP B 1 231 ? -2.739  4.860   54.953  1.00 52.87  ? 230 ASP F OD1   1 
ATOM   4455 O  OD2   . ASP B 1 231 ? -3.378  6.727   55.915  1.00 57.48  ? 230 ASP F OD2   1 
ATOM   4456 N  N     . GLU B 1 232 ? -5.036  2.170   54.060  1.00 47.90  ? 231 GLU F N     1 
ATOM   4457 C  CA    . GLU B 1 232 ? -5.394  0.991   54.841  1.00 53.78  ? 231 GLU F CA    1 
ATOM   4458 C  C     . GLU B 1 232 ? -4.380  0.685   55.939  1.00 52.96  ? 231 GLU F C     1 
ATOM   4459 O  O     . GLU B 1 232 ? -4.481  -0.339  56.614  1.00 53.89  ? 231 GLU F O     1 
ATOM   4460 C  CB    . GLU B 1 232 ? -5.560  -0.228  53.928  1.00 57.19  ? 231 GLU F CB    1 
ATOM   4461 C  CG    . GLU B 1 232 ? -6.917  -0.909  54.038  1.00 62.06  ? 231 GLU F CG    1 
ATOM   4462 C  CD    . GLU B 1 232 ? -8.039  -0.077  53.446  1.00 67.93  ? 231 GLU F CD    1 
ATOM   4463 O  OE1   . GLU B 1 232 ? -8.640  0.732   54.185  1.00 64.31  ? 231 GLU F OE1   1 
ATOM   4464 O  OE2   . GLU B 1 232 ? -8.321  -0.234  52.239  1.00 66.40  ? 231 GLU F OE2   1 
ATOM   4465 N  N     . ARG B 1 233 ? -3.402  1.571   56.111  1.00 50.41  ? 232 ARG F N     1 
ATOM   4466 C  CA    . ARG B 1 233 ? -2.401  1.406   57.160  1.00 46.92  ? 232 ARG F CA    1 
ATOM   4467 C  C     . ARG B 1 233 ? -3.058  1.390   58.533  1.00 47.95  ? 232 ARG F C     1 
ATOM   4468 O  O     . ARG B 1 233 ? -3.792  2.311   58.893  1.00 52.37  ? 232 ARG F O     1 
ATOM   4469 C  CB    . ARG B 1 233 ? -1.357  2.520   57.099  1.00 52.47  ? 232 ARG F CB    1 
ATOM   4470 C  CG    . ARG B 1 233 ? -0.503  2.520   55.844  1.00 52.70  ? 232 ARG F CG    1 
ATOM   4471 C  CD    . ARG B 1 233 ? 0.475   3.676   55.878  1.00 47.51  ? 232 ARG F CD    1 
ATOM   4472 N  NE    . ARG B 1 233 ? -0.211  4.942   56.118  1.00 55.52  ? 232 ARG F NE    1 
ATOM   4473 C  CZ    . ARG B 1 233 ? 0.365   6.018   56.641  1.00 52.75  ? 232 ARG F CZ    1 
ATOM   4474 N  NH1   . ARG B 1 233 ? 1.645   5.986   56.987  1.00 55.93  ? 232 ARG F NH1   1 
ATOM   4475 N  NH2   . ARG B 1 233 ? -0.340  7.126   56.824  1.00 57.80  ? 232 ARG F NH2   1 
ATOM   4476 N  N     . ASP B 1 234 ? -2.789  0.339   59.297  1.00 44.56  ? 233 ASP F N     1 
ATOM   4477 C  CA    . ASP B 1 234 ? -3.399  0.175   60.607  1.00 50.71  ? 233 ASP F CA    1 
ATOM   4478 C  C     . ASP B 1 234 ? -2.528  0.778   61.705  1.00 48.68  ? 233 ASP F C     1 
ATOM   4479 O  O     . ASP B 1 234 ? -1.301  0.788   61.602  1.00 56.85  ? 233 ASP F O     1 
ATOM   4480 C  CB    . ASP B 1 234 ? -3.651  -1.309  60.889  1.00 52.87  ? 233 ASP F CB    1 
ATOM   4481 C  CG    . ASP B 1 234 ? -4.541  -1.531  62.094  1.00 68.13  ? 233 ASP F CG    1 
ATOM   4482 O  OD1   . ASP B 1 234 ? -5.390  -0.659  62.377  1.00 68.00  ? 233 ASP F OD1   1 
ATOM   4483 O  OD2   . ASP B 1 234 ? -4.395  -2.579  62.757  1.00 70.21  ? 233 ASP F OD2   1 
ATOM   4484 N  N     . VAL B 1 235 ? -3.173  1.290   62.748  1.00 49.61  ? 234 VAL F N     1 
ATOM   4485 C  CA    . VAL B 1 235 ? -2.470  1.791   63.923  1.00 53.98  ? 234 VAL F CA    1 
ATOM   4486 C  C     . VAL B 1 235 ? -1.722  0.642   64.595  1.00 62.07  ? 234 VAL F C     1 
ATOM   4487 O  O     . VAL B 1 235 ? -2.324  -0.368  64.959  1.00 66.40  ? 234 VAL F O     1 
ATOM   4488 C  CB    . VAL B 1 235 ? -3.447  2.431   64.925  1.00 56.00  ? 234 VAL F CB    1 
ATOM   4489 C  CG1   . VAL B 1 235 ? -2.730  2.794   66.215  1.00 55.81  ? 234 VAL F CG1   1 
ATOM   4490 C  CG2   . VAL B 1 235 ? -4.110  3.655   64.309  1.00 54.30  ? 234 VAL F CG2   1 
ATOM   4491 N  N     . ASN B 1 236 ? -0.412  0.799   64.761  1.00 60.69  ? 235 ASN F N     1 
ATOM   4492 C  CA    . ASN B 1 236 ? 0.440   -0.313  65.178  1.00 60.42  ? 235 ASN F CA    1 
ATOM   4493 C  C     . ASN B 1 236 ? 0.563   -0.519  66.689  1.00 64.95  ? 235 ASN F C     1 
ATOM   4494 O  O     . ASN B 1 236 ? 0.150   -1.556  67.208  1.00 71.09  ? 235 ASN F O     1 
ATOM   4495 C  CB    . ASN B 1 236 ? 1.830   -0.186  64.549  1.00 65.35  ? 235 ASN F CB    1 
ATOM   4496 C  CG    . ASN B 1 236 ? 2.572   -1.510  64.502  1.00 67.51  ? 235 ASN F CG    1 
ATOM   4497 O  OD1   . ASN B 1 236 ? 2.445   -2.341  65.401  1.00 62.43  ? 235 ASN F OD1   1 
ATOM   4498 N  ND2   . ASN B 1 236 ? 3.348   -1.715  63.444  1.00 68.06  ? 235 ASN F ND2   1 
ATOM   4499 N  N     . SER B 1 237 ? 1.163   0.454   67.372  1.00 61.67  ? 236 SER F N     1 
ATOM   4500 C  CA    . SER B 1 237 ? 1.424   0.395   68.817  1.00 65.43  ? 236 SER F CA    1 
ATOM   4501 C  C     . SER B 1 237 ? 2.461   -0.653  69.227  1.00 65.64  ? 236 SER F C     1 
ATOM   4502 O  O     . SER B 1 237 ? 2.859   -0.714  70.389  1.00 64.49  ? 236 SER F O     1 
ATOM   4503 C  CB    . SER B 1 237 ? 0.133   0.190   69.618  1.00 62.99  ? 236 SER F CB    1 
ATOM   4504 O  OG    . SER B 1 237 ? -0.333  -1.142  69.499  1.00 59.82  ? 236 SER F OG    1 
ATOM   4505 N  N     . GLU B 1 238 ? 2.893   -1.477  68.278  1.00 63.81  ? 237 GLU F N     1 
ATOM   4506 C  CA    . GLU B 1 238 ? 3.885   -2.510  68.559  1.00 70.06  ? 237 GLU F CA    1 
ATOM   4507 C  C     . GLU B 1 238 ? 5.237   -2.201  67.921  1.00 64.97  ? 237 GLU F C     1 
ATOM   4508 O  O     . GLU B 1 238 ? 6.131   -3.045  67.912  1.00 62.18  ? 237 GLU F O     1 
ATOM   4509 C  CB    . GLU B 1 238 ? 3.395   -3.882  68.083  1.00 68.62  ? 237 GLU F CB    1 
ATOM   4510 C  CG    . GLU B 1 238 ? 2.235   -4.453  68.881  1.00 70.02  ? 237 GLU F CG    1 
ATOM   4511 C  CD    . GLU B 1 238 ? 1.929   -5.891  68.507  1.00 78.94  ? 237 GLU F CD    1 
ATOM   4512 O  OE1   . GLU B 1 238 ? 1.033   -6.494  69.134  1.00 83.64  ? 237 GLU F OE1   1 
ATOM   4513 O  OE2   . GLU B 1 238 ? 2.586   -6.421  67.586  1.00 76.32  ? 237 GLU F OE2   1 
ATOM   4514 N  N     . ARG B 1 239 ? 5.381   -0.991  67.389  1.00 63.33  ? 238 ARG F N     1 
ATOM   4515 C  CA    . ARG B 1 239 ? 6.616   -0.596  66.717  1.00 58.10  ? 238 ARG F CA    1 
ATOM   4516 C  C     . ARG B 1 239 ? 7.782   -0.445  67.691  1.00 55.09  ? 238 ARG F C     1 
ATOM   4517 O  O     . ARG B 1 239 ? 7.639   0.146   68.761  1.00 53.21  ? 238 ARG F O     1 
ATOM   4518 C  CB    . ARG B 1 239 ? 6.412   0.704   65.936  1.00 58.78  ? 238 ARG F CB    1 
ATOM   4519 C  CG    . ARG B 1 239 ? 5.412   0.594   64.797  1.00 61.39  ? 238 ARG F CG    1 
ATOM   4520 C  CD    . ARG B 1 239 ? 5.280   1.912   64.054  1.00 64.01  ? 238 ARG F CD    1 
ATOM   4521 N  NE    . ARG B 1 239 ? 6.546   2.328   63.458  1.00 71.66  ? 238 ARG F NE    1 
ATOM   4522 C  CZ    . ARG B 1 239 ? 6.726   3.475   62.814  1.00 72.64  ? 238 ARG F CZ    1 
ATOM   4523 N  NH1   . ARG B 1 239 ? 5.717   4.323   62.669  1.00 76.01  ? 238 ARG F NH1   1 
ATOM   4524 N  NH2   . ARG B 1 239 ? 7.912   3.768   62.297  1.00 68.62  ? 238 ARG F NH2   1 
ATOM   4525 N  N     . LEU B 1 240 ? 8.933   -0.991  67.308  1.00 51.93  ? 239 LEU F N     1 
ATOM   4526 C  CA    . LEU B 1 240 ? 10.163  -0.868  68.084  1.00 48.80  ? 239 LEU F CA    1 
ATOM   4527 C  C     . LEU B 1 240 ? 11.202  -0.118  67.258  1.00 51.68  ? 239 LEU F C     1 
ATOM   4528 O  O     . LEU B 1 240 ? 11.197  -0.203  66.030  1.00 50.21  ? 239 LEU F O     1 
ATOM   4529 C  CB    . LEU B 1 240 ? 10.708  -2.251  68.446  1.00 54.81  ? 239 LEU F CB    1 
ATOM   4530 C  CG    . LEU B 1 240 ? 10.220  -2.982  69.701  1.00 54.18  ? 239 LEU F CG    1 
ATOM   4531 C  CD1   . LEU B 1 240 ? 8.994   -2.325  70.316  1.00 59.29  ? 239 LEU F CD1   1 
ATOM   4532 C  CD2   . LEU B 1 240 ? 9.939   -4.442  69.375  1.00 47.91  ? 239 LEU F CD2   1 
ATOM   4533 N  N     . ARG B 1 241 ? 12.095  0.611   67.921  1.00 45.34  ? 240 ARG F N     1 
ATOM   4534 C  CA    . ARG B 1 241 ? 13.126  1.343   67.193  1.00 50.59  ? 240 ARG F CA    1 
ATOM   4535 C  C     . ARG B 1 241 ? 14.213  0.399   66.686  1.00 49.00  ? 240 ARG F C     1 
ATOM   4536 O  O     . ARG B 1 241 ? 14.436  -0.669  67.257  1.00 55.07  ? 240 ARG F O     1 
ATOM   4537 C  CB    . ARG B 1 241 ? 13.720  2.480   68.030  1.00 56.34  ? 240 ARG F CB    1 
ATOM   4538 C  CG    . ARG B 1 241 ? 14.805  2.078   69.014  1.00 52.46  ? 240 ARG F CG    1 
ATOM   4539 C  CD    . ARG B 1 241 ? 15.691  3.281   69.312  1.00 54.72  ? 240 ARG F CD    1 
ATOM   4540 N  NE    . ARG B 1 241 ? 16.237  3.268   70.665  1.00 66.76  ? 240 ARG F NE    1 
ATOM   4541 C  CZ    . ARG B 1 241 ? 16.942  4.266   71.189  1.00 70.82  ? 240 ARG F CZ    1 
ATOM   4542 N  NH1   . ARG B 1 241 ? 17.186  5.354   70.471  1.00 69.78  ? 240 ARG F NH1   1 
ATOM   4543 N  NH2   . ARG B 1 241 ? 17.402  4.181   72.429  1.00 73.24  ? 240 ARG F NH2   1 
ATOM   4544 N  N     . LYS B 1 242 ? 14.882  0.796   65.609  1.00 46.26  ? 241 LYS F N     1 
ATOM   4545 C  CA    . LYS B 1 242 ? 15.810  -0.094  64.919  1.00 44.32  ? 241 LYS F CA    1 
ATOM   4546 C  C     . LYS B 1 242 ? 17.269  0.340   65.011  1.00 46.05  ? 241 LYS F C     1 
ATOM   4547 O  O     . LYS B 1 242 ? 18.170  -0.444  64.712  1.00 46.43  ? 241 LYS F O     1 
ATOM   4548 C  CB    . LYS B 1 242 ? 15.416  -0.228  63.446  1.00 46.67  ? 241 LYS F CB    1 
ATOM   4549 C  CG    . LYS B 1 242 ? 14.046  -0.838  63.213  1.00 47.77  ? 241 LYS F CG    1 
ATOM   4550 C  CD    . LYS B 1 242 ? 13.770  -0.999  61.726  1.00 46.34  ? 241 LYS F CD    1 
ATOM   4551 C  CE    . LYS B 1 242 ? 12.435  -1.680  61.479  1.00 54.72  ? 241 LYS F CE    1 
ATOM   4552 N  NZ    . LYS B 1 242 ? 11.300  -0.892  62.032  1.00 54.05  ? 241 LYS F NZ    1 
ATOM   4553 N  N     . SER B 1 243 ? 17.509  1.582   65.416  1.00 44.97  ? 242 SER F N     1 
ATOM   4554 C  CA    . SER B 1 243 ? 18.869  2.107   65.414  1.00 44.80  ? 242 SER F CA    1 
ATOM   4555 C  C     . SER B 1 243 ? 19.130  3.132   66.511  1.00 44.59  ? 242 SER F C     1 
ATOM   4556 O  O     . SER B 1 243 ? 18.208  3.776   67.011  1.00 49.33  ? 242 SER F O     1 
ATOM   4557 C  CB    . SER B 1 243 ? 19.197  2.718   64.049  1.00 43.65  ? 242 SER F CB    1 
ATOM   4558 O  OG    . SER B 1 243 ? 18.352  3.821   63.768  1.00 44.03  ? 242 SER F OG    1 
ATOM   4559 N  N     . VAL B 1 244 ? 20.399  3.268   66.883  1.00 48.51  ? 243 VAL F N     1 
ATOM   4560 C  CA    . VAL B 1 244 ? 20.821  4.286   67.838  1.00 48.80  ? 243 VAL F CA    1 
ATOM   4561 C  C     . VAL B 1 244 ? 22.025  5.036   67.280  1.00 45.75  ? 243 VAL F C     1 
ATOM   4562 O  O     . VAL B 1 244 ? 23.045  4.430   66.959  1.00 49.07  ? 243 VAL F O     1 
ATOM   4563 C  CB    . VAL B 1 244 ? 21.207  3.674   69.199  1.00 46.32  ? 243 VAL F CB    1 
ATOM   4564 C  CG1   . VAL B 1 244 ? 21.578  4.772   70.185  1.00 47.40  ? 243 VAL F CG1   1 
ATOM   4565 C  CG2   . VAL B 1 244 ? 20.072  2.823   69.748  1.00 40.19  ? 243 VAL F CG2   1 
ATOM   4566 N  N     . GLY B 1 245 ? 21.903  6.354   67.161  1.00 50.50  ? 244 GLY F N     1 
ATOM   4567 C  CA    . GLY B 1 245 ? 22.980  7.165   66.623  1.00 47.95  ? 244 GLY F CA    1 
ATOM   4568 C  C     . GLY B 1 245 ? 23.317  8.355   67.499  1.00 48.40  ? 244 GLY F C     1 
ATOM   4569 O  O     . GLY B 1 245 ? 22.468  8.848   68.238  1.00 45.14  ? 244 GLY F O     1 
ATOM   4570 N  N     . VAL B 1 246 ? 24.567  8.806   67.426  1.00 52.50  ? 245 VAL F N     1 
ATOM   4571 C  CA    . VAL B 1 246 ? 25.016  9.987   68.161  1.00 48.70  ? 245 VAL F CA    1 
ATOM   4572 C  C     . VAL B 1 246 ? 25.949  10.810  67.285  1.00 47.94  ? 245 VAL F C     1 
ATOM   4573 O  O     . VAL B 1 246 ? 27.004  10.330  66.886  1.00 51.02  ? 245 VAL F O     1 
ATOM   4574 C  CB    . VAL B 1 246 ? 25.784  9.609   69.443  1.00 53.72  ? 245 VAL F CB    1 
ATOM   4575 C  CG1   . VAL B 1 246 ? 26.385  10.851  70.086  1.00 55.77  ? 245 VAL F CG1   1 
ATOM   4576 C  CG2   . VAL B 1 246 ? 24.881  8.886   70.423  1.00 55.07  ? 245 VAL F CG2   1 
ATOM   4577 N  N     . GLU B 1 247 ? 25.575  12.049  66.991  1.00 49.79  ? 246 GLU F N     1 
ATOM   4578 C  CA    . GLU B 1 247 ? 26.383  12.873  66.098  1.00 51.08  ? 246 GLU F CA    1 
ATOM   4579 C  C     . GLU B 1 247 ? 26.563  14.296  66.612  1.00 50.76  ? 246 GLU F C     1 
ATOM   4580 O  O     . GLU B 1 247 ? 25.732  14.809  67.362  1.00 48.72  ? 246 GLU F O     1 
ATOM   4581 C  CB    . GLU B 1 247 ? 25.772  12.893  64.696  1.00 51.00  ? 246 GLU F CB    1 
ATOM   4582 C  CG    . GLU B 1 247 ? 24.405  13.548  64.626  1.00 50.84  ? 246 GLU F CG    1 
ATOM   4583 C  CD    . GLU B 1 247 ? 23.601  13.079  63.431  1.00 56.87  ? 246 GLU F CD    1 
ATOM   4584 O  OE1   . GLU B 1 247 ? 23.768  11.910  63.029  1.00 51.58  ? 246 GLU F OE1   1 
ATOM   4585 O  OE2   . GLU B 1 247 ? 22.802  13.876  62.896  1.00 59.12  ? 246 GLU F OE2   1 
ATOM   4586 N  N     . ARG B 1 248 ? 27.656  14.932  66.203  1.00 54.44  ? 247 ARG F N     1 
ATOM   4587 C  CA    . ARG B 1 248 ? 27.913  16.307  66.604  1.00 52.90  ? 247 ARG F CA    1 
ATOM   4588 C  C     . ARG B 1 248 ? 28.398  17.158  65.437  1.00 55.20  ? 247 ARG F C     1 
ATOM   4589 O  O     . ARG B 1 248 ? 29.277  16.748  64.671  1.00 54.80  ? 247 ARG F O     1 
ATOM   4590 C  CB    . ARG B 1 248 ? 28.930  16.363  67.747  1.00 56.95  ? 247 ARG F CB    1 
ATOM   4591 C  CG    . ARG B 1 248 ? 28.687  17.504  68.726  1.00 60.38  ? 247 ARG F CG    1 
ATOM   4592 C  CD    . ARG B 1 248 ? 29.910  18.394  68.886  1.00 69.15  ? 247 ARG F CD    1 
ATOM   4593 N  NE    . ARG B 1 248 ? 29.681  19.444  69.877  1.00 79.31  ? 247 ARG F NE    1 
ATOM   4594 C  CZ    . ARG B 1 248 ? 30.559  20.393  70.182  1.00 82.03  ? 247 ARG F CZ    1 
ATOM   4595 N  NH1   . ARG B 1 248 ? 31.736  20.434  69.571  1.00 80.87  ? 247 ARG F NH1   1 
ATOM   4596 N  NH2   . ARG B 1 248 ? 30.261  21.305  71.098  1.00 73.18  ? 247 ARG F NH2   1 
ATOM   4597 N  N     . THR B 1 249 ? 27.798  18.338  65.307  1.00 56.39  ? 248 THR F N     1 
ATOM   4598 C  CA    . THR B 1 249 ? 28.266  19.354  64.378  1.00 55.02  ? 248 THR F CA    1 
ATOM   4599 C  C     . THR B 1 249 ? 29.076  20.386  65.152  1.00 55.78  ? 248 THR F C     1 
ATOM   4600 O  O     . THR B 1 249 ? 28.565  21.019  66.077  1.00 58.56  ? 248 THR F O     1 
ATOM   4601 C  CB    . THR B 1 249 ? 27.099  20.060  63.658  1.00 56.73  ? 248 THR F CB    1 
ATOM   4602 O  OG1   . THR B 1 249 ? 26.537  19.181  62.675  1.00 53.79  ? 248 THR F OG1   1 
ATOM   4603 C  CG2   . THR B 1 249 ? 27.581  21.329  62.970  1.00 53.51  ? 248 THR F CG2   1 
ATOM   4604 N  N     . MET B 1 250 ? 30.341  20.546  64.780  1.00 54.31  ? 249 MET F N     1 
ATOM   4605 C  CA    . MET B 1 250 ? 31.226  21.480  65.468  1.00 63.52  ? 249 MET F CA    1 
ATOM   4606 C  C     . MET B 1 250 ? 30.993  22.922  65.024  1.00 60.20  ? 249 MET F C     1 
ATOM   4607 O  O     . MET B 1 250 ? 30.514  23.171  63.917  1.00 57.01  ? 249 MET F O     1 
ATOM   4608 C  CB    . MET B 1 250 ? 32.691  21.084  65.267  1.00 61.28  ? 249 MET F CB    1 
ATOM   4609 C  CG    . MET B 1 250 ? 33.081  19.796  65.975  1.00 58.36  ? 249 MET F CG    1 
ATOM   4610 S  SD    . MET B 1 250 ? 32.236  18.339  65.331  1.00 65.91  ? 249 MET F SD    1 
ATOM   4611 C  CE    . MET B 1 250 ? 33.122  18.081  63.797  1.00 55.51  ? 249 MET F CE    1 
ATOM   4612 N  N     . ALA B 1 251 ? 31.330  23.863  65.903  1.00 57.67  ? 250 ALA F N     1 
ATOM   4613 C  CA    . ALA B 1 251 ? 31.158  25.284  65.627  1.00 57.83  ? 250 ALA F CA    1 
ATOM   4614 C  C     . ALA B 1 251 ? 32.033  25.703  64.455  1.00 65.76  ? 250 ALA F C     1 
ATOM   4615 O  O     . ALA B 1 251 ? 31.627  26.516  63.620  1.00 69.39  ? 250 ALA F O     1 
ATOM   4616 C  CB    . ALA B 1 251 ? 31.481  26.110  66.867  1.00 55.56  ? 250 ALA F CB    1 
ATOM   4617 N  N     . GLU B 1 252 ? 33.233  25.134  64.395  1.00 65.11  ? 251 GLU F N     1 
ATOM   4618 C  CA    . GLU B 1 252 ? 34.131  25.363  63.270  1.00 60.77  ? 251 GLU F CA    1 
ATOM   4619 C  C     . GLU B 1 252 ? 34.566  24.033  62.664  1.00 58.78  ? 251 GLU F C     1 
ATOM   4620 O  O     . GLU B 1 252 ? 34.747  23.047  63.387  1.00 64.56  ? 251 GLU F O     1 
ATOM   4621 C  CB    . GLU B 1 252 ? 35.353  26.178  63.704  1.00 66.19  ? 251 GLU F CB    1 
ATOM   4622 C  CG    . GLU B 1 252 ? 35.019  27.541  64.305  1.00 73.92  ? 251 GLU F CG    1 
ATOM   4623 C  CD    . GLU B 1 252 ? 34.491  28.524  63.282  1.00 81.52  ? 251 GLU F CD    1 
ATOM   4624 O  OE1   . GLU B 1 252 ? 34.619  28.252  62.072  1.00 83.73  ? 251 GLU F OE1   1 
ATOM   4625 O  OE2   . GLU B 1 252 ? 33.941  29.568  63.689  1.00 73.56  ? 251 GLU F OE2   1 
ATOM   4626 N  N     . ASP B 1 253 ? 34.719  24.005  61.342  1.00 54.47  ? 252 ASP F N     1 
ATOM   4627 C  CA    . ASP B 1 253 ? 35.104  22.784  60.639  1.00 55.88  ? 252 ASP F CA    1 
ATOM   4628 C  C     . ASP B 1 253 ? 36.451  22.251  61.129  1.00 65.07  ? 252 ASP F C     1 
ATOM   4629 O  O     . ASP B 1 253 ? 37.236  22.989  61.729  1.00 70.29  ? 252 ASP F O     1 
ATOM   4630 C  CB    . ASP B 1 253 ? 35.167  23.044  59.138  1.00 62.67  ? 252 ASP F CB    1 
ATOM   4631 C  CG    . ASP B 1 253 ? 33.809  23.335  58.542  1.00 65.39  ? 252 ASP F CG    1 
ATOM   4632 O  OD1   . ASP B 1 253 ? 32.866  23.635  59.305  1.00 66.94  ? 252 ASP F OD1   1 
ATOM   4633 O  OD2   . ASP B 1 253 ? 33.688  23.280  57.304  1.00 67.44  ? 252 ASP F OD2   1 
ATOM   4634 N  N     . ILE B 1 254 ? 36.709  20.968  60.890  1.00 68.01  ? 253 ILE F N     1 
ATOM   4635 C  CA    . ILE B 1 254 ? 37.982  20.367  61.272  1.00 63.32  ? 253 ILE F CA    1 
ATOM   4636 C  C     . ILE B 1 254 ? 38.668  19.788  60.038  1.00 65.58  ? 253 ILE F C     1 
ATOM   4637 O  O     . ILE B 1 254 ? 38.005  19.304  59.117  1.00 64.27  ? 253 ILE F O     1 
ATOM   4638 C  CB    . ILE B 1 254 ? 37.806  19.268  62.349  1.00 60.34  ? 253 ILE F CB    1 
ATOM   4639 C  CG1   . ILE B 1 254 ? 36.947  18.115  61.822  1.00 56.35  ? 253 ILE F CG1   1 
ATOM   4640 C  CG2   . ILE B 1 254 ? 37.184  19.845  63.605  1.00 58.53  ? 253 ILE F CG2   1 
ATOM   4641 C  CD1   . ILE B 1 254 ? 36.761  16.982  62.814  1.00 61.89  ? 253 ILE F CD1   1 
ATOM   4642 N  N     . HIS B 1 255 ? 39.996  19.843  60.019  1.00 68.39  ? 254 HIS F N     1 
ATOM   4643 C  CA    . HIS B 1 255 ? 40.760  19.385  58.864  1.00 67.89  ? 254 HIS F CA    1 
ATOM   4644 C  C     . HIS B 1 255 ? 41.826  18.380  59.284  1.00 64.50  ? 254 HIS F C     1 
ATOM   4645 O  O     . HIS B 1 255 ? 42.498  17.787  58.443  1.00 69.12  ? 254 HIS F O     1 
ATOM   4646 C  CB    . HIS B 1 255 ? 41.414  20.571  58.149  1.00 63.67  ? 254 HIS F CB    1 
ATOM   4647 C  CG    . HIS B 1 255 ? 40.457  21.666  57.788  1.00 57.69  ? 254 HIS F CG    1 
ATOM   4648 N  ND1   . HIS B 1 255 ? 39.964  22.557  58.715  1.00 63.01  ? 254 HIS F ND1   1 
ATOM   4649 C  CD2   . HIS B 1 255 ? 39.905  22.012  56.602  1.00 53.62  ? 254 HIS F CD2   1 
ATOM   4650 C  CE1   . HIS B 1 255 ? 39.147  23.406  58.117  1.00 52.94  ? 254 HIS F CE1   1 
ATOM   4651 N  NE2   . HIS B 1 255 ? 39.093  23.096  56.833  1.00 54.39  ? 254 HIS F NE2   1 
ATOM   4652 N  N     . HIS B 1 256 ? 41.980  18.195  60.590  1.00 64.44  ? 255 HIS F N     1 
ATOM   4653 C  CA    . HIS B 1 256 ? 42.983  17.273  61.112  1.00 65.41  ? 255 HIS F CA    1 
ATOM   4654 C  C     . HIS B 1 256 ? 42.335  16.064  61.778  1.00 61.68  ? 255 HIS F C     1 
ATOM   4655 O  O     . HIS B 1 256 ? 41.337  16.198  62.486  1.00 62.81  ? 255 HIS F O     1 
ATOM   4656 C  CB    . HIS B 1 256 ? 43.908  17.990  62.099  1.00 63.69  ? 255 HIS F CB    1 
ATOM   4657 C  CG    . HIS B 1 256 ? 44.528  19.236  61.547  1.00 62.29  ? 255 HIS F CG    1 
ATOM   4658 N  ND1   . HIS B 1 256 ? 45.495  19.214  60.566  1.00 56.33  ? 255 HIS F ND1   1 
ATOM   4659 C  CD2   . HIS B 1 256 ? 44.314  20.542  61.837  1.00 61.37  ? 255 HIS F CD2   1 
ATOM   4660 C  CE1   . HIS B 1 256 ? 45.851  20.453  60.275  1.00 60.06  ? 255 HIS F CE1   1 
ATOM   4661 N  NE2   . HIS B 1 256 ? 45.150  21.277  61.032  1.00 56.75  ? 255 HIS F NE2   1 
ATOM   4662 N  N     . TRP B 1 257 ? 42.908  14.885  61.549  1.00 57.76  ? 256 TRP F N     1 
ATOM   4663 C  CA    . TRP B 1 257 ? 42.357  13.649  62.098  1.00 55.10  ? 256 TRP F CA    1 
ATOM   4664 C  C     . TRP B 1 257 ? 42.374  13.622  63.622  1.00 54.38  ? 256 TRP F C     1 
ATOM   4665 O  O     . TRP B 1 257 ? 41.465  13.083  64.246  1.00 58.31  ? 256 TRP F O     1 
ATOM   4666 C  CB    . TRP B 1 257 ? 43.089  12.419  61.557  1.00 52.06  ? 256 TRP F CB    1 
ATOM   4667 C  CG    . TRP B 1 257 ? 42.891  11.216  62.429  1.00 56.86  ? 256 TRP F CG    1 
ATOM   4668 C  CD1   . TRP B 1 257 ? 43.824  10.617  63.222  1.00 58.43  ? 256 TRP F CD1   1 
ATOM   4669 C  CD2   . TRP B 1 257 ? 41.671  10.490  62.625  1.00 57.34  ? 256 TRP F CD2   1 
ATOM   4670 N  NE1   . TRP B 1 257 ? 43.266  9.551   63.887  1.00 59.69  ? 256 TRP F NE1   1 
ATOM   4671 C  CE2   . TRP B 1 257 ? 41.945  9.453   63.538  1.00 59.01  ? 256 TRP F CE2   1 
ATOM   4672 C  CE3   . TRP B 1 257 ? 40.377  10.610  62.108  1.00 56.49  ? 256 TRP F CE3   1 
ATOM   4673 C  CZ2   . TRP B 1 257 ? 40.974  8.541   63.946  1.00 58.13  ? 256 TRP F CZ2   1 
ATOM   4674 C  CZ3   . TRP B 1 257 ? 39.413  9.704   62.516  1.00 57.38  ? 256 TRP F CZ3   1 
ATOM   4675 C  CH2   . TRP B 1 257 ? 39.717  8.683   63.425  1.00 56.80  ? 256 TRP F CH2   1 
ATOM   4676 N  N     . SER B 1 258 ? 43.414  14.197  64.216  1.00 57.40  ? 257 SER F N     1 
ATOM   4677 C  CA    . SER B 1 258 ? 43.516  14.282  65.670  1.00 61.67  ? 257 SER F CA    1 
ATOM   4678 C  C     . SER B 1 258 ? 42.259  14.893  66.291  1.00 62.25  ? 257 SER F C     1 
ATOM   4679 O  O     . SER B 1 258 ? 41.810  14.466  67.358  1.00 60.91  ? 257 SER F O     1 
ATOM   4680 C  CB    . SER B 1 258 ? 44.755  15.084  66.068  1.00 60.45  ? 257 SER F CB    1 
ATOM   4681 O  OG    . SER B 1 258 ? 44.746  16.373  65.476  1.00 56.75  ? 257 SER F OG    1 
ATOM   4682 N  N     . GLU B 1 259 ? 41.688  15.874  65.597  1.00 58.20  ? 258 GLU F N     1 
ATOM   4683 C  CA    . GLU B 1 259 ? 40.450  16.517  66.024  1.00 60.90  ? 258 GLU F CA    1 
ATOM   4684 C  C     . GLU B 1 259 ? 39.266  15.549  65.939  1.00 58.26  ? 258 GLU F C     1 
ATOM   4685 O  O     . GLU B 1 259 ? 38.508  15.400  66.903  1.00 56.67  ? 258 GLU F O     1 
ATOM   4686 C  CB    . GLU B 1 259 ? 40.182  17.766  65.173  1.00 62.09  ? 258 GLU F CB    1 
ATOM   4687 C  CG    . GLU B 1 259 ? 41.332  18.771  65.140  1.00 58.84  ? 258 GLU F CG    1 
ATOM   4688 C  CD    . GLU B 1 259 ? 41.143  19.844  64.088  1.00 62.02  ? 258 GLU F CD    1 
ATOM   4689 O  OE1   . GLU B 1 259 ? 41.104  19.495  62.893  1.00 61.78  ? 258 GLU F OE1   1 
ATOM   4690 O  OE2   . GLU B 1 259 ? 41.038  21.034  64.449  1.00 59.12  ? 258 GLU F OE2   1 
ATOM   4691 N  N     . CYS B 1 260 ? 39.110  14.908  64.782  1.00 57.14  ? 259 CYS F N     1 
ATOM   4692 C  CA    . CYS B 1 260 ? 38.028  13.954  64.556  1.00 57.13  ? 259 CYS F CA    1 
ATOM   4693 C  C     . CYS B 1 260 ? 38.033  12.867  65.625  1.00 61.12  ? 259 CYS F C     1 
ATOM   4694 O  O     . CYS B 1 260 ? 37.005  12.578  66.239  1.00 62.00  ? 259 CYS F O     1 
ATOM   4695 C  CB    . CYS B 1 260 ? 38.167  13.331  63.166  1.00 52.39  ? 259 CYS F CB    1 
ATOM   4696 S  SG    . CYS B 1 260 ? 36.838  12.188  62.699  1.00 47.27  ? 259 CYS F SG    1 
ATOM   4697 N  N     . GLU B 1 261 ? 39.210  12.292  65.850  1.00 59.80  ? 260 GLU F N     1 
ATOM   4698 C  CA    . GLU B 1 261 ? 39.427  11.298  66.892  1.00 61.28  ? 260 GLU F CA    1 
ATOM   4699 C  C     . GLU B 1 261 ? 39.082  11.857  68.269  1.00 58.46  ? 260 GLU F C     1 
ATOM   4700 O  O     . GLU B 1 261 ? 38.401  11.199  69.062  1.00 56.63  ? 260 GLU F O     1 
ATOM   4701 C  CB    . GLU B 1 261 ? 40.884  10.830  66.859  1.00 62.79  ? 260 GLU F CB    1 
ATOM   4702 C  CG    . GLU B 1 261 ? 41.477  10.502  68.219  1.00 65.21  ? 260 GLU F CG    1 
ATOM   4703 C  CD    . GLU B 1 261 ? 41.505  9.016   68.505  1.00 69.80  ? 260 GLU F CD    1 
ATOM   4704 O  OE1   . GLU B 1 261 ? 42.186  8.281   67.760  1.00 72.50  ? 260 GLU F OE1   1 
ATOM   4705 O  OE2   . GLU B 1 261 ? 40.850  8.585   69.476  1.00 69.40  ? 260 GLU F OE2   1 
ATOM   4706 N  N     . ALA B 1 262 ? 39.547  13.074  68.543  1.00 58.00  ? 261 ALA F N     1 
ATOM   4707 C  CA    . ALA B 1 262 ? 39.290  13.727  69.823  1.00 58.14  ? 261 ALA F CA    1 
ATOM   4708 C  C     . ALA B 1 262 ? 37.795  13.865  70.081  1.00 63.20  ? 261 ALA F C     1 
ATOM   4709 O  O     . ALA B 1 262 ? 37.344  13.789  71.223  1.00 61.66  ? 261 ALA F O     1 
ATOM   4710 C  CB    . ALA B 1 262 ? 39.968  15.091  69.875  1.00 48.62  ? 261 ALA F CB    1 
ATOM   4711 N  N     . ILE B 1 263 ? 37.030  14.059  69.011  1.00 65.75  ? 262 ILE F N     1 
ATOM   4712 C  CA    . ILE B 1 263 ? 35.583  14.195  69.121  1.00 63.81  ? 262 ILE F CA    1 
ATOM   4713 C  C     . ILE B 1 263 ? 34.901  12.839  69.292  1.00 62.33  ? 262 ILE F C     1 
ATOM   4714 O  O     . ILE B 1 263 ? 33.996  12.696  70.115  1.00 63.66  ? 262 ILE F O     1 
ATOM   4715 C  CB    . ILE B 1 263 ? 34.992  14.931  67.907  1.00 60.30  ? 262 ILE F CB    1 
ATOM   4716 C  CG1   . ILE B 1 263 ? 35.590  16.334  67.806  1.00 60.62  ? 262 ILE F CG1   1 
ATOM   4717 C  CG2   . ILE B 1 263 ? 33.480  15.015  68.019  1.00 64.48  ? 262 ILE F CG2   1 
ATOM   4718 C  CD1   . ILE B 1 263 ? 35.346  17.009  66.482  1.00 61.18  ? 262 ILE F CD1   1 
ATOM   4719 N  N     . ILE B 1 264 ? 35.339  11.848  68.517  1.00 53.21  ? 263 ILE F N     1 
ATOM   4720 C  CA    . ILE B 1 264 ? 34.806  10.491  68.632  1.00 49.68  ? 263 ILE F CA    1 
ATOM   4721 C  C     . ILE B 1 264 ? 34.981  9.962   70.053  1.00 53.83  ? 263 ILE F C     1 
ATOM   4722 O  O     . ILE B 1 264 ? 34.099  9.288   70.593  1.00 52.42  ? 263 ILE F O     1 
ATOM   4723 C  CB    . ILE B 1 264 ? 35.487  9.533   67.638  1.00 49.70  ? 263 ILE F CB    1 
ATOM   4724 C  CG1   . ILE B 1 264 ? 35.228  9.990   66.205  1.00 50.15  ? 263 ILE F CG1   1 
ATOM   4725 C  CG2   . ILE B 1 264 ? 34.983  8.109   67.826  1.00 49.92  ? 263 ILE F CG2   1 
ATOM   4726 C  CD1   . ILE B 1 264 ? 36.011  9.221   65.181  1.00 49.04  ? 263 ILE F CD1   1 
ATOM   4727 N  N     . GLU B 1 265 ? 36.122  10.291  70.655  1.00 60.27  ? 264 GLU F N     1 
ATOM   4728 C  CA    . GLU B 1 265 ? 36.396  9.939   72.045  1.00 57.27  ? 264 GLU F CA    1 
ATOM   4729 C  C     . GLU B 1 265 ? 35.321  10.474  72.988  1.00 55.95  ? 264 GLU F C     1 
ATOM   4730 O  O     . GLU B 1 265 ? 35.022  9.863   74.013  1.00 61.75  ? 264 GLU F O     1 
ATOM   4731 C  CB    . GLU B 1 265 ? 37.766  10.475  72.465  1.00 58.81  ? 264 GLU F CB    1 
ATOM   4732 C  CG    . GLU B 1 265 ? 38.940  9.735   71.850  1.00 56.75  ? 264 GLU F CG    1 
ATOM   4733 C  CD    . GLU B 1 265 ? 39.204  8.407   72.525  1.00 55.71  ? 264 GLU F CD    1 
ATOM   4734 O  OE1   . GLU B 1 265 ? 38.790  8.243   73.692  1.00 56.34  ? 264 GLU F OE1   1 
ATOM   4735 O  OE2   . GLU B 1 265 ? 39.823  7.527   71.891  1.00 62.07  ? 264 GLU F OE2   1 
ATOM   4736 N  N     . ARG B 1 266 ? 34.747  11.620  72.635  1.00 58.58  ? 265 ARG F N     1 
ATOM   4737 C  CA    . ARG B 1 266 ? 33.688  12.229  73.432  1.00 57.03  ? 265 ARG F CA    1 
ATOM   4738 C  C     . ARG B 1 266 ? 32.315  11.680  73.052  1.00 54.41  ? 265 ARG F C     1 
ATOM   4739 O  O     . ARG B 1 266 ? 31.390  11.678  73.863  1.00 56.54  ? 265 ARG F O     1 
ATOM   4740 C  CB    . ARG B 1 266 ? 33.717  13.754  73.283  1.00 52.30  ? 265 ARG F CB    1 
ATOM   4741 C  CG    . ARG B 1 266 ? 34.797  14.423  74.118  1.00 69.24  ? 265 ARG F CG    1 
ATOM   4742 C  CD    . ARG B 1 266 ? 35.583  15.466  73.334  1.00 71.77  ? 265 ARG F CD    1 
ATOM   4743 N  NE    . ARG B 1 266 ? 34.827  16.693  73.098  1.00 78.92  ? 265 ARG F NE    1 
ATOM   4744 C  CZ    . ARG B 1 266 ? 35.374  17.836  72.695  1.00 82.17  ? 265 ARG F CZ    1 
ATOM   4745 N  NH1   . ARG B 1 266 ? 36.683  17.910  72.491  1.00 78.78  ? 265 ARG F NH1   1 
ATOM   4746 N  NH2   . ARG B 1 266 ? 34.617  18.908  72.503  1.00 84.15  ? 265 ARG F NH2   1 
ATOM   4747 N  N     . LEU B 1 267 ? 32.197  11.206  71.817  1.00 54.49  ? 266 LEU F N     1 
ATOM   4748 C  CA    . LEU B 1 267 ? 30.930  10.699  71.303  1.00 49.91  ? 266 LEU F CA    1 
ATOM   4749 C  C     . LEU B 1 267 ? 30.610  9.301   71.822  1.00 55.70  ? 266 LEU F C     1 
ATOM   4750 O  O     . LEU B 1 267 ? 29.460  9.006   72.151  1.00 54.02  ? 266 LEU F O     1 
ATOM   4751 C  CB    . LEU B 1 267 ? 30.947  10.691  69.773  1.00 55.51  ? 266 LEU F CB    1 
ATOM   4752 C  CG    . LEU B 1 267 ? 29.981  11.635  69.057  1.00 54.39  ? 266 LEU F CG    1 
ATOM   4753 C  CD1   . LEU B 1 267 ? 30.048  13.031  69.653  1.00 59.86  ? 266 LEU F CD1   1 
ATOM   4754 C  CD2   . LEU B 1 267 ? 30.297  11.672  67.571  1.00 49.31  ? 266 LEU F CD2   1 
ATOM   4755 N  N     . TYR B 1 268 ? 31.627  8.445   71.893  1.00 54.03  ? 267 TYR F N     1 
ATOM   4756 C  CA    . TYR B 1 268 ? 31.425  7.039   72.258  1.00 51.30  ? 267 TYR F CA    1 
ATOM   4757 C  C     . TYR B 1 268 ? 30.711  6.764   73.594  1.00 48.98  ? 267 TYR F C     1 
ATOM   4758 O  O     . TYR B 1 268 ? 29.802  5.934   73.632  1.00 50.98  ? 267 TYR F O     1 
ATOM   4759 C  CB    . TYR B 1 268 ? 32.731  6.237   72.175  1.00 48.82  ? 267 TYR F CB    1 
ATOM   4760 C  CG    . TYR B 1 268 ? 32.526  4.761   72.431  1.00 44.65  ? 267 TYR F CG    1 
ATOM   4761 C  CD1   . TYR B 1 268 ? 32.758  4.212   73.687  1.00 42.08  ? 267 TYR F CD1   1 
ATOM   4762 C  CD2   . TYR B 1 268 ? 32.081  3.919   71.421  1.00 46.62  ? 267 TYR F CD2   1 
ATOM   4763 C  CE1   . TYR B 1 268 ? 32.561  2.865   73.925  1.00 44.15  ? 267 TYR F CE1   1 
ATOM   4764 C  CE2   . TYR B 1 268 ? 31.882  2.571   71.649  1.00 50.31  ? 267 TYR F CE2   1 
ATOM   4765 C  CZ    . TYR B 1 268 ? 32.123  2.049   72.902  1.00 48.16  ? 267 TYR F CZ    1 
ATOM   4766 O  OH    . TYR B 1 268 ? 31.925  0.707   73.132  1.00 54.51  ? 267 TYR F OH    1 
ATOM   4767 N  N     . PRO B 1 269 ? 31.124  7.432   74.691  1.00 49.34  ? 268 PRO F N     1 
ATOM   4768 C  CA    . PRO B 1 269 ? 30.423  7.168   75.954  1.00 50.29  ? 268 PRO F CA    1 
ATOM   4769 C  C     . PRO B 1 269 ? 28.929  7.475   75.869  1.00 54.35  ? 268 PRO F C     1 
ATOM   4770 O  O     . PRO B 1 269 ? 28.128  6.807   76.523  1.00 58.46  ? 268 PRO F O     1 
ATOM   4771 C  CB    . PRO B 1 269 ? 31.099  8.129   76.936  1.00 52.12  ? 268 PRO F CB    1 
ATOM   4772 C  CG    . PRO B 1 269 ? 32.451  8.352   76.369  1.00 49.87  ? 268 PRO F CG    1 
ATOM   4773 C  CD    . PRO B 1 269 ? 32.259  8.354   74.884  1.00 50.49  ? 268 PRO F CD    1 
ATOM   4774 N  N     . GLU B 1 270 ? 28.567  8.469   75.062  1.00 54.13  ? 269 GLU F N     1 
ATOM   4775 C  CA    . GLU B 1 270 ? 27.169  8.839   74.872  1.00 54.18  ? 269 GLU F CA    1 
ATOM   4776 C  C     . GLU B 1 270 ? 26.397  7.741   74.149  1.00 50.22  ? 269 GLU F C     1 
ATOM   4777 O  O     . GLU B 1 270 ? 25.327  7.331   74.595  1.00 54.73  ? 269 GLU F O     1 
ATOM   4778 C  CB    . GLU B 1 270 ? 27.063  10.153  74.096  1.00 49.00  ? 269 GLU F CB    1 
ATOM   4779 C  CG    . GLU B 1 270 ? 27.681  11.338  74.811  1.00 53.58  ? 269 GLU F CG    1 
ATOM   4780 C  CD    . GLU B 1 270 ? 27.104  11.542  76.197  1.00 62.56  ? 269 GLU F CD    1 
ATOM   4781 O  OE1   . GLU B 1 270 ? 26.016  12.145  76.305  1.00 71.09  ? 269 GLU F OE1   1 
ATOM   4782 O  OE2   . GLU B 1 270 ? 27.736  11.096  77.179  1.00 61.64  ? 269 GLU F OE2   1 
ATOM   4783 N  N     . LEU B 1 271 ? 26.945  7.272   73.032  1.00 45.01  ? 270 LEU F N     1 
ATOM   4784 C  CA    . LEU B 1 271 ? 26.339  6.181   72.274  1.00 49.91  ? 270 LEU F CA    1 
ATOM   4785 C  C     . LEU B 1 271 ? 26.219  4.921   73.127  1.00 51.41  ? 270 LEU F C     1 
ATOM   4786 O  O     . LEU B 1 271 ? 25.260  4.160   73.001  1.00 48.11  ? 270 LEU F O     1 
ATOM   4787 C  CB    . LEU B 1 271 ? 27.160  5.891   71.015  1.00 46.71  ? 270 LEU F CB    1 
ATOM   4788 C  CG    . LEU B 1 271 ? 26.702  4.689   70.183  1.00 45.25  ? 270 LEU F CG    1 
ATOM   4789 C  CD1   . LEU B 1 271 ? 25.276  4.886   69.692  1.00 46.65  ? 270 LEU F CD1   1 
ATOM   4790 C  CD2   . LEU B 1 271 ? 27.643  4.436   69.015  1.00 43.13  ? 270 LEU F CD2   1 
ATOM   4791 N  N     . GLU B 1 272 ? 27.198  4.718   74.004  1.00 52.54  ? 271 GLU F N     1 
ATOM   4792 C  CA    . GLU B 1 272 ? 27.239  3.557   74.889  1.00 56.34  ? 271 GLU F CA    1 
ATOM   4793 C  C     . GLU B 1 272 ? 26.183  3.658   75.989  1.00 56.55  ? 271 GLU F C     1 
ATOM   4794 O  O     . GLU B 1 272 ? 25.568  2.656   76.370  1.00 59.15  ? 271 GLU F O     1 
ATOM   4795 C  CB    . GLU B 1 272 ? 28.636  3.421   75.506  1.00 53.19  ? 271 GLU F CB    1 
ATOM   4796 C  CG    . GLU B 1 272 ? 28.833  2.204   76.402  1.00 56.14  ? 271 GLU F CG    1 
ATOM   4797 C  CD    . GLU B 1 272 ? 29.930  2.413   77.431  1.00 69.60  ? 271 GLU F CD    1 
ATOM   4798 O  OE1   . GLU B 1 272 ? 29.923  3.466   78.103  1.00 71.47  ? 271 GLU F OE1   1 
ATOM   4799 O  OE2   . GLU B 1 272 ? 30.793  1.524   77.576  1.00 73.85  ? 271 GLU F OE2   1 
ATOM   4800 N  N     . ARG B 1 273 ? 25.979  4.872   76.492  1.00 57.24  ? 272 ARG F N     1 
ATOM   4801 C  CA    . ARG B 1 273 ? 24.996  5.113   77.540  1.00 50.30  ? 272 ARG F CA    1 
ATOM   4802 C  C     . ARG B 1 273 ? 23.575  4.932   77.014  1.00 54.55  ? 272 ARG F C     1 
ATOM   4803 O  O     . ARG B 1 273 ? 22.701  4.423   77.717  1.00 57.69  ? 272 ARG F O     1 
ATOM   4804 C  CB    . ARG B 1 273 ? 25.181  6.519   78.109  1.00 52.75  ? 272 ARG F CB    1 
ATOM   4805 C  CG    . ARG B 1 273 ? 24.072  6.984   79.039  1.00 59.64  ? 272 ARG F CG    1 
ATOM   4806 C  CD    . ARG B 1 273 ? 24.318  8.408   79.507  1.00 61.46  ? 272 ARG F CD    1 
ATOM   4807 N  NE    . ARG B 1 273 ? 23.091  9.048   79.967  1.00 72.28  ? 272 ARG F NE    1 
ATOM   4808 C  CZ    . ARG B 1 273 ? 22.219  9.642   79.161  1.00 69.70  ? 272 ARG F CZ    1 
ATOM   4809 N  NH1   . ARG B 1 273 ? 22.440  9.676   77.854  1.00 66.69  ? 272 ARG F NH1   1 
ATOM   4810 N  NH2   . ARG B 1 273 ? 21.125  10.203  79.657  1.00 68.62  ? 272 ARG F NH2   1 
ATOM   4811 N  N     . ARG B 1 274 ? 23.357  5.337   75.767  1.00 51.40  ? 273 ARG F N     1 
ATOM   4812 C  CA    . ARG B 1 274 ? 22.041  5.249   75.149  1.00 52.57  ? 273 ARG F CA    1 
ATOM   4813 C  C     . ARG B 1 274 ? 21.698  3.819   74.747  1.00 55.94  ? 273 ARG F C     1 
ATOM   4814 O  O     . ARG B 1 274 ? 20.562  3.377   74.913  1.00 58.10  ? 273 ARG F O     1 
ATOM   4815 C  CB    . ARG B 1 274 ? 21.970  6.168   73.931  1.00 49.10  ? 273 ARG F CB    1 
ATOM   4816 C  CG    . ARG B 1 274 ? 22.184  7.631   74.263  1.00 53.72  ? 273 ARG F CG    1 
ATOM   4817 C  CD    . ARG B 1 274 ? 22.224  8.470   73.006  1.00 65.09  ? 273 ARG F CD    1 
ATOM   4818 N  NE    . ARG B 1 274 ? 20.948  8.448   72.302  1.00 70.09  ? 273 ARG F NE    1 
ATOM   4819 C  CZ    . ARG B 1 274 ? 20.745  9.004   71.115  1.00 65.13  ? 273 ARG F CZ    1 
ATOM   4820 N  NH1   . ARG B 1 274 ? 21.740  9.623   70.498  1.00 67.24  ? 273 ARG F NH1   1 
ATOM   4821 N  NH2   . ARG B 1 274 ? 19.552  8.941   70.546  1.00 69.62  ? 273 ARG F NH2   1 
ATOM   4822 N  N     . LEU B 1 275 ? 22.683  3.103   74.215  1.00 60.06  ? 274 LEU F N     1 
ATOM   4823 C  CA    . LEU B 1 275 ? 22.478  1.727   73.779  1.00 51.98  ? 274 LEU F CA    1 
ATOM   4824 C  C     . LEU B 1 275 ? 22.199  0.810   74.964  1.00 52.49  ? 274 LEU F C     1 
ATOM   4825 O  O     . LEU B 1 275 ? 21.407  -0.126  74.864  1.00 52.58  ? 274 LEU F O     1 
ATOM   4826 C  CB    . LEU B 1 275 ? 23.699  1.225   73.007  1.00 52.41  ? 274 LEU F CB    1 
