data_4Q8E
# 
_entry.id   4Q8E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.295 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Q8E         
NDB   NA2988       
RCSB  RCSB085733   
WWPDB D_1000085733 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4Q8F 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        4Q8E 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-04-26 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gregory, M.T.' 1 
'Yang, W.'      2 
# 
_citation.id                        primary 
_citation.title                     'Structural and mechanistic studies of polymerase eta bypass of phenanthriplatin DNA damage.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            111 
_citation.page_first                9133 
_citation.page_last                 9138 
_citation.year                      2014 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24927576 
_citation.pdbx_database_id_DOI      10.1073/pnas.1405739111 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gregory, M.T.'   1 
primary 'Park, G.Y.'      2 
primary 'Johnstone, T.C.' 3 
primary 'Lee, Y.S.'       4 
primary 'Yang, W.'        5 
primary 'Lippard, S.J.'   6 
# 
_cell.length_a           98.766 
_cell.length_b           98.766 
_cell.length_c           82.197 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           4Q8E 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.entry_id                         4Q8E 
_symmetry.Int_Tables_number                169 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                                                        48617.707 1   
2.7.7.7 ? ? ? 
2 polymer     syn "5'-D(*CP*AP*TP*GP*CP*TP*CP*AP*CP*AP*CP*T)-3'"                                              3386.309  1   ? ? ? 
? 
3 polymer     syn "5'-D(*AP*GP*TP*GP*TP*GP*AP*G)-3'"                                                          2506.665  1   ? ? ? 
? 
4 non-polymer syn "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" 466.172   1   ? ? ? 
? 
5 non-polymer syn 'MAGNESIUM ION'                                                                             24.305    2   ? ? ? 
? 
6 non-polymer syn GLYCEROL                                                                                    92.094    3   ? ? ? 
? 
7 water       nat water                                                                                       18.015    394 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no yes '(DT)(P9G)(DC)(DT)(DC)(DA)(DC)(DA)(DC)(DT)' TXCTCACACT T ? 
3 polydeoxyribonucleotide no no  '(DA)(DG)(DT)(DG)(DT)(DG)(DA)(DG)' AGTGTGAG P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DT  n 
2 2   P9G n 
2 3   DC  n 
2 4   DT  n 
2 5   DC  n 
2 6   DA  n 
2 7   DC  n 
2 8   DA  n 
2 9   DC  n 
2 10  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DT  n 
3 4   DG  n 
3 5   DT  n 
3 6   DG  n 
3 7   DA  n 
3 8   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, POLH RAD30 RAD30A XPV, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'Synthesized by Sigma-Aldrich and adducted with phenanthriplatin' 
3 1 sample ? ? ? ? ? 'Synthesized by Sigma-Aldrich'                                    
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4Q8E       4Q8E   2 TXCTCACACT ? ? 
3 PDB 4Q8E       4Q8E   3 AGTGTGAG ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4Q8E A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4Q8E T 1 ? 10  ? 4Q8E   3 ? 12  ? 3 12  
3 3 4Q8E P 1 ? 8   ? 4Q8E   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Q8E GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4Q8E PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4Q8E HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0KX non-polymer         . "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" ? 
'C9 H17 N4 O12 P3'   466.172 
ALA 'L-peptide linking' y ALANINE                                                                                     ? 
'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE                                                                                    ? 
'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                  ? 
'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                             ? 
'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                    ? 
'C3 H7 N O2 S'       121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                        ? 
'C10 H14 N5 O6 P'    331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                         ? 
'C9 H14 N3 O7 P'     307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                        ? 
'C10 H14 N5 O7 P'    347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                ? 
'C10 H15 N2 O8 P'    322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                                   ? 
'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                             ? 
'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE                                                                                     ? 
'C2 H5 N O2'         75.067  
GOL non-polymer         . GLYCEROL                                                                                    
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'           92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                                   ? 
'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER                                                                                       ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                  ? 
'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                     ? 
'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE                                                                                      ? 
'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE                                                                                  ? 
'C5 H11 N O2 S'      149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                             ? 'Mg 2' 
24.305  
P9G 'DNA linking'       . 
;diamino(2'-deoxy-5'-guanylic acid-kappaN~8~)(phenanthridine)platinum
;
?                               'C23 H27 N8 O7 P Pt' 753.562 
PHE 'L-peptide linking' y PHENYLALANINE                                                                               ? 
'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE                                                                                     ? 
'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE                                                                                      ? 
'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE                                                                                   ? 
'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                  ? 
'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                    ? 
'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE                                                                                      ? 
'C5 H11 N O2'        117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4Q8E 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   42.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    'PEG 2000-MME, MES, pH 6.0, vapor diffusion, hanging drop, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2012-11-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
# 
_reflns.entry_id                     4Q8E 
_reflns.d_resolution_high            1.549 
_reflns.d_resolution_low             30.000 
_reflns.number_obs                   65955 
_reflns.pdbx_Rmerge_I_obs            0.078 
_reflns.pdbx_netI_over_sigmaI        10.200 
_reflns.pdbx_chi_squared             1.007 
_reflns.pdbx_redundancy              3.400 
_reflns.percent_possible_obs         99.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.550 1.580  ? ? ? 0.660 ? ? 1.006 3.200 ? 3259 99.500  1  1 
1.580 1.610  ? ? ? 0.585 ? ? 1.027 3.200 ? 3283 99.500  2  1 
1.610 1.640  ? ? ? 0.531 ? ? 1.023 3.200 ? 3259 99.600  3  1 
1.640 1.670  ? ? ? 0.438 ? ? 0.907 3.300 ? 3314 99.700  4  1 
1.670 1.710  ? ? ? 0.394 ? ? 1.001 3.300 ? 3265 99.800  5  1 
1.710 1.750  ? ? ? 0.338 ? ? 0.991 3.300 ? 3298 99.800  6  1 
1.750 1.790  ? ? ? 0.291 ? ? 0.972 3.400 ? 3293 99.800  7  1 
1.790 1.840  ? ? ? 0.249 ? ? 0.967 3.400 ? 3296 99.900  8  1 
1.840 1.890  ? ? ? 0.210 ? ? 1.028 3.400 ? 3282 99.900  9  1 
1.890 1.950  ? ? ? 0.172 ? ? 1.024 3.400 ? 3304 99.900  10 1 
1.950 2.020  ? ? ? 0.130 ? ? 1.001 3.400 ? 3294 99.900  11 1 
2.020 2.100  ? ? ? 0.111 ? ? 1.035 3.400 ? 3304 100.000 12 1 
2.100 2.200  ? ? ? 0.099 ? ? 1.079 3.400 ? 3288 100.000 13 1 
2.200 2.320  ? ? ? 0.099 ? ? 0.958 3.400 ? 3305 100.000 14 1 
2.320 2.460  ? ? ? 0.103 ? ? 1.033 3.400 ? 3313 100.000 15 1 
2.460 2.650  ? ? ? 0.102 ? ? 1.069 3.400 ? 3296 100.000 16 1 
2.650 2.920  ? ? ? 0.080 ? ? 1.063 3.400 ? 3330 100.000 17 1 
2.920 3.340  ? ? ? 0.060 ? ? 1.011 3.400 ? 3313 100.000 18 1 
3.340 4.200  ? ? ? 0.041 ? ? 0.971 3.400 ? 3330 99.900  19 1 
4.200 30.000 ? ? ? 0.036 ? ? 0.969 3.300 ? 3329 97.900  20 1 
# 
_refine.entry_id                                 4Q8E 
_refine.ls_d_res_high                            1.5490 
_refine.ls_d_res_low                             26.9370 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.6400 
_refine.ls_number_reflns_obs                     65893 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            'Copied from 3MR2 and extended randomly.' 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1864 
_refine.ls_R_factor_R_work                       0.1832 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2253 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 7.7700 
_refine.ls_number_reflns_R_free                  5122 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               21.9214 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1700 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                103.870 
_refine.B_iso_min                                4.390 
_refine.pdbx_overall_phase_error                 22.0100 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3358 
_refine_hist.pdbx_number_atoms_nucleic_acid   380 
_refine_hist.pdbx_number_atoms_ligand         48 
_refine_hist.number_atoms_solvent             394 
_refine_hist.number_atoms_total               4180 
_refine_hist.d_res_high                       1.5490 
_refine_hist.d_res_low                        26.9370 
# 
_struct.entry_id                  4Q8E 
_struct.title                     'Human DNA polymerase eta inserting dCMPNPP opposite a phenanthriplatin adducted G' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4Q8E 
_struct_keywords.text            'polymerase, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? ASN A 233 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 17 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 18 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 19 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 20 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 21 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DT  1   "O3'" A ? ? 1_555 B P9G 2 P  A ? T DT  3   T P9G 4   1_555 ? ? ? ? ? ? ?            1.615 ? 
covale2  covale ? ? B DT  1   "O3'" B ? ? 1_555 B P9G 2 P  B ? T DT  3   T P9G 4   1_555 ? ? ? ? ? ? ?            1.618 ? 
metalc1  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 F MG  . MG ? ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            1.898 ? 
metalc2  metalc ? ? A GLU 119 OE2   ? ? ? 1_555 F MG  . MG ? ? A GLU 116 A MG  503 1_555 ? ? ? ? ? ? ?            1.941 ? 
metalc3  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 E MG  . MG ? ? A ASP 13  A MG  502 1_555 ? ? ? ? ? ? ?            2.103 ? 
metalc4  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E MG  . MG ? ? A ASP 115 A MG  502 1_555 ? ? ? ? ? ? ?            2.165 ? 
metalc5  metalc ? ? D 0KX .   O2B   ? ? ? 1_555 E MG  . MG ? ? A 0KX 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.181 ? 
metalc6  metalc ? ? D 0KX .   O2G   ? ? ? 1_555 E MG  . MG ? ? A 0KX 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.187 ? 
metalc7  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 F MG  . MG ? ? A ASP 115 A MG  503 1_555 ? ? ? ? ? ? ?            2.189 ? 
metalc8  metalc ? ? A MET 17  O     ? ? ? 1_555 E MG  . MG ? ? A MET 14  A MG  502 1_555 ? ? ? ? ? ? ?            2.244 ? 
metalc9  metalc ? ? D 0KX .   O1A   ? ? ? 1_555 E MG  . MG ? ? A 0KX 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.261 ? 
metalc10 metalc ? ? D 0KX .   O1A   ? ? ? 1_555 F MG  . MG ? ? A 0KX 501 A MG  503 1_555 ? ? ? ? ? ? ?            2.350 ? 
metalc11 metalc ? ? C DG  8   "O3'" ? ? ? 1_555 F MG  . MG ? ? P DG  8   A MG  503 1_555 ? ? ? ? ? ? ?            2.486 ? 
metalc12 metalc ? ? F MG  .   MG    ? ? ? 1_555 J HOH . O  ? ? A MG  503 A HOH 930 1_555 ? ? ? ? ? ? ?            2.122 ? 
hydrog1  hydrog ? ? B DC  3   N3    ? ? ? 1_555 C DG  8 N1 ? ? T DC  5   P DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  3   N4    ? ? ? 1_555 C DG  8 O6 ? ? T DC  5   P DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  3   O2    ? ? ? 1_555 C DG  8 N2 ? ? T DC  5   P DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  4   N3    ? ? ? 1_555 C DA  7 N1 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  4   O4    ? ? ? 1_555 C DA  7 N6 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DC  5   N3    ? ? ? 1_555 C DG  6 N1 ? ? T DC  7   P DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DC  5   N4    ? ? ? 1_555 C DG  6 O6 ? ? T DC  7   P DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  5   O2    ? ? ? 1_555 C DG  6 N2 ? ? T DC  7   P DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  6   N1    ? ? ? 1_555 C DT  5 N3 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  6   N6    ? ? ? 1_555 C DT  5 O4 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  7   N3    ? ? ? 1_555 C DG  4 N1 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  7   N4    ? ? ? 1_555 C DG  4 O6 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  7   O2    ? ? ? 1_555 C DG  4 N2 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  3 N3 ? ? T DA  10  P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  3 O4 ? ? T DA  10  P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  2 N1 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  2 O6 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  2 N2 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  10  N3    ? ? ? 1_555 C DA  1 N1 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  10  O4    ? ? ? 1_555 C DA  1 N6 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 3.01  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 8.31  
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -9.47 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
A 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O LEU A 422 ? O LEU A 419 N LEU A 334 ? N LEU A 331 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE 0KX A 501' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 502'  
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 503'  
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 504' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 505' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 24 ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 24 MET A 17  ? MET A 14  . ? 1_555 ? 
3  AC1 24 ASP A 18  ? ASP A 15  . ? 1_555 ? 
4  AC1 24 CYS A 19  ? CYS A 16  . ? 1_555 ? 
5  AC1 24 PHE A 20  ? PHE A 17  . ? 1_555 ? 
6  AC1 24 PHE A 21  ? PHE A 18  . ? 1_555 ? 
7  AC1 24 ILE A 51  ? ILE A 48  . ? 1_555 ? 
8  AC1 24 ALA A 52  ? ALA A 49  . ? 1_555 ? 
9  AC1 24 TYR A 55  ? TYR A 52  . ? 1_555 ? 
10 AC1 24 ARG A 58  ? ARG A 55  . ? 1_555 ? 
11 AC1 24 ARG A 64  ? ARG A 61  . ? 1_555 ? 
12 AC1 24 ASP A 118 ? ASP A 115 . ? 1_555 ? 
13 AC1 24 LYS A 234 ? LYS A 231 . ? 1_555 ? 
14 AC1 24 MG  E .   ? MG  A 502 . ? 1_555 ? 
15 AC1 24 MG  F .   ? MG  A 503 . ? 1_555 ? 
16 AC1 24 HOH J .   ? HOH A 612 . ? 1_555 ? 
17 AC1 24 HOH J .   ? HOH A 638 . ? 1_555 ? 
18 AC1 24 HOH J .   ? HOH A 639 . ? 1_555 ? 
19 AC1 24 HOH J .   ? HOH A 725 . ? 1_555 ? 
20 AC1 24 HOH J .   ? HOH A 924 . ? 1_555 ? 
21 AC1 24 HOH J .   ? HOH A 930 . ? 1_555 ? 
22 AC1 24 HOH J .   ? HOH A 931 . ? 1_555 ? 
23 AC1 24 DG  C 8   ? DG  P 8   . ? 1_555 ? 
24 AC1 24 P9G B 2   ? P9G T 4   . ? 1_555 ? 
25 AC2 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
26 AC2 5  MET A 17  ? MET A 14  . ? 1_555 ? 
27 AC2 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
28 AC2 5  0KX D .   ? 0KX A 501 . ? 1_555 ? 
29 AC2 5  MG  F .   ? MG  A 503 . ? 1_555 ? 
30 AC3 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
31 AC3 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
32 AC3 7  GLU A 119 ? GLU A 116 . ? 1_555 ? 
33 AC3 7  0KX D .   ? 0KX A 501 . ? 1_555 ? 
34 AC3 7  MG  E .   ? MG  A 502 . ? 1_555 ? 
35 AC3 7  HOH J .   ? HOH A 930 . ? 1_555 ? 
36 AC3 7  DG  C 8   ? DG  P 8   . ? 1_555 ? 
37 AC4 10 ARG A 27  ? ARG A 24  . ? 6_545 ? 
38 AC4 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
39 AC4 10 PHE A 250 ? PHE A 247 . ? 1_555 ? 
40 AC4 10 SER A 251 ? SER A 248 . ? 1_555 ? 
41 AC4 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
42 AC4 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
43 AC4 10 HOH J .   ? HOH A 602 . ? 1_555 ? 
44 AC4 10 HOH J .   ? HOH A 644 . ? 1_555 ? 
45 AC4 10 HOH J .   ? HOH A 672 . ? 1_555 ? 
46 AC4 10 HOH J .   ? HOH A 702 . ? 1_555 ? 
47 AC5 9  GLU A 97  ? GLU A 94  . ? 1_555 ? 
48 AC5 9  ALA A 98  ? ALA A 95  . ? 1_555 ? 
49 AC5 9  GLU A 101 ? GLU A 98  . ? 1_555 ? 
50 AC5 9  ARG A 306 ? ARG A 303 . ? 5_664 ? 
51 AC5 9  HOH J .   ? HOH A 631 . ? 1_555 ? 
52 AC5 9  HOH J .   ? HOH A 637 . ? 1_555 ? 
53 AC5 9  HOH J .   ? HOH A 728 . ? 5_664 ? 
54 AC5 9  HOH J .   ? HOH A 794 . ? 5_664 ? 
55 AC5 9  HOH J .   ? HOH A 807 . ? 5_664 ? 
56 AC6 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
57 AC6 10 PRO A 30  ? PRO A 27  . ? 1_555 ? 
58 AC6 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
59 AC6 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
60 AC6 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
61 AC6 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
62 AC6 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
63 AC6 10 HOH J .   ? HOH A 667 . ? 1_555 ? 
64 AC6 10 HOH J .   ? HOH A 787 . ? 5_664 ? 
65 AC6 10 HOH J .   ? HOH A 818 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4Q8E 
_atom_sites.fract_transf_matrix[1][1]   0.010125 
_atom_sites.fract_transf_matrix[1][2]   0.005846 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011691 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012166 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
PT 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 66.389 -34.603 -4.019  1.00 37.82  ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.761 -34.165 -4.208  1.00 42.58  ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.920 -33.217 -5.381  1.00 42.77  ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.559 -32.041 -5.283  1.00 43.98  ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.459 -33.728 -6.504  1.00 45.52  ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.709 -32.960 -7.734  1.00 38.98  ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.451 -32.376 -8.386  1.00 46.06  ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.569 -31.559 -9.306  1.00 45.03  ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.355 -33.994 -8.671  1.00 44.77  ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.972 -35.334 -8.107  1.00 43.03  ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.920 -35.124 -6.624  1.00 40.53  ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.273 -32.778 -7.915  1.00 38.26  ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.023 -32.401 -8.577  1.00 42.38  ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.046 -31.677 -7.666  1.00 42.34  ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 62.885 -31.480 -8.029  1.00 40.74  ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.347 -33.639 -9.164  1.00 31.46  ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.279 -34.506 -9.939  1.00 30.96  ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.687 -35.743 -9.488  1.00 30.42  ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.908 -34.307 -11.122 1.00 27.19  ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.515 -36.274 -10.370 1.00 28.79  ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.663 -35.427 -11.373 1.00 33.69  ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.518 -31.292 -6.483  1.00 41.21  ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.703 -30.536 -5.543  1.00 45.76  ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.928 -29.042 -5.765  1.00 40.33  ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.997 -28.521 -5.453  1.00 34.78  ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 64.061 -30.907 -4.102  1.00 49.80  ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.904 -30.777 -3.128  1.00 60.48  ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.703 -32.112 -3.325  1.00 72.53  ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 62.439 -33.392 -2.305  1.00 55.27  ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.925 -28.366 -6.319  1.00 38.45  ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 63.022 -26.933 -6.592  1.00 38.34  ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.146 -26.171 -5.287  1.00 29.13  ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.619 -26.589 -4.255  1.00 30.13  ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.824 -26.445 -7.388  1.00 41.18  ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.881 -25.068 -5.319  1.00 23.29  ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.172 -24.355 -4.087  1.00 24.05  ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.681 -22.924 -4.150  1.00 18.99  ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.920 -22.141 -3.236  1.00 18.78  ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.669 -24.334 -3.805  1.00 24.60  ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.340 -23.774 -4.942  1.00 20.90  ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.173 -25.754 -3.534  1.00 24.46  ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 63.005 -22.586 -5.242  1.00 20.92  ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.454 -21.252 -5.413  1.00 15.86  ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.504 -20.159 -5.360  1.00 18.41  ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.287 -19.114 -4.737  1.00 17.18  ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.648 -20.395 -6.000  1.00 15.65  ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.750 -19.440 -5.948  1.00 12.67  ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.054 -18.856 -7.320  1.00 14.38  ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.138 -18.335 -7.550  1.00 15.08  ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 67.007 -20.115 -5.384  1.00 12.57  ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.964 -20.330 -3.872  1.00 15.10  ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.165 -21.108 -3.384  1.00 14.34  ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.333 -22.265 -3.758  1.00 16.05  ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 69.016 -20.489 -2.583  1.00 15.52  ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.053 -18.906 -8.197  1.00 15.45  ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.199 -18.590 -9.613  1.00 16.68  ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.149 -17.093 -9.942  1.00 17.42  ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.655 -16.665 -10.978 1.00 21.36  ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.106 -19.332 -10.398 1.00 18.07  ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.707 -19.133 -9.798  1.00 23.53  ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.516 -19.355 -8.581  1.00 24.43  ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.778 -18.737 -10.545 1.00 34.44  ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.536 -16.303 -9.069  1.00 14.32  ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.374 -14.870 -9.328  1.00 14.05  ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 64.986 -14.041 -8.212  1.00 11.30  ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.184 -14.532 -7.102  1.00 11.37  ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.900 -14.497 -9.377  1.00 11.69  ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.056 -15.138 -10.474 1.00 15.02  ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.607 -14.692 -10.322 1.00 14.43  ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 59.972 -15.325 -9.159  1.00 14.93  ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.886 -14.874 -8.543  1.00 14.75  ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.411 -15.535 -7.496  1.00 13.14  ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.292 -13.742 -8.937  1.00 14.06  ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.253 -12.768 -8.510  1.00 9.01   ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.577 -11.778 -7.481  1.00 6.75   ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.448 -10.762 -7.483  1.00 10.36  ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.211 -10.136 -8.503  1.00 10.34  ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.914 -11.037 -7.735  1.00 9.81   ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.194 -10.061 -6.605  1.00 10.69  ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.070 -12.039 -7.851  1.00 12.35  ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.750 -10.628 -6.348  1.00 7.19   ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.578 -9.747  -6.256  1.00 7.97   ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.784 -8.788  -5.112  1.00 6.98   ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.211 -9.202  -4.019  1.00 8.18   ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.287 -10.563 -6.017  1.00 6.20   ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.093 -9.668  -5.772  1.00 10.54  ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 61.011 -11.469 -7.217  1.00 9.61   ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.514 -7.505  -5.340  1.00 8.51   ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.494 -6.565  -4.231  1.00 6.67   ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.150 -5.941  -4.050  1.00 8.16   ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.341 -5.851  -4.979  1.00 9.21   ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.563 -5.453  -4.381  1.00 8.54   ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.920 -5.517  -2.816  1.00 5.83   ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.746 -4.730  -2.477  1.00 6.35   ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.239 -3.442  -1.829  1.00 9.69   ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.963 -3.492  -0.828  1.00 8.72   ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.813 -5.504  -1.549  1.00 8.90   ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.483 -4.921  -1.063  1.00 9.42   ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.662 -4.005  0.135   1.00 10.72  ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.712 -4.190  -2.170  1.00 8.46   ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.858 -2.301  -2.403  1.00 8.08   ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.246 -0.995  -1.858  1.00 8.31   ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 59.002 -0.365  -1.265  1.00 10.19  ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.975 -0.334  -1.920  1.00 10.85  ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.808 -0.101  -2.980  1.00 10.80  ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.131 1.288   -2.433  1.00 10.98  ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 62.038 -0.738  -3.583  1.00 11.69  ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 59.071 0.062   -0.000  1.00 7.75   ? 13  ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 57.910 0.644   0.673   1.00 8.32   ? 13  ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 58.298 1.963   1.331   1.00 7.30   ? 13  ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 59.202 2.013   2.175   1.00 8.61   ? 13  ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 57.321 -0.295  1.715   1.00 9.90   ? 13  ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 56.052 0.273   2.308   1.00 11.62  ? 13  ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 56.167 1.127   3.153   1.00 11.67  ? 13  ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 54.954 -0.080  1.861   1.00 18.87  ? 13  ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 57.567 3.020   1.021   1.00 7.34   ? 14  MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 57.951 4.316   1.555   1.00 7.00   ? 14  MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 57.744 4.379   3.063   1.00 7.35   ? 14  MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 56.804 3.826   3.584   1.00 7.83   ? 14  MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 57.111 5.417   0.891   1.00 8.48   ? 14  MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 57.239 5.424   -0.653  1.00 7.72   ? 14  MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 58.919 5.459   -1.313  1.00 10.55  ? 14  MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 59.446 7.034   -0.777  1.00 13.16  ? 14  MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 58.661 5.042   3.757   1.00 5.71   ? 15  ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 58.484 5.210   5.212   1.00 7.09   ? 15  ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 57.438 6.284   5.489   1.00 8.23   ? 15  ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 57.414 7.329   4.803   1.00 7.27   ? 15  ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 59.817 5.588   5.849   1.00 9.74   ? 15  ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 60.877 4.500   5.678   1.00 9.15   ? 15  ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 60.498 3.321   5.577   1.00 10.14  ? 15  ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 62.069 4.825   5.674   1.00 12.40  ? 15  ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 56.592 6.030   6.487   1.00 6.06   ? 16  CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 55.488 6.952   6.898   1.00 6.53   ? 16  CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 55.067 7.899   5.774   1.00 6.33   ? 16  CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 55.249 9.121   5.856   1.00 7.04   ? 16  CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 55.821 7.691   8.207   1.00 10.89  ? 16  CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 57.382 8.617   8.257   1.00 11.03  ? 16  CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 54.566 7.324   4.696   1.00 5.44   ? 17  PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 54.581 8.034   3.412   1.00 5.60   ? 17  PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 53.849 9.367   3.442   1.00 5.97   ? 17  PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 54.441 10.361  3.073   1.00 5.73   ? 17  PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 53.989 7.160   2.299   1.00 6.88   ? 17  PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 54.040 7.794   0.932   1.00 5.26   ? 17  PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 55.221 8.379   0.449   1.00 7.92   ? 17  PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 52.917 7.778   0.119   1.00 7.58   ? 17  PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 55.249 8.954   -0.838  1.00 9.45   ? 17  PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 52.961 8.348   -1.186  1.00 8.94   ? 17  PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 54.116 8.922   -1.633  1.00 8.68   ? 17  PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 52.588 9.400   3.865   1.00 5.46   ? 18  PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 51.848 10.669  3.747   1.00 5.79   ? 18  PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 52.492 11.719  4.663   1.00 7.61   ? 18  PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 52.470 12.905  4.363   1.00 7.28   ? 18  PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 50.369 10.534  4.135   1.00 5.58   ? 18  PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 49.513 9.785   3.148   1.00 7.91   ? 18  PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 50.056 9.054   2.102   1.00 5.94   ? 18  PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 48.134 9.827   3.266   1.00 8.02   ? 18  PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 49.223 8.354   1.198   1.00 7.81   ? 18  PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 47.295 9.136   2.370   1.00 8.17   ? 18  PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 47.857 8.385   1.353   1.00 8.57   ? 18  PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 53.047 11.286  5.797   1.00 5.99   ? 19  VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 53.784 12.211  6.669   1.00 6.88   ? 19  VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 55.010 12.780  5.918   1.00 6.89   ? 19  VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 55.255 13.985  5.968   1.00 7.68   ? 19  VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 54.211 11.504  7.977   1.00 5.17   ? 19  VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 55.319 12.296  8.702   1.00 8.49   ? 19  VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 52.998 11.287  8.870   1.00 10.30  ? 19  VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 55.773 11.958  5.205   1.00 6.90   ? 20  GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 56.915 12.530  4.470   1.00 5.38   ? 20  GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 56.504 13.523  3.408   1.00 7.30   ? 20  GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 57.242 14.494  3.169   1.00 7.58   ? 20  GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 57.785 11.476  3.794   1.00 6.72   ? 20  GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 58.551 10.640  4.771   1.00 10.82  ? 20  GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 59.636 9.919   4.034   1.00 11.70  ? 20  GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 60.694 10.482  3.767   1.00 11.11  ? 20  GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 59.355 8.685   3.631   1.00 12.89  ? 20  GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 55.398 13.230  2.726   1.00 5.13   ? 21  VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 54.845 14.171  1.742   1.00 4.77   ? 21  VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 54.579 15.525  2.423   1.00 6.60   ? 21  VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 55.001 16.583  1.907   1.00 7.33   ? 21  VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 53.587 13.630  1.044   1.00 6.42   ? 21  VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 53.035 14.664  0.067   1.00 8.12   ? 21  VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 53.934 12.348  0.263   1.00 6.27   ? 21  VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 53.937 15.492  3.580   1.00 5.20   ? 22  GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 53.640 16.752  4.266   1.00 5.87   ? 22  GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 54.907 17.414  4.831   1.00 6.81   ? 22  GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 55.011 18.648  4.874   1.00 8.15   ? 22  GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 52.580 16.534  5.359   1.00 5.30   ? 22  GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 51.262 16.057  4.826   1.00 7.73   ? 22  GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 50.536 17.090  3.950   1.00 11.21  ? 22  GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 50.780 18.316  4.087   1.00 12.48  ? 22  GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 49.665 16.663  3.160   1.00 13.58  ? 22  GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 55.863 16.619  5.313   1.00 6.04   ? 23  GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 57.104 17.186  5.823   1.00 6.53   ? 23  GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 57.987 17.830  4.755   1.00 7.33   ? 23  GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 58.697 18.812  5.034   1.00 8.60   ? 23  GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 57.906 16.117  6.570   1.00 6.83   ? 23  GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 57.252 15.676  7.875   1.00 7.41   ? 23  GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 58.007 14.516  8.497   1.00 10.08  ? 23  GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 58.431 13.610  7.797   1.00 11.68  ? 23  GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 58.190 14.549  9.814   1.00 11.56  ? 23  GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 57.969 17.273  3.548   1.00 6.79   ? 24  ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 58.725 17.899  2.472   1.00 8.22   ? 24  ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 58.132 19.274  2.195   1.00 9.34   ? 24  ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 58.872 20.244  2.050   1.00 8.23   ? 24  ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 58.689 17.062  1.206   1.00 8.27   ? 24  ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 59.480 17.700  0.034   1.00 8.49   ? 24  ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 59.495 16.728  -1.181  1.00 10.61  ? 24  ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 58.190 16.668  -1.837  1.00 8.72   ? 24  ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 57.975 16.082  -3.010  1.00 8.15   ? 24  ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 58.980 15.469  -3.633  1.00 8.32   ? 24  ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 56.766 16.071  -3.547  1.00 11.09  ? 24  ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 56.805 19.345  2.183   1.00 7.12   ? 25  GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 56.103 20.605  1.861   1.00 7.61   ? 25  GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 56.299 21.661  2.953   1.00 9.22   ? 25  GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 56.406 22.851  2.664   1.00 9.98   ? 25  GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 54.604 20.337  1.661   1.00 7.23   ? 25  GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 53.803 21.574  1.240   1.00 10.87  ? 25  GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 52.332 21.255  1.068   1.00 11.70  ? 25  GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 51.985 20.203  0.564   1.00 13.06  ? 25  GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 51.458 22.177  1.477   1.00 21.21  ? 25  GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 56.273 21.216  4.208   1.00 7.98   ? 26  ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 56.301 22.112  5.370   1.00 9.84   ? 26  ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 57.460 21.735  6.279   1.00 9.13   ? 26  ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 57.332 20.847  7.142   1.00 8.26   ? 26  ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 54.987 22.039  6.172   1.00 9.05   ? 26  ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 54.968 23.033  7.353   1.00 10.37  ? 26  ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 55.956 23.672  7.652   1.00 11.75  ? 26  ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 53.808 23.153  8.009   1.00 15.35  ? 26  ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 58.599 22.415  6.112   1.00 8.88   ? 27  PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 59.803 22.090  6.871   1.00 10.21  ? 27  PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 59.608 22.153  8.389   1.00 11.92  ? 27  PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 60.372 21.520  9.101   1.00 10.88  ? 27  PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? 60.802 23.165  6.420   1.00 14.14  ? 27  PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? 60.347 23.520  5.062   1.00 12.02  ? 27  PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? 58.851 23.393  5.041   1.00 9.45   ? 27  PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 58.598 22.873  8.870   1.00 11.08  ? 28  HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 58.368 22.937  10.308  1.00 14.55  ? 28  HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 57.951 21.605  10.890  1.00 13.11  ? 28  HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 57.991 21.428  12.108  1.00 14.66  ? 28  HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? 57.277 23.945  10.641  1.00 17.48  ? 28  HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? 57.734 25.361  10.596  1.00 22.01  ? 28  HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? 57.019 26.355  9.964   1.00 31.94  ? 28  HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? 58.832 25.957  11.118  1.00 23.01  ? 28  HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? 57.659 27.503  10.097  1.00 28.51  ? 28  HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? 58.764 27.288  10.788  1.00 25.83  ? 28  HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 57.529 20.675  10.040  1.00 9.94   ? 29  LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 57.080 19.365  10.526  1.00 9.83   ? 29  LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 58.206 18.343  10.517  1.00 9.48   ? 29  LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 58.041 17.243  11.027  1.00 9.91   ? 29  LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 55.936 18.816  9.655   1.00 8.12   ? 29  LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 54.692 19.676  9.540   1.00 9.80   ? 29  LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 53.696 19.002  8.580   1.00 10.40  ? 29  LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 54.029 19.878  10.907  1.00 13.70  ? 29  LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 59.352 18.697  9.932   1.00 8.40   ? 30  ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 60.462 17.761  9.829   1.00 9.18   ? 30  ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 61.077 17.392  11.182  1.00 12.51  ? 30  ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 61.220 18.238  12.051  1.00 12.50  ? 30  ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 61.545 18.291  8.879   1.00 10.17  ? 30  ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 60.990 18.566  7.472   1.00 10.66  ? 30  ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 62.040 19.124  6.523   1.00 11.61  ? 30  ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 61.474 19.415  5.201   1.00 10.21  ? 30  ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 62.186 19.907  4.191   1.00 15.70  ? 30  ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 63.480 20.165  4.368   1.00 15.37  ? 30  ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 61.603 20.168  3.021   1.00 12.39  ? 30  ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 61.395 16.109  11.342  1.00 13.35  ? 31  ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 62.029 15.612  12.562  1.00 15.07  ? 31  ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 61.224 15.896  13.827  1.00 18.55  ? 31  ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 61.778 16.198  14.890  1.00 18.88  ? 31  ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 63.443 16.172  12.686  1.00 19.51  ? 31  ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 64.268 15.920  11.448  1.00 20.21  ? 31  ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 64.454 14.777  11.029  1.00 28.02  ? 31  ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 64.733 16.993  10.828  1.00 27.43  ? 31  ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 59.910 15.798  13.699  1.00 12.59  ? 32  LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 58.990 16.091  14.796  1.00 14.93  ? 32  LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 57.989 14.963  14.908  1.00 13.46  ? 32  LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 57.732 14.280  13.924  1.00 11.78  ? 32  LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 58.178 17.356  14.497  1.00 14.28  ? 32  LYS A CB    1 
ATOM   278  C  CG    A LYS A 1 35  ? 58.999 18.630  14.420  0.25 17.42  ? 32  LYS A CG    1 
ATOM   279  C  CG    B LYS A 1 35  ? 58.986 18.626  14.383  0.75 17.41  ? 32  LYS A CG    1 
ATOM   280  C  CD    A LYS A 1 35  ? 59.379 19.142  15.792  0.25 22.69  ? 32  LYS A CD    1 
ATOM   281  C  CD    B LYS A 1 35  ? 59.241 19.241  15.719  0.75 22.82  ? 32  LYS A CD    1 
ATOM   282  C  CE    A LYS A 1 35  ? 60.373 20.292  15.673  0.25 24.43  ? 32  LYS A CE    1 
ATOM   283  C  CE    B LYS A 1 35  ? 60.185 20.440  15.578  0.75 24.53  ? 32  LYS A CE    1 
ATOM   284  N  NZ    A LYS A 1 35  ? 59.921 21.298  14.674  0.25 25.26  ? 32  LYS A NZ    1 
ATOM   285  N  NZ    B LYS A 1 35  ? 60.385 21.080  16.902  0.75 30.73  ? 32  LYS A NZ    1 
ATOM   286  N  N     . PRO A 1 36  ? 57.401 14.773  16.109  1.00 11.06  ? 33  PRO A N     1 
ATOM   287  C  CA    . PRO A 1 36  ? 56.266 13.860  16.194  1.00 10.00  ? 33  PRO A CA    1 
ATOM   288  C  C     . PRO A 1 36  ? 55.114 14.511  15.427  1.00 9.35   ? 33  PRO A C     1 
ATOM   289  O  O     . PRO A 1 36  ? 54.650 15.620  15.777  1.00 10.41  ? 33  PRO A O     1 
ATOM   290  C  CB    . PRO A 1 36  ? 55.966 13.812  17.691  1.00 11.05  ? 33  PRO A CB    1 
ATOM   291  C  CG    . PRO A 1 36  ? 56.519 15.090  18.244  1.00 15.72  ? 33  PRO A CG    1 
ATOM   292  C  CD    . PRO A 1 36  ? 57.675 15.468  17.387  1.00 13.73  ? 33  PRO A CD    1 
ATOM   293  N  N     A CYS A 1 37  ? 54.670 13.855  14.368  0.65 10.04  ? 34  CYS A N     1 
ATOM   294  N  N     B CYS A 1 37  ? 54.686 13.824  14.363  0.35 10.02  ? 34  CYS A N     1 
ATOM   295  C  CA    A CYS A 1 37  ? 53.560 14.411  13.640  0.65 8.69   ? 34  CYS A CA    1 
ATOM   296  C  CA    B CYS A 1 37  ? 53.759 14.362  13.371  0.35 8.93   ? 34  CYS A CA    1 
ATOM   297  C  C     A CYS A 1 37  ? 52.766 13.328  12.942  0.65 8.25   ? 34  CYS A C     1 
ATOM   298  C  C     B CYS A 1 37  ? 52.758 13.284  12.947  0.35 8.29   ? 34  CYS A C     1 
ATOM   299  O  O     A CYS A 1 37  ? 53.234 12.195  12.799  0.65 9.88   ? 34  CYS A O     1 
ATOM   300  O  O     B CYS A 1 37  ? 53.067 12.094  13.008  0.35 9.64   ? 34  CYS A O     1 
ATOM   301  C  CB    A CYS A 1 37  ? 54.044 15.465  12.643  0.65 9.63   ? 34  CYS A CB    1 
ATOM   302  C  CB    B CYS A 1 37  ? 54.556 14.837  12.142  0.35 10.18  ? 34  CYS A CB    1 
ATOM   303  S  SG    A CYS A 1 37  ? 55.105 14.781  11.381  0.65 12.06  ? 34  CYS A SG    1 
ATOM   304  S  SG    B CYS A 1 37  ? 53.662 15.759  10.852  0.35 9.48   ? 34  CYS A SG    1 
ATOM   305  N  N     . ALA A 1 38  ? 51.559 13.682  12.537  1.00 6.75   ? 35  ALA A N     1 
ATOM   306  C  CA    . ALA A 1 38  ? 50.616 12.726  11.955  1.00 7.66   ? 35  ALA A CA    1 
ATOM   307  C  C     . ALA A 1 38  ? 49.804 13.408  10.890  1.00 8.50   ? 35  ALA A C     1 
ATOM   308  O  O     . ALA A 1 38  ? 49.650 14.614  10.915  1.00 9.22   ? 35  ALA A O     1 
ATOM   309  C  CB    . ALA A 1 38  ? 49.693 12.120  13.033  1.00 9.62   ? 35  ALA A CB    1 
ATOM   310  N  N     . VAL A 1 39  ? 49.242 12.617  9.980   1.00 8.23   ? 36  VAL A N     1 
ATOM   311  C  CA    . VAL A 1 39  ? 48.319 13.130  8.978   1.00 7.53   ? 36  VAL A CA    1 
ATOM   312  C  C     . VAL A 1 39  ? 46.921 12.685  9.334   1.00 10.63  ? 36  VAL A C     1 
ATOM   313  O  O     . VAL A 1 39  ? 46.723 11.516  9.700   1.00 8.63   ? 36  VAL A O     1 
ATOM   314  C  CB    . VAL A 1 39  ? 48.728 12.624  7.597   1.00 7.66   ? 36  VAL A CB    1 
ATOM   315  C  CG1   . VAL A 1 39  ? 47.676 12.980  6.554   1.00 9.37   ? 36  VAL A CG1   1 
ATOM   316  C  CG2   . VAL A 1 39  ? 50.111 13.187  7.243   1.00 8.21   ? 36  VAL A CG2   1 
ATOM   317  N  N     . VAL A 1 40  ? 45.971 13.627  9.296   1.00 9.25   ? 37  VAL A N     1 
ATOM   318  C  CA    . VAL A 1 40  ? 44.600 13.358  9.717   1.00 9.19   ? 37  VAL A CA    1 
ATOM   319  C  C     . VAL A 1 40  ? 43.630 13.669  8.601   1.00 13.12  ? 37  VAL A C     1 
ATOM   320  O  O     . VAL A 1 40  ? 43.907 14.509  7.761   1.00 11.60  ? 37  VAL A O     1 
ATOM   321  C  CB    . VAL A 1 40  ? 44.155 14.239  10.956  1.00 11.85  ? 37  VAL A CB    1 
ATOM   322  C  CG1   . VAL A 1 40  ? 44.897 13.814  12.212  1.00 15.77  ? 37  VAL A CG1   1 
ATOM   323  C  CG2   . VAL A 1 40  ? 44.315 15.742  10.661  1.00 14.82  ? 37  VAL A CG2   1 
ATOM   324  N  N     A GLN A 1 41  ? 42.517 12.960  8.529   0.45 11.62  ? 38  GLN A N     1 
ATOM   325  N  N     B GLN A 1 41  ? 42.465 13.015  8.662   0.55 11.47  ? 38  GLN A N     1 
ATOM   326  C  CA    A GLN A 1 41  ? 41.514 13.382  7.561   0.45 12.32  ? 38  GLN A CA    1 
ATOM   327  C  CA    B GLN A 1 41  ? 41.311 13.294  7.791   0.55 12.05  ? 38  GLN A CA    1 
ATOM   328  C  C     A GLN A 1 41  ? 40.279 13.806  8.305   0.45 12.48  ? 38  GLN A C     1 
ATOM   329  C  C     B GLN A 1 41  ? 40.135 13.766  8.648   0.55 12.54  ? 38  GLN A C     1 
ATOM   330  O  O     A GLN A 1 41  ? 39.905 13.191  9.306   0.45 12.87  ? 38  GLN A O     1 
ATOM   331  O  O     B GLN A 1 41  ? 39.824 13.133  9.652   0.55 12.98  ? 38  GLN A O     1 
ATOM   332  C  CB    A GLN A 1 41  ? 41.230 12.342  6.479   0.45 15.45  ? 38  GLN A CB    1 
ATOM   333  C  CB    B GLN A 1 41  ? 40.867 12.029  7.038   0.55 15.14  ? 38  GLN A CB    1 
ATOM   334  C  CG    A GLN A 1 41  ? 40.636 11.057  6.959   0.45 15.87  ? 38  GLN A CG    1 
ATOM   335  C  CG    B GLN A 1 41  ? 41.858 11.456  6.053   0.55 16.57  ? 38  GLN A CG    1 
ATOM   336  C  CD    A GLN A 1 41  ? 40.516 10.052  5.833   0.45 17.07  ? 38  GLN A CD    1 
ATOM   337  C  CD    B GLN A 1 41  ? 41.257 10.363  5.169   0.55 15.21  ? 38  GLN A CD    1 
ATOM   338  O  OE1   A GLN A 1 41  ? 40.140 8.902   6.045   0.45 15.64  ? 38  GLN A OE1   1 
ATOM   339  O  OE1   B GLN A 1 41  ? 41.355 10.429  3.942   0.55 17.30  ? 38  GLN A OE1   1 
ATOM   340  N  NE2   A GLN A 1 41  ? 40.837 10.487  4.624   0.45 16.10  ? 38  GLN A NE2   1 
ATOM   341  N  NE2   B GLN A 1 41  ? 40.648 9.350   5.787   0.55 16.82  ? 38  GLN A NE2   1 
ATOM   342  N  N     A TYR A 1 42  ? 39.689 14.895  7.818   0.45 12.58  ? 39  TYR A N     1 
ATOM   343  N  N     B TYR A 1 42  ? 39.479 14.855  8.241   0.55 12.46  ? 39  TYR A N     1 
ATOM   344  C  CA    A TYR A 1 42  ? 38.656 15.643  8.519   0.45 15.31  ? 39  TYR A CA    1 
ATOM   345  C  CA    B TYR A 1 42  ? 38.211 15.343  8.841   0.55 13.80  ? 39  TYR A CA    1 
ATOM   346  C  C     A TYR A 1 42  ? 39.245 16.216  9.821   0.45 15.74  ? 39  TYR A C     1 
ATOM   347  C  C     B TYR A 1 42  ? 38.290 15.885  10.284  0.55 15.69  ? 39  TYR A C     1 
ATOM   348  O  O     A TYR A 1 42  ? 40.330 15.847  10.239  0.45 16.02  ? 39  TYR A O     1 
ATOM   349  O  O     B TYR A 1 42  ? 38.015 15.163  11.233  0.55 19.94  ? 39  TYR A O     1 
ATOM   350  C  CB    A TYR A 1 42  ? 37.395 14.794  8.717   0.45 14.47  ? 39  TYR A CB    1 
ATOM   351  C  CB    B TYR A 1 42  ? 37.110 14.282  8.745   0.55 14.63  ? 39  TYR A CB    1 
ATOM   352  C  CG    A TYR A 1 42  ? 36.889 14.179  7.413   0.45 14.30  ? 39  TYR A CG    1 
ATOM   353  C  CG    B TYR A 1 42  ? 36.774 13.866  7.333   0.55 13.95  ? 39  TYR A CG    1 
ATOM   354  C  CD1   A TYR A 1 42  ? 36.365 14.974  6.403   0.45 16.01  ? 39  TYR A CD1   1 
ATOM   355  C  CD1   B TYR A 1 42  ? 36.336 14.796  6.406   0.55 16.08  ? 39  TYR A CD1   1 
ATOM   356  C  CD2   A TYR A 1 42  ? 36.944 12.802  7.195   0.45 13.34  ? 39  TYR A CD2   1 
ATOM   357  C  CD2   B TYR A 1 42  ? 36.881 12.535  6.933   0.55 12.97  ? 39  TYR A CD2   1 
ATOM   358  C  CE1   A TYR A 1 42  ? 35.913 14.412  5.212   0.45 15.95  ? 39  TYR A CE1   1 
ATOM   359  C  CE1   B TYR A 1 42  ? 36.032 14.414  5.114   0.55 15.84  ? 39  TYR A CE1   1 
ATOM   360  C  CE2   A TYR A 1 42  ? 36.492 12.236  6.010   0.45 13.79  ? 39  TYR A CE2   1 
ATOM   361  C  CE2   B TYR A 1 42  ? 36.568 12.151  5.646   0.55 13.57  ? 39  TYR A CE2   1 
ATOM   362  C  CZ    A TYR A 1 42  ? 35.975 13.049  5.026   0.45 13.88  ? 39  TYR A CZ    1 
ATOM   363  C  CZ    B TYR A 1 42  ? 36.141 13.095  4.752   0.55 14.14  ? 39  TYR A CZ    1 
ATOM   364  O  OH    A TYR A 1 42  ? 35.518 12.500  3.847   0.45 14.10  ? 39  TYR A OH    1 
ATOM   365  O  OH    B TYR A 1 42  ? 35.832 12.728  3.470   0.55 12.49  ? 39  TYR A OH    1 
ATOM   366  N  N     . LYS A 1 43  ? 38.568 17.175  10.422  1.00 24.28  ? 40  LYS A N     1 
ATOM   367  C  CA    . LYS A 1 43  ? 39.059 17.748  11.684  1.00 21.26  ? 40  LYS A CA    1 
ATOM   368  C  C     . LYS A 1 43  ? 37.989 17.883  12.749  1.00 26.98  ? 40  LYS A C     1 
ATOM   369  O  O     . LYS A 1 43  ? 38.291 17.931  13.946  1.00 27.33  ? 40  LYS A O     1 
ATOM   370  C  CB    . LYS A 1 43  ? 39.723 19.109  11.417  1.00 25.29  ? 40  LYS A CB    1 
ATOM   371  C  CG    . LYS A 1 43  ? 40.641 19.613  12.547  1.00 31.55  ? 40  LYS A CG    1 
ATOM   372  C  CD    . LYS A 1 43  ? 42.066 19.090  12.379  1.00 25.97  ? 40  LYS A CD    1 
ATOM   373  C  CE    . LYS A 1 43  ? 42.917 19.347  13.626  1.00 26.43  ? 40  LYS A CE    1 
ATOM   374  N  NZ    . LYS A 1 43  ? 42.689 18.364  14.716  1.00 28.34  ? 40  LYS A NZ    1 
ATOM   375  N  N     . SER A 1 44  ? 36.733 17.934  12.314  1.00 24.72  ? 41  SER A N     1 
ATOM   376  C  CA    . SER A 1 44  ? 35.628 18.296  13.193  1.00 27.19  ? 41  SER A CA    1 
ATOM   377  C  C     . SER A 1 44  ? 35.321 17.228  14.221  1.00 31.53  ? 41  SER A C     1 
ATOM   378  O  O     . SER A 1 44  ? 35.038 17.535  15.374  1.00 38.58  ? 41  SER A O     1 
ATOM   379  C  CB    . SER A 1 44  ? 34.383 18.599  12.365  1.00 30.73  ? 41  SER A CB    1 
ATOM   380  O  OG    . SER A 1 44  ? 34.707 19.525  11.343  1.00 38.89  ? 41  SER A OG    1 
ATOM   381  N  N     . TRP A 1 45  ? 35.378 15.969  13.807  1.00 32.46  ? 42  TRP A N     1 
ATOM   382  C  CA    . TRP A 1 45  ? 35.060 14.892  14.730  1.00 33.95  ? 42  TRP A CA    1 
ATOM   383  C  C     . TRP A 1 45  ? 36.327 14.389  15.416  1.00 32.86  ? 42  TRP A C     1 
ATOM   384  O  O     . TRP A 1 45  ? 37.158 13.712  14.802  1.00 28.22  ? 42  TRP A O     1 
ATOM   385  C  CB    . TRP A 1 45  ? 34.285 13.761  14.041  1.00 40.67  ? 42  TRP A CB    1 
ATOM   386  C  CG    . TRP A 1 45  ? 33.861 12.662  14.968  1.00 44.83  ? 42  TRP A CG    1 
ATOM   387  C  CD1   . TRP A 1 45  ? 34.079 11.325  14.804  1.00 43.50  ? 42  TRP A CD1   1 
ATOM   388  C  CD2   . TRP A 1 45  ? 33.165 12.802  16.215  1.00 50.42  ? 42  TRP A CD2   1 
ATOM   389  N  NE1   . TRP A 1 45  ? 33.554 10.623  15.862  1.00 46.16  ? 42  TRP A NE1   1 
ATOM   390  C  CE2   . TRP A 1 45  ? 32.990 11.508  16.743  1.00 52.21  ? 42  TRP A CE2   1 
ATOM   391  C  CE3   . TRP A 1 45  ? 32.671 13.898  16.935  1.00 52.46  ? 42  TRP A CE3   1 
ATOM   392  C  CZ2   . TRP A 1 45  ? 32.343 11.278  17.958  1.00 62.75  ? 42  TRP A CZ2   1 
ATOM   393  C  CZ3   . TRP A 1 45  ? 32.027 13.667  18.143  1.00 58.84  ? 42  TRP A CZ3   1 
ATOM   394  C  CH2   . TRP A 1 45  ? 31.870 12.368  18.641  1.00 56.91  ? 42  TRP A CH2   1 
ATOM   395  N  N     . LYS A 1 46  ? 36.471 14.779  16.681  1.00 26.80  ? 43  LYS A N     1 
ATOM   396  C  CA    . LYS A 1 46  ? 37.567 14.331  17.542  1.00 23.27  ? 43  LYS A CA    1 
