data_4QLC
# 
_entry.id   4QLC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4QLC         
NDB   NA3055       
RCSB  RCSB086199   
WWPDB D_1000086199 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4QLC 
_pdbx_database_status.recvd_initial_deposition_date   2014-06-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jiang, J.S.' 1 
'Zhou, B.R.'  2 
'Xiao, T.S.'  3 
'Bai, Y.W.'   4 
# 
_citation.id                        primary 
_citation.title                     'Structural Mechanisms of Nucleosome Recognition by Linker Histones.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            '33 Suppl 1' 
_citation.page_first                2 
_citation.page_last                 3 
_citation.year                      2015 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26212454 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2015.06.025 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhou, B.R.'    1 
primary 'Jiang, J.'     2 
primary 'Feng, H.'      3 
primary 'Ghirlando, R.' 4 
primary 'Xiao, T.S.'    5 
primary 'Bai, Y.'       6 
# 
_cell.entry_id           4QLC 
_cell.length_a           262.870 
_cell.length_b           262.870 
_cell.length_c           91.790 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4QLC 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA (167-mer)' 51325.676 1 ? ? '167bp Widom 601 DNA' ? 
2 polymer     man 'DNA (167-mer)' 51783.977 1 ? ? '167bp Widom 601 DNA' ? 
3 polymer     man 'Histone H3'    15289.904 2 ? ? ?                     ? 
4 polymer     man 'Histone H4'    11277.257 2 ? ? ?                     ? 
5 polymer     man 'Histone H2A'   13257.529 2 ? ? ?                     ? 
6 polymer     man 'Histone H2B'   13595.869 2 ? ? ?                     ? 
7 polymer     man H5              8286.562  1 ? ? ?                     ? 
8 non-polymer syn 'CITRIC ACID'   192.124   3 ? ? ?                     ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DC)(DT)(DG)(DG)(DC)(DC)(DG)(DC)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DA)(DT)(DC)
(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)
(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)
(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)
(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)
(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)
(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)
(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DG)(DC)(DA)
(DT)(DG)(DT)(DA)(DA)(DG)(DT)
;
;ACTGGCCGCCCTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTAC
GCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGCA
TGTAAGT
;
I   ? 
2 polydeoxyribonucleotide no no 
;(DA)(DC)(DT)(DT)(DA)(DC)(DA)(DT)(DG)(DC)(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)
(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)
(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)
(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)
(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)
(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)
(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)
(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DG)(DC)
(DG)(DG)(DC)(DC)(DA)(DG)(DT)
;
;ACTTACATGCACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGG
ACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAGGGC
GGCCAGT
;
J   ? 
3 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
4 'polypeptide(L)'        no no 
;TGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;TGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
5 'polypeptide(L)'        no no 
;SGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPR
HLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
;
;SGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPR
HLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
;
C,G ? 
6 'polypeptide(L)'        no no 
;PPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
;PPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
D,H ? 
7 'polypeptide(L)'        no no SASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKS 
SASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKS U   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DC  n 
1 3   DT  n 
1 4   DG  n 
1 5   DG  n 
1 6   DC  n 
1 7   DC  n 
1 8   DG  n 
1 9   DC  n 
1 10  DC  n 
1 11  DC  n 
1 12  DT  n 
1 13  DG  n 
1 14  DG  n 
1 15  DA  n 
1 16  DG  n 
1 17  DA  n 
1 18  DA  n 
1 19  DT  n 
1 20  DC  n 
1 21  DC  n 
1 22  DC  n 
1 23  DG  n 
1 24  DG  n 
1 25  DT  n 
1 26  DG  n 
1 27  DC  n 
1 28  DC  n 
1 29  DG  n 
1 30  DA  n 
1 31  DG  n 
1 32  DG  n 
1 33  DC  n 
1 34  DC  n 
1 35  DG  n 
1 36  DC  n 
1 37  DT  n 
1 38  DC  n 
1 39  DA  n 
1 40  DA  n 
1 41  DT  n 
1 42  DT  n 
1 43  DG  n 
1 44  DG  n 
1 45  DT  n 
1 46  DC  n 
1 47  DG  n 
1 48  DT  n 
1 49  DA  n 
1 50  DG  n 
1 51  DA  n 
1 52  DC  n 
1 53  DA  n 
1 54  DG  n 
1 55  DC  n 
1 56  DT  n 
1 57  DC  n 
1 58  DT  n 
1 59  DA  n 
1 60  DG  n 
1 61  DC  n 
1 62  DA  n 
1 63  DC  n 
1 64  DC  n 
1 65  DG  n 
1 66  DC  n 
1 67  DT  n 
1 68  DT  n 
1 69  DA  n 
1 70  DA  n 
1 71  DA  n 
1 72  DC  n 
1 73  DG  n 
1 74  DC  n 
1 75  DA  n 
1 76  DC  n 
1 77  DG  n 
1 78  DT  n 
1 79  DA  n 
1 80  DC  n 
1 81  DG  n 
1 82  DC  n 
1 83  DG  n 
1 84  DC  n 
1 85  DT  n 
1 86  DG  n 
1 87  DT  n 
1 88  DC  n 
1 89  DC  n 
1 90  DC  n 
1 91  DC  n 
1 92  DC  n 
1 93  DG  n 
1 94  DC  n 
1 95  DG  n 
1 96  DT  n 
1 97  DT  n 
1 98  DT  n 
1 99  DT  n 
1 100 DA  n 
1 101 DA  n 
1 102 DC  n 
1 103 DC  n 
1 104 DG  n 
1 105 DC  n 
1 106 DC  n 
1 107 DA  n 
1 108 DA  n 
1 109 DG  n 
1 110 DG  n 
1 111 DG  n 
1 112 DG  n 
1 113 DA  n 
1 114 DT  n 
1 115 DT  n 
1 116 DA  n 
1 117 DC  n 
1 118 DT  n 
1 119 DC  n 
1 120 DC  n 
1 121 DC  n 
1 122 DT  n 
1 123 DA  n 
1 124 DG  n 
1 125 DT  n 
1 126 DC  n 
1 127 DT  n 
1 128 DC  n 
1 129 DC  n 
1 130 DA  n 
1 131 DG  n 
1 132 DG  n 
1 133 DC  n 
1 134 DA  n 
1 135 DC  n 
1 136 DG  n 
1 137 DT  n 
1 138 DG  n 
1 139 DT  n 
1 140 DC  n 
1 141 DA  n 
1 142 DG  n 
1 143 DA  n 
1 144 DT  n 
1 145 DA  n 
1 146 DT  n 
1 147 DA  n 
1 148 DT  n 
1 149 DA  n 
1 150 DC  n 
1 151 DA  n 
1 152 DT  n 
1 153 DC  n 
1 154 DC  n 
1 155 DT  n 
1 156 DG  n 
1 157 DT  n 
1 158 DG  n 
1 159 DC  n 
1 160 DA  n 
1 161 DT  n 
1 162 DG  n 
1 163 DT  n 
1 164 DA  n 
1 165 DA  n 
1 166 DG  n 
1 167 DT  n 
2 1   DA  n 
2 2   DC  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
2 9   DG  n 
2 10  DC  n 
2 11  DA  n 
2 12  DC  n 
2 13  DA  n 
2 14  DG  n 
2 15  DG  n 
2 16  DA  n 
2 17  DT  n 
2 18  DG  n 
2 19  DT  n 
2 20  DA  n 
2 21  DT  n 
2 22  DA  n 
2 23  DT  n 
2 24  DA  n 
2 25  DT  n 
2 26  DC  n 
2 27  DT  n 
2 28  DG  n 
2 29  DA  n 
2 30  DC  n 
2 31  DA  n 
2 32  DC  n 
2 33  DG  n 
2 34  DT  n 
2 35  DG  n 
2 36  DC  n 
2 37  DC  n 
2 38  DT  n 
2 39  DG  n 
2 40  DG  n 
2 41  DA  n 
2 42  DG  n 
2 43  DA  n 
2 44  DC  n 
2 45  DT  n 
2 46  DA  n 
2 47  DG  n 
2 48  DG  n 
2 49  DG  n 
2 50  DA  n 
2 51  DG  n 
2 52  DT  n 
2 53  DA  n 
2 54  DA  n 
2 55  DT  n 
2 56  DC  n 
2 57  DC  n 
2 58  DC  n 
2 59  DC  n 
2 60  DT  n 
2 61  DT  n 
2 62  DG  n 
2 63  DG  n 
2 64  DC  n 
2 65  DG  n 
2 66  DG  n 
2 67  DT  n 
2 68  DT  n 
2 69  DA  n 
2 70  DA  n 
2 71  DA  n 
2 72  DA  n 
2 73  DC  n 
2 74  DG  n 
2 75  DC  n 
2 76  DG  n 
2 77  DG  n 
2 78  DG  n 
2 79  DG  n 
2 80  DG  n 
2 81  DA  n 
2 82  DC  n 
2 83  DA  n 
2 84  DG  n 
2 85  DC  n 
2 86  DG  n 
2 87  DC  n 
2 88  DG  n 
2 89  DT  n 
2 90  DA  n 
2 91  DC  n 
2 92  DG  n 
2 93  DT  n 
2 94  DG  n 
2 95  DC  n 
2 96  DG  n 
2 97  DT  n 
2 98  DT  n 
2 99  DT  n 
2 100 DA  n 
2 101 DA  n 
2 102 DG  n 
2 103 DC  n 
2 104 DG  n 
2 105 DG  n 
2 106 DT  n 
2 107 DG  n 
2 108 DC  n 
2 109 DT  n 
2 110 DA  n 
2 111 DG  n 
2 112 DA  n 
2 113 DG  n 
2 114 DC  n 
2 115 DT  n 
2 116 DG  n 
2 117 DT  n 
2 118 DC  n 
2 119 DT  n 
2 120 DA  n 
2 121 DC  n 
2 122 DG  n 
2 123 DA  n 
2 124 DC  n 
2 125 DC  n 
2 126 DA  n 
2 127 DA  n 
2 128 DT  n 
2 129 DT  n 
2 130 DG  n 
2 131 DA  n 
2 132 DG  n 
2 133 DC  n 
2 134 DG  n 
2 135 DG  n 
2 136 DC  n 
2 137 DC  n 
2 138 DT  n 
2 139 DC  n 
2 140 DG  n 
2 141 DG  n 
2 142 DC  n 
2 143 DA  n 
2 144 DC  n 
2 145 DC  n 
2 146 DG  n 
2 147 DG  n 
2 148 DG  n 
2 149 DA  n 
2 150 DT  n 
2 151 DT  n 
2 152 DC  n 
2 153 DT  n 
2 154 DC  n 
2 155 DC  n 
2 156 DA  n 
2 157 DG  n 
2 158 DG  n 
2 159 DG  n 
2 160 DC  n 
2 161 DG  n 
2 162 DG  n 
2 163 DC  n 
2 164 DC  n 
2 165 DA  n 
2 166 DG  n 
2 167 DT  n 
3 1   ALA n 
3 2   ARG n 
3 3   THR n 
3 4   LYS n 
3 5   GLN n 
3 6   THR n 
3 7   ALA n 
3 8   ARG n 
3 9   LYS n 
3 10  SER n 
3 11  THR n 
3 12  GLY n 
3 13  GLY n 
3 14  LYS n 
3 15  ALA n 
3 16  PRO n 
3 17  ARG n 
3 18  LYS n 
3 19  GLN n 
3 20  LEU n 
3 21  ALA n 
3 22  THR n 
3 23  LYS n 
3 24  ALA n 
3 25  ALA n 
3 26  ARG n 
3 27  LYS n 
3 28  SER n 
3 29  ALA n 
3 30  PRO n 
3 31  ALA n 
3 32  THR n 
3 33  GLY n 
3 34  GLY n 
3 35  VAL n 
3 36  LYS n 
3 37  LYS n 
3 38  PRO n 
3 39  HIS n 
3 40  ARG n 
3 41  TYR n 
3 42  ARG n 
3 43  PRO n 
3 44  GLY n 
3 45  THR n 
3 46  VAL n 
3 47  ALA n 
3 48  LEU n 
3 49  ARG n 
3 50  GLU n 
3 51  ILE n 
3 52  ARG n 
3 53  ARG n 
3 54  TYR n 
3 55  GLN n 
3 56  LYS n 
3 57  SER n 
3 58  THR n 
3 59  GLU n 
3 60  LEU n 
3 61  LEU n 
3 62  ILE n 
3 63  ARG n 
3 64  LYS n 
3 65  LEU n 
3 66  PRO n 
3 67  PHE n 
3 68  GLN n 
3 69  ARG n 
3 70  LEU n 
3 71  VAL n 
3 72  ARG n 
3 73  GLU n 
3 74  ILE n 
3 75  ALA n 
3 76  GLN n 
3 77  ASP n 
3 78  PHE n 
3 79  LYS n 
3 80  THR n 
3 81  ASP n 
3 82  LEU n 
3 83  ARG n 
3 84  PHE n 
3 85  GLN n 
3 86  SER n 
3 87  SER n 
3 88  ALA n 
3 89  VAL n 
3 90  MET n 
3 91  ALA n 
3 92  LEU n 
3 93  GLN n 
3 94  GLU n 
3 95  ALA n 
3 96  SER n 
3 97  GLU n 
3 98  ALA n 
3 99  TYR n 
3 100 LEU n 
3 101 VAL n 
3 102 GLY n 
3 103 LEU n 
3 104 PHE n 
3 105 GLU n 
3 106 ASP n 
3 107 THR n 
3 108 ASN n 
3 109 LEU n 
3 110 CYS n 
3 111 ALA n 
3 112 ILE n 
3 113 HIS n 
3 114 ALA n 
3 115 LYS n 
3 116 ARG n 
3 117 VAL n 
3 118 THR n 
3 119 ILE n 
3 120 MET n 
3 121 PRO n 
3 122 LYS n 
3 123 ASP n 
3 124 ILE n 
3 125 GLN n 
3 126 LEU n 
3 127 ALA n 
3 128 ARG n 
3 129 ARG n 
3 130 ILE n 
3 131 ARG n 
3 132 GLY n 
3 133 GLU n 
3 134 ARG n 
3 135 ALA n 
4 1   THR n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLY n 
4 7   GLY n 
4 8   LYS n 
4 9   GLY n 
4 10  LEU n 
4 11  GLY n 
4 12  LYS n 
4 13  GLY n 
4 14  GLY n 
4 15  ALA n 
4 16  LYS n 
4 17  ARG n 
4 18  HIS n 
4 19  ARG n 
4 20  LYS n 
4 21  VAL n 
4 22  LEU n 
4 23  ARG n 
4 24  ASP n 
4 25  ASN n 
4 26  ILE n 
4 27  GLN n 
4 28  GLY n 
4 29  ILE n 
4 30  THR n 
4 31  LYS n 
4 32  PRO n 
4 33  ALA n 
4 34  ILE n 
4 35  ARG n 
4 36  ARG n 
4 37  LEU n 
4 38  ALA n 
4 39  ARG n 
4 40  ARG n 
4 41  GLY n 
4 42  GLY n 
4 43  VAL n 
4 44  LYS n 
4 45  ARG n 
4 46  ILE n 
4 47  SER n 
4 48  GLY n 
4 49  LEU n 
4 50  ILE n 
4 51  TYR n 
4 52  GLU n 
4 53  GLU n 
4 54  THR n 
4 55  ARG n 
4 56  GLY n 
4 57  VAL n 
4 58  LEU n 
4 59  LYS n 
4 60  VAL n 
4 61  PHE n 
4 62  LEU n 
4 63  GLU n 
4 64  ASN n 
4 65  VAL n 
4 66  ILE n 
4 67  ARG n 
4 68  ASP n 
4 69  ALA n 
4 70  VAL n 
4 71  THR n 
4 72  TYR n 
4 73  THR n 
4 74  GLU n 
4 75  HIS n 
4 76  ALA n 
4 77  LYS n 
4 78  ARG n 
4 79  LYS n 
4 80  THR n 
4 81  VAL n 
4 82  THR n 
4 83  ALA n 
4 84  MET n 
4 85  ASP n 
4 86  VAL n 
4 87  VAL n 
4 88  TYR n 
4 89  ALA n 
4 90  LEU n 
4 91  LYS n 
4 92  ARG n 
4 93  GLN n 
4 94  GLY n 
4 95  ARG n 
4 96  THR n 
4 97  LEU n 
4 98  TYR n 
4 99  GLY n 
4 100 PHE n 
4 101 GLY n 
4 102 GLY n 
5 1   SER n 
5 2   GLY n 
5 3   ARG n 
5 4   GLY n 
5 5   LYS n 
5 6   GLY n 
5 7   GLY n 
5 8   LYS n 
5 9   VAL n 
5 10  LYS n 
5 11  GLY n 
5 12  LYS n 
5 13  ALA n 
5 14  LYS n 
5 15  SER n 
5 16  ARG n 
5 17  SER n 
5 18  ASN n 
5 19  ARG n 
5 20  ALA n 
5 21  GLY n 
5 22  LEU n 
5 23  GLN n 
5 24  PHE n 
5 25  PRO n 
5 26  VAL n 
5 27  GLY n 
5 28  ARG n 
5 29  ILE n 
5 30  HIS n 
5 31  ARG n 
5 32  LEU n 
5 33  LEU n 
5 34  ARG n 
5 35  LYS n 
5 36  GLY n 
5 37  ASN n 
5 38  TYR n 
5 39  ALA n 
5 40  GLU n 
5 41  ARG n 
5 42  VAL n 
5 43  GLY n 
5 44  ALA n 
5 45  GLY n 
5 46  ALA n 
5 47  PRO n 
5 48  VAL n 
5 49  TYR n 
5 50  LEU n 
5 51  ALA n 
5 52  ALA n 
5 53  VAL n 
5 54  MET n 
5 55  GLU n 
5 56  TYR n 
5 57  LEU n 
5 58  ALA n 
5 59  ALA n 
5 60  GLU n 
5 61  VAL n 
5 62  LEU n 
5 63  GLU n 
5 64  LEU n 
5 65  ALA n 
5 66  GLY n 
5 67  ASN n 
5 68  ALA n 
5 69  ALA n 
5 70  ARG n 
5 71  ASP n 
5 72  ASN n 
5 73  LYS n 
5 74  LYS n 
5 75  THR n 
5 76  ARG n 
5 77  ILE n 
5 78  ILE n 
5 79  PRO n 
5 80  ARG n 
5 81  HIS n 
5 82  LEU n 
5 83  GLN n 
5 84  LEU n 
5 85  ALA n 
5 86  ILE n 
5 87  ARG n 
5 88  ASN n 
5 89  ASP n 
5 90  GLU n 
5 91  GLU n 
5 92  LEU n 
5 93  ASN n 
5 94  LYS n 
5 95  LEU n 
5 96  LEU n 
5 97  SER n 
5 98  GLY n 
5 99  VAL n 
5 100 THR n 
5 101 ILE n 
5 102 ALA n 
5 103 GLN n 
5 104 GLY n 
5 105 GLY n 
5 106 VAL n 
5 107 LEU n 
5 108 PRO n 
5 109 ASN n 
5 110 ILE n 
5 111 GLN n 
5 112 ALA n 
5 113 VAL n 
5 114 LEU n 
5 115 LEU n 
5 116 PRO n 
5 117 LYS n 
5 118 LYS n 
5 119 THR n 
5 120 GLU n 
5 121 LYS n 
5 122 LYS n 
5 123 ALA n 
6 1   PRO n 
6 2   PRO n 
6 3   LYS n 
6 4   THR n 
6 5   SER n 
6 6   GLY n 
6 7   LYS n 
6 8   ALA n 
6 9   ALA n 
6 10  LYS n 
6 11  LYS n 
6 12  ALA n 
6 13  GLY n 
6 14  LYS n 
6 15  ALA n 
6 16  GLN n 
6 17  LYS n 
6 18  ASN n 
6 19  ILE n 
6 20  THR n 
6 21  LYS n 
6 22  THR n 
6 23  ASP n 
6 24  LYS n 
6 25  LYS n 
6 26  LYS n 
6 27  LYS n 
6 28  ARG n 
6 29  LYS n 
6 30  ARG n 
6 31  LYS n 
6 32  GLU n 
6 33  SER n 
6 34  TYR n 
6 35  ALA n 
6 36  ILE n 
6 37  TYR n 
6 38  ILE n 
6 39  TYR n 
6 40  LYS n 
6 41  VAL n 
6 42  LEU n 
6 43  LYS n 
6 44  GLN n 
6 45  VAL n 
6 46  HIS n 
6 47  PRO n 
6 48  ASP n 
6 49  THR n 
6 50  GLY n 
6 51  ILE n 
6 52  SER n 
6 53  SER n 
6 54  LYS n 
6 55  ALA n 
6 56  MET n 
6 57  SER n 
6 58  ILE n 
6 59  MET n 
6 60  ASN n 
6 61  SER n 
6 62  PHE n 
6 63  VAL n 
6 64  ASN n 
6 65  ASP n 
6 66  ILE n 
6 67  PHE n 
6 68  GLU n 
6 69  ARG n 
6 70  ILE n 
6 71  ALA n 
6 72  ALA n 
6 73  GLU n 
6 74  ALA n 
6 75  SER n 
6 76  ARG n 
6 77  LEU n 
6 78  ALA n 
6 79  HIS n 
6 80  TYR n 
6 81  ASN n 
6 82  LYS n 
6 83  ARG n 
6 84  SER n 
6 85  THR n 
6 86  ILE n 
6 87  THR n 
6 88  SER n 
6 89  ARG n 
6 90  GLU n 
6 91  ILE n 
6 92  GLN n 
6 93  THR n 
6 94  ALA n 
6 95  VAL n 
6 96  ARG n 
6 97  LEU n 
6 98  LEU n 
6 99  LEU n 
6 100 PRO n 
6 101 GLY n 
6 102 GLU n 
6 103 LEU n 
6 104 ALA n 
6 105 LYS n 
6 106 HIS n 
6 107 ALA n 
6 108 VAL n 
6 109 SER n 
6 110 GLU n 
6 111 GLY n 
6 112 THR n 
6 113 LYS n 
6 114 ALA n 
6 115 VAL n 
6 116 THR n 
6 117 LYS n 
6 118 TYR n 
6 119 THR n 
6 120 SER n 
6 121 SER n 
6 122 LYS n 
7 1   SER n 
7 2   ALA n 
7 3   SER n 
7 4   HIS n 
7 5   PRO n 
7 6   THR n 
7 7   TYR n 
7 8   SER n 
7 9   GLU n 
7 10  MET n 
7 11  ILE n 
7 12  ALA n 
7 13  ALA n 
7 14  ALA n 
7 15  ILE n 
7 16  ARG n 
7 17  ALA n 
7 18  GLU n 
7 19  LYS n 
7 20  SER n 
7 21  ARG n 
7 22  GLY n 
7 23  GLY n 
7 24  SER n 
7 25  SER n 
7 26  ARG n 
7 27  GLN n 
7 28  SER n 
7 29  ILE n 
7 30  GLN n 
7 31  LYS n 
7 32  TYR n 
7 33  ILE n 
7 34  LYS n 
7 35  SER n 
7 36  HIS n 
7 37  TYR n 
7 38  LYS n 
7 39  VAL n 
7 40  GLY n 
7 41  HIS n 
7 42  ASN n 
7 43  ALA n 
7 44  ASP n 
7 45  LEU n 
7 46  GLN n 
7 47  ILE n 
7 48  LYS n 
7 49  LEU n 
7 50  SER n 
7 51  ILE n 
7 52  ARG n 
7 53  ARG n 
7 54  LEU n 
7 55  LEU n 
7 56  ALA n 
7 57  ALA n 
7 58  GLY n 
7 59  VAL n 
7 60  LEU n 
7 61  LYS n 
7 62  GLN n 
7 63  THR n 
7 64  LYS n 
7 65  GLY n 
7 66  VAL n 
7 67  GLY n 
7 68  ALA n 
7 69  SER n 
7 70  GLY n 
7 71  SER n 
7 72  PHE n 
7 73  ARG n 
7 74  LEU n 
7 75  ALA n 
7 76  LYS n 
7 77  SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ?           ? DNA ? ?    ? ? 
;147 BP WIDOM 601 DNA FRAGMENT       
and 20 bp linker DNA fragment
;
? 'Homo sapiens'            9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ?   ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? ?           ? DNA ? ?    ? ? 
;147 BP WIDOM 601 DNA FRAGMENT       
and 20 bp linker DNA fragment
;
? 'Homo sapiens'            9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ?   ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'Fruit fly' ? 
;CG31613, CG33803, CG33806, CG33809, CG33812, CG33815, CG33818, CG33821, CG33824, CG33827, CG33830, CG33833, CG33836, CG33839, CG33842, CG33845, CG33848, CG33851, CG33854, CG33857, CG33860, CG33863, CG33866, H3_DROME, His3, His3:CG31613, His3:CG33803, His3:CG33806, His3:CG33809, His3:CG33812, His3:CG33815, His3:CG33818, His3:CG33821, His3:CG33824, His3:CG33827, His3:CG33830, His3:CG33833, His3:CG33836, His3:CG33839, His3:CG33842, His3:CG33845, His3:CG33848, His3:CG33851, His3:CG33854, His3:CG33857, His3:CG33860, His3:CG33863, His3:CG33866
;
? 7227 ? ? ?                                                                    ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'Fruit fly' ? 
;CG31611, CG3379, CG33869, CG33871, CG33873, CG33875, CG33877, CG33879, CG33881, CG33883, CG33885, CG33887, CG33889, CG33891, CG33893, CG33895, CG33897, CG33899, CG33901, CG33903, CG33905, CG33907, CG33909, H4, H4r, H4_DROME, His4, His4:CG31611, His4:CG33869, His4:CG33871, His4:CG33873, His4:CG33875, His4:CG33877, His4:CG33879, His4:CG33881, His4:CG33883, His4:CG33885, His4:CG33887, His4:CG33889, His4:CG33891, His4:CG33893, His4:CG33895, His4:CG33897, His4:CG33899, His4:CG33901, His4:CG33903, His4:CG33905, His4:CG33907, His4:CG33909, His4r
;
? 7227 ? ? 'The first residue M is replaced by I'                               ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ? 'Fruit fly' ? 
;CG31618, CG33808, CG33814, CG33817, CG33820, CG33823, CG33826, CG33829, CG33832, CG33835, CG33838, CG33841, CG33844, CG33847, CG33850, CG33862, CG33865, H2a, H2A_DROME, His2A, His2A:CG31618, His2A:CG33808, His2A:CG33814, His2A:CG33817, His2A:CG33820, His2A:CG33823, His2A:CG33826, His2A:CG33829, His2A:CG33832, His2A:CG33835, His2A:CG33838, His2A:CG33841, His2A:CG33844, His2A:CG33847, His2A:CG33850, His2A:CG33862, His2A:CG33865
;
? 7227 ? ? 'EKKA are replaced by DSHKAKAK'                                      ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample ? ? ? 'Fruit fly' ? 
;CG17949, CG33868, CG33870, CG33872, CG33874, CG33876, CG33878, CG33880, CG33882, CG33884, CG33886, CG33888, CG33890, CG33892, CG33894, CG33896, CG33898, CG33900, CG33902, CG33904, CG33906, CG33908, CG33910, H2B_DROME, His2B, His2B:CG17949, His2B:CG33868, His2B:CG33870, His2B:CG33872, His2B:CG33874, His2B:CG33876, His2B:CG33878, His2B:CG33880, His2B:CG33882, His2B:CG33884, His2B:CG33886, His2B:CG33888, His2B:CG33890, His2B:CG33892, His2B:CG33894, His2B:CG33896, His2B:CG33898, His2B:CG33900, His2B:CG33902, His2B:CG33904, His2B:CG33906, His2B:CG33908, His2B:CG33910
;
? 7227 ? ? 'The first residue M is replaced by I'                               ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample ? ? ? ?           ? H5_CHICK ? 9031 ? ? 'HIS-tag at the N-term: MGSSHHHHHHSSGLVPRGSHMTE'                     ? 
'Gallus gallus'           9031 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H3_DROME  P02299 3 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2  ? 
2 UNP H4_DROME  P84040 4 
;TGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2  ? 
3 UNP H2A_DROME P84051 5 
;SGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPR
HLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
;
2  ? 
4 UNP H2B_DROME P02283 6 
;PPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
2  ? 
5 UNP H5_CHICK  P02259 7 SASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKS 23 ? 
6 PDB 4QLC      4QLC   1 ? ?  ? 
7 PDB 4QLC      4QLC   2 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4QLC A 1 ? 135 ? P02299 2  ? 136 ? 1  135 
2  2 4QLC B 1 ? 102 ? P84040 2  ? 103 ? 1  102 
3  3 4QLC C 1 ? 123 ? P84051 2  ? 124 ? 1  123 
4  4 4QLC D 1 ? 122 ? P02283 2  ? 123 ? 1  122 
5  1 4QLC E 1 ? 135 ? P02299 2  ? 136 ? 1  135 
6  2 4QLC F 1 ? 102 ? P84040 2  ? 103 ? 1  102 
7  3 4QLC G 1 ? 123 ? P84051 2  ? 124 ? 1  123 
8  4 4QLC H 1 ? 122 ? P02283 2  ? 123 ? 1  122 
9  5 4QLC U 1 ? 77  ? P02259 23 ? 99  ? 22 98  
10 6 4QLC I 1 ? 167 ? 4QLC   1  ? 167 ? 1  167 
11 7 4QLC J 1 ? 167 ? 4QLC   1  ? 167 ? 1  167 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CIT non-polymer         . 'CITRIC ACID'                        ? 'C6 H8 O7'        192.124 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4QLC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.19 
_exptl_crystal.density_percent_sol   70.68 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              3.75 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.1 mM Citric acid, 0.1mM potassium chloride, and 10% MPD, pH 3.75, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           274 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2013-11-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.033 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4QLC 
_reflns.observed_criterion_sigma_I   0.00 
_reflns.observed_criterion_sigma_F   0.00 
_reflns.d_resolution_low             45.393 
_reflns.d_resolution_high            3.50 
_reflns.number_obs                   45664 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.117 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.2 
_reflns.B_iso_Wilson_estimate        91.5 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.50 
_reflns_shell.d_res_low              3.63 
_reflns_shell.percent_possible_all   98.4 
_reflns_shell.Rmerge_I_obs           1.002 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.3 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4QLC 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     87833 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.393 
_refine.ls_d_res_high                            3.503 
_refine.ls_percent_reflns_obs                    98.49 
_refine.ls_R_factor_obs                          0.2196 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2184 
_refine.ls_R_factor_R_free                       0.2435 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_number_reflns_R_free                  4443 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               137.1 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'Zero occupancy atoms represent atoms for which no electron density observed' 
_refine.pdbx_starting_model                      '4INM, 1HST' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       TWIN_LSQ_F 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            . 
_refine.pdbx_overall_phase_error                 30.37 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6509 
_refine_hist.pdbx_number_atoms_nucleic_acid   6807 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               13355 
_refine_hist.d_res_high                       3.503 
_refine_hist.d_res_low                        45.393 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 14280 'X-RAY DIFFRACTION' ? 
f_angle_d          0.757  ? ? 20705 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 26.823 ? ? 5889  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.033  ? ? 2341  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 1471  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.5047 3.5651  4128 0.3003 93.00 0.3074 . . 213 . . . . 
'X-RAY DIFFRACTION' . 3.5651 3.6299  4191 0.2894 94.00 0.3345 . . 225 . . . . 
'X-RAY DIFFRACTION' . 3.6299 3.6997  4201 0.2842 94.00 0.3634 . . 216 . . . . 
'X-RAY DIFFRACTION' . 3.6997 3.7752  4193 0.2825 94.00 0.3084 . . 218 . . . . 
'X-RAY DIFFRACTION' . 3.7752 3.8572  4218 0.2759 94.00 0.3239 . . 223 . . . . 
'X-RAY DIFFRACTION' . 3.8572 3.9469  4150 0.2621 94.00 0.3172 . . 216 . . . . 
'X-RAY DIFFRACTION' . 3.9469 4.0455  4220 0.2577 94.00 0.3179 . . 225 . . . . 
'X-RAY DIFFRACTION' . 4.0455 4.1548  4223 0.2421 94.00 0.2621 . . 225 . . . . 
'X-RAY DIFFRACTION' . 4.1548 4.2770  4171 0.2422 94.00 0.2715 . . 220 . . . . 
'X-RAY DIFFRACTION' . 4.2770 4.4149  4201 0.2226 94.00 0.2729 . . 221 . . . . 
'X-RAY DIFFRACTION' . 4.4149 4.5725  4195 0.2230 94.00 0.2952 . . 217 . . . . 
'X-RAY DIFFRACTION' . 4.5725 4.7554  4164 0.2219 94.00 0.2511 . . 220 . . . . 
'X-RAY DIFFRACTION' . 4.7554 4.9715  4154 0.2161 94.00 0.2531 . . 222 . . . . 
'X-RAY DIFFRACTION' . 4.9715 5.2332  4204 0.2190 94.00 0.2339 . . 217 . . . . 
'X-RAY DIFFRACTION' . 5.2332 5.5605  4159 0.2163 94.00 0.2320 . . 218 . . . . 
'X-RAY DIFFRACTION' . 5.5605 5.9889  4190 0.2283 94.00 0.2711 . . 217 . . . . 
'X-RAY DIFFRACTION' . 5.9889 6.5897  4178 0.2196 94.00 0.2543 . . 221 . . . . 
'X-RAY DIFFRACTION' . 6.5897 7.5390  4156 0.2007 93.00 0.2159 . . 222 . . . . 
'X-RAY DIFFRACTION' . 7.5390 9.4824  4143 0.1579 93.00 0.1608 . . 221 . . . . 
'X-RAY DIFFRACTION' . 9.4824 43.6930 3991 0.1486 90.00 0.1354 . . 209 . . . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 2 
3 ? 3 
4 ? 4 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
# 
_struct.entry_id                  4QLC 
_struct.title                     'Crystal structure of chromatosome at 3.5 angstrom resolution' 
_struct.pdbx_descriptor           'PROTEIN/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4QLC 
_struct_keywords.pdbx_keywords   'CHROMATIN BINDING PROTEIN/DNA' 
_struct_keywords.text            
;NUCLEOSOME CORE PARTICLE, HISTONE FOLD, CHROMOSOME, CHROMATIN, Global histone H5, gH5, NCP167, Regulation, SEGREGATION, CHROMATOSOME, gH1, Liker Histone H5, Linker DNA, Protein-DNA Complexes, DNA BINDING PROTEIN-DNA complex, CHROMATIN BINDING PROTEIN-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 44  ? SER C 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG C 63  ? ASP C 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN C 85  ? ALA C 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET C 120 ? GLY C 132 ? MET A 120 GLY A 132 1 ? 13 
HELX_P HELX_P5  5  ASN D 25  ? ILE D 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  6  THR D 30  ? GLY D 42  ? THR B 30  GLY B 42  1 ? 13 
HELX_P HELX_P7  7  LEU D 49  ? ALA D 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR D 82  ? GLN D 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  SER E 15  ? ALA E 20  ? SER C 15  ALA C 20  1 ? 6  
HELX_P HELX_P10 10 PRO E 25  ? LYS E 35  ? PRO C 25  LYS C 35  1 ? 11 
HELX_P HELX_P11 11 ALA E 44  ? ASN E 72  ? ALA C 44  ASN C 72  1 ? 29 
HELX_P HELX_P12 12 ILE E 78  ? ASP E 89  ? ILE C 78  ASP C 89  1 ? 12 
HELX_P HELX_P13 13 ASP E 89  ? LEU E 96  ? ASP C 89  LEU C 96  1 ? 8  
HELX_P HELX_P14 14 GLN E 111 ? LEU E 115 ? GLN C 111 LEU C 115 5 ? 5  
HELX_P HELX_P15 15 TYR F 34  ? HIS F 46  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER F 52  ? ASN F 81  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR F 87  ? LEU F 99  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO F 100 ? SER F 120 ? PRO D 100 SER D 120 1 ? 21 
HELX_P HELX_P19 19 GLY G 44  ? SER G 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG G 63  ? ASP G 77  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P21 21 GLN G 85  ? ALA G 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET G 120 ? GLY G 132 ? MET E 120 GLY E 132 1 ? 13 
HELX_P HELX_P23 23 ASP H 24  ? ILE H 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 24 THR H 30  ? GLY H 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU H 49  ? ALA H 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 26 THR H 82  ? GLN H 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 SER I 15  ? ALA I 20  ? SER G 15  ALA G 20  1 ? 6  
HELX_P HELX_P28 28 PRO I 25  ? LYS I 35  ? PRO G 25  LYS G 35  1 ? 11 
HELX_P HELX_P29 29 ALA I 44  ? ASP I 71  ? ALA G 44  ASP G 71  1 ? 28 
HELX_P HELX_P30 30 ILE I 78  ? ASN I 88  ? ILE G 78  ASN G 88  1 ? 11 
HELX_P HELX_P31 31 ASP I 89  ? LEU I 96  ? ASP G 89  LEU G 96  1 ? 8  
HELX_P HELX_P32 32 GLN I 111 ? LEU I 115 ? GLN G 111 LEU G 115 5 ? 5  
HELX_P HELX_P33 33 TYR J 34  ? HIS J 46  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER J 52  ? ASN J 81  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR J 87  ? LEU J 99  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO J 100 ? SER J 120 ? PRO H 100 SER H 120 1 ? 21 
HELX_P HELX_P37 37 THR K 6   ? ALA K 17  ? THR U 27  ALA U 38  1 ? 12 
HELX_P HELX_P38 38 ARG K 26  ? TYR K 37  ? ARG U 47  TYR U 58  1 ? 12 
HELX_P HELX_P39 39 ASN K 42  ? ALA K 57  ? ASN U 63  ALA U 78  1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DC 2   O2 ? ? ? 1_555 B DG 166 N2 ? ? I DC 2   J DG 166 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog2   hydrog ? ? A DT 3   N3 ? ? ? 1_555 B DA 165 N1 ? ? I DT 3   J DA 165 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog3   hydrog ? ? A DG 4   O6 ? ? ? 1_555 B DC 163 N4 ? ? I DG 4   J DC 163 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog4   hydrog ? ? A DG 4   N2 ? ? ? 1_555 B DC 164 O2 ? ? I DG 4   J DC 164 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog5   hydrog ? ? A DG 5   N2 ? ? ? 1_555 B DC 163 O2 ? ? I DG 5   J DC 163 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog6   hydrog ? ? A DC 6   O2 ? ? ? 1_555 B DG 162 N2 ? ? I DC 6   J DG 162 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog7   hydrog ? ? A DC 7   O2 ? ? ? 1_555 B DG 161 N2 ? ? I DC 7   J DG 161 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog8   hydrog ? ? A DG 8   O6 ? ? ? 1_555 B DG 159 N1 ? ? I DG 8   J DG 159 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? 
hydrog9   hydrog ? ? A DG 8   N1 ? ? ? 1_555 B DC 160 N3 ? ? I DG 8   J DC 160 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog10  hydrog ? ? A DC 9   N4 ? ? ? 1_555 B DG 158 O6 ? ? I DC 9   J DG 158 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog11  hydrog ? ? A DC 9   O2 ? ? ? 1_555 B DG 159 N2 ? ? I DC 9   J DG 159 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog12  hydrog ? ? A DC 10  N3 ? ? ? 1_555 B DG 158 N1 ? ? I DC 10  J DG 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13  hydrog ? ? A DC 10  N4 ? ? ? 1_555 B DG 158 O6 ? ? I DC 10  J DG 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14  hydrog ? ? A DC 10  O2 ? ? ? 1_555 B DG 158 N2 ? ? I DC 10  J DG 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15  hydrog ? ? A DC 11  O2 ? ? ? 1_555 B DG 157 N2 ? ? I DC 11  J DG 157 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog16  hydrog ? ? A DG 13  O6 ? ? ? 1_555 B DC 155 N4 ? ? I DG 13  J DC 155 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog17  hydrog ? ? A DG 14  N1 ? ? ? 1_555 B DC 154 N3 ? ? I DG 14  J DC 154 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog18  hydrog ? ? A DG 14  N2 ? ? ? 1_555 B DC 155 O2 ? ? I DG 14  J DC 155 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog19  hydrog ? ? A DA 15  N1 ? ? ? 1_555 B DT 153 N3 ? ? I DA 15  J DT 153 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog20  hydrog ? ? A DG 16  N1 ? ? ? 1_555 B DC 152 N3 ? ? I DG 16  J DC 152 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog21  hydrog ? ? A DA 17  N1 ? ? ? 1_555 B DT 151 N3 ? ? I DA 17  J DT 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22  hydrog ? ? A DA 17  N6 ? ? ? 1_555 B DT 151 O4 ? ? I DA 17  J DT 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23  hydrog ? ? A DA 18  N1 ? ? ? 1_555 B DT 150 N3 ? ? I DA 18  J DT 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24  hydrog ? ? A DA 18  N6 ? ? ? 1_555 B DT 150 O4 ? ? I DA 18  J DT 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25  hydrog ? ? A DC 21  O2 ? ? ? 1_555 B DG 148 N1 ? ? I DC 21  J DG 148 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog26  hydrog ? ? A DC 22  O2 ? ? ? 1_555 B DG 146 N2 ? ? I DC 22  J DG 146 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog27  hydrog ? ? A DG 23  N2 ? ? ? 1_555 B DC 145 O2 ? ? I DG 23  J DC 145 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog28  hydrog ? ? A DG 24  N1 ? ? ? 1_555 B DC 144 N3 ? ? I DG 24  J DC 144 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog29  hydrog ? ? A DT 25  O4 ? ? ? 1_555 B DC 142 N4 ? ? I DT 25  J DC 142 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? 
hydrog30  hydrog ? ? A DT 25  N3 ? ? ? 1_555 B DA 143 N1 ? ? I DT 25  J DA 143 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog31  hydrog ? ? A DG 26  N1 ? ? ? 1_555 B DG 141 O6 ? ? I DG 26  J DG 141 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? 
hydrog32  hydrog ? ? A DG 26  N2 ? ? ? 1_555 B DC 142 O2 ? ? I DG 26  J DC 142 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog33  hydrog ? ? A DC 27  N4 ? ? ? 1_555 B DG 140 O6 ? ? I DC 27  J DG 140 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog34  hydrog ? ? A DC 27  O2 ? ? ? 1_555 B DG 141 N1 ? ? I DC 27  J DG 141 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog35  hydrog ? ? A DC 28  O2 ? ? ? 1_555 B DG 140 N2 ? ? I DC 28  J DG 140 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog36  hydrog ? ? A DG 29  N1 ? ? ? 1_555 B DC 139 N3 ? ? I DG 29  J DC 139 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37  hydrog ? ? A DG 29  N2 ? ? ? 1_555 B DC 139 O2 ? ? I DG 29  J DC 139 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38  hydrog ? ? A DG 29  O6 ? ? ? 1_555 B DC 139 N4 ? ? I DG 29  J DC 139 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39  hydrog ? ? A DA 30  N1 ? ? ? 1_555 B DT 138 N3 ? ? I DA 30  J DT 138 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40  hydrog ? ? A DA 30  N6 ? ? ? 1_555 B DT 138 O4 ? ? I DA 30  J DT 138 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41  hydrog ? ? A DG 31  N1 ? ? ? 1_555 B DC 137 N3 ? ? I DG 31  J DC 137 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog42  hydrog ? ? A DG 32  N1 ? ? ? 1_555 B DC 136 N3 ? ? I DG 32  J DC 136 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43  hydrog ? ? A DG 32  N2 ? ? ? 1_555 B DC 136 O2 ? ? I DG 32  J DC 136 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44  hydrog ? ? A DG 32  O6 ? ? ? 1_555 B DC 136 N4 ? ? I DG 32  J DC 136 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45  hydrog ? ? A DC 33  N3 ? ? ? 1_555 B DG 135 N1 ? ? I DC 33  J DG 135 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46  hydrog ? ? A DC 33  N4 ? ? ? 1_555 B DG 135 O6 ? ? I DC 33  J DG 135 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47  hydrog ? ? A DC 33  O2 ? ? ? 1_555 B DG 135 N2 ? ? I DC 33  J DG 135 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? A DC 34  O2 ? ? ? 1_555 B DG 134 N1 ? ? I DC 34  J DG 134 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog49  hydrog ? ? A DG 35  O6 ? ? ? 1_555 B DG 132 N1 ? ? I DG 35  J DG 132 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? 
hydrog50  hydrog ? ? A DG 35  N1 ? ? ? 1_555 B DC 133 N3 ? ? I DG 35  J DC 133 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog51  hydrog ? ? A DC 36  O2 ? ? ? 1_555 B DG 132 N2 ? ? I DC 36  J DG 132 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog52  hydrog ? ? A DT 37  N3 ? ? ? 1_555 B DA 131 N1 ? ? I DT 37  J DA 131 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B DA 131 N6 ? ? I DT 37  J DA 131 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54  hydrog ? ? A DC 38  O2 ? ? ? 1_555 B DG 130 N2 ? ? I DC 38  J DG 130 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog55  hydrog ? ? A DA 39  N1 ? ? ? 1_555 B DT 129 N3 ? ? I DA 39  J DT 129 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog56  hydrog ? ? A DA 40  N1 ? ? ? 1_555 B DT 128 N3 ? ? I DA 40  J DT 128 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57  hydrog ? ? A DA 40  N6 ? ? ? 1_555 B DT 128 O4 ? ? I DA 40  J DT 128 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58  hydrog ? ? A DT 41  N3 ? ? ? 1_555 B DA 127 N1 ? ? I DT 41  J DA 127 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog59  hydrog ? ? A DT 42  N3 ? ? ? 1_555 B DA 126 N1 ? ? I DT 42  J DA 126 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60  hydrog ? ? A DT 42  O4 ? ? ? 1_555 B DA 126 N6 ? ? I DT 42  J DA 126 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61  hydrog ? ? A DG 43  N1 ? ? ? 1_555 B DC 125 N3 ? ? I DG 43  J DC 125 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog62  hydrog ? ? A DG 44  N1 ? ? ? 1_555 B DC 124 O2 ? ? I DG 44  J DC 124 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog63  hydrog ? ? A DG 44  N2 ? ? ? 1_555 B DC 125 O2 ? ? I DG 44  J DC 125 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog64  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B DA 123 N1 ? ? I DT 45  J DA 123 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog65  hydrog ? ? A DC 46  O2 ? ? ? 1_555 B DG 122 N2 ? ? I DC 46  J DG 122 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog66  hydrog ? ? A DG 47  N2 ? ? ? 1_555 B DC 121 O2 ? ? I DG 47  J DC 121 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog67  hydrog ? ? A DT 48  N3 ? ? ? 1_555 B DA 120 N1 ? ? I DT 48  J DA 120 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68  hydrog ? ? A DT 48  O4 ? ? ? 1_555 B DA 120 N6 ? ? I DT 48  J DA 120 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? A DA 49  N6 ? ? ? 1_555 B DC 118 N3 ? ? I DA 49  J DC 118 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ? ? 
hydrog70  hydrog ? ? A DA 49  N1 ? ? ? 1_555 B DT 119 N3 ? ? I DA 49  J DT 119 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71  hydrog ? ? A DA 49  N6 ? ? ? 1_555 B DT 119 O4 ? ? I DA 49  J DT 119 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72  hydrog ? ? A DG 50  N2 ? ? ? 1_555 B DC 118 O2 ? ? I DG 50  J DC 118 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog73  hydrog ? ? A DC 52  O2 ? ? ? 1_555 B DG 116 N2 ? ? I DC 52  J DG 116 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog74  hydrog ? ? A DA 53  N1 ? ? ? 1_555 B DT 115 N3 ? ? I DA 53  J DT 115 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog75  hydrog ? ? A DG 54  N1 ? ? ? 1_555 B DC 114 N3 ? ? I DG 54  J DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76  hydrog ? ? A DG 54  N2 ? ? ? 1_555 B DC 114 O2 ? ? I DG 54  J DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77  hydrog ? ? A DG 54  O6 ? ? ? 1_555 B DC 114 N4 ? ? I DG 54  J DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78  hydrog ? ? A DC 55  O2 ? ? ? 1_555 B DG 113 N2 ? ? I DC 55  J DG 113 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog79  hydrog ? ? A DT 56  N3 ? ? ? 1_555 B DA 112 N1 ? ? I DT 56  J DA 112 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog80  hydrog ? ? A DC 57  O2 ? ? ? 1_555 B DG 111 N1 ? ? I DC 57  J DG 111 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog81  hydrog ? ? A DT 58  O2 ? ? ? 1_555 B DG 111 N2 ? ? I DT 58  J DG 111 1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ? ? 
hydrog82  hydrog ? ? A DA 59  N1 ? ? ? 1_555 B DT 109 N3 ? ? I DA 59  J DT 109 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83  hydrog ? ? A DA 59  N6 ? ? ? 1_555 B DT 109 O4 ? ? I DA 59  J DT 109 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog84  hydrog ? ? A DG 60  N1 ? ? ? 1_555 B DG 107 O6 ? ? I DG 60  J DG 107 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? 
hydrog85  hydrog ? ? A DG 60  N2 ? ? ? 1_555 B DC 108 O2 ? ? I DG 60  J DC 108 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog86  hydrog ? ? A DC 61  O2 ? ? ? 1_555 B DG 107 N2 ? ? I DC 61  J DG 107 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog87  hydrog ? ? A DA 62  N1 ? ? ? 1_555 B DT 106 N3 ? ? I DA 62  J DT 106 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog88  hydrog ? ? A DA 62  N6 ? ? ? 1_555 B DT 106 O4 ? ? I DA 62  J DT 106 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog89  hydrog ? ? A DC 63  N3 ? ? ? 1_555 B DG 105 N1 ? ? I DC 63  J DG 105 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog90  hydrog ? ? A DC 63  N4 ? ? ? 1_555 B DG 105 O6 ? ? I DC 63  J DG 105 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91  hydrog ? ? A DC 63  O2 ? ? ? 1_555 B DG 105 N2 ? ? I DC 63  J DG 105 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? A DC 64  N3 ? ? ? 1_555 B DG 104 N1 ? ? I DC 64  J DG 104 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? A DC 64  N4 ? ? ? 1_555 B DG 104 O6 ? ? I DC 64  J DG 104 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog94  hydrog ? ? A DC 64  O2 ? ? ? 1_555 B DG 104 N2 ? ? I DC 64  J DG 104 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog95  hydrog ? ? A DG 65  N1 ? ? ? 1_555 B DC 103 N3 ? ? I DG 65  J DC 103 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog96  hydrog ? ? A DG 65  N2 ? ? ? 1_555 B DC 103 O2 ? ? I DG 65  J DC 103 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog97  hydrog ? ? A DG 65  O6 ? ? ? 1_555 B DC 103 N4 ? ? I DG 65  J DC 103 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? A DC 66  O2 ? ? ? 1_555 B DG 102 N1 ? ? I DC 66  J DG 102 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog99  hydrog ? ? A DT 67  O4 ? ? ? 1_555 B DA 101 N6 ? ? I DT 67  J DA 101 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog100 hydrog ? ? A DT 67  O2 ? ? ? 1_555 B DG 102 N2 ? ? I DT 67  J DG 102 1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ? ? 