ATOM   4827 C  CG    . LEU B 1 275 ? 23.616  -0.198  72.454  1.00 54.11  ? 274 LEU F CG    1 
ATOM   4828 C  CD1   . LEU B 1 275 ? 22.496  -0.312  71.433  1.00 51.40  ? 274 LEU F CD1   1 
ATOM   4829 C  CD2   . LEU B 1 275 ? 24.945  -0.609  71.848  1.00 46.32  ? 274 LEU F CD2   1 
ATOM   4830 N  N     . ALA B 1 276 ? 22.848  1.094   76.089  1.00 58.03  ? 275 ALA F N     1 
ATOM   4831 C  CA    . ALA B 1 276 ? 22.718  0.271   77.287  1.00 55.89  ? 275 ALA F CA    1 
ATOM   4832 C  C     . ALA B 1 276 ? 21.346  0.405   77.946  1.00 60.12  ? 275 ALA F C     1 
ATOM   4833 O  O     . ALA B 1 276 ? 20.995  -0.381  78.825  1.00 62.43  ? 275 ALA F O     1 
ATOM   4834 C  CB    . ALA B 1 276 ? 23.821  0.605   78.280  1.00 50.37  ? 275 ALA F CB    1 
ATOM   4835 N  N     . LYS B 1 277 ? 20.576  1.404   77.525  1.00 60.78  ? 276 LYS F N     1 
ATOM   4836 C  CA    . LYS B 1 277 ? 19.221  1.588   78.034  1.00 57.43  ? 276 LYS F CA    1 
ATOM   4837 C  C     . LYS B 1 277 ? 18.250  0.630   77.353  1.00 59.05  ? 276 LYS F C     1 
ATOM   4838 O  O     . LYS B 1 277 ? 17.218  0.269   77.920  1.00 58.94  ? 276 LYS F O     1 
ATOM   4839 C  CB    . LYS B 1 277 ? 18.754  3.030   77.825  1.00 56.89  ? 276 LYS F CB    1 
ATOM   4840 C  CG    . LYS B 1 277 ? 19.493  4.059   78.660  1.00 53.76  ? 276 LYS F CG    1 
ATOM   4841 C  CD    . LYS B 1 277 ? 18.917  5.448   78.441  1.00 60.66  ? 276 LYS F CD    1 
ATOM   4842 C  CE    . LYS B 1 277 ? 19.610  6.479   79.313  1.00 61.10  ? 276 LYS F CE    1 
ATOM   4843 N  NZ    . LYS B 1 277 ? 19.036  7.837   79.119  1.00 63.84  ? 276 LYS F NZ    1 
ATOM   4844 N  N     . VAL B 1 278 ? 18.588  0.225   76.133  1.00 55.47  ? 277 VAL F N     1 
ATOM   4845 C  CA    . VAL B 1 278 ? 17.729  -0.650  75.344  1.00 56.27  ? 277 VAL F CA    1 
ATOM   4846 C  C     . VAL B 1 278 ? 18.367  -2.029  75.190  1.00 58.70  ? 277 VAL F C     1 
ATOM   4847 O  O     . VAL B 1 278 ? 17.674  -3.034  75.020  1.00 59.13  ? 277 VAL F O     1 
ATOM   4848 C  CB    . VAL B 1 278 ? 17.452  -0.042  73.954  1.00 56.41  ? 277 VAL F CB    1 
ATOM   4849 C  CG1   . VAL B 1 278 ? 16.401  -0.850  73.206  1.00 57.08  ? 277 VAL F CG1   1 
ATOM   4850 C  CG2   . VAL B 1 278 ? 17.004  1.401   74.097  1.00 60.45  ? 277 VAL F CG2   1 
ATOM   4851 N  N     . LYS B 1 279 ? 19.693  -2.069  75.262  1.00 58.84  ? 278 LYS F N     1 
ATOM   4852 C  CA    . LYS B 1 279 ? 20.433  -3.318  75.134  1.00 58.75  ? 278 LYS F CA    1 
ATOM   4853 C  C     . LYS B 1 279 ? 21.686  -3.268  76.006  1.00 59.19  ? 278 LYS F C     1 
ATOM   4854 O  O     . LYS B 1 279 ? 22.768  -2.934  75.522  1.00 59.93  ? 278 LYS F O     1 
ATOM   4855 C  CB    . LYS B 1 279 ? 20.814  -3.557  73.672  1.00 56.34  ? 278 LYS F CB    1 
ATOM   4856 C  CG    . LYS B 1 279 ? 21.159  -4.998  73.334  1.00 61.76  ? 278 LYS F CG    1 
ATOM   4857 C  CD    . LYS B 1 279 ? 19.948  -5.906  73.484  1.00 60.29  ? 278 LYS F CD    1 
ATOM   4858 C  CE    . LYS B 1 279 ? 20.188  -7.261  72.835  1.00 66.16  ? 278 LYS F CE    1 
ATOM   4859 N  NZ    . LYS B 1 279 ? 21.375  -7.953  73.404  1.00 64.33  ? 278 LYS F NZ    1 
ATOM   4860 N  N     . PRO B 1 280 ? 21.536  -3.598  77.300  1.00 57.31  ? 279 PRO F N     1 
ATOM   4861 C  CA    . PRO B 1 280 ? 22.602  -3.517  78.308  1.00 59.41  ? 279 PRO F CA    1 
ATOM   4862 C  C     . PRO B 1 280 ? 23.870  -4.285  77.939  1.00 58.58  ? 279 PRO F C     1 
ATOM   4863 O  O     . PRO B 1 280 ? 24.969  -3.807  78.219  1.00 54.96  ? 279 PRO F O     1 
ATOM   4864 C  CB    . PRO B 1 280 ? 21.952  -4.141  79.547  1.00 58.91  ? 279 PRO F CB    1 
ATOM   4865 C  CG    . PRO B 1 280 ? 20.499  -3.887  79.366  1.00 51.34  ? 279 PRO F CG    1 
ATOM   4866 C  CD    . PRO B 1 280 ? 20.257  -4.028  77.892  1.00 55.97  ? 279 PRO F CD    1 
ATOM   4867 N  N     . ASP B 1 281 ? 23.723  -5.452  77.319  1.00 58.76  ? 280 ASP F N     1 
ATOM   4868 C  CA    . ASP B 1 281 ? 24.883  -6.255  76.937  1.00 62.39  ? 280 ASP F CA    1 
ATOM   4869 C  C     . ASP B 1 281 ? 25.540  -5.733  75.659  1.00 63.86  ? 280 ASP F C     1 
ATOM   4870 O  O     . ASP B 1 281 ? 26.496  -6.325  75.156  1.00 65.72  ? 280 ASP F O     1 
ATOM   4871 C  CB    . ASP B 1 281 ? 24.504  -7.732  76.793  1.00 61.07  ? 280 ASP F CB    1 
ATOM   4872 C  CG    . ASP B 1 281 ? 23.443  -7.965  75.736  1.00 65.42  ? 280 ASP F CG    1 
ATOM   4873 O  OD1   . ASP B 1 281 ? 22.795  -6.987  75.311  1.00 67.09  ? 280 ASP F OD1   1 
ATOM   4874 O  OD2   . ASP B 1 281 ? 23.250  -9.133  75.337  1.00 63.99  ? 280 ASP F OD2   1 
ATOM   4875 N  N     . LEU B 1 282 ? 25.005  -4.629  75.141  1.00 60.69  ? 281 LEU F N     1 
ATOM   4876 C  CA    . LEU B 1 282 ? 25.572  -3.922  73.992  1.00 52.15  ? 281 LEU F CA    1 
ATOM   4877 C  C     . LEU B 1 282 ? 25.629  -4.755  72.713  1.00 56.13  ? 281 LEU F C     1 
ATOM   4878 O  O     . LEU B 1 282 ? 26.303  -4.378  71.754  1.00 58.02  ? 281 LEU F O     1 
ATOM   4879 C  CB    . LEU B 1 282 ? 26.964  -3.375  74.326  1.00 49.21  ? 281 LEU F CB    1 
ATOM   4880 C  CG    . LEU B 1 282 ? 27.064  -2.477  75.560  1.00 50.41  ? 281 LEU F CG    1 
ATOM   4881 C  CD1   . LEU B 1 282 ? 28.507  -2.060  75.807  1.00 43.48  ? 281 LEU F CD1   1 
ATOM   4882 C  CD2   . LEU B 1 282 ? 26.169  -1.258  75.410  1.00 57.10  ? 281 LEU F CD2   1 
ATOM   4883 N  N     . LEU B 1 283 ? 24.921  -5.879  72.694  1.00 53.33  ? 282 LEU F N     1 
ATOM   4884 C  CA    . LEU B 1 283 ? 24.910  -6.737  71.515  1.00 55.01  ? 282 LEU F CA    1 
ATOM   4885 C  C     . LEU B 1 283 ? 24.097  -6.110  70.392  1.00 55.98  ? 282 LEU F C     1 
ATOM   4886 O  O     . LEU B 1 283 ? 22.912  -5.818  70.552  1.00 58.87  ? 282 LEU F O     1 
ATOM   4887 C  CB    . LEU B 1 283 ? 24.379  -8.131  71.849  1.00 63.87  ? 282 LEU F CB    1 
ATOM   4888 C  CG    . LEU B 1 283 ? 25.235  -8.960  72.808  1.00 59.97  ? 282 LEU F CG    1 
ATOM   4889 C  CD1   . LEU B 1 283 ? 24.874  -10.435 72.702  1.00 51.89  ? 282 LEU F CD1   1 
ATOM   4890 C  CD2   . LEU B 1 283 ? 26.720  -8.741  72.552  1.00 57.48  ? 282 LEU F CD2   1 
ATOM   4891 N  N     . ILE B 1 284 ? 24.749  -5.905  69.253  1.00 57.04  ? 283 ILE F N     1 
ATOM   4892 C  CA    . ILE B 1 284 ? 24.139  -5.215  68.126  1.00 53.27  ? 283 ILE F CA    1 
ATOM   4893 C  C     . ILE B 1 284 ? 24.283  -6.027  66.847  1.00 56.17  ? 283 ILE F C     1 
ATOM   4894 O  O     . ILE B 1 284 ? 24.922  -7.080  66.838  1.00 55.43  ? 283 ILE F O     1 
ATOM   4895 C  CB    . ILE B 1 284 ? 24.788  -3.839  67.919  1.00 47.93  ? 283 ILE F CB    1 
ATOM   4896 C  CG1   . ILE B 1 284 ? 26.279  -4.003  67.617  1.00 50.62  ? 283 ILE F CG1   1 
ATOM   4897 C  CG2   . ILE B 1 284 ? 24.598  -2.980  69.153  1.00 49.67  ? 283 ILE F CG2   1 
ATOM   4898 C  CD1   . ILE B 1 284 ? 27.059  -2.706  67.628  1.00 50.28  ? 283 ILE F CD1   1 
ATOM   4899 N  N     . ALA B 1 285 ? 23.686  -5.535  65.767  1.00 55.71  ? 284 ALA F N     1 
ATOM   4900 C  CA    . ALA B 1 285 ? 23.776  -6.204  64.476  1.00 55.92  ? 284 ALA F CA    1 
ATOM   4901 C  C     . ALA B 1 285 ? 24.855  -5.563  63.612  1.00 60.13  ? 284 ALA F C     1 
ATOM   4902 O  O     . ALA B 1 285 ? 25.652  -6.255  62.979  1.00 64.90  ? 284 ALA F O     1 
ATOM   4903 C  CB    . ALA B 1 285 ? 22.432  -6.169  63.765  1.00 53.02  ? 284 ALA F CB    1 
ATOM   4904 N  N     . ARG B 1 286 ? 24.870  -4.234  63.591  1.00 52.10  ? 285 ARG F N     1 
ATOM   4905 C  CA    . ARG B 1 286 ? 25.833  -3.483  62.797  1.00 49.55  ? 285 ARG F CA    1 
ATOM   4906 C  C     . ARG B 1 286 ? 26.300  -2.249  63.555  1.00 52.21  ? 285 ARG F C     1 
ATOM   4907 O  O     . ARG B 1 286 ? 25.601  -1.752  64.441  1.00 55.90  ? 285 ARG F O     1 
ATOM   4908 C  CB    . ARG B 1 286 ? 25.205  -3.050  61.469  1.00 52.45  ? 285 ARG F CB    1 
ATOM   4909 C  CG    . ARG B 1 286 ? 24.820  -4.195  60.545  1.00 58.72  ? 285 ARG F CG    1 
ATOM   4910 C  CD    . ARG B 1 286 ? 23.705  -3.786  59.595  1.00 51.88  ? 285 ARG F CD    1 
ATOM   4911 N  NE    . ARG B 1 286 ? 24.069  -2.628  58.784  1.00 67.41  ? 285 ARG F NE    1 
ATOM   4912 C  CZ    . ARG B 1 286 ? 24.661  -2.706  57.597  1.00 79.53  ? 285 ARG F CZ    1 
ATOM   4913 N  NH1   . ARG B 1 286 ? 24.956  -3.890  57.079  1.00 73.75  ? 285 ARG F NH1   1 
ATOM   4914 N  NH2   . ARG B 1 286 ? 24.956  -1.600  56.926  1.00 72.64  ? 285 ARG F NH2   1 
ATOM   4915 N  N     . GLN B 1 287 ? 27.485  -1.758  63.208  1.00 49.68  ? 286 GLN F N     1 
ATOM   4916 C  CA    . GLN B 1 287 ? 27.948  -0.473  63.722  1.00 50.52  ? 286 GLN F CA    1 
ATOM   4917 C  C     . GLN B 1 287 ? 28.761  0.257   62.660  1.00 51.32  ? 286 GLN F C     1 
ATOM   4918 O  O     . GLN B 1 287 ? 29.225  -0.352  61.691  1.00 49.42  ? 286 GLN F O     1 
ATOM   4919 C  CB    . GLN B 1 287 ? 28.748  -0.632  65.021  1.00 49.52  ? 286 GLN F CB    1 
ATOM   4920 C  CG    . GLN B 1 287 ? 30.217  -0.986  64.843  1.00 49.81  ? 286 GLN F CG    1 
ATOM   4921 C  CD    . GLN B 1 287 ? 30.998  -0.876  66.143  1.00 51.63  ? 286 GLN F CD    1 
ATOM   4922 O  OE1   . GLN B 1 287 ? 30.418  -0.729  67.219  1.00 47.03  ? 286 GLN F OE1   1 
ATOM   4923 N  NE2   . GLN B 1 287 ? 32.322  -0.939  66.047  1.00 50.79  ? 286 GLN F NE2   1 
ATOM   4924 N  N     . GLY B 1 288 ? 28.916  1.566   62.834  1.00 44.59  ? 287 GLY F N     1 
ATOM   4925 C  CA    . GLY B 1 288 ? 29.632  2.368   61.863  1.00 47.28  ? 287 GLY F CA    1 
ATOM   4926 C  C     . GLY B 1 288 ? 29.662  3.854   62.160  1.00 52.20  ? 287 GLY F C     1 
ATOM   4927 O  O     . GLY B 1 288 ? 29.306  4.290   63.256  1.00 48.80  ? 287 GLY F O     1 
ATOM   4928 N  N     . VAL B 1 289 ? 30.091  4.635   61.172  1.00 53.74  ? 288 VAL F N     1 
ATOM   4929 C  CA    . VAL B 1 289 ? 30.280  6.071   61.358  1.00 49.84  ? 288 VAL F CA    1 
ATOM   4930 C  C     . VAL B 1 289 ? 29.716  6.903   60.210  1.00 50.46  ? 288 VAL F C     1 
ATOM   4931 O  O     . VAL B 1 289 ? 29.401  6.380   59.139  1.00 47.51  ? 288 VAL F O     1 
ATOM   4932 C  CB    . VAL B 1 289 ? 31.773  6.425   61.503  1.00 47.16  ? 288 VAL F CB    1 
ATOM   4933 C  CG1   . VAL B 1 289 ? 32.338  5.857   62.794  1.00 49.31  ? 288 VAL F CG1   1 
ATOM   4934 C  CG2   . VAL B 1 289 ? 32.554  5.919   60.300  1.00 47.60  ? 288 VAL F CG2   1 
ATOM   4935 N  N     . LYS B 1 290 ? 29.602  8.205   60.450  1.00 43.08  ? 289 LYS F N     1 
ATOM   4936 C  CA    . LYS B 1 290 ? 29.179  9.155   59.429  1.00 47.13  ? 289 LYS F CA    1 
ATOM   4937 C  C     . LYS B 1 290 ? 30.069  10.392  59.432  1.00 52.80  ? 289 LYS F C     1 
ATOM   4938 O  O     . LYS B 1 290 ? 30.388  10.937  60.490  1.00 49.29  ? 289 LYS F O     1 
ATOM   4939 C  CB    . LYS B 1 290 ? 27.721  9.569   59.636  1.00 55.17  ? 289 LYS F CB    1 
ATOM   4940 C  CG    . LYS B 1 290 ? 27.365  10.900  58.983  1.00 55.36  ? 289 LYS F CG    1 
ATOM   4941 C  CD    . LYS B 1 290 ? 25.877  11.183  59.050  1.00 56.17  ? 289 LYS F CD    1 
ATOM   4942 C  CE    . LYS B 1 290 ? 25.362  11.088  60.471  1.00 57.24  ? 289 LYS F CE    1 
ATOM   4943 N  NZ    . LYS B 1 290 ? 23.928  11.481  60.563  1.00 63.54  ? 289 LYS F NZ    1 
ATOM   4944 N  N     . LEU B 1 291 ? 30.473  10.827  58.243  1.00 55.92  ? 290 LEU F N     1 
ATOM   4945 C  CA    . LEU B 1 291 ? 31.218  12.070  58.095  1.00 60.10  ? 290 LEU F CA    1 
ATOM   4946 C  C     . LEU B 1 291 ? 30.444  13.073  57.242  1.00 55.15  ? 290 LEU F C     1 
ATOM   4947 O  O     . LEU B 1 291 ? 29.903  12.723  56.188  1.00 59.22  ? 290 LEU F O     1 
ATOM   4948 C  CB    . LEU B 1 291 ? 32.604  11.808  57.496  1.00 57.20  ? 290 LEU F CB    1 
ATOM   4949 C  CG    . LEU B 1 291 ? 33.657  11.221  58.440  1.00 49.79  ? 290 LEU F CG    1 
ATOM   4950 C  CD1   . LEU B 1 291 ? 34.995  11.089  57.737  1.00 52.91  ? 290 LEU F CD1   1 
ATOM   4951 C  CD2   . LEU B 1 291 ? 33.794  12.078  59.688  1.00 48.44  ? 290 LEU F CD2   1 
ATOM   4952 N  N     . LYS B 1 292 ? 30.392  14.316  57.712  1.00 50.88  ? 291 LYS F N     1 
ATOM   4953 C  CA    . LYS B 1 292 ? 29.704  15.391  57.002  1.00 60.23  ? 291 LYS F CA    1 
ATOM   4954 C  C     . LYS B 1 292 ? 30.660  16.550  56.737  1.00 64.62  ? 291 LYS F C     1 
ATOM   4955 O  O     . LYS B 1 292 ? 31.276  17.097  57.661  1.00 63.73  ? 291 LYS F O     1 
ATOM   4956 C  CB    . LYS B 1 292 ? 28.491  15.865  57.801  1.00 61.62  ? 291 LYS F CB    1 
ATOM   4957 C  CG    . LYS B 1 292 ? 27.725  17.020  57.177  1.00 62.32  ? 291 LYS F CG    1 
ATOM   4958 C  CD    . LYS B 1 292 ? 26.519  16.522  56.407  1.00 63.24  ? 291 LYS F CD    1 
ATOM   4959 C  CE    . LYS B 1 292 ? 25.330  17.436  56.613  1.00 61.19  ? 291 LYS F CE    1 
ATOM   4960 N  NZ    . LYS B 1 292 ? 25.187  17.777  58.045  1.00 62.69  ? 291 LYS F NZ    1 
ATOM   4961 N  N     . PHE B 1 293 ? 30.772  16.932  55.471  1.00 66.03  ? 292 PHE F N     1 
ATOM   4962 C  CA    . PHE B 1 293 ? 31.803  17.877  55.058  1.00 64.71  ? 292 PHE F CA    1 
ATOM   4963 C  C     . PHE B 1 293 ? 31.342  19.332  55.001  1.00 65.40  ? 292 PHE F C     1 
ATOM   4964 O  O     . PHE B 1 293 ? 30.212  19.647  55.367  1.00 67.37  ? 292 PHE F O     1 
ATOM   4965 C  CB    . PHE B 1 293 ? 32.357  17.451  53.709  1.00 61.96  ? 292 PHE F CB    1 
ATOM   4966 C  CG    . PHE B 1 293 ? 32.721  15.999  53.645  1.00 63.52  ? 292 PHE F CG    1 
ATOM   4967 C  CD1   . PHE B 1 293 ? 32.077  15.148  52.756  1.00 62.73  ? 292 PHE F CD1   1 
ATOM   4968 C  CD2   . PHE B 1 293 ? 33.705  15.480  54.482  1.00 66.24  ? 292 PHE F CD2   1 
ATOM   4969 C  CE1   . PHE B 1 293 ? 32.413  13.806  52.692  1.00 60.30  ? 292 PHE F CE1   1 
ATOM   4970 C  CE2   . PHE B 1 293 ? 34.043  14.136  54.429  1.00 60.67  ? 292 PHE F CE2   1 
ATOM   4971 C  CZ    . PHE B 1 293 ? 33.397  13.300  53.532  1.00 56.30  ? 292 PHE F CZ    1 
ATOM   4972 N  N     . ASP B 1 294 ? 32.232  20.214  54.548  1.00 68.91  ? 293 ASP F N     1 
ATOM   4973 C  CA    . ASP B 1 294 ? 31.926  21.638  54.439  1.00 67.54  ? 293 ASP F CA    1 
ATOM   4974 C  C     . ASP B 1 294 ? 30.988  21.917  53.271  1.00 64.30  ? 293 ASP F C     1 
ATOM   4975 O  O     . ASP B 1 294 ? 30.209  22.867  53.308  1.00 65.17  ? 293 ASP F O     1 
ATOM   4976 C  CB    . ASP B 1 294 ? 33.215  22.459  54.305  1.00 66.52  ? 293 ASP F CB    1 
ATOM   4977 C  CG    . ASP B 1 294 ? 34.196  21.854  53.311  1.00 67.54  ? 293 ASP F CG    1 
ATOM   4978 O  OD1   . ASP B 1 294 ? 33.765  21.040  52.466  1.00 62.69  ? 293 ASP F OD1   1 
ATOM   4979 O  OD2   . ASP B 1 294 ? 35.400  22.189  53.371  1.00 73.90  ? 293 ASP F OD2   1 
ATOM   4980 N  N     . ASP B 1 295 ? 31.061  21.078  52.241  1.00 59.92  ? 294 ASP F N     1 
ATOM   4981 C  CA    . ASP B 1 295 ? 30.197  21.217  51.071  1.00 57.27  ? 294 ASP F CA    1 
ATOM   4982 C  C     . ASP B 1 295 ? 28.817  20.610  51.336  1.00 70.77  ? 294 ASP F C     1 
ATOM   4983 O  O     . ASP B 1 295 ? 27.960  20.570  50.448  1.00 74.12  ? 294 ASP F O     1 
ATOM   4984 C  CB    . ASP B 1 295 ? 30.856  20.603  49.823  1.00 59.95  ? 294 ASP F CB    1 
ATOM   4985 C  CG    . ASP B 1 295 ? 30.920  19.080  49.865  1.00 67.35  ? 294 ASP F CG    1 
ATOM   4986 O  OD1   . ASP B 1 295 ? 30.691  18.490  50.936  1.00 73.74  ? 294 ASP F OD1   1 
ATOM   4987 O  OD2   . ASP B 1 295 ? 31.214  18.464  48.818  1.00 68.07  ? 294 ASP F OD2   1 
ATOM   4988 N  N     . PHE B 1 296 ? 28.637  20.133  52.568  1.00 71.26  ? 295 PHE F N     1 
ATOM   4989 C  CA    . PHE B 1 296 ? 27.369  19.596  53.066  1.00 71.17  ? 295 PHE F CA    1 
ATOM   4990 C  C     . PHE B 1 296 ? 26.996  18.221  52.515  1.00 66.19  ? 295 PHE F C     1 
ATOM   4991 O  O     . PHE B 1 296 ? 25.882  17.742  52.727  1.00 68.17  ? 295 PHE F O     1 
ATOM   4992 C  CB    . PHE B 1 296 ? 26.222  20.599  52.891  1.00 66.57  ? 295 PHE F CB    1 
ATOM   4993 C  CG    . PHE B 1 296 ? 25.428  20.827  54.144  1.00 64.14  ? 295 PHE F CG    1 
ATOM   4994 C  CD1   . PHE B 1 296 ? 24.231  20.162  54.357  1.00 68.52  ? 295 PHE F CD1   1 
ATOM   4995 C  CD2   . PHE B 1 296 ? 25.885  21.701  55.116  1.00 62.33  ? 295 PHE F CD2   1 
ATOM   4996 C  CE1   . PHE B 1 296 ? 23.503  20.370  55.514  1.00 70.86  ? 295 PHE F CE1   1 
ATOM   4997 C  CE2   . PHE B 1 296 ? 25.163  21.913  56.273  1.00 67.96  ? 295 PHE F CE2   1 
ATOM   4998 C  CZ    . PHE B 1 296 ? 23.971  21.247  56.473  1.00 70.58  ? 295 PHE F CZ    1 
ATOM   4999 N  N     . GLN B 1 297 ? 27.927  17.589  51.811  1.00 61.05  ? 296 GLN F N     1 
ATOM   5000 C  CA    . GLN B 1 297 ? 27.750  16.200  51.422  1.00 61.78  ? 296 GLN F CA    1 
ATOM   5001 C  C     . GLN B 1 297 ? 27.969  15.359  52.675  1.00 65.62  ? 296 GLN F C     1 
ATOM   5002 O  O     . GLN B 1 297 ? 28.497  15.858  53.673  1.00 66.30  ? 296 GLN F O     1 
ATOM   5003 C  CB    . GLN B 1 297 ? 28.757  15.814  50.338  1.00 58.25  ? 296 GLN F CB    1 
ATOM   5004 C  CG    . GLN B 1 297 ? 28.471  14.490  49.644  1.00 53.06  ? 296 GLN F CG    1 
ATOM   5005 C  CD    . GLN B 1 297 ? 29.664  13.975  48.867  1.00 67.83  ? 296 GLN F CD    1 
ATOM   5006 O  OE1   . GLN B 1 297 ? 30.766  14.510  48.980  1.00 71.18  ? 296 GLN F OE1   1 
ATOM   5007 N  NE2   . GLN B 1 297 ? 29.453  12.929  48.075  1.00 64.05  ? 296 GLN F NE2   1 
ATOM   5008 N  N     . GLN B 1 298 ? 27.557  14.096  52.641  1.00 62.91  ? 297 GLN F N     1 
ATOM   5009 C  CA    . GLN B 1 298 ? 27.829  13.209  53.767  1.00 60.24  ? 297 GLN F CA    1 
ATOM   5010 C  C     . GLN B 1 298 ? 28.015  11.761  53.328  1.00 58.39  ? 297 GLN F C     1 
ATOM   5011 O  O     . GLN B 1 298 ? 27.541  11.360  52.258  1.00 62.45  ? 297 GLN F O     1 
ATOM   5012 C  CB    . GLN B 1 298 ? 26.725  13.304  54.822  1.00 62.72  ? 297 GLN F CB    1 
ATOM   5013 C  CG    . GLN B 1 298 ? 25.621  12.259  54.668  1.00 63.54  ? 297 GLN F CG    1 
ATOM   5014 C  CD    . GLN B 1 298 ? 24.613  12.303  55.797  1.00 64.31  ? 297 GLN F CD    1 
ATOM   5015 O  OE1   . GLN B 1 298 ? 24.280  13.373  56.300  1.00 66.78  ? 297 GLN F OE1   1 
ATOM   5016 N  NE2   . GLN B 1 298 ? 24.124  11.138  56.204  1.00 58.24  ? 297 GLN F NE2   1 
ATOM   5017 N  N     . THR B 1 299 ? 28.724  10.988  54.146  1.00 56.44  ? 298 THR F N     1 
ATOM   5018 C  CA    . THR B 1 299 ? 28.933  9.579   53.844  1.00 53.82  ? 298 THR F CA    1 
ATOM   5019 C  C     . THR B 1 299 ? 28.901  8.723   55.101  1.00 56.49  ? 298 THR F C     1 
ATOM   5020 O  O     . THR B 1 299 ? 29.243  9.190   56.189  1.00 49.62  ? 298 THR F O     1 
ATOM   5021 C  CB    . THR B 1 299 ? 30.255  9.352   53.095  1.00 62.41  ? 298 THR F CB    1 
ATOM   5022 O  OG1   . THR B 1 299 ? 30.476  7.947   52.935  1.00 63.97  ? 298 THR F OG1   1 
ATOM   5023 C  CG2   . THR B 1 299 ? 31.421  9.956   53.858  1.00 59.33  ? 298 THR F CG2   1 
ATOM   5024 N  N     . THR B 1 300 ? 28.483  7.471   54.942  1.00 51.53  ? 299 THR F N     1 
ATOM   5025 C  CA    . THR B 1 300 ? 28.388  6.545   56.065  1.00 51.42  ? 299 THR F CA    1 
ATOM   5026 C  C     . THR B 1 300 ? 29.146  5.258   55.773  1.00 57.48  ? 299 THR F C     1 
ATOM   5027 O  O     . THR B 1 300 ? 29.120  4.752   54.646  1.00 59.15  ? 299 THR F O     1 
ATOM   5028 C  CB    . THR B 1 300 ? 26.924  6.184   56.382  1.00 55.35  ? 299 THR F CB    1 
ATOM   5029 O  OG1   . THR B 1 300 ? 26.319  5.572   55.234  1.00 51.34  ? 299 THR F OG1   1 
ATOM   5030 C  CG2   . THR B 1 300 ? 26.144  7.424   56.764  1.00 47.00  ? 299 THR F CG2   1 
ATOM   5031 N  N     . GLN B 1 301 ? 29.826  4.733   56.786  1.00 53.22  ? 300 GLN F N     1 
ATOM   5032 C  CA    . GLN B 1 301 ? 30.482  3.444   56.649  1.00 54.62  ? 300 GLN F CA    1 
ATOM   5033 C  C     . GLN B 1 301 ? 30.028  2.542   57.787  1.00 53.11  ? 300 GLN F C     1 
ATOM   5034 O  O     . GLN B 1 301 ? 30.374  2.764   58.947  1.00 49.38  ? 300 GLN F O     1 
ATOM   5035 C  CB    . GLN B 1 301 ? 32.001  3.606   56.653  1.00 61.87  ? 300 GLN F CB    1 
ATOM   5036 C  CG    . GLN B 1 301 ? 32.726  2.637   55.728  1.00 63.51  ? 300 GLN F CG    1 
ATOM   5037 C  CD    . GLN B 1 301 ? 34.199  2.967   55.568  1.00 69.51  ? 300 GLN F CD    1 
ATOM   5038 O  OE1   . GLN B 1 301 ? 35.054  2.083   55.619  1.00 71.26  ? 300 GLN F OE1   1 
ATOM   5039 N  NE2   . GLN B 1 301 ? 34.501  4.244   55.367  1.00 63.45  ? 300 GLN F NE2   1 
ATOM   5040 N  N     . GLU B 1 302 ? 29.241  1.529   57.443  1.00 57.13  ? 301 GLU F N     1 
ATOM   5041 C  CA    . GLU B 1 302 ? 28.629  0.654   58.433  1.00 57.78  ? 301 GLU F CA    1 
ATOM   5042 C  C     . GLU B 1 302 ? 28.841  -0.806  58.064  1.00 58.63  ? 301 GLU F C     1 
ATOM   5043 O  O     . GLU B 1 302 ? 28.648  -1.196  56.912  1.00 61.17  ? 301 GLU F O     1 
ATOM   5044 C  CB    . GLU B 1 302 ? 27.131  0.942   58.532  1.00 60.06  ? 301 GLU F CB    1 
ATOM   5045 C  CG    . GLU B 1 302 ? 26.802  2.379   58.887  1.00 65.85  ? 301 GLU F CG    1 
ATOM   5046 C  CD    . GLU B 1 302 ? 25.448  2.808   58.364  1.00 74.26  ? 301 GLU F CD    1 
ATOM   5047 O  OE1   . GLU B 1 302 ? 24.864  2.066   57.546  1.00 78.02  ? 301 GLU F OE1   1 
ATOM   5048 O  OE2   . GLU B 1 302 ? 24.967  3.888   58.769  1.00 67.18  ? 301 GLU F OE2   1 
ATOM   5049 N  N     . HIS B 1 303 ? 29.228  -1.613  59.045  1.00 53.65  ? 302 HIS F N     1 
ATOM   5050 C  CA    . HIS B 1 303 ? 29.460  -3.032  58.806  1.00 58.09  ? 302 HIS F CA    1 
ATOM   5051 C  C     . HIS B 1 303 ? 28.840  -3.879  59.910  1.00 57.96  ? 302 HIS F C     1 
ATOM   5052 O  O     . HIS B 1 303 ? 28.530  -3.365  60.989  1.00 57.40  ? 302 HIS F O     1 
ATOM   5053 C  CB    . HIS B 1 303 ? 30.961  -3.307  58.707  1.00 55.96  ? 302 HIS F CB    1 
ATOM   5054 C  CG    . HIS B 1 303 ? 31.752  -2.746  59.847  1.00 49.00  ? 302 HIS F CG    1 
ATOM   5055 N  ND1   . HIS B 1 303 ? 32.504  -1.597  59.739  1.00 52.76  ? 302 HIS F ND1   1 
ATOM   5056 C  CD2   . HIS B 1 303 ? 31.901  -3.175  61.123  1.00 49.95  ? 302 HIS F CD2   1 
ATOM   5057 C  CE1   . HIS B 1 303 ? 33.086  -1.343  60.898  1.00 51.02  ? 302 HIS F CE1   1 
ATOM   5058 N  NE2   . HIS B 1 303 ? 32.736  -2.285  61.754  1.00 49.33  ? 302 HIS F NE2   1 
ATOM   5059 N  N     . VAL B 1 304 ? 28.648  -5.170  59.646  1.00 58.31  ? 303 VAL F N     1 
ATOM   5060 C  CA    . VAL B 1 304 ? 28.165  -6.059  60.698  1.00 58.61  ? 303 VAL F CA    1 
ATOM   5061 C  C     . VAL B 1 304 ? 29.208  -6.144  61.807  1.00 58.57  ? 303 VAL F C     1 
ATOM   5062 O  O     . VAL B 1 304 ? 30.412  -6.066  61.549  1.00 54.60  ? 303 VAL F O     1 
ATOM   5063 C  CB    . VAL B 1 304 ? 27.768  -7.476  60.187  1.00 53.66  ? 303 VAL F CB    1 
ATOM   5064 C  CG1   . VAL B 1 304 ? 27.415  -7.447  58.712  1.00 57.34  ? 303 VAL F CG1   1 
ATOM   5065 C  CG2   . VAL B 1 304 ? 28.860  -8.486  60.443  1.00 54.53  ? 303 VAL F CG2   1 
ATOM   5066 N  N     . TRP B 1 305 ? 28.734  -6.288  63.038  1.00 56.50  ? 304 TRP F N     1 
ATOM   5067 C  CA    . TRP B 1 305 ? 29.589  -6.223  64.210  1.00 52.62  ? 304 TRP F CA    1 
ATOM   5068 C  C     . TRP B 1 305 ? 28.721  -6.578  65.409  1.00 58.03  ? 304 TRP F C     1 
ATOM   5069 O  O     . TRP B 1 305 ? 27.639  -6.019  65.580  1.00 62.41  ? 304 TRP F O     1 
ATOM   5070 C  CB    . TRP B 1 305 ? 30.175  -4.816  64.354  1.00 48.42  ? 304 TRP F CB    1 
ATOM   5071 C  CG    . TRP B 1 305 ? 31.260  -4.711  65.375  1.00 54.52  ? 304 TRP F CG    1 
ATOM   5072 C  CD1   . TRP B 1 305 ? 31.104  -4.436  66.694  1.00 54.22  ? 304 TRP F CD1   1 
ATOM   5073 C  CD2   . TRP B 1 305 ? 32.670  -4.875  65.162  1.00 56.93  ? 304 TRP F CD2   1 
ATOM   5074 N  NE1   . TRP B 1 305 ? 32.324  -4.420  67.325  1.00 51.37  ? 304 TRP F NE1   1 
ATOM   5075 C  CE2   . TRP B 1 305 ? 33.303  -4.685  66.406  1.00 54.33  ? 304 TRP F CE2   1 
ATOM   5076 C  CE3   . TRP B 1 305 ? 33.456  -5.165  64.043  1.00 55.89  ? 304 TRP F CE3   1 
ATOM   5077 C  CZ2   . TRP B 1 305 ? 34.686  -4.775  66.563  1.00 53.16  ? 304 TRP F CZ2   1 
ATOM   5078 C  CZ3   . TRP B 1 305 ? 34.831  -5.253  64.201  1.00 47.09  ? 304 TRP F CZ3   1 
ATOM   5079 C  CH2   . TRP B 1 305 ? 35.431  -5.059  65.452  1.00 46.56  ? 304 TRP F CH2   1 
ATOM   5080 N  N     . PRO B 1 306 ? 29.189  -7.517  66.244  1.00 59.48  ? 305 PRO F N     1 
ATOM   5081 C  CA    . PRO B 1 306 ? 28.327  -8.114  67.269  1.00 58.71  ? 305 PRO F CA    1 
ATOM   5082 C  C     . PRO B 1 306 ? 28.170  -7.288  68.546  1.00 53.52  ? 305 PRO F C     1 
ATOM   5083 O  O     . PRO B 1 306 ? 27.217  -7.515  69.290  1.00 57.89  ? 305 PRO F O     1 
ATOM   5084 C  CB    . PRO B 1 306 ? 29.043  -9.425  67.588  1.00 57.99  ? 305 PRO F CB    1 
ATOM   5085 C  CG    . PRO B 1 306 ? 30.484  -9.106  67.378  1.00 51.88  ? 305 PRO F CG    1 
ATOM   5086 C  CD    . PRO B 1 306 ? 30.535  -8.118  66.235  1.00 53.50  ? 305 PRO F CD    1 
ATOM   5087 N  N     . ARG B 1 307 ? 29.080  -6.354  68.801  1.00 48.58  ? 306 ARG F N     1 
ATOM   5088 C  CA    . ARG B 1 307 ? 29.074  -5.645  70.076  1.00 51.52  ? 306 ARG F CA    1 
ATOM   5089 C  C     . ARG B 1 307 ? 29.717  -4.266  69.988  1.00 52.41  ? 306 ARG F C     1 
ATOM   5090 O  O     . ARG B 1 307 ? 30.820  -4.124  69.468  1.00 52.39  ? 306 ARG F O     1 
ATOM   5091 C  CB    . ARG B 1 307 ? 29.786  -6.485  71.138  1.00 50.79  ? 306 ARG F CB    1 
ATOM   5092 C  CG    . ARG B 1 307 ? 29.832  -5.851  72.512  1.00 54.41  ? 306 ARG F CG    1 
ATOM   5093 C  CD    . ARG B 1 307 ? 30.565  -6.747  73.493  1.00 57.44  ? 306 ARG F CD    1 
ATOM   5094 N  NE    . ARG B 1 307 ? 30.615  -6.165  74.830  1.00 63.25  ? 306 ARG F NE    1 
ATOM   5095 C  CZ    . ARG B 1 307 ? 31.561  -5.328  75.245  1.00 73.51  ? 306 ARG F CZ    1 
ATOM   5096 N  NH1   . ARG B 1 307 ? 32.541  -4.971  74.426  1.00 76.24  ? 306 ARG F NH1   1 
ATOM   5097 N  NH2   . ARG B 1 307 ? 31.526  -4.848  76.481  1.00 71.07  ? 306 ARG F NH2   1 
ATOM   5098 N  N     . LEU B 1 308 ? 29.019  -3.264  70.517  1.00 55.09  ? 307 LEU F N     1 
ATOM   5099 C  CA    . LEU B 1 308 ? 29.471  -1.873  70.486  1.00 52.95  ? 307 LEU F CA    1 
ATOM   5100 C  C     . LEU B 1 308 ? 30.940  -1.716  70.867  1.00 52.74  ? 307 LEU F C     1 
ATOM   5101 O  O     . LEU B 1 308 ? 31.303  -1.801  72.039  1.00 60.41  ? 307 LEU F O     1 
ATOM   5102 C  CB    . LEU B 1 308 ? 28.608  -1.018  71.411  1.00 49.09  ? 307 LEU F CB    1 
ATOM   5103 C  CG    . LEU B 1 308 ? 28.906  0.479   71.383  1.00 48.22  ? 307 LEU F CG    1 
ATOM   5104 C  CD1   . LEU B 1 308 ? 28.658  1.040   69.995  1.00 45.83  ? 307 LEU F CD1   1 
ATOM   5105 C  CD2   . LEU B 1 308 ? 28.062  1.201   72.407  1.00 52.42  ? 307 LEU F CD2   1 
ATOM   5106 N  N     . ASN B 1 309 ? 31.779  -1.489  69.863  1.00 52.68  ? 308 ASN F N     1 
ATOM   5107 C  CA    . ASN B 1 309 ? 33.216  -1.400  70.077  1.00 48.89  ? 308 ASN F CA    1 
ATOM   5108 C  C     . ASN B 1 309 ? 33.775  -0.069  69.580  1.00 52.20  ? 308 ASN F C     1 
ATOM   5109 O  O     . ASN B 1 309 ? 33.397  0.417   68.515  1.00 56.89  ? 308 ASN F O     1 
ATOM   5110 C  CB    . ASN B 1 309 ? 33.911  -2.587  69.403  1.00 49.66  ? 308 ASN F CB    1 
ATOM   5111 C  CG    . ASN B 1 309 ? 35.268  -2.908  70.019  1.00 57.18  ? 308 ASN F CG    1 
ATOM   5112 O  OD1   . ASN B 1 309 ? 36.118  -2.031  70.184  1.00 58.48  ? 308 ASN F OD1   1 
ATOM   5113 N  ND2   . ASN B 1 309 ? 35.473  -4.170  70.360  1.00 61.31  ? 308 ASN F ND2   1 
ATOM   5114 N  N     . LYS B 1 310 ? 34.699  0.497   70.350  1.00 47.08  ? 309 LYS F N     1 
ATOM   5115 C  CA    . LYS B 1 310 ? 35.174  1.864   70.146  1.00 48.37  ? 309 LYS F CA    1 
ATOM   5116 C  C     . LYS B 1 310 ? 36.345  2.002   69.161  1.00 55.49  ? 309 LYS F C     1 
ATOM   5117 O  O     . LYS B 1 310 ? 36.389  2.947   68.371  1.00 56.41  ? 309 LYS F O     1 
ATOM   5118 C  CB    . LYS B 1 310 ? 35.545  2.467   71.503  1.00 46.61  ? 309 LYS F CB    1 
ATOM   5119 C  CG    . LYS B 1 310 ? 36.285  3.786   71.455  1.00 41.56  ? 309 LYS F CG    1 
ATOM   5120 C  CD    . LYS B 1 310 ? 36.556  4.280   72.866  1.00 42.43  ? 309 LYS F CD    1 
ATOM   5121 C  CE    . LYS B 1 310 ? 37.534  5.437   72.874  1.00 48.92  ? 309 LYS F CE    1 
ATOM   5122 N  NZ    . LYS B 1 310 ? 37.785  5.932   74.256  1.00 48.84  ? 309 LYS F NZ    1 
ATOM   5123 N  N     . ALA B 1 311 ? 37.284  1.060   69.205  1.00 57.14  ? 310 ALA F N     1 
ATOM   5124 C  CA    . ALA B 1 311 ? 38.492  1.133   68.380  1.00 60.87  ? 310 ALA F CA    1 
ATOM   5125 C  C     . ALA B 1 311 ? 38.213  0.817   66.914  1.00 56.61  ? 310 ALA F C     1 
ATOM   5126 O  O     . ALA B 1 311 ? 38.955  1.242   66.034  1.00 61.16  ? 310 ALA F O     1 
ATOM   5127 C  CB    . ALA B 1 311 ? 39.566  0.200   68.923  1.00 57.48  ? 310 ALA F CB    1 
ATOM   5128 N  N     . ASP B 1 312 ? 37.155  0.051   66.661  1.00 48.36  ? 311 ASP F N     1 
ATOM   5129 C  CA    . ASP B 1 312 ? 36.721  -0.266  65.303  1.00 51.39  ? 311 ASP F CA    1 
ATOM   5130 C  C     . ASP B 1 312 ? 35.963  0.909   64.709  1.00 57.93  ? 311 ASP F C     1 
ATOM   5131 O  O     . ASP B 1 312 ? 35.923  1.082   63.495  1.00 55.27  ? 311 ASP F O     1 
ATOM   5132 C  CB    . ASP B 1 312 ? 35.828  -1.508  65.313  1.00 39.56  ? 311 ASP F CB    1 
ATOM   5133 C  CG    . ASP B 1 312 ? 35.201  -1.799  63.963  1.00 51.84  ? 311 ASP F CG    1 
ATOM   5134 O  OD1   . ASP B 1 312 ? 35.924  -1.801  62.943  1.00 55.43  ? 311 ASP F OD1   1 
ATOM   5135 O  OD2   . ASP B 1 312 ? 33.975  -2.031  63.926  1.00 54.58  ? 311 ASP F OD2   1 
ATOM   5136 N  N     . LEU B 1 313 ? 35.350  1.708   65.574  1.00 51.97  ? 312 LEU F N     1 
ATOM   5137 C  CA    . LEU B 1 313 ? 34.679  2.919   65.135  1.00 54.03  ? 312 LEU F CA    1 
ATOM   5138 C  C     . LEU B 1 313 ? 35.718  3.995   64.853  1.00 51.13  ? 312 LEU F C     1 
ATOM   5139 O  O     . LEU B 1 313 ? 35.604  4.734   63.879  1.00 52.10  ? 312 LEU F O     1 
ATOM   5140 C  CB    . LEU B 1 313 ? 33.666  3.388   66.180  1.00 56.23  ? 312 LEU F CB    1 
ATOM   5141 C  CG    . LEU B 1 313 ? 32.377  2.566   66.251  1.00 46.10  ? 312 LEU F CG    1 
ATOM   5142 C  CD1   . LEU B 1 313 ? 31.363  3.243   67.154  1.00 46.90  ? 312 LEU F CD1   1 
ATOM   5143 C  CD2   . LEU B 1 313 ? 31.804  2.356   64.861  1.00 46.99  ? 312 LEU F CD2   1 
ATOM   5144 N  N     . ILE B 1 314 ? 36.740  4.066   65.702  1.00 49.63  ? 313 ILE F N     1 
ATOM   5145 C  CA    . ILE B 1 314 ? 37.853  4.983   65.476  1.00 54.31  ? 313 ILE F CA    1 
ATOM   5146 C  C     . ILE B 1 314 ? 38.610  4.598   64.206  1.00 53.14  ? 313 ILE F C     1 
ATOM   5147 O  O     . ILE B 1 314 ? 38.988  5.457   63.408  1.00 54.52  ? 313 ILE F O     1 
ATOM   5148 C  CB    . ILE B 1 314 ? 38.820  5.016   66.682  1.00 56.83  ? 313 ILE F CB    1 
ATOM   5149 C  CG1   . ILE B 1 314 ? 38.147  5.677   67.886  1.00 53.48  ? 313 ILE F CG1   1 
ATOM   5150 C  CG2   . ILE B 1 314 ? 40.102  5.758   66.332  1.00 52.31  ? 313 ILE F CG2   1 
ATOM   5151 C  CD1   . ILE B 1 314 ? 39.061  5.860   69.080  1.00 44.28  ? 313 ILE F CD1   1 
ATOM   5152 N  N     . ALA B 1 315 ? 38.808  3.297   64.018  1.00 50.91  ? 314 ALA F N     1 
ATOM   5153 C  CA    . ALA B 1 315 ? 39.503  2.780   62.844  1.00 52.46  ? 314 ALA F CA    1 
ATOM   5154 C  C     . ALA B 1 315 ? 38.699  3.033   61.577  1.00 49.23  ? 314 ALA F C     1 
ATOM   5155 O  O     . ALA B 1 315 ? 39.233  3.520   60.582  1.00 54.13  ? 314 ALA F O     1 
ATOM   5156 C  CB    . ALA B 1 315 ? 39.786  1.293   63.002  1.00 43.74  ? 314 ALA F CB    1 
ATOM   5157 N  N     . THR B 1 316 ? 37.413  2.695   61.624  1.00 55.97  ? 315 THR F N     1 
ATOM   5158 C  CA    . THR B 1 316 ? 36.520  2.885   60.487  1.00 55.50  ? 315 THR F CA    1 
ATOM   5159 C  C     . THR B 1 316 ? 36.428  4.359   60.126  1.00 50.55  ? 315 THR F C     1 
ATOM   5160 O  O     . THR B 1 316 ? 36.361  4.717   58.952  1.00 53.01  ? 315 THR F O     1 
ATOM   5161 C  CB    . THR B 1 316 ? 35.103  2.350   60.782  1.00 52.77  ? 315 THR F CB    1 
ATOM   5162 O  OG1   . THR B 1 316 ? 35.181  0.977   61.186  1.00 57.47  ? 315 THR F OG1   1 
ATOM   5163 C  CG2   . THR B 1 316 ? 34.215  2.460   59.552  1.00 55.99  ? 315 THR F CG2   1 
ATOM   5164 N  N     . ALA B 1 317 ? 36.437  5.214   61.142  1.00 49.18  ? 316 ALA F N     1 
ATOM   5165 C  CA    . ALA B 1 317 ? 36.365  6.651   60.917  1.00 48.93  ? 316 ALA F CA    1 
ATOM   5166 C  C     . ALA B 1 317 ? 37.672  7.206   60.367  1.00 56.26  ? 316 ALA F C     1 
ATOM   5167 O  O     . ALA B 1 317 ? 37.657  8.164   59.606  1.00 57.78  ? 316 ALA F O     1 
ATOM   5168 C  CB    . ALA B 1 317 ? 35.977  7.372   62.187  1.00 45.52  ? 316 ALA F CB    1 
ATOM   5169 N  N     . ARG B 1 318 ? 38.797  6.617   60.761  1.00 57.89  ? 317 ARG F N     1 
ATOM   5170 C  CA    . ARG B 1 318 ? 40.090  7.023   60.218  1.00 56.99  ? 317 ARG F CA    1 
ATOM   5171 C  C     . ARG B 1 318 ? 40.169  6.638   58.748  1.00 58.05  ? 317 ARG F C     1 
ATOM   5172 O  O     . ARG B 1 318 ? 40.588  7.432   57.903  1.00 53.99  ? 317 ARG F O     1 
ATOM   5173 C  CB    . ARG B 1 318 ? 41.239  6.369   60.988  1.00 56.90  ? 317 ARG F CB    1 
ATOM   5174 C  CG    . ARG B 1 318 ? 42.613  6.691   60.418  1.00 57.22  ? 317 ARG F CG    1 
ATOM   5175 C  CD    . ARG B 1 318 ? 42.906  8.177   60.528  1.00 56.82  ? 317 ARG F CD    1 
ATOM   5176 N  NE    . ARG B 1 318 ? 43.912  8.628   59.571  1.00 62.93  ? 317 ARG F NE    1 
ATOM   5177 C  CZ    . ARG B 1 318 ? 45.220  8.639   59.806  1.00 68.39  ? 317 ARG F CZ    1 
ATOM   5178 N  NH1   . ARG B 1 318 ? 45.693  8.214   60.970  1.00 60.66  ? 317 ARG F NH1   1 
ATOM   5179 N  NH2   . ARG B 1 318 ? 46.057  9.072   58.873  1.00 65.53  ? 317 ARG F NH2   1 
ATOM   5180 N  N     . LYS B 1 319 ? 39.756  5.409   58.458  1.00 50.36  ? 318 LYS F N     1 
ATOM   5181 C  CA    . LYS B 1 319 ? 39.719  4.893   57.098  1.00 50.99  ? 318 LYS F CA    1 
ATOM   5182 C  C     . LYS B 1 319 ? 38.819  5.754   56.221  1.00 57.40  ? 318 LYS F C     1 
ATOM   5183 O  O     . LYS B 1 319 ? 39.211  6.157   55.128  1.00 59.41  ? 318 LYS F O     1 
ATOM   5184 C  CB    . LYS B 1 319 ? 39.223  3.447   57.096  1.00 54.34  ? 318 LYS F CB    1 
ATOM   5185 C  CG    . LYS B 1 319 ? 39.044  2.850   55.713  1.00 57.52  ? 318 LYS F CG    1 
ATOM   5186 C  CD    . LYS B 1 319 ? 38.598  1.399   55.794  1.00 62.99  ? 318 LYS F CD    1 
ATOM   5187 C  CE    . LYS B 1 319 ? 39.629  0.543   56.515  1.00 70.68  ? 318 LYS F CE    1 
ATOM   5188 N  NZ    . LYS B 1 319 ? 39.208  -0.884  56.595  1.00 70.98  ? 318 LYS F NZ    1 
ATOM   5189 N  N     . THR B 1 320 ? 37.614  6.034   56.711  1.00 55.47  ? 319 THR F N     1 
ATOM   5190 C  CA    . THR B 1 320 ? 36.668  6.895   56.009  1.00 56.83  ? 319 THR F CA    1 
ATOM   5191 C  C     . THR B 1 320 ? 37.289  8.267   55.776  1.00 57.30  ? 319 THR F C     1 
ATOM   5192 O  O     . THR B 1 320 ? 37.220  8.815   54.677  1.00 60.81  ? 319 THR F O     1 
ATOM   5193 C  CB    . THR B 1 320 ? 35.368  7.079   56.818  1.00 52.79  ? 319 THR F CB    1 
ATOM   5194 O  OG1   . THR B 1 320 ? 34.811  5.799   57.138  1.00 48.70  ? 319 THR F OG1   1 
ATOM   5195 C  CG2   . THR B 1 320 ? 34.350  7.884   56.022  1.00 50.23  ? 319 THR F CG2   1 
ATOM   5196 N  N     . TRP B 1 321 ? 37.903  8.804   56.825  1.00 54.80  ? 320 TRP F N     1 
ATOM   5197 C  CA    . TRP B 1 321 ? 38.537  10.115  56.798  1.00 60.09  ? 320 TRP F CA    1 
ATOM   5198 C  C     . TRP B 1 321 ? 39.580  10.199  55.688  1.00 65.17  ? 320 TRP F C     1 