ATOM   397  C  C     . LYS A 1 46  ? 38.963 14.640  17.009  1.00 22.84  ? 43  LYS A C     1 
ATOM   398  O  O     . LYS A 1 46  ? 39.906 13.877  17.245  1.00 22.34  ? 43  LYS A O     1 
ATOM   399  C  CB    . LYS A 1 46  ? 37.421 12.843  17.849  1.00 28.84  ? 43  LYS A CB    1 
ATOM   400  C  CG    . LYS A 1 46  ? 36.136 12.497  18.580  1.00 36.15  ? 43  LYS A CG    1 
ATOM   401  C  CD    . LYS A 1 46  ? 36.317 11.323  19.525  1.00 39.00  ? 43  LYS A CD    1 
ATOM   402  C  CE    . LYS A 1 46  ? 35.432 11.490  20.759  1.00 49.89  ? 43  LYS A CE    1 
ATOM   403  N  NZ    . LYS A 1 46  ? 35.369 10.263  21.605  1.00 54.79  ? 43  LYS A NZ    1 
ATOM   404  N  N     . GLY A 1 47  ? 39.094 15.765  16.305  1.00 19.69  ? 44  GLY A N     1 
ATOM   405  C  CA    . GLY A 1 47  ? 40.374 16.260  15.847  1.00 17.86  ? 44  GLY A CA    1 
ATOM   406  C  C     . GLY A 1 47  ? 40.826 15.662  14.526  1.00 15.70  ? 44  GLY A C     1 
ATOM   407  O  O     . GLY A 1 47  ? 41.872 16.041  14.012  1.00 19.76  ? 44  GLY A O     1 
ATOM   408  N  N     . GLY A 1 48  ? 40.046 14.714  14.014  1.00 18.64  ? 45  GLY A N     1 
ATOM   409  C  CA    . GLY A 1 48  ? 40.372 14.037  12.767  1.00 18.37  ? 45  GLY A CA    1 
ATOM   410  C  C     . GLY A 1 48  ? 40.856 12.624  12.995  1.00 16.89  ? 45  GLY A C     1 
ATOM   411  O  O     . GLY A 1 48  ? 41.358 12.298  14.070  1.00 16.39  ? 45  GLY A O     1 
ATOM   412  N  N     . GLY A 1 49  ? 40.695 11.778  11.983  1.00 11.53  ? 46  GLY A N     1 
ATOM   413  C  CA    . GLY A 1 49  ? 41.176 10.404  12.093  1.00 12.15  ? 46  GLY A CA    1 
ATOM   414  C  C     . GLY A 1 49  ? 42.593 10.309  11.563  1.00 11.26  ? 46  GLY A C     1 
ATOM   415  O  O     . GLY A 1 49  ? 42.850 10.756  10.440  1.00 11.04  ? 46  GLY A O     1 
ATOM   416  N  N     . ILE A 1 50  ? 43.505 9.728   12.344  1.00 10.00  ? 47  ILE A N     1 
ATOM   417  C  CA    . ILE A 1 50  ? 44.913 9.640   11.937  1.00 9.08   ? 47  ILE A CA    1 
ATOM   418  C  C     . ILE A 1 50  ? 45.104 8.533   10.922  1.00 9.44   ? 47  ILE A C     1 
ATOM   419  O  O     . ILE A 1 50  ? 44.657 7.415   11.151  1.00 12.73  ? 47  ILE A O     1 
ATOM   420  C  CB    . ILE A 1 50  ? 45.794 9.356   13.153  1.00 10.05  ? 47  ILE A CB    1 
ATOM   421  C  CG1   . ILE A 1 50  ? 45.824 10.614  14.009  1.00 13.67  ? 47  ILE A CG1   1 
ATOM   422  C  CG2   . ILE A 1 50  ? 47.227 8.984   12.746  1.00 10.97  ? 47  ILE A CG2   1 
ATOM   423  C  CD1   . ILE A 1 50  ? 46.604 10.429  15.285  1.00 18.09  ? 47  ILE A CD1   1 
ATOM   424  N  N     . ILE A 1 51  ? 45.751 8.831   9.801   1.00 8.50   ? 48  ILE A N     1 
ATOM   425  C  CA    . ILE A 1 51  ? 46.001 7.812   8.787   1.00 9.97   ? 48  ILE A CA    1 
ATOM   426  C  C     . ILE A 1 51  ? 47.491 7.532   8.548   1.00 10.84  ? 48  ILE A C     1 
ATOM   427  O  O     . ILE A 1 51  ? 47.826 6.569   7.874   1.00 9.63   ? 48  ILE A O     1 
ATOM   428  C  CB    . ILE A 1 51  ? 45.273 8.108   7.465   1.00 12.02  ? 48  ILE A CB    1 
ATOM   429  C  CG1   . ILE A 1 51  ? 45.756 9.408   6.785   1.00 10.22  ? 48  ILE A CG1   1 
ATOM   430  C  CG2   . ILE A 1 51  ? 43.757 8.171   7.744   1.00 12.25  ? 48  ILE A CG2   1 
ATOM   431  C  CD1   . ILE A 1 51  ? 45.178 9.568   5.360   1.00 11.11  ? 48  ILE A CD1   1 
ATOM   432  N  N     . ALA A 1 52  ? 48.376 8.362   9.104   1.00 8.49   ? 49  ALA A N     1 
ATOM   433  C  CA    . ALA A 1 52  ? 49.829 8.138   8.990   1.00 6.03   ? 49  ALA A CA    1 
ATOM   434  C  C     . ALA A 1 52  ? 50.522 8.844   10.133  1.00 7.37   ? 49  ALA A C     1 
ATOM   435  O  O     . ALA A 1 52  ? 50.045 9.882   10.601  1.00 8.79   ? 49  ALA A O     1 
ATOM   436  C  CB    . ALA A 1 52  ? 50.380 8.615   7.633   1.00 8.74   ? 49  ALA A CB    1 
ATOM   437  N  N     . VAL A 1 53  ? 51.645 8.273   10.584  1.00 7.16   ? 50  VAL A N     1 
ATOM   438  C  CA    . VAL A 1 53  ? 52.311 8.671   11.830  1.00 7.81   ? 50  VAL A CA    1 
ATOM   439  C  C     . VAL A 1 53  ? 53.824 8.626   11.674  1.00 6.98   ? 50  VAL A C     1 
ATOM   440  O  O     . VAL A 1 53  ? 54.385 7.596   11.250  1.00 9.09   ? 50  VAL A O     1 
ATOM   441  C  CB    . VAL A 1 53  ? 51.904 7.725   12.999  1.00 8.34   ? 50  VAL A CB    1 
ATOM   442  C  CG1   . VAL A 1 53  ? 52.371 8.269   14.320  1.00 10.54  ? 50  VAL A CG1   1 
ATOM   443  C  CG2   . VAL A 1 53  ? 50.393 7.535   13.070  1.00 11.73  ? 50  VAL A CG2   1 
ATOM   444  N  N     . SER A 1 54  ? 54.487 9.736   11.991  1.00 7.47   ? 51  SER A N     1 
ATOM   445  C  CA    . SER A 1 54  ? 55.941 9.776   11.932  1.00 8.26   ? 51  SER A CA    1 
ATOM   446  C  C     . SER A 1 54  ? 56.539 8.852   12.998  1.00 10.45  ? 51  SER A C     1 
ATOM   447  O  O     . SER A 1 54  ? 55.909 8.552   14.013  1.00 9.23   ? 51  SER A O     1 
ATOM   448  C  CB    . SER A 1 54  ? 56.474 11.209  12.114  1.00 8.94   ? 51  SER A CB    1 
ATOM   449  O  OG    . SER A 1 54  ? 56.523 11.552  13.494  1.00 11.55  ? 51  SER A OG    1 
ATOM   450  N  N     . TYR A 1 55  ? 57.757 8.412   12.756  1.00 10.38  ? 52  TYR A N     1 
ATOM   451  C  CA    . TYR A 1 55  ? 58.397 7.510   13.704  1.00 10.08  ? 52  TYR A CA    1 
ATOM   452  C  C     . TYR A 1 55  ? 58.612 8.181   15.059  1.00 11.58  ? 52  TYR A C     1 
ATOM   453  O  O     . TYR A 1 55  ? 58.529 7.502   16.089  1.00 12.84  ? 52  TYR A O     1 
ATOM   454  C  CB    . TYR A 1 55  ? 59.689 6.928   13.131  1.00 8.03   ? 52  TYR A CB    1 
ATOM   455  C  CG    . TYR A 1 55  ? 59.378 5.831   12.137  1.00 9.82   ? 52  TYR A CG    1 
ATOM   456  C  CD1   . TYR A 1 55  ? 58.988 6.122   10.822  1.00 9.73   ? 52  TYR A CD1   1 
ATOM   457  C  CD2   . TYR A 1 55  ? 59.353 4.507   12.539  1.00 12.69  ? 52  TYR A CD2   1 
ATOM   458  C  CE1   . TYR A 1 55  ? 58.623 5.112   9.942   1.00 9.02   ? 52  TYR A CE1   1 
ATOM   459  C  CE2   . TYR A 1 55  ? 58.999 3.495   11.665  1.00 9.74   ? 52  TYR A CE2   1 
ATOM   460  C  CZ    . TYR A 1 55  ? 58.636 3.792   10.364  1.00 10.65  ? 52  TYR A CZ    1 
ATOM   461  O  OH    . TYR A 1 55  ? 58.276 2.776   9.489   1.00 12.03  ? 52  TYR A OH    1 
ATOM   462  N  N     . GLU A 1 56  ? 58.859 9.494   15.070  1.00 10.95  ? 53  GLU A N     1 
ATOM   463  C  CA    . GLU A 1 56  ? 58.943 10.187  16.368  1.00 13.25  ? 53  GLU A CA    1 
ATOM   464  C  C     . GLU A 1 56  ? 57.638 10.093  17.163  1.00 12.79  ? 53  GLU A C     1 
ATOM   465  O  O     . GLU A 1 56  ? 57.671 9.937   18.380  1.00 14.57  ? 53  GLU A O     1 
ATOM   466  C  CB    . GLU A 1 56  ? 59.324 11.654  16.188  1.00 11.98  ? 53  GLU A CB    1 
ATOM   467  C  CG    . GLU A 1 56  ? 60.697 11.899  15.554  1.00 15.51  ? 53  GLU A CG    1 
ATOM   468  C  CD    . GLU A 1 56  ? 60.737 11.791  14.013  1.00 22.51  ? 53  GLU A CD    1 
ATOM   469  O  OE1   . GLU A 1 56  ? 59.844 11.186  13.371  1.00 19.74  ? 53  GLU A OE1   1 
ATOM   470  O  OE2   . GLU A 1 56  ? 61.698 12.332  13.432  1.00 26.73  ? 53  GLU A OE2   1 
ATOM   471  N  N     . ALA A 1 57  ? 56.483 10.223  16.499  1.00 9.29   ? 54  ALA A N     1 
ATOM   472  C  CA    . ALA A 1 57  ? 55.201 10.096  17.166  1.00 9.90   ? 54  ALA A CA    1 
ATOM   473  C  C     . ALA A 1 57  ? 54.901 8.643   17.555  1.00 10.44  ? 54  ALA A C     1 
ATOM   474  O  O     . ALA A 1 57  ? 54.259 8.383   18.589  1.00 11.02  ? 54  ALA A O     1 
ATOM   475  C  CB    . ALA A 1 57  ? 54.071 10.660  16.281  1.00 10.56  ? 54  ALA A CB    1 
ATOM   476  N  N     . ARG A 1 58  ? 55.348 7.689   16.741  1.00 10.93  ? 55  ARG A N     1 
ATOM   477  C  CA    . ARG A 1 58  ? 55.117 6.289   17.097  1.00 10.01  ? 55  ARG A CA    1 
ATOM   478  C  C     . ARG A 1 58  ? 55.768 5.914   18.430  1.00 11.74  ? 55  ARG A C     1 
ATOM   479  O  O     . ARG A 1 58  ? 55.245 5.050   19.140  1.00 15.10  ? 55  ARG A O     1 
ATOM   480  C  CB    . ARG A 1 58  ? 55.604 5.329   16.011  1.00 10.51  ? 55  ARG A CB    1 
ATOM   481  C  CG    . ARG A 1 58  ? 54.859 5.459   14.718  1.00 12.05  ? 55  ARG A CG    1 
ATOM   482  C  CD    . ARG A 1 58  ? 55.451 4.543   13.678  1.00 10.61  ? 55  ARG A CD    1 
ATOM   483  N  NE    . ARG A 1 58  ? 55.075 4.975   12.331  1.00 8.44   ? 55  ARG A NE    1 
ATOM   484  C  CZ    . ARG A 1 58  ? 55.137 4.246   11.227  1.00 11.58  ? 55  ARG A CZ    1 
ATOM   485  N  NH1   . ARG A 1 58  ? 55.514 2.977   11.257  1.00 14.86  ? 55  ARG A NH1   1 
ATOM   486  N  NH2   . ARG A 1 58  ? 54.773 4.817   10.067  1.00 13.83  ? 55  ARG A NH2   1 
ATOM   487  N  N     . ALA A 1 59  ? 56.869 6.579   18.757  1.00 9.90   ? 56  ALA A N     1 
ATOM   488  C  CA    . ALA A 1 59  ? 57.554 6.379   20.050  1.00 12.43  ? 56  ALA A CA    1 
ATOM   489  C  C     . ALA A 1 59  ? 56.680 6.719   21.255  1.00 17.50  ? 56  ALA A C     1 
ATOM   490  O  O     . ALA A 1 59  ? 56.923 6.213   22.359  1.00 17.72  ? 56  ALA A O     1 
ATOM   491  C  CB    . ALA A 1 59  ? 58.837 7.188   20.088  1.00 16.02  ? 56  ALA A CB    1 
ATOM   492  N  N     . PHE A 1 60  ? 55.675 7.570   21.058  1.00 12.41  ? 57  PHE A N     1 
ATOM   493  C  CA    . PHE A 1 60  ? 54.749 7.940   22.122  1.00 13.53  ? 57  PHE A CA    1 
ATOM   494  C  C     . PHE A 1 60  ? 53.536 7.014   22.169  1.00 13.55  ? 57  PHE A C     1 
ATOM   495  O  O     . PHE A 1 60  ? 52.698 7.130   23.076  1.00 18.25  ? 57  PHE A O     1 
ATOM   496  C  CB    . PHE A 1 60  ? 54.255 9.383   21.948  1.00 14.54  ? 57  PHE A CB    1 
ATOM   497  C  CG    . PHE A 1 60  ? 55.300 10.426  22.216  1.00 16.69  ? 57  PHE A CG    1 
ATOM   498  C  CD1   . PHE A 1 60  ? 56.192 10.797  21.227  1.00 18.70  ? 57  PHE A CD1   1 
ATOM   499  C  CD2   . PHE A 1 60  ? 55.381 11.054  23.462  1.00 20.49  ? 57  PHE A CD2   1 
ATOM   500  C  CE1   . PHE A 1 60  ? 57.156 11.772  21.460  1.00 19.96  ? 57  PHE A CE1   1 
ATOM   501  C  CE2   . PHE A 1 60  ? 56.331 12.037  23.703  1.00 24.07  ? 57  PHE A CE2   1 
ATOM   502  C  CZ    . PHE A 1 60  ? 57.225 12.399  22.702  1.00 24.91  ? 57  PHE A CZ    1 
ATOM   503  N  N     . GLY A 1 61  ? 53.424 6.114   21.195  1.00 12.98  ? 58  GLY A N     1 
ATOM   504  C  CA    . GLY A 1 61  ? 52.295 5.206   21.114  1.00 14.62  ? 58  GLY A CA    1 
ATOM   505  C  C     . GLY A 1 61  ? 51.194 5.642   20.179  1.00 12.89  ? 58  GLY A C     1 
ATOM   506  O  O     . GLY A 1 61  ? 50.137 5.018   20.124  1.00 15.60  ? 58  GLY A O     1 
ATOM   507  N  N     . VAL A 1 62  ? 51.436 6.722   19.422  1.00 11.56  ? 59  VAL A N     1 
ATOM   508  C  CA    . VAL A 1 62  ? 50.471 7.157   18.426  1.00 12.85  ? 59  VAL A CA    1 
ATOM   509  C  C     . VAL A 1 62  ? 50.361 6.147   17.276  1.00 12.27  ? 59  VAL A C     1 
ATOM   510  O  O     . VAL A 1 62  ? 51.386 5.691   16.750  1.00 13.11  ? 59  VAL A O     1 
ATOM   511  C  CB    . VAL A 1 62  ? 50.830 8.559   17.880  1.00 10.38  ? 59  VAL A CB    1 
ATOM   512  C  CG1   . VAL A 1 62  ? 49.739 9.022   16.925  1.00 10.81  ? 59  VAL A CG1   1 
ATOM   513  C  CG2   . VAL A 1 62  ? 50.921 9.534   19.044  1.00 13.35  ? 59  VAL A CG2   1 
ATOM   514  N  N     . THR A 1 63  ? 49.127 5.818   16.881  1.00 13.62  ? 60  THR A N     1 
ATOM   515  C  CA    . THR A 1 63  ? 48.924 4.852   15.791  1.00 14.89  ? 60  THR A CA    1 
ATOM   516  C  C     . THR A 1 63  ? 47.907 5.337   14.777  1.00 15.06  ? 60  THR A C     1 
ATOM   517  O  O     . THR A 1 63  ? 47.087 6.212   15.068  1.00 17.78  ? 60  THR A O     1 
ATOM   518  C  CB    . THR A 1 63  ? 48.451 3.456   16.302  1.00 18.56  ? 60  THR A CB    1 
ATOM   519  O  OG1   . THR A 1 63  ? 47.113 3.555   16.790  1.00 22.26  ? 60  THR A OG1   1 
ATOM   520  C  CG2   . THR A 1 63  ? 49.359 2.941   17.398  1.00 17.61  ? 60  THR A CG2   1 
ATOM   521  N  N     . ARG A 1 64  ? 47.981 4.775   13.570  1.00 13.41  ? 61  ARG A N     1 
ATOM   522  C  CA    . ARG A 1 64  ? 46.884 4.839   12.619  1.00 18.65  ? 61  ARG A CA    1 
ATOM   523  C  C     . ARG A 1 64  ? 45.549 4.420   13.267  1.00 16.97  ? 61  ARG A C     1 
ATOM   524  O  O     . ARG A 1 64  ? 45.517 3.588   14.181  1.00 19.34  ? 61  ARG A O     1 
ATOM   525  C  CB    . ARG A 1 64  ? 47.267 3.919   11.447  1.00 23.35  ? 61  ARG A CB    1 
ATOM   526  C  CG    A ARG A 1 64  ? 46.097 3.421   10.602  0.50 23.73  ? 61  ARG A CG    1 
ATOM   527  C  CG    B ARG A 1 64  ? 46.322 3.808   10.284  0.50 23.19  ? 61  ARG A CG    1 
ATOM   528  C  CD    A ARG A 1 64  ? 46.606 2.816   9.295   0.50 21.76  ? 61  ARG A CD    1 
ATOM   529  C  CD    B ARG A 1 64  ? 47.036 3.025   9.160   0.50 21.43  ? 61  ARG A CD    1 
ATOM   530  N  NE    A ARG A 1 64  ? 47.601 3.710   8.716   0.50 20.18  ? 61  ARG A NE    1 
ATOM   531  N  NE    B ARG A 1 64  ? 47.630 1.761   9.618   0.50 22.61  ? 61  ARG A NE    1 
ATOM   532  C  CZ    A ARG A 1 64  ? 48.803 3.343   8.288   0.50 17.96  ? 61  ARG A CZ    1 
ATOM   533  C  CZ    B ARG A 1 64  ? 48.617 1.117   8.992   0.50 19.60  ? 61  ARG A CZ    1 
ATOM   534  N  NH1   A ARG A 1 64  ? 49.177 2.068   8.315   0.50 22.33  ? 61  ARG A NH1   1 
ATOM   535  N  NH1   B ARG A 1 64  ? 49.148 1.607   7.876   0.50 20.16  ? 61  ARG A NH1   1 
ATOM   536  N  NH2   A ARG A 1 64  ? 49.623 4.261   7.810   0.50 8.16   ? 61  ARG A NH2   1 
ATOM   537  N  NH2   B ARG A 1 64  ? 49.080 -0.027  9.478   0.50 24.89  ? 61  ARG A NH2   1 
ATOM   538  N  N     . SER A 1 65  ? 44.450 4.997   12.786  1.00 17.11  ? 62  SER A N     1 
ATOM   539  C  CA    . SER A 1 65  ? 43.098 4.762   13.297  1.00 21.84  ? 62  SER A CA    1 
ATOM   540  C  C     . SER A 1 65  ? 42.749 5.369   14.670  1.00 20.17  ? 62  SER A C     1 
ATOM   541  O  O     . SER A 1 65  ? 41.633 5.195   15.145  1.00 29.03  ? 62  SER A O     1 
ATOM   542  C  CB    . SER A 1 65  ? 42.717 3.283   13.269  1.00 28.18  ? 62  SER A CB    1 
ATOM   543  O  OG    . SER A 1 65  ? 42.938 2.716   14.542  1.00 36.44  ? 62  SER A OG    1 
ATOM   544  N  N     . MET A 1 66  ? 43.686 6.057   15.318  1.00 19.23  ? 63  MET A N     1 
ATOM   545  C  CA    . MET A 1 66  ? 43.345 6.844   16.497  1.00 17.06  ? 63  MET A CA    1 
ATOM   546  C  C     . MET A 1 66  ? 42.717 8.145   16.055  1.00 18.20  ? 63  MET A C     1 
ATOM   547  O  O     . MET A 1 66  ? 43.106 8.706   15.018  1.00 15.67  ? 63  MET A O     1 
ATOM   548  C  CB    . MET A 1 66  ? 44.599 7.230   17.286  1.00 17.65  ? 63  MET A CB    1 
ATOM   549  C  CG    . MET A 1 66  ? 45.122 6.193   18.200  1.00 24.23  ? 63  MET A CG    1 
ATOM   550  S  SD    . MET A 1 66  ? 46.557 6.832   19.093  1.00 21.38  ? 63  MET A SD    1 
ATOM   551  C  CE    . MET A 1 66  ? 46.825 5.396   20.131  1.00 27.64  ? 63  MET A CE    1 
ATOM   552  N  N     . TRP A 1 67  ? 41.795 8.662   16.862  1.00 15.92  ? 64  TRP A N     1 
ATOM   553  C  CA    . TRP A 1 67  ? 41.362 10.051  16.716  1.00 15.70  ? 64  TRP A CA    1 
ATOM   554  C  C     . TRP A 1 67  ? 42.488 10.952  17.178  1.00 14.46  ? 64  TRP A C     1 
ATOM   555  O  O     . TRP A 1 67  ? 43.188 10.627  18.130  1.00 13.78  ? 64  TRP A O     1 
ATOM   556  C  CB    . TRP A 1 67  ? 40.145 10.325  17.583  1.00 17.58  ? 64  TRP A CB    1 
ATOM   557  C  CG    . TRP A 1 67  ? 38.953 9.560   17.141  1.00 19.75  ? 64  TRP A CG    1 
ATOM   558  C  CD1   . TRP A 1 67  ? 38.262 8.629   17.864  1.00 25.66  ? 64  TRP A CD1   1 
ATOM   559  C  CD2   . TRP A 1 67  ? 38.313 9.634   15.861  1.00 25.00  ? 64  TRP A CD2   1 
ATOM   560  N  NE1   . TRP A 1 67  ? 37.218 8.132   17.114  1.00 27.55  ? 64  TRP A NE1   1 
ATOM   561  C  CE2   . TRP A 1 67  ? 37.232 8.733   15.883  1.00 32.26  ? 64  TRP A CE2   1 
ATOM   562  C  CE3   . TRP A 1 67  ? 38.546 10.384  14.700  1.00 18.57  ? 64  TRP A CE3   1 
ATOM   563  C  CZ2   . TRP A 1 67  ? 36.385 8.559   14.786  1.00 32.31  ? 64  TRP A CZ2   1 
ATOM   564  C  CZ3   . TRP A 1 67  ? 37.711 10.206  13.616  1.00 24.37  ? 64  TRP A CZ3   1 
ATOM   565  C  CH2   . TRP A 1 67  ? 36.645 9.297   13.663  1.00 28.50  ? 64  TRP A CH2   1 
ATOM   566  N  N     . ALA A 1 68  ? 42.662 12.096  16.537  1.00 13.40  ? 65  ALA A N     1 
ATOM   567  C  CA    . ALA A 1 68  ? 43.773 12.970  16.904  1.00 13.24  ? 65  ALA A CA    1 
ATOM   568  C  C     . ALA A 1 68  ? 43.660 13.477  18.353  1.00 12.18  ? 65  ALA A C     1 
ATOM   569  O  O     . ALA A 1 68  ? 44.679 13.663  19.016  1.00 12.61  ? 65  ALA A O     1 
ATOM   570  C  CB    . ALA A 1 68  ? 43.868 14.127  15.950  1.00 16.16  ? 65  ALA A CB    1 
ATOM   571  N  N     . ASP A 1 69  ? 42.438 13.706  18.817  1.00 15.46  ? 66  ASP A N     1 
ATOM   572  C  CA    . ASP A 1 69  ? 42.238 14.188  20.190  1.00 15.20  ? 66  ASP A CA    1 
ATOM   573  C  C     . ASP A 1 69  ? 42.795 13.141  21.161  1.00 13.67  ? 66  ASP A C     1 
ATOM   574  O  O     . ASP A 1 69  ? 43.370 13.481  22.201  1.00 13.93  ? 66  ASP A O     1 
ATOM   575  C  CB    . ASP A 1 69  ? 40.755 14.396  20.480  1.00 19.23  ? 66  ASP A CB    1 
ATOM   576  C  CG    . ASP A 1 69  ? 40.201 15.680  19.883  1.00 24.39  ? 66  ASP A CG    1 
ATOM   577  O  OD1   . ASP A 1 69  ? 40.980 16.549  19.435  1.00 23.74  ? 66  ASP A OD1   1 
ATOM   578  O  OD2   . ASP A 1 69  ? 38.956 15.811  19.886  1.00 30.48  ? 66  ASP A OD2   1 
ATOM   579  N  N     . ASP A 1 70  ? 42.618 11.872  20.807  1.00 13.03  ? 67  ASP A N     1 
ATOM   580  C  CA    . ASP A 1 70  ? 43.127 10.783  21.646  1.00 13.14  ? 67  ASP A CA    1 
ATOM   581  C  C     . ASP A 1 70  ? 44.638 10.657  21.505  1.00 14.86  ? 67  ASP A C     1 
ATOM   582  O  O     . ASP A 1 70  ? 45.339 10.454  22.494  1.00 12.69  ? 67  ASP A O     1 
ATOM   583  C  CB    . ASP A 1 70  ? 42.402 9.476   21.304  1.00 15.09  ? 67  ASP A CB    1 
ATOM   584  C  CG    . ASP A 1 70  ? 40.922 9.544   21.628  1.00 23.69  ? 67  ASP A CG    1 
ATOM   585  O  OD1   . ASP A 1 70  ? 40.560 10.288  22.565  1.00 24.27  ? 67  ASP A OD1   1 
ATOM   586  O  OD2   . ASP A 1 70  ? 40.118 8.868   20.948  1.00 21.61  ? 67  ASP A OD2   1 
ATOM   587  N  N     . ALA A 1 71  ? 45.170 10.807  20.286  1.00 12.05  ? 68  ALA A N     1 
ATOM   588  C  CA    . ALA A 1 71  ? 46.617 10.784  20.111  1.00 12.70  ? 68  ALA A CA    1 
ATOM   589  C  C     . ALA A 1 71  ? 47.305 11.890  20.898  1.00 12.84  ? 68  ALA A C     1 
ATOM   590  O  O     . ALA A 1 71  ? 48.415 11.710  21.368  1.00 13.80  ? 68  ALA A O     1 
ATOM   591  C  CB    . ALA A 1 71  ? 46.995 10.915  18.631  1.00 12.16  ? 68  ALA A CB    1 
ATOM   592  N  N     . LYS A 1 72  ? 46.641 13.042  21.009  1.00 13.05  ? 69  LYS A N     1 
ATOM   593  C  CA    . LYS A 1 72  ? 47.172 14.171  21.779  1.00 13.60  ? 69  LYS A CA    1 
ATOM   594  C  C     . LYS A 1 72  ? 47.302 13.850  23.282  1.00 13.79  ? 69  LYS A C     1 
ATOM   595  O  O     . LYS A 1 72  ? 48.118 14.437  23.990  1.00 15.17  ? 69  LYS A O     1 
ATOM   596  C  CB    . LYS A 1 72  ? 46.307 15.429  21.565  1.00 12.21  ? 69  LYS A CB    1 
ATOM   597  C  CG    . LYS A 1 72  ? 46.632 16.242  20.278  1.00 16.09  ? 69  LYS A CG    1 
ATOM   598  C  CD    . LYS A 1 72  ? 47.833 17.150  20.491  1.00 19.85  ? 69  LYS A CD    1 
ATOM   599  C  CE    . LYS A 1 72  ? 48.024 18.188  19.378  1.00 24.76  ? 69  LYS A CE    1 
ATOM   600  N  NZ    . LYS A 1 72  ? 49.253 19.022  19.636  1.00 18.86  ? 69  LYS A NZ    1 
ATOM   601  N  N     . LYS A 1 73  ? 46.498 12.914  23.774  1.00 14.28  ? 70  LYS A N     1 
ATOM   602  C  CA    . LYS A 1 73  ? 46.636 12.513  25.175  1.00 12.52  ? 70  LYS A CA    1 
ATOM   603  C  C     . LYS A 1 73  ? 47.951 11.753  25.383  1.00 17.22  ? 70  LYS A C     1 
ATOM   604  O  O     . LYS A 1 73  ? 48.577 11.867  26.437  1.00 16.95  ? 70  LYS A O     1 
ATOM   605  C  CB    . LYS A 1 73  ? 45.422 11.667  25.593  1.00 12.34  ? 70  LYS A CB    1 
ATOM   606  C  CG    . LYS A 1 73  ? 44.075 12.302  25.235  1.00 11.45  ? 70  LYS A CG    1 
ATOM   607  C  CD    . LYS A 1 73  ? 42.901 11.354  25.418  1.00 17.01  ? 70  LYS A CD    1 
ATOM   608  C  CE    . LYS A 1 73  ? 41.570 12.104  25.295  1.00 21.21  ? 70  LYS A CE    1 
ATOM   609  N  NZ    . LYS A 1 73  ? 40.403 11.184  25.150  1.00 23.57  ? 70  LYS A NZ    1 
ATOM   610  N  N     . LEU A 1 74  ? 48.390 11.000  24.372  1.00 13.22  ? 71  LEU A N     1 
ATOM   611  C  CA    . LEU A 1 74  ? 49.675 10.281  24.457  1.00 13.82  ? 71  LEU A CA    1 
ATOM   612  C  C     . LEU A 1 74  ? 50.876 11.150  24.119  1.00 14.86  ? 71  LEU A C     1 
ATOM   613  O  O     . LEU A 1 74  ? 51.977 10.898  24.584  1.00 15.51  ? 71  LEU A O     1 
ATOM   614  C  CB    . LEU A 1 74  ? 49.679 9.082   23.485  1.00 12.89  ? 71  LEU A CB    1 
ATOM   615  C  CG    . LEU A 1 74  ? 48.590 8.031   23.687  1.00 15.81  ? 71  LEU A CG    1 
ATOM   616  C  CD1   . LEU A 1 74  ? 48.732 6.976   22.605  1.00 17.08  ? 71  LEU A CD1   1 
ATOM   617  C  CD2   . LEU A 1 74  ? 48.753 7.406   25.058  1.00 17.56  ? 71  LEU A CD2   1 
ATOM   618  N  N     . CYS A 1 75  ? 50.664 12.137  23.249  1.00 14.12  ? 72  CYS A N     1 
ATOM   619  C  CA    . CYS A 1 75  ? 51.736 12.947  22.711  1.00 15.83  ? 72  CYS A CA    1 
ATOM   620  C  C     . CYS A 1 75  ? 51.231 14.374  22.606  1.00 17.38  ? 72  CYS A C     1 
ATOM   621  O  O     . CYS A 1 75  ? 50.731 14.775  21.562  1.00 15.09  ? 72  CYS A O     1 
ATOM   622  C  CB    . CYS A 1 75  ? 52.076 12.418  21.315  1.00 12.26  ? 72  CYS A CB    1 
ATOM   623  S  SG    . CYS A 1 75  ? 53.436 13.298  20.523  1.00 17.15  ? 72  CYS A SG    1 
ATOM   624  N  N     . PRO A 1 76  ? 51.322 15.152  23.695  1.00 17.21  ? 73  PRO A N     1 
ATOM   625  C  CA    . PRO A 1 76  ? 50.678 16.472  23.689  1.00 16.03  ? 73  PRO A CA    1 
ATOM   626  C  C     . PRO A 1 76  ? 51.237 17.467  22.659  1.00 14.18  ? 73  PRO A C     1 
ATOM   627  O  O     . PRO A 1 76  ? 50.514 18.381  22.251  1.00 18.80  ? 73  PRO A O     1 
ATOM   628  C  CB    . PRO A 1 76  ? 50.923 16.985  25.119  1.00 21.15  ? 73  PRO A CB    1 
ATOM   629  C  CG    . PRO A 1 76  ? 51.072 15.742  25.933  1.00 21.32  ? 73  PRO A CG    1 
ATOM   630  C  CD    . PRO A 1 76  ? 51.748 14.730  25.042  1.00 19.78  ? 73  PRO A CD    1 
ATOM   631  N  N     . ASP A 1 77  ? 52.477 17.269  22.247  1.00 18.57  ? 74  ASP A N     1 
ATOM   632  C  CA    . ASP A 1 77  ? 53.105 18.170  21.278  1.00 21.00  ? 74  ASP A CA    1 
ATOM   633  C  C     . ASP A 1 77  ? 52.992 17.671  19.846  1.00 17.24  ? 74  ASP A C     1 
ATOM   634  O  O     . ASP A 1 77  ? 53.666 18.198  18.947  1.00 16.63  ? 74  ASP A O     1 
ATOM   635  C  CB    . ASP A 1 77  ? 54.580 18.355  21.604  1.00 23.04  ? 74  ASP A CB    1 
ATOM   636  C  CG    . ASP A 1 77  ? 54.802 19.096  22.907  1.00 31.81  ? 74  ASP A CG    1 
ATOM   637  O  OD1   . ASP A 1 77  ? 54.038 20.045  23.193  1.00 36.88  ? 74  ASP A OD1   1 
ATOM   638  O  OD2   . ASP A 1 77  ? 55.741 18.726  23.647  1.00 36.42  ? 74  ASP A OD2   1 
ATOM   639  N  N     . LEU A 1 78  ? 52.172 16.646  19.631  1.00 13.72  ? 75  LEU A N     1 
ATOM   640  C  CA    . LEU A 1 78  ? 52.002 16.084  18.284  1.00 10.19  ? 75  LEU A CA    1 
ATOM   641  C  C     . LEU A 1 78  ? 51.568 17.160  17.303  1.00 10.61  ? 75  LEU A C     1 
ATOM   642  O  O     . LEU A 1 78  ? 50.615 17.916  17.572  1.00 12.10  ? 75  LEU A O     1 
ATOM   643  C  CB    . LEU A 1 78  ? 50.908 15.013  18.320  1.00 11.14  ? 75  LEU A CB    1 
ATOM   644  C  CG    . LEU A 1 78  ? 50.561 14.238  17.039  1.00 9.24   ? 75  LEU A CG    1 
ATOM   645  C  CD1   . LEU A 1 78  ? 51.738 13.357  16.646  1.00 9.58   ? 75  LEU A CD1   1 
ATOM   646  C  CD2   . LEU A 1 78  ? 49.310 13.432  17.283  1.00 11.59  ? 75  LEU A CD2   1 
ATOM   647  N  N     . LEU A 1 79  ? 52.285 17.234  16.179  1.00 10.02  ? 76  LEU A N     1 
ATOM   648  C  CA    . LEU A 1 79  ? 51.883 18.147  15.101  1.00 8.66   ? 76  LEU A CA    1 
ATOM   649  C  C     . LEU A 1 79  ? 51.029 17.416  14.074  1.00 11.02  ? 76  LEU A C     1 
ATOM   650  O  O     . LEU A 1 79  ? 51.159 16.211  13.881  1.00 11.25  ? 76  LEU A O     1 
ATOM   651  C  CB    . LEU A 1 79  ? 53.120 18.781  14.447  1.00 9.37   ? 76  LEU A CB    1 
ATOM   652  C  CG    . LEU A 1 79  ? 54.055 19.533  15.402  1.00 10.32  ? 76  LEU A CG    1 
ATOM   653  C  CD1   . LEU A 1 79  ? 55.292 20.059  14.671  1.00 11.89  ? 76  LEU A CD1   1 
ATOM   654  C  CD2   . LEU A 1 79  ? 53.309 20.674  16.129  1.00 11.25  ? 76  LEU A CD2   1 
ATOM   655  N  N     . LEU A 1 80  ? 50.149 18.151  13.414  1.00 9.50   ? 77  LEU A N     1 
ATOM   656  C  CA    . LEU A 1 80  ? 49.199 17.510  12.518  1.00 8.80   ? 77  LEU A CA    1 
ATOM   657  C  C     . LEU A 1 80  ? 49.210 18.214  11.193  1.00 15.05  ? 77  LEU A C     1 
ATOM   658  O  O     . LEU A 1 80  ? 49.334 19.446  11.114  1.00 16.16  ? 77  LEU A O     1 
ATOM   659  C  CB    . LEU A 1 80  ? 47.802 17.537  13.094  1.00 9.54   ? 77  LEU A CB    1 
ATOM   660  C  CG    . LEU A 1 80  ? 47.628 16.782  14.394  1.00 11.82  ? 77  LEU A CG    1 
ATOM   661  C  CD1   . LEU A 1 80  ? 46.214 16.990  14.904  1.00 15.07  ? 77  LEU A CD1   1 
ATOM   662  C  CD2   . LEU A 1 80  ? 47.918 15.306  14.163  1.00 13.10  ? 77  LEU A CD2   1 
ATOM   663  N  N     . ALA A 1 81  ? 49.105 17.415  10.153  1.00 8.69   ? 78  ALA A N     1 
ATOM   664  C  CA    . ALA A 1 81  ? 48.784 17.939  8.823   1.00 8.42   ? 78  ALA A CA    1 
ATOM   665  C  C     . ALA A 1 81  ? 47.491 17.330  8.324   1.00 11.54  ? 78  ALA A C     1 
ATOM   666  O  O     . ALA A 1 81  ? 47.280 16.145  8.509   1.00 14.39  ? 78  ALA A O     1 
ATOM   667  C  CB    . ALA A 1 81  ? 49.934 17.631  7.847   1.00 11.61  ? 78  ALA A CB    1 
ATOM   668  N  N     . GLN A 1 82  ? 46.625 18.122  7.686   1.00 9.75   ? 79  GLN A N     1 
ATOM   669  C  CA    . GLN A 1 82  ? 45.301 17.625  7.257   1.00 11.56  ? 79  GLN A CA    1 
ATOM   670  C  C     . GLN A 1 82  ? 45.277 17.298  5.790   1.00 9.74   ? 79  GLN A C     1 
ATOM   671  O  O     . GLN A 1 82  ? 45.829 18.058  4.973   1.00 13.31  ? 79  GLN A O     1 
ATOM   672  C  CB    . GLN A 1 82  ? 44.250 18.723  7.474   1.00 14.19  ? 79  GLN A CB    1 
ATOM   673  C  CG    . GLN A 1 82  ? 44.045 19.080  8.892   1.00 19.72  ? 79  GLN A CG    1 
ATOM   674  C  CD    . GLN A 1 82  ? 43.333 20.403  9.038   1.00 30.43  ? 79  GLN A CD    1 
ATOM   675  O  OE1   . GLN A 1 82  ? 42.525 20.810  8.193   1.00 31.25  ? 79  GLN A OE1   1 
ATOM   676  N  NE2   . GLN A 1 82  ? 43.639 21.082  10.104  1.00 28.71  ? 79  GLN A NE2   1 
ATOM   677  N  N     . VAL A 1 83  ? 44.638 16.178  5.466   1.00 9.15   ? 80  VAL A N     1 
ATOM   678  C  CA    . VAL A 1 83  ? 44.308 15.856  4.085   1.00 11.05  ? 80  VAL A CA    1 
ATOM   679  C  C     . VAL A 1 83  ? 43.402 16.934  3.512   1.00 11.38  ? 80  VAL A C     1 
ATOM   680  O  O     . VAL A 1 83  ? 42.460 17.405  4.162   1.00 11.23  ? 80  VAL A O     1 
ATOM   681  C  CB    . VAL A 1 83  ? 43.586 14.507  4.015   1.00 9.00   ? 80  VAL A CB    1 
ATOM   682  C  CG1   . VAL A 1 83  ? 43.102 14.197  2.608   1.00 11.53  ? 80  VAL A CG1   1 
ATOM   683  C  CG2   . VAL A 1 83  ? 44.520 13.396  4.567   1.00 10.80  ? 80  VAL A CG2   1 
ATOM   684  N  N     . ARG A 1 84  ? 43.695 17.309  2.272   1.00 10.45  ? 81  ARG A N     1 
ATOM   685  C  CA    . ARG A 1 84  ? 42.905 18.306  1.570   1.00 10.30  ? 81  ARG A CA    1 
ATOM   686  C  C     . ARG A 1 84  ? 41.450 17.858  1.489   1.00 11.10  ? 81  ARG A C     1 
ATOM   687  O  O     . ARG A 1 84  ? 41.170 16.669  1.359   1.00 11.65  ? 81  ARG A O     1 
ATOM   688  C  CB    . ARG A 1 84  ? 43.460 18.442  0.159   1.00 13.72  ? 81  ARG A CB    1 
ATOM   689  C  CG    . ARG A 1 84  ? 42.644 19.390  -0.721  1.00 20.05  ? 81  ARG A CG    1 
ATOM   690  C  CD    . ARG A 1 84  ? 43.350 19.646  -2.043  1.00 30.43  ? 81  ARG A CD    1 
ATOM   691  N  NE    . ARG A 1 84  ? 42.414 19.927  -3.131  1.00 36.47  ? 81  ARG A NE    1 
ATOM   692  C  CZ    . ARG A 1 84  ? 42.764 19.981  -4.413  1.00 46.71  ? 81  ARG A CZ    1 
ATOM   693  N  NH1   . ARG A 1 84  ? 44.028 19.767  -4.761  1.00 37.54  ? 81  ARG A NH1   1 
ATOM   694  N  NH2   . ARG A 1 84  ? 41.853 20.240  -5.347  1.00 42.09  ? 81  ARG A NH2   1 
ATOM   695  N  N     . GLU A 1 85  ? 40.529 18.801  1.626   1.00 11.55  ? 82  GLU A N     1 
ATOM   696  C  CA    . GLU A 1 85  ? 39.135 18.481  1.398   1.00 12.68  ? 82  GLU A CA    1 
ATOM   697  C  C     . GLU A 1 85  ? 38.660 19.255  0.202   1.00 14.88  ? 82  GLU A C     1 
ATOM   698  O  O     . GLU A 1 85  ? 38.950 20.447  0.075   1.00 17.45  ? 82  GLU A O     1 
ATOM   699  C  CB    . GLU A 1 85  ? 38.306 18.818  2.625   1.00 16.00  ? 82  GLU A CB    1 
ATOM   700  C  CG    . GLU A 1 85  ? 38.508 17.813  3.682   1.00 18.11  ? 82  GLU A CG    1 
ATOM   701  C  CD    . GLU A 1 85  ? 37.769 18.154  4.939   1.00 28.85  ? 82  GLU A CD    1 
ATOM   702  O  OE1   . GLU A 1 85  ? 36.614 18.644  4.837   1.00 36.77  ? 82  GLU A OE1   1 
ATOM   703  O  OE2   . GLU A 1 85  ? 38.359 17.925  6.014   1.00 27.76  ? 82  GLU A OE2   1 
ATOM   704  N  N     . SER A 1 86  ? 37.958 18.551  -0.684  1.00 16.50  ? 83  SER A N     1 
ATOM   705  C  CA    . SER A 1 86  ? 37.390 19.136  -1.880  1.00 13.93  ? 83  SER A CA    1 
ATOM   706  C  C     . SER A 1 86  ? 36.005 18.546  -2.075  1.00 16.94  ? 83  SER A C     1 
ATOM   707  O  O     . SER A 1 86  ? 35.810 17.329  -1.954  1.00 16.99  ? 83  SER A O     1 
ATOM   708  C  CB    . SER A 1 86  ? 38.244 18.810  -3.113  1.00 18.02  ? 83  SER A CB    1 
ATOM   709  O  OG    . SER A 1 86  ? 39.559 19.294  -2.950  1.00 25.07  ? 83  SER A OG    1 
ATOM   710  N  N     . ARG A 1 87  ? 35.047 19.425  -2.353  1.00 22.44  ? 84  ARG A N     1 
ATOM   711  C  CA    . ARG A 1 87  ? 33.660 19.021  -2.581  1.00 25.44  ? 84  ARG A CA    1 
ATOM   712  C  C     . ARG A 1 87  ? 33.122 18.206  -1.424  1.00 23.63  ? 84  ARG A C     1 
ATOM   713  O  O     . ARG A 1 87  ? 32.396 17.232  -1.633  1.00 28.70  ? 84  ARG A O     1 
ATOM   714  C  CB    . ARG A 1 87  ? 33.528 18.246  -3.902  1.00 23.25  ? 84  ARG A CB    1 
ATOM   715  C  CG    . ARG A 1 87  ? 33.947 19.025  -5.135  1.00 28.71  ? 84  ARG A CG    1 
ATOM   716  C  CD    . ARG A 1 87  ? 33.681 18.243  -6.425  1.00 25.82  ? 84  ARG A CD    1 
ATOM   717  N  NE    . ARG A 1 87  ? 34.897 18.109  -7.224  1.00 27.81  ? 84  ARG A NE    1 
ATOM   718  C  CZ    . ARG A 1 87  ? 35.161 18.848  -8.294  1.00 33.50  ? 84  ARG A CZ    1 
ATOM   719  N  NH1   . ARG A 1 87  ? 34.283 19.759  -8.703  1.00 41.63  ? 84  ARG A NH1   1 
ATOM   720  N  NH2   . ARG A 1 87  ? 36.295 18.673  -8.958  1.00 39.16  ? 84  ARG A NH2   1 
ATOM   721  N  N     . GLY A 1 88  ? 33.499 18.582  -0.202  1.00 22.87  ? 85  GLY A N     1 
ATOM   722  C  CA    . GLY A 1 88  ? 33.032 17.921  1.007   1.00 26.69  ? 85  GLY A CA    1 
ATOM   723  C  C     . GLY A 1 88  ? 33.634 16.574  1.363   1.00 21.96  ? 85  GLY A C     1 
ATOM   724  O  O     . GLY A 1 88  ? 33.132 15.858  2.232   1.00 21.45  ? 85  GLY A O     1 
ATOM   725  N  N     . LYS A 1 89  ? 34.726 16.210  0.699   1.00 14.82  ? 86  LYS A N     1 
ATOM   726  C  CA    . LYS A 1 89  ? 35.330 14.921  0.935   1.00 14.51  ? 86  LYS A CA    1 
ATOM   727  C  C     . LYS A 1 89  ? 36.846 14.998  0.918   1.00 12.44  ? 86  LYS A C     1 
ATOM   728  O  O     . LYS A 1 89  ? 37.433 15.899  0.311   1.00 12.64  ? 86  LYS A O     1 
ATOM   729  C  CB    . LYS A 1 89  ? 34.841 13.872  -0.085  1.00 19.42  ? 86  LYS A CB    1 
ATOM   730  C  CG    . LYS A 1 89  ? 35.191 14.166  -1.498  1.00 20.82  ? 86  LYS A CG    1 
ATOM   731  C  CD    . LYS A 1 89  ? 34.750 13.026  -2.427  1.00 25.34  ? 86  LYS A CD    1 
ATOM   732  C  CE    . LYS A 1 89  ? 35.421 11.698  -2.066  1.00 18.94  ? 86  LYS A CE    1 
ATOM   733  N  NZ    . LYS A 1 89  ? 36.923 11.730  -2.322  1.00 18.38  ? 86  LYS A NZ    1 
ATOM   734  N  N     . ALA A 1 90  ? 37.472 14.032  1.567   1.00 14.67  ? 87  ALA A N     1 
ATOM   735  C  CA    . ALA A 1 90  ? 38.917 13.953  1.575   1.00 15.48  ? 87  ALA A CA    1 
ATOM   736  C  C     . ALA A 1 90  ? 39.372 13.755  0.142   1.00 14.55  ? 87  ALA A C     1 
ATOM   737  O  O     . ALA A 1 90  ? 38.705 13.066  -0.638  1.00 18.02  ? 87  ALA A O     1 
ATOM   738  C  CB    . ALA A 1 90  ? 39.364 12.818  2.442   1.00 18.28  ? 87  ALA A CB    1 
ATOM   739  N  N     . ASN A 1 91  ? 40.463 14.417  -0.214  1.00 11.96  ? 88  ASN A N     1 
ATOM   740  C  CA    . ASN A 1 91  ? 41.002 14.352  -1.566  1.00 12.26  ? 88  ASN A CA    1 
ATOM   741  C  C     . ASN A 1 91  ? 42.468 13.988  -1.492  1.00 12.56  ? 88  ASN A C     1 
ATOM   742  O  O     . ASN A 1 91  ? 43.282 14.703  -0.896  1.00 11.50  ? 88  ASN A O     1 
ATOM   743  C  CB    . ASN A 1 91  ? 40.779 15.678  -2.290  1.00 13.45  ? 88  ASN A CB    1 
ATOM   744  C  CG    . ASN A 1 91  ? 41.161 15.615  -3.764  1.00 16.49  ? 88  ASN A CG    1 
ATOM   745  O  OD1   . ASN A 1 91  ? 42.261 15.204  -4.113  1.00 14.48  ? 88  ASN A OD1   1 
ATOM   746  N  ND2   . ASN A 1 91  ? 40.224 15.983  -4.632  1.00 26.60  ? 88  ASN A ND2   1 
ATOM   747  N  N     . LEU A 1 92  ? 42.796 12.840  -2.072  1.00 10.42  ? 89  LEU A N     1 
ATOM   748  C  CA    . LEU A 1 92  ? 44.133 12.254  -1.944  1.00 9.58   ? 89  LEU A CA    1 
ATOM   749  C  C     . LEU A 1 92  ? 45.101 12.594  -3.093  1.00 9.38   ? 89  LEU A C     1 
ATOM   750  O  O     . LEU A 1 92  ? 46.172 12.009  -3.199  1.00 10.08  ? 89  LEU A O     1 
ATOM   751  C  CB    . LEU A 1 92  ? 44.000 10.730  -1.767  1.00 10.78  ? 89  LEU A CB    1 
ATOM   752  C  CG    . LEU A 1 92  ? 43.093 10.308  -0.620  1.00 10.20  ? 89  LEU A CG    1 
ATOM   753  C  CD1   . LEU A 1 92  ? 42.879 8.768   -0.675  1.00 15.79  ? 89  LEU A CD1   1 
ATOM   754  C  CD2   . LEU A 1 92  ? 43.760 10.726  0.687   1.00 13.58  ? 89  LEU A CD2   1 
ATOM   755  N  N     . THR A 1 93  ? 44.760 13.598  -3.908  1.00 8.69   ? 90  THR A N     1 
ATOM   756  C  CA    . THR A 1 93  ? 45.601 13.955  -5.050  1.00 8.77   ? 90  THR A CA    1 
ATOM   757  C  C     . THR A 1 93  ? 47.079 14.161  -4.746  1.00 9.18   ? 90  THR A C     1 
ATOM   758  O  O     . THR A 1 93  ? 47.929 13.692  -5.503  1.00 10.92  ? 90  THR A O     1 
ATOM   759  C  CB    . THR A 1 93  ? 45.002 15.172  -5.798  1.00 11.63  ? 90  THR A CB    1 
ATOM   760  O  OG1   . THR A 1 93  ? 43.685 14.822  -6.223  1.00 17.18  ? 90  THR A OG1   1 
ATOM   761  C  CG2   . THR A 1 93  ? 45.828 15.524  -7.018  1.00 14.91  ? 90  THR A CG2   1 
ATOM   762  N  N     . LYS A 1 94  ? 47.398 14.865  -3.661  1.00 7.70   ? 91  LYS A N     1 
ATOM   763  C  CA    . LYS A 1 94  ? 48.776 15.199  -3.375  1.00 7.94   ? 91  LYS A CA    1 
ATOM   764  C  C     . LYS A 1 94  ? 49.615 13.917  -3.222  1.00 8.52   ? 91  LYS A C     1 
ATOM   765  O  O     . LYS A 1 94  ? 50.751 13.843  -3.681  1.00 9.89   ? 91  LYS A O     1 
ATOM   766  C  CB    . LYS A 1 94  ? 48.856 16.066  -2.112  1.00 9.81   ? 91  LYS A CB    1 
ATOM   767  C  CG    . LYS A 1 94  ? 50.248 16.617  -1.831  1.00 12.15  ? 91  LYS A CG    1 
ATOM   768  C  CD    . LYS A 1 94  ? 50.337 17.134  -0.397  1.00 11.43  ? 91  LYS A CD    1 
ATOM   769  C  CE    . LYS A 1 94  ? 49.374 18.265  -0.164  1.00 15.68  ? 91  LYS A CE    1 
ATOM   770  N  NZ    . LYS A 1 94  ? 49.595 18.824  1.199   1.00 12.09  ? 91  LYS A NZ    1 
ATOM   771  N  N     . TYR A 1 95  ? 49.041 12.937  -2.554  1.00 9.24   ? 92  TYR A N     1 
ATOM   772  C  CA    . TYR A 1 95  ? 49.725 11.677  -2.275  1.00 8.53   ? 92  TYR A CA    1 
ATOM   773  C  C     . TYR A 1 95  ? 49.789 10.807  -3.512  1.00 9.42   ? 92  TYR A C     1 
ATOM   774  O  O     . TYR A 1 95  ? 50.806 10.145  -3.740  1.00 9.05   ? 92  TYR A O     1 
ATOM   775  C  CB    . TYR A 1 95  ? 49.040 10.939  -1.095  1.00 7.59   ? 92  TYR A CB    1 
ATOM   776  C  CG    . TYR A 1 95  ? 48.758 11.914  0.027   1.00 7.18   ? 92  TYR A CG    1 
ATOM   777  C  CD1   . TYR A 1 95  ? 49.797 12.507  0.745   1.00 7.35   ? 92  TYR A CD1   1 
ATOM   778  C  CD2   . TYR A 1 95  ? 47.472 12.307  0.291   1.00 7.66   ? 92  TYR A CD2   1 
ATOM   779  C  CE1   . TYR A 1 95  ? 49.544 13.441  1.719   1.00 8.17   ? 92  TYR A CE1   1 
ATOM   780  C  CE2   . TYR A 1 95  ? 47.199 13.256  1.243   1.00 10.67  ? 92  TYR A CE2   1 
ATOM   781  C  CZ    . TYR A 1 95  ? 48.227 13.806  1.955   1.00 8.28   ? 92  TYR A CZ    1 
ATOM   782  O  OH    . TYR A 1 95  ? 47.883 14.757  2.904   1.00 12.22  ? 92  TYR A OH    1 
ATOM   783  N  N     . ARG A 1 96  ? 48.738 10.835  -4.340  1.00 7.30   ? 93  ARG A N     1 
ATOM   784  C  CA    . ARG A 1 96  ? 48.823 10.125  -5.623  1.00 9.96   ? 93  ARG A CA    1 
ATOM   785  C  C     . ARG A 1 96  ? 49.913 10.697  -6.539  1.00 12.89  ? 93  ARG A C     1 
ATOM   786  O  O     . ARG A 1 96  ? 50.638 9.925   -7.200  1.00 12.37  ? 93  ARG A O     1 
ATOM   787  C  CB    . ARG A 1 96  ? 47.464 10.136  -6.346  1.00 9.96   ? 93  ARG A CB    1 
ATOM   788  C  CG    . ARG A 1 96  ? 46.390 9.375   -5.637  1.00 9.41   ? 93  ARG A CG    1 
ATOM   789  C  CD    . ARG A 1 96  ? 45.120 9.117   -6.514  1.00 12.08  ? 93  ARG A CD    1 
ATOM   790  N  NE    . ARG A 1 96  ? 44.095 8.390   -5.770  1.00 16.50  ? 93  ARG A NE    1 
ATOM   791  C  CZ    . ARG A 1 96  ? 43.029 8.954   -5.204  1.00 15.28  ? 93  ARG A CZ    1 
ATOM   792  N  NH1   . ARG A 1 96  ? 42.179 8.207   -4.500  1.00 14.96  ? 93  ARG A NH1   1 
ATOM   793  N  NH2   . ARG A 1 96  ? 42.817 10.263  -5.338  1.00 13.82  ? 93  ARG A NH2   1 
ATOM   794  N  N     . GLU A 1 97  ? 50.037 12.023  -6.595  1.00 10.30  ? 94  GLU A N     1 
ATOM   795  C  CA    . GLU A 1 97  ? 51.077 12.670  -7.393  1.00 11.53  ? 94  GLU A CA    1 
ATOM   796  C  C     . GLU A 1 97  ? 52.478 12.363  -6.854  1.00 10.13  ? 94  GLU A C     1 
ATOM   797  O  O     . GLU A 1 97  ? 53.392 12.114  -7.623  1.00 10.48  ? 94  GLU A O     1 
ATOM   798  C  CB    . GLU A 1 97  ? 50.812 14.174  -7.536  1.00 14.76  ? 94  GLU A CB    1 
ATOM   799  C  CG    . GLU A 1 97  ? 49.561 14.412  -8.344  1.00 16.11  ? 94  GLU A CG    1 
ATOM   800  C  CD    . GLU A 1 97  ? 49.163 15.872  -8.439  1.00 28.84  ? 94  GLU A CD    1 
ATOM   801  O  OE1   . GLU A 1 97  ? 49.648 16.695  -7.625  1.00 33.71  ? 94  GLU A OE1   1 
ATOM   802  O  OE2   . GLU A 1 97  ? 48.348 16.190  -9.339  1.00 30.27  ? 94  GLU A OE2   1 
ATOM   803  N  N     . ALA A 1 98  ? 52.630 12.336  -5.529  1.00 9.15   ? 95  ALA A N     1 
ATOM   804  C  CA    . ALA A 1 98  ? 53.905 12.018  -4.928  1.00 9.90   ? 95  ALA A CA    1 
ATOM   805  C  C     . ALA A 1 98  ? 54.263 10.550  -5.209  1.00 10.17  ? 95  ALA A C     1 
ATOM   806  O  O     . ALA A 1 98  ? 55.433 10.236  -5.443  1.00 10.44  ? 95  ALA A O     1 
ATOM   807  C  CB    . ALA A 1 98  ? 53.861 12.285  -3.405  1.00 8.43   ? 95  ALA A CB    1 
ATOM   808  N  N     . SER A 1 99  ? 53.267 9.680   -5.191  1.00 8.58   ? 96  SER A N     1 
ATOM   809  C  CA    . SER A 1 99  ? 53.470 8.263   -5.558  1.00 7.00   ? 96  SER A CA    1 
ATOM   810  C  C     . SER A 1 99  ? 54.004 8.144   -6.989  1.00 11.57  ? 96  SER A C     1 
ATOM   811  O  O     . SER A 1 99  ? 54.946 7.393   -7.267  1.00 11.13  ? 96  SER A O     1 
ATOM   812  C  CB    . SER A 1 99  ? 52.162 7.511   -5.412  1.00 9.53   ? 96  SER A CB    1 
ATOM   813  O  OG    . SER A 1 99  ? 52.280 6.158   -5.848  1.00 13.21  ? 96  SER A OG    1 
ATOM   814  N  N     . VAL A 1 100 ? 53.406 8.900   -7.900  1.00 9.86   ? 97  VAL A N     1 
ATOM   815  C  CA    . VAL A 1 100 ? 53.901 8.873   -9.290  1.00 9.60   ? 97  VAL A CA    1 
ATOM   816  C  C     . VAL A 1 100 ? 55.384 9.292   -9.385  1.00 10.59  ? 97  VAL A C     1 
ATOM   817  O  O     . VAL A 1 100 ? 56.177 8.670   -10.116 1.00 11.56  ? 97  VAL A O     1 
ATOM   818  C  CB    . VAL A 1 100 ? 53.007 9.740   -10.191 1.00 11.21  ? 97  VAL A CB    1 
ATOM   819  C  CG1   . VAL A 1 100 ? 53.706 10.018  -11.554 1.00 13.68  ? 97  VAL A CG1   1 
ATOM   820  C  CG2   . VAL A 1 100 ? 51.640 9.081   -10.381 1.00 13.14  ? 97  VAL A CG2   1 
ATOM   821  N  N     . GLU A 1 101 ? 55.804 10.296  -8.618  1.00 9.05   ? 98  GLU A N     1 
ATOM   822  C  CA    . GLU A 1 101 ? 57.226 10.680  -8.588  1.00 8.62   ? 98  GLU A CA    1 
ATOM   823  C  C     . GLU A 1 101 ? 58.122 9.474   -8.279  1.00 11.50  ? 98  GLU A C     1 
ATOM   824  O  O     . GLU A 1 101 ? 59.131 9.251   -8.928  1.00 12.94  ? 98  GLU A O     1 
ATOM   825  C  CB    . GLU A 1 101 ? 57.519 11.717  -7.510  1.00 11.97  ? 98  GLU A CB    1 
ATOM   826  C  CG    . GLU A 1 101 ? 57.047 13.158  -7.778  1.00 16.08  ? 98  GLU A CG    1 
ATOM   827  C  CD    . GLU A 1 101 ? 57.405 14.098  -6.634  1.00 14.58  ? 98  GLU A CD    1 
ATOM   828  O  OE1   . GLU A 1 101 ? 58.612 14.431  -6.475  1.00 15.42  ? 98  GLU A OE1   1 
ATOM   829  O  OE2   . GLU A 1 101 ? 56.473 14.526  -5.895  1.00 18.48  ? 98  GLU A OE2   1 
ATOM   830  N  N     . VAL A 1 102 ? 57.724 8.705   -7.270  1.00 9.42   ? 99  VAL A N     1 
ATOM   831  C  CA    . VAL A 1 102 ? 58.557 7.593   -6.822  1.00 9.73   ? 99  VAL A CA    1 
ATOM   832  C  C     . VAL A 1 102 ? 58.525 6.453   -7.805  1.00 8.87   ? 99  VAL A C     1 
ATOM   833  O  O     . VAL A 1 102 ? 59.582 5.884   -8.118  1.00 11.13  ? 99  VAL A O     1 
ATOM   834  C  CB    . VAL A 1 102 ? 58.121 7.072   -5.440  1.00 9.96   ? 99  VAL A CB    1 
ATOM   835  C  CG1   . VAL A 1 102 ? 58.930 5.829   -5.078  1.00 14.02  ? 99  VAL A CG1   1 
ATOM   836  C  CG2   . VAL A 1 102 ? 58.287 8.183   -4.415  1.00 11.38  ? 99  VAL A CG2   1 
ATOM   837  N  N     . MET A 1 103 ? 57.330 6.134   -8.296  1.00 8.94   ? 100 MET A N     1 
ATOM   838  C  CA    . MET A 1 103 ? 57.163 5.004   -9.222  1.00 9.37   ? 100 MET A CA    1 
ATOM   839  C  C     . MET A 1 103 ? 57.915 5.264   -10.520 1.00 11.70  ? 100 MET A C     1 
ATOM   840  O  O     . MET A 1 103 ? 58.468 4.327   -11.101 1.00 13.00  ? 100 MET A O     1 
ATOM   841  C  CB    . MET A 1 103 ? 55.686 4.729   -9.487  1.00 14.15  ? 100 MET A CB    1 
ATOM   842  C  CG    A MET A 1 103 ? 54.881 4.522   -8.179  0.45 13.87  ? 100 MET A CG    1 
ATOM   843  C  CG    B MET A 1 103 ? 54.880 4.489   -8.265  0.55 13.88  ? 100 MET A CG    1 
ATOM   844  S  SD    A MET A 1 103 ? 54.513 2.815   -7.675  0.45 12.94  ? 100 MET A SD    1 
ATOM   845  S  SD    B MET A 1 103 ? 55.528 3.029   -7.470  0.55 9.75   ? 100 MET A SD    1 
ATOM   846  C  CE    A MET A 1 103 ? 54.035 2.982   -5.948  0.45 11.36  ? 100 MET A CE    1 
ATOM   847  C  CE    B MET A 1 103 ? 54.537 3.002   -5.960  0.55 12.12  ? 100 MET A CE    1 
ATOM   848  N  N     . GLU A 1 104 ? 57.994 6.525   -10.950 1.00 10.27  ? 101 GLU A N     1 
ATOM   849  C  CA    . GLU A 1 104 ? 58.717 6.825   -12.180 1.00 13.86  ? 101 GLU A CA    1 
ATOM   850  C  C     . GLU A 1 104 ? 60.215 6.623   -12.019 1.00 11.73  ? 101 GLU A C     1 
ATOM   851  O  O     . GLU A 1 104 ? 60.873 6.100   -12.941 1.00 15.36  ? 101 GLU A O     1 
ATOM   852  C  CB    . GLU A 1 104 ? 58.362 8.230   -12.702 1.00 13.61  ? 101 GLU A CB    1 
ATOM   853  C  CG    . GLU A 1 104 ? 56.949 8.264   -13.306 1.00 19.07  ? 101 GLU A CG    1 
ATOM   854  C  CD    . GLU A 1 104 ? 56.571 9.589   -13.947 1.00 30.71  ? 101 GLU A CD    1 
ATOM   855  O  OE1   . GLU A 1 104 ? 57.299 10.589  -13.753 1.00 30.92  ? 101 GLU A OE1   1 
ATOM   856  O  OE2   . GLU A 1 104 ? 55.530 9.620   -14.638 1.00 35.27  ? 101 GLU A OE2   1 
ATOM   857  N  N     . ILE A 1 105 ? 60.771 7.003   -10.863 1.00 9.86   ? 102 ILE A N     1 
ATOM   858  C  CA    . ILE A 1 105 ? 62.184 6.723   -10.574 1.00 10.93  ? 102 ILE A CA    1 
ATOM   859  C  C     . ILE A 1 105 ? 62.457 5.205   -10.545 1.00 11.28  ? 102 ILE A C     1 
ATOM   860  O  O     . ILE A 1 105 ? 63.390 4.700   -11.204 1.00 13.46  ? 102 ILE A O     1 
ATOM   861  C  CB    . ILE A 1 105 ? 62.632 7.395   -9.270  1.00 12.41  ? 102 ILE A CB    1 
ATOM   862  C  CG1   . ILE A 1 105 ? 62.566 8.919   -9.401  1.00 11.74  ? 102 ILE A CG1   1 
ATOM   863  C  CG2   . ILE A 1 105 ? 64.034 6.976   -8.896  1.00 14.68  ? 102 ILE A CG2   1 
ATOM   864  C  CD1   . ILE A 1 105 ? 62.391 9.600   -8.059  1.00 11.59  ? 102 ILE A CD1   1 
ATOM   865  N  N     . MET A 1 106 ? 61.629 4.461   -9.829  1.00 10.24  ? 103 MET A N     1 
ATOM   866  C  CA    . MET A 1 106 ? 61.858 3.011   -9.754  1.00 11.23  ? 103 MET A CA    1 
ATOM   867  C  C     . MET A 1 106 ? 61.843 2.368   -11.142 1.00 14.87  ? 103 MET A C     1 
ATOM   868  O  O     . MET A 1 106 ? 62.634 1.456   -11.431 1.00 14.41  ? 103 MET A O     1 
ATOM   869  C  CB    . MET A 1 106 ? 60.810 2.362   -8.840  1.00 11.97  ? 103 MET A CB    1 
ATOM   870  C  CG    . MET A 1 106 ? 61.033 2.705   -7.383  1.00 12.02  ? 103 MET A CG    1 
ATOM   871  S  SD    . MET A 1 106 ? 59.834 1.794   -6.369  1.00 15.95  ? 103 MET A SD    1 
ATOM   872  C  CE    . MET A 1 106 ? 60.261 0.100   -6.756  1.00 18.88  ? 103 MET A CE    1 
ATOM   873  N  N     . SER A 1 107 ? 60.960 2.871   -12.004 1.00 12.03  ? 104 SER A N     1 
ATOM   874  C  CA    . SER A 1 107 ? 60.811 2.330   -13.363 1.00 13.68  ? 104 SER A CA    1 
ATOM   875  C  C     . SER A 1 107 ? 62.077 2.488   -14.212 1.00 17.58  ? 104 SER A C     1 
ATOM   876  O  O     . SER A 1 107 ? 62.221 1.805   -15.224 1.00 18.06  ? 104 SER A O     1 
ATOM   877  C  CB    . SER A 1 107 ? 59.608 2.975   -14.067 1.00 18.99  ? 104 SER A CB    1 
ATOM   878  O  OG    . SER A 1 107 ? 58.399 2.616   -13.432 1.00 24.96  ? 104 SER A OG    1 
ATOM   879  N  N     . ARG A 1 108 ? 62.986 3.383   -13.832 1.00 14.95  ? 105 ARG A N     1 
ATOM   880  C  CA    . ARG A 1 108 ? 64.243 3.497   -14.577 1.00 15.88  ? 105 ARG A CA    1 
ATOM   881  C  C     . ARG A 1 108 ? 65.119 2.265   -14.391 1.00 19.62  ? 105 ARG A C     1 
ATOM   882  O  O     . ARG A 1 108 ? 65.945 1.944   -15.256 1.00 19.59  ? 105 ARG A O     1 
ATOM   883  C  CB    . ARG A 1 108 ? 65.039 4.734   -14.181 1.00 18.02  ? 105 ARG A CB    1 
ATOM   884  C  CG    . ARG A 1 108 ? 64.287 6.036   -14.329 1.00 18.77  ? 105 ARG A CG    1 
ATOM   885  C  CD    . ARG A 1 108 ? 65.244 7.199   -14.516 1.00 22.42  ? 105 ARG A CD    1 
ATOM   886  N  NE    . ARG A 1 108 ? 66.278 7.311   -13.499 1.00 24.41  ? 105 ARG A NE    1 
ATOM   887  C  CZ    . ARG A 1 108 ? 66.225 8.169   -12.484 1.00 23.63  ? 105 ARG A CZ    1 
ATOM   888  N  NH1   . ARG A 1 108 ? 67.210 8.229   -11.598 1.00 21.67  ? 105 ARG A NH1   1 
ATOM   889  N  NH2   . ARG A 1 108 ? 65.177 8.961   -12.362 1.00 19.58  ? 105 ARG A NH2   1 
ATOM   890  N  N     . PHE A 1 109 ? 64.941 1.585   -13.262 1.00 17.67  ? 106 PHE A N     1 
ATOM   891  C  CA    . PHE A 1 109 ? 65.774 0.427   -12.918 1.00 18.22  ? 106 PHE A CA    1 
ATOM   892  C  C     . PHE A 1 109 ? 65.227 -0.906  -13.433 1.00 23.30  ? 106 PHE A C     1 
ATOM   893  O  O     . PHE A 1 109 ? 66.000 -1.788  -13.827 1.00 24.68  ? 106 PHE A O     1 
ATOM   894  C  CB    . PHE A 1 109 ? 65.976 0.372   -11.407 1.00 13.93  ? 106 PHE A CB    1 
ATOM   895  C  CG    . PHE A 1 109 ? 66.725 1.541   -10.866 1.00 17.43  ? 106 PHE A CG    1 
ATOM   896  C  CD1   . PHE A 1 109 ? 66.082 2.748   -10.635 1.00 13.82  ? 106 PHE A CD1   1 
ATOM   897  C  CD2   . PHE A 1 109 ? 68.081 1.443   -10.584 1.00 15.70  ? 106 PHE A CD2   1 
ATOM   898  C  CE1   . PHE A 1 109 ? 66.768 3.834   -10.152 1.00 14.84  ? 106 PHE A CE1   1 
ATOM   899  C  CE2   . PHE A 1 109 ? 68.780 2.527   -10.083 1.00 14.71  ? 106 PHE A CE2   1 
ATOM   900  C  CZ    . PHE A 1 109 ? 68.126 3.731   -9.860  1.00 15.67  ? 106 PHE A CZ    1 
ATOM   901  N  N     . ALA A 1 110 ? 63.905 -1.035  -13.451 1.00 18.61  ? 107 ALA A N     1 
ATOM   902  C  CA    . ALA A 1 110 ? 63.230 -2.278  -13.804 1.00 20.47  ? 107 ALA A CA    1 
ATOM   903  C  C     . ALA A 1 110 ? 61.745 -2.033  -13.988 1.00 23.83  ? 107 ALA A C     1 
ATOM   904  O  O     . ALA A 1 110 ? 61.214 -1.014  -13.550 1.00 24.53  ? 107 ALA A O     1 
ATOM   905  C  CB    . ALA A 1 110 ? 63.456 -3.344  -12.734 1.00 22.68  ? 107 ALA A CB    1 
ATOM   906  N  N     . VAL A 1 111 ? 61.071 -2.964  -14.654 1.00 25.71  ? 108 VAL A N     1 
ATOM   907  C  CA    . VAL A 1 111 ? 59.633 -2.872  -14.800 1.00 22.21  ? 108 VAL A CA    1 
ATOM   908  C  C     . VAL A 1 111 ? 59.077 -3.117  -13.391 1.00 25.68  ? 108 VAL A C     1 
ATOM   909  O  O     . VAL A 1 111 ? 59.550 -4.002  -12.684 1.00 24.95  ? 108 VAL A O     1 
ATOM   910  C  CB    . VAL A 1 111 ? 59.089 -3.891  -15.804 1.00 32.06  ? 108 VAL A CB    1 
ATOM   911  C  CG1   . VAL A 1 111 ? 57.583 -3.976  -15.696 1.00 27.59  ? 108 VAL A CG1   1 
ATOM   912  C  CG2   . VAL A 1 111 ? 59.507 -3.503  -17.227 1.00 33.63  ? 108 VAL A CG2   1 
ATOM   913  N  N     . ILE A 1 112 ? 58.122 -2.302  -12.965 1.00 22.07  ? 109 ILE A N     1 
ATOM   914  C  CA    . ILE A 1 112 ? 57.623 -2.441  -11.600 1.00 18.33  ? 109 ILE A CA    1 
ATOM   915  C  C     . ILE A 1 112 ? 56.198 -2.928  -11.572 1.00 15.04  ? 109 ILE A C     1 
ATOM   916  O  O     . ILE A 1 112 ? 55.466 -2.805  -12.554 1.00 16.05  ? 109 ILE A O     1 
ATOM   917  C  CB    . ILE A 1 112 ? 57.723 -1.092  -10.819 1.00 17.47  ? 109 ILE A CB    1 
ATOM   918  C  CG1   . ILE A 1 112 ? 56.630 -0.121  -11.251 1.00 23.99  ? 109 ILE A CG1   1 
ATOM   919  C  CG2   . ILE A 1 112 ? 59.134 -0.529  -10.945 1.00 24.50  ? 109 ILE A CG2   1 
ATOM   920  C  CD1   . ILE A 1 112 ? 56.592 1.160   -10.397 1.00 22.79  ? 109 ILE A CD1   1 
ATOM   921  N  N     . GLU A 1 113 ? 55.808 -3.523  -10.454 1.00 9.73   ? 110 GLU A N     1 
ATOM   922  C  CA    . GLU A 1 113 ? 54.411 -3.762  -10.155 1.00 9.74   ? 110 GLU A CA    1 
ATOM   923  C  C     . GLU A 1 113 ? 53.988 -2.813  -9.045  1.00 12.42  ? 110 GLU A C     1 
ATOM   924  O  O     . GLU A 1 113 ? 54.471 -2.933  -7.920  1.00 10.75  ? 110 GLU A O     1 
ATOM   925  C  CB    . GLU A 1 113 ? 54.153 -5.212  -9.684  1.00 11.44  ? 110 GLU A CB    1 
ATOM   926  C  CG    . GLU A 1 113 ? 52.686 -5.452  -9.326  1.00 12.37  ? 110 GLU A CG    1 
ATOM   927  C  CD    . GLU A 1 113 ? 52.399 -6.863  -8.812  1.00 20.96  ? 110 GLU A CD    1 
ATOM   928  O  OE1   . GLU A 1 113 ? 51.378 -7.040  -8.105  1.00 22.17  ? 110 GLU A OE1   1 
ATOM   929  O  OE2   . GLU A 1 113 ? 53.190 -7.791  -9.111  1.00 16.00  ? 110 GLU A OE2   1 
ATOM   930  N  N     . ARG A 1 114 ? 53.112 -1.859  -9.357  1.00 13.37  ? 111 ARG A N     1 
ATOM   931  C  CA    . ARG A 1 114 ? 52.597 -0.951  -8.324  1.00 12.24  ? 111 ARG A CA    1 
ATOM   932  C  C     . ARG A 1 114 ? 51.667 -1.717  -7.408  1.00 13.63  ? 111 ARG A C     1 
ATOM   933  O  O     . ARG A 1 114 ? 50.599 -2.171  -7.820  1.00 19.46  ? 111 ARG A O     1 
ATOM   934  C  CB    . ARG A 1 114 ? 51.830 0.215   -8.968  1.00 12.79  ? 111 ARG A CB    1 
ATOM   935  C  CG    . ARG A 1 114 ? 51.216 1.206   -7.938  1.00 13.66  ? 111 ARG A CG    1 
ATOM   936  C  CD    . ARG A 1 114 ? 49.950 1.885   -8.507  1.00 16.51  ? 111 ARG A CD    1 
ATOM   937  N  NE    . ARG A 1 114 ? 49.581 3.115   -7.797  1.00 17.73  ? 111 ARG A NE    1 
ATOM   938  C  CZ    . ARG A 1 114 ? 48.652 3.203   -6.847  1.00 23.32  ? 111 ARG A CZ    1 
ATOM   939  N  NH1   . ARG A 1 114 ? 47.981 2.130   -6.450  1.00 23.11  ? 111 ARG A NH1   1 
ATOM   940  N  NH2   . ARG A 1 114 ? 48.401 4.382   -6.285  1.00 18.75  ? 111 ARG A NH2   1 
ATOM   941  N  N     . ALA A 1 115 ? 52.060 -1.877  -6.156  1.00 9.27   ? 112 ALA A N     1 
ATOM   942  C  CA    . ALA A 1 115 ? 51.270 -2.666  -5.230  1.00 9.44   ? 112 ALA A CA    1 
ATOM   943  C  C     . ALA A 1 115 ? 50.323 -1.823  -4.383  1.00 11.27  ? 112 ALA A C     1 
ATOM   944  O  O     . ALA A 1 115 ? 49.303 -2.307  -3.907  1.00 15.68  ? 112 ALA A O     1 
ATOM   945  C  CB    . ALA A 1 115 ? 52.192 -3.463  -4.318  1.00 12.23  ? 112 ALA A CB    1 
ATOM   946  N  N     . SER A 1 116 ? 50.670 -0.562  -4.191  1.00 10.89  ? 113 SER A N     1 
ATOM   947  C  CA    . SER A 1 116 ? 49.837 0.332   -3.404  1.00 10.45  ? 113 SER A CA    1 
ATOM   948  C  C     . SER A 1 116 ? 50.331 1.735   -3.707  1.00 9.74   ? 113 SER A C     1 
ATOM   949  O  O     . SER A 1 116 ? 51.252 1.919   -4.483  1.00 10.23  ? 113 SER A O     1 
ATOM   950  C  CB    . SER A 1 116 ? 49.983 0.086   -1.906  1.00 11.95  ? 113 SER A CB    1 
ATOM   951  O  OG    . SER A 1 116 ? 51.199 0.645   -1.408  1.00 12.89  ? 113 SER A OG    1 
ATOM   952  N  N     . ILE A 1 117 ? 49.726 2.729   -3.072  1.00 9.96   ? 114 ILE A N     1 
ATOM   953  C  CA    . ILE A 1 117 ? 50.170 4.102   -3.284  1.00 9.15   ? 114 ILE A CA    1 
ATOM   954  C  C     . ILE A 1 117 ? 51.646 4.302   -2.909  1.00 8.07   ? 114 ILE A C     1 
ATOM   955  O  O     . ILE A 1 117 ? 52.294 5.204   -3.430  1.00 10.05  ? 114 ILE A O     1 
ATOM   956  C  CB    . ILE A 1 117 ? 49.257 5.089   -2.520  1.00 9.26   ? 114 ILE A CB    1 
ATOM   957  C  CG1   . ILE A 1 117 ? 49.347 6.487   -3.142  1.00 8.76   ? 114 ILE A CG1   1 
ATOM   958  C  CG2   . ILE A 1 117 ? 49.576 5.104   -1.035  1.00 8.65   ? 114 ILE A CG2   1 
ATOM   959  C  CD1   . ILE A 1 117 ? 48.252 7.409   -2.649  1.00 7.97   ? 114 ILE A CD1   1 
ATOM   960  N  N     . ASP A 1 118 ? 52.182 3.467   -2.013  1.00 8.20   ? 115 ASP A N     1 
ATOM   961  C  CA    . ASP A 1 118 ? 53.557 3.703   -1.578  1.00 8.31   ? 115 ASP A CA    1 
ATOM   962  C  C     . ASP A 1 118 ? 54.477 2.502   -1.662  1.00 9.75   ? 115 ASP A C     1 
ATOM   963  O  O     . ASP A 1 118 ? 55.574 2.500   -1.073  1.00 8.37   ? 115 ASP A O     1 
ATOM   964  C  CB    . ASP A 1 118 ? 53.586 4.306   -0.170  1.00 7.07   ? 115 ASP A CB    1 
ATOM   965  C  CG    . ASP A 1 118 ? 53.639 3.250   0.904   1.00 9.88   ? 115 ASP A CG    1 
ATOM   966  O  OD1   . ASP A 1 118 ? 52.994 2.164   0.757   1.00 11.41  ? 115 ASP A OD1   1 
ATOM   967  O  OD2   . ASP A 1 118 ? 54.374 3.501   1.883   1.00 8.94   ? 115 ASP A OD2   1 
ATOM   968  N  N     . GLU A 1 119 ? 54.097 1.506   -2.450  1.00 9.02   ? 116 GLU A N     1 
ATOM   969  C  CA    . GLU A 1 119 ? 55.046 0.428   -2.629  1.00 10.64  ? 116 GLU A CA    1 
ATOM   970  C  C     . GLU A 1 119 ? 54.947 -0.246  -3.955  1.00 8.25   ? 116 GLU A C     1 
ATOM   971  O  O     . GLU A 1 119 ? 53.910 -0.191  -4.626  1.00 9.59   ? 116 GLU A O     1 
ATOM   972  C  CB    . GLU A 1 119 ? 54.929 -0.583  -1.531  1.00 15.60  ? 116 GLU A CB    1 
ATOM   973  C  CG    . GLU A 1 119 ? 53.698 -1.341  -1.536  1.00 12.94  ? 116 GLU A CG    1 
ATOM   974  C  CD    . GLU A 1 119 ? 53.293 -1.726  -0.128  1.00 23.12  ? 116 GLU A CD    1 
ATOM   975  O  OE1   . GLU A 1 119 ? 53.539 -2.875  0.264   1.00 23.67  ? 116 GLU A OE1   1 
ATOM   976  O  OE2   . GLU A 1 119 ? 52.736 -0.867  0.583   1.00 26.35  ? 116 GLU A OE2   1 
ATOM   977  N  N     . ALA A 1 120 ? 56.069 -0.834  -4.334  1.00 8.08   ? 117 ALA A N     1 
ATOM   978  C  CA    . ALA A 1 120 ? 56.177 -1.464  -5.624  1.00 6.70   ? 117 ALA A CA    1 
ATOM   979  C  C     . ALA A 1 120 ? 57.114 -2.646  -5.509  1.00 8.26   ? 117 ALA A C     1 
ATOM   980  O  O     . ALA A 1 120 ? 58.119 -2.571  -4.809  1.00 7.77   ? 117 ALA A O     1 
ATOM   981  C  CB    . ALA A 1 120 ? 56.691 -0.503  -6.678  1.00 11.01  ? 117 ALA A CB    1 
ATOM   982  N  N     . TYR A 1 121 ? 56.759 -3.724  -6.189  1.00 8.91   ? 118 TYR A N     1 
ATOM   983  C  CA    . TYR A 1 121 ? 57.692 -4.836  -6.379  1.00 7.59   ? 118 TYR A CA    1 
ATOM   984  C  C     . TYR A 1 121 ? 58.491 -4.605  -7.627  1.00 9.74   ? 118 TYR A C     1 
ATOM   985  O  O     . TYR A 1 121 ? 57.993 -4.017  -8.586  1.00 9.61   ? 118 TYR A O     1 
ATOM   986  C  CB    . TYR A 1 121 ? 56.936 -6.154  -6.513  1.00 7.93   ? 118 TYR A CB    1 
ATOM   987  C  CG    . TYR A 1 121 ? 56.203 -6.531  -5.259  1.00 8.25   ? 118 TYR A CG    1 
ATOM   988  C  CD1   . TYR A 1 121 ? 56.862 -7.240  -4.249  1.00 8.21   ? 118 TYR A CD1   1 
ATOM   989  C  CD2   . TYR A 1 121 ? 54.862 -6.216  -5.083  1.00 9.03   ? 118 TYR A CD2   1 
ATOM   990  C  CE1   . TYR A 1 121 ? 56.187 -7.597  -3.073  1.00 10.44  ? 118 TYR A CE1   1 
ATOM   991  C  CE2   . TYR A 1 121 ? 54.194 -6.531  -3.911  1.00 11.67  ? 118 TYR A CE2   1 
ATOM   992  C  CZ    . TYR A 1 121 ? 54.865 -7.238  -2.914  1.00 10.84  ? 118 TYR A CZ    1 
ATOM   993  O  OH    . TYR A 1 121 ? 54.179 -7.570  -1.766  1.00 14.68  ? 118 TYR A OH    1 