hydrog101 hydrog ? ? A DA 69  N1 ? ? ? 1_555 B DT 99  N3 ? ? I DA 69  J DT 99  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog102 hydrog ? ? A DA 69  N6 ? ? ? 1_555 B DT 99  O4 ? ? I DA 69  J DT 99  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog103 hydrog ? ? A DA 70  N6 ? ? ? 1_555 B DT 97  O4 ? ? I DA 70  J DT 97  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog104 hydrog ? ? A DA 70  N1 ? ? ? 1_555 B DT 98  N3 ? ? I DA 70  J DT 98  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? A DA 70  N6 ? ? ? 1_555 B DT 98  O4 ? ? I DA 70  J DT 98  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog106 hydrog ? ? A DA 71  N1 ? ? ? 1_555 B DT 97  N3 ? ? I DA 71  J DT 97  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog107 hydrog ? ? A DA 71  N6 ? ? ? 1_555 B DT 97  O4 ? ? I DA 71  J DT 97  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? A DC 72  N3 ? ? ? 1_555 B DG 96  N1 ? ? I DC 72  J DG 96  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog109 hydrog ? ? A DC 72  N4 ? ? ? 1_555 B DG 96  O6 ? ? I DC 72  J DG 96  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog110 hydrog ? ? A DC 72  O2 ? ? ? 1_555 B DG 96  N2 ? ? I DC 72  J DG 96  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog111 hydrog ? ? A DG 73  N1 ? ? ? 1_555 B DC 95  N3 ? ? I DG 73  J DC 95  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog112 hydrog ? ? A DG 73  N2 ? ? ? 1_555 B DC 95  O2 ? ? I DG 73  J DC 95  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog113 hydrog ? ? A DG 73  O6 ? ? ? 1_555 B DC 95  N4 ? ? I DG 73  J DC 95  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? A DC 74  N3 ? ? ? 1_555 B DG 94  N1 ? ? I DC 74  J DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog115 hydrog ? ? A DC 74  N4 ? ? ? 1_555 B DG 94  O6 ? ? I DC 74  J DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog116 hydrog ? ? A DC 74  O2 ? ? ? 1_555 B DG 94  N2 ? ? I DC 74  J DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog117 hydrog ? ? A DA 75  N1 ? ? ? 1_555 B DT 93  N3 ? ? I DA 75  J DT 93  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog118 hydrog ? ? A DA 75  N6 ? ? ? 1_555 B DT 93  O4 ? ? I DA 75  J DT 93  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog119 hydrog ? ? A DC 76  N3 ? ? ? 1_555 B DG 92  N1 ? ? I DC 76  J DG 92  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? A DC 76  N4 ? ? ? 1_555 B DG 92  O6 ? ? I DC 76  J DG 92  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog121 hydrog ? ? A DC 76  O2 ? ? ? 1_555 B DG 92  N2 ? ? I DC 76  J DG 92  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? A DG 77  N1 ? ? ? 1_555 B DC 91  N3 ? ? I DG 77  J DC 91  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog123 hydrog ? ? A DG 77  N2 ? ? ? 1_555 B DC 91  O2 ? ? I DG 77  J DC 91  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog124 hydrog ? ? A DG 77  O6 ? ? ? 1_555 B DC 91  N4 ? ? I DG 77  J DC 91  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog125 hydrog ? ? A DT 78  N3 ? ? ? 1_555 B DA 90  N1 ? ? I DT 78  J DA 90  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog126 hydrog ? ? A DT 78  O4 ? ? ? 1_555 B DA 90  N6 ? ? I DT 78  J DA 90  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog127 hydrog ? ? A DA 79  N1 ? ? ? 1_555 B DT 89  N3 ? ? I DA 79  J DT 89  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? A DA 79  N6 ? ? ? 1_555 B DT 89  O4 ? ? I DA 79  J DT 89  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog129 hydrog ? ? A DC 80  N3 ? ? ? 1_555 B DG 88  N1 ? ? I DC 80  J DG 88  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog130 hydrog ? ? A DC 80  N4 ? ? ? 1_555 B DG 88  O6 ? ? I DC 80  J DG 88  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog131 hydrog ? ? A DC 80  O2 ? ? ? 1_555 B DG 88  N2 ? ? I DC 80  J DG 88  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? A DG 81  N1 ? ? ? 1_555 B DC 87  N3 ? ? I DG 81  J DC 87  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? A DG 81  N2 ? ? ? 1_555 B DC 87  O2 ? ? I DG 81  J DC 87  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? A DG 81  O6 ? ? ? 1_555 B DC 87  N4 ? ? I DG 81  J DC 87  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog135 hydrog ? ? A DC 82  O2 ? ? ? 1_555 B DG 86  N2 ? ? I DC 82  J DG 86  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog136 hydrog ? ? A DG 83  N1 ? ? ? 1_555 B DC 85  N3 ? ? I DG 83  J DC 85  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? A DG 83  N2 ? ? ? 1_555 B DC 85  O2 ? ? I DG 83  J DC 85  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? A DG 83  O6 ? ? ? 1_555 B DC 85  N4 ? ? I DG 83  J DC 85  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog139 hydrog ? ? A DC 84  N3 ? ? ? 1_555 B DG 84  N1 ? ? I DC 84  J DG 84  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog140 hydrog ? ? A DC 84  N4 ? ? ? 1_555 B DG 84  O6 ? ? I DC 84  J DG 84  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog141 hydrog ? ? A DC 84  O2 ? ? ? 1_555 B DG 84  N2 ? ? I DC 84  J DG 84  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog142 hydrog ? ? A DT 85  N3 ? ? ? 1_555 B DA 83  N1 ? ? I DT 85  J DA 83  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog143 hydrog ? ? A DT 85  O4 ? ? ? 1_555 B DA 83  N6 ? ? I DT 85  J DA 83  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog144 hydrog ? ? A DG 86  N1 ? ? ? 1_555 B DC 82  N3 ? ? I DG 86  J DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? A DG 86  N2 ? ? ? 1_555 B DC 82  O2 ? ? I DG 86  J DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog146 hydrog ? ? A DG 86  O6 ? ? ? 1_555 B DC 82  N4 ? ? I DG 86  J DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? A DT 87  N3 ? ? ? 1_555 B DA 81  N1 ? ? I DT 87  J DA 81  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? A DT 87  O4 ? ? ? 1_555 B DA 81  N6 ? ? I DT 87  J DA 81  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? A DC 88  N3 ? ? ? 1_555 B DG 80  N1 ? ? I DC 88  J DG 80  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog150 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B DG 80  O6 ? ? I DC 88  J DG 80  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog151 hydrog ? ? A DC 88  O2 ? ? ? 1_555 B DG 80  N2 ? ? I DC 88  J DG 80  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog152 hydrog ? ? A DC 89  N3 ? ? ? 1_555 B DG 79  N1 ? ? I DC 89  J DG 79  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog153 hydrog ? ? A DC 89  N4 ? ? ? 1_555 B DG 79  O6 ? ? I DC 89  J DG 79  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? A DC 89  O2 ? ? ? 1_555 B DG 79  N2 ? ? I DC 89  J DG 79  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? A DC 90  N3 ? ? ? 1_555 B DG 78  N1 ? ? I DC 90  J DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog156 hydrog ? ? A DC 90  N4 ? ? ? 1_555 B DG 78  O6 ? ? I DC 90  J DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog157 hydrog ? ? A DC 90  O2 ? ? ? 1_555 B DG 78  N2 ? ? I DC 90  J DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog158 hydrog ? ? A DC 91  N3 ? ? ? 1_555 B DG 77  N1 ? ? I DC 91  J DG 77  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog159 hydrog ? ? A DC 91  N4 ? ? ? 1_555 B DG 77  O6 ? ? I DC 91  J DG 77  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog160 hydrog ? ? A DC 91  O2 ? ? ? 1_555 B DG 77  N2 ? ? I DC 91  J DG 77  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog161 hydrog ? ? A DC 92  N3 ? ? ? 1_555 B DG 76  N1 ? ? I DC 92  J DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog162 hydrog ? ? A DC 92  N4 ? ? ? 1_555 B DG 76  O6 ? ? I DC 92  J DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog163 hydrog ? ? A DC 92  O2 ? ? ? 1_555 B DG 76  N2 ? ? I DC 92  J DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog164 hydrog ? ? A DG 93  N1 ? ? ? 1_555 B DC 75  N3 ? ? I DG 93  J DC 75  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog165 hydrog ? ? A DG 93  N2 ? ? ? 1_555 B DC 75  O2 ? ? I DG 93  J DC 75  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog166 hydrog ? ? A DG 93  O6 ? ? ? 1_555 B DC 75  N4 ? ? I DG 93  J DC 75  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog167 hydrog ? ? A DC 94  N3 ? ? ? 1_555 B DG 74  N1 ? ? I DC 94  J DG 74  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog168 hydrog ? ? A DC 94  N4 ? ? ? 1_555 B DG 74  O6 ? ? I DC 94  J DG 74  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog169 hydrog ? ? A DC 94  O2 ? ? ? 1_555 B DG 74  N2 ? ? I DC 94  J DG 74  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog170 hydrog ? ? A DG 95  N1 ? ? ? 1_555 B DC 73  N3 ? ? I DG 95  J DC 73  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog171 hydrog ? ? A DG 95  N2 ? ? ? 1_555 B DC 73  O2 ? ? I DG 95  J DC 73  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog172 hydrog ? ? A DG 95  O6 ? ? ? 1_555 B DC 73  N4 ? ? I DG 95  J DC 73  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog173 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B DA 72  N1 ? ? I DT 96  J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog174 hydrog ? ? A DT 96  O4 ? ? ? 1_555 B DA 72  N6 ? ? I DT 96  J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog175 hydrog ? ? A DT 97  O4 ? ? ? 1_555 B DA 70  N6 ? ? I DT 97  J DA 70  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog176 hydrog ? ? A DT 97  N3 ? ? ? 1_555 B DA 71  N1 ? ? I DT 97  J DA 71  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog177 hydrog ? ? A DT 98  O4 ? ? ? 1_555 B DA 69  N6 ? ? I DT 98  J DA 69  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog178 hydrog ? ? A DT 98  N3 ? ? ? 1_555 B DA 70  N1 ? ? I DT 98  J DA 70  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog179 hydrog ? ? A DT 99  N3 ? ? ? 1_555 B DA 69  N1 ? ? I DT 99  J DA 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog180 hydrog ? ? A DT 99  O4 ? ? ? 1_555 B DA 69  N6 ? ? I DT 99  J DA 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog181 hydrog ? ? A DA 100 N1 ? ? ? 1_555 B DT 68  N3 ? ? I DA 100 J DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog182 hydrog ? ? A DA 100 N6 ? ? ? 1_555 B DT 68  O4 ? ? I DA 100 J DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog183 hydrog ? ? A DA 101 N1 ? ? ? 1_555 B DT 67  N3 ? ? I DA 101 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog184 hydrog ? ? A DA 101 N6 ? ? ? 1_555 B DT 67  O4 ? ? I DA 101 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog185 hydrog ? ? A DC 102 N4 ? ? ? 1_555 B DG 65  O6 ? ? I DC 102 J DG 65  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog186 hydrog ? ? A DC 102 O2 ? ? ? 1_555 B DG 66  N2 ? ? I DC 102 J DG 66  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog187 hydrog ? ? A DC 103 O2 ? ? ? 1_555 B DG 65  N2 ? ? I DC 103 J DG 65  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog188 hydrog ? ? A DC 103 O2 ? ? ? 1_555 B DG 66  N2 ? ? I DC 103 J DG 66  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog189 hydrog ? ? A DG 104 N1 ? ? ? 1_555 B DC 64  N3 ? ? I DG 104 J DC 64  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog190 hydrog ? ? A DC 105 O2 ? ? ? 1_555 B DG 63  N1 ? ? I DC 105 J DG 63  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog191 hydrog ? ? A DC 106 O2 ? ? ? 1_555 B DG 62  N2 ? ? I DC 106 J DG 62  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog192 hydrog ? ? A DA 107 N1 ? ? ? 1_555 B DT 61  N3 ? ? I DA 107 J DT 61  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog193 hydrog ? ? A DA 107 N6 ? ? ? 1_555 B DT 61  O4 ? ? I DA 107 J DT 61  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog194 hydrog ? ? A DA 108 N1 ? ? ? 1_555 B DT 60  N3 ? ? I DA 108 J DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog195 hydrog ? ? A DA 108 N6 ? ? ? 1_555 B DT 60  O4 ? ? I DA 108 J DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog196 hydrog ? ? A DG 109 N1 ? ? ? 1_555 B DC 59  N3 ? ? I DG 109 J DC 59  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog197 hydrog ? ? A DG 110 N1 ? ? ? 1_555 B DC 58  N3 ? ? I DG 110 J DC 58  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog198 hydrog ? ? A DG 111 N1 ? ? ? 1_555 B DC 57  N3 ? ? I DG 111 J DC 57  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog199 hydrog ? ? A DG 112 N1 ? ? ? 1_555 B DC 56  N3 ? ? I DG 112 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog200 hydrog ? ? A DG 112 N2 ? ? ? 1_555 B DC 56  O2 ? ? I DG 112 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog201 hydrog ? ? A DG 112 O6 ? ? ? 1_555 B DC 56  N4 ? ? I DG 112 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog202 hydrog ? ? A DT 114 N3 ? ? ? 1_555 B DA 54  N1 ? ? I DT 114 J DA 54  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog203 hydrog ? ? A DT 115 N3 ? ? ? 1_555 B DA 53  N1 ? ? I DT 115 J DA 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog204 hydrog ? ? A DT 115 O4 ? ? ? 1_555 B DA 53  N6 ? ? I DT 115 J DA 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog205 hydrog ? ? A DA 116 N1 ? ? ? 1_555 B DT 52  N3 ? ? I DA 116 J DT 52  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog206 hydrog ? ? A DC 117 O2 ? ? ? 1_555 B DG 51  N2 ? ? I DC 117 J DG 51  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog207 hydrog ? ? A DT 118 N3 ? ? ? 1_555 B DA 50  N1 ? ? I DT 118 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog208 hydrog ? ? A DT 118 O4 ? ? ? 1_555 B DA 50  N6 ? ? I DT 118 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog209 hydrog ? ? A DT 118 O2 ? ? ? 1_555 B DG 51  N1 ? ? I DT 118 J DG 51  1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ? ? 
hydrog210 hydrog ? ? A DC 119 N4 ? ? ? 1_555 B DG 49  O6 ? ? I DC 119 J DG 49  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog211 hydrog ? ? A DC 120 O2 ? ? ? 1_555 B DG 48  N2 ? ? I DC 120 J DG 48  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog212 hydrog ? ? A DC 120 O2 ? ? ? 1_555 B DG 49  N2 ? ? I DC 120 J DG 49  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog213 hydrog ? ? A DC 121 N4 ? ? ? 1_555 B DG 47  O6 ? ? I DC 121 J DG 47  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog214 hydrog ? ? A DT 122 N3 ? ? ? 1_555 B DA 46  N1 ? ? I DT 122 J DA 46  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog215 hydrog ? ? A DA 123 N1 ? ? ? 1_555 B DT 45  N3 ? ? I DA 123 J DT 45  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog216 hydrog ? ? A DG 124 N1 ? ? ? 1_555 B DC 44  O2 ? ? I DG 124 J DC 44  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog217 hydrog ? ? A DT 125 N3 ? ? ? 1_555 B DA 43  N1 ? ? I DT 125 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog218 hydrog ? ? A DT 125 O4 ? ? ? 1_555 B DA 43  N6 ? ? I DT 125 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog219 hydrog ? ? A DC 126 O2 ? ? ? 1_555 B DG 42  N2 ? ? I DC 126 J DG 42  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog220 hydrog ? ? A DT 127 N3 ? ? ? 1_555 B DA 41  N1 ? ? I DT 127 J DA 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog221 hydrog ? ? A DT 127 O4 ? ? ? 1_555 B DA 41  N6 ? ? I DT 127 J DA 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog222 hydrog ? ? A DC 128 N4 ? ? ? 1_555 B DG 39  O6 ? ? I DC 128 J DG 39  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog223 hydrog ? ? A DC 128 N3 ? ? ? 1_555 B DG 40  N2 ? ? I DC 128 J DG 40  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog224 hydrog ? ? A DC 129 N3 ? ? ? 1_555 B DG 39  N2 ? ? I DC 129 J DG 39  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog225 hydrog ? ? A DA 130 N1 ? ? ? 1_555 B DT 38  N3 ? ? I DA 130 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog226 hydrog ? ? A DA 130 N6 ? ? ? 1_555 B DT 38  O4 ? ? I DA 130 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog227 hydrog ? ? A DG 131 O6 ? ? ? 1_555 B DC 36  N4 ? ? I DG 131 J DC 36  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog228 hydrog ? ? A DG 131 N2 ? ? ? 1_555 B DC 37  O2 ? ? I DG 131 J DC 37  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog229 hydrog ? ? A DG 131 N2 ? ? ? 1_555 B DT 38  O2 ? ? I DG 131 J DT 38  1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ? ? 
hydrog230 hydrog ? ? A DG 132 O6 ? ? ? 1_555 B DG 35  N1 ? ? I DG 132 J DG 35  1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? 
hydrog231 hydrog ? ? A DG 132 N2 ? ? ? 1_555 B DC 36  O2 ? ? I DG 132 J DC 36  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog232 hydrog ? ? A DG 132 N2 ? ? ? 1_555 B DC 37  O2 ? ? I DG 132 J DC 37  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog233 hydrog ? ? A DC 133 O2 ? ? ? 1_555 B DG 35  N2 ? ? I DC 133 J DG 35  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog234 hydrog ? ? A DC 135 O2 ? ? ? 1_555 B DG 33  N1 ? ? I DC 135 J DG 33  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog235 hydrog ? ? A DG 136 N1 ? ? ? 1_555 B DC 32  O2 ? ? I DG 136 J DC 32  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog236 hydrog ? ? A DT 137 N3 ? ? ? 1_555 B DA 31  N1 ? ? I DT 137 J DA 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog237 hydrog ? ? A DT 137 O4 ? ? ? 1_555 B DA 31  N6 ? ? I DT 137 J DA 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog238 hydrog ? ? A DG 138 N1 ? ? ? 1_555 B DC 30  N3 ? ? I DG 138 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog239 hydrog ? ? A DG 138 N2 ? ? ? 1_555 B DC 30  O2 ? ? I DG 138 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog240 hydrog ? ? A DG 138 O6 ? ? ? 1_555 B DC 30  N4 ? ? I DG 138 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog241 hydrog ? ? A DT 139 N3 ? ? ? 1_555 B DA 29  N1 ? ? I DT 139 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog242 hydrog ? ? A DT 139 O4 ? ? ? 1_555 B DA 29  N6 ? ? I DT 139 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog243 hydrog ? ? A DC 140 N3 ? ? ? 1_555 B DG 28  N1 ? ? I DC 140 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog244 hydrog ? ? A DC 140 N4 ? ? ? 1_555 B DG 28  O6 ? ? I DC 140 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog245 hydrog ? ? A DC 140 O2 ? ? ? 1_555 B DG 28  N2 ? ? I DC 140 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog246 hydrog ? ? A DA 141 N1 ? ? ? 1_555 B DT 27  N3 ? ? I DA 141 J DT 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog247 hydrog ? ? A DA 141 N6 ? ? ? 1_555 B DT 27  O4 ? ? I DA 141 J DT 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog248 hydrog ? ? A DG 142 N1 ? ? ? 1_555 B DC 26  N3 ? ? I DG 142 J DC 26  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog249 hydrog ? ? A DA 143 N1 ? ? ? 1_555 B DT 25  N3 ? ? I DA 143 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog250 hydrog ? ? A DA 143 N6 ? ? ? 1_555 B DT 25  O4 ? ? I DA 143 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog251 hydrog ? ? A DT 144 N3 ? ? ? 1_555 B DA 24  N1 ? ? I DT 144 J DA 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog252 hydrog ? ? A DT 144 O4 ? ? ? 1_555 B DA 24  N6 ? ? I DT 144 J DA 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog253 hydrog ? ? A DA 145 N1 ? ? ? 1_555 B DT 23  N3 ? ? I DA 145 J DT 23  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog254 hydrog ? ? A DT 146 N3 ? ? ? 1_555 B DA 22  N1 ? ? I DT 146 J DA 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog255 hydrog ? ? A DT 146 O4 ? ? ? 1_555 B DA 22  N6 ? ? I DT 146 J DA 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog256 hydrog ? ? A DA 147 N1 ? ? ? 1_555 B DT 21  N3 ? ? I DA 147 J DT 21  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog257 hydrog ? ? A DT 148 N3 ? ? ? 1_555 B DA 20  N1 ? ? I DT 148 J DA 20  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog258 hydrog ? ? A DA 149 N1 ? ? ? 1_555 B DT 19  N3 ? ? I DA 149 J DT 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog259 hydrog ? ? A DA 149 N6 ? ? ? 1_555 B DT 19  O4 ? ? I DA 149 J DT 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog260 hydrog ? ? A DC 150 O2 ? ? ? 1_555 B DG 18  N2 ? ? I DC 150 J DG 18  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog261 hydrog ? ? A DA 151 N1 ? ? ? 1_555 B DA 16  N6 ? ? I DA 151 J DA 16  1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ? ? 
hydrog262 hydrog ? ? A DT 152 N3 ? ? ? 1_555 B DA 16  N1 ? ? I DT 152 J DA 16  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog263 hydrog ? ? A DC 153 N3 ? ? ? 1_555 B DG 14  N2 ? ? I DC 153 J DG 14  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog264 hydrog ? ? A DT 155 N3 ? ? ? 1_555 B DA 13  N1 ? ? I DT 155 J DA 13  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog265 hydrog ? ? A DG 156 N1 ? ? ? 1_555 B DC 12  N3 ? ? I DG 156 J DC 12  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog266 hydrog ? ? A DT 157 N3 ? ? ? 1_555 B DA 11  N1 ? ? I DT 157 J DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog267 hydrog ? ? A DT 157 O4 ? ? ? 1_555 B DA 11  N6 ? ? I DT 157 J DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog268 hydrog ? ? A DG 158 N1 ? ? ? 1_555 B DC 10  N3 ? ? I DG 158 J DC 10  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog269 hydrog ? ? A DC 159 O2 ? ? ? 1_555 B DG 9   N1 ? ? I DC 159 J DG 9   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog270 hydrog ? ? A DA 160 N6 ? ? ? 1_555 B DA 7   N1 ? ? I DA 160 J DA 7   1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ? ? 
hydrog271 hydrog ? ? A DG 162 N1 ? ? ? 1_555 B DC 6   N3 ? ? I DG 162 J DC 6   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog272 hydrog ? ? A DT 163 N3 ? ? ? 1_555 B DA 5   N1 ? ? I DT 163 J DA 5   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog273 hydrog ? ? A DA 164 N1 ? ? ? 1_555 B DT 4   N3 ? ? I DA 164 J DT 4   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog274 hydrog ? ? A DA 165 N1 ? ? ? 1_555 B DT 3   N3 ? ? I DA 165 J DT 3   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog275 hydrog ? ? A DG 166 N2 ? ? ? 1_555 B DC 2   O2 ? ? I DG 166 J DC 2   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog276 hydrog ? ? A DG 166 N2 ? ? ? 1_555 B DT 3   O2 ? ? I DG 166 J DT 3   1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
K ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? parallel      
C 1 2 ? parallel      
D 1 2 ? parallel      
E 1 2 ? parallel      
F 1 2 ? parallel      
G 1 2 ? parallel      
H 1 2 ? parallel      
I 1 2 ? parallel      
J 1 2 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 83  ? PHE C 84  ? ARG A 83  PHE A 84  
A 2 THR D 80  ? VAL D 81  ? THR B 80  VAL B 81  
B 1 THR C 118 ? ILE C 119 ? THR A 118 ILE A 119 
B 2 ARG D 45  ? ILE D 46  ? ARG B 45  ILE B 46  
C 1 THR D 96  ? TYR D 98  ? THR B 96  TYR B 98  
C 2 VAL I 99  ? ILE I 101 ? VAL G 99  ILE G 101 
D 1 ARG E 41  ? VAL E 42  ? ARG C 41  VAL C 42  
D 2 THR F 85  ? ILE F 86  ? THR D 85  ILE D 86  
E 1 ARG E 76  ? ILE E 77  ? ARG C 76  ILE C 77  
E 2 GLY F 50  ? ILE F 51  ? GLY D 50  ILE D 51  
F 1 VAL E 99  ? ILE E 101 ? VAL C 99  ILE C 101 
F 2 THR H 96  ? TYR H 98  ? THR F 96  TYR F 98  
G 1 ARG G 83  ? PHE G 84  ? ARG E 83  PHE E 84  
G 2 THR H 80  ? VAL H 81  ? THR F 80  VAL F 81  
H 1 THR G 118 ? ILE G 119 ? THR E 118 ILE E 119 
H 2 ARG H 45  ? ILE H 46  ? ARG F 45  ILE F 46  
I 1 ARG I 41  ? VAL I 42  ? ARG G 41  VAL G 42  
I 2 THR J 85  ? ILE J 86  ? THR H 85  ILE H 86  
J 1 ARG I 76  ? ILE I 77  ? ARG G 76  ILE G 77  
J 2 GLY J 50  ? ILE J 51  ? GLY H 50  ILE H 51  
K 1 SER K 24  ? SER K 25  ? SER U 45  SER U 46  
K 2 GLY K 70  ? LEU K 74  ? GLY U 91  LEU U 95  
K 3 LEU K 60  ? GLY K 65  ? LEU U 81  GLY U 86  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 83  ? N ARG A 83  O VAL D 81  ? O VAL B 81  
B 1 2 N ILE C 119 ? N ILE A 119 O ARG D 45  ? O ARG B 45  
C 1 2 N THR D 96  ? N THR B 96  O THR I 100 ? O THR G 100 
D 1 2 N ARG E 41  ? N ARG C 41  O ILE F 86  ? O ILE D 86  
E 1 2 N ILE E 77  ? N ILE C 77  O GLY F 50  ? O GLY D 50  
F 1 2 N THR E 100 ? N THR C 100 O THR H 96  ? O THR F 96  
G 1 2 N ARG G 83  ? N ARG E 83  O VAL H 81  ? O VAL F 81  
H 1 2 N ILE G 119 ? N ILE E 119 O ARG H 45  ? O ARG F 45  
I 1 2 N ARG I 41  ? N ARG G 41  O ILE J 86  ? O ILE H 86  
J 1 2 N ILE I 77  ? N ILE G 77  O GLY J 50  ? O GLY H 50  
K 1 2 N SER K 24  ? N SER U 45  O PHE K 72  ? O PHE U 93  
K 2 3 O ARG K 73  ? O ARG U 94  N LYS K 61  ? N LYS U 82  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CIT A 201' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CIT G 201' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CIT G 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 ARG C 129 ? ARG A 129 . ? 1_555 ? 
2 AC1 2 ARG C 134 ? ARG A 134 . ? 1_555 ? 
3 AC2 2 GLU I 60  ? GLU G 60  . ? 1_555 ? 
4 AC2 2 GLU I 63  ? GLU G 63  . ? 1_555 ? 
5 AC3 2 LYS C 64  ? LYS A 64  . ? 1_555 ? 
6 AC3 2 GLN I 103 ? GLN G 103 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4QLC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4QLC 
_atom_sites.fract_transf_matrix[1][1]   0.003804 
_atom_sites.fract_transf_matrix[1][2]   0.002196 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004393 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010894 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     P P     . DA  A 1 1   ? 11.994  186.094 59.428  1.00   153.50 ? 1   DA  I P     1 
ATOM   2     O OP1   . DA  A 1 1   ? 11.497  184.842 58.812  1.00   106.70 ? 1   DA  I OP1   1 
ATOM   3     O OP2   . DA  A 1 1   ? 12.891  186.993 58.666  1.00   116.83 ? 1   DA  I OP2   1 
ATOM   4     O "O5'" . DA  A 1 1   ? 10.742  186.955 59.932  1.00   139.22 ? 1   DA  I "O5'" 1 
ATOM   5     C "C5'" . DA  A 1 1   ? 9.420   186.556 59.587  1.00   143.00 ? 1   DA  I "C5'" 1 
ATOM   6     C "C4'" . DA  A 1 1   ? 8.639   187.720 59.004  1.00   135.36 ? 1   DA  I "C4'" 1 
ATOM   7     O "O4'" . DA  A 1 1   ? 9.415   188.341 57.947  1.00   110.96 ? 1   DA  I "O4'" 1 
ATOM   8     C "C3'" . DA  A 1 1   ? 7.294   187.344 58.389  1.00   121.31 ? 1   DA  I "C3'" 1 
ATOM   9     O "O3'" . DA  A 1 1   ? 6.305   188.313 58.711  1.00   97.93  ? 1   DA  I "O3'" 1 
ATOM   10    C "C2'" . DA  A 1 1   ? 7.577   187.306 56.891  1.00   108.19 ? 1   DA  I "C2'" 1 
ATOM   11    C "C1'" . DA  A 1 1   ? 8.699   188.322 56.731  1.00   95.99  ? 1   DA  I "C1'" 1 
ATOM   12    N N9    . DA  A 1 1   ? 9.629   187.973 55.661  1.00   117.88 ? 1   DA  I N9    1 
ATOM   13    C C8    . DA  A 1 1   ? 10.962  187.695 55.784  1.00   124.19 ? 1   DA  I C8    1 
ATOM   14    N N7    . DA  A 1 1   ? 11.549  187.399 54.648  1.00   125.92 ? 1   DA  I N7    1 
ATOM   15    C C5    . DA  A 1 1   ? 10.528  187.481 53.715  1.00   118.14 ? 1   DA  I C5    1 
ATOM   16    C C6    . DA  A 1 1   ? 10.496  187.281 52.320  1.00   99.47  ? 1   DA  I C6    1 
ATOM   17    N N6    . DA  A 1 1   ? 11.571  186.942 51.600  1.00   112.86 ? 1   DA  I N6    1 
ATOM   18    N N1    . DA  A 1 1   ? 9.314   187.445 51.691  1.00   65.36  ? 1   DA  I N1    1 
ATOM   19    C C2    . DA  A 1 1   ? 8.241   187.787 52.414  1.00   81.52  ? 1   DA  I C2    1 
ATOM   20    N N3    . DA  A 1 1   ? 8.147   188.002 53.725  1.00   91.56  ? 1   DA  I N3    1 
ATOM   21    C C4    . DA  A 1 1   ? 9.337   187.831 54.323  1.00   109.28 ? 1   DA  I C4    1 
ATOM   22    P P     . DC  A 1 2   ? 4.776   187.856 58.903  1.00   139.95 ? 2   DC  I P     1 
ATOM   23    O OP1   . DC  A 1 2   ? 3.996   189.046 59.309  1.00   102.32 ? 2   DC  I OP1   1 
ATOM   24    O OP2   . DC  A 1 2   ? 4.780   186.650 59.762  1.00   140.34 ? 2   DC  I OP2   1 
ATOM   25    O "O5'" . DC  A 1 2   ? 4.320   187.407 57.434  1.00   136.08 ? 2   DC  I "O5'" 1 
ATOM   26    C "C5'" . DC  A 1 2   ? 3.822   186.086 57.205  1.00   125.14 ? 2   DC  I "C5'" 1 
ATOM   27    C "C4'" . DC  A 1 2   ? 3.811   185.769 55.719  1.00   96.00  ? 2   DC  I "C4'" 1 
ATOM   28    O "O4'" . DC  A 1 2   ? 5.095   186.125 55.150  1.00   88.62  ? 2   DC  I "O4'" 1 
ATOM   29    C "C3'" . DC  A 1 2   ? 3.618   184.299 55.371  1.00   115.36 ? 2   DC  I "C3'" 1 
ATOM   30    O "O3'" . DC  A 1 2   ? 2.210   183.962 55.293  1.00   114.08 ? 2   DC  I "O3'" 1 
ATOM   31    C "C2'" . DC  A 1 2   ? 4.329   184.180 54.026  1.00   119.13 ? 2   DC  I "C2'" 1 
ATOM   32    C "C1'" . DC  A 1 2   ? 5.480   185.175 54.172  1.00   97.36  ? 2   DC  I "C1'" 1 
ATOM   33    N N1    . DC  A 1 2   ? 6.780   184.548 54.584  1.00   117.32 ? 2   DC  I N1    1 
ATOM   34    C C2    . DC  A 1 2   ? 7.799   184.394 53.640  1.00   130.36 ? 2   DC  I C2    1 
ATOM   35    O O2    . DC  A 1 2   ? 7.607   184.774 52.478  1.00   130.47 ? 2   DC  I O2    1 
ATOM   36    N N3    . DC  A 1 2   ? 8.972   183.828 54.023  1.00   127.91 ? 2   DC  I N3    1 
ATOM   37    C C4    . DC  A 1 2   ? 9.141   183.429 55.284  1.00   125.92 ? 2   DC  I C4    1 
ATOM   38    N N4    . DC  A 1 2   ? 10.313  182.879 55.615  1.00   112.77 ? 2   DC  I N4    1 
ATOM   39    C C5    . DC  A 1 2   ? 8.115   183.579 56.263  1.00   133.24 ? 2   DC  I C5    1 
ATOM   40    C C6    . DC  A 1 2   ? 6.963   184.135 55.873  1.00   121.89 ? 2   DC  I C6    1 
ATOM   41    P P     . DT  A 1 3   ? 1.315   184.296 53.994  1.00   99.43  ? 3   DT  I P     1 
ATOM   42    O OP1   . DT  A 1 3   ? 1.655   185.640 53.482  1.00   93.52  ? 3   DT  I OP1   1 
ATOM   43    O OP2   . DT  A 1 3   ? -0.085  184.003 54.368  1.00   109.86 ? 3   DT  I OP2   1 
ATOM   44    O "O5'" . DT  A 1 3   ? 1.735   183.197 52.910  1.00   95.03  ? 3   DT  I "O5'" 1 
ATOM   45    C "C5'" . DT  A 1 3   ? 1.212   183.274 51.590  1.00   95.39  ? 3   DT  I "C5'" 1 
ATOM   46    C "C4'" . DT  A 1 3   ? 2.181   182.680 50.584  1.00   106.79 ? 3   DT  I "C4'" 1 
ATOM   47    O "O4'" . DT  A 1 3   ? 3.530   182.818 51.073  1.00   105.32 ? 3   DT  I "O4'" 1 
ATOM   48    C "C3'" . DT  A 1 3   ? 2.029   181.190 50.342  1.00   127.12 ? 3   DT  I "C3'" 1 
ATOM   49    O "O3'" . DT  A 1 3   ? 0.978   180.926 49.377  1.00   121.58 ? 3   DT  I "O3'" 1 
ATOM   50    C "C2'" . DT  A 1 3   ? 3.411   180.795 49.824  1.00   131.58 ? 3   DT  I "C2'" 1 
ATOM   51    C "C1'" . DT  A 1 3   ? 4.342   181.820 50.481  1.00   119.61 ? 3   DT  I "C1'" 1 
ATOM   52    N N1    . DT  A 1 3   ? 5.232   181.232 51.524  1.00   114.33 ? 3   DT  I N1    1 
ATOM   53    C C2    . DT  A 1 3   ? 6.525   180.908 51.193  1.00   117.50 ? 3   DT  I C2    1 
ATOM   54    O O2    . DT  A 1 3   ? 6.993   181.085 50.082  1.00   117.27 ? 3   DT  I O2    1 
ATOM   55    N N3    . DT  A 1 3   ? 7.264   180.378 52.216  1.00   127.78 ? 3   DT  I N3    1 
ATOM   56    C C4    . DT  A 1 3   ? 6.844   180.136 53.511  1.00   135.43 ? 3   DT  I C4    1 
ATOM   57    O O4    . DT  A 1 3   ? 7.584   179.652 54.361  1.00   144.82 ? 3   DT  I O4    1 
ATOM   58    C C5    . DT  A 1 3   ? 5.473   180.493 53.791  1.00   125.62 ? 3   DT  I C5    1 
ATOM   59    C C7    . DT  A 1 3   ? 4.902   180.278 55.162  1.00   111.81 ? 3   DT  I C7    1 
ATOM   60    C C6    . DT  A 1 3   ? 4.741   181.015 52.794  1.00   121.98 ? 3   DT  I C6    1 
ATOM   61    P P     . DG  A 1 4   ? 1.180   181.169 47.794  1.00   122.29 ? 4   DG  I P     1 
ATOM   62    O OP1   . DG  A 1 4   ? 1.922   182.426 47.551  1.00   125.95 ? 4   DG  I OP1   1 
ATOM   63    O OP2   . DG  A 1 4   ? -0.158  181.003 47.187  1.00   124.95 ? 4   DG  I OP2   1 
ATOM   64    O "O5'" . DG  A 1 4   ? 2.071   179.935 47.300  1.00   110.38 ? 4   DG  I "O5'" 1 
ATOM   65    C "C5'" . DG  A 1 4   ? 3.049   180.133 46.278  1.00   137.32 ? 4   DG  I "C5'" 1 
ATOM   66    C "C4'" . DG  A 1 4   ? 4.116   179.053 46.330  1.00   143.22 ? 4   DG  I "C4'" 1 
ATOM   67    O "O4'" . DG  A 1 4   ? 4.628   178.948 47.671  1.00   148.29 ? 4   DG  I "O4'" 1 
ATOM   68    C "C3'" . DG  A 1 4   ? 3.633   177.657 45.950  1.00   168.21 ? 4   DG  I "C3'" 1 
ATOM   69    O "O3'" . DG  A 1 4   ? 4.087   177.338 44.639  1.00   179.42 ? 4   DG  I "O3'" 1 
ATOM   70    C "C2'" . DG  A 1 4   ? 4.242   176.718 47.009  1.00   166.93 ? 4   DG  I "C2'" 1 
ATOM   71    C "C1'" . DG  A 1 4   ? 5.082   177.640 47.895  1.00   157.55 ? 4   DG  I "C1'" 1 
ATOM   72    N N9    . DG  A 1 4   ? 4.948   177.356 49.324  1.00   151.12 ? 4   DG  I N9    1 
ATOM   73    C C8    . DG  A 1 4   ? 3.802   177.448 50.077  1.00   143.40 ? 4   DG  I C8    1 
ATOM   74    N N7    . DG  A 1 4   ? 3.975   177.132 51.329  1.00   143.65 ? 4   DG  I N7    1 
ATOM   75    C C5    . DG  A 1 4   ? 5.319   176.796 51.413  1.00   142.06 ? 4   DG  I C5    1 
ATOM   76    C C6    . DG  A 1 4   ? 6.081   176.366 52.525  1.00   147.01 ? 4   DG  I C6    1 
ATOM   77    O O6    . DG  A 1 4   ? 5.704   176.192 53.693  1.00   120.45 ? 4   DG  I O6    1 
ATOM   78    N N1    . DG  A 1 4   ? 7.408   176.129 52.178  1.00   163.91 ? 4   DG  I N1    1 
ATOM   79    C C2    . DG  A 1 4   ? 7.933   176.290 50.917  1.00   153.51 ? 4   DG  I C2    1 
ATOM   80    N N2    . DG  A 1 4   ? 9.235   176.008 50.778  1.00   152.79 ? 4   DG  I N2    1 
ATOM   81    N N3    . DG  A 1 4   ? 7.230   176.692 49.865  1.00   143.81 ? 4   DG  I N3    1 
ATOM   82    C C4    . DG  A 1 4   ? 5.934   176.926 50.186  1.00   147.19 ? 4   DG  I C4    1 
ATOM   83    P P     . DG  A 1 5   ? 3.393   176.156 43.801  1.00   169.95 ? 5   DG  I P     1 
ATOM   84    O OP1   . DG  A 1 5   ? 3.280   176.610 42.396  1.00   75.16  ? 5   DG  I OP1   1 
ATOM   85    O OP2   . DG  A 1 5   ? 2.182   175.733 44.539  1.00   162.34 ? 5   DG  I OP2   1 
ATOM   86    O "O5'" . DG  A 1 5   ? 4.458   174.965 43.876  1.00   165.37 ? 5   DG  I "O5'" 1 
ATOM   87    C "C5'" . DG  A 1 5   ? 5.810   175.199 43.496  1.00   167.02 ? 5   DG  I "C5'" 1 
ATOM   88    C "C4'" . DG  A 1 5   ? 6.759   174.384 44.354  1.00   161.81 ? 5   DG  I "C4'" 1 
ATOM   89    O "O4'" . DG  A 1 5   ? 6.489   174.645 45.740  1.00   149.89 ? 5   DG  I "O4'" 1 
ATOM   90    C "C3'" . DG  A 1 5   ? 6.617   172.879 44.210  1.00   172.93 ? 5   DG  I "C3'" 1 
ATOM   91    O "O3'" . DG  A 1 5   ? 7.490   172.410 43.186  1.00   182.74 ? 5   DG  I "O3'" 1 