ATOM   5199 O  O     . TRP B 1 321 ? 39.593  11.157  54.917  1.00 71.36  ? 320 TRP F O     1 
ATOM   5200 C  CB    . TRP B 1 321 ? 39.188  10.412  58.155  1.00 59.19  ? 320 TRP F CB    1 
ATOM   5201 C  CG    . TRP B 1 321 ? 39.933  11.715  58.204  1.00 58.13  ? 320 TRP F CG    1 
ATOM   5202 C  CD1   . TRP B 1 321 ? 41.203  11.947  57.771  1.00 56.69  ? 320 TRP F CD1   1 
ATOM   5203 C  CD2   . TRP B 1 321 ? 39.456  12.966  58.727  1.00 59.13  ? 320 TRP F CD2   1 
ATOM   5204 N  NE1   . TRP B 1 321 ? 41.542  13.264  57.981  1.00 63.81  ? 320 TRP F NE1   1 
ATOM   5205 C  CE2   . TRP B 1 321 ? 40.484  13.910  58.568  1.00 62.58  ? 320 TRP F CE2   1 
ATOM   5206 C  CE3   . TRP B 1 321 ? 38.253  13.374  59.311  1.00 60.93  ? 320 TRP F CE3   1 
ATOM   5207 C  CZ2   . TRP B 1 321 ? 40.346  15.244  58.972  1.00 62.16  ? 320 TRP F CZ2   1 
ATOM   5208 C  CZ3   . TRP B 1 321 ? 38.120  14.696  59.711  1.00 60.41  ? 320 TRP F CZ3   1 
ATOM   5209 C  CH2   . TRP B 1 321 ? 39.155  15.613  59.538  1.00 64.06  ? 320 TRP F CH2   1 
ATOM   5210 N  N     . ASP B 1 322 ? 40.451  9.199   55.605  1.00 60.23  ? 321 ASP F N     1 
ATOM   5211 C  CA    . ASP B 1 322 ? 41.496  9.204   54.587  1.00 64.05  ? 321 ASP F CA    1 
ATOM   5212 C  C     . ASP B 1 322 ? 40.936  8.956   53.182  1.00 63.12  ? 321 ASP F C     1 
ATOM   5213 O  O     . ASP B 1 322 ? 41.374  9.575   52.209  1.00 68.08  ? 321 ASP F O     1 
ATOM   5214 C  CB    . ASP B 1 322 ? 42.557  8.151   54.907  1.00 58.91  ? 321 ASP F CB    1 
ATOM   5215 C  CG    . ASP B 1 322 ? 43.316  8.455   56.175  1.00 56.19  ? 321 ASP F CG    1 
ATOM   5216 O  OD1   . ASP B 1 322 ? 43.553  9.647   56.457  1.00 53.86  ? 321 ASP F OD1   1 
ATOM   5217 O  OD2   . ASP B 1 322 ? 43.679  7.499   56.889  1.00 50.68  ? 321 ASP F OD2   1 
ATOM   5218 N  N     . GLU B 1 323 ? 39.953  8.065   53.086  1.00 59.47  ? 322 GLU F N     1 
ATOM   5219 C  CA    . GLU B 1 323 ? 39.526  7.530   51.792  1.00 62.08  ? 322 GLU F CA    1 
ATOM   5220 C  C     . GLU B 1 323 ? 38.432  8.310   51.048  1.00 71.30  ? 322 GLU F C     1 
ATOM   5221 O  O     . GLU B 1 323 ? 38.135  7.985   49.893  1.00 76.38  ? 322 GLU F O     1 
ATOM   5222 C  CB    . GLU B 1 323 ? 39.122  6.054   51.927  1.00 55.23  ? 322 GLU F CB    1 
ATOM   5223 C  CG    . GLU B 1 323 ? 40.273  5.123   52.307  1.00 61.23  ? 322 GLU F CG    1 
ATOM   5224 C  CD    . GLU B 1 323 ? 39.834  3.679   52.437  1.00 59.24  ? 322 GLU F CD    1 
ATOM   5225 O  OE1   . GLU B 1 323 ? 38.626  3.403   52.276  1.00 61.74  ? 322 GLU F OE1   1 
ATOM   5226 O  OE2   . GLU B 1 323 ? 40.695  2.816   52.702  1.00 62.89  ? 322 GLU F OE2   1 
ATOM   5227 N  N     . ARG B 1 324 ? 37.833  9.313   51.693  1.00 61.52  ? 323 ARG F N     1 
ATOM   5228 C  CA    . ARG B 1 324 ? 36.854  10.178  51.022  1.00 58.51  ? 323 ARG F CA    1 
ATOM   5229 C  C     . ARG B 1 324 ? 36.544  11.481  51.765  1.00 61.63  ? 323 ARG F C     1 
ATOM   5230 O  O     . ARG B 1 324 ? 35.639  11.522  52.601  1.00 71.32  ? 323 ARG F O     1 
ATOM   5231 C  CB    . ARG B 1 324 ? 35.554  9.418   50.707  1.00 57.92  ? 323 ARG F CB    1 
ATOM   5232 C  CG    . ARG B 1 324 ? 35.086  8.438   51.775  1.00 59.88  ? 323 ARG F CG    1 
ATOM   5233 C  CD    . ARG B 1 324 ? 33.790  7.774   51.335  1.00 72.54  ? 323 ARG F CD    1 
ATOM   5234 N  NE    . ARG B 1 324 ? 33.796  6.327   51.532  1.00 70.79  ? 323 ARG F NE    1 
ATOM   5235 C  CZ    . ARG B 1 324 ? 32.963  5.679   52.341  1.00 68.00  ? 323 ARG F CZ    1 
ATOM   5236 N  NH1   . ARG B 1 324 ? 32.054  6.350   53.033  1.00 62.90  ? 323 ARG F NH1   1 
ATOM   5237 N  NH2   . ARG B 1 324 ? 33.035  4.360   52.455  1.00 67.62  ? 323 ARG F NH2   1 
ATOM   5238 N  N     . ARG B 1 325 ? 37.298  12.532  51.444  1.00 59.99  ? 324 ARG F N     1 
ATOM   5239 C  CA    . ARG B 1 325 ? 37.038  13.881  51.950  1.00 64.52  ? 324 ARG F CA    1 
ATOM   5240 C  C     . ARG B 1 325 ? 37.887  14.899  51.192  1.00 69.90  ? 324 ARG F C     1 
ATOM   5241 O  O     . ARG B 1 325 ? 37.585  16.094  51.192  1.00 60.85  ? 324 ARG F O     1 
ATOM   5242 C  CB    . ARG B 1 325 ? 37.296  13.989  53.458  1.00 60.42  ? 324 ARG F CB    1 
ATOM   5243 C  CG    . ARG B 1 325 ? 38.746  13.852  53.853  1.00 61.68  ? 324 ARG F CG    1 
ATOM   5244 C  CD    . ARG B 1 325 ? 38.978  14.280  55.300  1.00 64.50  ? 324 ARG F CD    1 
ATOM   5245 N  NE    . ARG B 1 325 ? 39.758  15.512  55.370  1.00 72.41  ? 324 ARG F NE    1 
ATOM   5246 C  CZ    . ARG B 1 325 ? 41.062  15.588  55.111  1.00 68.60  ? 324 ARG F CZ    1 
ATOM   5247 N  NH1   . ARG B 1 325 ? 41.748  14.505  54.755  1.00 56.82  ? 324 ARG F NH1   1 
ATOM   5248 N  NH2   . ARG B 1 325 ? 41.685  16.755  55.201  1.00 57.46  ? 324 ARG F NH2   1 
ATOM   5249 N  N     . GLY B 1 326 ? 38.955  14.411  50.564  1.00 65.84  ? 325 GLY F N     1 
ATOM   5250 C  CA    . GLY B 1 326 ? 39.830  15.224  49.735  1.00 63.49  ? 325 GLY F CA    1 
ATOM   5251 C  C     . GLY B 1 326 ? 40.179  16.609  50.248  1.00 62.17  ? 325 GLY F C     1 
ATOM   5252 O  O     . GLY B 1 326 ? 40.089  17.591  49.511  1.00 69.99  ? 325 GLY F O     1 
ATOM   5253 N  N     . GLY B 1 327 ? 40.563  16.696  51.516  1.00 57.51  ? 326 GLY F N     1 
ATOM   5254 C  CA    . GLY B 1 327 ? 40.965  17.964  52.095  1.00 60.55  ? 326 GLY F CA    1 
ATOM   5255 C  C     . GLY B 1 327 ? 39.816  18.916  52.375  1.00 62.63  ? 326 GLY F C     1 
ATOM   5256 O  O     . GLY B 1 327 ? 40.036  20.100  52.630  1.00 57.72  ? 326 GLY F O     1 
ATOM   5257 N  N     . ARG B 1 328 ? 38.588  18.410  52.322  1.00 64.34  ? 327 ARG F N     1 
ATOM   5258 C  CA    . ARG B 1 328 ? 37.429  19.216  52.689  1.00 63.10  ? 327 ARG F CA    1 
ATOM   5259 C  C     . ARG B 1 328 ? 37.393  19.421  54.197  1.00 60.77  ? 327 ARG F C     1 
ATOM   5260 O  O     . ARG B 1 328 ? 37.827  18.556  54.957  1.00 59.66  ? 327 ARG F O     1 
ATOM   5261 C  CB    . ARG B 1 328 ? 36.128  18.544  52.241  1.00 65.27  ? 327 ARG F CB    1 
ATOM   5262 C  CG    . ARG B 1 328 ? 35.750  18.790  50.792  1.00 61.58  ? 327 ARG F CG    1 
ATOM   5263 C  CD    . ARG B 1 328 ? 34.517  17.986  50.404  1.00 67.84  ? 327 ARG F CD    1 
ATOM   5264 N  NE    . ARG B 1 328 ? 34.790  16.552  50.359  1.00 67.06  ? 327 ARG F NE    1 
ATOM   5265 C  CZ    . ARG B 1 328 ? 33.903  15.633  49.990  1.00 70.73  ? 327 ARG F CZ    1 
ATOM   5266 N  NH1   . ARG B 1 328 ? 32.678  15.996  49.635  1.00 72.05  ? 327 ARG F NH1   1 
ATOM   5267 N  NH2   . ARG B 1 328 ? 34.240  14.350  49.978  1.00 69.58  ? 327 ARG F NH2   1 
ATOM   5268 N  N     . GLY B 1 329 ? 36.878  20.566  54.629  1.00 62.09  ? 328 GLY F N     1 
ATOM   5269 C  CA    . GLY B 1 329 ? 36.597  20.769  56.036  1.00 61.43  ? 328 GLY F CA    1 
ATOM   5270 C  C     . GLY B 1 329 ? 35.486  19.826  56.455  1.00 66.67  ? 328 GLY F C     1 
ATOM   5271 O  O     . GLY B 1 329 ? 34.697  19.375  55.623  1.00 65.07  ? 328 GLY F O     1 
ATOM   5272 N  N     . VAL B 1 330 ? 35.428  19.514  57.744  1.00 65.38  ? 329 VAL F N     1 
ATOM   5273 C  CA    . VAL B 1 330 ? 34.398  18.621  58.264  1.00 60.13  ? 329 VAL F CA    1 
ATOM   5274 C  C     . VAL B 1 330 ? 33.600  19.294  59.375  1.00 65.71  ? 329 VAL F C     1 
ATOM   5275 O  O     . VAL B 1 330 ? 34.173  19.739  60.371  1.00 61.77  ? 329 VAL F O     1 
ATOM   5276 C  CB    . VAL B 1 330 ? 35.004  17.302  58.775  1.00 57.11  ? 329 VAL F CB    1 
ATOM   5277 C  CG1   . VAL B 1 330 ? 34.049  16.607  59.716  1.00 57.36  ? 329 VAL F CG1   1 
ATOM   5278 C  CG2   . VAL B 1 330 ? 35.319  16.398  57.613  1.00 54.85  ? 329 VAL F CG2   1 
ATOM   5279 N  N     . ARG B 1 331 ? 32.282  19.372  59.202  1.00 67.41  ? 330 ARG F N     1 
ATOM   5280 C  CA    . ARG B 1 331 ? 31.436  20.058  60.178  1.00 62.48  ? 330 ARG F CA    1 
ATOM   5281 C  C     . ARG B 1 331 ? 30.809  19.099  61.185  1.00 56.21  ? 330 ARG F C     1 
ATOM   5282 O  O     . ARG B 1 331 ? 30.622  19.449  62.349  1.00 54.57  ? 330 ARG F O     1 
ATOM   5283 C  CB    . ARG B 1 331 ? 30.349  20.881  59.480  1.00 59.30  ? 330 ARG F CB    1 
ATOM   5284 C  CG    . ARG B 1 331 ? 29.503  20.094  58.493  1.00 61.68  ? 330 ARG F CG    1 
ATOM   5285 C  CD    . ARG B 1 331 ? 28.407  20.955  57.883  1.00 61.77  ? 330 ARG F CD    1 
ATOM   5286 N  NE    . ARG B 1 331 ? 27.470  21.441  58.892  1.00 61.83  ? 330 ARG F NE    1 
ATOM   5287 C  CZ    . ARG B 1 331 ? 27.353  22.714  59.254  1.00 57.43  ? 330 ARG F CZ    1 
ATOM   5288 N  NH1   . ARG B 1 331 ? 28.109  23.643  58.685  1.00 63.56  ? 330 ARG F NH1   1 
ATOM   5289 N  NH2   . ARG B 1 331 ? 26.473  23.059  60.183  1.00 54.59  ? 330 ARG F NH2   1 
ATOM   5290 N  N     . LEU B 1 332 ? 30.492  17.888  60.738  1.00 55.84  ? 331 LEU F N     1 
ATOM   5291 C  CA    . LEU B 1 332 ? 29.861  16.902  61.609  1.00 59.14  ? 331 LEU F CA    1 
ATOM   5292 C  C     . LEU B 1 332 ? 30.574  15.555  61.611  1.00 55.23  ? 331 LEU F C     1 
ATOM   5293 O  O     . LEU B 1 332 ? 31.097  15.111  60.589  1.00 55.90  ? 331 LEU F O     1 
ATOM   5294 C  CB    . LEU B 1 332 ? 28.383  16.718  61.235  1.00 61.59  ? 331 LEU F CB    1 
ATOM   5295 C  CG    . LEU B 1 332 ? 27.582  15.572  61.870  1.00 59.70  ? 331 LEU F CG    1 
ATOM   5296 C  CD1   . LEU B 1 332 ? 26.150  15.998  62.123  1.00 55.26  ? 331 LEU F CD1   1 
ATOM   5297 C  CD2   . LEU B 1 332 ? 27.599  14.313  61.004  1.00 52.15  ? 331 LEU F CD2   1 
ATOM   5298 N  N     . VAL B 1 333 ? 30.584  14.908  62.772  1.00 55.80  ? 332 VAL F N     1 
ATOM   5299 C  CA    . VAL B 1 333 ? 31.023  13.519  62.864  1.00 55.57  ? 332 VAL F CA    1 
ATOM   5300 C  C     . VAL B 1 333 ? 30.063  12.752  63.773  1.00 50.42  ? 332 VAL F C     1 
ATOM   5301 O  O     . VAL B 1 333 ? 29.590  13.287  64.779  1.00 42.42  ? 332 VAL F O     1 
ATOM   5302 C  CB    . VAL B 1 333 ? 32.486  13.406  63.361  1.00 54.11  ? 332 VAL F CB    1 
ATOM   5303 C  CG1   . VAL B 1 333 ? 32.670  14.165  64.659  1.00 52.01  ? 332 VAL F CG1   1 
ATOM   5304 C  CG2   . VAL B 1 333 ? 32.903  11.945  63.514  1.00 47.44  ? 332 VAL F CG2   1 
ATOM   5305 N  N     . GLY B 1 334 ? 29.753  11.512  63.406  1.00 44.13  ? 333 GLY F N     1 
ATOM   5306 C  CA    . GLY B 1 334 ? 28.800  10.726  64.168  1.00 47.01  ? 333 GLY F CA    1 
ATOM   5307 C  C     . GLY B 1 334 ? 29.056  9.231   64.191  1.00 49.41  ? 333 GLY F C     1 
ATOM   5308 O  O     . GLY B 1 334 ? 29.624  8.663   63.258  1.00 47.37  ? 333 GLY F O     1 
ATOM   5309 N  N     . LEU B 1 335 ? 28.629  8.599   65.279  1.00 51.39  ? 334 LEU F N     1 
ATOM   5310 C  CA    . LEU B 1 335 ? 28.690  7.153   65.432  1.00 52.36  ? 334 LEU F CA    1 
ATOM   5311 C  C     . LEU B 1 335 ? 27.281  6.584   65.312  1.00 49.98  ? 334 LEU F C     1 
ATOM   5312 O  O     . LEU B 1 335 ? 26.307  7.232   65.702  1.00 50.37  ? 334 LEU F O     1 
ATOM   5313 C  CB    . LEU B 1 335 ? 29.280  6.794   66.796  1.00 47.33  ? 334 LEU F CB    1 
ATOM   5314 C  CG    . LEU B 1 335 ? 30.638  7.407   67.139  1.00 48.85  ? 334 LEU F CG    1 
ATOM   5315 C  CD1   . LEU B 1 335 ? 31.004  7.123   68.585  1.00 47.72  ? 334 LEU F CD1   1 
ATOM   5316 C  CD2   . LEU B 1 335 ? 31.711  6.882   66.204  1.00 42.71  ? 334 LEU F CD2   1 
ATOM   5317 N  N     . HIS B 1 336 ? 27.171  5.372   64.777  1.00 49.79  ? 335 HIS F N     1 
ATOM   5318 C  CA    . HIS B 1 336 ? 25.864  4.767   64.544  1.00 50.29  ? 335 HIS F CA    1 
ATOM   5319 C  C     . HIS B 1 336 ? 25.835  3.278   64.881  1.00 51.66  ? 335 HIS F C     1 
ATOM   5320 O  O     . HIS B 1 336 ? 26.862  2.600   64.847  1.00 50.11  ? 335 HIS F O     1 
ATOM   5321 C  CB    . HIS B 1 336 ? 25.429  4.989   63.094  1.00 50.94  ? 335 HIS F CB    1 
ATOM   5322 C  CG    . HIS B 1 336 ? 24.035  4.528   62.803  1.00 47.46  ? 335 HIS F CG    1 
ATOM   5323 N  ND1   . HIS B 1 336 ? 23.760  3.312   62.216  1.00 49.64  ? 335 HIS F ND1   1 
ATOM   5324 C  CD2   . HIS B 1 336 ? 22.837  5.119   63.023  1.00 48.48  ? 335 HIS F CD2   1 
ATOM   5325 C  CE1   . HIS B 1 336 ? 22.453  3.174   62.084  1.00 47.78  ? 335 HIS F CE1   1 
ATOM   5326 N  NE2   . HIS B 1 336 ? 21.870  4.257   62.566  1.00 51.91  ? 335 HIS F NE2   1 
ATOM   5327 N  N     . VAL B 1 337 ? 24.645  2.782   65.203  1.00 52.21  ? 336 VAL F N     1 
ATOM   5328 C  CA    . VAL B 1 337 ? 24.448  1.382   65.555  1.00 48.98  ? 336 VAL F CA    1 
ATOM   5329 C  C     . VAL B 1 337 ? 23.102  0.873   65.044  1.00 49.96  ? 336 VAL F C     1 
ATOM   5330 O  O     . VAL B 1 337 ? 22.062  1.494   65.278  1.00 52.44  ? 336 VAL F O     1 
ATOM   5331 C  CB    . VAL B 1 337 ? 24.536  1.172   67.085  1.00 49.44  ? 336 VAL F CB    1 
ATOM   5332 C  CG1   . VAL B 1 337 ? 23.675  0.001   67.525  1.00 45.61  ? 336 VAL F CG1   1 
ATOM   5333 C  CG2   . VAL B 1 337 ? 25.981  0.972   67.515  1.00 49.29  ? 336 VAL F CG2   1 
ATOM   5334 N  N     . THR B 1 338 ? 23.133  -0.249  64.331  1.00 48.61  ? 337 THR F N     1 
ATOM   5335 C  CA    . THR B 1 338 ? 21.912  -0.923  63.911  1.00 49.27  ? 337 THR F CA    1 
ATOM   5336 C  C     . THR B 1 338 ? 21.593  -2.041  64.895  1.00 51.00  ? 337 THR F C     1 
ATOM   5337 O  O     . THR B 1 338 ? 22.397  -2.951  65.094  1.00 50.96  ? 337 THR F O     1 
ATOM   5338 C  CB    . THR B 1 338 ? 22.041  -1.518  62.498  1.00 49.95  ? 337 THR F CB    1 
ATOM   5339 O  OG1   . THR B 1 338 ? 22.327  -0.474  61.560  1.00 50.78  ? 337 THR F OG1   1 
ATOM   5340 C  CG2   . THR B 1 338 ? 20.749  -2.216  62.096  1.00 38.40  ? 337 THR F CG2   1 
ATOM   5341 N  N     . LEU B 1 339 ? 20.420  -1.962  65.511  1.00 53.15  ? 338 LEU F N     1 
ATOM   5342 C  CA    . LEU B 1 339 ? 20.016  -2.933  66.521  1.00 45.53  ? 338 LEU F CA    1 
ATOM   5343 C  C     . LEU B 1 339 ? 19.750  -4.307  65.916  1.00 49.49  ? 338 LEU F C     1 
ATOM   5344 O  O     . LEU B 1 339 ? 19.446  -4.425  64.729  1.00 51.22  ? 338 LEU F O     1 
ATOM   5345 C  CB    . LEU B 1 339 ? 18.771  -2.438  67.263  1.00 42.14  ? 338 LEU F CB    1 
ATOM   5346 C  CG    . LEU B 1 339 ? 18.976  -1.716  68.597  1.00 45.01  ? 338 LEU F CG    1 
ATOM   5347 C  CD1   . LEU B 1 339 ? 20.224  -0.848  68.578  1.00 42.93  ? 338 LEU F CD1   1 
ATOM   5348 C  CD2   . LEU B 1 339 ? 17.753  -0.877  68.931  1.00 40.71  ? 338 LEU F CD2   1 
ATOM   5349 N  N     . LEU B 1 340 ? 19.872  -5.343  66.742  1.00 54.78  ? 339 LEU F N     1 
ATOM   5350 C  CA    . LEU B 1 340 ? 19.525  -6.702  66.340  1.00 55.42  ? 339 LEU F CA    1 
ATOM   5351 C  C     . LEU B 1 340 ? 18.033  -6.766  66.033  1.00 58.80  ? 339 LEU F C     1 
ATOM   5352 O  O     . LEU B 1 340 ? 17.294  -5.839  66.365  1.00 62.11  ? 339 LEU F O     1 
ATOM   5353 C  CB    . LEU B 1 340 ? 19.884  -7.694  67.447  1.00 55.32  ? 339 LEU F CB    1 
ATOM   5354 C  CG    . LEU B 1 340 ? 21.376  -7.892  67.722  1.00 57.75  ? 339 LEU F CG    1 
ATOM   5355 C  CD1   . LEU B 1 340 ? 21.592  -8.583  69.059  1.00 55.39  ? 339 LEU F CD1   1 
ATOM   5356 C  CD2   . LEU B 1 340 ? 22.020  -8.691  66.599  1.00 49.53  ? 339 LEU F CD2   1 
ATOM   5357 N  N     . ASP B 1 341 ? 17.584  -7.849  65.406  1.00 62.85  ? 340 ASP F N     1 
ATOM   5358 C  CA    . ASP B 1 341 ? 16.184  -7.926  64.984  1.00 63.84  ? 340 ASP F CA    1 
ATOM   5359 C  C     . ASP B 1 341 ? 15.177  -8.158  66.139  1.00 75.23  ? 340 ASP F C     1 
ATOM   5360 O  O     . ASP B 1 341 ? 15.185  -7.372  67.086  1.00 77.35  ? 340 ASP F O     1 
ATOM   5361 C  CB    . ASP B 1 341 ? 15.995  -8.842  63.762  1.00 69.29  ? 340 ASP F CB    1 
ATOM   5362 C  CG    . ASP B 1 341 ? 16.435  -8.186  62.469  1.00 76.48  ? 340 ASP F CG    1 
ATOM   5363 O  OD1   . ASP B 1 341 ? 16.356  -6.943  62.375  1.00 79.45  ? 340 ASP F OD1   1 
ATOM   5364 O  OD2   . ASP B 1 341 ? 16.856  -8.914  61.546  1.00 77.59  ? 340 ASP F OD2   1 
ATOM   5365 N  N     . PRO B 1 342 ? 14.385  -9.260  66.113  1.00 88.11  ? 341 PRO F N     1 
ATOM   5366 C  CA    . PRO B 1 342 ? 13.008  -9.213  66.644  1.00 81.99  ? 341 PRO F CA    1 
ATOM   5367 C  C     . PRO B 1 342 ? 12.748  -8.209  67.767  1.00 82.91  ? 341 PRO F C     1 
ATOM   5368 O  O     . PRO B 1 342 ? 12.395  -7.057  67.513  1.00 80.62  ? 341 PRO F O     1 
ATOM   5369 C  CB    . PRO B 1 342 ? 12.784  -10.637 67.162  1.00 77.37  ? 341 PRO F CB    1 
ATOM   5370 C  CG    . PRO B 1 342 ? 13.675  -11.468 66.343  1.00 77.64  ? 341 PRO F CG    1 
ATOM   5371 C  CD    . PRO B 1 342 ? 14.910  -10.640 66.171  1.00 82.37  ? 341 PRO F CD    1 
ATOM   5372 O  OXT   . PRO B 1 342 ? 12.899  -8.520  68.948  1.00 88.91  ? 341 PRO F OXT   1 
ATOM   5373 O  "O5'" . DT  C 2 1   ? 38.900  40.527  26.258  1.00 90.17  ? 837 DT  B "O5'" 1 
ATOM   5374 C  "C5'" . DT  C 2 1   ? 37.533  40.751  25.935  1.00 87.03  ? 837 DT  B "C5'" 1 
ATOM   5375 C  "C4'" . DT  C 2 1   ? 36.797  39.438  25.734  1.00 87.65  ? 837 DT  B "C4'" 1 
ATOM   5376 O  "O4'" . DT  C 2 1   ? 37.500  38.631  24.754  1.00 86.64  ? 837 DT  B "O4'" 1 
ATOM   5377 C  "C3'" . DT  C 2 1   ? 36.667  38.564  26.979  1.00 88.58  ? 837 DT  B "C3'" 1 
ATOM   5378 O  "O3'" . DT  C 2 1   ? 35.370  37.988  27.012  1.00 85.24  ? 837 DT  B "O3'" 1 
ATOM   5379 C  "C2'" . DT  C 2 1   ? 37.736  37.496  26.769  1.00 89.37  ? 837 DT  B "C2'" 1 
ATOM   5380 C  "C1'" . DT  C 2 1   ? 37.633  37.320  25.261  1.00 84.60  ? 837 DT  B "C1'" 1 
ATOM   5381 N  N1    . DT  C 2 1   ? 38.817  36.674  24.631  1.00 90.79  ? 837 DT  B N1    1 
ATOM   5382 C  C2    . DT  C 2 1   ? 38.885  35.299  24.595  1.00 92.03  ? 837 DT  B C2    1 
ATOM   5383 O  O2    . DT  C 2 1   ? 38.021  34.576  25.059  1.00 90.36  ? 837 DT  B O2    1 
ATOM   5384 N  N3    . DT  C 2 1   ? 40.011  34.799  23.992  1.00 96.19  ? 837 DT  B N3    1 
ATOM   5385 C  C4    . DT  C 2 1   ? 41.049  35.523  23.434  1.00 91.76  ? 837 DT  B C4    1 
ATOM   5386 O  O4    . DT  C 2 1   ? 42.021  34.982  22.914  1.00 92.73  ? 837 DT  B O4    1 
ATOM   5387 C  C5    . DT  C 2 1   ? 40.912  36.956  23.505  1.00 92.28  ? 837 DT  B C5    1 
ATOM   5388 C  C7    . DT  C 2 1   ? 41.978  37.841  22.932  1.00 88.18  ? 837 DT  B C7    1 
ATOM   5389 C  C6    . DT  C 2 1   ? 39.816  37.458  24.090  1.00 92.63  ? 837 DT  B C6    1 
ATOM   5390 P  P     . DC  C 2 2   ? 34.593  37.823  28.408  1.00 86.03  ? 838 DC  B P     1 
ATOM   5391 O  OP1   . DC  C 2 2   ? 33.228  38.361  28.228  1.00 84.02  ? 838 DC  B OP1   1 
ATOM   5392 O  OP2   . DC  C 2 2   ? 35.463  38.370  29.472  1.00 83.50  ? 838 DC  B OP2   1 
ATOM   5393 O  "O5'" . DC  C 2 2   ? 34.487  36.240  28.605  1.00 88.72  ? 838 DC  B "O5'" 1 
ATOM   5394 C  "C5'" . DC  C 2 2   ? 34.705  35.354  27.513  1.00 78.17  ? 838 DC  B "C5'" 1 
ATOM   5395 C  "C4'" . DC  C 2 2   ? 35.305  34.051  28.011  1.00 71.98  ? 838 DC  B "C4'" 1 
ATOM   5396 O  "O4'" . DC  C 2 2   ? 36.741  34.192  28.165  1.00 79.63  ? 838 DC  B "O4'" 1 
ATOM   5397 C  "C3'" . DC  C 2 2   ? 34.778  33.589  29.366  1.00 71.46  ? 838 DC  B "C3'" 1 
ATOM   5398 O  "O3'" . DC  C 2 2   ? 34.577  32.187  29.353  1.00 66.60  ? 838 DC  B "O3'" 1 
ATOM   5399 C  "C2'" . DC  C 2 2   ? 35.898  33.964  30.329  1.00 77.41  ? 838 DC  B "C2'" 1 
ATOM   5400 C  "C1'" . DC  C 2 2   ? 37.115  33.727  29.445  1.00 82.98  ? 838 DC  B "C1'" 1 
ATOM   5401 N  N1    . DC  C 2 2   ? 38.326  34.466  29.894  1.00 99.00  ? 838 DC  B N1    1 
ATOM   5402 C  C2    . DC  C 2 2   ? 39.582  34.094  29.402  1.00 99.43  ? 838 DC  B C2    1 
ATOM   5403 O  O2    . DC  C 2 2   ? 39.660  33.157  28.598  1.00 95.14  ? 838 DC  B O2    1 
ATOM   5404 N  N3    . DC  C 2 2   ? 40.676  34.775  29.821  1.00 101.86 ? 838 DC  B N3    1 
ATOM   5405 C  C4    . DC  C 2 2   ? 40.547  35.780  30.689  1.00 99.87  ? 838 DC  B C4    1 
ATOM   5406 N  N4    . DC  C 2 2   ? 41.655  36.421  31.072  1.00 96.08  ? 838 DC  B N4    1 
ATOM   5407 C  C5    . DC  C 2 2   ? 39.275  36.172  31.203  1.00 95.38  ? 838 DC  B C5    1 
ATOM   5408 C  C6    . DC  C 2 2   ? 38.203  35.494  30.782  1.00 95.83  ? 838 DC  B C6    1 
ATOM   5409 P  P     . DT  C 2 3   ? 33.136  31.580  29.719  1.00 63.55  ? 839 DT  B P     1 
ATOM   5410 O  OP1   . DT  C 2 3   ? 32.289  32.692  30.203  1.00 74.86  ? 839 DT  B OP1   1 
ATOM   5411 O  OP2   . DT  C 2 3   ? 33.360  30.394  30.576  1.00 61.73  ? 839 DT  B OP2   1 
ATOM   5412 O  "O5'" . DT  C 2 3   ? 32.567  31.074  28.314  1.00 71.98  ? 839 DT  B "O5'" 1 
ATOM   5413 C  "C5'" . DT  C 2 3   ? 32.897  29.769  27.865  1.00 62.47  ? 839 DT  B "C5'" 1 
ATOM   5414 C  "C4'" . DT  C 2 3   ? 33.834  29.777  26.672  1.00 54.02  ? 839 DT  B "C4'" 1 
ATOM   5415 O  "O4'" . DT  C 2 3   ? 35.011  30.585  26.928  1.00 60.44  ? 839 DT  B "O4'" 1 
ATOM   5416 C  "C3'" . DT  C 2 3   ? 34.392  28.403  26.348  1.00 54.47  ? 839 DT  B "C3'" 1 
ATOM   5417 O  "O3'" . DT  C 2 3   ? 33.449  27.672  25.583  1.00 63.27  ? 839 DT  B "O3'" 1 
ATOM   5418 C  "C2'" . DT  C 2 3   ? 35.638  28.772  25.554  1.00 52.66  ? 839 DT  B "C2'" 1 
ATOM   5419 C  "C1'" . DT  C 2 3   ? 36.154  29.950  26.377  1.00 55.62  ? 839 DT  B "C1'" 1 
ATOM   5420 N  N1    . DT  C 2 3   ? 37.058  29.559  27.504  1.00 58.83  ? 839 DT  B N1    1 
ATOM   5421 C  C2    . DT  C 2 3   ? 38.281  28.970  27.250  1.00 54.56  ? 839 DT  B C2    1 
ATOM   5422 O  O2    . DT  C 2 3   ? 38.704  28.729  26.133  1.00 49.79  ? 839 DT  B O2    1 
ATOM   5423 N  N3    . DT  C 2 3   ? 39.009  28.663  28.372  1.00 58.89  ? 839 DT  B N3    1 
ATOM   5424 C  C4    . DT  C 2 3   ? 38.650  28.882  29.690  1.00 56.44  ? 839 DT  B C4    1 
ATOM   5425 O  O4    . DT  C 2 3   ? 39.375  28.570  30.630  1.00 58.80  ? 839 DT  B O4    1 
ATOM   5426 C  C5    . DT  C 2 3   ? 37.365  29.501  29.883  1.00 55.97  ? 839 DT  B C5    1 
ATOM   5427 C  C7    . DT  C 2 3   ? 36.865  29.789  31.267  1.00 54.24  ? 839 DT  B C7    1 
ATOM   5428 C  C6    . DT  C 2 3   ? 36.644  29.805  28.797  1.00 60.59  ? 839 DT  B C6    1 
ATOM   5429 P  P     . DA  C 2 4   ? 33.051  26.178  26.017  1.00 48.80  ? 840 DA  B P     1 
ATOM   5430 O  OP1   . DA  C 2 4   ? 32.903  26.155  27.490  1.00 48.14  ? 840 DA  B OP1   1 
ATOM   5431 O  OP2   . DA  C 2 4   ? 33.999  25.254  25.356  1.00 60.20  ? 840 DA  B OP2   1 
ATOM   5432 O  "O5'" . DA  C 2 4   ? 31.616  25.955  25.355  1.00 48.15  ? 840 DA  B "O5'" 1 
ATOM   5433 C  "C5'" . DA  C 2 4   ? 30.470  26.635  25.848  1.00 50.39  ? 840 DA  B "C5'" 1 
ATOM   5434 C  "C4'" . DA  C 2 4   ? 29.207  26.000  25.290  1.00 52.54  ? 840 DA  B "C4'" 1 
ATOM   5435 O  "O4'" . DA  C 2 4   ? 29.248  26.051  23.842  1.00 52.89  ? 840 DA  B "O4'" 1 
ATOM   5436 C  "C3'" . DA  C 2 4   ? 29.013  24.531  25.647  1.00 47.62  ? 840 DA  B "C3'" 1 
ATOM   5437 O  "O3'" . DA  C 2 4   ? 27.632  24.233  25.787  1.00 51.08  ? 840 DA  B "O3'" 1 
ATOM   5438 C  "C2'" . DA  C 2 4   ? 29.607  23.790  24.456  1.00 50.24  ? 840 DA  B "C2'" 1 
ATOM   5439 C  "C1'" . DA  C 2 4   ? 29.336  24.746  23.300  1.00 53.26  ? 840 DA  B "C1'" 1 
ATOM   5440 N  N9    . DA  C 2 4   ? 30.394  24.735  22.293  1.00 51.43  ? 840 DA  B N9    1 
ATOM   5441 C  C8    . DA  C 2 4   ? 31.743  24.725  22.513  1.00 52.67  ? 840 DA  B C8    1 
ATOM   5442 N  N7    . DA  C 2 4   ? 32.459  24.717  21.414  1.00 54.58  ? 840 DA  B N7    1 
ATOM   5443 C  C5    . DA  C 2 4   ? 31.513  24.721  20.402  1.00 46.28  ? 840 DA  B C5    1 
ATOM   5444 C  C6    . DA  C 2 4   ? 31.624  24.720  18.998  1.00 45.94  ? 840 DA  B C6    1 
ATOM   5445 N  N6    . DA  C 2 4   ? 32.794  24.710  18.351  1.00 43.32  ? 840 DA  B N6    1 
ATOM   5446 N  N1    . DA  C 2 4   ? 30.480  24.729  18.281  1.00 49.72  ? 840 DA  B N1    1 
ATOM   5447 C  C2    . DA  C 2 4   ? 29.310  24.740  18.930  1.00 51.42  ? 840 DA  B C2    1 
ATOM   5448 N  N3    . DA  C 2 4   ? 29.082  24.743  20.242  1.00 53.42  ? 840 DA  B N3    1 
ATOM   5449 C  C4    . DA  C 2 4   ? 30.235  24.734  20.927  1.00 49.86  ? 840 DA  B C4    1 
HETATM 5450 O  OP2   . RDG C 2 5   ? 28.403  22.339  27.415  1.00 51.59  ? 841 RDG B OP2   1 
HETATM 5451 P  P     . RDG C 2 5   ? 27.170  22.930  26.605  1.00 46.81  ? 841 RDG B P     1 
HETATM 5452 O  OP1   . RDG C 2 5   ? 26.026  23.269  27.537  1.00 52.32  ? 841 RDG B OP1   1 
HETATM 5453 O  "O5'" . RDG C 2 5   ? 26.729  21.909  25.512  1.00 56.74  ? 841 RDG B "O5'" 1 
HETATM 5454 C  "C5'" . RDG C 2 5   ? 26.065  22.338  24.350  1.00 49.75  ? 841 RDG B "C5'" 1 
HETATM 5455 C  "C4'" . RDG C 2 5   ? 25.995  21.417  23.270  1.00 55.38  ? 841 RDG B "C4'" 1 
HETATM 5456 C  "C3'" . RDG C 2 5   ? 26.261  20.047  23.732  1.00 59.42  ? 841 RDG B "C3'" 1 
HETATM 5457 O  "O3'" . RDG C 2 5   ? 25.450  19.194  23.067  1.00 58.57  ? 841 RDG B "O3'" 1 
HETATM 5458 C  "C2'" . RDG C 2 5   ? 27.627  19.772  23.329  1.00 52.99  ? 841 RDG B "C2'" 1 
HETATM 5459 C  "C1'" . RDG C 2 5   ? 27.771  20.577  22.084  1.00 56.79  ? 841 RDG B "C1'" 1 
HETATM 5460 O  "O4'" . RDG C 2 5   ? 27.017  21.741  22.299  1.00 56.76  ? 841 RDG B "O4'" 1 
HETATM 5461 N  N9    . RDG C 2 5   ? 29.143  20.830  21.793  1.00 56.20  ? 841 RDG B N9    1 
HETATM 5462 C  C4    . RDG C 2 5   ? 29.675  20.984  20.502  1.00 50.90  ? 841 RDG B C4    1 
HETATM 5463 N  N3    . RDG C 2 5   ? 29.096  20.946  19.238  1.00 51.03  ? 841 RDG B N3    1 
HETATM 5464 C  C2    . RDG C 2 5   ? 29.867  21.132  18.136  1.00 52.32  ? 841 RDG B C2    1 
HETATM 5465 N  N1    . RDG C 2 5   ? 31.216  21.359  18.229  1.00 50.26  ? 841 RDG B N1    1 
HETATM 5466 C  C6    . RDG C 2 5   ? 31.839  21.406  19.449  1.00 50.38  ? 841 RDG B C6    1 
HETATM 5467 O  O6    . RDG C 2 5   ? 33.248  21.643  19.532  1.00 49.31  ? 841 RDG B O6    1 
HETATM 5468 C  C5    . RDG C 2 5   ? 31.054  21.213  20.645  1.00 52.75  ? 841 RDG B C5    1 
HETATM 5469 N  N7    . RDG C 2 5   ? 31.331  21.193  22.006  1.00 48.76  ? 841 RDG B N7    1 
HETATM 5470 C  C8    . RDG C 2 5   ? 30.148  20.956  22.684  1.00 52.64  ? 841 RDG B C8    1 
HETATM 5471 N  N2    . RDG C 2 5   ? 29.246  21.090  16.824  1.00 60.58  ? 841 RDG B N2    1 
HETATM 5472 C  C11   . RDG C 2 5   ? 27.807  21.214  16.679  1.00 58.59  ? 841 RDG B C11   1 
HETATM 5473 C  C10   . RDG C 2 5   ? 27.028  19.980  16.243  1.00 59.10  ? 841 RDG B C10   1 
HETATM 5474 C  C9    . RDG C 2 5   ? 27.570  18.670  16.119  1.00 57.53  ? 841 RDG B C9    1 
HETATM 5475 O  O7    . RDG C 2 5   ? 25.742  19.975  15.923  1.00 61.84  ? 841 RDG B O7    1 
HETATM 5476 C  C12   . RDG C 2 5   ? 25.348  18.755  15.584  1.00 57.45  ? 841 RDG B C12   1 
HETATM 5477 C  C7    . RDG C 2 5   ? 26.444  17.869  15.682  1.00 54.92  ? 841 RDG B C7    1 
ATOM   5478 P  P     . DG  C 2 6   ? 24.888  17.874  23.792  1.00 62.77  ? 842 DG  B P     1 
ATOM   5479 O  OP1   . DG  C 2 6   ? 23.467  18.117  24.126  1.00 64.53  ? 842 DG  B OP1   1 
ATOM   5480 O  OP2   . DG  C 2 6   ? 25.838  17.492  24.858  1.00 61.42  ? 842 DG  B OP2   1 
ATOM   5481 O  "O5'" . DG  C 2 6   ? 24.977  16.748  22.662  1.00 54.70  ? 842 DG  B "O5'" 1 
ATOM   5482 C  "C5'" . DG  C 2 6   ? 26.243  16.206  22.304  1.00 55.41  ? 842 DG  B "C5'" 1 
ATOM   5483 C  "C4'" . DG  C 2 6   ? 26.551  16.471  20.843  1.00 60.20  ? 842 DG  B "C4'" 1 
ATOM   5484 O  "O4'" . DG  C 2 6   ? 27.510  17.549  20.736  1.00 58.08  ? 842 DG  B "O4'" 1 
ATOM   5485 C  "C3'" . DG  C 2 6   ? 27.192  15.305  20.108  1.00 57.26  ? 842 DG  B "C3'" 1 
ATOM   5486 O  "O3'" . DG  C 2 6   ? 26.168  14.476  19.571  1.00 62.47  ? 842 DG  B "O3'" 1 
ATOM   5487 C  "C2'" . DG  C 2 6   ? 27.993  15.989  19.002  1.00 56.84  ? 842 DG  B "C2'" 1 
ATOM   5488 C  "C1'" . DG  C 2 6   ? 28.274  17.385  19.558  1.00 58.89  ? 842 DG  B "C1'" 1 
ATOM   5489 N  N9    . DG  C 2 6   ? 29.677  17.636  19.883  1.00 53.85  ? 842 DG  B N9    1 
ATOM   5490 C  C8    . DG  C 2 6   ? 30.217  17.789  21.138  1.00 52.54  ? 842 DG  B C8    1 
ATOM   5491 N  N7    . DG  C 2 6   ? 31.503  18.009  21.127  1.00 52.56  ? 842 DG  B N7    1 
ATOM   5492 C  C5    . DG  C 2 6   ? 31.837  18.001  19.779  1.00 50.57  ? 842 DG  B C5    1 
ATOM   5493 C  C6    . DG  C 2 6   ? 33.092  18.186  19.152  1.00 52.35  ? 842 DG  B C6    1 
ATOM   5494 O  O6    . DG  C 2 6   ? 34.190  18.399  19.683  1.00 57.23  ? 842 DG  B O6    1 
ATOM   5495 N  N1    . DG  C 2 6   ? 32.993  18.102  17.766  1.00 55.85  ? 842 DG  B N1    1 
ATOM   5496 C  C2    . DG  C 2 6   ? 31.829  17.870  17.073  1.00 56.91  ? 842 DG  B C2    1 
ATOM   5497 N  N2    . DG  C 2 6   ? 31.933  17.824  15.737  1.00 54.73  ? 842 DG  B N2    1 
ATOM   5498 N  N3    . DG  C 2 6   ? 30.645  17.696  17.649  1.00 55.57  ? 842 DG  B N3    1 
ATOM   5499 C  C4    . DG  C 2 6   ? 30.725  17.774  19.000  1.00 50.97  ? 842 DG  B C4    1 
ATOM   5500 P  P     . DG  C 2 7   ? 26.259  12.878  19.710  1.00 59.03  ? 843 DG  B P     1 
ATOM   5501 O  OP1   . DG  C 2 7   ? 24.891  12.341  19.537  1.00 67.52  ? 843 DG  B OP1   1 
ATOM   5502 O  OP2   . DG  C 2 7   ? 27.022  12.570  20.940  1.00 56.19  ? 843 DG  B OP2   1 
ATOM   5503 O  "O5'" . DG  C 2 7   ? 27.151  12.434  18.460  1.00 52.21  ? 843 DG  B "O5'" 1 
ATOM   5504 C  "C5'" . DG  C 2 7   ? 28.445  11.880  18.664  1.00 53.94  ? 843 DG  B "C5'" 1 
ATOM   5505 C  "C4'" . DG  C 2 7   ? 29.382  12.331  17.559  1.00 57.46  ? 843 DG  B "C4'" 1 
ATOM   5506 O  "O4'" . DG  C 2 7   ? 29.903  13.644  17.876  1.00 56.31  ? 843 DG  B "O4'" 1 
ATOM   5507 C  "C3'" . DG  C 2 7   ? 30.617  11.469  17.358  1.00 59.88  ? 843 DG  B "C3'" 1 
ATOM   5508 O  "O3'" . DG  C 2 7   ? 30.297  10.386  16.493  1.00 62.46  ? 843 DG  B "O3'" 1 
ATOM   5509 C  "C2'" . DG  C 2 7   ? 31.580  12.449  16.695  1.00 54.63  ? 843 DG  B "C2'" 1 
ATOM   5510 C  "C1'" . DG  C 2 7   ? 31.191  13.793  17.310  1.00 54.01  ? 843 DG  B "C1'" 1 
ATOM   5511 N  N9    . DG  C 2 7   ? 32.107  14.255  18.351  1.00 56.11  ? 843 DG  B N9    1 
ATOM   5512 C  C8    . DG  C 2 7   ? 31.850  14.355  19.697  1.00 53.74  ? 843 DG  B C8    1 
ATOM   5513 N  N7    . DG  C 2 7   ? 32.863  14.803  20.387  1.00 51.99  ? 843 DG  B N7    1 
ATOM   5514 C  C5    . DG  C 2 7   ? 33.855  15.013  19.438  1.00 53.98  ? 843 DG  B C5    1 
ATOM   5515 C  C6    . DG  C 2 7   ? 35.178  15.494  19.591  1.00 55.68  ? 843 DG  B C6    1 
ATOM   5516 O  O6    . DG  C 2 7   ? 35.754  15.840  20.633  1.00 52.97  ? 843 DG  B O6    1 
ATOM   5517 N  N1    . DG  C 2 7   ? 35.849  15.556  18.371  1.00 54.92  ? 843 DG  B N1    1 
ATOM   5518 C  C2    . DG  C 2 7   ? 35.309  15.199  17.158  1.00 52.91  ? 843 DG  B C2    1 
ATOM   5519 N  N2    . DG  C 2 7   ? 36.108  15.326  16.089  1.00 45.09  ? 843 DG  B N2    1 
ATOM   5520 N  N3    . DG  C 2 7   ? 34.070  14.748  17.001  1.00 56.50  ? 843 DG  B N3    1 
ATOM   5521 C  C4    . DG  C 2 7   ? 33.404  14.682  18.179  1.00 52.84  ? 843 DG  B C4    1 
ATOM   5522 P  P     . DT  C 2 8   ? 31.140  9.019   16.554  1.00 60.82  ? 844 DT  B P     1 
ATOM   5523 O  OP1   . DT  C 2 8   ? 30.385  7.999   15.794  1.00 60.94  ? 844 DT  B OP1   1 
ATOM   5524 O  OP2   . DT  C 2 8   ? 31.498  8.768   17.968  1.00 61.74  ? 844 DT  B OP2   1 
ATOM   5525 O  "O5'" . DT  C 2 8   ? 32.485  9.359   15.759  1.00 54.51  ? 844 DT  B "O5'" 1 
ATOM   5526 C  "C5'" . DT  C 2 8   ? 32.426  9.690   14.376  1.00 53.69  ? 844 DT  B "C5'" 1 
ATOM   5527 C  "C4'" . DT  C 2 8   ? 33.758  10.238  13.901  1.00 55.56  ? 844 DT  B "C4'" 1 
ATOM   5528 O  "O4'" . DT  C 2 8   ? 34.089  11.413  14.680  1.00 60.29  ? 844 DT  B "O4'" 1 
ATOM   5529 C  "C3'" . DT  C 2 8   ? 34.941  9.296   14.076  1.00 56.51  ? 844 DT  B "C3'" 1 
ATOM   5530 O  "O3'" . DT  C 2 8   ? 35.103  8.496   12.907  1.00 63.05  ? 844 DT  B "O3'" 1 
ATOM   5531 C  "C2'" . DT  C 2 8   ? 36.115  10.255  14.245  1.00 60.59  ? 844 DT  B "C2'" 1 
ATOM   5532 C  "C1'" . DT  C 2 8   ? 35.493  11.530  14.805  1.00 57.76  ? 844 DT  B "C1'" 1 
ATOM   5533 N  N1    . DT  C 2 8   ? 35.834  11.778  16.236  1.00 57.63  ? 844 DT  B N1    1 
ATOM   5534 C  C2    . DT  C 2 8   ? 37.080  12.270  16.561  1.00 54.29  ? 844 DT  B C2    1 
ATOM   5535 O  O2    . DT  C 2 8   ? 37.940  12.517  15.735  1.00 56.81  ? 844 DT  B O2    1 
ATOM   5536 N  N3    . DT  C 2 8   ? 37.285  12.463  17.904  1.00 50.75  ? 844 DT  B N3    1 
ATOM   5537 C  C4    . DT  C 2 8   ? 36.388  12.219  18.927  1.00 54.82  ? 844 DT  B C4    1 
ATOM   5538 O  O4    . DT  C 2 8   ? 36.666  12.424  20.104  1.00 57.00  ? 844 DT  B O4    1 
ATOM   5539 C  C5    . DT  C 2 8   ? 35.105  11.705  18.517  1.00 54.83  ? 844 DT  B C5    1 
ATOM   5540 C  C7    . DT  C 2 8   ? 34.051  11.402  19.539  1.00 54.77  ? 844 DT  B C7    1 
ATOM   5541 C  C6    . DT  C 2 8   ? 34.893  11.512  17.209  1.00 56.39  ? 844 DT  B C6    1 
ATOM   5542 P  P     . DC  C 2 9   ? 35.740  7.023   13.011  1.00 62.70  ? 845 DC  B P     1 
ATOM   5543 O  OP1   . DC  C 2 9   ? 35.664  6.403   11.670  1.00 72.15  ? 845 DC  B OP1   1 
ATOM   5544 O  OP2   . DC  C 2 9   ? 35.122  6.347   14.171  1.00 69.10  ? 845 DC  B OP2   1 
ATOM   5545 O  "O5'" . DC  C 2 9   ? 37.275  7.287   13.369  1.00 55.74  ? 845 DC  B "O5'" 1 
ATOM   5546 C  "C5'" . DC  C 2 9   ? 38.098  8.015   12.471  1.00 61.64  ? 845 DC  B "C5'" 1 
ATOM   5547 C  "C4'" . DC  C 2 9   ? 39.364  8.477   13.169  1.00 61.94  ? 845 DC  B "C4'" 1 
ATOM   5548 O  "O4'" . DC  C 2 9   ? 39.050  9.213   14.380  1.00 59.66  ? 845 DC  B "O4'" 1 
ATOM   5549 C  "C3'" . DC  C 2 9   ? 40.295  7.349   13.600  1.00 58.72  ? 845 DC  B "C3'" 1 
ATOM   5550 O  "O3'" . DC  C 2 9   ? 41.550  7.568   12.996  1.00 64.17  ? 845 DC  B "O3'" 1 
ATOM   5551 C  "C2'" . DC  C 2 9   ? 40.383  7.477   15.119  1.00 59.99  ? 845 DC  B "C2'" 1 
ATOM   5552 C  "C1'" . DC  C 2 9   ? 40.075  8.954   15.312  1.00 63.65  ? 845 DC  B "C1'" 1 
ATOM   5553 N  N1    . DC  C 2 9   ? 39.604  9.288   16.685  1.00 59.34  ? 845 DC  B N1    1 
ATOM   5554 C  C2    . DC  C 2 9   ? 40.384  10.119  17.495  1.00 58.34  ? 845 DC  B C2    1 
ATOM   5555 O  O2    . DC  C 2 9   ? 41.449  10.567  17.052  1.00 61.49  ? 845 DC  B O2    1 
ATOM   5556 N  N3    . DC  C 2 9   ? 39.948  10.413  18.745  1.00 54.65  ? 845 DC  B N3    1 
ATOM   5557 C  C4    . DC  C 2 9   ? 38.794  9.909   19.184  1.00 59.39  ? 845 DC  B C4    1 
ATOM   5558 N  N4    . DC  C 2 9   ? 38.404  10.227  20.423  1.00 58.15  ? 845 DC  B N4    1 
ATOM   5559 C  C5    . DC  C 2 9   ? 37.986  9.058   18.373  1.00 56.21  ? 845 DC  B C5    1 
ATOM   5560 C  C6    . DC  C 2 9   ? 38.426  8.775   17.143  1.00 59.54  ? 845 DC  B C6    1 
ATOM   5561 P  P     . DC  C 2 10  ? 42.625  6.380   12.912  1.00 73.13  ? 846 DC  B P     1 
ATOM   5562 O  OP1   . DC  C 2 10  ? 43.176  6.402   11.541  1.00 66.79  ? 846 DC  B OP1   1 
ATOM   5563 O  OP2   . DC  C 2 10  ? 41.994  5.146   13.432  1.00 73.13  ? 846 DC  B OP2   1 
ATOM   5564 O  "O5'" . DC  C 2 10  ? 43.769  6.835   13.930  1.00 71.97  ? 846 DC  B "O5'" 1 
ATOM   5565 C  "C5'" . DC  C 2 10  ? 44.195  8.191   13.951  1.00 66.99  ? 846 DC  B "C5'" 1 
ATOM   5566 C  "C4'" . DC  C 2 10  ? 44.978  8.458   15.220  1.00 64.85  ? 846 DC  B "C4'" 1 
ATOM   5567 O  "O4'" . DC  C 2 10  ? 44.074  8.803   16.300  1.00 66.33  ? 846 DC  B "O4'" 1 
ATOM   5568 C  "C3'" . DC  C 2 10  ? 45.789  7.260   15.702  1.00 66.09  ? 846 DC  B "C3'" 1 
ATOM   5569 O  "O3'" . DC  C 2 10  ? 47.154  7.628   15.824  1.00 62.14  ? 846 DC  B "O3'" 1 
ATOM   5570 C  "C2'" . DC  C 2 10  ? 45.171  6.893   17.050  1.00 70.05  ? 846 DC  B "C2'" 1 