ATOM   994  N  N     . VAL A 1 122 ? 59.705 -5.146  -7.623  1.00 10.51  ? 119 VAL A N     1 
ATOM   995  C  CA    . VAL A 1 122 ? 60.653 -5.037  -8.724  1.00 12.35  ? 119 VAL A CA    1 
ATOM   996  C  C     . VAL A 1 122 ? 61.175 -6.444  -9.018  1.00 13.87  ? 119 VAL A C     1 
ATOM   997  O  O     . VAL A 1 122 ? 61.579 -7.140  -8.089  1.00 11.35  ? 119 VAL A O     1 
ATOM   998  C  CB    . VAL A 1 122 ? 61.877 -4.208  -8.241  1.00 15.73  ? 119 VAL A CB    1 
ATOM   999  C  CG1   . VAL A 1 122 ? 62.613 -3.653  -9.401  1.00 25.89  ? 119 VAL A CG1   1 
ATOM   1000 C  CG2   . VAL A 1 122 ? 61.428 -3.102  -7.289  1.00 21.86  ? 119 VAL A CG2   1 
ATOM   1001 N  N     . ASP A 1 123 ? 61.196 -6.884  -10.279 1.00 13.87  ? 120 ASP A N     1 
ATOM   1002 C  CA    . ASP A 1 123 ? 61.915 -8.126  -10.611 1.00 12.55  ? 120 ASP A CA    1 
ATOM   1003 C  C     . ASP A 1 123 ? 63.281 -7.753  -11.148 1.00 15.62  ? 120 ASP A C     1 
ATOM   1004 O  O     . ASP A 1 123 ? 63.400 -7.190  -12.241 1.00 16.66  ? 120 ASP A O     1 
ATOM   1005 C  CB    . ASP A 1 123 ? 61.159 -9.020  -11.620 1.00 17.92  ? 120 ASP A CB    1 
ATOM   1006 C  CG    . ASP A 1 123 ? 61.839 -10.382 -11.832 1.00 19.53  ? 120 ASP A CG    1 
ATOM   1007 O  OD1   . ASP A 1 123 ? 63.065 -10.406 -12.000 1.00 18.53  ? 120 ASP A OD1   1 
ATOM   1008 O  OD2   . ASP A 1 123 ? 61.156 -11.443 -11.828 1.00 21.93  ? 120 ASP A OD2   1 
ATOM   1009 N  N     . LEU A 1 124 ? 64.307 -8.058  -10.363 1.00 12.16  ? 121 LEU A N     1 
ATOM   1010 C  CA    . LEU A 1 124 ? 65.674 -7.641  -10.630 1.00 10.99  ? 121 LEU A CA    1 
ATOM   1011 C  C     . LEU A 1 124 ? 66.549 -8.728  -11.256 1.00 11.01  ? 121 LEU A C     1 
ATOM   1012 O  O     . LEU A 1 124 ? 67.758 -8.536  -11.393 1.00 12.64  ? 121 LEU A O     1 
ATOM   1013 C  CB    . LEU A 1 124 ? 66.331 -7.152  -9.340  1.00 11.71  ? 121 LEU A CB    1 
ATOM   1014 C  CG    . LEU A 1 124 ? 65.719 -5.875  -8.777  1.00 12.53  ? 121 LEU A CG    1 
ATOM   1015 C  CD1   . LEU A 1 124 ? 66.336 -5.536  -7.460  1.00 17.02  ? 121 LEU A CD1   1 
ATOM   1016 C  CD2   . LEU A 1 124 ? 65.930 -4.759  -9.799  1.00 19.66  ? 121 LEU A CD2   1 
ATOM   1017 N  N     . THR A 1 125 ? 65.937 -9.859  -11.584 1.00 11.79  ? 122 THR A N     1 
ATOM   1018 C  CA    . THR A 1 125 ? 66.695 -11.005 -12.089 1.00 12.48  ? 122 THR A CA    1 
ATOM   1019 C  C     . THR A 1 125 ? 67.584 -10.621 -13.280 1.00 13.00  ? 122 THR A C     1 
ATOM   1020 O  O     . THR A 1 125 ? 68.778 -10.900 -13.251 1.00 15.15  ? 122 THR A O     1 
ATOM   1021 C  CB    . THR A 1 125 ? 65.775 -12.139 -12.490 1.00 14.17  ? 122 THR A CB    1 
ATOM   1022 O  OG1   . THR A 1 125 ? 64.840 -12.379 -11.436 1.00 12.45  ? 122 THR A OG1   1 
ATOM   1023 C  CG2   . THR A 1 125 ? 66.588 -13.404 -12.792 1.00 19.25  ? 122 THR A CG2   1 
ATOM   1024 N  N     . SER A 1 126 ? 67.023 -9.912  -14.261 1.00 15.93  ? 123 SER A N     1 
ATOM   1025 C  CA    . SER A 1 126 ? 67.797 -9.525  -15.450 1.00 17.57  ? 123 SER A CA    1 
ATOM   1026 C  C     . SER A 1 126 ? 68.856 -8.477  -15.155 1.00 18.21  ? 123 SER A C     1 
ATOM   1027 O  O     . SER A 1 126 ? 70.002 -8.580  -15.629 1.00 16.79  ? 123 SER A O     1 
ATOM   1028 C  CB    . SER A 1 126 ? 66.867 -9.035  -16.557 1.00 23.23  ? 123 SER A CB    1 
ATOM   1029 O  OG    A SER A 1 126 ? 66.101 -10.099 -17.069 0.56 23.37  ? 123 SER A OG    1 
ATOM   1030 O  OG    B SER A 1 126 ? 66.234 -7.818  -16.207 0.44 19.60  ? 123 SER A OG    1 
ATOM   1031 N  N     . ALA A 1 127 ? 68.481 -7.474  -14.368 1.00 13.80  ? 124 ALA A N     1 
ATOM   1032 C  CA    . ALA A 1 127 ? 69.439 -6.453  -13.977 1.00 16.82  ? 124 ALA A CA    1 
ATOM   1033 C  C     . ALA A 1 127 ? 70.620 -7.031  -13.210 1.00 18.31  ? 124 ALA A C     1 
ATOM   1034 O  O     . ALA A 1 127 ? 71.733 -6.540  -13.312 1.00 17.81  ? 124 ALA A O     1 
ATOM   1035 C  CB    . ALA A 1 127 ? 68.769 -5.348  -13.148 1.00 17.44  ? 124 ALA A CB    1 
ATOM   1036 N  N     . VAL A 1 128 ? 70.357 -8.057  -12.395 1.00 15.23  ? 125 VAL A N     1 
ATOM   1037 C  CA    . VAL A 1 128 ? 71.403 -8.680  -11.615 1.00 16.06  ? 125 VAL A CA    1 
ATOM   1038 C  C     . VAL A 1 128 ? 72.374 -9.419  -12.529 1.00 19.53  ? 125 VAL A C     1 
ATOM   1039 O  O     . VAL A 1 128 ? 73.586 -9.337  -12.343 1.00 19.16  ? 125 VAL A O     1 
ATOM   1040 C  CB    . VAL A 1 128 ? 70.802 -9.662  -10.602 1.00 16.44  ? 125 VAL A CB    1 
ATOM   1041 C  CG1   . VAL A 1 128 ? 71.841 -10.701 -10.172 1.00 14.99  ? 125 VAL A CG1   1 
ATOM   1042 C  CG2   . VAL A 1 128 ? 70.296 -8.897  -9.406  1.00 13.13  ? 125 VAL A CG2   1 
ATOM   1043 N  N     . GLN A 1 129 ? 71.804 -10.130 -13.493 1.00 16.29  ? 126 GLN A N     1 
ATOM   1044 C  CA    . GLN A 1 129 ? 72.600 -10.857 -14.484 1.00 26.46  ? 126 GLN A CA    1 
ATOM   1045 C  C     . GLN A 1 129 ? 73.507 -9.893  -15.232 1.00 26.33  ? 126 GLN A C     1 
ATOM   1046 O  O     . GLN A 1 129 ? 74.701 -10.155 -15.384 1.00 27.84  ? 126 GLN A O     1 
ATOM   1047 C  CB    . GLN A 1 129 ? 71.712 -11.637 -15.449 1.00 28.24  ? 126 GLN A CB    1 
ATOM   1048 C  CG    . GLN A 1 129 ? 71.104 -12.893 -14.828 1.00 30.45  ? 126 GLN A CG    1 
ATOM   1049 C  CD    . GLN A 1 129 ? 72.141 -13.759 -14.117 1.00 39.81  ? 126 GLN A CD    1 
ATOM   1050 O  OE1   . GLN A 1 129 ? 72.109 -13.916 -12.889 1.00 36.73  ? 126 GLN A OE1   1 
ATOM   1051 N  NE2   . GLN A 1 129 ? 73.070 -14.323 -14.887 1.00 49.49  ? 126 GLN A NE2   1 
ATOM   1052 N  N     . GLU A 1 130 ? 72.946 -8.766  -15.667 1.00 23.05  ? 127 GLU A N     1 
ATOM   1053 C  CA    . GLU A 1 130 ? 73.741 -7.744  -16.336 1.00 29.38  ? 127 GLU A CA    1 
ATOM   1054 C  C     . GLU A 1 130 ? 74.889 -7.258  -15.436 1.00 30.94  ? 127 GLU A C     1 
ATOM   1055 O  O     . GLU A 1 130 ? 76.043 -7.214  -15.856 1.00 28.17  ? 127 GLU A O     1 
ATOM   1056 C  CB    . GLU A 1 130 ? 72.854 -6.572  -16.777 1.00 32.51  ? 127 GLU A CB    1 
ATOM   1057 C  CG    . GLU A 1 130 ? 73.546 -5.564  -17.688 1.00 41.92  ? 127 GLU A CG    1 
ATOM   1058 C  CD    . GLU A 1 130 ? 72.673 -4.361  -18.010 1.00 52.54  ? 127 GLU A CD    1 
ATOM   1059 O  OE1   . GLU A 1 130 ? 71.449 -4.416  -17.750 1.00 58.58  ? 127 GLU A OE1   1 
ATOM   1060 O  OE2   . GLU A 1 130 ? 73.214 -3.358  -18.522 1.00 53.10  ? 127 GLU A OE2   1 
ATOM   1061 N  N     . ARG A 1 131 ? 74.577 -6.905  -14.193 1.00 23.26  ? 128 ARG A N     1 
ATOM   1062 C  CA    . ARG A 1 131 ? 75.587 -6.368  -13.291 1.00 22.94  ? 128 ARG A CA    1 
ATOM   1063 C  C     . ARG A 1 131 ? 76.689 -7.385  -12.958 1.00 25.76  ? 128 ARG A C     1 
ATOM   1064 O  O     . ARG A 1 131 ? 77.851 -7.010  -12.803 1.00 31.75  ? 128 ARG A O     1 
ATOM   1065 C  CB    . ARG A 1 131 ? 74.928 -5.831  -12.012 1.00 21.31  ? 128 ARG A CB    1 
ATOM   1066 C  CG    A ARG A 1 131 ? 75.855 -5.155  -11.031 0.44 26.10  ? 128 ARG A CG    1 
ATOM   1067 C  CG    B ARG A 1 131 ? 75.899 -5.209  -11.018 0.56 26.14  ? 128 ARG A CG    1 
ATOM   1068 C  CD    A ARG A 1 131 ? 76.402 -3.860  -11.594 0.44 23.78  ? 128 ARG A CD    1 
ATOM   1069 C  CD    B ARG A 1 131 ? 76.537 -3.946  -11.586 0.56 23.76  ? 128 ARG A CD    1 
ATOM   1070 N  NE    A ARG A 1 131 ? 76.884 -2.994  -10.529 0.44 24.62  ? 128 ARG A NE    1 
ATOM   1071 N  NE    B ARG A 1 131 ? 75.518 -2.940  -11.838 0.56 23.57  ? 128 ARG A NE    1 
ATOM   1072 C  CZ    A ARG A 1 131 ? 76.114 -2.138  -9.863  0.44 20.80  ? 128 ARG A CZ    1 
ATOM   1073 C  CZ    B ARG A 1 131 ? 75.060 -2.110  -10.908 0.56 22.45  ? 128 ARG A CZ    1 
ATOM   1074 N  NH1   A ARG A 1 131 ? 76.640 -1.390  -8.904  0.44 22.06  ? 128 ARG A NH1   1 
ATOM   1075 N  NH1   B ARG A 1 131 ? 74.113 -1.236  -11.212 0.56 24.84  ? 128 ARG A NH1   1 
ATOM   1076 N  NH2   A ARG A 1 131 ? 74.825 -2.024  -10.166 0.44 21.25  ? 128 ARG A NH2   1 
ATOM   1077 N  NH2   B ARG A 1 131 ? 75.557 -2.153  -9.675  0.56 18.94  ? 128 ARG A NH2   1 
ATOM   1078 N  N     . LEU A 1 132 ? 76.320 -8.661  -12.852 1.00 26.84  ? 129 LEU A N     1 
ATOM   1079 C  CA    . LEU A 1 132 ? 77.284 -9.731  -12.577 1.00 25.35  ? 129 LEU A CA    1 
ATOM   1080 C  C     . LEU A 1 132 ? 78.326 -9.864  -13.686 1.00 38.36  ? 129 LEU A C     1 
ATOM   1081 O  O     . LEU A 1 132 ? 79.506 -10.074 -13.414 1.00 39.85  ? 129 LEU A O     1 
ATOM   1082 C  CB    . LEU A 1 132 ? 76.565 -11.069 -12.366 1.00 28.29  ? 129 LEU A CB    1 
ATOM   1083 C  CG    . LEU A 1 132 ? 76.018 -11.252 -10.946 1.00 23.44  ? 129 LEU A CG    1 
ATOM   1084 C  CD1   . LEU A 1 132 ? 75.093 -12.453 -10.854 1.00 25.82  ? 129 LEU A CD1   1 
ATOM   1085 C  CD2   . LEU A 1 132 ? 77.176 -11.372 -9.955  1.00 23.78  ? 129 LEU A CD2   1 
ATOM   1086 N  N     . GLN A 1 133 ? 77.880 -9.750  -14.933 1.00 38.36  ? 130 GLN A N     1 
ATOM   1087 C  CA    . GLN A 1 133 ? 78.789 -9.765  -16.077 1.00 40.84  ? 130 GLN A CA    1 
ATOM   1088 C  C     . GLN A 1 133 ? 79.778 -8.609  -16.013 1.00 43.35  ? 130 GLN A C     1 
ATOM   1089 O  O     . GLN A 1 133 ? 80.965 -8.786  -16.265 1.00 53.14  ? 130 GLN A O     1 
ATOM   1090 C  CB    . GLN A 1 133 ? 78.002 -9.703  -17.384 1.00 41.41  ? 130 GLN A CB    1 
ATOM   1091 C  CG    . GLN A 1 133 ? 77.123 -10.921 -17.634 1.00 46.89  ? 130 GLN A CG    1 
ATOM   1092 C  CD    . GLN A 1 133 ? 77.931 -12.179 -17.895 1.00 61.11  ? 130 GLN A CD    1 
ATOM   1093 O  OE1   . GLN A 1 133 ? 79.076 -12.114 -18.351 1.00 62.29  ? 130 GLN A OE1   1 
ATOM   1094 N  NE2   . GLN A 1 133 ? 77.339 -13.333 -17.604 1.00 60.49  ? 130 GLN A NE2   1 
ATOM   1095 N  N     . LYS A 1 134 ? 79.283 -7.428  -15.663 1.00 42.17  ? 131 LYS A N     1 
ATOM   1096 C  CA    . LYS A 1 134 ? 80.119 -6.237  -15.551 1.00 46.53  ? 131 LYS A CA    1 
ATOM   1097 C  C     . LYS A 1 134 ? 81.116 -6.333  -14.400 1.00 51.59  ? 131 LYS A C     1 
ATOM   1098 O  O     . LYS A 1 134 ? 82.237 -5.834  -14.501 1.00 54.41  ? 131 LYS A O     1 
ATOM   1099 C  CB    . LYS A 1 134 ? 79.250 -4.987  -15.385 1.00 47.29  ? 131 LYS A CB    1 
ATOM   1100 C  CG    . LYS A 1 134 ? 80.028 -3.680  -15.326 1.00 52.21  ? 131 LYS A CG    1 
ATOM   1101 C  CD    . LYS A 1 134 ? 79.118 -2.484  -15.572 1.00 58.41  ? 131 LYS A CD    1 
ATOM   1102 C  CE    . LYS A 1 134 ? 78.196 -2.217  -14.389 1.00 50.38  ? 131 LYS A CE    1 
ATOM   1103 N  NZ    . LYS A 1 134 ? 78.722 -1.137  -13.507 1.00 45.06  ? 131 LYS A NZ    1 
ATOM   1104 N  N     . LEU A 1 135 ? 80.703 -6.969  -13.307 1.00 49.89  ? 132 LEU A N     1 
ATOM   1105 C  CA    . LEU A 1 135 ? 81.550 -7.100  -12.123 1.00 54.05  ? 132 LEU A CA    1 
ATOM   1106 C  C     . LEU A 1 135 ? 82.762 -7.997  -12.373 1.00 57.29  ? 132 LEU A C     1 
ATOM   1107 O  O     . LEU A 1 135 ? 83.833 -7.777  -11.802 1.00 59.06  ? 132 LEU A O     1 
ATOM   1108 C  CB    . LEU A 1 135 ? 80.746 -7.624  -10.927 1.00 53.53  ? 132 LEU A CB    1 
ATOM   1109 C  CG    . LEU A 1 135 ? 80.419 -6.621  -9.816  1.00 46.71  ? 132 LEU A CG    1 
ATOM   1110 C  CD1   . LEU A 1 135 ? 79.482 -5.543  -10.326 1.00 42.06  ? 132 LEU A CD1   1 
ATOM   1111 C  CD2   . LEU A 1 135 ? 79.819 -7.330  -8.614  1.00 43.60  ? 132 LEU A CD2   1 
ATOM   1112 N  N     . GLN A 1 136 ? 82.577 -9.010  -13.216 1.00 57.04  ? 133 GLN A N     1 
ATOM   1113 C  CA    . GLN A 1 136 ? 83.666 -9.900  -13.616 1.00 63.22  ? 133 GLN A CA    1 
ATOM   1114 C  C     . GLN A 1 136 ? 84.289 -10.651 -12.442 1.00 62.54  ? 133 GLN A C     1 
ATOM   1115 O  O     . GLN A 1 136 ? 85.500 -10.583 -12.227 1.00 65.07  ? 133 GLN A O     1 
ATOM   1116 C  CB    . GLN A 1 136 ? 84.748 -9.122  -14.375 1.00 60.72  ? 133 GLN A CB    1 
ATOM   1117 C  CG    . GLN A 1 136 ? 84.338 -8.682  -15.768 1.00 62.63  ? 133 GLN A CG    1 
ATOM   1118 C  CD    . GLN A 1 136 ? 84.311 -9.833  -16.757 1.00 72.18  ? 133 GLN A CD    1 
ATOM   1119 O  OE1   . GLN A 1 136 ? 85.353 -10.400 -17.095 1.00 77.00  ? 133 GLN A OE1   1 
ATOM   1120 N  NE2   . GLN A 1 136 ? 83.117 -10.189 -17.223 1.00 68.24  ? 133 GLN A NE2   1 
ATOM   1121 N  N     . GLY A 1 137 ? 83.457 -11.359 -11.685 1.00 56.41  ? 134 GLY A N     1 
ATOM   1122 C  CA    . GLY A 1 137 ? 83.927 -12.189 -10.589 1.00 53.59  ? 134 GLY A CA    1 
ATOM   1123 C  C     . GLY A 1 137 ? 84.681 -11.441 -9.505  1.00 56.72  ? 134 GLY A C     1 
ATOM   1124 O  O     . GLY A 1 137 ? 85.362 -12.057 -8.687  1.00 56.02  ? 134 GLY A O     1 
ATOM   1125 N  N     . GLN A 1 138 ? 84.568 -10.115 -9.497  1.00 53.78  ? 135 GLN A N     1 
ATOM   1126 C  CA    . GLN A 1 138 ? 85.219 -9.297  -8.477  1.00 54.11  ? 135 GLN A CA    1 
ATOM   1127 C  C     . GLN A 1 138 ? 84.316 -9.124  -7.255  1.00 51.16  ? 135 GLN A C     1 
ATOM   1128 O  O     . GLN A 1 138 ? 83.103 -8.965  -7.398  1.00 48.23  ? 135 GLN A O     1 
ATOM   1129 C  CB    . GLN A 1 138 ? 85.622 -7.939  -9.056  1.00 57.08  ? 135 GLN A CB    1 
ATOM   1130 C  CG    . GLN A 1 138 ? 86.737 -8.032  -10.091 1.00 65.68  ? 135 GLN A CG    1 
ATOM   1131 C  CD    . GLN A 1 138 ? 87.999 -8.687  -9.536  1.00 68.99  ? 135 GLN A CD    1 
ATOM   1132 O  OE1   . GLN A 1 138 ? 88.374 -8.463  -8.384  1.00 64.17  ? 135 GLN A OE1   1 
ATOM   1133 N  NE2   . GLN A 1 138 ? 88.655 -9.506  -10.357 1.00 69.74  ? 135 GLN A NE2   1 
ATOM   1134 N  N     . PRO A 1 139 ? 84.911 -9.163  -6.049  1.00 47.56  ? 136 PRO A N     1 
ATOM   1135 C  CA    . PRO A 1 139 ? 84.180 -9.165  -4.774  1.00 39.13  ? 136 PRO A CA    1 
ATOM   1136 C  C     . PRO A 1 139 ? 83.294 -7.940  -4.571  1.00 41.30  ? 136 PRO A C     1 
ATOM   1137 O  O     . PRO A 1 139 ? 83.542 -6.877  -5.135  1.00 35.17  ? 136 PRO A O     1 
ATOM   1138 C  CB    . PRO A 1 139 ? 85.299 -9.180  -3.727  1.00 46.04  ? 136 PRO A CB    1 
ATOM   1139 C  CG    . PRO A 1 139 ? 86.501 -8.664  -4.441  1.00 47.88  ? 136 PRO A CG    1 
ATOM   1140 C  CD    . PRO A 1 139 ? 86.368 -9.169  -5.839  1.00 48.94  ? 136 PRO A CD    1 
ATOM   1141 N  N     . ILE A 1 140 ? 82.256 -8.106  -3.762  1.00 34.03  ? 137 ILE A N     1 
ATOM   1142 C  CA    . ILE A 1 140 ? 81.358 -7.009  -3.440  1.00 27.52  ? 137 ILE A CA    1 
ATOM   1143 C  C     . ILE A 1 140 ? 81.759 -6.402  -2.108  1.00 25.41  ? 137 ILE A C     1 
ATOM   1144 O  O     . ILE A 1 140 ? 81.794 -7.081  -1.084  1.00 27.33  ? 137 ILE A O     1 
ATOM   1145 C  CB    . ILE A 1 140 ? 79.893 -7.487  -3.406  1.00 26.53  ? 137 ILE A CB    1 
ATOM   1146 C  CG1   . ILE A 1 140 ? 79.516 -8.049  -4.780  1.00 27.77  ? 137 ILE A CG1   1 
ATOM   1147 C  CG2   . ILE A 1 140 ? 78.963 -6.358  -2.980  1.00 23.82  ? 137 ILE A CG2   1 
ATOM   1148 C  CD1   . ILE A 1 140 ? 78.130 -8.662  -4.862  1.00 25.72  ? 137 ILE A CD1   1 
ATOM   1149 N  N     . SER A 1 141 ? 82.064 -5.110  -2.139  1.00 23.93  ? 138 SER A N     1 
ATOM   1150 C  CA    . SER A 1 141 ? 82.502 -4.381  -0.955  1.00 20.61  ? 138 SER A CA    1 
ATOM   1151 C  C     . SER A 1 141 ? 81.317 -4.065  -0.043  1.00 20.30  ? 138 SER A C     1 
ATOM   1152 O  O     . SER A 1 141 ? 80.222 -3.782  -0.537  1.00 23.02  ? 138 SER A O     1 
ATOM   1153 C  CB    . SER A 1 141 ? 83.183 -3.078  -1.393  1.00 22.16  ? 138 SER A CB    1 
ATOM   1154 O  OG    . SER A 1 141 ? 83.523 -2.273  -0.282  1.00 26.17  ? 138 SER A OG    1 
ATOM   1155 N  N     . ALA A 1 142 ? 81.527 -4.124  1.272   1.00 20.79  ? 139 ALA A N     1 
ATOM   1156 C  CA    . ALA A 1 142 ? 80.507 -3.701  2.226   1.00 21.72  ? 139 ALA A CA    1 
ATOM   1157 C  C     . ALA A 1 142 ? 80.090 -2.245  1.975   1.00 24.19  ? 139 ALA A C     1 
ATOM   1158 O  O     . ALA A 1 142 ? 78.982 -1.836  2.326   1.00 21.22  ? 139 ALA A O     1 
ATOM   1159 C  CB    . ALA A 1 142 ? 80.990 -3.870  3.658   1.00 24.40  ? 139 ALA A CB    1 
ATOM   1160 N  N     . ASP A 1 143 ? 80.986 -1.471  1.368   1.00 21.30  ? 140 ASP A N     1 
ATOM   1161 C  CA    . ASP A 1 143 ? 80.720 -0.059  1.097   1.00 24.33  ? 140 ASP A CA    1 
ATOM   1162 C  C     . ASP A 1 143 ? 79.584 0.123   0.108   1.00 23.17  ? 140 ASP A C     1 
ATOM   1163 O  O     . ASP A 1 143 ? 78.954 1.187   0.054   1.00 22.86  ? 140 ASP A O     1 
ATOM   1164 C  CB    . ASP A 1 143 ? 81.970 0.633   0.558   1.00 27.39  ? 140 ASP A CB    1 
ATOM   1165 C  CG    . ASP A 1 143 ? 83.042 0.806   1.612   1.00 38.00  ? 140 ASP A CG    1 
ATOM   1166 O  OD1   . ASP A 1 143 ? 82.749 0.609   2.817   1.00 32.80  ? 140 ASP A OD1   1 
ATOM   1167 O  OD2   . ASP A 1 143 ? 84.181 1.159   1.227   1.00 39.61  ? 140 ASP A OD2   1 
ATOM   1168 N  N     . LEU A 1 144 ? 79.339 -0.907  -0.689  1.00 17.99  ? 141 LEU A N     1 
ATOM   1169 C  CA    . LEU A 1 144 ? 78.233 -0.881  -1.644  1.00 18.11  ? 141 LEU A CA    1 
ATOM   1170 C  C     . LEU A 1 144 ? 76.876 -1.193  -0.988  1.00 16.14  ? 141 LEU A C     1 
ATOM   1171 O  O     . LEU A 1 144 ? 75.833 -1.055  -1.631  1.00 14.63  ? 141 LEU A O     1 
ATOM   1172 C  CB    . LEU A 1 144 ? 78.501 -1.857  -2.775  1.00 20.47  ? 141 LEU A CB    1 
ATOM   1173 C  CG    . LEU A 1 144 ? 79.744 -1.548  -3.615  1.00 22.04  ? 141 LEU A CG    1 
ATOM   1174 C  CD1   . LEU A 1 144 ? 79.839 -2.549  -4.740  1.00 23.76  ? 141 LEU A CD1   1 
ATOM   1175 C  CD2   . LEU A 1 144 ? 79.639 -0.145  -4.156  1.00 23.40  ? 141 LEU A CD2   1 
ATOM   1176 N  N     . LEU A 1 145 ? 76.901 -1.594  0.282   1.00 14.32  ? 142 LEU A N     1 
ATOM   1177 C  CA    . LEU A 1 145 ? 75.681 -1.990  1.020   1.00 12.88  ? 142 LEU A CA    1 
ATOM   1178 C  C     . LEU A 1 145 ? 75.536 -1.269  2.370   1.00 13.22  ? 142 LEU A C     1 
ATOM   1179 O  O     . LEU A 1 145 ? 75.385 -1.895  3.412   1.00 14.24  ? 142 LEU A O     1 
ATOM   1180 C  CB    . LEU A 1 145 ? 75.711 -3.524  1.202   1.00 13.67  ? 142 LEU A CB    1 
ATOM   1181 C  CG    . LEU A 1 145 ? 75.655 -4.363  -0.073  1.00 13.17  ? 142 LEU A CG    1 
ATOM   1182 C  CD1   . LEU A 1 145 ? 76.095 -5.816  0.209   1.00 14.97  ? 142 LEU A CD1   1 
ATOM   1183 C  CD2   . LEU A 1 145 ? 74.250 -4.370  -0.719  1.00 14.59  ? 142 LEU A CD2   1 
ATOM   1184 N  N     . PRO A 1 146 ? 75.544 0.080   2.352   1.00 12.88  ? 143 PRO A N     1 
ATOM   1185 C  CA    . PRO A 1 146 ? 75.638 0.862   3.584   1.00 13.72  ? 143 PRO A CA    1 
ATOM   1186 C  C     . PRO A 1 146 ? 74.386 0.895   4.445   1.00 12.06  ? 143 PRO A C     1 
ATOM   1187 O  O     . PRO A 1 146 ? 74.448 1.348   5.585   1.00 15.14  ? 143 PRO A O     1 
ATOM   1188 C  CB    . PRO A 1 146 ? 75.936 2.276   3.061   1.00 15.32  ? 143 PRO A CB    1 
ATOM   1189 C  CG    . PRO A 1 146 ? 75.314 2.309   1.697   1.00 14.92  ? 143 PRO A CG    1 
ATOM   1190 C  CD    . PRO A 1 146 ? 75.535 0.928   1.143   1.00 13.40  ? 143 PRO A CD    1 
ATOM   1191 N  N     . SER A 1 147 ? 73.267 0.371   3.934   1.00 13.00  ? 144 SER A N     1 
ATOM   1192 C  CA    . SER A 1 147 ? 72.045 0.388   4.719   1.00 13.00  ? 144 SER A CA    1 
ATOM   1193 C  C     . SER A 1 147 ? 71.361 -0.979  4.720   1.00 11.55  ? 144 SER A C     1 
ATOM   1194 O  O     . SER A 1 147 ? 70.177 -1.084  5.032   1.00 10.23  ? 144 SER A O     1 
ATOM   1195 C  CB    . SER A 1 147 ? 71.082 1.483   4.220   1.00 12.88  ? 144 SER A CB    1 
ATOM   1196 O  OG    . SER A 1 147 ? 70.595 1.216   2.914   1.00 14.10  ? 144 SER A OG    1 
ATOM   1197 N  N     . THR A 1 148 ? 72.147 -2.022  4.463   1.00 10.19  ? 145 THR A N     1 
ATOM   1198 C  CA    . THR A 1 148 ? 71.636 -3.392  4.268   1.00 9.45   ? 145 THR A CA    1 
ATOM   1199 C  C     . THR A 1 148 ? 71.844 -4.245  5.514   1.00 8.82   ? 145 THR A C     1 
ATOM   1200 O  O     . THR A 1 148 ? 72.932 -4.289  6.096   1.00 12.00  ? 145 THR A O     1 
ATOM   1201 C  CB    . THR A 1 148 ? 72.335 -4.063  3.068   1.00 7.92   ? 145 THR A CB    1 
ATOM   1202 O  OG1   . THR A 1 148 ? 71.915 -3.415  1.845   1.00 9.68   ? 145 THR A OG1   1 
ATOM   1203 C  CG2   . THR A 1 148 ? 71.941 -5.549  2.986   1.00 9.37   ? 145 THR A CG2   1 
ATOM   1204 N  N     . TYR A 1 149 ? 70.771 -4.911  5.921   1.00 7.72   ? 146 TYR A N     1 
ATOM   1205 C  CA    . TYR A 1 149 ? 70.805 -5.975  6.945   1.00 8.90   ? 146 TYR A CA    1 
ATOM   1206 C  C     . TYR A 1 149 ? 70.704 -7.317  6.278   1.00 12.20  ? 146 TYR A C     1 
ATOM   1207 O  O     . TYR A 1 149 ? 69.948 -7.500  5.320   1.00 11.25  ? 146 TYR A O     1 
ATOM   1208 C  CB    . TYR A 1 149 ? 69.605 -5.862  7.885   1.00 10.11  ? 146 TYR A CB    1 
ATOM   1209 C  CG    . TYR A 1 149 ? 69.786 -4.805  8.940   1.00 11.30  ? 146 TYR A CG    1 
ATOM   1210 C  CD1   . TYR A 1 149 ? 69.552 -3.461  8.655   1.00 11.93  ? 146 TYR A CD1   1 
ATOM   1211 C  CD2   . TYR A 1 149 ? 70.206 -5.150  10.215  1.00 13.76  ? 146 TYR A CD2   1 
ATOM   1212 C  CE1   . TYR A 1 149 ? 69.737 -2.478  9.637   1.00 13.87  ? 146 TYR A CE1   1 
ATOM   1213 C  CE2   . TYR A 1 149 ? 70.406 -4.188  11.180  1.00 15.72  ? 146 TYR A CE2   1 
ATOM   1214 C  CZ    . TYR A 1 149 ? 70.176 -2.867  10.891  1.00 16.74  ? 146 TYR A CZ    1 
ATOM   1215 O  OH    . TYR A 1 149 ? 70.371 -1.909  11.877  1.00 23.12  ? 146 TYR A OH    1 
ATOM   1216 N  N     . ILE A 1 150 ? 71.453 -8.285  6.803   1.00 8.32   ? 147 ILE A N     1 
ATOM   1217 C  CA    . ILE A 1 150 ? 71.321 -9.646  6.325   1.00 11.05  ? 147 ILE A CA    1 
ATOM   1218 C  C     . ILE A 1 150 ? 70.565 -10.424 7.384   1.00 10.77  ? 147 ILE A C     1 
ATOM   1219 O  O     . ILE A 1 150 ? 71.063 -10.633 8.482   1.00 11.67  ? 147 ILE A O     1 
ATOM   1220 C  CB    . ILE A 1 150 ? 72.685 -10.314 6.117   1.00 8.17   ? 147 ILE A CB    1 
ATOM   1221 C  CG1   . ILE A 1 150 ? 73.608 -9.465  5.231   1.00 9.47   ? 147 ILE A CG1   1 
ATOM   1222 C  CG2   . ILE A 1 150 ? 72.465 -11.723 5.520   1.00 10.88  ? 147 ILE A CG2   1 
ATOM   1223 C  CD1   . ILE A 1 150 ? 73.083 -9.204  3.832   1.00 12.45  ? 147 ILE A CD1   1 
ATOM   1224 N  N     . GLU A 1 151 ? 69.324 -10.798 7.087   1.00 9.32   ? 148 GLU A N     1 
ATOM   1225 C  CA    . GLU A 1 151 ? 68.504 -11.440 8.101   1.00 8.57   ? 148 GLU A CA    1 
ATOM   1226 C  C     . GLU A 1 151 ? 69.117 -12.769 8.568   1.00 10.95  ? 148 GLU A C     1 
ATOM   1227 O  O     . GLU A 1 151 ? 69.520 -13.597 7.749   1.00 10.66  ? 148 GLU A O     1 
ATOM   1228 C  CB    . GLU A 1 151 ? 67.077 -11.671 7.584   1.00 9.76   ? 148 GLU A CB    1 
ATOM   1229 C  CG    . GLU A 1 151 ? 66.181 -12.470 8.572   1.00 13.27  ? 148 GLU A CG    1 
ATOM   1230 C  CD    . GLU A 1 151 ? 65.978 -11.811 9.934   1.00 16.91  ? 148 GLU A CD    1 
ATOM   1231 O  OE1   . GLU A 1 151 ? 65.705 -12.545 10.911  1.00 17.52  ? 148 GLU A OE1   1 
ATOM   1232 O  OE2   . GLU A 1 151 ? 66.042 -10.568 10.042  1.00 17.73  ? 148 GLU A OE2   1 
ATOM   1233 N  N     . GLY A 1 152 ? 69.187 -12.923 9.895   1.00 12.02  ? 149 GLY A N     1 
ATOM   1234 C  CA    . GLY A 1 152 ? 69.795 -14.099 10.512  1.00 13.12  ? 149 GLY A CA    1 
ATOM   1235 C  C     . GLY A 1 152 ? 71.230 -13.927 10.978  1.00 17.60  ? 149 GLY A C     1 
ATOM   1236 O  O     . GLY A 1 152 ? 71.741 -14.776 11.726  1.00 17.14  ? 149 GLY A O     1 
ATOM   1237 N  N     . LEU A 1 153 ? 71.884 -12.858 10.536  1.00 11.19  ? 150 LEU A N     1 
ATOM   1238 C  CA    . LEU A 1 153 ? 73.290 -12.644 10.861  1.00 15.14  ? 150 LEU A CA    1 
ATOM   1239 C  C     . LEU A 1 153 ? 73.415 -11.346 11.647  1.00 17.54  ? 150 LEU A C     1 
ATOM   1240 O  O     . LEU A 1 153 ? 72.596 -10.443 11.486  1.00 15.49  ? 150 LEU A O     1 
ATOM   1241 C  CB    . LEU A 1 153 ? 74.139 -12.604 9.585   1.00 11.94  ? 150 LEU A CB    1 
ATOM   1242 C  CG    . LEU A 1 153 ? 74.186 -13.879 8.737   1.00 14.15  ? 150 LEU A CG    1 
ATOM   1243 C  CD1   . LEU A 1 153 ? 75.029 -13.682 7.478   1.00 15.45  ? 150 LEU A CD1   1 
ATOM   1244 C  CD2   . LEU A 1 153 ? 74.696 -15.070 9.579   1.00 19.59  ? 150 LEU A CD2   1 
ATOM   1245 N  N     . PRO A 1 154 ? 74.432 -11.238 12.521  1.00 14.38  ? 151 PRO A N     1 
ATOM   1246 C  CA    . PRO A 1 154 ? 75.496 -12.228 12.767  1.00 16.26  ? 151 PRO A CA    1 
ATOM   1247 C  C     . PRO A 1 154 ? 75.028 -13.415 13.591  1.00 18.08  ? 151 PRO A C     1 
ATOM   1248 O  O     . PRO A 1 154 ? 74.071 -13.301 14.351  1.00 17.80  ? 151 PRO A O     1 
ATOM   1249 C  CB    . PRO A 1 154 ? 76.519 -11.428 13.582  1.00 15.47  ? 151 PRO A CB    1 
ATOM   1250 C  CG    . PRO A 1 154 ? 75.716 -10.381 14.291  1.00 19.56  ? 151 PRO A CG    1 
ATOM   1251 C  CD    . PRO A 1 154 ? 74.629 -10.001 13.292  1.00 18.11  ? 151 PRO A CD    1 
ATOM   1252 N  N     . GLN A 1 155 ? 75.722 -14.543 13.444  1.00 21.55  ? 152 GLN A N     1 
ATOM   1253 C  CA    . GLN A 1 155 ? 75.431 -15.768 14.180  1.00 22.77  ? 152 GLN A CA    1 
ATOM   1254 C  C     . GLN A 1 155 ? 76.752 -16.475 14.445  1.00 27.98  ? 152 GLN A C     1 
ATOM   1255 O  O     . GLN A 1 155 ? 77.727 -16.268 13.720  1.00 27.99  ? 152 GLN A O     1 
ATOM   1256 C  CB    . GLN A 1 155 ? 74.540 -16.715 13.362  1.00 26.44  ? 152 GLN A CB    1 
ATOM   1257 C  CG    . GLN A 1 155 ? 73.068 -16.713 13.736  1.00 37.04  ? 152 GLN A CG    1 
ATOM   1258 C  CD    . GLN A 1 155 ? 72.252 -17.800 13.020  1.00 38.37  ? 152 GLN A CD    1 
ATOM   1259 O  OE1   . GLN A 1 155 ? 72.181 -18.951 13.483  1.00 30.99  ? 152 GLN A OE1   1 
ATOM   1260 N  NE2   . GLN A 1 155 ? 71.605 -17.429 11.900  1.00 26.60  ? 152 GLN A NE2   1 
ATOM   1261 N  N     . GLY A 1 156 ? 76.780 -17.310 15.480  1.00 33.13  ? 153 GLY A N     1 
ATOM   1262 C  CA    . GLY A 1 156 ? 77.916 -18.185 15.714  1.00 38.41  ? 153 GLY A CA    1 
ATOM   1263 C  C     . GLY A 1 156 ? 78.823 -17.729 16.838  1.00 40.58  ? 153 GLY A C     1 
ATOM   1264 O  O     . GLY A 1 156 ? 78.531 -16.752 17.526  1.00 41.99  ? 153 GLY A O     1 
ATOM   1265 N  N     . PRO A 1 157 ? 79.936 -18.454 17.039  1.00 42.47  ? 154 PRO A N     1 
ATOM   1266 C  CA    . PRO A 1 157 ? 80.933 -18.173 18.081  1.00 43.67  ? 154 PRO A CA    1 
ATOM   1267 C  C     . PRO A 1 157 ? 81.675 -16.847 17.884  1.00 39.25  ? 154 PRO A C     1 
ATOM   1268 O  O     . PRO A 1 157 ? 82.267 -16.621 16.828  1.00 43.96  ? 154 PRO A O     1 
ATOM   1269 C  CB    . PRO A 1 157 ? 81.905 -19.355 17.965  1.00 27.47  ? 154 PRO A CB    1 
ATOM   1270 C  CG    . PRO A 1 157 ? 81.667 -19.935 16.605  1.00 29.45  ? 154 PRO A CG    1 
ATOM   1271 C  CD    . PRO A 1 157 ? 80.217 -19.710 16.324  1.00 40.81  ? 154 PRO A CD    1 
ATOM   1272 N  N     . THR A 1 163 ? 80.038 -6.312  20.416  1.00 58.38  ? 160 THR A N     1 
ATOM   1273 C  CA    . THR A 1 163 ? 79.370 -5.043  20.140  1.00 58.33  ? 160 THR A CA    1 
ATOM   1274 C  C     . THR A 1 163 ? 77.922 -5.049  20.623  1.00 52.04  ? 160 THR A C     1 
ATOM   1275 O  O     . THR A 1 163 ? 77.233 -6.068  20.543  1.00 52.85  ? 160 THR A O     1 
ATOM   1276 C  CB    . THR A 1 163 ? 79.397 -4.694  18.638  1.00 50.43  ? 160 THR A CB    1 
ATOM   1277 O  OG1   . THR A 1 163 ? 78.665 -3.481  18.419  1.00 49.52  ? 160 THR A OG1   1 
ATOM   1278 C  CG2   . THR A 1 163 ? 78.771 -5.810  17.819  1.00 50.29  ? 160 THR A CG2   1 
ATOM   1279 N  N     . VAL A 1 164 ? 77.467 -3.903  21.119  1.00 46.56  ? 161 VAL A N     1 
ATOM   1280 C  CA    . VAL A 1 164 ? 76.134 -3.796  21.702  1.00 45.11  ? 161 VAL A CA    1 
ATOM   1281 C  C     . VAL A 1 164 ? 75.317 -2.671  21.055  1.00 45.73  ? 161 VAL A C     1 
ATOM   1282 O  O     . VAL A 1 164 ? 74.263 -2.284  21.563  1.00 46.13  ? 161 VAL A O     1 
ATOM   1283 C  CB    . VAL A 1 164 ? 76.215 -3.561  23.228  1.00 46.06  ? 161 VAL A CB    1 
ATOM   1284 C  CG1   . VAL A 1 164 ? 77.072 -4.635  23.887  1.00 39.57  ? 161 VAL A CG1   1 
ATOM   1285 C  CG2   . VAL A 1 164 ? 76.777 -2.175  23.527  1.00 46.16  ? 161 VAL A CG2   1 
ATOM   1286 N  N     . GLN A 1 165 ? 75.806 -2.158  19.929  1.00 42.29  ? 162 GLN A N     1 
ATOM   1287 C  CA    . GLN A 1 165 ? 75.133 -1.075  19.209  1.00 42.00  ? 162 GLN A CA    1 
ATOM   1288 C  C     . GLN A 1 165 ? 74.476 -1.593  17.927  1.00 36.88  ? 162 GLN A C     1 
ATOM   1289 O  O     . GLN A 1 165 ? 74.916 -2.589  17.351  1.00 33.65  ? 162 GLN A O     1 
ATOM   1290 C  CB    . GLN A 1 165 ? 76.137 0.023   18.862  1.00 49.48  ? 162 GLN A CB    1 
ATOM   1291 C  CG    . GLN A 1 165 ? 77.296 -0.478  18.009  1.00 53.92  ? 162 GLN A CG    1 
ATOM   1292 C  CD    . GLN A 1 165 ? 78.385 0.555   17.826  1.00 64.26  ? 162 GLN A CD    1 
ATOM   1293 O  OE1   . GLN A 1 165 ? 78.563 1.440   18.663  1.00 75.80  ? 162 GLN A OE1   1 
ATOM   1294 N  NE2   . GLN A 1 165 ? 79.124 0.448   16.726  1.00 61.86  ? 162 GLN A NE2   1 
ATOM   1295 N  N     . LYS A 1 166 ? 73.438 -0.898  17.477  1.00 39.50  ? 163 LYS A N     1 
ATOM   1296 C  CA    . LYS A 1 166 ? 72.645 -1.350  16.339  1.00 35.12  ? 163 LYS A CA    1 
ATOM   1297 C  C     . LYS A 1 166 ? 73.446 -1.423  15.044  1.00 25.84  ? 163 LYS A C     1 
ATOM   1298 O  O     . LYS A 1 166 ? 73.435 -2.442  14.353  1.00 21.65  ? 163 LYS A O     1 
ATOM   1299 C  CB    . LYS A 1 166 ? 71.422 -0.445  16.158  1.00 38.67  ? 163 LYS A CB    1 
ATOM   1300 C  CG    . LYS A 1 166 ? 70.571 -0.789  14.963  1.00 41.07  ? 163 LYS A CG    1 
ATOM   1301 C  CD    . LYS A 1 166 ? 70.043 -2.219  15.046  1.00 35.78  ? 163 LYS A CD    1 
ATOM   1302 C  CE    . LYS A 1 166 ? 68.582 -2.238  14.657  1.00 30.31  ? 163 LYS A CE    1 
ATOM   1303 N  NZ    . LYS A 1 166 ? 68.031 -3.619  14.460  1.00 33.79  ? 163 LYS A NZ    1 
ATOM   1304 N  N     . GLU A 1 167 ? 74.148 -0.347  14.709  1.00 28.23  ? 164 GLU A N     1 
ATOM   1305 C  CA    . GLU A 1 167 ? 74.904 -0.315  13.463  1.00 24.78  ? 164 GLU A CA    1 
ATOM   1306 C  C     . GLU A 1 167 ? 76.074 -1.304  13.500  1.00 26.30  ? 164 GLU A C     1 
ATOM   1307 O  O     . GLU A 1 167 ? 76.478 -1.842  12.475  1.00 22.12  ? 164 GLU A O     1 
ATOM   1308 C  CB    . GLU A 1 167 ? 75.380 1.115   13.152  1.00 28.14  ? 164 GLU A CB    1 
ATOM   1309 C  CG    . GLU A 1 167 ? 76.347 1.244   11.980  1.00 26.13  ? 164 GLU A CG    1 
ATOM   1310 C  CD    . GLU A 1 167 ? 75.721 0.935   10.620  1.00 28.56  ? 164 GLU A CD    1 
ATOM   1311 O  OE1   . GLU A 1 167 ? 76.491 0.805   9.639   1.00 29.71  ? 164 GLU A OE1   1 
ATOM   1312 O  OE2   . GLU A 1 167 ? 74.474 0.838   10.521  1.00 29.19  ? 164 GLU A OE2   1 
ATOM   1313 N  N     . GLY A 1 168 ? 76.613 -1.545  14.689  1.00 31.52  ? 165 GLY A N     1 
ATOM   1314 C  CA    . GLY A 1 168 ? 77.688 -2.504  14.842  1.00 29.84  ? 165 GLY A CA    1 
ATOM   1315 C  C     . GLY A 1 168 ? 77.231 -3.906  14.493  1.00 22.34  ? 165 GLY A C     1 
ATOM   1316 O  O     . GLY A 1 168 ? 77.929 -4.638  13.792  1.00 25.42  ? 165 GLY A O     1 
ATOM   1317 N  N     . MET A 1 169 ? 76.060 -4.282  14.999  1.00 23.07  ? 166 MET A N     1 
ATOM   1318 C  CA    . MET A 1 169 ? 75.472 -5.574  14.674  1.00 21.66  ? 166 MET A CA    1 
ATOM   1319 C  C     . MET A 1 169 ? 75.232 -5.665  13.172  1.00 18.57  ? 166 MET A C     1 
ATOM   1320 O  O     . MET A 1 169 ? 75.527 -6.690  12.545  1.00 17.61  ? 166 MET A O     1 
ATOM   1321 C  CB    . MET A 1 169 ? 74.156 -5.778  15.421  1.00 25.49  ? 166 MET A CB    1 
ATOM   1322 C  CG    . MET A 1 169 ? 74.296 -5.715  16.936  1.00 38.91  ? 166 MET A CG    1 
ATOM   1323 S  SD    . MET A 1 169 ? 74.983 -7.247  17.575  1.00 56.28  ? 166 MET A SD    1 
ATOM   1324 C  CE    . MET A 1 169 ? 73.827 -8.405  16.848  1.00 26.90  ? 166 MET A CE    1 
ATOM   1325 N  N     . ARG A 1 170 ? 74.714 -4.588  12.582  1.00 18.06  ? 167 ARG A N     1 
ATOM   1326 C  CA    . ARG A 1 170 ? 74.428 -4.628  11.152  1.00 16.65  ? 167 ARG A CA    1 
ATOM   1327 C  C     . ARG A 1 170 ? 75.684 -4.922  10.359  1.00 16.71  ? 167 ARG A C     1 
ATOM   1328 O  O     . ARG A 1 170 ? 75.673 -5.775  9.462   1.00 15.51  ? 167 ARG A O     1 
ATOM   1329 C  CB    . ARG A 1 170 ? 73.796 -3.319  10.651  1.00 15.32  ? 167 ARG A CB    1 
ATOM   1330 C  CG    . ARG A 1 170 ? 73.439 -3.372  9.168   1.00 14.61  ? 167 ARG A CG    1 
ATOM   1331 C  CD    . ARG A 1 170 ? 73.222 -1.980  8.586   1.00 14.34  ? 167 ARG A CD    1 
ATOM   1332 N  NE    . ARG A 1 170 ? 74.477 -1.238  8.355   1.00 16.30  ? 167 ARG A NE    1 
ATOM   1333 C  CZ    . ARG A 1 170 ? 75.275 -1.389  7.297   1.00 13.93  ? 167 ARG A CZ    1 
ATOM   1334 N  NH1   . ARG A 1 170 ? 75.006 -2.262  6.343   1.00 11.94  ? 167 ARG A NH1   1 
ATOM   1335 N  NH2   . ARG A 1 170 ? 76.384 -0.658  7.195   1.00 18.98  ? 167 ARG A NH2   1 
ATOM   1336 N  N     . LYS A 1 171 ? 76.764 -4.197  10.665  1.00 16.59  ? 168 LYS A N     1 
ATOM   1337 C  CA    . LYS A 1 171 ? 78.027 -4.429  9.972   1.00 19.33  ? 168 LYS A CA    1 
ATOM   1338 C  C     . LYS A 1 171 ? 78.584 -5.832  10.213  1.00 17.52  ? 168 LYS A C     1 
ATOM   1339 O  O     . LYS A 1 171 ? 79.131 -6.449  9.285   1.00 16.93  ? 168 LYS A O     1 
ATOM   1340 C  CB    . LYS A 1 171 ? 79.081 -3.392  10.375  1.00 27.33  ? 168 LYS A CB    1 
ATOM   1341 C  CG    . LYS A 1 171 ? 78.946 -2.047  9.679   1.00 35.01  ? 168 LYS A CG    1 
ATOM   1342 C  CD    . LYS A 1 171 ? 80.210 -1.206  9.889   1.00 35.50  ? 168 LYS A CD    1 
ATOM   1343 C  CE    . LYS A 1 171 ? 80.192 0.079   9.065   1.00 42.96  ? 168 LYS A CE    1 
ATOM   1344 N  NZ    . LYS A 1 171 ? 79.213 1.082   9.586   1.00 45.61  ? 168 LYS A NZ    1 
ATOM   1345 N  N     . GLN A 1 172 ? 78.457 -6.323  11.443  1.00 21.55  ? 169 GLN A N     1 
ATOM   1346 C  CA    . GLN A 1 172 ? 78.986 -7.639  11.785  1.00 19.53  ? 169 GLN A CA    1 
ATOM   1347 C  C     . GLN A 1 172 ? 78.301 -8.693  10.928  1.00 16.62  ? 169 GLN A C     1 
ATOM   1348 O  O     . GLN A 1 172 ? 78.954 -9.560  10.349  1.00 18.55  ? 169 GLN A O     1 
ATOM   1349 C  CB    . GLN A 1 172 ? 78.788 -7.946  13.270  1.00 18.79  ? 169 GLN A CB    1 
ATOM   1350 C  CG    . GLN A 1 172 ? 79.896 -8.759  13.877  1.00 38.12  ? 169 GLN A CG    1 
ATOM   1351 C  CD    . GLN A 1 172 ? 79.508 -9.348  15.218  1.00 38.84  ? 169 GLN A CD    1 
ATOM   1352 O  OE1   . GLN A 1 172 ? 78.668 -8.794  15.937  1.00 44.68  ? 169 GLN A OE1   1 
ATOM   1353 N  NE2   . GLN A 1 172 ? 80.106 -10.489 15.556  1.00 38.54  ? 169 GLN A NE2   1 
ATOM   1354 N  N     . GLY A 1 173 ? 76.974 -8.602  10.835  1.00 17.28  ? 170 GLY A N     1 
ATOM   1355 C  CA    . GLY A 1 173 ? 76.203 -9.527  10.020  1.00 13.61  ? 170 GLY A CA    1 
ATOM   1356 C  C     . GLY A 1 173 ? 76.556 -9.434  8.552   1.00 13.88  ? 170 GLY A C     1 
ATOM   1357 O  O     . GLY A 1 173 ? 76.701 -10.446 7.862   1.00 13.46  ? 170 GLY A O     1 
ATOM   1358 N  N     . LEU A 1 174 ? 76.701 -8.206  8.050   1.00 11.49  ? 171 LEU A N     1 
ATOM   1359 C  CA    . LEU A 1 174 ? 77.057 -8.006  6.660   1.00 13.48  ? 171 LEU A CA    1 
ATOM   1360 C  C     . LEU A 1 174 ? 78.454 -8.564  6.338   1.00 14.38  ? 171 LEU A C     1 
ATOM   1361 O  O     . LEU A 1 174 ? 78.671 -9.153  5.286   1.00 13.92  ? 171 LEU A O     1 
ATOM   1362 C  CB    . LEU A 1 174 ? 76.929 -6.521  6.287   1.00 12.87  ? 171 LEU A CB    1 
ATOM   1363 C  CG    . LEU A 1 174 ? 77.319 -6.146  4.863   1.00 12.77  ? 171 LEU A CG    1 
ATOM   1364 C  CD1   . LEU A 1 174 ? 76.379 -6.840  3.840   1.00 13.01  ? 171 LEU A CD1   1 
ATOM   1365 C  CD2   . LEU A 1 174 ? 77.322 -4.621  4.682   1.00 17.03  ? 171 LEU A CD2   1 
ATOM   1366 N  N     . PHE A 1 175 ? 79.386 -8.376  7.266   1.00 16.16  ? 172 PHE A N     1 
ATOM   1367 C  CA    . PHE A 1 175 ? 80.727 -8.939  7.097   1.00 19.38  ? 172 PHE A CA    1 
ATOM   1368 C  C     . PHE A 1 175 ? 80.706 -10.472 7.003   1.00 16.82  ? 172 PHE A C     1 
ATOM   1369 O  O     . PHE A 1 175 ? 81.308 -11.043 6.095   1.00 19.56  ? 172 PHE A O     1 
ATOM   1370 C  CB    . PHE A 1 175 ? 81.640 -8.482  8.223   1.00 16.07  ? 172 PHE A CB    1 
ATOM   1371 C  CG    . PHE A 1 175 ? 82.089 -7.051  8.101   1.00 29.00  ? 172 PHE A CG    1 
ATOM   1372 C  CD1   . PHE A 1 175 ? 82.331 -6.489  6.854   1.00 33.42  ? 172 PHE A CD1   1 
ATOM   1373 C  CD2   . PHE A 1 175 ? 82.273 -6.270  9.233   1.00 35.50  ? 172 PHE A CD2   1 
ATOM   1374 C  CE1   . PHE A 1 175 ? 82.752 -5.168  6.739   1.00 36.10  ? 172 PHE A CE1   1 
ATOM   1375 C  CE2   . PHE A 1 175 ? 82.698 -4.947  9.126   1.00 41.68  ? 172 PHE A CE2   1 
ATOM   1376 C  CZ    . PHE A 1 175 ? 82.935 -4.398  7.877   1.00 34.48  ? 172 PHE A CZ    1 
ATOM   1377 N  N     . GLN A 1 176 ? 79.992 -11.129 7.922   1.00 17.25  ? 173 GLN A N     1 
ATOM   1378 C  CA    . GLN A 1 176 ? 79.868 -12.590 7.888   1.00 14.56  ? 173 GLN A CA    1 
ATOM   1379 C  C     . GLN A 1 176 ? 79.313 -13.059 6.546   1.00 17.37  ? 173 GLN A C     1 
ATOM   1380 O  O     . GLN A 1 176 ? 79.812 -14.003 5.940   1.00 18.44  ? 173 GLN A O     1 
ATOM   1381 C  CB    . GLN A 1 176 ? 78.983 -13.103 9.037   1.00 16.17  ? 173 GLN A CB    1 
ATOM   1382 C  CG    . GLN A 1 176 ? 79.582 -12.875 10.415  1.00 19.67  ? 173 GLN A CG    1 
ATOM   1383 C  CD    . GLN A 1 176 ? 78.821 -13.567 11.534  1.00 21.43  ? 173 GLN A CD    1 
ATOM   1384 O  OE1   . GLN A 1 176 ? 77.694 -14.027 11.357  1.00 20.54  ? 173 GLN A OE1   1 
ATOM   1385 N  NE2   . GLN A 1 176 ? 79.447 -13.648 12.708  1.00 24.71  ? 173 GLN A NE2   1 
ATOM   1386 N  N     . TRP A 1 177 ? 78.278 -12.369 6.070   1.00 13.76  ? 174 TRP A N     1 
ATOM   1387 C  CA    . TRP A 1 177 ? 77.653 -12.731 4.813   1.00 13.43  ? 174 TRP A CA    1 
ATOM   1388 C  C     . TRP A 1 177 ? 78.627 -12.633 3.637   1.00 14.59  ? 174 TRP A C     1 
ATOM   1389 O  O     . TRP A 1 177 ? 78.782 -13.571 2.858   1.00 15.87  ? 174 TRP A O     1 
ATOM   1390 C  CB    . TRP A 1 177 ? 76.440 -11.810 4.578   1.00 12.06  ? 174 TRP A CB    1 
ATOM   1391 C  CG    . TRP A 1 177 ? 75.779 -11.969 3.232   1.00 12.33  ? 174 TRP A CG    1 
ATOM   1392 C  CD1   . TRP A 1 177 ? 75.875 -11.104 2.162   1.00 11.07  ? 174 TRP A CD1   1 
ATOM   1393 C  CD2   . TRP A 1 177 ? 74.862 -12.994 2.830   1.00 10.86  ? 174 TRP A CD2   1 
ATOM   1394 N  NE1   . TRP A 1 177 ? 75.124 -11.558 1.124   1.00 11.25  ? 174 TRP A NE1   1 
ATOM   1395 C  CE2   . TRP A 1 177 ? 74.464 -12.701 1.511   1.00 13.00  ? 174 TRP A CE2   1 
ATOM   1396 C  CE3   . TRP A 1 177 ? 74.330 -14.125 3.460   1.00 13.47  ? 174 TRP A CE3   1 
ATOM   1397 C  CZ2   . TRP A 1 177 ? 73.601 -13.512 0.792   1.00 11.61  ? 174 TRP A CZ2   1 
ATOM   1398 C  CZ3   . TRP A 1 177 ? 73.455 -14.932 2.754   1.00 13.38  ? 174 TRP A CZ3   1 
ATOM   1399 C  CH2   . TRP A 1 177 ? 73.087 -14.624 1.432   1.00 15.56  ? 174 TRP A CH2   1 
ATOM   1400 N  N     . LEU A 1 178 ? 79.279 -11.482 3.518   1.00 14.18  ? 175 LEU A N     1 
ATOM   1401 C  CA    . LEU A 1 178 ? 80.152 -11.221 2.390   1.00 13.42  ? 175 LEU A CA    1 
ATOM   1402 C  C     . LEU A 1 178 ? 81.339 -12.180 2.418   1.00 21.44  ? 175 LEU A C     1 
ATOM   1403 O  O     . LEU A 1 178 ? 81.745 -12.692 1.377   1.00 23.28  ? 175 LEU A O     1 
ATOM   1404 C  CB    . LEU A 1 178 ? 80.632 -9.775  2.418   1.00 17.33  ? 175 LEU A CB    1 
ATOM   1405 C  CG    . LEU A 1 178 ? 79.523 -8.747  2.142   1.00 18.69  ? 175 LEU A CG    1 
ATOM   1406 C  CD1   . LEU A 1 178 ? 80.056 -7.333  2.270   1.00 18.34  ? 175 LEU A CD1   1 
ATOM   1407 C  CD2   . LEU A 1 178 ? 78.907 -8.961  0.765   1.00 15.68  ? 175 LEU A CD2   1 
ATOM   1408 N  N     . ASP A 1 179 ? 81.841 -12.454 3.619   1.00 23.31  ? 176 ASP A N     1 
ATOM   1409 C  CA    . ASP A 1 179 ? 83.007 -13.327 3.790   1.00 26.40  ? 176 ASP A CA    1 
ATOM   1410 C  C     . ASP A 1 179 ? 82.736 -14.735 3.302   1.00 31.07  ? 176 ASP A C     1 
ATOM   1411 O  O     . ASP A 1 179 ? 83.659 -15.432 2.889   1.00 36.11  ? 176 ASP A O     1 
ATOM   1412 C  CB    . ASP A 1 179 ? 83.480 -13.353 5.246   1.00 25.36  ? 176 ASP A CB    1 
ATOM   1413 C  CG    . ASP A 1 179 ? 84.148 -12.059 5.659   1.00 34.84  ? 176 ASP A CG    1 
ATOM   1414 O  OD1   . ASP A 1 179 ? 84.518 -11.271 4.764   1.00 40.54  ? 176 ASP A OD1   1 
ATOM   1415 O  OD2   . ASP A 1 179 ? 84.305 -11.820 6.877   1.00 39.68  ? 176 ASP A OD2   1 
ATOM   1416 N  N     . SER A 1 180 ? 81.466 -15.136 3.326   1.00 24.87  ? 177 SER A N     1 
ATOM   1417 C  CA    . SER A 1 180 ? 81.060 -16.474 2.917   1.00 21.25  ? 177 SER A CA    1 
ATOM   1418 C  C     . SER A 1 180 ? 80.649 -16.600 1.445   1.00 26.64  ? 177 SER A C     1 
ATOM   1419 O  O     . SER A 1 180 ? 80.397 -17.702 0.951   1.00 32.34  ? 177 SER A O     1 
ATOM   1420 C  CB    . SER A 1 180 ? 79.886 -16.927 3.788   1.00 26.11  ? 177 SER A CB    1 
ATOM   1421 O  OG    . SER A 1 180 ? 80.172 -16.761 5.162   1.00 37.58  ? 177 SER A OG    1 
ATOM   1422 N  N     . LEU A 1 181 ? 80.556 -15.478 0.747   1.00 22.00  ? 178 LEU A N     1 
ATOM   1423 C  CA    . LEU A 1 181 ? 79.991 -15.485 -0.598  1.00 21.50  ? 178 LEU A CA    1 
ATOM   1424 C  C     . LEU A 1 181 ? 80.927 -16.088 -1.655  1.00 33.03  ? 178 LEU A C     1 
ATOM   1425 O  O     . LEU A 1 181 ? 82.125 -15.803 -1.644  1.00 33.90  ? 178 LEU A O     1 
ATOM   1426 C  CB    . LEU A 1 181 ? 79.630 -14.046 -0.979  1.00 25.91  ? 178 LEU A CB    1 
ATOM   1427 C  CG    . LEU A 1 181 ? 78.431 -13.711 -1.861  1.00 29.21  ? 178 LEU A CG    1 
ATOM   1428 C  CD1   . LEU A 1 181 ? 77.170 -14.447 -1.402  1.00 19.66  ? 178 LEU A CD1   1 
ATOM   1429 C  CD2   . LEU A 1 181 ? 78.218 -12.177 -1.841  1.00 21.47  ? 178 LEU A CD2   1 
ATOM   1430 N  N     . GLN A 1 182 ? 80.389 -16.909 -2.564  1.00 32.92  ? 179 GLN A N     1 
ATOM   1431 C  CA    . GLN A 1 182 ? 81.186 -17.427 -3.688  1.00 41.66  ? 179 GLN A CA    1 
ATOM   1432 C  C     . GLN A 1 182 ? 81.068 -16.571 -4.966  1.00 41.42  ? 179 GLN A C     1 
ATOM   1433 O  O     . GLN A 1 182 ? 80.258 -16.851 -5.860  1.00 41.67  ? 179 GLN A O     1 
ATOM   1434 C  CB    . GLN A 1 182 ? 80.901 -18.916 -3.969  1.00 45.91  ? 179 GLN A CB    1 
ATOM   1435 C  CG    . GLN A 1 182 ? 79.459 -19.270 -4.320  1.00 41.87  ? 179 GLN A CG    1 
ATOM   1436 C  CD    . GLN A 1 182 ? 79.257 -20.752 -4.630  1.00 53.07  ? 179 GLN A CD    1 
ATOM   1437 O  OE1   . GLN A 1 182 ? 78.758 -21.112 -5.700  1.00 53.63  ? 179 GLN A OE1   1 
ATOM   1438 N  NE2   . GLN A 1 182 ? 79.630 -21.615 -3.688  1.00 59.58  ? 179 GLN A NE2   1 
ATOM   1439 N  N     . ILE A 1 183 ? 81.911 -15.543 -5.046  1.00 38.96  ? 180 ILE A N     1 
ATOM   1440 C  CA    . ILE A 1 183 ? 81.803 -14.498 -6.065  1.00 41.27  ? 180 ILE A CA    1 
ATOM   1441 C  C     . ILE A 1 183 ? 82.169 -14.947 -7.481  1.00 46.31  ? 180 ILE A C     1 
ATOM   1442 O  O     . ILE A 1 183 ? 81.865 -14.256 -8.456  1.00 45.80  ? 180 ILE A O     1 
ATOM   1443 C  CB    . ILE A 1 183 ? 82.682 -13.286 -5.705  1.00 47.10  ? 180 ILE A CB    1 
ATOM   1444 C  CG1   . ILE A 1 183 ? 84.162 -13.669 -5.785  1.00 49.65  ? 180 ILE A CG1   1 
ATOM   1445 C  CG2   . ILE A 1 183 ? 82.329 -12.758 -4.321  1.00 41.54  ? 180 ILE A CG2   1 
ATOM   1446 C  CD1   . ILE A 1 183 ? 85.105 -12.572 -5.374  1.00 49.03  ? 180 ILE A CD1   1 
ATOM   1447 N  N     . ASP A 1 184 ? 82.826 -16.096 -7.593  1.00 50.73  ? 181 ASP A N     1 
ATOM   1448 C  CA    . ASP A 1 184 ? 83.231 -16.613 -8.896  1.00 50.89  ? 181 ASP A CA    1 
ATOM   1449 C  C     . ASP A 1 184 ? 82.180 -17.554 -9.480  1.00 51.38  ? 181 ASP A C     1 
ATOM   1450 O  O     . ASP A 1 184 ? 82.429 -18.235 -10.476 1.00 52.07  ? 181 ASP A O     1 
ATOM   1451 C  CB    . ASP A 1 184 ? 84.582 -17.324 -8.796  1.00 58.92  ? 181 ASP A CB    1 
ATOM   1452 C  CG    . ASP A 1 184 ? 84.571 -18.458 -7.786  1.00 64.34  ? 181 ASP A CG    1 
ATOM   1453 O  OD1   . ASP A 1 184 ? 83.903 -18.319 -6.736  1.00 64.24  ? 181 ASP A OD1   1 
ATOM   1454 O  OD2   . ASP A 1 184 ? 85.229 -19.491 -8.042  1.00 66.09  ? 181 ASP A OD2   1 
ATOM   1455 N  N     . ASN A 1 185 ? 81.008 -17.600 -8.852  1.00 42.33  ? 182 ASN A N     1 
ATOM   1456 C  CA    . ASN A 1 185 ? 79.901 -18.382 -9.388  1.00 43.17  ? 182 ASN A CA    1 
ATOM   1457 C  C     . ASN A 1 185 ? 78.698 -17.501 -9.687  1.00 40.14  ? 182 ASN A C     1 
ATOM   1458 O  O     . ASN A 1 185 ? 77.963 -17.113 -8.778  1.00 38.64  ? 182 ASN A O     1 
ATOM   1459 C  CB    . ASN A 1 185 ? 79.508 -19.507 -8.431  1.00 40.16  ? 182 ASN A CB    1 
ATOM   1460 C  CG    . ASN A 1 185 ? 78.364 -20.357 -8.962  1.00 37.72  ? 182 ASN A CG    1 
ATOM   1461 O  OD1   . ASN A 1 185 ? 77.974 -20.254 -10.131 1.00 38.92  ? 182 ASN A OD1   1 
ATOM   1462 N  ND2   . ASN A 1 185 ? 77.825 -21.217 -8.103  1.00 42.28  ? 182 ASN A ND2   1 
ATOM   1463 N  N     . LEU A 1 186 ? 78.495 -17.212 -10.969 1.00 36.90  ? 183 LEU A N     1 
ATOM   1464 C  CA    . LEU A 1 186 ? 77.459 -16.280 -11.407 1.00 40.43  ? 183 LEU A CA    1 
ATOM   1465 C  C     . LEU A 1 186 ? 76.042 -16.845 -11.315 1.00 34.52  ? 183 LEU A C     1 
ATOM   1466 O  O     . LEU A 1 186 ? 75.070 -16.123 -11.535 1.00 37.29  ? 183 LEU A O     1 
ATOM   1467 C  CB    . LEU A 1 186 ? 77.737 -15.797 -12.836 1.00 41.01  ? 183 LEU A CB    1 
ATOM   1468 C  CG    . LEU A 1 186 ? 78.941 -14.873 -13.049 1.00 47.60  ? 183 LEU A CG    1 
ATOM   1469 C  CD1   . LEU A 1 186 ? 80.245 -15.659 -13.177 1.00 55.47  ? 183 LEU A CD1   1 
ATOM   1470 C  CD2   . LEU A 1 186 ? 78.731 -13.967 -14.258 1.00 47.17  ? 183 LEU A CD2   1 
ATOM   1471 N  N     . THR A 1 187 ? 75.919 -18.131 -11.002 1.00 31.99  ? 184 THR A N     1 
ATOM   1472 C  CA    . THR A 1 187 ? 74.597 -18.736 -10.831 1.00 33.92  ? 184 THR A CA    1 
ATOM   1473 C  C     . THR A 1 187 ? 74.225 -18.948 -9.362  1.00 26.73  ? 184 THR A C     1 
ATOM   1474 O  O     . THR A 1 187 ? 73.139 -19.451 -9.069  1.00 29.94  ? 184 THR A O     1 
ATOM   1475 C  CB    . THR A 1 187 ? 74.458 -20.083 -11.591 1.00 36.81  ? 184 THR A CB    1 
ATOM   1476 O  OG1   . THR A 1 187 ? 75.340 -21.060 -11.019 1.00 42.54  ? 184 THR A OG1   1 
ATOM   1477 C  CG2   . THR A 1 187 ? 74.778 -19.902 -13.068 1.00 38.32  ? 184 THR A CG2   1 
ATOM   1478 N  N     . SER A 1 188 ? 75.123 -18.585 -8.446  1.00 24.06  ? 185 SER A N     1 
ATOM   1479 C  CA    . SER A 1 188 ? 74.830 -18.659 -7.007  1.00 18.64  ? 185 SER A CA    1 
ATOM   1480 C  C     . SER A 1 188 ? 73.662 -17.747 -6.596  1.00 17.96  ? 185 SER A C     1 
ATOM   1481 O  O     . SER A 1 188 ? 73.725 -16.532 -6.765  1.00 15.26  ? 185 SER A O     1 
ATOM   1482 C  CB    . SER A 1 188 ? 76.055 -18.293 -6.173  1.00 24.00  ? 185 SER A CB    1 
ATOM   1483 O  OG    . SER A 1 188 ? 75.721 -18.249 -4.782  1.00 26.06  ? 185 SER A OG    1 
ATOM   1484 N  N     . PRO A 1 189 ? 72.592 -18.335 -6.052  1.00 13.94  ? 186 PRO A N     1 
ATOM   1485 C  CA    . PRO A 1 189 ? 71.450 -17.508 -5.616  1.00 10.97  ? 186 PRO A CA    1 
ATOM   1486 C  C     . PRO A 1 189 ? 71.826 -16.470 -4.571  1.00 12.51  ? 186 PRO A C     1 
ATOM   1487 O  O     . PRO A 1 189 ? 71.304 -15.336 -4.657  1.00 11.91  ? 186 PRO A O     1 
ATOM   1488 C  CB    . PRO A 1 189 ? 70.507 -18.526 -4.991  1.00 14.68  ? 186 PRO A CB    1 
ATOM   1489 C  CG    . PRO A 1 189 ? 70.836 -19.821 -5.703  1.00 15.56  ? 186 PRO A CG    1 
ATOM   1490 C  CD    . PRO A 1 189 ? 72.318 -19.777 -5.926  1.00 18.02  ? 186 PRO A CD    1 
ATOM   1491 N  N     . ASP A 1 190 ? 72.677 -16.814 -3.605  1.00 11.48  ? 187 ASP A N     1 
ATOM   1492 C  CA    . ASP A 1 190 ? 73.067 -15.849 -2.580  1.00 6.55   ? 187 ASP A CA    1 
ATOM   1493 C  C     . ASP A 1 190 ? 73.803 -14.676 -3.215  1.00 11.72  ? 187 ASP A C     1 
ATOM   1494 O  O     . ASP A 1 190 ? 73.616 -13.529 -2.813  1.00 11.80  ? 187 ASP A O     1 
ATOM   1495 C  CB    . ASP A 1 190 ? 73.957 -16.506 -1.501  1.00 12.54  ? 187 ASP A CB    1 
ATOM   1496 C  CG    . ASP A 1 190 ? 73.177 -17.418 -0.540  1.00 19.24  ? 187 ASP A CG    1 
ATOM   1497 O  OD1   . ASP A 1 190 ? 71.927 -17.435 -0.533  1.00 12.73  ? 187 ASP A OD1   1 
ATOM   1498 O  OD2   . ASP A 1 190 ? 73.844 -18.125 0.241   1.00 19.91  ? 187 ASP A OD2   1 
ATOM   1499 N  N     . LEU A 1 191 ? 74.651 -14.967 -4.206  1.00 10.30  ? 188 LEU A N     1 
ATOM   1500 C  CA    . LEU A 1 191 ? 75.389 -13.897 -4.877  1.00 12.54  ? 188 LEU A CA    1 
ATOM   1501 C  C     . LEU A 1 191 ? 74.406 -13.026 -5.663  1.00 11.56  ? 188 LEU A C     1 
ATOM   1502 O  O     . LEU A 1 191 ? 74.530 -11.788 -5.662  1.00 10.94  ? 188 LEU A O     1 
ATOM   1503 C  CB    . LEU A 1 191 ? 76.463 -14.470 -5.822  1.00 15.74  ? 188 LEU A CB    1 
ATOM   1504 C  CG    . LEU A 1 191 ? 77.207 -13.421 -6.671  1.00 16.60  ? 188 LEU A CG    1 
ATOM   1505 C  CD1   . LEU A 1 191 ? 77.898 -12.393 -5.815  1.00 15.02  ? 188 LEU A CD1   1 
ATOM   1506 C  CD2   . LEU A 1 191 ? 78.220 -14.125 -7.573  1.00 22.28  ? 188 LEU A CD2   1 
ATOM   1507 N  N     . GLN A 1 192 ? 73.422 -13.662 -6.287  1.00 10.95  ? 189 GLN A N     1 
ATOM   1508 C  CA    . GLN A 1 192 ? 72.419 -12.919 -7.061  1.00 11.06  ? 189 GLN A CA    1 
ATOM   1509 C  C     . GLN A 1 192 ? 71.639 -11.975 -6.127  1.00 10.65  ? 189 GLN A C     1 
ATOM   1510 O  O     . GLN A 1 192 ? 71.427 -10.795 -6.457  1.00 10.51  ? 189 GLN A O     1 
ATOM   1511 C  CB    . GLN A 1 192 ? 71.504 -13.857 -7.847  1.00 13.40  ? 189 GLN A CB    1 
ATOM   1512 C  CG    . GLN A 1 192 ? 72.259 -14.599 -8.958  1.00 13.07  ? 189 GLN A CG    1 
ATOM   1513 C  CD    . GLN A 1 192 ? 71.531 -15.809 -9.470  1.00 22.83  ? 189 GLN A CD    1 
ATOM   1514 O  OE1   . GLN A 1 192 ? 70.516 -16.226 -8.919  1.00 26.00  ? 189 GLN A OE1   1 
ATOM   1515 N  NE2   . GLN A 1 192 ? 72.062 -16.395 -10.542 1.00 27.39  ? 189 GLN A NE2   1 
ATOM   1516 N  N     . LEU A 1 193 ? 71.245 -12.461 -4.955  1.00 9.38   ? 190 LEU A N     1 
ATOM   1517 C  CA    . LEU A 1 193 ? 70.532 -11.598 -4.003  1.00 8.55   ? 190 LEU A CA    1 
ATOM   1518 C  C     . LEU A 1 193 ? 71.392 -10.413 -3.579  1.00 9.86   ? 190 LEU A C     1 
ATOM   1519 O  O     . LEU A 1 193 ? 70.880 -9.333  -3.350  1.00 11.66  ? 190 LEU A O     1 
ATOM   1520 C  CB    . LEU A 1 193 ? 70.117 -12.372 -2.745  1.00 9.23   ? 190 LEU A CB    1 
ATOM   1521 C  CG    . LEU A 1 193 ? 69.019 -13.414 -2.870  1.00 8.75   ? 190 LEU A CG    1 
ATOM   1522 C  CD1   . LEU A 1 193 ? 68.751 -13.976 -1.455  1.00 10.22  ? 190 LEU A CD1   1 
ATOM   1523 C  CD2   . LEU A 1 193 ? 67.751 -12.857 -3.484  1.00 9.98   ? 190 LEU A CD2   1 
ATOM   1524 N  N     . THR A 1 194 ? 72.678 -10.654 -3.376  1.00 9.50   ? 191 THR A N     1 
ATOM   1525 C  CA    . THR A 1 194 ? 73.592 -9.618  -2.925  1.00 9.48   ? 191 THR A CA    1 
ATOM   1526 C  C     . THR A 1 194 ? 73.728 -8.528  -3.974  1.00 9.20   ? 191 THR A C     1 
ATOM   1527 O  O     . THR A 1 194 ? 73.712 -7.339  -3.639  1.00 10.42  ? 191 THR A O     1 
ATOM   1528 C  CB    . THR A 1 194 ? 74.975 -10.203 -2.656  1.00 11.53  ? 191 THR A CB    1 
ATOM   1529 O  OG1   . THR A 1 194 ? 74.845 -11.224 -1.666  1.00 10.15  ? 191 THR A OG1   1 
ATOM   1530 C  CG2   . THR A 1 194 ? 75.910 -9.129  -2.120  1.00 11.91  ? 191 THR A CG2   1 
ATOM   1531 N  N     . VAL A 1 195 ? 73.882 -8.934  -5.223  1.00 11.18  ? 192 VAL A N     1 
ATOM   1532 C  CA    . VAL A 1 195 ? 73.918 -7.943  -6.296  1.00 10.27  ? 192 VAL A CA    1 
ATOM   1533 C  C     . VAL A 1 195 ? 72.565 -7.223  -6.365  1.00 9.46   ? 192 VAL A C     1 
ATOM   1534 O  O     . VAL A 1 195 ? 72.526 -5.993  -6.555  1.00 11.00  ? 192 VAL A O     1 
ATOM   1535 C  CB    . VAL A 1 195 ? 74.290 -8.582  -7.628  1.00 12.14  ? 192 VAL A CB    1 
ATOM   1536 C  CG1   . VAL A 1 195 ? 74.210 -7.546  -8.740  1.00 13.66  ? 192 VAL A CG1   1 
ATOM   1537 C  CG2   . VAL A 1 195 ? 75.715 -9.115  -7.554  1.00 12.60  ? 192 VAL A CG2   1 
ATOM   1538 N  N     . GLY A 1 196 ? 71.480 -7.964  -6.162  1.00 9.02   ? 193 GLY A N     1 
ATOM   1539 C  CA    . GLY A 1 196 ? 70.149 -7.329  -6.068  1.00 9.31   ? 193 GLY A CA    1 
ATOM   1540 C  C     . GLY A 1 196 ? 70.147 -6.230  -5.008  1.00 9.97   ? 193 GLY A C     1 
ATOM   1541 O  O     . GLY A 1 196 ? 69.629 -5.120  -5.248  1.00 10.57  ? 193 GLY A O     1 
ATOM   1542 N  N     . ALA A 1 197 ? 70.711 -6.499  -3.831  1.00 9.34   ? 194 ALA A N     1 
ATOM   1543 C  CA    . ALA A 1 197 ? 70.749 -5.506  -2.757  1.00 8.13   ? 194 ALA A CA    1 
ATOM   1544 C  C     . ALA A 1 197 ? 71.579 -4.266  -3.123  1.00 10.21  ? 194 ALA A C     1 
ATOM   1545 O  O     . ALA A 1 197 ? 71.226 -3.149  -2.745  1.00 9.85   ? 194 ALA A O     1 
ATOM   1546 C  CB    . ALA A 1 197 ? 71.249 -6.155  -1.471  1.00 9.77   ? 194 ALA A CB    1 
ATOM   1547 N  N     . VAL A 1 198 ? 72.684 -4.473  -3.834  1.00 9.45   ? 195 VAL A N     1 
ATOM   1548 C  CA    . VAL A 1 198 ? 73.479 -3.359  -4.391  1.00 8.80   ? 195 VAL A CA    1 
ATOM   1549 C  C     . VAL A 1 198 ? 72.647 -2.434  -5.288  1.00 11.38  ? 195 VAL A C     1 
ATOM   1550 O  O     . VAL A 1 198 ? 72.660 -1.200  -5.114  1.00 12.87  ? 195 VAL A O     1 
ATOM   1551 C  CB    . VAL A 1 198 ? 74.677 -3.892  -5.174  1.00 10.93  ? 195 VAL A CB    1 
ATOM   1552 C  CG1   . VAL A 1 198 ? 75.404 -2.751  -5.908  1.00 17.21  ? 195 VAL A CG1   1 
ATOM   1553 C  CG2   . VAL A 1 198 ? 75.627 -4.576  -4.203  1.00 13.44  ? 195 VAL A CG2   1 
ATOM   1554 N  N     . ILE A 1 199 ? 71.903 -3.040  -6.205  1.00 8.65   ? 196 ILE A N     1 
ATOM   1555 C  CA    . ILE A 1 199 ? 71.006 -2.298  -7.094  1.00 9.94   ? 196 ILE A CA    1 
ATOM   1556 C  C     . ILE A 1 199 ? 69.931 -1.549  -6.297  1.00 11.48  ? 196 ILE A C     1 
ATOM   1557 O  O     . ILE A 1 199 ? 69.637 -0.381  -6.591  1.00 11.91  ? 196 ILE A O     1 
ATOM   1558 C  CB    . ILE A 1 199 ? 70.401 -3.173  -8.175  1.00 10.44  ? 196 ILE A CB    1 
ATOM   1559 C  CG1   . ILE A 1 199 ? 71.510 -3.704  -9.103  1.00 13.25  ? 196 ILE A CG1   1 
ATOM   1560 C  CG2   . ILE A 1 199 ? 69.380 -2.368  -8.993  1.00 11.70  ? 196 ILE A CG2   1 
ATOM   1561 C  CD1   . ILE A 1 199 ? 71.054 -4.795  -10.030 1.00 15.99  ? 196 ILE A CD1   1 
ATOM   1562 N  N     . VAL A 1 200 ? 69.374 -2.192  -5.261  1.00 9.57   ? 197 VAL A N     1 
ATOM   1563 C  CA    . VAL A 1 200 ? 68.323 -1.557  -4.476  1.00 8.48   ? 197 VAL A CA    1 
ATOM   1564 C  C     . VAL A 1 200 ? 68.869 -0.389  -3.654  1.00 10.39  ? 197 VAL A C     1 
ATOM   1565 O  O     . VAL A 1 200 ? 68.186 0.617   -3.451  1.00 10.69  ? 197 VAL A O     1 
ATOM   1566 C  CB    . VAL A 1 200 ? 67.583 -2.606  -3.606  1.00 7.72   ? 197 VAL A CB    1 
ATOM   1567 C  CG1   . VAL A 1 200 ? 66.614 -1.922  -2.681  1.00 10.13  ? 197 VAL A CG1   1 
ATOM   1568 C  CG2   . VAL A 1 200 ? 66.865 -3.576  -4.525  1.00 9.67   ? 197 VAL A CG2   1 
ATOM   1569 N  N     . GLU A 1 201 ? 70.107 -0.485  -3.186  1.00 9.65   ? 198 GLU A N     1 
ATOM   1570 C  CA    . GLU A 1 201 ? 70.733 0.667   -2.524  1.00 10.26  ? 198 GLU A CA    1 
ATOM   1571 C  C     . GLU A 1 201 ? 70.745 1.859   -3.486  1.00 10.79  ? 198 GLU A C     1 
ATOM   1572 O  O     . GLU A 1 201 ? 70.419 2.987   -3.091  1.00 12.39  ? 198 GLU A O     1 
ATOM   1573 C  CB    . GLU A 1 201 ? 72.179 0.351   -2.136  1.00 10.15  ? 198 GLU A CB    1 
ATOM   1574 C  CG    . GLU A 1 201 ? 72.312 -0.666  -0.968  1.00 12.11  ? 198 GLU A CG    1 
ATOM   1575 C  CD    . GLU A 1 201 ? 72.249 -0.073  0.449   1.00 13.37  ? 198 GLU A CD    1 
ATOM   1576 O  OE1   . GLU A 1 201 ? 71.902 1.122   0.631   1.00 15.47  ? 198 GLU A OE1   1 
ATOM   1577 O  OE2   . GLU A 1 201 ? 72.536 -0.817  1.423   1.00 12.50  ? 198 GLU A OE2   1 
ATOM   1578 N  N     . GLU A 1 202 ? 71.098 1.580   -4.741  1.00 10.78  ? 199 GLU A N     1 
ATOM   1579 C  CA    . GLU A 1 202 ? 71.196 2.616   -5.771  1.00 10.17  ? 199 GLU A CA    1 
ATOM   1580 C  C     . GLU A 1 202 ? 69.806 3.192   -6.040  1.00 11.07  ? 199 GLU A C     1 
ATOM   1581 O  O     . GLU A 1 202 ? 69.643 4.424   -6.119  1.00 12.45  ? 199 GLU A O     1 
ATOM   1582 C  CB    . GLU A 1 202 ? 71.806 2.040   -7.055  1.00 13.61  ? 199 GLU A CB    1 
ATOM   1583 C  CG    . GLU A 1 202 ? 73.236 1.567   -6.839  1.00 13.30  ? 199 GLU A CG    1 
ATOM   1584 C  CD    . GLU A 1 202 ? 73.798 0.698   -7.979  1.00 16.93  ? 199 GLU A CD    1 
ATOM   1585 O  OE1   . GLU A 1 202 ? 75.034 0.456   -7.978  1.00 25.59  ? 199 GLU A OE1   1 
ATOM   1586 O  OE2   . GLU A 1 202 ? 73.034 0.273   -8.874  1.00 22.39  ? 199 GLU A OE2   1 
ATOM   1587 N  N     . MET A 1 203 ? 68.802 2.323   -6.123  1.00 10.08  ? 200 MET A N     1 
ATOM   1588 C  CA    A MET A 1 203 ? 67.438 2.776   -6.355  0.56 11.09  ? 200 MET A CA    1 
ATOM   1589 C  CA    B MET A 1 203 ? 67.422 2.771   -6.340  0.44 11.10  ? 200 MET A CA    1 
ATOM   1590 C  C     . MET A 1 203 ? 66.942 3.648   -5.203  1.00 11.07  ? 200 MET A C     1 