ATOM   92    C "C2'" . DG  A 1 5   ? 7.028   172.339 45.589  1.00   162.21 ? 5   DG  I "C2'" 1 
ATOM   93    C "C1'" . DG  A 1 5   ? 6.958   173.564 46.510  1.00   149.23 ? 5   DG  I "C1'" 1 
ATOM   94    N N9    . DG  A 1 5   ? 6.065   173.387 47.651  1.00   152.33 ? 5   DG  I N9    1 
ATOM   95    C C8    . DG  A 1 5   ? 4.692   173.333 47.627  1.00   158.54 ? 5   DG  I C8    1 
ATOM   96    N N7    . DG  A 1 5   ? 4.158   173.169 48.806  1.00   160.77 ? 5   DG  I N7    1 
ATOM   97    C C5    . DG  A 1 5   ? 5.246   173.112 49.668  1.00   164.36 ? 5   DG  I C5    1 
ATOM   98    C C6    . DG  A 1 5   ? 5.289   172.947 51.073  1.00   158.37 ? 5   DG  I C6    1 
ATOM   99    O O6    . DG  A 1 5   ? 4.340   172.811 51.859  1.00   148.43 ? 5   DG  I O6    1 
ATOM   100   N N1    . DG  A 1 5   ? 6.597   172.943 51.552  1.00   158.43 ? 5   DG  I N1    1 
ATOM   101   C C2    . DG  A 1 5   ? 7.721   173.082 50.772  1.00   151.95 ? 5   DG  I C2    1 
ATOM   102   N N2    . DG  A 1 5   ? 8.898   173.056 51.415  1.00   137.57 ? 5   DG  I N2    1 
ATOM   103   N N3    . DG  A 1 5   ? 7.695   173.240 49.454  1.00   155.97 ? 5   DG  I N3    1 
ATOM   104   C C4    . DG  A 1 5   ? 6.428   173.244 48.972  1.00   161.42 ? 5   DG  I C4    1 
ATOM   105   P P     . DC  A 1 6   ? 7.413   170.884 42.686  1.00   201.80 ? 6   DC  I P     1 
ATOM   106   O OP1   . DC  A 1 6   ? 8.052   170.817 41.353  1.00   200.23 ? 6   DC  I OP1   1 
ATOM   107   O OP2   . DC  A 1 6   ? 6.017   170.425 42.859  1.00   166.39 ? 6   DC  I OP2   1 
ATOM   108   O "O5'" . DC  A 1 6   ? 8.326   170.091 43.734  1.00   186.08 ? 6   DC  I "O5'" 1 
ATOM   109   C "C5'" . DC  A 1 6   ? 9.652   170.535 44.001  1.00   159.76 ? 6   DC  I "C5'" 1 
ATOM   110   C "C4'" . DC  A 1 6   ? 10.188  169.899 45.271  1.00   159.72 ? 6   DC  I "C4'" 1 
ATOM   111   O "O4'" . DC  A 1 6   ? 9.401   170.334 46.409  1.00   153.61 ? 6   DC  I "O4'" 1 
ATOM   112   C "C3'" . DC  A 1 6   ? 10.156  168.365 45.289  1.00   165.87 ? 6   DC  I "C3'" 1 
ATOM   113   O "O3'" . DC  A 1 6   ? 11.449  167.854 45.585  1.00   173.92 ? 6   DC  I "O3'" 1 
ATOM   114   C "C2'" . DC  A 1 6   ? 9.150   168.028 46.393  1.00   155.60 ? 6   DC  I "C2'" 1 
ATOM   115   C "C1'" . DC  A 1 6   ? 9.242   169.251 47.286  1.00   148.80 ? 6   DC  I "C1'" 1 
ATOM   116   N N1    . DC  A 1 6   ? 8.021   169.469 48.113  1.00   147.84 ? 6   DC  I N1    1 
ATOM   117   C C2    . DC  A 1 6   ? 8.148   169.727 49.482  1.00   156.48 ? 6   DC  I C2    1 
ATOM   118   O O2    . DC  A 1 6   ? 9.279   169.786 49.983  1.00   161.44 ? 6   DC  I O2    1 
ATOM   119   N N3    . DC  A 1 6   ? 7.027   169.913 50.222  1.00   142.80 ? 6   DC  I N3    1 
ATOM   120   C C4    . DC  A 1 6   ? 5.827   169.842 49.644  1.00   146.41 ? 6   DC  I C4    1 
ATOM   121   N N4    . DC  A 1 6   ? 4.750   170.029 50.413  1.00   149.00 ? 6   DC  I N4    1 
ATOM   122   C C5    . DC  A 1 6   ? 5.678   169.573 48.251  1.00   148.95 ? 6   DC  I C5    1 
ATOM   123   C C6    . DC  A 1 6   ? 6.790   169.392 47.533  1.00   139.66 ? 6   DC  I C6    1 
ATOM   124   P P     . DC  A 1 7   ? 11.687  166.268 45.690  1.00   173.48 ? 7   DC  I P     1 
ATOM   125   O OP1   . DC  A 1 7   ? 13.100  166.008 45.337  1.00   185.70 ? 7   DC  I OP1   1 
ATOM   126   O OP2   . DC  A 1 7   ? 10.604  165.593 44.940  1.00   136.56 ? 7   DC  I OP2   1 
ATOM   127   O "O5'" . DC  A 1 7   ? 11.480  165.952 47.243  1.00   133.65 ? 7   DC  I "O5'" 1 
ATOM   128   C "C5'" . DC  A 1 7   ? 12.266  166.630 48.215  1.00   147.81 ? 7   DC  I "C5'" 1 
ATOM   129   C "C4'" . DC  A 1 7   ? 11.985  166.094 49.606  1.00   139.18 ? 7   DC  I "C4'" 1 
ATOM   130   O "O4'" . DC  A 1 7   ? 10.723  166.625 50.088  1.00   137.22 ? 7   DC  I "O4'" 1 
ATOM   131   C "C3'" . DC  A 1 7   ? 11.872  164.571 49.696  1.00   151.36 ? 7   DC  I "C3'" 1 
ATOM   132   O "O3'" . DC  A 1 7   ? 12.577  164.095 50.836  1.00   164.86 ? 7   DC  I "O3'" 1 
ATOM   133   C "C2'" . DC  A 1 7   ? 10.369  164.336 49.822  1.00   164.69 ? 7   DC  I "C2'" 1 
ATOM   134   C "C1'" . DC  A 1 7   ? 9.932   165.573 50.588  1.00   153.36 ? 7   DC  I "C1'" 1 
ATOM   135   N N1    . DC  A 1 7   ? 8.495   165.923 50.390  1.00   150.72 ? 7   DC  I N1    1 
ATOM   136   C C2    . DC  A 1 7   ? 7.738   166.377 51.475  1.00   148.89 ? 7   DC  I C2    1 
ATOM   137   O O2    . DC  A 1 7   ? 8.276   166.486 52.584  1.00   151.74 ? 7   DC  I O2    1 
ATOM   138   N N3    . DC  A 1 7   ? 6.433   166.690 51.280  1.00   139.20 ? 7   DC  I N3    1 
ATOM   139   C C4    . DC  A 1 7   ? 5.889   166.560 50.069  1.00   138.23 ? 7   DC  I C4    1 
ATOM   140   N N4    . DC  A 1 7   ? 4.599   166.880 49.925  1.00   121.57 ? 7   DC  I N4    1 
ATOM   141   C C5    . DC  A 1 7   ? 6.645   166.096 48.951  1.00   132.75 ? 7   DC  I C5    1 
ATOM   142   C C6    . DC  A 1 7   ? 7.931   165.791 49.156  1.00   133.28 ? 7   DC  I C6    1 
ATOM   143   P P     . DG  A 1 8   ? 13.325  162.674 50.782  1.00   180.77 ? 8   DG  I P     1 
ATOM   144   O OP1   . DG  A 1 8   ? 14.312  162.634 51.885  1.00   171.33 ? 8   DG  I OP1   1 
ATOM   145   O OP2   . DG  A 1 8   ? 13.784  162.473 49.389  1.00   177.64 ? 8   DG  I OP2   1 
ATOM   146   O "O5'" . DG  A 1 8   ? 12.155  161.614 51.055  1.00   145.89 ? 8   DG  I "O5'" 1 
ATOM   147   C "C5'" . DG  A 1 8   ? 11.990  161.037 52.349  1.00   148.84 ? 8   DG  I "C5'" 1 
ATOM   148   C "C4'" . DG  A 1 8   ? 11.592  162.085 53.375  1.00   153.51 ? 8   DG  I "C4'" 1 
ATOM   149   O "O4'" . DG  A 1 8   ? 10.734  163.074 52.756  1.00   145.83 ? 8   DG  I "O4'" 1 
ATOM   150   C "C3'" . DG  A 1 8   ? 10.811  161.545 54.563  1.00   165.04 ? 8   DG  I "C3'" 1 
ATOM   151   O "O3'" . DG  A 1 8   ? 11.709  161.186 55.604  1.00   179.88 ? 8   DG  I "O3'" 1 
ATOM   152   C "C2'" . DG  A 1 8   ? 9.942   162.733 54.958  1.00   153.77 ? 8   DG  I "C2'" 1 
ATOM   153   C "C1'" . DG  A 1 8   ? 9.643   163.374 53.605  1.00   157.44 ? 8   DG  I "C1'" 1 
ATOM   154   N N9    . DG  A 1 8   ? 8.422   162.883 52.968  1.00   165.84 ? 8   DG  I N9    1 
ATOM   155   C C8    . DG  A 1 8   ? 8.316   162.310 51.724  1.00   152.87 ? 8   DG  I C8    1 
ATOM   156   N N7    . DG  A 1 8   ? 7.099   161.971 51.409  1.00   136.17 ? 8   DG  I N7    1 
ATOM   157   C C5    . DG  A 1 8   ? 6.345   162.342 52.514  1.00   153.90 ? 8   DG  I C5    1 
ATOM   158   C C6    . DG  A 1 8   ? 4.956   162.221 52.749  1.00   166.60 ? 8   DG  I C6    1 
ATOM   159   O O6    . DG  A 1 8   ? 4.091   161.743 52.003  1.00   161.23 ? 8   DG  I O6    1 
ATOM   160   N N1    . DG  A 1 8   ? 4.599   162.721 53.998  1.00   175.94 ? 8   DG  I N1    1 
ATOM   161   C C2    . DG  A 1 8   ? 5.475   163.270 54.905  1.00   180.39 ? 8   DG  I C2    1 
ATOM   162   N N2    . DG  A 1 8   ? 4.943   163.700 56.059  1.00   185.84 ? 8   DG  I N2    1 
ATOM   163   N N3    . DG  A 1 8   ? 6.780   163.392 54.696  1.00   167.53 ? 8   DG  I N3    1 
ATOM   164   C C4    . DG  A 1 8   ? 7.144   162.907 53.483  1.00   159.91 ? 8   DG  I C4    1 
ATOM   165   P P     . DC  A 1 9   ? 11.816  159.658 56.087  1.00   170.46 ? 9   DC  I P     1 
ATOM   166   O OP1   . DC  A 1 9   ? 13.252  159.333 56.237  1.00   140.81 ? 9   DC  I OP1   1 
ATOM   167   O OP2   . DC  A 1 9   ? 10.965  158.845 55.190  1.00   144.22 ? 9   DC  I OP2   1 
ATOM   168   O "O5'" . DC  A 1 9   ? 11.134  159.666 57.532  1.00   155.46 ? 9   DC  I "O5'" 1 
ATOM   169   C "C5'" . DC  A 1 9   ? 10.093  158.749 57.827  1.00   160.38 ? 9   DC  I "C5'" 1 
ATOM   170   C "C4'" . DC  A 1 9   ? 8.844   159.479 58.283  1.00   157.90 ? 9   DC  I "C4'" 1 
ATOM   171   O "O4'" . DC  A 1 9   ? 8.395   160.375 57.238  1.00   159.93 ? 9   DC  I "O4'" 1 
ATOM   172   C "C3'" . DC  A 1 9   ? 7.655   158.581 58.570  1.00   162.64 ? 9   DC  I "C3'" 1 
ATOM   173   O "O3'" . DC  A 1 9   ? 7.710   158.129 59.910  1.00   149.22 ? 9   DC  I "O3'" 1 
ATOM   174   C "C2'" . DC  A 1 9   ? 6.479   159.523 58.348  1.00   176.59 ? 9   DC  I "C2'" 1 
ATOM   175   C "C1'" . DC  A 1 9   ? 6.977   160.390 57.190  1.00   172.91 ? 9   DC  I "C1'" 1 
ATOM   176   N N1    . DC  A 1 9   ? 6.544   159.909 55.843  1.00   172.04 ? 9   DC  I N1    1 
ATOM   177   C C2    . DC  A 1 9   ? 5.195   159.993 55.470  1.00   169.72 ? 9   DC  I C2    1 
ATOM   178   O O2    . DC  A 1 9   ? 4.373   160.462 56.267  1.00   148.21 ? 9   DC  I O2    1 
ATOM   179   N N3    . DC  A 1 9   ? 4.827   159.554 54.240  1.00   176.89 ? 9   DC  I N3    1 
ATOM   180   C C4    . DC  A 1 9   ? 5.742   159.056 53.406  1.00   177.54 ? 9   DC  I C4    1 
ATOM   181   N N4    . DC  A 1 9   ? 5.332   158.638 52.204  1.00   166.22 ? 9   DC  I N4    1 
ATOM   182   C C5    . DC  A 1 9   ? 7.118   158.966 53.766  1.00   173.55 ? 9   DC  I C5    1 
ATOM   183   C C6    . DC  A 1 9   ? 7.471   159.400 54.980  1.00   165.85 ? 9   DC  I C6    1 
ATOM   184   P P     . DC  A 1 10  ? 7.460   156.579 60.245  1.00   180.29 ? 10  DC  I P     1 
ATOM   185   O OP1   . DC  A 1 10  ? 8.016   156.317 61.591  1.00   178.73 ? 10  DC  I OP1   1 
ATOM   186   O OP2   . DC  A 1 10  ? 7.931   155.788 59.087  1.00   177.72 ? 10  DC  I OP2   1 
ATOM   187   O "O5'" . DC  A 1 10  ? 5.867   156.453 60.312  1.00   176.29 ? 10  DC  I "O5'" 1 
ATOM   188   C "C5'" . DC  A 1 10  ? 5.124   157.292 61.189  1.00   165.26 ? 10  DC  I "C5'" 1 
ATOM   189   C "C4'" . DC  A 1 10  ? 3.633   157.121 60.966  1.00   165.16 ? 10  DC  I "C4'" 1 
ATOM   190   O "O4'" . DC  A 1 10  ? 3.303   157.599 59.635  1.00   165.29 ? 10  DC  I "O4'" 1 
ATOM   191   C "C3'" . DC  A 1 10  ? 3.143   155.672 61.035  1.00   174.07 ? 10  DC  I "C3'" 1 
ATOM   192   O "O3'" . DC  A 1 10  ? 1.955   155.566 61.824  1.00   175.01 ? 10  DC  I "O3'" 1 
ATOM   193   C "C2'" . DC  A 1 10  ? 2.888   155.317 59.572  1.00   163.50 ? 10  DC  I "C2'" 1 
ATOM   194   C "C1'" . DC  A 1 10  ? 2.472   156.661 59.000  1.00   174.03 ? 10  DC  I "C1'" 1 
ATOM   195   N N1    . DC  A 1 10  ? 2.705   156.759 57.531  1.00   173.66 ? 10  DC  I N1    1 
ATOM   196   C C2    . DC  A 1 10  ? 1.647   157.087 56.679  1.00   176.33 ? 10  DC  I C2    1 
ATOM   197   O O2    . DC  A 1 10  ? 0.528   157.301 57.160  1.00   179.96 ? 10  DC  I O2    1 
ATOM   198   N N3    . DC  A 1 10  ? 1.880   157.167 55.345  1.00   176.44 ? 10  DC  I N3    1 
ATOM   199   C C4    . DC  A 1 10  ? 3.102   156.929 54.864  1.00   163.56 ? 10  DC  I C4    1 
ATOM   200   N N4    . DC  A 1 10  ? 3.282   157.018 53.543  1.00   152.67 ? 10  DC  I N4    1 
ATOM   201   C C5    . DC  A 1 10  ? 4.192   156.589 55.718  1.00   158.11 ? 10  DC  I C5    1 
ATOM   202   C C6    . DC  A 1 10  ? 3.951   156.515 57.030  1.00   166.34 ? 10  DC  I C6    1 
ATOM   203   P P     . DC  A 1 11  ? 1.274   154.124 62.020  1.00   167.21 ? 11  DC  I P     1 
ATOM   204   O OP1   . DC  A 1 11  ? 0.520   154.172 63.291  1.00   164.27 ? 11  DC  I OP1   1 
ATOM   205   O OP2   . DC  A 1 11  ? 2.331   153.104 61.837  1.00   168.59 ? 11  DC  I OP2   1 
ATOM   206   O "O5'" . DC  A 1 11  ? 0.232   153.970 60.815  1.00   158.43 ? 11  DC  I "O5'" 1 
ATOM   207   C "C5'" . DC  A 1 11  ? -0.897  154.842 60.745  1.00   148.33 ? 11  DC  I "C5'" 1 
ATOM   208   C "C4'" . DC  A 1 11  ? -1.855  154.407 59.646  1.00   161.54 ? 11  DC  I "C4'" 1 
ATOM   209   O "O4'" . DC  A 1 11  ? -1.318  154.766 58.351  1.00   158.07 ? 11  DC  I "O4'" 1 
ATOM   210   C "C3'" . DC  A 1 11  ? -2.125  152.894 59.610  1.00   179.29 ? 11  DC  I "C3'" 1 
ATOM   211   O "O3'" . DC  A 1 11  ? -3.531  152.550 59.414  1.00   171.92 ? 11  DC  I "O3'" 1 
ATOM   212   C "C2'" . DC  A 1 11  ? -1.292  152.447 58.403  1.00   185.42 ? 11  DC  I "C2'" 1 
ATOM   213   C "C1'" . DC  A 1 11  ? -1.432  153.663 57.495  1.00   171.37 ? 11  DC  I "C1'" 1 
ATOM   214   N N1    . DC  A 1 11  ? -0.388  153.775 56.438  1.00   156.32 ? 11  DC  I N1    1 
ATOM   215   C C2    . DC  A 1 11  ? -0.741  154.263 55.175  1.00   143.12 ? 11  DC  I C2    1 
ATOM   216   O O2    . DC  A 1 11  ? -1.913  154.595 54.963  1.00   138.13 ? 11  DC  I O2    1 
ATOM   217   N N3    . DC  A 1 11  ? 0.215   154.365 54.220  1.00   149.87 ? 11  DC  I N3    1 
ATOM   218   C C4    . DC  A 1 11  ? 1.469   153.999 54.489  1.00   161.31 ? 11  DC  I C4    1 
ATOM   219   N N4    . DC  A 1 11  ? 2.377   154.115 53.514  1.00   147.23 ? 11  DC  I N4    1 
ATOM   220   C C5    . DC  A 1 11  ? 1.848   153.498 55.771  1.00   164.41 ? 11  DC  I C5    1 
ATOM   221   C C6    . DC  A 1 11  ? 0.896   153.404 56.706  1.00   159.74 ? 11  DC  I C6    1 
ATOM   222   P P     . DT  A 1 12  ? -4.723  153.628 59.273  1.00   185.56 ? 12  DT  I P     1 
ATOM   223   O OP1   . DT  A 1 12  ? -4.650  154.717 60.274  1.00   186.60 ? 12  DT  I OP1   1 
ATOM   224   O OP2   . DT  A 1 12  ? -5.953  152.809 59.299  1.00   164.75 ? 12  DT  I OP2   1 
ATOM   225   O "O5'" . DT  A 1 12  ? -4.563  154.181 57.780  1.00   173.67 ? 12  DT  I "O5'" 1 
ATOM   226   C "C5'" . DT  A 1 12  ? -5.714  154.565 57.030  1.00   170.07 ? 12  DT  I "C5'" 1 
ATOM   227   C "C4'" . DT  A 1 12  ? -5.986  153.595 55.886  1.00   161.40 ? 12  DT  I "C4'" 1 
ATOM   228   O "O4'" . DT  A 1 12  ? -4.803  153.457 55.055  1.00   177.47 ? 12  DT  I "O4'" 1 
ATOM   229   C "C3'" . DT  A 1 12  ? -6.379  152.169 56.302  1.00   159.03 ? 12  DT  I "C3'" 1 
ATOM   230   O "O3'" . DT  A 1 12  ? -7.554  151.772 55.612  1.00   170.43 ? 12  DT  I "O3'" 1 
ATOM   231   C "C2'" . DT  A 1 12  ? -5.175  151.326 55.876  1.00   162.02 ? 12  DT  I "C2'" 1 
ATOM   232   C "C1'" . DT  A 1 12  ? -4.688  152.109 54.674  1.00   170.00 ? 12  DT  I "C1'" 1 
ATOM   233   N N1    . DT  A 1 12  ? -3.273  151.826 54.299  1.00   160.64 ? 12  DT  I N1    1 
ATOM   234   C C2    . DT  A 1 12  ? -2.783  152.319 53.112  1.00   156.72 ? 12  DT  I C2    1 
ATOM   235   O O2    . DT  A 1 12  ? -3.446  152.993 52.345  1.00   150.54 ? 12  DT  I O2    1 
ATOM   236   N N3    . DT  A 1 12  ? -1.477  151.998 52.856  1.00   163.86 ? 12  DT  I N3    1 
ATOM   237   C C4    . DT  A 1 12  ? -0.630  151.245 53.649  1.00   163.20 ? 12  DT  I C4    1 
ATOM   238   O O4    . DT  A 1 12  ? 0.531   151.011 53.331  1.00   158.63 ? 12  DT  I O4    1 
ATOM   239   C C5    . DT  A 1 12  ? -1.209  150.754 54.878  1.00   149.57 ? 12  DT  I C5    1 
ATOM   240   C C7    . DT  A 1 12  ? -0.387  149.925 55.820  1.00   127.27 ? 12  DT  I C7    1 
ATOM   241   C C6    . DT  A 1 12  ? -2.489  151.062 55.139  1.00   153.46 ? 12  DT  I C6    1 
ATOM   242   P P     . DG  A 1 13  ? -8.433  150.540 56.151  1.00   195.78 ? 13  DG  I P     1 
ATOM   243   O OP1   . DG  A 1 13  ? -8.820  150.840 57.548  1.00   200.83 ? 13  DG  I OP1   1 
ATOM   244   O OP2   . DG  A 1 13  ? -7.701  149.290 55.844  1.00   161.21 ? 13  DG  I OP2   1 
ATOM   245   O "O5'" . DG  A 1 13  ? -9.740  150.576 55.231  1.00   185.22 ? 13  DG  I "O5'" 1 
ATOM   246   C "C5'" . DG  A 1 13  ? -9.881  149.655 54.157  1.00   160.27 ? 13  DG  I "C5'" 1 
ATOM   247   C "C4'" . DG  A 1 13  ? -9.290  150.211 52.871  1.00   152.95 ? 13  DG  I "C4'" 1 
ATOM   248   O "O4'" . DG  A 1 13  ? -7.856  150.304 53.000  1.00   158.73 ? 13  DG  I "O4'" 1 
ATOM   249   C "C3'" . DG  A 1 13  ? -9.576  149.372 51.624  1.00   158.06 ? 13  DG  I "C3'" 1 
ATOM   250   O "O3'" . DG  A 1 13  ? -10.579 150.048 50.826  1.00   182.95 ? 13  DG  I "O3'" 1 
ATOM   251   C "C2'" . DG  A 1 13  ? -8.226  149.291 50.890  1.00   152.20 ? 13  DG  I "C2'" 1 
ATOM   252   C "C1'" . DG  A 1 13  ? -7.258  150.088 51.751  1.00   151.91 ? 13  DG  I "C1'" 1 
ATOM   253   N N9    . DG  A 1 13  ? -5.955  149.455 51.932  1.00   157.99 ? 13  DG  I N9    1 
ATOM   254   C C8    . DG  A 1 13  ? -5.665  148.338 52.676  1.00   163.45 ? 13  DG  I C8    1 
ATOM   255   N N7    . DG  A 1 13  ? -4.409  147.990 52.619  1.00   156.21 ? 13  DG  I N7    1 
ATOM   256   C C5    . DG  A 1 13  ? -3.844  148.901 51.735  1.00   158.02 ? 13  DG  I C5    1 
ATOM   257   C C6    . DG  A 1 13  ? -2.513  149.017 51.265  1.00   156.69 ? 13  DG  I C6    1 
ATOM   258   O O6    . DG  A 1 13  ? -1.534  148.310 51.546  1.00   146.19 ? 13  DG  I O6    1 
ATOM   259   N N1    . DG  A 1 13  ? -2.370  150.085 50.380  1.00   163.56 ? 13  DG  I N1    1 
ATOM   260   C C2    . DG  A 1 13  ? -3.387  150.930 49.999  1.00   177.68 ? 13  DG  I C2    1 
ATOM   261   N N2    . DG  A 1 13  ? -3.065  151.904 49.137  1.00   155.45 ? 13  DG  I N2    1 
ATOM   262   N N3    . DG  A 1 13  ? -4.634  150.830 50.433  1.00   190.73 ? 13  DG  I N3    1 
ATOM   263   C C4    . DG  A 1 13  ? -4.789  149.798 51.293  1.00   167.10 ? 13  DG  I C4    1 
ATOM   264   P P     . DG  A 1 14  ? -11.157 149.440 49.445  1.00   220.07 ? 14  DG  I P     1 
ATOM   265   O OP1   . DG  A 1 14  ? -11.638 150.582 48.637  1.00   213.49 ? 14  DG  I OP1   1 
ATOM   266   O OP2   . DG  A 1 14  ? -12.088 148.346 49.797  1.00   208.45 ? 14  DG  I OP2   1 
ATOM   267   O "O5'" . DG  A 1 14  ? -9.906  148.786 48.695  1.00   178.59 ? 14  DG  I "O5'" 1 
ATOM   268   C "C5'" . DG  A 1 14  ? -10.027 147.506 48.102  1.00   175.04 ? 14  DG  I "C5'" 1 
ATOM   269   C "C4'" . DG  A 1 14  ? -9.039  147.341 46.965  1.00   165.13 ? 14  DG  I "C4'" 1 
ATOM   270   O "O4'" . DG  A 1 14  ? -7.697  147.314 47.519  1.00   147.89 ? 14  DG  I "O4'" 1 
ATOM   271   C "C3'" . DG  A 1 14  ? -9.166  146.039 46.192  1.00   175.41 ? 14  DG  I "C3'" 1 
ATOM   272   O "O3'" . DG  A 1 14  ? -8.577  146.175 44.910  1.00   167.64 ? 14  DG  I "O3'" 1 
ATOM   273   C "C2'" . DG  A 1 14  ? -8.354  145.095 47.061  1.00   166.33 ? 14  DG  I "C2'" 1 
ATOM   274   C "C1'" . DG  A 1 14  ? -7.183  145.993 47.455  1.00   155.97 ? 14  DG  I "C1'" 1 
ATOM   275   N N9    . DG  A 1 14  ? -6.609  145.651 48.754  1.00   152.91 ? 14  DG  I N9    1 
ATOM   276   C C8    . DG  A 1 14  ? -7.257  145.059 49.812  1.00   147.92 ? 14  DG  I C8    1 
ATOM   277   N N7    . DG  A 1 14  ? -6.491  144.862 50.848  1.00   126.68 ? 14  DG  I N7    1 
ATOM   278   C C5    . DG  A 1 14  ? -5.252  145.349 50.452  1.00   143.26 ? 14  DG  I C5    1 
ATOM   279   C C6    . DG  A 1 14  ? -4.027  145.401 51.157  1.00   148.12 ? 14  DG  I C6    1 
ATOM   280   O O6    . DG  A 1 14  ? -3.790  145.019 52.312  1.00   145.58 ? 14  DG  I O6    1 
ATOM   281   N N1    . DG  A 1 14  ? -3.015  145.974 50.391  1.00   145.95 ? 14  DG  I N1    1 
ATOM   282   C C2    . DG  A 1 14  ? -3.168  146.434 49.105  1.00   146.73 ? 14  DG  I C2    1 
ATOM   283   N N2    . DG  A 1 14  ? -2.075  146.953 48.527  1.00   148.16 ? 14  DG  I N2    1 
ATOM   284   N N3    . DG  A 1 14  ? -4.311  146.390 48.431  1.00   143.47 ? 14  DG  I N3    1 
ATOM   285   C C4    . DG  A 1 14  ? -5.307  145.836 49.164  1.00   146.61 ? 14  DG  I C4    1 
ATOM   286   P P     . DA  A 1 15  ? -9.187  145.371 43.660  1.00   177.85 ? 15  DA  I P     1 
ATOM   287   O OP1   . DA  A 1 15  ? -9.954  146.332 42.836  1.00   174.40 ? 15  DA  I OP1   1 
ATOM   288   O OP2   . DA  A 1 15  ? -9.851  144.159 44.192  1.00   152.35 ? 15  DA  I OP2   1 
ATOM   289   O "O5'" . DA  A 1 15  ? -7.899  144.898 42.840  1.00   154.32 ? 15  DA  I "O5'" 1 
ATOM   290   C "C5'" . DA  A 1 15  ? -7.000  145.862 42.310  1.00   150.39 ? 15  DA  I "C5'" 1 
ATOM   291   C "C4'" . DA  A 1 15  ? -5.610  145.273 42.155  1.00   136.63 ? 15  DA  I "C4'" 1 
ATOM   292   O "O4'" . DA  A 1 15  ? -5.001  145.119 43.465  1.00   146.80 ? 15  DA  I "O4'" 1 
ATOM   293   C "C3'" . DA  A 1 15  ? -5.564  143.894 41.500  1.00   128.41 ? 15  DA  I "C3'" 1 
ATOM   294   O "O3'" . DA  A 1 15  ? -4.459  143.815 40.614  1.00   119.90 ? 15  DA  I "O3'" 1 
ATOM   295   C "C2'" . DA  A 1 15  ? -5.401  142.947 42.686  1.00   115.64 ? 15  DA  I "C2'" 1 
ATOM   296   C "C1'" . DA  A 1 15  ? -4.565  143.788 43.636  1.00   144.82 ? 15  DA  I "C1'" 1 
ATOM   297   N N9    . DA  A 1 15  ? -4.741  143.422 45.039  1.00   158.45 ? 15  DA  I N9    1 
ATOM   298   C C8    . DA  A 1 15  ? -5.913  143.099 45.664  1.00   157.93 ? 15  DA  I C8    1 
ATOM   299   N N7    . DA  A 1 15  ? -5.772  142.811 46.937  1.00   167.04 ? 15  DA  I N7    1 
ATOM   300   C C5    . DA  A 1 15  ? -4.412  142.956 47.162  1.00   155.98 ? 15  DA  I C5    1 
ATOM   301   C C6    . DA  A 1 15  ? -3.618  142.792 48.315  1.00   140.80 ? 15  DA  I C6    1 
ATOM   302   N N6    . DA  A 1 15  ? -4.111  142.431 49.504  1.00   136.64 ? 15  DA  I N6    1 
ATOM   303   N N1    . DA  A 1 15  ? -2.292  143.014 48.196  1.00   133.01 ? 15  DA  I N1    1 
ATOM   304   C C2    . DA  A 1 15  ? -1.802  143.375 47.004  1.00   137.95 ? 15  DA  I C2    1 
ATOM   305   N N3    . DA  A 1 15  ? -2.447  143.560 45.854  1.00   148.32 ? 15  DA  I N3    1 
ATOM   306   C C4    . DA  A 1 15  ? -3.762  143.332 46.002  1.00   158.15 ? 15  DA  I C4    1 
ATOM   307   P P     . DG  A 1 16  ? -4.203  142.479 39.760  1.00   132.80 ? 16  DG  I P     1 
ATOM   308   O OP1   . DG  A 1 16  ? -3.603  142.884 38.470  1.00   128.63 ? 16  DG  I OP1   1 
ATOM   309   O OP2   . DG  A 1 16  ? -5.447  141.676 39.772  1.00   128.82 ? 16  DG  I OP2   1 
ATOM   310   O "O5'" . DG  A 1 16  ? -3.101  141.692 40.607  1.00   140.99 ? 16  DG  I "O5'" 1 
ATOM   311   C "C5'" . DG  A 1 16  ? -1.761  142.161 40.624  1.00   147.16 ? 16  DG  I "C5'" 1 
ATOM   312   C "C4'" . DG  A 1 16  ? -0.850  141.174 41.332  1.00   139.03 ? 16  DG  I "C4'" 1 
ATOM   313   O "O4'" . DG  A 1 16  ? -1.155  141.142 42.746  1.00   134.20 ? 16  DG  I "O4'" 1 
ATOM   314   C "C3'" . DG  A 1 16  ? -0.943  139.742 40.813  1.00   122.19 ? 16  DG  I "C3'" 1 
ATOM   315   O "O3'" . DG  A 1 16  ? 0.351   139.267 40.471  1.00   112.05 ? 16  DG  I "O3'" 1 
ATOM   316   C "C2'" . DG  A 1 16  ? -1.569  138.940 41.961  1.00   111.97 ? 16  DG  I "C2'" 1 
ATOM   317   C "C1'" . DG  A 1 16  ? -1.347  139.817 43.190  1.00   120.81 ? 16  DG  I "C1'" 1 
ATOM   318   N N9    . DG  A 1 16  ? -2.464  139.803 44.133  1.00   130.55 ? 16  DG  I N9    1 
ATOM   319   C C8    . DG  A 1 16  ? -3.804  139.850 43.832  1.00   132.18 ? 16  DG  I C8    1 
ATOM   320   N N7    . DG  A 1 16  ? -4.574  139.821 44.884  1.00   130.62 ? 16  DG  I N7    1 
ATOM   321   C C5    . DG  A 1 16  ? -3.690  139.745 45.952  1.00   132.87 ? 16  DG  I C5    1 
ATOM   322   C C6    . DG  A 1 16  ? -3.943  139.683 47.344  1.00   130.49 ? 16  DG  I C6    1 
ATOM   323   O O6    . DG  A 1 16  ? -5.036  139.684 47.926  1.00   125.38 ? 16  DG  I O6    1 
ATOM   324   N N1    . DG  A 1 16  ? -2.763  139.616 48.080  1.00   128.74 ? 16  DG  I N1    1 
ATOM   325   C C2    . DG  A 1 16  ? -1.499  139.609 47.540  1.00   137.79 ? 16  DG  I C2    1 
ATOM   326   N N2    . DG  A 1 16  ? -0.481  139.539 48.410  1.00   146.77 ? 16  DG  I N2    1 
ATOM   327   N N3    . DG  A 1 16  ? -1.247  139.666 46.238  1.00   137.70 ? 16  DG  I N3    1 
ATOM   328   C C4    . DG  A 1 16  ? -2.387  139.732 45.507  1.00   133.44 ? 16  DG  I C4    1 
ATOM   329   P P     . DA  A 1 17  ? 0.541   137.798 39.850  1.00   118.04 ? 17  DA  I P     1 
ATOM   330   O OP1   . DA  A 1 17  ? 1.676   137.857 38.902  1.00   97.35  ? 17  DA  I OP1   1 
ATOM   331   O OP2   . DA  A 1 17  ? -0.778  137.315 39.384  1.00   136.61 ? 17  DA  I OP2   1 
ATOM   332   O "O5'" . DA  A 1 17  ? 0.974   136.921 41.112  1.00   136.67 ? 17  DA  I "O5'" 1 
ATOM   333   C "C5'" . DA  A 1 17  ? 1.975   137.409 41.991  1.00   122.68 ? 17  DA  I "C5'" 1 
ATOM   334   C "C4'" . DA  A 1 17  ? 2.029   136.590 43.266  1.00   113.75 ? 17  DA  I "C4'" 1 
ATOM   335   O "O4'" . DA  A 1 17  ? 0.883   136.905 44.099  1.00   118.47 ? 17  DA  I "O4'" 1 
ATOM   336   C "C3'" . DA  A 1 17  ? 2.005   135.074 43.059  1.00   111.39 ? 17  DA  I "C3'" 1 
ATOM   337   O "O3'" . DA  A 1 17  ? 2.971   134.462 43.895  1.00   125.19 ? 17  DA  I "O3'" 1 
ATOM   338   C "C2'" . DA  A 1 17  ? 0.587   134.687 43.474  1.00   122.78 ? 17  DA  I "C2'" 1 
ATOM   339   C "C1'" . DA  A 1 17  ? 0.312   135.706 44.564  1.00   122.61 ? 17  DA  I "C1'" 1 
ATOM   340   N N9    . DA  A 1 17  ? -1.109  135.930 44.815  1.00   125.75 ? 17  DA  I N9    1 
ATOM   341   C C8    . DA  A 1 17  ? -2.108  136.019 43.886  1.00   116.64 ? 17  DA  I C8    1 
ATOM   342   N N7    . DA  A 1 17  ? -3.296  136.224 44.404  1.00   118.73 ? 17  DA  I N7    1 
ATOM   343   C C5    . DA  A 1 17  ? -3.060  136.275 45.768  1.00   129.07 ? 17  DA  I C5    1 
ATOM   344   C C6    . DA  A 1 17  ? -3.912  136.469 46.874  1.00   128.53 ? 17  DA  I C6    1 
ATOM   345   N N6    . DA  A 1 17  ? -5.231  136.654 46.762  1.00   123.99 ? 17  DA  I N6    1 
ATOM   346   N N1    . DA  A 1 17  ? -3.354  136.464 48.102  1.00   128.15 ? 17  DA  I N1    1 
ATOM   347   C C2    . DA  A 1 17  ? -2.033  136.279 48.210  1.00   133.10 ? 17  DA  I C2    1 
ATOM   348   N N3    . DA  A 1 17  ? -1.133  136.086 47.247  1.00   133.85 ? 17  DA  I N3    1 
ATOM   349   C C4    . DA  A 1 17  ? -1.717  136.096 46.038  1.00   130.64 ? 17  DA  I C4    1 
ATOM   350   P P     . DA  A 1 18  ? 4.180   133.622 43.254  1.00   143.68 ? 18  DA  I P     1 
ATOM   351   O OP1   . DA  A 1 18  ? 5.307   134.554 43.019  1.00   112.10 ? 18  DA  I OP1   1 
ATOM   352   O OP2   . DA  A 1 18  ? 3.632   132.831 42.129  1.00   136.31 ? 18  DA  I OP2   1 
ATOM   353   O "O5'" . DA  A 1 18  ? 4.583   132.602 44.415  1.00   116.02 ? 18  DA  I "O5'" 1 
ATOM   354   C "C5'" . DA  A 1 18  ? 3.600   131.738 44.962  1.00   120.09 ? 18  DA  I "C5'" 1 
ATOM   355   C "C4'" . DA  A 1 18  ? 3.584   131.824 46.477  1.00   117.33 ? 18  DA  I "C4'" 1 
ATOM   356   O "O4'" . DA  A 1 18  ? 2.499   132.692 46.897  1.00   90.74  ? 18  DA  I "O4'" 1 
ATOM   357   C "C3'" . DA  A 1 18  ? 3.363   130.491 47.180  1.00   150.17 ? 18  DA  I "C3'" 1 
ATOM   358   O "O3'" . DA  A 1 18  ? 4.152   130.399 48.356  1.00   138.61 ? 18  DA  I "O3'" 1 
ATOM   359   C "C2'" . DA  A 1 18  ? 1.871   130.487 47.496  1.00   147.88 ? 18  DA  I "C2'" 1 
ATOM   360   C "C1'" . DA  A 1 18  ? 1.545   131.969 47.651  1.00   133.68 ? 18  DA  I "C1'" 1 
ATOM   361   N N9    . DA  A 1 18  ? 0.214   132.301 47.153  1.00   140.50 ? 18  DA  I N9    1 
ATOM   362   C C8    . DA  A 1 18  ? -0.186  132.345 45.846  1.00   130.87 ? 18  DA  I C8    1 
ATOM   363   N N7    . DA  A 1 18  ? -1.450  132.660 45.689  1.00   138.00 ? 18  DA  I N7    1 
ATOM   364   C C5    . DA  A 1 18  ? -1.915  132.828 46.982  1.00   146.42 ? 18  DA  I C5    1 
ATOM   365   C C6    . DA  A 1 18  ? -3.180  133.168 47.499  1.00   150.71 ? 18  DA  I C6    1 
ATOM   366   N N6    . DA  A 1 18  ? -4.248  133.409 46.731  1.00   147.08 ? 18  DA  I N6    1 
ATOM   367   N N1    . DA  A 1 18  ? -3.306  133.252 48.840  1.00   150.19 ? 18  DA  I N1    1 
ATOM   368   C C2    . DA  A 1 18  ? -2.235  133.011 49.605  1.00   143.98 ? 18  DA  I C2    1 
ATOM   369   N N3    . DA  A 1 18  ? -0.998  132.681 49.236  1.00   150.10 ? 18  DA  I N3    1 
ATOM   370   C C4    . DA  A 1 18  ? -0.903  132.606 47.898  1.00   146.82 ? 18  DA  I C4    1 
ATOM   371   P P     . DT  A 1 19  ? 4.478   128.951 48.973  1.00   140.73 ? 19  DT  I P     1 
ATOM   372   O OP1   . DT  A 1 19  ? 5.801   128.997 49.628  1.00   122.79 ? 19  DT  I OP1   1 
ATOM   373   O OP2   . DT  A 1 19  ? 4.228   127.960 47.903  1.00   145.05 ? 19  DT  I OP2   1 
ATOM   374   O "O5'" . DT  A 1 19  ? 3.355   128.747 50.090  1.00   118.64 ? 19  DT  I "O5'" 1 
ATOM   375   C "C5'" . DT  A 1 19  ? 3.384   129.525 51.278  1.00   124.48 ? 19  DT  I "C5'" 1 
ATOM   376   C "C4'" . DT  A 1 19  ? 2.228   129.155 52.188  1.00   146.32 ? 19  DT  I "C4'" 1 
ATOM   377   O "O4'" . DT  A 1 19  ? 0.995   129.704 51.653  1.00   157.06 ? 19  DT  I "O4'" 1 
ATOM   378   C "C3'" . DT  A 1 19  ? 1.992   127.652 52.351  1.00   154.02 ? 19  DT  I "C3'" 1 
ATOM   379   O "O3'" . DT  A 1 19  ? 1.690   127.350 53.706  1.00   153.88 ? 19  DT  I "O3'" 1 
ATOM   380   C "C2'" . DT  A 1 19  ? 0.799   127.385 51.437  1.00   150.46 ? 19  DT  I "C2'" 1 
ATOM   381   C "C1'" . DT  A 1 19  ? 0.024   128.687 51.556  1.00   149.61 ? 19  DT  I "C1'" 1 
ATOM   382   N N1    . DT  A 1 19  ? -0.841  128.969 50.377  1.00   144.24 ? 19  DT  I N1    1 
ATOM   383   C C2    . DT  A 1 19  ? -1.974  129.730 50.539  1.00   153.85 ? 19  DT  I C2    1 
ATOM   384   O O2    . DT  A 1 19  ? -2.315  130.201 51.610  1.00   143.88 ? 19  DT  I O2    1 
ATOM   385   N N3    . DT  A 1 19  ? -2.700  129.926 49.394  1.00   162.64 ? 19  DT  I N3    1 
ATOM   386   C C4    . DT  A 1 19  ? -2.412  129.446 48.129  1.00   157.61 ? 19  DT  I C4    1 
ATOM   387   O O4    . DT  A 1 19  ? -3.128  129.677 47.160  1.00   152.98 ? 19  DT  I O4    1 
ATOM   388   C C5    . DT  A 1 19  ? -1.210  128.652 48.030  1.00   145.69 ? 19  DT  I C5    1 
ATOM   389   C C7    . DT  A 1 19  ? -0.794  128.075 46.709  1.00   146.25 ? 19  DT  I C7    1 
ATOM   390   C C6    . DT  A 1 19  ? -0.492  128.453 49.145  1.00   138.95 ? 19  DT  I C6    1 
ATOM   391   P P     . DC  A 1 20  ? 1.778   125.837 54.241  1.00   156.50 ? 20  DC  I P     1 
ATOM   392   O OP1   . DC  A 1 20  ? 2.776   125.806 55.333  1.00   143.81 ? 20  DC  I OP1   1 
ATOM   393   O OP2   . DC  A 1 20  ? 1.943   124.941 53.074  1.00   125.07 ? 20  DC  I OP2   1 
ATOM   394   O "O5'" . DC  A 1 20  ? 0.327   125.571 54.857  1.00   136.87 ? 20  DC  I "O5'" 1 
ATOM   395   C "C5'" . DC  A 1 20  ? -0.223  126.492 55.788  1.00   143.46 ? 20  DC  I "C5'" 1 
ATOM   396   C "C4'" . DC  A 1 20  ? -1.739  126.458 55.748  1.00   167.35 ? 20  DC  I "C4'" 1 
ATOM   397   O "O4'" . DC  A 1 20  ? -2.199  126.841 54.425  1.00   165.29 ? 20  DC  I "O4'" 1 
ATOM   398   C "C3'" . DC  A 1 20  ? -2.363  125.092 56.043  1.00   174.87 ? 20  DC  I "C3'" 1 
ATOM   399   O "O3'" . DC  A 1 20  ? -3.435  125.235 56.966  1.00   187.52 ? 20  DC  I "O3'" 1 
ATOM   400   C "C2'" . DC  A 1 20  ? -2.853  124.615 54.676  1.00   164.40 ? 20  DC  I "C2'" 1 
ATOM   401   C "C1'" . DC  A 1 20  ? -3.177  125.929 53.985  1.00   167.54 ? 20  DC  I "C1'" 1 
ATOM   402   N N1    . DC  A 1 20  ? -3.112  125.848 52.498  1.00   166.54 ? 20  DC  I N1    1 
ATOM   403   C C2    . DC  A 1 20  ? -4.182  126.318 51.730  1.00   158.70 ? 20  DC  I C2    1 
ATOM   404   O O2    . DC  A 1 20  ? -5.169  126.800 52.300  1.00   139.70 ? 20  DC  I O2    1 
ATOM   405   N N3    . DC  A 1 20  ? -4.107  126.233 50.378  1.00   160.87 ? 20  DC  I N3    1 
ATOM   406   C C4    . DC  A 1 20  ? -3.025  125.707 49.800  1.00   160.97 ? 20  DC  I C4    1 
ATOM   407   N N4    . DC  A 1 20  ? -2.997  125.646 48.465  1.00   150.31 ? 20  DC  I N4    1 
ATOM   408   C C5    . DC  A 1 20  ? -1.925  125.221 50.566  1.00   159.14 ? 20  DC  I C5    1 
ATOM   409   C C6    . DC  A 1 20  ? -2.011  125.309 51.898  1.00   163.00 ? 20  DC  I C6    1 
ATOM   410   P P     . DC  A 1 21  ? -4.126  123.935 57.610  1.00   150.56 ? 21  DC  I P     1 
ATOM   411   O OP1   . DC  A 1 21  ? -4.671  124.320 58.930  1.00   159.56 ? 21  DC  I OP1   1 
ATOM   412   O OP2   . DC  A 1 21  ? -3.162  122.817 57.509  1.00   160.72 ? 21  DC  I OP2   1 
ATOM   413   O "O5'" . DC  A 1 21  ? -5.344  123.624 56.623  1.00   153.28 ? 21  DC  I "O5'" 1 
ATOM   414   C "C5'" . DC  A 1 21  ? -6.311  124.630 56.355  1.00   154.41 ? 21  DC  I "C5'" 1 
ATOM   415   C "C4'" . DC  A 1 21  ? -7.335  124.137 55.351  1.00   175.26 ? 21  DC  I "C4'" 1 
ATOM   416   O "O4'" . DC  A 1 21  ? -6.767  124.173 54.016  1.00   170.99 ? 21  DC  I "O4'" 1 
ATOM   417   C "C3'" . DC  A 1 21  ? -7.821  122.702 55.576  1.00   169.60 ? 21  DC  I "C3'" 1 
ATOM   418   O "O3'" . DC  A 1 21  ? -9.236  122.651 55.487  1.00   172.86 ? 21  DC  I "O3'" 1 
ATOM   419   C "C2'" . DC  A 1 21  ? -7.155  121.914 54.446  1.00   165.32 ? 21  DC  I "C2'" 1 
ATOM   420   C "C1'" . DC  A 1 21  ? -7.050  122.965 53.353  1.00   167.27 ? 21  DC  I "C1'" 1 
ATOM   421   N N1    . DC  A 1 21  ? -5.959  122.698 52.376  1.00   171.79 ? 21  DC  I N1    1 
ATOM   422   C C2    . DC  A 1 21  ? -6.156  122.986 51.022  1.00   165.13 ? 21  DC  I C2    1 
ATOM   423   O O2    . DC  A 1 21  ? -7.238  123.462 50.658  1.00   139.67 ? 21  DC  I O2    1 
ATOM   424   N N3    . DC  A 1 21  ? -5.151  122.737 50.145  1.00   176.98 ? 21  DC  I N3    1 
ATOM   425   C C4    . DC  A 1 21  ? -3.998  122.223 50.579  1.00   177.53 ? 21  DC  I C4    1 
ATOM   426   N N4    . DC  A 1 21  ? -3.037  121.994 49.678  1.00   176.67 ? 21  DC  I N4    1 
ATOM   427   C C5    . DC  A 1 21  ? -3.780  121.921 51.956  1.00   163.02 ? 21  DC  I C5    1 
ATOM   428   C C6    . DC  A 1 21  ? -4.777  122.172 52.810  1.00   165.36 ? 21  DC  I C6    1 
ATOM   429   P P     . DC  A 1 22  ? -10.048 121.441 56.165  1.00   161.57 ? 22  DC  I P     1 
ATOM   430   O OP1   . DC  A 1 22  ? -10.968 122.024 57.166  1.00   142.23 ? 22  DC  I OP1   1 
ATOM   431   O OP2   . DC  A 1 22  ? -9.069  120.412 56.579  1.00   172.47 ? 22  DC  I OP2   1 
ATOM   432   O "O5'" . DC  A 1 22  ? -10.909 120.845 54.957  1.00   155.29 ? 22  DC  I "O5'" 1 
ATOM   433   C "C5'" . DC  A 1 22  ? -11.734 121.707 54.187  1.00   149.72 ? 22  DC  I "C5'" 1 
ATOM   434   C "C4'" . DC  A 1 22  ? -11.935 121.155 52.788  1.00   151.13 ? 22  DC  I "C4'" 1 
ATOM   435   O "O4'" . DC  A 1 22  ? -10.678 121.171 52.073  1.00   155.31 ? 22  DC  I "O4'" 1 
ATOM   436   C "C3'" . DC  A 1 22  ? -12.441 119.709 52.729  1.00   165.58 ? 22  DC  I "C3'" 1 
ATOM   437   O "O3'" . DC  A 1 22  ? -13.720 119.666 52.108  1.00   181.42 ? 22  DC  I "O3'" 1 
ATOM   438   C "C2'" . DC  A 1 22  ? -11.381 118.962 51.903  1.00   160.86 ? 22  DC  I "C2'" 1 
ATOM   439   C "C1'" . DC  A 1 22  ? -10.664 120.092 51.180  1.00   161.95 ? 22  DC  I "C1'" 1 
ATOM   440   N N1    . DC  A 1 22  ? -9.245  119.777 50.834  1.00   159.83 ? 22  DC  I N1    1 
ATOM   441   C C2    . DC  A 1 22  ? -8.901  119.502 49.506  1.00   161.23 ? 22  DC  I C2    1 
ATOM   442   O O2    . DC  A 1 22  ? -9.782  119.530 48.637  1.00   164.63 ? 22  DC  I O2    1 
ATOM   443   N N3    . DC  A 1 22  ? -7.610  119.217 49.207  1.00   162.75 ? 22  DC  I N3    1 