ATOM   5571 C  "C1'" . DC  C 2 10  ? 44.554  8.214   17.488  1.00 70.30  ? 846 DC  B "C1'" 1 
ATOM   5572 N  N1    . DC  C 2 10  ? 43.418  8.057   18.437  1.00 64.32  ? 846 DC  B N1    1 
ATOM   5573 C  C2    . DC  C 2 10  ? 43.481  8.664   19.696  1.00 63.54  ? 846 DC  B C2    1 
ATOM   5574 O  O2    . DC  C 2 10  ? 44.483  9.324   19.997  1.00 62.69  ? 846 DC  B O2    1 
ATOM   5575 N  N3    . DC  C 2 10  ? 42.437  8.512   20.549  1.00 60.57  ? 846 DC  B N3    1 
ATOM   5576 C  C4    . DC  C 2 10  ? 41.375  7.793   20.184  1.00 58.64  ? 846 DC  B C4    1 
ATOM   5577 N  N4    . DC  C 2 10  ? 40.370  7.670   21.057  1.00 57.63  ? 846 DC  B N4    1 
ATOM   5578 C  C5    . DC  C 2 10  ? 41.294  7.165   18.906  1.00 58.37  ? 846 DC  B C5    1 
ATOM   5579 C  C6    . DC  C 2 10  ? 42.328  7.322   18.074  1.00 61.53  ? 846 DC  B C6    1 
ATOM   5580 P  P     . DT  C 2 11  ? 48.272  6.506   16.089  1.00 68.67  ? 847 DT  B P     1 
ATOM   5581 O  OP1   . DT  C 2 11  ? 49.471  6.869   15.301  1.00 68.67  ? 847 DT  B OP1   1 
ATOM   5582 O  OP2   . DT  C 2 11  ? 47.639  5.182   15.898  1.00 66.81  ? 847 DT  B OP2   1 
ATOM   5583 O  "O5'" . DT  C 2 11  ? 48.631  6.690   17.634  1.00 69.66  ? 847 DT  B "O5'" 1 
ATOM   5584 C  "C5'" . DT  C 2 11  ? 48.988  7.979   18.111  1.00 65.54  ? 847 DT  B "C5'" 1 
ATOM   5585 C  "C4'" . DT  C 2 11  ? 49.054  7.986   19.626  1.00 68.90  ? 847 DT  B "C4'" 1 
ATOM   5586 O  "O4'" . DT  C 2 11  ? 47.716  7.907   20.182  1.00 67.56  ? 847 DT  B "O4'" 1 
ATOM   5587 C  "C3'" . DT  C 2 11  ? 49.836  6.824   20.229  1.00 69.79  ? 847 DT  B "C3'" 1 
ATOM   5588 O  "O3'" . DT  C 2 11  ? 50.684  7.318   21.250  1.00 74.19  ? 847 DT  B "O3'" 1 
ATOM   5589 C  "C2'" . DT  C 2 11  ? 48.743  5.928   20.801  1.00 65.53  ? 847 DT  B "C2'" 1 
ATOM   5590 C  "C1'" . DT  C 2 11  ? 47.730  6.975   21.242  1.00 67.28  ? 847 DT  B "C1'" 1 
ATOM   5591 N  N1    . DT  C 2 11  ? 46.350  6.450   21.441  1.00 66.92  ? 847 DT  B N1    1 
ATOM   5592 C  C2    . DT  C 2 11  ? 45.672  6.761   22.601  1.00 64.73  ? 847 DT  B C2    1 
ATOM   5593 O  O2    . DT  C 2 11  ? 46.142  7.451   23.488  1.00 59.22  ? 847 DT  B O2    1 
ATOM   5594 N  N3    . DT  C 2 11  ? 44.410  6.229   22.683  1.00 61.22  ? 847 DT  B N3    1 
ATOM   5595 C  C4    . DT  C 2 11  ? 43.777  5.436   21.744  1.00 60.31  ? 847 DT  B C4    1 
ATOM   5596 O  O4    . DT  C 2 11  ? 42.640  5.004   21.908  1.00 63.10  ? 847 DT  B O4    1 
ATOM   5597 C  C5    . DT  C 2 11  ? 44.544  5.150   20.557  1.00 61.26  ? 847 DT  B C5    1 
ATOM   5598 C  C7    . DT  C 2 11  ? 43.957  4.300   19.470  1.00 66.30  ? 847 DT  B C7    1 
ATOM   5599 C  C6    . DT  C 2 11  ? 45.777  5.664   20.463  1.00 62.57  ? 847 DT  B C6    1 
ATOM   5600 P  P     . DA  C 2 12  ? 52.111  6.633   21.524  1.00 80.08  ? 848 DA  B P     1 
ATOM   5601 O  OP1   . DA  C 2 12  ? 53.149  7.493   20.914  1.00 71.76  ? 848 DA  B OP1   1 
ATOM   5602 O  OP2   . DA  C 2 12  ? 52.013  5.208   21.137  1.00 79.18  ? 848 DA  B OP2   1 
ATOM   5603 O  "O5'" . DA  C 2 12  ? 52.254  6.695   23.113  1.00 81.17  ? 848 DA  B "O5'" 1 
ATOM   5604 C  "C5'" . DA  C 2 12  ? 51.439  7.602   23.845  1.00 75.99  ? 848 DA  B "C5'" 1 
ATOM   5605 C  "C4'" . DA  C 2 12  ? 50.765  6.881   24.997  1.00 77.31  ? 848 DA  B "C4'" 1 
ATOM   5606 O  "O4'" . DA  C 2 12  ? 49.427  6.456   24.623  1.00 77.24  ? 848 DA  B "O4'" 1 
ATOM   5607 C  "C3'" . DA  C 2 12  ? 51.493  5.619   25.451  1.00 78.32  ? 848 DA  B "C3'" 1 
ATOM   5608 O  "O3'" . DA  C 2 12  ? 51.676  5.654   26.856  1.00 80.60  ? 848 DA  B "O3'" 1 
ATOM   5609 C  "C2'" . DA  C 2 12  ? 50.544  4.492   25.050  1.00 71.22  ? 848 DA  B "C2'" 1 
ATOM   5610 C  "C1'" . DA  C 2 12  ? 49.209  5.199   25.225  1.00 65.44  ? 848 DA  B "C1'" 1 
ATOM   5611 N  N9    . DA  C 2 12  ? 48.080  4.527   24.589  1.00 64.67  ? 848 DA  B N9    1 
ATOM   5612 C  C8    . DA  C 2 12  ? 48.064  3.885   23.382  1.00 71.66  ? 848 DA  B C8    1 
ATOM   5613 N  N7    . DA  C 2 12  ? 46.897  3.372   23.068  1.00 63.59  ? 848 DA  B N7    1 
ATOM   5614 C  C5    . DA  C 2 12  ? 46.092  3.699   24.146  1.00 58.67  ? 848 DA  B C5    1 
ATOM   5615 C  C6    . DA  C 2 12  ? 44.737  3.444   24.432  1.00 60.57  ? 848 DA  B C6    1 
ATOM   5616 N  N6    . DA  C 2 12  ? 43.927  2.770   23.609  1.00 59.66  ? 848 DA  B N6    1 
ATOM   5617 N  N1    . DA  C 2 12  ? 44.246  3.911   25.598  1.00 62.14  ? 848 DA  B N1    1 
ATOM   5618 C  C2    . DA  C 2 12  ? 45.060  4.585   26.418  1.00 59.02  ? 848 DA  B C2    1 
ATOM   5619 N  N3    . DA  C 2 12  ? 46.347  4.887   26.259  1.00 63.46  ? 848 DA  B N3    1 
ATOM   5620 C  C4    . DA  C 2 12  ? 46.806  4.410   25.092  1.00 62.85  ? 848 DA  B C4    1 
ATOM   5621 P  P     . DG  C 2 13  ? 53.069  5.177   27.499  1.00 92.14  ? 849 DG  B P     1 
ATOM   5622 O  OP1   . DG  C 2 13  ? 54.110  6.149   27.098  1.00 80.31  ? 849 DG  B OP1   1 
ATOM   5623 O  OP2   . DG  C 2 13  ? 53.236  3.741   27.179  1.00 73.90  ? 849 DG  B OP2   1 
ATOM   5624 O  "O5'" . DG  C 2 13  ? 52.823  5.295   29.074  1.00 84.59  ? 849 DG  B "O5'" 1 
ATOM   5625 C  "C5'" . DG  C 2 13  ? 51.704  6.019   29.570  1.00 74.97  ? 849 DG  B "C5'" 1 
ATOM   5626 C  "C4'" . DG  C 2 13  ? 50.950  5.182   30.587  1.00 75.92  ? 849 DG  B "C4'" 1 
ATOM   5627 O  "O4'" . DG  C 2 13  ? 49.782  4.584   29.968  1.00 76.84  ? 849 DG  B "O4'" 1 
ATOM   5628 C  "C3'" . DG  C 2 13  ? 51.750  4.034   31.193  1.00 80.52  ? 849 DG  B "C3'" 1 
ATOM   5629 O  "O3'" . DG  C 2 13  ? 51.462  3.939   32.582  1.00 85.60  ? 849 DG  B "O3'" 1 
ATOM   5630 C  "C2'" . DG  C 2 13  ? 51.264  2.810   30.419  1.00 77.79  ? 849 DG  B "C2'" 1 
ATOM   5631 C  "C1'" . DG  C 2 13  ? 49.819  3.177   30.102  1.00 74.99  ? 849 DG  B "C1'" 1 
ATOM   5632 N  N9    . DG  C 2 13  ? 49.330  2.602   28.852  1.00 71.81  ? 849 DG  B N9    1 
ATOM   5633 C  C8    . DG  C 2 13  ? 50.054  2.377   27.706  1.00 69.07  ? 849 DG  B C8    1 
ATOM   5634 N  N7    . DG  C 2 13  ? 49.349  1.856   26.741  1.00 71.96  ? 849 DG  B N7    1 
ATOM   5635 C  C5    . DG  C 2 13  ? 48.075  1.728   27.280  1.00 67.18  ? 849 DG  B C5    1 
ATOM   5636 C  C6    . DG  C 2 13  ? 46.887  1.223   26.702  1.00 65.76  ? 849 DG  B C6    1 
ATOM   5637 O  O6    . DG  C 2 13  ? 46.720  0.773   25.559  1.00 65.25  ? 849 DG  B O6    1 
ATOM   5638 N  N1    . DG  C 2 13  ? 45.819  1.272   27.595  1.00 68.40  ? 849 DG  B N1    1 
ATOM   5639 C  C2    . DG  C 2 13  ? 45.891  1.750   28.882  1.00 66.42  ? 849 DG  B C2    1 
ATOM   5640 N  N2    . DG  C 2 13  ? 44.755  1.718   29.594  1.00 62.97  ? 849 DG  B N2    1 
ATOM   5641 N  N3    . DG  C 2 13  ? 46.999  2.226   29.436  1.00 66.87  ? 849 DG  B N3    1 
ATOM   5642 C  C4    . DG  C 2 13  ? 48.047  2.184   28.579  1.00 70.62  ? 849 DG  B C4    1 
ATOM   5643 P  P     . DG  C 2 14  ? 52.337  2.980   33.530  1.00 88.90  ? 850 DG  B P     1 
ATOM   5644 O  OP1   . DG  C 2 14  ? 52.579  3.709   34.795  1.00 90.55  ? 850 DG  B OP1   1 
ATOM   5645 O  OP2   . DG  C 2 14  ? 53.483  2.476   32.742  1.00 89.73  ? 850 DG  B OP2   1 
ATOM   5646 O  "O5'" . DG  C 2 14  ? 51.358  1.753   33.830  1.00 80.61  ? 850 DG  B "O5'" 1 
ATOM   5647 C  "C5'" . DG  C 2 14  ? 50.100  2.027   34.427  1.00 80.61  ? 850 DG  B "C5'" 1 
ATOM   5648 C  "C4'" . DG  C 2 14  ? 49.048  1.032   33.977  1.00 77.10  ? 850 DG  B "C4'" 1 
ATOM   5649 O  "O4'" . DG  C 2 14  ? 49.035  0.937   32.531  1.00 82.04  ? 850 DG  B "O4'" 1 
ATOM   5650 C  "C3'" . DG  C 2 14  ? 49.248  -0.395  34.482  1.00 78.45  ? 850 DG  B "C3'" 1 
ATOM   5651 O  "O3'" . DG  C 2 14  ? 48.196  -0.717  35.384  1.00 80.62  ? 850 DG  B "O3'" 1 
ATOM   5652 C  "C2'" . DG  C 2 14  ? 49.200  -1.259  33.220  1.00 76.55  ? 850 DG  B "C2'" 1 
ATOM   5653 C  "C1'" . DG  C 2 14  ? 48.506  -0.334  32.230  1.00 78.43  ? 850 DG  B "C1'" 1 
ATOM   5654 N  N9    . DG  C 2 14  ? 48.738  -0.659  30.824  1.00 73.68  ? 850 DG  B N9    1 
ATOM   5655 C  C8    . DG  C 2 14  ? 49.912  -0.558  30.116  1.00 70.38  ? 850 DG  B C8    1 
ATOM   5656 N  N7    . DG  C 2 14  ? 49.797  -0.926  28.869  1.00 68.30  ? 850 DG  B N7    1 
ATOM   5657 C  C5    . DG  C 2 14  ? 48.463  -1.295  28.740  1.00 71.12  ? 850 DG  B C5    1 
ATOM   5658 C  C6    . DG  C 2 14  ? 47.747  -1.779  27.618  1.00 72.16  ? 850 DG  B C6    1 
ATOM   5659 O  O6    . DG  C 2 14  ? 48.165  -1.987  26.469  1.00 74.31  ? 850 DG  B O6    1 
ATOM   5660 N  N1    . DG  C 2 14  ? 46.411  -2.029  27.926  1.00 69.00  ? 850 DG  B N1    1 
ATOM   5661 C  C2    . DG  C 2 14  ? 45.839  -1.835  29.162  1.00 66.46  ? 850 DG  B C2    1 
ATOM   5662 N  N2    . DG  C 2 14  ? 44.536  -2.131  29.270  1.00 63.77  ? 850 DG  B N2    1 
ATOM   5663 N  N3    . DG  C 2 14  ? 46.498  -1.383  30.220  1.00 66.06  ? 850 DG  B N3    1 
ATOM   5664 C  C4    . DG  C 2 14  ? 47.800  -1.135  29.936  1.00 69.03  ? 850 DG  B C4    1 
ATOM   5665 P  P     . DA  C 2 15  ? 48.294  -2.021  36.316  1.00 80.55  ? 851 DA  B P     1 
ATOM   5666 O  OP1   . DA  C 2 15  ? 47.905  -1.615  37.685  1.00 84.90  ? 851 DA  B OP1   1 
ATOM   5667 O  OP2   . DA  C 2 15  ? 49.610  -2.659  36.084  1.00 64.03  ? 851 DA  B OP2   1 
ATOM   5668 O  "O5'" . DA  C 2 15  ? 47.169  -2.992  35.728  1.00 72.56  ? 851 DA  B "O5'" 1 
ATOM   5669 C  "C5'" . DA  C 2 15  ? 45.824  -2.535  35.650  1.00 73.25  ? 851 DA  B "C5'" 1 
ATOM   5670 C  "C4'" . DA  C 2 15  ? 44.980  -3.450  34.781  1.00 81.28  ? 851 DA  B "C4'" 1 
ATOM   5671 O  "O4'" . DA  C 2 15  ? 45.443  -3.383  33.407  1.00 82.24  ? 851 DA  B "O4'" 1 
ATOM   5672 C  "C3'" . DA  C 2 15  ? 45.014  -4.924  35.169  1.00 72.80  ? 851 DA  B "C3'" 1 
ATOM   5673 O  "O3'" . DA  C 2 15  ? 43.716  -5.482  35.013  1.00 79.53  ? 851 DA  B "O3'" 1 
ATOM   5674 C  "C2'" . DA  C 2 15  ? 46.003  -5.515  34.168  1.00 70.51  ? 851 DA  B "C2'" 1 
ATOM   5675 C  "C1'" . DA  C 2 15  ? 45.691  -4.688  32.927  1.00 71.88  ? 851 DA  B "C1'" 1 
ATOM   5676 N  N9    . DA  C 2 15  ? 46.788  -4.617  31.966  1.00 64.50  ? 851 DA  B N9    1 
ATOM   5677 C  C8    . DA  C 2 15  ? 48.089  -4.293  32.229  1.00 65.80  ? 851 DA  B C8    1 
ATOM   5678 N  N7    . DA  C 2 15  ? 48.863  -4.301  31.170  1.00 65.36  ? 851 DA  B N7    1 
ATOM   5679 C  C5    . DA  C 2 15  ? 48.009  -4.654  30.139  1.00 63.08  ? 851 DA  B C5    1 
ATOM   5680 C  C6    . DA  C 2 15  ? 48.216  -4.839  28.758  1.00 62.27  ? 851 DA  B C6    1 
ATOM   5681 N  N6    . DA  C 2 15  ? 49.405  -4.682  28.166  1.00 61.92  ? 851 DA  B N6    1 
ATOM   5682 N  N1    . DA  C 2 15  ? 47.151  -5.191  28.008  1.00 64.22  ? 851 DA  B N1    1 
ATOM   5683 C  C2    . DA  C 2 15  ? 45.964  -5.347  28.605  1.00 62.51  ? 851 DA  B C2    1 
ATOM   5684 N  N3    . DA  C 2 15  ? 45.648  -5.202  29.891  1.00 65.59  ? 851 DA  B N3    1 
ATOM   5685 C  C4    . DA  C 2 15  ? 46.725  -4.852  30.611  1.00 65.39  ? 851 DA  B C4    1 
ATOM   5686 P  P     . DC  C 2 16  ? 43.117  -6.469  36.131  1.00 90.47  ? 852 DC  B P     1 
ATOM   5687 O  OP1   . DC  C 2 16  ? 41.832  -5.900  36.592  1.00 88.78  ? 852 DC  B OP1   1 
ATOM   5688 O  OP2   . DC  C 2 16  ? 44.193  -6.756  37.105  1.00 84.32  ? 852 DC  B OP2   1 
ATOM   5689 O  "O5'" . DC  C 2 16  ? 42.793  -7.807  35.321  1.00 82.28  ? 852 DC  B "O5'" 1 
ATOM   5690 C  "C5'" . DC  C 2 16  ? 43.780  -8.326  34.447  1.00 84.17  ? 852 DC  B "C5'" 1 
ATOM   5691 C  "C4'" . DC  C 2 16  ? 43.189  -8.600  33.079  1.00 76.26  ? 852 DC  B "C4'" 1 
ATOM   5692 O  "O4'" . DC  C 2 16  ? 43.997  -7.961  32.058  1.00 73.19  ? 852 DC  B "O4'" 1 
ATOM   5693 C  "C3'" . DC  C 2 16  ? 43.139  -10.078 32.728  1.00 72.34  ? 852 DC  B "C3'" 1 
ATOM   5694 O  "O3'" . DC  C 2 16  ? 41.969  -10.368 31.980  1.00 70.55  ? 852 DC  B "O3'" 1 
ATOM   5695 C  "C2'" . DC  C 2 16  ? 44.413  -10.278 31.913  1.00 71.32  ? 852 DC  B "C2'" 1 
ATOM   5696 C  "C1'" . DC  C 2 16  ? 44.594  -8.932  31.221  1.00 67.99  ? 852 DC  B "C1'" 1 
ATOM   5697 N  N1    . DC  C 2 16  ? 46.025  -8.558  31.017  1.00 67.06  ? 852 DC  B N1    1 
ATOM   5698 C  C2    . DC  C 2 16  ? 46.575  -8.576  29.730  1.00 65.62  ? 852 DC  B C2    1 
ATOM   5699 O  O2    . DC  C 2 16  ? 45.861  -8.903  28.774  1.00 64.13  ? 852 DC  B O2    1 
ATOM   5700 N  N3    . DC  C 2 16  ? 47.877  -8.232  29.568  1.00 63.55  ? 852 DC  B N3    1 
ATOM   5701 C  C4    . DC  C 2 16  ? 48.615  -7.884  30.624  1.00 60.51  ? 852 DC  B C4    1 
ATOM   5702 N  N4    . DC  C 2 16  ? 49.893  -7.553  30.414  1.00 59.39  ? 852 DC  B N4    1 
ATOM   5703 C  C5    . DC  C 2 16  ? 48.072  -7.860  31.942  1.00 59.72  ? 852 DC  B C5    1 
ATOM   5704 C  C6    . DC  C 2 16  ? 46.788  -8.202  32.089  1.00 65.00  ? 852 DC  B C6    1 
ATOM   5705 P  P     . DC  C 2 17  ? 41.228  -11.780 32.169  1.00 79.34  ? 853 DC  B P     1 
ATOM   5706 O  OP1   . DC  C 2 17  ? 39.771  -11.547 32.053  1.00 85.88  ? 853 DC  B OP1   1 
ATOM   5707 O  OP2   . DC  C 2 17  ? 41.779  -12.408 33.389  1.00 68.06  ? 853 DC  B OP2   1 
ATOM   5708 O  "O5'" . DC  C 2 17  ? 41.701  -12.631 30.902  1.00 80.58  ? 853 DC  B "O5'" 1 
ATOM   5709 C  "C5'" . DC  C 2 17  ? 41.486  -12.126 29.590  1.00 79.21  ? 853 DC  B "C5'" 1 
ATOM   5710 C  "C4'" . DC  C 2 17  ? 42.360  -12.860 28.590  1.00 79.43  ? 853 DC  B "C4'" 1 
ATOM   5711 O  "O4'" . DC  C 2 17  ? 43.662  -12.229 28.503  1.00 77.98  ? 853 DC  B "O4'" 1 
ATOM   5712 C  "C3'" . DC  C 2 17  ? 42.615  -14.328 28.924  1.00 82.43  ? 853 DC  B "C3'" 1 
ATOM   5713 O  "O3'" . DC  C 2 17  ? 42.137  -15.140 27.859  1.00 89.19  ? 853 DC  B "O3'" 1 
ATOM   5714 C  "C2'" . DC  C 2 17  ? 44.133  -14.430 29.091  1.00 73.30  ? 853 DC  B "C2'" 1 
ATOM   5715 C  "C1'" . DC  C 2 17  ? 44.629  -13.234 28.288  1.00 76.56  ? 853 DC  B "C1'" 1 
ATOM   5716 N  N1    . DC  C 2 17  ? 45.953  -12.705 28.725  1.00 69.64  ? 853 DC  B N1    1 
ATOM   5717 C  C2    . DC  C 2 17  ? 46.953  -12.459 27.778  1.00 66.80  ? 853 DC  B C2    1 
ATOM   5718 O  O2    . DC  C 2 17  ? 46.723  -12.686 26.584  1.00 67.20  ? 853 DC  B O2    1 
ATOM   5719 N  N3    . DC  C 2 17  ? 48.149  -11.974 28.198  1.00 66.71  ? 853 DC  B N3    1 
ATOM   5720 C  C4    . DC  C 2 17  ? 48.358  -11.740 29.495  1.00 67.42  ? 853 DC  B C4    1 
ATOM   5721 N  N4    . DC  C 2 17  ? 49.552  -11.264 29.863  1.00 61.77  ? 853 DC  B N4    1 
ATOM   5722 C  C5    . DC  C 2 17  ? 47.352  -11.985 30.473  1.00 66.63  ? 853 DC  B C5    1 
ATOM   5723 C  C6    . DC  C 2 17  ? 46.179  -12.465 30.046  1.00 66.24  ? 853 DC  B C6    1 
ATOM   5724 P  P     . DC  C 2 18  ? 42.085  -16.738 28.017  1.00 94.32  ? 854 DC  B P     1 
ATOM   5725 O  OP1   . DC  C 2 18  ? 41.001  -17.236 27.141  1.00 90.01  ? 854 DC  B OP1   1 
ATOM   5726 O  OP2   . DC  C 2 18  ? 42.066  -17.052 29.463  1.00 91.73  ? 854 DC  B OP2   1 
ATOM   5727 O  "O5'" . DC  C 2 18  ? 43.476  -17.226 27.400  1.00 79.55  ? 854 DC  B "O5'" 1 
ATOM   5728 C  "C5'" . DC  C 2 18  ? 43.781  -16.927 26.043  1.00 81.03  ? 854 DC  B "C5'" 1 
ATOM   5729 C  "C4'" . DC  C 2 18  ? 45.226  -17.268 25.727  1.00 80.55  ? 854 DC  B "C4'" 1 
ATOM   5730 O  "O4'" . DC  C 2 18  ? 46.098  -16.204 26.169  1.00 78.12  ? 854 DC  B "O4'" 1 
ATOM   5731 C  "C3'" . DC  C 2 18  ? 45.758  -18.503 26.436  1.00 74.42  ? 854 DC  B "C3'" 1 
ATOM   5732 O  "O3'" . DC  C 2 18  ? 45.429  -19.667 25.689  1.00 86.09  ? 854 DC  B "O3'" 1 
ATOM   5733 C  "C2'" . DC  C 2 18  ? 47.266  -18.257 26.455  1.00 75.16  ? 854 DC  B "C2'" 1 
ATOM   5734 C  "C1'" . DC  C 2 18  ? 47.394  -16.736 26.361  1.00 70.39  ? 854 DC  B "C1'" 1 
ATOM   5735 N  N1    . DC  C 2 18  ? 47.995  -16.107 27.571  1.00 67.18  ? 854 DC  B N1    1 
ATOM   5736 C  C2    . DC  C 2 18  ? 49.255  -15.511 27.476  1.00 68.68  ? 854 DC  B C2    1 
ATOM   5737 O  O2    . DC  C 2 18  ? 49.846  -15.518 26.389  1.00 68.78  ? 854 DC  B O2    1 
ATOM   5738 N  N3    . DC  C 2 18  ? 49.794  -14.942 28.581  1.00 65.79  ? 854 DC  B N3    1 
ATOM   5739 C  C4    . DC  C 2 18  ? 49.128  -14.952 29.736  1.00 67.38  ? 854 DC  B C4    1 
ATOM   5740 N  N4    . DC  C 2 18  ? 49.708  -14.376 30.794  1.00 65.44  ? 854 DC  B N4    1 
ATOM   5741 C  C5    . DC  C 2 18  ? 47.841  -15.556 29.853  1.00 69.60  ? 854 DC  B C5    1 
ATOM   5742 C  C6    . DC  C 2 18  ? 47.318  -16.116 28.756  1.00 70.15  ? 854 DC  B C6    1 
ATOM   5743 O  "O5'" . DC  D 2 2   ? 65.825  -25.018 35.804  1.00 107.70 ? 857 DC  C "O5'" 1 
ATOM   5744 C  "C5'" . DC  D 2 2   ? 64.516  -24.518 36.055  1.00 102.53 ? 857 DC  C "C5'" 1 
ATOM   5745 C  "C4'" . DC  D 2 2   ? 64.324  -23.159 35.403  1.00 115.10 ? 857 DC  C "C4'" 1 
ATOM   5746 O  "O4'" . DC  D 2 2   ? 64.579  -23.260 33.977  1.00 120.55 ? 857 DC  C "O4'" 1 
ATOM   5747 C  "C3'" . DC  D 2 2   ? 62.923  -22.563 35.548  1.00 114.19 ? 857 DC  C "C3'" 1 
ATOM   5748 O  "O3'" . DC  D 2 2   ? 62.997  -21.255 36.129  1.00 112.15 ? 857 DC  C "O3'" 1 
ATOM   5749 C  "C2'" . DC  D 2 2   ? 62.387  -22.536 34.118  1.00 110.72 ? 857 DC  C "C2'" 1 
ATOM   5750 C  "C1'" . DC  D 2 2   ? 63.672  -22.407 33.315  1.00 118.56 ? 857 DC  C "C1'" 1 
ATOM   5751 N  N1    . DC  D 2 2   ? 63.515  -22.829 31.896  1.00 121.80 ? 857 DC  C N1    1 
ATOM   5752 C  C2    . DC  D 2 2   ? 63.652  -21.879 30.877  1.00 122.43 ? 857 DC  C C2    1 
ATOM   5753 O  O2    . DC  D 2 2   ? 63.910  -20.707 31.177  1.00 118.05 ? 857 DC  C O2    1 
ATOM   5754 N  N3    . DC  D 2 2   ? 63.501  -22.273 29.589  1.00 123.53 ? 857 DC  C N3    1 
ATOM   5755 C  C4    . DC  D 2 2   ? 63.223  -23.547 29.308  1.00 122.38 ? 857 DC  C C4    1 
ATOM   5756 N  N4    . DC  D 2 2   ? 63.084  -23.888 28.023  1.00 121.39 ? 857 DC  C N4    1 
ATOM   5757 C  C5    . DC  D 2 2   ? 63.076  -24.528 30.333  1.00 114.24 ? 857 DC  C C5    1 
ATOM   5758 C  C6    . DC  D 2 2   ? 63.227  -24.129 31.600  1.00 117.99 ? 857 DC  C C6    1 
ATOM   5759 P  P     . DT  D 2 3   ? 61.827  -20.181 35.873  1.00 115.56 ? 858 DT  C P     1 
ATOM   5760 O  OP1   . DT  D 2 3   ? 60.526  -20.869 36.028  1.00 103.93 ? 858 DT  C OP1   1 
ATOM   5761 O  OP2   . DT  D 2 3   ? 62.146  -19.452 34.626  1.00 98.50  ? 858 DT  C OP2   1 
ATOM   5762 O  "O5'" . DT  D 2 3   ? 61.970  -19.152 37.087  1.00 92.89  ? 858 DT  C "O5'" 1 
ATOM   5763 C  "C5'" . DT  D 2 3   ? 61.678  -17.773 36.866  1.00 93.02  ? 858 DT  C "C5'" 1 
ATOM   5764 C  "C4'" . DT  D 2 3   ? 60.193  -17.510 36.670  1.00 82.34  ? 858 DT  C "C4'" 1 
ATOM   5765 O  "O4'" . DT  D 2 3   ? 59.723  -16.712 37.787  1.00 82.25  ? 858 DT  C "O4'" 1 
ATOM   5766 C  "C3'" . DT  D 2 3   ? 59.821  -16.742 35.403  1.00 86.73  ? 858 DT  C "C3'" 1 
ATOM   5767 O  "O3'" . DT  D 2 3   ? 58.638  -17.315 34.801  1.00 85.46  ? 858 DT  C "O3'" 1 
ATOM   5768 C  "C2'" . DT  D 2 3   ? 59.653  -15.300 35.880  1.00 86.90  ? 858 DT  C "C2'" 1 
ATOM   5769 C  "C1'" . DT  D 2 3   ? 59.396  -15.400 37.374  1.00 90.06  ? 858 DT  C "C1'" 1 
ATOM   5770 N  N1    . DT  D 2 3   ? 60.247  -14.402 38.059  1.00 90.50  ? 858 DT  C N1    1 
ATOM   5771 C  C2    . DT  D 2 3   ? 59.654  -13.408 38.803  1.00 90.06  ? 858 DT  C C2    1 
ATOM   5772 O  O2    . DT  D 2 3   ? 58.449  -13.318 38.955  1.00 85.64  ? 858 DT  C O2    1 
ATOM   5773 N  N3    . DT  D 2 3   ? 60.537  -12.529 39.375  1.00 94.73  ? 858 DT  C N3    1 
ATOM   5774 C  C4    . DT  D 2 3   ? 61.916  -12.542 39.267  1.00 92.92  ? 858 DT  C C4    1 
ATOM   5775 O  O4    . DT  D 2 3   ? 62.626  -11.707 39.818  1.00 93.86  ? 858 DT  C O4    1 
ATOM   5776 C  C5    . DT  D 2 3   ? 62.466  -13.602 38.462  1.00 85.64  ? 858 DT  C C5    1 
ATOM   5777 C  C7    . DT  D 2 3   ? 63.949  -13.714 38.275  1.00 82.63  ? 858 DT  C C7    1 
ATOM   5778 C  C6    . DT  D 2 3   ? 61.616  -14.466 37.899  1.00 83.13  ? 858 DT  C C6    1 
ATOM   5779 P  P     . DA  D 2 4   ? 57.602  -16.413 33.956  1.00 87.30  ? 859 DA  C P     1 
ATOM   5780 O  OP1   . DA  D 2 4   ? 56.743  -15.653 34.886  1.00 87.02  ? 859 DA  C OP1   1 
ATOM   5781 O  OP2   . DA  D 2 4   ? 56.989  -17.279 32.927  1.00 82.61  ? 859 DA  C OP2   1 
ATOM   5782 O  "O5'" . DA  D 2 4   ? 58.518  -15.362 33.181  1.00 76.46  ? 859 DA  C "O5'" 1 
ATOM   5783 C  "C5'" . DA  D 2 4   ? 59.232  -15.745 32.019  1.00 75.39  ? 859 DA  C "C5'" 1 
ATOM   5784 C  "C4'" . DA  D 2 4   ? 58.829  -14.909 30.811  1.00 75.53  ? 859 DA  C "C4'" 1 
ATOM   5785 O  "O4'" . DA  D 2 4   ? 57.588  -15.437 30.282  1.00 71.19  ? 859 DA  C "O4'" 1 
ATOM   5786 C  "C3'" . DA  D 2 4   ? 58.589  -13.405 30.983  1.00 72.38  ? 859 DA  C "C3'" 1 
ATOM   5787 O  "O3'" . DA  D 2 4   ? 58.894  -12.742 29.753  1.00 68.53  ? 859 DA  C "O3'" 1 
ATOM   5788 C  "C2'" . DA  D 2 4   ? 57.086  -13.345 31.213  1.00 68.23  ? 859 DA  C "C2'" 1 
ATOM   5789 C  "C1'" . DA  D 2 4   ? 56.639  -14.397 30.205  1.00 70.62  ? 859 DA  C "C1'" 1 
ATOM   5790 N  N9    . DA  D 2 4   ? 55.326  -14.978 30.459  1.00 72.71  ? 859 DA  C N9    1 
ATOM   5791 C  C8    . DA  D 2 4   ? 54.602  -14.953 31.618  1.00 71.46  ? 859 DA  C C8    1 
ATOM   5792 N  N7    . DA  D 2 4   ? 53.447  -15.572 31.529  1.00 67.23  ? 859 DA  C N7    1 
ATOM   5793 C  C5    . DA  D 2 4   ? 53.415  -16.037 30.225  1.00 71.03  ? 859 DA  C C5    1 
ATOM   5794 C  C6    . DA  D 2 4   ? 52.462  -16.775 29.494  1.00 74.66  ? 859 DA  C C6    1 
ATOM   5795 N  N6    . DA  D 2 4   ? 51.300  -17.193 30.006  1.00 71.51  ? 859 DA  C N6    1 
ATOM   5796 N  N1    . DA  D 2 4   ? 52.750  -17.070 28.208  1.00 72.65  ? 859 DA  C N1    1 
ATOM   5797 C  C2    . DA  D 2 4   ? 53.913  -16.653 27.695  1.00 70.03  ? 859 DA  C C2    1 
ATOM   5798 N  N3    . DA  D 2 4   ? 54.883  -15.956 28.281  1.00 71.12  ? 859 DA  C N3    1 
ATOM   5799 C  C4    . DA  D 2 4   ? 54.568  -15.679 29.554  1.00 70.45  ? 859 DA  C C4    1 
HETATM 5800 O  OP2   . RDG D 2 5   ? 58.775  -10.376 30.740  1.00 71.22  ? 860 RDG C OP2   1 
HETATM 5801 P  P     . RDG D 2 5   ? 59.513  -11.258 29.754  1.00 63.23  ? 860 RDG C P     1 
HETATM 5802 O  OP1   . RDG D 2 5   ? 61.063  -11.324 30.097  1.00 64.45  ? 860 RDG C OP1   1 
HETATM 5803 O  "O5'" . RDG D 2 5   ? 59.310  -10.746 28.294  1.00 73.66  ? 860 RDG C "O5'" 1 
HETATM 5804 C  "C5'" . RDG D 2 5   ? 59.787  -11.528 27.227  1.00 72.91  ? 860 RDG C "C5'" 1 
HETATM 5805 C  "C4'" . RDG D 2 5   ? 58.976  -11.700 26.071  1.00 70.49  ? 860 RDG C "C4'" 1 
HETATM 5806 C  "C3'" . RDG D 2 5   ? 58.570  -10.416 25.493  1.00 73.32  ? 860 RDG C "C3'" 1 
HETATM 5807 O  "O3'" . RDG D 2 5   ? 58.592  -10.590 24.153  1.00 72.37  ? 860 RDG C "O3'" 1 
HETATM 5808 C  "C2'" . RDG D 2 5   ? 57.209  -10.202 25.958  1.00 69.24  ? 860 RDG C "C2'" 1 
HETATM 5809 C  "C1'" . RDG D 2 5   ? 56.667  -11.567 26.221  1.00 67.19  ? 860 RDG C "C1'" 1 
HETATM 5810 O  "O4'" . RDG D 2 5   ? 57.767  -12.423 26.394  1.00 68.14  ? 860 RDG C "O4'" 1 
HETATM 5811 N  N9    . RDG D 2 5   ? 55.820  -11.583 27.366  1.00 67.51  ? 860 RDG C N9    1 
HETATM 5812 C  C4    . RDG D 2 5   ? 54.595  -12.269 27.457  1.00 68.27  ? 860 RDG C C4    1 
HETATM 5813 N  N3    . RDG D 2 5   ? 53.884  -13.056 26.556  1.00 66.03  ? 860 RDG C N3    1 
HETATM 5814 C  C2    . RDG D 2 5   ? 52.695  -13.604 26.921  1.00 68.14  ? 860 RDG C C2    1 
HETATM 5815 N  N1    . RDG D 2 5   ? 52.161  -13.406 28.168  1.00 69.61  ? 860 RDG C N1    1 
HETATM 5816 C  C6    . RDG D 2 5   ? 52.820  -12.639 29.097  1.00 69.13  ? 860 RDG C C6    1 
HETATM 5817 O  O6    . RDG D 2 5   ? 52.258  -12.436 30.397  1.00 70.49  ? 860 RDG C O6    1 
HETATM 5818 C  C5    . RDG D 2 5   ? 54.086  -12.040 28.746  1.00 68.53  ? 860 RDG C C5    1 
HETATM 5819 N  N7    . RDG D 2 5   ? 55.001  -11.231 29.407  1.00 67.10  ? 860 RDG C N7    1 
HETATM 5820 C  C8    . RDG D 2 5   ? 56.051  -10.970 28.545  1.00 68.11  ? 860 RDG C C8    1 
HETATM 5821 N  N2    . RDG D 2 5   ? 51.976  -14.419 25.959  1.00 67.62  ? 860 RDG C N2    1 
HETATM 5822 C  C11   . RDG D 2 5   ? 52.409  -14.458 24.574  1.00 66.04  ? 860 RDG C C11   1 
HETATM 5823 C  C10   . RDG D 2 5   ? 53.594  -15.349 24.225  1.00 73.66  ? 860 RDG C C10   1 
HETATM 5824 C  C9    . RDG D 2 5   ? 53.605  -16.768 24.324  1.00 67.94  ? 860 RDG C C9    1 
HETATM 5825 O  O7    . RDG D 2 5   ? 54.764  -14.911 23.784  1.00 78.20  ? 860 RDG C O7    1 
HETATM 5826 C  C12   . RDG D 2 5   ? 55.592  -15.924 23.570  1.00 75.37  ? 860 RDG C C12   1 
HETATM 5827 C  C7    . RDG D 2 5   ? 54.937  -17.135 23.886  1.00 71.83  ? 860 RDG C C7    1 
ATOM   5828 P  P     . DG  D 2 6   ? 58.263  -9.375  23.153  1.00 76.04  ? 861 DG  C P     1 
ATOM   5829 O  OP1   . DG  D 2 6   ? 59.213  -9.483  22.024  1.00 77.61  ? 861 DG  C OP1   1 
ATOM   5830 O  OP2   . DG  D 2 6   ? 58.189  -8.113  23.922  1.00 69.99  ? 861 DG  C OP2   1 
ATOM   5831 O  "O5'" . DG  D 2 6   ? 56.801  -9.726  22.611  1.00 73.89  ? 861 DG  C "O5'" 1 
ATOM   5832 C  "C5'" . DG  D 2 6   ? 56.592  -10.985 21.978  1.00 68.86  ? 861 DG  C "C5'" 1 
ATOM   5833 C  "C4'" . DG  D 2 6   ? 55.143  -11.157 21.564  1.00 70.13  ? 861 DG  C "C4'" 1 
ATOM   5834 O  "O4'" . DG  D 2 6   ? 54.329  -11.429 22.732  1.00 68.69  ? 861 DG  C "O4'" 1 
ATOM   5835 C  "C3'" . DG  D 2 6   ? 54.534  -9.943  20.871  1.00 71.97  ? 861 DG  C "C3'" 1 
ATOM   5836 O  "O3'" . DG  D 2 6   ? 53.886  -10.360 19.673  1.00 74.94  ? 861 DG  C "O3'" 1 
ATOM   5837 C  "C2'" . DG  D 2 6   ? 53.560  -9.370  21.901  1.00 67.94  ? 861 DG  C "C2'" 1 
ATOM   5838 C  "C1'" . DG  D 2 6   ? 53.195  -10.588 22.741  1.00 65.79  ? 861 DG  C "C1'" 1 
ATOM   5839 N  N9    . DG  D 2 6   ? 52.896  -10.276 24.134  1.00 63.44  ? 861 DG  C N9    1 
ATOM   5840 C  C8    . DG  D 2 6   ? 53.629  -9.478  24.979  1.00 69.32  ? 861 DG  C C8    1 
ATOM   5841 N  N7    . DG  D 2 6   ? 53.122  -9.385  26.177  1.00 63.82  ? 861 DG  C N7    1 
ATOM   5842 C  C5    . DG  D 2 6   ? 51.982  -10.177 26.124  1.00 63.67  ? 861 DG  C C5    1 
ATOM   5843 C  C6    . DG  D 2 6   ? 51.025  -10.463 27.126  1.00 66.87  ? 861 DG  C C6    1 
ATOM   5844 O  O6    . DG  D 2 6   ? 50.994  -10.056 28.296  1.00 66.60  ? 861 DG  C O6    1 
ATOM   5845 N  N1    . DG  D 2 6   ? 50.024  -11.310 26.656  1.00 66.11  ? 861 DG  C N1    1 
ATOM   5846 C  C2    . DG  D 2 6   ? 49.958  -11.817 25.380  1.00 61.80  ? 861 DG  C C2    1 
ATOM   5847 N  N2    . DG  D 2 6   ? 48.918  -12.619 25.111  1.00 68.73  ? 861 DG  C N2    1 
ATOM   5848 N  N3    . DG  D 2 6   ? 50.849  -11.557 24.432  1.00 63.27  ? 861 DG  C N3    1 
ATOM   5849 C  C4    . DG  D 2 6   ? 51.830  -10.733 24.874  1.00 64.30  ? 861 DG  C C4    1 
ATOM   5850 P  P     . DG  D 2 7   ? 53.121  -9.291  18.748  1.00 72.03  ? 862 DG  C P     1 
ATOM   5851 O  OP1   . DG  D 2 7   ? 53.094  -9.819  17.367  1.00 72.79  ? 862 DG  C OP1   1 
ATOM   5852 O  OP2   . DG  D 2 7   ? 53.708  -7.959  19.014  1.00 71.62  ? 862 DG  C OP2   1 
ATOM   5853 O  "O5'" . DG  D 2 7   ? 51.630  -9.301  19.317  1.00 67.72  ? 862 DG  C "O5'" 1 
ATOM   5854 C  "C5'" . DG  D 2 7   ? 50.949  -10.542 19.438  1.00 61.31  ? 862 DG  C "C5'" 1 
ATOM   5855 C  "C4'" . DG  D 2 7   ? 49.597  -10.345 20.094  1.00 64.84  ? 862 DG  C "C4'" 1 
ATOM   5856 O  "O4'" . DG  D 2 7   ? 49.760  -10.132 21.519  1.00 70.99  ? 862 DG  C "O4'" 1 
ATOM   5857 C  "C3'" . DG  D 2 7   ? 48.809  -9.148  19.574  1.00 71.53  ? 862 DG  C "C3'" 1 
ATOM   5858 O  "O3'" . DG  D 2 7   ? 47.455  -9.530  19.420  1.00 80.29  ? 862 DG  C "O3'" 1 
ATOM   5859 C  "C2'" . DG  D 2 7   ? 48.970  -8.114  20.684  1.00 65.62  ? 862 DG  C "C2'" 1 
ATOM   5860 C  "C1'" . DG  D 2 7   ? 48.966  -9.029  21.900  1.00 70.13  ? 862 DG  C "C1'" 1 
ATOM   5861 N  N9    . DG  D 2 7   ? 49.535  -8.430  23.102  1.00 66.78  ? 862 DG  C N9    1 
ATOM   5862 C  C8    . DG  D 2 7   ? 50.704  -7.715  23.209  1.00 65.82  ? 862 DG  C C8    1 
ATOM   5863 N  N7    . DG  D 2 7   ? 50.952  -7.306  24.422  1.00 67.18  ? 862 DG  C N7    1 
ATOM   5864 C  C5    . DG  D 2 7   ? 49.881  -7.782  25.168  1.00 64.38  ? 862 DG  C C5    1 
ATOM   5865 C  C6    . DG  D 2 7   ? 49.598  -7.652  26.548  1.00 63.33  ? 862 DG  C C6    1 
ATOM   5866 O  O6    . DG  D 2 7   ? 50.265  -7.073  27.418  1.00 63.16  ? 862 DG  C O6    1 
ATOM   5867 N  N1    . DG  D 2 7   ? 48.407  -8.288  26.892  1.00 62.44  ? 862 DG  C N1    1 
ATOM   5868 C  C2    . DG  D 2 7   ? 47.592  -8.961  26.012  1.00 61.80  ? 862 DG  C C2    1 
ATOM   5869 N  N2    . DG  D 2 7   ? 46.482  -9.509  26.527  1.00 65.07  ? 862 DG  C N2    1 
ATOM   5870 N  N3    . DG  D 2 7   ? 47.844  -9.089  24.717  1.00 60.26  ? 862 DG  C N3    1 
ATOM   5871 C  C4    . DG  D 2 7   ? 49.001  -8.476  24.369  1.00 64.06  ? 862 DG  C C4    1 
ATOM   5872 P  P     . DT  D 2 8   ? 46.489  -8.719  18.426  1.00 80.92  ? 863 DT  C P     1 
ATOM   5873 O  OP1   . DT  D 2 8   ? 46.115  -9.634  17.326  1.00 80.66  ? 863 DT  C OP1   1 
ATOM   5874 O  OP2   . DT  D 2 8   ? 47.131  -7.420  18.121  1.00 79.69  ? 863 DT  C OP2   1 
ATOM   5875 O  "O5'" . DT  D 2 8   ? 45.185  -8.451  19.309  1.00 72.23  ? 863 DT  C "O5'" 1 
ATOM   5876 C  "C5'" . DT  D 2 8   ? 44.621  -9.520  20.056  1.00 67.87  ? 863 DT  C "C5'" 1 
ATOM   5877 C  "C4'" . DT  D 2 8   ? 43.949  -8.989  21.308  1.00 69.65  ? 863 DT  C "C4'" 1 
ATOM   5878 O  "O4'" . DT  D 2 8   ? 44.952  -8.536  22.251  1.00 65.07  ? 863 DT  C "O4'" 1 
ATOM   5879 C  "C3'" . DT  D 2 8   ? 43.014  -7.805  21.073  1.00 71.46  ? 863 DT  C "C3'" 1 
ATOM   5880 O  "O3'" . DT  D 2 8   ? 41.683  -8.183  21.411  1.00 72.08  ? 863 DT  C "O3'" 1 
ATOM   5881 C  "C2'" . DT  D 2 8   ? 43.559  -6.696  21.975  1.00 62.80  ? 863 DT  C "C2'" 1 
ATOM   5882 C  "C1'" . DT  D 2 8   ? 44.409  -7.460  22.981  1.00 66.04  ? 863 DT  C "C1'" 1 
ATOM   5883 N  N1    . DT  D 2 8   ? 45.524  -6.657  23.563  1.00 66.00  ? 863 DT  C N1    1 
ATOM   5884 C  C2    . DT  D 2 8   ? 45.595  -6.499  24.930  1.00 62.96  ? 863 DT  C C2    1 
ATOM   5885 O  O2    . DT  D 2 8   ? 44.789  -6.985  25.703  1.00 65.50  ? 863 DT  C O2    1 
ATOM   5886 N  N3    . DT  D 2 8   ? 46.656  -5.744  25.362  1.00 61.86  ? 863 DT  C N3    1 
ATOM   5887 C  C4    . DT  D 2 8   ? 47.628  -5.146  24.581  1.00 65.09  ? 863 DT  C C4    1 
ATOM   5888 O  O4    . DT  D 2 8   ? 48.544  -4.485  25.063  1.00 64.32  ? 863 DT  C O4    1 
ATOM   5889 C  C5    . DT  D 2 8   ? 47.492  -5.351  23.162  1.00 64.77  ? 863 DT  C C5    1 
ATOM   5890 C  C7    . DT  D 2 8   ? 48.490  -4.748  22.217  1.00 57.11  ? 863 DT  C C7    1 
ATOM   5891 C  C6    . DT  D 2 8   ? 46.461  -6.086  22.726  1.00 65.74  ? 863 DT  C C6    1 
ATOM   5892 P  P     . DC  D 2 9   ? 40.485  -7.115  21.333  1.00 75.70  ? 864 DC  C P     1 
ATOM   5893 O  OP1   . DC  D 2 9   ? 39.240  -7.862  21.047  1.00 75.49  ? 864 DC  C OP1   1 
ATOM   5894 O  OP2   . DC  D 2 9   ? 40.900  -6.017  20.430  1.00 74.56  ? 864 DC  C OP2   1 
ATOM   5895 O  "O5'" . DC  D 2 9   ? 40.378  -6.555  22.827  1.00 77.59  ? 864 DC  C "O5'" 1 
ATOM   5896 C  "C5'" . DC  D 2 9   ? 40.209  -7.469  23.907  1.00 75.04  ? 864 DC  C "C5'" 1 
ATOM   5897 C  "C4'" . DC  D 2 9   ? 40.279  -6.766  25.252  1.00 72.04  ? 864 DC  C "C4'" 1 
ATOM   5898 O  "O4'" . DC  D 2 9   ? 41.617  -6.242  25.471  1.00 75.78  ? 864 DC  C "O4'" 1 
ATOM   5899 C  "C3'" . DC  D 2 9   ? 39.338  -5.576  25.409  1.00 75.06  ? 864 DC  C "C3'" 1 
ATOM   5900 O  "O3'" . DC  D 2 9   ? 38.842  -5.528  26.746  1.00 74.24  ? 864 DC  C "O3'" 1 
ATOM   5901 C  "C2'" . DC  D 2 9   ? 40.268  -4.400  25.132  1.00 71.23  ? 864 DC  C "C2'" 1 
ATOM   5902 C  "C1'" . DC  D 2 9   ? 41.504  -4.892  25.868  1.00 67.40  ? 864 DC  C "C1'" 1 
ATOM   5903 N  N1    . DC  D 2 9   ? 42.751  -4.163  25.513  1.00 66.47  ? 864 DC  C N1    1 
ATOM   5904 C  C2    . DC  D 2 9   ? 43.502  -3.547  26.520  1.00 66.52  ? 864 DC  C C2    1 
ATOM   5905 O  O2    . DC  D 2 9   ? 43.115  -3.621  27.693  1.00 64.18  ? 864 DC  C O2    1 
ATOM   5906 N  N3    . DC  D 2 9   ? 44.636  -2.885  26.180  1.00 65.49  ? 864 DC  C N3    1 
ATOM   5907 C  C4    . DC  D 2 9   ? 45.019  -2.828  24.903  1.00 62.23  ? 864 DC  C C4    1 
ATOM   5908 N  N4    . DC  D 2 9   ? 46.143  -2.165  24.615  1.00 62.61  ? 864 DC  C N4    1 
ATOM   5909 C  C5    . DC  D 2 9   ? 44.265  -3.449  23.863  1.00 62.50  ? 864 DC  C C5    1 
ATOM   5910 C  C6    . DC  D 2 9   ? 43.149  -4.097  24.211  1.00 64.70  ? 864 DC  C C6    1 
ATOM   5911 P  P     . DC  D 2 10  ? 37.265  -5.395  27.024  1.00 82.03  ? 865 DC  C P     1 
ATOM   5912 O  OP1   . DC  D 2 10  ? 36.934  -6.278  28.164  1.00 82.74  ? 865 DC  C OP1   1 
ATOM   5913 O  OP2   . DC  D 2 10  ? 36.565  -5.563  25.731  1.00 84.07  ? 865 DC  C OP2   1 
ATOM   5914 O  "O5'" . DC  D 2 10  ? 37.080  -3.884  27.517  1.00 75.17  ? 865 DC  C "O5'" 1 
ATOM   5915 C  "C5'" . DC  D 2 10  ? 38.191  -3.004  27.547  1.00 76.00  ? 865 DC  C "C5'" 1 
ATOM   5916 C  "C4'" . DC  D 2 10  ? 38.654  -2.720  28.961  1.00 79.22  ? 865 DC  C "C4'" 1 
ATOM   5917 O  "O4'" . DC  D 2 10  ? 40.084  -2.491  28.960  1.00 77.20  ? 865 DC  C "O4'" 1 
ATOM   5918 C  "C3'" . DC  D 2 10  ? 38.070  -1.440  29.525  1.00 77.79  ? 865 DC  C "C3'" 1 
ATOM   5919 O  "O3'" . DC  D 2 10  ? 38.142  -1.416  30.940  1.00 83.03  ? 865 DC  C "O3'" 1 
ATOM   5920 C  "C2'" . DC  D 2 10  ? 38.993  -0.399  28.904  1.00 74.62  ? 865 DC  C "C2'" 1 
ATOM   5921 C  "C1'" . DC  D 2 10  ? 40.345  -1.100  28.988  1.00 69.23  ? 865 DC  C "C1'" 1 
ATOM   5922 N  N1    . DC  D 2 10  ? 41.267  -0.773  27.862  1.00 65.25  ? 865 DC  C N1    1 
ATOM   5923 C  C2    . DC  D 2 10  ? 42.448  -0.070  28.118  1.00 68.18  ? 865 DC  C C2    1 
ATOM   5924 O  O2    . DC  D 2 10  ? 42.708  0.269   29.279  1.00 68.70  ? 865 DC  C O2    1 
ATOM   5925 N  N3    . DC  D 2 10  ? 43.278  0.216   27.085  1.00 65.96  ? 865 DC  C N3    1 
ATOM   5926 C  C4    . DC  D 2 10  ? 42.961  -0.169  25.847  1.00 65.25  ? 865 DC  C C4    1 
ATOM   5927 N  N4    . DC  D 2 10  ? 43.810  0.136   24.861  1.00 65.10  ? 865 DC  C N4    1 
ATOM   5928 C  C5    . DC  D 2 10  ? 41.761  -0.884  25.564  1.00 58.32  ? 865 DC  C C5    1 
ATOM   5929 C  C6    . DC  D 2 10  ? 40.953  -1.162  26.592  1.00 64.79  ? 865 DC  C C6    1 
ATOM   5930 P  P     . DT  D 2 11  ? 37.128  -0.484  31.765  1.00 88.68  ? 866 DT  C P     1 
ATOM   5931 O  OP1   . DT  D 2 11  ? 37.158  -0.894  33.187  1.00 86.07  ? 866 DT  C OP1   1 
ATOM   5932 O  OP2   . DT  D 2 11  ? 35.855  -0.505  31.014  1.00 72.86  ? 866 DT  C OP2   1 
ATOM   5933 O  "O5'" . DT  D 2 11  ? 37.772  0.976   31.651  1.00 77.72  ? 866 DT  C "O5'" 1 
ATOM   5934 C  "C5'" . DT  D 2 11  ? 39.019  1.229   32.285  1.00 73.13  ? 866 DT  C "C5'" 1 
ATOM   5935 C  "C4'" . DT  D 2 11  ? 39.715  2.461   31.729  1.00 73.09  ? 866 DT  C "C4'" 1 
ATOM   5936 O  "O4'" . DT  D 2 11  ? 40.337  2.178   30.449  1.00 72.22  ? 866 DT  C "O4'" 1 
ATOM   5937 C  "C3'" . DT  D 2 11  ? 38.837  3.692   31.503  1.00 74.01  ? 866 DT  C "C3'" 1 
ATOM   5938 O  "O3'" . DT  D 2 11  ? 39.414  4.771   32.216  1.00 75.80  ? 866 DT  C "O3'" 1 
ATOM   5939 C  "C2'" . DT  D 2 11  ? 38.927  3.928   29.996  1.00 72.55  ? 866 DT  C "C2'" 1 
ATOM   5940 C  "C1'" . DT  D 2 11  ? 40.328  3.393   29.734  1.00 70.44  ? 866 DT  C "C1'" 1 
ATOM   5941 N  N1    . DT  D 2 11  ? 40.662  3.139   28.303  1.00 66.21  ? 866 DT  C N1    1 
ATOM   5942 C  C2    . DT  D 2 11  ? 41.930  3.442   27.857  1.00 63.30  ? 866 DT  C C2    1 
ATOM   5943 O  O2    . DT  D 2 11  ? 42.797  3.908   28.574  1.00 63.06  ? 866 DT  C O2    1 