ATOM   1591 O  O     . MET A 1 203 ? 66.333 4.711   -5.426  1.00 8.79   ? 200 MET A O     1 
ATOM   1592 C  CB    A MET A 1 203 ? 66.515 1.575   -6.546  0.56 12.03  ? 200 MET A CB    1 
ATOM   1593 C  CB    B MET A 1 203 ? 66.466 1.585   -6.455  0.44 12.03  ? 200 MET A CB    1 
ATOM   1594 C  CG    A MET A 1 203 ? 65.132 1.948   -6.971  0.56 12.41  ? 200 MET A CG    1 
ATOM   1595 C  CG    B MET A 1 203 ? 66.779 0.655   -7.576  0.44 11.96  ? 200 MET A CG    1 
ATOM   1596 S  SD    A MET A 1 203 ? 64.100 0.485   -7.193  0.56 19.53  ? 200 MET A SD    1 
ATOM   1597 S  SD    B MET A 1 203 ? 65.598 -0.700  -7.665  0.44 15.86  ? 200 MET A SD    1 
ATOM   1598 C  CE    A MET A 1 203 ? 65.278 -0.652  -7.919  0.56 15.73  ? 200 MET A CE    1 
ATOM   1599 C  CE    B MET A 1 203 ? 64.112 0.160   -8.170  0.44 10.44  ? 200 MET A CE    1 
ATOM   1600 N  N     . ARG A 1 204 ? 67.190 3.215   -3.978  1.00 9.16   ? 201 ARG A N     1 
ATOM   1601 C  CA    . ARG A 1 204 ? 66.725 3.970   -2.812  1.00 8.47   ? 201 ARG A CA    1 
ATOM   1602 C  C     . ARG A 1 204 ? 67.444 5.309   -2.708  1.00 10.88  ? 201 ARG A C     1 
ATOM   1603 O  O     . ARG A 1 204 ? 66.847 6.294   -2.294  1.00 10.55  ? 201 ARG A O     1 
ATOM   1604 C  CB    . ARG A 1 204 ? 66.902 3.140   -1.540  1.00 11.16  ? 201 ARG A CB    1 
ATOM   1605 C  CG    . ARG A 1 204 ? 65.900 1.968   -1.531  1.00 9.92   ? 201 ARG A CG    1 
ATOM   1606 C  CD    . ARG A 1 204 ? 66.084 1.104   -0.297  1.00 10.35  ? 201 ARG A CD    1 
ATOM   1607 N  NE    . ARG A 1 204 ? 66.078 1.911   0.899   1.00 9.34   ? 201 ARG A NE    1 
ATOM   1608 C  CZ    . ARG A 1 204 ? 67.116 2.076   1.703   1.00 10.83  ? 201 ARG A CZ    1 
ATOM   1609 N  NH1   . ARG A 1 204 ? 67.047 2.901   2.742   1.00 11.46  ? 201 ARG A NH1   1 
ATOM   1610 N  NH2   . ARG A 1 204 ? 68.215 1.373   1.483   1.00 12.29  ? 201 ARG A NH2   1 
ATOM   1611 N  N     . ALA A 1 205 ? 68.718 5.336   -3.100  1.00 11.58  ? 202 ALA A N     1 
ATOM   1612 C  CA    . ALA A 1 205 ? 69.467 6.591   -3.069  1.00 10.17  ? 202 ALA A CA    1 
ATOM   1613 C  C     . ALA A 1 205 ? 68.883 7.540   -4.121  1.00 9.46   ? 202 ALA A C     1 
ATOM   1614 O  O     . ALA A 1 205 ? 68.755 8.747   -3.854  1.00 10.82  ? 202 ALA A O     1 
ATOM   1615 C  CB    . ALA A 1 205 ? 70.946 6.320   -3.353  1.00 12.97  ? 202 ALA A CB    1 
ATOM   1616 N  N     . ALA A 1 206 ? 68.527 7.000   -5.289  1.00 11.45  ? 203 ALA A N     1 
ATOM   1617 C  CA    . ALA A 1 206 ? 67.916 7.812   -6.342  1.00 9.98   ? 203 ALA A CA    1 
ATOM   1618 C  C     . ALA A 1 206 ? 66.580 8.372   -5.881  1.00 10.59  ? 203 ALA A C     1 
ATOM   1619 O  O     . ALA A 1 206 ? 66.278 9.546   -6.104  1.00 11.36  ? 203 ALA A O     1 
ATOM   1620 C  CB    . ALA A 1 206 ? 67.762 7.037   -7.635  1.00 13.70  ? 203 ALA A CB    1 
ATOM   1621 N  N     . ILE A 1 207 ? 65.759 7.542   -5.239  1.00 8.23   ? 204 ILE A N     1 
ATOM   1622 C  CA    . ILE A 1 207 ? 64.481 8.066   -4.748  1.00 7.56   ? 204 ILE A CA    1 
ATOM   1623 C  C     . ILE A 1 207 ? 64.716 9.193   -3.742  1.00 9.80   ? 204 ILE A C     1 
ATOM   1624 O  O     . ILE A 1 207 ? 64.054 10.246  -3.807  1.00 8.22   ? 204 ILE A O     1 
ATOM   1625 C  CB    . ILE A 1 207 ? 63.655 6.932   -4.104  1.00 7.14   ? 204 ILE A CB    1 
ATOM   1626 C  CG1   . ILE A 1 207 ? 63.225 5.929   -5.171  1.00 8.44   ? 204 ILE A CG1   1 
ATOM   1627 C  CG2   . ILE A 1 207 ? 62.452 7.490   -3.331  1.00 8.56   ? 204 ILE A CG2   1 
ATOM   1628 C  CD1   . ILE A 1 207 ? 62.639 4.592   -4.533  1.00 12.47  ? 204 ILE A CD1   1 
ATOM   1629 N  N     . GLU A 1 208 ? 65.629 9.003   -2.800  1.00 9.32   ? 205 GLU A N     1 
ATOM   1630 C  CA    . GLU A 1 208 ? 65.841 10.040  -1.784  1.00 8.41   ? 205 GLU A CA    1 
ATOM   1631 C  C     . GLU A 1 208 ? 66.421 11.314  -2.412  1.00 9.38   ? 205 GLU A C     1 
ATOM   1632 O  O     . GLU A 1 208 ? 65.972 12.436  -2.117  1.00 11.33  ? 205 GLU A O     1 
ATOM   1633 C  CB    . GLU A 1 208 ? 66.705 9.545   -0.637  1.00 12.79  ? 205 GLU A CB    1 
ATOM   1634 C  CG    . GLU A 1 208 ? 66.740 10.565  0.509   1.00 13.95  ? 205 GLU A CG    1 
ATOM   1635 C  CD    . GLU A 1 208 ? 67.485 10.100  1.754   1.00 14.77  ? 205 GLU A CD    1 
ATOM   1636 O  OE1   . GLU A 1 208 ? 67.504 10.872  2.737   1.00 22.02  ? 205 GLU A OE1   1 
ATOM   1637 O  OE2   . GLU A 1 208 ? 68.053 8.979   1.757   1.00 18.22  ? 205 GLU A OE2   1 
ATOM   1638 N  N     . ARG A 1 209 ? 67.396 11.147  -3.300  1.00 10.82  ? 206 ARG A N     1 
ATOM   1639 C  CA    . ARG A 1 209 ? 68.012 12.321  -3.939  1.00 10.15  ? 206 ARG A CA    1 
ATOM   1640 C  C     . ARG A 1 209 ? 66.977 13.133  -4.699  1.00 11.29  ? 206 ARG A C     1 
ATOM   1641 O  O     . ARG A 1 209 ? 66.973 14.369  -4.587  1.00 13.72  ? 206 ARG A O     1 
ATOM   1642 C  CB    . ARG A 1 209 ? 69.165 11.931  -4.881  1.00 13.01  ? 206 ARG A CB    1 
ATOM   1643 C  CG    . ARG A 1 209 ? 69.920 13.203  -5.422  1.00 18.76  ? 206 ARG A CG    1 
ATOM   1644 C  CD    . ARG A 1 209 ? 71.003 12.919  -6.493  1.00 24.70  ? 206 ARG A CD    1 
ATOM   1645 N  NE    . ARG A 1 209 ? 70.489 12.640  -7.841  1.00 27.97  ? 206 ARG A NE    1 
ATOM   1646 C  CZ    . ARG A 1 209 ? 70.126 13.568  -8.728  1.00 24.04  ? 206 ARG A CZ    1 
ATOM   1647 N  NH1   . ARG A 1 209 ? 69.683 13.205  -9.936  1.00 24.88  ? 206 ARG A NH1   1 
ATOM   1648 N  NH2   . ARG A 1 209 ? 70.177 14.856  -8.402  1.00 22.88  ? 206 ARG A NH2   1 
ATOM   1649 N  N     . GLU A 1 210 ? 66.097 12.454  -5.432  1.00 9.07   ? 207 GLU A N     1 
ATOM   1650 C  CA    . GLU A 1 210 ? 65.261 13.099  -6.437  1.00 10.03  ? 207 GLU A CA    1 
ATOM   1651 C  C     . GLU A 1 210 ? 63.903 13.513  -5.892  1.00 9.58   ? 207 GLU A C     1 
ATOM   1652 O  O     . GLU A 1 210 ? 63.188 14.310  -6.523  1.00 11.55  ? 207 GLU A O     1 
ATOM   1653 C  CB    . GLU A 1 210 ? 65.111 12.223  -7.672  1.00 10.40  ? 207 GLU A CB    1 
ATOM   1654 C  CG    . GLU A 1 210 ? 66.440 11.967  -8.336  1.00 8.63   ? 207 GLU A CG    1 
ATOM   1655 C  CD    . GLU A 1 210 ? 66.339 11.104  -9.568  1.00 18.71  ? 207 GLU A CD    1 
ATOM   1656 O  OE1   . GLU A 1 210 ? 65.290 11.123  -10.239 1.00 19.79  ? 207 GLU A OE1   1 
ATOM   1657 O  OE2   . GLU A 1 210 ? 67.335 10.405  -9.867  1.00 24.29  ? 207 GLU A OE2   1 
ATOM   1658 N  N     . THR A 1 211 ? 63.547 13.005  -4.707  1.00 9.12   ? 208 THR A N     1 
ATOM   1659 C  CA    . THR A 1 211 ? 62.246 13.369  -4.127  1.00 8.65   ? 208 THR A CA    1 
ATOM   1660 C  C     . THR A 1 211 ? 62.309 13.890  -2.714  1.00 10.90  ? 208 THR A C     1 
ATOM   1661 O  O     . THR A 1 211 ? 61.380 14.567  -2.267  1.00 11.74  ? 208 THR A O     1 
ATOM   1662 C  CB    . THR A 1 211 ? 61.242 12.182  -4.092  1.00 9.12   ? 208 THR A CB    1 
ATOM   1663 O  OG1   . THR A 1 211 ? 61.664 11.195  -3.134  1.00 9.61   ? 208 THR A OG1   1 
ATOM   1664 C  CG2   . THR A 1 211 ? 61.076 11.568  -5.448  1.00 10.94  ? 208 THR A CG2   1 
ATOM   1665 N  N     . GLY A 1 212 ? 63.365 13.540  -1.988  1.00 9.06   ? 209 GLY A N     1 
ATOM   1666 C  CA    . GLY A 1 212 ? 63.427 13.840  -0.571  1.00 10.51  ? 209 GLY A CA    1 
ATOM   1667 C  C     . GLY A 1 212 ? 62.874 12.743  0.313   1.00 11.76  ? 209 GLY A C     1 
ATOM   1668 O  O     . GLY A 1 212 ? 63.065 12.813  1.521   1.00 15.02  ? 209 GLY A O     1 
ATOM   1669 N  N     . PHE A 1 213 ? 62.236 11.727  -0.270  1.00 10.34  ? 210 PHE A N     1 
ATOM   1670 C  CA    . PHE A 1 213 ? 61.547 10.710  0.529   1.00 8.00   ? 210 PHE A CA    1 
ATOM   1671 C  C     . PHE A 1 213 ? 62.464 9.521   0.819   1.00 9.26   ? 210 PHE A C     1 
ATOM   1672 O  O     . PHE A 1 213 ? 63.169 9.046   -0.055  1.00 11.79  ? 210 PHE A O     1 
ATOM   1673 C  CB    . PHE A 1 213 ? 60.298 10.190  -0.181  1.00 8.89   ? 210 PHE A CB    1 
ATOM   1674 C  CG    . PHE A 1 213 ? 59.325 11.246  -0.584  1.00 7.02   ? 210 PHE A CG    1 
ATOM   1675 C  CD1   . PHE A 1 213 ? 59.043 12.323  0.255   1.00 8.51   ? 210 PHE A CD1   1 
ATOM   1676 C  CD2   . PHE A 1 213 ? 58.659 11.147  -1.798  1.00 10.69  ? 210 PHE A CD2   1 
ATOM   1677 C  CE1   . PHE A 1 213 ? 58.116 13.291  -0.135  1.00 8.63   ? 210 PHE A CE1   1 
ATOM   1678 C  CE2   . PHE A 1 213 ? 57.719 12.125  -2.183  1.00 8.44   ? 210 PHE A CE2   1 
ATOM   1679 C  CZ    . PHE A 1 213 ? 57.454 13.168  -1.336  1.00 8.00   ? 210 PHE A CZ    1 
ATOM   1680 N  N     . GLN A 1 214 ? 62.433 9.053   2.062   1.00 9.26   ? 211 GLN A N     1 
ATOM   1681 C  CA    . GLN A 1 214 ? 63.152 7.838   2.442   1.00 10.18  ? 211 GLN A CA    1 
ATOM   1682 C  C     . GLN A 1 214 ? 62.234 6.627   2.367   1.00 8.64   ? 211 GLN A C     1 
ATOM   1683 O  O     . GLN A 1 214 ? 61.024 6.747   2.486   1.00 9.01   ? 211 GLN A O     1 
ATOM   1684 C  CB    . GLN A 1 214 ? 63.665 7.970   3.878   1.00 10.92  ? 211 GLN A CB    1 
ATOM   1685 C  CG    . GLN A 1 214 ? 64.802 8.996   3.968   1.00 12.62  ? 211 GLN A CG    1 
ATOM   1686 C  CD    . GLN A 1 214 ? 65.409 9.099   5.348   1.00 14.85  ? 211 GLN A CD    1 
ATOM   1687 O  OE1   . GLN A 1 214 ? 64.845 8.633   6.341   1.00 15.39  ? 211 GLN A OE1   1 
ATOM   1688 N  NE2   . GLN A 1 214 ? 66.601 9.696   5.408   1.00 15.33  ? 211 GLN A NE2   1 
ATOM   1689 N  N     . CYS A 1 215 ? 62.823 5.458   2.177   1.00 8.39   ? 212 CYS A N     1 
ATOM   1690 C  CA    . CYS A 1 215 ? 62.027 4.252   2.110   1.00 7.34   ? 212 CYS A CA    1 
ATOM   1691 C  C     . CYS A 1 215 ? 62.840 3.084   2.637   1.00 8.20   ? 212 CYS A C     1 
ATOM   1692 O  O     . CYS A 1 215 ? 64.044 3.194   2.884   1.00 10.30  ? 212 CYS A O     1 
ATOM   1693 C  CB    . CYS A 1 215 ? 61.611 3.967   0.661   1.00 8.35   ? 212 CYS A CB    1 
ATOM   1694 S  SG    . CYS A 1 215 ? 63.032 3.667   -0.397  1.00 14.67  ? 212 CYS A SG    1 
ATOM   1695 N  N     . SER A 1 216 ? 62.155 1.974   2.817   1.00 7.32   ? 213 SER A N     1 
ATOM   1696 C  CA    A SER A 1 216 ? 62.794 0.712   3.175   0.82 6.77   ? 213 SER A CA    1 
ATOM   1697 C  CA    B SER A 1 216 ? 62.831 0.733   3.152   0.18 6.89   ? 213 SER A CA    1 
ATOM   1698 C  C     . SER A 1 216 ? 62.597 -0.285  2.051   1.00 8.48   ? 213 SER A C     1 
ATOM   1699 O  O     . SER A 1 216 ? 61.779 -0.089  1.157   1.00 8.00   ? 213 SER A O     1 
ATOM   1700 C  CB    A SER A 1 216 ? 62.193 0.199   4.474   0.82 9.27   ? 213 SER A CB    1 
ATOM   1701 C  CB    B SER A 1 216 ? 62.331 0.194   4.482   0.18 9.26   ? 213 SER A CB    1 
ATOM   1702 O  OG    A SER A 1 216 ? 62.433 1.138   5.529   0.82 9.57   ? 213 SER A OG    1 
ATOM   1703 O  OG    B SER A 1 216 ? 60.968 -0.137  4.390   0.18 9.38   ? 213 SER A OG    1 
ATOM   1704 N  N     . ALA A 1 217 ? 63.353 -1.373  2.076   1.00 6.81   ? 214 ALA A N     1 
ATOM   1705 C  CA    . ALA A 1 217 ? 63.150 -2.370  1.050   1.00 6.04   ? 214 ALA A CA    1 
ATOM   1706 C  C     . ALA A 1 217 ? 63.484 -3.749  1.534   1.00 6.90   ? 214 ALA A C     1 
ATOM   1707 O  O     . ALA A 1 217 ? 64.239 -3.895  2.482   1.00 6.55   ? 214 ALA A O     1 
ATOM   1708 C  CB    . ALA A 1 217 ? 63.976 -2.071  -0.230  1.00 9.25   ? 214 ALA A CB    1 
ATOM   1709 N  N     . GLY A 1 218 ? 62.861 -4.739  0.894   1.00 6.42   ? 215 GLY A N     1 
ATOM   1710 C  CA    . GLY A 1 218 ? 63.204 -6.145  1.130   1.00 7.32   ? 215 GLY A CA    1 
ATOM   1711 C  C     . GLY A 1 218 ? 63.741 -6.738  -0.152  1.00 7.13   ? 215 GLY A C     1 
ATOM   1712 O  O     . GLY A 1 218 ? 63.209 -6.444  -1.212  1.00 6.76   ? 215 GLY A O     1 
ATOM   1713 N  N     . ILE A 1 219 ? 64.783 -7.571  -0.075  1.00 6.57   ? 216 ILE A N     1 
ATOM   1714 C  CA    . ILE A 1 219 ? 65.297 -8.280  -1.245  1.00 5.76   ? 216 ILE A CA    1 
ATOM   1715 C  C     . ILE A 1 219 ? 65.278 -9.771  -0.941  1.00 7.21   ? 216 ILE A C     1 
ATOM   1716 O  O     . ILE A 1 219 ? 65.857 -10.199 0.073   1.00 6.89   ? 216 ILE A O     1 
ATOM   1717 C  CB    . ILE A 1 219 ? 66.746 -7.846  -1.562  1.00 7.89   ? 216 ILE A CB    1 
ATOM   1718 C  CG1   . ILE A 1 219 ? 66.835 -6.317  -1.761  1.00 9.29   ? 216 ILE A CG1   1 
ATOM   1719 C  CG2   . ILE A 1 219 ? 67.259 -8.545  -2.838  1.00 10.10  ? 216 ILE A CG2   1 
ATOM   1720 C  CD1   . ILE A 1 219 ? 67.228 -5.513  -0.516  1.00 9.76   ? 216 ILE A CD1   1 
ATOM   1721 N  N     . SER A 1 220 ? 64.609 -10.537 -1.795  1.00 6.78   ? 217 SER A N     1 
ATOM   1722 C  CA    . SER A 1 220 ? 64.596 -11.995 -1.653  1.00 5.90   ? 217 SER A CA    1 
ATOM   1723 C  C     . SER A 1 220 ? 64.289 -12.645 -2.991  1.00 7.92   ? 217 SER A C     1 
ATOM   1724 O  O     . SER A 1 220 ? 64.539 -12.063 -4.028  1.00 7.89   ? 217 SER A O     1 
ATOM   1725 C  CB    . SER A 1 220 ? 63.594 -12.393 -0.565  1.00 8.48   ? 217 SER A CB    1 
ATOM   1726 O  OG    . SER A 1 220 ? 63.795 -13.756 -0.209  1.00 7.89   ? 217 SER A OG    1 
ATOM   1727 N  N     . HIS A 1 221 ? 63.781 -13.872 -2.970  1.00 7.73   ? 218 HIS A N     1 
ATOM   1728 C  CA    . HIS A 1 221 ? 63.542 -14.617 -4.196  1.00 8.44   ? 218 HIS A CA    1 
ATOM   1729 C  C     . HIS A 1 221 ? 62.090 -14.590 -4.658  1.00 7.95   ? 218 HIS A C     1 
ATOM   1730 O  O     . HIS A 1 221 ? 61.766 -15.159 -5.703  1.00 9.42   ? 218 HIS A O     1 
ATOM   1731 C  CB    . HIS A 1 221 ? 63.994 -16.085 -4.002  1.00 8.32   ? 218 HIS A CB    1 
ATOM   1732 C  CG    . HIS A 1 221 ? 65.481 -16.250 -3.931  1.00 8.59   ? 218 HIS A CG    1 
ATOM   1733 N  ND1   . HIS A 1 221 ? 66.312 -15.930 -4.987  1.00 8.54   ? 218 HIS A ND1   1 
ATOM   1734 C  CD2   . HIS A 1 221 ? 66.288 -16.724 -2.947  1.00 8.05   ? 218 HIS A CD2   1 
ATOM   1735 C  CE1   . HIS A 1 221 ? 67.567 -16.180 -4.647  1.00 9.65   ? 218 HIS A CE1   1 
ATOM   1736 N  NE2   . HIS A 1 221 ? 67.580 -16.673 -3.418  1.00 10.96  ? 218 HIS A NE2   1 
ATOM   1737 N  N     . ASN A 1 222 ? 61.215 -13.935 -3.908  1.00 7.38   ? 219 ASN A N     1 
ATOM   1738 C  CA    . ASN A 1 222 ? 59.810 -13.868 -4.294  1.00 6.59   ? 219 ASN A CA    1 
ATOM   1739 C  C     . ASN A 1 222 ? 59.160 -12.689 -3.556  1.00 7.10   ? 219 ASN A C     1 
ATOM   1740 O  O     . ASN A 1 222 ? 59.758 -12.074 -2.643  1.00 9.31   ? 219 ASN A O     1 
ATOM   1741 C  CB    . ASN A 1 222 ? 59.081 -15.191 -4.022  1.00 8.10   ? 219 ASN A CB    1 
ATOM   1742 C  CG    . ASN A 1 222 ? 59.206 -15.641 -2.577  1.00 9.77   ? 219 ASN A CG    1 
ATOM   1743 O  OD1   . ASN A 1 222 ? 58.742 -14.956 -1.662  1.00 9.25   ? 219 ASN A OD1   1 
ATOM   1744 N  ND2   . ASN A 1 222 ? 59.808 -16.830 -2.366  1.00 9.26   ? 219 ASN A ND2   1 
ATOM   1745 N  N     . LYS A 1 223 ? 57.935 -12.384 -3.966  1.00 8.69   ? 220 LYS A N     1 
ATOM   1746 C  CA    . LYS A 1 223 ? 57.232 -11.237 -3.416  1.00 8.71   ? 220 LYS A CA    1 
ATOM   1747 C  C     . LYS A 1 223 ? 56.912 -11.364 -1.925  1.00 9.50   ? 220 LYS A C     1 
ATOM   1748 O  O     . LYS A 1 223 ? 57.052 -10.381 -1.190  1.00 8.88   ? 220 LYS A O     1 
ATOM   1749 C  CB    . LYS A 1 223 ? 55.962 -10.960 -4.245  1.00 9.83   ? 220 LYS A CB    1 
ATOM   1750 C  CG    . LYS A 1 223 ? 56.249 -10.504 -5.672  1.00 11.17  ? 220 LYS A CG    1 
ATOM   1751 C  CD    . LYS A 1 223 ? 55.039 -10.697 -6.598  1.00 22.99  ? 220 LYS A CD    1 
ATOM   1752 C  CE    . LYS A 1 223 ? 53.879 -9.835  -6.231  1.00 20.56  ? 220 LYS A CE    1 
ATOM   1753 N  NZ    . LYS A 1 223 ? 52.743 -9.969  -7.250  1.00 18.03  ? 220 LYS A NZ    1 
ATOM   1754 N  N     . VAL A 1 224 ? 56.479 -12.540 -1.470  1.00 9.46   ? 221 VAL A N     1 
ATOM   1755 C  CA    . VAL A 1 224 ? 56.108 -12.686 -0.073  1.00 9.36   ? 221 VAL A CA    1 
ATOM   1756 C  C     . VAL A 1 224 ? 57.310 -12.481 0.846   1.00 7.88   ? 221 VAL A C     1 
ATOM   1757 O  O     . VAL A 1 224 ? 57.210 -11.739 1.843   1.00 8.09   ? 221 VAL A O     1 
ATOM   1758 C  CB    . VAL A 1 224 ? 55.433 -14.038 0.215   1.00 10.55  ? 221 VAL A CB    1 
ATOM   1759 C  CG1   . VAL A 1 224 ? 55.417 -14.332 1.711   1.00 14.02  ? 221 VAL A CG1   1 
ATOM   1760 C  CG2   . VAL A 1 224 ? 54.009 -14.012 -0.346  1.00 12.38  ? 221 VAL A CG2   1 
ATOM   1761 N  N     . LEU A 1 225 ? 58.449 -13.078 0.492   1.00 7.23   ? 222 LEU A N     1 
ATOM   1762 C  CA    . LEU A 1 225 ? 59.648 -12.907 1.306   1.00 7.01   ? 222 LEU A CA    1 
ATOM   1763 C  C     . LEU A 1 225 ? 60.193 -11.495 1.196   1.00 7.55   ? 222 LEU A C     1 
ATOM   1764 O  O     . LEU A 1 225 ? 60.681 -10.949 2.177   1.00 7.93   ? 222 LEU A O     1 
ATOM   1765 C  CB    . LEU A 1 225 ? 60.753 -13.918 0.950   1.00 5.66   ? 222 LEU A CB    1 
ATOM   1766 C  CG    . LEU A 1 225 ? 60.425 -15.370 1.341   1.00 7.70   ? 222 LEU A CG    1 
ATOM   1767 C  CD1   . LEU A 1 225 ? 61.587 -16.267 0.947   1.00 7.91   ? 222 LEU A CD1   1 
ATOM   1768 C  CD2   . LEU A 1 225 ? 60.145 -15.463 2.818   1.00 11.87  ? 222 LEU A CD2   1 
ATOM   1769 N  N     . ALA A 1 226 ? 60.095 -10.888 0.013   1.00 6.86   ? 223 ALA A N     1 
ATOM   1770 C  CA    . ALA A 1 226 ? 60.593 -9.524  -0.098  1.00 6.16   ? 223 ALA A CA    1 
ATOM   1771 C  C     . ALA A 1 226 ? 59.779 -8.560  0.757   1.00 8.05   ? 223 ALA A C     1 
ATOM   1772 O  O     . ALA A 1 226 ? 60.333 -7.632  1.363   1.00 6.83   ? 223 ALA A O     1 
ATOM   1773 C  CB    . ALA A 1 226 ? 60.565 -9.088  -1.554  1.00 8.85   ? 223 ALA A CB    1 
ATOM   1774 N  N     . LYS A 1 227 ? 58.460 -8.776  0.822   1.00 7.59   ? 224 LYS A N     1 
ATOM   1775 C  CA    . LYS A 1 227 ? 57.580 -7.923  1.621   1.00 8.66   ? 224 LYS A CA    1 
ATOM   1776 C  C     . LYS A 1 227 ? 57.875 -8.115  3.095   1.00 9.89   ? 224 LYS A C     1 
ATOM   1777 O  O     . LYS A 1 227 ? 57.966 -7.137  3.832   1.00 10.71  ? 224 LYS A O     1 
ATOM   1778 C  CB    . LYS A 1 227 ? 56.099 -8.253  1.328   1.00 8.01   ? 224 LYS A CB    1 
ATOM   1779 C  CG    A LYS A 1 227 ? 55.087 -7.486  2.184   0.52 10.31  ? 224 LYS A CG    1 
ATOM   1780 C  CG    B LYS A 1 227 ? 55.096 -7.537  2.230   0.48 10.31  ? 224 LYS A CG    1 
ATOM   1781 C  CD    A LYS A 1 227 ? 55.250 -5.963  2.067   0.52 15.03  ? 224 LYS A CD    1 
ATOM   1782 C  CD    B LYS A 1 227 ? 55.036 -6.036  1.955   0.48 15.29  ? 224 LYS A CD    1 
ATOM   1783 C  CE    A LYS A 1 227 ? 54.050 -5.230  2.697   0.52 18.87  ? 224 LYS A CE    1 
ATOM   1784 C  CE    B LYS A 1 227 ? 54.058 -5.337  2.914   0.48 18.86  ? 224 LYS A CE    1 
ATOM   1785 N  NZ    A LYS A 1 227 ? 54.265 -3.754  2.820   0.52 16.26  ? 224 LYS A NZ    1 
ATOM   1786 N  NZ    B LYS A 1 227 ? 52.739 -6.024  3.025   0.48 19.99  ? 224 LYS A NZ    1 
ATOM   1787 N  N     . LEU A 1 228 ? 58.027 -9.373  3.509   1.00 9.32   ? 225 LEU A N     1 
ATOM   1788 C  CA    . LEU A 1 228 ? 58.317 -9.683  4.892   1.00 9.52   ? 225 LEU A CA    1 
ATOM   1789 C  C     . LEU A 1 228 ? 59.666 -9.059  5.288   1.00 9.60   ? 225 LEU A C     1 
ATOM   1790 O  O     . LEU A 1 228 ? 59.800 -8.386  6.335   1.00 9.59   ? 225 LEU A O     1 
ATOM   1791 C  CB    . LEU A 1 228 ? 58.299 -11.192 5.078   1.00 10.43  ? 225 LEU A CB    1 
ATOM   1792 C  CG    . LEU A 1 228 ? 58.491 -11.647 6.513   1.00 16.37  ? 225 LEU A CG    1 
ATOM   1793 C  CD1   . LEU A 1 228 ? 57.265 -11.238 7.321   1.00 18.42  ? 225 LEU A CD1   1 
ATOM   1794 C  CD2   . LEU A 1 228 ? 58.720 -13.153 6.592   1.00 12.56  ? 225 LEU A CD2   1 
ATOM   1795 N  N     . ALA A 1 229 ? 60.651 -9.222  4.410   1.00 8.35   ? 226 ALA A N     1 
ATOM   1796 C  CA    . ALA A 1 229 ? 61.986 -8.665  4.616   1.00 9.58   ? 226 ALA A CA    1 
ATOM   1797 C  C     . ALA A 1 229 ? 61.945 -7.141  4.816   1.00 9.85   ? 226 ALA A C     1 
ATOM   1798 O  O     . ALA A 1 229 ? 62.641 -6.615  5.678   1.00 10.98  ? 226 ALA A O     1 
ATOM   1799 C  CB    . ALA A 1 229 ? 62.885 -9.006  3.436   1.00 8.11   ? 226 ALA A CB    1 
ATOM   1800 N  N     . CYS A 1 230 ? 61.143 -6.449  4.000   1.00 8.52   ? 227 CYS A N     1 
ATOM   1801 C  CA    . CYS A 1 230 ? 61.110 -4.992  4.028   1.00 9.16   ? 227 CYS A CA    1 
ATOM   1802 C  C     . CYS A 1 230 ? 60.791 -4.485  5.425   1.00 11.22  ? 227 CYS A C     1 
ATOM   1803 O  O     . CYS A 1 230 ? 61.437 -3.565  5.931   1.00 11.59  ? 227 CYS A O     1 
ATOM   1804 C  CB    . CYS A 1 230 ? 60.057 -4.507  3.027   1.00 7.28   ? 227 CYS A CB    1 
ATOM   1805 S  SG    . CYS A 1 230 ? 59.978 -2.710  2.879   1.00 10.95  ? 227 CYS A SG    1 
ATOM   1806 N  N     . GLY A 1 231 ? 59.817 -5.114  6.065   1.00 10.31  ? 228 GLY A N     1 
ATOM   1807 C  CA    . GLY A 1 231 ? 59.409 -4.645  7.379   1.00 12.63  ? 228 GLY A CA    1 
ATOM   1808 C  C     . GLY A 1 231 ? 60.352 -4.973  8.525   1.00 12.60  ? 228 GLY A C     1 
ATOM   1809 O  O     . GLY A 1 231 ? 60.187 -4.444  9.616   1.00 16.36  ? 228 GLY A O     1 
ATOM   1810 N  N     . LEU A 1 232 ? 61.337 -5.825  8.289   1.00 11.39  ? 229 LEU A N     1 
ATOM   1811 C  CA    . LEU A 1 232 ? 62.200 -6.282  9.382   1.00 10.09  ? 229 LEU A CA    1 
ATOM   1812 C  C     . LEU A 1 232 ? 63.083 -5.162  9.952   1.00 11.70  ? 229 LEU A C     1 
ATOM   1813 O  O     . LEU A 1 232 ? 63.405 -5.178  11.169  1.00 12.73  ? 229 LEU A O     1 
ATOM   1814 C  CB    . LEU A 1 232 ? 63.068 -7.471  8.941   1.00 11.03  ? 229 LEU A CB    1 
ATOM   1815 C  CG    . LEU A 1 232 ? 62.264 -8.752  8.664   1.00 12.72  ? 229 LEU A CG    1 
ATOM   1816 C  CD1   . LEU A 1 232 ? 63.201 -9.870  8.191   1.00 13.52  ? 229 LEU A CD1   1 
ATOM   1817 C  CD2   . LEU A 1 232 ? 61.470 -9.154  9.921   1.00 15.63  ? 229 LEU A CD2   1 
ATOM   1818 N  N     . ASN A 1 233 ? 63.481 -4.197  9.114   1.00 10.15  ? 230 ASN A N     1 
ATOM   1819 C  CA    . ASN A 1 233 ? 64.376 -3.138  9.588   1.00 9.07   ? 230 ASN A CA    1 
ATOM   1820 C  C     . ASN A 1 233 ? 63.983 -1.709  9.197   1.00 12.80  ? 230 ASN A C     1 
ATOM   1821 O  O     . ASN A 1 233 ? 64.802 -0.774  9.250   1.00 14.36  ? 230 ASN A O     1 
ATOM   1822 C  CB    . ASN A 1 233 ? 65.823 -3.434  9.215   1.00 11.10  ? 230 ASN A CB    1 
ATOM   1823 C  CG    . ASN A 1 233 ? 66.361 -4.645  9.953   1.00 13.22  ? 230 ASN A CG    1 
ATOM   1824 O  OD1   . ASN A 1 233 ? 66.662 -4.548  11.143  1.00 13.45  ? 230 ASN A OD1   1 
ATOM   1825 N  ND2   . ASN A 1 233 ? 66.466 -5.790  9.264   1.00 11.37  ? 230 ASN A ND2   1 
ATOM   1826 N  N     . LYS A 1 234 ? 62.712 -1.544  8.885   1.00 16.20  ? 231 LYS A N     1 
ATOM   1827 C  CA    . LYS A 1 234 ? 62.123 -0.227  8.647   1.00 12.59  ? 231 LYS A CA    1 
ATOM   1828 C  C     . LYS A 1 234 ? 62.283 0.628   9.914   1.00 15.40  ? 231 LYS A C     1 
ATOM   1829 O  O     . LYS A 1 234 ? 62.078 0.105   11.027  1.00 20.78  ? 231 LYS A O     1 
ATOM   1830 C  CB    . LYS A 1 234 ? 60.647 -0.475  8.315   1.00 18.15  ? 231 LYS A CB    1 
ATOM   1831 C  CG    . LYS A 1 234 ? 59.947 0.555   7.503   1.00 18.34  ? 231 LYS A CG    1 
ATOM   1832 C  CD    . LYS A 1 234 ? 58.523 0.119   7.198   1.00 13.52  ? 231 LYS A CD    1 
ATOM   1833 C  CE    . LYS A 1 234 ? 58.240 0.196   5.693   1.00 15.09  ? 231 LYS A CE    1 
ATOM   1834 N  NZ    . LYS A 1 234 ? 58.366 1.607   5.164   1.00 10.10  ? 231 LYS A NZ    1 
ATOM   1835 N  N     . PRO A 1 235 ? 62.597 1.943   9.790   1.00 13.15  ? 232 PRO A N     1 
ATOM   1836 C  CA    . PRO A 1 235 ? 62.655 2.749   8.560   1.00 11.48  ? 232 PRO A CA    1 
ATOM   1837 C  C     . PRO A 1 235 ? 64.056 2.981   8.035   1.00 11.62  ? 232 PRO A C     1 
ATOM   1838 O  O     . PRO A 1 235 ? 65.068 2.772   8.728   1.00 12.70  ? 232 PRO A O     1 
ATOM   1839 C  CB    . PRO A 1 235 ? 62.099 4.111   9.017   1.00 13.86  ? 232 PRO A CB    1 
ATOM   1840 C  CG    . PRO A 1 235 ? 62.576 4.225   10.451  1.00 14.81  ? 232 PRO A CG    1 
ATOM   1841 C  CD    . PRO A 1 235 ? 62.675 2.806   10.986  1.00 16.16  ? 232 PRO A CD    1 
ATOM   1842 N  N     . ASN A 1 236 ? 64.103 3.418   6.786   1.00 9.49   ? 233 ASN A N     1 
ATOM   1843 C  CA    . ASN A 1 236 ? 65.348 3.812   6.115   1.00 9.31   ? 233 ASN A CA    1 
ATOM   1844 C  C     . ASN A 1 236 ? 66.436 2.748   6.051   1.00 7.68   ? 233 ASN A C     1 
ATOM   1845 O  O     . ASN A 1 236 ? 67.614 3.070   6.106   1.00 10.75  ? 233 ASN A O     1 
ATOM   1846 C  CB    . ASN A 1 236 ? 65.898 5.098   6.737   1.00 11.84  ? 233 ASN A CB    1 
ATOM   1847 C  CG    . ASN A 1 236 ? 66.842 5.835   5.822   1.00 12.54  ? 233 ASN A CG    1 
ATOM   1848 O  OD1   . ASN A 1 236 ? 66.735 5.769   4.601   1.00 16.75  ? 233 ASN A OD1   1 
ATOM   1849 N  ND2   . ASN A 1 236 ? 67.801 6.533   6.423   1.00 19.16  ? 233 ASN A ND2   1 
ATOM   1850 N  N     . ARG A 1 237 ? 66.034 1.476   5.948   1.00 8.56   ? 234 ARG A N     1 
ATOM   1851 C  CA    . ARG A 1 237 ? 67.013 0.390   5.804   1.00 8.58   ? 234 ARG A CA    1 
ATOM   1852 C  C     . ARG A 1 237 ? 66.464 -0.641  4.863   1.00 9.85   ? 234 ARG A C     1 
ATOM   1853 O  O     . ARG A 1 237 ? 65.269 -0.650  4.571   1.00 9.20   ? 234 ARG A O     1 
ATOM   1854 C  CB    . ARG A 1 237 ? 67.310 -0.298  7.150   1.00 9.62   ? 234 ARG A CB    1 
ATOM   1855 C  CG    . ARG A 1 237 ? 67.906 0.599   8.213   1.00 11.68  ? 234 ARG A CG    1 
ATOM   1856 C  CD    . ARG A 1 237 ? 69.325 0.980   7.849   1.00 14.99  ? 234 ARG A CD    1 
ATOM   1857 N  NE    . ARG A 1 237 ? 69.999 1.708   8.923   1.00 17.20  ? 234 ARG A NE    1 
ATOM   1858 C  CZ    . ARG A 1 237 ? 70.060 3.037   8.990   1.00 22.62  ? 234 ARG A CZ    1 
ATOM   1859 N  NH1   . ARG A 1 237 ? 69.465 3.779   8.062   1.00 22.70  ? 234 ARG A NH1   1 
ATOM   1860 N  NH2   . ARG A 1 237 ? 70.701 3.624   9.995   1.00 29.08  ? 234 ARG A NH2   1 
ATOM   1861 N  N     . GLN A 1 238 ? 67.314 -1.519  4.357   1.00 8.77   ? 235 GLN A N     1 
ATOM   1862 C  CA    . GLN A 1 238 ? 66.830 -2.599  3.511   1.00 8.62   ? 235 GLN A CA    1 
ATOM   1863 C  C     . GLN A 1 238 ? 67.335 -3.909  4.076   1.00 8.76   ? 235 GLN A C     1 
ATOM   1864 O  O     . GLN A 1 238 ? 68.369 -3.938  4.740   1.00 9.39   ? 235 GLN A O     1 
ATOM   1865 C  CB    . GLN A 1 238 ? 67.281 -2.433  2.057   1.00 8.46   ? 235 GLN A CB    1 
ATOM   1866 C  CG    . GLN A 1 238 ? 68.787 -2.228  1.867   1.00 10.78  ? 235 GLN A CG    1 
ATOM   1867 C  CD    . GLN A 1 238 ? 69.141 -1.990  0.402   1.00 11.59  ? 235 GLN A CD    1 
ATOM   1868 O  OE1   . GLN A 1 238 ? 68.739 -0.986  -0.192  1.00 12.31  ? 235 GLN A OE1   1 
ATOM   1869 N  NE2   . GLN A 1 238 ? 69.861 -2.917  -0.193  1.00 9.14   ? 235 GLN A NE2   1 
ATOM   1870 N  N     . THR A 1 239 ? 66.607 -4.990  3.800   1.00 7.13   ? 236 THR A N     1 
ATOM   1871 C  CA    . THR A 1 239 ? 66.897 -6.278  4.427   1.00 7.27   ? 236 THR A CA    1 
ATOM   1872 C  C     . THR A 1 239 ? 66.929 -7.367  3.360   1.00 8.32   ? 236 THR A C     1 
ATOM   1873 O  O     . THR A 1 239 ? 66.015 -7.453  2.536   1.00 8.42   ? 236 THR A O     1 
ATOM   1874 C  CB    . THR A 1 239 ? 65.849 -6.624  5.454   1.00 8.35   ? 236 THR A CB    1 
ATOM   1875 O  OG1   . THR A 1 239 ? 65.823 -5.604  6.445   1.00 9.53   ? 236 THR A OG1   1 
ATOM   1876 C  CG2   . THR A 1 239 ? 66.186 -7.936  6.164   1.00 9.95   ? 236 THR A CG2   1 
ATOM   1877 N  N     . LEU A 1 240 ? 67.998 -8.176  3.371   1.00 6.99   ? 237 LEU A N     1 
ATOM   1878 C  CA    . LEU A 1 240 ? 68.129 -9.316  2.472   1.00 6.50   ? 237 LEU A CA    1 
ATOM   1879 C  C     . LEU A 1 240 ? 67.735 -10.592 3.235   1.00 6.74   ? 237 LEU A C     1 
ATOM   1880 O  O     . LEU A 1 240 ? 68.320 -10.896 4.287   1.00 8.46   ? 237 LEU A O     1 
ATOM   1881 C  CB    . LEU A 1 240 ? 69.576 -9.412  1.939   1.00 6.96   ? 237 LEU A CB    1 
ATOM   1882 C  CG    . LEU A 1 240 ? 69.974 -10.421 0.857   1.00 8.28   ? 237 LEU A CG    1 
ATOM   1883 C  CD1   . LEU A 1 240 ? 71.307 -9.992  0.229   1.00 10.19  ? 237 LEU A CD1   1 
ATOM   1884 C  CD2   . LEU A 1 240 ? 70.125 -11.855 1.421   1.00 9.25   ? 237 LEU A CD2   1 
ATOM   1885 N  N     . VAL A 1 241 ? 66.744 -11.307 2.708   1.00 5.54   ? 238 VAL A N     1 
ATOM   1886 C  CA    . VAL A 1 241 ? 66.282 -12.592 3.268   1.00 5.77   ? 238 VAL A CA    1 
ATOM   1887 C  C     . VAL A 1 241 ? 66.665 -13.672 2.266   1.00 8.03   ? 238 VAL A C     1 
ATOM   1888 O  O     . VAL A 1 241 ? 66.085 -13.769 1.174   1.00 9.17   ? 238 VAL A O     1 
ATOM   1889 C  CB    . VAL A 1 241 ? 64.767 -12.599 3.557   1.00 5.73   ? 238 VAL A CB    1 
ATOM   1890 C  CG1   . VAL A 1 241 ? 64.223 -14.032 3.764   1.00 8.79   ? 238 VAL A CG1   1 
ATOM   1891 C  CG2   . VAL A 1 241 ? 64.475 -11.749 4.793   1.00 8.31   ? 238 VAL A CG2   1 
ATOM   1892 N  N     . SER A 1 242 ? 67.685 -14.464 2.617   1.00 7.40   ? 239 SER A N     1 
ATOM   1893 C  CA    . SER A 1 242 ? 68.152 -15.525 1.741   1.00 8.85   ? 239 SER A CA    1 
ATOM   1894 C  C     . SER A 1 242 ? 67.286 -16.773 1.896   1.00 8.20   ? 239 SER A C     1 
ATOM   1895 O  O     . SER A 1 242 ? 66.545 -16.899 2.858   1.00 8.65   ? 239 SER A O     1 
ATOM   1896 C  CB    . SER A 1 242 ? 69.602 -15.895 2.096   1.00 12.10  ? 239 SER A CB    1 
ATOM   1897 O  OG    . SER A 1 242 ? 69.630 -16.446 3.404   1.00 13.55  ? 239 SER A OG    1 
ATOM   1898 N  N     . HIS A 1 243 ? 67.392 -17.701 0.953   1.00 8.33   ? 240 HIS A N     1 
ATOM   1899 C  CA    . HIS A 1 243 ? 66.649 -18.959 1.055   1.00 6.81   ? 240 HIS A CA    1 
ATOM   1900 C  C     . HIS A 1 243 ? 67.057 -19.685 2.349   1.00 8.75   ? 240 HIS A C     1 
ATOM   1901 O  O     . HIS A 1 243 ? 66.179 -20.240 3.064   1.00 9.35   ? 240 HIS A O     1 
ATOM   1902 C  CB    . HIS A 1 243 ? 66.871 -19.850 -0.176  1.00 10.81  ? 240 HIS A CB    1 
ATOM   1903 C  CG    . HIS A 1 243 ? 66.071 -21.123 -0.154  1.00 11.88  ? 240 HIS A CG    1 
ATOM   1904 N  ND1   . HIS A 1 243 ? 64.703 -21.153 -0.308  1.00 17.28  ? 240 HIS A ND1   1 
ATOM   1905 C  CD2   . HIS A 1 243 ? 66.456 -22.408 0.041   1.00 18.73  ? 240 HIS A CD2   1 
ATOM   1906 C  CE1   . HIS A 1 243 ? 64.279 -22.406 -0.232  1.00 17.58  ? 240 HIS A CE1   1 
ATOM   1907 N  NE2   . HIS A 1 243 ? 65.325 -23.186 -0.012  1.00 16.06  ? 240 HIS A NE2   1 
ATOM   1908 N  N     . GLY A 1 244 ? 68.364 -19.649 2.641   1.00 9.22   ? 241 GLY A N     1 
ATOM   1909 C  CA    . GLY A 1 244 ? 68.887 -20.331 3.828   1.00 9.42   ? 241 GLY A CA    1 
ATOM   1910 C  C     . GLY A 1 244 ? 68.361 -19.774 5.139   1.00 9.57   ? 241 GLY A C     1 
ATOM   1911 O  O     . GLY A 1 244 ? 68.293 -20.485 6.133   1.00 11.58  ? 241 GLY A O     1 
ATOM   1912 N  N     . SER A 1 245 ? 67.996 -18.496 5.155   1.00 7.75   ? 242 SER A N     1 
ATOM   1913 C  CA    . SER A 1 245 ? 67.484 -17.840 6.353   1.00 8.99   ? 242 SER A CA    1 
ATOM   1914 C  C     . SER A 1 245 ? 66.059 -18.254 6.711   1.00 9.55   ? 242 SER A C     1 
ATOM   1915 O  O     . SER A 1 245 ? 65.604 -17.986 7.819   1.00 8.60   ? 242 SER A O     1 
ATOM   1916 C  CB    . SER A 1 245 ? 67.572 -16.308 6.223   1.00 10.78  ? 242 SER A CB    1 
ATOM   1917 O  OG    . SER A 1 245 ? 66.482 -15.800 5.456   1.00 10.59  ? 242 SER A OG    1 
ATOM   1918 N  N     . VAL A 1 246 ? 65.361 -18.929 5.798   1.00 8.85   ? 243 VAL A N     1 
ATOM   1919 C  CA    . VAL A 1 246 ? 63.933 -19.157 5.994   1.00 8.26   ? 243 VAL A CA    1 
ATOM   1920 C  C     . VAL A 1 246 ? 63.565 -20.074 7.189   1.00 8.83   ? 243 VAL A C     1 
ATOM   1921 O  O     . VAL A 1 246 ? 62.679 -19.724 7.979   1.00 9.86   ? 243 VAL A O     1 
ATOM   1922 C  CB    . VAL A 1 246 ? 63.261 -19.597 4.676   1.00 7.56   ? 243 VAL A CB    1 
ATOM   1923 C  CG1   . VAL A 1 246 ? 61.821 -20.040 4.893   1.00 10.27  ? 243 VAL A CG1   1 
ATOM   1924 C  CG2   . VAL A 1 246 ? 63.310 -18.428 3.687   1.00 9.53   ? 243 VAL A CG2   1 
ATOM   1925 N  N     . PRO A 1 247 ? 64.245 -21.231 7.350   1.00 7.55   ? 244 PRO A N     1 
ATOM   1926 C  CA    . PRO A 1 247 ? 63.824 -22.096 8.464   1.00 7.47   ? 244 PRO A CA    1 
ATOM   1927 C  C     . PRO A 1 247 ? 63.873 -21.395 9.820   1.00 8.02   ? 244 PRO A C     1 
ATOM   1928 O  O     . PRO A 1 247 ? 62.890 -21.480 10.567  1.00 9.80   ? 244 PRO A O     1 
ATOM   1929 C  CB    . PRO A 1 247 ? 64.830 -23.255 8.402   1.00 10.61  ? 244 PRO A CB    1 
ATOM   1930 C  CG    . PRO A 1 247 ? 65.147 -23.358 6.927   1.00 11.44  ? 244 PRO A CG    1 
ATOM   1931 C  CD    . PRO A 1 247 ? 65.251 -21.902 6.493   1.00 8.96   ? 244 PRO A CD    1 
ATOM   1932 N  N     . GLN A 1 248 ? 64.961 -20.707 10.134  1.00 9.01   ? 245 GLN A N     1 
ATOM   1933 C  CA    . GLN A 1 248 ? 64.995 -20.028 11.416  1.00 9.19   ? 245 GLN A CA    1 
ATOM   1934 C  C     . GLN A 1 248 ? 63.980 -18.889 11.477  1.00 8.11   ? 245 GLN A C     1 
ATOM   1935 O  O     . GLN A 1 248 ? 63.285 -18.738 12.483  1.00 8.85   ? 245 GLN A O     1 
ATOM   1936 C  CB    . GLN A 1 248 ? 66.404 -19.524 11.748  1.00 12.45  ? 245 GLN A CB    1 
ATOM   1937 C  CG    . GLN A 1 248 ? 67.349 -20.686 12.082  1.00 17.04  ? 245 GLN A CG    1 
ATOM   1938 C  CD    . GLN A 1 248 ? 68.491 -20.312 13.034  1.00 24.14  ? 245 GLN A CD    1 
ATOM   1939 O  OE1   . GLN A 1 248 ? 68.272 -20.178 14.235  1.00 30.45  ? 245 GLN A OE1   1 
ATOM   1940 N  NE2   . GLN A 1 248 ? 69.723 -20.174 12.499  1.00 24.76  ? 245 GLN A NE2   1 
ATOM   1941 N  N     . LEU A 1 249 ? 63.879 -18.098 10.401  1.00 7.60   ? 246 LEU A N     1 
ATOM   1942 C  CA    . LEU A 1 249 ? 62.983 -16.953 10.385  1.00 8.28   ? 246 LEU A CA    1 
ATOM   1943 C  C     . LEU A 1 249 ? 61.541 -17.401 10.579  1.00 7.35   ? 246 LEU A C     1 
ATOM   1944 O  O     . LEU A 1 249 ? 60.782 -16.777 11.341  1.00 9.75   ? 246 LEU A O     1 
ATOM   1945 C  CB    . LEU A 1 249 ? 63.096 -16.226 9.034   1.00 9.87   ? 246 LEU A CB    1 
ATOM   1946 C  CG    . LEU A 1 249 ? 62.174 -15.025 8.834   1.00 8.54   ? 246 LEU A CG    1 
ATOM   1947 C  CD1   . LEU A 1 249 ? 62.523 -13.919 9.836   1.00 13.06  ? 246 LEU A CD1   1 
ATOM   1948 C  CD2   . LEU A 1 249 ? 62.342 -14.549 7.386   1.00 12.48  ? 246 LEU A CD2   1 
ATOM   1949 N  N     . PHE A 1 250 ? 61.175 -18.493 9.927   1.00 7.07   ? 247 PHE A N     1 
ATOM   1950 C  CA    . PHE A 1 250 ? 59.786 -18.944 9.987   1.00 6.50   ? 247 PHE A CA    1 
ATOM   1951 C  C     . PHE A 1 250 ? 59.466 -19.717 11.248  1.00 7.80   ? 247 PHE A C     1 
ATOM   1952 O  O     . PHE A 1 250 ? 58.298 -19.910 11.577  1.00 7.42   ? 247 PHE A O     1 
ATOM   1953 C  CB    . PHE A 1 250 ? 59.437 -19.794 8.771   1.00 8.36   ? 247 PHE A CB    1 
ATOM   1954 C  CG    . PHE A 1 250 ? 59.075 -19.001 7.546   1.00 5.91   ? 247 PHE A CG    1 
ATOM   1955 C  CD1   . PHE A 1 250 ? 59.214 -17.615 7.497   1.00 9.09   ? 247 PHE A CD1   1 
ATOM   1956 C  CD2   . PHE A 1 250 ? 58.561 -19.672 6.451   1.00 9.59   ? 247 PHE A CD2   1 
ATOM   1957 C  CE1   . PHE A 1 250 ? 58.840 -16.922 6.352   1.00 11.30  ? 247 PHE A CE1   1 
ATOM   1958 C  CE2   . PHE A 1 250 ? 58.183 -18.995 5.307   1.00 10.17  ? 247 PHE A CE2   1 
ATOM   1959 C  CZ    . PHE A 1 250 ? 58.310 -17.629 5.251   1.00 11.03  ? 247 PHE A CZ    1 
ATOM   1960 N  N     . SER A 1 251 ? 60.508 -20.165 11.957  1.00 7.65   ? 248 SER A N     1 
ATOM   1961 C  CA    . SER A 1 251 ? 60.290 -21.028 13.116  1.00 9.43   ? 248 SER A CA    1 
ATOM   1962 C  C     . SER A 1 251 ? 59.560 -20.325 14.244  1.00 9.59   ? 248 SER A C     1 
ATOM   1963 O  O     . SER A 1 251 ? 58.893 -20.985 15.023  1.00 7.72   ? 248 SER A O     1 
ATOM   1964 C  CB    . SER A 1 251 ? 61.618 -21.606 13.626  1.00 9.14   ? 248 SER A CB    1 
ATOM   1965 O  OG    . SER A 1 251 ? 62.391 -20.637 14.293  1.00 8.90   ? 248 SER A OG    1 
ATOM   1966 N  N     . GLN A 1 252 ? 59.665 -18.993 14.319  1.00 8.57   ? 249 GLN A N     1 
ATOM   1967 C  CA    . GLN A 1 252 ? 58.916 -18.239 15.320  1.00 9.96   ? 249 GLN A CA    1 
ATOM   1968 C  C     . GLN A 1 252 ? 58.073 -17.128 14.710  1.00 10.19  ? 249 GLN A C     1 
ATOM   1969 O  O     . GLN A 1 252 ? 57.750 -16.155 15.409  1.00 12.84  ? 249 GLN A O     1 
ATOM   1970 C  CB    . GLN A 1 252 ? 59.862 -17.601 16.337  1.00 15.47  ? 249 GLN A CB    1 
ATOM   1971 C  CG    . GLN A 1 252 ? 60.743 -18.569 17.092  1.00 14.58  ? 249 GLN A CG    1 
ATOM   1972 C  CD    . GLN A 1 252 ? 61.550 -17.833 18.143  1.00 16.69  ? 249 GLN A CD    1 
ATOM   1973 O  OE1   . GLN A 1 252 ? 61.106 -17.685 19.284  1.00 23.48  ? 249 GLN A OE1   1 
ATOM   1974 N  NE2   . GLN A 1 252 ? 62.710 -17.326 17.751  1.00 21.38  ? 249 GLN A NE2   1 
ATOM   1975 N  N     . MET A 1 253 ? 57.712 -17.260 13.433  1.00 8.82   ? 250 MET A N     1 
ATOM   1976 C  CA    . MET A 1 253 ? 57.024 -16.184 12.701  1.00 9.68   ? 250 MET A CA    1 
ATOM   1977 C  C     . MET A 1 253 ? 55.542 -16.476 12.756  1.00 8.48   ? 250 MET A C     1 
ATOM   1978 O  O     . MET A 1 253 ? 55.117 -17.464 12.192  1.00 8.77   ? 250 MET A O     1 
ATOM   1979 C  CB    . MET A 1 253 ? 57.492 -16.186 11.229  1.00 10.76  ? 250 MET A CB    1 
ATOM   1980 C  CG    . MET A 1 253 ? 56.859 -15.089 10.357  1.00 14.43  ? 250 MET A CG    1 
ATOM   1981 S  SD    . MET A 1 253 ? 57.204 -13.414 10.939  1.00 14.39  ? 250 MET A SD    1 
ATOM   1982 C  CE    . MET A 1 253 ? 58.991 -13.265 10.753  1.00 14.58  ? 250 MET A CE    1 
ATOM   1983 N  N     . PRO A 1 254 ? 54.749 -15.634 13.433  1.00 9.90   ? 251 PRO A N     1 
ATOM   1984 C  CA    . PRO A 1 254 ? 53.296 -15.862 13.464  1.00 8.94   ? 251 PRO A CA    1 
ATOM   1985 C  C     . PRO A 1 254 ? 52.739 -15.913 12.044  1.00 10.26  ? 251 PRO A C     1 
ATOM   1986 O  O     . PRO A 1 254 ? 53.161 -15.140 11.181  1.00 10.10  ? 251 PRO A O     1 
ATOM   1987 C  CB    . PRO A 1 254 ? 52.770 -14.616 14.207  1.00 9.89   ? 251 PRO A CB    1 
ATOM   1988 C  CG    . PRO A 1 254 ? 53.906 -14.192 15.053  1.00 11.43  ? 251 PRO A CG    1 
ATOM   1989 C  CD    . PRO A 1 254 ? 55.118 -14.397 14.139  1.00 9.48   ? 251 PRO A CD    1 
ATOM   1990 N  N     . ILE A 1 255 ? 51.818 -16.848 11.804  1.00 9.45   ? 252 ILE A N     1 
ATOM   1991 C  CA    . ILE A 1 255 ? 51.210 -17.039 10.502  1.00 9.70   ? 252 ILE A CA    1 
ATOM   1992 C  C     . ILE A 1 255 ? 50.623 -15.726 9.928   1.00 8.71   ? 252 ILE A C     1 
ATOM   1993 O  O     . ILE A 1 255 ? 50.763 -15.456 8.745   1.00 9.92   ? 252 ILE A O     1 
ATOM   1994 C  CB    . ILE A 1 255 ? 50.195 -18.214 10.580  1.00 13.83  ? 252 ILE A CB    1 
ATOM   1995 C  CG1   . ILE A 1 255 ? 50.976 -19.538 10.645  1.00 13.76  ? 252 ILE A CG1   1 
ATOM   1996 C  CG2   . ILE A 1 255 ? 49.216 -18.188 9.405   1.00 13.27  ? 252 ILE A CG2   1 
ATOM   1997 C  CD1   . ILE A 1 255 ? 50.189 -20.706 11.186  1.00 17.00  ? 252 ILE A CD1   1 
ATOM   1998 N  N     . ARG A 1 256 ? 50.021 -14.903 10.799  1.00 9.84   ? 253 ARG A N     1 
ATOM   1999 C  CA    . ARG A 1 256 ? 49.326 -13.715 10.347  1.00 9.99   ? 253 ARG A CA    1 
ATOM   2000 C  C     . ARG A 1 256 ? 50.270 -12.677 9.741   1.00 13.90  ? 253 ARG A C     1 
ATOM   2001 O  O     . ARG A 1 256 ? 49.819 -11.734 9.107   1.00 13.09  ? 253 ARG A O     1 
ATOM   2002 C  CB    . ARG A 1 256 ? 48.556 -13.089 11.515  1.00 13.13  ? 253 ARG A CB    1 
ATOM   2003 C  CG    . ARG A 1 256 ? 49.450 -12.488 12.578  1.00 14.02  ? 253 ARG A CG    1 
ATOM   2004 C  CD    . ARG A 1 256 ? 48.627 -11.860 13.696  1.00 17.49  ? 253 ARG A CD    1 
ATOM   2005 N  NE    . ARG A 1 256 ? 49.509 -11.390 14.771  1.00 17.78  ? 253 ARG A NE    1 
ATOM   2006 C  CZ    . ARG A 1 256 ? 49.921 -12.141 15.789  1.00 18.77  ? 253 ARG A CZ    1 
ATOM   2007 N  NH1   . ARG A 1 256 ? 49.530 -13.408 15.898  1.00 20.29  ? 253 ARG A NH1   1 
ATOM   2008 N  NH2   . ARG A 1 256 ? 50.731 -11.610 16.705  1.00 20.29  ? 253 ARG A NH2   1 
ATOM   2009 N  N     . LYS A 1 257 ? 51.580 -12.845 9.921   1.00 11.08  ? 254 LYS A N     1 
ATOM   2010 C  CA    . LYS A 1 257 ? 52.522 -11.847 9.397   1.00 10.63  ? 254 LYS A CA    1 
ATOM   2011 C  C     . LYS A 1 257 ? 52.795 -12.005 7.918   1.00 12.85  ? 254 LYS A C     1 
ATOM   2012 O  O     . LYS A 1 257 ? 53.406 -11.115 7.305   1.00 13.61  ? 254 LYS A O     1 
ATOM   2013 C  CB    . LYS A 1 257 ? 53.871 -11.922 10.123  1.00 12.28  ? 254 LYS A CB    1 
ATOM   2014 C  CG    . LYS A 1 257 ? 53.758 -11.712 11.583  1.00 13.88  ? 254 LYS A CG    1 
ATOM   2015 C  CD    . LYS A 1 257 ? 53.184 -10.368 11.921  1.00 17.57  ? 254 LYS A CD    1 
ATOM   2016 C  CE    . LYS A 1 257 ? 53.136 -10.199 13.433  1.00 27.64  ? 254 LYS A CE    1 
ATOM   2017 N  NZ    . LYS A 1 257 ? 52.669 -8.834  13.788  1.00 26.63  ? 254 LYS A NZ    1 
ATOM   2018 N  N     . ILE A 1 258 ? 52.418 -13.157 7.357   1.00 10.02  ? 255 ILE A N     1 
ATOM   2019 C  CA    . ILE A 1 258 ? 52.683 -13.428 5.943   1.00 8.99   ? 255 ILE A CA    1 
ATOM   2020 C  C     . ILE A 1 258 ? 51.565 -12.813 5.086   1.00 9.85   ? 255 ILE A C     1 
ATOM   2021 O  O     . ILE A 1 258 ? 50.392 -12.983 5.407   1.00 10.92  ? 255 ILE A O     1 
ATOM   2022 C  CB    . ILE A 1 258 ? 52.775 -14.966 5.668   1.00 9.78   ? 255 ILE A CB    1 
ATOM   2023 C  CG1   . ILE A 1 258 ? 54.173 -15.508 6.017   1.00 20.70  ? 255 ILE A CG1   1 
ATOM   2024 C  CG2   . ILE A 1 258 ? 52.646 -15.233 4.202   1.00 13.50  ? 255 ILE A CG2   1 
ATOM   2025 C  CD1   . ILE A 1 258 ? 54.624 -15.323 7.415   1.00 22.18  ? 255 ILE A CD1   1 
ATOM   2026 N  N     . ARG A 1 259 ? 51.922 -12.129 3.993   1.00 12.02  ? 256 ARG A N     1 
ATOM   2027 C  CA    A ARG A 1 259 ? 50.936 -11.468 3.130   0.50 12.63  ? 256 ARG A CA    1 
ATOM   2028 C  CA    B ARG A 1 259 ? 50.922 -11.463 3.163   0.50 12.63  ? 256 ARG A CA    1 
ATOM   2029 C  C     . ARG A 1 259 ? 49.853 -12.433 2.657   1.00 14.39  ? 256 ARG A C     1 
ATOM   2030 O  O     . ARG A 1 259 ? 50.172 -13.475 2.084   1.00 15.55  ? 256 ARG A O     1 
ATOM   2031 C  CB    A ARG A 1 259 ? 51.631 -10.830 1.919   0.50 15.42  ? 256 ARG A CB    1 
ATOM   2032 C  CB    B ARG A 1 259 ? 51.595 -10.728 2.002   0.50 15.40  ? 256 ARG A CB    1 
ATOM   2033 C  CG    A ARG A 1 259 ? 50.692 -10.078 0.967   0.50 18.00  ? 256 ARG A CG    1 
ATOM   2034 C  CG    B ARG A 1 259 ? 50.657 -9.832  1.209   0.50 17.25  ? 256 ARG A CG    1 
ATOM   2035 C  CD    A ARG A 1 259 ? 51.353 -9.809  -0.402  0.50 19.35  ? 256 ARG A CD    1 
ATOM   2036 C  CD    B ARG A 1 259 ? 51.410 -9.092  0.102   0.50 20.40  ? 256 ARG A CD    1 
ATOM   2037 N  NE    A ARG A 1 259 ? 51.665 -11.035 -1.134  0.50 24.68  ? 256 ARG A NE    1 
ATOM   2038 N  NE    B ARG A 1 259 ? 50.514 -8.653  -0.964  0.50 23.56  ? 256 ARG A NE    1 
ATOM   2039 C  CZ    A ARG A 1 259 ? 52.251 -11.077 -2.330  0.50 23.66  ? 256 ARG A CZ    1 
ATOM   2040 C  CZ    B ARG A 1 259 ? 49.624 -7.679  -0.834  0.50 24.13  ? 256 ARG A CZ    1 
ATOM   2041 N  NH1   A ARG A 1 259 ? 52.586 -9.948  -2.945  0.50 18.21  ? 256 ARG A NH1   1 
ATOM   2042 N  NH1   B ARG A 1 259 ? 48.837 -7.346  -1.853  0.50 24.24  ? 256 ARG A NH1   1 
ATOM   2043 N  NH2   A ARG A 1 259 ? 52.501 -12.251 -2.917  0.50 22.86  ? 256 ARG A NH2   1 
ATOM   2044 N  NH2   B ARG A 1 259 ? 49.515 -7.041  0.319   0.50 23.65  ? 256 ARG A NH2   1 
ATOM   2045 N  N     . SER A 1 260 ? 48.592 -12.054 2.898   1.00 12.81  ? 257 SER A N     1 
ATOM   2046 C  CA    . SER A 1 260 ? 47.364 -12.808 2.565   1.00 12.28  ? 257 SER A CA    1 
ATOM   2047 C  C     . SER A 1 260 ? 46.869 -13.704 3.695   1.00 12.68  ? 257 SER A C     1 
ATOM   2048 O  O     . SER A 1 260 ? 45.748 -14.205 3.628   1.00 12.52  ? 257 SER A O     1 
ATOM   2049 C  CB    . SER A 1 260 ? 47.465 -13.636 1.269   1.00 15.35  ? 257 SER A CB    1 
ATOM   2050 O  OG    . SER A 1 260 ? 48.135 -14.862 1.497   1.00 13.29  ? 257 SER A OG    1 
ATOM   2051 N  N     . LEU A 1 261 ? 47.693 -13.902 4.723   1.00 12.09  ? 258 LEU A N     1 
ATOM   2052 C  CA    . LEU A 1 261 ? 47.294 -14.723 5.878   1.00 9.98   ? 258 LEU A CA    1 
ATOM   2053 C  C     . LEU A 1 261 ? 46.907 -13.903 7.130   1.00 11.61  ? 258 LEU A C     1 
ATOM   2054 O  O     . LEU A 1 261 ? 46.762 -14.452 8.239   1.00 11.40  ? 258 LEU A O     1 
ATOM   2055 C  CB    . LEU A 1 261 ? 48.385 -15.758 6.218   1.00 10.45  ? 258 LEU A CB    1 
ATOM   2056 C  CG    . LEU A 1 261 ? 48.775 -16.716 5.085   1.00 10.16  ? 258 LEU A CG    1 
ATOM   2057 C  CD1   . LEU A 1 261 ? 49.830 -17.726 5.564   1.00 10.25  ? 258 LEU A CD1   1 
ATOM   2058 C  CD2   . LEU A 1 261 ? 47.536 -17.446 4.544   1.00 12.37  ? 258 LEU A CD2   1 
ATOM   2059 N  N     . GLY A 1 262 ? 46.732 -12.590 6.962   1.00 12.29  ? 259 GLY A N     1 
ATOM   2060 C  CA    . GLY A 1 262 ? 46.415 -11.716 8.076   1.00 13.58  ? 259 GLY A CA    1 
ATOM   2061 C  C     . GLY A 1 262 ? 44.951 -11.658 8.486   1.00 14.61  ? 259 GLY A C     1 
ATOM   2062 O  O     . GLY A 1 262 ? 44.600 -10.951 9.437   1.00 16.52  ? 259 GLY A O     1 
ATOM   2063 N  N     . GLY A 1 263 ? 44.108 -12.403 7.779   1.00 13.96  ? 260 GLY A N     1 
ATOM   2064 C  CA    . GLY A 1 263 ? 42.667 -12.358 7.971   1.00 13.39  ? 260 GLY A CA    1 
ATOM   2065 C  C     . GLY A 1 263 ? 42.072 -13.717 8.314   1.00 14.52  ? 260 GLY A C     1 
ATOM   2066 O  O     . GLY A 1 263 ? 42.669 -14.512 9.044   1.00 13.40  ? 260 GLY A O     1 
ATOM   2067 N  N     . LYS A 1 264 ? 40.896 -14.003 7.765   1.00 13.78  ? 261 LYS A N     1 
ATOM   2068 C  CA    . LYS A 1 264 ? 40.178 -15.236 8.114   1.00 13.67  ? 261 LYS A CA    1 
ATOM   2069 C  C     . LYS A 1 264 ? 40.898 -16.536 7.706   1.00 14.67  ? 261 LYS A C     1 
ATOM   2070 O  O     . LYS A 1 264 ? 40.878 -17.534 8.448   1.00 16.72  ? 261 LYS A O     1 
ATOM   2071 C  CB    . LYS A 1 264 ? 38.770 -15.204 7.485   1.00 16.86  ? 261 LYS A CB    1 
ATOM   2072 C  CG    . LYS A 1 264 ? 37.878 -14.137 8.082   1.00 20.95  ? 261 LYS A CG    1 
ATOM   2073 C  CD    . LYS A 1 264 ? 36.473 -14.120 7.433   1.00 22.09  ? 261 LYS A CD    1 
ATOM   2074 C  CE    . LYS A 1 264 ? 35.535 -13.174 8.181   1.00 36.96  ? 261 LYS A CE    1 
ATOM   2075 N  NZ    . LYS A 1 264 ? 34.139 -13.215 7.654   1.00 32.84  ? 261 LYS A NZ    1 
ATOM   2076 N  N     . LEU A 1 265 ? 41.524 -16.537 6.526   1.00 12.16  ? 262 LEU A N     1 
ATOM   2077 C  CA    . LEU A 1 265 ? 42.243 -17.723 6.081   1.00 12.70  ? 262 LEU A CA    1 
ATOM   2078 C  C     . LEU A 1 265 ? 43.361 -18.061 7.070   1.00 13.30  ? 262 LEU A C     1 
ATOM   2079 O  O     . LEU A 1 265 ? 43.445 -19.188 7.527   1.00 12.79  ? 262 LEU A O     1 
ATOM   2080 C  CB    . LEU A 1 265 ? 42.814 -17.558 4.682   1.00 13.51  ? 262 LEU A CB    1 
ATOM   2081 C  CG    . LEU A 1 265 ? 43.709 -18.711 4.223   1.00 16.60  ? 262 LEU A CG    1 
ATOM   2082 C  CD1   . LEU A 1 265 ? 42.891 -19.998 4.159   1.00 17.34  ? 262 LEU A CD1   1 
ATOM   2083 C  CD2   . LEU A 1 265 ? 44.319 -18.403 2.862   1.00 14.90  ? 262 LEU A CD2   1 
ATOM   2084 N  N     . GLY A 1 266 ? 44.173 -17.066 7.427   1.00 13.70  ? 263 GLY A N     1 
ATOM   2085 C  CA    . GLY A 1 266 ? 45.236 -17.293 8.397   1.00 9.86   ? 263 GLY A CA    1 
ATOM   2086 C  C     . GLY A 1 266 ? 44.715 -17.781 9.726   1.00 13.13  ? 263 GLY A C     1 
ATOM   2087 O  O     . GLY A 1 266 ? 45.271 -18.716 10.319  1.00 12.41  ? 263 GLY A O     1 
ATOM   2088 N  N     . ALA A 1 267 ? 43.619 -17.179 10.195  1.00 13.62  ? 264 ALA A N     1 
ATOM   2089 C  CA    . ALA A 1 267 ? 42.988 -17.648 11.420  1.00 13.64  ? 264 ALA A CA    1 
ATOM   2090 C  C     . ALA A 1 267 ? 42.534 -19.115 11.304  1.00 13.15  ? 264 ALA A C     1 
ATOM   2091 O  O     . ALA A 1 267 ? 42.668 -19.883 12.255  1.00 16.60  ? 264 ALA A O     1 
ATOM   2092 C  CB    . ALA A 1 267 ? 41.806 -16.728 11.818  1.00 15.43  ? 264 ALA A CB    1 
ATOM   2093 N  N     . SER A 1 268 ? 42.010 -19.510 10.150  1.00 12.53  ? 265 SER A N     1 
ATOM   2094 C  CA    . SER A 1 268 ? 41.613 -20.903 9.950   1.00 14.73  ? 265 SER A CA    1 
ATOM   2095 C  C     . SER A 1 268 ? 42.803 -21.877 9.927   1.00 12.01  ? 265 SER A C     1 
ATOM   2096 O  O     . SER A 1 268 ? 42.676 -22.997 10.405  1.00 12.72  ? 265 SER A O     1 
ATOM   2097 C  CB    . SER A 1 268 ? 40.713 -21.081 8.722   1.00 17.78  ? 265 SER A CB    1 
ATOM   2098 O  OG    . SER A 1 268 ? 41.457 -21.035 7.526   1.00 23.76  ? 265 SER A OG    1 
ATOM   2099 N  N     . VAL A 1 269 ? 43.949 -21.449 9.389   1.00 11.39  ? 266 VAL A N     1 
ATOM   2100 C  CA    . VAL A 1 269 ? 45.153 -22.277 9.387   1.00 12.09  ? 266 VAL A CA    1 
ATOM   2101 C  C     . VAL A 1 269 ? 45.549 -22.575 10.837  1.00 13.72  ? 266 VAL A C     1 
ATOM   2102 O  O     . VAL A 1 269 ? 45.818 -23.731 11.213  1.00 12.87  ? 266 VAL A O     1 
ATOM   2103 C  CB    . VAL A 1 269 ? 46.319 -21.575 8.642   1.00 12.94  ? 266 VAL A CB    1 
ATOM   2104 C  CG1   . VAL A 1 269 ? 47.580 -22.384 8.775   1.00 15.82  ? 266 VAL A CG1   1 
ATOM   2105 C  CG2   . VAL A 1 269 ? 45.982 -21.422 7.164   1.00 12.24  ? 266 VAL A CG2   1 
ATOM   2106 N  N     . ILE A 1 270 ? 45.578 -21.527 11.660  1.00 11.00  ? 267 ILE A N     1 
ATOM   2107 C  CA    . ILE A 1 270 ? 45.906 -21.650 13.077  1.00 11.22  ? 267 ILE A CA    1 
ATOM   2108 C  C     . ILE A 1 270 ? 44.913 -22.562 13.804  1.00 12.94  ? 267 ILE A C     1 
ATOM   2109 O  O     . ILE A 1 270 ? 45.308 -23.472 14.525  1.00 16.69  ? 267 ILE A O     1 
ATOM   2110 C  CB    . ILE A 1 270 ? 45.953 -20.249 13.726  1.00 11.26  ? 267 ILE A CB    1 
ATOM   2111 C  CG1   . ILE A 1 270 ? 47.164 -19.485 13.202  1.00 13.47  ? 267 ILE A CG1   1 
ATOM   2112 C  CG2   . ILE A 1 270 ? 45.962 -20.353 15.250  1.00 15.62  ? 267 ILE A CG2   1 
ATOM   2113 C  CD1   . ILE A 1 270 ? 47.065 -17.997 13.437  1.00 17.99  ? 267 ILE A CD1   1 
ATOM   2114 N  N     . GLU A 1 271 ? 43.619 -22.357 13.568  1.00 12.95  ? 268 GLU A N     1 
ATOM   2115 C  CA    . GLU A 1 271 ? 42.607 -23.131 14.284  1.00 14.55  ? 268 GLU A CA    1 
ATOM   2116 C  C     . GLU A 1 271 ? 42.534 -24.587 13.855  1.00 14.40  ? 268 GLU A C     1 
ATOM   2117 O  O     . GLU A 1 271 ? 42.465 -25.499 14.698  1.00 18.91  ? 268 GLU A O     1 
ATOM   2118 C  CB    . GLU A 1 271 ? 41.231 -22.488 14.114  1.00 23.28  ? 268 GLU A CB    1 
ATOM   2119 C  CG    . GLU A 1 271 ? 40.087 -23.241 14.805  1.00 35.95  ? 268 GLU A CG    1 
ATOM   2120 C  CD    . GLU A 1 271 ? 38.818 -22.402 14.918  1.00 46.54  ? 268 GLU A CD    1 
ATOM   2121 O  OE1   . GLU A 1 271 ? 38.631 -21.476 14.092  1.00 53.78  ? 268 GLU A OE1   1 
ATOM   2122 O  OE2   . GLU A 1 271 ? 38.009 -22.662 15.837  1.00 49.10  ? 268 GLU A OE2   1 
ATOM   2123 N  N     . ILE A 1 272 ? 42.507 -24.816 12.548  1.00 13.49  ? 269 ILE A N     1 
ATOM   2124 C  CA    . ILE A 1 272 ? 42.291 -26.155 12.039  1.00 13.54  ? 269 ILE A CA    1 
ATOM   2125 C  C     . ILE A 1 272 ? 43.500 -27.018 12.314  1.00 14.85  ? 269 ILE A C     1 
ATOM   2126 O  O     . ILE A 1 272 ? 43.364 -28.181 12.679  1.00 17.54  ? 269 ILE A O     1 
ATOM   2127 C  CB    . ILE A 1 272 ? 41.973 -26.150 10.529  1.00 13.71  ? 269 ILE A CB    1 
ATOM   2128 C  CG1   . ILE A 1 272 ? 40.591 -25.540 10.321  1.00 19.58  ? 269 ILE A CG1   1 
ATOM   2129 C  CG2   . ILE A 1 272 ? 42.023 -27.578 9.985   1.00 14.05  ? 269 ILE A CG2   1 
ATOM   2130 C  CD1   . ILE A 1 272 ? 40.202 -25.314 8.867   1.00 19.96  ? 269 ILE A CD1   1 
ATOM   2131 N  N     . LEU A 1 273 ? 44.691 -26.446 12.137  1.00 12.36  ? 270 LEU A N     1 
ATOM   2132 C  CA    . LEU A 1 273 ? 45.914 -27.228 12.263  1.00 13.93  ? 270 LEU A CA    1 
ATOM   2133 C  C     . LEU A 1 273 ? 46.499 -27.229 13.671  1.00 14.39  ? 270 LEU A C     1 
ATOM   2134 O  O     . LEU A 1 273 ? 47.325 -28.090 13.986  1.00 16.26  ? 270 LEU A O     1 
ATOM   2135 C  CB    . LEU A 1 273 ? 46.953 -26.756 11.256  1.00 12.43  ? 270 LEU A CB    1 
ATOM   2136 C  CG    . LEU A 1 273 ? 46.542 -26.860 9.789   1.00 12.07  ? 270 LEU A CG    1 
ATOM   2137 C  CD1   . LEU A 1 273 ? 47.704 -26.419 8.923   1.00 12.22  ? 270 LEU A CD1   1 
ATOM   2138 C  CD2   . LEU A 1 273 ? 46.153 -28.301 9.472   1.00 18.56  ? 270 LEU A CD2   1 
ATOM   2139 N  N     . GLY A 1 274 ? 46.086 -26.263 14.491  1.00 12.49  ? 271 GLY A N     1 
ATOM   2140 C  CA    . GLY A 1 274 ? 46.565 -26.157 15.862  1.00 13.99  ? 271 GLY A CA    1 
ATOM   2141 C  C     . GLY A 1 274 ? 48.026 -25.766 15.930  1.00 14.76  ? 271 GLY A C     1 
ATOM   2142 O  O     . GLY A 1 274 ? 48.792 -26.261 16.771  1.00 18.49  ? 271 GLY A O     1 
ATOM   2143 N  N     . ILE A 1 275 ? 48.412 -24.836 15.058  1.00 12.86  ? 272 ILE A N     1 
ATOM   2144 C  CA    . ILE A 1 275 ? 49.793 -24.339 15.027  1.00 12.03  ? 272 ILE A CA    1 
ATOM   2145 C  C     . ILE A 1 275 ? 49.804 -22.833 15.212  1.00 12.52  ? 272 ILE A C     1 
ATOM   2146 O  O     . ILE A 1 275 ? 48.749 -22.199 15.197  1.00 13.40  ? 272 ILE A O     1 
ATOM   2147 C  CB    . ILE A 1 275 ? 50.501 -24.713 13.707  1.00 12.11  ? 272 ILE A CB    1 
ATOM   2148 C  CG1   . ILE A 1 275 ? 49.758 -24.137 12.492  1.00 14.60  ? 272 ILE A CG1   1 
ATOM   2149 C  CG2   . ILE A 1 275 ? 50.603 -26.230 13.593  1.00 13.56  ? 272 ILE A CG2   1 
ATOM   2150 C  CD1   . ILE A 1 275 ? 50.526 -24.323 11.160  1.00 13.62  ? 272 ILE A CD1   1 
ATOM   2151 N  N     . GLU A 1 276 ? 50.981 -22.258 15.397  1.00 11.52  ? 273 GLU A N     1 
ATOM   2152 C  CA    . GLU A 1 276 ? 51.099 -20.809 15.537  1.00 11.46  ? 273 GLU A CA    1 
ATOM   2153 C  C     . GLU A 1 276 ? 52.043 -20.145 14.523  1.00 12.34  ? 273 GLU A C     1 
ATOM   2154 O  O     . GLU A 1 276 ? 51.853 -18.982 14.168  1.00 12.46  ? 273 GLU A O     1 
ATOM   2155 C  CB    . GLU A 1 276 ? 51.574 -20.450 16.946  1.00 16.20  ? 273 GLU A CB    1 
ATOM   2156 C  CG    . GLU A 1 276 ? 50.561 -20.778 18.041  1.00 20.49  ? 273 GLU A CG    1 
ATOM   2157 C  CD    . GLU A 1 276 ? 51.137 -20.676 19.456  1.00 29.51  ? 273 GLU A CD    1 
ATOM   2158 O  OE1   . GLU A 1 276 ? 50.715 -21.473 20.326  1.00 39.97  ? 273 GLU A OE1   1 
ATOM   2159 O  OE2   . GLU A 1 276 ? 51.993 -19.804 19.709  1.00 32.70  ? 273 GLU A OE2   1 
ATOM   2160 N  N     . TYR A 1 277 ? 53.082 -20.868 14.098  1.00 8.89   ? 274 TYR A N     1 
ATOM   2161 C  CA    . TYR A 1 277 ? 54.184 -20.258 13.345  1.00 9.21   ? 274 TYR A CA    1 
ATOM   2162 C  C     . TYR A 1 277 ? 54.248 -20.849 11.937  1.00 9.21   ? 274 TYR A C     1 
ATOM   2163 O  O     . TYR A 1 277 ? 53.886 -22.017 11.703  1.00 9.25   ? 274 TYR A O     1 
ATOM   2164 C  CB    . TYR A 1 277 ? 55.502 -20.519 14.079  1.00 9.73   ? 274 TYR A CB    1 
ATOM   2165 C  CG    . TYR A 1 277 ? 55.505 -20.010 15.486  1.00 8.14   ? 274 TYR A CG    1 
ATOM   2166 C  CD1   . TYR A 1 277 ? 55.282 -18.661 15.743  1.00 11.31  ? 274 TYR A CD1   1 
ATOM   2167 C  CD2   . TYR A 1 277 ? 55.721 -20.868 16.549  1.00 12.47  ? 274 TYR A CD2   1 
ATOM   2168 C  CE1   . TYR A 1 277 ? 55.256 -18.164 17.042  1.00 13.09  ? 274 TYR A CE1   1 
ATOM   2169 C  CE2   . TYR A 1 277 ? 55.716 -20.392 17.849  1.00 13.52  ? 274 TYR A CE2   1 
ATOM   2170 C  CZ    . TYR A 1 277 ? 55.482 -19.042 18.091  1.00 13.94  ? 274 TYR A CZ    1 
ATOM   2171 O  OH    . TYR A 1 277 ? 55.477 -18.594 19.406  1.00 17.79  ? 274 TYR A OH    1 
ATOM   2172 N  N     . MET A 1 278 ? 54.723 -20.039 11.007  1.00 6.88   ? 275 MET A N     1 
ATOM   2173 C  CA    . MET A 1 278 ? 54.736 -20.411 9.610   1.00 9.00   ? 275 MET A CA    1 
ATOM   2174 C  C     . MET A 1 278 ? 55.541 -21.704 9.406   1.00 8.46   ? 275 MET A C     1 
ATOM   2175 O  O     . MET A 1 278 ? 55.184 -22.557 8.600   1.00 9.69   ? 275 MET A O     1 
ATOM   2176 C  CB    . MET A 1 278 ? 55.313 -19.241 8.806   1.00 11.64  ? 275 MET A CB    1 
ATOM   2177 C  CG    A MET A 1 278 ? 54.986 -19.297 7.358   0.59 13.18  ? 275 MET A CG    1 
ATOM   2178 C  CG    B MET A 1 278 ? 55.180 -19.407 7.301   0.41 12.97  ? 275 MET A CG    1 
ATOM   2179 S  SD    A MET A 1 278 ? 53.227 -19.003 7.080   0.59 13.07  ? 275 MET A SD    1 
ATOM   2180 S  SD    B MET A 1 278 ? 53.471 -19.336 6.733   0.41 14.63  ? 275 MET A SD    1 
ATOM   2181 C  CE    A MET A 1 278 ? 53.173 -19.452 5.337   0.59 19.27  ? 275 MET A CE    1 
ATOM   2182 C  CE    B MET A 1 278 ? 53.662 -19.577 4.978   0.41 17.70  ? 275 MET A CE    1 
ATOM   2183 N  N     . GLY A 1 279 ? 56.628 -21.858 10.151  1.00 9.21   ? 276 GLY A N     1 
ATOM   2184 C  CA    . GLY A 1 279 ? 57.489 -23.013 9.957   1.00 10.25  ? 276 GLY A CA    1 
ATOM   2185 C  C     . GLY A 1 279 ? 56.784 -24.317 10.268  1.00 10.79  ? 276 GLY A C     1 
ATOM   2186 O  O     . GLY A 1 279 ? 57.124 -25.351 9.690   1.00 10.58  ? 276 GLY A O     1 