ATOM   444   C C4    . DC  A 1 22  ? -6.689  119.198 50.171  1.00   159.79 ? 22  DC  I C4    1 
ATOM   445   N N4    . DC  A 1 22  ? -5.429  118.911 49.828  1.00   144.90 ? 22  DC  I N4    1 
ATOM   446   C C5    . DC  A 1 22  ? -7.020  119.473 51.531  1.00   165.96 ? 22  DC  I C5    1 
ATOM   447   C C6    . DC  A 1 22  ? -8.297  119.754 51.814  1.00   163.65 ? 22  DC  I C6    1 
ATOM   448   P P     . DG  A 1 23  ? -14.621 118.338 52.199  1.00   185.25 ? 23  DG  I P     1 
ATOM   449   O OP1   . DG  A 1 23  ? -16.039 118.761 52.204  1.00   126.29 ? 23  DG  I OP1   1 
ATOM   450   O OP2   . DG  A 1 23  ? -14.096 117.510 53.307  1.00   183.57 ? 23  DG  I OP2   1 
ATOM   451   O "O5'" . DG  A 1 23  ? -14.315 117.575 50.827  1.00   168.46 ? 23  DG  I "O5'" 1 
ATOM   452   C "C5'" . DG  A 1 23  ? -14.644 118.191 49.588  1.00   158.02 ? 23  DG  I "C5'" 1 
ATOM   453   C "C4'" . DG  A 1 23  ? -13.910 117.524 48.439  1.00   155.48 ? 23  DG  I "C4'" 1 
ATOM   454   O "O4'" . DG  A 1 23  ? -12.496 117.765 48.564  1.00   162.25 ? 23  DG  I "O4'" 1 
ATOM   455   C "C3'" . DG  A 1 23  ? -14.034 116.014 48.389  1.00   171.64 ? 23  DG  I "C3'" 1 
ATOM   456   O "O3'" . DG  A 1 23  ? -15.230 115.652 47.708  1.00   185.23 ? 23  DG  I "O3'" 1 
ATOM   457   C "C2'" . DG  A 1 23  ? -12.790 115.609 47.596  1.00   168.58 ? 23  DG  I "C2'" 1 
ATOM   458   C "C1'" . DG  A 1 23  ? -11.784 116.719 47.929  1.00   167.70 ? 23  DG  I "C1'" 1 
ATOM   459   N N9    . DG  A 1 23  ? -10.701 116.288 48.810  1.00   168.50 ? 23  DG  I N9    1 
ATOM   460   C C8    . DG  A 1 23  ? -10.767 116.089 50.168  1.00   160.48 ? 23  DG  I C8    1 
ATOM   461   N N7    . DG  A 1 23  ? -9.637  115.707 50.694  1.00   147.58 ? 23  DG  I N7    1 
ATOM   462   C C5    . DG  A 1 23  ? -8.763  115.649 49.615  1.00   165.32 ? 23  DG  I C5    1 
ATOM   463   C C6    . DG  A 1 23  ? -7.393  115.296 49.569  1.00   177.31 ? 23  DG  I C6    1 
ATOM   464   O O6    . DG  A 1 23  ? -6.657  114.950 50.505  1.00   174.74 ? 23  DG  I O6    1 
ATOM   465   N N1    . DG  A 1 23  ? -6.885  115.369 48.274  1.00   179.60 ? 23  DG  I N1    1 
ATOM   466   C C2    . DG  A 1 23  ? -7.609  115.737 47.165  1.00   170.93 ? 23  DG  I C2    1 
ATOM   467   N N2    . DG  A 1 23  ? -6.946  115.748 46.000  1.00   153.46 ? 23  DG  I N2    1 
ATOM   468   N N3    . DG  A 1 23  ? -8.893  116.072 47.195  1.00   166.40 ? 23  DG  I N3    1 
ATOM   469   C C4    . DG  A 1 23  ? -9.403  116.005 48.449  1.00   166.35 ? 23  DG  I C4    1 
ATOM   470   P P     . DG  A 1 24  ? -15.762 114.136 47.749  1.00   196.28 ? 24  DG  I P     1 
ATOM   471   O OP1   . DG  A 1 24  ? -17.212 114.162 47.456  1.00   184.87 ? 24  DG  I OP1   1 
ATOM   472   O OP2   . DG  A 1 24  ? -15.274 113.521 49.004  1.00   172.26 ? 24  DG  I OP2   1 
ATOM   473   O "O5'" . DG  A 1 24  ? -15.000 113.430 46.532  1.00   169.06 ? 24  DG  I "O5'" 1 
ATOM   474   C "C5'" . DG  A 1 24  ? -15.023 114.025 45.241  1.00   154.12 ? 24  DG  I "C5'" 1 
ATOM   475   C "C4'" . DG  A 1 24  ? -13.928 113.446 44.364  1.00   159.09 ? 24  DG  I "C4'" 1 
ATOM   476   O "O4'" . DG  A 1 24  ? -12.635 113.694 44.975  1.00   160.84 ? 24  DG  I "O4'" 1 
ATOM   477   C "C3'" . DG  A 1 24  ? -14.018 111.934 44.137  1.00   168.85 ? 24  DG  I "C3'" 1 
ATOM   478   O "O3'" . DG  A 1 24  ? -13.913 111.643 42.750  1.00   179.45 ? 24  DG  I "O3'" 1 
ATOM   479   C "C2'" . DG  A 1 24  ? -12.835 111.370 44.927  1.00   176.85 ? 24  DG  I "C2'" 1 
ATOM   480   C "C1'" . DG  A 1 24  ? -11.852 112.528 44.904  1.00   176.85 ? 24  DG  I "C1'" 1 
ATOM   481   N N9    . DG  A 1 24  ? -10.928 112.517 46.036  1.00   163.91 ? 24  DG  I N9    1 
ATOM   482   C C8    . DG  A 1 24  ? -11.255 112.541 47.370  1.00   156.56 ? 24  DG  I C8    1 
ATOM   483   N N7    . DG  A 1 24  ? -10.219 112.516 48.161  1.00   145.25 ? 24  DG  I N7    1 
ATOM   484   C C5    . DG  A 1 24  ? -9.133  112.470 47.297  1.00   155.17 ? 24  DG  I C5    1 
ATOM   485   C C6    . DG  A 1 24  ? -7.747  112.427 47.578  1.00   157.48 ? 24  DG  I C6    1 
ATOM   486   O O6    . DG  A 1 24  ? -7.187  112.421 48.684  1.00   148.38 ? 24  DG  I O6    1 
ATOM   487   N N1    . DG  A 1 24  ? -6.985  112.389 46.413  1.00   156.28 ? 24  DG  I N1    1 
ATOM   488   C C2    . DG  A 1 24  ? -7.499  112.391 45.138  1.00   158.77 ? 24  DG  I C2    1 
ATOM   489   N N2    . DG  A 1 24  ? -6.606  112.349 44.138  1.00   153.94 ? 24  DG  I N2    1 
ATOM   490   N N3    . DG  A 1 24  ? -8.797  112.430 44.860  1.00   165.68 ? 24  DG  I N3    1 
ATOM   491   C C4    . DG  A 1 24  ? -9.552  112.468 45.985  1.00   157.80 ? 24  DG  I C4    1 
ATOM   492   P P     . DT  A 1 25  ? -13.980 110.123 42.233  1.00   182.64 ? 25  DT  I P     1 
ATOM   493   O OP1   . DT  A 1 25  ? -14.560 110.142 40.872  1.00   186.40 ? 25  DT  I OP1   1 
ATOM   494   O OP2   . DT  A 1 25  ? -14.616 109.303 43.289  1.00   157.51 ? 25  DT  I OP2   1 
ATOM   495   O "O5'" . DT  A 1 25  ? -12.444 109.689 42.131  1.00   181.80 ? 25  DT  I "O5'" 1 
ATOM   496   C "C5'" . DT  A 1 25  ? -11.536 110.477 41.370  1.00   169.92 ? 25  DT  I "C5'" 1 
ATOM   497   C "C4'" . DT  A 1 25  ? -10.146 109.868 41.384  1.00   159.12 ? 25  DT  I "C4'" 1 
ATOM   498   O "O4'" . DT  A 1 25  ? -9.516  110.114 42.670  1.00   159.78 ? 25  DT  I "O4'" 1 
ATOM   499   C "C3'" . DT  A 1 25  ? -10.101 108.351 41.169  1.00   165.99 ? 25  DT  I "C3'" 1 
ATOM   500   O "O3'" . DT  A 1 25  ? -9.087  108.026 40.225  1.00   187.94 ? 25  DT  I "O3'" 1 
ATOM   501   C "C2'" . DT  A 1 25  ? -9.765  107.810 42.558  1.00   172.63 ? 25  DT  I "C2'" 1 
ATOM   502   C "C1'" . DT  A 1 25  ? -8.897  108.929 43.105  1.00   169.43 ? 25  DT  I "C1'" 1 
ATOM   503   N N1    . DT  A 1 25  ? -8.805  108.947 44.594  1.00   165.56 ? 25  DT  I N1    1 
ATOM   504   C C2    . DT  A 1 25  ? -7.564  108.942 45.188  1.00   145.68 ? 25  DT  I C2    1 
ATOM   505   O O2    . DT  A 1 25  ? -6.522  108.930 44.558  1.00   130.68 ? 25  DT  I O2    1 
ATOM   506   N N3    . DT  A 1 25  ? -7.584  108.956 46.557  1.00   147.69 ? 25  DT  I N3    1 
ATOM   507   C C4    . DT  A 1 25  ? -8.699  108.971 47.376  1.00   157.80 ? 25  DT  I C4    1 
ATOM   508   O O4    . DT  A 1 25  ? -8.613  108.982 48.600  1.00   152.07 ? 25  DT  I O4    1 
ATOM   509   C C5    . DT  A 1 25  ? -9.970  108.972 46.689  1.00   152.20 ? 25  DT  I C5    1 
ATOM   510   C C7    . DT  A 1 25  ? -11.249 108.988 47.471  1.00   122.64 ? 25  DT  I C7    1 
ATOM   511   C C6    . DT  A 1 25  ? -9.961  108.959 45.347  1.00   162.39 ? 25  DT  I C6    1 
ATOM   512   P P     . DG  A 1 26  ? -9.193  106.683 39.348  1.00   182.57 ? 26  DG  I P     1 
ATOM   513   O OP1   . DG  A 1 26  ? -9.637  107.072 37.991  1.00   188.17 ? 26  DG  I OP1   1 
ATOM   514   O OP2   . DG  A 1 26  ? -9.973  105.692 40.122  1.00   135.35 ? 26  DG  I OP2   1 
ATOM   515   O "O5'" . DG  A 1 26  ? -7.683  106.162 39.262  1.00   183.85 ? 26  DG  I "O5'" 1 
ATOM   516   C "C5'" . DG  A 1 26  ? -6.697  106.945 38.597  1.00   175.08 ? 26  DG  I "C5'" 1 
ATOM   517   C "C4'" . DG  A 1 26  ? -5.309  106.650 39.142  1.00   170.48 ? 26  DG  I "C4'" 1 
ATOM   518   O "O4'" . DG  A 1 26  ? -5.263  106.973 40.556  1.00   164.67 ? 26  DG  I "O4'" 1 
ATOM   519   C "C3'" . DG  A 1 26  ? -4.858  105.196 39.022  1.00   159.46 ? 26  DG  I "C3'" 1 
ATOM   520   O "O3'" . DG  A 1 26  ? -3.477  105.146 38.684  1.00   167.92 ? 26  DG  I "O3'" 1 
ATOM   521   C "C2'" . DG  A 1 26  ? -5.121  104.633 40.417  1.00   133.03 ? 26  DG  I "C2'" 1 
ATOM   522   C "C1'" . DG  A 1 26  ? -4.852  105.844 41.298  1.00   147.59 ? 26  DG  I "C1'" 1 
ATOM   523   N N9    . DG  A 1 26  ? -5.601  105.826 42.551  1.00   147.06 ? 26  DG  I N9    1 
ATOM   524   C C8    . DG  A 1 26  ? -6.966  105.860 42.694  1.00   150.94 ? 26  DG  I C8    1 
ATOM   525   N N7    . DG  A 1 26  ? -7.360  105.834 43.937  1.00   152.76 ? 26  DG  I N7    1 
ATOM   526   C C5    . DG  A 1 26  ? -6.180  105.781 44.666  1.00   153.86 ? 26  DG  I C5    1 
ATOM   527   C C6    . DG  A 1 26  ? -5.976  105.735 46.066  1.00   149.35 ? 26  DG  I C6    1 
ATOM   528   O O6    . DG  A 1 26  ? -6.828  105.732 46.966  1.00   140.51 ? 26  DG  I O6    1 
ATOM   529   N N1    . DG  A 1 26  ? -4.622  105.688 46.388  1.00   146.16 ? 26  DG  I N1    1 
ATOM   530   C C2    . DG  A 1 26  ? -3.595  105.687 45.473  1.00   143.12 ? 26  DG  I C2    1 
ATOM   531   N N2    . DG  A 1 26  ? -2.352  105.639 45.974  1.00   130.06 ? 26  DG  I N2    1 
ATOM   532   N N3    . DG  A 1 26  ? -3.773  105.731 44.158  1.00   154.50 ? 26  DG  I N3    1 
ATOM   533   C C4    . DG  A 1 26  ? -5.087  105.776 43.828  1.00   156.44 ? 26  DG  I C4    1 
ATOM   534   P P     . DC  A 1 27  ? -2.734  103.732 38.509  1.00   176.67 ? 27  DC  I P     1 
ATOM   535   O OP1   . DC  A 1 27  ? -1.583  103.934 37.601  1.00   162.36 ? 27  DC  I OP1   1 
ATOM   536   O OP2   . DC  A 1 27  ? -3.757  102.713 38.185  1.00   153.45 ? 27  DC  I OP2   1 
ATOM   537   O "O5'" . DC  A 1 27  ? -2.177  103.416 39.972  1.00   167.14 ? 27  DC  I "O5'" 1 
ATOM   538   C "C5'" . DC  A 1 27  ? -1.388  104.381 40.655  1.00   150.68 ? 27  DC  I "C5'" 1 
ATOM   539   C "C4'" . DC  A 1 27  ? -0.758  103.771 41.891  1.00   141.31 ? 27  DC  I "C4'" 1 
ATOM   540   O "O4'" . DC  A 1 27  ? -1.681  103.866 43.006  1.00   144.79 ? 27  DC  I "O4'" 1 
ATOM   541   C "C3'" . DC  A 1 27  ? -0.398  102.292 41.753  1.00   147.42 ? 27  DC  I "C3'" 1 
ATOM   542   O "O3'" . DC  A 1 27  ? 0.889   102.055 42.289  1.00   134.89 ? 27  DC  I "O3'" 1 
ATOM   543   C "C2'" . DC  A 1 27  ? -1.487  101.580 42.553  1.00   142.28 ? 27  DC  I "C2'" 1 
ATOM   544   C "C1'" . DC  A 1 27  ? -1.812  102.607 43.624  1.00   144.05 ? 27  DC  I "C1'" 1 
ATOM   545   N N1    . DC  A 1 27  ? -3.199  102.487 44.152  1.00   149.97 ? 27  DC  I N1    1 
ATOM   546   C C2    . DC  A 1 27  ? -3.411  102.396 45.532  1.00   141.80 ? 27  DC  I C2    1 
ATOM   547   O O2    . DC  A 1 27  ? -2.437  102.421 46.294  1.00   145.20 ? 27  DC  I O2    1 
ATOM   548   N N3    . DC  A 1 27  ? -4.680  102.289 45.994  1.00   144.87 ? 27  DC  I N3    1 
ATOM   549   C C4    . DC  A 1 27  ? -5.704  102.266 45.139  1.00   144.53 ? 27  DC  I C4    1 
ATOM   550   N N4    . DC  A 1 27  ? -6.938  102.156 45.643  1.00   126.82 ? 27  DC  I N4    1 
ATOM   551   C C5    . DC  A 1 27  ? -5.508  102.355 43.729  1.00   138.93 ? 27  DC  I C5    1 
ATOM   552   C C6    . DC  A 1 27  ? -4.252  102.463 43.285  1.00   143.81 ? 27  DC  I C6    1 
ATOM   553   P P     . DC  A 1 28  ? 2.154   101.925 41.308  1.00   153.83 ? 28  DC  I P     1 
ATOM   554   O OP1   . DC  A 1 28  ? 2.324   103.225 40.621  1.00   131.14 ? 28  DC  I OP1   1 
ATOM   555   O OP2   . DC  A 1 28  ? 1.989   100.687 40.515  1.00   154.43 ? 28  DC  I OP2   1 
ATOM   556   O "O5'" . DC  A 1 28  ? 3.381   101.703 42.303  1.00   142.84 ? 28  DC  I "O5'" 1 
ATOM   557   C "C5'" . DC  A 1 28  ? 3.761   102.734 43.202  1.00   143.38 ? 28  DC  I "C5'" 1 
ATOM   558   C "C4'" . DC  A 1 28  ? 3.895   102.209 44.623  1.00   139.11 ? 28  DC  I "C4'" 1 
ATOM   559   O "O4'" . DC  A 1 28  ? 2.576   101.871 45.144  1.00   126.97 ? 28  DC  I "O4'" 1 
ATOM   560   C "C3'" . DC  A 1 28  ? 4.726   100.931 44.769  1.00   135.98 ? 28  DC  I "C3'" 1 
ATOM   561   O "O3'" . DC  A 1 28  ? 5.336   100.906 46.042  1.00   139.87 ? 28  DC  I "O3'" 1 
ATOM   562   C "C2'" . DC  A 1 28  ? 3.648   99.859  44.682  1.00   129.98 ? 28  DC  I "C2'" 1 
ATOM   563   C "C1'" . DC  A 1 28  ? 2.573   100.513 45.534  1.00   136.98 ? 28  DC  I "C1'" 1 
ATOM   564   N N1    . DC  A 1 28  ? 1.204   99.948  45.333  1.00   136.04 ? 28  DC  I N1    1 
ATOM   565   C C2    . DC  A 1 28  ? 0.219   100.162 46.304  1.00   122.70 ? 28  DC  I C2    1 
ATOM   566   O O2    . DC  A 1 28  ? 0.499   100.825 47.310  1.00   122.40 ? 28  DC  I O2    1 
ATOM   567   N N3    . DC  A 1 28  ? -1.017  99.640  46.113  1.00   116.17 ? 28  DC  I N3    1 
ATOM   568   C C4    . DC  A 1 28  ? -1.279  98.931  45.015  1.00   125.48 ? 28  DC  I C4    1 
ATOM   569   N N4    . DC  A 1 28  ? -2.513  98.437  44.872  1.00   123.59 ? 28  DC  I N4    1 
ATOM   570   C C5    . DC  A 1 28  ? -0.288  98.696  44.016  1.00   134.03 ? 28  DC  I C5    1 
ATOM   571   C C6    . DC  A 1 28  ? 0.927   99.218  44.214  1.00   141.80 ? 28  DC  I C6    1 
ATOM   572   P P     . DG  A 1 29  ? 6.934   100.808 46.168  1.00   142.57 ? 29  DG  I P     1 
ATOM   573   O OP1   . DG  A 1 29  ? 7.494   102.096 45.700  1.00   129.21 ? 29  DG  I OP1   1 
ATOM   574   O OP2   . DG  A 1 29  ? 7.364   99.542  45.534  1.00   116.85 ? 29  DG  I OP2   1 
ATOM   575   O "O5'" . DG  A 1 29  ? 7.181   100.682 47.742  1.00   134.10 ? 29  DG  I "O5'" 1 
ATOM   576   C "C5'" . DG  A 1 29  ? 6.728   101.710 48.608  1.00   138.13 ? 29  DG  I "C5'" 1 
ATOM   577   C "C4'" . DG  A 1 29  ? 5.735   101.169 49.619  1.00   129.78 ? 29  DG  I "C4'" 1 
ATOM   578   O "O4'" . DG  A 1 29  ? 4.621   100.547 48.930  1.00   109.30 ? 29  DG  I "O4'" 1 
ATOM   579   C "C3'" . DG  A 1 29  ? 6.294   100.111 50.577  1.00   135.62 ? 29  DG  I "C3'" 1 
ATOM   580   O "O3'" . DG  A 1 29  ? 5.975   100.467 51.912  1.00   140.60 ? 29  DG  I "O3'" 1 
ATOM   581   C "C2'" . DG  A 1 29  ? 5.583   98.821  50.152  1.00   130.98 ? 29  DG  I "C2'" 1 
ATOM   582   C "C1'" . DG  A 1 29  ? 4.276   99.359  49.596  1.00   135.57 ? 29  DG  I "C1'" 1 
ATOM   583   N N9    . DG  A 1 29  ? 3.627   98.462  48.643  1.00   139.09 ? 29  DG  I N9    1 
ATOM   584   C C8    . DG  A 1 29  ? 4.182   97.914  47.512  1.00   129.32 ? 29  DG  I C8    1 
ATOM   585   N N7    . DG  A 1 29  ? 3.359   97.151  46.847  1.00   135.12 ? 29  DG  I N7    1 
ATOM   586   C C5    . DG  A 1 29  ? 2.181   97.197  47.582  1.00   142.61 ? 29  DG  I C5    1 
ATOM   587   C C6    . DG  A 1 29  ? 0.936   96.566  47.350  1.00   147.41 ? 29  DG  I C6    1 
ATOM   588   O O6    . DG  A 1 29  ? 0.617   95.815  46.417  1.00   156.32 ? 29  DG  I O6    1 
ATOM   589   N N1    . DG  A 1 29  ? 0.007   96.879  48.339  1.00   138.06 ? 29  DG  I N1    1 
ATOM   590   C C2    . DG  A 1 29  ? 0.251   97.698  49.416  1.00   127.36 ? 29  DG  I C2    1 
ATOM   591   N N2    . DG  A 1 29  ? -0.769  97.881  50.266  1.00   142.44 ? 29  DG  I N2    1 
ATOM   592   N N3    . DG  A 1 29  ? 1.413   98.296  49.645  1.00   125.61 ? 29  DG  I N3    1 
ATOM   593   C C4    . DG  A 1 29  ? 2.329   98.001  48.690  1.00   137.28 ? 29  DG  I C4    1 
ATOM   594   P P     . DA  A 1 30  ? 6.920   100.016 53.130  1.00   140.15 ? 30  DA  I P     1 
ATOM   595   O OP1   . DA  A 1 30  ? 7.688   101.204 53.567  1.00   117.80 ? 30  DA  I OP1   1 
ATOM   596   O OP2   . DA  A 1 30  ? 7.631   98.782  52.728  1.00   151.38 ? 30  DA  I OP2   1 
ATOM   597   O "O5'" . DA  A 1 30  ? 5.874   99.630  54.272  1.00   110.46 ? 30  DA  I "O5'" 1 
ATOM   598   C "C5'" . DA  A 1 30  ? 4.851   100.546 54.609  1.00   107.62 ? 30  DA  I "C5'" 1 
ATOM   599   C "C4'" . DA  A 1 30  ? 3.607   99.817  55.075  1.00   118.92 ? 30  DA  I "C4'" 1 
ATOM   600   O "O4'" . DA  A 1 30  ? 3.068   99.036  53.979  1.00   133.53 ? 30  DA  I "O4'" 1 
ATOM   601   C "C3'" . DA  A 1 30  ? 3.814   98.835  56.228  1.00   96.82  ? 30  DA  I "C3'" 1 
ATOM   602   O "O3'" . DA  A 1 30  ? 2.716   98.931  57.121  1.00   91.18  ? 30  DA  I "O3'" 1 
ATOM   603   C "C2'" . DA  A 1 30  ? 3.852   97.483  55.522  1.00   106.81 ? 30  DA  I "C2'" 1 
ATOM   604   C "C1'" . DA  A 1 30  ? 2.847   97.715  54.410  1.00   133.33 ? 30  DA  I "C1'" 1 
ATOM   605   N N9    . DA  A 1 30  ? 3.032   96.837  53.262  1.00   151.01 ? 30  DA  I N9    1 
ATOM   606   C C8    . DA  A 1 30  ? 4.205   96.565  52.615  1.00   133.61 ? 30  DA  I C8    1 
ATOM   607   N N7    . DA  A 1 30  ? 4.072   95.741  51.604  1.00   134.74 ? 30  DA  I N7    1 
ATOM   608   C C5    . DA  A 1 30  ? 2.717   95.453  51.587  1.00   149.33 ? 30  DA  I C5    1 
ATOM   609   C C6    . DA  A 1 30  ? 1.932   94.635  50.752  1.00   161.12 ? 30  DA  I C6    1 
ATOM   610   N N6    . DA  A 1 30  ? 2.434   93.934  49.733  1.00   159.66 ? 30  DA  I N6    1 
ATOM   611   N N1    . DA  A 1 30  ? 0.608   94.568  51.007  1.00   163.28 ? 30  DA  I N1    1 
ATOM   612   C C2    . DA  A 1 30  ? 0.111   95.275  52.029  1.00   150.03 ? 30  DA  I C2    1 
ATOM   613   N N3    . DA  A 1 30  ? 0.748   96.077  52.881  1.00   147.16 ? 30  DA  I N3    1 
ATOM   614   C C4    . DA  A 1 30  ? 2.061   96.122  52.601  1.00   156.32 ? 30  DA  I C4    1 
ATOM   615   P P     . DG  A 1 31  ? 2.840   98.410  58.634  1.00   121.25 ? 31  DG  I P     1 
ATOM   616   O OP1   . DG  A 1 31  ? 2.189   99.422  59.492  1.00   85.43  ? 31  DG  I OP1   1 
ATOM   617   O OP2   . DG  A 1 31  ? 4.244   98.012  58.881  1.00   115.51 ? 31  DG  I OP2   1 
ATOM   618   O "O5'" . DG  A 1 31  ? 1.928   97.098  58.657  1.00   141.34 ? 31  DG  I "O5'" 1 
ATOM   619   C "C5'" . DG  A 1 31  ? 0.533   97.208  58.408  1.00   129.08 ? 31  DG  I "C5'" 1 
ATOM   620   C "C4'" . DG  A 1 31  ? -0.086  95.841  58.189  1.00   129.70 ? 31  DG  I "C4'" 1 
ATOM   621   O "O4'" . DG  A 1 31  ? 0.329   95.316  56.899  1.00   135.83 ? 31  DG  I "O4'" 1 
ATOM   622   C "C3'" . DG  A 1 31  ? 0.298   94.783  59.227  1.00   125.12 ? 31  DG  I "C3'" 1 
ATOM   623   O "O3'" . DG  A 1 31  ? -0.861  94.064  59.630  1.00   142.56 ? 31  DG  I "O3'" 1 
ATOM   624   C "C2'" . DG  A 1 31  ? 1.281   93.890  58.471  1.00   125.97 ? 31  DG  I "C2'" 1 
ATOM   625   C "C1'" . DG  A 1 31  ? 0.734   93.978  57.057  1.00   138.68 ? 31  DG  I "C1'" 1 
ATOM   626   N N9    . DG  A 1 31  ? 1.715   93.659  56.021  1.00   131.50 ? 31  DG  I N9    1 
ATOM   627   C C8    . DG  A 1 31  ? 3.011   94.106  55.940  1.00   124.15 ? 31  DG  I C8    1 
ATOM   628   N N7    . DG  A 1 31  ? 3.653   93.654  54.898  1.00   116.74 ? 31  DG  I N7    1 
ATOM   629   C C5    . DG  A 1 31  ? 2.723   92.857  54.245  1.00   132.03 ? 31  DG  I C5    1 
ATOM   630   C C6    . DG  A 1 31  ? 2.844   92.104  53.052  1.00   147.15 ? 31  DG  I C6    1 
ATOM   631   O O6    . DG  A 1 31  ? 3.832   91.989  52.314  1.00   125.49 ? 31  DG  I O6    1 
ATOM   632   N N1    . DG  A 1 31  ? 1.660   91.438  52.740  1.00   177.06 ? 31  DG  I N1    1 
ATOM   633   C C2    . DG  A 1 31  ? 0.505   91.494  53.486  1.00   170.35 ? 31  DG  I C2    1 
ATOM   634   N N2    . DG  A 1 31  ? -0.536  90.784  53.026  1.00   147.54 ? 31  DG  I N2    1 
ATOM   635   N N3    . DG  A 1 31  ? 0.379   92.196  54.606  1.00   163.63 ? 31  DG  I N3    1 
ATOM   636   C C4    . DG  A 1 31  ? 1.524   92.850  54.923  1.00   142.64 ? 31  DG  I C4    1 
ATOM   637   P P     . DG  A 1 32  ? -0.890  93.287  61.036  1.00   143.27 ? 32  DG  I P     1 
ATOM   638   O OP1   . DG  A 1 32  ? -2.054  93.791  61.799  1.00   103.28 ? 32  DG  I OP1   1 
ATOM   639   O OP2   . DG  A 1 32  ? 0.466   93.364  61.628  1.00   112.33 ? 32  DG  I OP2   1 
ATOM   640   O "O5'" . DG  A 1 32  ? -1.166  91.766  60.620  1.00   148.72 ? 32  DG  I "O5'" 1 
ATOM   641   C "C5'" . DG  A 1 32  ? -2.304  91.445  59.828  1.00   127.74 ? 32  DG  I "C5'" 1 
ATOM   642   C "C4'" . DG  A 1 32  ? -2.001  90.295  58.884  1.00   125.24 ? 32  DG  I "C4'" 1 
ATOM   643   O "O4'" . DG  A 1 32  ? -0.955  90.680  57.977  1.00   136.34 ? 32  DG  I "O4'" 1 
ATOM   644   C "C3'" . DG  A 1 32  ? -1.491  89.026  59.557  1.00   148.71 ? 32  DG  I "C3'" 1 
ATOM   645   O "O3'" . DG  A 1 32  ? -2.570  88.116  59.757  1.00   173.74 ? 32  DG  I "O3'" 1 
ATOM   646   C "C2'" . DG  A 1 32  ? -0.449  88.461  58.573  1.00   143.33 ? 32  DG  I "C2'" 1 
ATOM   647   C "C1'" . DG  A 1 32  ? -0.367  89.514  57.465  1.00   133.75 ? 32  DG  I "C1'" 1 
ATOM   648   N N9    . DG  A 1 32  ? 1.002   89.819  57.059  1.00   133.35 ? 32  DG  I N9    1 
ATOM   649   C C8    . DG  A 1 32  ? 1.880   90.670  57.685  1.00   124.52 ? 32  DG  I C8    1 
ATOM   650   N N7    . DG  A 1 32  ? 3.041   90.745  57.096  1.00   128.94 ? 32  DG  I N7    1 
ATOM   651   C C5    . DG  A 1 32  ? 2.928   89.884  56.012  1.00   151.19 ? 32  DG  I C5    1 
ATOM   652   C C6    . DG  A 1 32  ? 3.871   89.551  55.010  1.00   151.87 ? 32  DG  I C6    1 
ATOM   653   O O6    . DG  A 1 32  ? 5.031   89.966  54.879  1.00   122.96 ? 32  DG  I O6    1 
ATOM   654   N N1    . DG  A 1 32  ? 3.350   88.637  54.095  1.00   156.34 ? 32  DG  I N1    1 
ATOM   655   C C2    . DG  A 1 32  ? 2.080   88.112  54.144  1.00   149.59 ? 32  DG  I C2    1 
ATOM   656   N N2    . DG  A 1 32  ? 1.757   87.244  53.175  1.00   134.47 ? 32  DG  I N2    1 
ATOM   657   N N3    . DG  A 1 32  ? 1.187   88.416  55.078  1.00   160.27 ? 32  DG  I N3    1 
ATOM   658   C C4    . DG  A 1 32  ? 1.679   89.305  55.976  1.00   154.05 ? 32  DG  I C4    1 
ATOM   659   P P     . DC  A 1 33  ? -2.301  86.652  60.365  1.00   174.32 ? 33  DC  I P     1 
ATOM   660   O OP1   . DC  A 1 33  ? -3.565  86.179  60.972  1.00   169.37 ? 33  DC  I OP1   1 
ATOM   661   O OP2   . DC  A 1 33  ? -1.073  86.720  61.189  1.00   168.34 ? 33  DC  I OP2   1 
ATOM   662   O "O5'" . DC  A 1 33  ? -1.979  85.755  59.080  1.00   122.58 ? 33  DC  I "O5'" 1 
ATOM   663   C "C5'" . DC  A 1 33  ? -2.832  85.810  57.942  1.00   132.36 ? 33  DC  I "C5'" 1 
ATOM   664   C "C4'" . DC  A 1 33  ? -2.325  84.894  56.844  1.00   116.60 ? 33  DC  I "C4'" 1 
ATOM   665   O "O4'" . DC  A 1 33  ? -1.092  85.430  56.294  1.00   110.91 ? 33  DC  I "O4'" 1 
ATOM   666   C "C3'" . DC  A 1 33  ? -2.006  83.467  57.296  1.00   147.93 ? 33  DC  I "C3'" 1 
ATOM   667   O "O3'" . DC  A 1 33  ? -2.488  82.530  56.343  1.00   145.90 ? 33  DC  I "O3'" 1 
ATOM   668   C "C2'" . DC  A 1 33  ? -0.482  83.454  57.372  1.00   160.26 ? 33  DC  I "C2'" 1 
ATOM   669   C "C1'" . DC  A 1 33  ? -0.117  84.414  56.253  1.00   140.90 ? 33  DC  I "C1'" 1 
ATOM   670   N N1    . DC  A 1 33  ? 1.225   85.033  56.422  1.00   126.63 ? 33  DC  I N1    1 
ATOM   671   C C2    . DC  A 1 33  ? 2.196   84.864  55.430  1.00   134.59 ? 33  DC  I C2    1 
ATOM   672   O O2    . DC  A 1 33  ? 1.918   84.206  54.421  1.00   135.15 ? 33  DC  I O2    1 
ATOM   673   N N3    . DC  A 1 33  ? 3.415   85.432  55.603  1.00   139.76 ? 33  DC  I N3    1 
ATOM   674   C C4    . DC  A 1 33  ? 3.674   86.135  56.707  1.00   141.22 ? 33  DC  I C4    1 
ATOM   675   N N4    . DC  A 1 33  ? 4.890   86.676  56.834  1.00   144.28 ? 33  DC  I N4    1 
ATOM   676   C C5    . DC  A 1 33  ? 2.698   86.314  57.730  1.00   136.26 ? 33  DC  I C5    1 
ATOM   677   C C6    . DC  A 1 33  ? 1.500   85.749  57.549  1.00   133.27 ? 33  DC  I C6    1 
ATOM   678   P P     . DC  A 1 34  ? -2.518  80.964  56.701  1.00   134.86 ? 34  DC  I P     1 
ATOM   679   O OP1   . DC  A 1 34  ? -3.486  80.315  55.791  1.00   164.47 ? 34  DC  I OP1   1 
ATOM   680   O OP2   . DC  A 1 34  ? -2.690  80.847  58.167  1.00   111.69 ? 34  DC  I OP2   1 
ATOM   681   O "O5'" . DC  A 1 34  ? -1.044  80.453  56.338  1.00   115.89 ? 34  DC  I "O5'" 1 
ATOM   682   C "C5'" . DC  A 1 34  ? -0.599  80.473  54.987  1.00   117.19 ? 34  DC  I "C5'" 1 
ATOM   683   C "C4'" . DC  A 1 34  ? 0.800   79.892  54.867  1.00   152.05 ? 34  DC  I "C4'" 1 
ATOM   684   O "O4'" . DC  A 1 34  ? 1.777   80.868  55.316  1.00   165.37 ? 34  DC  I "O4'" 1 
ATOM   685   C "C3'" . DC  A 1 34  ? 1.053   78.623  55.690  1.00   154.47 ? 34  DC  I "C3'" 1 
ATOM   686   O "O3'" . DC  A 1 34  ? 1.714   77.647  54.889  1.00   173.64 ? 34  DC  I "O3'" 1 
ATOM   687   C "C2'" . DC  A 1 34  ? 1.953   79.113  56.825  1.00   164.63 ? 34  DC  I "C2'" 1 
ATOM   688   C "C1'" . DC  A 1 34  ? 2.724   80.219  56.129  1.00   172.85 ? 34  DC  I "C1'" 1 
ATOM   689   N N1    . DC  A 1 34  ? 3.324   81.216  57.063  1.00   161.37 ? 34  DC  I N1    1 
ATOM   690   C C2    . DC  A 1 34  ? 4.628   81.672  56.840  1.00   145.52 ? 34  DC  I C2    1 
ATOM   691   O O2    . DC  A 1 34  ? 5.258   81.245  55.865  1.00   140.10 ? 34  DC  I O2    1 
ATOM   692   N N3    . DC  A 1 34  ? 5.163   82.575  57.698  1.00   147.74 ? 34  DC  I N3    1 
ATOM   693   C C4    . DC  A 1 34  ? 4.449   83.013  58.737  1.00   154.86 ? 34  DC  I C4    1 
ATOM   694   N N4    . DC  A 1 34  ? 5.019   83.904  59.556  1.00   135.14 ? 34  DC  I N4    1 
ATOM   695   C C5    . DC  A 1 34  ? 3.120   82.557  58.982  1.00   156.51 ? 34  DC  I C5    1 
ATOM   696   C C6    . DC  A 1 34  ? 2.603   81.666  58.129  1.00   153.33 ? 34  DC  I C6    1 
ATOM   697   P P     . DG  A 1 35  ? 1.554   76.081  55.217  1.00   180.66 ? 35  DG  I P     1 
ATOM   698   O OP1   . DG  A 1 35  ? 0.462   75.560  54.364  1.00   160.57 ? 35  DG  I OP1   1 
ATOM   699   O OP2   . DG  A 1 35  ? 1.472   75.930  56.687  1.00   166.03 ? 35  DG  I OP2   1 
ATOM   700   O "O5'" . DG  A 1 35  ? 2.940   75.441  54.732  1.00   175.48 ? 35  DG  I "O5'" 1 
ATOM   701   C "C5'" . DG  A 1 35  ? 3.232   75.343  53.340  1.00   174.40 ? 35  DG  I "C5'" 1 
ATOM   702   C "C4'" . DG  A 1 35  ? 4.522   76.073  53.004  1.00   184.40 ? 35  DG  I "C4'" 1 
ATOM   703   O "O4'" . DG  A 1 35  ? 4.570   77.317  53.740  1.00   180.88 ? 35  DG  I "O4'" 1 
ATOM   704   C "C3'" . DG  A 1 35  ? 5.798   75.332  53.374  1.00   182.49 ? 35  DG  I "C3'" 1 
ATOM   705   O "O3'" . DG  A 1 35  ? 6.213   74.510  52.283  1.00   187.45 ? 35  DG  I "O3'" 1 
ATOM   706   C "C2'" . DG  A 1 35  ? 6.788   76.471  53.613  1.00   178.66 ? 35  DG  I "C2'" 1 
ATOM   707   C "C1'" . DG  A 1 35  ? 5.897   77.591  54.152  1.00   172.87 ? 35  DG  I "C1'" 1 
ATOM   708   N N9    . DG  A 1 35  ? 5.915   77.713  55.607  1.00   167.81 ? 35  DG  I N9    1 
ATOM   709   C C8    . DG  A 1 35  ? 5.153   77.006  56.507  1.00   177.26 ? 35  DG  I C8    1 
ATOM   710   N N7    . DG  A 1 35  ? 5.380   77.333  57.749  1.00   176.77 ? 35  DG  I N7    1 
ATOM   711   C C5    . DG  A 1 35  ? 6.352   78.322  57.669  1.00   163.68 ? 35  DG  I C5    1 
ATOM   712   C C6    . DG  A 1 35  ? 6.991   79.056  58.695  1.00   155.12 ? 35  DG  I C6    1 
ATOM   713   O O6    . DG  A 1 35  ? 6.819   78.972  59.919  1.00   155.72 ? 35  DG  I O6    1 
ATOM   714   N N1    . DG  A 1 35  ? 7.916   79.961  58.183  1.00   147.92 ? 35  DG  I N1    1 
ATOM   715   C C2    . DG  A 1 35  ? 8.184   80.140  56.847  1.00   149.13 ? 35  DG  I C2    1 
ATOM   716   N N2    . DG  A 1 35  ? 9.113   81.058  56.548  1.00   149.92 ? 35  DG  I N2    1 
ATOM   717   N N3    . DG  A 1 35  ? 7.595   79.456  55.874  1.00   148.09 ? 35  DG  I N3    1 
ATOM   718   C C4    . DG  A 1 35  ? 6.691   78.569  56.357  1.00   157.28 ? 35  DG  I C4    1 
ATOM   719   P P     . DC  A 1 36  ? 7.026   73.149  52.549  1.00   180.42 ? 36  DC  I P     1 
ATOM   720   O OP1   . DC  A 1 36  ? 7.496   72.642  51.241  1.00   176.20 ? 36  DC  I OP1   1 
ATOM   721   O OP2   . DC  A 1 36  ? 6.189   72.288  53.414  1.00   168.80 ? 36  DC  I OP2   1 
ATOM   722   O "O5'" . DC  A 1 36  ? 8.293   73.613  53.407  1.00   174.18 ? 36  DC  I "O5'" 1 
ATOM   723   C "C5'" . DC  A 1 36  ? 9.477   74.087  52.761  1.00   163.97 ? 36  DC  I "C5'" 1 
ATOM   724   C "C4'" . DC  A 1 36  ? 10.314  74.891  53.740  1.00   156.92 ? 36  DC  I "C4'" 1 
ATOM   725   O "O4'" . DC  A 1 36  ? 9.539   75.203  54.901  1.00   172.54 ? 36  DC  I "O4'" 1 
ATOM   726   C "C3'" . DC  A 1 36  ? 11.563  74.195  54.279  1.00   142.71 ? 36  DC  I "C3'" 1 
ATOM   727   O "O3'" . DC  A 1 36  ? 12.710  74.586  53.526  1.00   134.04 ? 36  DC  I "O3'" 1 
ATOM   728   C "C2'" . DC  A 1 36  ? 11.641  74.652  55.755  1.00   151.30 ? 36  DC  I "C2'" 1 
ATOM   729   C "C1'" . DC  A 1 36  ? 10.435  75.582  55.903  1.00   162.51 ? 36  DC  I "C1'" 1 
ATOM   730   N N1    . DC  A 1 36  ? 9.732   75.450  57.203  1.00   164.34 ? 36  DC  I N1    1 
ATOM   731   C C2    . DC  A 1 36  ? 9.334   76.597  57.891  1.00   156.20 ? 36  DC  I C2    1 
ATOM   732   O O2    . DC  A 1 36  ? 9.620   77.704  57.427  1.00   147.07 ? 36  DC  I O2    1 
ATOM   733   N N3    . DC  A 1 36  ? 8.678   76.460  59.069  1.00   163.34 ? 36  DC  I N3    1 
ATOM   734   C C4    . DC  A 1 36  ? 8.396   75.244  59.539  1.00   172.65 ? 36  DC  I C4    1 
ATOM   735   N N4    . DC  A 1 36  ? 7.741   75.158  60.701  1.00   163.05 ? 36  DC  I N4    1 
ATOM   736   C C5    . DC  A 1 36  ? 8.774   74.062  58.837  1.00   179.49 ? 36  DC  I C5    1 
ATOM   737   C C6    . DC  A 1 36  ? 9.427   74.211  57.681  1.00   170.04 ? 36  DC  I C6    1 
ATOM   738   P P     . DT  A 1 37  ? 14.018  73.651  53.479  1.00   180.51 ? 37  DT  I P     1 
ATOM   739   O OP1   . DT  A 1 37  ? 15.121  74.458  52.909  1.00   157.62 ? 37  DT  I OP1   1 
ATOM   740   O OP2   . DT  A 1 37  ? 13.634  72.377  52.832  1.00   197.79 ? 37  DT  I OP2   1 
ATOM   741   O "O5'" . DT  A 1 37  ? 14.336  73.345  55.018  1.00   173.97 ? 37  DT  I "O5'" 1 
ATOM   742   C "C5'" . DT  A 1 37  ? 15.669  73.440  55.510  1.00   171.43 ? 37  DT  I "C5'" 1 
ATOM   743   C "C4'" . DT  A 1 37  ? 15.951  74.834  56.043  1.00   157.20 ? 37  DT  I "C4'" 1 
ATOM   744   O "O4'" . DT  A 1 37  ? 14.768  75.347  56.709  1.00   152.95 ? 37  DT  I "O4'" 1 
ATOM   745   C "C3'" . DT  A 1 37  ? 17.082  74.915  57.064  1.00   140.84 ? 37  DT  I "C3'" 1 
ATOM   746   O "O3'" . DT  A 1 37  ? 17.826  76.111  56.877  1.00   138.68 ? 37  DT  I "O3'" 1 
ATOM   747   C "C2'" . DT  A 1 37  ? 16.340  74.919  58.396  1.00   138.13 ? 37  DT  I "C2'" 1 
ATOM   748   C "C1'" . DT  A 1 37  ? 15.076  75.688  58.044  1.00   156.21 ? 37  DT  I "C1'" 1 
ATOM   749   N N1    . DT  A 1 37  ? 13.911  75.333  58.901  1.00   161.07 ? 37  DT  I N1    1 
ATOM   750   C C2    . DT  A 1 37  ? 13.380  76.282  59.744  1.00   165.63 ? 37  DT  I C2    1 
ATOM   751   O O2    . DT  A 1 37  ? 13.813  77.418  59.829  1.00   161.93 ? 37  DT  I O2    1 
ATOM   752   N N3    . DT  A 1 37  ? 12.314  75.853  60.489  1.00   159.79 ? 37  DT  I N3    1 
ATOM   753   C C4    . DT  A 1 37  ? 11.739  74.596  60.477  1.00   155.70 ? 37  DT  I C4    1 
ATOM   754   O O4    . DT  A 1 37  ? 10.781  74.308  61.186  1.00   142.76 ? 37  DT  I O4    1 
ATOM   755   C C5    . DT  A 1 37  ? 12.344  73.647  59.572  1.00   168.42 ? 37  DT  I C5    1 
ATOM   756   C C7    . DT  A 1 37  ? 11.807  72.250  59.471  1.00   163.99 ? 37  DT  I C7    1 
ATOM   757   C C6    . DT  A 1 37  ? 13.389  74.057  58.837  1.00   158.82 ? 37  DT  I C6    1 
ATOM   758   P P     . DC  A 1 38  ? 19.433  76.072  56.902  1.00   168.88 ? 38  DC  I P     1 
ATOM   759   O OP1   . DC  A 1 38  ? 19.918  77.234  56.125  1.00   150.05 ? 38  DC  I OP1   1 
ATOM   760   O OP2   . DC  A 1 38  ? 19.857  74.704  56.528  1.00   178.47 ? 38  DC  I OP2   1 
ATOM   761   O "O5'" . DC  A 1 38  ? 19.804  76.299  58.442  1.00   165.23 ? 38  DC  I "O5'" 1 
ATOM   762   C "C5'" . DC  A 1 38  ? 20.116  77.605  58.905  1.00   152.56 ? 38  DC  I "C5'" 1 
ATOM   763   C "C4'" . DC  A 1 38  ? 19.779  77.758  60.378  1.00   152.73 ? 38  DC  I "C4'" 1 
ATOM   764   O "O4'" . DC  A 1 38  ? 18.518  77.091  60.666  1.00   134.96 ? 38  DC  I "O4'" 1 
ATOM   765   C "C3'" . DC  A 1 38  ? 20.800  77.161  61.345  1.00   151.86 ? 38  DC  I "C3'" 1 
ATOM   766   O "O3'" . DC  A 1 38  ? 20.909  77.992  62.491  1.00   135.89 ? 38  DC  I "O3'" 1 
ATOM   767   C "C2'" . DC  A 1 38  ? 20.166  75.820  61.697  1.00   155.18 ? 38  DC  I "C2'" 1 
ATOM   768   C "C1'" . DC  A 1 38  ? 18.702  76.217  61.756  1.00   144.24 ? 38  DC  I "C1'" 1 
ATOM   769   N N1    . DC  A 1 38  ? 17.754  75.069  61.626  1.00   158.78 ? 38  DC  I N1    1 
ATOM   770   C C2    . DC  A 1 38  ? 16.412  75.233  61.991  1.00   162.74 ? 38  DC  I C2    1 
ATOM   771   O O2    . DC  A 1 38  ? 16.029  76.332  62.409  1.00   155.29 ? 38  DC  I O2    1 
ATOM   772   N N3    . DC  A 1 38  ? 15.566  74.179  61.871  1.00   161.68 ? 38  DC  I N3    1 
ATOM   773   C C4    . DC  A 1 38  ? 16.016  73.009  61.415  1.00   161.78 ? 38  DC  I C4    1 
ATOM   774   N N4    . DC  A 1 38  ? 15.145  72.000  61.315  1.00   157.69 ? 38  DC  I N4    1 
ATOM   775   C C5    . DC  A 1 38  ? 17.381  72.821  61.044  1.00   157.41 ? 38  DC  I C5    1 
ATOM   776   C C6    . DC  A 1 38  ? 18.206  73.866  61.166  1.00   157.31 ? 38  DC  I C6    1 
ATOM   777   P P     . DA  A 1 39  ? 22.044  79.127  62.579  1.00   155.24 ? 39  DA  I P     1 
ATOM   778   O OP1   . DA  A 1 39  ? 21.872  80.031  61.420  1.00   131.45 ? 39  DA  I OP1   1 
ATOM   779   O OP2   . DA  A 1 39  ? 23.341  78.454  62.808  1.00   179.23 ? 39  DA  I OP2   1 
ATOM   780   O "O5'" . DA  A 1 39  ? 21.665  79.927  63.910  1.00   168.29 ? 39  DA  I "O5'" 1 
ATOM   781   C "C5'" . DA  A 1 39  ? 20.588  80.851  63.892  1.00   157.31 ? 39  DA  I "C5'" 1 
ATOM   782   C "C4'" . DA  A 1 39  ? 19.670  80.634  65.080  1.00   150.49 ? 39  DA  I "C4'" 1 
ATOM   783   O "O4'" . DA  A 1 39  ? 18.994  79.360  64.932  1.00   150.58 ? 39  DA  I "O4'" 1 
ATOM   784   C "C3'" . DA  A 1 39  ? 20.358  80.603  66.444  1.00   164.86 ? 39  DA  I "C3'" 1 
ATOM   785   O "O3'" . DA  A 1 39  ? 19.606  81.355  67.391  1.00   166.60 ? 39  DA  I "O3'" 1 
ATOM   786   C "C2'" . DA  A 1 39  ? 20.387  79.120  66.801  1.00   160.06 ? 39  DA  I "C2'" 1 
ATOM   787   C "C1'" . DA  A 1 39  ? 19.150  78.581  66.097  1.00   153.87 ? 39  DA  I "C1'" 1 
ATOM   788   N N9    . DA  A 1 39  ? 19.295  77.184  65.700  1.00   161.57 ? 39  DA  I N9    1 
ATOM   789   C C8    . DA  A 1 39  ? 20.370  76.616  65.077  1.00   142.48 ? 39  DA  I C8    1 
ATOM   790   N N7    . DA  A 1 39  ? 20.221  75.338  64.824  1.00   143.29 ? 39  DA  I N7    1 
ATOM   791   C C5    . DA  A 1 39  ? 18.945  75.056  65.279  1.00   156.96 ? 39  DA  I C5    1 
ATOM   792   C C6    . DA  A 1 39  ? 18.183  73.872  65.290  1.00   162.67 ? 39  DA  I C6    1 
ATOM   793   N N6    . DA  A 1 39  ? 18.626  72.708  64.805  1.00   170.31 ? 39  DA  I N6    1 
ATOM   794   N N1    . DA  A 1 39  ? 16.944  73.931  65.821  1.00   154.63 ? 39  DA  I N1    1 