ATOM   5944 N  N3    . DT  D 2 11  ? 42.146  3.175   26.529  1.00 60.20  ? 866 DT  C N3    1 
ATOM   5945 C  C4    . DT  D 2 11  ? 41.242  2.651   25.625  1.00 60.98  ? 866 DT  C C4    1 
ATOM   5946 O  O4    . DT  D 2 11  ? 41.535  2.448   24.451  1.00 59.63  ? 866 DT  C O4    1 
ATOM   5947 C  C5    . DT  D 2 11  ? 39.936  2.358   26.159  1.00 62.84  ? 866 DT  C C5    1 
ATOM   5948 C  C7    . DT  D 2 11  ? 38.871  1.785   25.271  1.00 63.91  ? 866 DT  C C7    1 
ATOM   5949 C  C6    . DT  D 2 11  ? 39.710  2.616   27.453  1.00 62.76  ? 866 DT  C C6    1 
ATOM   5950 P  P     . DA  D 2 12  ? 38.495  5.956   32.792  1.00 74.41  ? 867 DA  C P     1 
ATOM   5951 O  OP1   . DA  D 2 12  ? 38.271  5.692   34.231  1.00 76.71  ? 867 DA  C OP1   1 
ATOM   5952 O  OP2   . DA  D 2 12  ? 37.342  6.122   31.880  1.00 63.25  ? 867 DA  C OP2   1 
ATOM   5953 O  "O5'" . DA  D 2 12  ? 39.434  7.242   32.678  1.00 69.44  ? 867 DA  C "O5'" 1 
ATOM   5954 C  "C5'" . DA  D 2 12  ? 40.787  7.156   33.107  1.00 61.74  ? 867 DA  C "C5'" 1 
ATOM   5955 C  "C4'" . DA  D 2 12  ? 41.648  8.116   32.308  1.00 59.38  ? 867 DA  C "C4'" 1 
ATOM   5956 O  "O4'" . DA  D 2 12  ? 41.957  7.537   31.014  1.00 68.21  ? 867 DA  C "O4'" 1 
ATOM   5957 C  "C3'" . DA  D 2 12  ? 40.985  9.460   32.035  1.00 62.42  ? 867 DA  C "C3'" 1 
ATOM   5958 O  "O3'" . DA  D 2 12  ? 41.884  10.508  32.360  1.00 56.73  ? 867 DA  C "O3'" 1 
ATOM   5959 C  "C2'" . DA  D 2 12  ? 40.665  9.423   30.542  1.00 59.54  ? 867 DA  C "C2'" 1 
ATOM   5960 C  "C1'" . DA  D 2 12  ? 41.743  8.497   30.002  1.00 61.28  ? 867 DA  C "C1'" 1 
ATOM   5961 N  N9    . DA  D 2 12  ? 41.332  7.813   28.781  1.00 59.40  ? 867 DA  C N9    1 
ATOM   5962 C  C8    . DA  D 2 12  ? 40.128  7.210   28.542  1.00 57.91  ? 867 DA  C C8    1 
ATOM   5963 N  N7    . DA  D 2 12  ? 40.034  6.671   27.350  1.00 53.33  ? 867 DA  C N7    1 
ATOM   5964 C  C5    . DA  D 2 12  ? 41.262  6.939   26.768  1.00 52.35  ? 867 DA  C C5    1 
ATOM   5965 C  C6    . DA  D 2 12  ? 41.801  6.633   25.503  1.00 55.04  ? 867 DA  C C6    1 
ATOM   5966 N  N6    . DA  D 2 12  ? 41.132  5.959   24.562  1.00 56.29  ? 867 DA  C N6    1 
ATOM   5967 N  N1    . DA  D 2 12  ? 43.059  7.047   25.241  1.00 57.36  ? 867 DA  C N1    1 
ATOM   5968 C  C2    . DA  D 2 12  ? 43.726  7.722   26.184  1.00 57.42  ? 867 DA  C C2    1 
ATOM   5969 N  N3    . DA  D 2 12  ? 43.326  8.068   27.406  1.00 57.49  ? 867 DA  C N3    1 
ATOM   5970 C  C4    . DA  D 2 12  ? 42.074  7.643   27.636  1.00 56.00  ? 867 DA  C C4    1 
ATOM   5971 P  P     . DG  D 2 13  ? 41.414  12.038  32.240  1.00 56.82  ? 868 DG  C P     1 
ATOM   5972 O  OP1   . DG  D 2 13  ? 41.956  12.778  33.401  1.00 68.57  ? 868 DG  C OP1   1 
ATOM   5973 O  OP2   . DG  D 2 13  ? 39.959  12.037  31.981  1.00 52.42  ? 868 DG  C OP2   1 
ATOM   5974 O  "O5'" . DG  D 2 13  ? 42.136  12.549  30.912  1.00 63.72  ? 868 DG  C "O5'" 1 
ATOM   5975 C  "C5'" . DG  D 2 13  ? 43.503  12.234  30.707  1.00 61.50  ? 868 DG  C "C5'" 1 
ATOM   5976 C  "C4'" . DG  D 2 13  ? 43.876  12.477  29.259  1.00 59.51  ? 868 DG  C "C4'" 1 
ATOM   5977 O  "O4'" . DG  D 2 13  ? 43.301  11.446  28.419  1.00 58.47  ? 868 DG  C "O4'" 1 
ATOM   5978 C  "C3'" . DG  D 2 13  ? 43.388  13.811  28.698  1.00 59.59  ? 868 DG  C "C3'" 1 
ATOM   5979 O  "O3'" . DG  D 2 13  ? 44.516  14.576  28.296  1.00 63.01  ? 868 DG  C "O3'" 1 
ATOM   5980 C  "C2'" . DG  D 2 13  ? 42.500  13.421  27.516  1.00 56.34  ? 868 DG  C "C2'" 1 
ATOM   5981 C  "C1'" . DG  D 2 13  ? 43.024  12.036  27.170  1.00 57.04  ? 868 DG  C "C1'" 1 
ATOM   5982 N  N9    . DG  D 2 13  ? 42.058  11.223  26.440  1.00 53.13  ? 868 DG  C N9    1 
ATOM   5983 C  C8    . DG  D 2 13  ? 40.786  10.881  26.830  1.00 51.38  ? 868 DG  C C8    1 
ATOM   5984 N  N7    . DG  D 2 13  ? 40.159  10.143  25.956  1.00 53.44  ? 868 DG  C N7    1 
ATOM   5985 C  C5    . DG  D 2 13  ? 41.075  9.988   24.922  1.00 51.92  ? 868 DG  C C5    1 
ATOM   5986 C  C6    . DG  D 2 13  ? 40.963  9.288   23.699  1.00 47.70  ? 868 DG  C C6    1 
ATOM   5987 O  O6    . DG  D 2 13  ? 39.997  8.640   23.272  1.00 55.64  ? 868 DG  C O6    1 
ATOM   5988 N  N1    . DG  D 2 13  ? 42.127  9.386   22.938  1.00 51.21  ? 868 DG  C N1    1 
ATOM   5989 C  C2    . DG  D 2 13  ? 43.255  10.076  23.314  1.00 55.70  ? 868 DG  C C2    1 
ATOM   5990 N  N2    . DG  D 2 13  ? 44.281  10.060  22.450  1.00 57.21  ? 868 DG  C N2    1 
ATOM   5991 N  N3    . DG  D 2 13  ? 43.373  10.737  24.457  1.00 54.34  ? 868 DG  C N3    1 
ATOM   5992 C  C4    . DG  D 2 13  ? 42.248  10.649  25.206  1.00 53.48  ? 868 DG  C C4    1 
ATOM   5993 P  P     . DG  D 2 14  ? 44.346  16.100  27.813  1.00 67.12  ? 869 DG  C P     1 
ATOM   5994 O  OP1   . DG  D 2 14  ? 45.297  16.917  28.597  1.00 60.34  ? 869 DG  C OP1   1 
ATOM   5995 O  OP2   . DG  D 2 14  ? 42.908  16.453  27.816  1.00 62.06  ? 869 DG  C OP2   1 
ATOM   5996 O  "O5'" . DG  D 2 14  ? 44.840  16.065  26.296  1.00 55.80  ? 869 DG  C "O5'" 1 
ATOM   5997 C  "C5'" . DG  D 2 14  ? 46.101  15.483  25.991  1.00 54.32  ? 869 DG  C "C5'" 1 
ATOM   5998 C  "C4'" . DG  D 2 14  ? 46.294  15.430  24.489  1.00 61.38  ? 869 DG  C "C4'" 1 
ATOM   5999 O  "O4'" . DG  D 2 14  ? 45.481  14.367  23.933  1.00 60.66  ? 869 DG  C "O4'" 1 
ATOM   6000 C  "C3'" . DG  D 2 14  ? 45.893  16.715  23.776  1.00 63.55  ? 869 DG  C "C3'" 1 
ATOM   6001 O  "O3'" . DG  D 2 14  ? 46.929  17.115  22.891  1.00 64.83  ? 869 DG  C "O3'" 1 
ATOM   6002 C  "C2'" . DG  D 2 14  ? 44.604  16.358  23.037  1.00 55.90  ? 869 DG  C "C2'" 1 
ATOM   6003 C  "C1'" . DG  D 2 14  ? 44.728  14.852  22.841  1.00 60.07  ? 869 DG  C "C1'" 1 
ATOM   6004 N  N9    . DG  D 2 14  ? 43.442  14.161  22.834  1.00 53.96  ? 869 DG  C N9    1 
ATOM   6005 C  C8    . DG  D 2 14  ? 42.477  14.199  23.812  1.00 52.57  ? 869 DG  C C8    1 
ATOM   6006 N  N7    . DG  D 2 14  ? 41.427  13.478  23.535  1.00 53.14  ? 869 DG  C N7    1 
ATOM   6007 C  C5    . DG  D 2 14  ? 41.713  12.923  22.294  1.00 54.41  ? 869 DG  C C5    1 
ATOM   6008 C  C6    . DG  D 2 14  ? 40.944  12.050  21.487  1.00 55.56  ? 869 DG  C C6    1 
ATOM   6009 O  O6    . DG  D 2 14  ? 39.822  11.580  21.719  1.00 61.50  ? 869 DG  C O6    1 
ATOM   6010 N  N1    . DG  D 2 14  ? 41.602  11.729  20.302  1.00 49.30  ? 869 DG  C N1    1 
ATOM   6011 C  C2    . DG  D 2 14  ? 42.846  12.192  19.944  1.00 55.51  ? 869 DG  C C2    1 
ATOM   6012 N  N2    . DG  D 2 14  ? 43.317  11.770  18.762  1.00 56.55  ? 869 DG  C N2    1 
ATOM   6013 N  N3    . DG  D 2 14  ? 43.577  13.010  20.691  1.00 56.89  ? 869 DG  C N3    1 
ATOM   6014 C  C4    . DG  D 2 14  ? 42.950  13.333  21.848  1.00 56.22  ? 869 DG  C C4    1 
ATOM   6015 P  P     . DA  D 2 15  ? 46.893  18.571  22.212  1.00 77.67  ? 870 DA  C P     1 
ATOM   6016 O  OP1   . DA  D 2 15  ? 48.283  19.074  22.149  1.00 67.07  ? 870 DA  C OP1   1 
ATOM   6017 O  OP2   . DA  D 2 15  ? 45.847  19.367  22.893  1.00 64.38  ? 870 DA  C OP2   1 
ATOM   6018 O  "O5'" . DA  D 2 15  ? 46.383  18.281  20.728  1.00 64.99  ? 870 DA  C "O5'" 1 
ATOM   6019 C  "C5'" . DA  D 2 15  ? 46.960  17.214  19.991  1.00 58.48  ? 870 DA  C "C5'" 1 
ATOM   6020 C  "C4'" . DA  D 2 15  ? 46.144  16.959  18.740  1.00 55.13  ? 870 DA  C "C4'" 1 
ATOM   6021 O  "O4'" . DA  D 2 15  ? 45.013  16.106  19.048  1.00 58.27  ? 870 DA  C "O4'" 1 
ATOM   6022 C  "C3'" . DA  D 2 15  ? 45.580  18.232  18.120  1.00 56.41  ? 870 DA  C "C3'" 1 
ATOM   6023 O  "O3'" . DA  D 2 15  ? 46.069  18.373  16.795  1.00 60.52  ? 870 DA  C "O3'" 1 
ATOM   6024 C  "C2'" . DA  D 2 15  ? 44.062  18.056  18.153  1.00 50.52  ? 870 DA  C "C2'" 1 
ATOM   6025 C  "C1'" . DA  D 2 15  ? 43.877  16.556  18.343  1.00 54.28  ? 870 DA  C "C1'" 1 
ATOM   6026 N  N9    . DA  D 2 15  ? 42.694  16.226  19.131  1.00 54.60  ? 870 DA  C N9    1 
ATOM   6027 C  C8    . DA  D 2 15  ? 42.391  16.681  20.385  1.00 54.85  ? 870 DA  C C8    1 
ATOM   6028 N  N7    . DA  D 2 15  ? 41.259  16.218  20.858  1.00 51.78  ? 870 DA  C N7    1 
ATOM   6029 C  C5    . DA  D 2 15  ? 40.787  15.402  19.844  1.00 51.28  ? 870 DA  C C5    1 
ATOM   6030 C  C6    . DA  D 2 15  ? 39.626  14.615  19.725  1.00 51.16  ? 870 DA  C C6    1 
ATOM   6031 N  N6    . DA  D 2 15  ? 38.698  14.528  20.684  1.00 50.67  ? 870 DA  C N6    1 
ATOM   6032 N  N1    . DA  D 2 15  ? 39.456  13.921  18.580  1.00 54.24  ? 870 DA  C N1    1 
ATOM   6033 C  C2    . DA  D 2 15  ? 40.389  14.012  17.624  1.00 50.36  ? 870 DA  C C2    1 
ATOM   6034 N  N3    . DA  D 2 15  ? 41.519  14.717  17.622  1.00 49.97  ? 870 DA  C N3    1 
ATOM   6035 C  C4    . DA  D 2 15  ? 41.659  15.394  18.772  1.00 53.13  ? 870 DA  C C4    1 
ATOM   6036 P  P     . DC  D 2 16  ? 45.753  19.703  15.953  1.00 57.25  ? 871 DC  C P     1 
ATOM   6037 O  OP1   . DC  D 2 16  ? 46.767  19.792  14.882  1.00 55.69  ? 871 DC  C OP1   1 
ATOM   6038 O  OP2   . DC  D 2 16  ? 45.587  20.827  16.902  1.00 56.17  ? 871 DC  C OP2   1 
ATOM   6039 O  "O5'" . DC  D 2 16  ? 44.347  19.387  15.262  1.00 54.50  ? 871 DC  C "O5'" 1 
ATOM   6040 C  "C5'" . DC  D 2 16  ? 44.229  18.203  14.487  1.00 51.02  ? 871 DC  C "C5'" 1 
ATOM   6041 C  "C4'" . DC  D 2 16  ? 42.778  17.817  14.269  1.00 49.03  ? 871 DC  C "C4'" 1 
ATOM   6042 O  "O4'" . DC  D 2 16  ? 42.156  17.443  15.519  1.00 51.90  ? 871 DC  C "O4'" 1 
ATOM   6043 C  "C3'" . DC  D 2 16  ? 41.887  18.926  13.732  1.00 47.82  ? 871 DC  C "C3'" 1 
ATOM   6044 O  "O3'" . DC  D 2 16  ? 41.916  18.888  12.312  1.00 51.57  ? 871 DC  C "O3'" 1 
ATOM   6045 C  "C2'" . DC  D 2 16  ? 40.503  18.582  14.288  1.00 44.87  ? 871 DC  C "C2'" 1 
ATOM   6046 C  "C1'" . DC  D 2 16  ? 40.762  17.461  15.294  1.00 47.86  ? 871 DC  C "C1'" 1 
ATOM   6047 N  N1    . DC  D 2 16  ? 40.058  17.629  16.602  1.00 51.11  ? 871 DC  C N1    1 
ATOM   6048 C  C2    . DC  D 2 16  ? 38.871  16.926  16.844  1.00 51.11  ? 871 DC  C C2    1 
ATOM   6049 O  O2    . DC  D 2 16  ? 38.423  16.176  15.969  1.00 48.82  ? 871 DC  C O2    1 
ATOM   6050 N  N3    . DC  D 2 16  ? 38.244  17.085  18.036  1.00 52.13  ? 871 DC  C N3    1 
ATOM   6051 C  C4    . DC  D 2 16  ? 38.757  17.902  18.957  1.00 52.54  ? 871 DC  C C4    1 
ATOM   6052 N  N4    . DC  D 2 16  ? 38.101  18.026  20.116  1.00 46.94  ? 871 DC  C N4    1 
ATOM   6053 C  C5    . DC  D 2 16  ? 39.965  18.627  18.730  1.00 49.66  ? 871 DC  C C5    1 
ATOM   6054 C  C6    . DC  D 2 16  ? 40.575  18.461  17.552  1.00 49.70  ? 871 DC  C C6    1 
ATOM   6055 P  P     . DC  D 2 17  ? 41.275  20.085  11.454  1.00 46.90  ? 872 DC  C P     1 
ATOM   6056 O  OP1   . DC  D 2 17  ? 41.884  20.035  10.106  1.00 56.67  ? 872 DC  C OP1   1 
ATOM   6057 O  OP2   . DC  D 2 17  ? 41.361  21.323  12.260  1.00 52.50  ? 872 DC  C OP2   1 
ATOM   6058 O  "O5'" . DC  D 2 17  ? 39.741  19.667  11.307  1.00 39.58  ? 872 DC  C "O5'" 1 
ATOM   6059 C  "C5'" . DC  D 2 17  ? 39.426  18.394  10.762  1.00 45.27  ? 872 DC  C "C5'" 1 
ATOM   6060 C  "C4'" . DC  D 2 17  ? 37.954  18.084  10.953  1.00 45.98  ? 872 DC  C "C4'" 1 
ATOM   6061 O  "O4'" . DC  D 2 17  ? 37.653  17.945  12.365  1.00 48.91  ? 872 DC  C "O4'" 1 
ATOM   6062 C  "C3'" . DC  D 2 17  ? 37.009  19.157  10.421  1.00 50.69  ? 872 DC  C "C3'" 1 
ATOM   6063 O  "O3'" . DC  D 2 17  ? 36.126  18.572  9.480   1.00 52.24  ? 872 DC  C "O3'" 1 
ATOM   6064 C  "C2'" . DC  D 2 17  ? 36.262  19.656  11.656  1.00 46.46  ? 872 DC  C "C2'" 1 
ATOM   6065 C  "C1'" . DC  D 2 17  ? 36.354  18.449  12.579  1.00 52.27  ? 872 DC  C "C1'" 1 
ATOM   6066 N  N1    . DC  D 2 17  ? 36.193  18.774  14.024  1.00 53.52  ? 872 DC  C N1    1 
ATOM   6067 C  C2    . DC  D 2 17  ? 35.032  18.379  14.697  1.00 54.27  ? 872 DC  C C2    1 
ATOM   6068 O  O2    . DC  D 2 17  ? 34.154  17.765  14.078  1.00 56.77  ? 872 DC  C O2    1 
ATOM   6069 N  N3    . DC  D 2 17  ? 34.901  18.682  16.013  1.00 55.50  ? 872 DC  C N3    1 
ATOM   6070 C  C4    . DC  D 2 17  ? 35.871  19.346  16.645  1.00 55.86  ? 872 DC  C C4    1 
ATOM   6071 N  N4    . DC  D 2 17  ? 35.698  19.623  17.942  1.00 55.57  ? 872 DC  C N4    1 
ATOM   6072 C  C5    . DC  D 2 17  ? 37.061  19.757  15.976  1.00 54.50  ? 872 DC  C C5    1 
ATOM   6073 C  C6    . DC  D 2 17  ? 37.177  19.453  14.679  1.00 54.64  ? 872 DC  C C6    1 
ATOM   6074 P  P     . DC  D 2 18  ? 35.353  19.495  8.418   1.00 54.47  ? 873 DC  C P     1 
ATOM   6075 O  OP1   . DC  D 2 18  ? 35.095  18.660  7.226   1.00 58.51  ? 873 DC  C OP1   1 
ATOM   6076 O  OP2   . DC  D 2 18  ? 36.102  20.765  8.285   1.00 57.37  ? 873 DC  C OP2   1 
ATOM   6077 O  "O5'" . DC  D 2 18  ? 33.962  19.821  9.135   1.00 47.98  ? 873 DC  C "O5'" 1 
ATOM   6078 C  "C5'" . DC  D 2 18  ? 32.988  18.798  9.282   1.00 46.31  ? 873 DC  C "C5'" 1 
ATOM   6079 C  "C4'" . DC  D 2 18  ? 31.855  19.268  10.176  1.00 48.84  ? 873 DC  C "C4'" 1 
ATOM   6080 O  "O4'" . DC  D 2 18  ? 32.315  19.341  11.543  1.00 52.95  ? 873 DC  C "O4'" 1 
ATOM   6081 C  "C3'" . DC  D 2 18  ? 31.327  20.661  9.857   1.00 46.62  ? 873 DC  C "C3'" 1 
ATOM   6082 O  "O3'" . DC  D 2 18  ? 30.130  20.549  9.105   1.00 51.79  ? 873 DC  C "O3'" 1 
ATOM   6083 C  "C2'" . DC  D 2 18  ? 31.062  21.306  11.219  1.00 49.54  ? 873 DC  C "C2'" 1 
ATOM   6084 C  "C1'" . DC  D 2 18  ? 31.477  20.243  12.230  1.00 48.76  ? 873 DC  C "C1'" 1 
ATOM   6085 N  N1    . DC  D 2 18  ? 32.235  20.794  13.381  1.00 57.10  ? 873 DC  C N1    1 
ATOM   6086 C  C2    . DC  D 2 18  ? 31.586  20.989  14.601  1.00 52.76  ? 873 DC  C C2    1 
ATOM   6087 O  O2    . DC  D 2 18  ? 30.388  20.699  14.703  1.00 53.55  ? 873 DC  C O2    1 
ATOM   6088 N  N3    . DC  D 2 18  ? 32.295  21.493  15.638  1.00 55.34  ? 873 DC  C N3    1 
ATOM   6089 C  C4    . DC  D 2 18  ? 33.586  21.795  15.494  1.00 52.71  ? 873 DC  C C4    1 
ATOM   6090 N  N4    . DC  D 2 18  ? 34.236  22.289  16.553  1.00 46.45  ? 873 DC  C N4    1 
ATOM   6091 C  C5    . DC  D 2 18  ? 34.264  21.603  14.256  1.00 50.60  ? 873 DC  C C5    1 
ATOM   6092 C  C6    . DC  D 2 18  ? 33.554  21.106  13.237  1.00 56.35  ? 873 DC  C C6    1 
ATOM   6093 O  "O5'" . DT  E 2 1   ? 21.195  37.570  57.661  1.00 91.82  ? 837 DT  G "O5'" 1 
ATOM   6094 C  "C5'" . DT  E 2 1   ? 20.759  36.447  56.904  1.00 88.97  ? 837 DT  G "C5'" 1 
ATOM   6095 C  "C4'" . DT  E 2 1   ? 21.075  35.149  57.626  1.00 90.66  ? 837 DT  G "C4'" 1 
ATOM   6096 O  "O4'" . DT  E 2 1   ? 20.219  34.100  57.107  1.00 93.38  ? 837 DT  G "O4'" 1 
ATOM   6097 C  "C3'" . DT  E 2 1   ? 22.504  34.645  57.455  1.00 88.18  ? 837 DT  G "C3'" 1 
ATOM   6098 O  "O3'" . DT  E 2 1   ? 22.972  34.033  58.648  1.00 85.12  ? 837 DT  G "O3'" 1 
ATOM   6099 C  "C2'" . DT  E 2 1   ? 22.376  33.620  56.335  1.00 90.68  ? 837 DT  G "C2'" 1 
ATOM   6100 C  "C1'" . DT  E 2 1   ? 20.998  33.034  56.609  1.00 91.84  ? 837 DT  G "C1'" 1 
ATOM   6101 N  N1    . DT  E 2 1   ? 20.342  32.538  55.377  1.00 93.65  ? 837 DT  G N1    1 
ATOM   6102 C  C2    . DT  E 2 1   ? 19.753  31.291  55.355  1.00 92.03  ? 837 DT  G C2    1 
ATOM   6103 O  O2    . DT  E 2 1   ? 19.731  30.541  56.314  1.00 89.55  ? 837 DT  G O2    1 
ATOM   6104 N  N3    . DT  E 2 1   ? 19.183  30.955  54.153  1.00 91.98  ? 837 DT  G N3    1 
ATOM   6105 C  C4    . DT  E 2 1   ? 19.148  31.723  53.003  1.00 96.33  ? 837 DT  G C4    1 
ATOM   6106 O  O4    . DT  E 2 1   ? 18.612  31.334  51.970  1.00 96.07  ? 837 DT  G O4    1 
ATOM   6107 C  C5    . DT  E 2 1   ? 19.784  33.012  53.101  1.00 100.80 ? 837 DT  G C5    1 
ATOM   6108 C  C7    . DT  E 2 1   ? 19.813  33.940  51.926  1.00 97.93  ? 837 DT  G C7    1 
ATOM   6109 C  C6    . DT  E 2 1   ? 20.342  33.352  54.267  1.00 97.14  ? 837 DT  G C6    1 
ATOM   6110 P  P     . DC  E 2 2   ? 24.503  33.558  58.756  1.00 95.43  ? 838 DC  G P     1 
ATOM   6111 O  OP1   . DC  E 2 2   ? 24.865  33.519  60.189  1.00 88.82  ? 838 DC  G OP1   1 
ATOM   6112 O  OP2   . DC  E 2 2   ? 25.292  34.390  57.821  1.00 92.22  ? 838 DC  G OP2   1 
ATOM   6113 O  "O5'" . DC  E 2 2   ? 24.485  32.051  58.215  1.00 87.21  ? 838 DC  G "O5'" 1 
ATOM   6114 C  "C5'" . DC  E 2 2   ? 23.912  31.017  59.007  1.00 78.77  ? 838 DC  G "C5'" 1 
ATOM   6115 C  "C4'" . DC  E 2 2   ? 23.898  29.692  58.263  1.00 75.03  ? 838 DC  G "C4'" 1 
ATOM   6116 O  "O4'" . DC  E 2 2   ? 23.037  29.788  57.098  1.00 76.64  ? 838 DC  G "O4'" 1 
ATOM   6117 C  "C3'" . DC  E 2 2   ? 25.251  29.210  57.741  1.00 71.78  ? 838 DC  G "C3'" 1 
ATOM   6118 O  "O3'" . DC  E 2 2   ? 25.385  27.816  57.973  1.00 63.06  ? 838 DC  G "O3'" 1 
ATOM   6119 C  "C2'" . DC  E 2 2   ? 25.149  29.479  56.244  1.00 74.97  ? 838 DC  G "C2'" 1 
ATOM   6120 C  "C1'" . DC  E 2 2   ? 23.686  29.111  56.045  1.00 80.28  ? 838 DC  G "C1'" 1 
ATOM   6121 N  N1    . DC  E 2 2   ? 23.109  29.530  54.739  1.00 91.49  ? 838 DC  G N1    1 
ATOM   6122 C  C2    . DC  E 2 2   ? 22.359  28.608  54.001  1.00 86.34  ? 838 DC  G C2    1 
ATOM   6123 O  O2    . DC  E 2 2   ? 22.192  27.470  54.454  1.00 77.13  ? 838 DC  G O2    1 
ATOM   6124 N  N3    . DC  E 2 2   ? 21.834  28.988  52.811  1.00 95.60  ? 838 DC  G N3    1 
ATOM   6125 C  C4    . DC  E 2 2   ? 22.040  30.226  52.359  1.00 96.05  ? 838 DC  G C4    1 
ATOM   6126 N  N4    . DC  E 2 2   ? 21.503  30.556  51.180  1.00 93.69  ? 838 DC  G N4    1 
ATOM   6127 C  C5    . DC  E 2 2   ? 22.803  31.179  53.097  1.00 92.90  ? 838 DC  G C5    1 
ATOM   6128 C  C6    . DC  E 2 2   ? 23.315  30.793  54.270  1.00 90.37  ? 838 DC  G C6    1 
ATOM   6129 P  P     . DT  E 2 3   ? 25.879  27.274  59.403  1.00 62.68  ? 839 DT  G P     1 
ATOM   6130 O  OP1   . DT  E 2 3   ? 26.392  28.423  60.180  1.00 64.82  ? 839 DT  G OP1   1 
ATOM   6131 O  OP2   . DT  E 2 3   ? 26.752  26.105  59.151  1.00 64.30  ? 839 DT  G OP2   1 
ATOM   6132 O  "O5'" . DT  E 2 3   ? 24.539  26.738  60.092  1.00 68.20  ? 839 DT  G "O5'" 1 
ATOM   6133 C  "C5'" . DT  E 2 3   ? 24.164  25.381  59.907  1.00 63.27  ? 839 DT  G "C5'" 1 
ATOM   6134 C  "C4'" . DT  E 2 3   ? 22.804  25.232  59.252  1.00 64.78  ? 839 DT  G "C4'" 1 
ATOM   6135 O  "O4'" . DT  E 2 3   ? 22.721  26.018  58.036  1.00 63.65  ? 839 DT  G "O4'" 1 
ATOM   6136 C  "C3'" . DT  E 2 3   ? 22.505  23.816  58.789  1.00 63.41  ? 839 DT  G "C3'" 1 
ATOM   6137 O  "O3'" . DT  E 2 3   ? 22.050  23.033  59.875  1.00 58.68  ? 839 DT  G "O3'" 1 
ATOM   6138 C  "C2'" . DT  E 2 3   ? 21.407  24.074  57.768  1.00 63.10  ? 839 DT  G "C2'" 1 
ATOM   6139 C  "C1'" . DT  E 2 3   ? 21.969  25.307  57.066  1.00 59.61  ? 839 DT  G "C1'" 1 
ATOM   6140 N  N1    . DT  E 2 3   ? 22.859  24.990  55.911  1.00 62.61  ? 839 DT  G N1    1 
ATOM   6141 C  C2    . DT  E 2 3   ? 22.339  24.376  54.789  1.00 66.22  ? 839 DT  G C2    1 
ATOM   6142 O  O2    . DT  E 2 3   ? 21.168  24.061  54.668  1.00 71.46  ? 839 DT  G O2    1 
ATOM   6143 N  N3    . DT  E 2 3   ? 23.255  24.138  53.796  1.00 66.36  ? 839 DT  G N3    1 
ATOM   6144 C  C4    . DT  E 2 3   ? 24.603  24.446  53.809  1.00 70.54  ? 839 DT  G C4    1 
ATOM   6145 O  O4    . DT  E 2 3   ? 25.344  24.190  52.866  1.00 72.09  ? 839 DT  G O4    1 
ATOM   6146 C  C5    . DT  E 2 3   ? 25.078  25.086  55.009  1.00 68.58  ? 839 DT  G C5    1 
ATOM   6147 C  C7    . DT  E 2 3   ? 26.522  25.467  55.140  1.00 65.21  ? 839 DT  G C7    1 
ATOM   6148 C  C6    . DT  E 2 3   ? 24.196  25.324  55.987  1.00 69.02  ? 839 DT  G C6    1 
ATOM   6149 P  P     . DA  E 2 4   ? 22.693  21.587  60.147  1.00 55.63  ? 840 DA  G P     1 
ATOM   6150 O  OP1   . DA  E 2 4   ? 24.164  21.743  60.143  1.00 58.36  ? 840 DA  G OP1   1 
ATOM   6151 O  OP2   . DA  E 2 4   ? 22.053  20.628  59.218  1.00 56.42  ? 840 DA  G OP2   1 
ATOM   6152 O  "O5'" . DA  E 2 4   ? 22.219  21.233  61.630  1.00 53.25  ? 840 DA  G "O5'" 1 
ATOM   6153 C  "C5'" . DA  E 2 4   ? 22.657  22.021  62.731  1.00 52.58  ? 840 DA  G "C5'" 1 
ATOM   6154 C  "C4'" . DA  E 2 4   ? 22.413  21.307  64.051  1.00 57.99  ? 840 DA  G "C4'" 1 
ATOM   6155 O  "O4'" . DA  E 2 4   ? 20.989  21.199  64.300  1.00 56.41  ? 840 DA  G "O4'" 1 
ATOM   6156 C  "C3'" . DA  E 2 4   ? 22.952  19.885  64.137  1.00 51.94  ? 840 DA  G "C3'" 1 
ATOM   6157 O  "O3'" . DA  E 2 4   ? 23.355  19.595  65.467  1.00 58.89  ? 840 DA  G "O3'" 1 
ATOM   6158 C  "C2'" . DA  E 2 4   ? 21.760  19.026  63.727  1.00 49.30  ? 840 DA  G "C2'" 1 
ATOM   6159 C  "C1'" . DA  E 2 4   ? 20.565  19.853  64.193  1.00 49.46  ? 840 DA  G "C1'" 1 
ATOM   6160 N  N9    . DA  E 2 4   ? 19.439  19.823  63.264  1.00 49.89  ? 840 DA  G N9    1 
ATOM   6161 C  C8    . DA  E 2 4   ? 19.491  19.804  61.898  1.00 54.78  ? 840 DA  G C8    1 
ATOM   6162 N  N7    . DA  E 2 4   ? 18.311  19.785  61.324  1.00 53.93  ? 840 DA  G N7    1 
ATOM   6163 C  C5    . DA  E 2 4   ? 17.425  19.795  62.388  1.00 47.33  ? 840 DA  G C5    1 
ATOM   6164 C  C6    . DA  E 2 4   ? 16.018  19.784  62.454  1.00 45.19  ? 840 DA  G C6    1 
ATOM   6165 N  N6    . DA  E 2 4   ? 15.231  19.760  61.374  1.00 47.46  ? 840 DA  G N6    1 
ATOM   6166 N  N1    . DA  E 2 4   ? 15.451  19.800  63.678  1.00 44.80  ? 840 DA  G N1    1 
ATOM   6167 C  C2    . DA  E 2 4   ? 16.241  19.824  64.758  1.00 46.90  ? 840 DA  G C2    1 
ATOM   6168 N  N3    . DA  E 2 4   ? 17.571  19.836  64.821  1.00 51.07  ? 840 DA  G N3    1 
ATOM   6169 C  C4    . DA  E 2 4   ? 18.105  19.818  63.591  1.00 43.63  ? 840 DA  G C4    1 
HETATM 6170 O  OP2   . RDG E 2 5   ? 24.896  17.793  64.380  1.00 48.95  ? 841 RDG G OP2   1 
HETATM 6171 P  P     . RDG E 2 5   ? 24.340  18.359  65.756  1.00 55.16  ? 841 RDG G P     1 
HETATM 6172 O  OP1   . RDG E 2 5   ? 25.471  18.774  66.674  1.00 60.26  ? 841 RDG G OP1   1 
HETATM 6173 O  "O5'" . RDG E 2 5   ? 23.438  17.285  66.432  1.00 54.06  ? 841 RDG G "O5'" 1 
HETATM 6174 C  "C5'" . RDG E 2 5   ? 22.429  17.671  67.331  1.00 51.38  ? 841 RDG G "C5'" 1 
HETATM 6175 C  "C4'" . RDG E 2 5   ? 21.429  16.706  67.617  1.00 45.20  ? 841 RDG G "C4'" 1 
HETATM 6176 C  "C3'" . RDG E 2 5   ? 21.932  15.356  67.339  1.00 50.80  ? 841 RDG G "C3'" 1 
HETATM 6177 O  "O3'" . RDG E 2 5   ? 21.485  14.526  68.307  1.00 54.84  ? 841 RDG G "O3'" 1 
HETATM 6178 C  "C2'" . RDG E 2 5   ? 21.338  14.974  66.070  1.00 49.70  ? 841 RDG G "C2'" 1 
HETATM 6179 C  "C1'" . RDG E 2 5   ? 20.048  15.718  66.061  1.00 48.92  ? 841 RDG G "C1'" 1 
HETATM 6180 O  "O4'" . RDG E 2 5   ? 20.293  16.918  66.748  1.00 53.54  ? 841 RDG G "O4'" 1 
HETATM 6181 N  N9    . RDG E 2 5   ? 19.567  15.925  64.736  1.00 48.34  ? 841 RDG G N9    1 
HETATM 6182 C  C4    . RDG E 2 5   ? 18.213  16.080  64.402  1.00 49.85  ? 841 RDG G C4    1 
HETATM 6183 N  N3    . RDG E 2 5   ? 17.061  16.080  65.173  1.00 50.54  ? 841 RDG G N3    1 
HETATM 6184 C  C2    . RDG E 2 5   ? 15.851  16.254  64.588  1.00 48.88  ? 841 RDG G C2    1 
HETATM 6185 N  N1    . RDG E 2 5   ? 15.719  16.435  63.234  1.00 46.99  ? 841 RDG G N1    1 
HETATM 6186 C  C6    . RDG E 2 5   ? 16.828  16.444  62.423  1.00 43.46  ? 841 RDG G C6    1 
HETATM 6187 O  O6    . RDG E 2 5   ? 16.692  16.632  61.011  1.00 48.84  ? 841 RDG G O6    1 
HETATM 6188 C  C5    . RDG E 2 5   ? 18.134  16.261  63.013  1.00 47.68  ? 841 RDG G C5    1 
HETATM 6189 N  N7    . RDG E 2 5   ? 19.436  16.213  62.530  1.00 45.69  ? 841 RDG G N7    1 
HETATM 6190 C  C8    . RDG E 2 5   ? 20.291  16.005  63.601  1.00 50.84  ? 841 RDG G C8    1 
HETATM 6191 N  N2    . RDG E 2 5   ? 14.688  16.243  65.453  1.00 57.05  ? 841 RDG G N2    1 
HETATM 6192 C  C11   . RDG E 2 5   ? 14.897  16.085  66.881  1.00 57.12  ? 841 RDG G C11   1 
HETATM 6193 C  C10   . RDG E 2 5   ? 13.921  15.204  67.648  1.00 78.54  ? 841 RDG G C10   1 
HETATM 6194 C  C9    . RDG E 2 5   ? 12.613  15.593  68.047  1.00 79.83  ? 841 RDG G C9    1 
HETATM 6195 O  O7    . RDG E 2 5   ? 14.172  13.963  68.039  1.00 87.59  ? 841 RDG G O7    1 
HETATM 6196 C  C12   . RDG E 2 5   ? 13.128  13.457  68.681  1.00 95.84  ? 841 RDG G C12   1 
HETATM 6197 C  C7    . RDG E 2 5   ? 12.100  14.424  68.732  1.00 90.60  ? 841 RDG G C7    1 
ATOM   6198 P  P     . DG  E 2 6   ? 22.117  13.058  68.470  1.00 47.46  ? 842 DG  G P     1 
ATOM   6199 O  OP1   . DG  E 2 6   ? 21.887  12.622  69.865  1.00 53.53  ? 842 DG  G OP1   1 
ATOM   6200 O  OP2   . DG  E 2 6   ? 23.494  13.100  67.927  1.00 63.09  ? 842 DG  G OP2   1 
ATOM   6201 O  "O5'" . DG  E 2 6   ? 21.232  12.151  67.497  1.00 46.47  ? 842 DG  G "O5'" 1 
ATOM   6202 C  "C5'" . DG  E 2 6   ? 20.391  11.149  68.047  1.00 56.65  ? 842 DG  G "C5'" 1 
ATOM   6203 C  "C4'" . DG  E 2 6   ? 18.933  11.375  67.707  1.00 55.24  ? 842 DG  G "C4'" 1 
ATOM   6204 O  "O4'" . DG  E 2 6   ? 18.805  12.392  66.688  1.00 53.76  ? 842 DG  G "O4'" 1 
ATOM   6205 C  "C3'" . DG  E 2 6   ? 18.227  10.173  67.102  1.00 48.16  ? 842 DG  G "C3'" 1 
ATOM   6206 O  "O3'" . DG  E 2 6   ? 17.827  9.276   68.131  1.00 52.46  ? 842 DG  G "O3'" 1 
ATOM   6207 C  "C2'" . DG  E 2 6   ? 17.027  10.833  66.429  1.00 54.99  ? 842 DG  G "C2'" 1 
ATOM   6208 C  "C1'" . DG  E 2 6   ? 17.534  12.235  66.088  1.00 56.01  ? 842 DG  G "C1'" 1 
ATOM   6209 N  N9    . DG  E 2 6   ? 17.642  12.482  64.653  1.00 52.49  ? 842 DG  G N9    1 
ATOM   6210 C  C8    . DG  E 2 6   ? 18.787  12.611  63.905  1.00 48.68  ? 842 DG  G C8    1 
ATOM   6211 N  N7    . DG  E 2 6   ? 18.555  12.830  62.640  1.00 48.35  ? 842 DG  G N7    1 
ATOM   6212 C  C5    . DG  E 2 6   ? 17.169  12.847  62.545  1.00 48.34  ? 842 DG  G C5    1 
ATOM   6213 C  C6    . DG  E 2 6   ? 16.330  13.041  61.422  1.00 47.78  ? 842 DG  G C6    1 
ATOM   6214 O  O6    . DG  E 2 6   ? 16.658  13.244  60.244  1.00 50.13  ? 842 DG  G O6    1 
ATOM   6215 N  N1    . DG  E 2 6   ? 14.982  12.980  61.768  1.00 48.85  ? 842 DG  G N1    1 
ATOM   6216 C  C2    . DG  E 2 6   ? 14.504  12.760  63.039  1.00 48.13  ? 842 DG  G C2    1 
ATOM   6217 N  N2    . DG  E 2 6   ? 13.171  12.736  63.180  1.00 52.70  ? 842 DG  G N2    1 
ATOM   6218 N  N3    . DG  E 2 6   ? 15.279  12.577  64.099  1.00 48.48  ? 842 DG  G N3    1 
ATOM   6219 C  C4    . DG  E 2 6   ? 16.594  12.634  63.776  1.00 52.66  ? 842 DG  G C4    1 
ATOM   6220 P  P     . DG  E 2 7   ? 18.182  7.711   68.028  1.00 54.04  ? 843 DG  G P     1 
ATOM   6221 O  OP1   . DG  E 2 7   ? 18.260  7.182   69.408  1.00 57.07  ? 843 DG  G OP1   1 
ATOM   6222 O  OP2   . DG  E 2 7   ? 19.335  7.567   67.112  1.00 53.37  ? 843 DG  G OP2   1 
ATOM   6223 O  "O5'" . DG  E 2 7   ? 16.908  7.070   67.313  1.00 52.60  ? 843 DG  G "O5'" 1 
ATOM   6224 C  "C5'" . DG  E 2 7   ? 16.966  6.710   65.944  1.00 44.64  ? 843 DG  G "C5'" 1 
ATOM   6225 C  "C4'" . DG  E 2 7   ? 15.664  7.095   65.274  1.00 41.72  ? 843 DG  G "C4'" 1 
ATOM   6226 O  "O4'" . DG  E 2 7   ? 15.770  8.447   64.769  1.00 39.21  ? 843 DG  G "O4'" 1 
ATOM   6227 C  "C3'" . DG  E 2 7   ? 15.292  6.256   64.065  1.00 43.80  ? 843 DG  G "C3'" 1 
ATOM   6228 O  "O3'" . DG  E 2 7   ? 14.586  5.102   64.499  1.00 43.88  ? 843 DG  G "O3'" 1 
ATOM   6229 C  "C2'" . DG  E 2 7   ? 14.393  7.211   63.287  1.00 44.04  ? 843 DG  G "C2'" 1 
ATOM   6230 C  "C1'" . DG  E 2 7   ? 15.023  8.571   63.575  1.00 44.71  ? 843 DG  G "C1'" 1 
ATOM   6231 N  N9    . DG  E 2 7   ? 15.906  9.037   62.511  1.00 43.46  ? 843 DG  G N9    1 
ATOM   6232 C  C8    . DG  E 2 7   ? 17.279  9.093   62.525  1.00 46.17  ? 843 DG  G C8    1 
ATOM   6233 N  N7    . DG  E 2 7   ? 17.790  9.560   61.420  1.00 47.41  ? 843 DG  G N7    1 
ATOM   6234 C  C5    . DG  E 2 7   ? 16.686  9.828   60.620  1.00 43.93  ? 843 DG  G C5    1 
ATOM   6235 C  C6    . DG  E 2 7   ? 16.612  10.350  59.307  1.00 45.61  ? 843 DG  G C6    1 
ATOM   6236 O  O6    . DG  E 2 7   ? 17.540  10.692  58.561  1.00 49.78  ? 843 DG  G O6    1 
ATOM   6237 N  N1    . DG  E 2 7   ? 15.294  10.465  58.871  1.00 51.37  ? 843 DG  G N1    1 
ATOM   6238 C  C2    . DG  E 2 7   ? 14.187  10.118  59.610  1.00 49.16  ? 843 DG  G C2    1 
ATOM   6239 N  N2    . DG  E 2 7   ? 12.997  10.299  59.020  1.00 46.06  ? 843 DG  G N2    1 
ATOM   6240 N  N3    . DG  E 2 7   ? 14.243  9.628   60.841  1.00 48.65  ? 843 DG  G N3    1 
ATOM   6241 C  C4    . DG  E 2 7   ? 15.520  9.511   61.279  1.00 46.68  ? 843 DG  G C4    1 
ATOM   6242 P  P     . DT  E 2 8   ? 14.480  3.813   63.547  1.00 51.31  ? 844 DT  G P     1 
ATOM   6243 O  OP1   . DT  E 2 8   ? 13.856  2.724   64.330  1.00 50.25  ? 844 DT  G OP1   1 
ATOM   6244 O  OP2   . DT  E 2 8   ? 15.803  3.605   62.919  1.00 48.21  ? 844 DT  G OP2   1 
ATOM   6245 O  "O5'" . DT  E 2 8   ? 13.466  4.265   62.396  1.00 44.26  ? 844 DT  G "O5'" 1 
ATOM   6246 C  "C5'" . DT  E 2 8   ? 12.104  4.544   62.693  1.00 47.24  ? 844 DT  G "C5'" 1 
ATOM   6247 C  "C4'" . DT  E 2 8   ? 11.392  5.001   61.433  1.00 45.75  ? 844 DT  G "C4'" 1 
ATOM   6248 O  "O4'" . DT  E 2 8   ? 12.024  6.208   60.943  1.00 45.97  ? 844 DT  G "O4'" 1 
ATOM   6249 C  "C3'" . DT  E 2 8   ? 11.475  4.011   60.282  1.00 49.08  ? 844 DT  G "C3'" 1 
ATOM   6250 O  "O3'" . DT  E 2 8   ? 10.302  3.206   60.298  1.00 54.03  ? 844 DT  G "O3'" 1 
ATOM   6251 C  "C2'" . DT  E 2 8   ? 11.530  4.883   59.030  1.00 50.57  ? 844 DT  G "C2'" 1 
ATOM   6252 C  "C1'" . DT  E 2 8   ? 12.001  6.242   59.530  1.00 45.95  ? 844 DT  G "C1'" 1 
ATOM   6253 N  N1    . DT  E 2 8   ? 13.356  6.577   59.020  1.00 48.71  ? 844 DT  G N1    1 
ATOM   6254 C  C2    . DT  E 2 8   ? 13.467  7.150   57.774  1.00 48.05  ? 844 DT  G C2    1 
ATOM   6255 O  O2    . DT  E 2 8   ? 12.503  7.403   57.074  1.00 44.84  ? 844 DT  G O2    1 
ATOM   6256 N  N3    . DT  E 2 8   ? 14.753  7.420   57.379  1.00 48.66  ? 844 DT  G N3    1 
ATOM   6257 C  C4    . DT  E 2 8   ? 15.911  7.174   58.095  1.00 46.49  ? 844 DT  G C4    1 
ATOM   6258 O  O4    . DT  E 2 8   ? 17.023  7.450   57.658  1.00 46.35  ? 844 DT  G O4    1 
ATOM   6259 C  C5    . DT  E 2 8   ? 15.722  6.568   59.389  1.00 42.37  ? 844 DT  G C5    1 
ATOM   6260 C  C7    . DT  E 2 8   ? 16.907  6.255   60.253  1.00 36.65  ? 844 DT  G C7    1 
ATOM   6261 C  C6    . DT  E 2 8   ? 14.471  6.300   59.785  1.00 45.83  ? 844 DT  G C6    1 
ATOM   6262 P  P     . DC  E 2 9   ? 10.308  1.752   59.611  1.00 65.52  ? 845 DC  G P     1 
ATOM   6263 O  OP1   . DC  E 2 9   ? 9.037   1.056   59.930  1.00 59.66  ? 845 DC  G OP1   1 
ATOM   6264 O  OP2   . DC  E 2 9   ? 11.625  1.138   59.874  1.00 54.29  ? 845 DC  G OP2   1 
ATOM   6265 O  "O5'" . DC  E 2 9   ? 10.270  2.066   58.048  1.00 57.28  ? 845 DC  G "O5'" 1 
ATOM   6266 C  "C5'" . DC  E 2 9   ? 9.187   2.817   57.496  1.00 48.16  ? 845 DC  G "C5'" 1 
ATOM   6267 C  "C4'" . DC  E 2 9   ? 9.487   3.287   56.081  1.00 52.37  ? 845 DC  G "C4'" 1 
ATOM   6268 O  "O4'" . DC  E 2 9   ? 10.685  4.107   56.072  1.00 51.53  ? 845 DC  G "O4'" 1 
ATOM   6269 C  "C3'" . DC  E 2 9   ? 9.714   2.165   55.070  1.00 51.53  ? 845 DC  G "C3'" 1 
ATOM   6270 O  "O3'" . DC  E 2 9   ? 8.813   2.326   53.987  1.00 57.84  ? 845 DC  G "O3'" 1 
ATOM   6271 C  "C2'" . DC  E 2 9   ? 11.140  2.360   54.569  1.00 55.32  ? 845 DC  G "C2'" 1 
ATOM   6272 C  "C1'" . DC  E 2 9   ? 11.458  3.806   54.934  1.00 53.20  ? 845 DC  G "C1'" 1 
ATOM   6273 N  N1    . DC  E 2 9   ? 12.895  4.064   55.276  1.00 53.86  ? 845 DC  G N1    1 
ATOM   6274 C  C2    . DC  E 2 9   ? 13.653  4.956   54.506  1.00 53.41  ? 845 DC  G C2    1 
ATOM   6275 O  O2    . DC  E 2 9   ? 13.125  5.524   53.543  1.00 52.89  ? 845 DC  G O2    1 
ATOM   6276 N  N3    . DC  E 2 9   ? 14.951  5.175   54.837  1.00 49.00  ? 845 DC  G N3    1 
ATOM   6277 C  C4    . DC  E 2 9   ? 15.491  4.548   55.884  1.00 50.09  ? 845 DC  G C4    1 
ATOM   6278 N  N4    . DC  E 2 9   ? 16.774  4.791   56.175  1.00 54.10  ? 845 DC  G N4    1 
ATOM   6279 C  C5    . DC  E 2 9   ? 14.734  3.639   56.680  1.00 47.28  ? 845 DC  G C5    1 
ATOM   6280 C  C6    . DC  E 2 9   ? 13.456  3.431   56.346  1.00 49.66  ? 845 DC  G C6    1 
ATOM   6281 P  P     . DC  E 2 10  ? 8.627   1.139   52.921  1.00 60.04  ? 846 DC  G P     1 
ATOM   6282 O  OP1   . DC  E 2 10  ? 7.258   1.215   52.374  1.00 59.49  ? 846 DC  G OP1   1 
ATOM   6283 O  OP2   . DC  E 2 10  ? 9.112   -0.110  53.554  1.00 58.07  ? 846 DC  G OP2   1 
ATOM   6284 O  "O5'" . DC  E 2 10  ? 9.620   1.527   51.732  1.00 61.77  ? 846 DC  G "O5'" 1 
ATOM   6285 C  "C5'" . DC  E 2 10  ? 9.458   2.782   51.092  1.00 58.58  ? 846 DC  G "C5'" 1 
ATOM   6286 C  "C4'" . DC  E 2 10  ? 10.601  3.059   50.135  1.00 55.68  ? 846 DC  G "C4'" 1 
ATOM   6287 O  "O4'" . DC  E 2 10  ? 11.795  3.398   50.880  1.00 55.42  ? 846 DC  G "O4'" 1 
ATOM   6288 C  "C3'" . DC  E 2 10  ? 10.971  1.889   49.230  1.00 51.85  ? 846 DC  G "C3'" 1 
ATOM   6289 O  "O3'" . DC  E 2 10  ? 10.699  2.245   47.880  1.00 52.81  ? 846 DC  G "O3'" 1 
ATOM   6290 C  "C2'" . DC  E 2 10  ? 12.461  1.647   49.481  1.00 53.79  ? 846 DC  G "C2'" 1 
ATOM   6291 C  "C1'" . DC  E 2 10  ? 12.915  2.932   50.164  1.00 54.28  ? 846 DC  G "C1'" 1 
ATOM   6292 N  N1    . DC  E 2 10  ? 14.028  2.748   51.136  1.00 53.18  ? 846 DC  G N1    1 
ATOM   6293 C  C2    . DC  E 2 10  ? 15.272  3.334   50.885  1.00 56.44  ? 846 DC  G C2    1 
ATOM   6294 O  O2    . DC  E 2 10  ? 15.428  3.996   49.851  1.00 60.27  ? 846 DC  G O2    1 
ATOM   6295 N  N3    . DC  E 2 10  ? 16.273  3.159   51.783  1.00 56.62  ? 846 DC  G N3    1 
ATOM   6296 C  C4    . DC  E 2 10  ? 16.063  2.438   52.886  1.00 55.14  ? 846 DC  G C4    1 
ATOM   6297 N  N4    . DC  E 2 10  ? 17.080  2.293   53.743  1.00 48.81  ? 846 DC  G N4    1 
ATOM   6298 C  C5    . DC  E 2 10  ? 14.801  1.833   53.160  1.00 55.24  ? 846 DC  G C5    1 
ATOM   6299 C  C6    . DC  E 2 10  ? 13.822  2.013   52.267  1.00 55.22  ? 846 DC  G C6    1 
ATOM   6300 P  P     . DT  E 2 11  ? 10.883  1.166   46.705  1.00 60.03  ? 847 DT  G P     1 
ATOM   6301 O  OP1   . DT  E 2 11  ? 9.988   1.559   45.595  1.00 56.51  ? 847 DT  G OP1   1 
ATOM   6302 O  OP2   . DT  E 2 11  ? 10.767  -0.183  47.303  1.00 59.91  ? 847 DT  G OP2   1 
ATOM   6303 O  "O5'" . DT  E 2 11  ? 12.386  1.395   46.214  1.00 52.63  ? 847 DT  G "O5'" 1 
ATOM   6304 C  "C5'" . DT  E 2 11  ? 12.760  2.688   45.760  1.00 54.41  ? 847 DT  G "C5'" 1 
ATOM   6305 C  "C4'" . DT  E 2 11  ? 14.225  2.742   45.367  1.00 59.82  ? 847 DT  G "C4'" 1 
ATOM   6306 O  "O4'" . DT  E 2 11  ? 15.062  2.719   46.550  1.00 56.41  ? 847 DT  G "O4'" 1 
ATOM   6307 C  "C3'" . DT  E 2 11  ? 14.704  1.602   44.475  1.00 57.18  ? 847 DT  G "C3'" 1 
ATOM   6308 O  "O3'" . DT  E 2 11  ? 15.389  2.166   43.368  1.00 65.63  ? 847 DT  G "O3'" 1 
ATOM   6309 C  "C2'" . DT  E 2 11  ? 15.643  0.799   45.373  1.00 55.11  ? 847 DT  G "C2'" 1 
ATOM   6310 C  "C1'" . DT  E 2 11  ? 16.170  1.882   46.305  1.00 53.22  ? 847 DT  G "C1'" 1 
ATOM   6311 N  N1    . DT  E 2 11  ? 16.652  1.384   47.619  1.00 58.66  ? 847 DT  G N1    1 
ATOM   6312 C  C2    . DT  E 2 11  ? 17.899  1.761   48.065  1.00 56.70  ? 847 DT  G C2    1 
ATOM   6313 O  O2    . DT  E 2 11  ? 18.643  2.488   47.431  1.00 55.79  ? 847 DT  G O2    1 
ATOM   6314 N  N3    . DT  E 2 11  ? 18.244  1.251   49.290  1.00 54.17  ? 847 DT  G N3    1 
ATOM   6315 C  C4    . DT  E 2 11  ? 17.482  0.422   50.093  1.00 54.07  ? 847 DT  G C4    1 