ATOM   2187 N  N     . GLU A 1 280 ? 55.819 -24.282 11.195  1.00 8.45   ? 277 GLU A N     1 
ATOM   2188 C  CA    . GLU A 1 280 ? 55.107 -25.497 11.577  1.00 8.60   ? 277 GLU A CA    1 
ATOM   2189 C  C     . GLU A 1 280 ? 54.319 -26.080 10.414  1.00 9.52   ? 277 GLU A C     1 
ATOM   2190 O  O     . GLU A 1 280 ? 53.974 -27.259 10.441  1.00 11.45  ? 277 GLU A O     1 
ATOM   2191 C  CB    . GLU A 1 280 ? 54.170 -25.253 12.754  1.00 11.43  ? 277 GLU A CB    1 
ATOM   2192 C  CG    . GLU A 1 280 ? 54.882 -24.951 14.065  1.00 10.17  ? 277 GLU A CG    1 
ATOM   2193 C  CD    . GLU A 1 280 ? 53.889 -24.642 15.146  1.00 14.90  ? 277 GLU A CD    1 
ATOM   2194 O  OE1   . GLU A 1 280 ? 53.575 -23.458 15.288  1.00 13.84  ? 277 GLU A OE1   1 
ATOM   2195 O  OE2   . GLU A 1 280 ? 53.404 -25.585 15.825  1.00 17.93  ? 277 GLU A OE2   1 
ATOM   2196 N  N     . LEU A 1 281 ? 54.030 -25.280 9.390   1.00 8.97   ? 278 LEU A N     1 
ATOM   2197 C  CA    . LEU A 1 281 ? 53.349 -25.829 8.226   1.00 8.22   ? 278 LEU A CA    1 
ATOM   2198 C  C     . LEU A 1 281 ? 54.105 -26.934 7.489   1.00 8.21   ? 278 LEU A C     1 
ATOM   2199 O  O     . LEU A 1 281 ? 53.487 -27.698 6.736   1.00 10.05  ? 278 LEU A O     1 
ATOM   2200 C  CB    . LEU A 1 281 ? 53.020 -24.715 7.238   1.00 8.14   ? 278 LEU A CB    1 
ATOM   2201 C  CG    . LEU A 1 281 ? 51.817 -23.870 7.635   1.00 9.59   ? 278 LEU A CG    1 
ATOM   2202 C  CD1   . LEU A 1 281 ? 51.838 -22.542 6.862   1.00 11.77  ? 278 LEU A CD1   1 
ATOM   2203 C  CD2   . LEU A 1 281 ? 50.492 -24.640 7.381   1.00 10.42  ? 278 LEU A CD2   1 
ATOM   2204 N  N     . THR A 1 282 ? 55.423 -27.011 7.645   1.00 9.97   ? 279 THR A N     1 
ATOM   2205 C  CA    . THR A 1 282 ? 56.195 -27.984 6.848   1.00 9.30   ? 279 THR A CA    1 
ATOM   2206 C  C     . THR A 1 282 ? 55.820 -29.426 7.208   1.00 10.91  ? 279 THR A C     1 
ATOM   2207 O  O     . THR A 1 282 ? 56.117 -30.350 6.449   1.00 12.35  ? 279 THR A O     1 
ATOM   2208 C  CB    . THR A 1 282 ? 57.729 -27.821 7.022   1.00 11.71  ? 279 THR A CB    1 
ATOM   2209 O  OG1   . THR A 1 282 ? 58.081 -28.091 8.390   1.00 12.84  ? 279 THR A OG1   1 
ATOM   2210 C  CG2   . THR A 1 282 ? 58.186 -26.393 6.643   1.00 10.55  ? 279 THR A CG2   1 
ATOM   2211 N  N     . GLN A 1 283 ? 55.172 -29.631 8.349   1.00 10.47  ? 280 GLN A N     1 
ATOM   2212 C  CA    A GLN A 1 283 ? 54.852 -30.983 8.795   0.51 11.65  ? 280 GLN A CA    1 
ATOM   2213 C  CA    B GLN A 1 283 ? 54.877 -31.007 8.770   0.49 11.65  ? 280 GLN A CA    1 
ATOM   2214 C  C     . GLN A 1 283 ? 53.617 -31.600 8.149   1.00 14.90  ? 280 GLN A C     1 
ATOM   2215 O  O     . GLN A 1 283 ? 53.228 -32.716 8.486   1.00 18.76  ? 280 GLN A O     1 
ATOM   2216 C  CB    A GLN A 1 283 ? 54.784 -31.016 10.323  0.51 13.63  ? 280 GLN A CB    1 
ATOM   2217 C  CB    B GLN A 1 283 ? 54.786 -31.109 10.287  0.49 13.64  ? 280 GLN A CB    1 
ATOM   2218 C  CG    A GLN A 1 283 ? 56.172 -30.772 10.888  0.51 11.89  ? 280 GLN A CG    1 
ATOM   2219 C  CG    B GLN A 1 283 ? 53.588 -30.443 10.840  0.49 14.78  ? 280 GLN A CG    1 
ATOM   2220 C  CD    A GLN A 1 283 ? 57.216 -31.614 10.162  0.51 12.79  ? 280 GLN A CD    1 
ATOM   2221 C  CD    B GLN A 1 283 ? 53.768 -30.112 12.299  0.49 18.38  ? 280 GLN A CD    1 
ATOM   2222 O  OE1   A GLN A 1 283 ? 57.221 -32.848 10.265  0.51 13.62  ? 280 GLN A OE1   1 
ATOM   2223 O  OE1   B GLN A 1 283 ? 54.249 -30.938 13.087  0.49 21.90  ? 280 GLN A OE1   1 
ATOM   2224 N  NE2   A GLN A 1 283 ? 58.085 -30.956 9.399   0.51 10.76  ? 280 GLN A NE2   1 
ATOM   2225 N  NE2   B GLN A 1 283 ? 53.393 -28.892 12.671  0.49 9.38   ? 280 GLN A NE2   1 
ATOM   2226 N  N     . PHE A 1 284 ? 52.993 -30.876 7.237   1.00 8.70   ? 281 PHE A N     1 
ATOM   2227 C  CA    . PHE A 1 284 ? 51.786 -31.380 6.574   1.00 12.35  ? 281 PHE A CA    1 
ATOM   2228 C  C     . PHE A 1 284 ? 52.080 -31.724 5.121   1.00 12.57  ? 281 PHE A C     1 
ATOM   2229 O  O     . PHE A 1 284 ? 52.931 -31.105 4.497   1.00 12.91  ? 281 PHE A O     1 
ATOM   2230 C  CB    . PHE A 1 284 ? 50.664 -30.353 6.671   1.00 9.72   ? 281 PHE A CB    1 
ATOM   2231 C  CG    . PHE A 1 284 ? 50.295 -30.039 8.093   1.00 9.57   ? 281 PHE A CG    1 
ATOM   2232 C  CD1   . PHE A 1 284 ? 49.399 -30.847 8.777   1.00 14.09  ? 281 PHE A CD1   1 
ATOM   2233 C  CD2   . PHE A 1 284 ? 50.924 -29.018 8.785   1.00 10.20  ? 281 PHE A CD2   1 
ATOM   2234 C  CE1   . PHE A 1 284 ? 49.074 -30.583 10.100  1.00 13.08  ? 281 PHE A CE1   1 
ATOM   2235 C  CE2   . PHE A 1 284 ? 50.612 -28.769 10.096  1.00 11.18  ? 281 PHE A CE2   1 
ATOM   2236 C  CZ    . PHE A 1 284 ? 49.699 -29.565 10.769  1.00 13.33  ? 281 PHE A CZ    1 
ATOM   2237 N  N     . THR A 1 285 ? 51.415 -32.739 4.580   1.00 10.93  ? 282 THR A N     1 
ATOM   2238 C  CA    . THR A 1 285 ? 51.611 -33.020 3.167   1.00 10.92  ? 282 THR A CA    1 
ATOM   2239 C  C     . THR A 1 285 ? 50.842 -31.991 2.357   1.00 10.02  ? 282 THR A C     1 
ATOM   2240 O  O     . THR A 1 285 ? 49.941 -31.332 2.877   1.00 10.57  ? 282 THR A O     1 
ATOM   2241 C  CB    . THR A 1 285 ? 51.100 -34.421 2.772   1.00 9.78   ? 282 THR A CB    1 
ATOM   2242 O  OG1   . THR A 1 285 ? 49.673 -34.466 2.914   1.00 14.04  ? 282 THR A OG1   1 
ATOM   2243 C  CG2   . THR A 1 285 ? 51.751 -35.500 3.612   1.00 15.22  ? 282 THR A CG2   1 
ATOM   2244 N  N     . GLU A 1 286 ? 51.203 -31.862 1.088   1.00 11.68  ? 283 GLU A N     1 
ATOM   2245 C  CA    . GLU A 1 286 ? 50.491 -30.946 0.218   1.00 12.20  ? 283 GLU A CA    1 
ATOM   2246 C  C     . GLU A 1 286 ? 49.009 -31.323 0.141   1.00 11.52  ? 283 GLU A C     1 
ATOM   2247 O  O     . GLU A 1 286 ? 48.143 -30.453 0.191   1.00 10.43  ? 283 GLU A O     1 
ATOM   2248 C  CB    . GLU A 1 286 ? 51.139 -30.923 -1.167  1.00 13.35  ? 283 GLU A CB    1 
ATOM   2249 C  CG    . GLU A 1 286 ? 50.561 -29.844 -2.056  1.00 11.83  ? 283 GLU A CG    1 
ATOM   2250 C  CD    . GLU A 1 286 ? 51.270 -29.738 -3.389  1.00 21.96  ? 283 GLU A CD    1 
ATOM   2251 O  OE1   . GLU A 1 286 ? 52.186 -30.538 -3.649  1.00 21.27  ? 283 GLU A OE1   1 
ATOM   2252 O  OE2   . GLU A 1 286 ? 50.897 -28.851 -4.178  1.00 20.75  ? 283 GLU A OE2   1 
ATOM   2253 N  N     A SER A 1 287 ? 48.726 -32.626 0.061   0.78 13.09  ? 284 SER A N     1 
ATOM   2254 N  N     B SER A 1 287 ? 48.715 -32.618 0.054   0.22 13.06  ? 284 SER A N     1 
ATOM   2255 C  CA    A SER A 1 287 ? 47.338 -33.068 0.003   0.78 12.90  ? 284 SER A CA    1 
ATOM   2256 C  CA    B SER A 1 287 ? 47.322 -33.052 -0.015  0.22 12.92  ? 284 SER A CA    1 
ATOM   2257 C  C     A SER A 1 287 ? 46.556 -32.718 1.261   0.78 11.25  ? 284 SER A C     1 
ATOM   2258 C  C     B SER A 1 287 ? 46.543 -32.758 1.269   0.22 11.38  ? 284 SER A C     1 
ATOM   2259 O  O     A SER A 1 287 ? 45.374 -32.385 1.188   0.78 12.76  ? 284 SER A O     1 
ATOM   2260 O  O     B SER A 1 287 ? 45.346 -32.481 1.214   0.22 12.75  ? 284 SER A O     1 
ATOM   2261 C  CB    A SER A 1 287 ? 47.231 -34.580 -0.258  0.78 14.88  ? 284 SER A CB    1 
ATOM   2262 C  CB    B SER A 1 287 ? 47.214 -34.538 -0.378  0.22 14.81  ? 284 SER A CB    1 
ATOM   2263 O  OG    A SER A 1 287 ? 47.771 -34.906 -1.526  0.78 16.04  ? 284 SER A OG    1 
ATOM   2264 O  OG    B SER A 1 287 ? 47.931 -35.340 0.539   0.22 14.47  ? 284 SER A OG    1 
ATOM   2265 N  N     . GLN A 1 288 ? 47.218 -32.824 2.418   1.00 10.94  ? 285 GLN A N     1 
ATOM   2266 C  CA    . GLN A 1 288 ? 46.594 -32.459 3.677   1.00 11.20  ? 285 GLN A CA    1 
ATOM   2267 C  C     . GLN A 1 288 ? 46.237 -30.974 3.615   1.00 12.11  ? 285 GLN A C     1 
ATOM   2268 O  O     . GLN A 1 288 ? 45.117 -30.558 3.951   1.00 11.80  ? 285 GLN A O     1 
ATOM   2269 C  CB    . GLN A 1 288 ? 47.543 -32.748 4.856   1.00 8.51   ? 285 GLN A CB    1 
ATOM   2270 C  CG    . GLN A 1 288 ? 47.588 -34.198 5.277   1.00 16.07  ? 285 GLN A CG    1 
ATOM   2271 C  CD    . GLN A 1 288 ? 48.477 -34.423 6.484   1.00 21.40  ? 285 GLN A CD    1 
ATOM   2272 O  OE1   . GLN A 1 288 ? 49.628 -34.015 6.505   1.00 13.95  ? 285 GLN A OE1   1 
ATOM   2273 N  NE2   . GLN A 1 288 ? 47.935 -35.069 7.507   1.00 24.68  ? 285 GLN A NE2   1 
ATOM   2274 N  N     . LEU A 1 289 ? 47.191 -30.154 3.186   1.00 10.18  ? 286 LEU A N     1 
ATOM   2275 C  CA    . LEU A 1 289 ? 46.890 -28.732 3.142   1.00 10.42  ? 286 LEU A CA    1 
ATOM   2276 C  C     . LEU A 1 289 ? 45.770 -28.404 2.144   1.00 12.11  ? 286 LEU A C     1 
ATOM   2277 O  O     . LEU A 1 289 ? 44.900 -27.562 2.430   1.00 11.86  ? 286 LEU A O     1 
ATOM   2278 C  CB    . LEU A 1 289 ? 48.138 -27.918 2.855   1.00 9.46   ? 286 LEU A CB    1 
ATOM   2279 C  CG    . LEU A 1 289 ? 49.181 -28.017 3.974   1.00 10.36  ? 286 LEU A CG    1 
ATOM   2280 C  CD1   . LEU A 1 289 ? 50.430 -27.239 3.565   1.00 11.25  ? 286 LEU A CD1   1 
ATOM   2281 C  CD2   . LEU A 1 289 ? 48.634 -27.536 5.332   1.00 10.99  ? 286 LEU A CD2   1 
ATOM   2282 N  N     . GLN A 1 290 ? 45.773 -29.074 0.991   1.00 12.37  ? 287 GLN A N     1 
ATOM   2283 C  CA    . GLN A 1 290 ? 44.724 -28.826 0.002   1.00 13.72  ? 287 GLN A CA    1 
ATOM   2284 C  C     . GLN A 1 290 ? 43.363 -29.297 0.504   1.00 13.23  ? 287 GLN A C     1 
ATOM   2285 O  O     . GLN A 1 290 ? 42.332 -28.711 0.177   1.00 14.83  ? 287 GLN A O     1 
ATOM   2286 C  CB    . GLN A 1 290 ? 45.033 -29.523 -1.317  1.00 12.10  ? 287 GLN A CB    1 
ATOM   2287 C  CG    . GLN A 1 290 ? 46.245 -28.951 -2.037  1.00 14.18  ? 287 GLN A CG    1 
ATOM   2288 C  CD    . GLN A 1 290 ? 46.633 -29.784 -3.225  1.00 17.31  ? 287 GLN A CD    1 
ATOM   2289 O  OE1   . GLN A 1 290 ? 46.693 -31.022 -3.140  1.00 17.70  ? 287 GLN A OE1   1 
ATOM   2290 N  NE2   . GLN A 1 290 ? 46.927 -29.123 -4.341  1.00 20.92  ? 287 GLN A NE2   1 
ATOM   2291 N  N     . SER A 1 291 ? 43.353 -30.339 1.318   1.00 11.51  ? 288 SER A N     1 
ATOM   2292 C  CA    . SER A 1 291 ? 42.098 -30.814 1.887   1.00 11.60  ? 288 SER A CA    1 
ATOM   2293 C  C     . SER A 1 291 ? 41.434 -29.788 2.801   1.00 17.72  ? 288 SER A C     1 
ATOM   2294 O  O     . SER A 1 291 ? 40.209 -29.662 2.810   1.00 22.08  ? 288 SER A O     1 
ATOM   2295 C  CB    . SER A 1 291 ? 42.279 -32.161 2.610   1.00 14.08  ? 288 SER A CB    1 
ATOM   2296 O  OG    A SER A 1 291 ? 42.801 -31.983 3.922   0.55 20.85  ? 288 SER A OG    1 
ATOM   2297 O  OG    B SER A 1 291 ? 42.846 -31.986 3.902   0.45 20.80  ? 288 SER A OG    1 
ATOM   2298 N  N     . HIS A 1 292 ? 42.227 -29.034 3.561   1.00 13.51  ? 289 HIS A N     1 
ATOM   2299 C  CA    . HIS A 1 292 ? 41.624 -28.050 4.445   1.00 15.12  ? 289 HIS A CA    1 
ATOM   2300 C  C     . HIS A 1 292 ? 41.349 -26.703 3.789   1.00 18.22  ? 289 HIS A C     1 
ATOM   2301 O  O     . HIS A 1 292 ? 40.352 -26.057 4.087   1.00 21.07  ? 289 HIS A O     1 
ATOM   2302 C  CB    . HIS A 1 292 ? 42.508 -27.802 5.658   1.00 16.60  ? 289 HIS A CB    1 
ATOM   2303 C  CG    . HIS A 1 292 ? 42.693 -28.991 6.545   1.00 16.79  ? 289 HIS A CG    1 
ATOM   2304 N  ND1   . HIS A 1 292 ? 41.650 -29.607 7.203   1.00 21.97  ? 289 HIS A ND1   1 
ATOM   2305 C  CD2   . HIS A 1 292 ? 43.816 -29.644 6.927   1.00 18.39  ? 289 HIS A CD2   1 
ATOM   2306 C  CE1   . HIS A 1 292 ? 42.123 -30.596 7.941   1.00 20.48  ? 289 HIS A CE1   1 
ATOM   2307 N  NE2   . HIS A 1 292 ? 43.434 -30.645 7.788   1.00 21.28  ? 289 HIS A NE2   1 
ATOM   2308 N  N     . PHE A 1 293 ? 42.248 -26.274 2.910   1.00 14.47  ? 290 PHE A N     1 
ATOM   2309 C  CA    . PHE A 1 293 ? 42.247 -24.898 2.445   1.00 14.88  ? 290 PHE A CA    1 
ATOM   2310 C  C     . PHE A 1 293 ? 41.956 -24.767 0.950   1.00 15.85  ? 290 PHE A C     1 
ATOM   2311 O  O     . PHE A 1 293 ? 41.927 -23.655 0.420   1.00 18.40  ? 290 PHE A O     1 
ATOM   2312 C  CB    . PHE A 1 293 ? 43.589 -24.239 2.863   1.00 13.18  ? 290 PHE A CB    1 
ATOM   2313 C  CG    . PHE A 1 293 ? 43.902 -24.466 4.326   1.00 12.77  ? 290 PHE A CG    1 
ATOM   2314 C  CD1   . PHE A 1 293 ? 43.059 -23.951 5.322   1.00 13.11  ? 290 PHE A CD1   1 
ATOM   2315 C  CD2   . PHE A 1 293 ? 44.994 -25.231 4.705   1.00 13.50  ? 290 PHE A CD2   1 
ATOM   2316 C  CE1   . PHE A 1 293 ? 43.309 -24.211 6.659   1.00 14.85  ? 290 PHE A CE1   1 
ATOM   2317 C  CE2   . PHE A 1 293 ? 45.264 -25.485 6.042   1.00 12.87  ? 290 PHE A CE2   1 
ATOM   2318 C  CZ    . PHE A 1 293 ? 44.418 -24.981 7.023   1.00 13.75  ? 290 PHE A CZ    1 
ATOM   2319 N  N     . GLY A 1 294 ? 41.701 -25.893 0.280   1.00 15.35  ? 291 GLY A N     1 
ATOM   2320 C  CA    . GLY A 1 294 ? 41.507 -25.868 -1.163  1.00 16.95  ? 291 GLY A CA    1 
ATOM   2321 C  C     . GLY A 1 294 ? 42.773 -26.113 -1.962  1.00 16.56  ? 291 GLY A C     1 
ATOM   2322 O  O     . GLY A 1 294 ? 43.886 -25.965 -1.445  1.00 14.17  ? 291 GLY A O     1 
ATOM   2323 N  N     . GLU A 1 295 ? 42.611 -26.481 -3.232  1.00 16.48  ? 292 GLU A N     1 
ATOM   2324 C  CA    . GLU A 1 295 ? 43.706 -26.880 -4.100  1.00 16.43  ? 292 GLU A CA    1 
ATOM   2325 C  C     . GLU A 1 295 ? 44.726 -25.746 -4.196  1.00 14.58  ? 292 GLU A C     1 
ATOM   2326 O  O     . GLU A 1 295 ? 45.919 -25.959 -3.994  1.00 14.72  ? 292 GLU A O     1 
ATOM   2327 C  CB    . GLU A 1 295 ? 43.148 -27.212 -5.490  1.00 16.26  ? 292 GLU A CB    1 
ATOM   2328 C  CG    . GLU A 1 295 ? 44.140 -27.817 -6.460  1.00 23.11  ? 292 GLU A CG    1 
ATOM   2329 C  CD    . GLU A 1 295 ? 43.493 -28.160 -7.799  1.00 38.28  ? 292 GLU A CD    1 
ATOM   2330 O  OE1   . GLU A 1 295 ? 44.118 -27.894 -8.851  1.00 46.35  ? 292 GLU A OE1   1 
ATOM   2331 O  OE2   . GLU A 1 295 ? 42.359 -28.694 -7.802  1.00 29.22  ? 292 GLU A OE2   1 
ATOM   2332 N  N     . LYS A 1 296 ? 44.239 -24.546 -4.500  1.00 14.69  ? 293 LYS A N     1 
ATOM   2333 C  CA    . LYS A 1 296 ? 45.102 -23.389 -4.726  1.00 16.20  ? 293 LYS A CA    1 
ATOM   2334 C  C     . LYS A 1 296 ? 45.805 -22.938 -3.434  1.00 13.74  ? 293 LYS A C     1 
ATOM   2335 O  O     . LYS A 1 296 ? 47.044 -22.826 -3.391  1.00 13.88  ? 293 LYS A O     1 
ATOM   2336 C  CB    . LYS A 1 296 ? 44.283 -22.241 -5.346  1.00 17.57  ? 293 LYS A CB    1 
ATOM   2337 C  CG    . LYS A 1 296 ? 45.041 -20.945 -5.562  1.00 25.74  ? 293 LYS A CG    1 
ATOM   2338 C  CD    . LYS A 1 296 ? 44.342 -20.075 -6.603  1.00 29.77  ? 293 LYS A CD    1 
ATOM   2339 C  CE    . LYS A 1 296 ? 44.905 -18.657 -6.621  1.00 36.13  ? 293 LYS A CE    1 
ATOM   2340 N  NZ    . LYS A 1 296 ? 44.366 -17.872 -7.765  1.00 39.48  ? 293 LYS A NZ    1 
ATOM   2341 N  N     . ASN A 1 297 ? 45.031 -22.677 -2.396  1.00 15.49  ? 294 ASN A N     1 
ATOM   2342 C  CA    . ASN A 1 297 ? 45.630 -22.258 -1.115  1.00 15.30  ? 294 ASN A CA    1 
ATOM   2343 C  C     . ASN A 1 297 ? 46.555 -23.337 -0.552  1.00 14.67  ? 294 ASN A C     1 
ATOM   2344 O  O     . ASN A 1 297 ? 47.613 -23.029 0.003   1.00 11.91  ? 294 ASN A O     1 
ATOM   2345 C  CB    . ASN A 1 297 ? 44.561 -22.000 -0.062  1.00 17.49  ? 294 ASN A CB    1 
ATOM   2346 C  CG    . ASN A 1 297 ? 43.827 -20.712 -0.270  1.00 23.38  ? 294 ASN A CG    1 
ATOM   2347 O  OD1   . ASN A 1 297 ? 44.314 -19.808 -0.951  1.00 23.56  ? 294 ASN A OD1   1 
ATOM   2348 N  ND2   . ASN A 1 297 ? 42.644 -20.600 0.348   1.00 21.71  ? 294 ASN A ND2   1 
ATOM   2349 N  N     . GLY A 1 298 ? 46.136 -24.596 -0.648  1.00 13.00  ? 295 GLY A N     1 
ATOM   2350 C  CA    . GLY A 1 298 ? 46.940 -25.704 -0.120  1.00 11.37  ? 295 GLY A CA    1 
ATOM   2351 C  C     . GLY A 1 298 ? 48.324 -25.824 -0.765  1.00 9.38   ? 295 GLY A C     1 
ATOM   2352 O  O     . GLY A 1 298 ? 49.339 -25.976 -0.064  1.00 10.45  ? 295 GLY A O     1 
ATOM   2353 N  N     . SER A 1 299 ? 48.385 -25.758 -2.096  1.00 10.20  ? 296 SER A N     1 
ATOM   2354 C  CA    . SER A 1 299 ? 49.642 -25.801 -2.824  1.00 8.93   ? 296 SER A CA    1 
ATOM   2355 C  C     . SER A 1 299 ? 50.473 -24.567 -2.469  1.00 9.75   ? 296 SER A C     1 
ATOM   2356 O  O     . SER A 1 299 ? 51.689 -24.658 -2.297  1.00 11.48  ? 296 SER A O     1 
ATOM   2357 C  CB    . SER A 1 299 ? 49.346 -25.799 -4.327  1.00 13.71  ? 296 SER A CB    1 
ATOM   2358 O  OG    . SER A 1 299 ? 48.916 -27.101 -4.715  1.00 17.23  ? 296 SER A OG    1 
ATOM   2359 N  N     . TRP A 1 300 ? 49.803 -23.419 -2.339  1.00 10.27  ? 297 TRP A N     1 
ATOM   2360 C  CA    . TRP A 1 300 ? 50.520 -22.185 -2.036  1.00 9.02   ? 297 TRP A CA    1 
ATOM   2361 C  C     . TRP A 1 300 ? 51.142 -22.281 -0.654  1.00 8.98   ? 297 TRP A C     1 
ATOM   2362 O  O     . TRP A 1 300 ? 52.332 -21.959 -0.491  1.00 9.69   ? 297 TRP A O     1 
ATOM   2363 C  CB    . TRP A 1 300 ? 49.575 -20.985 -2.140  1.00 9.93   ? 297 TRP A CB    1 
ATOM   2364 C  CG    . TRP A 1 300 ? 50.242 -19.677 -1.922  1.00 10.16  ? 297 TRP A CG    1 
ATOM   2365 C  CD1   . TRP A 1 300 ? 50.843 -18.907 -2.869  1.00 14.84  ? 297 TRP A CD1   1 
ATOM   2366 C  CD2   . TRP A 1 300 ? 50.362 -18.965 -0.683  1.00 11.77  ? 297 TRP A CD2   1 
ATOM   2367 N  NE1   . TRP A 1 300 ? 51.349 -17.765 -2.298  1.00 18.33  ? 297 TRP A NE1   1 
ATOM   2368 C  CE2   . TRP A 1 300 ? 51.062 -17.776 -0.959  1.00 15.55  ? 297 TRP A CE2   1 
ATOM   2369 C  CE3   . TRP A 1 300 ? 49.943 -19.215 0.623   1.00 13.33  ? 297 TRP A CE3   1 
ATOM   2370 C  CZ2   . TRP A 1 300 ? 51.349 -16.835 0.026   1.00 15.73  ? 297 TRP A CZ2   1 
ATOM   2371 C  CZ3   . TRP A 1 300 ? 50.240 -18.284 1.601   1.00 17.34  ? 297 TRP A CZ3   1 
ATOM   2372 C  CH2   . TRP A 1 300 ? 50.931 -17.113 1.293   1.00 14.29  ? 297 TRP A CH2   1 
ATOM   2373 N  N     . LEU A 1 301 ? 50.371 -22.777 0.315   1.00 8.43   ? 298 LEU A N     1 
ATOM   2374 C  CA    . LEU A 1 301 ? 50.901 -22.913 1.684   1.00 9.74   ? 298 LEU A CA    1 
ATOM   2375 C  C     . LEU A 1 301 ? 52.047 -23.915 1.757   1.00 9.45   ? 298 LEU A C     1 
ATOM   2376 O  O     . LEU A 1 301 ? 53.042 -23.687 2.449   1.00 8.39   ? 298 LEU A O     1 
ATOM   2377 C  CB    . LEU A 1 301 ? 49.821 -23.325 2.663   1.00 8.26   ? 298 LEU A CB    1 
ATOM   2378 C  CG    . LEU A 1 301 ? 48.750 -22.269 2.949   1.00 9.19   ? 298 LEU A CG    1 
ATOM   2379 C  CD1   . LEU A 1 301 ? 47.566 -22.921 3.637   1.00 12.28  ? 298 LEU A CD1   1 
ATOM   2380 C  CD2   . LEU A 1 301 ? 49.322 -21.155 3.845   1.00 12.09  ? 298 LEU A CD2   1 
ATOM   2381 N  N     . TYR A 1 302 ? 51.916 -25.030 1.052   1.00 7.82   ? 299 TYR A N     1 
ATOM   2382 C  CA    . TYR A 1 302 ? 52.985 -26.041 1.068   1.00 8.51   ? 299 TYR A CA    1 
ATOM   2383 C  C     . TYR A 1 302 ? 54.327 -25.487 0.597   1.00 9.28   ? 299 TYR A C     1 
ATOM   2384 O  O     . TYR A 1 302 ? 55.373 -25.729 1.209   1.00 8.89   ? 299 TYR A O     1 
ATOM   2385 C  CB    . TYR A 1 302 ? 52.574 -27.238 0.176   1.00 9.80   ? 299 TYR A CB    1 
ATOM   2386 C  CG    . TYR A 1 302 ? 53.585 -28.350 0.185   1.00 10.87  ? 299 TYR A CG    1 
ATOM   2387 C  CD1   . TYR A 1 302 ? 53.549 -29.316 1.170   1.00 12.31  ? 299 TYR A CD1   1 
ATOM   2388 C  CD2   . TYR A 1 302 ? 54.583 -28.419 -0.778  1.00 12.02  ? 299 TYR A CD2   1 
ATOM   2389 C  CE1   . TYR A 1 302 ? 54.483 -30.336 1.198   1.00 13.78  ? 299 TYR A CE1   1 
ATOM   2390 C  CE2   . TYR A 1 302 ? 55.526 -29.426 -0.747  1.00 15.56  ? 299 TYR A CE2   1 
ATOM   2391 C  CZ    . TYR A 1 302 ? 55.460 -30.380 0.239   1.00 15.42  ? 299 TYR A CZ    1 
ATOM   2392 O  OH    . TYR A 1 302 ? 56.401 -31.384 0.275   1.00 20.70  ? 299 TYR A OH    1 
ATOM   2393 N  N     . ALA A 1 303 ? 54.301 -24.740 -0.498  1.00 8.86   ? 300 ALA A N     1 
ATOM   2394 C  CA    . ALA A 1 303 ? 55.500 -24.113 -1.015  1.00 7.98   ? 300 ALA A CA    1 
ATOM   2395 C  C     . ALA A 1 303 ? 55.944 -22.933 -0.148  1.00 7.60   ? 300 ALA A C     1 
ATOM   2396 O  O     . ALA A 1 303 ? 57.146 -22.775 0.132   1.00 8.98   ? 300 ALA A O     1 
ATOM   2397 C  CB    . ALA A 1 303 ? 55.235 -23.616 -2.431  1.00 11.25  ? 300 ALA A CB    1 
ATOM   2398 N  N     . MET A 1 304 ? 54.986 -22.113 0.291   1.00 8.69   ? 301 MET A N     1 
ATOM   2399 C  CA    . MET A 1 304 ? 55.365 -20.875 0.970   1.00 7.41   ? 301 MET A CA    1 
ATOM   2400 C  C     . MET A 1 304 ? 56.065 -21.124 2.292   1.00 6.63   ? 301 MET A C     1 
ATOM   2401 O  O     . MET A 1 304 ? 57.014 -20.392 2.647   1.00 7.62   ? 301 MET A O     1 
ATOM   2402 C  CB    . MET A 1 304 ? 54.149 -19.981 1.202   1.00 9.62   ? 301 MET A CB    1 
ATOM   2403 C  CG    . MET A 1 304 ? 54.507 -18.569 1.653   1.00 11.42  ? 301 MET A CG    1 
ATOM   2404 S  SD    . MET A 1 304 ? 55.238 -17.647 0.301   1.00 12.98  ? 301 MET A SD    1 
ATOM   2405 C  CE    . MET A 1 304 ? 56.983 -17.576 0.777   1.00 13.16  ? 301 MET A CE    1 
ATOM   2406 N  N     . CYS A 1 305 ? 55.665 -22.184 2.983   1.00 6.34   ? 302 CYS A N     1 
ATOM   2407 C  CA    . CYS A 1 305 ? 56.281 -22.429 4.310   1.00 9.10   ? 302 CYS A CA    1 
ATOM   2408 C  C     . CYS A 1 305 ? 57.736 -22.915 4.154   1.00 8.00   ? 302 CYS A C     1 
ATOM   2409 O  O     . CYS A 1 305 ? 58.502 -22.937 5.133   1.00 10.24  ? 302 CYS A O     1 
ATOM   2410 C  CB    . CYS A 1 305 ? 55.450 -23.385 5.154   1.00 9.64   ? 302 CYS A CB    1 
ATOM   2411 S  SG    . CYS A 1 305 ? 55.470 -25.090 4.547   1.00 8.72   ? 302 CYS A SG    1 
ATOM   2412 N  N     . ARG A 1 306 ? 58.126 -23.252 2.930   1.00 7.67   ? 303 ARG A N     1 
ATOM   2413 C  CA    . ARG A 1 306 ? 59.506 -23.619 2.583   1.00 8.45   ? 303 ARG A CA    1 
ATOM   2414 C  C     . ARG A 1 306 ? 60.255 -22.451 1.897   1.00 10.78  ? 303 ARG A C     1 
ATOM   2415 O  O     . ARG A 1 306 ? 61.391 -22.619 1.431   1.00 12.78  ? 303 ARG A O     1 
ATOM   2416 C  CB    . ARG A 1 306 ? 59.518 -24.868 1.665   1.00 10.43  ? 303 ARG A CB    1 
ATOM   2417 C  CG    . ARG A 1 306 ? 58.912 -26.117 2.342   1.00 11.45  ? 303 ARG A CG    1 
ATOM   2418 C  CD    . ARG A 1 306 ? 58.563 -27.252 1.376   1.00 10.23  ? 303 ARG A CD    1 
ATOM   2419 N  NE    . ARG A 1 306 ? 58.379 -28.477 2.169   1.00 14.34  ? 303 ARG A NE    1 
ATOM   2420 C  CZ    . ARG A 1 306 ? 57.288 -28.742 2.885   1.00 11.53  ? 303 ARG A CZ    1 
ATOM   2421 N  NH1   . ARG A 1 306 ? 57.212 -29.857 3.622   1.00 10.76  ? 303 ARG A NH1   1 
ATOM   2422 N  NH2   . ARG A 1 306 ? 56.241 -27.925 2.850   1.00 9.32   ? 303 ARG A NH2   1 
ATOM   2423 N  N     . GLY A 1 307 ? 59.615 -21.285 1.827   1.00 8.76   ? 304 GLY A N     1 
ATOM   2424 C  CA    . GLY A 1 307 ? 60.242 -20.096 1.279   1.00 10.92  ? 304 GLY A CA    1 
ATOM   2425 C  C     . GLY A 1 307 ? 60.026 -19.946 -0.214  1.00 8.56   ? 304 GLY A C     1 
ATOM   2426 O  O     . GLY A 1 307 ? 60.685 -19.121 -0.852  1.00 10.35  ? 304 GLY A O     1 
ATOM   2427 N  N     . ILE A 1 308 ? 59.132 -20.755 -0.778  1.00 8.53   ? 305 ILE A N     1 
ATOM   2428 C  CA    . ILE A 1 308 ? 58.961 -20.818 -2.236  1.00 8.88   ? 305 ILE A CA    1 
ATOM   2429 C  C     . ILE A 1 308 ? 57.627 -20.257 -2.669  1.00 10.48  ? 305 ILE A C     1 
ATOM   2430 O  O     . ILE A 1 308 ? 56.603 -20.624 -2.133  1.00 9.47   ? 305 ILE A O     1 
ATOM   2431 C  CB    . ILE A 1 308 ? 59.047 -22.272 -2.712  1.00 10.93  ? 305 ILE A CB    1 
ATOM   2432 C  CG1   . ILE A 1 308 ? 60.426 -22.834 -2.347  1.00 11.78  ? 305 ILE A CG1   1 
ATOM   2433 C  CG2   . ILE A 1 308 ? 58.755 -22.353 -4.203  1.00 10.33  ? 305 ILE A CG2   1 
ATOM   2434 C  CD1   . ILE A 1 308 ? 60.578 -24.330 -2.614  1.00 17.62  ? 305 ILE A CD1   1 
ATOM   2435 N  N     . GLU A 1 309 ? 57.636 -19.375 -3.662  1.00 10.30  ? 306 GLU A N     1 
ATOM   2436 C  CA    . GLU A 1 309 ? 56.390 -18.793 -4.134  1.00 12.45  ? 306 GLU A CA    1 
ATOM   2437 C  C     . GLU A 1 309 ? 56.610 -18.334 -5.559  1.00 16.39  ? 306 GLU A C     1 
ATOM   2438 O  O     . GLU A 1 309 ? 57.691 -17.842 -5.864  1.00 15.62  ? 306 GLU A O     1 
ATOM   2439 C  CB    . GLU A 1 309 ? 56.009 -17.583 -3.282  1.00 17.33  ? 306 GLU A CB    1 
ATOM   2440 C  CG    . GLU A 1 309 ? 54.588 -17.192 -3.499  1.00 21.37  ? 306 GLU A CG    1 
ATOM   2441 C  CD    . GLU A 1 309 ? 54.311 -15.715 -3.374  1.00 21.75  ? 306 GLU A CD    1 
ATOM   2442 O  OE1   . GLU A 1 309 ? 55.226 -14.854 -3.473  1.00 17.96  ? 306 GLU A OE1   1 
ATOM   2443 O  OE2   . GLU A 1 309 ? 53.129 -15.413 -3.179  1.00 26.95  ? 306 GLU A OE2   1 
ATOM   2444 N  N     . HIS A 1 310 ? 55.602 -18.472 -6.427  1.00 16.58  ? 307 HIS A N     1 
ATOM   2445 C  CA    . HIS A 1 310 ? 55.851 -18.201 -7.848  1.00 17.11  ? 307 HIS A CA    1 
ATOM   2446 C  C     . HIS A 1 310 ? 55.117 -17.003 -8.441  1.00 15.14  ? 307 HIS A C     1 
ATOM   2447 O  O     . HIS A 1 310 ? 55.314 -16.685 -9.620  1.00 18.24  ? 307 HIS A O     1 
ATOM   2448 C  CB    . HIS A 1 310 ? 55.642 -19.463 -8.695  1.00 24.01  ? 307 HIS A CB    1 
ATOM   2449 C  CG    . HIS A 1 310 ? 56.562 -20.583 -8.316  1.00 28.14  ? 307 HIS A CG    1 
ATOM   2450 N  ND1   . HIS A 1 310 ? 57.936 -20.462 -8.349  1.00 32.50  ? 307 HIS A ND1   1 
ATOM   2451 C  CD2   . HIS A 1 310 ? 56.302 -21.828 -7.855  1.00 32.91  ? 307 HIS A CD2   1 
ATOM   2452 C  CE1   . HIS A 1 310 ? 58.484 -21.596 -7.947  1.00 32.19  ? 307 HIS A CE1   1 
ATOM   2453 N  NE2   . HIS A 1 310 ? 57.514 -22.441 -7.643  1.00 34.55  ? 307 HIS A NE2   1 
ATOM   2454 N  N     . ASP A 1 311 ? 54.309 -16.337 -7.626  1.00 14.47  ? 308 ASP A N     1 
ATOM   2455 C  CA    . ASP A 1 311 ? 53.531 -15.170 -8.071  1.00 16.87  ? 308 ASP A CA    1 
ATOM   2456 C  C     . ASP A 1 311 ? 54.441 -14.158 -8.788  1.00 17.54  ? 308 ASP A C     1 
ATOM   2457 O  O     . ASP A 1 311 ? 55.372 -13.641 -8.204  1.00 12.33  ? 308 ASP A O     1 
ATOM   2458 C  CB    . ASP A 1 311 ? 52.872 -14.520 -6.849  1.00 15.99  ? 308 ASP A CB    1 
ATOM   2459 C  CG    . ASP A 1 311 ? 51.958 -13.351 -7.214  1.00 24.49  ? 308 ASP A CG    1 
ATOM   2460 O  OD1   . ASP A 1 311 ? 51.399 -13.343 -8.326  1.00 31.80  ? 308 ASP A OD1   1 
ATOM   2461 O  OD2   . ASP A 1 311 ? 51.787 -12.440 -6.372  1.00 33.25  ? 308 ASP A OD2   1 
ATOM   2462 N  N     . PRO A 1 312 ? 54.202 -13.894 -10.084 1.00 12.54  ? 309 PRO A N     1 
ATOM   2463 C  CA    . PRO A 1 312 ? 55.098 -12.998 -10.806 1.00 13.03  ? 309 PRO A CA    1 
ATOM   2464 C  C     . PRO A 1 312 ? 54.944 -11.536 -10.428 1.00 10.57  ? 309 PRO A C     1 
ATOM   2465 O  O     . PRO A 1 312 ? 53.881 -11.103 -10.011 1.00 13.38  ? 309 PRO A O     1 
ATOM   2466 C  CB    . PRO A 1 312 ? 54.660 -13.187 -12.278 1.00 13.92  ? 309 PRO A CB    1 
ATOM   2467 C  CG    . PRO A 1 312 ? 53.278 -13.617 -12.182 1.00 14.54  ? 309 PRO A CG    1 
ATOM   2468 C  CD    . PRO A 1 312 ? 53.224 -14.526 -10.980 1.00 16.29  ? 309 PRO A CD    1 
ATOM   2469 N  N     . VAL A 1 313 ? 56.026 -10.786 -10.576 1.00 10.71  ? 310 VAL A N     1 
ATOM   2470 C  CA    . VAL A 1 313 ? 55.940 -9.327  -10.539 1.00 10.55  ? 310 VAL A CA    1 
ATOM   2471 C  C     . VAL A 1 313 ? 55.257 -8.915  -11.835 1.00 11.58  ? 310 VAL A C     1 
ATOM   2472 O  O     . VAL A 1 313 ? 55.826 -9.114  -12.910 1.00 12.96  ? 310 VAL A O     1 
ATOM   2473 C  CB    . VAL A 1 313 ? 57.330 -8.725  -10.477 1.00 11.31  ? 310 VAL A CB    1 
ATOM   2474 C  CG1   . VAL A 1 313 ? 57.243 -7.185  -10.508 1.00 12.26  ? 310 VAL A CG1   1 
ATOM   2475 C  CG2   . VAL A 1 313 ? 58.032 -9.176  -9.192  1.00 11.63  ? 310 VAL A CG2   1 
ATOM   2476 N  N     . LYS A 1 314 ? 54.032 -8.409  -11.722 1.00 14.44  ? 311 LYS A N     1 
ATOM   2477 C  CA    . LYS A 1 314 ? 53.234 -8.055  -12.893 1.00 14.56  ? 311 LYS A CA    1 
ATOM   2478 C  C     . LYS A 1 314 ? 53.639 -6.690  -13.431 1.00 15.33  ? 311 LYS A C     1 
ATOM   2479 O  O     . LYS A 1 314 ? 53.806 -5.735  -12.677 1.00 16.07  ? 311 LYS A O     1 
ATOM   2480 C  CB    . LYS A 1 314 ? 51.751 -8.075  -12.538 1.00 17.96  ? 311 LYS A CB    1 
ATOM   2481 C  CG    . LYS A 1 314 ? 51.269 -9.470  -12.159 1.00 20.64  ? 311 LYS A CG    1 
ATOM   2482 C  CD    . LYS A 1 314 ? 49.932 -9.443  -11.460 1.00 27.22  ? 311 LYS A CD    1 
ATOM   2483 C  CE    . LYS A 1 314 ? 49.548 -10.851 -10.984 1.00 31.45  ? 311 LYS A CE    1 
ATOM   2484 N  NZ    . LYS A 1 314 ? 50.645 -11.487 -10.168 1.00 28.49  ? 311 LYS A NZ    1 
ATOM   2485 N  N     . PRO A 1 315 ? 53.810 -6.595  -14.739 1.00 14.25  ? 312 PRO A N     1 
ATOM   2486 C  CA    . PRO A 1 315 ? 54.181 -5.331  -15.362 1.00 13.44  ? 312 PRO A CA    1 
ATOM   2487 C  C     . PRO A 1 315 ? 52.992 -4.376  -15.372 1.00 19.22  ? 312 PRO A C     1 
ATOM   2488 O  O     . PRO A 1 315 ? 52.250 -4.298  -16.356 1.00 20.12  ? 312 PRO A O     1 
ATOM   2489 C  CB    . PRO A 1 315 ? 54.560 -5.762  -16.783 1.00 16.06  ? 312 PRO A CB    1 
ATOM   2490 C  CG    . PRO A 1 315 ? 53.683 -6.981  -17.048 1.00 16.52  ? 312 PRO A CG    1 
ATOM   2491 C  CD    . PRO A 1 315 ? 53.682 -7.698  -15.722 1.00 15.11  ? 312 PRO A CD    1 
ATOM   2492 N  N     . ARG A 1 316 ? 52.817 -3.649  -14.275 1.00 16.51  ? 313 ARG A N     1 
ATOM   2493 C  CA    . ARG A 1 316 ? 51.667 -2.766  -14.106 1.00 17.53  ? 313 ARG A CA    1 
ATOM   2494 C  C     . ARG A 1 316 ? 52.050 -1.591  -13.209 1.00 17.94  ? 313 ARG A C     1 
ATOM   2495 O  O     . ARG A 1 316 ? 52.243 -1.760  -12.002 1.00 17.41  ? 313 ARG A O     1 
ATOM   2496 C  CB    A ARG A 1 316 ? 50.527 -3.563  -13.458 0.66 21.47  ? 313 ARG A CB    1 
ATOM   2497 C  CB    B ARG A 1 316 ? 50.469 -3.522  -13.532 0.34 21.50  ? 313 ARG A CB    1 
ATOM   2498 C  CG    A ARG A 1 316 ? 49.185 -2.839  -13.350 0.66 24.78  ? 313 ARG A CG    1 
ATOM   2499 C  CG    B ARG A 1 316 ? 49.170 -2.724  -13.573 0.34 24.54  ? 313 ARG A CG    1 
ATOM   2500 C  CD    A ARG A 1 316 ? 48.210 -3.639  -12.474 0.66 24.86  ? 313 ARG A CD    1 
ATOM   2501 C  CD    B ARG A 1 316 ? 48.020 -3.514  -12.970 0.34 24.86  ? 313 ARG A CD    1 
ATOM   2502 N  NE    A ARG A 1 316 ? 48.531 -3.504  -11.051 0.66 28.28  ? 313 ARG A NE    1 
ATOM   2503 N  NE    B ARG A 1 316 ? 48.386 -4.082  -11.677 0.34 26.62  ? 313 ARG A NE    1 
ATOM   2504 C  CZ    A ARG A 1 316 ? 48.706 -4.518  -10.202 0.66 27.91  ? 313 ARG A CZ    1 
ATOM   2505 C  CZ    B ARG A 1 316 ? 48.437 -3.388  -10.544 0.34 27.34  ? 313 ARG A CZ    1 
ATOM   2506 N  NH1   A ARG A 1 316 ? 49.001 -4.267  -8.932  0.66 27.61  ? 313 ARG A NH1   1 
ATOM   2507 N  NH1   B ARG A 1 316 ? 48.787 -3.988  -9.415  0.34 26.35  ? 313 ARG A NH1   1 
ATOM   2508 N  NH2   A ARG A 1 316 ? 48.584 -5.779  -10.608 0.66 27.81  ? 313 ARG A NH2   1 
ATOM   2509 N  NH2   B ARG A 1 316 ? 48.141 -2.092  -10.538 0.34 26.23  ? 313 ARG A NH2   1 
ATOM   2510 N  N     . GLN A 1 317 ? 52.159 -0.398  -13.790 1.00 20.15  ? 314 GLN A N     1 
ATOM   2511 C  CA    . GLN A 1 317 ? 52.635 0.764   -13.043 1.00 18.38  ? 314 GLN A CA    1 
ATOM   2512 C  C     . GLN A 1 317 ? 51.475 1.645   -12.599 1.00 19.68  ? 314 GLN A C     1 
ATOM   2513 O  O     . GLN A 1 317 ? 51.603 2.462   -11.674 1.00 21.77  ? 314 GLN A O     1 
ATOM   2514 C  CB    . GLN A 1 317 ? 53.581 1.577   -13.915 1.00 29.31  ? 314 GLN A CB    1 
ATOM   2515 C  CG    . GLN A 1 317 ? 54.319 2.633   -13.150 1.00 30.24  ? 314 GLN A CG    1 
ATOM   2516 C  CD    . GLN A 1 317 ? 55.362 3.322   -13.981 1.00 36.43  ? 314 GLN A CD    1 
ATOM   2517 O  OE1   . GLN A 1 317 ? 55.756 2.829   -15.044 1.00 38.94  ? 314 GLN A OE1   1 
ATOM   2518 N  NE2   . GLN A 1 317 ? 55.826 4.469   -13.502 1.00 29.73  ? 314 GLN A NE2   1 
ATOM   2519 N  N     . LEU A 1 318 ? 50.344 1.468   -13.265 1.00 17.88  ? 315 LEU A N     1 
ATOM   2520 C  CA    . LEU A 1 318 ? 49.160 2.286   -13.030 1.00 20.93  ? 315 LEU A CA    1 
ATOM   2521 C  C     . LEU A 1 318 ? 48.038 1.489   -12.388 1.00 20.71  ? 315 LEU A C     1 
ATOM   2522 O  O     . LEU A 1 318 ? 47.866 0.308   -12.670 1.00 20.53  ? 315 LEU A O     1 
ATOM   2523 C  CB    . LEU A 1 318 ? 48.627 2.817   -14.363 1.00 18.59  ? 315 LEU A CB    1 
ATOM   2524 C  CG    . LEU A 1 318 ? 49.565 3.588   -15.283 1.00 21.76  ? 315 LEU A CG    1 
ATOM   2525 C  CD1   . LEU A 1 318 ? 48.843 3.844   -16.607 1.00 21.10  ? 315 LEU A CD1   1 
ATOM   2526 C  CD2   . LEU A 1 318 ? 50.015 4.889   -14.648 1.00 19.89  ? 315 LEU A CD2   1 
ATOM   2527 N  N     . PRO A 1 319 ? 47.236 2.155   -11.545 1.00 16.57  ? 316 PRO A N     1 
ATOM   2528 C  CA    . PRO A 1 319 ? 46.026 1.538   -10.979 1.00 20.30  ? 316 PRO A CA    1 
ATOM   2529 C  C     . PRO A 1 319 ? 45.062 1.094   -12.085 1.00 19.02  ? 316 PRO A C     1 
ATOM   2530 O  O     . PRO A 1 319 ? 45.016 1.750   -13.122 1.00 21.64  ? 316 PRO A O     1 
ATOM   2531 C  CB    . PRO A 1 319 ? 45.400 2.672   -10.155 1.00 21.31  ? 316 PRO A CB    1 
ATOM   2532 C  CG    . PRO A 1 319 ? 46.524 3.658   -9.926  1.00 22.44  ? 316 PRO A CG    1 
ATOM   2533 C  CD    . PRO A 1 319 ? 47.445 3.546   -11.096 1.00 18.56  ? 316 PRO A CD    1 
ATOM   2534 N  N     . LYS A 1 320 ? 44.339 -0.009  -11.877 1.00 18.02  ? 317 LYS A N     1 
ATOM   2535 C  CA    . LYS A 1 320 ? 43.363 -0.541  -12.847 1.00 17.52  ? 317 LYS A CA    1 
ATOM   2536 C  C     . LYS A 1 320 ? 41.964 0.046   -12.700 1.00 22.37  ? 317 LYS A C     1 
ATOM   2537 O  O     . LYS A 1 320 ? 41.083 -0.228  -13.512 1.00 21.98  ? 317 LYS A O     1 
ATOM   2538 C  CB    . LYS A 1 320 ? 43.177 -2.048  -12.640 1.00 25.24  ? 317 LYS A CB    1 
ATOM   2539 C  CG    . LYS A 1 320 ? 44.346 -2.951  -12.912 1.00 29.02  ? 317 LYS A CG    1 
ATOM   2540 C  CD    . LYS A 1 320 ? 43.819 -4.389  -12.994 1.00 28.21  ? 317 LYS A CD    1 
ATOM   2541 C  CE    . LYS A 1 320 ? 44.942 -5.384  -13.181 1.00 36.27  ? 317 LYS A CE    1 
ATOM   2542 N  NZ    . LYS A 1 320 ? 44.442 -6.706  -13.646 1.00 37.38  ? 317 LYS A NZ    1 
ATOM   2543 N  N     . THR A 1 321 ? 41.732 0.773   -11.613 1.00 18.28  ? 318 THR A N     1 
ATOM   2544 C  CA    . THR A 1 321 ? 40.423 1.366   -11.359 1.00 18.73  ? 318 THR A CA    1 
ATOM   2545 C  C     . THR A 1 321 ? 40.690 2.744   -10.792 1.00 14.61  ? 318 THR A C     1 
ATOM   2546 O  O     . THR A 1 321 ? 41.782 3.024   -10.288 1.00 17.95  ? 318 THR A O     1 
ATOM   2547 C  CB    . THR A 1 321 ? 39.532 0.507   -10.386 1.00 19.78  ? 318 THR A CB    1 
ATOM   2548 O  OG1   . THR A 1 321 ? 40.240 0.263   -9.162  1.00 18.39  ? 318 THR A OG1   1 
ATOM   2549 C  CG2   . THR A 1 321 ? 39.156 -0.830  -10.994 1.00 20.35  ? 318 THR A CG2   1 
ATOM   2550 N  N     . ILE A 1 322 ? 39.709 3.629   -10.947 1.00 16.80  ? 319 ILE A N     1 
ATOM   2551 C  CA    . ILE A 1 322 ? 39.760 4.952   -10.365 1.00 14.73  ? 319 ILE A CA    1 
ATOM   2552 C  C     . ILE A 1 322 ? 38.411 5.144   -9.666  1.00 16.14  ? 319 ILE A C     1 
ATOM   2553 O  O     . ILE A 1 322 ? 37.361 5.090   -10.309 1.00 14.83  ? 319 ILE A O     1 
ATOM   2554 C  CB    . ILE A 1 322 ? 39.977 6.002   -11.466 1.00 13.95  ? 319 ILE A CB    1 
ATOM   2555 C  CG1   . ILE A 1 322 ? 41.354 5.804   -12.108 1.00 18.77  ? 319 ILE A CG1   1 
ATOM   2556 C  CG2   . ILE A 1 322 ? 39.862 7.408   -10.915 1.00 17.71  ? 319 ILE A CG2   1 
ATOM   2557 C  CD1   . ILE A 1 322 ? 41.678 6.818   -13.199 1.00 19.71  ? 319 ILE A CD1   1 
ATOM   2558 N  N     . GLY A 1 323 ? 38.443 5.268   -8.340  1.00 14.81  ? 320 GLY A N     1 
ATOM   2559 C  CA    . GLY A 1 323 ? 37.212 5.269   -7.563  1.00 16.54  ? 320 GLY A CA    1 
ATOM   2560 C  C     . GLY A 1 323 ? 37.127 6.437   -6.605  1.00 14.59  ? 320 GLY A C     1 
ATOM   2561 O  O     . GLY A 1 323 ? 38.137 7.010   -6.223  1.00 16.08  ? 320 GLY A O     1 
ATOM   2562 N  N     . CYS A 1 324 ? 35.891 6.758   -6.215  1.00 15.04  ? 321 CYS A N     1 
ATOM   2563 C  CA    A CYS A 1 324 ? 35.591 7.882   -5.338  0.30 17.50  ? 321 CYS A CA    1 
ATOM   2564 C  CA    B CYS A 1 324 ? 35.596 7.881   -5.313  0.52 17.51  ? 321 CYS A CA    1 
ATOM   2565 C  CA    C CYS A 1 324 ? 35.635 7.844   -5.286  0.17 17.48  ? 321 CYS A CA    1 
ATOM   2566 C  C     . CYS A 1 324 ? 34.499 7.436   -4.372  1.00 17.45  ? 321 CYS A C     1 
ATOM   2567 O  O     . CYS A 1 324 ? 33.428 7.046   -4.822  1.00 17.40  ? 321 CYS A O     1 
ATOM   2568 C  CB    A CYS A 1 324 ? 35.057 9.034   -6.197  0.30 16.77  ? 321 CYS A CB    1 
ATOM   2569 C  CB    B CYS A 1 324 ? 35.073 9.103   -6.092  0.52 16.71  ? 321 CYS A CB    1 
ATOM   2570 C  CB    C CYS A 1 324 ? 35.274 9.130   -6.035  0.17 16.94  ? 321 CYS A CB    1 
ATOM   2571 S  SG    A CYS A 1 324 ? 35.180 10.673  -5.493  0.30 19.21  ? 321 CYS A SG    1 
ATOM   2572 S  SG    B CYS A 1 324 ? 36.227 9.847   -7.264  0.52 20.23  ? 321 CYS A SG    1 
ATOM   2573 S  SG    C CYS A 1 324 ? 33.921 8.948   -7.211  0.17 19.08  ? 321 CYS A SG    1 
ATOM   2574 N  N     . SER A 1 325 ? 34.752 7.507   -3.066  1.00 16.39  ? 322 SER A N     1 
ATOM   2575 C  CA    A SER A 1 325 ? 33.741 7.046   -2.119  0.55 15.60  ? 322 SER A CA    1 
ATOM   2576 C  CA    B SER A 1 325 ? 33.865 6.942   -2.051  0.45 15.69  ? 322 SER A CA    1 
ATOM   2577 C  C     . SER A 1 325 ? 33.635 7.934   -0.902  1.00 15.68  ? 322 SER A C     1 
ATOM   2578 O  O     . SER A 1 325 ? 34.556 8.670   -0.549  1.00 17.74  ? 322 SER A O     1 
ATOM   2579 C  CB    A SER A 1 325 ? 34.003 5.610   -1.670  0.55 17.32  ? 322 SER A CB    1 
ATOM   2580 C  CB    B SER A 1 325 ? 34.534 5.668   -1.516  0.45 16.86  ? 322 SER A CB    1 
ATOM   2581 O  OG    A SER A 1 325 ? 35.210 5.527   -0.940  0.55 17.45  ? 322 SER A OG    1 
ATOM   2582 O  OG    B SER A 1 325 ? 33.871 5.102   -0.404  0.45 17.10  ? 322 SER A OG    1 
ATOM   2583 N  N     . LYS A 1 326 ? 32.454 7.893   -0.290  1.00 14.45  ? 323 LYS A N     1 
ATOM   2584 C  CA    . LYS A 1 326 ? 32.249 8.635   0.954   1.00 14.55  ? 323 LYS A CA    1 
ATOM   2585 C  C     . LYS A 1 326 ? 31.262 7.930   1.870   1.00 16.86  ? 323 LYS A C     1 
ATOM   2586 O  O     . LYS A 1 326 ? 30.222 7.449   1.434   1.00 14.68  ? 323 LYS A O     1 
ATOM   2587 C  CB    . LYS A 1 326 ? 31.804 10.065  0.682   1.00 12.64  ? 323 LYS A CB    1 
ATOM   2588 C  CG    . LYS A 1 326 ? 31.682 10.903  1.986   1.00 13.98  ? 323 LYS A CG    1 
ATOM   2589 C  CD    . LYS A 1 326 ? 31.658 12.373  1.649   1.00 17.99  ? 323 LYS A CD    1 
ATOM   2590 C  CE    . LYS A 1 326 ? 31.407 13.242  2.866   1.00 20.96  ? 323 LYS A CE    1 
ATOM   2591 N  NZ    . LYS A 1 326 ? 32.393 12.991  3.961   1.00 20.89  ? 323 LYS A NZ    1 
ATOM   2592 N  N     . ASN A 1 327 ? 31.607 7.849   3.147   1.00 13.62  ? 324 ASN A N     1 
ATOM   2593 C  CA    . ASN A 1 327 ? 30.699 7.344   4.168   1.00 18.12  ? 324 ASN A CA    1 
ATOM   2594 C  C     . ASN A 1 327 ? 29.851 8.466   4.755   1.00 20.43  ? 324 ASN A C     1 
ATOM   2595 O  O     . ASN A 1 327 ? 30.273 9.631   4.805   1.00 15.96  ? 324 ASN A O     1 
ATOM   2596 C  CB    . ASN A 1 327 ? 31.450 6.674   5.319   1.00 20.31  ? 324 ASN A CB    1 
ATOM   2597 C  CG    . ASN A 1 327 ? 32.131 5.385   4.917   1.00 23.75  ? 324 ASN A CG    1 
ATOM   2598 O  OD1   . ASN A 1 327 ? 31.839 4.809   3.871   1.00 26.25  ? 324 ASN A OD1   1 
ATOM   2599 N  ND2   . ASN A 1 327 ? 33.032 4.910   5.770   1.00 30.56  ? 324 ASN A ND2   1 
ATOM   2600 N  N     . PHE A 1 328 ? 28.652 8.083   5.196   1.00 19.86  ? 325 PHE A N     1 
ATOM   2601 C  CA    . PHE A 1 328 ? 27.706 8.982   5.842   1.00 26.70  ? 325 PHE A CA    1 
ATOM   2602 C  C     . PHE A 1 328 ? 27.169 8.218   7.048   1.00 30.78  ? 325 PHE A C     1 
ATOM   2603 O  O     . PHE A 1 328 ? 26.072 7.671   7.013   1.00 27.77  ? 325 PHE A O     1 
ATOM   2604 C  CB    . PHE A 1 328 ? 26.579 9.336   4.864   1.00 23.70  ? 325 PHE A CB    1 
ATOM   2605 C  CG    . PHE A 1 328 ? 27.073 9.954   3.591   1.00 19.19  ? 325 PHE A CG    1 
ATOM   2606 C  CD1   . PHE A 1 328 ? 27.341 11.301  3.532   1.00 18.57  ? 325 PHE A CD1   1 
ATOM   2607 C  CD2   . PHE A 1 328 ? 27.304 9.176   2.460   1.00 18.62  ? 325 PHE A CD2   1 
ATOM   2608 C  CE1   . PHE A 1 328 ? 27.806 11.891  2.390   1.00 16.83  ? 325 PHE A CE1   1 
ATOM   2609 C  CE2   . PHE A 1 328 ? 27.783 9.753   1.296   1.00 16.48  ? 325 PHE A CE2   1 
ATOM   2610 C  CZ    . PHE A 1 328 ? 28.032 11.110  1.245   1.00 18.60  ? 325 PHE A CZ    1 
ATOM   2611 N  N     . PRO A 1 329 ? 27.968 8.150   8.119   1.00 32.27  ? 326 PRO A N     1 
ATOM   2612 C  CA    . PRO A 1 329 ? 27.678 7.279   9.262   1.00 31.60  ? 326 PRO A CA    1 
ATOM   2613 C  C     . PRO A 1 329 ? 26.610 7.824   10.201  1.00 36.71  ? 326 PRO A C     1 
ATOM   2614 O  O     . PRO A 1 329 ? 26.389 9.040   10.268  1.00 33.96  ? 326 PRO A O     1 
ATOM   2615 C  CB    . PRO A 1 329 ? 29.020 7.226   9.993   1.00 40.43  ? 326 PRO A CB    1 
ATOM   2616 C  CG    . PRO A 1 329 ? 29.637 8.549   9.692   1.00 37.07  ? 326 PRO A CG    1 
ATOM   2617 C  CD    . PRO A 1 329 ? 29.247 8.863   8.281   1.00 32.44  ? 326 PRO A CD    1 
ATOM   2618 N  N     . GLY A 1 330 ? 25.961 6.903   10.913  1.00 41.64  ? 327 GLY A N     1 
ATOM   2619 C  CA    . GLY A 1 330 ? 25.014 7.227   11.962  1.00 40.71  ? 327 GLY A CA    1 
ATOM   2620 C  C     . GLY A 1 330 ? 23.934 8.199   11.548  1.00 39.02  ? 327 GLY A C     1 
ATOM   2621 O  O     . GLY A 1 330 ? 23.209 7.969   10.573  1.00 38.91  ? 327 GLY A O     1 
ATOM   2622 N  N     . LYS A 1 331 ? 23.845 9.301   12.289  1.00 42.43  ? 328 LYS A N     1 
ATOM   2623 C  CA    . LYS A 1 331 ? 22.792 10.287  12.089  1.00 44.13  ? 328 LYS A CA    1 
ATOM   2624 C  C     . LYS A 1 331 ? 23.027 11.133  10.841  1.00 41.53  ? 328 LYS A C     1 
ATOM   2625 O  O     . LYS A 1 331 ? 22.220 12.002  10.513  1.00 45.78  ? 328 LYS A O     1 
ATOM   2626 C  CB    . LYS A 1 331 ? 22.650 11.182  13.328  1.00 43.77  ? 328 LYS A CB    1 
ATOM   2627 N  N     . THR A 1 332 ? 24.121 10.878  10.135  1.00 38.42  ? 329 THR A N     1 
ATOM   2628 C  CA    . THR A 1 332 ? 24.421 11.657  8.933   1.00 36.53  ? 329 THR A CA    1 
ATOM   2629 C  C     . THR A 1 332 ? 23.970 10.955  7.648   1.00 33.63  ? 329 THR A C     1 
ATOM   2630 O  O     . THR A 1 332 ? 24.130 11.496  6.560   1.00 29.55  ? 329 THR A O     1 
ATOM   2631 C  CB    . THR A 1 332 ? 25.921 12.006  8.823   1.00 39.82  ? 329 THR A CB    1 
ATOM   2632 O  OG1   . THR A 1 332 ? 26.661 10.843  8.432   1.00 31.41  ? 329 THR A OG1   1 
ATOM   2633 C  CG2   . THR A 1 332 ? 26.453 12.534  10.157  1.00 42.52  ? 329 THR A CG2   1 
ATOM   2634 N  N     . ALA A 1 333 ? 23.402 9.762   7.787   1.00 33.98  ? 330 ALA A N     1 
ATOM   2635 C  CA    . ALA A 1 333 ? 22.949 8.983   6.634   1.00 29.99  ? 330 ALA A CA    1 
ATOM   2636 C  C     . ALA A 1 333 ? 22.022 9.795   5.735   1.00 36.06  ? 330 ALA A C     1 
ATOM   2637 O  O     . ALA A 1 333 ? 21.228 10.593  6.220   1.00 36.93  ? 330 ALA A O     1 
ATOM   2638 C  CB    . ALA A 1 333 ? 22.274 7.708   7.099   1.00 34.30  ? 330 ALA A CB    1 
ATOM   2639 N  N     . LEU A 1 334 ? 22.135 9.598   4.425   1.00 29.08  ? 331 LEU A N     1 
ATOM   2640 C  CA    . LEU A 1 334 ? 21.426 10.434  3.465   1.00 30.10  ? 331 LEU A CA    1 
ATOM   2641 C  C     . LEU A 1 334 ? 19.966 10.005  3.388   1.00 29.63  ? 331 LEU A C     1 
ATOM   2642 O  O     . LEU A 1 334 ? 19.671 8.826   3.214   1.00 31.35  ? 331 LEU A O     1 
ATOM   2643 C  CB    . LEU A 1 334 ? 22.073 10.335  2.088   1.00 34.47  ? 331 LEU A CB    1 
ATOM   2644 C  CG    . LEU A 1 334 ? 23.586 10.551  2.071   1.00 27.38  ? 331 LEU A CG    1 
ATOM   2645 C  CD1   . LEU A 1 334 ? 24.077 10.472  0.642   1.00 26.54  ? 331 LEU A CD1   1 
ATOM   2646 C  CD2   . LEU A 1 334 ? 23.935 11.880  2.704   1.00 25.14  ? 331 LEU A CD2   1 
ATOM   2647 N  N     . ALA A 1 335 ? 19.055 10.963  3.538   1.00 33.87  ? 332 ALA A N     1 
ATOM   2648 C  CA    . ALA A 1 335 ? 17.640 10.617  3.701   1.00 38.26  ? 332 ALA A CA    1 
ATOM   2649 C  C     . ALA A 1 335 ? 16.692 11.340  2.749   1.00 38.05  ? 332 ALA A C     1 
ATOM   2650 O  O     . ALA A 1 335 ? 15.492 11.069  2.760   1.00 45.15  ? 332 ALA A O     1 
ATOM   2651 C  CB    . ALA A 1 335 ? 17.201 10.825  5.147   1.00 33.97  ? 332 ALA A CB    1 
ATOM   2652 N  N     . THR A 1 336 ? 17.216 12.261  1.946   1.00 36.59  ? 333 THR A N     1 
ATOM   2653 C  CA    . THR A 1 336 ? 16.411 12.902  0.912   1.00 38.84  ? 333 THR A CA    1 
ATOM   2654 C  C     . THR A 1 336 ? 16.965 12.663  -0.488  1.00 50.11  ? 333 THR A C     1 
ATOM   2655 O  O     . THR A 1 336 ? 18.167 12.443  -0.668  1.00 41.44  ? 333 THR A O     1 
ATOM   2656 C  CB    . THR A 1 336 ? 16.240 14.420  1.137   1.00 44.50  ? 333 THR A CB    1 
ATOM   2657 O  OG1   . THR A 1 336 ? 17.418 15.125  0.722   1.00 39.25  ? 333 THR A OG1   1 
ATOM   2658 C  CG2   . THR A 1 336 ? 15.954 14.706  2.594   1.00 44.34  ? 333 THR A CG2   1 
ATOM   2659 N  N     . ARG A 1 337 ? 16.071 12.704  -1.471  1.00 48.45  ? 334 ARG A N     1 
ATOM   2660 C  CA    . ARG A 1 337 ? 16.435 12.520  -2.866  1.00 43.72  ? 334 ARG A CA    1 
ATOM   2661 C  C     . ARG A 1 337 ? 17.484 13.543  -3.271  1.00 42.93  ? 334 ARG A C     1 
ATOM   2662 O  O     . ARG A 1 337 ? 18.512 13.193  -3.852  1.00 41.26  ? 334 ARG A O     1 
ATOM   2663 C  CB    . ARG A 1 337 ? 15.183 12.656  -3.741  1.00 54.43  ? 334 ARG A CB    1 
ATOM   2664 C  CG    . ARG A 1 337 ? 15.387 12.400  -5.227  1.00 55.23  ? 334 ARG A CG    1 
ATOM   2665 C  CD    . ARG A 1 337 ? 14.050 12.444  -5.971  1.00 63.81  ? 334 ARG A CD    1 
ATOM   2666 N  NE    . ARG A 1 337 ? 13.544 11.112  -6.305  1.00 68.39  ? 334 ARG A NE    1 
ATOM   2667 C  CZ    . ARG A 1 337 ? 13.488 10.624  -7.541  1.00 70.19  ? 334 ARG A CZ    1 
ATOM   2668 N  NH1   . ARG A 1 337 ? 13.900 11.362  -8.565  1.00 69.78  ? 334 ARG A NH1   1 
ATOM   2669 N  NH2   . ARG A 1 337 ? 13.016 9.402   -7.757  1.00 62.89  ? 334 ARG A NH2   1 
ATOM   2670 N  N     . GLU A 1 338 ? 17.227 14.803  -2.938  1.00 39.59  ? 335 GLU A N     1 
ATOM   2671 C  CA    . GLU A 1 338 ? 18.126 15.900  -3.270  1.00 42.58  ? 335 GLU A CA    1 
ATOM   2672 C  C     . GLU A 1 338 ? 19.495 15.746  -2.590  1.00 35.70  ? 335 GLU A C     1 
ATOM   2673 O  O     . GLU A 1 338 ? 20.512 16.187  -3.123  1.00 31.58  ? 335 GLU A O     1 
ATOM   2674 C  CB    . GLU A 1 338 ? 17.492 17.232  -2.867  1.00 43.99  ? 335 GLU A CB    1 
ATOM   2675 C  CG    . GLU A 1 338 ? 17.831 18.391  -3.796  1.00 50.81  ? 335 GLU A CG    1 
ATOM   2676 C  CD    . GLU A 1 338 ? 17.173 18.258  -5.159  1.00 60.15  ? 335 GLU A CD    1 
ATOM   2677 O  OE1   . GLU A 1 338 ? 17.876 18.423  -6.181  1.00 65.05  ? 335 GLU A OE1   1 
ATOM   2678 O  OE2   . GLU A 1 338 ? 15.950 17.997  -5.209  1.00 55.91  ? 335 GLU A OE2   1 
ATOM   2679 N  N     . GLN A 1 339 ? 19.504 15.139  -1.406  1.00 34.55  ? 336 GLN A N     1 
ATOM   2680 C  CA    . GLN A 1 339 ? 20.743 14.880  -0.668  1.00 30.62  ? 336 GLN A CA    1 
ATOM   2681 C  C     . GLN A 1 339 ? 21.570 13.856  -1.444  1.00 33.92  ? 336 GLN A C     1 
ATOM   2682 O  O     . GLN A 1 339 ? 22.758 14.071  -1.733  1.00 27.12  ? 336 GLN A O     1 
ATOM   2683 C  CB    . GLN A 1 339 ? 20.420 14.301  0.711   1.00 35.31  ? 336 GLN A CB    1 
ATOM   2684 C  CG    . GLN A 1 339 ? 20.964 15.070  1.905   1.00 36.97  ? 336 GLN A CG    1 
ATOM   2685 C  CD    . GLN A 1 339 ? 20.841 14.271  3.189   1.00 34.66  ? 336 GLN A CD    1 
ATOM   2686 O  OE1   . GLN A 1 339 ? 19.944 13.437  3.328   1.00 32.96  ? 336 GLN A OE1   1 
ATOM   2687 N  NE2   . GLN A 1 339 ? 21.755 14.504  4.130   1.00 27.44  ? 336 GLN A NE2   1 
ATOM   2688 N  N     . VAL A 1 340 ? 20.925 12.740  -1.775  1.00 32.96  ? 337 VAL A N     1 
ATOM   2689 C  CA    . VAL A 1 340 ? 21.572 11.656  -2.496  1.00 33.69  ? 337 VAL A CA    1 
ATOM   2690 C  C     . VAL A 1 340 ? 22.089 12.175  -3.828  1.00 32.37  ? 337 VAL A C     1 
ATOM   2691 O  O     . VAL A 1 340 ? 23.219 11.890  -4.228  1.00 26.61  ? 337 VAL A O     1 
ATOM   2692 C  CB    . VAL A 1 340 ? 20.602 10.470  -2.708  1.00 35.78  ? 337 VAL A CB    1 
ATOM   2693 C  CG1   . VAL A 1 340 ? 21.208 9.416   -3.636  1.00 27.54  ? 337 VAL A CG1   1 
ATOM   2694 C  CG2   . VAL A 1 340 ? 20.223 9.848   -1.374  1.00 29.99  ? 337 VAL A CG2   1 
ATOM   2695 N  N     . GLN A 1 341 ? 21.273 12.971  -4.503  1.00 33.85  ? 338 GLN A N     1 
ATOM   2696 C  CA    . GLN A 1 341 ? 21.653 13.487  -5.807  1.00 29.18  ? 338 GLN A CA    1 
ATOM   2697 C  C     . GLN A 1 341 ? 22.808 14.476  -5.720  1.00 30.10  ? 338 GLN A C     1 
ATOM   2698 O  O     . GLN A 1 341 ? 23.657 14.525  -6.606  1.00 30.58  ? 338 GLN A O     1 
ATOM   2699 C  CB    . GLN A 1 341 ? 20.443 14.084  -6.533  1.00 37.42  ? 338 GLN A CB    1 
ATOM   2700 C  CG    . GLN A 1 341 ? 19.435 13.015  -6.930  1.00 40.79  ? 338 GLN A CG    1 
ATOM   2701 C  CD    . GLN A 1 341 ? 18.190 13.565  -7.601  1.00 45.92  ? 338 GLN A CD    1 
ATOM   2702 O  OE1   . GLN A 1 341 ? 17.952 14.774  -7.615  1.00 42.70  ? 338 GLN A OE1   1 
ATOM   2703 N  NE2   . GLN A 1 341 ? 17.388 12.670  -8.171  1.00 50.58  ? 338 GLN A NE2   1 
ATOM   2704 N  N     . TRP A 1 342 ? 22.858 15.241  -4.637  1.00 25.92  ? 339 TRP A N     1 
ATOM   2705 C  CA    . TRP A 1 342 ? 23.916 16.231  -4.488  1.00 25.25  ? 339 TRP A CA    1 
ATOM   2706 C  C     . TRP A 1 342 ? 25.273 15.552  -4.278  1.00 21.36  ? 339 TRP A C     1 
ATOM   2707 O  O     . TRP A 1 342 ? 26.269 15.966  -4.865  1.00 20.08  ? 339 TRP A O     1 
ATOM   2708 C  CB    . TRP A 1 342 ? 23.632 17.197  -3.332  1.00 26.22  ? 339 TRP A CB    1 
ATOM   2709 C  CG    . TRP A 1 342 ? 24.620 18.341  -3.297  1.00 27.85  ? 339 TRP A CG    1 
ATOM   2710 C  CD1   . TRP A 1 342 ? 24.624 19.446  -4.100  1.00 26.90  ? 339 TRP A CD1   1 
ATOM   2711 C  CD2   . TRP A 1 342 ? 25.754 18.472  -2.435  1.00 22.37  ? 339 TRP A CD2   1 
ATOM   2712 N  NE1   . TRP A 1 342 ? 25.679 20.261  -3.787  1.00 29.55  ? 339 TRP A NE1   1 
ATOM   2713 C  CE2   . TRP A 1 342 ? 26.390 19.692  -2.764  1.00 20.62  ? 339 TRP A CE2   1 
ATOM   2714 C  CE3   . TRP A 1 342 ? 26.288 17.683  -1.413  1.00 22.55  ? 339 TRP A CE3   1 
ATOM   2715 C  CZ2   . TRP A 1 342 ? 27.541 20.140  -2.117  1.00 24.70  ? 339 TRP A CZ2   1 
ATOM   2716 C  CZ3   . TRP A 1 342 ? 27.426 18.134  -0.760  1.00 23.35  ? 339 TRP A CZ3   1 
ATOM   2717 C  CH2   . TRP A 1 342 ? 28.046 19.349  -1.123  1.00 22.38  ? 339 TRP A CH2   1 
ATOM   2718 N  N     . TRP A 1 343 ? 25.289 14.532  -3.432  1.00 23.51  ? 340 TRP A N     1 
ATOM   2719 C  CA    . TRP A 1 343 ? 26.529 13.816  -3.108  1.00 18.85  ? 340 TRP A CA    1 
ATOM   2720 C  C     . TRP A 1 343 ? 27.006 12.942  -4.267  1.00 22.56  ? 340 TRP A C     1 
ATOM   2721 O  O     . TRP A 1 343 ? 28.214 12.856  -4.498  1.00 20.30  ? 340 TRP A O     1 
ATOM   2722 C  CB    . TRP A 1 343 ? 26.383 12.979  -1.836  1.00 20.68  ? 340 TRP A CB    1 
ATOM   2723 C  CG    . TRP A 1 343 ? 26.496 13.788  -0.564  1.00 20.16  ? 340 TRP A CG    1 
ATOM   2724 C  CD1   . TRP A 1 343 ? 25.513 14.005  0.357   1.00 23.15  ? 340 TRP A CD1   1 
ATOM   2725 C  CD2   . TRP A 1 343 ? 27.659 14.481  -0.083  1.00 19.21  ? 340 TRP A CD2   1 
ATOM   2726 N  NE1   . TRP A 1 343 ? 25.993 14.802  1.382   1.00 22.07  ? 340 TRP A NE1   1 
ATOM   2727 C  CE2   . TRP A 1 343 ? 27.305 15.105  1.130   1.00 20.78  ? 340 TRP A CE2   1 
ATOM   2728 C  CE3   . TRP A 1 343 ? 28.965 14.637  -0.565  1.00 21.97  ? 340 TRP A CE3   1 
ATOM   2729 C  CZ2   . TRP A 1 343 ? 28.210 15.867  1.872   1.00 23.85  ? 340 TRP A CZ2   1 
ATOM   2730 C  CZ3   . TRP A 1 343 ? 29.856 15.393  0.166   1.00 21.90  ? 340 TRP A CZ3   1 
ATOM   2731 C  CH2   . TRP A 1 343 ? 29.474 16.001  1.377   1.00 22.49  ? 340 TRP A CH2   1 
ATOM   2732 N  N     . LEU A 1 344 ? 26.076 12.322  -5.001  1.00 20.90  ? 341 LEU A N     1 
ATOM   2733 C  CA    . LEU A 1 344 ? 26.468 11.546  -6.186  1.00 21.18  ? 341 LEU A CA    1 
ATOM   2734 C  C     . LEU A 1 344 ? 27.152 12.475  -7.150  1.00 19.22  ? 341 LEU A C     1 
ATOM   2735 O  O     . LEU A 1 344 ? 28.144 12.123  -7.800  1.00 21.12  ? 341 LEU A O     1 
ATOM   2736 C  CB    . LEU A 1 344 ? 25.263 10.925  -6.904  1.00 20.10  ? 341 LEU A CB    1 
ATOM   2737 C  CG    . LEU A 1 344 ? 24.678 9.689   -6.236  1.00 22.47  ? 341 LEU A CG    1 
ATOM   2738 C  CD1   . LEU A 1 344 ? 23.380 9.298   -6.949  1.00 21.77  ? 341 LEU A CD1   1 
ATOM   2739 C  CD2   . LEU A 1 344 ? 25.651 8.538   -6.235  1.00 22.80  ? 341 LEU A CD2   1 
ATOM   2740 N  N     . LEU A 1 345 ? 26.622 13.677  -7.250  1.00 19.27  ? 342 LEU A N     1 
ATOM   2741 C  CA    . LEU A 1 345 ? 27.219 14.673  -8.095  1.00 14.79  ? 342 LEU A CA    1 
ATOM   2742 C  C     . LEU A 1 345 ? 28.623 15.077  -7.616  1.00 18.57  ? 342 LEU A C     1 
ATOM   2743 O  O     . LEU A 1 345 ? 29.544 15.215  -8.416  1.00 19.07  ? 342 LEU A O     1 
ATOM   2744 C  CB    . LEU A 1 345 ? 26.311 15.900  -8.213  1.00 22.61  ? 342 LEU A CB    1 
ATOM   2745 C  CG    . LEU A 1 345 ? 26.913 16.988  -9.089  1.00 20.38  ? 342 LEU A CG    1 
ATOM   2746 C  CD1   . LEU A 1 345 ? 27.121 16.454  -10.520 1.00 24.98  ? 342 LEU A CD1   1 
ATOM   2747 C  CD2   . LEU A 1 345 ? 26.050 18.254  -9.116  1.00 29.72  ? 342 LEU A CD2   1 
ATOM   2748 N  N     . GLN A 1 346 ? 28.796 15.247  -6.311  1.00 16.74  ? 343 GLN A N     1 
ATOM   2749 C  CA    . GLN A 1 346 ? 30.117 15.598  -5.791  1.00 16.99  ? 343 GLN A CA    1 
ATOM   2750 C  C     . GLN A 1 346 ? 31.152 14.527  -6.157  1.00 16.45  ? 343 GLN A C     1 
ATOM   2751 O  O     . GLN A 1 346 ? 32.262 14.858  -6.593  1.00 17.28  ? 343 GLN A O     1 
ATOM   2752 C  CB    . GLN A 1 346 ? 30.090 15.762  -4.264  1.00 18.64  ? 343 GLN A CB    1 
ATOM   2753 C  CG    . GLN A 1 346 ? 29.102 16.825  -3.749  1.00 18.18  ? 343 GLN A CG    1 
ATOM   2754 C  CD    . GLN A 1 346 ? 29.068 18.058  -4.613  1.00 20.56  ? 343 GLN A CD    1 
ATOM   2755 O  OE1   . GLN A 1 346 ? 30.039 18.809  -4.691  1.00 22.07  ? 343 GLN A OE1   1 
ATOM   2756 N  NE2   . GLN A 1 346 ? 27.923 18.290  -5.269  1.00 24.06  ? 343 GLN A NE2   1 
ATOM   2757 N  N     . LEU A 1 347 ? 30.771 13.268  -5.967  1.00 18.35  ? 344 LEU A N     1 
ATOM   2758 C  CA    . LEU A 1 347 ? 31.656 12.139  -6.260  1.00 17.90  ? 344 LEU A CA    1 
ATOM   2759 C  C     . LEU A 1 347 ? 31.949 12.115  -7.757  1.00 17.63  ? 344 LEU A C     1 
ATOM   2760 O  O     . LEU A 1 347 ? 33.104 11.949  -8.172  1.00 15.35  ? 344 LEU A O     1 
ATOM   2761 C  CB    . LEU A 1 347 ? 31.016 10.822  -5.835  1.00 16.34  ? 344 LEU A CB    1 
ATOM   2762 C  CG    . LEU A 1 347 ? 30.809 10.555  -4.353  1.00 20.05  ? 344 LEU A CG    1 
ATOM   2763 C  CD1   . LEU A 1 347 ? 30.117 9.209   -4.165  1.00 19.92  ? 344 LEU A CD1   1 
ATOM   2764 C  CD2   . LEU A 1 347 ? 32.153 10.572  -3.672  1.00 19.41  ? 344 LEU A CD2   1 
ATOM   2765 N  N     . ALA A 1 348 ? 30.904 12.292  -8.570  1.00 14.48  ? 345 ALA A N     1 
ATOM   2766 C  CA    . ALA A 1 348 ? 31.058 12.234  -10.019 1.00 16.15  ? 345 ALA A CA    1 
ATOM   2767 C  C     . ALA A 1 348 ? 31.969 13.339  -10.520 1.00 15.57  ? 345 ALA A C     1 
ATOM   2768 O  O     . ALA A 1 348 ? 32.703 13.164  -11.489 1.00 16.54  ? 345 ALA A O     1 
ATOM   2769 C  CB    . ALA A 1 348 ? 29.699 12.339  -10.697 1.00 15.05  ? 345 ALA A CB    1 
ATOM   2770 N  N     . GLN A 1 349 ? 31.918 14.503  -9.873  1.00 14.11  ? 346 GLN A N     1 
ATOM   2771 C  CA    . GLN A 1 349 ? 32.787 15.589  -10.277 1.00 15.03  ? 346 GLN A CA    1 
ATOM   2772 C  C     . GLN A 1 349 ? 34.248 15.282  -9.960  1.00 16.85  ? 346 GLN A C     1 
ATOM   2773 O  O     . GLN A 1 349 ? 35.135 15.608  -10.741 1.00 15.65  ? 346 GLN A O     1 
ATOM   2774 C  CB    . GLN A 1 349 ? 32.370 16.914  -9.630  1.00 20.68  ? 346 GLN A CB    1 
ATOM   2775 C  CG    . GLN A 1 349 ? 31.032 17.441  -10.154 1.00 21.61  ? 346 GLN A CG    1 
ATOM   2776 C  CD    . GLN A 1 349 ? 30.582 18.701  -9.414  1.00 30.36  ? 346 GLN A CD    1 
ATOM   2777 O  OE1   . GLN A 1 349 ? 31.049 18.988  -8.313  1.00 35.47  ? 346 GLN A OE1   1 
ATOM   2778 N  NE2   . GLN A 1 349 ? 29.677 19.454  -10.024 1.00 36.12  ? 346 GLN A NE2   1 
ATOM   2779 N  N     . GLU A 1 350 ? 34.495 14.636  -8.833  1.00 16.66  ? 347 GLU A N     1 
ATOM   2780 C  CA    . GLU A 1 350 ? 35.886 14.308  -8.531  1.00 17.17  ? 347 GLU A CA    1 
ATOM   2781 C  C     . GLU A 1 350 ? 36.346 13.242  -9.515  1.00 15.15  ? 347 GLU A C     1 
ATOM   2782 O  O     . GLU A 1 350 ? 37.452 13.316  -10.042 1.00 16.72  ? 347 GLU A O     1 
ATOM   2783 C  CB    . GLU A 1 350 ? 36.087 13.807  -7.102  1.00 17.33  ? 347 GLU A CB    1 