ATOM   795   C C2    . DA  A 1 39  ? 16.505  75.099  66.305  1.00   147.35 ? 39  DA  I C2    1 
ATOM   796   N N3    . DA  A 1 39  ? 17.129  76.276  66.351  1.00   145.00 ? 39  DA  I N3    1 
ATOM   797   C C4    . DA  A 1 39  ? 18.356  76.185  65.816  1.00   156.59 ? 39  DA  I C4    1 
ATOM   798   P P     . DA  A 1 40  ? 20.306  81.906  68.730  1.00   139.83 ? 40  DA  I P     1 
ATOM   799   O OP1   . DA  A 1 40  ? 20.432  83.375  68.600  1.00   111.96 ? 40  DA  I OP1   1 
ATOM   800   O OP2   . DA  A 1 40  ? 21.505  81.082  68.995  1.00   138.27 ? 40  DA  I OP2   1 
ATOM   801   O "O5'" . DA  A 1 40  ? 19.250  81.566  69.880  1.00   129.46 ? 40  DA  I "O5'" 1 
ATOM   802   C "C5'" . DA  A 1 40  ? 17.865  81.801  69.666  1.00   141.05 ? 40  DA  I "C5'" 1 
ATOM   803   C "C4'" . DA  A 1 40  ? 17.025  80.787  70.422  1.00   135.84 ? 40  DA  I "C4'" 1 
ATOM   804   O "O4'" . DA  A 1 40  ? 17.128  79.490  69.776  1.00   147.94 ? 40  DA  I "O4'" 1 
ATOM   805   C "C3'" . DA  A 1 40  ? 17.433  80.570  71.880  1.00   132.91 ? 40  DA  I "C3'" 1 
ATOM   806   O "O3'" . DA  A 1 40  ? 16.277  80.471  72.692  1.00   124.25 ? 40  DA  I "O3'" 1 
ATOM   807   C "C2'" . DA  A 1 40  ? 18.199  79.251  71.837  1.00   131.51 ? 40  DA  I "C2'" 1 
ATOM   808   C "C1'" . DA  A 1 40  ? 17.465  78.511  70.732  1.00   150.73 ? 40  DA  I "C1'" 1 
ATOM   809   N N9    . DA  A 1 40  ? 18.277  77.487  70.079  1.00   157.62 ? 40  DA  I N9    1 
ATOM   810   C C8    . DA  A 1 40  ? 19.562  77.615  69.635  1.00   152.12 ? 40  DA  I C8    1 
ATOM   811   N N7    . DA  A 1 40  ? 20.044  76.528  69.081  1.00   143.79 ? 40  DA  I N7    1 
ATOM   812   C C5    . DA  A 1 40  ? 19.002  75.620  69.171  1.00   146.30 ? 40  DA  I C5    1 
ATOM   813   C C6    . DA  A 1 40  ? 18.876  74.278  68.765  1.00   146.92 ? 40  DA  I C6    1 
ATOM   814   N N6    . DA  A 1 40  ? 19.856  73.597  68.161  1.00   151.24 ? 40  DA  I N6    1 
ATOM   815   N N1    . DA  A 1 40  ? 17.700  73.661  69.004  1.00   149.78 ? 40  DA  I N1    1 
ATOM   816   C C2    . DA  A 1 40  ? 16.722  74.346  69.609  1.00   142.65 ? 40  DA  I C2    1 
ATOM   817   N N3    . DA  A 1 40  ? 16.723  75.608  70.034  1.00   140.74 ? 40  DA  I N3    1 
ATOM   818   C C4    . DA  A 1 40  ? 17.904  76.195  69.783  1.00   150.95 ? 40  DA  I C4    1 
ATOM   819   P P     . DT  A 1 41  ? 16.362  80.801  74.262  1.00   128.55 ? 41  DT  I P     1 
ATOM   820   O OP1   . DT  A 1 41  ? 15.366  81.857  74.547  1.00   118.11 ? 41  DT  I OP1   1 
ATOM   821   O OP2   . DT  A 1 41  ? 17.786  81.012  74.607  1.00   113.16 ? 41  DT  I OP2   1 
ATOM   822   O "O5'" . DT  A 1 41  ? 15.894  79.441  74.958  1.00   168.98 ? 41  DT  I "O5'" 1 
ATOM   823   C "C5'" . DT  A 1 41  ? 14.698  78.801  74.531  1.00   156.54 ? 41  DT  I "C5'" 1 
ATOM   824   C "C4'" . DT  A 1 41  ? 14.702  77.339  74.934  1.00   155.12 ? 41  DT  I "C4'" 1 
ATOM   825   O "O4'" . DT  A 1 41  ? 15.541  76.584  74.021  1.00   160.55 ? 41  DT  I "O4'" 1 
ATOM   826   C "C3'" . DT  A 1 41  ? 15.238  77.063  76.341  1.00   156.41 ? 41  DT  I "C3'" 1 
ATOM   827   O "O3'" . DT  A 1 41  ? 14.359  76.192  77.033  1.00   160.35 ? 41  DT  I "O3'" 1 
ATOM   828   C "C2'" . DT  A 1 41  ? 16.599  76.412  76.091  1.00   150.73 ? 41  DT  I "C2'" 1 
ATOM   829   C "C1'" . DT  A 1 41  ? 16.373  75.721  74.757  1.00   160.62 ? 41  DT  I "C1'" 1 
ATOM   830   N N1    . DT  A 1 41  ? 17.629  75.493  73.981  1.00   156.17 ? 41  DT  I N1    1 
ATOM   831   C C2    . DT  A 1 41  ? 17.766  74.337  73.248  1.00   144.08 ? 41  DT  I C2    1 
ATOM   832   O O2    . DT  A 1 41  ? 16.907  73.476  73.192  1.00   140.01 ? 41  DT  I O2    1 
ATOM   833   N N3    . DT  A 1 41  ? 18.953  74.223  72.575  1.00   155.50 ? 41  DT  I N3    1 
ATOM   834   C C4    . DT  A 1 41  ? 19.998  75.130  72.563  1.00   164.85 ? 41  DT  I C4    1 
ATOM   835   O O4    . DT  A 1 41  ? 21.028  74.936  71.925  1.00   154.79 ? 41  DT  I O4    1 
ATOM   836   C C5    . DT  A 1 41  ? 19.790  76.320  73.353  1.00   169.54 ? 41  DT  I C5    1 
ATOM   837   C C7    . DT  A 1 41  ? 20.854  77.376  73.418  1.00   164.77 ? 41  DT  I C7    1 
ATOM   838   C C6    . DT  A 1 41  ? 18.630  76.442  74.017  1.00   160.31 ? 41  DT  I C6    1 
ATOM   839   P P     . DT  A 1 42  ? 14.195  76.311  78.627  1.00   171.85 ? 42  DT  I P     1 
ATOM   840   O OP1   . DT  A 1 42  ? 12.806  76.740  78.904  1.00   161.42 ? 42  DT  I OP1   1 
ATOM   841   O OP2   . DT  A 1 42  ? 15.329  77.114  79.137  1.00   157.55 ? 42  DT  I OP2   1 
ATOM   842   O "O5'" . DT  A 1 42  ? 14.383  74.809  79.140  1.00   176.75 ? 42  DT  I "O5'" 1 
ATOM   843   C "C5'" . DT  A 1 42  ? 13.529  73.784  78.651  1.00   172.22 ? 42  DT  I "C5'" 1 
ATOM   844   C "C4'" . DT  A 1 42  ? 14.224  72.434  78.690  1.00   179.22 ? 42  DT  I "C4'" 1 
ATOM   845   O "O4'" . DT  A 1 42  ? 15.291  72.406  77.710  1.00   169.53 ? 42  DT  I "O4'" 1 
ATOM   846   C "C3'" . DT  A 1 42  ? 14.864  72.072  80.035  1.00   186.42 ? 42  DT  I "C3'" 1 
ATOM   847   O "O3'" . DT  A 1 42  ? 14.364  70.819  80.487  1.00   191.41 ? 42  DT  I "O3'" 1 
ATOM   848   C "C2'" . DT  A 1 42  ? 16.366  72.009  79.732  1.00   156.73 ? 42  DT  I "C2'" 1 
ATOM   849   C "C1'" . DT  A 1 42  ? 16.378  71.699  78.245  1.00   162.57 ? 42  DT  I "C1'" 1 
ATOM   850   N N1    . DT  A 1 42  ? 17.621  72.146  77.553  1.00   164.52 ? 42  DT  I N1    1 
ATOM   851   C C2    . DT  A 1 42  ? 18.255  71.286  76.686  1.00   170.92 ? 42  DT  I C2    1 
ATOM   852   O O2    . DT  A 1 42  ? 17.850  70.163  76.443  1.00   166.91 ? 42  DT  I O2    1 
ATOM   853   N N3    . DT  A 1 42  ? 19.388  71.792  76.105  1.00   174.69 ? 42  DT  I N3    1 
ATOM   854   C C4    . DT  A 1 42  ? 19.940  73.044  76.302  1.00   175.02 ? 42  DT  I C4    1 
ATOM   855   O O4    . DT  A 1 42  ? 20.965  73.407  75.732  1.00   172.83 ? 42  DT  I O4    1 
ATOM   856   C C5    . DT  A 1 42  ? 19.227  73.896  77.225  1.00   176.29 ? 42  DT  I C5    1 
ATOM   857   C C7    . DT  A 1 42  ? 19.731  75.278  77.520  1.00   172.69 ? 42  DT  I C7    1 
ATOM   858   C C6    . DT  A 1 42  ? 18.115  73.410  77.800  1.00   170.59 ? 42  DT  I C6    1 
ATOM   859   P P     . DG  A 1 43  ? 14.782  70.251  81.931  1.00   175.79 ? 43  DG  I P     1 
ATOM   860   O OP1   . DG  A 1 43  ? 13.703  69.347  82.386  1.00   177.71 ? 43  DG  I OP1   1 
ATOM   861   O OP2   . DG  A 1 43  ? 15.185  71.400  82.772  1.00   148.26 ? 43  DG  I OP2   1 
ATOM   862   O "O5'" . DG  A 1 43  ? 16.091  69.383  81.633  1.00   174.64 ? 43  DG  I "O5'" 1 
ATOM   863   C "C5'" . DG  A 1 43  ? 16.072  68.405  80.601  1.00   177.14 ? 43  DG  I "C5'" 1 
ATOM   864   C "C4'" . DG  A 1 43  ? 17.426  67.734  80.473  1.00   172.66 ? 43  DG  I "C4'" 1 
ATOM   865   O "O4'" . DG  A 1 43  ? 18.314  68.570  79.686  1.00   168.14 ? 43  DG  I "O4'" 1 
ATOM   866   C "C3'" . DG  A 1 43  ? 18.144  67.478  81.802  1.00   182.29 ? 43  DG  I "C3'" 1 
ATOM   867   O "O3'" . DG  A 1 43  ? 18.612  66.137  81.853  1.00   192.00 ? 43  DG  I "O3'" 1 
ATOM   868   C "C2'" . DG  A 1 43  ? 19.300  68.480  81.788  1.00   172.63 ? 43  DG  I "C2'" 1 
ATOM   869   C "C1'" . DG  A 1 43  ? 19.578  68.601  80.301  1.00   175.04 ? 43  DG  I "C1'" 1 
ATOM   870   N N9    . DG  A 1 43  ? 20.248  69.844  79.931  1.00   168.76 ? 43  DG  I N9    1 
ATOM   871   C C8    . DG  A 1 43  ? 19.968  71.106  80.395  1.00   173.76 ? 43  DG  I C8    1 
ATOM   872   N N7    . DG  A 1 43  ? 20.736  72.029  79.887  1.00   168.09 ? 43  DG  I N7    1 
ATOM   873   C C5    . DG  A 1 43  ? 21.580  71.335  79.030  1.00   163.74 ? 43  DG  I C5    1 
ATOM   874   C C6    . DG  A 1 43  ? 22.626  71.806  78.200  1.00   168.38 ? 43  DG  I C6    1 
ATOM   875   O O6    . DG  A 1 43  ? 23.026  72.970  78.054  1.00   164.94 ? 43  DG  I O6    1 
ATOM   876   N N1    . DG  A 1 43  ? 23.230  70.768  77.494  1.00   166.04 ? 43  DG  I N1    1 
ATOM   877   C C2    . DG  A 1 43  ? 22.869  69.445  77.579  1.00   161.74 ? 43  DG  I C2    1 
ATOM   878   N N2    . DG  A 1 43  ? 23.568  68.588  76.821  1.00   164.29 ? 43  DG  I N2    1 
ATOM   879   N N3    . DG  A 1 43  ? 21.891  68.991  78.352  1.00   157.40 ? 43  DG  I N3    1 
ATOM   880   C C4    . DG  A 1 43  ? 21.293  69.988  79.046  1.00   159.47 ? 43  DG  I C4    1 
ATOM   881   P P     . DG  A 1 44  ? 18.378  65.250  83.173  1.00   189.46 ? 44  DG  I P     1 
ATOM   882   O OP1   . DG  A 1 44  ? 17.824  63.947  82.745  1.00   193.86 ? 44  DG  I OP1   1 
ATOM   883   O OP2   . DG  A 1 44  ? 17.636  66.083  84.145  1.00   152.48 ? 44  DG  I OP2   1 
ATOM   884   O "O5'" . DG  A 1 44  ? 19.853  65.022  83.752  1.00   173.90 ? 44  DG  I "O5'" 1 
ATOM   885   C "C5'" . DG  A 1 44  ? 20.659  66.140  84.104  1.00   161.34 ? 44  DG  I "C5'" 1 
ATOM   886   C "C4'" . DG  A 1 44  ? 22.018  66.055  83.435  1.00   174.04 ? 44  DG  I "C4'" 1 
ATOM   887   O "O4'" . DG  A 1 44  ? 22.260  67.255  82.672  1.00   181.93 ? 44  DG  I "O4'" 1 
ATOM   888   C "C3'" . DG  A 1 44  ? 23.198  65.923  84.404  1.00   178.16 ? 44  DG  I "C3'" 1 
ATOM   889   O "O3'" . DG  A 1 44  ? 23.812  64.647  84.249  1.00   191.82 ? 44  DG  I "O3'" 1 
ATOM   890   C "C2'" . DG  A 1 44  ? 24.151  67.071  84.023  1.00   180.17 ? 44  DG  I "C2'" 1 
ATOM   891   C "C1'" . DG  A 1 44  ? 23.639  67.506  82.658  1.00   180.66 ? 44  DG  I "C1'" 1 
ATOM   892   N N9    . DG  A 1 44  ? 23.847  68.926  82.384  1.00   182.85 ? 44  DG  I N9    1 
ATOM   893   C C8    . DG  A 1 44  ? 23.361  69.987  83.109  1.00   172.89 ? 44  DG  I C8    1 
ATOM   894   N N7    . DG  A 1 44  ? 23.716  71.148  82.633  1.00   167.66 ? 44  DG  I N7    1 
ATOM   895   C C5    . DG  A 1 44  ? 24.501  70.838  81.529  1.00   173.09 ? 44  DG  I C5    1 
ATOM   896   C C6    . DG  A 1 44  ? 25.167  71.691  80.617  1.00   174.50 ? 44  DG  I C6    1 
ATOM   897   O O6    . DG  A 1 44  ? 25.197  72.930  80.605  1.00   173.90 ? 44  DG  I O6    1 
ATOM   898   N N1    . DG  A 1 44  ? 25.852  70.968  79.643  1.00   172.71 ? 44  DG  I N1    1 
ATOM   899   C C2    . DG  A 1 44  ? 25.887  69.596  79.561  1.00   171.61 ? 44  DG  I C2    1 
ATOM   900   N N2    . DG  A 1 44  ? 26.601  69.080  78.550  1.00   174.95 ? 44  DG  I N2    1 
ATOM   901   N N3    . DG  A 1 44  ? 25.267  68.785  80.409  1.00   165.75 ? 44  DG  I N3    1 
ATOM   902   C C4    . DG  A 1 44  ? 24.595  69.474  81.364  1.00   170.76 ? 44  DG  I C4    1 
ATOM   903   P P     . DT  A 1 45  ? 25.088  64.242  85.138  1.00   194.93 ? 45  DT  I P     1 
ATOM   904   O OP1   . DT  A 1 45  ? 25.030  62.780  85.359  1.00   206.26 ? 45  DT  I OP1   1 
ATOM   905   O OP2   . DT  A 1 45  ? 25.156  65.153  86.302  1.00   158.28 ? 45  DT  I OP2   1 
ATOM   906   O "O5'" . DT  A 1 45  ? 26.327  64.566  84.183  1.00   159.05 ? 45  DT  I "O5'" 1 
ATOM   907   C "C5'" . DT  A 1 45  ? 27.652  64.336  84.633  1.00   167.65 ? 45  DT  I "C5'" 1 
ATOM   908   C "C4'" . DT  A 1 45  ? 28.653  64.774  83.583  1.00   153.46 ? 45  DT  I "C4'" 1 
ATOM   909   O "O4'" . DT  A 1 45  ? 28.075  65.840  82.789  1.00   154.60 ? 45  DT  I "O4'" 1 
ATOM   910   C "C3'" . DT  A 1 45  ? 29.947  65.344  84.137  1.00   157.71 ? 45  DT  I "C3'" 1 
ATOM   911   O "O3'" . DT  A 1 45  ? 30.887  64.298  84.351  1.00   174.50 ? 45  DT  I "O3'" 1 
ATOM   912   C "C2'" . DT  A 1 45  ? 30.392  66.281  83.020  1.00   153.20 ? 45  DT  I "C2'" 1 
ATOM   913   C "C1'" . DT  A 1 45  ? 29.058  66.819  82.503  1.00   159.90 ? 45  DT  I "C1'" 1 
ATOM   914   N N1    . DT  A 1 45  ? 28.641  68.117  83.129  1.00   168.49 ? 45  DT  I N1    1 
ATOM   915   C C2    . DT  A 1 45  ? 29.116  69.297  82.607  1.00   160.61 ? 45  DT  I C2    1 
ATOM   916   O O2    . DT  A 1 45  ? 29.873  69.350  81.653  1.00   145.79 ? 45  DT  I O2    1 
ATOM   917   N N3    . DT  A 1 45  ? 28.673  70.426  83.247  1.00   160.87 ? 45  DT  I N3    1 
ATOM   918   C C4    . DT  A 1 45  ? 27.819  70.491  84.333  1.00   148.49 ? 45  DT  I C4    1 
ATOM   919   O O4    . DT  A 1 45  ? 27.478  71.556  84.838  1.00   135.38 ? 45  DT  I O4    1 
ATOM   920   C C5    . DT  A 1 45  ? 27.355  69.217  84.830  1.00   156.06 ? 45  DT  I C5    1 
ATOM   921   C C7    . DT  A 1 45  ? 26.423  69.161  86.005  1.00   127.69 ? 45  DT  I C7    1 
ATOM   922   C C6    . DT  A 1 45  ? 27.781  68.106  84.210  1.00   172.41 ? 45  DT  I C6    1 
ATOM   923   P P     . DC  A 1 46  ? 32.151  64.533  85.313  1.00   188.36 ? 46  DC  I P     1 
ATOM   924   O OP1   . DC  A 1 46  ? 32.423  63.262  86.021  1.00   177.78 ? 46  DC  I OP1   1 
ATOM   925   O OP2   . DC  A 1 46  ? 31.897  65.764  86.094  1.00   177.31 ? 46  DC  I OP2   1 
ATOM   926   O "O5'" . DC  A 1 46  ? 33.353  64.823  84.298  1.00   166.14 ? 46  DC  I "O5'" 1 
ATOM   927   C "C5'" . DC  A 1 46  ? 34.396  65.717  84.664  1.00   161.05 ? 46  DC  I "C5'" 1 
ATOM   928   C "C4'" . DC  A 1 46  ? 34.246  67.039  83.934  1.00   143.50 ? 46  DC  I "C4'" 1 
ATOM   929   O "O4'" . DC  A 1 46  ? 32.991  67.639  84.283  1.00   171.55 ? 46  DC  I "O4'" 1 
ATOM   930   C "C3'" . DC  A 1 46  ? 35.293  68.087  84.284  1.00   126.14 ? 46  DC  I "C3'" 1 
ATOM   931   O "O3'" . DC  A 1 46  ? 36.356  68.033  83.342  1.00   129.98 ? 46  DC  I "O3'" 1 
ATOM   932   C "C2'" . DC  A 1 46  ? 34.532  69.425  84.202  1.00   153.95 ? 46  DC  I "C2'" 1 
ATOM   933   C "C1'" . DC  A 1 46  ? 33.066  69.015  84.018  1.00   165.88 ? 46  DC  I "C1'" 1 
ATOM   934   N N1    . DC  A 1 46  ? 32.118  69.723  84.934  1.00   165.39 ? 46  DC  I N1    1 
ATOM   935   C C2    . DC  A 1 46  ? 31.756  71.050  84.672  1.00   148.41 ? 46  DC  I C2    1 
ATOM   936   O O2    . DC  A 1 46  ? 32.233  71.623  83.684  1.00   130.32 ? 46  DC  I O2    1 
ATOM   937   N N3    . DC  A 1 46  ? 30.892  71.672  85.513  1.00   151.25 ? 46  DC  I N3    1 
ATOM   938   C C4    . DC  A 1 46  ? 30.398  71.020  86.567  1.00   147.94 ? 46  DC  I C4    1 
ATOM   939   N N4    . DC  A 1 46  ? 29.550  71.675  87.367  1.00   129.87 ? 46  DC  I N4    1 
ATOM   940   C C5    . DC  A 1 46  ? 30.753  69.668  86.849  1.00   155.72 ? 46  DC  I C5    1 
ATOM   941   C C6    . DC  A 1 46  ? 31.605  69.064  86.014  1.00   163.62 ? 46  DC  I C6    1 
ATOM   942   P P     . DG  A 1 47  ? 37.879  68.202  83.827  1.00   154.18 ? 47  DG  I P     1 
ATOM   943   O OP1   . DG  A 1 47  ? 38.753  67.760  82.718  1.00   161.12 ? 47  DG  I OP1   1 
ATOM   944   O OP2   . DG  A 1 47  ? 38.004  67.576  85.162  1.00   152.27 ? 47  DG  I OP2   1 
ATOM   945   O "O5'" . DG  A 1 47  ? 38.048  69.780  84.009  1.00   154.00 ? 47  DG  I "O5'" 1 
ATOM   946   C "C5'" . DG  A 1 47  ? 37.837  70.648  82.903  1.00   159.17 ? 47  DG  I "C5'" 1 
ATOM   947   C "C4'" . DG  A 1 47  ? 37.813  72.096  83.354  1.00   149.15 ? 47  DG  I "C4'" 1 
ATOM   948   O "O4'" . DG  A 1 47  ? 36.524  72.402  83.956  1.00   149.79 ? 47  DG  I "O4'" 1 
ATOM   949   C "C3'" . DG  A 1 47  ? 38.868  72.461  84.402  1.00   142.14 ? 47  DG  I "C3'" 1 
ATOM   950   O "O3'" . DG  A 1 47  ? 39.422  73.734  84.105  1.00   146.30 ? 47  DG  I "O3'" 1 
ATOM   951   C "C2'" . DG  A 1 47  ? 38.060  72.496  85.695  1.00   138.09 ? 47  DG  I "C2'" 1 
ATOM   952   C "C1'" . DG  A 1 47  ? 36.737  73.041  85.192  1.00   153.13 ? 47  DG  I "C1'" 1 
ATOM   953   N N9    . DG  A 1 47  ? 35.610  72.756  86.077  1.00   136.49 ? 47  DG  I N9    1 
ATOM   954   C C8    . DG  A 1 47  ? 35.331  71.568  86.708  1.00   121.97 ? 47  DG  I C8    1 
ATOM   955   N N7    . DG  A 1 47  ? 34.254  71.611  87.442  1.00   122.88 ? 47  DG  I N7    1 
ATOM   956   C C5    . DG  A 1 47  ? 33.791  72.912  87.292  1.00   139.76 ? 47  DG  I C5    1 
ATOM   957   C C6    . DG  A 1 47  ? 32.656  73.547  87.852  1.00   142.31 ? 47  DG  I C6    1 
ATOM   958   O O6    . DG  A 1 47  ? 31.808  73.069  88.618  1.00   147.70 ? 47  DG  I O6    1 
ATOM   959   N N1    . DG  A 1 47  ? 32.553  74.874  87.442  1.00   143.59 ? 47  DG  I N1    1 
ATOM   960   C C2    . DG  A 1 47  ? 33.435  75.507  86.597  1.00   157.30 ? 47  DG  I C2    1 
ATOM   961   N N2    . DG  A 1 47  ? 33.171  76.791  86.315  1.00   156.87 ? 47  DG  I N2    1 
ATOM   962   N N3    . DG  A 1 47  ? 34.502  74.923  86.066  1.00   152.76 ? 47  DG  I N3    1 
ATOM   963   C C4    . DG  A 1 47  ? 34.616  73.630  86.456  1.00   143.22 ? 47  DG  I C4    1 
ATOM   964   P P     . DT  A 1 48  ? 40.843  74.173  84.716  1.00   130.86 ? 48  DT  I P     1 
ATOM   965   O OP1   . DT  A 1 48  ? 41.867  73.947  83.672  1.00   137.55 ? 48  DT  I OP1   1 
ATOM   966   O OP2   . DT  A 1 48  ? 40.996  73.551  86.050  1.00   123.82 ? 48  DT  I OP2   1 
ATOM   967   O "O5'" . DT  A 1 48  ? 40.679  75.746  84.936  1.00   144.37 ? 48  DT  I "O5'" 1 
ATOM   968   C "C5'" . DT  A 1 48  ? 39.915  76.506  84.013  1.00   137.67 ? 48  DT  I "C5'" 1 
ATOM   969   C "C4'" . DT  A 1 48  ? 38.986  77.457  84.742  1.00   127.61 ? 48  DT  I "C4'" 1 
ATOM   970   O "O4'" . DT  A 1 48  ? 38.017  76.707  85.526  1.00   124.39 ? 48  DT  I "O4'" 1 
ATOM   971   C "C3'" . DT  A 1 48  ? 39.676  78.423  85.710  1.00   143.14 ? 48  DT  I "C3'" 1 
ATOM   972   O "O3'" . DT  A 1 48  ? 39.215  79.747  85.488  1.00   157.46 ? 48  DT  I "O3'" 1 
ATOM   973   C "C2'" . DT  A 1 48  ? 39.238  77.926  87.085  1.00   130.62 ? 48  DT  I "C2'" 1 
ATOM   974   C "C1'" . DT  A 1 48  ? 37.879  77.319  86.785  1.00   137.16 ? 48  DT  I "C1'" 1 
ATOM   975   N N1    . DT  A 1 48  ? 37.426  76.321  87.804  1.00   140.60 ? 48  DT  I N1    1 
ATOM   976   C C2    . DT  A 1 48  ? 36.331  76.620  88.581  1.00   138.09 ? 48  DT  I C2    1 
ATOM   977   O O2    . DT  A 1 48  ? 35.674  77.636  88.442  1.00   149.47 ? 48  DT  I O2    1 
ATOM   978   N N3    . DT  A 1 48  ? 35.999  75.663  89.500  1.00   128.37 ? 48  DT  I N3    1 
ATOM   979   C C4    . DT  A 1 48  ? 36.657  74.474  89.741  1.00   140.93 ? 48  DT  I C4    1 
ATOM   980   O O4    . DT  A 1 48  ? 36.283  73.680  90.598  1.00   142.49 ? 48  DT  I O4    1 
ATOM   981   C C5    . DT  A 1 48  ? 37.816  74.231  88.915  1.00   149.94 ? 48  DT  I C5    1 
ATOM   982   C C7    . DT  A 1 48  ? 38.612  72.971  89.092  1.00   145.41 ? 48  DT  I C7    1 
ATOM   983   C C6    . DT  A 1 48  ? 38.149  75.161  88.002  1.00   148.21 ? 48  DT  I C6    1 
ATOM   984   P P     . DA  A 1 49  ? 40.012  80.759  84.528  1.00   158.84 ? 49  DA  I P     1 
ATOM   985   O OP1   . DA  A 1 49  ? 39.608  80.489  83.130  1.00   150.96 ? 49  DA  I OP1   1 
ATOM   986   O OP2   . DA  A 1 49  ? 41.442  80.706  84.905  1.00   129.40 ? 49  DA  I OP2   1 
ATOM   987   O "O5'" . DA  A 1 49  ? 39.450  82.189  84.970  1.00   146.75 ? 49  DA  I "O5'" 1 
ATOM   988   C "C5'" . DA  A 1 49  ? 38.090  82.515  84.715  1.00   135.19 ? 49  DA  I "C5'" 1 
ATOM   989   C "C4'" . DA  A 1 49  ? 37.391  82.924  86.002  1.00   130.01 ? 49  DA  I "C4'" 1 
ATOM   990   O "O4'" . DA  A 1 49  ? 37.300  81.781  86.897  1.00   126.56 ? 49  DA  I "O4'" 1 
ATOM   991   C "C3'" . DA  A 1 49  ? 38.109  84.022  86.805  1.00   158.14 ? 49  DA  I "C3'" 1 
ATOM   992   O "O3'" . DA  A 1 49  ? 37.158  84.897  87.395  1.00   155.44 ? 49  DA  I "O3'" 1 
ATOM   993   C "C2'" . DA  A 1 49  ? 38.790  83.210  87.898  1.00   147.11 ? 49  DA  I "C2'" 1 
ATOM   994   C "C1'" . DA  A 1 49  ? 37.685  82.209  88.177  1.00   143.67 ? 49  DA  I "C1'" 1 
ATOM   995   N N9    . DA  A 1 49  ? 38.096  81.068  88.988  1.00   136.34 ? 49  DA  I N9    1 
ATOM   996   C C8    . DA  A 1 49  ? 39.330  80.486  89.037  1.00   144.51 ? 49  DA  I C8    1 
ATOM   997   N N7    . DA  A 1 49  ? 39.396  79.457  89.852  1.00   147.04 ? 49  DA  I N7    1 
ATOM   998   C C5    . DA  A 1 49  ? 38.105  79.335  90.339  1.00   141.02 ? 49  DA  I C5    1 
ATOM   999   C C6    . DA  A 1 49  ? 37.509  78.428  91.241  1.00   145.85 ? 49  DA  I C6    1 
ATOM   1000  N N6    . DA  A 1 49  ? 38.175  77.430  91.830  1.00   142.23 ? 49  DA  I N6    1 
ATOM   1001  N N1    . DA  A 1 49  ? 36.197  78.590  91.513  1.00   145.40 ? 49  DA  I N1    1 
ATOM   1002  C C2    . DA  A 1 49  ? 35.532  79.588  90.920  1.00   133.21 ? 49  DA  I C2    1 
ATOM   1003  N N3    . DA  A 1 49  ? 35.984  80.500  90.061  1.00   134.23 ? 49  DA  I N3    1 
ATOM   1004  C C4    . DA  A 1 49  ? 37.290  80.314  89.810  1.00   132.53 ? 49  DA  I C4    1 
ATOM   1005  P P     . DG  A 1 50  ? 36.649  86.233  86.663  1.00   132.53 ? 50  DG  I P     1 
ATOM   1006  O OP1   . DG  A 1 50  ? 36.205  85.877  85.296  1.00   99.66  ? 50  DG  I OP1   1 
ATOM   1007  O OP2   . DG  A 1 50  ? 37.677  87.279  86.861  1.00   138.66 ? 50  DG  I OP2   1 
ATOM   1008  O "O5'" . DG  A 1 50  ? 35.366  86.618  87.538  1.00   123.81 ? 50  DG  I "O5'" 1 
ATOM   1009  C "C5'" . DG  A 1 50  ? 34.223  85.786  87.493  1.00   142.38 ? 50  DG  I "C5'" 1 
ATOM   1010  C "C4'" . DG  A 1 50  ? 33.754  85.457  88.901  1.00   145.20 ? 50  DG  I "C4'" 1 
ATOM   1011  O "O4'" . DG  A 1 50  ? 34.620  84.429  89.449  1.00   131.98 ? 50  DG  I "O4'" 1 
ATOM   1012  C "C3'" . DG  A 1 50  ? 33.812  86.623  89.897  1.00   145.03 ? 50  DG  I "C3'" 1 
ATOM   1013  O "O3'" . DG  A 1 50  ? 32.539  86.805  90.509  1.00   141.97 ? 50  DG  I "O3'" 1 
ATOM   1014  C "C2'" . DG  A 1 50  ? 34.889  86.214  90.905  1.00   138.77 ? 50  DG  I "C2'" 1 
ATOM   1015  C "C1'" . DG  A 1 50  ? 34.881  84.701  90.804  1.00   137.19 ? 50  DG  I "C1'" 1 
ATOM   1016  N N9    . DG  A 1 50  ? 36.187  84.135  91.126  1.00   148.95 ? 50  DG  I N9    1 
ATOM   1017  C C8    . DG  A 1 50  ? 37.393  84.512  90.592  1.00   145.90 ? 50  DG  I C8    1 
ATOM   1018  N N7    . DG  A 1 50  ? 38.404  83.827  91.047  1.00   149.89 ? 50  DG  I N7    1 
ATOM   1019  C C5    . DG  A 1 50  ? 37.832  82.922  91.927  1.00   153.26 ? 50  DG  I C5    1 
ATOM   1020  C C6    . DG  A 1 50  ? 38.437  81.916  92.716  1.00   149.24 ? 50  DG  I C6    1 
ATOM   1021  O O6    . DG  A 1 50  ? 39.638  81.622  92.795  1.00   150.10 ? 50  DG  I O6    1 
ATOM   1022  N N1    . DG  A 1 50  ? 37.498  81.221  93.473  1.00   138.58 ? 50  DG  I N1    1 
ATOM   1023  C C2    . DG  A 1 50  ? 36.145  81.467  93.467  1.00   140.80 ? 50  DG  I C2    1 
ATOM   1024  N N2    . DG  A 1 50  ? 35.398  80.688  94.261  1.00   157.36 ? 50  DG  I N2    1 
ATOM   1025  N N3    . DG  A 1 50  ? 35.563  82.405  92.728  1.00   140.19 ? 50  DG  I N3    1 
ATOM   1026  C C4    . DG  A 1 50  ? 36.465  83.092  91.986  1.00   148.99 ? 50  DG  I C4    1 
ATOM   1027  P P     . DA  A 1 51  ? 32.251  88.086  91.438  1.00   161.51 ? 51  DA  I P     1 
ATOM   1028  O OP1   . DA  A 1 51  ? 30.997  88.704  90.952  1.00   173.83 ? 51  DA  I OP1   1 
ATOM   1029  O OP2   . DA  A 1 51  ? 33.481  88.904  91.522  1.00   131.27 ? 51  DA  I OP2   1 
ATOM   1030  O "O5'" . DA  A 1 51  ? 31.980  87.452  92.880  1.00   130.22 ? 51  DA  I "O5'" 1 
ATOM   1031  C "C5'" . DA  A 1 51  ? 30.947  86.489  93.046  1.00   126.46 ? 51  DA  I "C5'" 1 
ATOM   1032  C "C4'" . DA  A 1 51  ? 31.070  85.788  94.387  1.00   139.63 ? 51  DA  I "C4'" 1 
ATOM   1033  O "O4'" . DA  A 1 51  ? 32.285  84.992  94.408  1.00   138.98 ? 51  DA  I "O4'" 1 
ATOM   1034  C "C3'" . DA  A 1 51  ? 31.147  86.720  95.598  1.00   140.96 ? 51  DA  I "C3'" 1 
ATOM   1035  O "O3'" . DA  A 1 51  ? 30.349  86.211  96.658  1.00   138.53 ? 51  DA  I "O3'" 1 
ATOM   1036  C "C2'" . DA  A 1 51  ? 32.630  86.709  95.958  1.00   135.49 ? 51  DA  I "C2'" 1 
ATOM   1037  C "C1'" . DA  A 1 51  ? 33.033  85.297  95.563  1.00   138.66 ? 51  DA  I "C1'" 1 
ATOM   1038  N N9    . DA  A 1 51  ? 34.452  85.172  95.245  1.00   147.32 ? 51  DA  I N9    1 
ATOM   1039  C C8    . DA  A 1 51  ? 35.184  85.977  94.417  1.00   145.00 ? 51  DA  I C8    1 
ATOM   1040  N N7    . DA  A 1 51  ? 36.446  85.632  94.321  1.00   141.44 ? 51  DA  I N7    1 
ATOM   1041  C C5    . DA  A 1 51  ? 36.550  84.522  95.144  1.00   145.85 ? 51  DA  I C5    1 
ATOM   1042  C C6    . DA  A 1 51  ? 37.634  83.687  95.478  1.00   144.30 ? 51  DA  I C6    1 
ATOM   1043  N N6    . DA  A 1 51  ? 38.870  83.857  94.995  1.00   127.31 ? 51  DA  I N6    1 
ATOM   1044  N N1    . DA  A 1 51  ? 37.398  82.667  96.330  1.00   146.65 ? 51  DA  I N1    1 
ATOM   1045  C C2    . DA  A 1 51  ? 36.161  82.502  96.813  1.00   139.52 ? 51  DA  I C2    1 
ATOM   1046  N N3    . DA  A 1 51  ? 35.065  83.221  96.573  1.00   139.65 ? 51  DA  I N3    1 
ATOM   1047  C C4    . DA  A 1 51  ? 35.330  84.226  95.723  1.00   145.34 ? 51  DA  I C4    1 
ATOM   1048  P P     . DC  A 1 52  ? 30.144  87.075  97.997  1.00   142.94 ? 52  DC  I P     1 
ATOM   1049  O OP1   . DC  A 1 52  ? 28.867  86.658  98.616  1.00   132.91 ? 52  DC  I OP1   1 
ATOM   1050  O OP2   . DC  A 1 52  ? 30.364  88.498  97.653  1.00   157.66 ? 52  DC  I OP2   1 
ATOM   1051  O "O5'" . DC  A 1 52  ? 31.352  86.614  98.937  1.00   140.94 ? 52  DC  I "O5'" 1 
ATOM   1052  C "C5'" . DC  A 1 52  ? 31.533  85.237  99.236  1.00   128.46 ? 52  DC  I "C5'" 1 
ATOM   1053  C "C4'" . DC  A 1 52  ? 32.750  85.035  100.119 1.00   136.48 ? 52  DC  I "C4'" 1 
ATOM   1054  O "O4'" . DC  A 1 52  ? 33.943  84.949  99.298  1.00   137.87 ? 52  DC  I "O4'" 1 
ATOM   1055  C "C3'" . DC  A 1 52  ? 33.005  86.157  101.132 1.00   142.81 ? 52  DC  I "C3'" 1 
ATOM   1056  O "O3'" . DC  A 1 52  ? 33.178  85.610  102.429 1.00   143.32 ? 52  DC  I "O3'" 1 
ATOM   1057  C "C2'" . DC  A 1 52  ? 34.288  86.822  100.625 1.00   134.38 ? 52  DC  I "C2'" 1 
ATOM   1058  C "C1'" . DC  A 1 52  ? 34.976  85.666  99.923  1.00   133.43 ? 52  DC  I "C1'" 1 
ATOM   1059  N N1    . DC  A 1 52  ? 35.955  86.096  98.884  1.00   137.01 ? 52  DC  I N1    1 
ATOM   1060  C C2    . DC  A 1 52  ? 37.178  85.427  98.767  1.00   140.93 ? 52  DC  I C2    1 
ATOM   1061  O O2    . DC  A 1 52  ? 37.424  84.482  99.527  1.00   131.56 ? 52  DC  I O2    1 
ATOM   1062  N N3    . DC  A 1 52  ? 38.059  85.832  97.819  1.00   131.14 ? 52  DC  I N3    1 
ATOM   1063  C C4    . DC  A 1 52  ? 37.756  86.856  97.019  1.00   132.66 ? 52  DC  I C4    1 
ATOM   1064  N N4    . DC  A 1 52  ? 38.656  87.218  96.100  1.00   141.32 ? 52  DC  I N4    1 
ATOM   1065  C C5    . DC  A 1 52  ? 36.515  87.551  97.125  1.00   118.62 ? 52  DC  I C5    1 
ATOM   1066  C C6    . DC  A 1 52  ? 35.654  87.143  98.063  1.00   121.16 ? 52  DC  I C6    1 
ATOM   1067  P P     . DA  A 1 53  ? 32.810  86.478  103.730 1.00   155.23 ? 53  DA  I P     1 
ATOM   1068  O OP1   . DA  A 1 53  ? 31.563  85.924  104.300 1.00   156.63 ? 53  DA  I OP1   1 
ATOM   1069  O OP2   . DA  A 1 53  ? 32.874  87.908  103.354 1.00   135.55 ? 53  DA  I OP2   1 
ATOM   1070  O "O5'" . DA  A 1 53  ? 34.018  86.183  104.735 1.00   169.46 ? 53  DA  I "O5'" 1 
ATOM   1071  C "C5'" . DA  A 1 53  ? 34.382  84.840  105.033 1.00   158.05 ? 53  DA  I "C5'" 1 
ATOM   1072  C "C4'" . DA  A 1 53  ? 35.868  84.735  105.325 1.00   162.80 ? 53  DA  I "C4'" 1 
ATOM   1073  O "O4'" . DA  A 1 53  ? 36.620  84.959  104.102 1.00   147.80 ? 53  DA  I "O4'" 1 
ATOM   1074  C "C3'" . DA  A 1 53  ? 36.401  85.744  106.345 1.00   172.05 ? 53  DA  I "C3'" 1 
ATOM   1075  O "O3'" . DA  A 1 53  ? 37.311  85.107  107.234 1.00   177.62 ? 53  DA  I "O3'" 1 
ATOM   1076  C "C2'" . DA  A 1 53  ? 37.104  86.784  105.475 1.00   161.72 ? 53  DA  I "C2'" 1 
ATOM   1077  C "C1'" . DA  A 1 53  ? 37.620  85.923  104.334 1.00   155.03 ? 53  DA  I "C1'" 1 
ATOM   1078  N N9    . DA  A 1 53  ? 37.844  86.670  103.099 1.00   148.36 ? 53  DA  I N9    1 
ATOM   1079  C C8    . DA  A 1 53  ? 37.047  87.647  102.571 1.00   148.88 ? 53  DA  I C8    1 
ATOM   1080  N N7    . DA  A 1 53  ? 37.498  88.148  101.445 1.00   158.38 ? 53  DA  I N7    1 
ATOM   1081  C C5    . DA  A 1 53  ? 38.673  87.451  101.218 1.00   159.15 ? 53  DA  I C5    1 
ATOM   1082  C C6    . DA  A 1 53  ? 39.630  87.512  100.184 1.00   148.73 ? 53  DA  I C6    1 
ATOM   1083  N N6    . DA  A 1 53  ? 39.539  88.348  99.145  1.00   134.43 ? 53  DA  I N6    1 
ATOM   1084  N N1    . DA  A 1 53  ? 40.688  86.677  100.261 1.00   147.12 ? 53  DA  I N1    1 
ATOM   1085  C C2    . DA  A 1 53  ? 40.776  85.842  101.304 1.00   148.81 ? 53  DA  I C2    1 
ATOM   1086  N N3    . DA  A 1 53  ? 39.942  85.694  102.333 1.00   153.57 ? 53  DA  I N3    1 
ATOM   1087  C C4    . DA  A 1 53  ? 38.902  86.536  102.229 1.00   155.68 ? 53  DA  I C4    1 
ATOM   1088  P P     . DG  A 1 54  ? 37.639  85.767  108.662 1.00   162.06 ? 54  DG  I P     1 
ATOM   1089  O OP1   . DG  A 1 54  ? 37.520  84.705  109.686 1.00   158.72 ? 54  DG  I OP1   1 
ATOM   1090  O OP2   . DG  A 1 54  ? 36.830  87.000  108.783 1.00   159.23 ? 54  DG  I OP2   1 
ATOM   1091  O "O5'" . DG  A 1 54  ? 39.175  86.199  108.543 1.00   161.26 ? 54  DG  I "O5'" 1 
ATOM   1092  C "C5'" . DG  A 1 54  ? 40.191  85.203  108.504 1.00   171.26 ? 54  DG  I "C5'" 1 
ATOM   1093  C "C4'" . DG  A 1 54  ? 41.423  85.714  107.779 1.00   173.58 ? 54  DG  I "C4'" 1 
ATOM   1094  O "O4'" . DG  A 1 54  ? 41.069  86.075  106.435 1.00   169.61 ? 54  DG  I "O4'" 1 
ATOM   1095  C "C3'" . DG  A 1 54  ? 42.039  86.976  108.366 1.00   170.59 ? 54  DG  I "C3'" 1 
ATOM   1096  O "O3'" . DG  A 1 54  ? 43.045  86.630  109.315 1.00   170.61 ? 54  DG  I "O3'" 1 
ATOM   1097  C "C2'" . DG  A 1 54  ? 42.642  87.694  107.147 1.00   162.31 ? 54  DG  I "C2'" 1 
ATOM   1098  C "C1'" . DG  A 1 54  ? 42.040  86.964  105.940 1.00   163.07 ? 54  DG  I "C1'" 1 
ATOM   1099  N N9    . DG  A 1 54  ? 41.406  87.858  104.976 1.00   158.46 ? 54  DG  I N9    1 
ATOM   1100  C C8    . DG  A 1 54  ? 40.146  88.400  105.053 1.00   156.16 ? 54  DG  I C8    1 
ATOM   1101  N N7    . DG  A 1 54  ? 39.848  89.168  104.043 1.00   156.02 ? 54  DG  I N7    1 
ATOM   1102  C C5    . DG  A 1 54  ? 40.984  89.135  103.244 1.00   154.11 ? 54  DG  I C5    1 
ATOM   1103  C C6    . DG  A 1 54  ? 41.251  89.778  102.012 1.00   150.84 ? 54  DG  I C6    1 
ATOM   1104  O O6    . DG  A 1 54  ? 40.510  90.528  101.361 1.00   156.07 ? 54  DG  I O6    1 
ATOM   1105  N N1    . DG  A 1 54  ? 42.525  89.477  101.539 1.00   142.19 ? 54  DG  I N1    1 
ATOM   1106  C C2    . DG  A 1 54  ? 43.427  88.659  102.177 1.00   144.08 ? 54  DG  I C2    1 
ATOM   1107  N N2    . DG  A 1 54  ? 44.608  88.488  101.566 1.00   155.15 ? 54  DG  I N2    1 
ATOM   1108  N N3    . DG  A 1 54  ? 43.190  88.051  103.332 1.00   140.08 ? 54  DG  I N3    1 
ATOM   1109  C C4    . DG  A 1 54  ? 41.952  88.334  103.805 1.00   147.02 ? 54  DG  I C4    1 
ATOM   1110  P P     . DC  A 1 55  ? 43.722  87.766  110.230 1.00   155.95 ? 55  DC  I P     1 
ATOM   1111  O OP1   . DC  A 1 55  ? 44.344  87.094  111.392 1.00   132.74 ? 55  DC  I OP1   1 
ATOM   1112  O OP2   . DC  A 1 55  ? 42.713  88.826  110.448 1.00   149.61 ? 55  DC  I OP2   1 
ATOM   1113  O "O5'" . DC  A 1 55  ? 44.880  88.374  109.304 1.00   175.57 ? 55  DC  I "O5'" 1 
ATOM   1114  C "C5'" . DC  A 1 55  ? 45.934  87.536  108.837 1.00   154.68 ? 55  DC  I "C5'" 1 
ATOM   1115  C "C4'" . DC  A 1 55  ? 46.652  88.170  107.657 1.00   144.81 ? 55  DC  I "C4'" 1 
ATOM   1116  O "O4'" . DC  A 1 55  ? 45.700  88.470  106.617 1.00   166.94 ? 55  DC  I "O4'" 1 
ATOM   1117  C "C3'" . DC  A 1 55  ? 47.325  89.498  107.949 1.00   146.80 ? 55  DC  I "C3'" 1 
ATOM   1118  O "O3'" . DC  A 1 55  ? 48.628  89.273  108.479 1.00   151.52 ? 55  DC  I "O3'" 1 
ATOM   1119  C "C2'" . DC  A 1 55  ? 47.390  90.149  106.565 1.00   160.08 ? 55  DC  I "C2'" 1 
ATOM   1120  C "C1'" . DC  A 1 55  ? 46.183  89.545  105.833 1.00   161.08 ? 55  DC  I "C1'" 1 
ATOM   1121  N N1    . DC  A 1 55  ? 45.068  90.516  105.605 1.00   157.05 ? 55  DC  I N1    1 
ATOM   1122  C C2    . DC  A 1 55  ? 44.922  91.118  104.351 1.00   147.39 ? 55  DC  I C2    1 
ATOM   1123  O O2    . DC  A 1 55  ? 45.723  90.837  103.450 1.00   136.77 ? 55  DC  I O2    1 
ATOM   1124  N N3    . DC  A 1 55  ? 43.905  91.996  104.158 1.00   136.13 ? 55  DC  I N3    1 
ATOM   1125  C C4    . DC  A 1 55  ? 43.064  92.272  105.155 1.00   124.82 ? 55  DC  I C4    1 
ATOM   1126  N N4    . DC  A 1 55  ? 42.079  93.144  104.917 1.00   122.60 ? 55  DC  I N4    1 
ATOM   1127  C C5    . DC  A 1 55  ? 43.196  91.668  106.440 1.00   143.08 ? 55  DC  I C5    1 
ATOM   1128  C C6    . DC  A 1 55  ? 44.202  90.805  106.618 1.00   158.01 ? 55  DC  I C6    1 
ATOM   1129  P P     . DT  A 1 56  ? 49.391  90.439  109.281 1.00   168.35 ? 56  DT  I P     1 
ATOM   1130  O OP1   . DT  A 1 56  ? 50.430  89.798  110.117 1.00   147.60 ? 56  DT  I OP1   1 
ATOM   1131  O OP2   . DT  A 1 56  ? 48.361  91.293  109.915 1.00   158.95 ? 56  DT  I OP2   1 
ATOM   1132  O "O5'" . DT  A 1 56  ? 50.104  91.299  108.133 1.00   137.84 ? 56  DT  I "O5'" 1 
ATOM   1133  C "C5'" . DT  A 1 56  ? 51.015  90.673  107.237 1.00   119.89 ? 56  DT  I "C5'" 1 
ATOM   1134  C "C4'" . DT  A 1 56  ? 51.370  91.597  106.083 1.00   132.91 ? 56  DT  I "C4'" 1 
ATOM   1135  O "O4'" . DT  A 1 56  ? 50.154  92.132  105.496 1.00   128.68 ? 56  DT  I "O4'" 1 
ATOM   1136  C "C3'" . DT  A 1 56  ? 52.227  92.808  106.459 1.00   156.86 ? 56  DT  I "C3'" 1 
ATOM   1137  O "O3'" . DT  A 1 56  ? 53.194  93.053  105.440 1.00   159.60 ? 56  DT  I "O3'" 1 
ATOM   1138  C "C2'" . DT  A 1 56  ? 51.206  93.938  106.544 1.00   142.06 ? 56  DT  I "C2'" 1 
ATOM   1139  C "C1'" . DT  A 1 56  ? 50.231  93.541  105.449 1.00   152.47 ? 56  DT  I "C1'" 1 
ATOM   1140  N N1    . DT  A 1 56  ? 48.862  94.096  105.640 1.00   160.77 ? 56  DT  I N1    1 
ATOM   1141  C C2    . DT  A 1 56  ? 48.406  95.074  104.786 1.00   144.50 ? 56  DT  I C2    1 
ATOM   1142  O O2    . DT  A 1 56  ? 49.069  95.519  103.865 1.00   110.40 ? 56  DT  I O2    1 
ATOM   1143  N N3    . DT  A 1 56  ? 47.136  95.516  105.049 1.00   155.13 ? 56  DT  I N3    1 
ATOM   1144  C C4    . DT  A 1 56  ? 46.294  95.087  106.060 1.00   148.81 ? 56  DT  I C4    1 
ATOM   1145  O O4    . DT  A 1 56  ? 45.166  95.547  106.215 1.00   136.97 ? 56  DT  I O4    1 
ATOM   1146  C C5    . DT  A 1 56  ? 46.835  94.061  106.920 1.00   143.34 ? 56  DT  I C5    1 