ATOM   6316 O  O4    . DT  E 2 11  ? 17.880  0.014   51.180  1.00 56.64  ? 847 DT  G O4    1 
ATOM   6317 C  C5    . DT  E 2 11  ? 16.188  0.069   49.565  1.00 58.47  ? 847 DT  G C5    1 
ATOM   6318 C  C7    . DT  E 2 11  ? 15.273  -0.825  50.348  1.00 57.09  ? 847 DT  G C7    1 
ATOM   6319 C  C6    . DT  E 2 11  ? 15.838  0.561   48.370  1.00 59.49  ? 847 DT  G C6    1 
ATOM   6320 P  P     . DA  E 2 12  ? 15.473  1.374   41.975  1.00 67.39  ? 848 DA  G P     1 
ATOM   6321 O  OP1   . DA  E 2 12  ? 15.278  2.361   40.890  1.00 66.80  ? 848 DA  G OP1   1 
ATOM   6322 O  OP2   . DA  E 2 12  ? 14.591  0.189   42.066  1.00 72.36  ? 848 DA  G OP2   1 
ATOM   6323 O  "O5'" . DA  E 2 12  ? 16.981  0.852   41.929  1.00 48.63  ? 848 DA  G "O5'" 1 
ATOM   6324 C  "C5'" . DA  E 2 12  ? 18.054  1.772   42.078  1.00 55.62  ? 848 DA  G "C5'" 1 
ATOM   6325 C  "C4'" . DA  E 2 12  ? 19.324  1.008   42.387  1.00 59.43  ? 848 DA  G "C4'" 1 
ATOM   6326 O  "O4'" . DA  E 2 12  ? 19.415  0.770   43.817  1.00 66.08  ? 848 DA  G "O4'" 1 
ATOM   6327 C  "C3'" . DA  E 2 12  ? 19.373  -0.361  41.715  1.00 66.83  ? 848 DA  G "C3'" 1 
ATOM   6328 O  "O3'" . DA  E 2 12  ? 20.610  -0.548  41.050  1.00 64.43  ? 848 DA  G "O3'" 1 
ATOM   6329 C  "C2'" . DA  E 2 12  ? 19.220  -1.339  42.875  1.00 64.55  ? 848 DA  G "C2'" 1 
ATOM   6330 C  "C1'" . DA  E 2 12  ? 19.849  -0.557  44.018  1.00 65.67  ? 848 DA  G "C1'" 1 
ATOM   6331 N  N9    . DA  E 2 12  ? 19.414  -1.047  45.322  1.00 59.27  ? 848 DA  G N9    1 
ATOM   6332 C  C8    . DA  E 2 12  ? 18.213  -1.631  45.612  1.00 59.64  ? 848 DA  G C8    1 
ATOM   6333 N  N7    . DA  E 2 12  ? 18.085  -1.989  46.866  1.00 61.05  ? 848 DA  G N7    1 
ATOM   6334 C  C5    . DA  E 2 12  ? 19.289  -1.616  47.441  1.00 59.90  ? 848 DA  G C5    1 
ATOM   6335 C  C6    . DA  E 2 12  ? 19.784  -1.723  48.756  1.00 59.66  ? 848 DA  G C6    1 
ATOM   6336 N  N6    . DA  E 2 12  ? 19.087  -2.263  49.762  1.00 59.42  ? 848 DA  G N6    1 
ATOM   6337 N  N1    . DA  E 2 12  ? 21.025  -1.254  48.996  1.00 60.19  ? 848 DA  G N1    1 
ATOM   6338 C  C2    . DA  E 2 12  ? 21.718  -0.715  47.986  1.00 63.72  ? 848 DA  G C2    1 
ATOM   6339 N  N3    . DA  E 2 12  ? 21.359  -0.560  46.712  1.00 65.08  ? 848 DA  G N3    1 
ATOM   6340 C  C4    . DA  E 2 12  ? 20.122  -1.036  46.503  1.00 60.04  ? 848 DA  G C4    1 
ATOM   6341 P  P     . DG  E 2 13  ? 20.708  -1.549  39.796  1.00 65.95  ? 849 DG  G P     1 
ATOM   6342 O  OP1   . DG  E 2 13  ? 20.421  -0.768  38.572  1.00 73.31  ? 849 DG  G OP1   1 
ATOM   6343 O  OP2   . DG  E 2 13  ? 19.904  -2.752  40.105  1.00 73.41  ? 849 DG  G OP2   1 
ATOM   6344 O  "O5'" . DG  E 2 13  ? 22.243  -1.985  39.784  1.00 68.36  ? 849 DG  G "O5'" 1 
ATOM   6345 C  "C5'" . DG  E 2 13  ? 23.246  -1.001  39.988  1.00 72.40  ? 849 DG  G "C5'" 1 
ATOM   6346 C  "C4'" . DG  E 2 13  ? 24.375  -1.561  40.832  1.00 68.18  ? 849 DG  G "C4'" 1 
ATOM   6347 O  "O4'" . DG  E 2 13  ? 23.927  -1.751  42.200  1.00 70.15  ? 849 DG  G "O4'" 1 
ATOM   6348 C  "C3'" . DG  E 2 13  ? 24.912  -2.911  40.371  1.00 71.81  ? 849 DG  G "C3'" 1 
ATOM   6349 O  "O3'" . DG  E 2 13  ? 26.326  -2.906  40.515  1.00 77.27  ? 849 DG  G "O3'" 1 
ATOM   6350 C  "C2'" . DG  E 2 13  ? 24.234  -3.895  41.324  1.00 67.39  ? 849 DG  G "C2'" 1 
ATOM   6351 C  "C1'" . DG  E 2 13  ? 24.176  -3.080  42.611  1.00 70.87  ? 849 DG  G "C1'" 1 
ATOM   6352 N  N9    . DG  E 2 13  ? 23.111  -3.473  43.531  1.00 68.35  ? 849 DG  G N9    1 
ATOM   6353 C  C8    . DG  E 2 13  ? 21.770  -3.559  43.249  1.00 66.88  ? 849 DG  G C8    1 
ATOM   6354 N  N7    . DG  E 2 13  ? 21.042  -3.927  44.266  1.00 69.23  ? 849 DG  G N7    1 
ATOM   6355 C  C5    . DG  E 2 13  ? 21.960  -4.093  45.293  1.00 66.53  ? 849 DG  G C5    1 
ATOM   6356 C  C6    . DG  E 2 13  ? 21.753  -4.485  46.635  1.00 63.44  ? 849 DG  G C6    1 
ATOM   6357 O  O6    . DG  E 2 13  ? 20.682  -4.770  47.189  1.00 63.57  ? 849 DG  G O6    1 
ATOM   6358 N  N1    . DG  E 2 13  ? 22.951  -4.531  47.346  1.00 63.61  ? 849 DG  G N1    1 
ATOM   6359 C  C2    . DG  E 2 13  ? 24.188  -4.233  46.819  1.00 65.76  ? 849 DG  G C2    1 
ATOM   6360 N  N2    . DG  E 2 13  ? 25.235  -4.330  47.652  1.00 65.03  ? 849 DG  G N2    1 
ATOM   6361 N  N3    . DG  E 2 13  ? 24.393  -3.864  45.562  1.00 64.62  ? 849 DG  G N3    1 
ATOM   6362 C  C4    . DG  E 2 13  ? 23.237  -3.816  44.859  1.00 65.39  ? 849 DG  G C4    1 
ATOM   6363 P  P     . DG  E 2 14  ? 27.257  -3.687  39.463  1.00 78.23  ? 850 DG  G P     1 
ATOM   6364 O  OP1   . DG  E 2 14  ? 28.175  -2.697  38.857  1.00 82.58  ? 850 DG  G OP1   1 
ATOM   6365 O  OP2   . DG  E 2 14  ? 26.381  -4.514  38.603  1.00 72.73  ? 850 DG  G OP2   1 
ATOM   6366 O  "O5'" . DG  E 2 14  ? 28.108  -4.675  40.383  1.00 77.13  ? 850 DG  G "O5'" 1 
ATOM   6367 C  "C5'" . DG  E 2 14  ? 27.418  -5.371  41.402  1.00 70.76  ? 850 DG  G "C5'" 1 
ATOM   6368 C  "C4'" . DG  E 2 14  ? 28.348  -5.871  42.482  1.00 71.73  ? 850 DG  G "C4'" 1 
ATOM   6369 O  "O4'" . DG  E 2 14  ? 27.589  -5.968  43.709  1.00 72.80  ? 850 DG  G "O4'" 1 
ATOM   6370 C  "C3'" . DG  E 2 14  ? 28.856  -7.281  42.250  1.00 70.88  ? 850 DG  G "C3'" 1 
ATOM   6371 O  "O3'" . DG  E 2 14  ? 29.949  -7.551  43.114  1.00 72.99  ? 850 DG  G "O3'" 1 
ATOM   6372 C  "C2'" . DG  E 2 14  ? 27.618  -8.077  42.639  1.00 70.45  ? 850 DG  G "C2'" 1 
ATOM   6373 C  "C1'" . DG  E 2 14  ? 27.113  -7.293  43.848  1.00 72.82  ? 850 DG  G "C1'" 1 
ATOM   6374 N  N9    . DG  E 2 14  ? 25.656  -7.276  43.951  1.00 70.56  ? 850 DG  G N9    1 
ATOM   6375 C  C8    . DG  E 2 14  ? 24.747  -7.083  42.938  1.00 66.88  ? 850 DG  G C8    1 
ATOM   6376 N  N7    . DG  E 2 14  ? 23.506  -7.124  43.338  1.00 66.46  ? 850 DG  G N7    1 
ATOM   6377 C  C5    . DG  E 2 14  ? 23.597  -7.360  44.704  1.00 66.80  ? 850 DG  G C5    1 
ATOM   6378 C  C6    . DG  E 2 14  ? 22.580  -7.505  45.677  1.00 65.85  ? 850 DG  G C6    1 
ATOM   6379 O  O6    . DG  E 2 14  ? 21.352  -7.450  45.517  1.00 68.31  ? 850 DG  G O6    1 
ATOM   6380 N  N1    . DG  E 2 14  ? 23.109  -7.733  46.946  1.00 66.16  ? 850 DG  G N1    1 
ATOM   6381 C  C2    . DG  E 2 14  ? 24.451  -7.813  47.237  1.00 67.18  ? 850 DG  G C2    1 
ATOM   6382 N  N2    . DG  E 2 14  ? 24.773  -8.039  48.519  1.00 62.33  ? 850 DG  G N2    1 
ATOM   6383 N  N3    . DG  E 2 14  ? 25.413  -7.680  46.334  1.00 66.49  ? 850 DG  G N3    1 
ATOM   6384 C  C4    . DG  E 2 14  ? 24.914  -7.456  45.095  1.00 67.39  ? 850 DG  G C4    1 
ATOM   6385 P  P     . DA  E 2 15  ? 30.691  -8.975  43.064  1.00 82.49  ? 851 DA  G P     1 
ATOM   6386 O  OP1   . DA  E 2 15  ? 32.142  -8.723  43.200  1.00 81.22  ? 851 DA  G OP1   1 
ATOM   6387 O  OP2   . DA  E 2 15  ? 30.184  -9.726  41.893  1.00 70.19  ? 851 DA  G OP2   1 
ATOM   6388 O  "O5'" . DA  E 2 15  ? 30.180  -9.715  44.385  1.00 68.83  ? 851 DA  G "O5'" 1 
ATOM   6389 C  "C5'" . DA  E 2 15  ? 30.502  -9.162  45.654  1.00 63.29  ? 851 DA  G "C5'" 1 
ATOM   6390 C  "C4'" . DA  E 2 15  ? 29.916  -9.985  46.788  1.00 65.31  ? 851 DA  G "C4'" 1 
ATOM   6391 O  "O4'" . DA  E 2 15  ? 28.475  -9.831  46.813  1.00 68.42  ? 851 DA  G "O4'" 1 
ATOM   6392 C  "C3'" . DA  E 2 15  ? 30.180  -11.484 46.714  1.00 66.78  ? 851 DA  G "C3'" 1 
ATOM   6393 O  "O3'" . DA  E 2 15  ? 30.414  -11.967 48.028  1.00 64.42  ? 851 DA  G "O3'" 1 
ATOM   6394 C  "C2'" . DA  E 2 15  ? 28.884  -12.042 46.131  1.00 67.17  ? 851 DA  G "C2'" 1 
ATOM   6395 C  "C1'" . DA  E 2 15  ? 27.852  -11.097 46.735  1.00 71.03  ? 851 DA  G "C1'" 1 
ATOM   6396 N  N9    . DA  E 2 15  ? 26.639  -10.935 45.940  1.00 69.98  ? 851 DA  G N9    1 
ATOM   6397 C  C8    . DA  E 2 15  ? 26.552  -10.615 44.614  1.00 66.73  ? 851 DA  G C8    1 
ATOM   6398 N  N7    . DA  E 2 15  ? 25.320  -10.527 44.168  1.00 64.64  ? 851 DA  G N7    1 
ATOM   6399 C  C5    . DA  E 2 15  ? 24.546  -10.808 45.282  1.00 69.08  ? 851 DA  G C5    1 
ATOM   6400 C  C6    . DA  E 2 15  ? 23.154  -10.879 45.479  1.00 64.07  ? 851 DA  G C6    1 
ATOM   6401 N  N6    . DA  E 2 15  ? 22.261  -10.660 44.509  1.00 68.17  ? 851 DA  G N6    1 
ATOM   6402 N  N1    . DA  E 2 15  ? 22.714  -11.183 46.717  1.00 62.80  ? 851 DA  G N1    1 
ATOM   6403 C  C2    . DA  E 2 15  ? 23.610  -11.401 47.687  1.00 65.41  ? 851 DA  G C2    1 
ATOM   6404 N  N3    . DA  E 2 15  ? 24.939  -11.364 47.624  1.00 61.97  ? 851 DA  G N3    1 
ATOM   6405 C  C4    . DA  E 2 15  ? 25.344  -11.059 46.382  1.00 65.98  ? 851 DA  G C4    1 
ATOM   6406 P  P     . DC  E 2 16  ? 31.148  -13.377 48.255  1.00 61.76  ? 852 DC  G P     1 
ATOM   6407 O  OP1   . DC  E 2 16  ? 31.944  -13.271 49.498  1.00 62.39  ? 852 DC  G OP1   1 
ATOM   6408 O  OP2   . DC  E 2 16  ? 31.807  -13.752 46.984  1.00 66.55  ? 852 DC  G OP2   1 
ATOM   6409 O  "O5'" . DC  E 2 16  ? 29.944  -14.390 48.528  1.00 65.95  ? 852 DC  G "O5'" 1 
ATOM   6410 C  "C5'" . DC  E 2 16  ? 29.032  -14.105 49.578  1.00 68.18  ? 852 DC  G "C5'" 1 
ATOM   6411 C  "C4'" . DC  E 2 16  ? 27.731  -14.857 49.377  1.00 67.49  ? 852 DC  G "C4'" 1 
ATOM   6412 O  "O4'" . DC  E 2 16  ? 26.952  -14.250 48.318  1.00 67.50  ? 852 DC  G "O4'" 1 
ATOM   6413 C  "C3'" . DC  E 2 16  ? 27.895  -16.323 48.990  1.00 70.34  ? 852 DC  G "C3'" 1 
ATOM   6414 O  "O3'" . DC  E 2 16  ? 27.360  -17.115 50.036  1.00 74.45  ? 852 DC  G "O3'" 1 
ATOM   6415 C  "C2'" . DC  E 2 16  ? 27.102  -16.473 47.689  1.00 63.96  ? 852 DC  G "C2'" 1 
ATOM   6416 C  "C1'" . DC  E 2 16  ? 26.165  -15.273 47.752  1.00 68.63  ? 852 DC  G "C1'" 1 
ATOM   6417 N  N1    . DC  E 2 16  ? 25.645  -14.807 46.434  1.00 69.03  ? 852 DC  G N1    1 
ATOM   6418 C  C2    . DC  E 2 16  ? 24.279  -14.535 46.299  1.00 64.35  ? 852 DC  G C2    1 
ATOM   6419 O  O2    . DC  E 2 16  ? 23.537  -14.689 47.276  1.00 64.32  ? 852 DC  G O2    1 
ATOM   6420 N  N3    . DC  E 2 16  ? 23.808  -14.109 45.101  1.00 66.85  ? 852 DC  G N3    1 
ATOM   6421 C  C4    . DC  E 2 16  ? 24.643  -13.955 44.073  1.00 66.70  ? 852 DC  G C4    1 
ATOM   6422 N  N4    . DC  E 2 16  ? 24.133  -13.533 42.911  1.00 62.47  ? 852 DC  G N4    1 
ATOM   6423 C  C5    . DC  E 2 16  ? 26.038  -14.228 44.190  1.00 68.76  ? 852 DC  G C5    1 
ATOM   6424 C  C6    . DC  E 2 16  ? 26.492  -14.647 45.377  1.00 67.83  ? 852 DC  G C6    1 
ATOM   6425 P  P     . DC  E 2 17  ? 27.770  -18.661 50.178  1.00 72.63  ? 853 DC  G P     1 
ATOM   6426 O  OP1   . DC  E 2 17  ? 28.106  -18.901 51.599  1.00 73.72  ? 853 DC  G OP1   1 
ATOM   6427 O  OP2   . DC  E 2 17  ? 28.758  -18.971 49.121  1.00 72.83  ? 853 DC  G OP2   1 
ATOM   6428 O  "O5'" . DC  E 2 17  ? 26.414  -19.438 49.853  1.00 74.75  ? 853 DC  G "O5'" 1 
ATOM   6429 C  "C5'" . DC  E 2 17  ? 25.198  -18.969 50.420  1.00 71.03  ? 853 DC  G "C5'" 1 
ATOM   6430 C  "C4'" . DC  E 2 17  ? 24.030  -19.346 49.531  1.00 68.03  ? 853 DC  G "C4'" 1 
ATOM   6431 O  "O4'" . DC  E 2 17  ? 23.940  -18.448 48.401  1.00 69.35  ? 853 DC  G "O4'" 1 
ATOM   6432 C  "C3'" . DC  E 2 17  ? 24.132  -20.739 48.921  1.00 76.63  ? 853 DC  G "C3'" 1 
ATOM   6433 O  "O3'" . DC  E 2 17  ? 23.293  -21.626 49.645  1.00 88.77  ? 853 DC  G "O3'" 1 
ATOM   6434 C  "C2'" . DC  E 2 17  ? 23.673  -20.570 47.470  1.00 70.70  ? 853 DC  G "C2'" 1 
ATOM   6435 C  "C1'" . DC  E 2 17  ? 23.188  -19.125 47.421  1.00 71.23  ? 853 DC  G "C1'" 1 
ATOM   6436 N  N1    . DC  E 2 17  ? 23.386  -18.460 46.103  1.00 68.75  ? 853 DC  G N1    1 
ATOM   6437 C  C2    . DC  E 2 17  ? 22.267  -18.024 45.385  1.00 72.06  ? 853 DC  G C2    1 
ATOM   6438 O  O2    . DC  E 2 17  ? 21.140  -18.200 45.862  1.00 71.86  ? 853 DC  G O2    1 
ATOM   6439 N  N3    . DC  E 2 17  ? 22.452  -17.418 44.187  1.00 70.82  ? 853 DC  G N3    1 
ATOM   6440 C  C4    . DC  E 2 17  ? 23.685  -17.248 43.709  1.00 69.59  ? 853 DC  G C4    1 
ATOM   6441 N  N4    . DC  E 2 17  ? 23.817  -16.646 42.522  1.00 71.39  ? 853 DC  G N4    1 
ATOM   6442 C  C5    . DC  E 2 17  ? 24.838  -17.686 44.426  1.00 65.97  ? 853 DC  G C5    1 
ATOM   6443 C  C6    . DC  E 2 17  ? 24.644  -18.282 45.608  1.00 62.21  ? 853 DC  G C6    1 
ATOM   6444 P  P     . DC  E 2 18  ? 23.357  -23.206 49.366  1.00 87.92  ? 854 DC  G P     1 
ATOM   6445 O  OP1   . DC  E 2 18  ? 22.965  -23.893 50.616  1.00 89.38  ? 854 DC  G OP1   1 
ATOM   6446 O  OP2   . DC  E 2 18  ? 24.663  -23.502 48.737  1.00 80.62  ? 854 DC  G OP2   1 
ATOM   6447 O  "O5'" . DC  E 2 18  ? 22.200  -23.447 48.290  1.00 81.09  ? 854 DC  G "O5'" 1 
ATOM   6448 C  "C5'" . DC  E 2 18  ? 20.890  -22.969 48.561  1.00 79.96  ? 854 DC  G "C5'" 1 
ATOM   6449 C  "C4'" . DC  E 2 18  ? 20.011  -23.089 47.332  1.00 81.58  ? 854 DC  G "C4'" 1 
ATOM   6450 O  "O4'" . DC  E 2 18  ? 20.391  -22.069 46.381  1.00 75.61  ? 854 DC  G "O4'" 1 
ATOM   6451 C  "C3'" . DC  E 2 18  ? 20.128  -24.429 46.612  1.00 74.18  ? 854 DC  G "C3'" 1 
ATOM   6452 O  "O3'" . DC  E 2 18  ? 18.915  -25.161 46.756  1.00 77.51  ? 854 DC  G "O3'" 1 
ATOM   6453 C  "C2'" . DC  E 2 18  ? 20.405  -24.081 45.149  1.00 74.13  ? 854 DC  G "C2'" 1 
ATOM   6454 C  "C1'" . DC  E 2 18  ? 20.216  -22.569 45.075  1.00 71.50  ? 854 DC  G "C1'" 1 
ATOM   6455 N  N1    . DC  E 2 18  ? 21.207  -21.897 44.198  1.00 72.61  ? 854 DC  G N1    1 
ATOM   6456 C  C2    . DC  E 2 18  ? 20.756  -21.084 43.157  1.00 74.20  ? 854 DC  G C2    1 
ATOM   6457 O  O2    . DC  E 2 18  ? 19.539  -20.942 42.989  1.00 78.01  ? 854 DC  G O2    1 
ATOM   6458 N  N3    . DC  E 2 18  ? 21.668  -20.475 42.362  1.00 71.82  ? 854 DC  G N3    1 
ATOM   6459 C  C4    . DC  E 2 18  ? 22.972  -20.654 42.577  1.00 70.95  ? 854 DC  G C4    1 
ATOM   6460 N  N4    . DC  E 2 18  ? 23.830  -20.030 41.764  1.00 71.67  ? 854 DC  G N4    1 
ATOM   6461 C  C5    . DC  E 2 18  ? 23.452  -21.480 43.636  1.00 67.52  ? 854 DC  G C5    1 
ATOM   6462 C  C6    . DC  E 2 18  ? 22.542  -22.077 44.414  1.00 73.70  ? 854 DC  G C6    1 
HETATM 6463 O  OP2   . RDG F 2 5   ? 17.000  -17.218 30.977  1.00 83.42  ? 860 RDG H OP2   1 
HETATM 6464 P  P     . RDG F 2 5   ? 18.507  -17.107 31.011  1.00 95.19  ? 860 RDG H P     1 
HETATM 6465 O  OP1   . RDG F 2 5   ? 19.145  -18.560 31.100  1.00 88.51  ? 860 RDG H OP1   1 
HETATM 6466 O  "O5'" . RDG F 2 5   ? 18.942  -16.273 32.253  1.00 95.40  ? 860 RDG H "O5'" 1 
HETATM 6467 C  "C5'" . RDG F 2 5   ? 17.973  -15.627 33.041  1.00 90.30  ? 860 RDG H "C5'" 1 
HETATM 6468 C  "C4'" . RDG F 2 5   ? 17.447  -16.346 34.147  1.00 93.50  ? 860 RDG H "C4'" 1 
HETATM 6469 C  "C3'" . RDG F 2 5   ? 16.999  -15.418 35.194  1.00 92.93  ? 860 RDG H "C3'" 1 
HETATM 6470 O  "O3'" . RDG F 2 5   ? 15.854  -15.894 35.732  1.00 95.26  ? 860 RDG H "O3'" 1 
HETATM 6471 C  "C2'" . RDG F 2 5   ? 18.040  -15.471 36.203  1.00 85.81  ? 860 RDG H "C2'" 1 
HETATM 6472 C  "C1'" . RDG F 2 5   ? 18.554  -16.865 36.090  1.00 82.94  ? 860 RDG H "C1'" 1 
HETATM 6473 O  "O4'" . RDG F 2 5   ? 18.486  -17.172 34.723  1.00 87.47  ? 860 RDG H "O4'" 1 
HETATM 6474 N  N9    . RDG F 2 5   ? 19.866  -16.959 36.638  1.00 81.68  ? 860 RDG H N9    1 
HETATM 6475 C  C4    . RDG F 2 5   ? 20.204  -17.644 37.819  1.00 76.37  ? 860 RDG H C4    1 
HETATM 6476 N  N3    . RDG F 2 5   ? 19.453  -18.376 38.732  1.00 73.84  ? 860 RDG H N3    1 
HETATM 6477 C  C2    . RDG F 2 5   ? 20.056  -18.945 39.809  1.00 75.52  ? 860 RDG H C2    1 
HETATM 6478 N  N1    . RDG F 2 5   ? 21.404  -18.822 40.034  1.00 74.10  ? 860 RDG H N1    1 
HETATM 6479 C  C6    . RDG F 2 5   ? 22.193  -18.111 39.165  1.00 73.11  ? 860 RDG H C6    1 
HETATM 6480 O  O6    . RDG F 2 5   ? 23.598  -17.985 39.403  1.00 73.08  ? 860 RDG H O6    1 
HETATM 6481 C  C5    . RDG F 2 5   ? 21.587  -17.492 38.008  1.00 74.07  ? 860 RDG H C5    1 
HETATM 6482 N  N7    . RDG F 2 5   ? 22.058  -16.723 36.951  1.00 75.41  ? 860 RDG H N7    1 
HETATM 6483 C  C8    . RDG F 2 5   ? 20.989  -16.410 36.130  1.00 79.19  ? 860 RDG H C8    1 
HETATM 6484 N  N2    . RDG F 2 5   ? 19.240  -19.701 40.741  1.00 75.33  ? 860 RDG H N2    1 
HETATM 6485 C  C11   . RDG F 2 5   ? 17.797  -19.719 40.588  1.00 75.89  ? 860 RDG H C11   1 
HETATM 6486 C  C10   . RDG F 2 5   ? 17.170  -20.961 39.968  1.00 77.47  ? 860 RDG H C10   1 
HETATM 6487 C  C9    . RDG F 2 5   ? 16.946  -22.190 40.648  1.00 64.67  ? 860 RDG H C9    1 
HETATM 6488 O  O7    . RDG F 2 5   ? 16.754  -21.050 38.713  1.00 80.41  ? 860 RDG H O7    1 
HETATM 6489 C  C12   . RDG F 2 5   ? 16.256  -22.254 38.469  1.00 74.82  ? 860 RDG H C12   1 
HETATM 6490 C  C7    . RDG F 2 5   ? 16.339  -23.037 39.641  1.00 67.75  ? 860 RDG H C7    1 
ATOM   6491 P  P     . DG  F 2 6   ? 14.784  -14.894 36.395  1.00 90.80  ? 861 DG  H P     1 
ATOM   6492 O  OP1   . DG  F 2 6   ? 13.890  -14.419 35.316  1.00 88.33  ? 861 DG  H OP1   1 
ATOM   6493 O  OP2   . DG  F 2 6   ? 15.510  -13.913 37.232  1.00 84.08  ? 861 DG  H OP2   1 
ATOM   6494 O  "O5'" . DG  F 2 6   ? 13.948  -15.838 37.376  1.00 89.63  ? 861 DG  H "O5'" 1 
ATOM   6495 C  "C5'" . DG  F 2 6   ? 14.651  -16.791 38.159  1.00 78.97  ? 861 DG  H "C5'" 1 
ATOM   6496 C  "C4'" . DG  F 2 6   ? 14.134  -16.826 39.583  1.00 73.13  ? 861 DG  H "C4'" 1 
ATOM   6497 O  "O4'" . DG  F 2 6   ? 15.245  -17.146 40.456  1.00 76.94  ? 861 DG  H "O4'" 1 
ATOM   6498 C  "C3'" . DG  F 2 6   ? 13.618  -15.502 40.122  1.00 78.18  ? 861 DG  H "C3'" 1 
ATOM   6499 O  "O3'" . DG  F 2 6   ? 12.848  -15.758 41.292  1.00 79.62  ? 861 DG  H "O3'" 1 
ATOM   6500 C  "C2'" . DG  F 2 6   ? 14.936  -14.811 40.445  1.00 75.80  ? 861 DG  H "C2'" 1 
ATOM   6501 C  "C1'" . DG  F 2 6   ? 15.699  -15.962 41.088  1.00 78.25  ? 861 DG  H "C1'" 1 
ATOM   6502 N  N9    . DG  F 2 6   ? 17.145  -15.853 40.927  1.00 79.85  ? 861 DG  H N9    1 
ATOM   6503 C  C8    . DG  F 2 6   ? 17.828  -15.313 39.863  1.00 75.93  ? 861 DG  H C8    1 
ATOM   6504 N  N7    . DG  F 2 6   ? 19.124  -15.354 40.006  1.00 74.71  ? 861 DG  H N7    1 
ATOM   6505 C  C5    . DG  F 2 6   ? 19.311  -15.959 41.242  1.00 73.90  ? 861 DG  H C5    1 
ATOM   6506 C  C6    . DG  F 2 6   ? 20.503  -16.274 41.935  1.00 74.31  ? 861 DG  H C6    1 
ATOM   6507 O  O6    . DG  F 2 6   ? 21.673  -16.072 41.579  1.00 79.22  ? 861 DG  H O6    1 
ATOM   6508 N  N1    . DG  F 2 6   ? 20.243  -16.883 43.161  1.00 74.34  ? 861 DG  H N1    1 
ATOM   6509 C  C2    . DG  F 2 6   ? 18.988  -17.154 43.654  1.00 71.98  ? 861 DG  H C2    1 
ATOM   6510 N  N2    . DG  F 2 6   ? 18.934  -17.746 44.856  1.00 73.43  ? 861 DG  H N2    1 
ATOM   6511 N  N3    . DG  F 2 6   ? 17.863  -16.864 43.015  1.00 74.02  ? 861 DG  H N3    1 
ATOM   6512 C  C4    . DG  F 2 6   ? 18.102  -16.271 41.821  1.00 76.16  ? 861 DG  H C4    1 
ATOM   6513 P  P     . DG  F 2 7   ? 12.135  -14.558 42.092  1.00 78.20  ? 862 DG  H P     1 
ATOM   6514 O  OP1   . DG  F 2 7   ? 10.722  -14.945 42.291  1.00 76.33  ? 862 DG  H OP1   1 
ATOM   6515 O  OP2   . DG  F 2 7   ? 12.447  -13.275 41.424  1.00 73.17  ? 862 DG  H OP2   1 
ATOM   6516 O  "O5'" . DG  F 2 7   ? 12.858  -14.574 43.517  1.00 74.05  ? 862 DG  H "O5'" 1 
ATOM   6517 C  "C5'" . DG  F 2 7   ? 12.762  -15.747 44.319  1.00 69.73  ? 862 DG  H "C5'" 1 
ATOM   6518 C  "C4'" . DG  F 2 7   ? 13.768  -15.735 45.457  1.00 74.64  ? 862 DG  H "C4'" 1 
ATOM   6519 O  "O4'" . DG  F 2 7   ? 15.113  -15.657 44.923  1.00 73.20  ? 862 DG  H "O4'" 1 
ATOM   6520 C  "C3'" . DG  F 2 7   ? 13.621  -14.577 46.440  1.00 69.28  ? 862 DG  H "C3'" 1 
ATOM   6521 O  "O3'" . DG  F 2 7   ? 13.500  -15.098 47.756  1.00 65.72  ? 862 DG  H "O3'" 1 
ATOM   6522 C  "C2'" . DG  F 2 7   ? 14.899  -13.757 46.268  1.00 76.32  ? 862 DG  H "C2'" 1 
ATOM   6523 C  "C1'" . DG  F 2 7   ? 15.882  -14.785 45.722  1.00 74.85  ? 862 DG  H "C1'" 1 
ATOM   6524 N  N9    . DG  F 2 7   ? 16.923  -14.205 44.881  1.00 74.70  ? 862 DG  H N9    1 
ATOM   6525 C  C8    . DG  F 2 7   ? 16.746  -13.542 43.690  1.00 76.00  ? 862 DG  H C8    1 
ATOM   6526 N  N7    . DG  F 2 7   ? 17.861  -13.133 43.153  1.00 75.44  ? 862 DG  H N7    1 
ATOM   6527 C  C5    . DG  F 2 7   ? 18.841  -13.552 44.043  1.00 75.76  ? 862 DG  H C5    1 
ATOM   6528 C  C6    . DG  F 2 7   ? 20.246  -13.392 43.989  1.00 69.10  ? 862 DG  H C6    1 
ATOM   6529 O  O6    . DG  F 2 7   ? 20.922  -12.831 43.115  1.00 69.40  ? 862 DG  H O6    1 
ATOM   6530 N  N1    . DG  F 2 7   ? 20.872  -13.967 45.093  1.00 65.40  ? 862 DG  H N1    1 
ATOM   6531 C  C2    . DG  F 2 7   ? 20.221  -14.612 46.118  1.00 69.04  ? 862 DG  H C2    1 
ATOM   6532 N  N2    . DG  F 2 7   ? 20.994  -15.102 47.098  1.00 70.29  ? 862 DG  H N2    1 
ATOM   6533 N  N3    . DG  F 2 7   ? 18.904  -14.768 46.180  1.00 71.46  ? 862 DG  H N3    1 
ATOM   6534 C  C4    . DG  F 2 7   ? 18.281  -14.214 45.112  1.00 75.34  ? 862 DG  H C4    1 
ATOM   6535 P  P     . DT  F 2 8   ? 13.232  -14.111 48.995  1.00 69.63  ? 863 DT  H P     1 
ATOM   6536 O  OP1   . DT  F 2 8   ? 12.503  -14.878 50.029  1.00 75.26  ? 863 DT  H OP1   1 
ATOM   6537 O  OP2   . DT  F 2 8   ? 12.656  -12.858 48.459  1.00 74.50  ? 863 DT  H OP2   1 
ATOM   6538 O  "O5'" . DT  F 2 8   ? 14.694  -13.807 49.563  1.00 77.06  ? 863 DT  H "O5'" 1 
ATOM   6539 C  "C5'" . DT  F 2 8   ? 15.476  -14.875 50.077  1.00 73.65  ? 863 DT  H "C5'" 1 
ATOM   6540 C  "C4'" . DT  F 2 8   ? 16.816  -14.357 50.557  1.00 71.90  ? 863 DT  H "C4'" 1 
ATOM   6541 O  "O4'" . DT  F 2 8   ? 17.605  -13.955 49.412  1.00 70.35  ? 863 DT  H "O4'" 1 
ATOM   6542 C  "C3'" . DT  F 2 8   ? 16.731  -13.145 51.482  1.00 66.38  ? 863 DT  H "C3'" 1 
ATOM   6543 O  "O3'" . DT  F 2 8   ? 17.328  -13.461 52.738  1.00 72.86  ? 863 DT  H "O3'" 1 
ATOM   6544 C  "C2'" . DT  F 2 8   ? 17.485  -12.038 50.745  1.00 64.38  ? 863 DT  H "C2'" 1 
ATOM   6545 C  "C1'" . DT  F 2 8   ? 18.348  -12.809 49.756  1.00 70.09  ? 863 DT  H "C1'" 1 
ATOM   6546 N  N1    . DT  F 2 8   ? 18.634  -12.052 48.511  1.00 71.07  ? 863 DT  H N1    1 
ATOM   6547 C  C2    . DT  F 2 8   ? 19.940  -11.903 48.112  1.00 68.83  ? 863 DT  H C2    1 
ATOM   6548 O  O2    . DT  F 2 8   ? 20.875  -12.369 48.736  1.00 70.60  ? 863 DT  H O2    1 
ATOM   6549 N  N3    . DT  F 2 8   ? 20.106  -11.190 46.952  1.00 67.20  ? 863 DT  H N3    1 
ATOM   6550 C  C4    . DT  F 2 8   ? 19.112  -10.624 46.174  1.00 68.08  ? 863 DT  H C4    1 
ATOM   6551 O  O4    . DT  F 2 8   ? 19.358  -10.000 45.147  1.00 63.96  ? 863 DT  H O4    1 
ATOM   6552 C  C5    . DT  F 2 8   ? 17.766  -10.819 46.653  1.00 70.96  ? 863 DT  H C5    1 
ATOM   6553 C  C7    . DT  F 2 8   ? 16.604  -10.251 45.892  1.00 71.33  ? 863 DT  H C7    1 
ATOM   6554 C  C6    . DT  F 2 8   ? 17.593  -11.514 47.784  1.00 71.23  ? 863 DT  H C6    1 
ATOM   6555 P  P     . DC  F 2 9   ? 17.314  -12.393 53.939  1.00 85.48  ? 864 DC  H P     1 
ATOM   6556 O  OP1   . DC  F 2 9   ? 17.154  -13.146 55.202  1.00 77.37  ? 864 DC  H OP1   1 
ATOM   6557 O  OP2   . DC  F 2 9   ? 16.349  -11.322 53.600  1.00 87.16  ? 864 DC  H OP2   1 
ATOM   6558 O  "O5'" . DC  F 2 9   ? 18.792  -11.785 53.925  1.00 80.43  ? 864 DC  H "O5'" 1 
ATOM   6559 C  "C5'" . DC  F 2 9   ? 19.904  -12.661 54.073  1.00 77.85  ? 864 DC  H "C5'" 1 
ATOM   6560 C  "C4'" . DC  F 2 9   ? 21.206  -11.940 53.775  1.00 74.57  ? 864 DC  H "C4'" 1 
ATOM   6561 O  "O4'" . DC  F 2 9   ? 21.240  -11.565 52.375  1.00 72.97  ? 864 DC  H "O4'" 1 
ATOM   6562 C  "C3'" . DC  F 2 9   ? 21.422  -10.660 54.578  1.00 72.30  ? 864 DC  H "C3'" 1 
ATOM   6563 O  "O3'" . DC  F 2 9   ? 22.642  -10.746 55.306  1.00 70.70  ? 864 DC  H "O3'" 1 
ATOM   6564 C  "C2'" . DC  F 2 9   ? 21.463  -9.547  53.532  1.00 74.95  ? 864 DC  H "C2'" 1 
ATOM   6565 C  "C1'" . DC  F 2 9   ? 21.833  -10.291 52.256  1.00 73.43  ? 864 DC  H "C1'" 1 
ATOM   6566 N  N1    . DC  F 2 9   ? 21.303  -9.635  51.032  1.00 67.11  ? 864 DC  H N1    1 
ATOM   6567 C  C2    . DC  F 2 9   ? 22.187  -9.111  50.084  1.00 66.97  ? 864 DC  H C2    1 
ATOM   6568 O  O2    . DC  F 2 9   ? 23.405  -9.204  50.280  1.00 69.38  ? 864 DC  H O2    1 
ATOM   6569 N  N3    . DC  F 2 9   ? 21.682  -8.514  48.976  1.00 65.95  ? 864 DC  H N3    1 
ATOM   6570 C  C4    . DC  F 2 9   ? 20.361  -8.434  48.804  1.00 63.79  ? 864 DC  H C4    1 
ATOM   6571 N  N4    . DC  F 2 9   ? 19.907  -7.838  47.697  1.00 64.16  ? 864 DC  H N4    1 
ATOM   6572 C  C5    . DC  F 2 9   ? 19.444  -8.961  49.760  1.00 64.87  ? 864 DC  H C5    1 
ATOM   6573 C  C6    . DC  F 2 9   ? 19.955  -9.546  50.848  1.00 67.94  ? 864 DC  H C6    1 
ATOM   6574 P  P     . DC  F 2 10  ? 23.112  -9.529  56.245  1.00 87.50  ? 865 DC  H P     1 
ATOM   6575 O  OP1   . DC  F 2 10  ? 23.973  -10.089 57.310  1.00 87.20  ? 865 DC  H OP1   1 
ATOM   6576 O  OP2   . DC  F 2 10  ? 21.912  -8.742  56.608  1.00 77.99  ? 865 DC  H OP2   1 
ATOM   6577 O  "O5'" . DC  F 2 10  ? 24.036  -8.642  55.288  1.00 80.52  ? 865 DC  H "O5'" 1 
ATOM   6578 C  "C5'" . DC  F 2 10  ? 25.167  -9.217  54.643  1.00 75.04  ? 865 DC  H "C5'" 1 
ATOM   6579 C  "C4'" . DC  F 2 10  ? 25.914  -8.146  53.871  1.00 71.30  ? 865 DC  H "C4'" 1 
ATOM   6580 O  "O4'" . DC  F 2 10  ? 25.193  -7.841  52.649  1.00 66.60  ? 865 DC  H "O4'" 1 
ATOM   6581 C  "C3'" . DC  F 2 10  ? 26.056  -6.832  54.636  1.00 73.51  ? 865 DC  H "C3'" 1 
ATOM   6582 O  "O3'" . DC  F 2 10  ? 27.404  -6.377  54.658  1.00 77.29  ? 865 DC  H "O3'" 1 
ATOM   6583 C  "C2'" . DC  F 2 10  ? 25.160  -5.855  53.883  1.00 70.06  ? 865 DC  H "C2'" 1 
ATOM   6584 C  "C1'" . DC  F 2 10  ? 25.132  -6.441  52.479  1.00 64.86  ? 865 DC  H "C1'" 1 
ATOM   6585 N  N1    . DC  F 2 10  ? 23.884  -6.089  51.750  1.00 62.26  ? 865 DC  H N1    1 
ATOM   6586 C  C2    . DC  F 2 10  ? 23.956  -5.349  50.565  1.00 64.12  ? 865 DC  H C2    1 
ATOM   6587 O  O2    . DC  F 2 10  ? 25.063  -5.006  50.134  1.00 64.50  ? 865 DC  H O2    1 
ATOM   6588 N  N3    . DC  F 2 10  ? 22.805  -5.034  49.920  1.00 64.55  ? 865 DC  H N3    1 
ATOM   6589 C  C4    . DC  F 2 10  ? 21.630  -5.424  50.418  1.00 62.51  ? 865 DC  H C4    1 
ATOM   6590 N  N4    . DC  F 2 10  ? 20.523  -5.089  49.747  1.00 61.70  ? 865 DC  H N4    1 
ATOM   6591 C  C5    . DC  F 2 10  ? 21.538  -6.174  51.627  1.00 61.21  ? 865 DC  H C5    1 
ATOM   6592 C  C6    . DC  F 2 10  ? 22.678  -6.479  52.253  1.00 64.30  ? 865 DC  H C6    1 
ATOM   6593 P  P     . DT  F 2 11  ? 27.841  -5.224  55.690  1.00 79.73  ? 866 DT  H P     1 
ATOM   6594 O  OP1   . DT  F 2 11  ? 29.257  -5.453  56.053  1.00 72.15  ? 866 DT  H OP1   1 
ATOM   6595 O  OP2   . DT  F 2 11  ? 26.805  -5.151  56.740  1.00 73.82  ? 866 DT  H OP2   1 
ATOM   6596 O  "O5'" . DT  F 2 11  ? 27.747  -3.876  54.837  1.00 72.82  ? 866 DT  H "O5'" 1 
ATOM   6597 C  "C5'" . DT  F 2 11  ? 28.693  -3.589  53.821  1.00 66.68  ? 866 DT  H "C5'" 1 
ATOM   6598 C  "C4'" . DT  F 2 11  ? 28.145  -2.512  52.904  1.00 59.97  ? 866 DT  H "C4'" 1 
ATOM   6599 O  "O4'" . DT  F 2 11  ? 26.824  -2.893  52.456  1.00 66.11  ? 866 DT  H "O4'" 1 
ATOM   6600 C  "C3'" . DT  F 2 11  ? 27.970  -1.137  53.542  1.00 56.50  ? 866 DT  H "C3'" 1 
ATOM   6601 O  "O3'" . DT  F 2 11  ? 29.014  -0.292  53.080  1.00 49.11  ? 866 DT  H "O3'" 1 
ATOM   6602 C  "C2'" . DT  F 2 11  ? 26.593  -0.652  53.079  1.00 56.72  ? 866 DT  H "C2'" 1 
ATOM   6603 C  "C1'" . DT  F 2 11  ? 26.152  -1.713  52.077  1.00 61.91  ? 866 DT  H "C1'" 1 
ATOM   6604 N  N1    . DT  F 2 11  ? 24.686  -1.985  52.069  1.00 62.67  ? 866 DT  H N1    1 
ATOM   6605 C  C2    . DT  F 2 11  ? 23.937  -1.588  50.983  1.00 65.96  ? 866 DT  H C2    1 
ATOM   6606 O  O2    . DT  F 2 11  ? 24.414  -1.018  50.018  1.00 67.41  ? 866 DT  H O2    1 
ATOM   6607 N  N3    . DT  F 2 11  ? 22.601  -1.884  51.071  1.00 66.70  ? 866 DT  H N3    1 
ATOM   6608 C  C4    . DT  F 2 11  ? 21.954  -2.524  52.112  1.00 60.15  ? 866 DT  H C4    1 
ATOM   6609 O  O4    . DT  F 2 11  ? 20.747  -2.745  52.098  1.00 63.17  ? 866 DT  H O4    1 
ATOM   6610 C  C5    . DT  F 2 11  ? 22.796  -2.913  53.215  1.00 57.90  ? 866 DT  H C5    1 
ATOM   6611 C  C7    . DT  F 2 11  ? 22.206  -3.614  54.403  1.00 55.68  ? 866 DT  H C7    1 
ATOM   6612 C  C6    . DT  F 2 11  ? 24.103  -2.628  53.142  1.00 65.29  ? 866 DT  H C6    1 
ATOM   6613 P  P     . DA  F 2 12  ? 29.156  1.207   53.639  1.00 63.81  ? 867 DA  H P     1 
ATOM   6614 O  OP1   . DA  F 2 12  ? 30.573  1.602   53.485  1.00 70.98  ? 867 DA  H OP1   1 
ATOM   6615 O  OP2   . DA  F 2 12  ? 28.513  1.266   54.970  1.00 60.71  ? 867 DA  H OP2   1 
ATOM   6616 O  "O5'" . DA  F 2 12  ? 28.299  2.079   52.610  1.00 64.66  ? 867 DA  H "O5'" 1 
ATOM   6617 C  "C5'" . DA  F 2 12  ? 28.620  2.027   51.228  1.00 51.83  ? 867 DA  H "C5'" 1 
ATOM   6618 C  "C4'" . DA  F 2 12  ? 27.824  3.060   50.453  1.00 58.12  ? 867 DA  H "C4'" 1 
ATOM   6619 O  "O4'" . DA  F 2 12  ? 26.467  2.589   50.261  1.00 65.44  ? 867 DA  H "O4'" 1 
ATOM   6620 C  "C3'" . DA  F 2 12  ? 27.731  4.428   51.120  1.00 53.39  ? 867 DA  H "C3'" 1 
ATOM   6621 O  "O3'" . DA  F 2 12  ? 28.005  5.420   50.139  1.00 51.02  ? 867 DA  H "O3'" 1 
ATOM   6622 C  "C2'" . DA  F 2 12  ? 26.299  4.493   51.653  1.00 54.46  ? 867 DA  H "C2'" 1 
ATOM   6623 C  "C1'" . DA  F 2 12  ? 25.533  3.529   50.754  1.00 59.04  ? 867 DA  H "C1'" 1 
ATOM   6624 N  N9    . DA  F 2 12  ? 24.487  2.778   51.444  1.00 62.76  ? 867 DA  H N9    1 
ATOM   6625 C  C8    . DA  F 2 12  ? 24.562  2.201   52.681  1.00 65.32  ? 867 DA  H C8    1 
ATOM   6626 N  N7    . DA  F 2 12  ? 23.464  1.580   53.044  1.00 62.38  ? 867 DA  H N7    1 
ATOM   6627 C  C5    . DA  F 2 12  ? 22.610  1.759   51.969  1.00 60.81  ? 867 DA  H C5    1 
ATOM   6628 C  C6    . DA  F 2 12  ? 21.286  1.342   51.725  1.00 61.73  ? 867 DA  H C6    1 
ATOM   6629 N  N6    . DA  F 2 12  ? 20.566  0.627   52.596  1.00 63.48  ? 867 DA  H N6    1 
ATOM   6630 N  N1    . DA  F 2 12  ? 20.727  1.690   50.548  1.00 59.64  ? 867 DA  H N1    1 
ATOM   6631 C  C2    . DA  F 2 12  ? 21.448  2.406   49.676  1.00 58.72  ? 867 DA  H C2    1 
ATOM   6632 N  N3    . DA  F 2 12  ? 22.697  2.854   49.793  1.00 61.55  ? 867 DA  H N3    1 
ATOM   6633 C  C4    . DA  F 2 12  ? 23.226  2.493   50.973  1.00 62.45  ? 867 DA  H C4    1 
ATOM   6634 P  P     . DG  F 2 13  ? 27.980  6.980   50.523  1.00 63.69  ? 868 DG  H P     1 
ATOM   6635 O  OP1   . DG  F 2 13  ? 29.015  7.656   49.709  1.00 68.83  ? 868 DG  H OP1   1 
ATOM   6636 O  OP2   . DG  F 2 13  ? 28.014  7.100   51.997  1.00 63.46  ? 868 DG  H OP2   1 
ATOM   6637 O  "O5'" . DG  F 2 13  ? 26.541  7.460   50.028  1.00 62.98  ? 868 DG  H "O5'" 1 
ATOM   6638 C  "C5'" . DG  F 2 13  ? 26.049  6.976   48.786  1.00 62.74  ? 868 DG  H "C5'" 1 
ATOM   6639 C  "C4'" . DG  F 2 13  ? 24.563  7.250   48.676  1.00 60.55  ? 868 DG  H "C4'" 1 
ATOM   6640 O  "O4'" . DG  F 2 13  ? 23.801  6.221   49.357  1.00 61.80  ? 868 DG  H "O4'" 1 
ATOM   6641 C  "C3'" . DG  F 2 13  ? 24.139  8.578   49.294  1.00 57.20  ? 868 DG  H "C3'" 1 
ATOM   6642 O  "O3'" . DG  F 2 13  ? 23.472  9.349   48.313  1.00 59.42  ? 868 DG  H "O3'" 1 
ATOM   6643 C  "C2'" . DG  F 2 13  ? 23.200  8.182   50.431  1.00 53.54  ? 868 DG  H "C2'" 1 
ATOM   6644 C  "C1'" . DG  F 2 13  ? 22.676  6.843   49.936  1.00 54.92  ? 868 DG  H "C1'" 1 
ATOM   6645 N  N9    . DG  F 2 13  ? 22.137  6.001   51.000  1.00 56.58  ? 868 DG  H N9    1 
ATOM   6646 C  C8    . DG  F 2 13  ? 22.773  5.600   52.150  1.00 58.75  ? 868 DG  H C8    1 
ATOM   6647 N  N7    . DG  F 2 13  ? 22.031  4.850   52.917  1.00 60.87  ? 868 DG  H N7    1 
ATOM   6648 C  C5    . DG  F 2 13  ? 20.826  4.746   52.231  1.00 60.70  ? 868 DG  H C5    1 
ATOM   6649 C  C6    . DG  F 2 13  ? 19.637  4.058   52.569  1.00 55.02  ? 868 DG  H C6    1 
ATOM   6650 O  O6    . DG  F 2 13  ? 19.403  3.377   53.577  1.00 54.79  ? 868 DG  H O6    1 
ATOM   6651 N  N1    . DG  F 2 13  ? 18.655  4.215   51.593  1.00 56.47  ? 868 DG  H N1    1 
ATOM   6652 C  C2    . DG  F 2 13  ? 18.804  4.945   50.437  1.00 54.94  ? 868 DG  H C2    1 
ATOM   6653 N  N2    . DG  F 2 13  ? 17.746  4.981   49.615  1.00 56.26  ? 868 DG  H N2    1 
ATOM   6654 N  N3    . DG  F 2 13  ? 19.913  5.595   50.109  1.00 55.20  ? 868 DG  H N3    1 
ATOM   6655 C  C4    . DG  F 2 13  ? 20.877  5.451   51.049  1.00 57.40  ? 868 DG  H C4    1 
ATOM   6656 P  P     . DG  F 2 14  ? 23.375  10.944  48.464  1.00 66.22  ? 869 DG  H P     1 
ATOM   6657 O  OP1   . DG  F 2 14  ? 24.199  11.547  47.393  1.00 63.15  ? 869 DG  H OP1   1 
ATOM   6658 O  OP2   . DG  F 2 14  ? 23.639  11.285  49.881  1.00 62.13  ? 869 DG  H OP2   1 
ATOM   6659 O  "O5'" . DG  F 2 14  ? 21.835  11.253  48.177  1.00 68.02  ? 869 DG  H "O5'" 1 
ATOM   6660 C  "C5'" . DG  F 2 14  ? 21.123  10.468  47.231  1.00 63.73  ? 869 DG  H "C5'" 1 
ATOM   6661 C  "C4'" . DG  F 2 14  ? 19.680  10.330  47.675  1.00 57.77  ? 869 DG  H "C4'" 1 
ATOM   6662 O  "O4'" . DG  F 2 14  ? 19.565  9.274   48.662  1.00 58.46  ? 869 DG  H "O4'" 1 
ATOM   6663 C  "C3'" . DG  F 2 14  ? 19.112  11.589  48.323  1.00 63.81  ? 869 DG  H "C3'" 1 
ATOM   6664 O  "O3'" . DG  F 2 14  ? 17.920  11.968  47.654  1.00 65.00  ? 869 DG  H "O3'" 1 
ATOM   6665 C  "C2'" . DG  F 2 14  ? 18.843  11.181  49.771  1.00 58.90  ? 869 DG  H "C2'" 1 
ATOM   6666 C  "C1'" . DG  F 2 14  ? 18.619  9.683   49.625  1.00 61.69  ? 869 DG  H "C1'" 1 
ATOM   6667 N  N9    . DG  F 2 14  ? 18.825  8.934   50.861  1.00 57.78  ? 869 DG  H N9    1 
ATOM   6668 C  C8    . DG  F 2 14  ? 19.986  8.820   51.586  1.00 55.97  ? 869 DG  H C8    1 
ATOM   6669 N  N7    . DG  F 2 14  ? 19.862  8.080   52.653  1.00 57.02  ? 869 DG  H N7    1 
ATOM   6670 C  C5    . DG  F 2 14  ? 18.532  7.677   52.635  1.00 58.34  ? 869 DG  H C5    1 
ATOM   6671 C  C6    . DG  F 2 14  ? 17.813  6.858   53.537  1.00 53.77  ? 869 DG  H C6    1 
ATOM   6672 O  O6    . DG  F 2 14  ? 18.222  6.307   54.568  1.00 54.72  ? 869 DG  H O6    1 
ATOM   6673 N  N1    . DG  F 2 14  ? 16.486  6.701   53.144  1.00 54.06  ? 869 DG  H N1    1 
ATOM   6674 C  C2    . DG  F 2 14  ? 15.925  7.263   52.022  1.00 52.66  ? 869 DG  H C2    1 
ATOM   6675 N  N2    . DG  F 2 14  ? 14.628  7.000   51.807  1.00 52.83  ? 869 DG  H N2    1 
ATOM   6676 N  N3    . DG  F 2 14  ? 16.588  8.032   51.169  1.00 54.95  ? 869 DG  H N3    1 
ATOM   6677 C  C4    . DG  F 2 14  ? 17.881  8.194   51.538  1.00 58.13  ? 869 DG  H C4    1 
ATOM   6678 P  P     . DA  F 2 15  ? 17.423  13.495  47.692  1.00 72.36  ? 870 DA  H P     1 
ATOM   6679 O  OP1   . DA  F 2 15  ? 17.398  13.995  46.299  1.00 64.32  ? 870 DA  H OP1   1 
ATOM   6680 O  OP2   . DA  F 2 15  ? 18.207  14.203  48.727  1.00 62.67  ? 870 DA  H OP2   1 
ATOM   6681 O  "O5'" . DA  F 2 15  ? 15.925  13.389  48.228  1.00 65.65  ? 870 DA  H "O5'" 1 
ATOM   6682 C  "C5'" . DA  F 2 15  ? 15.042  12.469  47.612  1.00 53.11  ? 870 DA  H "C5'" 1 
ATOM   6683 C  "C4'" . DA  F 2 15  ? 13.948  12.086  48.585  1.00 48.11  ? 870 DA  H "C4'" 1 
ATOM   6684 O  "O4'" . DA  F 2 15  ? 14.495  11.225  49.614  1.00 49.48  ? 870 DA  H "O4'" 1 
ATOM   6685 C  "C3'" . DA  F 2 15  ? 13.324  13.278  49.299  1.00 50.83  ? 870 DA  H "C3'" 1 
ATOM   6686 O  "O3'" . DA  F 2 15  ? 11.925  13.269  49.070  1.00 47.04  ? 870 DA  H "O3'" 1 
ATOM   6687 C  "C2'" . DA  F 2 15  ? 13.673  13.080  50.775  1.00 46.85  ? 870 DA  H "C2'" 1 
ATOM   6688 C  "C1'" . DA  F 2 15  ? 13.940  11.582  50.861  1.00 48.76  ? 870 DA  H "C1'" 1 