ATOM   2784 C  CG    . GLU A 1 350 ? 37.585 13.526  -6.835  1.00 20.20  ? 347 GLU A CG    1 
ATOM   2785 C  CD    . GLU A 1 350 ? 37.874 12.960  -5.461  1.00 25.32  ? 347 GLU A CD    1 
ATOM   2786 O  OE1   . GLU A 1 350 ? 37.170 13.323  -4.496  1.00 28.91  ? 347 GLU A OE1   1 
ATOM   2787 O  OE2   . GLU A 1 350 ? 38.816 12.151  -5.348  1.00 20.15  ? 347 GLU A OE2   1 
ATOM   2788 N  N     . LEU A 1 351 ? 35.481 12.270  -9.759  1.00 14.08  ? 348 LEU A N     1 
ATOM   2789 C  CA    . LEU A 1 351 ? 35.793 11.173  -10.674 1.00 14.78  ? 348 LEU A CA    1 
ATOM   2790 C  C     . LEU A 1 351 ? 36.101 11.696  -12.071 1.00 16.99  ? 348 LEU A C     1 
ATOM   2791 O  O     . LEU A 1 351 ? 37.098 11.307  -12.676 1.00 17.49  ? 348 LEU A O     1 
ATOM   2792 C  CB    . LEU A 1 351 ? 34.648 10.162  -10.703 1.00 16.17  ? 348 LEU A CB    1 
ATOM   2793 C  CG    . LEU A 1 351 ? 34.887 8.864   -11.476 1.00 20.04  ? 348 LEU A CG    1 
ATOM   2794 C  CD1   . LEU A 1 351 ? 36.191 8.211   -10.983 1.00 20.98  ? 348 LEU A CD1   1 
ATOM   2795 C  CD2   . LEU A 1 351 ? 33.695 7.912   -11.368 1.00 18.75  ? 348 LEU A CD2   1 
ATOM   2796 N  N     . GLU A 1 352 ? 35.252 12.588  -12.582 1.00 14.21  ? 349 GLU A N     1 
ATOM   2797 C  CA    . GLU A 1 352 ? 35.501 13.178  -13.890 1.00 17.20  ? 349 GLU A CA    1 
ATOM   2798 C  C     . GLU A 1 352 ? 36.867 13.848  -13.982 1.00 14.80  ? 349 GLU A C     1 
ATOM   2799 O  O     . GLU A 1 352 ? 37.586 13.687  -14.981 1.00 18.82  ? 349 GLU A O     1 
ATOM   2800 C  CB    . GLU A 1 352 ? 34.403 14.194  -14.235 1.00 18.11  ? 349 GLU A CB    1 
ATOM   2801 C  CG    . GLU A 1 352 ? 34.630 14.890  -15.568 1.00 21.00  ? 349 GLU A CG    1 
ATOM   2802 C  CD    . GLU A 1 352 ? 33.832 16.184  -15.703 1.00 37.27  ? 349 GLU A CD    1 
ATOM   2803 O  OE1   . GLU A 1 352 ? 34.395 17.179  -16.216 1.00 42.71  ? 349 GLU A OE1   1 
ATOM   2804 O  OE2   . GLU A 1 352 ? 32.642 16.205  -15.304 1.00 34.03  ? 349 GLU A OE2   1 
ATOM   2805 N  N     . GLU A 1 353 ? 37.216 14.610  -12.951 1.00 14.79  ? 350 GLU A N     1 
ATOM   2806 C  CA    . GLU A 1 353 ? 38.484 15.317  -12.906 1.00 13.30  ? 350 GLU A CA    1 
ATOM   2807 C  C     . GLU A 1 353 ? 39.650 14.323  -12.992 1.00 17.22  ? 350 GLU A C     1 
ATOM   2808 O  O     . GLU A 1 353 ? 40.580 14.484  -13.786 1.00 17.12  ? 350 GLU A O     1 
ATOM   2809 C  CB    . GLU A 1 353 ? 38.564 16.125  -11.614 1.00 22.20  ? 350 GLU A CB    1 
ATOM   2810 C  CG    . GLU A 1 353 ? 39.621 17.210  -11.612 1.00 31.78  ? 350 GLU A CG    1 
ATOM   2811 C  CD    . GLU A 1 353 ? 39.384 18.244  -10.511 1.00 43.25  ? 350 GLU A CD    1 
ATOM   2812 O  OE1   . GLU A 1 353 ? 38.212 18.441  -10.120 1.00 35.93  ? 350 GLU A OE1   1 
ATOM   2813 O  OE2   . GLU A 1 353 ? 40.367 18.857  -10.039 1.00 55.64  ? 350 GLU A OE2   1 
ATOM   2814 N  N     . ARG A 1 354 ? 39.561 13.277  -12.182 1.00 14.48  ? 351 ARG A N     1 
ATOM   2815 C  CA    . ARG A 1 354 ? 40.614 12.262  -12.169 1.00 13.83  ? 351 ARG A CA    1 
ATOM   2816 C  C     . ARG A 1 354 ? 40.671 11.495  -13.472 1.00 15.62  ? 351 ARG A C     1 
ATOM   2817 O  O     . ARG A 1 354 ? 41.769 11.202  -13.969 1.00 15.17  ? 351 ARG A O     1 
ATOM   2818 C  CB    . ARG A 1 354 ? 40.450 11.327  -10.969 1.00 15.13  ? 351 ARG A CB    1 
ATOM   2819 C  CG    A ARG A 1 354 ? 40.922 12.046  -9.704  0.64 16.44  ? 351 ARG A CG    1 
ATOM   2820 C  CG    B ARG A 1 354 ? 40.708 11.930  -9.603  0.36 16.61  ? 351 ARG A CG    1 
ATOM   2821 C  CD    A ARG A 1 354 ? 40.413 11.381  -8.454  0.64 16.37  ? 351 ARG A CD    1 
ATOM   2822 C  CD    B ARG A 1 354 ? 40.626 10.827  -8.547  0.36 16.12  ? 351 ARG A CD    1 
ATOM   2823 N  NE    A ARG A 1 354 ? 40.944 10.036  -8.341  0.64 13.80  ? 351 ARG A NE    1 
ATOM   2824 N  NE    B ARG A 1 354 ? 41.588 9.764   -8.831  0.36 13.47  ? 351 ARG A NE    1 
ATOM   2825 C  CZ    A ARG A 1 354 ? 40.509 9.144   -7.470  0.64 13.51  ? 351 ARG A CZ    1 
ATOM   2826 C  CZ    B ARG A 1 354 ? 41.554 8.541   -8.307  0.36 14.54  ? 351 ARG A CZ    1 
ATOM   2827 N  NH1   A ARG A 1 354 ? 39.526 9.455   -6.608  0.64 12.57  ? 351 ARG A NH1   1 
ATOM   2828 N  NH1   B ARG A 1 354 ? 40.582 8.189   -7.483  0.36 14.00  ? 351 ARG A NH1   1 
ATOM   2829 N  NH2   A ARG A 1 354 ? 41.069 7.943   -7.464  0.64 13.34  ? 351 ARG A NH2   1 
ATOM   2830 N  NH2   B ARG A 1 354 ? 42.484 7.659   -8.643  0.36 14.49  ? 351 ARG A NH2   1 
ATOM   2831 N  N     . LEU A 1 355 ? 39.502 11.184  -14.030 1.00 14.85  ? 352 LEU A N     1 
ATOM   2832 C  CA    . LEU A 1 355 ? 39.430 10.448  -15.292 1.00 15.48  ? 352 LEU A CA    1 
ATOM   2833 C  C     . LEU A 1 355 ? 39.984 11.265  -16.456 1.00 17.29  ? 352 LEU A C     1 
ATOM   2834 O  O     . LEU A 1 355 ? 40.703 10.729  -17.304 1.00 15.60  ? 352 LEU A O     1 
ATOM   2835 C  CB    . LEU A 1 355 ? 38.003 10.025  -15.598 1.00 16.75  ? 352 LEU A CB    1 
ATOM   2836 C  CG    . LEU A 1 355 ? 37.469 8.828   -14.820 1.00 20.36  ? 352 LEU A CG    1 
ATOM   2837 C  CD1   . LEU A 1 355 ? 35.997 8.606   -15.100 1.00 17.71  ? 352 LEU A CD1   1 
ATOM   2838 C  CD2   . LEU A 1 355 ? 38.251 7.570   -15.147 1.00 19.92  ? 352 LEU A CD2   1 
ATOM   2839 N  N     . THR A 1 356 ? 39.646 12.552  -16.509 1.00 16.35  ? 353 THR A N     1 
ATOM   2840 C  CA    . THR A 1 356 ? 40.144 13.379  -17.602 1.00 16.99  ? 353 THR A CA    1 
ATOM   2841 C  C     . THR A 1 356 ? 41.666 13.472  -17.562 1.00 17.99  ? 353 THR A C     1 
ATOM   2842 O  O     . THR A 1 356 ? 42.322 13.354  -18.592 1.00 18.41  ? 353 THR A O     1 
ATOM   2843 C  CB    . THR A 1 356 ? 39.499 14.770  -17.598 1.00 19.31  ? 353 THR A CB    1 
ATOM   2844 O  OG1   . THR A 1 356 ? 38.088 14.629  -17.803 1.00 22.19  ? 353 THR A OG1   1 
ATOM   2845 C  CG2   . THR A 1 356 ? 40.089 15.621  -18.694 1.00 22.01  ? 353 THR A CG2   1 
ATOM   2846 N  N     . LYS A 1 357 ? 42.221 13.649  -16.364 1.00 16.90  ? 354 LYS A N     1 
ATOM   2847 C  CA    . LYS A 1 357 ? 43.664 13.731  -16.195 1.00 13.71  ? 354 LYS A CA    1 
ATOM   2848 C  C     . LYS A 1 357 ? 44.283 12.401  -16.611 1.00 18.79  ? 354 LYS A C     1 
ATOM   2849 O  O     . LYS A 1 357 ? 45.341 12.352  -17.251 1.00 19.29  ? 354 LYS A O     1 
ATOM   2850 C  CB    . LYS A 1 357 ? 44.010 14.007  -14.732 1.00 16.58  ? 354 LYS A CB    1 
ATOM   2851 C  CG    . LYS A 1 357 ? 45.517 14.045  -14.443 1.00 19.49  ? 354 LYS A CG    1 
ATOM   2852 C  CD    . LYS A 1 357 ? 46.211 15.059  -15.349 1.00 32.95  ? 354 LYS A CD    1 
ATOM   2853 C  CE    . LYS A 1 357 ? 47.359 15.773  -14.638 1.00 40.73  ? 354 LYS A CE    1 
ATOM   2854 N  NZ    . LYS A 1 357 ? 48.434 14.846  -14.189 1.00 34.41  ? 354 LYS A NZ    1 
ATOM   2855 N  N     . ASP A 1 358 ? 43.607 11.319  -16.247 1.00 15.77  ? 355 ASP A N     1 
ATOM   2856 C  CA    . ASP A 1 358 ? 44.124 9.980   -16.540 1.00 18.31  ? 355 ASP A CA    1 
ATOM   2857 C  C     . ASP A 1 358 ? 44.212 9.742   -18.039 1.00 21.05  ? 355 ASP A C     1 
ATOM   2858 O  O     . ASP A 1 358 ? 45.200 9.201   -18.516 1.00 19.19  ? 355 ASP A O     1 
ATOM   2859 C  CB    . ASP A 1 358 ? 43.268 8.903   -15.860 1.00 17.73  ? 355 ASP A CB    1 
ATOM   2860 C  CG    . ASP A 1 358 ? 43.808 7.499   -16.084 1.00 22.45  ? 355 ASP A CG    1 
ATOM   2861 O  OD1   . ASP A 1 358 ? 44.796 7.133   -15.414 1.00 18.34  ? 355 ASP A OD1   1 
ATOM   2862 O  OD2   . ASP A 1 358 ? 43.249 6.768   -16.934 1.00 17.88  ? 355 ASP A OD2   1 
ATOM   2863 N  N     . ARG A 1 359 ? 43.181 10.165  -18.767 1.00 15.67  ? 356 ARG A N     1 
ATOM   2864 C  CA    . ARG A 1 359 ? 43.094 9.960   -20.210 1.00 19.69  ? 356 ARG A CA    1 
ATOM   2865 C  C     . ARG A 1 359 ? 44.188 10.743  -20.941 1.00 20.07  ? 356 ARG A C     1 
ATOM   2866 O  O     . ARG A 1 359 ? 44.802 10.229  -21.891 1.00 20.23  ? 356 ARG A O     1 
ATOM   2867 C  CB    . ARG A 1 359 ? 41.703 10.369  -20.719 1.00 19.03  ? 356 ARG A CB    1 
ATOM   2868 C  CG    . ARG A 1 359 ? 41.501 10.149  -22.228 1.00 20.88  ? 356 ARG A CG    1 
ATOM   2869 C  CD    . ARG A 1 359 ? 40.109 10.596  -22.683 1.00 24.68  ? 356 ARG A CD    1 
ATOM   2870 N  NE    . ARG A 1 359 ? 39.927 12.040  -22.542 1.00 27.87  ? 356 ARG A NE    1 
ATOM   2871 C  CZ    . ARG A 1 359 ? 38.755 12.653  -22.367 1.00 30.24  ? 356 ARG A CZ    1 
ATOM   2872 N  NH1   . ARG A 1 359 ? 37.624 11.955  -22.305 1.00 31.69  ? 356 ARG A NH1   1 
ATOM   2873 N  NH2   . ARG A 1 359 ? 38.721 13.978  -22.250 1.00 27.63  ? 356 ARG A NH2   1 
ATOM   2874 N  N     . ASN A 1 360 ? 44.473 11.960  -20.476 1.00 17.61  ? 357 ASN A N     1 
ATOM   2875 C  CA    . ASN A 1 360 ? 45.557 12.754  -21.074 1.00 19.49  ? 357 ASN A CA    1 
ATOM   2876 C  C     . ASN A 1 360 ? 46.951 12.196  -20.763 1.00 20.00  ? 357 ASN A C     1 
ATOM   2877 O  O     . ASN A 1 360 ? 47.856 12.240  -21.605 1.00 19.79  ? 357 ASN A O     1 
ATOM   2878 C  CB    . ASN A 1 360 ? 45.503 14.212  -20.609 1.00 17.97  ? 357 ASN A CB    1 
ATOM   2879 C  CG    . ASN A 1 360 ? 44.350 14.983  -21.210 1.00 22.94  ? 357 ASN A CG    1 
ATOM   2880 O  OD1   . ASN A 1 360 ? 43.855 14.664  -22.292 1.00 24.66  ? 357 ASN A OD1   1 
ATOM   2881 N  ND2   . ASN A 1 360 ? 43.925 16.022  -20.510 1.00 23.66  ? 357 ASN A ND2   1 
ATOM   2882 N  N     . ASP A 1 361 ? 47.138 11.693  -19.540 1.00 20.23  ? 358 ASP A N     1 
ATOM   2883 C  CA    . ASP A 1 361 ? 48.460 11.251  -19.101 1.00 21.86  ? 358 ASP A CA    1 
ATOM   2884 C  C     . ASP A 1 361 ? 48.793 9.870   -19.615 1.00 18.75  ? 358 ASP A C     1 
ATOM   2885 O  O     . ASP A 1 361 ? 49.949 9.576   -19.940 1.00 19.87  ? 358 ASP A O     1 
ATOM   2886 C  CB    . ASP A 1 361 ? 48.558 11.219  -17.564 1.00 20.53  ? 358 ASP A CB    1 
ATOM   2887 C  CG    . ASP A 1 361 ? 48.659 12.611  -16.950 1.00 30.32  ? 358 ASP A CG    1 
ATOM   2888 O  OD1   . ASP A 1 361 ? 48.879 13.591  -17.702 1.00 29.56  ? 358 ASP A OD1   1 
ATOM   2889 O  OD2   . ASP A 1 361 ? 48.521 12.715  -15.707 1.00 33.31  ? 358 ASP A OD2   1 
ATOM   2890 N  N     . ASN A 1 362 ? 47.782 9.015   -19.654 1.00 18.63  ? 359 ASN A N     1 
ATOM   2891 C  CA    . ASN A 1 362 ? 48.047 7.587   -19.799 1.00 18.79  ? 359 ASN A CA    1 
ATOM   2892 C  C     . ASN A 1 362 ? 47.429 6.948   -21.031 1.00 21.36  ? 359 ASN A C     1 
ATOM   2893 O  O     . ASN A 1 362 ? 47.537 5.753   -21.193 1.00 18.01  ? 359 ASN A O     1 
ATOM   2894 C  CB    . ASN A 1 362 ? 47.634 6.827   -18.521 1.00 17.97  ? 359 ASN A CB    1 
ATOM   2895 C  CG    . ASN A 1 362 ? 48.376 7.319   -17.276 1.00 17.94  ? 359 ASN A CG    1 
ATOM   2896 O  OD1   . ASN A 1 362 ? 49.598 7.476   -17.280 1.00 20.91  ? 359 ASN A OD1   1 
ATOM   2897 N  ND2   . ASN A 1 362 ? 47.628 7.539   -16.190 1.00 16.89  ? 359 ASN A ND2   1 
ATOM   2898 N  N     . ASP A 1 363 ? 46.818 7.742   -21.904 1.00 22.61  ? 360 ASP A N     1 
ATOM   2899 C  CA    . ASP A 1 363 ? 46.294 7.230   -23.182 1.00 22.84  ? 360 ASP A CA    1 
ATOM   2900 C  C     . ASP A 1 363 ? 45.361 6.059   -23.015 1.00 23.35  ? 360 ASP A C     1 
ATOM   2901 O  O     . ASP A 1 363 ? 45.542 5.009   -23.659 1.00 24.07  ? 360 ASP A O     1 
ATOM   2902 C  CB    . ASP A 1 363 ? 47.432 6.757   -24.092 1.00 22.02  ? 360 ASP A CB    1 
ATOM   2903 C  CG    . ASP A 1 363 ? 48.382 7.854   -24.445 1.00 29.57  ? 360 ASP A CG    1 
ATOM   2904 O  OD1   . ASP A 1 363 ? 47.914 8.955   -24.817 1.00 27.70  ? 360 ASP A OD1   1 
ATOM   2905 O  OD2   . ASP A 1 363 ? 49.596 7.600   -24.343 1.00 32.38  ? 360 ASP A OD2   1 
ATOM   2906 N  N     . ARG A 1 364 ? 44.378 6.210   -22.140 1.00 21.44  ? 361 ARG A N     1 
ATOM   2907 C  CA    . ARG A 1 364 ? 43.385 5.165   -21.952 1.00 22.81  ? 361 ARG A CA    1 
ATOM   2908 C  C     . ARG A 1 364 ? 42.064 5.785   -21.544 1.00 20.48  ? 361 ARG A C     1 
ATOM   2909 O  O     . ARG A 1 364 ? 42.030 6.907   -21.028 1.00 21.72  ? 361 ARG A O     1 
ATOM   2910 C  CB    . ARG A 1 364 ? 43.848 4.162   -20.889 1.00 20.40  ? 361 ARG A CB    1 
ATOM   2911 C  CG    . ARG A 1 364 ? 44.159 4.789   -19.521 1.00 20.06  ? 361 ARG A CG    1 
ATOM   2912 C  CD    . ARG A 1 364 ? 44.613 3.738   -18.506 1.00 20.20  ? 361 ARG A CD    1 
ATOM   2913 N  NE    . ARG A 1 364 ? 44.622 4.281   -17.151 1.00 19.22  ? 361 ARG A NE    1 
ATOM   2914 C  CZ    . ARG A 1 364 ? 44.894 3.581   -16.055 1.00 20.71  ? 361 ARG A CZ    1 
ATOM   2915 N  NH1   . ARG A 1 364 ? 44.855 4.172   -14.867 1.00 17.30  ? 361 ARG A NH1   1 
ATOM   2916 N  NH2   . ARG A 1 364 ? 45.211 2.301   -16.143 1.00 19.81  ? 361 ARG A NH2   1 
ATOM   2917 N  N     . VAL A 1 365 ? 40.983 5.044   -21.759 1.00 18.44  ? 362 VAL A N     1 
ATOM   2918 C  CA    . VAL A 1 365 ? 39.657 5.473   -21.287 1.00 21.06  ? 362 VAL A CA    1 
ATOM   2919 C  C     . VAL A 1 365 ? 38.933 4.366   -20.529 1.00 24.13  ? 362 VAL A C     1 
ATOM   2920 O  O     . VAL A 1 365 ? 38.967 3.202   -20.920 1.00 21.32  ? 362 VAL A O     1 
ATOM   2921 C  CB    . VAL A 1 365 ? 38.744 5.913   -22.454 1.00 26.04  ? 362 VAL A CB    1 
ATOM   2922 C  CG1   . VAL A 1 365 ? 39.297 7.166   -23.114 1.00 28.31  ? 362 VAL A CG1   1 
ATOM   2923 C  CG2   . VAL A 1 365 ? 38.595 4.788   -23.469 1.00 29.82  ? 362 VAL A CG2   1 
ATOM   2924 N  N     . ALA A 1 366 ? 38.248 4.747   -19.455 1.00 18.25  ? 363 ALA A N     1 
ATOM   2925 C  CA    . ALA A 1 366 ? 37.400 3.831   -18.715 1.00 20.66  ? 363 ALA A CA    1 
ATOM   2926 C  C     . ALA A 1 366 ? 36.094 3.585   -19.478 1.00 22.18  ? 363 ALA A C     1 
ATOM   2927 O  O     . ALA A 1 366 ? 35.562 4.500   -20.120 1.00 25.96  ? 363 ALA A O     1 
ATOM   2928 C  CB    . ALA A 1 366 ? 37.109 4.422   -17.338 1.00 17.93  ? 363 ALA A CB    1 
ATOM   2929 N  N     . THR A 1 367 ? 35.571 2.364   -19.415 1.00 18.70  ? 364 THR A N     1 
ATOM   2930 C  CA    . THR A 1 367 ? 34.333 2.042   -20.134 1.00 16.79  ? 364 THR A CA    1 
ATOM   2931 C  C     . THR A 1 367 ? 33.160 1.551   -19.294 1.00 20.49  ? 364 THR A C     1 
ATOM   2932 O  O     . THR A 1 367 ? 32.057 1.326   -19.804 1.00 21.36  ? 364 THR A O     1 
ATOM   2933 C  CB    . THR A 1 367 ? 34.579 1.010   -21.267 1.00 18.75  ? 364 THR A CB    1 
ATOM   2934 O  OG1   . THR A 1 367 ? 34.875 -0.266  -20.684 1.00 23.94  ? 364 THR A OG1   1 
ATOM   2935 C  CG2   . THR A 1 367 ? 35.744 1.477   -22.141 1.00 22.55  ? 364 THR A CG2   1 
ATOM   2936 N  N     . GLN A 1 368 ? 33.388 1.351   -18.007 1.00 19.76  ? 365 GLN A N     1 
ATOM   2937 C  CA    . GLN A 1 368 ? 32.321 0.883   -17.148 1.00 21.39  ? 365 GLN A CA    1 
ATOM   2938 C  C     . GLN A 1 368 ? 32.321 1.706   -15.863 1.00 17.97  ? 365 GLN A C     1 
ATOM   2939 O  O     . GLN A 1 368 ? 33.378 2.012   -15.322 1.00 20.61  ? 365 GLN A O     1 
ATOM   2940 C  CB    . GLN A 1 368 ? 32.511 -0.591  -16.821 1.00 23.72  ? 365 GLN A CB    1 
ATOM   2941 C  CG    . GLN A 1 368 ? 31.476 -1.149  -15.888 1.00 26.62  ? 365 GLN A CG    1 
ATOM   2942 C  CD    . GLN A 1 368 ? 31.662 -2.635  -15.675 1.00 32.31  ? 365 GLN A CD    1 
ATOM   2943 O  OE1   . GLN A 1 368 ? 32.528 -3.056  -14.912 1.00 37.63  ? 365 GLN A OE1   1 
ATOM   2944 N  NE2   . GLN A 1 368 ? 30.860 -3.437  -16.360 1.00 36.46  ? 365 GLN A NE2   1 
ATOM   2945 N  N     . LEU A 1 369 ? 31.125 2.069   -15.421 1.00 19.00  ? 366 LEU A N     1 
ATOM   2946 C  CA    . LEU A 1 369 ? 30.935 2.800   -14.162 1.00 20.05  ? 366 LEU A CA    1 
ATOM   2947 C  C     . LEU A 1 369 ? 30.277 1.880   -13.152 1.00 21.20  ? 366 LEU A C     1 
ATOM   2948 O  O     . LEU A 1 369 ? 29.209 1.334   -13.409 1.00 24.64  ? 366 LEU A O     1 
ATOM   2949 C  CB    . LEU A 1 369 ? 30.035 4.018   -14.393 1.00 22.03  ? 366 LEU A CB    1 
ATOM   2950 C  CG    . LEU A 1 369 ? 29.730 4.799   -13.108 1.00 20.10  ? 366 LEU A CG    1 
ATOM   2951 C  CD1   . LEU A 1 369 ? 30.978 5.559   -12.697 1.00 21.22  ? 366 LEU A CD1   1 
ATOM   2952 C  CD2   . LEU A 1 369 ? 28.516 5.730   -13.304 1.00 22.05  ? 366 LEU A CD2   1 
ATOM   2953 N  N     . VAL A 1 370 ? 30.919 1.689   -12.005 1.00 18.06  ? 367 VAL A N     1 
ATOM   2954 C  CA    . VAL A 1 370 ? 30.376 0.825   -10.967 1.00 18.80  ? 367 VAL A CA    1 
ATOM   2955 C  C     . VAL A 1 370 ? 29.836 1.732   -9.867  1.00 21.24  ? 367 VAL A C     1 
ATOM   2956 O  O     . VAL A 1 370 ? 30.519 2.672   -9.452  1.00 19.72  ? 367 VAL A O     1 
ATOM   2957 C  CB    . VAL A 1 370 ? 31.455 -0.107  -10.385 1.00 25.25  ? 367 VAL A CB    1 
ATOM   2958 C  CG1   . VAL A 1 370 ? 30.921 -0.862  -9.179  1.00 28.57  ? 367 VAL A CG1   1 
ATOM   2959 C  CG2   . VAL A 1 370 ? 31.974 -1.053  -11.452 1.00 22.47  ? 367 VAL A CG2   1 
ATOM   2960 N  N     . VAL A 1 371 ? 28.617 1.454   -9.418  1.00 19.94  ? 368 VAL A N     1 
ATOM   2961 C  CA    . VAL A 1 371 ? 27.970 2.241   -8.369  1.00 22.47  ? 368 VAL A CA    1 
ATOM   2962 C  C     . VAL A 1 371 ? 27.676 1.324   -7.186  1.00 28.58  ? 368 VAL A C     1 
ATOM   2963 O  O     . VAL A 1 371 ? 27.090 0.254   -7.350  1.00 26.62  ? 368 VAL A O     1 
ATOM   2964 C  CB    . VAL A 1 371 ? 26.662 2.887   -8.890  1.00 23.32  ? 368 VAL A CB    1 
ATOM   2965 C  CG1   . VAL A 1 371 ? 26.079 3.842   -7.856  1.00 25.15  ? 368 VAL A CG1   1 
ATOM   2966 C  CG2   . VAL A 1 371 ? 26.917 3.613   -10.213 1.00 25.89  ? 368 VAL A CG2   1 
ATOM   2967 N  N     . SER A 1 372 ? 28.106 1.719   -5.992  1.00 23.73  ? 369 SER A N     1 
ATOM   2968 C  CA    . SER A 1 372 ? 27.850 0.912   -4.813  1.00 24.23  ? 369 SER A CA    1 
ATOM   2969 C  C     . SER A 1 372 ? 27.295 1.792   -3.701  1.00 24.70  ? 369 SER A C     1 
ATOM   2970 O  O     . SER A 1 372 ? 27.664 2.963   -3.578  1.00 21.71  ? 369 SER A O     1 
ATOM   2971 C  CB    . SER A 1 372 ? 29.128 0.214   -4.350  1.00 26.49  ? 369 SER A CB    1 
ATOM   2972 O  OG    . SER A 1 372 ? 28.899 -0.575  -3.192  1.00 32.20  ? 369 SER A OG    1 
ATOM   2973 N  N     . ILE A 1 373 ? 26.377 1.230   -2.923  1.00 25.39  ? 370 ILE A N     1 
ATOM   2974 C  CA    . ILE A 1 373 ? 25.848 1.904   -1.737  1.00 23.98  ? 370 ILE A CA    1 
ATOM   2975 C  C     . ILE A 1 373 ? 25.810 0.978   -0.520  1.00 29.88  ? 370 ILE A C     1 
ATOM   2976 O  O     . ILE A 1 373 ? 26.018 -0.240  -0.617  1.00 25.70  ? 370 ILE A O     1 
ATOM   2977 C  CB    . ILE A 1 373 ? 24.438 2.503   -1.976  1.00 29.09  ? 370 ILE A CB    1 
ATOM   2978 C  CG1   . ILE A 1 373 ? 23.425 1.397   -2.264  1.00 33.25  ? 370 ILE A CG1   1 
ATOM   2979 C  CG2   . ILE A 1 373 ? 24.464 3.541   -3.098  1.00 23.10  ? 370 ILE A CG2   1 
ATOM   2980 C  CD1   . ILE A 1 373 ? 22.031 1.920   -2.530  1.00 40.21  ? 370 ILE A CD1   1 
ATOM   2981 N  N     . ARG A 1 374 ? 25.584 1.581   0.643   1.00 25.66  ? 371 ARG A N     1 
ATOM   2982 C  CA    . ARG A 1 374 ? 25.307 0.826   1.847   1.00 29.08  ? 371 ARG A CA    1 
ATOM   2983 C  C     . ARG A 1 374 ? 24.090 1.508   2.445   1.00 29.99  ? 371 ARG A C     1 
ATOM   2984 O  O     . ARG A 1 374 ? 24.018 2.736   2.485   1.00 24.64  ? 371 ARG A O     1 
ATOM   2985 C  CB    . ARG A 1 374 ? 26.486 0.875   2.820   1.00 29.87  ? 371 ARG A CB    1 
ATOM   2986 C  CG    . ARG A 1 374 ? 26.337 -0.017  4.040   1.00 36.18  ? 371 ARG A CG    1 
ATOM   2987 C  CD    . ARG A 1 374 ? 27.564 0.069   4.932   1.00 33.28  ? 371 ARG A CD    1 
ATOM   2988 N  NE    . ARG A 1 374 ? 27.571 -1.004  5.916   1.00 45.68  ? 371 ARG A NE    1 
ATOM   2989 C  CZ    . ARG A 1 374 ? 28.510 -1.174  6.838   1.00 48.63  ? 371 ARG A CZ    1 
ATOM   2990 N  NH1   . ARG A 1 374 ? 29.534 -0.332  6.914   1.00 50.45  ? 371 ARG A NH1   1 
ATOM   2991 N  NH2   . ARG A 1 374 ? 28.422 -2.188  7.690   1.00 52.84  ? 371 ARG A NH2   1 
ATOM   2992 N  N     . VAL A 1 375 ? 23.113 0.713   2.864   1.00 34.67  ? 372 VAL A N     1 
ATOM   2993 C  CA    . VAL A 1 375 ? 21.937 1.263   3.524   1.00 36.59  ? 372 VAL A CA    1 
ATOM   2994 C  C     . VAL A 1 375 ? 22.059 1.018   5.018   1.00 35.69  ? 372 VAL A C     1 
ATOM   2995 O  O     . VAL A 1 375 ? 22.660 0.032   5.450   1.00 36.38  ? 372 VAL A O     1 
ATOM   2996 C  CB    . VAL A 1 375 ? 20.627 0.648   2.989   1.00 41.93  ? 372 VAL A CB    1 
ATOM   2997 C  CG1   . VAL A 1 375 ? 20.433 1.006   1.519   1.00 37.27  ? 372 VAL A CG1   1 
ATOM   2998 C  CG2   . VAL A 1 375 ? 20.634 -0.854  3.182   1.00 40.46  ? 372 VAL A CG2   1 
ATOM   2999 N  N     . GLN A 1 376 ? 21.507 1.933   5.803   1.00 39.74  ? 373 GLN A N     1 
ATOM   3000 C  CA    . GLN A 1 376 ? 21.590 1.850   7.258   1.00 43.43  ? 373 GLN A CA    1 
ATOM   3001 C  C     . GLN A 1 376 ? 20.939 0.584   7.795   1.00 44.67  ? 373 GLN A C     1 
ATOM   3002 O  O     . GLN A 1 376 ? 19.848 0.206   7.375   1.00 48.05  ? 373 GLN A O     1 
ATOM   3003 C  CB    . GLN A 1 376 ? 20.941 3.073   7.887   1.00 44.08  ? 373 GLN A CB    1 
ATOM   3004 C  CG    . GLN A 1 376 ? 21.297 3.262   9.341   1.00 51.83  ? 373 GLN A CG    1 
ATOM   3005 C  CD    . GLN A 1 376 ? 21.142 4.701   9.766   1.00 54.21  ? 373 GLN A CD    1 
ATOM   3006 O  OE1   . GLN A 1 376 ? 20.042 5.257   9.716   1.00 50.91  ? 373 GLN A OE1   1 
ATOM   3007 N  NE2   . GLN A 1 376 ? 22.249 5.325   10.161  1.00 47.76  ? 373 GLN A NE2   1 
ATOM   3008 N  N     . GLY A 1 377 ? 21.618 -0.067  8.728   1.00 43.85  ? 374 GLY A N     1 
ATOM   3009 C  CA    . GLY A 1 377 ? 21.155 -1.335  9.253   1.00 47.10  ? 374 GLY A CA    1 
ATOM   3010 C  C     . GLY A 1 377 ? 21.983 -2.474  8.695   1.00 47.25  ? 374 GLY A C     1 
ATOM   3011 O  O     . GLY A 1 377 ? 22.235 -3.471  9.378   1.00 50.26  ? 374 GLY A O     1 
ATOM   3012 N  N     . ASP A 1 378 ? 22.417 -2.318  7.446   1.00 50.08  ? 375 ASP A N     1 
ATOM   3013 C  CA    . ASP A 1 378 ? 23.206 -3.342  6.773   1.00 45.50  ? 375 ASP A CA    1 
ATOM   3014 C  C     . ASP A 1 378 ? 24.575 -3.485  7.430   1.00 48.93  ? 375 ASP A C     1 
ATOM   3015 O  O     . ASP A 1 378 ? 25.279 -2.497  7.639   1.00 50.57  ? 375 ASP A O     1 
ATOM   3016 C  CB    . ASP A 1 378 ? 23.355 -3.015  5.283   1.00 41.94  ? 375 ASP A CB    1 
ATOM   3017 C  CG    . ASP A 1 378 ? 23.554 -4.254  4.431   1.00 43.08  ? 375 ASP A CG    1 
ATOM   3018 O  OD1   . ASP A 1 378 ? 24.267 -5.184  4.874   1.00 47.54  ? 375 ASP A OD1   1 
ATOM   3019 O  OD2   . ASP A 1 378 ? 22.989 -4.302  3.321   1.00 43.34  ? 375 ASP A OD2   1 
ATOM   3020 N  N     . LYS A 1 379 ? 24.948 -4.719  7.755   1.00 48.73  ? 376 LYS A N     1 
ATOM   3021 C  CA    . LYS A 1 379 ? 26.217 -4.984  8.425   1.00 49.08  ? 376 LYS A CA    1 
ATOM   3022 C  C     . LYS A 1 379 ? 27.312 -5.315  7.417   1.00 53.73  ? 376 LYS A C     1 
ATOM   3023 O  O     . LYS A 1 379 ? 28.448 -5.606  7.790   1.00 52.09  ? 376 LYS A O     1 
ATOM   3024 C  CB    . LYS A 1 379 ? 26.064 -6.133  9.422   1.00 54.11  ? 376 LYS A CB    1 
ATOM   3025 N  N     . ARG A 1 380 ? 26.956 -5.274  6.138   1.00 49.11  ? 377 ARG A N     1 
ATOM   3026 C  CA    . ARG A 1 380 ? 27.905 -5.545  5.066   1.00 49.43  ? 377 ARG A CA    1 
ATOM   3027 C  C     . ARG A 1 380 ? 28.491 -4.242  4.549   1.00 47.94  ? 377 ARG A C     1 
ATOM   3028 O  O     . ARG A 1 380 ? 27.831 -3.204  4.578   1.00 48.66  ? 377 ARG A O     1 
ATOM   3029 C  CB    . ARG A 1 380 ? 27.221 -6.283  3.920   1.00 47.70  ? 377 ARG A CB    1 
ATOM   3030 C  CG    . ARG A 1 380 ? 26.703 -7.659  4.282   1.00 53.85  ? 377 ARG A CG    1 
ATOM   3031 C  CD    . ARG A 1 380 ? 25.821 -8.167  3.174   1.00 44.45  ? 377 ARG A CD    1 
ATOM   3032 N  NE    . ARG A 1 380 ? 24.657 -7.307  3.015   1.00 47.67  ? 377 ARG A NE    1 
ATOM   3033 C  CZ    . ARG A 1 380 ? 23.956 -7.207  1.894   1.00 44.21  ? 377 ARG A CZ    1 
ATOM   3034 N  NH1   . ARG A 1 380 ? 24.315 -7.903  0.825   1.00 49.19  ? 377 ARG A NH1   1 
ATOM   3035 N  NH2   . ARG A 1 380 ? 22.904 -6.403  1.839   1.00 43.24  ? 377 ARG A NH2   1 
ATOM   3036 N  N     . LEU A 1 381 ? 29.728 -4.306  4.069   1.00 45.33  ? 378 LEU A N     1 
ATOM   3037 C  CA    . LEU A 1 381 ? 30.423 -3.122  3.574   1.00 40.57  ? 378 LEU A CA    1 
ATOM   3038 C  C     . LEU A 1 381 ? 29.676 -2.493  2.406   1.00 37.84  ? 378 LEU A C     1 
ATOM   3039 O  O     . LEU A 1 381 ? 29.719 -1.281  2.214   1.00 27.91  ? 378 LEU A O     1 
ATOM   3040 C  CB    . LEU A 1 381 ? 31.867 -3.456  3.194   1.00 37.76  ? 378 LEU A CB    1 
ATOM   3041 C  CG    . LEU A 1 381 ? 32.885 -3.482  4.342   1.00 46.44  ? 378 LEU A CG    1 
ATOM   3042 C  CD1   . LEU A 1 381 ? 32.578 -4.570  5.366   1.00 51.21  ? 378 LEU A CD1   1 
ATOM   3043 C  CD2   . LEU A 1 381 ? 34.304 -3.645  3.807   1.00 49.00  ? 378 LEU A CD2   1 
ATOM   3044 N  N     . SER A 1 382 ? 28.981 -3.323  1.634   1.00 35.71  ? 379 SER A N     1 
ATOM   3045 C  CA    . SER A 1 382 ? 28.126 -2.839  0.564   1.00 36.27  ? 379 SER A CA    1 
ATOM   3046 C  C     . SER A 1 382 ? 26.758 -3.515  0.590   1.00 37.78  ? 379 SER A C     1 
ATOM   3047 O  O     . SER A 1 382 ? 26.652 -4.724  0.799   1.00 44.87  ? 379 SER A O     1 
ATOM   3048 C  CB    . SER A 1 382 ? 28.771 -3.086  -0.801  1.00 36.05  ? 379 SER A CB    1 
ATOM   3049 O  OG    . SER A 1 382 ? 27.791 -2.995  -1.823  1.00 35.91  ? 379 SER A OG    1 
ATOM   3050 N  N     . SER A 1 383 ? 25.715 -2.732  0.370   1.00 34.39  ? 380 SER A N     1 
ATOM   3051 C  CA    . SER A 1 383 ? 24.390 -3.293  0.190   1.00 40.63  ? 380 SER A CA    1 
ATOM   3052 C  C     . SER A 1 383 ? 24.262 -3.700  -1.263  1.00 46.99  ? 380 SER A C     1 
ATOM   3053 O  O     . SER A 1 383 ? 24.262 -4.888  -1.586  1.00 52.12  ? 380 SER A O     1 
ATOM   3054 C  CB    . SER A 1 383 ? 23.312 -2.273  0.548   1.00 40.57  ? 380 SER A CB    1 
ATOM   3055 O  OG    . SER A 1 383 ? 23.378 -1.941  1.923   1.00 41.20  ? 380 SER A OG    1 
ATOM   3056 N  N     . LEU A 1 384 ? 24.184 -2.699  -2.135  1.00 43.04  ? 381 LEU A N     1 
ATOM   3057 C  CA    . LEU A 1 384 ? 23.976 -2.919  -3.559  1.00 41.27  ? 381 LEU A CA    1 
ATOM   3058 C  C     . LEU A 1 384 ? 25.203 -2.525  -4.382  1.00 43.73  ? 381 LEU A C     1 
ATOM   3059 O  O     . LEU A 1 384 ? 25.823 -1.482  -4.144  1.00 31.25  ? 381 LEU A O     1 
ATOM   3060 C  CB    . LEU A 1 384 ? 22.781 -2.096  -4.032  1.00 40.80  ? 381 LEU A CB    1 
ATOM   3061 C  CG    . LEU A 1 384 ? 22.111 -2.550  -5.323  1.00 47.01  ? 381 LEU A CG    1 
ATOM   3062 C  CD1   . LEU A 1 384 ? 21.002 -3.550  -5.012  1.00 49.93  ? 381 LEU A CD1   1 
ATOM   3063 C  CD2   . LEU A 1 384 ? 21.583 -1.358  -6.097  1.00 44.59  ? 381 LEU A CD2   1 
ATOM   3064 N  N     . ARG A 1 385 ? 25.551 -3.361  -5.353  1.00 41.42  ? 382 ARG A N     1 
ATOM   3065 C  CA    . ARG A 1 385 ? 26.507 -2.952  -6.371  1.00 34.82  ? 382 ARG A CA    1 
ATOM   3066 C  C     . ARG A 1 385 ? 25.942 -3.219  -7.760  1.00 38.80  ? 382 ARG A C     1 
ATOM   3067 O  O     . ARG A 1 385 ? 25.442 -4.304  -8.054  1.00 38.33  ? 382 ARG A O     1 
ATOM   3068 C  CB    . ARG A 1 385 ? 27.854 -3.639  -6.196  1.00 37.84  ? 382 ARG A CB    1 
ATOM   3069 C  CG    . ARG A 1 385 ? 28.858 -3.222  -7.252  1.00 42.67  ? 382 ARG A CG    1 
ATOM   3070 C  CD    . ARG A 1 385 ? 30.147 -3.964  -7.061  1.00 44.47  ? 382 ARG A CD    1 
ATOM   3071 N  NE    . ARG A 1 385 ? 31.036 -3.905  -8.218  1.00 38.62  ? 382 ARG A NE    1 
ATOM   3072 C  CZ    . ARG A 1 385 ? 30.837 -4.538  -9.374  1.00 42.08  ? 382 ARG A CZ    1 
ATOM   3073 N  NH1   . ARG A 1 385 ? 31.732 -4.415  -10.347 1.00 39.53  ? 382 ARG A NH1   1 
ATOM   3074 N  NH2   . ARG A 1 385 ? 29.752 -5.281  -9.569  1.00 38.70  ? 382 ARG A NH2   1 
ATOM   3075 N  N     . ARG A 1 386 ? 26.003 -2.201  -8.602  1.00 30.52  ? 383 ARG A N     1 
ATOM   3076 C  CA    . ARG A 1 386 ? 25.466 -2.288  -9.949  1.00 36.02  ? 383 ARG A CA    1 
ATOM   3077 C  C     . ARG A 1 386 ? 26.443 -1.606  -10.892 1.00 32.08  ? 383 ARG A C     1 
ATOM   3078 O  O     . ARG A 1 386 ? 27.170 -0.701  -10.493 1.00 27.29  ? 383 ARG A O     1 
ATOM   3079 C  CB    . ARG A 1 386 ? 24.118 -1.582  -10.021 1.00 34.16  ? 383 ARG A CB    1 
ATOM   3080 C  CG    . ARG A 1 386 ? 23.022 -2.225  -9.199  1.00 39.12  ? 383 ARG A CG    1 
ATOM   3081 C  CD    . ARG A 1 386 ? 22.420 -3.416  -9.911  1.00 37.10  ? 383 ARG A CD    1 
ATOM   3082 N  NE    . ARG A 1 386 ? 21.146 -3.807  -9.321  1.00 42.32  ? 383 ARG A NE    1 
ATOM   3083 C  CZ    . ARG A 1 386 ? 21.031 -4.661  -8.312  1.00 42.87  ? 383 ARG A CZ    1 
ATOM   3084 N  NH1   . ARG A 1 386 ? 22.120 -5.207  -7.787  1.00 40.23  ? 383 ARG A NH1   1 
ATOM   3085 N  NH2   . ARG A 1 386 ? 19.830 -4.969  -7.835  1.00 42.49  ? 383 ARG A NH2   1 
ATOM   3086 N  N     . CYS A 1 387 ? 26.467 -2.033  -12.147 1.00 31.10  ? 384 CYS A N     1 
ATOM   3087 C  CA    . CYS A 1 387 ? 27.307 -1.360  -13.119 1.00 30.59  ? 384 CYS A CA    1 
ATOM   3088 C  C     . CYS A 1 387 ? 26.453 -0.787  -14.226 1.00 27.58  ? 384 CYS A C     1 
ATOM   3089 O  O     . CYS A 1 387 ? 25.324 -1.219  -14.422 1.00 30.18  ? 384 CYS A O     1 
ATOM   3090 C  CB    . CYS A 1 387 ? 28.353 -2.321  -13.693 1.00 33.21  ? 384 CYS A CB    1 
ATOM   3091 S  SG    A CYS A 1 387 ? 27.665 -3.772  -14.573 0.64 32.67  ? 384 CYS A SG    1 
ATOM   3092 S  SG    B CYS A 1 387 ? 29.320 -3.135  -12.430 0.36 32.91  ? 384 CYS A SG    1 
ATOM   3093 N  N     . CYS A 1 388 ? 26.990 0.198   -14.936 1.00 27.97  ? 385 CYS A N     1 
ATOM   3094 C  CA    . CYS A 1 388 ? 26.394 0.646   -16.190 1.00 36.03  ? 385 CYS A CA    1 
ATOM   3095 C  C     . CYS A 1 388 ? 27.506 1.096   -17.129 1.00 31.50  ? 385 CYS A C     1 
ATOM   3096 O  O     . CYS A 1 388 ? 28.683 1.004   -16.783 1.00 25.71  ? 385 CYS A O     1 
ATOM   3097 C  CB    . CYS A 1 388 ? 25.394 1.777   -15.954 1.00 29.67  ? 385 CYS A CB    1 
ATOM   3098 S  SG    . CYS A 1 388 ? 26.096 3.227   -15.137 1.00 33.66  ? 385 CYS A SG    1 
ATOM   3099 N  N     . ALA A 1 389 ? 27.141 1.565   -18.318 1.00 33.19  ? 386 ALA A N     1 
ATOM   3100 C  CA    . ALA A 1 389 ? 28.142 2.012   -19.281 1.00 26.35  ? 386 ALA A CA    1 
ATOM   3101 C  C     . ALA A 1 389 ? 28.704 3.380   -18.917 1.00 27.09  ? 386 ALA A C     1 
ATOM   3102 O  O     . ALA A 1 389 ? 27.964 4.275   -18.520 1.00 31.01  ? 386 ALA A O     1 
ATOM   3103 C  CB    . ALA A 1 389 ? 27.556 2.024   -20.699 1.00 26.98  ? 386 ALA A CB    1 
ATOM   3104 N  N     . LEU A 1 390 ? 30.017 3.540   -19.029 1.00 25.55  ? 387 LEU A N     1 
ATOM   3105 C  CA    . LEU A 1 390 ? 30.623 4.855   -18.893 1.00 26.88  ? 387 LEU A CA    1 
ATOM   3106 C  C     . LEU A 1 390 ? 31.015 5.264   -20.300 1.00 27.58  ? 387 LEU A C     1 
ATOM   3107 O  O     . LEU A 1 390 ? 32.056 4.844   -20.801 1.00 27.19  ? 387 LEU A O     1 
ATOM   3108 C  CB    . LEU A 1 390 ? 31.863 4.806   -17.994 1.00 24.18  ? 387 LEU A CB    1 
ATOM   3109 C  CG    . LEU A 1 390 ? 32.265 6.053   -17.202 1.00 22.51  ? 387 LEU A CG    1 
ATOM   3110 C  CD1   . LEU A 1 390 ? 33.486 5.731   -16.347 1.00 21.40  ? 387 LEU A CD1   1 
ATOM   3111 C  CD2   . LEU A 1 390 ? 32.540 7.264   -18.072 1.00 26.62  ? 387 LEU A CD2   1 
ATOM   3112 N  N     . THR A 1 391 ? 30.180 6.081   -20.931 1.00 29.78  ? 388 THR A N     1 
ATOM   3113 C  CA    . THR A 1 391 ? 30.366 6.437   -22.330 1.00 33.29  ? 388 THR A CA    1 
ATOM   3114 C  C     . THR A 1 391 ? 30.913 7.850   -22.524 1.00 32.79  ? 388 THR A C     1 
ATOM   3115 O  O     . THR A 1 391 ? 31.474 8.167   -23.568 1.00 31.30  ? 388 THR A O     1 
ATOM   3116 C  CB    . THR A 1 391 ? 29.041 6.313   -23.115 1.00 38.10  ? 388 THR A CB    1 
ATOM   3117 O  OG1   . THR A 1 391 ? 28.120 7.308   -22.655 1.00 41.11  ? 388 THR A OG1   1 
ATOM   3118 C  CG2   . THR A 1 391 ? 28.413 4.929   -22.927 1.00 31.11  ? 388 THR A CG2   1 
ATOM   3119 N  N     . ARG A 1 392 ? 30.723 8.703   -21.522 1.00 30.19  ? 389 ARG A N     1 
ATOM   3120 C  CA    . ARG A 1 392 ? 31.220 10.073  -21.569 1.00 28.52  ? 389 ARG A CA    1 
ATOM   3121 C  C     . ARG A 1 392 ? 31.778 10.515  -20.220 1.00 24.90  ? 389 ARG A C     1 
ATOM   3122 O  O     . ARG A 1 392 ? 31.185 10.244  -19.185 1.00 30.67  ? 389 ARG A O     1 
ATOM   3123 C  CB    . ARG A 1 392 ? 30.112 11.039  -21.995 1.00 37.27  ? 389 ARG A CB    1 
ATOM   3124 C  CG    . ARG A 1 392 ? 29.913 11.132  -23.495 1.00 38.93  ? 389 ARG A CG    1 
ATOM   3125 C  CD    . ARG A 1 392 ? 28.997 12.290  -23.842 1.00 47.24  ? 389 ARG A CD    1 
ATOM   3126 N  NE    . ARG A 1 392 ? 29.462 13.558  -23.284 1.00 49.94  ? 389 ARG A NE    1 
ATOM   3127 C  CZ    . ARG A 1 392 ? 28.733 14.336  -22.488 1.00 53.65  ? 389 ARG A CZ    1 
ATOM   3128 N  NH1   . ARG A 1 392 ? 29.237 15.474  -22.024 1.00 53.76  ? 389 ARG A NH1   1 
ATOM   3129 N  NH2   . ARG A 1 392 ? 27.498 13.976  -22.160 1.00 49.97  ? 389 ARG A NH2   1 
ATOM   3130 N  N     . TYR A 1 393 ? 32.915 11.198  -20.246 1.00 26.32  ? 390 TYR A N     1 
ATOM   3131 C  CA    . TYR A 1 393 ? 33.497 11.755  -19.030 1.00 23.22  ? 390 TYR A CA    1 
ATOM   3132 C  C     . TYR A 1 393 ? 32.757 13.036  -18.658 1.00 27.06  ? 390 TYR A C     1 
ATOM   3133 O  O     . TYR A 1 393 ? 33.235 14.155  -18.897 1.00 26.07  ? 390 TYR A O     1 
ATOM   3134 C  CB    . TYR A 1 393 ? 34.984 12.031  -19.219 1.00 23.72  ? 390 TYR A CB    1 
ATOM   3135 C  CG    . TYR A 1 393 ? 35.882 10.804  -19.160 1.00 18.44  ? 390 TYR A CG    1 
ATOM   3136 C  CD1   . TYR A 1 393 ? 35.346 9.529   -19.085 1.00 24.73  ? 390 TYR A CD1   1 
ATOM   3137 C  CD2   . TYR A 1 393 ? 37.261 10.937  -19.167 1.00 19.12  ? 390 TYR A CD2   1 
ATOM   3138 C  CE1   . TYR A 1 393 ? 36.168 8.410   -19.015 1.00 20.56  ? 390 TYR A CE1   1 
ATOM   3139 C  CE2   . TYR A 1 393 ? 38.090 9.830   -19.087 1.00 15.54  ? 390 TYR A CE2   1 
ATOM   3140 C  CZ    . TYR A 1 393 ? 37.536 8.572   -19.023 1.00 20.23  ? 390 TYR A CZ    1 
ATOM   3141 O  OH    . TYR A 1 393 ? 38.379 7.474   -18.937 1.00 22.60  ? 390 TYR A OH    1 
ATOM   3142 N  N     . ASP A 1 394 ? 31.576 12.858  -18.089 1.00 24.98  ? 391 ASP A N     1 
ATOM   3143 C  CA    . ASP A 1 394 ? 30.720 13.978  -17.735 1.00 27.84  ? 391 ASP A CA    1 
ATOM   3144 C  C     . ASP A 1 394 ? 30.045 13.730  -16.401 1.00 19.86  ? 391 ASP A C     1 
ATOM   3145 O  O     . ASP A 1 394 ? 29.266 12.781  -16.252 1.00 26.96  ? 391 ASP A O     1 
ATOM   3146 C  CB    . ASP A 1 394 ? 29.671 14.211  -18.815 1.00 30.39  ? 391 ASP A CB    1 
ATOM   3147 C  CG    . ASP A 1 394 ? 28.797 15.399  -18.509 1.00 38.64  ? 391 ASP A CG    1 
ATOM   3148 O  OD1   . ASP A 1 394 ? 29.146 16.517  -18.943 1.00 44.63  ? 391 ASP A OD1   1 
ATOM   3149 O  OD2   . ASP A 1 394 ? 27.780 15.214  -17.809 1.00 34.37  ? 391 ASP A OD2   1 
ATOM   3150 N  N     . ALA A 1 395 ? 30.337 14.587  -15.428 1.00 22.63  ? 392 ALA A N     1 
ATOM   3151 C  CA    . ALA A 1 395 ? 29.872 14.360  -14.067 1.00 23.70  ? 392 ALA A CA    1 
ATOM   3152 C  C     . ALA A 1 395 ? 28.346 14.305  -13.922 1.00 20.77  ? 392 ALA A C     1 
ATOM   3153 O  O     . ALA A 1 395 ? 27.824 13.478  -13.187 1.00 22.01  ? 392 ALA A O     1 
ATOM   3154 C  CB    . ALA A 1 395 ? 30.479 15.382  -13.115 1.00 21.57  ? 392 ALA A CB    1 
ATOM   3155 N  N     . HIS A 1 396 ? 27.633 15.186  -14.616 1.00 28.86  ? 393 HIS A N     1 
ATOM   3156 C  CA    . HIS A 1 396 ? 26.182 15.175  -14.511 1.00 29.82  ? 393 HIS A CA    1 
ATOM   3157 C  C     . HIS A 1 396 ? 25.601 13.905  -15.099 1.00 23.52  ? 393 HIS A C     1 
ATOM   3158 O  O     . HIS A 1 396 ? 24.687 13.319  -14.525 1.00 29.95  ? 393 HIS A O     1 
ATOM   3159 C  CB    . HIS A 1 396 ? 25.561 16.420  -15.150 1.00 26.34  ? 393 HIS A CB    1 
ATOM   3160 C  CG    . HIS A 1 396 ? 25.724 17.657  -14.321 1.00 36.01  ? 393 HIS A CG    1 
ATOM   3161 N  ND1   . HIS A 1 396 ? 26.706 18.593  -14.563 1.00 40.07  ? 393 HIS A ND1   1 
ATOM   3162 C  CD2   . HIS A 1 396 ? 25.048 18.093  -13.232 1.00 38.25  ? 393 HIS A CD2   1 
ATOM   3163 C  CE1   . HIS A 1 396 ? 26.618 19.563  -13.670 1.00 35.73  ? 393 HIS A CE1   1 
ATOM   3164 N  NE2   . HIS A 1 396 ? 25.619 19.284  -12.851 1.00 47.07  ? 393 HIS A NE2   1 
ATOM   3165 N  N     . LYS A 1 397 ? 26.135 13.457  -16.231 1.00 26.84  ? 394 LYS A N     1 
ATOM   3166 C  CA    . LYS A 1 397 ? 25.696 12.169  -16.770 1.00 26.87  ? 394 LYS A CA    1 
ATOM   3167 C  C     . LYS A 1 397 ? 26.057 10.991  -15.872 1.00 26.78  ? 394 LYS A C     1 
ATOM   3168 O  O     . LYS A 1 397 ? 25.244 10.089  -15.663 1.00 26.77  ? 394 LYS A O     1 
ATOM   3169 C  CB    . LYS A 1 397 ? 26.208 11.916  -18.187 1.00 30.01  ? 394 LYS A CB    1 
ATOM   3170 C  CG    . LYS A 1 397 ? 25.800 10.529  -18.700 1.00 35.60  ? 394 LYS A CG    1 
ATOM   3171 C  CD    . LYS A 1 397 ? 26.172 10.294  -20.153 1.00 36.49  ? 394 LYS A CD    1 
ATOM   3172 C  CE    . LYS A 1 397 ? 25.936 8.837   -20.534 1.00 35.50  ? 394 LYS A CE    1 
ATOM   3173 N  NZ    . LYS A 1 397 ? 24.532 8.406   -20.267 1.00 38.39  ? 394 LYS A NZ    1 
ATOM   3174 N  N     . MET A 1 398 ? 27.276 10.991  -15.339 1.00 25.18  ? 395 MET A N     1 
ATOM   3175 C  CA    . MET A 1 398 ? 27.673 9.901   -14.468 1.00 23.10  ? 395 MET A CA    1 
ATOM   3176 C  C     . MET A 1 398 ? 26.799 9.846   -13.217 1.00 22.18  ? 395 MET A C     1 
ATOM   3177 O  O     . MET A 1 398 ? 26.351 8.772   -12.818 1.00 24.54  ? 395 MET A O     1 
ATOM   3178 C  CB    . MET A 1 398 ? 29.170 9.952   -14.139 1.00 22.75  ? 395 MET A CB    1 
ATOM   3179 C  CG    . MET A 1 398 ? 30.019 9.375   -15.260 1.00 24.32  ? 395 MET A CG    1 
ATOM   3180 S  SD    . MET A 1 398 ? 31.769 9.256   -14.866 1.00 27.59  ? 395 MET A SD    1 
ATOM   3181 C  CE    . MET A 1 398 ? 32.180 10.987  -14.972 1.00 21.76  ? 395 MET A CE    1 
ATOM   3182 N  N     . SER A 1 399 ? 26.527 11.011  -12.629 1.00 25.41  ? 396 SER A N     1 
ATOM   3183 C  CA    . SER A 1 399 ? 25.714 11.069  -11.415 1.00 22.63  ? 396 SER A CA    1 
ATOM   3184 C  C     . SER A 1 399 ? 24.241 10.736  -11.673 1.00 23.55  ? 396 SER A C     1 
ATOM   3185 O  O     . SER A 1 399 ? 23.588 10.107  -10.846 1.00 24.20  ? 396 SER A O     1 
ATOM   3186 C  CB    . SER A 1 399 ? 25.873 12.417  -10.693 1.00 22.01  ? 396 SER A CB    1 
ATOM   3187 O  OG    . SER A 1 399 ? 25.444 13.515  -11.474 1.00 27.29  ? 396 SER A OG    1 
ATOM   3188 N  N     . HIS A 1 400 ? 23.733 11.130  -12.830 1.00 29.74  ? 397 HIS A N     1 
ATOM   3189 C  CA    . HIS A 1 400 ? 22.371 10.755  -13.207 1.00 32.47  ? 397 HIS A CA    1 
ATOM   3190 C  C     . HIS A 1 400 ? 22.262 9.246   -13.474 1.00 30.18  ? 397 HIS A C     1 
ATOM   3191 O  O     . HIS A 1 400 ? 21.319 8.597   -13.030 1.00 32.74  ? 397 HIS A O     1 
ATOM   3192 C  CB    . HIS A 1 400 ? 21.911 11.560  -14.425 1.00 36.38  ? 397 HIS A CB    1 
ATOM   3193 C  CG    . HIS A 1 400 ? 20.471 11.348  -14.776 1.00 46.95  ? 397 HIS A CG    1 
ATOM   3194 N  ND1   . HIS A 1 400 ? 20.042 10.293  -15.555 1.00 49.04  ? 397 HIS A ND1   1 
ATOM   3195 C  CD2   . HIS A 1 400 ? 19.360 12.049  -14.448 1.00 55.08  ? 397 HIS A CD2   1 
ATOM   3196 C  CE1   . HIS A 1 400 ? 18.731 10.356  -15.693 1.00 54.58  ? 397 HIS A CE1   1 
ATOM   3197 N  NE2   . HIS A 1 400 ? 18.291 11.412  -15.031 1.00 55.26  ? 397 HIS A NE2   1 
ATOM   3198 N  N     . ASP A 1 401 ? 23.243 8.687   -14.182 1.00 31.44  ? 398 ASP A N     1 
ATOM   3199 C  CA    . ASP A 1 401 ? 23.279 7.246   -14.430 1.00 29.70  ? 398 ASP A CA    1 
ATOM   3200 C  C     . ASP A 1 401 ? 23.390 6.450   -13.132 1.00 28.74  ? 398 ASP A C     1 
ATOM   3201 O  O     . ASP A 1 401 ? 22.753 5.413   -12.970 1.00 28.56  ? 398 ASP A O     1 
ATOM   3202 C  CB    . ASP A 1 401 ? 24.442 6.875   -15.353 1.00 30.23  ? 398 ASP A CB    1 
ATOM   3203 C  CG    . ASP A 1 401 ? 24.229 7.335   -16.782 1.00 36.49  ? 398 ASP A CG    1 
ATOM   3204 O  OD1   . ASP A 1 401 ? 23.108 7.778   -17.120 1.00 31.96  ? 398 ASP A OD1   1 
ATOM   3205 O  OD2   . ASP A 1 401 ? 25.190 7.237   -17.574 1.00 33.23  ? 398 ASP A OD2   1 
ATOM   3206 N  N     . ALA A 1 402 ? 24.222 6.936   -12.211 1.00 27.33  ? 399 ALA A N     1 
ATOM   3207 C  CA    . ALA A 1 402 ? 24.404 6.273   -10.930 1.00 26.19  ? 399 ALA A CA    1 
ATOM   3208 C  C     . ALA A 1 402 ? 23.088 6.214   -10.158 1.00 24.37  ? 399 ALA A C     1 
ATOM   3209 O  O     . ALA A 1 402 ? 22.768 5.201   -9.544  1.00 27.02  ? 399 ALA A O     1 
ATOM   3210 C  CB    . ALA A 1 402 ? 25.477 7.006   -10.104 1.00 23.56  ? 399 ALA A CB    1 
ATOM   3211 N  N     . PHE A 1 403 ? 22.344 7.313   -10.191 1.00 28.86  ? 400 PHE A N     1 
ATOM   3212 C  CA    . PHE A 1 403 ? 21.063 7.402   -9.508  1.00 33.90  ? 400 PHE A CA    1 
ATOM   3213 C  C     . PHE A 1 403 ? 20.086 6.390   -10.091 1.00 37.72  ? 400 PHE A C     1 
ATOM   3214 O  O     . PHE A 1 403 ? 19.364 5.721   -9.362  1.00 38.13  ? 400 PHE A O     1 
ATOM   3215 C  CB    . PHE A 1 403 ? 20.493 8.813   -9.636  1.00 31.82  ? 400 PHE A CB    1 
ATOM   3216 C  CG    . PHE A 1 403 ? 19.244 9.037   -8.830  1.00 45.27  ? 400 PHE A CG    1 
ATOM   3217 C  CD1   . PHE A 1 403 ? 17.995 8.782   -9.375  1.00 48.49  ? 400 PHE A CD1   1 
ATOM   3218 C  CD2   . PHE A 1 403 ? 19.318 9.506   -7.529  1.00 46.17  ? 400 PHE A CD2   1 
ATOM   3219 C  CE1   . PHE A 1 403 ? 16.844 8.988   -8.636  1.00 50.94  ? 400 PHE A CE1   1 
ATOM   3220 C  CE2   . PHE A 1 403 ? 18.171 9.715   -6.785  1.00 51.24  ? 400 PHE A CE2   1 
ATOM   3221 C  CZ    . PHE A 1 403 ? 16.933 9.454   -7.340  1.00 54.05  ? 400 PHE A CZ    1 
ATOM   3222 N  N     . THR A 1 404 ? 20.082 6.274   -11.410 1.00 37.59  ? 401 THR A N     1 
ATOM   3223 C  CA    . THR A 1 404 ? 19.203 5.328   -12.091 1.00 37.13  ? 401 THR A CA    1 
ATOM   3224 C  C     . THR A 1 404 ? 19.394 3.882   -11.626 1.00 40.48  ? 401 THR A C     1 
ATOM   3225 O  O     . THR A 1 404 ? 18.420 3.188   -11.327 1.00 41.58  ? 401 THR A O     1 
ATOM   3226 C  CB    . THR A 1 404 ? 19.373 5.410   -13.619 1.00 36.48  ? 401 THR A CB    1 
ATOM   3227 O  OG1   . THR A 1 404 ? 19.140 6.754   -14.054 1.00 34.32  ? 401 THR A OG1   1 
ATOM   3228 C  CG2   . THR A 1 404 ? 18.399 4.475   -14.320 1.00 38.80  ? 401 THR A CG2   1 
ATOM   3229 N  N     . VAL A 1 405 ? 20.640 3.423   -11.543 1.00 31.97  ? 402 VAL A N     1 
ATOM   3230 C  CA    . VAL A 1 405 ? 20.863 2.028   -11.202 1.00 34.44  ? 402 VAL A CA    1 
ATOM   3231 C  C     . VAL A 1 405 ? 20.573 1.732   -9.734  1.00 34.49  ? 402 VAL A C     1 
ATOM   3232 O  O     . VAL A 1 405 ? 20.450 0.570   -9.364  1.00 38.24  ? 402 VAL A O     1 
ATOM   3233 C  CB    . VAL A 1 405 ? 22.280 1.543   -11.581 1.00 41.66  ? 402 VAL A CB    1 
ATOM   3234 C  CG1   . VAL A 1 405 ? 22.631 1.999   -12.988 1.00 38.97  ? 402 VAL A CG1   1 
ATOM   3235 C  CG2   . VAL A 1 405 ? 23.297 2.042   -10.583 1.00 41.24  ? 402 VAL A CG2   1 
ATOM   3236 N  N     . ILE A 1 406 ? 20.460 2.778   -8.909  1.00 39.51  ? 403 ILE A N     1 
ATOM   3237 C  CA    . ILE A 1 406 ? 20.189 2.608   -7.478  1.00 40.19  ? 403 ILE A CA    1 
ATOM   3238 C  C     . ILE A 1 406 ? 18.828 3.126   -6.988  1.00 41.64  ? 403 ILE A C     1 
ATOM   3239 O  O     . ILE A 1 406 ? 18.419 2.802   -5.876  1.00 41.82  ? 403 ILE A O     1 
ATOM   3240 C  CB    . ILE A 1 406 ? 21.271 3.274   -6.590  1.00 35.83  ? 403 ILE A CB    1 
ATOM   3241 C  CG1   . ILE A 1 406 ? 21.124 4.800   -6.619  1.00 33.21  ? 403 ILE A CG1   1 
ATOM   3242 C  CG2   . ILE A 1 406 ? 22.658 2.818   -7.001  1.00 37.22  ? 403 ILE A CG2   1 
ATOM   3243 C  CD1   . ILE A 1 406 ? 21.844 5.518   -5.476  1.00 33.38  ? 403 ILE A CD1   1 
ATOM   3244 N  N     . LYS A 1 407 ? 18.133 3.921   -7.798  1.00 40.96  ? 404 LYS A N     1 
ATOM   3245 C  CA    . LYS A 1 407 ? 16.903 4.583   -7.342  1.00 47.46  ? 404 LYS A CA    1 
ATOM   3246 C  C     . LYS A 1 407 ? 15.787 3.639   -6.880  1.00 49.23  ? 404 LYS A C     1 
ATOM   3247 O  O     . LYS A 1 407 ? 14.889 4.048   -6.140  1.00 44.60  ? 404 LYS A O     1 
ATOM   3248 C  CB    . LYS A 1 407 ? 16.368 5.558   -8.394  1.00 47.53  ? 404 LYS A CB    1 
ATOM   3249 C  CG    . LYS A 1 407 ? 15.789 4.907   -9.642  1.00 46.27  ? 404 LYS A CG    1 
ATOM   3250 C  CD    . LYS A 1 407 ? 15.311 5.978   -10.614 1.00 49.05  ? 404 LYS A CD    1 
ATOM   3251 C  CE    . LYS A 1 407 ? 14.447 5.400   -11.725 1.00 54.03  ? 404 LYS A CE    1 
ATOM   3252 N  NZ    . LYS A 1 407 ? 15.191 4.436   -12.580 1.00 53.89  ? 404 LYS A NZ    1 
ATOM   3253 N  N     . ASN A 1 408 ? 15.858 2.381   -7.304  1.00 47.80  ? 405 ASN A N     1 
ATOM   3254 C  CA    . ASN A 1 408 ? 14.886 1.370   -6.907  1.00 49.04  ? 405 ASN A CA    1 
ATOM   3255 C  C     . ASN A 1 408 ? 15.228 0.747   -5.561  1.00 53.54  ? 405 ASN A C     1 
ATOM   3256 O  O     . ASN A 1 408 ? 14.603 -0.227  -5.139  1.00 50.38  ? 405 ASN A O     1 
ATOM   3257 C  CB    . ASN A 1 408 ? 14.815 0.264   -7.961  1.00 54.59  ? 405 ASN A CB    1 
ATOM   3258 C  CG    . ASN A 1 408 ? 15.976 -0.714  -7.856  1.00 59.53  ? 405 ASN A CG    1 
ATOM   3259 O  OD1   . ASN A 1 408 ? 17.122 -0.376  -8.170  1.00 54.33  ? 405 ASN A OD1   1 
ATOM   3260 N  ND2   . ASN A 1 408 ? 15.683 -1.934  -7.410  1.00 62.64  ? 405 ASN A ND2   1 
ATOM   3261 N  N     . CYS A 1 409 ? 16.241 1.288   -4.896  1.00 47.85  ? 406 CYS A N     1 
ATOM   3262 C  CA    . CYS A 1 409 ? 16.602 0.791   -3.577  1.00 49.46  ? 406 CYS A CA    1 
ATOM   3263 C  C     . CYS A 1 409 ? 15.785 1.522   -2.538  1.00 42.82  ? 406 CYS A C     1 
ATOM   3264 O  O     . CYS A 1 409 ? 15.611 1.046   -1.418  1.00 49.90  ? 406 CYS A O     1 
ATOM   3265 C  CB    . CYS A 1 409 ? 18.088 0.989   -3.303  1.00 47.09  ? 406 CYS A CB    1 
ATOM   3266 S  SG    . CYS A 1 409 ? 19.104 -0.299  -4.011  1.00 54.49  ? 406 CYS A SG    1 
ATOM   3267 N  N     . ASN A 1 410 ? 15.289 2.687   -2.930  1.00 42.23  ? 407 ASN A N     1 
ATOM   3268 C  CA    . ASN A 1 410 ? 14.484 3.519   -2.058  1.00 46.50  ? 407 ASN A CA    1 
ATOM   3269 C  C     . ASN A 1 410 ? 13.127 2.866   -1.773  1.00 54.60  ? 407 ASN A C     1 
ATOM   3270 O  O     . ASN A 1 410 ? 12.201 2.953   -2.583  1.00 52.86  ? 407 ASN A O     1 
ATOM   3271 C  CB    . ASN A 1 410 ? 14.302 4.893   -2.702  1.00 37.63  ? 407 ASN A CB    1 
ATOM   3272 C  CG    . ASN A 1 410 ? 13.666 5.888   -1.772  1.00 45.81  ? 407 ASN A CG    1 
ATOM   3273 O  OD1   . ASN A 1 410 ? 13.426 5.589   -0.599  1.00 49.17  ? 407 ASN A OD1   1 
ATOM   3274 N  ND2   . ASN A 1 410 ? 13.394 7.088   -2.282  1.00 32.80  ? 407 ASN A ND2   1 
ATOM   3275 N  N     . THR A 1 411 ? 13.018 2.217   -0.616  1.00 50.90  ? 408 THR A N     1 
ATOM   3276 C  CA    . THR A 1 411 ? 11.805 1.489   -0.246  1.00 56.36  ? 408 THR A CA    1 
ATOM   3277 C  C     . THR A 1 411 ? 10.707 2.414   0.274   1.00 58.75  ? 408 THR A C     1 
ATOM   3278 O  O     . THR A 1 411 ? 9.698  1.954   0.811   1.00 66.36  ? 408 THR A O     1 
ATOM   3279 C  CB    . THR A 1 411 ? 12.094 0.389   0.801   1.00 55.47  ? 408 THR A CB    1 
ATOM   3280 O  OG1   . THR A 1 411 ? 10.972 -0.498  0.886   1.00 72.41  ? 408 THR A OG1   1 
ATOM   3281 C  CG2   . THR A 1 411 ? 12.366 0.994   2.177   1.00 53.33  ? 408 THR A CG2   1 
ATOM   3282 N  N     . SER A 1 412 ? 10.909 3.718   0.103   1.00 58.62  ? 409 SER A N     1 
ATOM   3283 C  CA    . SER A 1 412 ? 9.934  4.724   0.507   1.00 61.42  ? 409 SER A CA    1 
ATOM   3284 C  C     . SER A 1 412 ? 8.944  5.034   -0.606  1.00 68.88  ? 409 SER A C     1 
ATOM   3285 O  O     . SER A 1 412 ? 9.335  5.465   -1.693  1.00 71.97  ? 409 SER A O     1 
ATOM   3286 C  CB    . SER A 1 412 ? 10.642 6.014   0.920   1.00 58.91  ? 409 SER A CB    1 
ATOM   3287 O  OG    . SER A 1 412 ? 9.782  7.135   0.808   1.00 64.76  ? 409 SER A OG    1 
ATOM   3288 N  N     . GLY A 1 413 ? 7.662  4.818   -0.328  1.00 75.68  ? 410 GLY A N     1 
ATOM   3289 C  CA    . GLY A 1 413 ? 6.607  5.221   -1.239  1.00 76.39  ? 410 GLY A CA    1 
ATOM   3290 C  C     . GLY A 1 413 ? 6.660  6.718   -1.469  1.00 76.75  ? 410 GLY A C     1 
ATOM   3291 O  O     . GLY A 1 413 ? 6.468  7.193   -2.589  1.00 75.72  ? 410 GLY A O     1 
ATOM   3292 N  N     . ILE A 1 414 ? 6.922  7.462   -0.396  1.00 77.00  ? 411 ILE A N     1 
ATOM   3293 C  CA    . ILE A 1 414 ? 7.171  8.892   -0.496  1.00 75.17  ? 411 ILE A CA    1 
ATOM   3294 C  C     . ILE A 1 414 ? 8.387  9.083   -1.384  1.00 78.02  ? 411 ILE A C     1 
ATOM   3295 O  O     . ILE A 1 414 ? 9.472  8.585   -1.075  1.00 74.35  ? 411 ILE A O     1 
ATOM   3296 C  CB    . ILE A 1 414 ? 7.467  9.511   0.877   1.00 74.27  ? 411 ILE A CB    1 
ATOM   3297 C  CG1   . ILE A 1 414 ? 6.604  8.856   1.958   1.00 71.41  ? 411 ILE A CG1   1 
ATOM   3298 C  CG2   . ILE A 1 414 ? 7.267  11.021  0.833   1.00 70.69  ? 411 ILE A CG2   1 
ATOM   3299 C  CD1   . ILE A 1 414 ? 6.859  9.395   3.349   1.00 69.17  ? 411 ILE A CD1   1 
ATOM   3300 N  N     . GLN A 1 415 ? 8.204  9.795   -2.491  1.00 83.20  ? 412 GLN A N     1 
ATOM   3301 C  CA    . GLN A 1 415 ? 9.246  9.903   -3.506  1.00 84.43  ? 412 GLN A CA    1 
ATOM   3302 C  C     . GLN A 1 415 ? 10.437 10.743  -3.045  1.00 78.12  ? 412 GLN A C     1 
ATOM   3303 O  O     . GLN A 1 415 ? 11.591 10.405  -3.325  1.00 75.60  ? 412 GLN A O     1 
ATOM   3304 C  CB    . GLN A 1 415 ? 8.668  10.472  -4.806  1.00 92.28  ? 412 GLN A CB    1 
ATOM   3305 C  CG    . GLN A 1 415 ? 9.495  10.173  -6.052  1.00 97.65  ? 412 GLN A CG    1 
ATOM   3306 C  CD    . GLN A 1 415 ? 9.290  8.761   -6.584  1.00 103.59 ? 412 GLN A CD    1 
ATOM   3307 O  OE1   . GLN A 1 415 ? 9.257  7.789   -5.825  1.00 101.95 ? 412 GLN A OE1   1 
ATOM   3308 N  NE2   . GLN A 1 415 ? 9.146  8.644   -7.899  1.00 103.87 ? 412 GLN A NE2   1 
ATOM   3309 N  N     . THR A 1 416 ? 10.151 11.830  -2.334  1.00 70.96  ? 413 THR A N     1 
ATOM   3310 C  CA    . THR A 1 416 ? 11.187 12.764  -1.901  1.00 64.57  ? 413 THR A CA    1 
ATOM   3311 C  C     . THR A 1 416 ? 12.121 12.171  -0.848  1.00 58.86  ? 413 THR A C     1 
ATOM   3312 O  O     . THR A 1 416 ? 13.324 12.408  -0.879  1.00 58.04  ? 413 THR A O     1 
ATOM   3313 C  CB    . THR A 1 416 ? 10.574 14.069  -1.364  1.00 65.61  ? 413 THR A CB    1 
ATOM   3314 O  OG1   . THR A 1 416 ? 9.767  14.666  -2.385  1.00 66.55  ? 413 THR A OG1   1 
ATOM   3315 C  CG2   . THR A 1 416 ? 11.666 15.048  -0.951  1.00 60.38  ? 413 THR A CG2   1 
ATOM   3316 N  N     . GLU A 1 417 ? 11.566 11.398  0.078   1.00 57.47  ? 414 GLU A N     1 
ATOM   3317 C  CA    . GLU A 1 417 ? 12.372 10.762  1.113   1.00 54.88  ? 414 GLU A CA    1 
ATOM   3318 C  C     . GLU A 1 417 ? 13.171 9.584   0.562   1.00 52.91  ? 414 GLU A C     1 
ATOM   3319 O  O     . GLU A 1 417 ? 12.876 9.074   -0.519  1.00 50.69  ? 414 GLU A O     1 
ATOM   3320 C  CB    . GLU A 1 417 ? 11.487 10.297  2.271   1.00 53.67  ? 414 GLU A CB    1 
ATOM   3321 C  CG    . GLU A 1 417 ? 10.600 11.391  2.830   1.00 55.95  ? 414 GLU A CG    1 
ATOM   3322 C  CD    . GLU A 1 417 ? 11.364 12.672  3.087   1.00 56.02  ? 414 GLU A CD    1 
ATOM   3323 O  OE1   . GLU A 1 417 ? 12.151 12.713  4.060   1.00 52.96  ? 414 GLU A OE1   1 
ATOM   3324 O  OE2   . GLU A 1 417 ? 11.184 13.636  2.310   1.00 58.90  ? 414 GLU A OE2   1 
ATOM   3325 N  N     . TRP A 1 418 ? 14.189 9.161   1.308   1.00 47.51  ? 415 TRP A N     1 
ATOM   3326 C  CA    . TRP A 1 418 ? 14.942 7.965   0.957   1.00 35.13  ? 415 TRP A CA    1 
ATOM   3327 C  C     . TRP A 1 418 ? 15.042 6.998   2.140   1.00 42.83  ? 415 TRP A C     1 
ATOM   3328 O  O     . TRP A 1 418 ? 15.541 7.354   3.209   1.00 38.11  ? 415 TRP A O     1 
ATOM   3329 C  CB    . TRP A 1 418 ? 16.347 8.321   0.435   1.00 42.75  ? 415 TRP A CB    1 
ATOM   3330 C  CG    . TRP A 1 418 ? 17.012 7.147   -0.226  1.00 39.39  ? 415 TRP A CG    1 
ATOM   3331 C  CD1   . TRP A 1 418 ? 17.437 6.003   0.380   1.00 34.79  ? 415 TRP A CD1   1 
ATOM   3332 C  CD2   . TRP A 1 418 ? 17.294 6.988   -1.624  1.00 37.84  ? 415 TRP A CD2   1 
ATOM   3333 N  NE1   . TRP A 1 418 ? 17.964 5.142   -0.548  1.00 38.25  ? 415 TRP A NE1   1 
ATOM   3334 C  CE2   . TRP A 1 418 ? 17.891 5.723   -1.786  1.00 34.28  ? 415 TRP A CE2   1 
ATOM   3335 C  CE3   . TRP A 1 418 ? 17.107 7.796   -2.750  1.00 38.32  ? 415 TRP A CE3   1 
ATOM   3336 C  CZ2   . TRP A 1 418 ? 18.309 5.245   -3.029  1.00 42.32  ? 415 TRP A CZ2   1 
ATOM   3337 C  CZ3   . TRP A 1 418 ? 17.521 7.319   -3.986  1.00 40.16  ? 415 TRP A CZ3   1 
ATOM   3338 C  CH2   . TRP A 1 418 ? 18.113 6.055   -4.114  1.00 32.64  ? 415 TRP A CH2   1 
ATOM   3339 N  N     . SER A 1 419 ? 14.579 5.767   1.943   1.00 41.79  ? 416 SER A N     1 
ATOM   3340 C  CA    . SER A 1 419 ? 14.661 4.756   2.993   1.00 44.47  ? 416 SER A CA    1 
ATOM   3341 C  C     . SER A 1 419 ? 15.040 3.378   2.442   1.00 42.70  ? 416 SER A C     1 
ATOM   3342 O  O     . SER A 1 419 ? 14.638 3.026   1.333   1.00 47.73  ? 416 SER A O     1 
ATOM   3343 C  CB    . SER A 1 419 ? 13.347 4.678   3.775   1.00 52.71  ? 416 SER A CB    1 
ATOM   3344 O  OG    . SER A 1 419 ? 12.270 4.317   2.928   1.00 58.60  ? 416 SER A OG    1 
ATOM   3345 N  N     . PRO A 1 420 ? 15.853 2.610   3.198   1.00 43.79  ? 417 PRO A N     1 
ATOM   3346 C  CA    . PRO A 1 420 ? 16.552 3.074   4.403   1.00 48.15  ? 417 PRO A CA    1 
ATOM   3347 C  C     . PRO A 1 420 ? 17.589 4.116   3.999   1.00 42.49  ? 417 PRO A C     1 
ATOM   3348 O  O     . PRO A 1 420 ? 17.973 4.140   2.828   1.00 40.83  ? 417 PRO A O     1 
ATOM   3349 C  CB    . PRO A 1 420 ? 17.246 1.805   4.921   1.00 45.60  ? 417 PRO A CB    1 
ATOM   3350 C  CG    . PRO A 1 420 ? 16.482 0.675   4.317   1.00 46.10  ? 417 PRO A CG    1 
ATOM   3351 C  CD    . PRO A 1 420 ? 16.075 1.173   2.965   1.00 47.48  ? 417 PRO A CD    1 
ATOM   3352 N  N     . PRO A 1 421 ? 17.987 4.997   4.929   1.00 42.90  ? 418 PRO A N     1 
ATOM   3353 C  CA    . PRO A 1 421 ? 18.949 6.045   4.573   1.00 37.41  ? 418 PRO A CA    1 
ATOM   3354 C  C     . PRO A 1 421 ? 20.289 5.457   4.141   1.00 32.53  ? 418 PRO A C     1 
ATOM   3355 O  O     . PRO A 1 421 ? 20.640 4.353   4.558   1.00 32.83  ? 418 PRO A O     1 
ATOM   3356 C  CB    . PRO A 1 421 ? 19.103 6.836   5.877   1.00 35.64  ? 418 PRO A CB    1 
ATOM   3357 C  CG    . PRO A 1 421 ? 17.859 6.536   6.659   1.00 37.47  ? 418 PRO A CG    1 
ATOM   3358 C  CD    . PRO A 1 421 ? 17.528 5.118   6.324   1.00 37.73  ? 418 PRO A CD    1 
ATOM   3359 N  N     . LEU A 1 422 ? 21.018 6.198   3.312   1.00 36.47  ? 419 LEU A N     1 
ATOM   3360 C  CA    . LEU A 1 422 ? 22.290 5.740   2.750   1.00 32.28  ? 419 LEU A CA    1 
ATOM   3361 C  C     . LEU A 1 422 ? 23.480 6.101   3.641   1.00 26.91  ? 419 LEU A C     1 
ATOM   3362 O  O     . LEU A 1 422 ? 23.668 7.271   3.975   1.00 28.77  ? 419 LEU A O     1 
ATOM   3363 C  CB    . LEU A 1 422 ? 22.491 6.353   1.356   1.00 25.07  ? 419 LEU A CB    1 
ATOM   3364 C  CG    . LEU A 1 422 ? 21.417 5.999   0.316   1.00 33.06  ? 419 LEU A CG    1 
ATOM   3365 C  CD1   . LEU A 1 422 ? 21.817 6.455   -1.095  1.00 28.19  ? 419 LEU A CD1   1 
ATOM   3366 C  CD2   . LEU A 1 422 ? 21.153 4.506   0.340   1.00 30.71  ? 419 LEU A CD2   1 
ATOM   3367 N  N     . THR A 1 423 ? 24.273 5.097   4.008   1.00 27.09  ? 420 THR A N     1 
ATOM   3368 C  CA    . THR A 1 423 ? 25.459 5.308   4.849   1.00 26.57  ? 420 THR A CA    1 
ATOM   3369 C  C     . THR A 1 423 ? 26.777 5.286   4.050   1.00 25.80  ? 420 THR A C     1 
ATOM   3370 O  O     . THR A 1 423 ? 27.860 5.458   4.616   1.00 22.62  ? 420 THR A O     1 
ATOM   3371 C  CB    . THR A 1 423 ? 25.534 4.271   5.997   1.00 27.65  ? 420 THR A CB    1 
ATOM   3372 O  OG1   . THR A 1 423 ? 25.536 2.946   5.448   1.00 30.35  ? 420 THR A OG1   1 
ATOM   3373 C  CG2   . THR A 1 423 ? 24.342 4.429   6.953   1.00 30.22  ? 420 THR A CG2   1 
ATOM   3374 N  N     . MET A 1 424 ? 26.687 5.062   2.742   1.00 21.09  ? 421 MET A N     1 
ATOM   3375 C  CA    . MET A 1 424 ? 27.889 5.054   1.888   1.00 20.41  ? 421 MET A CA    1 
ATOM   3376 C  C     . MET A 1 424 ? 27.517 5.202   0.410   1.00 24.39  ? 421 MET A C     1 
ATOM   3377 O  O     . MET A 1 424 ? 26.576 4.563   -0.052  1.00 25.60  ? 421 MET A O     1 
ATOM   3378 C  CB    . MET A 1 424 ? 28.692 3.761   2.092   1.00 20.95  ? 421 MET A CB    1 
ATOM   3379 C  CG    . MET A 1 424 ? 30.001 3.677   1.303   1.00 22.58  ? 421 MET A CG    1 
ATOM   3380 S  SD    . MET A 1 424 ? 29.836 3.055   -0.398  1.00 20.66  ? 421 MET A SD    1 