ATOM   1147  C C7    . DT  A 1 56  ? 46.016  93.517  108.052 1.00   126.98 ? 56  DT  I C7    1 
ATOM   1148  C C6    . DT  A 1 56  ? 48.077  93.621  106.672 1.00   156.72 ? 56  DT  I C6    1 
ATOM   1149  P P     . DC  A 1 57  ? 54.375  94.116  105.680 1.00   106.99 ? 57  DC  I P     1 
ATOM   1150  O OP1   . DC  A 1 57  ? 55.511  93.720  104.818 1.00   87.64  ? 57  DC  I OP1   1 
ATOM   1151  O OP2   . DC  A 1 57  ? 54.571  94.256  107.140 1.00   105.03 ? 57  DC  I OP2   1 
ATOM   1152  O "O5'" . DC  A 1 57  ? 53.772  95.492  105.128 1.00   150.05 ? 57  DC  I "O5'" 1 
ATOM   1153  C "C5'" . DC  A 1 57  ? 53.530  95.653  103.733 1.00   146.99 ? 57  DC  I "C5'" 1 
ATOM   1154  C "C4'" . DC  A 1 57  ? 52.893  97.001  103.442 1.00   128.64 ? 57  DC  I "C4'" 1 
ATOM   1155  O "O4'" . DC  A 1 57  ? 51.530  97.014  103.936 1.00   122.05 ? 57  DC  I "O4'" 1 
ATOM   1156  C "C3'" . DC  A 1 57  ? 53.596  98.204  104.080 1.00   115.05 ? 57  DC  I "C3'" 1 
ATOM   1157  O "O3'" . DC  A 1 57  ? 53.747  99.240  103.120 1.00   107.22 ? 57  DC  I "O3'" 1 
ATOM   1158  C "C2'" . DC  A 1 57  ? 52.649  98.615  105.208 1.00   123.81 ? 57  DC  I "C2'" 1 
ATOM   1159  C "C1'" . DC  A 1 57  ? 51.299  98.211  104.637 1.00   139.02 ? 57  DC  I "C1'" 1 
ATOM   1160  N N1    . DC  A 1 57  ? 50.260  97.956  105.677 1.00   141.50 ? 57  DC  I N1    1 
ATOM   1161  C C2    . DC  A 1 57  ? 48.917  98.236  105.399 1.00   133.80 ? 57  DC  I C2    1 
ATOM   1162  O O2    . DC  A 1 57  ? 48.612  98.690  104.289 1.00   132.21 ? 57  DC  I O2    1 
ATOM   1163  N N3    . DC  A 1 57  ? 47.985  97.998  106.356 1.00   123.76 ? 57  DC  I N3    1 
ATOM   1164  C C4    . DC  A 1 57  ? 48.355  97.506  107.540 1.00   136.02 ? 57  DC  I C4    1 
ATOM   1165  N N4    . DC  A 1 57  ? 47.401  97.289  108.451 1.00   137.36 ? 57  DC  I N4    1 
ATOM   1166  C C5    . DC  A 1 57  ? 49.718  97.217  107.842 1.00   143.81 ? 57  DC  I C5    1 
ATOM   1167  C C6    . DC  A 1 57  ? 50.628  97.455  106.891 1.00   141.39 ? 57  DC  I C6    1 
ATOM   1168  P P     . DT  A 1 58  ? 55.160  99.466  102.389 1.00   128.51 ? 58  DT  I P     1 
ATOM   1169  O OP1   . DT  A 1 58  ? 55.659  98.140  101.963 1.00   118.36 ? 58  DT  I OP1   1 
ATOM   1170  O OP2   . DT  A 1 58  ? 55.992  100.321 103.264 1.00   118.83 ? 58  DT  I OP2   1 
ATOM   1171  O "O5'" . DT  A 1 58  ? 54.786  100.312 101.082 1.00   156.66 ? 58  DT  I "O5'" 1 
ATOM   1172  C "C5'" . DT  A 1 58  ? 54.100  99.686  100.000 1.00   151.21 ? 58  DT  I "C5'" 1 
ATOM   1173  C "C4'" . DT  A 1 58  ? 52.894  100.504 99.564  1.00   135.14 ? 58  DT  I "C4'" 1 
ATOM   1174  O "O4'" . DT  A 1 58  ? 51.891  100.461 100.617 1.00   134.02 ? 58  DT  I "O4'" 1 
ATOM   1175  C "C3'" . DT  A 1 58  ? 53.160  101.993 99.316  1.00   126.43 ? 58  DT  I "C3'" 1 
ATOM   1176  O "O3'" . DT  A 1 58  ? 52.334  102.433 98.250  1.00   131.84 ? 58  DT  I "O3'" 1 
ATOM   1177  C "C2'" . DT  A 1 58  ? 52.727  102.611 100.643 1.00   81.87  ? 58  DT  I "C2'" 1 
ATOM   1178  C "C1'" . DT  A 1 58  ? 51.492  101.777 100.914 1.00   102.53 ? 58  DT  I "C1'" 1 
ATOM   1179  N N1    . DT  A 1 58  ? 51.055  101.804 102.336 1.00   116.09 ? 58  DT  I N1    1 
ATOM   1180  C C2    . DT  A 1 58  ? 49.768  101.439 102.655 1.00   112.91 ? 58  DT  I C2    1 
ATOM   1181  O O2    . DT  A 1 58  ? 48.933  101.138 101.822 1.00   121.93 ? 58  DT  I O2    1 
ATOM   1182  N N3    . DT  A 1 58  ? 49.476  101.480 103.993 1.00   108.48 ? 58  DT  I N3    1 
ATOM   1183  C C4    . DT  A 1 58  ? 50.335  101.813 105.026 1.00   116.82 ? 58  DT  I C4    1 
ATOM   1184  O O4    . DT  A 1 58  ? 49.980  101.814 106.201 1.00   97.55  ? 58  DT  I O4    1 
ATOM   1185  C C5    . DT  A 1 58  ? 51.679  102.160 104.623 1.00   137.94 ? 58  DT  I C5    1 
ATOM   1186  C C7    . DT  A 1 58  ? 52.704  102.537 105.651 1.00   134.64 ? 58  DT  I C7    1 
ATOM   1187  C C6    . DT  A 1 58  ? 51.971  102.129 103.314 1.00   130.40 ? 58  DT  I C6    1 
ATOM   1188  P P     . DA  A 1 59  ? 52.341  103.964 97.763  1.00   120.55 ? 59  DA  I P     1 
ATOM   1189  O OP1   . DA  A 1 59  ? 52.002  103.973 96.322  1.00   106.58 ? 59  DA  I OP1   1 
ATOM   1190  O OP2   . DA  A 1 59  ? 53.596  104.595 98.230  1.00   96.45  ? 59  DA  I OP2   1 
ATOM   1191  O "O5'" . DA  A 1 59  ? 51.126  104.610 98.572  1.00   123.06 ? 59  DA  I "O5'" 1 
ATOM   1192  C "C5'" . DA  A 1 59  ? 49.812  104.133 98.342  1.00   109.11 ? 59  DA  I "C5'" 1 
ATOM   1193  C "C4'" . DA  A 1 59  ? 48.772  105.039 98.974  1.00   113.30 ? 59  DA  I "C4'" 1 
ATOM   1194  O "O4'" . DA  A 1 59  ? 48.740  104.829 100.410 1.00   114.09 ? 59  DA  I "O4'" 1 
ATOM   1195  C "C3'" . DA  A 1 59  ? 49.004  106.533 98.767  1.00   96.27  ? 59  DA  I "C3'" 1 
ATOM   1196  O "O3'" . DA  A 1 59  ? 47.763  107.166 98.517  1.00   101.90 ? 59  DA  I "O3'" 1 
ATOM   1197  C "C2'" . DA  A 1 59  ? 49.614  106.994 100.088 1.00   67.96  ? 59  DA  I "C2'" 1 
ATOM   1198  C "C1'" . DA  A 1 59  ? 48.957  106.051 101.086 1.00   100.46 ? 59  DA  I "C1'" 1 
ATOM   1199  N N9    . DA  A 1 59  ? 49.762  105.807 102.277 1.00   97.14  ? 59  DA  I N9    1 
ATOM   1200  C C8    . DA  A 1 59  ? 51.090  105.489 102.331 1.00   118.21 ? 59  DA  I C8    1 
ATOM   1201  N N7    . DA  A 1 59  ? 51.543  105.320 103.552 1.00   126.70 ? 59  DA  I N7    1 
ATOM   1202  C C5    . DA  A 1 59  ? 50.428  105.519 104.350 1.00   120.08 ? 59  DA  I C5    1 
ATOM   1203  C C6    . DA  A 1 59  ? 50.235  105.474 105.746 1.00   127.75 ? 59  DA  I C6    1 
ATOM   1204  N N6    . DA  A 1 59  ? 51.210  105.203 106.618 1.00   126.80 ? 59  DA  I N6    1 
ATOM   1205  N N1    . DA  A 1 59  ? 48.995  105.723 106.213 1.00   122.79 ? 59  DA  I N1    1 
ATOM   1206  C C2    . DA  A 1 59  ? 48.020  105.993 105.338 1.00   114.41 ? 59  DA  I C2    1 
ATOM   1207  N N3    . DA  A 1 59  ? 48.080  106.065 104.012 1.00   109.81 ? 59  DA  I N3    1 
ATOM   1208  C C4    . DA  A 1 59  ? 49.323  105.815 103.577 1.00   109.82 ? 59  DA  I C4    1 
ATOM   1209  P P     . DG  A 1 60  ? 47.677  108.463 97.575  1.00   109.01 ? 60  DG  I P     1 
ATOM   1210  O OP1   . DG  A 1 60  ? 47.438  107.983 96.196  1.00   87.49  ? 60  DG  I OP1   1 
ATOM   1211  O OP2   . DG  A 1 60  ? 48.847  109.325 97.856  1.00   66.29  ? 60  DG  I OP2   1 
ATOM   1212  O "O5'" . DG  A 1 60  ? 46.370  109.215 98.110  1.00   117.14 ? 60  DG  I "O5'" 1 
ATOM   1213  C "C5'" . DG  A 1 60  ? 45.202  108.461 98.429  1.00   100.35 ? 60  DG  I "C5'" 1 
ATOM   1214  C "C4'" . DG  A 1 60  ? 44.722  108.763 99.840  1.00   88.91  ? 60  DG  I "C4'" 1 
ATOM   1215  O "O4'" . DG  A 1 60  ? 45.630  108.191 100.801 1.00   83.76  ? 60  DG  I "O4'" 1 
ATOM   1216  C "C3'" . DG  A 1 60  ? 44.661  110.234 100.203 1.00   96.27  ? 60  DG  I "C3'" 1 
ATOM   1217  O "O3'" . DG  A 1 60  ? 43.426  110.788 99.735  1.00   103.00 ? 60  DG  I "O3'" 1 
ATOM   1218  C "C2'" . DG  A 1 60  ? 44.735  110.193 101.732 1.00   99.18  ? 60  DG  I "C2'" 1 
ATOM   1219  C "C1'" . DG  A 1 60  ? 45.561  108.930 102.009 1.00   92.27  ? 60  DG  I "C1'" 1 
ATOM   1220  N N9    . DG  A 1 60  ? 46.920  109.204 102.468 1.00   92.11  ? 60  DG  I N9    1 
ATOM   1221  C C8    . DG  A 1 60  ? 48.011  109.501 101.688 1.00   110.69 ? 60  DG  I C8    1 
ATOM   1222  N N7    . DG  A 1 60  ? 49.103  109.693 102.372 1.00   100.09 ? 60  DG  I N7    1 
ATOM   1223  C C5    . DG  A 1 60  ? 48.714  109.513 103.692 1.00   105.57 ? 60  DG  I C5    1 
ATOM   1224  C C6    . DG  A 1 60  ? 49.471  109.595 104.884 1.00   118.95 ? 60  DG  I C6    1 
ATOM   1225  O O6    . DG  A 1 60  ? 50.677  109.853 105.011 1.00   119.78 ? 60  DG  I O6    1 
ATOM   1226  N N1    . DG  A 1 60  ? 48.691  109.344 106.010 1.00   121.68 ? 60  DG  I N1    1 
ATOM   1227  C C2    . DG  A 1 60  ? 47.347  109.051 105.985 1.00   112.33 ? 60  DG  I C2    1 
ATOM   1228  N N2    . DG  A 1 60  ? 46.766  108.836 107.174 1.00   118.78 ? 60  DG  I N2    1 
ATOM   1229  N N3    . DG  A 1 60  ? 46.626  108.967 104.874 1.00   94.79  ? 60  DG  I N3    1 
ATOM   1230  C C4    . DG  A 1 60  ? 47.372  109.210 103.769 1.00   94.97  ? 60  DG  I C4    1 
ATOM   1231  P P     . DC  A 1 61  ? 42.794  112.112 100.396 1.00   100.38 ? 61  DC  I P     1 
ATOM   1232  O OP1   . DC  A 1 61  ? 41.775  112.622 99.451  1.00   75.78  ? 61  DC  I OP1   1 
ATOM   1233  O OP2   . DC  A 1 61  ? 43.888  113.008 100.835 1.00   78.03  ? 61  DC  I OP2   1 
ATOM   1234  O "O5'" . DC  A 1 61  ? 42.024  111.563 101.684 1.00   78.86  ? 61  DC  I "O5'" 1 
ATOM   1235  C "C5'" . DC  A 1 61  ? 41.226  112.439 102.447 1.00   119.36 ? 61  DC  I "C5'" 1 
ATOM   1236  C "C4'" . DC  A 1 61  ? 41.629  112.399 103.907 1.00   108.48 ? 61  DC  I "C4'" 1 
ATOM   1237  O "O4'" . DC  A 1 61  ? 43.006  111.959 104.029 1.00   87.26  ? 61  DC  I "O4'" 1 
ATOM   1238  C "C3'" . DC  A 1 61  ? 41.540  113.744 104.634 1.00   106.10 ? 61  DC  I "C3'" 1 
ATOM   1239  O "O3'" . DC  A 1 61  ? 40.732  113.609 105.790 1.00   95.24  ? 61  DC  I "O3'" 1 
ATOM   1240  C "C2'" . DC  A 1 61  ? 42.995  114.070 104.989 1.00   105.77 ? 61  DC  I "C2'" 1 
ATOM   1241  C "C1'" . DC  A 1 61  ? 43.616  112.688 105.063 1.00   111.50 ? 61  DC  I "C1'" 1 
ATOM   1242  N N1    . DC  A 1 61  ? 45.090  112.688 104.847 1.00   125.68 ? 61  DC  I N1    1 
ATOM   1243  C C2    . DC  A 1 61  ? 45.932  112.131 105.817 1.00   119.31 ? 61  DC  I C2    1 
ATOM   1244  O O2    . DC  A 1 61  ? 45.433  111.638 106.837 1.00   111.36 ? 61  DC  I O2    1 
ATOM   1245  N N3    . DC  A 1 61  ? 47.272  112.144 105.607 1.00   106.58 ? 61  DC  I N3    1 
ATOM   1246  C C4    . DC  A 1 61  ? 47.769  112.682 104.493 1.00   91.13  ? 61  DC  I C4    1 
ATOM   1247  N N4    . DC  A 1 61  ? 49.094  112.670 104.331 1.00   82.83  ? 61  DC  I N4    1 
ATOM   1248  C C5    . DC  A 1 61  ? 46.928  113.259 103.496 1.00   116.17 ? 61  DC  I C5    1 
ATOM   1249  C C6    . DC  A 1 61  ? 45.608  113.242 103.713 1.00   120.11 ? 61  DC  I C6    1 
ATOM   1250  P P     . DA  A 1 62  ? 40.178  114.910 106.553 1.00   116.94 ? 62  DA  I P     1 
ATOM   1251  O OP1   . DA  A 1 62  ? 38.702  114.884 106.450 1.00   131.23 ? 62  DA  I OP1   1 
ATOM   1252  O OP2   . DA  A 1 62  ? 40.924  116.097 106.075 1.00   72.73  ? 62  DA  I OP2   1 
ATOM   1253  O "O5'" . DA  A 1 62  ? 40.596  114.649 108.072 1.00   138.50 ? 62  DA  I "O5'" 1 
ATOM   1254  C "C5'" . DA  A 1 62  ? 41.814  113.974 108.360 1.00   103.35 ? 62  DA  I "C5'" 1 
ATOM   1255  C "C4'" . DA  A 1 62  ? 42.682  114.809 109.277 1.00   104.88 ? 62  DA  I "C4'" 1 
ATOM   1256  O "O4'" . DA  A 1 62  ? 44.084  114.533 109.003 1.00   114.81 ? 62  DA  I "O4'" 1 
ATOM   1257  C "C3'" . DA  A 1 62  ? 42.516  116.323 109.118 1.00   92.57  ? 62  DA  I "C3'" 1 
ATOM   1258  O "O3'" . DA  A 1 62  ? 42.593  116.942 110.390 1.00   104.78 ? 62  DA  I "O3'" 1 
ATOM   1259  C "C2'" . DA  A 1 62  ? 43.711  116.698 108.251 1.00   109.05 ? 62  DA  I "C2'" 1 
ATOM   1260  C "C1'" . DA  A 1 62  ? 44.758  115.754 108.807 1.00   117.90 ? 62  DA  I "C1'" 1 
ATOM   1261  N N9    . DA  A 1 62  ? 45.893  115.539 107.916 1.00   100.19 ? 62  DA  I N9    1 
ATOM   1262  C C8    . DA  A 1 62  ? 45.895  115.593 106.550 1.00   97.96  ? 62  DA  I C8    1 
ATOM   1263  N N7    . DA  A 1 62  ? 47.070  115.365 106.014 1.00   104.78 ? 62  DA  I N7    1 
ATOM   1264  C C5    . DA  A 1 62  ? 47.896  115.149 107.105 1.00   114.00 ? 62  DA  I C5    1 
ATOM   1265  C C6    . DA  A 1 62  ? 49.270  114.853 107.214 1.00   118.83 ? 62  DA  I C6    1 
ATOM   1266  N N6    . DA  A 1 62  ? 50.082  114.721 106.160 1.00   110.61 ? 62  DA  I N6    1 
ATOM   1267  N N1    . DA  A 1 62  ? 49.780  114.699 108.454 1.00   122.48 ? 62  DA  I N1    1 
ATOM   1268  C C2    . DA  A 1 62  ? 48.965  114.833 109.508 1.00   114.36 ? 62  DA  I C2    1 
ATOM   1269  N N3    . DA  A 1 62  ? 47.663  115.108 109.530 1.00   103.07 ? 62  DA  I N3    1 
ATOM   1270  C C4    . DA  A 1 62  ? 47.186  115.255 108.284 1.00   103.57 ? 62  DA  I C4    1 
ATOM   1271  P P     . DC  A 1 63  ? 41.962  118.399 110.631 1.00   111.30 ? 63  DC  I P     1 
ATOM   1272  O OP1   . DC  A 1 63  ? 40.614  118.211 111.212 1.00   99.31  ? 63  DC  I OP1   1 
ATOM   1273  O OP2   . DC  A 1 63  ? 42.131  119.191 109.392 1.00   90.13  ? 63  DC  I OP2   1 
ATOM   1274  O "O5'" . DC  A 1 63  ? 42.917  119.035 111.742 1.00   114.67 ? 63  DC  I "O5'" 1 
ATOM   1275  C "C5'" . DC  A 1 63  ? 43.457  118.208 112.765 1.00   111.21 ? 63  DC  I "C5'" 1 
ATOM   1276  C "C4'" . DC  A 1 63  ? 44.896  118.587 113.054 1.00   113.15 ? 63  DC  I "C4'" 1 
ATOM   1277  O "O4'" . DC  A 1 63  ? 45.754  118.071 112.015 1.00   106.96 ? 63  DC  I "O4'" 1 
ATOM   1278  C "C3'" . DC  A 1 63  ? 45.161  120.094 113.114 1.00   101.26 ? 63  DC  I "C3'" 1 
ATOM   1279  O "O3'" . DC  A 1 63  ? 45.526  120.470 114.436 1.00   118.27 ? 63  DC  I "O3'" 1 
ATOM   1280  C "C2'" . DC  A 1 63  ? 46.305  120.332 112.113 1.00   98.07  ? 63  DC  I "C2'" 1 
ATOM   1281  C "C1'" . DC  A 1 63  ? 46.851  118.932 111.874 1.00   115.86 ? 63  DC  I "C1'" 1 
ATOM   1282  N N1    . DC  A 1 63  ? 47.432  118.742 110.511 1.00   124.21 ? 63  DC  I N1    1 
ATOM   1283  C C2    . DC  A 1 63  ? 48.773  118.361 110.374 1.00   125.11 ? 63  DC  I C2    1 
ATOM   1284  O O2    . DC  A 1 63  ? 49.457  118.183 111.389 1.00   119.40 ? 63  DC  I O2    1 
ATOM   1285  N N3    . DC  A 1 63  ? 49.283  118.194 109.129 1.00   116.61 ? 63  DC  I N3    1 
ATOM   1286  C C4    . DC  A 1 63  ? 48.513  118.395 108.058 1.00   121.26 ? 63  DC  I C4    1 
ATOM   1287  N N4    . DC  A 1 63  ? 49.061  118.218 106.851 1.00   117.31 ? 63  DC  I N4    1 
ATOM   1288  C C5    . DC  A 1 63  ? 47.146  118.785 108.177 1.00   105.02 ? 63  DC  I C5    1 
ATOM   1289  C C6    . DC  A 1 63  ? 46.653  118.947 109.410 1.00   105.91 ? 63  DC  I C6    1 
ATOM   1290  P P     . DC  A 1 64  ? 45.798  122.011 114.792 1.00   117.28 ? 64  DC  I P     1 
ATOM   1291  O OP1   . DC  A 1 64  ? 45.571  122.202 116.241 1.00   120.75 ? 64  DC  I OP1   1 
ATOM   1292  O OP2   . DC  A 1 64  ? 45.043  122.834 113.819 1.00   130.00 ? 64  DC  I OP2   1 
ATOM   1293  O "O5'" . DC  A 1 64  ? 47.354  122.195 114.482 1.00   94.20  ? 64  DC  I "O5'" 1 
ATOM   1294  C "C5'" . DC  A 1 64  ? 48.368  121.383 115.158 1.00   125.93 ? 64  DC  I "C5'" 1 
ATOM   1295  C "C4'" . DC  A 1 64  ? 49.735  121.913 114.760 1.00   116.63 ? 64  DC  I "C4'" 1 
ATOM   1296  O "O4'" . DC  A 1 64  ? 50.094  121.421 113.427 1.00   104.84 ? 64  DC  I "O4'" 1 
ATOM   1297  C "C3'" . DC  A 1 64  ? 49.823  123.439 114.717 1.00   116.18 ? 64  DC  I "C3'" 1 
ATOM   1298  O "O3'" . DC  A 1 64  ? 50.994  123.875 115.411 1.00   114.07 ? 64  DC  I "O3'" 1 
ATOM   1299  C "C2'" . DC  A 1 64  ? 49.868  123.748 113.230 1.00   118.28 ? 64  DC  I "C2'" 1 
ATOM   1300  C "C1'" . DC  A 1 64  ? 50.606  122.544 112.724 1.00   113.75 ? 64  DC  I "C1'" 1 
ATOM   1301  N N1    . DC  A 1 64  ? 50.467  122.340 111.245 1.00   115.65 ? 64  DC  I N1    1 
ATOM   1302  C C2    . DC  A 1 64  ? 51.577  122.016 110.478 1.00   123.58 ? 64  DC  I C2    1 
ATOM   1303  O O2    . DC  A 1 64  ? 52.693  122.337 110.906 1.00   138.92 ? 64  DC  I O2    1 
ATOM   1304  N N3    . DC  A 1 64  ? 51.388  121.814 109.141 1.00   128.87 ? 64  DC  I N3    1 
ATOM   1305  C C4    . DC  A 1 64  ? 50.162  121.590 108.665 1.00   122.71 ? 64  DC  I C4    1 
ATOM   1306  N N4    . DC  A 1 64  ? 50.033  121.287 107.369 1.00   109.60 ? 64  DC  I N4    1 
ATOM   1307  C C5    . DC  A 1 64  ? 49.019  121.668 109.504 1.00   129.30 ? 64  DC  I C5    1 
ATOM   1308  C C6    . DC  A 1 64  ? 49.228  121.984 110.787 1.00   129.77 ? 64  DC  I C6    1 
ATOM   1309  P P     . DG  A 1 65  ? 51.017  125.302 116.147 1.00   135.82 ? 65  DG  I P     1 
ATOM   1310  O OP1   . DG  A 1 65  ? 51.361  125.079 117.569 1.00   150.29 ? 65  DG  I OP1   1 
ATOM   1311  O OP2   . DG  A 1 65  ? 49.763  126.002 115.793 1.00   138.30 ? 65  DG  I OP2   1 
ATOM   1312  O "O5'" . DG  A 1 65  ? 52.226  126.072 115.439 1.00   142.09 ? 65  DG  I "O5'" 1 
ATOM   1313  C "C5'" . DG  A 1 65  ? 53.541  125.529 115.488 1.00   139.76 ? 65  DG  I "C5'" 1 
ATOM   1314  C "C4'" . DG  A 1 65  ? 54.308  125.870 114.224 1.00   127.74 ? 65  DG  I "C4'" 1 
ATOM   1315  O "O4'" . DG  A 1 65  ? 53.651  125.266 113.096 1.00   123.62 ? 65  DG  I "O4'" 1 
ATOM   1316  C "C3'" . DG  A 1 65  ? 54.392  127.364 113.911 1.00   120.55 ? 65  DG  I "C3'" 1 
ATOM   1317  O "O3'" . DG  A 1 65  ? 55.702  127.843 114.189 1.00   126.61 ? 65  DG  I "O3'" 1 
ATOM   1318  C "C2'" . DG  A 1 65  ? 54.049  127.481 112.414 1.00   122.59 ? 65  DG  I "C2'" 1 
ATOM   1319  C "C1'" . DG  A 1 65  ? 53.904  126.033 111.950 1.00   115.33 ? 65  DG  I "C1'" 1 
ATOM   1320  N N9    . DG  A 1 65  ? 52.798  125.830 111.018 1.00   130.27 ? 65  DG  I N9    1 
ATOM   1321  C C8    . DG  A 1 65  ? 51.460  126.016 111.272 1.00   128.24 ? 65  DG  I C8    1 
ATOM   1322  N N7    . DG  A 1 65  ? 50.694  125.751 110.250 1.00   109.79 ? 65  DG  I N7    1 
ATOM   1323  C C5    . DG  A 1 65  ? 51.580  125.362 109.254 1.00   123.16 ? 65  DG  I C5    1 
ATOM   1324  C C6    . DG  A 1 65  ? 51.332  124.957 107.922 1.00   111.28 ? 65  DG  I C6    1 
ATOM   1325  O O6    . DG  A 1 65  ? 50.243  124.860 107.340 1.00   99.29  ? 65  DG  I O6    1 
ATOM   1326  N N1    . DG  A 1 65  ? 52.512  124.648 107.249 1.00   112.63 ? 65  DG  I N1    1 
ATOM   1327  C C2    . DG  A 1 65  ? 53.773  124.723 107.797 1.00   109.07 ? 65  DG  I C2    1 
ATOM   1328  N N2    . DG  A 1 65  ? 54.792  124.384 106.995 1.00   98.23  ? 65  DG  I N2    1 
ATOM   1329  N N3    . DG  A 1 65  ? 54.018  125.101 109.045 1.00   105.97 ? 65  DG  I N3    1 
ATOM   1330  C C4    . DG  A 1 65  ? 52.880  125.404 109.712 1.00   125.89 ? 65  DG  I C4    1 
ATOM   1331  P P     . DC  A 1 66  ? 56.021  129.416 114.122 1.00   156.71 ? 66  DC  I P     1 
ATOM   1332  O OP1   . DC  A 1 66  ? 57.152  129.681 115.041 1.00   124.93 ? 66  DC  I OP1   1 
ATOM   1333  O OP2   . DC  A 1 66  ? 54.743  130.144 114.294 1.00   124.22 ? 66  DC  I OP2   1 
ATOM   1334  O "O5'" . DC  A 1 66  ? 56.515  129.638 112.617 1.00   138.18 ? 66  DC  I "O5'" 1 
ATOM   1335  C "C5'" . DC  A 1 66  ? 57.515  128.788 112.070 1.00   127.22 ? 66  DC  I "C5'" 1 
ATOM   1336  C "C4'" . DC  A 1 66  ? 57.550  128.897 110.557 1.00   125.53 ? 66  DC  I "C4'" 1 
ATOM   1337  O "O4'" . DC  A 1 66  ? 56.362  128.303 110.006 1.00   134.26 ? 66  DC  I "O4'" 1 
ATOM   1338  C "C3'" . DC  A 1 66  ? 57.593  130.328 110.027 1.00   104.48 ? 66  DC  I "C3'" 1 
ATOM   1339  O "O3'" . DC  A 1 66  ? 58.913  130.633 109.587 1.00   103.95 ? 66  DC  I "O3'" 1 
ATOM   1340  C "C2'" . DC  A 1 66  ? 56.585  130.360 108.863 1.00   101.83 ? 66  DC  I "C2'" 1 
ATOM   1341  C "C1'" . DC  A 1 66  ? 56.047  128.931 108.790 1.00   127.51 ? 66  DC  I "C1'" 1 
ATOM   1342  N N1    . DC  A 1 66  ? 54.570  128.847 108.582 1.00   119.69 ? 66  DC  I N1    1 
ATOM   1343  C C2    . DC  A 1 66  ? 54.067  128.164 107.468 1.00   105.96 ? 66  DC  I C2    1 
ATOM   1344  O O2    . DC  A 1 66  ? 54.857  127.646 106.670 1.00   110.53 ? 66  DC  I O2    1 
ATOM   1345  N N3    . DC  A 1 66  ? 52.725  128.093 107.293 1.00   96.19  ? 66  DC  I N3    1 
ATOM   1346  C C4    . DC  A 1 66  ? 51.905  128.664 108.177 1.00   112.51 ? 66  DC  I C4    1 
ATOM   1347  N N4    . DC  A 1 66  ? 50.589  128.567 107.961 1.00   112.00 ? 66  DC  I N4    1 
ATOM   1348  C C5    . DC  A 1 66  ? 52.399  129.362 109.319 1.00   121.21 ? 66  DC  I C5    1 
ATOM   1349  C C6    . DC  A 1 66  ? 53.725  129.427 109.480 1.00   116.23 ? 66  DC  I C6    1 
ATOM   1350  P P     . DT  A 1 67  ? 59.656  131.969 110.086 1.00   110.99 ? 67  DT  I P     1 
ATOM   1351  O OP1   . DT  A 1 67  ? 60.866  131.564 110.835 1.00   104.32 ? 67  DT  I OP1   1 
ATOM   1352  O OP2   . DT  A 1 67  ? 58.646  132.834 110.734 1.00   110.03 ? 67  DT  I OP2   1 
ATOM   1353  O "O5'" . DT  A 1 67  ? 60.108  132.677 108.725 1.00   100.32 ? 67  DT  I "O5'" 1 
ATOM   1354  C "C5'" . DT  A 1 67  ? 59.129  133.237 107.867 1.00   93.59  ? 67  DT  I "C5'" 1 
ATOM   1355  C "C4'" . DT  A 1 67  ? 59.459  132.983 106.408 1.00   89.40  ? 67  DT  I "C4'" 1 
ATOM   1356  O "O4'" . DT  A 1 67  ? 58.534  131.995 105.885 1.00   75.04  ? 67  DT  I "O4'" 1 
ATOM   1357  C "C3'" . DT  A 1 67  ? 59.276  134.199 105.517 1.00   113.81 ? 67  DT  I "C3'" 1 
ATOM   1358  O "O3'" . DT  A 1 67  ? 60.060  134.106 104.332 1.00   77.66  ? 67  DT  I "O3'" 1 
ATOM   1359  C "C2'" . DT  A 1 67  ? 57.797  134.132 105.205 1.00   117.55 ? 67  DT  I "C2'" 1 
ATOM   1360  C "C1'" . DT  A 1 67  ? 57.563  132.633 105.073 1.00   101.04 ? 67  DT  I "C1'" 1 
ATOM   1361  N N1    . DT  A 1 67  ? 56.203  132.231 105.530 1.00   112.77 ? 67  DT  I N1    1 
ATOM   1362  C C2    . DT  A 1 67  ? 55.584  131.146 104.955 1.00   108.87 ? 67  DT  I C2    1 
ATOM   1363  O O2    . DT  A 1 67  ? 56.099  130.461 104.088 1.00   99.69  ? 67  DT  I O2    1 
ATOM   1364  N N3    . DT  A 1 67  ? 54.331  130.881 105.443 1.00   99.88  ? 67  DT  I N3    1 
ATOM   1365  C C4    . DT  A 1 67  ? 53.648  131.582 106.419 1.00   96.51  ? 67  DT  I C4    1 
ATOM   1366  O O4    . DT  A 1 67  ? 52.524  131.266 106.790 1.00   107.69 ? 67  DT  I O4    1 
ATOM   1367  C C5    . DT  A 1 67  ? 54.350  132.714 106.971 1.00   96.80  ? 67  DT  I C5    1 
ATOM   1368  C C7    . DT  A 1 67  ? 53.711  133.551 108.038 1.00   102.87 ? 67  DT  I C7    1 
ATOM   1369  C C6    . DT  A 1 67  ? 55.576  132.983 106.502 1.00   106.43 ? 67  DT  I C6    1 
ATOM   1370  P P     . DT  A 1 68  ? 60.585  135.455 103.627 1.00   137.42 ? 68  DT  I P     1 
ATOM   1371  O OP1   . DT  A 1 68  ? 62.046  135.301 103.442 1.00   103.58 ? 68  DT  I OP1   1 
ATOM   1372  O OP2   . DT  A 1 68  ? 60.054  136.603 104.397 1.00   93.75  ? 68  DT  I OP2   1 
ATOM   1373  O "O5'" . DT  A 1 68  ? 59.892  135.461 102.177 1.00   150.75 ? 68  DT  I "O5'" 1 
ATOM   1374  C "C5'" . DT  A 1 68  ? 59.923  134.283 101.400 1.00   123.51 ? 68  DT  I "C5'" 1 
ATOM   1375  C "C4'" . DT  A 1 68  ? 58.679  134.088 100.535 1.00   117.82 ? 68  DT  I "C4'" 1 
ATOM   1376  O "O4'" . DT  A 1 68  ? 57.525  133.772 101.371 1.00   106.02 ? 68  DT  I "O4'" 1 
ATOM   1377  C "C3'" . DT  A 1 68  ? 58.249  135.306 99.703  1.00   99.17  ? 68  DT  I "C3'" 1 
ATOM   1378  O "O3'" . DT  A 1 68  ? 57.740  134.842 98.466  1.00   102.39 ? 68  DT  I "O3'" 1 
ATOM   1379  C "C2'" . DT  A 1 68  ? 57.149  135.927 100.551 1.00   90.86  ? 68  DT  I "C2'" 1 
ATOM   1380  C "C1'" . DT  A 1 68  ? 56.473  134.680 101.090 1.00   102.29 ? 68  DT  I "C1'" 1 
ATOM   1381  N N1    . DT  A 1 68  ? 55.673  134.927 102.321 1.00   94.89  ? 68  DT  I N1    1 
ATOM   1382  C C2    . DT  A 1 68  ? 54.513  134.216 102.519 1.00   95.81  ? 68  DT  I C2    1 
ATOM   1383  O O2    . DT  A 1 68  ? 54.143  133.322 101.778 1.00   95.25  ? 68  DT  I O2    1 
ATOM   1384  N N3    . DT  A 1 68  ? 53.834  134.534 103.664 1.00   88.32  ? 68  DT  I N3    1 
ATOM   1385  C C4    . DT  A 1 68  ? 54.163  135.511 104.584 1.00   98.30  ? 68  DT  I C4    1 
ATOM   1386  O O4    . DT  A 1 68  ? 53.480  135.732 105.579 1.00   94.91  ? 68  DT  I O4    1 
ATOM   1387  C C5    . DT  A 1 68  ? 55.367  136.256 104.290 1.00   120.26 ? 68  DT  I C5    1 
ATOM   1388  C C7    . DT  A 1 68  ? 55.829  137.342 105.217 1.00   128.72 ? 68  DT  I C7    1 
ATOM   1389  C C6    . DT  A 1 68  ? 56.042  135.946 103.172 1.00   102.58 ? 68  DT  I C6    1 
ATOM   1390  P P     . DA  A 1 69  ? 58.718  134.758 97.196  1.00   112.66 ? 69  DA  I P     1 
ATOM   1391  O OP1   . DA  A 1 69  ? 59.775  133.766 97.492  1.00   131.66 ? 69  DA  I OP1   1 
ATOM   1392  O OP2   . DA  A 1 69  ? 59.089  136.152 96.862  1.00   59.51  ? 69  DA  I OP2   1 
ATOM   1393  O "O5'" . DA  A 1 69  ? 57.798  134.212 96.004  1.00   136.74 ? 69  DA  I "O5'" 1 
ATOM   1394  C "C5'" . DA  A 1 69  ? 57.017  133.034 96.220  1.00   135.40 ? 69  DA  I "C5'" 1 
ATOM   1395  C "C4'" . DA  A 1 69  ? 55.531  133.291 96.023  1.00   96.59  ? 69  DA  I "C4'" 1 
ATOM   1396  O "O4'" . DA  A 1 69  ? 54.944  133.843 97.246  1.00   84.84  ? 69  DA  I "O4'" 1 
ATOM   1397  C "C3'" . DA  A 1 69  ? 55.183  134.313 94.929  1.00   111.09 ? 69  DA  I "C3'" 1 
ATOM   1398  O "O3'" . DA  A 1 69  ? 53.980  133.916 94.314  1.00   105.44 ? 69  DA  I "O3'" 1 
ATOM   1399  C "C2'" . DA  A 1 69  ? 54.941  135.566 95.746  1.00   112.48 ? 69  DA  I "C2'" 1 
ATOM   1400  C "C1'" . DA  A 1 69  ? 54.140  134.931 96.852  1.00   106.55 ? 69  DA  I "C1'" 1 
ATOM   1401  N N9    . DA  A 1 69  ? 53.869  135.814 97.980  1.00   93.86  ? 69  DA  I N9    1 
ATOM   1402  C C8    . DA  A 1 69  ? 54.518  136.975 98.296  1.00   89.69  ? 69  DA  I C8    1 
ATOM   1403  N N7    . DA  A 1 69  ? 54.032  137.580 99.353  1.00   88.25  ? 69  DA  I N7    1 
ATOM   1404  C C5    . DA  A 1 69  ? 52.975  136.773 99.741  1.00   85.64  ? 69  DA  I C5    1 
ATOM   1405  C C6    . DA  A 1 69  ? 52.048  136.865 100.797 1.00   97.72  ? 69  DA  I C6    1 
ATOM   1406  N N6    . DA  A 1 69  ? 52.045  137.860 101.690 1.00   98.63  ? 69  DA  I N6    1 
ATOM   1407  N N1    . DA  A 1 69  ? 51.119  135.891 100.900 1.00   99.97  ? 69  DA  I N1    1 
ATOM   1408  C C2    . DA  A 1 69  ? 51.125  134.897 100.003 1.00   82.23  ? 69  DA  I C2    1 
ATOM   1409  N N3    . DA  A 1 69  ? 51.943  134.705 98.972  1.00   72.87  ? 69  DA  I N3    1 
ATOM   1410  C C4    . DA  A 1 69  ? 52.853  135.688 98.897  1.00   77.70  ? 69  DA  I C4    1 
ATOM   1411  P P     . DA  A 1 70  ? 53.942  133.481 92.771  1.00   101.47 ? 70  DA  I P     1 
ATOM   1412  O OP1   . DA  A 1 70  ? 54.571  132.146 92.658  1.00   59.34  ? 70  DA  I OP1   1 
ATOM   1413  O OP2   . DA  A 1 70  ? 54.458  134.613 91.969  1.00   114.72 ? 70  DA  I OP2   1 
ATOM   1414  O "O5'" . DA  A 1 70  ? 52.378  133.333 92.483  1.00   127.55 ? 70  DA  I "O5'" 1 
ATOM   1415  C "C5'" . DA  A 1 70  ? 51.569  132.577 93.380  1.00   108.32 ? 70  DA  I "C5'" 1 
ATOM   1416  C "C4'" . DA  A 1 70  ? 50.452  133.425 93.971  1.00   96.50  ? 70  DA  I "C4'" 1 
ATOM   1417  O "O4'" . DA  A 1 70  ? 50.987  134.368 94.921  1.00   100.75 ? 70  DA  I "O4'" 1 
ATOM   1418  C "C3'" . DA  A 1 70  ? 49.661  134.266 92.964  1.00   84.18  ? 70  DA  I "C3'" 1 
ATOM   1419  O "O3'" . DA  A 1 70  ? 48.384  133.681 92.745  1.00   90.82  ? 70  DA  I "O3'" 1 
ATOM   1420  C "C2'" . DA  A 1 70  ? 49.542  135.654 93.630  1.00   72.21  ? 70  DA  I "C2'" 1 
ATOM   1421  C "C1'" . DA  A 1 70  ? 50.053  135.406 95.043  1.00   82.61  ? 70  DA  I "C1'" 1 
ATOM   1422  N N9    . DA  A 1 70  ? 50.697  136.572 95.643  1.00   82.95  ? 70  DA  I N9    1 
ATOM   1423  C C8    . DA  A 1 70  ? 51.856  137.176 95.241  1.00   94.14  ? 70  DA  I C8    1 
ATOM   1424  N N7    . DA  A 1 70  ? 52.190  138.218 95.969  1.00   94.27  ? 70  DA  I N7    1 
ATOM   1425  C C5    . DA  A 1 70  ? 51.177  138.305 96.910  1.00   89.62  ? 70  DA  I C5    1 
ATOM   1426  C C6    . DA  A 1 70  ? 50.942  139.199 97.976  1.00   78.84  ? 70  DA  I C6    1 
ATOM   1427  N N6    . DA  A 1 70  ? 51.754  140.217 98.276  1.00   78.27  ? 70  DA  I N6    1 
ATOM   1428  N N1    . DA  A 1 70  ? 49.837  139.004 98.723  1.00   72.73  ? 70  DA  I N1    1 
ATOM   1429  C C2    . DA  A 1 70  ? 49.025  137.984 98.421  1.00   90.95  ? 70  DA  I C2    1 
ATOM   1430  N N3    . DA  A 1 70  ? 49.141  137.081 97.448  1.00   96.31  ? 70  DA  I N3    1 
ATOM   1431  C C4    . DA  A 1 70  ? 50.248  137.300 96.722  1.00   84.72  ? 70  DA  I C4    1 
ATOM   1432  P P     . DA  A 1 71  ? 47.310  134.405 91.794  1.00   66.08  ? 71  DA  I P     1 
ATOM   1433  O OP1   . DA  A 1 71  ? 46.490  133.345 91.167  1.00   53.26  ? 71  DA  I OP1   1 
ATOM   1434  O OP2   . DA  A 1 71  ? 48.038  135.373 90.942  1.00   61.73  ? 71  DA  I OP2   1 
ATOM   1435  O "O5'" . DA  A 1 71  ? 46.392  135.228 92.814  1.00   81.22  ? 71  DA  I "O5'" 1 
ATOM   1436  C "C5'" . DA  A 1 71  ? 45.714  134.544 93.860  1.00   69.59  ? 71  DA  I "C5'" 1 
ATOM   1437  C "C4'" . DA  A 1 71  ? 45.109  135.521 94.856  1.00   89.26  ? 71  DA  I "C4'" 1 
ATOM   1438  O "O4'" . DA  A 1 71  ? 46.131  136.435 95.334  1.00   91.74  ? 71  DA  I "O4'" 1 
ATOM   1439  C "C3'" . DA  A 1 71  ? 43.977  136.399 94.308  1.00   86.90  ? 71  DA  I "C3'" 1 
ATOM   1440  O "O3'" . DA  A 1 71  ? 42.897  136.415 95.231  1.00   92.62  ? 71  DA  I "O3'" 1 
ATOM   1441  C "C2'" . DA  A 1 71  ? 44.624  137.778 94.186  1.00   69.48  ? 71  DA  I "C2'" 1 
ATOM   1442  C "C1'" . DA  A 1 71  ? 45.609  137.741 95.338  1.00   73.72  ? 71  DA  I "C1'" 1 
ATOM   1443  N N9    . DA  A 1 71  ? 46.712  138.686 95.198  1.00   77.27  ? 71  DA  I N9    1 
ATOM   1444  C C8    . DA  A 1 71  ? 47.626  138.742 94.183  1.00   81.54  ? 71  DA  I C8    1 
ATOM   1445  N N7    . DA  A 1 71  ? 48.512  139.700 94.322  1.00   97.06  ? 71  DA  I N7    1 
ATOM   1446  C C5    . DA  A 1 71  ? 48.155  140.314 95.512  1.00   88.32  ? 71  DA  I C5    1 
ATOM   1447  C C6    . DA  A 1 71  ? 48.700  141.404 96.222  1.00   85.94  ? 71  DA  I C6    1 
ATOM   1448  N N6    . DA  A 1 71  ? 49.768  142.092 95.806  1.00   91.30  ? 71  DA  I N6    1 
ATOM   1449  N N1    . DA  A 1 71  ? 48.102  141.760 97.377  1.00   81.15  ? 71  DA  I N1    1 
ATOM   1450  C C2    . DA  A 1 71  ? 47.033  141.069 97.790  1.00   87.54  ? 71  DA  I C2    1 
ATOM   1451  N N3    . DA  A 1 71  ? 46.432  140.030 97.211  1.00   88.72  ? 71  DA  I N3    1 
ATOM   1452  C C4    . DA  A 1 71  ? 47.048  139.700 96.065  1.00   83.48  ? 71  DA  I C4    1 
ATOM   1453  P P     . DC  A 1 72  ? 41.483  137.047 94.808  1.00   67.98  ? 72  DC  I P     1 
ATOM   1454  O OP1   . DC  A 1 72  ? 40.414  136.292 95.500  1.00   73.31  ? 72  DC  I OP1   1 
ATOM   1455  O OP2   . DC  A 1 72  ? 41.469  137.164 93.333  1.00   46.18  ? 72  DC  I OP2   1 
ATOM   1456  O "O5'" . DC  A 1 72  ? 41.535  138.533 95.390  1.00   76.71  ? 72  DC  I "O5'" 1 
ATOM   1457  C "C5'" . DC  A 1 72  ? 41.839  138.778 96.766  1.00   91.10  ? 72  DC  I "C5'" 1 
ATOM   1458  C "C4'" . DC  A 1 72  ? 42.043  140.266 96.969  1.00   71.68  ? 72  DC  I "C4'" 1 
ATOM   1459  O "O4'" . DC  A 1 72  ? 43.373  140.670 96.555  1.00   64.63  ? 72  DC  I "O4'" 1 
ATOM   1460  C "C3'" . DC  A 1 72  ? 41.060  141.130 96.180  1.00   82.69  ? 72  DC  I "C3'" 1 
ATOM   1461  O "O3'" . DC  A 1 72  ? 40.404  142.063 97.021  1.00   103.51 ? 72  DC  I "O3'" 1 
ATOM   1462  C "C2'" . DC  A 1 72  ? 41.946  141.859 95.171  1.00   83.90  ? 72  DC  I "C2'" 1 
ATOM   1463  C "C1'" . DC  A 1 72  ? 43.264  141.915 95.917  1.00   59.71  ? 72  DC  I "C1'" 1 
ATOM   1464  N N1    . DC  A 1 72  ? 44.448  142.168 95.056  1.00   71.75  ? 72  DC  I N1    1 
ATOM   1465  C C2    . DC  A 1 72  ? 45.386  143.128 95.452  1.00   82.13  ? 72  DC  I C2    1 
ATOM   1466  O O2    . DC  A 1 72  ? 45.216  143.734 96.518  1.00   67.07  ? 72  DC  I O2    1 
ATOM   1467  N N3    . DC  A 1 72  ? 46.457  143.366 94.657  1.00   92.99  ? 72  DC  I N3    1 
ATOM   1468  C C4    . DC  A 1 72  ? 46.603  142.693 93.515  1.00   98.40  ? 72  DC  I C4    1 
ATOM   1469  N N4    . DC  A 1 72  ? 47.677  142.960 92.766  1.00   102.36 ? 72  DC  I N4    1 
ATOM   1470  C C5    . DC  A 1 72  ? 45.654  141.714 93.092  1.00   94.95  ? 72  DC  I C5    1 
ATOM   1471  C C6    . DC  A 1 72  ? 44.600  141.489 93.884  1.00   84.38  ? 72  DC  I C6    1 
ATOM   1472  P P     . DG  A 1 73  ? 38.981  142.654 96.573  1.00   104.60 ? 73  DG  I P     1 
ATOM   1473  O OP1   . DG  A 1 73  ? 37.974  141.628 96.927  1.00   53.62  ? 73  DG  I OP1   1 
ATOM   1474  O OP2   . DG  A 1 73  ? 39.079  143.155 95.184  1.00   116.92 ? 73  DG  I OP2   1 
ATOM   1475  O "O5'" . DG  A 1 73  ? 38.749  143.904 97.532  1.00   71.50  ? 73  DG  I "O5'" 1 
ATOM   1476  C "C5'" . DG  A 1 73  ? 39.691  144.248 98.536  1.00   89.42  ? 73  DG  I "C5'" 1 
ATOM   1477  C "C4'" . DG  A 1 73  ? 40.437  145.523 98.164  1.00   76.78  ? 73  DG  I "C4'" 1 
ATOM   1478  O "O4'" . DG  A 1 73  ? 41.565  145.245 97.301  1.00   66.61  ? 73  DG  I "O4'" 1 
ATOM   1479  C "C3'" . DG  A 1 73  ? 39.592  146.585 97.443  1.00   104.47 ? 73  DG  I "C3'" 1 
ATOM   1480  O "O3'" . DG  A 1 73  ? 39.583  147.785 98.173  1.00   119.37 ? 73  DG  I "O3'" 1 
ATOM   1481  C "C2'" . DG  A 1 73  ? 40.316  146.774 96.095  1.00   101.82 ? 73  DG  I "C2'" 1 
ATOM   1482  C "C1'" . DG  A 1 73  ? 41.731  146.350 96.450  1.00   89.25  ? 73  DG  I "C1'" 1 
ATOM   1483  N N9    . DG  A 1 73  ? 42.570  145.974 95.310  1.00   96.89  ? 73  DG  I N9    1 
ATOM   1484  C C8    . DG  A 1 73  ? 42.349  144.961 94.412  1.00   95.13  ? 73  DG  I C8    1 
ATOM   1485  N N7    . DG  A 1 73  ? 43.284  144.851 93.508  1.00   88.84  ? 73  DG  I N7    1 
ATOM   1486  C C5    . DG  A 1 73  ? 44.190  145.853 93.830  1.00   93.96  ? 73  DG  I C5    1 
ATOM   1487  C C6    . DG  A 1 73  ? 45.406  146.222 93.202  1.00   98.91  ? 73  DG  I C6    1 
ATOM   1488  O O6    . DG  A 1 73  ? 45.940  145.716 92.205  1.00   100.05 ? 73  DG  I O6    1 
ATOM   1489  N N1    . DG  A 1 73  ? 46.015  147.295 93.848  1.00   89.56  ? 73  DG  I N1    1 
ATOM   1490  C C2    . DG  A 1 73  ? 45.514  147.931 94.959  1.00   100.79 ? 73  DG  I C2    1 
ATOM   1491  N N2    . DG  A 1 73  ? 46.245  148.947 95.441  1.00   97.16  ? 73  DG  I N2    1 
ATOM   1492  N N3    . DG  A 1 73  ? 44.375  147.596 95.557  1.00   98.16  ? 73  DG  I N3    1 
ATOM   1493  C C4    . DG  A 1 73  ? 43.768  146.552 94.939  1.00   91.11  ? 73  DG  I C4    1 
ATOM   1494  P P     . DC  A 1 74  ? 38.568  148.959 97.763  1.00   116.05 ? 74  DC  I P     1 
ATOM   1495  O OP1   . DC  A 1 74  ? 38.101  149.614 99.006  1.00   127.98 ? 74  DC  I OP1   1 
ATOM   1496  O OP2   . DC  A 1 74  ? 37.582  148.396 96.812  1.00   88.84  ? 74  DC  I OP2   1 
ATOM   1497  O "O5'" . DC  A 1 74  ? 39.497  149.974 96.951  1.00   83.54  ? 74  DC  I "O5'" 1 