ATOM   6689 N  N9    . DA  F 2 15  ? 14.889  11.202  51.905  1.00 53.34  ? 870 DA  H N9    1 
ATOM   6690 C  C8    . DA  F 2 15  ? 16.189  11.606  52.027  1.00 53.90  ? 870 DA  H C8    1 
ATOM   6691 N  N7    . DA  F 2 15  ? 16.807  11.098  53.068  1.00 54.47  ? 870 DA  H N7    1 
ATOM   6692 C  C5    . DA  F 2 15  ? 15.846  10.302  53.669  1.00 54.55  ? 870 DA  H C5    1 
ATOM   6693 C  C6    . DA  F 2 15  ? 15.868  9.488   54.819  1.00 51.36  ? 870 DA  H C6    1 
ATOM   6694 N  N6    . DA  F 2 15  ? 16.947  9.343   55.596  1.00 51.45  ? 870 DA  H N6    1 
ATOM   6695 N  N1    . DA  F 2 15  ? 14.736  8.828   55.140  1.00 51.41  ? 870 DA  H N1    1 
ATOM   6696 C  C2    . DA  F 2 15  ? 13.659  8.975   54.361  1.00 47.04  ? 870 DA  H C2    1 
ATOM   6697 N  N3    . DA  F 2 15  ? 13.518  9.709   53.259  1.00 52.85  ? 870 DA  H N3    1 
ATOM   6698 C  C4    . DA  F 2 15  ? 14.658  10.353  52.964  1.00 54.94  ? 870 DA  H C4    1 
ATOM   6699 P  P     . DC  F 2 16  ? 11.031  14.535  49.490  1.00 45.09  ? 871 DC  H P     1 
ATOM   6700 O  OP1   . DC  F 2 16  ? 9.811   14.506  48.656  1.00 54.80  ? 871 DC  H OP1   1 
ATOM   6701 O  OP2   . DC  F 2 16  ? 11.901  15.732  49.489  1.00 60.07  ? 871 DC  H OP2   1 
ATOM   6702 O  "O5'" . DC  F 2 16  ? 10.596  14.205  50.990  1.00 49.98  ? 871 DC  H "O5'" 1 
ATOM   6703 C  "C5'" . DC  F 2 16  ? 9.961   12.961  51.241  1.00 50.34  ? 871 DC  H "C5'" 1 
ATOM   6704 C  "C4'" . DC  F 2 16  ? 9.984   12.625  52.718  1.00 44.14  ? 871 DC  H "C4'" 1 
ATOM   6705 O  "O4'" . DC  F 2 16  ? 11.321  12.275  53.137  1.00 48.39  ? 871 DC  H "O4'" 1 
ATOM   6706 C  "C3'" . DC  F 2 16  ? 9.592   13.768  53.644  1.00 43.00  ? 871 DC  H "C3'" 1 
ATOM   6707 O  "O3'" . DC  F 2 16  ? 8.192   13.716  53.884  1.00 49.47  ? 871 DC  H "O3'" 1 
ATOM   6708 C  "C2'" . DC  F 2 16  ? 10.401  13.503  54.915  1.00 42.47  ? 871 DC  H "C2'" 1 
ATOM   6709 C  "C1'" . DC  F 2 16  ? 11.317  12.336  54.546  1.00 46.59  ? 871 DC  H "C1'" 1 
ATOM   6710 N  N1    . DC  F 2 16  ? 12.719  12.478  55.039  1.00 51.42  ? 871 DC  H N1    1 
ATOM   6711 C  C2    . DC  F 2 16  ? 13.116  11.773  56.180  1.00 51.12  ? 871 DC  H C2    1 
ATOM   6712 O  O2    . DC  F 2 16  ? 12.297  11.048  56.756  1.00 46.89  ? 871 DC  H O2    1 
ATOM   6713 N  N3    . DC  F 2 16  ? 14.391  11.904  56.623  1.00 53.10  ? 871 DC  H N3    1 
ATOM   6714 C  C4    . DC  F 2 16  ? 15.245  12.696  55.974  1.00 51.66  ? 871 DC  H C4    1 
ATOM   6715 N  N4    . DC  F 2 16  ? 16.491  12.792  56.450  1.00 49.36  ? 871 DC  H N4    1 
ATOM   6716 C  C5    . DC  F 2 16  ? 14.859  13.423  54.809  1.00 46.02  ? 871 DC  H C5    1 
ATOM   6717 C  C6    . DC  F 2 16  ? 13.599  13.286  54.380  1.00 46.30  ? 871 DC  H C6    1 
ATOM   6718 P  P     . DC  F 2 17  ? 7.463   14.895  54.697  1.00 44.40  ? 872 DC  H P     1 
ATOM   6719 O  OP1   . DC  F 2 17  ? 6.024   14.848  54.356  1.00 61.24  ? 872 DC  H OP1   1 
ATOM   6720 O  OP2   . DC  F 2 17  ? 8.235   16.139  54.480  1.00 53.41  ? 872 DC  H OP2   1 
ATOM   6721 O  "O5'" . DC  F 2 17  ? 7.609   14.453  56.225  1.00 41.19  ? 872 DC  H "O5'" 1 
ATOM   6722 C  "C5'" . DC  F 2 17  ? 7.126   13.181  56.636  1.00 46.08  ? 872 DC  H "C5'" 1 
ATOM   6723 C  "C4'" . DC  F 2 17  ? 7.466   12.941  58.094  1.00 45.76  ? 872 DC  H "C4'" 1 
ATOM   6724 O  "O4'" . DC  F 2 17  ? 8.890   12.713  58.231  1.00 46.92  ? 872 DC  H "O4'" 1 
ATOM   6725 C  "C3'" . DC  F 2 17  ? 7.123   14.113  59.006  1.00 46.71  ? 872 DC  H "C3'" 1 
ATOM   6726 O  "O3'" . DC  F 2 17  ? 6.188   13.700  59.989  1.00 49.68  ? 872 DC  H "O3'" 1 
ATOM   6727 C  "C2'" . DC  F 2 17  ? 8.447   14.532  59.639  1.00 50.27  ? 872 DC  H "C2'" 1 
ATOM   6728 C  "C1'" . DC  F 2 17  ? 9.347   13.324  59.418  1.00 48.84  ? 872 DC  H "C1'" 1 
ATOM   6729 N  N1    . DC  F 2 17  ? 10.775  13.697  59.229  1.00 49.87  ? 872 DC  H N1    1 
ATOM   6730 C  C2    . DC  F 2 17  ? 11.738  13.252  60.140  1.00 45.67  ? 872 DC  H C2    1 
ATOM   6731 O  O2    . DC  F 2 17  ? 11.387  12.547  61.093  1.00 49.63  ? 872 DC  H O2    1 
ATOM   6732 N  N3    . DC  F 2 17  ? 13.033  13.606  59.947  1.00 49.65  ? 872 DC  H N3    1 
ATOM   6733 C  C4    . DC  F 2 17  ? 13.371  14.369  58.905  1.00 50.17  ? 872 DC  H C4    1 
ATOM   6734 N  N4    . DC  F 2 17  ? 14.659  14.693  58.757  1.00 49.05  ? 872 DC  H N4    1 
ATOM   6735 C  C5    . DC  F 2 17  ? 12.402  14.833  57.969  1.00 46.52  ? 872 DC  H C5    1 
ATOM   6736 C  C6    . DC  F 2 17  ? 11.130  14.478  58.169  1.00 46.98  ? 872 DC  H C6    1 
ATOM   6737 P  P     . DC  F 2 18  ? 5.441   14.795  60.895  1.00 69.06  ? 873 DC  H P     1 
ATOM   6738 O  OP1   . DC  F 2 18  ? 4.163   14.199  61.338  1.00 69.84  ? 873 DC  H OP1   1 
ATOM   6739 O  OP2   . DC  F 2 18  ? 5.454   16.080  60.158  1.00 51.43  ? 873 DC  H OP2   1 
ATOM   6740 O  "O5'" . DC  F 2 18  ? 6.391   14.954  62.169  1.00 55.13  ? 873 DC  H "O5'" 1 
ATOM   6741 C  "C5'" . DC  F 2 18  ? 6.510   13.881  63.090  1.00 50.62  ? 873 DC  H "C5'" 1 
ATOM   6742 C  "C4'" . DC  F 2 18  ? 7.518   14.239  64.164  1.00 55.22  ? 873 DC  H "C4'" 1 
ATOM   6743 O  "O4'" . DC  F 2 18  ? 8.834   14.322  63.565  1.00 52.44  ? 873 DC  H "O4'" 1 
ATOM   6744 C  "C3'" . DC  F 2 18  ? 7.263   15.584  64.838  1.00 52.36  ? 873 DC  H "C3'" 1 
ATOM   6745 O  "O3'" . DC  F 2 18  ? 6.982   15.393  66.218  1.00 53.16  ? 873 DC  H "O3'" 1 
ATOM   6746 C  "C2'" . DC  F 2 18  ? 8.552   16.383  64.639  1.00 55.20  ? 873 DC  H "C2'" 1 
ATOM   6747 C  "C1'" . DC  F 2 18  ? 9.568   15.324  64.231  1.00 54.83  ? 873 DC  H "C1'" 1 
ATOM   6748 N  N1    . DC  F 2 18  ? 10.606  15.839  63.299  1.00 50.02  ? 873 DC  H N1    1 
ATOM   6749 C  C2    . DC  F 2 18  ? 11.941  15.880  63.710  1.00 47.31  ? 873 DC  H C2    1 
ATOM   6750 O  O2    . DC  F 2 18  ? 12.236  15.484  64.845  1.00 50.50  ? 873 DC  H O2    1 
ATOM   6751 N  N3    . DC  F 2 18  ? 12.873  16.352  62.848  1.00 49.02  ? 873 DC  H N3    1 
ATOM   6752 C  C4    . DC  F 2 18  ? 12.517  16.769  61.633  1.00 50.31  ? 873 DC  H C4    1 
ATOM   6753 N  N4    . DC  F 2 18  ? 13.478  17.226  60.823  1.00 44.71  ? 873 DC  H N4    1 
ATOM   6754 C  C5    . DC  F 2 18  ? 11.160  16.737  61.196  1.00 43.60  ? 873 DC  H C5    1 
ATOM   6755 C  C6    . DC  F 2 18  ? 10.249  16.270  62.055  1.00 48.42  ? 873 DC  H C6    1 
HETATM 6756 O  O2    . 1FZ G 3 .   ? 28.370  24.320  15.664  1.00 53.80  ? 401 1FZ A O2    1 
HETATM 6757 O  O4    . 1FZ G 3 .   ? 32.808  24.949  15.635  1.00 54.36  ? 401 1FZ A O4    1 
HETATM 6758 C  C4    . 1FZ G 3 .   ? 31.738  24.764  15.016  1.00 49.28  ? 401 1FZ A C4    1 
HETATM 6759 C  C5    . 1FZ G 3 .   ? 31.732  24.686  13.536  1.00 53.12  ? 401 1FZ A C5    1 
HETATM 6760 C  C6    . 1FZ G 3 .   ? 30.522  24.480  12.889  1.00 53.08  ? 401 1FZ A C6    1 
HETATM 6761 C  C5M   . 1FZ G 3 .   ? 33.011  24.826  12.752  1.00 47.74  ? 401 1FZ A C5M   1 
HETATM 6762 N  N3    . 1FZ G 3 .   ? 30.586  24.635  15.680  1.00 53.12  ? 401 1FZ A N3    1 
HETATM 6763 C  C2    . 1FZ G 3 .   ? 29.436  24.439  15.022  1.00 53.32  ? 401 1FZ A C2    1 
HETATM 6764 N  N1    . 1FZ G 3 .   ? 29.404  24.353  13.613  1.00 54.41  ? 401 1FZ A N1    1 
HETATM 6765 C  "C1'" . 1FZ G 3 .   ? 28.122  24.144  12.940  1.00 54.66  ? 401 1FZ A "C1'" 1 
HETATM 6766 C  "C2'" . 1FZ G 3 .   ? 27.611  25.492  12.453  1.00 53.44  ? 401 1FZ A "C2'" 1 
HETATM 6767 C  "C3'" . 1FZ G 3 .   ? 27.640  25.405  10.940  1.00 54.03  ? 401 1FZ A "C3'" 1 
HETATM 6768 O  "O3'" . 1FZ G 3 .   ? 26.452  25.984  10.395  1.00 60.17  ? 401 1FZ A "O3'" 1 
HETATM 6769 O  "O4'" . 1FZ G 3 .   ? 28.295  23.309  11.792  1.00 60.81  ? 401 1FZ A "O4'" 1 
HETATM 6770 C  "C4'" . 1FZ G 3 .   ? 27.737  23.920  10.628  1.00 55.47  ? 401 1FZ A "C4'" 1 
HETATM 6771 C  "C5'" . 1FZ G 3 .   ? 28.653  23.647  9.444   1.00 49.65  ? 401 1FZ A "C5'" 1 
HETATM 6772 O  "O5'" . 1FZ G 3 .   ? 29.974  24.002  9.839   1.00 58.53  ? 401 1FZ A "O5'" 1 
HETATM 6773 P  PA    . 1FZ G 3 .   ? 31.037  24.531  8.758   1.00 54.11  ? 401 1FZ A PA    1 
HETATM 6774 O  O1A   . 1FZ G 3 .   ? 30.760  23.993  7.374   1.00 54.87  ? 401 1FZ A O1A   1 
HETATM 6775 O  O2A   . 1FZ G 3 .   ? 32.440  24.175  9.188   1.00 54.40  ? 401 1FZ A O2A   1 
HETATM 6776 N  N3A   . 1FZ G 3 .   ? 30.825  26.123  8.879   1.00 63.63  ? 401 1FZ A N3A   1 
HETATM 6777 P  PB    . 1FZ G 3 .   ? 29.868  26.958  7.888   1.00 53.84  ? 401 1FZ A PB    1 
HETATM 6778 O  O1B   . 1FZ G 3 .   ? 28.810  27.679  8.689   1.00 56.22  ? 401 1FZ A O1B   1 
HETATM 6779 O  O2B   . 1FZ G 3 .   ? 29.212  26.105  6.829   1.00 56.06  ? 401 1FZ A O2B   1 
HETATM 6780 O  O3B   . 1FZ G 3 .   ? 30.920  28.004  7.266   1.00 62.93  ? 401 1FZ A O3B   1 
HETATM 6781 P  PG    . 1FZ G 3 .   ? 31.297  27.979  5.702   1.00 64.31  ? 401 1FZ A PG    1 
HETATM 6782 O  O1G   . 1FZ G 3 .   ? 31.392  26.552  5.214   1.00 56.83  ? 401 1FZ A O1G   1 
HETATM 6783 O  O3G   . 1FZ G 3 .   ? 30.244  28.722  4.917   1.00 61.51  ? 401 1FZ A O3G   1 
HETATM 6784 O  O2G   . 1FZ G 3 .   ? 32.632  28.659  5.514   1.00 67.91  ? 401 1FZ A O2G   1 
HETATM 6785 MG MG    . MG  H 4 .   ? 29.666  24.530  5.652   1.00 46.18  ? 402 MG  A MG    1 
HETATM 6786 MG MG    . MG  I 4 .   ? 32.667  22.656  6.255   1.00 60.33  ? 403 MG  A MG    1 
HETATM 6787 O  O2    . 1FZ J 3 .   ? 13.437  19.256  66.712  1.00 53.62  ? 401 1FZ F O2    1 
HETATM 6788 O  O4    . 1FZ J 3 .   ? 12.611  19.792  62.336  1.00 46.90  ? 401 1FZ F O4    1 
HETATM 6789 C  C4    . 1FZ J 3 .   ? 12.196  19.670  63.509  1.00 46.56  ? 401 1FZ F C4    1 
HETATM 6790 C  C5    . 1FZ J 3 .   ? 10.741  19.688  63.794  1.00 49.14  ? 401 1FZ F C5    1 
HETATM 6791 C  C6    . 1FZ J 3 .   ? 10.322  19.551  65.109  1.00 49.28  ? 401 1FZ F C6    1 
HETATM 6792 C  C5M   . 1FZ J 3 .   ? 9.743   19.852  62.679  1.00 44.42  ? 401 1FZ F C5M   1 
HETATM 6793 N  N3    . 1FZ J 3 .   ? 13.054  19.522  64.523  1.00 46.22  ? 401 1FZ F N3    1 
HETATM 6794 C  C2    . 1FZ J 3 .   ? 12.613  19.393  65.781  1.00 46.73  ? 401 1FZ F C2    1 
HETATM 6795 N  N1    . 1FZ J 3 .   ? 11.233  19.404  66.079  1.00 51.24  ? 401 1FZ F N1    1 
HETATM 6796 C  "C1'" . 1FZ J 3 .   ? 10.796  19.261  67.469  1.00 56.39  ? 401 1FZ F "C1'" 1 
HETATM 6797 C  "C2'" . 1FZ J 3 .   ? 10.247  20.586  67.977  1.00 53.75  ? 401 1FZ F "C2'" 1 
HETATM 6798 C  "C3'" . 1FZ J 3 .   ? 8.783   20.327  68.278  1.00 52.98  ? 401 1FZ F "C3'" 1 
HETATM 6799 O  "O3'" . 1FZ J 3 .   ? 8.435   20.856  69.561  1.00 55.85  ? 401 1FZ F "O3'" 1 
HETATM 6800 O  "O4'" . 1FZ J 3 .   ? 9.742   18.297  67.541  1.00 59.51  ? 401 1FZ F "O4'" 1 
HETATM 6801 C  "C4'" . 1FZ J 3 .   ? 8.611   18.817  68.238  1.00 54.20  ? 401 1FZ F "C4'" 1 
HETATM 6802 C  "C5'" . 1FZ J 3 .   ? 7.351   18.434  67.478  1.00 49.46  ? 401 1FZ F "C5'" 1 
HETATM 6803 O  "O5'" . 1FZ J 3 .   ? 7.451   19.012  66.180  1.00 51.85  ? 401 1FZ F "O5'" 1 
HETATM 6804 P  PA    . 1FZ J 3 .   ? 6.135   19.478  65.384  1.00 51.93  ? 401 1FZ F PA    1 
HETATM 6805 O  O1A   . 1FZ J 3 .   ? 6.267   19.143  63.917  1.00 39.13  ? 401 1FZ F O1A   1 
HETATM 6806 O  O2A   . 1FZ J 3 .   ? 4.881   18.858  65.953  1.00 53.18  ? 401 1FZ F O2A   1 
HETATM 6807 N  N3A   . 1FZ J 3 .   ? 6.200   21.076  65.582  1.00 61.24  ? 401 1FZ F N3A   1 
HETATM 6808 P  PB    . 1FZ J 3 .   ? 5.410   21.851  66.755  1.00 51.59  ? 401 1FZ F PB    1 
HETATM 6809 O  O1B   . 1FZ J 3 .   ? 6.390   22.464  67.726  1.00 55.19  ? 401 1FZ F O1B   1 
HETATM 6810 O  O2B   . 1FZ J 3 .   ? 4.425   20.977  67.493  1.00 57.66  ? 401 1FZ F O2B   1 
HETATM 6811 O  O3B   . 1FZ J 3 .   ? 4.653   22.996  65.919  1.00 62.54  ? 401 1FZ F O3B   1 
HETATM 6812 P  PG    . 1FZ J 3 .   ? 3.065   22.887  65.697  1.00 49.99  ? 401 1FZ F PG    1 
HETATM 6813 O  O1G   . 1FZ J 3 .   ? 2.716   21.466  65.322  1.00 48.92  ? 401 1FZ F O1G   1 
HETATM 6814 O  O3G   . 1FZ J 3 .   ? 2.652   23.817  64.582  1.00 63.28  ? 401 1FZ F O3G   1 
HETATM 6815 O  O2G   . 1FZ J 3 .   ? 2.348   23.270  66.970  1.00 47.04  ? 401 1FZ F O2G   1 
HETATM 6816 MG MG    . MG  K 4 .   ? 3.222   19.393  67.906  1.00 39.87  ? 402 MG  F MG    1 
HETATM 6817 MG MG    . MG  L 4 .   ? 4.548   16.495  66.433  1.00 63.63  ? 403 MG  F MG    1 
HETATM 6818 O  O     . HOH M 5 .   ? 30.147  20.742  25.856  1.00 47.98  ? 501 HOH A O     1 
HETATM 6819 O  O     . HOH M 5 .   ? 34.275  24.908  5.579   1.00 54.83  ? 502 HOH A O     1 
HETATM 6820 O  O     . HOH M 5 .   ? 45.674  9.969   3.290   1.00 54.06  ? 503 HOH A O     1 
HETATM 6821 O  O     . HOH M 5 .   ? 34.561  23.479  2.941   1.00 55.75  ? 504 HOH A O     1 
HETATM 6822 O  O     . HOH M 5 .   ? 22.828  42.574  14.369  1.00 63.35  ? 505 HOH A O     1 
HETATM 6823 O  O     . HOH M 5 .   ? 18.071  30.181  16.196  1.00 64.11  ? 506 HOH A O     1 
HETATM 6824 O  O     . HOH M 5 .   ? 33.988  22.982  10.100  1.00 46.95  ? 507 HOH A O     1 
HETATM 6825 O  O     . HOH M 5 .   ? 34.306  26.053  -3.190  1.00 56.69  ? 508 HOH A O     1 
HETATM 6826 O  O     . HOH M 5 .   ? 32.017  6.493   12.704  1.00 56.16  ? 509 HOH A O     1 
HETATM 6827 O  O     . HOH M 5 .   ? 52.221  22.936  18.570  1.00 58.66  ? 510 HOH A O     1 
HETATM 6828 O  O     . HOH M 5 .   ? 14.372  0.566   29.960  1.00 63.90  ? 511 HOH A O     1 
HETATM 6829 O  O     . HOH M 5 .   ? 40.453  23.519  -13.423 1.00 50.20  ? 512 HOH A O     1 
HETATM 6830 O  O     . HOH M 5 .   ? 55.744  27.026  15.596  1.00 60.64  ? 513 HOH A O     1 
HETATM 6831 O  O     . HOH M 5 .   ? 49.758  10.019  14.676  1.00 61.96  ? 514 HOH A O     1 
HETATM 6832 O  O     . HOH M 5 .   ? 42.955  23.487  29.940  1.00 47.22  ? 515 HOH A O     1 
HETATM 6833 O  O     . HOH M 5 .   ? 18.188  12.019  44.624  1.00 66.16  ? 516 HOH A O     1 
HETATM 6834 O  O     . HOH M 5 .   ? 25.924  17.774  48.320  1.00 53.59  ? 517 HOH A O     1 
HETATM 6835 O  O     . HOH M 5 .   ? 37.259  6.010   4.364   1.00 60.08  ? 518 HOH A O     1 
HETATM 6836 O  O     . HOH N 5 .   ? -5.040  3.979   57.383  1.00 43.92  ? 501 HOH F O     1 
HETATM 6837 O  O     . HOH N 5 .   ? -12.207 14.106  45.006  1.00 54.58  ? 502 HOH F O     1 
HETATM 6838 O  O     . HOH N 5 .   ? 45.939  17.502  59.135  1.00 49.46  ? 503 HOH F O     1 
HETATM 6839 O  O     . HOH N 5 .   ? -17.481 6.326   72.743  1.00 66.98  ? 504 HOH F O     1 
HETATM 6840 O  O     . HOH N 5 .   ? 20.762  23.406  66.663  1.00 45.39  ? 505 HOH F O     1 
HETATM 6841 O  O     . HOH N 5 .   ? 4.398   15.778  52.792  1.00 52.05  ? 506 HOH F O     1 
HETATM 6842 O  O     . HOH N 5 .   ? -4.655  -2.718  71.776  1.00 53.61  ? 507 HOH F O     1 
HETATM 6843 O  O     . HOH N 5 .   ? 40.721  12.162  51.349  1.00 52.63  ? 508 HOH F O     1 
HETATM 6844 O  O     . HOH N 5 .   ? 25.088  1.177   61.190  1.00 54.66  ? 509 HOH F O     1 
HETATM 6845 O  O     . HOH N 5 .   ? 6.130   -0.810  71.339  1.00 55.32  ? 510 HOH F O     1 
HETATM 6846 O  O     . HOH N 5 .   ? 2.480   32.780  72.701  1.00 57.06  ? 511 HOH F O     1 
HETATM 6847 O  O     . HOH N 5 .   ? 7.228   18.035  81.599  1.00 51.38  ? 512 HOH F O     1 
HETATM 6848 O  O     . HOH N 5 .   ? 19.081  22.305  79.376  1.00 52.84  ? 513 HOH F O     1 
HETATM 6849 O  O     . HOH N 5 .   ? 3.199   6.939   79.522  1.00 53.55  ? 514 HOH F O     1 
HETATM 6850 O  O     . HOH N 5 .   ? 25.263  9.075   63.411  1.00 49.95  ? 515 HOH F O     1 
HETATM 6851 O  O     . HOH N 5 .   ? 43.377  5.363   55.861  1.00 49.95  ? 516 HOH F O     1 
HETATM 6852 O  O     . HOH N 5 .   ? 45.864  11.662  58.542  1.00 53.15  ? 517 HOH F O     1 
HETATM 6853 O  O     . HOH N 5 .   ? 19.513  -8.990  60.010  1.00 58.84  ? 518 HOH F O     1 
HETATM 6854 O  O     . HOH N 5 .   ? 19.031  -5.703  61.337  1.00 56.88  ? 519 HOH F O     1 
HETATM 6855 O  O     . HOH N 5 .   ? -0.800  -2.853  66.379  1.00 57.24  ? 520 HOH F O     1 
HETATM 6856 O  O     . HOH N 5 .   ? 36.096  -0.839  68.312  1.00 55.51  ? 521 HOH F O     1 
HETATM 6857 O  O     . HOH N 5 .   ? -0.044  18.135  63.181  1.00 54.89  ? 522 HOH F O     1 
HETATM 6858 O  O     . HOH N 5 .   ? 26.340  5.108   59.913  1.00 54.18  ? 523 HOH F O     1 
HETATM 6859 O  O     . HOH N 5 .   ? 2.573   20.587  63.640  1.00 61.21  ? 524 HOH F O     1 
HETATM 6860 O  O     . HOH N 5 .   ? -3.573  1.405   51.841  1.00 48.27  ? 525 HOH F O     1 
HETATM 6861 O  O     . HOH N 5 .   ? 3.611   8.388   54.981  1.00 50.17  ? 526 HOH F O     1 
HETATM 6862 O  O     . HOH N 5 .   ? 35.680  14.516  47.794  1.00 60.00  ? 527 HOH F O     1 
HETATM 6863 O  O     . HOH N 5 .   ? -1.883  28.070  72.213  1.00 44.67  ? 528 HOH F O     1 
HETATM 6864 O  O     . HOH N 5 .   ? 3.433   18.071  63.702  1.00 57.03  ? 529 HOH F O     1 
HETATM 6865 O  O     . HOH N 5 .   ? -14.510 10.125  60.486  1.00 46.50  ? 530 HOH F O     1 
HETATM 6866 O  O     . HOH N 5 .   ? 3.106   11.034  71.676  1.00 52.02  ? 531 HOH F O     1 
HETATM 6867 O  O     . HOH N 5 .   ? 0.385   28.532  72.343  1.00 53.70  ? 532 HOH F O     1 
HETATM 6868 O  O     . HOH N 5 .   ? -17.555 -0.542  67.647  1.00 64.05  ? 533 HOH F O     1 
HETATM 6869 O  O     . HOH N 5 .   ? 10.670  1.297   64.031  1.00 57.41  ? 534 HOH F O     1 
HETATM 6870 O  O     . HOH N 5 .   ? 5.116   5.238   75.500  1.00 54.21  ? 535 HOH F O     1 
HETATM 6871 O  O     . HOH N 5 .   ? -8.950  3.583   53.321  1.00 52.82  ? 536 HOH F O     1 
HETATM 6872 O  O     . HOH N 5 .   ? 24.815  8.996   53.947  1.00 50.74  ? 537 HOH F O     1 
HETATM 6873 O  O     . HOH N 5 .   ? 8.071   9.170   50.786  1.00 46.63  ? 538 HOH F O     1 
HETATM 6874 O  O     . HOH N 5 .   ? 31.887  -6.733  59.226  1.00 58.79  ? 539 HOH F O     1 
HETATM 6875 O  O     . HOH N 5 .   ? 16.300  -2.517  79.172  1.00 55.72  ? 540 HOH F O     1 
HETATM 6876 O  O     . HOH O 5 .   ? 32.147  24.204  29.126  1.00 49.20  ? 901 HOH B O     1 
HETATM 6877 O  O     . HOH O 5 .   ? 22.460  19.403  25.777  1.00 55.34  ? 902 HOH B O     1 
HETATM 6878 O  O     . HOH O 5 .   ? 34.005  20.511  23.243  1.00 51.43  ? 903 HOH B O     1 
HETATM 6879 O  O     . HOH O 5 .   ? 35.781  12.654  22.317  1.00 50.55  ? 904 HOH B O     1 
HETATM 6880 O  O     . HOH P 5 .   ? 34.616  23.159  6.673   1.00 58.76  ? 901 HOH C O     1 
HETATM 6881 O  O     . HOH P 5 .   ? 37.915  15.366  23.068  1.00 43.95  ? 902 HOH C O     1 
HETATM 6882 O  O     . HOH P 5 .   ? 36.935  23.658  17.012  1.00 43.60  ? 903 HOH C O     1 
HETATM 6883 O  O     . HOH P 5 .   ? 49.777  17.074  21.481  1.00 61.33  ? 904 HOH C O     1 
HETATM 6884 O  O     . HOH P 5 .   ? 50.567  20.479  22.687  1.00 57.37  ? 905 HOH C O     1 
HETATM 6885 O  O     . HOH P 5 .   ? 39.964  16.610  23.200  1.00 52.60  ? 906 HOH C O     1 
HETATM 6886 O  O     . HOH Q 5 .   ? 26.302  20.869  67.649  1.00 49.87  ? 901 HOH G O     1 
HETATM 6887 O  O     . HOH Q 5 .   ? 24.696  -10.248 41.222  1.00 49.52  ? 902 HOH G O     1 
HETATM 6888 O  O     . HOH Q 5 .   ? 19.124  -5.092  45.892  1.00 59.37  ? 903 HOH G O     1 
HETATM 6889 O  O     . HOH Q 5 .   ? 20.192  16.289  59.881  1.00 44.73  ? 904 HOH G O     1 
HETATM 6890 O  O     . HOH Q 5 .   ? 11.323  -0.727  52.751  1.00 51.55  ? 905 HOH G O     1 
HETATM 6891 O  O     . HOH Q 5 .   ? 19.165  20.665  58.005  1.00 38.12  ? 906 HOH G O     1 
HETATM 6892 O  O     . HOH Q 5 .   ? 19.206  7.765   57.945  1.00 45.41  ? 907 HOH G O     1 
HETATM 6893 O  O     . HOH Q 5 .   ? 9.254   6.726   55.541  1.00 51.54  ? 908 HOH G O     1 
HETATM 6894 O  O     . HOH Q 5 .   ? 9.516   4.577   46.284  1.00 47.10  ? 909 HOH G O     1 
HETATM 6895 O  O     . HOH Q 5 .   ? 12.898  -1.332  47.061  1.00 55.64  ? 910 HOH G O     1 
HETATM 6896 O  O     . HOH Q 5 .   ? 17.079  -1.820  52.998  1.00 50.48  ? 911 HOH G O     1 
HETATM 6897 O  O     . HOH R 5 .   ? 3.708   16.440  54.816  1.00 58.03  ? 901 HOH H O     1 
HETATM 6898 O  O     . HOH R 5 .   ? 13.114  18.609  58.311  1.00 41.90  ? 902 HOH H O     1 
HETATM 6899 O  O     . HOH R 5 .   ? 17.876  -5.687  50.650  1.00 54.46  ? 903 HOH H O     1 
HETATM 6900 O  O     . HOH R 5 .   ? 12.888  -15.855 52.493  1.00 57.35  ? 904 HOH H O     1 
HETATM 6901 O  O     . HOH R 5 .   ? 19.962  6.171   55.937  1.00 46.69  ? 905 HOH H O     1 
HETATM 6902 O  O     . HOH R 5 .   ? 22.312  0.499   55.116  1.00 59.26  ? 906 HOH H O     1 
HETATM 6903 O  O     . HOH R 5 .   ? 18.878  -9.101  43.633  1.00 66.16  ? 907 HOH H O     1 
HETATM 6904 O  O     . HOH R 5 .   ? 10.387  17.717  54.365  1.00 49.79  ? 908 HOH H O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   0   0   GLY GLY A . n 
A 1 2   SER 2   1   1   SER SER A . n 
A 1 3   ARG 3   2   2   ARG ARG A . n 
A 1 4   LYS 4   3   3   LYS LYS A . n 
A 1 5   ILE 5   4   4   ILE ILE A . n 
A 1 6   ILE 6   5   5   ILE ILE A . n 
A 1 7   HIS 7   6   6   HIS HIS A . n 
A 1 8   VAL 8   7   7   VAL VAL A . n 
A 1 9   ASP 9   8   8   ASP ASP A . n 
A 1 10  MET 10  9   9   MET MET A . n 
A 1 11  ASP 11  10  10  ASP ASP A . n 
A 1 12  CYS 12  11  11  CYS CYS A . n 
A 1 13  PHE 13  12  12  PHE PHE A . n 
A 1 14  PHE 14  13  13  PHE PHE A . n 
A 1 15  ALA 15  14  14  ALA ALA A . n 
A 1 16  ALA 16  15  15  ALA ALA A . n 
A 1 17  VAL 17  16  16  VAL VAL A . n 
A 1 18  GLU 18  17  17  GLU GLU A . n 
A 1 19  MET 19  18  18  MET MET A . n 
A 1 20  ARG 20  19  19  ARG ARG A . n 
A 1 21  ASP 21  20  20  ASP ASP A . n 
A 1 22  ASN 22  21  21  ASN ASN A . n 
A 1 23  PRO 23  22  22  PRO PRO A . n 
A 1 24  ALA 24  23  23  ALA ALA A . n 
A 1 25  LEU 25  24  24  LEU LEU A . n 
A 1 26  ARG 26  25  25  ARG ARG A . n 
A 1 27  ASP 27  26  26  ASP ASP A . n 
A 1 28  ILE 28  27  27  ILE ILE A . n 
A 1 29  PRO 29  28  28  PRO PRO A . n 
A 1 30  ILE 30  29  29  ILE ILE A . n 
A 1 31  ALA 31  30  30  ALA ALA A . n 
A 1 32  ILE 32  31  31  ILE ILE A . n 
A 1 33  GLY 33  32  32  GLY GLY A . n 
A 1 34  GLY 34  33  33  GLY GLY A . n 
A 1 35  SER 35  34  34  SER SER A . n 
A 1 36  ARG 36  35  35  ARG ARG A . n 
A 1 37  GLU 37  36  36  GLU GLU A . n 
A 1 38  ARG 38  37  37  ARG ARG A . n 
A 1 39  ARG 39  38  38  ARG ARG A . n 
A 1 40  GLY 40  39  39  GLY GLY A . n 
A 1 41  VAL 41  40  40  VAL VAL A . n 
A 1 42  ILE 42  41  41  ILE ILE A . n 
A 1 43  SER 43  42  42  SER SER A . n 
A 1 44  THR 44  43  43  THR THR A . n 
A 1 45  ALA 45  44  44  ALA ALA A . n 
A 1 46  ASN 46  45  45  ASN ASN A . n 
A 1 47  TYR 47  46  46  TYR TYR A . n 
A 1 48  PRO 48  47  47  PRO PRO A . n 
A 1 49  ALA 49  48  48  ALA ALA A . n 
A 1 50  ARG 50  49  49  ARG ARG A . n 
A 1 51  LYS 51  50  50  LYS LYS A . n 
A 1 52  PHE 52  51  51  PHE PHE A . n 
A 1 53  GLY 53  52  52  GLY GLY A . n 
A 1 54  VAL 54  53  53  VAL VAL A . n 
A 1 55  ARG 55  54  54  ARG ARG A . n 
A 1 56  SER 56  55  55  SER SER A . n 
A 1 57  ALA 57  56  56  ALA ALA A . n 
A 1 58  MET 58  57  57  MET MET A . n 
A 1 59  PRO 59  58  58  PRO PRO A . n 
A 1 60  THR 60  59  59  THR THR A . n 
A 1 61  GLY 61  60  60  GLY GLY A . n 
A 1 62  MET 62  61  61  MET MET A . n 
A 1 63  ALA 63  62  62  ALA ALA A . n 
A 1 64  LEU 64  63  63  LEU LEU A . n 
A 1 65  ALA 65  64  64  ALA ALA A . n 
A 1 66  LEU 66  65  65  LEU LEU A . n 
A 1 67  CYS 67  66  66  CYS CYS A . n 
A 1 68  PRO 68  67  67  PRO PRO A . n 
A 1 69  HIS 69  68  68  HIS HIS A . n 
A 1 70  LEU 70  69  69  LEU LEU A . n 
A 1 71  THR 71  70  70  THR THR A . n 
A 1 72  LEU 72  71  71  LEU LEU A . n 
A 1 73  LEU 73  72  72  LEU LEU A . n 
A 1 74  PRO 74  73  73  PRO PRO A . n 
A 1 75  GLY 75  74  74  GLY GLY A . n 
A 1 76  ARG 76  75  75  ARG ARG A . n 
A 1 77  PHE 77  76  76  PHE PHE A . n 
A 1 78  ASP 78  77  77  ASP ASP A . n 
A 1 79  ALA 79  78  78  ALA ALA A . n 
A 1 80  TYR 80  79  79  TYR TYR A . n 
A 1 81  LYS 81  80  80  LYS LYS A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  ALA 83  82  82  ALA ALA A . n 
A 1 84  SER 84  83  83  SER SER A . n 
A 1 85  ASN 85  84  84  ASN ASN A . n 
A 1 86  HIS 86  85  85  HIS HIS A . n 
A 1 87  ILE 87  86  86  ILE ILE A . n 
A 1 88  ARG 88  87  87  ARG ARG A . n 
A 1 89  GLU 89  88  88  GLU GLU A . n 
A 1 90  ILE 90  89  89  ILE ILE A . n 
A 1 91  PHE 91  90  90  PHE PHE A . n 
A 1 92  SER 92  91  91  SER SER A . n 
A 1 93  ARG 93  92  92  ARG ARG A . n 
A 1 94  TYR 94  93  93  TYR TYR A . n 
A 1 95  THR 95  94  94  THR THR A . n 
A 1 96  SER 96  95  95  SER SER A . n 
A 1 97  ARG 97  96  96  ARG ARG A . n 
A 1 98  ILE 98  97  97  ILE ILE A . n 
A 1 99  GLU 99  98  98  GLU GLU A . n 
A 1 100 PRO 100 99  99  PRO PRO A . n 
A 1 101 LEU 101 100 100 LEU LEU A . n 
A 1 102 SER 102 101 101 SER SER A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 ASP 104 103 103 ASP ASP A . n 
A 1 105 GLU 105 104 104 GLU GLU A . n 
A 1 106 ALA 106 105 105 ALA ALA A . n 
A 1 107 TYR 107 106 106 TYR TYR A . n 
A 1 108 LEU 108 107 107 LEU LEU A . n 
A 1 109 ASP 109 108 108 ASP ASP A . n 
A 1 110 VAL 110 109 109 VAL VAL A . n 
A 1 111 THR 111 110 110 THR THR A . n 
A 1 112 ASP 112 111 111 ASP ASP A . n 
A 1 113 SER 113 112 112 SER SER A . n 
A 1 114 VAL 114 113 113 VAL VAL A . n 
A 1 115 HIS 115 114 114 HIS HIS A . n 
A 1 116 CYS 116 115 115 CYS CYS A . n 
A 1 117 HIS 117 116 116 HIS HIS A . n 
A 1 118 GLY 118 117 117 GLY GLY A . n 
A 1 119 SER 119 118 118 SER SER A . n 
A 1 120 ALA 120 119 119 ALA ALA A . n 
A 1 121 THR 121 120 120 THR THR A . n 
A 1 122 LEU 122 121 121 LEU LEU A . n 
A 1 123 ILE 123 122 122 ILE ILE A . n 
A 1 124 ALA 124 123 123 ALA ALA A . n 
A 1 125 GLN 125 124 124 GLN GLN A . n 
A 1 126 GLU 126 125 125 GLU GLU A . n 
A 1 127 ILE 127 126 126 ILE ILE A . n 
A 1 128 ARG 128 127 127 ARG ARG A . n 
A 1 129 GLN 129 128 128 GLN GLN A . n 
A 1 130 THR 130 129 129 THR THR A . n 
A 1 131 ILE 131 130 130 ILE ILE A . n 
A 1 132 PHE 132 131 131 PHE PHE A . n 
A 1 133 ASN 133 132 132 ASN ASN A . n 
A 1 134 GLU 134 133 133 GLU GLU A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 GLN 136 135 135 GLN GLN A . n 
A 1 137 LEU 137 136 136 LEU LEU A . n 
A 1 138 THR 138 137 137 THR THR A . n 
A 1 139 ALA 139 138 138 ALA ALA A . n 
A 1 140 SER 140 139 139 SER SER A . n 
A 1 141 ALA 141 140 140 ALA ALA A . n 
A 1 142 GLY 142 141 141 GLY GLY A . n 
A 1 143 VAL 143 142 142 VAL VAL A . n 
A 1 144 ALA 144 143 143 ALA ALA A . n 
A 1 145 PRO 145 144 144 PRO PRO A . n 
A 1 146 VAL 146 145 145 VAL VAL A . n 
A 1 147 LYS 147 146 146 LYS LYS A . n 
A 1 148 PHE 148 147 147 PHE PHE A . n 
A 1 149 LEU 149 148 148 LEU LEU A . n 
A 1 150 ALA 150 149 149 ALA ALA A . n 
A 1 151 LYS 151 150 150 LYS LYS A . n 
A 1 152 ILE 152 151 151 ILE ILE A . n 
A 1 153 ALA 153 152 152 ALA ALA A . n 
A 1 154 SER 154 153 153 SER SER A . n 
A 1 155 ASP 155 154 154 ASP ASP A . n 
A 1 156 MET 156 155 155 MET MET A . n 
A 1 157 ASN 157 156 156 ASN ASN A . n 
A 1 158 LYS 158 157 157 LYS LYS A . n 
A 1 159 PRO 159 158 158 PRO PRO A . n 
A 1 160 ASN 160 159 159 ASN ASN A . n 
A 1 161 GLY 161 160 160 GLY GLY A . n 
A 1 162 GLN 162 161 161 GLN GLN A . n 
A 1 163 PHE 163 162 162 PHE PHE A . n 
A 1 164 VAL 164 163 163 VAL VAL A . n 
A 1 165 ILE 165 164 164 ILE ILE A . n 
A 1 166 THR 166 165 165 THR THR A . n 
A 1 167 PRO 167 166 166 PRO PRO A . n 
A 1 168 ALA 168 167 167 ALA ALA A . n 
A 1 169 GLU 169 168 168 GLU GLU A . n 
A 1 170 VAL 170 169 169 VAL VAL A . n 
A 1 171 PRO 171 170 170 PRO PRO A . n 
A 1 172 ALA 172 171 171 ALA ALA A . n 
A 1 173 PHE 173 172 172 PHE PHE A . n 
A 1 174 LEU 174 173 173 LEU LEU A . n 
A 1 175 GLN 175 174 174 GLN GLN A . n 
A 1 176 THR 176 175 175 THR THR A . n 
A 1 177 LEU 177 176 176 LEU LEU A . n 
A 1 178 PRO 178 177 177 PRO PRO A . n 
A 1 179 LEU 179 178 178 LEU LEU A . n 
A 1 180 ALA 180 179 179 ALA ALA A . n 
A 1 181 LYS 181 180 180 LYS LYS A . n 
A 1 182 ILE 182 181 181 ILE ILE A . n 
A 1 183 PRO 183 182 182 PRO PRO A . n 
A 1 184 GLY 184 183 183 GLY GLY A . n 
A 1 185 VAL 185 184 184 VAL VAL A . n 
A 1 186 GLY 186 185 185 GLY GLY A . n 
A 1 187 LYS 187 186 186 LYS LYS A . n 
A 1 188 VAL 188 187 187 VAL VAL A . n 
A 1 189 SER 189 188 188 SER SER A . n 
A 1 190 ALA 190 189 189 ALA ALA A . n 
A 1 191 ALA 191 190 190 ALA ALA A . n 
A 1 192 LYS 192 191 191 LYS LYS A . n 
A 1 193 LEU 193 192 192 LEU LEU A . n 
A 1 194 GLU 194 193 193 GLU GLU A . n 
A 1 195 ALA 195 194 194 ALA ALA A . n 
A 1 196 MET 196 195 195 MET MET A . n 
A 1 197 GLY 197 196 196 GLY GLY A . n 
A 1 198 LEU 198 197 197 LEU LEU A . n 
A 1 199 ARG 199 198 198 ARG ARG A . n 
A 1 200 THR 200 199 199 THR THR A . n 
A 1 201 CYS 201 200 200 CYS CYS A . n 
A 1 202 GLY 202 201 201 GLY GLY A . n 
A 1 203 ASP 203 202 202 ASP ASP A . n 
A 1 204 VAL 204 203 203 VAL VAL A . n 
A 1 205 GLN 205 204 204 GLN GLN A . n 
A 1 206 ALA 206 205 205 ALA ALA A . n 
A 1 207 CYS 207 206 206 CYS CYS A . n 
A 1 208 ASP 208 207 207 ASP ASP A . n 
A 1 209 LEU 209 208 208 LEU LEU A . n 
A 1 210 VAL 210 209 209 VAL VAL A . n 
A 1 211 MET 211 210 210 MET MET A . n 
A 1 212 LEU 212 211 211 LEU LEU A . n 
A 1 213 LEU 213 212 212 LEU LEU A . n 
A 1 214 LYS 214 213 213 LYS LYS A . n 
A 1 215 ARG 215 214 214 ARG ARG A . n 
A 1 216 PHE 216 215 215 PHE PHE A . n 
A 1 217 GLY 217 216 216 GLY GLY A . n 
A 1 218 LYS 218 217 217 LYS LYS A . n 
A 1 219 PHE 219 218 218 PHE PHE A . n 
A 1 220 GLY 220 219 219 GLY GLY A . n 
A 1 221 ARG 221 220 220 ARG ARG A . n 
A 1 222 ILE 222 221 221 ILE ILE A . n 
A 1 223 LEU 223 222 222 LEU LEU A . n 
A 1 224 TRP 224 223 223 TRP TRP A . n 
A 1 225 GLU 225 224 224 GLU GLU A . n 
A 1 226 ARG 226 225 225 ARG ARG A . n 
A 1 227 SER 227 226 226 SER SER A . n 
A 1 228 GLN 228 227 227 GLN GLN A . n 
A 1 229 GLY 229 228 228 GLY GLY A . n 
A 1 230 ILE 230 229 229 ILE ILE A . n 
A 1 231 ASP 231 230 230 ASP ASP A . n 
A 1 232 GLU 232 231 231 GLU GLU A . n 
A 1 233 ARG 233 232 232 ARG ARG A . n 
A 1 234 ASP 234 233 233 ASP ASP A . n 
A 1 235 VAL 235 234 234 VAL VAL A . n 
A 1 236 ASN 236 235 235 ASN ASN A . n 
A 1 237 SER 237 236 236 SER SER A . n 
A 1 238 GLU 238 237 237 GLU GLU A . n 
A 1 239 ARG 239 238 238 ARG ARG A . n 
A 1 240 LEU 240 239 239 LEU LEU A . n 
A 1 241 ARG 241 240 240 ARG ARG A . n 
A 1 242 LYS 242 241 241 LYS LYS A . n 
A 1 243 SER 243 242 242 SER SER A . n 
A 1 244 VAL 244 243 243 VAL VAL A . n 
A 1 245 GLY 245 244 244 GLY GLY A . n 
A 1 246 VAL 246 245 245 VAL VAL A . n 
A 1 247 GLU 247 246 246 GLU GLU A . n 
A 1 248 ARG 248 247 247 ARG ARG A . n 
A 1 249 THR 249 248 248 THR THR A . n 
A 1 250 MET 250 249 249 MET MET A . n 
A 1 251 ALA 251 250 250 ALA ALA A . n 
A 1 252 GLU 252 251 251 GLU GLU A . n 
A 1 253 ASP 253 252 252 ASP ASP A . n 
A 1 254 ILE 254 253 253 ILE ILE A . n 
A 1 255 HIS 255 254 254 HIS HIS A . n 
A 1 256 HIS 256 255 255 HIS HIS A . n 
A 1 257 TRP 257 256 256 TRP TRP A . n 
A 1 258 SER 258 257 257 SER SER A . n 
A 1 259 GLU 259 258 258 GLU GLU A . n 
A 1 260 CYS 260 259 259 CYS CYS A . n 
A 1 261 GLU 261 260 260 GLU GLU A . n 
A 1 262 ALA 262 261 261 ALA ALA A . n 
A 1 263 ILE 263 262 262 ILE ILE A . n 
A 1 264 ILE 264 263 263 ILE ILE A . n 
A 1 265 GLU 265 264 264 GLU GLU A . n 
A 1 266 ARG 266 265 265 ARG ARG A . n 
A 1 267 LEU 267 266 266 LEU LEU A . n 
A 1 268 TYR 268 267 267 TYR TYR A . n 
A 1 269 PRO 269 268 268 PRO PRO A . n 
A 1 270 GLU 270 269 269 GLU GLU A . n 
A 1 271 LEU 271 270 270 LEU LEU A . n 
A 1 272 GLU 272 271 271 GLU GLU A . n 
A 1 273 ARG 273 272 272 ARG ARG A . n 
A 1 274 ARG 274 273 273 ARG ARG A . n 
A 1 275 LEU 275 274 274 LEU LEU A . n 
A 1 276 ALA 276 275 275 ALA ALA A . n 
A 1 277 LYS 277 276 276 LYS LYS A . n 
A 1 278 VAL 278 277 277 VAL VAL A . n 
A 1 279 LYS 279 278 278 LYS LYS A . n 
A 1 280 PRO 280 279 279 PRO PRO A . n 
A 1 281 ASP 281 280 280 ASP ASP A . n 
A 1 282 LEU 282 281 281 LEU LEU A . n 
A 1 283 LEU 283 282 282 LEU LEU A . n 
A 1 284 ILE 284 283 283 ILE ILE A . n 
A 1 285 ALA 285 284 284 ALA ALA A . n 
A 1 286 ARG 286 285 285 ARG ARG A . n 
A 1 287 GLN 287 286 286 GLN GLN A . n 
A 1 288 GLY 288 287 287 GLY GLY A . n 
A 1 289 VAL 289 288 288 VAL VAL A . n 
A 1 290 LYS 290 289 289 LYS LYS A . n 
A 1 291 LEU 291 290 290 LEU LEU A . n 
A 1 292 LYS 292 291 291 LYS LYS A . n 
A 1 293 PHE 293 292 292 PHE PHE A . n 
A 1 294 ASP 294 293 293 ASP ASP A . n 
A 1 295 ASP 295 294 294 ASP ASP A . n 
A 1 296 PHE 296 295 295 PHE PHE A . n 
A 1 297 GLN 297 296 296 GLN GLN A . n 
A 1 298 GLN 298 297 297 GLN GLN A . n 
A 1 299 THR 299 298 298 THR THR A . n 
A 1 300 THR 300 299 299 THR THR A . n 
A 1 301 GLN 301 300 300 GLN GLN A . n 
A 1 302 GLU 302 301 301 GLU GLU A . n 
A 1 303 HIS 303 302 302 HIS HIS A . n 
A 1 304 VAL 304 303 303 VAL VAL A . n 
A 1 305 TRP 305 304 304 TRP TRP A . n 
A 1 306 PRO 306 305 305 PRO PRO A . n 
A 1 307 ARG 307 306 306 ARG ARG A . n 
A 1 308 LEU 308 307 307 LEU LEU A . n 
A 1 309 ASN 309 308 308 ASN ASN A . n 
A 1 310 LYS 310 309 309 LYS LYS A . n 
A 1 311 ALA 311 310 310 ALA ALA A . n 
A 1 312 ASP 312 311 311 ASP ASP A . n 
A 1 313 LEU 313 312 312 LEU LEU A . n 
A 1 314 ILE 314 313 313 ILE ILE A . n 
A 1 315 ALA 315 314 314 ALA ALA A . n 
A 1 316 THR 316 315 315 THR THR A . n 
A 1 317 ALA 317 316 316 ALA ALA A . n 
A 1 318 ARG 318 317 317 ARG ARG A . n 
A 1 319 LYS 319 318 318 LYS LYS A . n 
A 1 320 THR 320 319 319 THR THR A . n 
A 1 321 TRP 321 320 320 TRP TRP A . n 
A 1 322 ASP 322 321 321 ASP ASP A . n 
A 1 323 GLU 323 322 322 GLU GLU A . n 
A 1 324 ARG 324 323 323 ARG ARG A . n 
A 1 325 ARG 325 324 324 ARG ARG A . n 
A 1 326 GLY 326 325 325 GLY GLY A . n 
A 1 327 GLY 327 326 326 GLY GLY A . n 
A 1 328 ARG 328 327 327 ARG ARG A . n 
A 1 329 GLY 329 328 328 GLY GLY A . n 
A 1 330 VAL 330 329 329 VAL VAL A . n 
A 1 331 ARG 331 330 330 ARG ARG A . n 
A 1 332 LEU 332 331 331 LEU LEU A . n 
A 1 333 VAL 333 332 332 VAL VAL A . n 
A 1 334 GLY 334 333 333 GLY GLY A . n 
A 1 335 LEU 335 334 334 LEU LEU A . n 
A 1 336 HIS 336 335 335 HIS HIS A . n 
A 1 337 VAL 337 336 336 VAL VAL A . n 
A 1 338 THR 338 337 337 THR THR A . n 
A 1 339 LEU 339 338 338 LEU LEU A . n 
A 1 340 LEU 340 339 339 LEU LEU A . n 
A 1 341 ASP 341 340 340 ASP ASP A . n 
A 1 342 PRO 342 341 341 PRO PRO A . n 
B 1 1   GLY 1   0   0   GLY GLY F . n 
B 1 2   SER 2   1   1   SER SER F . n 
B 1 3   ARG 3   2   2   ARG ARG F . n 
B 1 4   LYS 4   3   3   LYS LYS F . n 
B 1 5   ILE 5   4   4   ILE ILE F . n 
B 1 6   ILE 6   5   5   ILE ILE F . n 
B 1 7   HIS 7   6   6   HIS HIS F . n 
B 1 8   VAL 8   7   7   VAL VAL F . n 
B 1 9   ASP 9   8   8   ASP ASP F . n 
B 1 10  MET 10  9   9   MET MET F . n 
B 1 11  ASP 11  10  10  ASP ASP F . n 
B 1 12  CYS 12  11  11  CYS CYS F . n 
B 1 13  PHE 13  12  12  PHE PHE F . n 
B 1 14  PHE 14  13  13  PHE PHE F . n 
B 1 15  ALA 15  14  14  ALA ALA F . n 
B 1 16  ALA 16  15  15  ALA ALA F . n 
B 1 17  VAL 17  16  16  VAL VAL F . n 
B 1 18  GLU 18  17  17  GLU GLU F . n 
B 1 19  MET 19  18  18  MET MET F . n 
B 1 20  ARG 20  19  19  ARG ARG F . n 
B 1 21  ASP 21  20  20  ASP ASP F . n 
B 1 22  ASN 22  21  21  ASN ASN F . n 
B 1 23  PRO 23  22  22  PRO PRO F . n 
B 1 24  ALA 24  23  23  ALA ALA F . n 
B 1 25  LEU 25  24  24  LEU LEU F . n 
B 1 26  ARG 26  25  25  ARG ARG F . n 
B 1 27  ASP 27  26  26  ASP ASP F . n 
B 1 28  ILE 28  27  27  ILE ILE F . n 
B 1 29  PRO 29  28  28  PRO PRO F . n 
B 1 30  ILE 30  29  29  ILE ILE F . n 
B 1 31  ALA 31  30  30  ALA ALA F . n 
B 1 32  ILE 32  31  31  ILE ILE F . n 
B 1 33  GLY 33  32  32  GLY GLY F . n 