ATOM   3381 C  CE    . MET A 1 424 ? 29.322 1.366   -0.094  1.00 22.24  ? 421 MET A CE    1 
ATOM   3382 N  N     . LEU A 1 425 ? 28.249 6.043   -0.321  1.00 19.42  ? 422 LEU A N     1 
ATOM   3383 C  CA    . LEU A 1 425 ? 28.149 6.084   -1.776  1.00 16.90  ? 422 LEU A CA    1 
ATOM   3384 C  C     . LEU A 1 425 ? 29.543 5.806   -2.355  1.00 18.49  ? 422 LEU A C     1 
ATOM   3385 O  O     . LEU A 1 425 ? 30.537 6.217   -1.781  1.00 17.80  ? 422 LEU A O     1 
ATOM   3386 C  CB    . LEU A 1 425 ? 27.704 7.457   -2.249  1.00 21.00  ? 422 LEU A CB    1 
ATOM   3387 C  CG    . LEU A 1 425 ? 26.301 7.964   -1.916  1.00 23.16  ? 422 LEU A CG    1 
ATOM   3388 C  CD1   . LEU A 1 425 ? 26.149 9.378   -2.445  1.00 22.70  ? 422 LEU A CD1   1 
ATOM   3389 C  CD2   . LEU A 1 425 ? 25.242 7.043   -2.489  1.00 26.32  ? 422 LEU A CD2   1 
ATOM   3390 N  N     . PHE A 1 426 ? 29.612 5.124   -3.496  1.00 18.93  ? 423 PHE A N     1 
ATOM   3391 C  CA    . PHE A 1 426 ? 30.896 4.770   -4.093  1.00 18.77  ? 423 PHE A CA    1 
ATOM   3392 C  C     . PHE A 1 426 ? 30.704 4.771   -5.597  1.00 21.21  ? 423 PHE A C     1 
ATOM   3393 O  O     . PHE A 1 426 ? 29.744 4.172   -6.083  1.00 21.71  ? 423 PHE A O     1 
ATOM   3394 C  CB    . PHE A 1 426 ? 31.316 3.373   -3.599  1.00 19.56  ? 423 PHE A CB    1 
ATOM   3395 C  CG    . PHE A 1 426 ? 32.582 2.828   -4.221  1.00 23.83  ? 423 PHE A CG    1 
ATOM   3396 C  CD1   . PHE A 1 426 ? 33.669 3.645   -4.477  1.00 23.78  ? 423 PHE A CD1   1 
ATOM   3397 C  CD2   . PHE A 1 426 ? 32.688 1.474   -4.507  1.00 35.32  ? 423 PHE A CD2   1 
ATOM   3398 C  CE1   . PHE A 1 426 ? 34.841 3.128   -5.034  1.00 24.26  ? 423 PHE A CE1   1 
ATOM   3399 C  CE2   . PHE A 1 426 ? 33.849 0.947   -5.060  1.00 34.79  ? 423 PHE A CE2   1 
ATOM   3400 C  CZ    . PHE A 1 426 ? 34.927 1.776   -5.319  1.00 30.46  ? 423 PHE A CZ    1 
ATOM   3401 N  N     . LEU A 1 427 ? 31.553 5.496   -6.317  1.00 16.09  ? 424 LEU A N     1 
ATOM   3402 C  CA    . LEU A 1 427 ? 31.581 5.420   -7.783  1.00 17.43  ? 424 LEU A CA    1 
ATOM   3403 C  C     . LEU A 1 427 ? 32.953 4.977   -8.207  1.00 15.38  ? 424 LEU A C     1 
ATOM   3404 O  O     . LEU A 1 427 ? 33.939 5.518   -7.729  1.00 17.90  ? 424 LEU A O     1 
ATOM   3405 C  CB    . LEU A 1 427 ? 31.318 6.770   -8.432  1.00 18.82  ? 424 LEU A CB    1 
ATOM   3406 C  CG    . LEU A 1 427 ? 29.983 7.451   -8.188  1.00 19.29  ? 424 LEU A CG    1 
ATOM   3407 C  CD1   . LEU A 1 427 ? 29.944 8.767   -8.963  1.00 19.64  ? 424 LEU A CD1   1 
ATOM   3408 C  CD2   . LEU A 1 427 ? 28.853 6.517   -8.599  1.00 22.00  ? 424 LEU A CD2   1 
ATOM   3409 N  N     . CYS A 1 428 ? 33.032 4.021   -9.134  1.00 16.49  ? 425 CYS A N     1 
ATOM   3410 C  CA    . CYS A 1 428 ? 34.335 3.539   -9.578  1.00 15.39  ? 425 CYS A CA    1 
ATOM   3411 C  C     . CYS A 1 428 ? 34.354 3.343   -11.099 1.00 18.84  ? 425 CYS A C     1 
ATOM   3412 O  O     . CYS A 1 428 ? 33.453 2.710   -11.639 1.00 18.37  ? 425 CYS A O     1 
ATOM   3413 C  CB    . CYS A 1 428 ? 34.662 2.202   -8.904  1.00 19.04  ? 425 CYS A CB    1 
ATOM   3414 S  SG    . CYS A 1 428 ? 36.370 1.621   -9.153  1.00 24.04  ? 425 CYS A SG    1 
ATOM   3415 N  N     . ALA A 1 429 ? 35.363 3.916   -11.756 1.00 13.63  ? 426 ALA A N     1 
ATOM   3416 C  CA    . ALA A 1 429 ? 35.562 3.735   -13.188 1.00 15.26  ? 426 ALA A CA    1 
ATOM   3417 C  C     . ALA A 1 429 ? 36.485 2.532   -13.401 1.00 14.86  ? 426 ALA A C     1 
ATOM   3418 O  O     . ALA A 1 429 ? 37.552 2.411   -12.772 1.00 14.47  ? 426 ALA A O     1 
ATOM   3419 C  CB    . ALA A 1 429 ? 36.155 5.004   -13.811 1.00 15.44  ? 426 ALA A CB    1 
ATOM   3420 N  N     . THR A 1 430 ? 36.064 1.638   -14.294 1.00 17.23  ? 427 THR A N     1 
ATOM   3421 C  CA    . THR A 1 430 ? 36.768 0.367   -14.496 1.00 19.35  ? 427 THR A CA    1 
ATOM   3422 C  C     . THR A 1 430 ? 36.799 0.023   -15.983 1.00 22.47  ? 427 THR A C     1 
ATOM   3423 O  O     . THR A 1 430 ? 36.240 0.755   -16.795 1.00 18.28  ? 427 THR A O     1 
ATOM   3424 C  CB    . THR A 1 430 ? 36.046 -0.786  -13.773 1.00 22.69  ? 427 THR A CB    1 
ATOM   3425 O  OG1   . THR A 1 430 ? 34.735 -0.947  -14.325 1.00 23.82  ? 427 THR A OG1   1 
ATOM   3426 C  CG2   . THR A 1 430 ? 35.889 -0.498  -12.280 1.00 22.25  ? 427 THR A CG2   1 
ATOM   3427 N  N     . LYS A 1 431 ? 37.422 -1.108  -16.326 1.00 18.43  ? 428 LYS A N     1 
ATOM   3428 C  CA    . LYS A 1 431 ? 37.459 -1.612  -17.714 1.00 19.76  ? 428 LYS A CA    1 
ATOM   3429 C  C     . LYS A 1 431 ? 38.059 -0.617  -18.714 1.00 16.86  ? 428 LYS A C     1 
ATOM   3430 O  O     . LYS A 1 431 ? 37.389 -0.160  -19.638 1.00 20.43  ? 428 LYS A O     1 
ATOM   3431 C  CB    . LYS A 1 431 ? 36.081 -2.084  -18.179 1.00 22.08  ? 428 LYS A CB    1 
ATOM   3432 C  CG    . LYS A 1 431 ? 35.612 -3.341  -17.469 1.00 32.54  ? 428 LYS A CG    1 
ATOM   3433 C  CD    . LYS A 1 431 ? 34.289 -3.856  -18.021 1.00 37.13  ? 428 LYS A CD    1 
ATOM   3434 C  CE    . LYS A 1 431 ? 34.124 -5.348  -17.744 1.00 40.56  ? 428 LYS A CE    1 
ATOM   3435 N  NZ    . LYS A 1 431 ? 34.424 -5.721  -16.333 1.00 39.18  ? 428 LYS A NZ    1 
ATOM   3436 N  N     . PHE A 1 432 ? 39.321 -0.282  -18.504 1.00 19.96  ? 429 PHE A N     1 
ATOM   3437 C  CA    . PHE A 1 432 ? 40.037 0.647   -19.373 1.00 18.05  ? 429 PHE A CA    1 
ATOM   3438 C  C     . PHE A 1 432 ? 40.377 0.038   -20.731 1.00 26.78  ? 429 PHE A C     1 
ATOM   3439 O  O     . PHE A 1 432 ? 40.680 -1.154  -20.818 1.00 23.35  ? 429 PHE A O     1 
ATOM   3440 C  CB    . PHE A 1 432 ? 41.291 1.165   -18.670 1.00 19.41  ? 429 PHE A CB    1 
ATOM   3441 C  CG    . PHE A 1 432 ? 40.990 2.157   -17.567 1.00 22.31  ? 429 PHE A CG    1 
ATOM   3442 C  CD1   . PHE A 1 432 ? 40.622 1.729   -16.296 1.00 26.65  ? 429 PHE A CD1   1 
ATOM   3443 C  CD2   . PHE A 1 432 ? 41.041 3.516   -17.817 1.00 20.26  ? 429 PHE A CD2   1 
ATOM   3444 C  CE1   . PHE A 1 432 ? 40.323 2.652   -15.288 1.00 24.09  ? 429 PHE A CE1   1 
ATOM   3445 C  CE2   . PHE A 1 432 ? 40.747 4.439   -16.825 1.00 19.77  ? 429 PHE A CE2   1 
ATOM   3446 C  CZ    . PHE A 1 432 ? 40.393 4.009   -15.553 1.00 25.79  ? 429 PHE A CZ    1 
ATOM   3447 N  N     . SER A 1 433 ? 40.284 0.864   -21.780 1.00 19.74  ? 430 SER A N     1 
ATOM   3448 C  CA    . SER A 1 433 ? 40.704 0.512   -23.136 1.00 18.46  ? 430 SER A CA    1 
ATOM   3449 C  C     . SER A 1 433 ? 41.683 1.567   -23.620 1.00 23.87  ? 430 SER A C     1 
ATOM   3450 O  O     . SER A 1 433 ? 41.620 2.716   -23.188 1.00 20.96  ? 430 SER A O     1 
ATOM   3451 C  CB    . SER A 1 433 ? 39.495 0.450   -24.072 1.00 28.03  ? 430 SER A CB    1 
ATOM   3452 O  OG    . SER A 1 433 ? 38.603 -0.572  -23.663 1.00 40.50  ? 430 SER A OG    1 
ATOM   3453 N  N     . ALA A 1 434 ? 42.597 1.185   -24.508 1.00 23.39  ? 431 ALA A N     1 
ATOM   3454 C  CA    . ALA A 1 434 ? 43.602 2.133   -24.986 1.00 25.54  ? 431 ALA A CA    1 
ATOM   3455 C  C     . ALA A 1 434 ? 42.936 3.268   -25.758 1.00 30.45  ? 431 ALA A C     1 
ATOM   3456 O  O     . ALA A 1 434 ? 41.908 3.060   -26.415 1.00 31.86  ? 431 ALA A O     1 
ATOM   3457 C  CB    . ALA A 1 434 ? 44.634 1.434   -25.849 1.00 35.80  ? 431 ALA A CB    1 
ATOM   3458 N  N     . SER A 1 435 ? 43.503 4.470   -25.662 1.00 24.17  ? 432 SER A N     1 
ATOM   3459 C  CA    . SER A 1 435 ? 42.976 5.603   -26.420 1.00 31.99  ? 432 SER A CA    1 
ATOM   3460 C  C     . SER A 1 435 ? 44.061 6.629   -26.759 1.00 36.84  ? 432 SER A C     1 
ATOM   3461 O  O     . SER A 1 435 ? 43.862 7.494   -27.605 1.00 33.74  ? 432 SER A O     1 
ATOM   3462 C  CB    . SER A 1 435 ? 41.857 6.290   -25.648 1.00 35.77  ? 432 SER A CB    1 
ATOM   3463 O  OG    . SER A 1 435 ? 42.406 7.185   -24.701 1.00 38.32  ? 432 SER A OG    1 
ATOM   3464 O  OXT   . SER A 1 435 ? 45.160 6.638   -26.202 1.00 41.77  ? 432 SER A OXT   1 
ATOM   3465 C  "C5'" A DT  B 2 1   ? 31.671 3.947   12.423  0.54 47.19  ? 3   DT  T "C5'" 1 
ATOM   3466 C  "C5'" B DT  B 2 1   ? 31.377 4.379   12.549  0.46 47.10  ? 3   DT  T "C5'" 1 
ATOM   3467 C  "C4'" A DT  B 2 1   ? 32.498 4.862   11.537  0.54 45.94  ? 3   DT  T "C4'" 1 
ATOM   3468 C  "C4'" B DT  B 2 1   ? 32.321 5.028   11.553  0.46 45.95  ? 3   DT  T "C4'" 1 
ATOM   3469 O  "O4'" A DT  B 2 1   ? 31.853 6.158   11.437  0.54 47.54  ? 3   DT  T "O4'" 1 
ATOM   3470 O  "O4'" B DT  B 2 1   ? 31.888 6.393   11.318  0.46 47.37  ? 3   DT  T "O4'" 1 
ATOM   3471 C  "C3'" A DT  B 2 1   ? 33.898 5.170   12.054  0.54 45.47  ? 3   DT  T "C3'" 1 
ATOM   3472 C  "C3'" B DT  B 2 1   ? 33.762 5.177   12.030  0.46 45.47  ? 3   DT  T "C3'" 1 
ATOM   3473 O  "O3'" A DT  B 2 1   ? 34.885 5.418   11.033  0.54 42.81  ? 3   DT  T "O3'" 1 
ATOM   3474 O  "O3'" B DT  B 2 1   ? 34.800 5.305   11.010  0.46 42.78  ? 3   DT  T "O3'" 1 
ATOM   3475 C  "C2'" A DT  B 2 1   ? 33.675 6.429   12.893  0.54 44.58  ? 3   DT  T "C2'" 1 
ATOM   3476 C  "C2'" B DT  B 2 1   ? 33.657 6.477   12.829  0.46 44.59  ? 3   DT  T "C2'" 1 
ATOM   3477 C  "C1'" A DT  B 2 1   ? 32.682 7.162   11.999  0.54 46.66  ? 3   DT  T "C1'" 1 
ATOM   3478 C  "C1'" B DT  B 2 1   ? 32.901 7.274   11.773  0.46 46.17  ? 3   DT  T "C1'" 1 
ATOM   3479 N  N1    A DT  B 2 1   ? 31.799 8.160   12.668  0.54 48.27  ? 3   DT  T N1    1 
ATOM   3480 N  N1    B DT  B 2 1   ? 32.283 8.568   12.173  0.46 46.59  ? 3   DT  T N1    1 
ATOM   3481 C  C2    A DT  B 2 1   ? 30.913 7.752   13.645  0.54 49.32  ? 3   DT  T C2    1 
ATOM   3482 C  C2    B DT  B 2 1   ? 31.293 8.630   13.133  0.46 48.77  ? 3   DT  T C2    1 
ATOM   3483 O  O2    A DT  B 2 1   ? 30.803 6.600   14.025  0.54 49.55  ? 3   DT  T O2    1 
ATOM   3484 O  O2    B DT  B 2 1   ? 30.864 7.659   13.736  0.46 49.33  ? 3   DT  T O2    1 
ATOM   3485 N  N3    A DT  B 2 1   ? 30.151 8.763   14.172  0.54 47.98  ? 3   DT  T N3    1 
ATOM   3486 N  N3    B DT  B 2 1   ? 30.825 9.898   13.371  0.46 47.90  ? 3   DT  T N3    1 
ATOM   3487 C  C4    A DT  B 2 1   ? 30.186 10.101  13.825  0.54 49.15  ? 3   DT  T C4    1 
ATOM   3488 C  C4    B DT  B 2 1   ? 31.234 11.069  12.756  0.46 48.73  ? 3   DT  T C4    1 
ATOM   3489 O  O4    A DT  B 2 1   ? 29.462 10.933  14.359  0.54 54.22  ? 3   DT  T O4    1 
ATOM   3490 O  O4    B DT  B 2 1   ? 30.750 12.157  13.043  0.46 49.53  ? 3   DT  T O4    1 
ATOM   3491 C  C5    A DT  B 2 1   ? 31.128 10.455  12.795  0.54 48.62  ? 3   DT  T C5    1 
ATOM   3492 C  C5    B DT  B 2 1   ? 32.265 10.920  11.757  0.46 46.92  ? 3   DT  T C5    1 
ATOM   3493 C  C7    A DT  B 2 1   ? 31.252 11.878  12.337  0.54 47.85  ? 3   DT  T C7    1 
ATOM   3494 C  C7    B DT  B 2 1   ? 32.805 12.098  11.008  0.46 47.52  ? 3   DT  T C7    1 
ATOM   3495 C  C6    A DT  B 2 1   ? 31.878 9.480   12.271  0.54 46.79  ? 3   DT  T C6    1 
ATOM   3496 C  C6    B DT  B 2 1   ? 32.728 9.694   11.517  0.46 45.80  ? 3   DT  T C6    1 
HETATM 3497 O  "O3'" . P9G B 2 2   ? 35.993 8.705   5.247   1.00 15.44  ? 4   P9G T "O3'" 1 
HETATM 3498 O  OP2   A P9G B 2 2   ? 33.393 6.417   9.130   0.66 36.20  ? 4   P9G T OP2   1 
HETATM 3499 O  OP2   B P9G B 2 2   ? 33.331 6.131   9.006   0.34 36.50  ? 4   P9G T OP2   1 
HETATM 3500 P  P     A P9G B 2 2   ? 34.527 5.507   9.461   0.66 40.52  ? 4   P9G T P     1 
HETATM 3501 P  P     B P9G B 2 2   ? 34.507 5.317   9.419   0.34 39.89  ? 4   P9G T P     1 
HETATM 3502 O  OP1   A P9G B 2 2   ? 34.584 4.147   8.862   0.66 35.65  ? 4   P9G T OP1   1 
HETATM 3503 O  OP1   B P9G B 2 2   ? 34.670 3.940   8.887   0.34 35.47  ? 4   P9G T OP1   1 
HETATM 3504 O  "O5'" A P9G B 2 2   ? 35.789 6.285   8.886   0.66 28.57  ? 4   P9G T "O5'" 1 
HETATM 3505 O  "O5'" B P9G B 2 2   ? 35.732 6.165   8.858   0.34 28.69  ? 4   P9G T "O5'" 1 
HETATM 3506 C  "C5'" A P9G B 2 2   ? 35.775 7.714   8.761   0.66 27.17  ? 4   P9G T "C5'" 1 
HETATM 3507 C  "C5'" B P9G B 2 2   ? 35.642 7.597   8.764   0.34 27.30  ? 4   P9G T "C5'" 1 
HETATM 3508 C  "C4'" A P9G B 2 2   ? 36.421 8.118   7.457   0.66 21.36  ? 4   P9G T "C4'" 1 
HETATM 3509 C  "C4'" B P9G B 2 2   ? 36.339 8.077   7.513   0.34 21.38  ? 4   P9G T "C4'" 1 
HETATM 3510 O  "O4'" A P9G B 2 2   ? 37.730 7.516   7.363   0.66 18.57  ? 4   P9G T "O4'" 1 
HETATM 3511 O  "O4'" B P9G B 2 2   ? 37.652 7.474   7.442   0.34 18.67  ? 4   P9G T "O4'" 1 
HETATM 3512 C  "C1'" A P9G B 2 2   ? 37.766 6.582   6.292   0.66 17.77  ? 4   P9G T "C1'" 1 
HETATM 3513 C  "C1'" B P9G B 2 2   ? 37.770 6.732   6.241   0.34 17.79  ? 4   P9G T "C1'" 1 
HETATM 3514 C  "C2'" A P9G B 2 2   ? 36.316 6.326   5.898   0.66 18.46  ? 4   P9G T "C2'" 1 
HETATM 3515 C  "C2'" B P9G B 2 2   ? 36.351 6.434   5.794   0.34 18.58  ? 4   P9G T "C2'" 1 
HETATM 3516 C  "C3'" A P9G B 2 2   ? 35.687 7.677   6.195   0.66 18.69  ? 4   P9G T "C3'" 1 
HETATM 3517 C  "C3'" B P9G B 2 2   ? 35.646 7.709   6.203   0.34 18.78  ? 4   P9G T "C3'" 1 
HETATM 3518 N  N9    A P9G B 2 2   ? 38.586 5.462   6.736   0.66 16.34  ? 4   P9G T N9    1 
HETATM 3519 N  N9    B P9G B 2 2   ? 38.543 5.537   6.538   0.34 16.55  ? 4   P9G T N9    1 
HETATM 3520 C  C8    A P9G B 2 2   ? 38.309 4.519   7.697   0.66 16.84  ? 4   P9G T C8    1 
HETATM 3521 C  C8    B P9G B 2 2   ? 38.111 4.414   7.195   0.34 16.90  ? 4   P9G T C8    1 
HETATM 3522 N  N7    A P9G B 2 2   ? 39.310 3.714   7.925   0.66 14.29  ? 4   P9G T N7    1 
HETATM 3523 N  N7    B P9G B 2 2   ? 39.037 3.504   7.319   0.34 14.41  ? 4   P9G T N7    1 
HETATM 3524 C  C5    A P9G B 2 2   ? 40.320 4.174   7.087   0.66 15.63  ? 4   P9G T C5    1 
HETATM 3525 C  C5    B P9G B 2 2   ? 40.145 4.053   6.686   0.34 15.15  ? 4   P9G T C5    1 
HETATM 3526 C  C6    A P9G B 2 2   ? 41.652 3.718   6.910   0.66 14.40  ? 4   P9G T C6    1 
HETATM 3527 C  C6    B P9G B 2 2   ? 41.454 3.533   6.490   0.34 14.20  ? 4   P9G T C6    1 
HETATM 3528 O  O6    A P9G B 2 2   ? 42.219 2.758   7.451   0.66 15.13  ? 4   P9G T O6    1 
HETATM 3529 O  O6    B P9G B 2 2   ? 41.909 2.434   6.832   0.34 13.01  ? 4   P9G T O6    1 
HETATM 3530 N  N1    A P9G B 2 2   ? 42.338 4.496   5.980   0.66 11.69  ? 4   P9G T N1    1 
HETATM 3531 N  N1    B P9G B 2 2   ? 42.267 4.439   5.813   0.34 12.05  ? 4   P9G T N1    1 
HETATM 3532 C  C2    A P9G B 2 2   ? 41.816 5.579   5.317   0.66 13.13  ? 4   P9G T C2    1 
HETATM 3533 C  C2    B P9G B 2 2   ? 41.874 5.681   5.377   0.34 13.16  ? 4   P9G T C2    1 
HETATM 3534 N  N2    A P9G B 2 2   ? 42.636 6.206   4.459   0.66 11.65  ? 4   P9G T N2    1 
HETATM 3535 N  N2    B P9G B 2 2   ? 42.802 6.410   4.739   0.34 11.36  ? 4   P9G T N2    1 
HETATM 3536 N  N3    A P9G B 2 2   ? 40.584 6.022   5.487   0.66 12.63  ? 4   P9G T N3    1 
HETATM 3537 N  N3    B P9G B 2 2   ? 40.661 6.173   5.550   0.34 12.88  ? 4   P9G T N3    1 
HETATM 3538 C  C4    A P9G B 2 2   ? 39.898 5.278   6.379   0.66 13.97  ? 4   P9G T C4    1 
HETATM 3539 C  C4    B P9G B 2 2   ? 39.855 5.312   6.205   0.34 14.24  ? 4   P9G T C4    1 
HETATM 3540 PT PT1   A P9G B 2 2   ? 39.363 2.127   9.233   0.66 18.17  ? 4   P9G T PT1   1 
HETATM 3541 PT PT1   B P9G B 2 2   ? 38.834 1.709   8.201   0.34 27.45  ? 4   P9G T PT1   1 
HETATM 3542 N  N12   A P9G B 2 2   ? 39.643 0.865   7.677   0.66 20.83  ? 4   P9G T N12   1 
HETATM 3543 N  N12   B P9G B 2 2   ? 37.488 1.168   6.785   0.34 20.60  ? 4   P9G T N12   1 
HETATM 3544 N  N11   A P9G B 2 2   ? 39.416 0.548   10.523  0.66 14.28  ? 4   P9G T N11   1 
HETATM 3545 N  N11   B P9G B 2 2   ? 38.624 -0.096  9.091   0.34 17.94  ? 4   P9G T N11   1 
HETATM 3546 N  N10   A P9G B 2 2   ? 39.083 3.394   10.795  0.66 20.14  ? 4   P9G T N10   1 
HETATM 3547 N  N10   B P9G B 2 2   ? 40.175 2.246   9.619   0.34 15.04  ? 4   P9G T N10   1 
HETATM 3548 C  C18   A P9G B 2 2   ? 38.171 3.090   11.747  0.66 24.65  ? 4   P9G T C18   1 
HETATM 3549 C  C13   A P9G B 2 2   ? 37.980 3.938   12.825  0.66 28.76  ? 4   P9G T C13   1 
HETATM 3550 C  C12   A P9G B 2 2   ? 37.032 3.626   13.794  0.66 36.97  ? 4   P9G T C12   1 
HETATM 3551 C  C11   A P9G B 2 2   ? 36.837 4.476   14.871  0.66 36.02  ? 4   P9G T C11   1 
HETATM 3552 C  C10   A P9G B 2 2   ? 37.593 5.631   14.985  0.66 36.98  ? 4   P9G T C10   1 
HETATM 3553 C  C16   A P9G B 2 2   ? 39.846 4.530   10.910  0.66 22.27  ? 4   P9G T C16   1 
HETATM 3554 C  C22   A P9G B 2 2   ? 40.806 4.822   9.957   0.66 20.35  ? 4   P9G T C22   1 
HETATM 3555 C  C21   A P9G B 2 2   ? 41.547 5.996   10.049  0.66 19.32  ? 4   P9G T C21   1 
HETATM 3556 C  C20   A P9G B 2 2   ? 41.357 6.854   11.119  0.66 17.87  ? 4   P9G T C20   1 
HETATM 3557 C  C19   A P9G B 2 2   ? 40.411 6.554   12.087  0.66 27.26  ? 4   P9G T C19   1 
HETATM 3558 C  C15   A P9G B 2 2   ? 39.656 5.387   11.984  0.66 27.11  ? 4   P9G T C15   1 
HETATM 3559 C  C14   A P9G B 2 2   ? 38.726 5.088   12.936  0.66 26.51  ? 4   P9G T C14   1 
HETATM 3560 C  C9    A P9G B 2 2   ? 38.535 5.940   14.013  0.66 29.84  ? 4   P9G T C9    1 
ATOM   3561 P  P     . DC  B 2 3   ? 35.342 8.737   3.789   1.00 15.39  ? 5   DC  T P     1 
ATOM   3562 O  OP1   . DC  B 2 3   ? 34.910 10.092  3.582   1.00 15.51  ? 5   DC  T OP1   1 
ATOM   3563 O  OP2   . DC  B 2 3   ? 34.408 7.591   3.670   1.00 17.27  ? 5   DC  T OP2   1 
ATOM   3564 O  "O5'" . DC  B 2 3   ? 36.567 8.338   2.825   1.00 17.14  ? 5   DC  T "O5'" 1 
ATOM   3565 C  "C5'" . DC  B 2 3   ? 37.698 9.229   2.679   1.00 13.76  ? 5   DC  T "C5'" 1 
ATOM   3566 C  "C4'" . DC  B 2 3   ? 38.683 8.643   1.693   1.00 15.24  ? 5   DC  T "C4'" 1 
ATOM   3567 O  "O4'" . DC  B 2 3   ? 39.291 7.512   2.353   1.00 16.77  ? 5   DC  T "O4'" 1 
ATOM   3568 C  "C3'" . DC  B 2 3   ? 38.079 8.125   0.393   1.00 15.06  ? 5   DC  T "C3'" 1 
ATOM   3569 O  "O3'" . DC  B 2 3   ? 39.032 8.381   -0.657  1.00 13.86  ? 5   DC  T "O3'" 1 
ATOM   3570 C  "C2'" . DC  B 2 3   ? 37.920 6.628   0.650   1.00 15.92  ? 5   DC  T "C2'" 1 
ATOM   3571 C  "C1'" . DC  B 2 3   ? 39.215 6.421   1.459   1.00 17.45  ? 5   DC  T "C1'" 1 
ATOM   3572 N  N1    . DC  B 2 3   ? 39.277 5.174   2.230   1.00 15.08  ? 5   DC  T N1    1 
ATOM   3573 C  C2    . DC  B 2 3   ? 40.497 4.489   2.298   1.00 14.39  ? 5   DC  T C2    1 
ATOM   3574 O  O2    . DC  B 2 3   ? 41.482 4.951   1.711   1.00 17.48  ? 5   DC  T O2    1 
ATOM   3575 N  N3    . DC  B 2 3   ? 40.561 3.334   2.983   1.00 14.58  ? 5   DC  T N3    1 
ATOM   3576 C  C4    . DC  B 2 3   ? 39.493 2.855   3.617   1.00 18.46  ? 5   DC  T C4    1 
ATOM   3577 N  N4    . DC  B 2 3   ? 39.599 1.697   4.291   1.00 16.74  ? 5   DC  T N4    1 
ATOM   3578 C  C5    . DC  B 2 3   ? 38.252 3.557   3.570   1.00 14.84  ? 5   DC  T C5    1 
ATOM   3579 C  C6    . DC  B 2 3   ? 38.186 4.700   2.876   1.00 16.91  ? 5   DC  T C6    1 
ATOM   3580 P  P     . DT  B 2 4   ? 38.625 8.359   -2.203  1.00 16.34  ? 6   DT  T P     1 
ATOM   3581 O  OP1   . DT  B 2 4   ? 39.824 8.784   -2.977  1.00 18.73  ? 6   DT  T OP1   1 
ATOM   3582 O  OP2   . DT  B 2 4   ? 37.343 9.129   -2.377  1.00 18.22  ? 6   DT  T OP2   1 
ATOM   3583 O  "O5'" . DT  B 2 4   ? 38.241 6.833   -2.455  1.00 18.40  ? 6   DT  T "O5'" 1 
ATOM   3584 C  "C5'" . DT  B 2 4   ? 39.132 6.009   -3.215  1.00 16.57  ? 6   DT  T "C5'" 1 
ATOM   3585 C  "C4'" . DT  B 2 4   ? 40.427 5.504   -2.598  1.00 18.56  ? 6   DT  T "C4'" 1 
ATOM   3586 O  "O4'" . DT  B 2 4   ? 40.197 4.834   -1.342  1.00 19.15  ? 6   DT  T "O4'" 1 
ATOM   3587 C  "C3'" . DT  B 2 4   ? 40.995 4.427   -3.509  1.00 18.43  ? 6   DT  T "C3'" 1 
ATOM   3588 O  "O3'" . DT  B 2 4   ? 41.942 5.053   -4.304  1.00 16.85  ? 6   DT  T "O3'" 1 
ATOM   3589 C  "C2'" . DT  B 2 4   ? 41.647 3.389   -2.604  1.00 17.77  ? 6   DT  T "C2'" 1 
ATOM   3590 C  "C1'" . DT  B 2 4   ? 41.115 3.767   -1.228  1.00 20.91  ? 6   DT  T "C1'" 1 
ATOM   3591 N  N1    . DT  B 2 4   ? 40.414 2.678   -0.520  1.00 18.94  ? 6   DT  T N1    1 
ATOM   3592 C  C2    . DT  B 2 4   ? 41.153 1.590   -0.112  1.00 17.43  ? 6   DT  T C2    1 
ATOM   3593 O  O2    . DT  B 2 4   ? 42.340 1.475   -0.326  1.00 20.62  ? 6   DT  T O2    1 
ATOM   3594 N  N3    . DT  B 2 4   ? 40.440 0.639   0.571   1.00 15.98  ? 6   DT  T N3    1 
ATOM   3595 C  C4    . DT  B 2 4   ? 39.102 0.668   0.880   1.00 18.87  ? 6   DT  T C4    1 
ATOM   3596 O  O4    . DT  B 2 4   ? 38.580 -0.240  1.517   1.00 19.90  ? 6   DT  T O4    1 
ATOM   3597 C  C5    . DT  B 2 4   ? 38.383 1.843   0.434   1.00 18.22  ? 6   DT  T C5    1 
ATOM   3598 C  C7    . DT  B 2 4   ? 36.914 1.990   0.721   1.00 18.23  ? 6   DT  T C7    1 
ATOM   3599 C  C6    . DT  B 2 4   ? 39.065 2.776   -0.234  1.00 17.69  ? 6   DT  T C6    1 
ATOM   3600 P  P     . DC  B 2 5   ? 42.129 4.656   -5.846  1.00 17.56  ? 7   DC  T P     1 
ATOM   3601 O  OP1   . DC  B 2 5   ? 43.266 5.486   -6.320  1.00 17.86  ? 7   DC  T OP1   1 
ATOM   3602 O  OP2   . DC  B 2 5   ? 40.875 4.619   -6.602  1.00 14.06  ? 7   DC  T OP2   1 
ATOM   3603 O  "O5'" . DC  B 2 5   ? 42.505 3.079   -5.790  1.00 19.42  ? 7   DC  T "O5'" 1 
ATOM   3604 C  "C5'" . DC  B 2 5   ? 43.723 2.544   -6.197  1.00 27.02  ? 7   DC  T "C5'" 1 
ATOM   3605 C  "C4'" . DC  B 2 5   ? 43.704 1.048   -5.908  1.00 14.45  ? 7   DC  T "C4'" 1 
ATOM   3606 O  "O4'" . DC  B 2 5   ? 42.982 0.771   -4.703  1.00 17.87  ? 7   DC  T "O4'" 1 
ATOM   3607 C  "C3'" . DC  B 2 5   ? 43.026 0.152   -6.937  1.00 21.88  ? 7   DC  T "C3'" 1 
ATOM   3608 O  "O3'" . DC  B 2 5   ? 44.024 -0.368  -7.749  1.00 24.74  ? 7   DC  T "O3'" 1 
ATOM   3609 C  "C2'" . DC  B 2 5   ? 42.419 -0.971  -6.112  1.00 21.46  ? 7   DC  T "C2'" 1 
ATOM   3610 C  "C1'" . DC  B 2 5   ? 42.785 -0.626  -4.685  1.00 20.39  ? 7   DC  T "C1'" 1 
ATOM   3611 N  N1    . DC  B 2 5   ? 41.677 -0.950  -3.786  1.00 17.12  ? 7   DC  T N1    1 
ATOM   3612 C  C2    . DC  B 2 5   ? 41.814 -2.109  -3.008  1.00 15.40  ? 7   DC  T C2    1 
ATOM   3613 O  O2    . DC  B 2 5   ? 42.855 -2.772  -3.131  1.00 18.32  ? 7   DC  T O2    1 
ATOM   3614 N  N3    . DC  B 2 5   ? 40.824 -2.441  -2.182  1.00 15.38  ? 7   DC  T N3    1 
ATOM   3615 C  C4    . DC  B 2 5   ? 39.716 -1.694  -2.107  1.00 17.02  ? 7   DC  T C4    1 
ATOM   3616 N  N4    . DC  B 2 5   ? 38.767 -2.082  -1.266  1.00 18.08  ? 7   DC  T N4    1 
ATOM   3617 C  C5    . DC  B 2 5   ? 39.552 -0.520  -2.895  1.00 20.85  ? 7   DC  T C5    1 
ATOM   3618 C  C6    . DC  B 2 5   ? 40.545 -0.188  -3.729  1.00 21.22  ? 7   DC  T C6    1 
ATOM   3619 P  P     . DA  B 2 6   ? 43.696 -1.483  -8.859  1.00 21.41  ? 8   DA  T P     1 
ATOM   3620 O  OP1   . DA  B 2 6   ? 44.749 -1.343  -9.854  1.00 23.31  ? 8   DA  T OP1   1 
ATOM   3621 O  OP2   . DA  B 2 6   ? 42.269 -1.597  -9.270  1.00 21.09  ? 8   DA  T OP2   1 
ATOM   3622 O  "O5'" . DA  B 2 6   ? 43.995 -2.881  -8.095  1.00 19.91  ? 8   DA  T "O5'" 1 
ATOM   3623 C  "C5'" . DA  B 2 6   ? 45.298 -3.206  -7.592  1.00 20.11  ? 8   DA  T "C5'" 1 
ATOM   3624 C  "C4'" . DA  B 2 6   ? 45.308 -4.682  -7.224  1.00 19.93  ? 8   DA  T "C4'" 1 
ATOM   3625 O  "O4'" . DA  B 2 6   ? 44.428 -4.883  -6.088  1.00 18.52  ? 8   DA  T "O4'" 1 
ATOM   3626 C  "C3'" . DA  B 2 6   ? 44.828 -5.601  -8.353  1.00 24.14  ? 8   DA  T "C3'" 1 
ATOM   3627 O  "O3'" . DA  B 2 6   ? 45.685 -6.740  -8.443  1.00 24.46  ? 8   DA  T "O3'" 1 
ATOM   3628 C  "C2'" . DA  B 2 6   ? 43.429 -5.999  -7.906  1.00 19.42  ? 8   DA  T "C2'" 1 
ATOM   3629 C  "C1'" . DA  B 2 6   ? 43.494 -5.910  -6.389  1.00 19.01  ? 8   DA  T "C1'" 1 
ATOM   3630 N  N9    . DA  B 2 6   ? 42.232 -5.512  -5.798  1.00 16.13  ? 8   DA  T N9    1 
ATOM   3631 C  C8    . DA  B 2 6   ? 41.457 -4.431  -6.153  1.00 17.40  ? 8   DA  T C8    1 
ATOM   3632 N  N7    . DA  B 2 6   ? 40.357 -4.310  -5.437  1.00 15.18  ? 8   DA  T N7    1 
ATOM   3633 C  C5    . DA  B 2 6   ? 40.426 -5.373  -4.548  1.00 14.45  ? 8   DA  T C5    1 
ATOM   3634 C  C6    . DA  B 2 6   ? 39.555 -5.796  -3.539  1.00 14.49  ? 8   DA  T C6    1 
ATOM   3635 N  N6    . DA  B 2 6   ? 38.410 -5.174  -3.228  1.00 15.19  ? 8   DA  T N6    1 
ATOM   3636 N  N1    . DA  B 2 6   ? 39.902 -6.902  -2.834  1.00 14.41  ? 8   DA  T N1    1 
ATOM   3637 C  C2    . DA  B 2 6   ? 41.043 -7.504  -3.168  1.00 10.80  ? 8   DA  T C2    1 
ATOM   3638 N  N3    . DA  B 2 6   ? 41.957 -7.216  -4.089  1.00 14.17  ? 8   DA  T N3    1 
ATOM   3639 C  C4    . DA  B 2 6   ? 41.571 -6.119  -4.767  1.00 15.80  ? 8   DA  T C4    1 
ATOM   3640 P  P     . DC  B 2 7   ? 45.481 -7.861  -9.580  1.00 27.55  ? 9   DC  T P     1 
ATOM   3641 O  OP1   . DC  B 2 7   ? 46.847 -8.363  -9.867  1.00 28.44  ? 9   DC  T OP1   1 
ATOM   3642 O  OP2   . DC  B 2 7   ? 44.638 -7.364  -10.677 1.00 25.70  ? 9   DC  T OP2   1 
ATOM   3643 O  "O5'" . DC  B 2 7   ? 44.628 -9.006  -8.845  1.00 23.19  ? 9   DC  T "O5'" 1 
ATOM   3644 C  "C5'" . DC  B 2 7   ? 45.159 -9.616  -7.687  1.00 24.82  ? 9   DC  T "C5'" 1 
ATOM   3645 C  "C4'" . DC  B 2 7   ? 44.076 -10.516 -7.153  1.00 23.59  ? 9   DC  T "C4'" 1 
ATOM   3646 O  "O4'" . DC  B 2 7   ? 43.007 -9.715  -6.598  1.00 22.96  ? 9   DC  T "O4'" 1 
ATOM   3647 C  "C3'" . DC  B 2 7   ? 43.436 -11.392 -8.228  1.00 28.33  ? 9   DC  T "C3'" 1 
ATOM   3648 O  "O3'" . DC  B 2 7   ? 43.462 -12.690 -7.692  1.00 36.26  ? 9   DC  T "O3'" 1 
ATOM   3649 C  "C2'" . DC  B 2 7   ? 42.019 -10.835 -8.380  1.00 20.63  ? 9   DC  T "C2'" 1 
ATOM   3650 C  "C1'" . DC  B 2 7   ? 41.778 -10.320 -6.967  1.00 24.92  ? 9   DC  T "C1'" 1 
ATOM   3651 N  N1    . DC  B 2 7   ? 40.694 -9.324  -6.880  1.00 19.46  ? 9   DC  T N1    1 
ATOM   3652 C  C2    . DC  B 2 7   ? 39.787 -9.418  -5.837  1.00 18.88  ? 9   DC  T C2    1 
ATOM   3653 O  O2    . DC  B 2 7   ? 39.924 -10.316 -5.002  1.00 18.09  ? 9   DC  T O2    1 
ATOM   3654 N  N3    . DC  B 2 7   ? 38.795 -8.517  -5.763  1.00 17.36  ? 9   DC  T N3    1 
ATOM   3655 C  C4    . DC  B 2 7   ? 38.671 -7.547  -6.662  1.00 18.34  ? 9   DC  T C4    1 
ATOM   3656 N  N4    . DC  B 2 7   ? 37.645 -6.704  -6.505  1.00 19.88  ? 9   DC  T N4    1 
ATOM   3657 C  C5    . DC  B 2 7   ? 39.578 -7.422  -7.748  1.00 18.55  ? 9   DC  T C5    1 
ATOM   3658 C  C6    . DC  B 2 7   ? 40.560 -8.336  -7.814  1.00 20.45  ? 9   DC  T C6    1 
ATOM   3659 P  P     . DA  B 2 8   ? 43.190 -13.974 -8.613  1.00 29.01  ? 10  DA  T P     1 
ATOM   3660 O  OP1   . DA  B 2 8   ? 44.471 -14.674 -8.808  1.00 39.85  ? 10  DA  T OP1   1 
ATOM   3661 O  OP2   . DA  B 2 8   ? 42.354 -13.631 -9.783  1.00 28.73  ? 10  DA  T OP2   1 
ATOM   3662 O  "O5'" . DA  B 2 8   ? 42.287 -14.855 -7.663  1.00 25.14  ? 10  DA  T "O5'" 1 
ATOM   3663 C  "C5'" . DA  B 2 8   ? 42.610 -14.961 -6.315  1.00 23.08  ? 10  DA  T "C5'" 1 
ATOM   3664 C  "C4'" . DA  B 2 8   ? 41.444 -15.632 -5.628  1.00 24.69  ? 10  DA  T "C4'" 1 
ATOM   3665 O  "O4'" . DA  B 2 8   ? 40.425 -14.642 -5.407  1.00 26.96  ? 10  DA  T "O4'" 1 
ATOM   3666 C  "C3'" . DA  B 2 8   ? 40.793 -16.742 -6.453  1.00 27.43  ? 10  DA  T "C3'" 1 
ATOM   3667 O  "O3'" . DA  B 2 8   ? 40.452 -17.782 -5.557  1.00 21.41  ? 10  DA  T "O3'" 1 
ATOM   3668 C  "C2'" . DA  B 2 8   ? 39.544 -16.096 -7.045  1.00 26.74  ? 10  DA  T "C2'" 1 
ATOM   3669 C  "C1'" . DA  B 2 8   ? 39.208 -15.028 -6.012  1.00 22.57  ? 10  DA  T "C1'" 1 
ATOM   3670 N  N9    . DA  B 2 8   ? 38.638 -13.806 -6.582  1.00 20.76  ? 10  DA  T N9    1 
ATOM   3671 C  C8    . DA  B 2 8   ? 39.140 -13.056 -7.607  1.00 25.88  ? 10  DA  T C8    1 
ATOM   3672 N  N7    . DA  B 2 8   ? 38.408 -12.004 -7.903  1.00 21.82  ? 10  DA  T N7    1 
ATOM   3673 C  C5    . DA  B 2 8   ? 37.364 -12.069 -6.999  1.00 18.58  ? 10  DA  T C5    1 
ATOM   3674 C  C6    . DA  B 2 8   ? 36.247 -11.248 -6.790  1.00 16.14  ? 10  DA  T C6    1 
ATOM   3675 N  N6    . DA  B 2 8   ? 35.994 -10.143 -7.517  1.00 20.07  ? 10  DA  T N6    1 
ATOM   3676 N  N1    . DA  B 2 8   ? 35.392 -11.605 -5.811  1.00 19.49  ? 10  DA  T N1    1 
ATOM   3677 C  C2    . DA  B 2 8   ? 35.634 -12.716 -5.092  1.00 20.20  ? 10  DA  T C2    1 
ATOM   3678 N  N3    . DA  B 2 8   ? 36.667 -13.567 -5.192  1.00 19.89  ? 10  DA  T N3    1 
ATOM   3679 C  C4    . DA  B 2 8   ? 37.494 -13.176 -6.173  1.00 17.61  ? 10  DA  T C4    1 
ATOM   3680 P  P     . DC  B 2 9   ? 39.811 -19.156 -6.105  1.00 25.82  ? 11  DC  T P     1 
ATOM   3681 O  OP1   . DC  B 2 9   ? 40.318 -20.231 -5.236  1.00 28.92  ? 11  DC  T OP1   1 
ATOM   3682 O  OP2   . DC  B 2 9   ? 40.047 -19.232 -7.564  1.00 30.46  ? 11  DC  T OP2   1 
ATOM   3683 O  "O5'" . DC  B 2 9   ? 38.252 -18.955 -5.859  1.00 25.22  ? 11  DC  T "O5'" 1 
ATOM   3684 C  "C5'" . DC  B 2 9   ? 37.693 -18.752 -4.582  1.00 22.12  ? 11  DC  T "C5'" 1 
ATOM   3685 C  "C4'" . DC  B 2 9   ? 36.193 -18.525 -4.728  1.00 24.15  ? 11  DC  T "C4'" 1 
ATOM   3686 O  "O4'" . DC  B 2 9   ? 35.995 -17.256 -5.384  1.00 21.14  ? 11  DC  T "O4'" 1 
ATOM   3687 C  "C3'" . DC  B 2 9   ? 35.414 -19.535 -5.583  1.00 20.69  ? 11  DC  T "C3'" 1 
ATOM   3688 O  "O3'" . DC  B 2 9   ? 34.397 -20.105 -4.746  1.00 20.37  ? 11  DC  T "O3'" 1 
ATOM   3689 C  "C2'" . DC  B 2 9   ? 34.825 -18.707 -6.738  1.00 22.09  ? 11  DC  T "C2'" 1 
ATOM   3690 C  "C1'" . DC  B 2 9   ? 34.812 -17.297 -6.155  1.00 22.36  ? 11  DC  T "C1'" 1 
ATOM   3691 N  N1    . DC  B 2 9   ? 34.940 -16.157 -7.118  1.00 17.31  ? 11  DC  T N1    1 
ATOM   3692 C  C2    . DC  B 2 9   ? 33.973 -15.141 -7.149  1.00 17.34  ? 11  DC  T C2    1 
ATOM   3693 O  O2    . DC  B 2 9   ? 32.991 -15.166 -6.404  1.00 22.61  ? 11  DC  T O2    1 
ATOM   3694 N  N3    . DC  B 2 9   ? 34.124 -14.121 -8.030  1.00 19.28  ? 11  DC  T N3    1 
ATOM   3695 C  C4    . DC  B 2 9   ? 35.172 -14.105 -8.840  1.00 19.48  ? 11  DC  T C4    1 
ATOM   3696 N  N4    . DC  B 2 9   ? 35.264 -13.070 -9.687  1.00 18.33  ? 11  DC  T N4    1 
ATOM   3697 C  C5    . DC  B 2 9   ? 36.177 -15.128 -8.820  1.00 17.55  ? 11  DC  T C5    1 
ATOM   3698 C  C6    . DC  B 2 9   ? 36.023 -16.126 -7.946  1.00 21.18  ? 11  DC  T C6    1 
ATOM   3699 P  P     . DT  B 2 10  ? 33.582 -21.398 -5.240  1.00 19.69  ? 12  DT  T P     1 
ATOM   3700 O  OP1   . DT  B 2 10  ? 33.030 -22.083 -4.062  1.00 20.12  ? 12  DT  T OP1   1 
ATOM   3701 O  OP2   . DT  B 2 10  ? 34.437 -22.117 -6.191  1.00 24.14  ? 12  DT  T OP2   1 
ATOM   3702 O  "O5'" . DT  B 2 10  ? 32.321 -20.772 -5.990  1.00 21.79  ? 12  DT  T "O5'" 1 
ATOM   3703 C  "C5'" . DT  B 2 10  ? 31.318 -20.090 -5.252  1.00 22.74  ? 12  DT  T "C5'" 1 
ATOM   3704 C  "C4'" . DT  B 2 10  ? 30.347 -19.465 -6.225  1.00 24.81  ? 12  DT  T "C4'" 1 
ATOM   3705 O  "O4'" . DT  B 2 10  ? 30.997 -18.354 -6.890  1.00 24.48  ? 12  DT  T "O4'" 1 
ATOM   3706 C  "C3'" . DT  B 2 10  ? 29.880 -20.423 -7.321  1.00 27.18  ? 12  DT  T "C3'" 1 
ATOM   3707 O  "O3'" . DT  B 2 10  ? 28.472 -20.360 -7.457  1.00 23.23  ? 12  DT  T "O3'" 1 
ATOM   3708 C  "C2'" . DT  B 2 10  ? 30.549 -19.853 -8.561  1.00 25.07  ? 12  DT  T "C2'" 1 
ATOM   3709 C  "C1'" . DT  B 2 10  ? 30.534 -18.366 -8.225  1.00 30.42  ? 12  DT  T "C1'" 1 
ATOM   3710 N  N1    . DT  B 2 10  ? 31.438 -17.538 -9.089  1.00 29.41  ? 12  DT  T N1    1 
ATOM   3711 C  C2    . DT  B 2 10  ? 31.072 -16.260 -9.457  1.00 23.84  ? 12  DT  T C2    1 
ATOM   3712 O  O2    . DT  B 2 10  ? 30.038 -15.716 -9.116  1.00 30.42  ? 12  DT  T O2    1 
ATOM   3713 N  N3    . DT  B 2 10  ? 31.970 -15.606 -10.260 1.00 24.22  ? 12  DT  T N3    1 
ATOM   3714 C  C4    . DT  B 2 10  ? 33.177 -16.112 -10.722 1.00 27.79  ? 12  DT  T C4    1 
ATOM   3715 O  O4    . DT  B 2 10  ? 33.927 -15.444 -11.435 1.00 28.58  ? 12  DT  T O4    1 
ATOM   3716 C  C5    . DT  B 2 10  ? 33.492 -17.452 -10.294 1.00 22.42  ? 12  DT  T C5    1 
ATOM   3717 C  C7    . DT  B 2 10  ? 34.766 -18.121 -10.716 1.00 31.79  ? 12  DT  T C7    1 
ATOM   3718 C  C6    . DT  B 2 10  ? 32.625 -18.100 -9.511  1.00 26.85  ? 12  DT  T C6    1 
ATOM   3719 O  "O5'" . DA  C 3 1   ? 28.597 -8.335  -16.712 1.00 41.11  ? 1   DA  P "O5'" 1 
ATOM   3720 C  "C5'" . DA  C 3 1   ? 28.374 -7.590  -15.534 1.00 30.81  ? 1   DA  P "C5'" 1 
ATOM   3721 C  "C4'" . DA  C 3 1   ? 27.312 -8.258  -14.688 1.00 32.45  ? 1   DA  P "C4'" 1 
ATOM   3722 O  "O4'" . DA  C 3 1   ? 27.552 -9.684  -14.651 1.00 33.67  ? 1   DA  P "O4'" 1 
ATOM   3723 C  "C3'" . DA  C 3 1   ? 27.248 -7.783  -13.243 1.00 30.14  ? 1   DA  P "C3'" 1 
ATOM   3724 O  "O3'" . DA  C 3 1   ? 25.902 -7.591  -12.875 1.00 34.86  ? 1   DA  P "O3'" 1 
ATOM   3725 C  "C2'" . DA  C 3 1   ? 27.811 -8.918  -12.399 1.00 33.90  ? 1   DA  P "C2'" 1 
ATOM   3726 C  "C1'" . DA  C 3 1   ? 27.922 -10.096 -13.356 1.00 33.48  ? 1   DA  P "C1'" 1 
ATOM   3727 N  N9    . DA  C 3 1   ? 29.285 -10.581 -13.427 1.00 25.92  ? 1   DA  P N9    1 
ATOM   3728 C  C8    . DA  C 3 1   ? 30.277 -10.158 -14.274 1.00 24.74  ? 1   DA  P C8    1 
ATOM   3729 N  N7    . DA  C 3 1   ? 31.410 -10.792 -14.089 1.00 26.85  ? 1   DA  P N7    1 
ATOM   3730 C  C5    . DA  C 3 1   ? 31.129 -11.678 -13.063 1.00 23.01  ? 1   DA  P C5    1 
ATOM   3731 C  C6    . DA  C 3 1   ? 31.907 -12.638 -12.410 1.00 25.04  ? 1   DA  P C6    1 
ATOM   3732 N  N6    . DA  C 3 1   ? 33.189 -12.870 -12.708 1.00 31.62  ? 1   DA  P N6    1 
ATOM   3733 N  N1    . DA  C 3 1   ? 31.313 -13.347 -11.427 1.00 25.45  ? 1   DA  P N1    1 
ATOM   3734 C  C2    . DA  C 3 1   ? 30.018 -13.126 -11.135 1.00 20.83  ? 1   DA  P C2    1 
ATOM   3735 N  N3    . DA  C 3 1   ? 29.182 -12.252 -11.678 1.00 23.89  ? 1   DA  P N3    1 
ATOM   3736 C  C4    . DA  C 3 1   ? 29.823 -11.556 -12.639 1.00 23.70  ? 1   DA  P C4    1 
ATOM   3737 P  P     . DG  C 3 2   ? 25.530 -6.477  -11.781 1.00 47.56  ? 2   DG  P P     1 
ATOM   3738 O  OP1   . DG  C 3 2   ? 24.068 -6.284  -11.875 1.00 32.61  ? 2   DG  P OP1   1 
ATOM   3739 O  OP2   . DG  C 3 2   ? 26.491 -5.361  -11.939 1.00 36.52  ? 2   DG  P OP2   1 
ATOM   3740 O  "O5'" . DG  C 3 2   ? 25.883 -7.170  -10.381 1.00 35.75  ? 2   DG  P "O5'" 1 
ATOM   3741 C  "C5'" . DG  C 3 2   ? 24.969 -8.066  -9.818  1.00 33.26  ? 2   DG  P "C5'" 1 
ATOM   3742 C  "C4'" . DG  C 3 2   ? 25.667 -8.798  -8.704  1.00 30.67  ? 2   DG  P "C4'" 1 
ATOM   3743 O  "O4'" . DG  C 3 2   ? 26.862 -9.438  -9.206  1.00 30.47  ? 2   DG  P "O4'" 1 
ATOM   3744 C  "C3'" . DG  C 3 2   ? 26.095 -7.903  -7.545  1.00 28.36  ? 2   DG  P "C3'" 1 
ATOM   3745 O  "O3'" . DG  C 3 2   ? 25.388 -8.417  -6.453  1.00 28.40  ? 2   DG  P "O3'" 1 
ATOM   3746 C  "C2'" . DG  C 3 2   ? 27.604 -8.098  -7.436  1.00 27.46  ? 2   DG  P "C2'" 1 
ATOM   3747 C  "C1'" . DG  C 3 2   ? 27.826 -9.416  -8.176  1.00 26.86  ? 2   DG  P "C1'" 1 
ATOM   3748 N  N9    . DG  C 3 2   ? 29.168 -9.545  -8.745  1.00 24.28  ? 2   DG  P N9    1 
ATOM   3749 C  C8    . DG  C 3 2   ? 29.773 -8.716  -9.664  1.00 22.87  ? 2   DG  P C8    1 
ATOM   3750 N  N7    . DG  C 3 2   ? 30.980 -9.096  -9.981  1.00 25.05  ? 2   DG  P N7    1 
ATOM   3751 C  C5    . DG  C 3 2   ? 31.200 -10.246 -9.227  1.00 23.25  ? 2   DG  P C5    1 
ATOM   3752 C  C6    . DG  C 3 2   ? 32.334 -11.099 -9.140  1.00 19.26  ? 2   DG  P C6    1 
ATOM   3753 O  O6    . DG  C 3 2   ? 33.417 -11.028 -9.735  1.00 20.51  ? 2   DG  P O6    1 
ATOM   3754 N  N1    . DG  C 3 2   ? 32.114 -12.156 -8.258  1.00 21.93  ? 2   DG  P N1    1 
ATOM   3755 C  C2    . DG  C 3 2   ? 30.962 -12.347 -7.548  1.00 22.24  ? 2   DG  P C2    1 
ATOM   3756 N  N2    . DG  C 3 2   ? 30.911 -13.416 -6.740  1.00 26.03  ? 2   DG  P N2    1 
ATOM   3757 N  N3    . DG  C 3 2   ? 29.904 -11.564 -7.620  1.00 23.74  ? 2   DG  P N3    1 
ATOM   3758 C  C4    . DG  C 3 2   ? 30.091 -10.530 -8.469  1.00 25.35  ? 2   DG  P C4    1 
ATOM   3759 P  P     . DT  C 3 3   ? 25.645 -7.884  -4.962  1.00 28.22  ? 3   DT  P P     1 
ATOM   3760 O  OP1   . DT  C 3 3   ? 24.355 -8.076  -4.267  1.00 27.63  ? 3   DT  P OP1   1 
ATOM   3761 O  OP2   . DT  C 3 3   ? 26.262 -6.537  -5.028  1.00 29.74  ? 3   DT  P OP2   1 
ATOM   3762 O  "O5'" . DT  C 3 3   ? 26.725 -8.910  -4.377  1.00 27.57  ? 3   DT  P "O5'" 1 
ATOM   3763 C  "C5'" . DT  C 3 3   ? 26.368 -10.238 -4.061  1.00 31.30  ? 3   DT  P "C5'" 1 
ATOM   3764 C  "C4'" . DT  C 3 3   ? 27.537 -10.883 -3.342  1.00 28.16  ? 3   DT  P "C4'" 1 
ATOM   3765 O  "O4'" . DT  C 3 3   ? 28.647 -10.927 -4.264  1.00 25.91  ? 3   DT  P "O4'" 1 
ATOM   3766 C  "C3'" . DT  C 3 3   ? 28.016 -10.129 -2.102  1.00 27.99  ? 3   DT  P "C3'" 1 
ATOM   3767 O  "O3'" . DT  C 3 3   ? 27.976 -10.982 -0.959  1.00 40.32  ? 3   DT  P "O3'" 1 
ATOM   3768 C  "C2'" . DT  C 3 3   ? 29.435 -9.681  -2.453  1.00 27.95  ? 3   DT  P "C2'" 1 
ATOM   3769 C  "C1'" . DT  C 3 3   ? 29.826 -10.698 -3.520  1.00 27.00  ? 3   DT  P "C1'" 1 
ATOM   3770 N  N1    . DT  C 3 3   ? 30.851 -10.172 -4.439  1.00 22.33  ? 3   DT  P N1    1 
ATOM   3771 C  C2    . DT  C 3 3   ? 32.043 -10.838 -4.594  1.00 21.80  ? 3   DT  P C2    1 
ATOM   3772 O  O2    . DT  C 3 3   ? 32.297 -11.866 -4.004  1.00 25.48  ? 3   DT  P O2    1 
ATOM   3773 N  N3    . DT  C 3 3   ? 32.935 -10.254 -5.453  1.00 21.10  ? 3   DT  P N3    1 
ATOM   3774 C  C4    . DT  C 3 3   ? 32.744 -9.087  -6.157  1.00 18.36  ? 3   DT  P C4    1 
ATOM   3775 O  O4    . DT  C 3 3   ? 33.587 -8.639  -6.923  1.00 21.75  ? 3   DT  P O4    1 
ATOM   3776 C  C5    . DT  C 3 3   ? 31.471 -8.454  -5.955  1.00 19.91  ? 3   DT  P C5    1 
ATOM   3777 C  C7    . DT  C 3 3   ? 31.176 -7.182  -6.686  1.00 23.83  ? 3   DT  P C7    1 
ATOM   3778 C  C6    . DT  C 3 3   ? 30.593 -8.997  -5.112  1.00 22.77  ? 3   DT  P C6    1 
ATOM   3779 P  P     . DG  C 3 4   ? 28.266 -10.381 0.505   1.00 38.13  ? 4   DG  P P     1 
ATOM   3780 O  OP1   . DG  C 3 4   ? 27.464 -11.161 1.475   1.00 44.92  ? 4   DG  P OP1   1 
ATOM   3781 O  OP2   . DG  C 3 4   ? 28.138 -8.911  0.443   1.00 43.29  ? 4   DG  P OP2   1 
ATOM   3782 O  "O5'" . DG  C 3 4   ? 29.815 -10.704 0.730   1.00 30.02  ? 4   DG  P "O5'" 1 
ATOM   3783 C  "C5'" . DG  C 3 4   ? 30.203 -12.060 0.666   1.00 25.96  ? 4   DG  P "C5'" 1 
ATOM   3784 C  "C4'" . DG  C 3 4   ? 31.712 -12.101 0.526   1.00 29.06  ? 4   DG  P "C4'" 1 
ATOM   3785 O  "O4'" . DG  C 3 4   ? 32.042 -11.381 -0.687  1.00 28.26  ? 4   DG  P "O4'" 1 
ATOM   3786 C  "C3'" . DG  C 3 4   ? 32.535 -11.440 1.639   1.00 24.74  ? 4   DG  P "C3'" 1 
ATOM   3787 O  "O3'" . DG  C 3 4   ? 32.971 -12.468 2.532   1.00 29.66  ? 4   DG  P "O3'" 1 
ATOM   3788 C  "C2'" . DG  C 3 4   ? 33.701 -10.802 0.892   1.00 26.12  ? 4   DG  P "C2'" 1 
ATOM   3789 C  "C1'" . DG  C 3 4   ? 33.410 -11.047 -0.581  1.00 25.47  ? 4   DG  P "C1'" 1 
ATOM   3790 N  N9    . DG  C 3 4   ? 33.644 -9.911  -1.455  1.00 19.89  ? 4   DG  P N9    1 
ATOM   3791 C  C8    . DG  C 3 4   ? 32.837 -8.840  -1.736  1.00 20.67  ? 4   DG  P C8    1 
ATOM   3792 N  N7    . DG  C 3 4   ? 33.371 -8.011  -2.601  1.00 20.72  ? 4   DG  P N7    1 
ATOM   3793 C  C5    . DG  C 3 4   ? 34.597 -8.590  -2.910  1.00 21.21  ? 4   DG  P C5    1 
ATOM   3794 C  C6    . DG  C 3 4   ? 35.618 -8.166  -3.778  1.00 15.55  ? 4   DG  P C6    1 
ATOM   3795 O  O6    . DG  C 3 4   ? 35.657 -7.154  -4.498  1.00 19.85  ? 4   DG  P O6    1 
ATOM   3796 N  N1    . DG  C 3 4   ? 36.688 -9.066  -3.777  1.00 19.61  ? 4   DG  P N1    1 
ATOM   3797 C  C2    . DG  C 3 4   ? 36.760 -10.222 -3.043  1.00 16.62  ? 4   DG  P C2    1 
ATOM   3798 N  N2    . DG  C 3 4   ? 37.873 -10.955 -3.192  1.00 18.74  ? 4   DG  P N2    1 
ATOM   3799 N  N3    . DG  C 3 4   ? 35.804 -10.630 -2.218  1.00 20.13  ? 4   DG  P N3    1 
ATOM   3800 C  C4    . DG  C 3 4   ? 34.766 -9.764  -2.217  1.00 18.21  ? 4   DG  P C4    1 
ATOM   3801 P  P     . DT  C 3 5   ? 33.914 -12.162 3.808   1.00 33.61  ? 5   DT  P P     1 
ATOM   3802 O  OP1   . DT  C 3 5   ? 33.856 -13.416 4.591   1.00 34.45  ? 5   DT  P OP1   1 
ATOM   3803 O  OP2   . DT  C 3 5   ? 33.608 -10.847 4.404   1.00 30.56  ? 5   DT  P OP2   1 
ATOM   3804 O  "O5'" . DT  C 3 5   ? 35.399 -12.032 3.192   1.00 28.28  ? 5   DT  P "O5'" 1 
ATOM   3805 C  "C5'" . DT  C 3 5   ? 35.942 -13.184 2.620   1.00 17.45  ? 5   DT  P "C5'" 1 
ATOM   3806 C  "C4'" . DT  C 3 5   ? 37.385 -12.975 2.217   1.00 16.21  ? 5   DT  P "C4'" 1 
ATOM   3807 O  "O4'" . DT  C 3 5   ? 37.457 -11.984 1.162   1.00 18.86  ? 5   DT  P "O4'" 1 
ATOM   3808 C  "C3'" . DT  C 3 5   ? 38.290 -12.438 3.317   1.00 17.19  ? 5   DT  P "C3'" 1 
ATOM   3809 O  "O3'" . DT  C 3 5   ? 39.483 -13.208 3.292   1.00 15.57  ? 5   DT  P "O3'" 1 
ATOM   3810 C  "C2'" . DT  C 3 5   ? 38.556 -10.984 2.933   1.00 15.74  ? 5   DT  P "C2'" 1 
ATOM   3811 C  "C1'" . DT  C 3 5   ? 38.504 -11.047 1.424   1.00 18.20  ? 5   DT  P "C1'" 1 
ATOM   3812 N  N1    . DT  C 3 5   ? 38.088 -9.787  0.741   1.00 16.50  ? 5   DT  P N1    1 
ATOM   3813 C  C2    . DT  C 3 5   ? 38.891 -9.242  -0.237  1.00 14.96  ? 5   DT  P C2    1 
ATOM   3814 O  O2    . DT  C 3 5   ? 39.948 -9.692  -0.607  1.00 15.85  ? 5   DT  P O2    1 
ATOM   3815 N  N3    . DT  C 3 5   ? 38.383 -8.114  -0.810  1.00 15.64  ? 5   DT  P N3    1 
ATOM   3816 C  C4    . DT  C 3 5   ? 37.206 -7.500  -0.501  1.00 16.09  ? 5   DT  P C4    1 
ATOM   3817 O  O4    . DT  C 3 5   ? 36.869 -6.483  -1.103  1.00 16.56  ? 5   DT  P O4    1 
ATOM   3818 C  C5    . DT  C 3 5   ? 36.413 -8.108  0.553   1.00 14.33  ? 5   DT  P C5    1 
ATOM   3819 C  C7    . DT  C 3 5   ? 35.109 -7.512  0.988   1.00 19.14  ? 5   DT  P C7    1 
ATOM   3820 C  C6    . DT  C 3 5   ? 36.892 -9.217  1.126   1.00 15.98  ? 5   DT  P C6    1 
ATOM   3821 P  P     . DG  C 3 6   ? 40.550 -13.077 4.484   1.00 14.49  ? 6   DG  P P     1 
ATOM   3822 O  OP1   . DG  C 3 6   ? 41.260 -14.388 4.546   1.00 14.23  ? 6   DG  P OP1   1 
ATOM   3823 O  OP2   . DG  C 3 6   ? 39.932 -12.493 5.669   1.00 15.90  ? 6   DG  P OP2   1 
ATOM   3824 O  "O5'" . DG  C 3 6   ? 41.576 -11.963 3.948   1.00 14.21  ? 6   DG  P "O5'" 1 
ATOM   3825 C  "C5'" . DG  C 3 6   ? 42.448 -12.237 2.867   1.00 10.25  ? 6   DG  P "C5'" 1 
ATOM   3826 C  "C4'" . DG  C 3 6   ? 43.202 -10.953 2.581   1.00 15.92  ? 6   DG  P "C4'" 1 
ATOM   3827 O  "O4'" . DG  C 3 6   ? 42.299 -10.032 1.907   1.00 15.95  ? 6   DG  P "O4'" 1 
ATOM   3828 C  "C3'" . DG  C 3 6   ? 43.729 -10.222 3.808   1.00 13.35  ? 6   DG  P "C3'" 1 
ATOM   3829 O  "O3'" . DG  C 3 6   ? 45.152 -10.337 3.725   1.00 12.77  ? 6   DG  P "O3'" 1 
ATOM   3830 C  "C2'" . DG  C 3 6   ? 43.244 -8.772  3.636   1.00 14.85  ? 6   DG  P "C2'" 1 
ATOM   3831 C  "C1'" . DG  C 3 6   ? 42.771 -8.737  2.180   1.00 16.80  ? 6   DG  P "C1'" 1 
ATOM   3832 N  N9    . DG  C 3 6   ? 41.687 -7.791  1.952   1.00 12.01  ? 6   DG  P N9    1 
ATOM   3833 C  C8    . DG  C 3 6   ? 40.492 -7.672  2.636   1.00 15.67  ? 6   DG  P C8    1 
ATOM   3834 N  N7    . DG  C 3 6   ? 39.733 -6.703  2.190   1.00 15.82  ? 6   DG  P N7    1 
ATOM   3835 C  C5    . DG  C 3 6   ? 40.479 -6.159  1.143   1.00 13.90  ? 6   DG  P C5    1 
ATOM   3836 C  C6    . DG  C 3 6   ? 40.189 -5.081  0.282   1.00 17.55  ? 6   DG  P C6    1 
ATOM   3837 O  O6    . DG  C 3 6   ? 39.157 -4.390  0.289   1.00 15.18  ? 6   DG  P O6    1 
ATOM   3838 N  N1    . DG  C 3 6   ? 41.206 -4.841  -0.634  1.00 14.67  ? 6   DG  P N1    1 
ATOM   3839 C  C2    . DG  C 3 6   ? 42.383 -5.545  -0.724  1.00 13.11  ? 6   DG  P C2    1 
ATOM   3840 N  N2    . DG  C 3 6   ? 43.242 -5.166  -1.678  1.00 15.22  ? 6   DG  P N2    1 
ATOM   3841 N  N3    . DG  C 3 6   ? 42.662 -6.575  0.076   1.00 13.84  ? 6   DG  P N3    1 
ATOM   3842 C  C4    . DG  C 3 6   ? 41.679 -6.812  0.976   1.00 14.40  ? 6   DG  P C4    1 
ATOM   3843 P  P     . DA  C 3 7   ? 46.142 -9.618  4.772   1.00 13.60  ? 7   DA  P P     1 
ATOM   3844 O  OP1   . DA  C 3 7   ? 47.346 -10.482 4.840   1.00 16.01  ? 7   DA  P OP1   1 
ATOM   3845 O  OP2   . DA  C 3 7   ? 45.447 -9.297  6.004   1.00 15.89  ? 7   DA  P OP2   1 
ATOM   3846 O  "O5'" . DA  C 3 7   ? 46.481 -8.228  4.057   1.00 15.29  ? 7   DA  P "O5'" 1 
ATOM   3847 C  "C5'" . DA  C 3 7   ? 47.172 -8.184  2.825   1.00 18.23  ? 7   DA  P "C5'" 1 
ATOM   3848 C  "C4'" . DA  C 3 7   ? 47.109 -6.751  2.313   1.00 22.52  ? 7   DA  P "C4'" 1 
ATOM   3849 O  "O4'" . DA  C 3 7   ? 45.729 -6.460  1.973   1.00 19.78  ? 7   DA  P "O4'" 1 
ATOM   3850 C  "C3'" . DA  C 3 7   ? 47.427 -5.633  3.324   1.00 22.97  ? 7   DA  P "C3'" 1 
ATOM   3851 O  "O3'" . DA  C 3 7   ? 48.828 -5.458  3.732   1.00 33.35  ? 7   DA  P "O3'" 1 
ATOM   3852 C  "C2'" . DA  C 3 7   ? 46.713 -4.417  2.769   1.00 26.45  ? 7   DA  P "C2'" 1 
ATOM   3853 C  "C1'" . DA  C 3 7   ? 45.585 -5.038  1.994   1.00 21.88  ? 7   DA  P "C1'" 1 
ATOM   3854 N  N9    . DA  C 3 7   ? 44.296 -4.637  2.509   1.00 16.77  ? 7   DA  P N9    1 
ATOM   3855 C  C8    . DA  C 3 7   ? 43.518 -5.124  3.511   1.00 17.21  ? 7   DA  P C8    1 
ATOM   3856 N  N7    . DA  C 3 7   ? 42.373 -4.501  3.649   1.00 17.94  ? 7   DA  P N7    1 
ATOM   3857 C  C5    . DA  C 3 7   ? 42.420 -3.532  2.667   1.00 17.74  ? 7   DA  P C5    1 
ATOM   3858 C  C6    . DA  C 3 7   ? 41.518 -2.533  2.294   1.00 16.33  ? 7   DA  P C6    1 
ATOM   3859 N  N6    . DA  C 3 7   ? 40.333 -2.352  2.878   1.00 18.71  ? 7   DA  P N6    1 
ATOM   3860 N  N1    . DA  C 3 7   ? 41.907 -1.740  1.268   1.00 13.55  ? 7   DA  P N1    1 
ATOM   3861 C  C2    . DA  C 3 7   ? 43.099 -1.918  0.683   1.00 13.32  ? 7   DA  P C2    1 
ATOM   3862 N  N3    . DA  C 3 7   ? 44.031 -2.838  0.961   1.00 13.93  ? 7   DA  P N3    1 
ATOM   3863 C  C4    . DA  C 3 7   ? 43.594 -3.605  1.955   1.00 15.90  ? 7   DA  P C4    1 
ATOM   3864 P  P     A DG  C 3 8   ? 50.000 -4.849  2.824   0.51 28.83  ? 8   DG  P P     1 
ATOM   3865 P  P     B DG  C 3 8   ? 49.432 -4.039  4.241   0.49 16.75  ? 8   DG  P P     1 
ATOM   3866 O  OP1   A DG  C 3 8   ? 50.222 -5.577  1.570   0.51 22.97  ? 8   DG  P OP1   1 
ATOM   3867 O  OP1   B DG  C 3 8   ? 50.880 -4.289  4.253   0.49 23.51  ? 8   DG  P OP1   1 
ATOM   3868 O  OP2   A DG  C 3 8   ? 51.068 -4.842  3.842   0.51 23.21  ? 8   DG  P OP2   1 
ATOM   3869 O  OP2   B DG  C 3 8   ? 48.781 -3.633  5.514   0.49 15.18  ? 8   DG  P OP2   1 
ATOM   3870 O  "O5'" A DG  C 3 8   ? 49.555 -3.341  2.560   0.51 23.87  ? 8   DG  P "O5'" 1 
ATOM   3871 O  "O5'" B DG  C 3 8   ? 49.140 -2.902  3.131   0.49 20.08  ? 8   DG  P "O5'" 1 
ATOM   3872 C  "C5'" A DG  C 3 8   ? 50.088 -2.694  1.466   0.51 19.64  ? 8   DG  P "C5'" 1 
ATOM   3873 C  "C5'" B DG  C 3 8   ? 49.876 -2.669  1.908   0.49 19.33  ? 8   DG  P "C5'" 1 
ATOM   3874 C  "C4'" . DG  C 3 8   ? 49.537 -1.280  1.383   1.00 14.11  ? 8   DG  P "C4'" 1 
ATOM   3875 O  "O4'" . DG  C 3 8   ? 48.111 -1.213  1.434   1.00 13.00  ? 8   DG  P "O4'" 1 
ATOM   3876 C  "C3'" . DG  C 3 8   ? 50.024 -0.244  2.385   1.00 17.28  ? 8   DG  P "C3'" 1 
ATOM   3877 O  "O3'" . DG  C 3 8   ? 50.679 0.710   1.676   1.00 17.51  ? 8   DG  P "O3'" 1 
ATOM   3878 C  "C2'" . DG  C 3 8   ? 48.777 0.404   2.964   1.00 20.27  ? 8   DG  P "C2'" 1 
ATOM   3879 C  "C1'" . DG  C 3 8   ? 47.695 0.021   1.972   1.00 17.90  ? 8   DG  P "C1'" 1 
ATOM   3880 N  N9    . DG  C 3 8   ? 46.437 -0.190  2.659   1.00 15.67  ? 8   DG  P N9    1 
ATOM   3881 C  C8    . DG  C 3 8   ? 46.090 -1.259  3.454   1.00 11.70  ? 8   DG  P C8    1 
ATOM   3882 N  N7    . DG  C 3 8   ? 44.902 -1.163  3.965   1.00 15.92  ? 8   DG  P N7    1 
ATOM   3883 C  C5    . DG  C 3 8   ? 44.413 0.038   3.458   1.00 12.88  ? 8   DG  P C5    1 
ATOM   3884 C  C6    . DG  C 3 8   ? 43.164 0.680   3.648   1.00 15.91  ? 8   DG  P C6    1 
ATOM   3885 O  O6    . DG  C 3 8   ? 42.189 0.314   4.310   1.00 17.68  ? 8   DG  P O6    1 
ATOM   3886 N  N1    . DG  C 3 8   ? 43.098 1.895   2.971   1.00 14.56  ? 8   DG  P N1    1 
ATOM   3887 C  C2    . DG  C 3 8   ? 44.103 2.429   2.217   1.00 13.86  ? 8   DG  P C2    1 
ATOM   3888 N  N2    . DG  C 3 8   ? 43.845 3.615   1.666   1.00 15.83  ? 8   DG  P N2    1 
ATOM   3889 N  N3    . DG  C 3 8   ? 45.279 1.833   2.025   1.00 13.34  ? 8   DG  P N3    1 
ATOM   3890 C  C4    . DG  C 3 8   ? 45.351 0.650   2.664   1.00 12.85  ? 8   DG  P C4    1 
HETATM 3891 P  PG    . 0KX D 4 .   ? 55.520 2.682   7.216   1.00 8.33   ? 501 0KX A PG    1 
HETATM 3892 O  O1G   . 0KX D 4 .   ? 55.166 1.716   8.347   1.00 9.98   ? 501 0KX A O1G   1 
HETATM 3893 O  O2G   . 0KX D 4 .   ? 55.499 2.078   5.830   1.00 8.64   ? 501 0KX A O2G   1 
HETATM 3894 O  O3G   . 0KX D 4 .   ? 56.842 3.339   7.470   1.00 8.62   ? 501 0KX A O3G   1 
HETATM 3895 P  PB    . 0KX D 4 .   ? 53.313 4.195   6.171   1.00 7.48   ? 501 0KX A PB    1 
HETATM 3896 O  O1B   . 0KX D 4 .   ? 52.615 5.469   6.647   1.00 8.82   ? 501 0KX A O1B   1 
HETATM 3897 O  O2B   . 0KX D 4 .   ? 53.967 4.364   4.818   1.00 6.87   ? 501 0KX A O2B   1 
HETATM 3898 O  O3B   . 0KX D 4 .   ? 54.376 3.794   7.278   1.00 7.16   ? 501 0KX A O3B   1 
HETATM 3899 P  PA    . 0KX D 4 .   ? 51.769 2.059   4.823   1.00 9.94   ? 501 0KX A PA    1 
HETATM 3900 O  O1A   . 0KX D 4 .   ? 52.900 1.623   4.002   1.00 9.88   ? 501 0KX A O1A   1 
HETATM 3901 O  O2A   . 0KX D 4 .   ? 50.906 0.912   5.404   1.00 13.50  ? 501 0KX A O2A   1 
HETATM 3902 N  N3A   . 0KX D 4 .   ? 52.252 2.910   6.219   1.00 10.67  ? 501 0KX A N3A   1 
HETATM 3903 O  "O5'" . 0KX D 4 .   ? 50.772 2.980   4.022   1.00 9.12   ? 501 0KX A "O5'" 1 
HETATM 3904 C  "C5'" . 0KX D 4 .   ? 51.149 3.976   3.145   1.00 9.36   ? 501 0KX A "C5'" 1 
HETATM 3905 C  "C4'" . 0KX D 4 .   ? 50.217 5.156   3.215   1.00 7.24   ? 501 0KX A "C4'" 1 
HETATM 3906 O  "O4'" . 0KX D 4 .   ? 48.910 4.710   2.851   1.00 9.92   ? 501 0KX A "O4'" 1 
HETATM 3907 C  "C3'" . 0KX D 4 .   ? 50.110 5.734   4.551   1.00 7.72   ? 501 0KX A "C3'" 1 
HETATM 3908 O  "O3'" . 0KX D 4 .   ? 51.134 6.732   4.783   1.00 8.56   ? 501 0KX A "O3'" 1 
HETATM 3909 C  "C2'" . 0KX D 4 .   ? 48.783 6.346   4.563   1.00 9.45   ? 501 0KX A "C2'" 1 
HETATM 3910 C  "C1'" . 0KX D 4 .   ? 47.987 5.398   3.702   1.00 9.31   ? 501 0KX A "C1'" 1 
HETATM 3911 N  N1    . 0KX D 4 .   ? 47.187 4.445   4.396   1.00 10.29  ? 501 0KX A N1    1 
HETATM 3912 C  C2    . 0KX D 4 .   ? 45.853 4.791   4.646   1.00 9.27   ? 501 0KX A C2    1 
HETATM 3913 N  N3    . 0KX D 4 .   ? 45.056 3.819   5.325   1.00 12.20  ? 501 0KX A N3    1 
HETATM 3914 C  C4    . 0KX D 4 .   ? 45.593 2.647   5.715   1.00 10.28  ? 501 0KX A C4    1 
HETATM 3915 C  C5    . 0KX D 4 .   ? 46.998 2.297   5.448   1.00 12.66  ? 501 0KX A C5    1 
HETATM 3916 C  C6    . 0KX D 4 .   ? 47.779 3.210   4.771   1.00 10.49  ? 501 0KX A C6    1 
HETATM 3917 O  O2    . 0KX D 4 .   ? 45.380 5.882   4.272   1.00 11.62  ? 501 0KX A O2    1 
HETATM 3918 N  N4    . 0KX D 4 .   ? 44.734 1.741   6.400   1.00 12.57  ? 501 0KX A N4    1 
HETATM 3919 MG MG    . MG  E 5 .   ? 54.896 2.667   3.812   1.00 4.39   ? 502 MG  A MG    1 
HETATM 3920 MG MG    . MG  F 5 .   ? 53.119 0.380   2.020   0.60 10.21  ? 503 MG  A MG    1 
HETATM 3921 C  C1    . GOL G 6 .   ? 60.521 -24.952 12.269  1.00 13.59  ? 504 GOL A C1    1 
HETATM 3922 O  O1    . GOL G 6 .   ? 59.125 -24.995 12.231  1.00 13.96  ? 504 GOL A O1    1 
HETATM 3923 C  C2    . GOL G 6 .   ? 61.116 -24.459 10.939  1.00 13.21  ? 504 GOL A C2    1 
HETATM 3924 O  O2    . GOL G 6 .   ? 60.665 -23.154 10.654  1.00 12.43  ? 504 GOL A O2    1 
HETATM 3925 C  C3    . GOL G 6 .   ? 60.812 -25.369 9.750   1.00 16.64  ? 504 GOL A C3    1 
HETATM 3926 O  O3    . GOL G 6 .   ? 61.601 -24.953 8.629   1.00 15.12  ? 504 GOL A O3    1 
HETATM 3927 C  C1    . GOL H 6 .   ? 54.276 16.616  -7.072  1.00 29.95  ? 505 GOL A C1    1 
HETATM 3928 O  O1    . GOL H 6 .   ? 54.118 15.265  -6.685  1.00 19.78  ? 505 GOL A O1    1 
HETATM 3929 C  C2    . GOL H 6 .   ? 54.904 16.682  -8.459  1.00 29.33  ? 505 GOL A C2    1 
HETATM 3930 O  O2    . GOL H 6 .   ? 53.981 16.124  -9.369  1.00 28.31  ? 505 GOL A O2    1 
HETATM 3931 C  C3    . GOL H 6 .   ? 55.167 18.139  -8.845  1.00 23.23  ? 505 GOL A C3    1 
HETATM 3932 O  O3    . GOL H 6 .   ? 56.129 18.165  -9.877  1.00 35.41  ? 505 GOL A O3    1 
HETATM 3933 C  C1    . GOL I 6 .   ? 54.645 28.203  4.717   1.00 31.55  ? 506 GOL A C1    1 
HETATM 3934 O  O1    . GOL I 6 .   ? 53.355 27.920  4.217   1.00 30.36  ? 506 GOL A O1    1 
HETATM 3935 C  C2    . GOL I 6 .   ? 55.091 27.156  5.736   1.00 39.63  ? 506 GOL A C2    1 
HETATM 3936 O  O2    . GOL I 6 .   ? 54.448 25.917  5.508   1.00 34.40  ? 506 GOL A O2    1 
HETATM 3937 C  C3    . GOL I 6 .   ? 56.601 26.997  5.606   1.00 33.26  ? 506 GOL A C3    1 
HETATM 3938 O  O3    . GOL I 6 .   ? 57.117 26.053  6.526   1.00 21.75  ? 506 GOL A O3    1 
HETATM 3939 O  O     . HOH J 7 .   ? 56.494 -14.058 -5.858  1.00 11.07  ? 601 HOH A O     1 
HETATM 3940 O  O     . HOH J 7 .   ? 58.000 -23.493 14.176  1.00 9.13   ? 602 HOH A O     1 
HETATM 3941 O  O     . HOH J 7 .   ? 69.240 -17.671 -1.321  1.00 10.79  ? 603 HOH A O     1 
HETATM 3942 O  O     . HOH J 7 .   ? 67.572 -20.744 8.786   1.00 10.48  ? 604 HOH A O     1 
HETATM 3943 O  O     . HOH J 7 .   ? 43.871 -14.367 5.771   1.00 12.24  ? 605 HOH A O     1 
HETATM 3944 O  O     . HOH J 7 .   ? 64.206 -3.422  5.992   1.00 10.55  ? 606 HOH A O     1 
HETATM 3945 O  O     . HOH J 7 .   ? 60.428 -18.540 -4.590  1.00 11.09  ? 607 HOH A O     1 
HETATM 3946 O  O     . HOH J 7 .   ? 67.293 -16.672 9.631   1.00 12.57  ? 608 HOH A O     1 
HETATM 3947 O  O     . HOH J 7 .   ? 69.301 -13.581 4.939   1.00 10.14  ? 609 HOH A O     1 
HETATM 3948 O  O     . HOH J 7 .   ? 59.616 9.633   10.835  1.00 12.10  ? 610 HOH A O     1 
HETATM 3949 O  O     . HOH J 7 .   ? 54.809 -11.422 3.468   1.00 12.58  ? 611 HOH A O     1 
HETATM 3950 O  O     . HOH J 7 .   ? 52.156 5.767   9.323   1.00 12.42  ? 612 HOH A O     1 
HETATM 3951 O  O     . HOH J 7 .   ? 55.688 17.473  -0.661  1.00 10.78  ? 613 HOH A O     1 
HETATM 3952 O  O     . HOH J 7 .   ? 53.912 -28.569 4.156   1.00 13.74  ? 614 HOH A O     1 
HETATM 3953 O  O     . HOH J 7 .   ? 58.574 -12.180 -11.420 1.00 15.04  ? 615 HOH A O     1 
HETATM 3954 O  O     . HOH J 7 .   ? 73.327 -7.477  8.876   1.00 12.47  ? 616 HOH A O     1 
HETATM 3955 O  O     . HOH J 7 .   ? 43.613 12.131  -7.306  1.00 18.49  ? 617 HOH A O     1 
HETATM 3956 O  O     . HOH J 7 .   ? 54.473 -9.544  5.341   1.00 14.92  ? 618 HOH A O     1 
HETATM 3957 O  O     . HOH J 7 .   ? 62.716 14.764  -9.151  1.00 13.82  ? 619 HOH A O     1 
HETATM 3958 O  O     . HOH J 7 .   ? 62.611 7.284   7.052   1.00 13.79  ? 620 HOH A O     1 
HETATM 3959 O  O     . HOH J 7 .   ? 53.720 -20.413 -2.490  1.00 14.98  ? 621 HOH A O     1 
HETATM 3960 O  O     . HOH J 7 .   ? 45.634 15.853  -1.526  1.00 12.00  ? 622 HOH A O     1 
HETATM 3961 O  O     . HOH J 7 .   ? 50.327 -17.237 15.539  1.00 15.40  ? 623 HOH A O     1 
HETATM 3962 O  O     . HOH J 7 .   ? 49.224 -15.518 13.562  1.00 17.93  ? 624 HOH A O     1 
HETATM 3963 O  O     . HOH J 7 .   ? 65.599 -22.994 3.285   1.00 13.52  ? 625 HOH A O     1 
HETATM 3964 O  O     . HOH J 7 .   ? 68.988 16.218  -4.125  1.00 15.27  ? 626 HOH A O     1 
HETATM 3965 O  O     . HOH J 7 .   ? 54.053 17.334  -3.217  1.00 16.94  ? 627 HOH A O     1 
HETATM 3966 O  O     . HOH J 7 .   ? 45.099 7.247   -10.195 1.00 17.86  ? 628 HOH A O     1 
HETATM 3967 O  O     . HOH J 7 .   ? 43.391 -33.209 -0.534  1.00 15.80  ? 629 HOH A O     1 
HETATM 3968 O  O     . HOH J 7 .   ? 46.352 16.617  1.173   1.00 11.36  ? 630 HOH A O     1 
HETATM 3969 O  O     . HOH J 7 .   ? 53.682 13.579  -9.945  1.00 17.57  ? 631 HOH A O     1 
HETATM 3970 O  O     . HOH J 7 .   ? 71.220 3.560   -0.446  1.00 17.40  ? 632 HOH A O     1 
HETATM 3971 O  O     . HOH J 7 .   ? 42.175 -22.612 -2.545  1.00 16.28  ? 633 HOH A O     1 
HETATM 3972 O  O     . HOH J 7 .   ? 70.842 16.206  -6.170  1.00 16.21  ? 634 HOH A O     1 
HETATM 3973 O  O     . HOH J 7 .   ? 65.682 -6.753  -13.868 1.00 17.66  ? 635 HOH A O     1 
HETATM 3974 O  O     . HOH J 7 .   ? 59.918 11.394  -10.413 1.00 18.65  ? 636 HOH A O     1 
HETATM 3975 O  O     . HOH J 7 .   ? 52.396 15.730  -4.685  1.00 14.72  ? 637 HOH A O     1 
HETATM 3976 O  O     . HOH J 7 .   ? 44.581 7.082   2.010   1.00 15.53  ? 638 HOH A O     1 