ATOM   1498  C "C5'" . DC  A 1 74  ? 40.583  150.609 97.598  1.00   81.67  ? 74  DC  I "C5'" 1 
ATOM   1499  C "C4'" . DC  A 1 74  ? 41.347  151.487 96.629  1.00   82.29  ? 74  DC  I "C4'" 1 
ATOM   1500  O "O4'" . DC  A 1 74  ? 42.154  150.652 95.750  1.00   97.54  ? 74  DC  I "O4'" 1 
ATOM   1501  C "C3'" . DC  A 1 74  ? 40.471  152.336 95.701  1.00   114.89 ? 74  DC  I "C3'" 1 
ATOM   1502  O "O3'" . DC  A 1 74  ? 41.036  153.625 95.568  1.00   124.34 ? 74  DC  I "O3'" 1 
ATOM   1503  C "C2'" . DC  A 1 74  ? 40.533  151.570 94.384  1.00   94.90  ? 74  DC  I "C2'" 1 
ATOM   1504  C "C1'" . DC  A 1 74  ? 41.968  151.090 94.425  1.00   108.82 ? 74  DC  I "C1'" 1 
ATOM   1505  N N1    . DC  A 1 74  ? 42.252  149.962 93.489  1.00   110.62 ? 74  DC  I N1    1 
ATOM   1506  C C2    . DC  A 1 74  ? 43.406  149.995 92.696  1.00   102.85 ? 74  DC  I C2    1 
ATOM   1507  O O2    . DC  A 1 74  ? 44.180  150.956 92.797  1.00   95.71  ? 74  DC  I O2    1 
ATOM   1508  N N3    . DC  A 1 74  ? 43.647  148.967 91.845  1.00   93.19  ? 74  DC  I N3    1 
ATOM   1509  C C4    . DC  A 1 74  ? 42.788  147.950 91.767  1.00   87.96  ? 74  DC  I C4    1 
ATOM   1510  N N4    . DC  A 1 74  ? 43.069  146.960 90.913  1.00   89.63  ? 74  DC  I N4    1 
ATOM   1511  C C5    . DC  A 1 74  ? 41.605  147.901 92.561  1.00   91.14  ? 74  DC  I C5    1 
ATOM   1512  C C6    . DC  A 1 74  ? 41.377  148.920 93.398  1.00   96.26  ? 74  DC  I C6    1 
ATOM   1513  P P     . DA  A 1 75  ? 40.091  154.911 95.388  1.00   123.21 ? 75  DA  I P     1 
ATOM   1514  O OP1   . DA  A 1 75  ? 40.107  155.664 96.662  1.00   118.30 ? 75  DA  I OP1   1 
ATOM   1515  O OP2   . DA  A 1 75  ? 38.805  154.453 94.814  1.00   94.52  ? 75  DA  I OP2   1 
ATOM   1516  O "O5'" . DA  A 1 75  ? 40.846  155.768 94.275  1.00   99.32  ? 75  DA  I "O5'" 1 
ATOM   1517  C "C5'" . DA  A 1 75  ? 42.266  155.820 94.267  1.00   98.89  ? 75  DA  I "C5'" 1 
ATOM   1518  C "C4'" . DA  A 1 75  ? 42.776  156.068 92.863  1.00   115.10 ? 75  DA  I "C4'" 1 
ATOM   1519  O "O4'" . DA  A 1 75  ? 43.098  154.800 92.230  1.00   98.10  ? 75  DA  I "O4'" 1 
ATOM   1520  C "C3'" . DA  A 1 75  ? 41.774  156.763 91.936  1.00   129.27 ? 75  DA  I "C3'" 1 
ATOM   1521  O "O3'" . DA  A 1 75  ? 42.431  157.754 91.164  1.00   141.16 ? 75  DA  I "O3'" 1 
ATOM   1522  C "C2'" . DA  A 1 75  ? 41.269  155.622 91.058  1.00   115.20 ? 75  DA  I "C2'" 1 
ATOM   1523  C "C1'" . DA  A 1 75  ? 42.520  154.772 90.947  1.00   113.09 ? 75  DA  I "C1'" 1 
ATOM   1524  N N9    . DA  A 1 75  ? 42.257  153.386 90.572  1.00   102.91 ? 75  DA  I N9    1 
ATOM   1525  C C8    . DA  A 1 75  ? 41.241  152.588 91.017  1.00   96.28  ? 75  DA  I C8    1 
ATOM   1526  N N7    . DA  A 1 75  ? 41.250  151.382 90.500  1.00   79.89  ? 75  DA  I N7    1 
ATOM   1527  C C5    . DA  A 1 75  ? 42.348  151.392 89.656  1.00   99.59  ? 75  DA  I C5    1 
ATOM   1528  C C6    . DA  A 1 75  ? 42.907  150.410 88.813  1.00   113.97 ? 75  DA  I C6    1 
ATOM   1529  N N6    . DA  A 1 75  ? 42.404  149.178 88.680  1.00   111.75 ? 75  DA  I N6    1 
ATOM   1530  N N1    . DA  A 1 75  ? 44.006  150.747 88.104  1.00   110.97 ? 75  DA  I N1    1 
ATOM   1531  C C2    . DA  A 1 75  ? 44.507  151.982 88.237  1.00   116.30 ? 75  DA  I C2    1 
ATOM   1532  N N3    . DA  A 1 75  ? 44.070  152.986 88.998  1.00   102.53 ? 75  DA  I N3    1 
ATOM   1533  C C4    . DA  A 1 75  ? 42.978  152.621 89.688  1.00   99.73  ? 75  DA  I C4    1 
ATOM   1534  P P     . DC  A 1 76  ? 41.614  159.023 90.615  1.00   143.02 ? 76  DC  I P     1 
ATOM   1535  O OP1   . DC  A 1 76  ? 41.762  160.111 91.607  1.00   136.06 ? 76  DC  I OP1   1 
ATOM   1536  O OP2   . DC  A 1 76  ? 40.262  158.557 90.230  1.00   96.71  ? 76  DC  I OP2   1 
ATOM   1537  O "O5'" . DC  A 1 76  ? 42.393  159.426 89.277  1.00   126.21 ? 76  DC  I "O5'" 1 
ATOM   1538  C "C5'" . DC  A 1 76  ? 43.808  159.568 89.295  1.00   97.93  ? 76  DC  I "C5'" 1 
ATOM   1539  C "C4'" . DC  A 1 76  ? 44.443  158.748 88.188  1.00   103.62 ? 76  DC  I "C4'" 1 
ATOM   1540  O "O4'" . DC  A 1 76  ? 43.972  157.394 88.273  1.00   117.62 ? 76  DC  I "O4'" 1 
ATOM   1541  C "C3'" . DC  A 1 76  ? 44.094  159.199 86.774  1.00   82.84  ? 76  DC  I "C3'" 1 
ATOM   1542  O "O3'" . DC  A 1 76  ? 45.125  160.034 86.263  1.00   75.21  ? 76  DC  I "O3'" 1 
ATOM   1543  C "C2'" . DC  A 1 76  ? 43.983  157.891 85.969  1.00   95.02  ? 76  DC  I "C2'" 1 
ATOM   1544  C "C1'" . DC  A 1 76  ? 44.132  156.787 87.018  1.00   111.49 ? 76  DC  I "C1'" 1 
ATOM   1545  N N1    . DC  A 1 76  ? 43.121  155.704 86.887  1.00   99.67  ? 76  DC  I N1    1 
ATOM   1546  C C2    . DC  A 1 76  ? 43.369  154.623 86.036  1.00   92.14  ? 76  DC  I C2    1 
ATOM   1547  O O2    . DC  A 1 76  ? 44.430  154.586 85.401  1.00   92.76  ? 76  DC  I O2    1 
ATOM   1548  N N3    . DC  A 1 76  ? 42.438  153.645 85.930  1.00   90.27  ? 76  DC  I N3    1 
ATOM   1549  C C4    . DC  A 1 76  ? 41.308  153.720 86.634  1.00   102.52 ? 76  DC  I C4    1 
ATOM   1550  N N4    . DC  A 1 76  ? 40.418  152.732 86.495  1.00   109.68 ? 76  DC  I N4    1 
ATOM   1551  C C5    . DC  A 1 76  ? 41.036  154.815 87.505  1.00   110.04 ? 76  DC  I C5    1 
ATOM   1552  C C6    . DC  A 1 76  ? 41.961  155.774 87.599  1.00   108.89 ? 76  DC  I C6    1 
ATOM   1553  P P     . DG  A 1 77  ? 44.828  161.019 85.028  1.00   97.48  ? 77  DG  I P     1 
ATOM   1554  O OP1   . DG  A 1 77  ? 45.964  161.960 84.918  1.00   99.76  ? 77  DG  I OP1   1 
ATOM   1555  O OP2   . DG  A 1 77  ? 43.449  161.535 85.185  1.00   112.54 ? 77  DG  I OP2   1 
ATOM   1556  O "O5'" . DG  A 1 77  ? 44.839  160.058 83.751  1.00   96.82  ? 77  DG  I "O5'" 1 
ATOM   1557  C "C5'" . DG  A 1 77  ? 46.048  159.434 83.337  1.00   84.52  ? 77  DG  I "C5'" 1 
ATOM   1558  C "C4'" . DG  A 1 77  ? 45.802  158.510 82.156  1.00   85.59  ? 77  DG  I "C4'" 1 
ATOM   1559  O "O4'" . DG  A 1 77  ? 44.941  157.413 82.563  1.00   103.10 ? 77  DG  I "O4'" 1 
ATOM   1560  C "C3'" . DG  A 1 77  ? 45.112  159.159 80.957  1.00   75.13  ? 77  DG  I "C3'" 1 
ATOM   1561  O "O3'" . DG  A 1 77  ? 45.630  158.614 79.759  1.00   69.79  ? 77  DG  I "O3'" 1 
ATOM   1562  C "C2'" . DG  A 1 77  ? 43.654  158.764 81.157  1.00   67.23  ? 77  DG  I "C2'" 1 
ATOM   1563  C "C1'" . DG  A 1 77  ? 43.807  157.364 81.723  1.00   85.04  ? 77  DG  I "C1'" 1 
ATOM   1564  N N9    . DG  A 1 77  ? 42.663  156.928 82.516  1.00   96.18  ? 77  DG  I N9    1 
ATOM   1565  C C8    . DG  A 1 77  ? 41.910  157.694 83.372  1.00   92.94  ? 77  DG  I C8    1 
ATOM   1566  N N7    . DG  A 1 77  ? 40.948  157.032 83.951  1.00   98.08  ? 77  DG  I N7    1 
ATOM   1567  C C5    . DG  A 1 77  ? 41.069  155.744 83.445  1.00   107.90 ? 77  DG  I C5    1 
ATOM   1568  C C6    . DG  A 1 77  ? 40.302  154.586 83.710  1.00   105.83 ? 77  DG  I C6    1 
ATOM   1569  O O6    . DG  A 1 77  ? 39.326  154.466 84.463  1.00   110.80 ? 77  DG  I O6    1 
ATOM   1570  N N1    . DG  A 1 77  ? 40.759  153.488 82.984  1.00   96.83  ? 77  DG  I N1    1 
ATOM   1571  C C2    . DG  A 1 77  ? 41.826  153.508 82.118  1.00   107.61 ? 77  DG  I C2    1 
ATOM   1572  N N2    . DG  A 1 77  ? 42.120  152.349 81.510  1.00   119.26 ? 77  DG  I N2    1 
ATOM   1573  N N3    . DG  A 1 77  ? 42.556  154.586 81.863  1.00   94.92  ? 77  DG  I N3    1 
ATOM   1574  C C4    . DG  A 1 77  ? 42.121  155.664 82.560  1.00   101.02 ? 77  DG  I C4    1 
ATOM   1575  P P     . DT  A 1 78  ? 45.493  159.415 78.373  1.00   114.84 ? 78  DT  I P     1 
ATOM   1576  O OP1   . DT  A 1 78  ? 46.484  160.516 78.382  1.00   54.37  ? 78  DT  I OP1   1 
ATOM   1577  O OP2   . DT  A 1 78  ? 44.059  159.719 78.160  1.00   104.01 ? 78  DT  I OP2   1 
ATOM   1578  O "O5'" . DT  A 1 78  ? 45.916  158.332 77.277  1.00   109.03 ? 78  DT  I "O5'" 1 
ATOM   1579  C "C5'" . DT  A 1 78  ? 46.539  157.121 77.688  1.00   60.34  ? 78  DT  I "C5'" 1 
ATOM   1580  C "C4'" . DT  A 1 78  ? 45.697  155.919 77.297  1.00   89.16  ? 78  DT  I "C4'" 1 
ATOM   1581  O "O4'" . DT  A 1 78  ? 44.558  155.798 78.191  1.00   103.96 ? 78  DT  I "O4'" 1 
ATOM   1582  C "C3'" . DT  A 1 78  ? 45.120  155.966 75.878  1.00   109.73 ? 78  DT  I "C3'" 1 
ATOM   1583  O "O3'" . DT  A 1 78  ? 45.354  154.730 75.228  1.00   107.13 ? 78  DT  I "O3'" 1 
ATOM   1584  C "C2'" . DT  A 1 78  ? 43.625  156.200 76.107  1.00   99.06  ? 78  DT  I "C2'" 1 
ATOM   1585  C "C1'" . DT  A 1 78  ? 43.416  155.491 77.431  1.00   85.68  ? 78  DT  I "C1'" 1 
ATOM   1586  N N1    . DT  A 1 78  ? 42.205  155.948 78.175  1.00   94.07  ? 78  DT  I N1    1 
ATOM   1587  C C2    . DT  A 1 78  ? 41.338  155.010 78.690  1.00   96.56  ? 78  DT  I C2    1 
ATOM   1588  O O2    . DT  A 1 78  ? 41.507  153.809 78.573  1.00   96.63  ? 78  DT  I O2    1 
ATOM   1589  N N3    . DT  A 1 78  ? 40.259  155.530 79.354  1.00   89.04  ? 78  DT  I N3    1 
ATOM   1590  C C4    . DT  A 1 78  ? 39.964  156.868 79.549  1.00   110.28 ? 78  DT  I C4    1 
ATOM   1591  O O4    . DT  A 1 78  ? 38.966  157.237 80.161  1.00   107.57 ? 78  DT  I O4    1 
ATOM   1592  C C5    . DT  A 1 78  ? 40.913  157.799 78.981  1.00   113.02 ? 78  DT  I C5    1 
ATOM   1593  C C7    . DT  A 1 78  ? 40.699  159.278 79.128  1.00   107.48 ? 78  DT  I C7    1 
ATOM   1594  C C6    . DT  A 1 78  ? 41.974  157.300 78.329  1.00   95.30  ? 78  DT  I C6    1 
ATOM   1595  P P     . DA  A 1 79  ? 46.136  154.683 73.827  1.00   98.47  ? 79  DA  I P     1 
ATOM   1596  O OP1   . DA  A 1 79  ? 47.525  154.254 74.100  1.00   101.25 ? 79  DA  I OP1   1 
ATOM   1597  O OP2   . DA  A 1 79  ? 45.883  155.958 73.119  1.00   85.18  ? 79  DA  I OP2   1 
ATOM   1598  O "O5'" . DA  A 1 79  ? 45.390  153.521 73.027  1.00   88.92  ? 79  DA  I "O5'" 1 
ATOM   1599  C "C5'" . DA  A 1 79  ? 45.069  152.307 73.688  1.00   84.59  ? 79  DA  I "C5'" 1 
ATOM   1600  C "C4'" . DA  A 1 79  ? 43.647  151.882 73.373  1.00   102.87 ? 79  DA  I "C4'" 1 
ATOM   1601  O "O4'" . DA  A 1 79  ? 42.709  152.690 74.136  1.00   99.02  ? 79  DA  I "O4'" 1 
ATOM   1602  C "C3'" . DA  A 1 79  ? 43.234  152.034 71.904  1.00   101.01 ? 79  DA  I "C3'" 1 
ATOM   1603  O "O3'" . DA  A 1 79  ? 42.417  150.941 71.523  1.00   87.18  ? 79  DA  I "O3'" 1 
ATOM   1604  C "C2'" . DA  A 1 79  ? 42.421  153.326 71.927  1.00   107.93 ? 79  DA  I "C2'" 1 
ATOM   1605  C "C1'" . DA  A 1 79  ? 41.717  153.170 73.261  1.00   96.69  ? 79  DA  I "C1'" 1 
ATOM   1606  N N9    . DA  A 1 79  ? 41.164  154.411 73.798  1.00   101.45 ? 79  DA  I N9    1 
ATOM   1607  C C8    . DA  A 1 79  ? 41.436  155.686 73.386  1.00   92.52  ? 79  DA  I C8    1 
ATOM   1608  N N7    . DA  A 1 79  ? 40.781  156.608 74.054  1.00   86.51  ? 79  DA  I N7    1 
ATOM   1609  C C5    . DA  A 1 79  ? 40.025  155.886 74.964  1.00   92.95  ? 79  DA  I C5    1 
ATOM   1610  C C6    . DA  A 1 79  ? 39.114  156.277 75.964  1.00   93.53  ? 79  DA  I C6    1 
ATOM   1611  N N6    . DA  A 1 79  ? 38.801  157.552 76.217  1.00   100.13 ? 79  DA  I N6    1 
ATOM   1612  N N1    . DA  A 1 79  ? 38.533  155.302 76.696  1.00   93.14  ? 79  DA  I N1    1 
ATOM   1613  C C2    . DA  A 1 79  ? 38.848  154.028 76.440  1.00   79.89  ? 79  DA  I C2    1 
ATOM   1614  N N3    . DA  A 1 79  ? 39.687  153.539 75.530  1.00   76.01  ? 79  DA  I N3    1 
ATOM   1615  C C4    . DA  A 1 79  ? 40.248  154.530 74.818  1.00   94.11  ? 79  DA  I C4    1 
ATOM   1616  P P     . DC  A 1 80  ? 43.055  149.566 70.988  1.00   93.70  ? 80  DC  I P     1 
ATOM   1617  O OP1   . DC  A 1 80  ? 44.222  149.216 71.828  1.00   76.25  ? 80  DC  I OP1   1 
ATOM   1618  O OP2   . DC  A 1 80  ? 43.223  149.689 69.523  1.00   112.42 ? 80  DC  I OP2   1 
ATOM   1619  O "O5'" . DC  A 1 80  ? 41.893  148.509 71.278  1.00   90.41  ? 80  DC  I "O5'" 1 
ATOM   1620  C "C5'" . DC  A 1 80  ? 41.479  148.293 72.617  1.00   75.63  ? 80  DC  I "C5'" 1 
ATOM   1621  C "C4'" . DC  A 1 80  ? 39.969  148.362 72.745  1.00   66.02  ? 80  DC  I "C4'" 1 
ATOM   1622  O "O4'" . DC  A 1 80  ? 39.586  149.747 72.990  1.00   90.40  ? 80  DC  I "O4'" 1 
ATOM   1623  C "C3'" . DC  A 1 80  ? 39.163  147.936 71.504  1.00   51.71  ? 80  DC  I "C3'" 1 
ATOM   1624  O "O3'" . DC  A 1 80  ? 38.047  147.163 71.912  1.00   50.44  ? 80  DC  I "O3'" 1 
ATOM   1625  C "C2'" . DC  A 1 80  ? 38.711  149.283 70.952  1.00   80.25  ? 80  DC  I "C2'" 1 
ATOM   1626  C "C1'" . DC  A 1 80  ? 38.419  149.986 72.258  1.00   87.41  ? 80  DC  I "C1'" 1 
ATOM   1627  N N1    . DC  A 1 80  ? 38.245  151.463 72.113  1.00   84.44  ? 80  DC  I N1    1 
ATOM   1628  C C2    . DC  A 1 80  ? 37.361  152.147 72.960  1.00   80.59  ? 80  DC  I C2    1 
ATOM   1629  O O2    . DC  A 1 80  ? 36.744  151.516 73.827  1.00   69.55  ? 80  DC  I O2    1 
ATOM   1630  N N3    . DC  A 1 80  ? 37.216  153.488 72.810  1.00   67.65  ? 80  DC  I N3    1 
ATOM   1631  C C4    . DC  A 1 80  ? 37.902  154.132 71.865  1.00   73.73  ? 80  DC  I C4    1 
ATOM   1632  N N4    . DC  A 1 80  ? 37.723  155.452 71.753  1.00   63.12  ? 80  DC  I N4    1 
ATOM   1633  C C5    . DC  A 1 80  ? 38.799  153.452 70.991  1.00   87.24  ? 80  DC  I C5    1 
ATOM   1634  C C6    . DC  A 1 80  ? 38.938  152.132 71.147  1.00   73.12  ? 80  DC  I C6    1 
ATOM   1635  P P     . DG  A 1 81  ? 37.404  146.072 70.922  1.00   57.02  ? 81  DG  I P     1 
ATOM   1636  O OP1   . DG  A 1 81  ? 37.919  144.737 71.298  1.00   56.64  ? 81  DG  I OP1   1 
ATOM   1637  O OP2   . DG  A 1 81  ? 37.562  146.577 69.539  1.00   43.61  ? 81  DG  I OP2   1 
ATOM   1638  O "O5'" . DG  A 1 81  ? 35.850  146.106 71.279  1.00   58.16  ? 81  DG  I "O5'" 1 
ATOM   1639  C "C5'" . DG  A 1 81  ? 35.431  146.335 72.619  1.00   70.53  ? 81  DG  I "C5'" 1 
ATOM   1640  C "C4'" . DG  A 1 81  ? 34.085  147.029 72.633  1.00   74.92  ? 81  DG  I "C4'" 1 
ATOM   1641  O "O4'" . DG  A 1 81  ? 34.279  148.468 72.535  1.00   72.10  ? 81  DG  I "O4'" 1 
ATOM   1642  C "C3'" . DG  A 1 81  ? 33.172  146.644 71.472  1.00   66.05  ? 81  DG  I "C3'" 1 
ATOM   1643  O "O3'" . DG  A 1 81  ? 31.831  146.535 71.908  1.00   50.83  ? 81  DG  I "O3'" 1 
ATOM   1644  C "C2'" . DG  A 1 81  ? 33.350  147.800 70.497  1.00   72.02  ? 81  DG  I "C2'" 1 
ATOM   1645  C "C1'" . DG  A 1 81  ? 33.536  148.972 71.446  1.00   61.47  ? 81  DG  I "C1'" 1 
ATOM   1646  N N9    . DG  A 1 81  ? 34.273  150.076 70.846  1.00   57.11  ? 81  DG  I N9    1 
ATOM   1647  C C8    . DG  A 1 81  ? 35.300  149.984 69.939  1.00   72.72  ? 81  DG  I C8    1 
ATOM   1648  N N7    . DG  A 1 81  ? 35.770  151.141 69.566  1.00   76.58  ? 81  DG  I N7    1 
ATOM   1649  C C5    . DG  A 1 81  ? 35.003  152.061 70.267  1.00   89.79  ? 81  DG  I C5    1 
ATOM   1650  C C6    . DG  A 1 81  ? 35.053  153.474 70.270  1.00   91.99  ? 81  DG  I C6    1 
ATOM   1651  O O6    . DG  A 1 81  ? 35.812  154.216 69.631  1.00   100.96 ? 81  DG  I O6    1 
ATOM   1652  N N1    . DG  A 1 81  ? 34.100  154.022 71.125  1.00   76.24  ? 81  DG  I N1    1 
ATOM   1653  C C2    . DG  A 1 81  ? 33.210  153.295 71.880  1.00   81.01  ? 81  DG  I C2    1 
ATOM   1654  N N2    . DG  A 1 81  ? 32.366  154.001 72.644  1.00   101.06 ? 81  DG  I N2    1 
ATOM   1655  N N3    . DG  A 1 81  ? 33.152  151.968 71.886  1.00   79.06  ? 81  DG  I N3    1 
ATOM   1656  C C4    . DG  A 1 81  ? 34.074  151.420 71.059  1.00   78.91  ? 81  DG  I C4    1 
ATOM   1657  P P     . DC  A 1 82  ? 30.754  145.780 70.988  1.00   84.55  ? 82  DC  I P     1 
ATOM   1658  O OP1   . DC  A 1 82  ? 30.213  144.666 71.799  1.00   75.07  ? 82  DC  I OP1   1 
ATOM   1659  O OP2   . DC  A 1 82  ? 31.360  145.503 69.667  1.00   100.69 ? 82  DC  I OP2   1 
ATOM   1660  O "O5'" . DC  A 1 82  ? 29.594  146.858 70.798  1.00   69.50  ? 82  DC  I "O5'" 1 
ATOM   1661  C "C5'" . DC  A 1 82  ? 28.961  147.348 71.941  1.00   71.10  ? 82  DC  I "C5'" 1 
ATOM   1662  C "C4'" . DC  A 1 82  ? 28.299  148.696 71.724  1.00   98.05  ? 82  DC  I "C4'" 1 
ATOM   1663  O "O4'" . DC  A 1 82  ? 29.317  149.700 71.438  1.00   87.82  ? 82  DC  I "O4'" 1 
ATOM   1664  C "C3'" . DC  A 1 82  ? 27.309  148.758 70.557  1.00   96.26  ? 82  DC  I "C3'" 1 
ATOM   1665  O "O3'" . DC  A 1 82  ? 26.099  149.312 71.021  1.00   81.57  ? 82  DC  I "O3'" 1 
ATOM   1666  C "C2'" . DC  A 1 82  ? 27.987  149.625 69.499  1.00   64.44  ? 82  DC  I "C2'" 1 
ATOM   1667  C "C1'" . DC  A 1 82  ? 28.940  150.477 70.317  1.00   73.05  ? 82  DC  I "C1'" 1 
ATOM   1668  N N1    . DC  A 1 82  ? 30.161  150.863 69.549  1.00   76.45  ? 82  DC  I N1    1 
ATOM   1669  C C2    . DC  A 1 82  ? 30.382  152.208 69.224  1.00   93.64  ? 82  DC  I C2    1 
ATOM   1670  O O2    . DC  A 1 82  ? 29.585  153.065 69.628  1.00   87.50  ? 82  DC  I O2    1 
ATOM   1671  N N3    . DC  A 1 82  ? 31.488  152.539 68.508  1.00   90.93  ? 82  DC  I N3    1 
ATOM   1672  C C4    . DC  A 1 82  ? 32.327  151.587 68.098  1.00   78.87  ? 82  DC  I C4    1 
ATOM   1673  N N4    . DC  A 1 82  ? 33.398  151.958 67.390  1.00   72.20  ? 82  DC  I N4    1 
ATOM   1674  C C5    . DC  A 1 82  ? 32.103  150.211 68.395  1.00   84.87  ? 82  DC  I C5    1 
ATOM   1675  C C6    . DC  A 1 82  ? 31.013  149.897 69.106  1.00   75.96  ? 82  DC  I C6    1 
ATOM   1676  P P     . DG  A 1 83  ? 24.748  149.201 70.162  1.00   110.95 ? 83  DG  I P     1 
ATOM   1677  O OP1   . DG  A 1 83  ? 23.604  149.091 71.094  1.00   117.31 ? 83  DG  I OP1   1 
ATOM   1678  O OP2   . DG  A 1 83  ? 24.973  148.163 69.128  1.00   55.39  ? 83  DG  I OP2   1 
ATOM   1679  O "O5'" . DG  A 1 83  ? 24.686  150.603 69.401  1.00   94.13  ? 83  DG  I "O5'" 1 
ATOM   1680  C "C5'" . DG  A 1 83  ? 24.635  151.760 70.225  1.00   77.12  ? 83  DG  I "C5'" 1 
ATOM   1681  C "C4'" . DG  A 1 83  ? 24.634  153.063 69.455  1.00   72.59  ? 83  DG  I "C4'" 1 
ATOM   1682  O "O4'" . DG  A 1 83  ? 25.958  153.366 68.956  1.00   64.82  ? 83  DG  I "O4'" 1 
ATOM   1683  C "C3'" . DG  A 1 83  ? 23.683  153.100 68.264  1.00   92.78  ? 83  DG  I "C3'" 1 
ATOM   1684  O "O3'" . DG  A 1 83  ? 22.790  154.189 68.448  1.00   107.99 ? 83  DG  I "O3'" 1 
ATOM   1685  C "C2'" . DG  A 1 83  ? 24.576  153.285 67.030  1.00   76.57  ? 83  DG  I "C2'" 1 
ATOM   1686  C "C1'" . DG  A 1 83  ? 25.902  153.769 67.605  1.00   69.79  ? 83  DG  I "C1'" 1 
ATOM   1687  N N9    . DG  A 1 83  ? 27.077  153.265 66.900  1.00   70.34  ? 83  DG  I N9    1 
ATOM   1688  C C8    . DG  A 1 83  ? 27.373  151.959 66.600  1.00   84.64  ? 83  DG  I C8    1 
ATOM   1689  N N7    . DG  A 1 83  ? 28.508  151.817 65.970  1.00   83.71  ? 83  DG  I N7    1 
ATOM   1690  C C5    . DG  A 1 83  ? 29.004  153.109 65.867  1.00   81.44  ? 83  DG  I C5    1 
ATOM   1691  C C6    . DG  A 1 83  ? 30.205  153.583 65.287  1.00   94.98  ? 83  DG  I C6    1 
ATOM   1692  O O6    . DG  A 1 83  ? 31.099  152.929 64.733  1.00   107.13 ? 83  DG  I O6    1 
ATOM   1693  N N1    . DG  A 1 83  ? 30.322  154.967 65.398  1.00   79.51  ? 83  DG  I N1    1 
ATOM   1694  C C2    . DG  A 1 83  ? 29.394  155.787 65.994  1.00   78.61  ? 83  DG  I C2    1 
ATOM   1695  N N2    . DG  A 1 83  ? 29.679  157.098 66.006  1.00   94.61  ? 83  DG  I N2    1 
ATOM   1696  N N3    . DG  A 1 83  ? 28.266  155.356 66.541  1.00   82.77  ? 83  DG  I N3    1 
ATOM   1697  C C4    . DG  A 1 83  ? 28.138  154.011 66.440  1.00   77.53  ? 83  DG  I C4    1 
ATOM   1698  P P     . DC  A 1 84  ? 21.515  154.398 67.498  1.00   87.61  ? 84  DC  I P     1 
ATOM   1699  O OP1   . DC  A 1 84  ? 20.507  155.158 68.271  1.00   91.75  ? 84  DC  I OP1   1 
ATOM   1700  O OP2   . DC  A 1 84  ? 21.155  153.091 66.904  1.00   64.27  ? 84  DC  I OP2   1 
ATOM   1701  O "O5'" . DC  A 1 84  ? 22.089  155.331 66.339  1.00   91.18  ? 84  DC  I "O5'" 1 
ATOM   1702  C "C5'" . DC  A 1 84  ? 22.682  156.578 66.681  1.00   74.15  ? 84  DC  I "C5'" 1 
ATOM   1703  C "C4'" . DC  A 1 84  ? 23.328  157.208 65.468  1.00   76.91  ? 84  DC  I "C4'" 1 
ATOM   1704  O "O4'" . DC  A 1 84  ? 24.557  156.520 65.151  1.00   75.84  ? 84  DC  I "O4'" 1 
ATOM   1705  C "C3'" . DC  A 1 84  ? 22.474  157.167 64.199  1.00   93.16  ? 84  DC  I "C3'" 1 
ATOM   1706  O "O3'" . DC  A 1 84  ? 22.105  158.497 63.841  1.00   96.67  ? 84  DC  I "O3'" 1 
ATOM   1707  C "C2'" . DC  A 1 84  ? 23.371  156.502 63.140  1.00   95.50  ? 84  DC  I "C2'" 1 
ATOM   1708  C "C1'" . DC  A 1 84  ? 24.756  156.587 63.765  1.00   98.05  ? 84  DC  I "C1'" 1 
ATOM   1709  N N1    . DC  A 1 84  ? 25.673  155.483 63.356  1.00   90.01  ? 84  DC  I N1    1 
ATOM   1710  C C2    . DC  A 1 84  ? 27.001  155.775 63.022  1.00   91.77  ? 84  DC  I C2    1 
ATOM   1711  O O2    . DC  A 1 84  ? 27.384  156.952 63.046  1.00   89.13  ? 84  DC  I O2    1 
ATOM   1712  N N3    . DC  A 1 84  ? 27.823  154.761 62.655  1.00   83.21  ? 84  DC  I N3    1 
ATOM   1713  C C4    . DC  A 1 84  ? 27.369  153.507 62.636  1.00   84.14  ? 84  DC  I C4    1 
ATOM   1714  N N4    . DC  A 1 84  ? 28.217  152.541 62.274  1.00   93.49  ? 84  DC  I N4    1 
ATOM   1715  C C5    . DC  A 1 84  ? 26.024  153.189 62.987  1.00   83.77  ? 84  DC  I C5    1 
ATOM   1716  C C6    . DC  A 1 84  ? 25.220  154.197 63.341  1.00   86.20  ? 84  DC  I C6    1 
ATOM   1717  P P     . DT  A 1 85  ? 21.244  158.783 62.516  1.00   99.47  ? 85  DT  I P     1 
ATOM   1718  O OP1   . DT  A 1 85  ? 20.604  160.106 62.688  1.00   112.41 ? 85  DT  I OP1   1 
ATOM   1719  O OP2   . DT  A 1 85  ? 20.411  157.590 62.241  1.00   65.31  ? 85  DT  I OP2   1 
ATOM   1720  O "O5'" . DT  A 1 85  ? 22.350  158.903 61.367  1.00   83.33  ? 85  DT  I "O5'" 1 
ATOM   1721  C "C5'" . DT  A 1 85  ? 23.513  159.691 61.584  1.00   75.85  ? 85  DT  I "C5'" 1 
ATOM   1722  C "C4'" . DT  A 1 85  ? 24.443  159.609 60.390  1.00   94.29  ? 85  DT  I "C4'" 1 
ATOM   1723  O "O4'" . DT  A 1 85  ? 25.209  158.386 60.454  1.00   100.17 ? 85  DT  I "O4'" 1 
ATOM   1724  C "C3'" . DT  A 1 85  ? 23.734  159.596 59.033  1.00   102.28 ? 85  DT  I "C3'" 1 
ATOM   1725  O "O3'" . DT  A 1 85  ? 24.106  160.732 58.276  1.00   83.26  ? 85  DT  I "O3'" 1 
ATOM   1726  C "C2'" . DT  A 1 85  ? 24.195  158.294 58.363  1.00   94.70  ? 85  DT  I "C2'" 1 
ATOM   1727  C "C1'" . DT  A 1 85  ? 25.449  157.942 59.145  1.00   95.20  ? 85  DT  I "C1'" 1 
ATOM   1728  N N1    . DT  A 1 85  ? 25.726  156.482 59.182  1.00   90.62  ? 85  DT  I N1    1 
ATOM   1729  C C2    . DT  A 1 85  ? 26.948  156.016 58.751  1.00   84.66  ? 85  DT  I C2    1 
ATOM   1730  O O2    . DT  A 1 85  ? 27.834  156.745 58.342  1.00   89.40  ? 85  DT  I O2    1 
ATOM   1731  N N3    . DT  A 1 85  ? 27.099  154.658 58.822  1.00   74.16  ? 85  DT  I N3    1 
ATOM   1732  C C4    . DT  A 1 85  ? 26.169  153.737 59.268  1.00   74.03  ? 85  DT  I C4    1 
ATOM   1733  O O4    . DT  A 1 85  ? 26.398  152.533 59.293  1.00   70.03  ? 85  DT  I O4    1 
ATOM   1734  C C5    . DT  A 1 85  ? 24.907  154.291 59.701  1.00   86.67  ? 85  DT  I C5    1 
ATOM   1735  C C7    . DT  A 1 85  ? 23.819  153.389 60.203  1.00   90.82  ? 85  DT  I C7    1 
ATOM   1736  C C6    . DT  A 1 85  ? 24.749  155.621 59.636  1.00   79.92  ? 85  DT  I C6    1 
ATOM   1737  P P     . DG  A 1 86  ? 23.328  161.069 56.913  1.00   96.04  ? 86  DG  I P     1 
ATOM   1738  O OP1   . DG  A 1 86  ? 23.320  162.538 56.757  1.00   114.24 ? 86  DG  I OP1   1 
ATOM   1739  O OP2   . DG  A 1 86  ? 22.050  160.321 56.920  1.00   87.23  ? 86  DG  I OP2   1 
ATOM   1740  O "O5'" . DG  A 1 86  ? 24.257  160.437 55.780  1.00   47.87  ? 86  DG  I "O5'" 1 
ATOM   1741  C "C5'" . DG  A 1 86  ? 25.570  160.927 55.598  1.00   68.83  ? 86  DG  I "C5'" 1 
ATOM   1742  C "C4'" . DG  A 1 86  ? 26.312  160.091 54.577  1.00   89.56  ? 86  DG  I "C4'" 1 
ATOM   1743  O "O4'" . DG  A 1 86  ? 26.561  158.773 55.123  1.00   102.14 ? 86  DG  I "O4'" 1 
ATOM   1744  C "C3'" . DG  A 1 86  ? 25.570  159.886 53.255  1.00   83.38  ? 86  DG  I "C3'" 1 
ATOM   1745  O "O3'" . DG  A 1 86  ? 26.398  160.280 52.170  1.00   78.44  ? 86  DG  I "O3'" 1 
ATOM   1746  C "C2'" . DG  A 1 86  ? 25.258  158.386 53.224  1.00   91.48  ? 86  DG  I "C2'" 1 
ATOM   1747  C "C1'" . DG  A 1 86  ? 26.322  157.801 54.138  1.00   91.86  ? 86  DG  I "C1'" 1 
ATOM   1748  N N9    . DG  A 1 86  ? 25.894  156.573 54.803  1.00   90.72  ? 86  DG  I N9    1 
ATOM   1749  C C8    . DG  A 1 86  ? 24.737  156.383 55.520  1.00   84.90  ? 86  DG  I C8    1 
ATOM   1750  N N7    . DG  A 1 86  ? 24.618  155.179 56.004  1.00   90.76  ? 86  DG  I N7    1 
ATOM   1751  C C5    . DG  A 1 86  ? 25.770  154.527 55.584  1.00   82.50  ? 86  DG  I C5    1 
ATOM   1752  C C6    . DG  A 1 86  ? 26.197  153.197 55.805  1.00   69.45  ? 86  DG  I C6    1 
ATOM   1753  O O6    . DG  A 1 86  ? 25.622  152.301 56.440  1.00   54.57  ? 86  DG  I O6    1 
ATOM   1754  N N1    . DG  A 1 86  ? 27.425  152.944 55.202  1.00   71.16  ? 86  DG  I N1    1 
ATOM   1755  C C2    . DG  A 1 86  ? 28.149  153.860 54.478  1.00   70.93  ? 86  DG  I C2    1 
ATOM   1756  N N2    . DG  A 1 86  ? 29.313  153.430 53.973  1.00   90.06  ? 86  DG  I N2    1 
ATOM   1757  N N3    . DG  A 1 86  ? 27.762  155.110 54.263  1.00   68.19  ? 86  DG  I N3    1 
ATOM   1758  C C4    . DG  A 1 86  ? 26.567  155.372 54.843  1.00   81.07  ? 86  DG  I C4    1 
ATOM   1759  P P     . DT  A 1 87  ? 25.852  160.222 50.660  1.00   89.54  ? 87  DT  I P     1 
ATOM   1760  O OP1   . DT  A 1 87  ? 26.323  161.449 49.980  1.00   84.94  ? 87  DT  I OP1   1 
ATOM   1761  O OP2   . DT  A 1 87  ? 24.406  159.911 50.678  1.00   86.82  ? 87  DT  I OP2   1 
ATOM   1762  O "O5'" . DT  A 1 87  ? 26.623  158.969 50.039  1.00   106.66 ? 87  DT  I "O5'" 1 
ATOM   1763  C "C5'" . DT  A 1 87  ? 28.042  158.988 49.968  1.00   84.84  ? 87  DT  I "C5'" 1 
ATOM   1764  C "C4'" . DT  A 1 87  ? 28.585  157.642 49.527  1.00   81.64  ? 87  DT  I "C4'" 1 
ATOM   1765  O "O4'" . DT  A 1 87  ? 28.214  156.616 50.484  1.00   83.42  ? 87  DT  I "O4'" 1 
ATOM   1766  C "C3'" . DT  A 1 87  ? 28.083  157.168 48.162  1.00   87.71  ? 87  DT  I "C3'" 1 
ATOM   1767  O "O3'" . DT  A 1 87  ? 29.176  156.736 47.378  1.00   95.40  ? 87  DT  I "O3'" 1 
ATOM   1768  C "C2'" . DT  A 1 87  ? 27.142  156.009 48.501  1.00   87.04  ? 87  DT  I "C2'" 1 
ATOM   1769  C "C1'" . DT  A 1 87  ? 27.740  155.484 49.795  1.00   76.03  ? 87  DT  I "C1'" 1 
ATOM   1770  N N1    . DT  A 1 87  ? 26.761  154.768 50.664  1.00   77.02  ? 87  DT  I N1    1 
ATOM   1771  C C2    . DT  A 1 87  ? 27.063  153.506 51.116  1.00   75.69  ? 87  DT  I C2    1 
ATOM   1772  O O2    . DT  A 1 87  ? 28.101  152.932 50.845  1.00   85.05  ? 87  DT  I O2    1 
ATOM   1773  N N3    . DT  A 1 87  ? 26.100  152.934 51.904  1.00   88.77  ? 87  DT  I N3    1 
ATOM   1774  C C4    . DT  A 1 87  ? 24.889  153.487 52.278  1.00   84.49  ? 87  DT  I C4    1 
ATOM   1775  O O4    . DT  A 1 87  ? 24.087  152.892 52.992  1.00   69.48  ? 87  DT  I O4    1 
ATOM   1776  C C5    . DT  A 1 87  ? 24.634  154.814 51.769  1.00   88.95  ? 87  DT  I C5    1 
ATOM   1777  C C7    . DT  A 1 87  ? 23.353  155.516 52.106  1.00   105.18 ? 87  DT  I C7    1 
ATOM   1778  C C6    . DT  A 1 87  ? 25.571  155.384 50.995  1.00   93.78  ? 87  DT  I C6    1 
ATOM   1779  P P     . DC  A 1 88  ? 29.072  156.731 45.776  1.00   97.40  ? 88  DC  I P     1 
ATOM   1780  O OP1   . DC  A 1 88  ? 30.046  157.718 45.259  1.00   95.53  ? 88  DC  I OP1   1 
ATOM   1781  O OP2   . DC  A 1 88  ? 27.641  156.842 45.412  1.00   98.67  ? 88  DC  I OP2   1 
ATOM   1782  O "O5'" . DC  A 1 88  ? 29.562  155.264 45.381  1.00   103.68 ? 88  DC  I "O5'" 1 
ATOM   1783  C "C5'" . DC  A 1 88  ? 30.627  154.663 46.103  1.00   106.87 ? 88  DC  I "C5'" 1 
ATOM   1784  C "C4'" . DC  A 1 88  ? 30.491  153.153 46.103  1.00   106.15 ? 88  DC  I "C4'" 1 
ATOM   1785  O "O4'" . DC  A 1 88  ? 29.468  152.750 47.054  1.00   92.05  ? 88  DC  I "O4'" 1 
ATOM   1786  C "C3'" . DC  A 1 88  ? 30.085  152.544 44.759  1.00   104.82 ? 88  DC  I "C3'" 1 
ATOM   1787  O "O3'" . DC  A 1 88  ? 30.879  151.406 44.493  1.00   89.85  ? 88  DC  I "O3'" 1 
ATOM   1788  C "C2'" . DC  A 1 88  ? 28.621  152.167 44.973  1.00   93.61  ? 88  DC  I "C2'" 1 
ATOM   1789  C "C1'" . DC  A 1 88  ? 28.625  151.802 46.445  1.00   88.52  ? 88  DC  I "C1'" 1 
ATOM   1790  N N1    . DC  A 1 88  ? 27.282  151.874 47.082  1.00   101.12 ? 88  DC  I N1    1 
ATOM   1791  C C2    . DC  A 1 88  ? 26.838  150.813 47.880  1.00   95.00  ? 88  DC  I C2    1 
ATOM   1792  O O2    . DC  A 1 88  ? 27.577  149.833 48.047  1.00   70.53  ? 88  DC  I O2    1 
ATOM   1793  N N3    . DC  A 1 88  ? 25.610  150.893 48.453  1.00   78.98  ? 88  DC  I N3    1 
ATOM   1794  C C4    . DC  A 1 88  ? 24.847  151.967 48.249  1.00   77.45  ? 88  DC  I C4    1 
ATOM   1795  N N4    . DC  A 1 88  ? 23.646  152.000 48.833  1.00   79.68  ? 88  DC  I N4    1 
ATOM   1796  C C5    . DC  A 1 88  ? 25.281  153.056 47.436  1.00   82.03  ? 88  DC  I C5    1 
ATOM   1797  C C6    . DC  A 1 88  ? 26.492  152.967 46.877  1.00   87.61  ? 88  DC  I C6    1 
ATOM   1798  P P     . DC  A 1 89  ? 31.022  150.848 42.995  1.00   80.71  ? 89  DC  I P     1 
ATOM   1799  O OP1   . DC  A 1 89  ? 32.442  150.987 42.604  1.00   115.61 ? 89  DC  I OP1   1 
ATOM   1800  O OP2   . DC  A 1 89  ? 29.969  151.474 42.165  1.00   71.99  ? 89  DC  I OP2   1 
ATOM   1801  O "O5'" . DC  A 1 89  ? 30.662  149.298 43.139  1.00   112.77 ? 89  DC  I "O5'" 1 
ATOM   1802  C "C5'" . DC  A 1 89  ? 30.955  148.609 44.352  1.00   84.78  ? 89  DC  I "C5'" 1 
ATOM   1803  C "C4'" . DC  A 1 89  ? 29.984  147.462 44.571  1.00   97.91  ? 89  DC  I "C4'" 1 
ATOM   1804  O "O4'" . DC  A 1 89  ? 28.750  147.965 45.156  1.00   106.28 ? 89  DC  I "O4'" 1 
ATOM   1805  C "C3'" . DC  A 1 89  ? 29.570  146.712 43.302  1.00   118.36 ? 89  DC  I "C3'" 1 
ATOM   1806  O "O3'" . DC  A 1 89  ? 29.449  145.329 43.583  1.00   117.49 ? 89  DC  I "O3'" 1 
ATOM   1807  C "C2'" . DC  A 1 89  ? 28.209  147.326 42.986  1.00   105.48 ? 89  DC  I "C2'" 1 
ATOM   1808  C "C1'" . DC  A 1 89  ? 27.657  147.509 44.388  1.00   93.54  ? 89  DC  I "C1'" 1 
ATOM   1809  N N1    . DC  A 1 89  ? 26.558  148.508 44.479  1.00   86.59  ? 89  DC  I N1    1 
ATOM   1810  C C2    . DC  A 1 89  ? 25.472  148.265 45.329  1.00   96.47  ? 89  DC  I C2    1 
ATOM   1811  O O2    . DC  A 1 89  ? 25.448  147.221 45.992  1.00   87.45  ? 89  DC  I O2    1 
ATOM   1812  N N3    . DC  A 1 89  ? 24.477  149.184 45.403  1.00   100.32 ? 89  DC  I N3    1 
ATOM   1813  C C4    . DC  A 1 89  ? 24.541  150.298 44.671  1.00   84.81  ? 89  DC  I C4    1 
ATOM   1814  N N4    . DC  A 1 89  ? 23.538  151.174 44.776  1.00   64.49  ? 89  DC  I N4    1 
ATOM   1815  C C5    . DC  A 1 89  ? 25.638  150.563 43.798  1.00   87.62  ? 89  DC  I C5    1 
ATOM   1816  C C6    . DC  A 1 89  ? 26.614  149.648 43.733  1.00   89.30  ? 89  DC  I C6    1 
ATOM   1817  P P     . DC  A 1 90  ? 30.678  144.329 43.320  1.00   102.58 ? 90  DC  I P     1 
ATOM   1818  O OP1   . DC  A 1 90  ? 31.920  145.005 43.757  1.00   99.40  ? 90  DC  I OP1   1 
ATOM   1819  O OP2   . DC  A 1 90  ? 30.556  143.829 41.933  1.00   88.97  ? 90  DC  I OP2   1 
ATOM   1820  O "O5'" . DC  A 1 90  ? 30.386  143.111 44.314  1.00   101.31 ? 90  DC  I "O5'" 1 
ATOM   1821  C "C5'" . DC  A 1 90  ? 30.296  143.347 45.715  1.00   85.38  ? 90  DC  I "C5'" 1 
ATOM   1822  C "C4'" . DC  A 1 90  ? 28.979  142.833 46.274  1.00   74.04  ? 90  DC  I "C4'" 1 
ATOM   1823  O "O4'" . DC  A 1 90  ? 27.899  143.731 45.905  1.00   80.02  ? 90  DC  I "O4'" 1 
ATOM   1824  C "C3'" . DC  A 1 90  ? 28.557  141.446 45.784  1.00   80.01  ? 90  DC  I "C3'" 1 
ATOM   1825  O "O3'" . DC  A 1 90  ? 28.018  140.707 46.866  1.00   92.76  ? 90  DC  I "O3'" 1 
ATOM   1826  C "C2'" . DC  A 1 90  ? 27.485  141.762 44.747  1.00   67.96  ? 90  DC  I "C2'" 1 
ATOM   1827  C "C1'" . DC  A 1 90  ? 26.832  142.971 45.386  1.00   78.28  ? 90  DC  I "C1'" 1 
ATOM   1828  N N1    . DC  A 1 90  ? 26.060  143.815 44.435  1.00   91.37  ? 90  DC  I N1    1 
ATOM   1829  C C2    . DC  A 1 90  ? 24.805  144.305 44.811  1.00   98.04  ? 90  DC  I C2    1 
ATOM   1830  O O2    . DC  A 1 90  ? 24.360  144.027 45.933  1.00   81.60  ? 90  DC  I O2    1 
ATOM   1831  N N3    . DC  A 1 90  ? 24.112  145.073 43.936  1.00   103.40 ? 90  DC  I N3    1 
ATOM   1832  C C4    . DC  A 1 90  ? 24.626  145.349 42.738  1.00   102.28 ? 90  DC  I C4    1 
ATOM   1833  N N4    . DC  A 1 90  ? 23.906  146.111 41.909  1.00   101.35 ? 90  DC  I N4    1 
ATOM   1834  C C5    . DC  A 1 90  ? 25.902  144.855 42.336  1.00   91.51  ? 90  DC  I C5    1 
ATOM   1835  C C6    . DC  A 1 90  ? 26.578  144.100 43.207  1.00   79.77  ? 90  DC  I C6    1 
ATOM   1836  P P     . DC  A 1 91  ? 28.071  139.102 46.861  1.00   90.46  ? 91  DC  I P     1 
ATOM   1837  O OP1   . DC  A 1 91  ? 28.669  138.698 48.151  1.00   75.59  ? 91  DC  I OP1   1 
ATOM   1838  O OP2   . DC  A 1 91  ? 28.691  138.662 45.589  1.00   89.24  ? 91  DC  I OP2   1 
ATOM   1839  O "O5'" . DC  A 1 91  ? 26.531  138.668 46.841  1.00   64.82  ? 91  DC  I "O5'" 1 
ATOM   1840  C "C5'" . DC  A 1 91  ? 25.748  138.785 48.020  1.00   75.05  ? 91  DC  I "C5'" 1 
ATOM   1841  C "C4'" . DC  A 1 91  ? 24.300  139.085 47.680  1.00   69.06  ? 91  DC  I "C4'" 1 
ATOM   1842  O "O4'" . DC  A 1 91  ? 24.253  140.140 46.704  1.00   67.75  ? 91  DC  I "O4'" 1 
ATOM   1843  C "C3'" . DC  A 1 91  ? 23.517  137.914 47.075  1.00   65.08  ? 91  DC  I "C3'" 1 
ATOM   1844  O "O3'" . DC  A 1 91  ? 22.557  137.433 48.022  1.00   60.82  ? 91  DC  I "O3'" 1 
ATOM   1845  C "C2'" . DC  A 1 91  ? 22.845  138.497 45.815  1.00   73.39  ? 91  DC  I "C2'" 1 
ATOM   1846  C "C1'" . DC  A 1 91  ? 23.087  139.999 45.942  1.00   85.85  ? 91  DC  I "C1'" 1 
ATOM   1847  N N1    . DC  A 1 91  ? 23.303  140.688 44.633  1.00   98.63  ? 91  DC  I N1    1 
ATOM   1848  C C2    . DC  A 1 91  ? 22.455  141.736 44.250  1.00   92.06  ? 91  DC  I C2    1 