B 1 34  GLY 34  33  33  GLY GLY F . n 
B 1 35  SER 35  34  34  SER SER F . n 
B 1 36  ARG 36  35  35  ARG ARG F . n 
B 1 37  GLU 37  36  36  GLU GLU F . n 
B 1 38  ARG 38  37  37  ARG ARG F . n 
B 1 39  ARG 39  38  38  ARG ARG F . n 
B 1 40  GLY 40  39  39  GLY GLY F . n 
B 1 41  VAL 41  40  40  VAL VAL F . n 
B 1 42  ILE 42  41  41  ILE ILE F . n 
B 1 43  SER 43  42  42  SER SER F . n 
B 1 44  THR 44  43  43  THR THR F . n 
B 1 45  ALA 45  44  44  ALA ALA F . n 
B 1 46  ASN 46  45  45  ASN ASN F . n 
B 1 47  TYR 47  46  46  TYR TYR F . n 
B 1 48  PRO 48  47  47  PRO PRO F . n 
B 1 49  ALA 49  48  48  ALA ALA F . n 
B 1 50  ARG 50  49  49  ARG ARG F . n 
B 1 51  LYS 51  50  50  LYS LYS F . n 
B 1 52  PHE 52  51  51  PHE PHE F . n 
B 1 53  GLY 53  52  52  GLY GLY F . n 
B 1 54  VAL 54  53  53  VAL VAL F . n 
B 1 55  ARG 55  54  54  ARG ARG F . n 
B 1 56  SER 56  55  55  SER SER F . n 
B 1 57  ALA 57  56  56  ALA ALA F . n 
B 1 58  MET 58  57  57  MET MET F . n 
B 1 59  PRO 59  58  58  PRO PRO F . n 
B 1 60  THR 60  59  59  THR THR F . n 
B 1 61  GLY 61  60  60  GLY GLY F . n 
B 1 62  MET 62  61  61  MET MET F . n 
B 1 63  ALA 63  62  62  ALA ALA F . n 
B 1 64  LEU 64  63  63  LEU LEU F . n 
B 1 65  ALA 65  64  64  ALA ALA F . n 
B 1 66  LEU 66  65  65  LEU LEU F . n 
B 1 67  CYS 67  66  66  CYS CYS F . n 
B 1 68  PRO 68  67  67  PRO PRO F . n 
B 1 69  HIS 69  68  68  HIS HIS F . n 
B 1 70  LEU 70  69  69  LEU LEU F . n 
B 1 71  THR 71  70  70  THR THR F . n 
B 1 72  LEU 72  71  71  LEU LEU F . n 
B 1 73  LEU 73  72  72  LEU LEU F . n 
B 1 74  PRO 74  73  73  PRO PRO F . n 
B 1 75  GLY 75  74  74  GLY GLY F . n 
B 1 76  ARG 76  75  75  ARG ARG F . n 
B 1 77  PHE 77  76  76  PHE PHE F . n 
B 1 78  ASP 78  77  77  ASP ASP F . n 
B 1 79  ALA 79  78  78  ALA ALA F . n 
B 1 80  TYR 80  79  79  TYR TYR F . n 
B 1 81  LYS 81  80  80  LYS LYS F . n 
B 1 82  GLU 82  81  81  GLU GLU F . n 
B 1 83  ALA 83  82  82  ALA ALA F . n 
B 1 84  SER 84  83  83  SER SER F . n 
B 1 85  ASN 85  84  84  ASN ASN F . n 
B 1 86  HIS 86  85  85  HIS HIS F . n 
B 1 87  ILE 87  86  86  ILE ILE F . n 
B 1 88  ARG 88  87  87  ARG ARG F . n 
B 1 89  GLU 89  88  88  GLU GLU F . n 
B 1 90  ILE 90  89  89  ILE ILE F . n 
B 1 91  PHE 91  90  90  PHE PHE F . n 
B 1 92  SER 92  91  91  SER SER F . n 
B 1 93  ARG 93  92  92  ARG ARG F . n 
B 1 94  TYR 94  93  93  TYR TYR F . n 
B 1 95  THR 95  94  94  THR THR F . n 
B 1 96  SER 96  95  95  SER SER F . n 
B 1 97  ARG 97  96  96  ARG ARG F . n 
B 1 98  ILE 98  97  97  ILE ILE F . n 
B 1 99  GLU 99  98  98  GLU GLU F . n 
B 1 100 PRO 100 99  99  PRO PRO F . n 
B 1 101 LEU 101 100 100 LEU LEU F . n 
B 1 102 SER 102 101 101 SER SER F . n 
B 1 103 LEU 103 102 102 LEU LEU F . n 
B 1 104 ASP 104 103 103 ASP ASP F . n 
B 1 105 GLU 105 104 104 GLU GLU F . n 
B 1 106 ALA 106 105 105 ALA ALA F . n 
B 1 107 TYR 107 106 106 TYR TYR F . n 
B 1 108 LEU 108 107 107 LEU LEU F . n 
B 1 109 ASP 109 108 108 ASP ASP F . n 
B 1 110 VAL 110 109 109 VAL VAL F . n 
B 1 111 THR 111 110 110 THR THR F . n 
B 1 112 ASP 112 111 111 ASP ASP F . n 
B 1 113 SER 113 112 112 SER SER F . n 
B 1 114 VAL 114 113 113 VAL VAL F . n 
B 1 115 HIS 115 114 114 HIS HIS F . n 
B 1 116 CYS 116 115 115 CYS CYS F . n 
B 1 117 HIS 117 116 116 HIS HIS F . n 
B 1 118 GLY 118 117 117 GLY GLY F . n 
B 1 119 SER 119 118 118 SER SER F . n 
B 1 120 ALA 120 119 119 ALA ALA F . n 
B 1 121 THR 121 120 120 THR THR F . n 
B 1 122 LEU 122 121 121 LEU LEU F . n 
B 1 123 ILE 123 122 122 ILE ILE F . n 
B 1 124 ALA 124 123 123 ALA ALA F . n 
B 1 125 GLN 125 124 124 GLN GLN F . n 
B 1 126 GLU 126 125 125 GLU GLU F . n 
B 1 127 ILE 127 126 126 ILE ILE F . n 
B 1 128 ARG 128 127 127 ARG ARG F . n 
B 1 129 GLN 129 128 128 GLN GLN F . n 
B 1 130 THR 130 129 129 THR THR F . n 
B 1 131 ILE 131 130 130 ILE ILE F . n 
B 1 132 PHE 132 131 131 PHE PHE F . n 
B 1 133 ASN 133 132 132 ASN ASN F . n 
B 1 134 GLU 134 133 133 GLU GLU F . n 
B 1 135 LEU 135 134 134 LEU LEU F . n 
B 1 136 GLN 136 135 135 GLN GLN F . n 
B 1 137 LEU 137 136 136 LEU LEU F . n 
B 1 138 THR 138 137 137 THR THR F . n 
B 1 139 ALA 139 138 138 ALA ALA F . n 
B 1 140 SER 140 139 139 SER SER F . n 
B 1 141 ALA 141 140 140 ALA ALA F . n 
B 1 142 GLY 142 141 141 GLY GLY F . n 
B 1 143 VAL 143 142 142 VAL VAL F . n 
B 1 144 ALA 144 143 143 ALA ALA F . n 
B 1 145 PRO 145 144 144 PRO PRO F . n 
B 1 146 VAL 146 145 145 VAL VAL F . n 
B 1 147 LYS 147 146 146 LYS LYS F . n 
B 1 148 PHE 148 147 147 PHE PHE F . n 
B 1 149 LEU 149 148 148 LEU LEU F . n 
B 1 150 ALA 150 149 149 ALA ALA F . n 
B 1 151 LYS 151 150 150 LYS LYS F . n 
B 1 152 ILE 152 151 151 ILE ILE F . n 
B 1 153 ALA 153 152 152 ALA ALA F . n 
B 1 154 SER 154 153 153 SER SER F . n 
B 1 155 ASP 155 154 154 ASP ASP F . n 
B 1 156 MET 156 155 155 MET MET F . n 
B 1 157 ASN 157 156 156 ASN ASN F . n 
B 1 158 LYS 158 157 157 LYS LYS F . n 
B 1 159 PRO 159 158 158 PRO PRO F . n 
B 1 160 ASN 160 159 159 ASN ASN F . n 
B 1 161 GLY 161 160 160 GLY GLY F . n 
B 1 162 GLN 162 161 161 GLN GLN F . n 
B 1 163 PHE 163 162 162 PHE PHE F . n 
B 1 164 VAL 164 163 163 VAL VAL F . n 
B 1 165 ILE 165 164 164 ILE ILE F . n 
B 1 166 THR 166 165 165 THR THR F . n 
B 1 167 PRO 167 166 166 PRO PRO F . n 
B 1 168 ALA 168 167 167 ALA ALA F . n 
B 1 169 GLU 169 168 168 GLU GLU F . n 
B 1 170 VAL 170 169 169 VAL VAL F . n 
B 1 171 PRO 171 170 170 PRO PRO F . n 
B 1 172 ALA 172 171 171 ALA ALA F . n 
B 1 173 PHE 173 172 172 PHE PHE F . n 
B 1 174 LEU 174 173 173 LEU LEU F . n 
B 1 175 GLN 175 174 174 GLN GLN F . n 
B 1 176 THR 176 175 175 THR THR F . n 
B 1 177 LEU 177 176 176 LEU LEU F . n 
B 1 178 PRO 178 177 177 PRO PRO F . n 
B 1 179 LEU 179 178 178 LEU LEU F . n 
B 1 180 ALA 180 179 179 ALA ALA F . n 
B 1 181 LYS 181 180 180 LYS LYS F . n 
B 1 182 ILE 182 181 181 ILE ILE F . n 
B 1 183 PRO 183 182 182 PRO PRO F . n 
B 1 184 GLY 184 183 183 GLY GLY F . n 
B 1 185 VAL 185 184 184 VAL VAL F . n 
B 1 186 GLY 186 185 185 GLY GLY F . n 
B 1 187 LYS 187 186 186 LYS LYS F . n 
B 1 188 VAL 188 187 187 VAL VAL F . n 
B 1 189 SER 189 188 188 SER SER F . n 
B 1 190 ALA 190 189 189 ALA ALA F . n 
B 1 191 ALA 191 190 190 ALA ALA F . n 
B 1 192 LYS 192 191 191 LYS LYS F . n 
B 1 193 LEU 193 192 192 LEU LEU F . n 
B 1 194 GLU 194 193 193 GLU GLU F . n 
B 1 195 ALA 195 194 194 ALA ALA F . n 
B 1 196 MET 196 195 195 MET MET F . n 
B 1 197 GLY 197 196 196 GLY GLY F . n 
B 1 198 LEU 198 197 197 LEU LEU F . n 
B 1 199 ARG 199 198 198 ARG ARG F . n 
B 1 200 THR 200 199 199 THR THR F . n 
B 1 201 CYS 201 200 200 CYS CYS F . n 
B 1 202 GLY 202 201 201 GLY GLY F . n 
B 1 203 ASP 203 202 202 ASP ASP F . n 
B 1 204 VAL 204 203 203 VAL VAL F . n 
B 1 205 GLN 205 204 204 GLN GLN F . n 
B 1 206 ALA 206 205 205 ALA ALA F . n 
B 1 207 CYS 207 206 206 CYS CYS F . n 
B 1 208 ASP 208 207 207 ASP ASP F . n 
B 1 209 LEU 209 208 208 LEU LEU F . n 
B 1 210 VAL 210 209 209 VAL VAL F . n 
B 1 211 MET 211 210 210 MET MET F . n 
B 1 212 LEU 212 211 211 LEU LEU F . n 
B 1 213 LEU 213 212 212 LEU LEU F . n 
B 1 214 LYS 214 213 213 LYS LYS F . n 
B 1 215 ARG 215 214 214 ARG ARG F . n 
B 1 216 PHE 216 215 215 PHE PHE F . n 
B 1 217 GLY 217 216 216 GLY GLY F . n 
B 1 218 LYS 218 217 217 LYS LYS F . n 
B 1 219 PHE 219 218 218 PHE PHE F . n 
B 1 220 GLY 220 219 219 GLY GLY F . n 
B 1 221 ARG 221 220 220 ARG ARG F . n 
B 1 222 ILE 222 221 221 ILE ILE F . n 
B 1 223 LEU 223 222 222 LEU LEU F . n 
B 1 224 TRP 224 223 223 TRP TRP F . n 
B 1 225 GLU 225 224 224 GLU GLU F . n 
B 1 226 ARG 226 225 225 ARG ARG F . n 
B 1 227 SER 227 226 226 SER SER F . n 
B 1 228 GLN 228 227 227 GLN GLN F . n 
B 1 229 GLY 229 228 228 GLY GLY F . n 
B 1 230 ILE 230 229 229 ILE ILE F . n 
B 1 231 ASP 231 230 230 ASP ASP F . n 
B 1 232 GLU 232 231 231 GLU GLU F . n 
B 1 233 ARG 233 232 232 ARG ARG F . n 
B 1 234 ASP 234 233 233 ASP ASP F . n 
B 1 235 VAL 235 234 234 VAL VAL F . n 
B 1 236 ASN 236 235 235 ASN ASN F . n 
B 1 237 SER 237 236 236 SER SER F . n 
B 1 238 GLU 238 237 237 GLU GLU F . n 
B 1 239 ARG 239 238 238 ARG ARG F . n 
B 1 240 LEU 240 239 239 LEU LEU F . n 
B 1 241 ARG 241 240 240 ARG ARG F . n 
B 1 242 LYS 242 241 241 LYS LYS F . n 
B 1 243 SER 243 242 242 SER SER F . n 
B 1 244 VAL 244 243 243 VAL VAL F . n 
B 1 245 GLY 245 244 244 GLY GLY F . n 
B 1 246 VAL 246 245 245 VAL VAL F . n 
B 1 247 GLU 247 246 246 GLU GLU F . n 
B 1 248 ARG 248 247 247 ARG ARG F . n 
B 1 249 THR 249 248 248 THR THR F . n 
B 1 250 MET 250 249 249 MET MET F . n 
B 1 251 ALA 251 250 250 ALA ALA F . n 
B 1 252 GLU 252 251 251 GLU GLU F . n 
B 1 253 ASP 253 252 252 ASP ASP F . n 
B 1 254 ILE 254 253 253 ILE ILE F . n 
B 1 255 HIS 255 254 254 HIS HIS F . n 
B 1 256 HIS 256 255 255 HIS HIS F . n 
B 1 257 TRP 257 256 256 TRP TRP F . n 
B 1 258 SER 258 257 257 SER SER F . n 
B 1 259 GLU 259 258 258 GLU GLU F . n 
B 1 260 CYS 260 259 259 CYS CYS F . n 
B 1 261 GLU 261 260 260 GLU GLU F . n 
B 1 262 ALA 262 261 261 ALA ALA F . n 
B 1 263 ILE 263 262 262 ILE ILE F . n 
B 1 264 ILE 264 263 263 ILE ILE F . n 
B 1 265 GLU 265 264 264 GLU GLU F . n 
B 1 266 ARG 266 265 265 ARG ARG F . n 
B 1 267 LEU 267 266 266 LEU LEU F . n 
B 1 268 TYR 268 267 267 TYR TYR F . n 
B 1 269 PRO 269 268 268 PRO PRO F . n 
B 1 270 GLU 270 269 269 GLU GLU F . n 
B 1 271 LEU 271 270 270 LEU LEU F . n 
B 1 272 GLU 272 271 271 GLU GLU F . n 
B 1 273 ARG 273 272 272 ARG ARG F . n 
B 1 274 ARG 274 273 273 ARG ARG F . n 
B 1 275 LEU 275 274 274 LEU LEU F . n 
B 1 276 ALA 276 275 275 ALA ALA F . n 
B 1 277 LYS 277 276 276 LYS LYS F . n 
B 1 278 VAL 278 277 277 VAL VAL F . n 
B 1 279 LYS 279 278 278 LYS LYS F . n 
B 1 280 PRO 280 279 279 PRO PRO F . n 
B 1 281 ASP 281 280 280 ASP ASP F . n 
B 1 282 LEU 282 281 281 LEU LEU F . n 
B 1 283 LEU 283 282 282 LEU LEU F . n 
B 1 284 ILE 284 283 283 ILE ILE F . n 
B 1 285 ALA 285 284 284 ALA ALA F . n 
B 1 286 ARG 286 285 285 ARG ARG F . n 
B 1 287 GLN 287 286 286 GLN GLN F . n 
B 1 288 GLY 288 287 287 GLY GLY F . n 
B 1 289 VAL 289 288 288 VAL VAL F . n 
B 1 290 LYS 290 289 289 LYS LYS F . n 
B 1 291 LEU 291 290 290 LEU LEU F . n 
B 1 292 LYS 292 291 291 LYS LYS F . n 
B 1 293 PHE 293 292 292 PHE PHE F . n 
B 1 294 ASP 294 293 293 ASP ASP F . n 
B 1 295 ASP 295 294 294 ASP ASP F . n 
B 1 296 PHE 296 295 295 PHE PHE F . n 
B 1 297 GLN 297 296 296 GLN GLN F . n 
B 1 298 GLN 298 297 297 GLN GLN F . n 
B 1 299 THR 299 298 298 THR THR F . n 
B 1 300 THR 300 299 299 THR THR F . n 
B 1 301 GLN 301 300 300 GLN GLN F . n 
B 1 302 GLU 302 301 301 GLU GLU F . n 
B 1 303 HIS 303 302 302 HIS HIS F . n 
B 1 304 VAL 304 303 303 VAL VAL F . n 
B 1 305 TRP 305 304 304 TRP TRP F . n 
B 1 306 PRO 306 305 305 PRO PRO F . n 
B 1 307 ARG 307 306 306 ARG ARG F . n 
B 1 308 LEU 308 307 307 LEU LEU F . n 
B 1 309 ASN 309 308 308 ASN ASN F . n 
B 1 310 LYS 310 309 309 LYS LYS F . n 
B 1 311 ALA 311 310 310 ALA ALA F . n 
B 1 312 ASP 312 311 311 ASP ASP F . n 
B 1 313 LEU 313 312 312 LEU LEU F . n 
B 1 314 ILE 314 313 313 ILE ILE F . n 
B 1 315 ALA 315 314 314 ALA ALA F . n 
B 1 316 THR 316 315 315 THR THR F . n 
B 1 317 ALA 317 316 316 ALA ALA F . n 
B 1 318 ARG 318 317 317 ARG ARG F . n 
B 1 319 LYS 319 318 318 LYS LYS F . n 
B 1 320 THR 320 319 319 THR THR F . n 
B 1 321 TRP 321 320 320 TRP TRP F . n 
B 1 322 ASP 322 321 321 ASP ASP F . n 
B 1 323 GLU 323 322 322 GLU GLU F . n 
B 1 324 ARG 324 323 323 ARG ARG F . n 
B 1 325 ARG 325 324 324 ARG ARG F . n 
B 1 326 GLY 326 325 325 GLY GLY F . n 
B 1 327 GLY 327 326 326 GLY GLY F . n 
B 1 328 ARG 328 327 327 ARG ARG F . n 
B 1 329 GLY 329 328 328 GLY GLY F . n 
B 1 330 VAL 330 329 329 VAL VAL F . n 
B 1 331 ARG 331 330 330 ARG ARG F . n 
B 1 332 LEU 332 331 331 LEU LEU F . n 
B 1 333 VAL 333 332 332 VAL VAL F . n 
B 1 334 GLY 334 333 333 GLY GLY F . n 
B 1 335 LEU 335 334 334 LEU LEU F . n 
B 1 336 HIS 336 335 335 HIS HIS F . n 
B 1 337 VAL 337 336 336 VAL VAL F . n 
B 1 338 THR 338 337 337 THR THR F . n 
B 1 339 LEU 339 338 338 LEU LEU F . n 
B 1 340 LEU 340 339 339 LEU LEU F . n 
B 1 341 ASP 341 340 340 ASP ASP F . n 
B 1 342 PRO 342 341 341 PRO PRO F . n 
C 2 1   DT  1   837 837 DT  DT  B . n 
C 2 2   DC  2   838 838 DC  DC  B . n 
C 2 3   DT  3   839 839 DT  DT  B . n 
C 2 4   DA  4   840 840 DA  DA  B . n 
C 2 5   RDG 5   841 841 RDG RDG B . n 
C 2 6   DG  6   842 842 DG  DG  B . n 
C 2 7   DG  7   843 843 DG  DG  B . n 
C 2 8   DT  8   844 844 DT  DT  B . n 
C 2 9   DC  9   845 845 DC  DC  B . n 
C 2 10  DC  10  846 846 DC  DC  B . n 
C 2 11  DT  11  847 847 DT  DT  B . n 
C 2 12  DA  12  848 848 DA  DA  B . n 
C 2 13  DG  13  849 849 DG  DG  B . n 
C 2 14  DG  14  850 850 DG  DG  B . n 
C 2 15  DA  15  851 851 DA  DA  B . n 
C 2 16  DC  16  852 852 DC  DC  B . n 
C 2 17  DC  17  853 853 DC  DC  B . n 
C 2 18  DC  18  854 854 DC  DC  B . n 
D 2 1   DT  1   856 ?   ?   ?   C . n 
D 2 2   DC  2   857 857 DC  DC  C . n 
D 2 3   DT  3   858 858 DT  DT  C . n 
D 2 4   DA  4   859 859 DA  DA  C . n 
D 2 5   RDG 5   860 860 RDG RDG C . n 
D 2 6   DG  6   861 861 DG  DG  C . n 
D 2 7   DG  7   862 862 DG  DG  C . n 
D 2 8   DT  8   863 863 DT  DT  C . n 
D 2 9   DC  9   864 864 DC  DC  C . n 
D 2 10  DC  10  865 865 DC  DC  C . n 
D 2 11  DT  11  866 866 DT  DT  C . n 
D 2 12  DA  12  867 867 DA  DA  C . n 
D 2 13  DG  13  868 868 DG  DG  C . n 
D 2 14  DG  14  869 869 DG  DG  C . n 
D 2 15  DA  15  870 870 DA  DA  C . n 
D 2 16  DC  16  871 871 DC  DC  C . n 
D 2 17  DC  17  872 872 DC  DC  C . n 
D 2 18  DC  18  873 873 DC  DC  C . n 
E 2 1   DT  1   837 837 DT  DT  G . n 
E 2 2   DC  2   838 838 DC  DC  G . n 
E 2 3   DT  3   839 839 DT  DT  G . n 
E 2 4   DA  4   840 840 DA  DA  G . n 
E 2 5   RDG 5   841 841 RDG RDG G . n 
E 2 6   DG  6   842 842 DG  DG  G . n 
E 2 7   DG  7   843 843 DG  DG  G . n 
E 2 8   DT  8   844 844 DT  DT  G . n 
E 2 9   DC  9   845 845 DC  DC  G . n 
E 2 10  DC  10  846 846 DC  DC  G . n 
E 2 11  DT  11  847 847 DT  DT  G . n 
E 2 12  DA  12  848 848 DA  DA  G . n 
E 2 13  DG  13  849 849 DG  DG  G . n 
E 2 14  DG  14  850 850 DG  DG  G . n 
E 2 15  DA  15  851 851 DA  DA  G . n 
E 2 16  DC  16  852 852 DC  DC  G . n 
E 2 17  DC  17  853 853 DC  DC  G . n 
E 2 18  DC  18  854 854 DC  DC  G . n 
F 2 1   DT  1   856 ?   ?   ?   H . n 
F 2 2   DC  2   857 ?   ?   ?   H . n 
F 2 3   DT  3   858 ?   ?   ?   H . n 
F 2 4   DA  4   859 ?   ?   ?   H . n 
F 2 5   RDG 5   860 860 RDG RDG H . n 
F 2 6   DG  6   861 861 DG  DG  H . n 
F 2 7   DG  7   862 862 DG  DG  H . n 
F 2 8   DT  8   863 863 DT  DT  H . n 
F 2 9   DC  9   864 864 DC  DC  H . n 
F 2 10  DC  10  865 865 DC  DC  H . n 
F 2 11  DT  11  866 866 DT  DT  H . n 
F 2 12  DA  12  867 867 DA  DA  H . n 
F 2 13  DG  13  868 868 DG  DG  H . n 
F 2 14  DG  14  869 869 DG  DG  H . n 
F 2 15  DA  15  870 870 DA  DA  H . n 
F 2 16  DC  16  871 871 DC  DC  H . n 
F 2 17  DC  17  872 872 DC  DC  H . n 
F 2 18  DC  18  873 873 DC  DC  H . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C RDG 5 B RDG 841 ? DG ? 
2 D RDG 5 C RDG 860 ? DG ? 
3 E RDG 5 G RDG 841 ? DG ? 
4 F RDG 5 H RDG 860 ? DG ? 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G,H,I,M,O,P 
2 1 B,E,F,J,K,L,N,Q,R 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4880  ? 
1 MORE         -48   ? 
1 'SSA (A^2)'  21520 ? 
2 'ABSA (A^2)' 4850  ? 
2 MORE         -50   ? 
2 'SSA (A^2)'  20440 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 9   ? A ASP 8   ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O2B   ? G 1FZ .   ? A 1FZ 401 ? 1_555 151.8 ? 
2  OD1 ? A ASP 9   ? A ASP 8   ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O1A   ? G 1FZ .   ? A 1FZ 401 ? 1_555 108.2 ? 
3  O2B ? G 1FZ .   ? A 1FZ 401 ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O1A   ? G 1FZ .   ? A 1FZ 401 ? 1_555 80.7  ? 
4  OD1 ? A ASP 9   ? A ASP 8   ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 OD2   ? A ASP 104 ? A ASP 103 ? 1_555 103.4 ? 
5  O2B ? G 1FZ .   ? A 1FZ 401 ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 OD2   ? A ASP 104 ? A ASP 103 ? 1_555 103.3 ? 
6  O1A ? G 1FZ .   ? A 1FZ 401 ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 OD2   ? A ASP 104 ? A ASP 103 ? 1_555 89.7  ? 
7  OD1 ? A ASP 9   ? A ASP 8   ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O     ? A MET 10  ? A MET 9   ? 1_555 86.3  ? 
8  O2B ? G 1FZ .   ? A 1FZ 401 ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O     ? A MET 10  ? A MET 9   ? 1_555 84.0  ? 
9  O1A ? G 1FZ .   ? A 1FZ 401 ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O     ? A MET 10  ? A MET 9   ? 1_555 164.6 ? 
10 OD2 ? A ASP 104 ? A ASP 103 ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O     ? A MET 10  ? A MET 9   ? 1_555 92.0  ? 
11 OD1 ? A ASP 9   ? A ASP 8   ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O1G   ? G 1FZ .   ? A 1FZ 401 ? 1_555 83.4  ? 
12 O2B ? G 1FZ .   ? A 1FZ 401 ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O1G   ? G 1FZ .   ? A 1FZ 401 ? 1_555 69.7  ? 
13 O1A ? G 1FZ .   ? A 1FZ 401 ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O1G   ? G 1FZ .   ? A 1FZ 401 ? 1_555 89.5  ? 
14 OD2 ? A ASP 104 ? A ASP 103 ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O1G   ? G 1FZ .   ? A 1FZ 401 ? 1_555 173.0 ? 
15 O   ? A MET 10  ? A MET 9   ? 1_555 MG ? H MG . ? A MG 402 ? 1_555 O1G   ? G 1FZ .   ? A 1FZ 401 ? 1_555 87.0  ? 
16 O   ? B MET 10  ? F MET 9   ? 1_555 MG ? K MG . ? F MG 402 ? 1_555 O2B   ? J 1FZ .   ? F 1FZ 401 ? 1_555 99.5  ? 
17 O   ? B MET 10  ? F MET 9   ? 1_555 MG ? K MG . ? F MG 402 ? 1_555 OD2   ? B ASP 104 ? F ASP 103 ? 1_555 124.3 ? 
18 O2B ? J 1FZ .   ? F 1FZ 401 ? 1_555 MG ? K MG . ? F MG 402 ? 1_555 OD2   ? B ASP 104 ? F ASP 103 ? 1_555 110.7 ? 
19 O   ? B MET 10  ? F MET 9   ? 1_555 MG ? K MG . ? F MG 402 ? 1_555 OD1   ? B ASP 9   ? F ASP 8   ? 1_555 95.6  ? 
20 O2B ? J 1FZ .   ? F 1FZ 401 ? 1_555 MG ? K MG . ? F MG 402 ? 1_555 OD1   ? B ASP 9   ? F ASP 8   ? 1_555 143.4 ? 
21 OD2 ? B ASP 104 ? F ASP 103 ? 1_555 MG ? K MG . ? F MG 402 ? 1_555 OD1   ? B ASP 9   ? F ASP 8   ? 1_555 87.0  ? 
22 O   ? B MET 10  ? F MET 9   ? 1_555 MG ? K MG . ? F MG 402 ? 1_555 O2A   ? J 1FZ .   ? F 1FZ 401 ? 1_555 162.5 ? 
23 O2B ? J 1FZ .   ? F 1FZ 401 ? 1_555 MG ? K MG . ? F MG 402 ? 1_555 O2A   ? J 1FZ .   ? F 1FZ 401 ? 1_555 68.4  ? 
24 OD2 ? B ASP 104 ? F ASP 103 ? 1_555 MG ? K MG . ? F MG 402 ? 1_555 O2A   ? J 1FZ .   ? F 1FZ 401 ? 1_555 72.8  ? 
25 OD1 ? B ASP 9   ? F ASP 8   ? 1_555 MG ? K MG . ? F MG 402 ? 1_555 O2A   ? J 1FZ .   ? F 1FZ 401 ? 1_555 88.2  ? 
26 OE2 ? A GLU 105 ? A GLU 104 ? 1_555 MG ? I MG . ? A MG 403 ? 1_555 OD2   ? A ASP 9   ? A ASP 8   ? 1_555 86.5  ? 
27 OE2 ? A GLU 105 ? A GLU 104 ? 1_555 MG ? I MG . ? A MG 403 ? 1_555 O1A   ? G 1FZ .   ? A 1FZ 401 ? 1_555 104.2 ? 
28 OD2 ? A ASP 9   ? A ASP 8   ? 1_555 MG ? I MG . ? A MG 403 ? 1_555 O1A   ? G 1FZ .   ? A 1FZ 401 ? 1_555 108.8 ? 
29 OE2 ? A GLU 105 ? A GLU 104 ? 1_555 MG ? I MG . ? A MG 403 ? 1_555 O     ? P HOH .   ? C HOH 901 ? 1_555 113.5 ? 
30 OD2 ? A ASP 9   ? A ASP 8   ? 1_555 MG ? I MG . ? A MG 403 ? 1_555 O     ? P HOH .   ? C HOH 901 ? 1_555 119.3 ? 
31 O1A ? G 1FZ .   ? A 1FZ 401 ? 1_555 MG ? I MG . ? A MG 403 ? 1_555 O     ? P HOH .   ? C HOH 901 ? 1_555 119.0 ? 
32 OE2 ? A GLU 105 ? A GLU 104 ? 1_555 MG ? I MG . ? A MG 403 ? 1_555 O     ? M HOH .   ? A HOH 502 ? 1_555 157.8 ? 
33 OD2 ? A ASP 9   ? A ASP 8   ? 1_555 MG ? I MG . ? A MG 403 ? 1_555 O     ? M HOH .   ? A HOH 502 ? 1_555 95.0  ? 
34 O1A ? G 1FZ .   ? A 1FZ 401 ? 1_555 MG ? I MG . ? A MG 403 ? 1_555 O     ? M HOH .   ? A HOH 502 ? 1_555 96.3  ? 
35 O   ? P HOH .   ? C HOH 901 ? 1_555 MG ? I MG . ? A MG 403 ? 1_555 O     ? M HOH .   ? A HOH 502 ? 1_555 47.1  ? 
36 OE2 ? B GLU 105 ? F GLU 104 ? 1_555 MG ? L MG . ? F MG 403 ? 1_555 OD1   ? B ASP 104 ? F ASP 103 ? 1_555 147.0 ? 
37 OE2 ? B GLU 105 ? F GLU 104 ? 1_555 MG ? L MG . ? F MG 403 ? 1_555 OD2   ? B ASP 104 ? F ASP 103 ? 1_555 150.2 ? 
38 OD1 ? B ASP 104 ? F ASP 103 ? 1_555 MG ? L MG . ? F MG 403 ? 1_555 OD2   ? B ASP 104 ? F ASP 103 ? 1_555 54.5  ? 
39 OE2 ? B GLU 105 ? F GLU 104 ? 1_555 MG ? L MG . ? F MG 403 ? 1_555 O2A   ? J 1FZ .   ? F 1FZ 401 ? 1_555 95.9  ? 
40 OD1 ? B ASP 104 ? F ASP 103 ? 1_555 MG ? L MG . ? F MG 403 ? 1_555 O2A   ? J 1FZ .   ? F 1FZ 401 ? 1_555 116.9 ? 
41 OD2 ? B ASP 104 ? F ASP 103 ? 1_555 MG ? L MG . ? F MG 403 ? 1_555 O2A   ? J 1FZ .   ? F 1FZ 401 ? 1_555 71.9  ? 
42 OE2 ? B GLU 105 ? F GLU 104 ? 1_555 MG ? L MG . ? F MG 403 ? 1_555 "O3'" ? F DC  18  ? H DC  873 ? 1_555 99.3  ? 
43 OD1 ? B ASP 104 ? F ASP 103 ? 1_555 MG ? L MG . ? F MG 403 ? 1_555 "O3'" ? F DC  18  ? H DC  873 ? 1_555 69.8  ? 
44 OD2 ? B ASP 104 ? F ASP 103 ? 1_555 MG ? L MG . ? F MG 403 ? 1_555 "O3'" ? F DC  18  ? H DC  873 ? 1_555 110.0 ? 
45 O2A ? J 1FZ .   ? F 1FZ 401 ? 1_555 MG ? L MG . ? F MG 403 ? 1_555 "O3'" ? F DC  18  ? H DC  873 ? 1_555 105.0 ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-05-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASER   phasing          .                           ? 1 
PHENIX   refinement       '(PHENIX.REFINE: 1.8_1069)' ? 2 
HKL-2000 'data reduction' .                           ? 3 
HKL-2000 'data scaling'   .                           ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   F ASN 235 ? ? O F HOH 520 ? ? 1.81 
2  1 O4  H DT  863 ? ? O H HOH 907 ? ? 1.83 
3  1 O1G F 1FZ 401 ? ? O F HOH 524 ? ? 1.90 
4  1 OD2 A ASP 154 ? ? O A HOH 504 ? ? 1.98 
5  1 O6  G DG  849 ? ? O G HOH 903 ? ? 2.05 
6  1 O   F ASP 230 ? ? O F HOH 501 ? ? 2.07 
7  1 O   A HOH 502 ? ? O C HOH 901 ? ? 2.09 
8  1 N   F ASP 311 ? ? O F HOH 521 ? ? 2.15 
9  1 OD2 F ASP 8   ? ? O F HOH 522 ? ? 2.15 
10 1 O2A A 1FZ 401 ? ? O A HOH 507 ? ? 2.16 
11 1 OE2 F GLU 301 ? ? O F HOH 523 ? ? 2.16 
12 1 N   F GLY 117 ? ? O F HOH 504 ? ? 2.18 
13 1 O   F VAL 184 ? ? O F HOH 506 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" B DA 848 ? ? "C1'" B DA 848 ? ? N9 B DA 848 ? ? 110.11 108.30 1.81 0.30 N 
2 1 "O4'" B DG 850 ? ? "C1'" B DG 850 ? ? N9 B DG 850 ? ? 110.27 108.30 1.97 0.30 N 
3 1 "O4'" C DC 857 ? ? "C1'" C DC 857 ? ? N1 C DC 857 ? ? 110.11 108.30 1.81 0.30 N 
4 1 "O4'" C DT 858 ? ? "C1'" C DT 858 ? ? N1 C DT 858 ? ? 110.96 108.30 2.66 0.30 N 
5 1 "O4'" G DA 848 ? ? "C1'" G DA 848 ? ? N9 G DA 848 ? ? 110.58 108.30 2.28 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 21  ? ? -155.54 82.38   
2  1 LEU A 24  ? ? -77.64  -111.07 
3  1 ARG A 25  ? ? 55.91   -60.37  
4  1 ARG A 96  ? ? -69.79  90.63   
5  1 SER A 101 ? ? -160.95 -145.24 
6  1 ASP A 111 ? ? -69.10  0.49    
7  1 CYS A 115 ? ? -118.16 58.92   
8  1 THR A 175 ? ? -98.00  31.78   
9  1 ALA A 205 ? ? -99.63  33.16   
10 1 SER A 236 ? ? 70.17   -4.87   
11 1 GLU A 251 ? ? 145.84  -110.90 
12 1 ASP A 252 ? ? 43.30   -115.96 
13 1 ILE A 253 ? ? 39.97   90.27   
14 1 LYS A 278 ? ? -167.48 96.66   
15 1 LEU A 281 ? ? 59.84   80.44   
16 1 LEU A 282 ? ? -62.63  -102.07 
17 1 ILE A 283 ? ? 88.16   117.67  
18 1 LEU A 338 ? ? 63.54   174.83  
19 1 CYS F 11  ? ? 34.38   52.35   
20 1 SER F 101 ? ? -168.30 -164.88 
21 1 ASP F 111 ? ? -96.00  39.57   
22 1 VAL F 113 ? ? -146.33 -10.37  
23 1 HIS F 114 ? ? -62.90  -72.82  
24 1 CYS F 115 ? ? -94.80  49.16   
25 1 THR F 129 ? ? 89.03   -29.05  
26 1 GLU F 133 ? ? 62.87   -54.73  
27 1 ARG F 198 ? ? -131.53 -38.96  
28 1 SER F 236 ? ? 67.85   -7.13   
29 1 TRP F 304 ? ? -174.10 129.75  
30 1 LEU F 307 ? ? -45.49  104.21  
31 1 ARG F 323 ? ? -164.57 91.07   
32 1 ARG F 324 ? ? -168.65 -20.24  
33 1 ASP F 340 ? ? -73.93  -120.58 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_1   F 
_pdbx_validate_peptide_omega.auth_seq_id_1    340 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   F 
_pdbx_validate_peptide_omega.auth_seq_id_2    341 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -145.72 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 3   ? CG  ? A LYS 4 CG  
2 1 Y 1 A LYS 3   ? CD  ? A LYS 4 CD  
3 1 Y 1 A LYS 3   ? CE  ? A LYS 4 CE  
4 1 Y 1 A LYS 3   ? NZ  ? A LYS 4 NZ  
5 1 Y 1 C DC  857 ? P   ? D DC  2 P   
6 1 Y 1 C DC  857 ? OP1 ? D DC  2 OP1 
7 1 Y 1 C DC  857 ? OP2 ? D DC  2 OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 C DT 856 ? D DT 1 
2 1 Y 1 H DT 856 ? F DT 1 
3 1 Y 1 H DC 857 ? F DC 2 
4 1 Y 1 H DT 858 ? F DT 3 
5 1 Y 1 H DA 859 ? F DA 4 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4Q44 'double helix'        
4Q44 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 6  1_555 D DC 17 1_555 0.477  -0.384 0.288  -5.893  -19.381 -5.764 1  B_DG842:DC872_C B 842 ? C 872 ? 19 1 
1 C DG 7  1_555 D DC 16 1_555 -0.199 -0.091 0.393  -11.316 -17.816 6.253  2  B_DG843:DC871_C B 843 ? C 871 ? 19 1 
1 C DT 8  1_555 D DA 15 1_555 -0.202 -0.217 0.577  -16.850 -14.039 0.728  3  B_DT844:DA870_C B 844 ? C 870 ? 20 1 
1 C DC 9  1_555 D DG 14 1_555 0.200  -0.508 -0.248 -2.716  -5.831  -6.773 4  B_DC845:DG869_C B 845 ? C 869 ? 19 1 
1 C DC 10 1_555 D DG 13 1_555 -0.422 -0.453 -0.043 -3.734  -3.950  -3.126 5  B_DC846:DG868_C B 846 ? C 868 ? 19 1 
1 C DT 11 1_555 D DA 12 1_555 0.188  0.026  0.137  3.421   -3.805  1.173  6  B_DT847:DA867_C B 847 ? C 867 ? 20 1 
1 C DA 12 1_555 D DT 11 1_555 0.143  -0.558 -0.178 7.013   -11.264 1.086  7  B_DA848:DT866_C B 848 ? C 866 ? 20 1 
1 C DG 13 1_555 D DC 10 1_555 0.066  -0.128 0.412  13.222  -12.304 4.678  8  B_DG849:DC865_C B 849 ? C 865 ? 19 1 
1 C DG 14 1_555 D DC 9  1_555 0.247  -0.368 0.532  8.689   -17.337 -1.347 9  B_DG850:DC864_C B 850 ? C 864 ? 19 1 
1 C DA 15 1_555 D DT 8  1_555 0.478  -0.149 0.182  -1.612  -22.525 5.525  10 B_DA851:DT863_C B 851 ? C 863 ? 20 1 
1 C DC 16 1_555 D DG 7  1_555 0.528  -0.307 0.375  -3.652  -14.745 5.867  11 B_DC852:DG862_C B 852 ? C 862 ? 19 1 
1 C DC 17 1_555 D DG 6  1_555 -0.183 -0.517 0.282  -5.857  -16.153 -4.817 12 B_DC853:DG861_C B 853 ? C 861 ? 19 1 
1 E DG 6  1_555 F DC 17 1_555 0.018  -0.252 0.140  -8.759  -23.955 -0.487 13 G_DG842:DC872_H G 842 ? H 872 ? 19 1 
1 E DG 7  1_555 F DC 16 1_555 0.072  -0.124 0.373  -8.714  -18.070 5.164  14 G_DG843:DC871_H G 843 ? H 871 ? 19 1 
1 E DT 8  1_555 F DA 15 1_555 0.141  -0.343 0.411  -13.370 -11.118 -1.137 15 G_DT844:DA870_H G 844 ? H 870 ? 20 1 
1 E DC 9  1_555 F DG 14 1_555 0.120  -0.305 -0.218 4.531   -2.215  -2.795 16 G_DC845:DG869_H G 845 ? H 869 ? 19 1 
1 E DC 10 1_555 F DG 13 1_555 -0.213 -0.384 0.076  -2.706  -0.991  -1.243 17 G_DC846:DG868_H G 846 ? H 868 ? 19 1 
1 E DT 11 1_555 F DA 12 1_555 -0.506 -0.095 -0.032 2.735   -3.723  3.655  18 G_DT847:DA867_H G 847 ? H 867 ? 20 1 
1 E DA 12 1_555 F DT 11 1_555 0.213  -0.224 -0.007 17.558  -2.559  2.657  19 G_DA848:DT866_H G 848 ? H 866 ? 20 1 
1 E DG 13 1_555 F DC 10 1_555 -0.003 -0.440 0.834  16.591  -1.771  -2.765 20 G_DG849:DC865_H G 849 ? H 865 ? 19 1 
1 E DG 14 1_555 F DC 9  1_555 0.236  -0.351 0.247  16.911  -8.331  0.325  21 G_DG850:DC864_H G 850 ? H 864 ? 19 1 
1 E DA 15 1_555 F DT 8  1_555 -0.532 -0.409 0.246  2.936   -18.908 5.012  22 G_DA851:DT863_H G 851 ? H 863 ? 20 1 
1 E DC 16 1_555 F DG 7  1_555 0.440  -0.020 0.031  10.380  -16.441 7.329  23 G_DC852:DG862_H G 852 ? H 862 ? 19 1 
1 E DC 17 1_555 F DG 6  1_555 0.438  -0.635 -0.053 3.659   -2.358  -2.309 24 G_DC853:DG861_H G 853 ? H 861 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 6  1_555 D DC 17 1_555 C DG 7  1_555 D DC 16 1_555 1.263  -1.325 3.327 4.709  9.589  27.732 -4.572 -1.490 2.890 19.129 
-9.395  29.681 1  BB_DG842DG843:DC871DC872_CC B 842 ? C 872 ? B 843 ? C 871 ? 
1 C DG 7  1_555 D DC 16 1_555 C DT 8  1_555 D DA 15 1_555 -0.927 -1.151 3.336 -0.739 -0.817 32.551 -1.905 1.521  3.383 -1.458 
1.317   32.569 2  BB_DG843DT844:DA870DC871_CC B 843 ? C 871 ? B 844 ? C 870 ? 
1 C DT 8  1_555 D DA 15 1_555 C DC 9  1_555 D DG 14 1_555 0.005  -0.750 2.916 8.449  5.789  31.590 -2.164 1.232  2.654 10.301 
-15.033 33.168 3  BB_DT844DC845:DG869DA870_CC B 844 ? C 870 ? B 845 ? C 869 ? 
1 C DC 9  1_555 D DG 14 1_555 C DC 10 1_555 D DG 13 1_555 0.586  -0.763 3.261 -1.145 3.746  34.503 -1.842 -1.155 3.143 6.291  
1.922   34.718 4  BB_DC845DC846:DG868DG869_CC B 845 ? C 869 ? B 846 ? C 868 ? 
1 C DC 10 1_555 D DG 13 1_555 C DT 11 1_555 D DA 12 1_555 -0.081 -0.660 3.265 -0.133 1.804  30.797 -1.589 0.126  3.223 3.393  
0.251   30.848 5  BB_DC846DT847:DA867DG868_CC B 846 ? C 868 ? B 847 ? C 867 ? 
1 C DT 11 1_555 D DA 12 1_555 C DA 12 1_555 D DT 11 1_555 0.415  0.288  3.254 1.752  6.456  33.604 -0.534 -0.427 3.269 11.032 
-2.994  34.245 6  BB_DT847DA848:DT866DA867_CC B 847 ? C 867 ? B 848 ? C 866 ? 
1 C DA 12 1_555 D DT 11 1_555 C DG 13 1_555 D DC 10 1_555 -0.800 0.499  3.114 -5.212 5.507  33.903 0.007  0.557  3.237 9.299  
8.801   34.716 7  BB_DA848DG849:DC865DT866_CC B 848 ? C 866 ? B 849 ? C 865 ? 
1 C DG 13 1_555 D DC 10 1_555 C DG 14 1_555 D DC 9  1_555 0.229  -0.372 3.228 -0.131 3.164  33.006 -1.173 -0.423 3.179 5.554  
0.229   33.153 8  BB_DG849DG850:DC864DC865_CC B 849 ? C 865 ? B 850 ? C 864 ? 
1 C DG 14 1_555 D DC 9  1_555 C DA 15 1_555 D DT 8  1_555 -0.091 -0.243 3.388 3.771  2.258  40.965 -0.597 0.550  3.349 3.215  
-5.369  41.190 9  BB_DG850DA851:DT863DC864_CC B 850 ? C 864 ? B 851 ? C 863 ? 
1 C DA 15 1_555 D DT 8  1_555 C DC 16 1_555 D DG 7  1_555 0.233  -0.258 3.214 -2.368 0.289  35.723 -0.460 -0.713 3.190 0.471  
3.855   35.800 10 BB_DA851DC852:DG862DT863_CC B 851 ? C 863 ? B 852 ? C 862 ? 
1 C DC 16 1_555 D DG 7  1_555 C DC 17 1_555 D DG 6  1_555 -1.039 -0.381 3.236 0.358  4.550  31.044 -1.542 1.987  3.138 8.444  
-0.665  31.370 11 BB_DC852DC853:DG861DG862_CC B 852 ? C 862 ? B 853 ? C 861 ? 
1 E DG 6  1_555 F DC 17 1_555 E DG 7  1_555 F DC 16 1_555 1.110  -0.977 3.260 2.760  8.393  31.060 -3.211 -1.520 2.986 15.290 
-5.028  32.263 12 GG_DG842DG843:DC871DC872_HH G 842 ? H 872 ? G 843 ? H 871 ? 
1 E DG 7  1_555 F DC 16 1_555 E DT 8  1_555 F DA 15 1_555 -0.814 -1.250 3.336 0.776  1.115  32.920 -2.396 1.569  3.274 1.966  
-1.369  32.947 13 GG_DG843DT844:DA870DC871_HH G 843 ? H 871 ? G 844 ? H 870 ? 
1 E DT 8  1_555 F DA 15 1_555 E DC 9  1_555 F DG 14 1_555 0.447  -0.411 2.870 7.390  1.745  33.559 -0.937 0.271  2.876 2.975  
-12.598 34.383 14 GG_DT844DC845:DG869DA870_HH G 844 ? H 870 ? G 845 ? H 869 ? 
1 E DC 9  1_555 F DG 14 1_555 E DC 10 1_555 F DG 13 1_555 0.234  -0.729 3.560 -0.129 6.057  31.260 -2.510 -0.451 3.362 11.110 
0.236   31.827 15 GG_DC845DC846:DG868DG869_HH G 845 ? H 869 ? G 846 ? H 868 ? 
1 E DC 10 1_555 F DG 13 1_555 E DT 11 1_555 F DA 12 1_555 -0.075 -0.775 3.170 3.536  2.454  26.869 -2.237 1.008  3.053 5.238  
-7.548  27.205 16 GG_DC846DT847:DA867DG868_HH G 846 ? H 868 ? G 847 ? H 867 ? 
1 E DT 11 1_555 F DA 12 1_555 E DA 12 1_555 F DT 11 1_555 0.357  0.268  3.130 -0.924 8.895  34.650 -0.804 -0.710 3.093 14.634 
1.521   35.751 17 GG_DT847DA848:DT866DA867_HH G 847 ? H 867 ? G 848 ? H 866 ? 
1 E DA 12 1_555 F DT 11 1_555 E DG 13 1_555 F DC 10 1_555 -0.951 0.122  3.461 -7.061 8.977  32.915 -1.296 0.411  3.499 15.281 
12.021  34.788 18 GG_DA848DG849:DC865DT866_HH G 848 ? H 866 ? G 849 ? H 865 ? 
1 E DG 13 1_555 F DC 10 1_555 E DG 14 1_555 F DC 9  1_555 -0.038 -0.357 3.380 5.480  4.448  37.047 -1.144 0.787  3.278 6.924  
-8.529  37.691 19 GG_DG849DG850:DC864DC865_HH G 849 ? H 865 ? G 850 ? H 864 ? 
1 E DG 14 1_555 F DC 9  1_555 E DA 15 1_555 F DT 8  1_555 0.025  -0.312 3.419 -1.586 3.491  35.427 -1.037 -0.280 3.369 5.715  
2.597   35.628 20 GG_DG850DA851:DT863DC864_HH G 850 ? H 864 ? G 851 ? H 863 ? 
1 E DA 15 1_555 F DT 8  1_555 E DC 16 1_555 F DG 7  1_555 0.470  -0.264 3.135 0.926  0.247  36.411 -0.454 -0.628 3.144 0.395  
-1.481  36.423 21 GG_DA851DC852:DG862DT863_HH G 851 ? H 863 ? G 852 ? H 862 ? 
1 E DC 16 1_555 F DG 7  1_555 E DC 17 1_555 F DG 6  1_555 -0.101 -0.432 3.497 0.597  3.985  32.424 -1.501 0.290  3.419 7.102  
-1.063  32.666 22 GG_DC852DC853:DG861DG862_HH G 852 ? H 862 ? G 853 ? H 861 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 "5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]thymidine" 1FZ 
4 'MAGNESIUM ION'                                                                     MG  
5 water                                                                               HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 3 1FZ 1  401 401 1FZ 1FZ A . 
H 4 MG  1  402 402 MG  MG  A . 
I 4 MG  1  403 403 MG  MG  A . 
J 3 1FZ 1  401 401 1FZ 1FZ F . 
K 4 MG  1  402 402 MG  MG  F . 
L 4 MG  1  403 403 MG  MG  F . 
M 5 HOH 1  501 501 HOH HOH A . 
M 5 HOH 2  502 502 HOH HOH A . 
M 5 HOH 3  503 503 HOH HOH A . 
M 5 HOH 4  504 504 HOH HOH A . 
M 5 HOH 5  505 505 HOH HOH A . 
M 5 HOH 6  506 506 HOH HOH A . 
M 5 HOH 7  507 507 HOH HOH A . 
M 5 HOH 8  508 508 HOH HOH A . 
M 5 HOH 9  509 509 HOH HOH A . 
M 5 HOH 10 510 510 HOH HOH A . 
M 5 HOH 11 511 511 HOH HOH A . 
M 5 HOH 12 512 512 HOH HOH A . 
M 5 HOH 13 513 513 HOH HOH A . 
M 5 HOH 14 514 514 HOH HOH A . 
M 5 HOH 15 515 515 HOH HOH A . 
M 5 HOH 16 516 516 HOH HOH A . 
M 5 HOH 17 517 517 HOH HOH A . 
M 5 HOH 18 518 518 HOH HOH A . 
N 5 HOH 1  501 501 HOH HOH F . 
N 5 HOH 2  502 502 HOH HOH F . 
N 5 HOH 3  503 503 HOH HOH F . 
N 5 HOH 4  504 504 HOH HOH F . 
N 5 HOH 5  505 505 HOH HOH F . 
N 5 HOH 6  506 506 HOH HOH F . 
N 5 HOH 7  507 507 HOH HOH F . 
N 5 HOH 8  508 508 HOH HOH F . 
N 5 HOH 9  509 509 HOH HOH F . 
N 5 HOH 10 510 510 HOH HOH F . 
N 5 HOH 11 511 511 HOH HOH F . 
N 5 HOH 12 512 512 HOH HOH F . 
N 5 HOH 13 513 513 HOH HOH F . 
N 5 HOH 14 514 514 HOH HOH F . 
N 5 HOH 15 515 515 HOH HOH F . 
N 5 HOH 16 516 516 HOH HOH F . 
N 5 HOH 17 517 517 HOH HOH F . 
N 5 HOH 18 518 518 HOH HOH F . 
N 5 HOH 19 519 519 HOH HOH F . 
N 5 HOH 20 520 520 HOH HOH F . 
N 5 HOH 21 521 521 HOH HOH F . 
N 5 HOH 22 522 522 HOH HOH F . 
N 5 HOH 23 523 523 HOH HOH F . 
N 5 HOH 24 524 524 HOH HOH F . 
N 5 HOH 25 525 525 HOH HOH F . 
N 5 HOH 26 526 526 HOH HOH F . 
N 5 HOH 27 527 527 HOH HOH F . 
N 5 HOH 28 528 528 HOH HOH F . 
N 5 HOH 29 529 529 HOH HOH F . 
N 5 HOH 30 530 530 HOH HOH F . 
N 5 HOH 31 531 531 HOH HOH F . 
N 5 HOH 32 532 532 HOH HOH F . 
N 5 HOH 33 533 533 HOH HOH F . 
N 5 HOH 34 534 534 HOH HOH F . 
N 5 HOH 35 535 535 HOH HOH F . 
N 5 HOH 36 536 536 HOH HOH F . 
N 5 HOH 37 537 537 HOH HOH F . 
N 5 HOH 38 538 538 HOH HOH F . 
N 5 HOH 39 539 539 HOH HOH F . 
N 5 HOH 40 540 540 HOH HOH F . 
O 5 HOH 1  901 901 HOH HOH B . 
O 5 HOH 2  902 902 HOH HOH B . 
O 5 HOH 3  903 903 HOH HOH B . 
O 5 HOH 4  904 904 HOH HOH B . 
P 5 HOH 1  901 901 HOH HOH C . 
P 5 HOH 2  902 902 HOH HOH C . 
P 5 HOH 3  903 903 HOH HOH C . 
P 5 HOH 4  904 904 HOH HOH C . 
P 5 HOH 5  905 905 HOH HOH C . 
P 5 HOH 6  906 906 HOH HOH C . 
Q 5 HOH 1  901 901 HOH HOH G . 
Q 5 HOH 2  902 902 HOH HOH G . 
Q 5 HOH 3  903 903 HOH HOH G . 
Q 5 HOH 4  904 904 HOH HOH G . 
Q 5 HOH 5  905 905 HOH HOH G . 
Q 5 HOH 6  906 906 HOH HOH G . 
Q 5 HOH 7  907 907 HOH HOH G . 
Q 5 HOH 8  908 908 HOH HOH G . 
Q 5 HOH 9  909 909 HOH HOH G . 
Q 5 HOH 10 910 910 HOH HOH G . 
Q 5 HOH 11 911 911 HOH HOH G . 
R 5 HOH 1  901 901 HOH HOH H . 
R 5 HOH 2  902 902 HOH HOH H . 
R 5 HOH 3  903 903 HOH HOH H . 
R 5 HOH 4  904 904 HOH HOH H . 
R 5 HOH 5  905 905 HOH HOH H . 
R 5 HOH 6  906 906 HOH HOH H . 
R 5 HOH 7  907 907 HOH HOH H . 
R 5 HOH 8  908 908 HOH HOH H . 
#