HETATM 3977 O  O     . HOH J 7 .   ? 52.627 1.492   9.292   1.00 20.53  ? 639 HOH A O     1 
HETATM 3978 O  O     . HOH J 7 .   ? 49.302 7.382   -7.742  1.00 18.45  ? 640 HOH A O     1 
HETATM 3979 O  O     . HOH J 7 .   ? 41.084 7.680   -18.501 1.00 18.35  ? 641 HOH A O     1 
HETATM 3980 O  O     . HOH J 7 .   ? 45.067 -14.208 10.471  1.00 15.32  ? 642 HOH A O     1 
HETATM 3981 O  O     . HOH J 7 .   ? 51.179 5.497   -8.295  1.00 18.72  ? 643 HOH A O     1 
HETATM 3982 O  O     . HOH J 7 .   ? 60.841 -23.539 6.427   1.00 17.60  ? 644 HOH A O     1 
HETATM 3983 O  O     . HOH J 7 .   ? 53.464 -28.143 15.333  1.00 16.71  ? 645 HOH A O     1 
HETATM 3984 O  O     . HOH J 7 .   ? 52.480 20.130  4.907   1.00 15.53  ? 646 HOH A O     1 
HETATM 3985 O  O     . HOH J 7 .   ? 41.115 7.050   19.184  1.00 19.39  ? 647 HOH A O     1 
HETATM 3986 O  O     . HOH J 7 .   ? 44.128 -15.019 1.389   1.00 18.48  ? 648 HOH A O     1 
HETATM 3987 O  O     . HOH J 7 .   ? 63.349 -19.059 -1.640  1.00 15.49  ? 649 HOH A O     1 
HETATM 3988 O  O     . HOH J 7 .   ? 71.516 6.020   -7.491  1.00 17.21  ? 650 HOH A O     1 
HETATM 3989 O  O     . HOH J 7 .   ? 64.720 6.528   -0.458  1.00 16.33  ? 651 HOH A O     1 
HETATM 3990 O  O     . HOH J 7 .   ? 50.132 -3.089  -17.326 1.00 25.37  ? 652 HOH A O     1 
HETATM 3991 O  O     . HOH J 7 .   ? 59.586 11.177  8.562   1.00 15.64  ? 653 HOH A O     1 
HETATM 3992 O  O     . HOH J 7 .   ? 41.909 8.261   2.860   1.00 13.86  ? 654 HOH A O     1 
HETATM 3993 O  O     . HOH J 7 .   ? 65.935 -15.209 11.583  1.00 17.60  ? 655 HOH A O     1 
HETATM 3994 O  O     . HOH J 7 .   ? 68.434 -15.766 -7.752  1.00 22.69  ? 656 HOH A O     1 
HETATM 3995 O  O     . HOH J 7 .   ? 50.179 3.138   12.808  1.00 24.75  ? 657 HOH A O     1 
HETATM 3996 O  O     . HOH J 7 .   ? 57.981 -7.449  8.026   1.00 19.87  ? 658 HOH A O     1 
HETATM 3997 O  O     . HOH J 7 .   ? 70.760 -19.121 1.341   1.00 15.27  ? 659 HOH A O     1 
HETATM 3998 O  O     . HOH J 7 .   ? 48.939 6.618   -11.749 1.00 23.33  ? 660 HOH A O     1 
HETATM 3999 O  O     . HOH J 7 .   ? 43.952 10.892  -12.348 1.00 23.15  ? 661 HOH A O     1 
HETATM 4000 O  O     . HOH J 7 .   ? 49.525 8.475   -13.514 1.00 29.12  ? 662 HOH A O     1 
HETATM 4001 O  O     . HOH J 7 .   ? 48.659 -22.351 -5.635  1.00 21.71  ? 663 HOH A O     1 
HETATM 4002 O  O     . HOH J 7 .   ? 60.124 13.961  -8.698  1.00 18.54  ? 664 HOH A O     1 
HETATM 4003 O  O     . HOH J 7 .   ? 49.358 2.781   21.303  1.00 27.69  ? 665 HOH A O     1 
HETATM 4004 O  O     . HOH J 7 .   ? 69.387 4.376   3.934   1.00 20.32  ? 666 HOH A O     1 
HETATM 4005 O  O     . HOH J 7 .   ? 50.899 28.305  5.058   1.00 31.19  ? 667 HOH A O     1 
HETATM 4006 O  O     . HOH J 7 .   ? 50.527 -34.745 -0.645  1.00 18.06  ? 668 HOH A O     1 
HETATM 4007 O  O     . HOH J 7 .   ? 51.486 5.008   -10.913 1.00 22.00  ? 669 HOH A O     1 
HETATM 4008 O  O     . HOH J 7 .   ? 42.861 15.698  23.702  1.00 24.51  ? 670 HOH A O     1 
HETATM 4009 O  O     . HOH J 7 .   ? 64.073 -9.516  -14.457 1.00 20.76  ? 671 HOH A O     1 
HETATM 4010 O  O     . HOH J 7 .   ? 63.107 -26.725 6.978   1.00 19.75  ? 672 HOH A O     1 
HETATM 4011 O  O     . HOH J 7 .   ? 40.617 16.501  5.896   1.00 20.82  ? 673 HOH A O     1 
HETATM 4012 O  O     . HOH J 7 .   ? 48.527 -36.853 2.567   1.00 19.54  ? 674 HOH A O     1 
HETATM 4013 O  O     . HOH J 7 .   ? 47.348 2.414   -1.396  1.00 16.59  ? 675 HOH A O     1 
HETATM 4014 O  O     . HOH J 7 .   ? 72.412 -7.774  11.553  1.00 17.11  ? 676 HOH A O     1 
HETATM 4015 O  O     . HOH J 7 .   ? 36.991 15.972  -4.088  1.00 29.63  ? 677 HOH A O     1 
HETATM 4016 O  O     . HOH J 7 .   ? 48.115 10.806  -9.695  1.00 21.12  ? 678 HOH A O     1 
HETATM 4017 O  O     . HOH J 7 .   ? 53.408 -33.470 -0.076  1.00 21.72  ? 679 HOH A O     1 
HETATM 4018 O  O     . HOH J 7 .   ? 41.735 -30.548 -6.327  1.00 21.28  ? 680 HOH A O     1 
HETATM 4019 O  O     . HOH J 7 .   ? 58.522 -9.361  -14.073 1.00 26.58  ? 681 HOH A O     1 
HETATM 4020 O  O     . HOH J 7 .   ? 51.501 3.464   10.559  1.00 19.65  ? 682 HOH A O     1 
HETATM 4021 O  O     . HOH J 7 .   ? 63.381 12.851  -10.839 1.00 26.20  ? 683 HOH A O     1 
HETATM 4022 O  O     . HOH J 7 .   ? 59.425 4.980   16.613  1.00 21.96  ? 684 HOH A O     1 
HETATM 4023 O  O     . HOH J 7 .   ? 46.724 -0.470  -15.201 1.00 24.81  ? 685 HOH A O     1 
HETATM 4024 O  O     . HOH J 7 .   ? 65.771 5.652   2.203   1.00 20.69  ? 686 HOH A O     1 
HETATM 4025 O  O     . HOH J 7 .   ? 41.226 -23.979 -4.986  1.00 24.21  ? 687 HOH A O     1 
HETATM 4026 O  O     . HOH J 7 .   ? 53.219 -20.173 -4.953  1.00 21.25  ? 688 HOH A O     1 
HETATM 4027 O  O     . HOH J 7 .   ? 41.237 16.939  -14.873 1.00 22.33  ? 689 HOH A O     1 
HETATM 4028 O  O     . HOH J 7 .   ? 58.638 15.263  -10.697 1.00 26.55  ? 690 HOH A O     1 
HETATM 4029 O  O     . HOH J 7 .   ? 67.655 -6.452  12.723  1.00 22.23  ? 691 HOH A O     1 
HETATM 4030 O  O     . HOH J 7 .   ? 45.195 0.329   -18.472 1.00 26.53  ? 692 HOH A O     1 
HETATM 4031 O  O     . HOH J 7 .   ? 47.759 7.867   -9.786  1.00 20.68  ? 693 HOH A O     1 
HETATM 4032 O  O     . HOH J 7 .   ? 43.038 -1.520  -24.866 1.00 31.20  ? 694 HOH A O     1 
HETATM 4033 O  O     . HOH J 7 .   ? 78.292 -1.144  5.189   1.00 19.04  ? 695 HOH A O     1 
HETATM 4034 O  O     . HOH J 7 .   ? 49.901 -8.930  12.981  1.00 28.08  ? 696 HOH A O     1 
HETATM 4035 O  O     . HOH J 7 .   ? 61.485 14.681  8.651   1.00 26.47  ? 697 HOH A O     1 
HETATM 4036 O  O     . HOH J 7 .   ? 55.602 -7.453  6.538   1.00 22.12  ? 698 HOH A O     1 
HETATM 4037 O  O     . HOH J 7 .   ? 48.455 -17.876 17.318  1.00 27.03  ? 699 HOH A O     1 
HETATM 4038 O  O     . HOH J 7 .   ? 48.904 -9.509  10.452  1.00 28.04  ? 700 HOH A O     1 
HETATM 4039 O  O     . HOH J 7 .   ? 49.892 -9.438  -8.242  1.00 30.76  ? 701 HOH A O     1 
HETATM 4040 O  O     . HOH J 7 .   ? 58.139 -27.486 11.370  1.00 15.34  ? 702 HOH A O     1 
HETATM 4041 O  O     . HOH J 7 .   ? 46.988 -14.646 14.988  1.00 28.30  ? 703 HOH A O     1 
HETATM 4042 O  O     . HOH J 7 .   ? 65.686 -4.276  -15.149 1.00 26.96  ? 704 HOH A O     1 
HETATM 4043 O  O     . HOH J 7 .   ? 46.303 -9.700  11.131  1.00 29.43  ? 705 HOH A O     1 
HETATM 4044 O  O     . HOH J 7 .   ? 51.036 -8.766  -5.116  1.00 27.40  ? 706 HOH A O     1 
HETATM 4045 O  O     . HOH J 7 .   ? 45.047 16.929  -18.116 1.00 30.29  ? 707 HOH A O     1 
HETATM 4046 O  O     . HOH J 7 .   ? 47.462 -20.096 18.391  1.00 31.75  ? 708 HOH A O     1 
HETATM 4047 O  O     . HOH J 7 .   ? 58.574 -18.070 19.820  1.00 23.62  ? 709 HOH A O     1 
HETATM 4048 O  O     . HOH J 7 .   ? 65.607 -22.360 -7.868  1.00 24.68  ? 710 HOH A O     1 
HETATM 4049 O  O     . HOH J 7 .   ? 83.976 -5.281  2.446   1.00 27.88  ? 711 HOH A O     1 
HETATM 4050 O  O     . HOH J 7 .   ? 41.506 21.350  2.442   1.00 26.42  ? 712 HOH A O     1 
HETATM 4051 O  O     . HOH J 7 .   ? 59.996 10.596  19.828  1.00 22.04  ? 713 HOH A O     1 
HETATM 4052 O  O     . HOH J 7 .   ? 53.032 -26.635 -3.874  1.00 22.23  ? 714 HOH A O     1 
HETATM 4053 O  O     . HOH J 7 .   ? 47.799 -27.225 -7.158  1.00 31.93  ? 715 HOH A O     1 
HETATM 4054 O  O     . HOH J 7 .   ? 28.936 8.257   -19.029 1.00 32.14  ? 716 HOH A O     1 
HETATM 4055 O  O     . HOH J 7 .   ? 53.476 19.278  -1.466  1.00 17.96  ? 717 HOH A O     1 
HETATM 4056 O  O     . HOH J 7 .   ? 68.022 -14.667 -10.107 1.00 23.39  ? 718 HOH A O     1 
HETATM 4057 O  O     . HOH J 7 .   ? 49.156 12.327  -11.415 1.00 32.63  ? 719 HOH A O     1 
HETATM 4058 O  O     . HOH J 7 .   ? 61.849 8.019   9.802   1.00 23.34  ? 720 HOH A O     1 
HETATM 4059 O  O     . HOH J 7 .   ? 59.751 13.215  11.527  1.00 22.69  ? 721 HOH A O     1 
HETATM 4060 O  O     . HOH J 7 .   ? 40.677 -1.912  -16.385 1.00 27.70  ? 722 HOH A O     1 
HETATM 4061 O  O     . HOH J 7 .   ? 51.116 8.561   -15.322 1.00 33.72  ? 723 HOH A O     1 
HETATM 4062 O  O     . HOH J 7 .   ? 57.968 -14.491 -12.982 1.00 24.80  ? 724 HOH A O     1 
HETATM 4063 O  O     . HOH J 7 .   ? 46.081 -0.862  7.323   1.00 22.18  ? 725 HOH A O     1 
HETATM 4064 O  O     . HOH J 7 .   ? 48.541 19.797  4.725   1.00 27.24  ? 726 HOH A O     1 
HETATM 4065 O  O     . HOH J 7 .   ? 48.429 -33.719 -3.576  1.00 24.32  ? 727 HOH A O     1 
HETATM 4066 O  O     . HOH J 7 .   ? 62.066 -25.422 4.924   1.00 26.04  ? 728 HOH A O     1 
HETATM 4067 O  O     . HOH J 7 .   ? 56.338 18.871  18.242  1.00 21.90  ? 729 HOH A O     1 
HETATM 4068 O  O     . HOH J 7 .   ? 34.765 15.229  11.241  1.00 27.56  ? 730 HOH A O     1 
HETATM 4069 O  O     . HOH J 7 .   ? 36.875 13.107  12.004  1.00 27.05  ? 731 HOH A O     1 
HETATM 4070 O  O     . HOH J 7 .   ? 61.337 20.994  11.926  1.00 26.08  ? 732 HOH A O     1 
HETATM 4071 O  O     . HOH J 7 .   ? 52.720 -18.264 -11.478 1.00 29.44  ? 733 HOH A O     1 
HETATM 4072 O  O     . HOH J 7 .   ? 54.564 15.566  23.462  1.00 30.38  ? 734 HOH A O     1 
HETATM 4073 O  O     . HOH J 7 .   ? 70.887 0.469   11.458  1.00 29.86  ? 735 HOH A O     1 
HETATM 4074 O  O     . HOH J 7 .   ? 62.277 -13.285 -13.557 1.00 25.13  ? 736 HOH A O     1 
HETATM 4075 O  O     . HOH J 7 .   ? 51.435 6.169   -18.828 1.00 28.52  ? 737 HOH A O     1 
HETATM 4076 O  O     . HOH J 7 .   ? 73.561 4.352   -1.392  1.00 30.85  ? 738 HOH A O     1 
HETATM 4077 O  O     . HOH J 7 .   ? 46.794 19.392  1.224   1.00 24.00  ? 739 HOH A O     1 
HETATM 4078 O  O     . HOH J 7 .   ? 44.727 -22.957 17.892  1.00 31.22  ? 740 HOH A O     1 
HETATM 4079 O  O     . HOH J 7 .   ? 53.597 7.441   -14.675 1.00 32.96  ? 741 HOH A O     1 
HETATM 4080 O  O     . HOH J 7 .   ? 60.324 14.461  3.358   1.00 24.91  ? 742 HOH A O     1 
HETATM 4081 O  O     . HOH J 7 .   ? 49.815 -0.185  -16.096 1.00 26.73  ? 743 HOH A O     1 
HETATM 4082 O  O     . HOH J 7 .   ? 79.516 3.413   1.653   1.00 32.47  ? 744 HOH A O     1 
HETATM 4083 O  O     . HOH J 7 .   ? 75.361 0.358   -3.853  1.00 24.65  ? 745 HOH A O     1 
HETATM 4084 O  O     . HOH J 7 .   ? 62.844 11.884  5.501   1.00 31.54  ? 746 HOH A O     1 
HETATM 4085 O  O     . HOH J 7 .   ? 38.631 -17.917 10.339  1.00 21.84  ? 747 HOH A O     1 
HETATM 4086 O  O     . HOH J 7 .   ? 42.454 -18.976 14.816  1.00 24.58  ? 748 HOH A O     1 
HETATM 4087 O  O     . HOH J 7 .   ? 49.963 26.132  2.487   1.00 35.46  ? 749 HOH A O     1 
HETATM 4088 O  O     . HOH J 7 .   ? 44.780 20.616  3.718   1.00 33.04  ? 750 HOH A O     1 
HETATM 4089 O  O     . HOH J 7 .   ? 45.341 -32.648 9.157   1.00 43.31  ? 751 HOH A O     1 
HETATM 4090 O  O     . HOH J 7 .   ? 55.497 14.778  25.986  1.00 38.66  ? 752 HOH A O     1 
HETATM 4091 O  O     . HOH J 7 .   ? 47.291 16.301  25.740  1.00 28.62  ? 753 HOH A O     1 
HETATM 4092 O  O     . HOH J 7 .   ? 58.964 -18.408 -10.048 1.00 28.57  ? 754 HOH A O     1 
HETATM 4093 O  O     . HOH J 7 .   ? 44.425 15.940  26.321  1.00 31.44  ? 755 HOH A O     1 
HETATM 4094 O  O     . HOH J 7 .   ? 47.547 -16.681 -1.033  1.00 26.36  ? 756 HOH A O     1 
HETATM 4095 O  O     . HOH J 7 .   ? 57.559 -34.881 8.411   1.00 30.08  ? 757 HOH A O     1 
HETATM 4096 O  O     . HOH J 7 .   ? 47.035 15.745  -23.633 1.00 24.38  ? 758 HOH A O     1 
HETATM 4097 O  O     . HOH J 7 .   ? 34.670 19.932  -16.174 1.00 27.92  ? 759 HOH A O     1 
HETATM 4098 O  O     . HOH J 7 .   ? 47.091 -22.740 17.424  1.00 23.62  ? 760 HOH A O     1 
HETATM 4099 O  O     . HOH J 7 .   ? 37.423 15.025  -20.249 1.00 30.84  ? 761 HOH A O     1 
HETATM 4100 O  O     . HOH J 7 .   ? 53.009 -19.688 22.188  1.00 29.28  ? 762 HOH A O     1 
HETATM 4101 O  O     . HOH J 7 .   ? 51.565 -35.339 7.732   1.00 29.33  ? 763 HOH A O     1 
HETATM 4102 O  O     . HOH J 7 .   ? 53.715 6.067   -12.397 1.00 26.57  ? 764 HOH A O     1 
HETATM 4103 O  O     . HOH J 7 .   ? 42.378 12.971  -23.994 1.00 27.46  ? 765 HOH A O     1 
HETATM 4104 O  O     . HOH J 7 .   ? 72.122 -3.930  -14.021 1.00 25.76  ? 766 HOH A O     1 
HETATM 4105 O  O     . HOH J 7 .   ? 65.865 8.446   8.934   1.00 26.85  ? 767 HOH A O     1 
HETATM 4106 O  O     . HOH J 7 .   ? 56.516 -2.848  3.956   1.00 24.75  ? 768 HOH A O     1 
HETATM 4107 O  O     . HOH J 7 .   ? 49.085 -34.590 10.194  1.00 33.82  ? 769 HOH A O     1 
HETATM 4108 O  O     . HOH J 7 .   ? 69.737 -13.091 -11.511 1.00 29.09  ? 770 HOH A O     1 
HETATM 4109 O  O     . HOH J 7 .   ? 40.130 -18.623 -1.377  1.00 32.64  ? 771 HOH A O     1 
HETATM 4110 O  O     . HOH J 7 .   ? 65.359 12.784  2.988   1.00 26.49  ? 772 HOH A O     1 
HETATM 4111 O  O     . HOH J 7 .   ? 58.963 4.667   23.145  1.00 24.87  ? 773 HOH A O     1 
HETATM 4112 O  O     . HOH J 7 .   ? 23.282 14.288  -9.457  1.00 32.46  ? 774 HOH A O     1 
HETATM 4113 O  O     . HOH J 7 .   ? 52.938 3.572   17.926  1.00 30.32  ? 775 HOH A O     1 
HETATM 4114 O  O     . HOH J 7 .   ? 43.920 -28.583 15.869  1.00 33.81  ? 776 HOH A O     1 
HETATM 4115 O  O     . HOH J 7 .   ? 56.718 21.632  18.201  1.00 27.23  ? 777 HOH A O     1 
HETATM 4116 O  O     . HOH J 7 .   ? 42.661 -8.767  9.472   1.00 37.01  ? 778 HOH A O     1 
HETATM 4117 O  O     . HOH J 7 .   ? 62.637 9.384   -13.622 1.00 29.26  ? 779 HOH A O     1 
HETATM 4118 O  O     . HOH J 7 .   ? 24.143 16.562  3.017   1.00 25.41  ? 780 HOH A O     1 
HETATM 4119 O  O     . HOH J 7 .   ? 69.417 -10.946 11.859  1.00 26.48  ? 781 HOH A O     1 
HETATM 4120 O  O     . HOH J 7 .   ? 67.525 6.307   0.730   1.00 26.99  ? 782 HOH A O     1 
HETATM 4121 O  O     . HOH J 7 .   ? 52.452 -5.623  -0.985  1.00 23.41  ? 783 HOH A O     1 
HETATM 4122 O  O     . HOH J 7 .   ? 57.239 -16.582 -11.343 1.00 23.73  ? 784 HOH A O     1 
HETATM 4123 O  O     . HOH J 7 .   ? 62.041 7.836   16.275  1.00 30.74  ? 785 HOH A O     1 
HETATM 4124 O  O     . HOH J 7 .   ? 50.868 17.564  -5.812  1.00 24.99  ? 786 HOH A O     1 
HETATM 4125 O  O     . HOH J 7 .   ? 55.668 -20.433 21.182  1.00 22.29  ? 787 HOH A O     1 
HETATM 4126 O  O     . HOH J 7 .   ? 57.436 0.115   -14.896 1.00 24.00  ? 788 HOH A O     1 
HETATM 4127 O  O     . HOH J 7 .   ? 63.610 -7.343  12.928  1.00 32.38  ? 789 HOH A O     1 
HETATM 4128 O  O     . HOH J 7 .   ? 39.028 -19.739 12.388  1.00 31.78  ? 790 HOH A O     1 
HETATM 4129 O  O     . HOH J 7 .   ? 83.414 -0.821  -4.292  1.00 36.90  ? 791 HOH A O     1 
HETATM 4130 O  O     . HOH J 7 .   ? 49.238 14.883  -22.416 1.00 29.61  ? 792 HOH A O     1 
HETATM 4131 O  O     . HOH J 7 .   ? 34.280 5.757   -21.939 1.00 34.78  ? 793 HOH A O     1 
HETATM 4132 O  O     . HOH J 7 .   ? 60.658 -28.366 8.408   1.00 25.02  ? 794 HOH A O     1 
HETATM 4133 O  O     . HOH J 7 .   ? 71.056 -6.677  13.796  1.00 29.03  ? 795 HOH A O     1 
HETATM 4134 O  O     . HOH J 7 .   ? 69.774 10.026  -8.651  1.00 25.51  ? 796 HOH A O     1 
HETATM 4135 O  O     . HOH J 7 .   ? 50.438 -13.139 -0.871  1.00 27.15  ? 797 HOH A O     1 
HETATM 4136 O  O     . HOH J 7 .   ? 60.332 9.200   6.779   1.00 33.91  ? 798 HOH A O     1 
HETATM 4137 O  O     . HOH J 7 .   ? 68.346 -26.232 -0.757  1.00 32.97  ? 799 HOH A O     1 
HETATM 4138 O  O     . HOH J 7 .   ? 47.693 15.858  -17.929 1.00 36.40  ? 800 HOH A O     1 
HETATM 4139 O  O     . HOH J 7 .   ? 56.394 1.178   13.079  1.00 26.87  ? 801 HOH A O     1 
HETATM 4140 O  O     . HOH J 7 .   ? 63.103 -23.658 3.598   1.00 24.92  ? 802 HOH A O     1 
HETATM 4141 O  O     . HOH J 7 .   ? 76.511 2.605   6.684   1.00 26.19  ? 803 HOH A O     1 
HETATM 4142 O  O     . HOH J 7 .   ? 57.716 23.349  14.272  1.00 24.98  ? 804 HOH A O     1 
HETATM 4143 O  O     . HOH J 7 .   ? 55.750 2.858   21.161  1.00 27.95  ? 805 HOH A O     1 
HETATM 4144 O  O     . HOH J 7 .   ? 34.884 16.697  18.841  1.00 43.17  ? 806 HOH A O     1 
HETATM 4145 O  O     . HOH J 7 .   ? 59.902 -31.636 3.755   1.00 30.70  ? 807 HOH A O     1 
HETATM 4146 O  O     . HOH J 7 .   ? 67.510 -8.373  9.815   1.00 20.19  ? 808 HOH A O     1 
HETATM 4147 O  O     . HOH J 7 .   ? 34.357 17.602  -12.935 1.00 35.22  ? 809 HOH A O     1 
HETATM 4148 O  O     . HOH J 7 .   ? 43.198 -16.327 15.328  1.00 39.85  ? 810 HOH A O     1 
HETATM 4149 O  O     . HOH J 7 .   ? 44.744 -17.067 -0.563  1.00 30.40  ? 811 HOH A O     1 
HETATM 4150 O  O     . HOH J 7 .   ? 27.678 6.800   -17.147 1.00 27.63  ? 812 HOH A O     1 
HETATM 4151 O  O     . HOH J 7 .   ? 41.273 -3.013  -22.809 1.00 27.54  ? 813 HOH A O     1 
HETATM 4152 O  O     . HOH J 7 .   ? 50.753 -6.354  -5.489  1.00 34.18  ? 814 HOH A O     1 
HETATM 4153 O  O     . HOH J 7 .   ? 61.297 -16.271 13.773  1.00 29.38  ? 815 HOH A O     1 
HETATM 4154 O  O     . HOH J 7 .   ? 60.463 9.734   22.263  1.00 32.19  ? 816 HOH A O     1 
HETATM 4155 O  O     . HOH J 7 .   ? 46.772 -18.708 -2.045  1.00 29.79  ? 817 HOH A O     1 
HETATM 4156 O  O     . HOH J 7 .   ? 53.354 24.130  4.110   1.00 24.64  ? 818 HOH A O     1 
HETATM 4157 O  O     . HOH J 7 .   ? 65.697 -25.975 0.653   1.00 33.42  ? 819 HOH A O     1 
HETATM 4158 O  O     . HOH J 7 .   ? 65.168 19.694  1.937   1.00 22.39  ? 820 HOH A O     1 
HETATM 4159 O  O     . HOH J 7 .   ? 73.215 2.032   7.854   1.00 27.54  ? 821 HOH A O     1 
HETATM 4160 O  O     . HOH J 7 .   ? 52.851 8.421   25.718  1.00 32.29  ? 822 HOH A O     1 
HETATM 4161 O  O     . HOH J 7 .   ? 69.965 -8.863  10.410  1.00 27.82  ? 823 HOH A O     1 
HETATM 4162 O  O     . HOH J 7 .   ? 68.442 10.202  7.754   1.00 34.12  ? 824 HOH A O     1 
HETATM 4163 O  O     . HOH J 7 .   ? 65.198 -34.894 -6.039  1.00 33.69  ? 825 HOH A O     1 
HETATM 4164 O  O     . HOH J 7 .   ? 39.632 18.766  18.363  1.00 37.71  ? 826 HOH A O     1 
HETATM 4165 O  O     . HOH J 7 .   ? 55.738 -33.017 4.922   1.00 28.66  ? 827 HOH A O     1 
HETATM 4166 O  O     . HOH J 7 .   ? 44.345 10.142  -24.614 1.00 33.02  ? 828 HOH A O     1 
HETATM 4167 O  O     . HOH J 7 .   ? 35.459 20.579  0.891   1.00 27.31  ? 829 HOH A O     1 
HETATM 4168 O  O     . HOH J 7 .   ? 52.974 -32.881 -3.121  1.00 35.32  ? 830 HOH A O     1 
HETATM 4169 O  O     . HOH J 7 .   ? 37.568 18.681  16.594  1.00 36.37  ? 831 HOH A O     1 
HETATM 4170 O  O     . HOH J 7 .   ? 58.476 18.038  19.610  1.00 29.85  ? 832 HOH A O     1 
HETATM 4171 O  O     . HOH J 7 .   ? 68.561 -1.587  -14.302 1.00 31.69  ? 833 HOH A O     1 
HETATM 4172 O  O     . HOH J 7 .   ? 38.513 10.427  9.644   1.00 22.91  ? 834 HOH A O     1 
HETATM 4173 O  O     . HOH J 7 .   ? 81.184 -16.110 7.246   1.00 28.96  ? 835 HOH A O     1 
HETATM 4174 O  O     . HOH J 7 .   ? 36.204 10.947  10.358  1.00 30.47  ? 836 HOH A O     1 
HETATM 4175 O  O     . HOH J 7 .   ? 42.101 5.925   21.351  1.00 34.56  ? 837 HOH A O     1 
HETATM 4176 O  O     . HOH J 7 .   ? 60.794 13.817  6.346   1.00 29.40  ? 838 HOH A O     1 
HETATM 4177 O  O     . HOH J 7 .   ? 38.817 -3.466  -20.165 1.00 25.17  ? 839 HOH A O     1 
HETATM 4178 O  O     . HOH J 7 .   ? 61.808 11.653  -12.253 1.00 29.77  ? 840 HOH A O     1 
HETATM 4179 O  O     . HOH J 7 .   ? 41.344 15.870  -22.908 1.00 23.66  ? 841 HOH A O     1 
HETATM 4180 O  O     . HOH J 7 .   ? 57.563 -18.838 22.131  1.00 26.21  ? 842 HOH A O     1 
HETATM 4181 O  O     . HOH J 7 .   ? 47.383 -30.707 13.412  1.00 31.59  ? 843 HOH A O     1 
HETATM 4182 O  O     . HOH J 7 .   ? 72.154 1.337   18.699  1.00 38.84  ? 844 HOH A O     1 
HETATM 4183 O  O     . HOH J 7 .   ? 29.363 3.730   6.541   1.00 31.12  ? 845 HOH A O     1 
HETATM 4184 O  O     . HOH J 7 .   ? 50.088 0.689   20.217  1.00 34.76  ? 846 HOH A O     1 
HETATM 4185 O  O     . HOH J 7 .   ? 81.569 -11.123 -8.485  1.00 42.53  ? 847 HOH A O     1 
HETATM 4186 O  O     . HOH J 7 .   ? 45.019 -14.848 13.205  1.00 35.01  ? 848 HOH A O     1 
HETATM 4187 O  O     . HOH J 7 .   ? 62.071 9.026   18.330  1.00 33.31  ? 849 HOH A O     1 
HETATM 4188 O  O     . HOH J 7 .   ? 39.190 0.294   -6.649  1.00 24.20  ? 850 HOH A O     1 
HETATM 4189 O  O     . HOH J 7 .   ? 82.900 -3.679  -4.516  1.00 31.23  ? 851 HOH A O     1 
HETATM 4190 O  O     . HOH J 7 .   ? 48.937 13.923  28.223  1.00 28.62  ? 852 HOH A O     1 
HETATM 4191 O  O     . HOH J 7 .   ? 61.726 -31.760 -10.510 1.00 35.82  ? 853 HOH A O     1 
HETATM 4192 O  O     . HOH J 7 .   ? 67.600 6.455   9.659   1.00 32.10  ? 854 HOH A O     1 
HETATM 4193 O  O     . HOH J 7 .   ? 53.733 -8.544  8.701   1.00 30.50  ? 855 HOH A O     1 
HETATM 4194 O  O     . HOH J 7 .   ? 68.058 -5.573  -17.500 1.00 41.03  ? 856 HOH A O     1 
HETATM 4195 O  O     . HOH J 7 .   ? 35.262 21.860  -2.148  1.00 30.22  ? 857 HOH A O     1 
HETATM 4196 O  O     . HOH J 7 .   ? 73.865 -20.426 1.196   1.00 34.91  ? 858 HOH A O     1 
HETATM 4197 O  O     . HOH J 7 .   ? 38.631 -25.296 5.759   1.00 36.02  ? 859 HOH A O     1 
HETATM 4198 O  O     . HOH J 7 .   ? 41.618 19.995  4.806   1.00 24.28  ? 860 HOH A O     1 
HETATM 4199 O  O     . HOH J 7 .   ? 62.602 -5.324  -15.688 1.00 38.44  ? 861 HOH A O     1 
HETATM 4200 O  O     . HOH J 7 .   ? 60.401 6.182   -15.652 1.00 26.87  ? 862 HOH A O     1 
HETATM 4201 O  O     . HOH J 7 .   ? 69.746 5.567   0.827   1.00 30.25  ? 863 HOH A O     1 
HETATM 4202 O  O     . HOH J 7 .   ? 69.237 7.792   3.802   1.00 28.73  ? 864 HOH A O     1 
HETATM 4203 O  O     . HOH J 7 .   ? 46.517 1.945   -4.069  1.00 26.63  ? 865 HOH A O     1 
HETATM 4204 O  O     . HOH J 7 .   ? 19.699 10.064  8.707   1.00 41.04  ? 866 HOH A O     1 
HETATM 4205 O  O     . HOH J 7 .   ? 45.697 2.093   18.265  1.00 32.41  ? 867 HOH A O     1 
HETATM 4206 O  O     . HOH J 7 .   ? 63.775 -17.237 14.932  1.00 26.50  ? 868 HOH A O     1 
HETATM 4207 O  O     . HOH J 7 .   ? 66.767 4.079   10.647  1.00 30.42  ? 869 HOH A O     1 
HETATM 4208 O  O     . HOH J 7 .   ? 83.559 -11.237 9.090   1.00 37.29  ? 870 HOH A O     1 
HETATM 4209 O  O     . HOH J 7 .   ? 55.320 -17.424 -13.339 1.00 35.03  ? 871 HOH A O     1 
HETATM 4210 O  O     . HOH J 7 .   ? 83.436 -8.152  0.571   1.00 33.21  ? 872 HOH A O     1 
HETATM 4211 O  O     . HOH J 7 .   ? 39.393 -2.043  -14.196 1.00 30.50  ? 873 HOH A O     1 
HETATM 4212 O  O     . HOH J 7 .   ? 70.130 -21.991 0.573   1.00 29.58  ? 874 HOH A O     1 
HETATM 4213 O  O     . HOH J 7 .   ? 25.446 14.861  5.144   1.00 37.05  ? 875 HOH A O     1 
HETATM 4214 O  O     . HOH J 7 .   ? 38.782 -28.410 7.158   1.00 35.77  ? 876 HOH A O     1 
HETATM 4215 O  O     . HOH J 7 .   ? 61.818 1.711   13.964  1.00 33.52  ? 877 HOH A O     1 
HETATM 4216 O  O     . HOH J 7 .   ? 39.927 -22.477 2.936   1.00 29.40  ? 878 HOH A O     1 
HETATM 4217 O  O     . HOH J 7 .   ? 55.335 -1.290  -14.862 1.00 24.99  ? 879 HOH A O     1 
HETATM 4218 O  O     . HOH J 7 .   ? 51.491 5.229   25.041  1.00 33.77  ? 880 HOH A O     1 
HETATM 4219 O  O     . HOH J 7 .   ? 37.540 13.902  21.811  1.00 35.33  ? 881 HOH A O     1 
HETATM 4220 O  O     . HOH J 7 .   ? 43.644 17.511  18.017  1.00 28.50  ? 882 HOH A O     1 
HETATM 4221 O  O     . HOH J 7 .   ? 64.486 -15.400 13.600  1.00 30.14  ? 883 HOH A O     1 
HETATM 4222 O  O     . HOH J 7 .   ? 40.827 -18.265 0.903   1.00 28.87  ? 884 HOH A O     1 
HETATM 4223 O  O     . HOH J 7 .   ? 51.023 5.821   -22.920 1.00 34.36  ? 885 HOH A O     1 
HETATM 4224 O  O     . HOH J 7 .   ? 62.595 15.685  5.339   1.00 37.07  ? 886 HOH A O     1 
HETATM 4225 O  O     . HOH J 7 .   ? 64.069 22.443  8.152   1.00 34.64  ? 887 HOH A O     1 
HETATM 4226 O  O     . HOH J 7 .   ? 62.059 24.494  9.977   1.00 32.81  ? 888 HOH A O     1 
HETATM 4227 O  O     . HOH J 7 .   ? 30.942 21.623  -3.032  1.00 30.48  ? 889 HOH A O     1 
HETATM 4228 O  O     . HOH J 7 .   ? 66.324 3.443   -17.591 1.00 32.18  ? 890 HOH A O     1 
HETATM 4229 O  O     . HOH J 7 .   ? 66.474 -2.351  12.564  1.00 30.69  ? 891 HOH A O     1 
HETATM 4230 O  O     . HOH J 7 .   ? 82.399 -10.713 -1.250  1.00 37.90  ? 892 HOH A O     1 
HETATM 4231 O  O     . HOH J 7 .   ? 38.406 -22.683 11.071  1.00 34.45  ? 893 HOH A O     1 
HETATM 4232 O  O     . HOH J 7 .   ? 42.827 -20.432 17.047  1.00 32.72  ? 894 HOH A O     1 
HETATM 4233 O  O     . HOH J 7 .   ? 21.621 13.420  6.436   1.00 37.25  ? 895 HOH A O     1 
HETATM 4234 O  O     . HOH J 7 .   ? 22.029 12.326  -9.546  1.00 30.62  ? 896 HOH A O     1 
HETATM 4235 O  O     . HOH J 7 .   ? 31.101 1.864   -22.307 1.00 29.64  ? 897 HOH A O     1 
HETATM 4236 O  O     . HOH J 7 .   ? 33.860 3.155   2.739   1.00 30.15  ? 898 HOH A O     1 
HETATM 4237 O  O     . HOH J 7 .   ? 69.814 -18.775 -9.763  1.00 33.31  ? 899 HOH A O     1 
HETATM 4238 O  O     . HOH J 7 .   ? 65.484 19.796  6.430   1.00 27.08  ? 900 HOH A O     1 
HETATM 4239 O  O     . HOH J 7 .   ? 51.433 13.458  -11.344 1.00 28.16  ? 901 HOH A O     1 
HETATM 4240 O  O     . HOH J 7 .   ? 71.356 8.907   -6.894  1.00 27.83  ? 902 HOH A O     1 
HETATM 4241 O  O     . HOH J 7 .   ? 79.513 1.613   4.411   1.00 35.31  ? 903 HOH A O     1 
HETATM 4242 O  O     . HOH J 7 .   ? 71.467 -12.397 14.737  1.00 34.60  ? 904 HOH A O     1 
HETATM 4243 O  O     . HOH J 7 .   ? 49.048 -23.924 19.142  1.00 34.02  ? 905 HOH A O     1 
HETATM 4244 O  O     . HOH J 7 .   ? 56.094 -33.269 2.279   1.00 31.86  ? 906 HOH A O     1 
HETATM 4245 O  O     . HOH J 7 .   ? 41.117 -29.727 12.913  1.00 29.62  ? 907 HOH A O     1 
HETATM 4246 O  O     . HOH J 7 .   ? 49.926 -15.961 -9.121  1.00 35.44  ? 908 HOH A O     1 
HETATM 4247 O  O     . HOH J 7 .   ? 32.239 3.334   -23.705 1.00 34.60  ? 909 HOH A O     1 
HETATM 4248 O  O     . HOH J 7 .   ? 46.833 0.907   14.268  1.00 35.83  ? 910 HOH A O     1 
HETATM 4249 O  O     . HOH J 7 .   ? 57.586 5.446   -15.904 1.00 30.93  ? 911 HOH A O     1 
HETATM 4250 O  O     . HOH J 7 .   ? 85.703 -5.003  -3.292  1.00 41.07  ? 912 HOH A O     1 
HETATM 4251 O  O     . HOH J 7 .   ? 48.018 16.759  28.024  1.00 34.18  ? 913 HOH A O     1 
HETATM 4252 O  O     . HOH J 7 .   ? 33.228 2.443   -0.267  1.00 28.56  ? 914 HOH A O     1 
HETATM 4253 O  O     . HOH J 7 .   ? 45.364 8.297   -13.312 1.00 32.89  ? 915 HOH A O     1 
HETATM 4254 O  O     . HOH J 7 .   ? 44.728 -33.098 -2.988  1.00 27.56  ? 916 HOH A O     1 
HETATM 4255 O  O     . HOH J 7 .   ? 52.259 -1.311  8.626   1.00 39.59  ? 917 HOH A O     1 
HETATM 4256 O  O     . HOH J 7 .   ? 38.138 17.097  -6.916  1.00 35.46  ? 918 HOH A O     1 
HETATM 4257 O  O     . HOH J 7 .   ? 45.768 18.209  -3.317  1.00 27.60  ? 919 HOH A O     1 
HETATM 4258 O  O     . HOH J 7 .   ? 85.364 -9.824  7.886   1.00 33.82  ? 920 HOH A O     1 
HETATM 4259 O  O     . HOH J 7 .   ? 43.282 -15.898 -2.606  1.00 37.16  ? 921 HOH A O     1 
HETATM 4260 O  O     . HOH J 7 .   ? 61.388 7.259   22.963  1.00 37.43  ? 922 HOH A O     1 
HETATM 4261 O  O     . HOH J 7 .   ? 45.949 5.432   -5.255  1.00 23.58  ? 923 HOH A O     1 
HETATM 4262 O  O     . HOH J 7 .   ? 54.819 -0.715  5.615   1.00 18.45  ? 924 HOH A O     1 
HETATM 4263 O  O     . HOH J 7 .   ? 60.566 -17.648 -7.440  1.00 23.02  ? 925 HOH A O     1 
HETATM 4264 O  O     . HOH J 7 .   ? 51.741 -8.571  4.798   1.00 23.04  ? 926 HOH A O     1 
HETATM 4265 O  O     . HOH J 7 .   ? 51.456 21.801  6.969   1.00 25.38  ? 927 HOH A O     1 
HETATM 4266 O  O     . HOH J 7 .   ? 76.498 -18.012 0.349   1.00 28.84  ? 928 HOH A O     1 
HETATM 4267 O  O     . HOH J 7 .   ? 73.555 -19.563 -2.895  1.00 25.41  ? 929 HOH A O     1 
HETATM 4268 O  O     . HOH J 7 .   ? 52.944 -1.050  3.578   1.00 20.04  ? 930 HOH A O     1 
HETATM 4269 O  O     . HOH J 7 .   ? 47.136 3.687   1.088   1.00 18.62  ? 931 HOH A O     1 
HETATM 4270 O  O     . HOH J 7 .   ? 43.354 5.291   -9.005  1.00 20.04  ? 932 HOH A O     1 
HETATM 4271 O  O     . HOH J 7 .   ? 35.587 5.770   18.299  1.00 43.67  ? 933 HOH A O     1 
HETATM 4272 O  O     . HOH J 7 .   ? 47.206 -0.761  -8.629  1.00 28.82  ? 934 HOH A O     1 
HETATM 4273 O  O     . HOH J 7 .   ? 31.976 15.044  11.363  1.00 48.88  ? 935 HOH A O     1 
HETATM 4274 O  O     . HOH J 7 .   ? 43.581 9.732   -10.017 1.00 20.34  ? 936 HOH A O     1 
HETATM 4275 O  O     . HOH J 7 .   ? 61.986 15.822  2.499   1.00 26.29  ? 937 HOH A O     1 
HETATM 4276 O  O     . HOH J 7 .   ? 40.148 18.433  7.600   1.00 27.21  ? 938 HOH A O     1 
HETATM 4277 O  O     . HOH J 7 .   ? 77.483 -17.428 -2.970  1.00 32.46  ? 939 HOH A O     1 
HETATM 4278 O  O     . HOH J 7 .   ? 46.427 -0.886  -4.639  1.00 27.30  ? 940 HOH A O     1 
HETATM 4279 O  O     . HOH J 7 .   ? 57.485 0.079   10.652  1.00 31.13  ? 941 HOH A O     1 
HETATM 4280 O  O     . HOH J 7 .   ? 57.985 -2.594  10.176  1.00 32.05  ? 942 HOH A O     1 
HETATM 4281 O  O     . HOH J 7 .   ? 56.368 -2.936  7.807   1.00 30.17  ? 943 HOH A O     1 
HETATM 4282 O  O     . HOH J 7 .   ? 32.888 10.642  5.315   1.00 19.21  ? 944 HOH A O     1 
HETATM 4283 O  O     . HOH J 7 .   ? 44.855 6.135   -2.956  1.00 20.59  ? 945 HOH A O     1 
HETATM 4284 O  O     . HOH K 7 .   ? 40.674 11.288  -3.493  1.00 15.73  ? 101 HOH T O     1 
HETATM 4285 O  O     . HOH K 7 .   ? 35.006 5.535   2.021   1.00 18.69  ? 102 HOH T O     1 
HETATM 4286 O  O     . HOH K 7 .   ? 36.352 -1.322  2.442   1.00 22.88  ? 103 HOH T O     1 
HETATM 4287 O  O     . HOH K 7 .   ? 45.709 -2.547  -3.044  1.00 27.87  ? 104 HOH T O     1 
HETATM 4288 O  O     . HOH K 7 .   ? 37.749 -1.470  5.403   1.00 38.85  ? 105 HOH T O     1 
HETATM 4289 O  O     . HOH K 7 .   ? 41.393 -20.086 -3.267  1.00 27.84  ? 106 HOH T O     1 
HETATM 4290 O  O     . HOH K 7 .   ? 35.505 10.821  1.024   1.00 26.79  ? 107 HOH T O     1 
HETATM 4291 O  O     . HOH K 7 .   ? 40.792 -3.753  -9.289  1.00 30.27  ? 108 HOH T O     1 
HETATM 4292 O  O     . HOH K 7 .   ? 36.933 -23.080 -5.795  1.00 27.44  ? 109 HOH T O     1 
HETATM 4293 O  O     . HOH K 7 .   ? 44.069 -8.800  -3.596  1.00 23.97  ? 110 HOH T O     1 
HETATM 4294 O  O     . HOH K 7 .   ? 35.658 2.541   5.986   1.00 32.52  ? 111 HOH T O     1 
HETATM 4295 O  O     . HOH K 7 .   ? 38.755 2.877   -5.724  1.00 23.48  ? 112 HOH T O     1 
HETATM 4296 O  O     . HOH K 7 .   ? 36.763 -2.484  -4.121  1.00 22.95  ? 113 HOH T O     1 
HETATM 4297 O  O     . HOH K 7 .   ? 37.769 -4.045  -8.255  1.00 35.28  ? 114 HOH T O     1 
HETATM 4298 O  O     . HOH K 7 .   ? 38.553 -2.360  -6.140  1.00 26.08  ? 115 HOH T O     1 
HETATM 4299 O  O     . HOH K 7 .   ? 36.607 -0.229  -1.998  1.00 31.18  ? 116 HOH T O     1 
HETATM 4300 O  O     . HOH K 7 .   ? 37.795 -12.771 -11.138 1.00 29.98  ? 117 HOH T O     1 
HETATM 4301 O  O     . HOH K 7 .   ? 42.154 -7.370  -10.524 1.00 29.48  ? 118 HOH T O     1 
HETATM 4302 O  O     A HOH K 7 .   ? 37.316 0.763   5.719   0.68 23.13  ? 119 HOH T O     1 
HETATM 4303 O  O     . HOH K 7 .   ? 42.243 -11.662 -11.786 1.00 37.20  ? 120 HOH T O     1 
HETATM 4304 O  O     . HOH K 7 .   ? 46.959 -8.826  -4.441  1.00 30.69  ? 121 HOH T O     1 
HETATM 4305 O  O     . HOH K 7 .   ? 40.979 -22.487 -7.291  1.00 31.51  ? 122 HOH T O     1 
HETATM 4306 O  O     . HOH K 7 .   ? 31.389 -16.456 -4.280  1.00 33.62  ? 123 HOH T O     1 
HETATM 4307 O  O     . HOH K 7 .   ? 34.163 -0.435  -1.021  1.00 43.91  ? 124 HOH T O     1 
HETATM 4308 O  O     . HOH K 7 .   ? 42.266 -11.616 -3.519  1.00 28.41  ? 125 HOH T O     1 
HETATM 4309 O  O     . HOH K 7 .   ? 38.526 -10.233 -9.986  1.00 30.92  ? 126 HOH T O     1 
HETATM 4310 O  O     . HOH K 7 .   ? 37.980 2.463   -3.241  1.00 22.65  ? 127 HOH T O     1 
HETATM 4311 O  O     . HOH K 7 .   ? 45.299 0.539   -1.575  1.00 29.13  ? 128 HOH T O     1 
HETATM 4312 O  O     . HOH L 7 .   ? 36.670 -3.792  1.458   1.00 22.68  ? 101 HOH P O     1 
HETATM 4313 O  O     . HOH L 7 .   ? 49.579 -9.983  6.720   1.00 20.16  ? 102 HOH P O     1 
HETATM 4314 O  O     . HOH L 7 .   ? 41.939 -11.350 -0.984  1.00 24.52  ? 103 HOH P O     1 
HETATM 4315 O  O     . HOH L 7 .   ? 42.898 -8.811  7.170   1.00 24.32  ? 104 HOH P O     1 
HETATM 4316 O  O     . HOH L 7 .   ? 41.602 -15.538 1.822   1.00 18.94  ? 105 HOH P O     1 
HETATM 4317 O  O     . HOH L 7 .   ? 44.091 -12.728 -0.297  1.00 21.12  ? 106 HOH P O     1 
HETATM 4318 O  O     . HOH L 7 .   ? 44.578 -8.493  -1.035  1.00 21.20  ? 107 HOH P O     1 
HETATM 4319 O  O     . HOH L 7 .   ? 46.428 -2.554  -0.468  1.00 25.88  ? 108 HOH P O     1 
HETATM 4320 O  O     . HOH L 7 .   ? 40.298 -9.282  5.943   1.00 31.33  ? 109 HOH P O     1 
HETATM 4321 O  O     . HOH L 7 .   ? 45.486 5.804   -0.139  1.00 17.62  ? 110 HOH P O     1 
HETATM 4322 O  O     . HOH L 7 .   ? 45.892 -10.725 0.005   1.00 23.04  ? 111 HOH P O     1 
HETATM 4323 O  O     . HOH L 7 .   ? 37.414 -5.879  3.200   1.00 26.91  ? 112 HOH P O     1 
HETATM 4324 O  O     . HOH L 7 .   ? 40.359 -13.675 0.030   1.00 26.17  ? 113 HOH P O     1 
HETATM 4325 O  O     . HOH L 7 .   ? 34.603 -8.992  -11.108 1.00 36.54  ? 114 HOH P O     1 
HETATM 4326 O  O     . HOH L 7 .   ? 41.917 -1.118  6.257   1.00 29.90  ? 115 HOH P O     1 
HETATM 4327 O  O     . HOH L 7 .   ? 31.488 -14.310 -2.789  1.00 35.59  ? 116 HOH P O     1 
HETATM 4328 O  O     . HOH L 7 .   ? 32.281 -7.741  -11.880 1.00 35.28  ? 117 HOH P O     1 
HETATM 4329 O  O     . HOH L 7 .   ? 40.500 -5.374  5.894   1.00 34.87  ? 118 HOH P O     1 
HETATM 4330 O  O     . HOH L 7 .   ? 46.377 -7.641  7.845   1.00 34.36  ? 119 HOH P O     1 
HETATM 4331 O  O     . HOH L 7 .   ? 39.099 -3.741  5.353   1.00 38.02  ? 120 HOH P O     1 
HETATM 4332 O  O     . HOH L 7 .   ? 35.010 -4.327  -0.707  1.00 25.73  ? 121 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DT  1   3   3   DT  DT  T . n 
B 2 2   P9G 2   4   4   P9G P9G T . n 
B 2 3   DC  3   5   5   DC  DC  T . n 
B 2 4   DT  4   6   6   DT  DT  T . n 
B 2 5   DC  5   7   7   DC  DC  T . n 
B 2 6   DA  6   8   8   DA  DA  T . n 
B 2 7   DC  7   9   9   DC  DC  T . n 
B 2 8   DA  8   10  10  DA  DA  T . n 
B 2 9   DC  9   11  11  DC  DC  T . n 
B 2 10  DT  10  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DT  3   3   3   DT  DT  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DG  6   6   6   DG  DG  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DG  8   8   8   DG  DG  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 0KX 1   501 433  0KX 0KX A . 
E 5 MG  1   502 434  MG  MG  A . 
F 5 MG  1   503 435  MG  MG  A . 
G 6 GOL 1   504 503  GOL GOL A . 
H 6 GOL 1   505 504  GOL GOL A . 
I 6 GOL 1   506 505  GOL GOL A . 
J 7 HOH 1   601 601  HOH HOH A . 
J 7 HOH 2   602 602  HOH HOH A . 
J 7 HOH 3   603 603  HOH HOH A . 
J 7 HOH 4   604 604  HOH HOH A . 
J 7 HOH 5   605 605  HOH HOH A . 
J 7 HOH 6   606 606  HOH HOH A . 
J 7 HOH 7   607 607  HOH HOH A . 
J 7 HOH 8   608 608  HOH HOH A . 
J 7 HOH 9   609 609  HOH HOH A . 
J 7 HOH 10  610 610  HOH HOH A . 
J 7 HOH 11  611 611  HOH HOH A . 
J 7 HOH 12  612 612  HOH HOH A . 
J 7 HOH 13  613 613  HOH HOH A . 
J 7 HOH 14  614 614  HOH HOH A . 
J 7 HOH 15  615 615  HOH HOH A . 
J 7 HOH 16  616 616  HOH HOH A . 
J 7 HOH 17  617 617  HOH HOH A . 
J 7 HOH 18  618 618  HOH HOH A . 
J 7 HOH 19  619 619  HOH HOH A . 
J 7 HOH 20  620 620  HOH HOH A . 
J 7 HOH 21  621 621  HOH HOH A . 
J 7 HOH 22  622 622  HOH HOH A . 
J 7 HOH 23  623 623  HOH HOH A . 
J 7 HOH 24  624 624  HOH HOH A . 
J 7 HOH 25  625 625  HOH HOH A . 
J 7 HOH 26  626 626  HOH HOH A . 
J 7 HOH 27  627 627  HOH HOH A . 
J 7 HOH 28  628 628  HOH HOH A . 
J 7 HOH 29  629 629  HOH HOH A . 
J 7 HOH 30  630 630  HOH HOH A . 
J 7 HOH 31  631 631  HOH HOH A . 
J 7 HOH 32  632 632  HOH HOH A . 
J 7 HOH 33  633 633  HOH HOH A . 
J 7 HOH 34  634 634  HOH HOH A . 
J 7 HOH 35  635 635  HOH HOH A . 
J 7 HOH 36  636 636  HOH HOH A . 
J 7 HOH 37  637 637  HOH HOH A . 
J 7 HOH 38  638 638  HOH HOH A . 
J 7 HOH 39  639 639  HOH HOH A . 
J 7 HOH 40  640 640  HOH HOH A . 
J 7 HOH 41  641 641  HOH HOH A . 
J 7 HOH 42  642 642  HOH HOH A . 
J 7 HOH 43  643 643  HOH HOH A . 
J 7 HOH 44  644 644  HOH HOH A . 
J 7 HOH 45  645 645  HOH HOH A . 
J 7 HOH 46  646 646  HOH HOH A . 
J 7 HOH 47  647 647  HOH HOH A . 
J 7 HOH 48  648 648  HOH HOH A . 
J 7 HOH 49  649 650  HOH HOH A . 
J 7 HOH 50  650 652  HOH HOH A . 
J 7 HOH 51  651 654  HOH HOH A . 
J 7 HOH 52  652 655  HOH HOH A . 
J 7 HOH 53  653 656  HOH HOH A . 
J 7 HOH 54  654 657  HOH HOH A . 
J 7 HOH 55  655 658  HOH HOH A . 
J 7 HOH 56  656 659  HOH HOH A . 
J 7 HOH 57  657 660  HOH HOH A . 
J 7 HOH 58  658 661  HOH HOH A . 
J 7 HOH 59  659 662  HOH HOH A . 
J 7 HOH 60  660 663  HOH HOH A . 
J 7 HOH 61  661 664  HOH HOH A . 
J 7 HOH 62  662 665  HOH HOH A . 
J 7 HOH 63  663 666  HOH HOH A . 
J 7 HOH 64  664 667  HOH HOH A . 
J 7 HOH 65  665 668  HOH HOH A . 
J 7 HOH 66  666 669  HOH HOH A . 
J 7 HOH 67  667 670  HOH HOH A . 
J 7 HOH 68  668 671  HOH HOH A . 
J 7 HOH 69  669 672  HOH HOH A . 
J 7 HOH 70  670 673  HOH HOH A . 
J 7 HOH 71  671 674  HOH HOH A . 
J 7 HOH 72  672 675  HOH HOH A . 
J 7 HOH 73  673 676  HOH HOH A . 
J 7 HOH 74  674 677  HOH HOH A . 
J 7 HOH 75  675 678  HOH HOH A . 
J 7 HOH 76  676 679  HOH HOH A . 
J 7 HOH 77  677 681  HOH HOH A . 
J 7 HOH 78  678 682  HOH HOH A . 
J 7 HOH 79  679 683  HOH HOH A . 
J 7 HOH 80  680 685  HOH HOH A . 
J 7 HOH 81  681 686  HOH HOH A . 
J 7 HOH 82  682 687  HOH HOH A . 
J 7 HOH 83  683 688  HOH HOH A . 
J 7 HOH 84  684 689  HOH HOH A . 
J 7 HOH 85  685 690  HOH HOH A . 
J 7 HOH 86  686 691  HOH HOH A . 
J 7 HOH 87  687 692  HOH HOH A . 
J 7 HOH 88  688 693  HOH HOH A . 
J 7 HOH 89  689 695  HOH HOH A . 
J 7 HOH 90  690 696  HOH HOH A . 
J 7 HOH 91  691 697  HOH HOH A . 
J 7 HOH 92  692 698  HOH HOH A . 
J 7 HOH 93  693 699  HOH HOH A . 
J 7 HOH 94  694 700  HOH HOH A . 
J 7 HOH 95  695 701  HOH HOH A . 
J 7 HOH 96  696 702  HOH HOH A . 
J 7 HOH 97  697 703  HOH HOH A . 
J 7 HOH 98  698 704  HOH HOH A . 
J 7 HOH 99  699 705  HOH HOH A . 
J 7 HOH 100 700 706  HOH HOH A . 
J 7 HOH 101 701 707  HOH HOH A . 
J 7 HOH 102 702 708  HOH HOH A . 
J 7 HOH 103 703 710  HOH HOH A . 
J 7 HOH 104 704 711  HOH HOH A . 
J 7 HOH 105 705 712  HOH HOH A . 
J 7 HOH 106 706 713  HOH HOH A . 
J 7 HOH 107 707 714  HOH HOH A . 
J 7 HOH 108 708 715  HOH HOH A . 
J 7 HOH 109 709 716  HOH HOH A . 
J 7 HOH 110 710 717  HOH HOH A . 
J 7 HOH 111 711 718  HOH HOH A . 
J 7 HOH 112 712 719  HOH HOH A . 
J 7 HOH 113 713 720  HOH HOH A . 
J 7 HOH 114 714 721  HOH HOH A . 
J 7 HOH 115 715 722  HOH HOH A . 
J 7 HOH 116 716 723  HOH HOH A . 
J 7 HOH 117 717 725  HOH HOH A . 
J 7 HOH 118 718 726  HOH HOH A . 
J 7 HOH 119 719 727  HOH HOH A . 
J 7 HOH 120 720 728  HOH HOH A . 
J 7 HOH 121 721 729  HOH HOH A . 
J 7 HOH 122 722 730  HOH HOH A . 
J 7 HOH 123 723 731  HOH HOH A . 
J 7 HOH 124 724 732  HOH HOH A . 
J 7 HOH 125 725 733  HOH HOH A . 
J 7 HOH 126 726 734  HOH HOH A . 
J 7 HOH 127 727 735  HOH HOH A . 
J 7 HOH 128 728 736  HOH HOH A . 
J 7 HOH 129 729 737  HOH HOH A . 
J 7 HOH 130 730 738  HOH HOH A . 
J 7 HOH 131 731 739  HOH HOH A . 
J 7 HOH 132 732 740  HOH HOH A . 
J 7 HOH 133 733 741  HOH HOH A . 
J 7 HOH 134 734 742  HOH HOH A . 
J 7 HOH 135 735 743  HOH HOH A . 
J 7 HOH 136 736 745  HOH HOH A . 
J 7 HOH 137 737 746  HOH HOH A . 
J 7 HOH 138 738 747  HOH HOH A . 
J 7 HOH 139 739 748  HOH HOH A . 
J 7 HOH 140 740 749  HOH HOH A . 
J 7 HOH 141 741 750  HOH HOH A . 
J 7 HOH 142 742 751  HOH HOH A . 
J 7 HOH 143 743 752  HOH HOH A . 
J 7 HOH 144 744 753  HOH HOH A . 
J 7 HOH 145 745 754  HOH HOH A . 
J 7 HOH 146 746 755  HOH HOH A . 
J 7 HOH 147 747 756  HOH HOH A . 
J 7 HOH 148 748 757  HOH HOH A . 
J 7 HOH 149 749 758  HOH HOH A . 
J 7 HOH 150 750 759  HOH HOH A . 
J 7 HOH 151 751 760  HOH HOH A . 
J 7 HOH 152 752 761  HOH HOH A . 
J 7 HOH 153 753 762  HOH HOH A . 
J 7 HOH 154 754 763  HOH HOH A . 
J 7 HOH 155 755 764  HOH HOH A . 
J 7 HOH 156 756 765  HOH HOH A . 
J 7 HOH 157 757 766  HOH HOH A . 
J 7 HOH 158 758 768  HOH HOH A . 
J 7 HOH 159 759 769  HOH HOH A . 
J 7 HOH 160 760 770  HOH HOH A . 
J 7 HOH 161 761 771  HOH HOH A . 
J 7 HOH 162 762 772  HOH HOH A . 
J 7 HOH 163 763 773  HOH HOH A . 
J 7 HOH 164 764 774  HOH HOH A . 
J 7 HOH 165 765 775  HOH HOH A . 
J 7 HOH 166 766 776  HOH HOH A . 
J 7 HOH 167 767 777  HOH HOH A . 
J 7 HOH 168 768 778  HOH HOH A . 
J 7 HOH 169 769 779  HOH HOH A . 
J 7 HOH 170 770 780  HOH HOH A . 
J 7 HOH 171 771 781  HOH HOH A . 
J 7 HOH 172 772 782  HOH HOH A . 
J 7 HOH 173 773 784  HOH HOH A . 
J 7 HOH 174 774 785  HOH HOH A . 
J 7 HOH 175 775 786  HOH HOH A . 
J 7 HOH 176 776 787  HOH HOH A . 
J 7 HOH 177 777 788  HOH HOH A . 
J 7 HOH 178 778 789  HOH HOH A . 
J 7 HOH 179 779 790  HOH HOH A . 
J 7 HOH 180 780 792  HOH HOH A . 
J 7 HOH 181 781 794  HOH HOH A . 
J 7 HOH 182 782 795  HOH HOH A . 
J 7 HOH 183 783 796  HOH HOH A . 
J 7 HOH 184 784 797  HOH HOH A . 
J 7 HOH 185 785 798  HOH HOH A . 
J 7 HOH 186 786 799  HOH HOH A . 
J 7 HOH 187 787 800  HOH HOH A . 
J 7 HOH 188 788 801  HOH HOH A . 
J 7 HOH 189 789 802  HOH HOH A . 
J 7 HOH 190 790 803  HOH HOH A . 
J 7 HOH 191 791 804  HOH HOH A . 
J 7 HOH 192 792 805  HOH HOH A . 
J 7 HOH 193 793 806  HOH HOH A . 
J 7 HOH 194 794 807  HOH HOH A . 
J 7 HOH 195 795 808  HOH HOH A . 
J 7 HOH 196 796 809  HOH HOH A . 
J 7 HOH 197 797 810  HOH HOH A . 
J 7 HOH 198 798 811  HOH HOH A . 
J 7 HOH 199 799 812  HOH HOH A . 
J 7 HOH 200 800 813  HOH HOH A . 
J 7 HOH 201 801 814  HOH HOH A . 
J 7 HOH 202 802 815  HOH HOH A . 
J 7 HOH 203 803 816  HOH HOH A . 
J 7 HOH 204 804 818  HOH HOH A . 
J 7 HOH 205 805 819  HOH HOH A . 
J 7 HOH 206 806 820  HOH HOH A . 
J 7 HOH 207 807 821  HOH HOH A . 
J 7 HOH 208 808 822  HOH HOH A . 
J 7 HOH 209 809 824  HOH HOH A . 
J 7 HOH 210 810 825  HOH HOH A . 
J 7 HOH 211 811 826  HOH HOH A . 
J 7 HOH 212 812 827  HOH HOH A . 
J 7 HOH 213 813 828  HOH HOH A . 
J 7 HOH 214 814 829  HOH HOH A . 
J 7 HOH 215 815 831  HOH HOH A . 
J 7 HOH 216 816 833  HOH HOH A . 
J 7 HOH 217 817 834  HOH HOH A . 
J 7 HOH 218 818 835  HOH HOH A . 
J 7 HOH 219 819 836  HOH HOH A . 
J 7 HOH 220 820 837  HOH HOH A . 
J 7 HOH 221 821 839  HOH HOH A . 
J 7 HOH 222 822 840  HOH HOH A . 
J 7 HOH 223 823 841  HOH HOH A . 
J 7 HOH 224 824 842  HOH HOH A . 
J 7 HOH 225 825 843  HOH HOH A . 
J 7 HOH 226 826 844  HOH HOH A . 
J 7 HOH 227 827 845  HOH HOH A . 
J 7 HOH 228 828 847  HOH HOH A . 
J 7 HOH 229 829 849  HOH HOH A . 
J 7 HOH 230 830 850  HOH HOH A . 
J 7 HOH 231 831 852  HOH HOH A . 
J 7 HOH 232 832 853  HOH HOH A . 
J 7 HOH 233 833 854  HOH HOH A . 
J 7 HOH 234 834 855  HOH HOH A . 
J 7 HOH 235 835 856  HOH HOH A . 
J 7 HOH 236 836 857  HOH HOH A . 
J 7 HOH 237 837 858  HOH HOH A . 
J 7 HOH 238 838 859  HOH HOH A . 
J 7 HOH 239 839 860  HOH HOH A . 
J 7 HOH 240 840 861  HOH HOH A . 
J 7 HOH 241 841 862  HOH HOH A . 
J 7 HOH 242 842 863  HOH HOH A . 
J 7 HOH 243 843 864  HOH HOH A . 
J 7 HOH 244 844 865  HOH HOH A . 
J 7 HOH 245 845 866  HOH HOH A . 
J 7 HOH 246 846 867  HOH HOH A . 
J 7 HOH 247 847 868  HOH HOH A . 
J 7 HOH 248 848 869  HOH HOH A . 
J 7 HOH 249 849 870  HOH HOH A . 
J 7 HOH 250 850 872  HOH HOH A . 
J 7 HOH 251 851 875  HOH HOH A . 
J 7 HOH 252 852 876  HOH HOH A . 
J 7 HOH 253 853 878  HOH HOH A . 
J 7 HOH 254 854 880  HOH HOH A . 
J 7 HOH 255 855 881  HOH HOH A . 
J 7 HOH 256 856 882  HOH HOH A . 
J 7 HOH 257 857 883  HOH HOH A . 
J 7 HOH 258 858 884  HOH HOH A . 
J 7 HOH 259 859 885  HOH HOH A . 
J 7 HOH 260 860 886  HOH HOH A . 
J 7 HOH 261 861 887  HOH HOH A . 
J 7 HOH 262 862 888  HOH HOH A . 
J 7 HOH 263 863 890  HOH HOH A . 
J 7 HOH 264 864 891  HOH HOH A . 
J 7 HOH 265 865 892  HOH HOH A . 
J 7 HOH 266 866 893  HOH HOH A . 
J 7 HOH 267 867 894  HOH HOH A . 
J 7 HOH 268 868 895  HOH HOH A . 
J 7 HOH 269 869 896  HOH HOH A . 
J 7 HOH 270 870 897  HOH HOH A . 
J 7 HOH 271 871 898  HOH HOH A . 
J 7 HOH 272 872 901  HOH HOH A . 
J 7 HOH 273 873 902  HOH HOH A . 
J 7 HOH 274 874 904  HOH HOH A . 
J 7 HOH 275 875 905  HOH HOH A . 
J 7 HOH 276 876 906  HOH HOH A . 
J 7 HOH 277 877 907  HOH HOH A . 
J 7 HOH 278 878 909  HOH HOH A . 
J 7 HOH 279 879 910  HOH HOH A . 
J 7 HOH 280 880 911  HOH HOH A . 
J 7 HOH 281 881 912  HOH HOH A . 
J 7 HOH 282 882 913  HOH HOH A . 
J 7 HOH 283 883 914  HOH HOH A . 
J 7 HOH 284 884 916  HOH HOH A . 
J 7 HOH 285 885 917  HOH HOH A . 
J 7 HOH 286 886 918  HOH HOH A . 
J 7 HOH 287 887 919  HOH HOH A . 
J 7 HOH 288 888 920  HOH HOH A . 
J 7 HOH 289 889 922  HOH HOH A . 
J 7 HOH 290 890 926  HOH HOH A . 
J 7 HOH 291 891 927  HOH HOH A . 
J 7 HOH 292 892 928  HOH HOH A . 
J 7 HOH 293 893 931  HOH HOH A . 
J 7 HOH 294 894 932  HOH HOH A . 
J 7 HOH 295 895 935  HOH HOH A . 
J 7 HOH 296 896 936  HOH HOH A . 
J 7 HOH 297 897 937  HOH HOH A . 
J 7 HOH 298 898 940  HOH HOH A . 
J 7 HOH 299 899 941  HOH HOH A . 
J 7 HOH 300 900 942  HOH HOH A . 
J 7 HOH 301 901 945  HOH HOH A . 
J 7 HOH 302 902 946  HOH HOH A . 
J 7 HOH 303 903 947  HOH HOH A . 
J 7 HOH 304 904 949  HOH HOH A . 
J 7 HOH 305 905 950  HOH HOH A . 
J 7 HOH 306 906 951  HOH HOH A . 
J 7 HOH 307 907 952  HOH HOH A . 
J 7 HOH 308 908 954  HOH HOH A . 
J 7 HOH 309 909 955  HOH HOH A . 
J 7 HOH 310 910 956  HOH HOH A . 
J 7 HOH 311 911 959  HOH HOH A . 
J 7 HOH 312 912 961  HOH HOH A . 
J 7 HOH 313 913 965  HOH HOH A . 
J 7 HOH 314 914 966  HOH HOH A . 
J 7 HOH 315 915 969  HOH HOH A . 
J 7 HOH 316 916 972  HOH HOH A . 
J 7 HOH 317 917 976  HOH HOH A . 
J 7 HOH 318 918 978  HOH HOH A . 
J 7 HOH 319 919 979  HOH HOH A . 
J 7 HOH 320 920 981  HOH HOH A . 
J 7 HOH 321 921 982  HOH HOH A . 
J 7 HOH 322 922 983  HOH HOH A . 
J 7 HOH 323 923 985  HOH HOH A . 
J 7 HOH 324 924 989  HOH HOH A . 
J 7 HOH 325 925 990  HOH HOH A . 
J 7 HOH 326 926 992  HOH HOH A . 
J 7 HOH 327 927 993  HOH HOH A . 
J 7 HOH 328 928 994  HOH HOH A . 
J 7 HOH 329 929 995  HOH HOH A . 
J 7 HOH 330 930 996  HOH HOH A . 
J 7 HOH 331 931 1005 HOH HOH A . 
J 7 HOH 332 932 1023 HOH HOH A . 
J 7 HOH 333 933 1029 HOH HOH A . 
J 7 HOH 334 934 1044 HOH HOH A . 
J 7 HOH 335 935 1049 HOH HOH A . 
J 7 HOH 336 936 1054 HOH HOH A . 
J 7 HOH 337 937 1055 HOH HOH A . 
J 7 HOH 338 938 1058 HOH HOH A . 
J 7 HOH 339 939 1060 HOH HOH A . 
J 7 HOH 340 940 1061 HOH HOH A . 
J 7 HOH 341 941 1063 HOH HOH A . 
J 7 HOH 342 942 1064 HOH HOH A . 
J 7 HOH 343 943 1065 HOH HOH A . 
J 7 HOH 344 944 684  HOH HOH A . 
J 7 HOH 345 945 958  HOH HOH A . 
K 7 HOH 1   101 649  HOH HOH T . 
K 7 HOH 2   102 651  HOH HOH T . 
K 7 HOH 3   103 986  HOH HOH T . 
K 7 HOH 4   104 997  HOH HOH T . 
K 7 HOH 5   105 1020 HOH HOH T . 
K 7 HOH 6   106 1021 HOH HOH T . 
K 7 HOH 7   107 1022 HOH HOH T . 
K 7 HOH 8   108 1024 HOH HOH T . 
K 7 HOH 9   109 1025 HOH HOH T . 
K 7 HOH 10  110 1027 HOH HOH T . 
K 7 HOH 11  111 1028 HOH HOH T . 
K 7 HOH 12  112 1030 HOH HOH T . 
K 7 HOH 13  113 1031 HOH HOH T . 
K 7 HOH 14  114 1032 HOH HOH T . 
K 7 HOH 15  115 1033 HOH HOH T . 
K 7 HOH 16  116 1034 HOH HOH T . 
K 7 HOH 17  117 1035 HOH HOH T . 
K 7 HOH 18  118 1036 HOH HOH T . 
K 7 HOH 19  119 1037 HOH HOH T . 
K 7 HOH 20  120 1038 HOH HOH T . 
K 7 HOH 21  121 1039 HOH HOH T . 
K 7 HOH 22  122 1041 HOH HOH T . 
K 7 HOH 23  123 1043 HOH HOH T . 
K 7 HOH 24  124 1046 HOH HOH T . 
K 7 HOH 25  125 1047 HOH HOH T . 
K 7 HOH 26  126 1048 HOH HOH T . 
K 7 HOH 27  127 1051 HOH HOH T . 
K 7 HOH 28  128 1062 HOH HOH T . 
L 7 HOH 1   101 987  HOH HOH P . 
L 7 HOH 2   102 991  HOH HOH P . 
L 7 HOH 3   103 998  HOH HOH P . 
L 7 HOH 4   104 999  HOH HOH P . 
L 7 HOH 5   105 1000 HOH HOH P . 
L 7 HOH 6   106 1001 HOH HOH P . 
L 7 HOH 7   107 1002 HOH HOH P . 
L 7 HOH 8   108 1003 HOH HOH P . 
L 7 HOH 9   109 1004 HOH HOH P . 
L 7 HOH 10  110 1006 HOH HOH P . 
L 7 HOH 11  111 1007 HOH HOH P . 
L 7 HOH 12  112 1008 HOH HOH P . 
L 7 HOH 13  113 1009 HOH HOH P . 
L 7 HOH 14  114 1010 HOH HOH P . 
L 7 HOH 15  115 1012 HOH HOH P . 
L 7 HOH 16  116 1013 HOH HOH P . 
L 7 HOH 17  117 1014 HOH HOH P . 
L 7 HOH 18  118 1015 HOH HOH P . 
L 7 HOH 19  119 1017 HOH HOH P . 
L 7 HOH 20  120 1018 HOH HOH P . 
L 7 HOH 21  121 1059 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4730  ? 
1 MORE         -42   ? 
1 'SSA (A^2)'  22030 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 88.5  ? 
2  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 101.8 ? 
3  OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 94.9  ? 
4  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O1A   ? D 0KX .   ? A 0KX 501 ? 1_555 106.8 ? 
5  OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O1A   ? D 0KX .   ? A 0KX 501 ? 1_555 161.1 ? 
6  OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O1A   ? D 0KX .   ? A 0KX 501 ? 1_555 92.9  ? 
7  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" ? C DG  8   ? P DG  8   ? 1_555 165.7 ? 
8  OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" ? C DG  8   ? P DG  8   ? 1_555 77.8  ? 
9  OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" ? C DG  8   ? P DG  8   ? 1_555 75.9  ? 
10 O1A   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" ? C DG  8   ? P DG  8   ? 1_555 87.4  ? 
11 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? J HOH .   ? A HOH 930 ? 1_555 88.7  ? 
12 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? J HOH .   ? A HOH 930 ? 1_555 95.4  ? 
13 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? J HOH .   ? A HOH 930 ? 1_555 165.5 ? 
14 O1A   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? J HOH .   ? A HOH 930 ? 1_555 74.3  ? 
15 "O3'" ? C DG  8   ? P DG  8   ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? J HOH .   ? A HOH 930 ? 1_555 96.3  ? 
16 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 98.5  ? 
17 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O2B   ? D 0KX .   ? A 0KX 501 ? 1_555 166.4 ? 
18 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O2B   ? D 0KX .   ? A 0KX 501 ? 1_555 90.5  ? 
19 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O2G   ? D 0KX .   ? A 0KX 501 ? 1_555 85.7  ? 
20 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O2G   ? D 0KX .   ? A 0KX 501 ? 1_555 172.8 ? 
21 O2B   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O2G   ? D 0KX .   ? A 0KX 501 ? 1_555 84.3  ? 
22 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 80.4  ? 
23 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 85.2  ? 
24 O2B   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 90.4  ? 
25 O2G   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 89.9  ? 
26 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A   ? D 0KX .   ? A 0KX 501 ? 1_555 102.8 ? 
27 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A   ? D 0KX .   ? A 0KX 501 ? 1_555 92.3  ? 
28 O2B   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A   ? D 0KX .   ? A 0KX 501 ? 1_555 86.8  ? 
29 O2G   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A   ? D 0KX .   ? A 0KX 501 ? 1_555 92.4  ? 
30 O     ? A MET 17  ? A MET 14  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A   ? D 0KX .   ? A 0KX 501 ? 1_555 176.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-07-02 
2 'Structure model' 1 1 2014-07-30 
3 'Structure model' 1 2 2018-06-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Data collection'      
3 3 'Structure model' 'Derived calculations' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            struct_conn 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .          ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 REFMAC      .          ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
3 PDB_EXTRACT 3.14       'Dec. 10, 2013' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
4 PHENIX      1.8.1_1168 ?               ?       ?                    ?                        refinement        ? ?          ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            P 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             8 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            "C3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_2            P 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             8 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.357 
_pdbx_validate_rmsd_bond.bond_target_value         1.419 
_pdbx_validate_rmsd_bond.bond_deviation            -0.062 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "C3'" T DT 3 ? B "C2'" T DT 3 ? B "C1'" T DT 3 ? B 96.70  102.40 -5.70 0.80 N 
2 1 "O4'" T DT 6 ? ? "C1'" T DT 6 ? ? "C2'" T DT 6 ? ? 109.98 106.80 3.18  0.50 N 
3 1 "O4'" P DA 7 ? ? "C4'" P DA 7 ? ? "C3'" P DA 7 ? ? 101.81 104.50 -2.69 0.40 N 
4 1 "O4'" P DA 7 ? ? "C1'" P DA 7 ? ? "C2'" P DA 7 ? ? 110.06 106.80 3.26  0.50 N 
5 1 "O4'" P DA 7 ? ? "C1'" P DA 7 ? ? N9    P DA 7 ? ? 111.79 108.30 3.49  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 22.87   62.87   
2 1 TYR A 39  ? A 62.87   164.14  
3 1 TYR A 39  ? B 67.91   88.61   
4 1 SER A 62  ? ? 72.29   -0.57   
5 1 SER A 217 ? ? -156.58 -156.79 
6 1 SER A 257 ? ? 92.54   -11.99  
7 1 SER A 380 ? ? -83.93  -70.59  
8 1 ASN A 407 ? ? -68.43  98.93   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 328 ? CG    ? A LYS 331 CG    
2 1 Y 1 A LYS 328 ? CD    ? A LYS 331 CD    
3 1 Y 1 A LYS 328 ? CE    ? A LYS 331 CE    
4 1 Y 1 A LYS 328 ? NZ    ? A LYS 331 NZ    
5 1 Y 1 A LYS 376 ? CG    ? A LYS 379 CG    
6 1 Y 1 A LYS 376 ? CD    ? A LYS 379 CD    
7 1 Y 1 A LYS 376 ? CE    ? A LYS 379 CE    
8 1 Y 1 A LYS 376 ? NZ    ? A LYS 379 NZ    
9 1 Y 1 T DT  3   ? "O5'" ? B DT  1   "O5'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4Q8E 'double helix'        
4Q8E 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 3  1_555 C DG 8 1_555 0.141  -0.094 0.001  6.492  -2.471  1.225  1 T_DC5:DG8_P  T 5  ? P 8 ? 19 1 
1 B DT 4  1_555 C DA 7 1_555 -0.032 -0.105 -0.030 -6.867 -18.541 1.771  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DC 5  1_555 C DG 6 1_555 0.237  -0.198 -0.087 -6.861 -0.846  -2.394 3 T_DC7:DG6_P  T 7  ? P 6 ? 19 1 
1 B DA 6  1_555 C DT 5 1_555 0.144  -0.129 -0.029 2.108  0.042   0.527  4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 7  1_555 C DG 4 1_555 0.207  -0.099 -0.236 14.000 -5.542  -0.323 5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DA 8  1_555 C DT 3 1_555 0.045  -0.150 0.025  7.717  -6.080  -1.637 6 T_DA10:DT3_P T 10 ? P 3 ? 20 1 
1 B DC 9  1_555 C DG 2 1_555 0.047  -0.181 -0.022 6.487  -7.033  -0.988 7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 10 1_555 C DA 1 1_555 -0.306 -0.222 -0.231 22.250 -5.034  5.132  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 3 1_555 C DG 8 1_555 B DT 4  1_555 C DA 7 1_555 1.049  -1.226 3.569 2.753  3.482 29.175 -3.210 -1.424 3.484 6.863  -5.426 
29.504 1 TT_DC5DT6:DA7DG8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 4 1_555 C DA 7 1_555 B DC 5  1_555 C DG 6 1_555 -0.467 -0.913 3.454 2.951  7.270 31.935 -2.885 1.342  3.122 12.970 -5.265 
32.860 2 TT_DT6DC7:DG6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DC 5 1_555 C DG 6 1_555 B DA 6  1_555 C DT 5 1_555 -0.470 -0.674 3.233 0.512  3.665 31.456 -1.895 0.954  3.129 6.732  -0.940 
31.667 3 TT_DC7DA8:DT5DG6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 6 1_555 C DT 5 1_555 B DC 7  1_555 C DG 4 1_555 0.516  -0.594 3.193 1.388  1.116 31.915 -1.276 -0.692 3.190 2.028  -2.523 
31.964 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 7 1_555 C DG 4 1_555 B DA 8  1_555 C DT 3 1_555 -0.964 -0.302 3.583 -3.665 2.211 34.224 -0.889 0.996  3.637 3.738  6.198  
34.483 5 TT_DC9DA10:DT3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DA 8 1_555 C DT 3 1_555 B DC 9  1_555 C DG 2 1_555 0.094  -0.783 3.433 -0.795 0.761 34.248 -1.454 -0.290 3.412 1.292  1.350  
34.265 6 TT_DA10DC11:DG2DT3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 9 1_555 C DG 2 1_555 B DT 10 1_555 C DA 1 1_555 0.568  -0.313 3.102 -1.022 4.218 27.247 -1.622 -1.426 2.997 8.882  2.153  
27.584 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" 0KX 
5 'MAGNESIUM ION'                                                                             MG  
6 GLYCEROL                                                                                    GOL 
7 water                                                                                       HOH 
#