ATOM   1849  O O2    . DC  A 1 91  ? 21.532  142.071 45.002  1.00   89.21  ? 91  DC  I O2    1 
ATOM   1850  N N3    . DC  A 1 91  ? 22.670  142.354 43.062  1.00   89.40  ? 91  DC  I N3    1 
ATOM   1851  C C4    . DC  A 1 91  ? 23.677  141.965 42.280  1.00   90.67  ? 91  DC  I C4    1 
ATOM   1852  N N4    . DC  A 1 91  ? 23.848  142.604 41.118  1.00   88.68  ? 91  DC  I N4    1 
ATOM   1853  C C5    . DC  A 1 91  ? 24.553  140.902 42.653  1.00   95.33  ? 91  DC  I C5    1 
ATOM   1854  C C6    . DC  A 1 91  ? 24.332  140.300 43.826  1.00   87.22  ? 91  DC  I C6    1 
ATOM   1855  P P     . DC  A 1 92  ? 21.620  136.169 47.679  1.00   87.86  ? 92  DC  I P     1 
ATOM   1856  O OP1   . DC  A 1 92  ? 21.345  135.437 48.934  1.00   91.46  ? 92  DC  I OP1   1 
ATOM   1857  O OP2   . DC  A 1 92  ? 22.240  135.454 46.541  1.00   73.21  ? 92  DC  I OP2   1 
ATOM   1858  O "O5'" . DC  A 1 92  ? 20.260  136.840 47.169  1.00   78.01  ? 92  DC  I "O5'" 1 
ATOM   1859  C "C5'" . DC  A 1 92  ? 19.750  138.001 47.825  1.00   81.87  ? 92  DC  I "C5'" 1 
ATOM   1860  C "C4'" . DC  A 1 92  ? 18.621  138.606 47.017  1.00   67.50  ? 92  DC  I "C4'" 1 
ATOM   1861  O "O4'" . DC  A 1 92  ? 19.187  139.276 45.880  1.00   80.71  ? 92  DC  I "O4'" 1 
ATOM   1862  C "C3'" . DC  A 1 92  ? 17.602  137.612 46.453  1.00   64.53  ? 92  DC  I "C3'" 1 
ATOM   1863  O "O3'" . DC  A 1 92  ? 16.343  137.752 47.145  1.00   77.03  ? 92  DC  I "O3'" 1 
ATOM   1864  C "C2'" . DC  A 1 92  ? 17.511  137.947 44.955  1.00   73.36  ? 92  DC  I "C2'" 1 
ATOM   1865  C "C1'" . DC  A 1 92  ? 18.263  139.268 44.834  1.00   86.65  ? 92  DC  I "C1'" 1 
ATOM   1866  N N1    . DC  A 1 92  ? 19.054  139.372 43.577  1.00   102.24 ? 92  DC  I N1    1 
ATOM   1867  C C2    . DC  A 1 92  ? 18.786  140.394 42.657  1.00   104.66 ? 92  DC  I C2    1 
ATOM   1868  O O2    . DC  A 1 92  ? 17.867  141.190 42.885  1.00   85.33  ? 92  DC  I O2    1 
ATOM   1869  N N3    . DC  A 1 92  ? 19.536  140.469 41.529  1.00   112.58 ? 92  DC  I N3    1 
ATOM   1870  C C4    . DC  A 1 92  ? 20.519  139.588 41.317  1.00   110.39 ? 92  DC  I C4    1 
ATOM   1871  N N4    . DC  A 1 92  ? 21.233  139.702 40.193  1.00   101.90 ? 92  DC  I N4    1 
ATOM   1872  C C5    . DC  A 1 92  ? 20.812  138.552 42.249  1.00   103.16 ? 92  DC  I C5    1 
ATOM   1873  C C6    . DC  A 1 92  ? 20.067  138.485 43.355  1.00   91.76  ? 92  DC  I C6    1 
ATOM   1874  P P     . DG  A 1 93  ? 15.122  136.734 46.883  1.00   71.08  ? 93  DG  I P     1 
ATOM   1875  O OP1   . DG  A 1 93  ? 14.150  136.928 47.982  1.00   37.85  ? 93  DG  I OP1   1 
ATOM   1876  O OP2   . DG  A 1 93  ? 15.676  135.387 46.623  1.00   69.47  ? 93  DG  I OP2   1 
ATOM   1877  O "O5'" . DG  A 1 93  ? 14.457  137.259 45.524  1.00   94.08  ? 93  DG  I "O5'" 1 
ATOM   1878  C "C5'" . DG  A 1 93  ? 13.836  138.541 45.482  1.00   90.29  ? 93  DG  I "C5'" 1 
ATOM   1879  C "C4'" . DG  A 1 93  ? 13.285  138.836 44.095  1.00   86.52  ? 93  DG  I "C4'" 1 
ATOM   1880  O "O4'" . DG  A 1 93  ? 14.381  139.024 43.163  1.00   81.52  ? 93  DG  I "O4'" 1 
ATOM   1881  C "C3'" . DG  A 1 93  ? 12.393  137.743 43.504  1.00   93.51  ? 93  DG  I "C3'" 1 
ATOM   1882  O "O3'" . DG  A 1 93  ? 11.221  138.325 42.942  1.00   110.21 ? 93  DG  I "O3'" 1 
ATOM   1883  C "C2'" . DG  A 1 93  ? 13.275  137.091 42.436  1.00   92.14  ? 93  DG  I "C2'" 1 
ATOM   1884  C "C1'" . DG  A 1 93  ? 14.170  138.245 42.007  1.00   83.95  ? 93  DG  I "C1'" 1 
ATOM   1885  N N9    . DG  A 1 93  ? 15.473  137.812 41.510  1.00   94.30  ? 93  DG  I N9    1 
ATOM   1886  C C8    . DG  A 1 93  ? 16.315  136.901 42.097  1.00   103.82 ? 93  DG  I C8    1 
ATOM   1887  N N7    . DG  A 1 93  ? 17.422  136.712 41.436  1.00   91.88  ? 93  DG  I N7    1 
ATOM   1888  C C5    . DG  A 1 93  ? 17.308  137.549 40.336  1.00   103.28 ? 93  DG  I C5    1 
ATOM   1889  C C6    . DG  A 1 93  ? 18.205  137.767 39.265  1.00   112.76 ? 93  DG  I C6    1 
ATOM   1890  O O6    . DG  A 1 93  ? 19.311  137.246 39.076  1.00   122.33 ? 93  DG  I O6    1 
ATOM   1891  N N1    . DG  A 1 93  ? 17.707  138.698 38.357  1.00   119.87 ? 93  DG  I N1    1 
ATOM   1892  C C2    . DG  A 1 93  ? 16.494  139.336 38.470  1.00   128.50 ? 93  DG  I C2    1 
ATOM   1893  N N2    . DG  A 1 93  ? 16.186  140.204 37.494  1.00   122.00 ? 93  DG  I N2    1 
ATOM   1894  N N3    . DG  A 1 93  ? 15.642  139.142 39.473  1.00   123.33 ? 93  DG  I N3    1 
ATOM   1895  C C4    . DG  A 1 93  ? 16.114  138.237 40.366  1.00   110.13 ? 93  DG  I C4    1 
ATOM   1896  P P     . DC  A 1 94  ? 10.030  137.393 42.394  1.00   98.38  ? 94  DC  I P     1 
ATOM   1897  O OP1   . DC  A 1 94  ? 8.756   138.083 42.686  1.00   83.22  ? 94  DC  I OP1   1 
ATOM   1898  O OP2   . DC  A 1 94  ? 10.257  136.011 42.871  1.00   96.12  ? 94  DC  I OP2   1 
ATOM   1899  O "O5'" . DC  A 1 94  ? 10.235  137.414 40.813  1.00   87.49  ? 94  DC  I "O5'" 1 
ATOM   1900  C "C5'" . DC  A 1 94  ? 10.112  138.638 40.113  1.00   103.07 ? 94  DC  I "C5'" 1 
ATOM   1901  C "C4'" . DC  A 1 94  ? 10.641  138.505 38.702  1.00   98.76  ? 94  DC  I "C4'" 1 
ATOM   1902  O "O4'" . DC  A 1 94  ? 12.057  138.271 38.739  1.00   93.37  ? 94  DC  I "O4'" 1 
ATOM   1903  C "C3'" . DC  A 1 94  ? 10.085  137.328 37.927  1.00   115.41 ? 94  DC  I "C3'" 1 
ATOM   1904  O "O3'" . DC  A 1 94  ? 8.878   137.712 37.273  1.00   131.21 ? 94  DC  I "O3'" 1 
ATOM   1905  C "C2'" . DC  A 1 94  ? 11.201  137.012 36.920  1.00   119.46 ? 94  DC  I "C2'" 1 
ATOM   1906  C "C1'" . DC  A 1 94  ? 12.446  137.682 37.521  1.00   101.28 ? 94  DC  I "C1'" 1 
ATOM   1907  N N1    . DC  A 1 94  ? 13.565  136.736 37.784  1.00   86.13  ? 94  DC  I N1    1 
ATOM   1908  C C2    . DC  A 1 94  ? 14.720  136.800 37.000  1.00   98.25  ? 94  DC  I C2    1 
ATOM   1909  O O2    . DC  A 1 94  ? 14.792  137.644 36.100  1.00   105.53 ? 94  DC  I O2    1 
ATOM   1910  N N3    . DC  A 1 94  ? 15.732  135.933 37.250  1.00   121.32 ? 94  DC  I N3    1 
ATOM   1911  C C4    . DC  A 1 94  ? 15.615  135.036 38.231  1.00   122.54 ? 94  DC  I C4    1 
ATOM   1912  N N4    . DC  A 1 94  ? 16.640  134.201 38.440  1.00   117.93 ? 94  DC  I N4    1 
ATOM   1913  C C5    . DC  A 1 94  ? 14.444  134.955 39.041  1.00   101.87 ? 94  DC  I C5    1 
ATOM   1914  C C6    . DC  A 1 94  ? 13.453  135.816 38.785  1.00   94.27  ? 94  DC  I C6    1 
ATOM   1915  P P     . DG  A 1 95  ? 8.016   136.631 36.455  1.00   126.28 ? 95  DG  I P     1 
ATOM   1916  O OP1   . DG  A 1 95  ? 6.633   137.148 36.352  1.00   113.36 ? 95  DG  I OP1   1 
ATOM   1917  O OP2   . DG  A 1 95  ? 8.263   135.301 37.058  1.00   90.27  ? 95  DG  I OP2   1 
ATOM   1918  O "O5'" . DG  A 1 95  ? 8.677   136.644 34.999  1.00   115.27 ? 95  DG  I "O5'" 1 
ATOM   1919  C "C5'" . DG  A 1 95  ? 8.938   137.884 34.352  1.00   107.64 ? 95  DG  I "C5'" 1 
ATOM   1920  C "C4'" . DG  A 1 95  ? 9.869   137.689 33.171  1.00   128.80 ? 95  DG  I "C4'" 1 
ATOM   1921  O "O4'" . DG  A 1 95  ? 11.197  137.325 33.642  1.00   125.47 ? 95  DG  I "O4'" 1 
ATOM   1922  C "C3'" . DG  A 1 95  ? 9.448   136.587 32.193  1.00   154.74 ? 95  DG  I "C3'" 1 
ATOM   1923  O "O3'" . DG  A 1 95  ? 9.565   137.061 30.854  1.00   165.67 ? 95  DG  I "O3'" 1 
ATOM   1924  C "C2'" . DG  A 1 95  ? 10.443  135.463 32.486  1.00   133.57 ? 95  DG  I "C2'" 1 
ATOM   1925  C "C1'" . DG  A 1 95  ? 11.678  136.259 32.860  1.00   128.69 ? 95  DG  I "C1'" 1 
ATOM   1926  N N9    . DG  A 1 95  ? 12.656  135.500 33.638  1.00   130.99 ? 95  DG  I N9    1 
ATOM   1927  C C8    . DG  A 1 95  ? 12.417  134.746 34.762  1.00   124.97 ? 95  DG  I C8    1 
ATOM   1928  N N7    . DG  A 1 95  ? 13.486  134.175 35.243  1.00   116.98 ? 95  DG  I N7    1 
ATOM   1929  C C5    . DG  A 1 95  ? 14.501  134.571 34.381  1.00   125.71 ? 95  DG  I C5    1 
ATOM   1930  C C6    . DG  A 1 95  ? 15.883  134.263 34.395  1.00   129.03 ? 95  DG  I C6    1 
ATOM   1931  O O6    . DG  A 1 95  ? 16.505  133.556 35.202  1.00   125.40 ? 95  DG  I O6    1 
ATOM   1932  N N1    . DG  A 1 95  ? 16.558  134.870 33.339  1.00   127.85 ? 95  DG  I N1    1 
ATOM   1933  C C2    . DG  A 1 95  ? 15.971  135.672 32.389  1.00   137.93 ? 95  DG  I C2    1 
ATOM   1934  N N2    . DG  A 1 95  ? 16.786  136.169 31.446  1.00   143.43 ? 95  DG  I N2    1 
ATOM   1935  N N3    . DG  A 1 95  ? 14.677  135.969 32.363  1.00   121.58 ? 95  DG  I N3    1 
ATOM   1936  C C4    . DG  A 1 95  ? 14.006  135.386 33.386  1.00   123.04 ? 95  DG  I C4    1 
ATOM   1937  P P     . DT  A 1 96  ? 8.767   136.340 29.660  1.00   165.05 ? 96  DT  I P     1 
ATOM   1938  O OP1   . DT  A 1 96  ? 7.887   137.352 29.033  1.00   102.67 ? 96  DT  I OP1   1 
ATOM   1939  O OP2   . DT  A 1 96  ? 8.184   135.087 30.191  1.00   147.35 ? 96  DT  I OP2   1 
ATOM   1940  O "O5'" . DT  A 1 96  ? 9.921   135.941 28.627  1.00   158.06 ? 96  DT  I "O5'" 1 
ATOM   1941  C "C5'" . DT  A 1 96  ? 11.068  135.252 29.096  1.00   127.47 ? 96  DT  I "C5'" 1 
ATOM   1942  C "C4'" . DT  A 1 96  ? 12.186  135.281 28.076  1.00   137.20 ? 96  DT  I "C4'" 1 
ATOM   1943  O "O4'" . DT  A 1 96  ? 13.434  134.972 28.738  1.00   145.90 ? 96  DT  I "O4'" 1 
ATOM   1944  C "C3'" . DT  A 1 96  ? 12.069  134.242 26.980  1.00   158.12 ? 96  DT  I "C3'" 1 
ATOM   1945  O "O3'" . DT  A 1 96  ? 12.838  134.638 25.852  1.00   164.87 ? 96  DT  I "O3'" 1 
ATOM   1946  C "C2'" . DT  A 1 96  ? 12.656  133.005 27.653  1.00   155.54 ? 96  DT  I "C2'" 1 
ATOM   1947  C "C1'" . DT  A 1 96  ? 13.753  133.604 28.541  1.00   160.77 ? 96  DT  I "C1'" 1 
ATOM   1948  N N1    . DT  A 1 96  ? 13.861  132.943 29.879  1.00   147.70 ? 96  DT  I N1    1 
ATOM   1949  C C2    . DT  A 1 96  ? 15.106  132.694 30.410  1.00   134.50 ? 96  DT  I C2    1 
ATOM   1950  O O2    . DT  A 1 96  ? 16.145  132.988 29.847  1.00   136.35 ? 96  DT  I O2    1 
ATOM   1951  N N3    . DT  A 1 96  ? 15.092  132.085 31.637  1.00   128.60 ? 96  DT  I N3    1 
ATOM   1952  C C4    . DT  A 1 96  ? 13.982  131.706 32.371  1.00   129.83 ? 96  DT  I C4    1 
ATOM   1953  O O4    . DT  A 1 96  ? 14.073  131.163 33.467  1.00   134.40 ? 96  DT  I O4    1 
ATOM   1954  C C5    . DT  A 1 96  ? 12.708  131.994 31.756  1.00   131.50 ? 96  DT  I C5    1 
ATOM   1955  C C7    . DT  A 1 96  ? 11.433  131.629 32.457  1.00   105.14 ? 96  DT  I C7    1 
ATOM   1956  C C6    . DT  A 1 96  ? 12.710  132.590 30.554  1.00   144.80 ? 96  DT  I C6    1 
ATOM   1957  P P     . DT  A 1 97  ? 12.864  133.723 24.531  1.00   159.22 ? 97  DT  I P     1 
ATOM   1958  O OP1   . DT  A 1 97  ? 13.146  134.609 23.379  1.00   147.14 ? 97  DT  I OP1   1 
ATOM   1959  O OP2   . DT  A 1 97  ? 11.644  132.886 24.538  1.00   104.75 ? 97  DT  I OP2   1 
ATOM   1960  O "O5'" . DT  A 1 97  ? 14.121  132.762 24.759  1.00   136.57 ? 97  DT  I "O5'" 1 
ATOM   1961  C "C5'" . DT  A 1 97  ? 15.394  133.320 25.062  1.00   133.93 ? 97  DT  I "C5'" 1 
ATOM   1962  C "C4'" . DT  A 1 97  ? 16.363  132.240 25.505  1.00   130.30 ? 97  DT  I "C4'" 1 
ATOM   1963  O "O4'" . DT  A 1 97  ? 15.993  131.764 26.815  1.00   136.97 ? 97  DT  I "O4'" 1 
ATOM   1964  C "C3'" . DT  A 1 97  ? 16.401  131.003 24.604  1.00   135.83 ? 97  DT  I "C3'" 1 
ATOM   1965  O "O3'" . DT  A 1 97  ? 17.645  130.937 23.915  1.00   118.69 ? 97  DT  I "O3'" 1 
ATOM   1966  C "C2'" . DT  A 1 97  ? 16.218  129.813 25.562  1.00   131.39 ? 97  DT  I "C2'" 1 
ATOM   1967  C "C1'" . DT  A 1 97  ? 16.416  130.435 26.937  1.00   129.01 ? 97  DT  I "C1'" 1 
ATOM   1968  N N1    . DT  A 1 97  ? 15.612  129.776 28.007  1.00   129.58 ? 97  DT  I N1    1 
ATOM   1969  C C2    . DT  A 1 97  ? 16.254  129.034 28.971  1.00   130.61 ? 97  DT  I C2    1 
ATOM   1970  O O2    . DT  A 1 97  ? 17.463  128.887 29.006  1.00   117.58 ? 97  DT  I O2    1 
ATOM   1971  N N3    . DT  A 1 97  ? 15.424  128.468 29.904  1.00   139.66 ? 97  DT  I N3    1 
ATOM   1972  C C4    . DT  A 1 97  ? 14.046  128.566 29.965  1.00   131.54 ? 97  DT  I C4    1 
ATOM   1973  O O4    . DT  A 1 97  ? 13.387  128.020 30.844  1.00   123.27 ? 97  DT  I O4    1 
ATOM   1974  C C5    . DT  A 1 97  ? 13.436  129.356 28.923  1.00   139.29 ? 97  DT  I C5    1 
ATOM   1975  C C7    . DT  A 1 97  ? 11.947  129.533 28.885  1.00   134.76 ? 97  DT  I C7    1 
ATOM   1976  C C6    . DT  A 1 97  ? 14.239  129.914 28.004  1.00   141.47 ? 97  DT  I C6    1 
ATOM   1977  P P     . DT  A 1 98  ? 17.909  129.781 22.829  1.00   138.74 ? 98  DT  I P     1 
ATOM   1978  O OP1   . DT  A 1 98  ? 18.799  130.349 21.791  1.00   108.24 ? 98  DT  I OP1   1 
ATOM   1979  O OP2   . DT  A 1 98  ? 16.603  129.200 22.441  1.00   104.14 ? 98  DT  I OP2   1 
ATOM   1980  O "O5'" . DT  A 1 98  ? 18.714  128.670 23.649  1.00   136.19 ? 98  DT  I "O5'" 1 
ATOM   1981  C "C5'" . DT  A 1 98  ? 19.886  129.038 24.361  1.00   117.95 ? 98  DT  I "C5'" 1 
ATOM   1982  C "C4'" . DT  A 1 98  ? 20.233  128.004 25.416  1.00   111.29 ? 98  DT  I "C4'" 1 
ATOM   1983  O "O4'" . DT  A 1 98  ? 19.104  127.797 26.304  1.00   112.15 ? 98  DT  I "O4'" 1 
ATOM   1984  C "C3'" . DT  A 1 98  ? 20.613  126.616 24.878  1.00   118.99 ? 98  DT  I "C3'" 1 
ATOM   1985  O "O3'" . DT  A 1 98  ? 21.873  126.228 25.426  1.00   143.60 ? 98  DT  I "O3'" 1 
ATOM   1986  C "C2'" . DT  A 1 98  ? 19.474  125.715 25.374  1.00   104.06 ? 98  DT  I "C2'" 1 
ATOM   1987  C "C1'" . DT  A 1 98  ? 19.057  126.436 26.640  1.00   115.86 ? 98  DT  I "C1'" 1 
ATOM   1988  N N1    . DT  A 1 98  ? 17.682  126.092 27.112  1.00   114.38 ? 98  DT  I N1    1 
ATOM   1989  C C2    . DT  A 1 98  ? 17.535  125.343 28.256  1.00   108.51 ? 98  DT  I C2    1 
ATOM   1990  O O2    . DT  A 1 98  ? 18.476  124.942 28.916  1.00   107.81 ? 98  DT  I O2    1 
ATOM   1991  N N3    . DT  A 1 98  ? 16.238  125.080 28.606  1.00   114.51 ? 98  DT  I N3    1 
ATOM   1992  C C4    . DT  A 1 98  ? 15.095  125.480 27.939  1.00   116.54 ? 98  DT  I C4    1 
ATOM   1993  O O4    . DT  A 1 98  ? 13.970  125.192 28.334  1.00   110.67 ? 98  DT  I O4    1 
ATOM   1994  C C5    . DT  A 1 98  ? 15.319  126.261 26.746  1.00   125.55 ? 98  DT  I C5    1 
ATOM   1995  C C7    . DT  A 1 98  ? 14.155  126.753 25.937  1.00   128.53 ? 98  DT  I C7    1 
ATOM   1996  C C6    . DT  A 1 98  ? 16.588  126.524 26.393  1.00   124.79 ? 98  DT  I C6    1 
ATOM   1997  P P     . DT  A 1 99  ? 22.645  124.916 24.907  1.00   136.34 ? 99  DT  I P     1 
ATOM   1998  O OP1   . DT  A 1 99  ? 23.934  125.364 24.333  1.00   73.52  ? 99  DT  I OP1   1 
ATOM   1999  O OP2   . DT  A 1 99  ? 21.727  124.094 24.085  1.00   115.58 ? 99  DT  I OP2   1 
ATOM   2000  O "O5'" . DT  A 1 99  ? 22.944  124.113 26.256  1.00   119.41 ? 99  DT  I "O5'" 1 
ATOM   2001  C "C5'" . DT  A 1 99  ? 21.936  124.022 27.252  1.00   110.67 ? 99  DT  I "C5'" 1 
ATOM   2002  C "C4'" . DT  A 1 99  ? 22.458  123.340 28.499  1.00   109.04 ? 99  DT  I "C4'" 1 
ATOM   2003  O "O4'" . DT  A 1 99  ? 21.358  123.130 29.415  1.00   122.84 ? 99  DT  I "O4'" 1 
ATOM   2004  C "C3'" . DT  A 1 99  ? 23.034  121.957 28.271  1.00   104.51 ? 99  DT  I "C3'" 1 
ATOM   2005  O "O3'" . DT  A 1 99  ? 23.899  121.613 29.345  1.00   113.49 ? 99  DT  I "O3'" 1 
ATOM   2006  C "C2'" . DT  A 1 99  ? 21.778  121.098 28.269  1.00   103.00 ? 99  DT  I "C2'" 1 
ATOM   2007  C "C1'" . DT  A 1 99  ? 20.926  121.781 29.341  1.00   111.56 ? 99  DT  I "C1'" 1 
ATOM   2008  N N1    . DT  A 1 99  ? 19.465  121.771 29.037  1.00   106.97 ? 99  DT  I N1    1 
ATOM   2009  C C2    . DT  A 1 99  ? 18.575  121.413 30.023  1.00   112.36 ? 99  DT  I C2    1 
ATOM   2010  O O2    . DT  A 1 99  ? 18.917  121.101 31.150  1.00   98.71  ? 99  DT  I O2    1 
ATOM   2011  N N3    . DT  A 1 99  ? 17.260  121.436 29.642  1.00   116.37 ? 99  DT  I N3    1 
ATOM   2012  C C4    . DT  A 1 99  ? 16.756  121.772 28.398  1.00   112.63 ? 99  DT  I C4    1 
ATOM   2013  O O4    . DT  A 1 99  ? 15.553  121.762 28.153  1.00   107.15 ? 99  DT  I O4    1 
ATOM   2014  C C5    . DT  A 1 99  ? 17.744  122.137 27.410  1.00   100.18 ? 99  DT  I C5    1 
ATOM   2015  C C7    . DT  A 1 99  ? 17.320  122.522 26.024  1.00   115.63 ? 99  DT  I C7    1 
ATOM   2016  C C6    . DT  A 1 99  ? 19.035  122.117 27.773  1.00   93.00  ? 99  DT  I C6    1 
ATOM   2017  P P     . DA  A 1 100 ? 24.690  120.214 29.334  1.00   115.09 ? 100 DA  I P     1 
ATOM   2018  O OP1   . DA  A 1 100 ? 25.887  120.377 30.187  1.00   106.82 ? 100 DA  I OP1   1 
ATOM   2019  O OP2   . DA  A 1 100 ? 24.844  119.793 27.923  1.00   116.99 ? 100 DA  I OP2   1 
ATOM   2020  O "O5'" . DA  A 1 100 ? 23.681  119.197 30.045  1.00   90.35  ? 100 DA  I "O5'" 1 
ATOM   2021  C "C5'" . DA  A 1 100 ? 23.212  119.470 31.358  1.00   95.60  ? 100 DA  I "C5'" 1 
ATOM   2022  C "C4'" . DA  A 1 100 ? 22.151  118.469 31.779  1.00   89.42  ? 100 DA  I "C4'" 1 
ATOM   2023  O "O4'" . DA  A 1 100 ? 20.899  118.765 31.104  1.00   103.75 ? 100 DA  I "O4'" 1 
ATOM   2024  C "C3'" . DA  A 1 100 ? 22.469  117.008 31.456  1.00   89.98  ? 100 DA  I "C3'" 1 
ATOM   2025  O "O3'" . DA  A 1 100 ? 22.048  116.184 32.527  1.00   101.64 ? 100 DA  I "O3'" 1 
ATOM   2026  C "C2'" . DA  A 1 100 ? 21.629  116.751 30.208  1.00   113.32 ? 100 DA  I "C2'" 1 
ATOM   2027  C "C1'" . DA  A 1 100 ? 20.400  117.582 30.526  1.00   115.73 ? 100 DA  I "C1'" 1 
ATOM   2028  N N9    . DA  A 1 100 ? 19.603  117.932 29.355  1.00   112.85 ? 100 DA  I N9    1 
ATOM   2029  C C8    . DA  A 1 100 ? 20.062  118.268 28.113  1.00   107.17 ? 100 DA  I C8    1 
ATOM   2030  N N7    . DA  A 1 100 ? 19.110  118.539 27.252  1.00   115.04 ? 100 DA  I N7    1 
ATOM   2031  C C5    . DA  A 1 100 ? 17.945  118.364 27.980  1.00   117.28 ? 100 DA  I C5    1 
ATOM   2032  C C6    . DA  A 1 100 ? 16.584  118.496 27.639  1.00   127.79 ? 100 DA  I C6    1 
ATOM   2033  N N6    . DA  A 1 100 ? 16.162  118.851 26.421  1.00   132.30 ? 100 DA  I N6    1 
ATOM   2034  N N1    . DA  A 1 100 ? 15.672  118.249 28.603  1.00   126.09 ? 100 DA  I N1    1 
ATOM   2035  C C2    . DA  A 1 100 ? 16.100  117.895 29.820  1.00   121.48 ? 100 DA  I C2    1 
ATOM   2036  N N3    . DA  A 1 100 ? 17.348  117.738 30.257  1.00   104.06 ? 100 DA  I N3    1 
ATOM   2037  C C4    . DA  A 1 100 ? 18.231  117.990 29.278  1.00   108.34 ? 100 DA  I C4    1 
ATOM   2038  P P     . DA  A 1 101 ? 23.111  115.615 33.587  1.00   95.43  ? 101 DA  I P     1 
ATOM   2039  O OP1   . DA  A 1 101 ? 24.140  116.657 33.799  1.00   61.87  ? 101 DA  I OP1   1 
ATOM   2040  O OP2   . DA  A 1 101 ? 23.515  114.265 33.137  1.00   114.92 ? 101 DA  I OP2   1 
ATOM   2041  O "O5'" . DA  A 1 101 ? 22.250  115.449 34.925  1.00   112.48 ? 101 DA  I "O5'" 1 
ATOM   2042  C "C5'" . DA  A 1 101 ? 21.658  116.593 35.532  1.00   119.07 ? 101 DA  I "C5'" 1 
ATOM   2043  C "C4'" . DA  A 1 101 ? 20.194  116.346 35.856  1.00   113.32 ? 101 DA  I "C4'" 1 
ATOM   2044  O "O4'" . DA  A 1 101 ? 19.407  116.421 34.638  1.00   100.63 ? 101 DA  I "O4'" 1 
ATOM   2045  C "C3'" . DA  A 1 101 ? 19.885  114.987 36.484  1.00   106.85 ? 101 DA  I "C3'" 1 
ATOM   2046  O "O3'" . DA  A 1 101 ? 18.920  115.140 37.521  1.00   103.66 ? 101 DA  I "O3'" 1 
ATOM   2047  C "C2'" . DA  A 1 101 ? 19.326  114.182 35.313  1.00   123.41 ? 101 DA  I "C2'" 1 
ATOM   2048  C "C1'" . DA  A 1 101 ? 18.615  115.262 34.512  1.00   126.86 ? 101 DA  I "C1'" 1 
ATOM   2049  N N9    . DA  A 1 101 ? 18.488  114.946 33.091  1.00   145.03 ? 101 DA  I N9    1 
ATOM   2050  C C8    . DA  A 1 101 ? 19.493  114.591 32.234  1.00   134.65 ? 101 DA  I C8    1 
ATOM   2051  N N7    . DA  A 1 101 ? 19.086  114.366 31.007  1.00   135.78 ? 101 DA  I N7    1 
ATOM   2052  C C5    . DA  A 1 101 ? 17.721  114.590 31.062  1.00   139.20 ? 101 DA  I C5    1 
ATOM   2053  C C6    . DA  A 1 101 ? 16.707  114.516 30.087  1.00   134.67 ? 101 DA  I C6    1 
ATOM   2054  N N6    . DA  A 1 101 ? 16.934  114.182 28.813  1.00   140.86 ? 101 DA  I N6    1 
ATOM   2055  N N1    . DA  A 1 101 ? 15.445  114.799 30.474  1.00   133.99 ? 101 DA  I N1    1 
ATOM   2056  C C2    . DA  A 1 101 ? 15.222  115.135 31.750  1.00   127.19 ? 101 DA  I C2    1 
ATOM   2057  N N3    . DA  A 1 101 ? 16.091  115.236 32.755  1.00   134.27 ? 101 DA  I N3    1 
ATOM   2058  C C4    . DA  A 1 101 ? 17.335  114.948 32.340  1.00   141.41 ? 101 DA  I C4    1 
ATOM   2059  P P     . DC  A 1 102 ? 18.608  113.924 38.524  1.00   99.50  ? 102 DC  I P     1 
ATOM   2060  O OP1   . DC  A 1 102 ? 18.238  114.504 39.834  1.00   102.05 ? 102 DC  I OP1   1 
ATOM   2061  O OP2   . DC  A 1 102 ? 19.732  112.966 38.436  1.00   120.97 ? 102 DC  I OP2   1 
ATOM   2062  O "O5'" . DC  A 1 102 ? 17.315  113.228 37.891  1.00   92.53  ? 102 DC  I "O5'" 1 
ATOM   2063  C "C5'" . DC  A 1 102 ? 16.101  113.957 37.789  1.00   108.55 ? 102 DC  I "C5'" 1 
ATOM   2064  C "C4'" . DC  A 1 102 ? 15.105  113.226 36.909  1.00   122.91 ? 102 DC  I "C4'" 1 
ATOM   2065  O "O4'" . DC  A 1 102 ? 15.555  113.257 35.544  1.00   131.27 ? 102 DC  I "O4'" 1 
ATOM   2066  C "C3'" . DC  A 1 102 ? 14.905  111.746 37.249  1.00   122.24 ? 102 DC  I "C3'" 1 
ATOM   2067  O "O3'" . DC  A 1 102 ? 13.636  111.560 37.866  1.00   125.12 ? 102 DC  I "O3'" 1 
ATOM   2068  C "C2'" . DC  A 1 102 ? 14.996  111.015 35.894  1.00   120.60 ? 102 DC  I "C2'" 1 
ATOM   2069  C "C1'" . DC  A 1 102 ? 15.009  112.153 34.877  1.00   149.14 ? 102 DC  I "C1'" 1 
ATOM   2070  N N1    . DC  A 1 102 ? 15.844  111.873 33.670  1.00   149.74 ? 102 DC  I N1    1 
ATOM   2071  C C2    . DC  A 1 102 ? 15.260  111.917 32.399  1.00   143.73 ? 102 DC  I C2    1 
ATOM   2072  O O2    . DC  A 1 102 ? 14.057  112.189 32.296  1.00   143.24 ? 102 DC  I O2    1 
ATOM   2073  N N3    . DC  A 1 102 ? 16.032  111.664 31.313  1.00   133.80 ? 102 DC  I N3    1 
ATOM   2074  C C4    . DC  A 1 102 ? 17.325  111.375 31.466  1.00   135.65 ? 102 DC  I C4    1 
ATOM   2075  N N4    . DC  A 1 102 ? 18.045  111.131 30.365  1.00   129.50 ? 102 DC  I N4    1 
ATOM   2076  C C5    . DC  A 1 102 ? 17.938  111.326 32.753  1.00   127.63 ? 102 DC  I C5    1 
ATOM   2077  C C6    . DC  A 1 102 ? 17.168  111.578 33.816  1.00   125.47 ? 102 DC  I C6    1 
ATOM   2078  P P     . DC  A 1 103 ? 13.247  110.143 38.517  1.00   116.13 ? 103 DC  I P     1 
ATOM   2079  O OP1   . DC  A 1 103 ? 12.342  110.404 39.659  1.00   102.52 ? 103 DC  I OP1   1 
ATOM   2080  O OP2   . DC  A 1 103 ? 14.496  109.380 38.729  1.00   120.49 ? 103 DC  I OP2   1 
ATOM   2081  O "O5'" . DC  A 1 103 ? 12.417  109.416 37.363  1.00   138.55 ? 103 DC  I "O5'" 1 
ATOM   2082  C "C5'" . DC  A 1 103 ? 11.334  110.092 36.739  1.00   144.02 ? 103 DC  I "C5'" 1 
ATOM   2083  C "C4'" . DC  A 1 103 ? 10.964  109.419 35.433  1.00   141.14 ? 103 DC  I "C4'" 1 
ATOM   2084  O "O4'" . DC  A 1 103 ? 12.028  109.611 34.473  1.00   136.17 ? 103 DC  I "O4'" 1 
ATOM   2085  C "C3'" . DC  A 1 103 ? 10.737  107.908 35.534  1.00   137.51 ? 103 DC  I "C3'" 1 
ATOM   2086  O "O3'" . DC  A 1 103 ? 9.439   107.579 35.064  1.00   157.62 ? 103 DC  I "O3'" 1 
ATOM   2087  C "C2'" . DC  A 1 103 ? 11.834  107.293 34.657  1.00   123.34 ? 103 DC  I "C2'" 1 
ATOM   2088  C "C1'" . DC  A 1 103 ? 12.195  108.438 33.723  1.00   134.74 ? 103 DC  I "C1'" 1 
ATOM   2089  N N1    . DC  A 1 103 ? 13.607  108.386 33.245  1.00   145.73 ? 103 DC  I N1    1 
ATOM   2090  C C2    . DC  A 1 103 ? 13.930  108.880 31.976  1.00   140.18 ? 103 DC  I C2    1 
ATOM   2091  O O2    . DC  A 1 103 ? 13.035  109.358 31.268  1.00   135.85 ? 103 DC  I O2    1 
ATOM   2092  N N3    . DC  A 1 103 ? 15.219  108.823 31.559  1.00   128.94 ? 103 DC  I N3    1 
ATOM   2093  C C4    . DC  A 1 103 ? 16.156  108.302 32.353  1.00   128.46 ? 103 DC  I C4    1 
ATOM   2094  N N4    . DC  A 1 103 ? 17.412  108.265 31.898  1.00   129.85 ? 103 DC  I N4    1 
ATOM   2095  C C5    . DC  A 1 103 ? 15.846  107.792 33.648  1.00   133.58 ? 103 DC  I C5    1 
ATOM   2096  C C6    . DC  A 1 103 ? 14.572  107.854 34.049  1.00   138.73 ? 103 DC  I C6    1 
ATOM   2097  P P     . DG  A 1 104 ? 8.643   106.335 35.697  1.00   160.31 ? 104 DG  I P     1 
ATOM   2098  O OP1   . DG  A 1 104 ? 7.254   106.773 35.961  1.00   119.06 ? 104 DG  I OP1   1 
ATOM   2099  O OP2   . DG  A 1 104 ? 9.467   105.785 36.797  1.00   152.65 ? 104 DG  I OP2   1 
ATOM   2100  O "O5'" . DG  A 1 104 ? 8.630   105.258 34.518  1.00   148.32 ? 104 DG  I "O5'" 1 
ATOM   2101  C "C5'" . DG  A 1 104 ? 8.121   105.616 33.242  1.00   144.56 ? 104 DG  I "C5'" 1 
ATOM   2102  C "C4'" . DG  A 1 104 ? 8.734   104.749 32.160  1.00   150.24 ? 104 DG  I "C4'" 1 
ATOM   2103  O "O4'" . DG  A 1 104 ? 10.077  105.202 31.877  1.00   150.99 ? 104 DG  I "O4'" 1 
ATOM   2104  C "C3'" . DG  A 1 104 ? 8.851   103.262 32.515  1.00   160.22 ? 104 DG  I "C3'" 1 
ATOM   2105  O "O3'" . DG  A 1 104 ? 8.071   102.484 31.615  1.00   163.21 ? 104 DG  I "O3'" 1 
ATOM   2106  C "C2'" . DG  A 1 104 ? 10.351  102.952 32.385  1.00   154.52 ? 104 DG  I "C2'" 1 
ATOM   2107  C "C1'" . DG  A 1 104 ? 10.850  104.092 31.513  1.00   152.62 ? 104 DG  I "C1'" 1 
ATOM   2108  N N9    . DG  A 1 104 ? 12.258  104.410 31.723  1.00   131.90 ? 104 DG  I N9    1 
ATOM   2109  C C8    . DG  A 1 104 ? 12.931  104.437 32.921  1.00   119.98 ? 104 DG  I C8    1 
ATOM   2110  N N7    . DG  A 1 104 ? 14.191  104.751 32.801  1.00   131.90 ? 104 DG  I N7    1 
ATOM   2111  C C5    . DG  A 1 104 ? 14.365  104.945 31.436  1.00   140.64 ? 104 DG  I C5    1 
ATOM   2112  C C6    . DG  A 1 104 ? 15.523  105.305 30.705  1.00   143.25 ? 104 DG  I C6    1 
ATOM   2113  O O6    . DG  A 1 104 ? 16.664  105.529 31.134  1.00   139.15 ? 104 DG  I O6    1 
ATOM   2114  N N1    . DG  A 1 104 ? 15.263  105.395 29.339  1.00   142.96 ? 104 DG  I N1    1 
ATOM   2115  C C2    . DG  A 1 104 ? 14.039  105.167 28.755  1.00   141.67 ? 104 DG  I C2    1 
ATOM   2116  N N2    . DG  A 1 104 ? 13.982  105.302 27.422  1.00   151.36 ? 104 DG  I N2    1 
ATOM   2117  N N3    . DG  A 1 104 ? 12.947  104.830 29.428  1.00   125.02 ? 104 DG  I N3    1 
ATOM   2118  C C4    . DG  A 1 104 ? 13.184  104.738 30.759  1.00   132.14 ? 104 DG  I C4    1 
ATOM   2119  P P     . DC  A 1 105 ? 8.079   100.879 31.708  1.00   164.99 ? 105 DC  I P     1 
ATOM   2120  O OP1   . DC  A 1 105 ? 6.784   100.400 31.177  1.00   156.71 ? 105 DC  I OP1   1 
ATOM   2121  O OP2   . DC  A 1 105 ? 8.494   100.495 33.076  1.00   146.86 ? 105 DC  I OP2   1 
ATOM   2122  O "O5'" . DC  A 1 105 ? 9.242   100.451 30.697  1.00   170.44 ? 105 DC  I "O5'" 1 
ATOM   2123  C "C5'" . DC  A 1 105 ? 9.230   100.941 29.362  1.00   168.49 ? 105 DC  I "C5'" 1 
ATOM   2124  C "C4'" . DC  A 1 105 ? 10.512  100.577 28.635  1.00   175.67 ? 105 DC  I "C4'" 1 
ATOM   2125  O "O4'" . DC  A 1 105 ? 11.562  101.486 29.011  1.00   159.96 ? 105 DC  I "O4'" 1 
ATOM   2126  C "C3'" . DC  A 1 105 ? 11.074  99.210  28.966  1.00   184.58 ? 105 DC  I "C3'" 1 
ATOM   2127  O "O3'" . DC  A 1 105 ? 10.431  98.218  28.175  1.00   198.74 ? 105 DC  I "O3'" 1 
ATOM   2128  C "C2'" . DC  A 1 105 ? 12.553  99.362  28.591  1.00   156.99 ? 105 DC  I "C2'" 1 
ATOM   2129  C "C1'" . DC  A 1 105 ? 12.808  100.870 28.749  1.00   154.31 ? 105 DC  I "C1'" 1 
ATOM   2130  N N1    . DC  A 1 105 ? 13.754  101.207 29.854  1.00   158.74 ? 105 DC  I N1    1 
ATOM   2131  C C2    . DC  A 1 105 ? 15.054  101.625 29.546  1.00   159.96 ? 105 DC  I C2    1 
ATOM   2132  O O2    . DC  A 1 105 ? 15.395  101.711 28.360  1.00   152.43 ? 105 DC  I O2    1 
ATOM   2133  N N3    . DC  A 1 105 ? 15.904  101.927 30.559  1.00   154.29 ? 105 DC  I N3    1 
ATOM   2134  C C4    . DC  A 1 105 ? 15.499  101.822 31.825  1.00   157.69 ? 105 DC  I C4    1 
ATOM   2135  N N4    . DC  A 1 105 ? 16.373  102.130 32.789  1.00   146.61 ? 105 DC  I N4    1 
ATOM   2136  C C5    . DC  A 1 105 ? 14.178  101.396 32.159  1.00   155.36 ? 105 DC  I C5    1 
ATOM   2137  C C6    . DC  A 1 105 ? 13.348  101.102 31.152  1.00   155.28 ? 105 DC  I C6    1 
ATOM   2138  P P     . DC  A 1 106 ? 10.533  96.665  28.578  1.00   187.57 ? 106 DC  I P     1 
ATOM   2139  O OP1   . DC  A 1 106 ? 9.330   95.984  28.048  1.00   106.68 ? 106 DC  I OP1   1 
ATOM   2140  O OP2   . DC  A 1 106 ? 10.841  96.595  30.024  1.00   182.70 ? 106 DC  I OP2   1 
ATOM   2141  O "O5'" . DC  A 1 106 ? 11.820  96.151  27.781  1.00   177.01 ? 106 DC  I "O5'" 1 
ATOM   2142  C "C5'" . DC  A 1 106 ? 11.973  96.469  26.403  1.00   165.43 ? 106 DC  I "C5'" 1 
ATOM   2143  C "C4'" . DC  A 1 106 ? 13.427  96.365  25.982  1.00   168.18 ? 106 DC  I "C4'" 1 
ATOM   2144  O "O4'" . DC  A 1 106 ? 14.229  97.288  26.764  1.00   181.54 ? 106 DC  I "O4'" 1 
ATOM   2145  C "C3'" . DC  A 1 106 ? 14.058  94.981  26.171  1.00   183.81 ? 106 DC  I "C3'" 1 
ATOM   2146  O "O3'" . DC  A 1 106 ? 14.747  94.598  24.988  1.00   190.56 ? 106 DC  I "O3'" 1 
ATOM   2147  C "C2'" . DC  A 1 106 ? 15.019  95.177  27.345  1.00   190.01 ? 106 DC  I "C2'" 1 
ATOM   2148  C "C1'" . DC  A 1 106 ? 15.402  96.638  27.189  1.00   191.78 ? 106 DC  I "C1'" 1 
ATOM   2149  N N1    . DC  A 1 106 ? 15.867  97.272  28.458  1.00   189.03 ? 106 DC  I N1    1 
ATOM   2150  C C2    . DC  A 1 106 ? 17.063  98.000  28.470  1.00   178.75 ? 106 DC  I C2    1 
ATOM   2151  O O2    . DC  A 1 106 ? 17.713  98.110  27.423  1.00   163.76 ? 106 DC  I O2    1 
ATOM   2152  N N3    . DC  A 1 106 ? 17.474  98.567  29.631  1.00   172.69 ? 106 DC  I N3    1 
ATOM   2153  C C4    . DC  A 1 106 ? 16.744  98.426  30.739  1.00   169.86 ? 106 DC  I C4    1 
ATOM   2154  N N4    . DC  A 1 106 ? 17.190  99.004  31.860  1.00   158.45 ? 106 DC  I N4    1 
ATOM   2155  C C5    . DC  A 1 106 ? 15.524  97.686  30.747  1.00   166.27 ? 106 DC  I C5    1 
ATOM   2156  C C6    . DC  A 1 106 ? 15.129  97.131  29.596  1.00   170.82 ? 106 DC  I C6    1 
ATOM   2157  P P     . DA  A 1 107 ? 15.284  93.093  24.818  1.00   190.80 ? 107 DA  I P     1 
ATOM   2158  O OP1   . DA  A 1 107 ? 15.115  92.717  23.397  1.00   188.59 ? 107 DA  I OP1   1 
ATOM   2159  O OP2   . DA  A 1 107 ? 14.662  92.267  25.877  1.00   156.14 ? 107 DA  I OP2   1 
ATOM   2160  O "O5'" . DA  A 1 107 ? 16.848  93.207  25.136  1.00   181.33 ? 107 DA  I "O5'" 1 
ATOM   2161  C "C5'" . DA  A 1 107 ? 17.684  94.004  24.306  1.00   164.93 ? 107 DA  I "C5'" 1 
ATOM   2162  C "C4'" . DA  A 1 107 ? 19.130  93.930  24.765  1.00   161.62 ? 107 DA  I "C4'" 1 
ATOM   2163  O "O4'" . DA  A 1 107 ? 19.328  94.819  25.897  1.00   174.57 ? 107 DA  I "O4'" 1 
ATOM   2164  C "C3'" . DA  A 1 107 ? 19.595  92.544  25.223  1.00   175.54 ? 107 DA  I "C3'" 1 
ATOM   2165  O "O3'" . DA  A 1 107 ? 20.890  92.271  24.703  1.00   186.84 ? 107 DA  I "O3'" 1 
ATOM   2166  C "C2'" . DA  A 1 107 ? 19.621  92.671  26.745  1.00   178.19 ? 107 DA  I "C2'" 1 
ATOM   2167  C "C1'" . DA  A 1 107 ? 20.014  94.128  26.914  1.00   185.65 ? 107 DA  I "C1'" 1 
ATOM   2168  N N9    . DA  A 1 107 ? 19.631  94.689  28.206  1.00   190.49 ? 107 DA  I N9    1 
ATOM   2169  C C8    . DA  A 1 107 ? 18.383  94.701  28.763  1.00   183.42 ? 107 DA  I C8    1 
ATOM   2170  N N7    . DA  A 1 107 ? 18.335  95.274  29.943  1.00   174.93 ? 107 DA  I N7    1 
ATOM   2171  C C5    . DA  A 1 107 ? 19.644  95.664  30.176  1.00   181.04 ? 107 DA  I C5    1 
ATOM   2172  C C6    . DA  A 1 107 ? 20.260  96.328  31.256  1.00   170.09 ? 107 DA  I C6    1 
ATOM   2173  N N6    . DA  A 1 107 ? 19.599  96.729  32.347  1.00   153.68 ? 107 DA  I N6    1 
ATOM   2174  N N1    . DA  A 1 107 ? 21.587  96.564  31.170  1.00   165.35 ? 107 DA  I N1    1 
ATOM   2175  C C2    . DA  A 1 107 ? 22.245  96.162  30.076  1.00   155.54 ? 107 DA  I C2    1 
ATOM   2176  N N3    . DA  A 1 107 ? 21.776  95.531  29.000  1.00   145.09 ? 107 DA  I N3    1 
ATOM   2177  C C4    . DA  A 1 107 ? 20.456  95.310  29.115  1.00   180.40 ? 107 DA  I C4    1 
ATOM   2178  P P     . DA  A 1 108 ? 21.458  90.767  24.680  1.00   179.49 ? 108 DA  I P     1 
ATOM   2179  O OP1   . DA  A 1 108 ? 21.673  90.396  23.264  1.00   198.00 ? 108 DA  I OP1   1 
ATOM   2180  O OP2   . DA  A 1 108 ? 20.588  89.927  25.533  1.00   148.95 ? 108 DA  I OP2   1 
ATOM   2181  O "O5'" . DA  A 1 108 ? 22.881  90.888  25.398  1.00   169.56 ? 108 DA  I "O5'" 1 
ATOM   2182  C "C5'" . DA  A 1 108 ? 23.880  91.745  24.854  1.00   160.45 ? 108 DA  I "C5'" 1 
ATOM   2183  C "C4'" . DA  A 1 108 ? 24.989  91.997  25.861  1.00   169.23 ? 108 DA  I "C4'" 1 
ATOM   2184  O "O4'" . DA  A 1 108 ? 24.451  92.706  27.008  1.00   184.06 ? 108 DA  I "O4'" 1 
ATOM   2185  C "C3'" . DA  A 1 108 ? 25.661  90.740  26.414  1.00   175.47 ? 108 DA  I "C3'" 1 
ATOM   2186  O "O3'" . DA  A 1 108 ? 27.060  90.955  26.544  1.00   180.22 ? 108 DA  I "O3'" 1 
ATOM   2187  C "C2'" . DA  A 1 108 ? 24.994  90.560  27.775  1.00   166.65 ? 108 DA  I "C2'" 1 
ATOM   2188  C "C1'" . DA  A 1 108 ? 24.757  92.003  28.193  1.00   175.11 ? 108 DA  I "C1'" 1 
ATOM   2189  N N9    . DA  A 1 108 ? 23.644  92.161  29.125  1.00   180.68 ? 108 DA  I N9    1 
ATOM   2190  C C8    . DA  A 1 108 ? 22.331  91.855  28.898  1.00   187.38 ? 108 DA  I C8    1 
ATOM   2191  N N7    . DA  A 1 108 ? 21.546  92.102  29.921  1.00   177.93 ? 108 DA  I N7    1 
ATOM   2192  C C5    . DA  A 1 108 ? 22.404  92.605  30.884  1.00   163.49 ? 108 DA  I C5    1 
ATOM   2193  C C6    . DA  A 1 108 ? 22.190  93.058  32.201  1.00   150.28 ? 108 DA  I C6    1 
ATOM   2194  N N6    . DA  A 1 108 ? 20.990  93.073  32.788  1.00   140.89 ? 108 DA  I N6    1 
ATOM   2195  N N1    . DA  A 1 108 ? 23.263  93.497  32.893  1.00   155.90 ? 108 DA  I N1    1 
ATOM   2196  C C2    . DA  A 1 108 ? 24.464  93.481  32.300  1.00   157.71 ? 108 DA  I C2    1 
ATOM   2197  N N3    . DA  A 1 108 ? 24.787  93.078  31.072  1.00   156.56 ? 108 DA  I N3    1 
ATOM   2198  C C4    . DA  A 1 108 ? 23.701  92.649  30.410  1.00   165.93 ? 108 DA  I C4    1 
ATOM   2199  P P     . DG  A 1 109 ? 28.054  89.709  26.745  1.00   183.34 ? 109 DG  I P     1 
ATOM   2200  O OP1   . DG  A 1 109 ? 29.181  89.875  25.800  1.00   187.73 ? 109 DG  I OP1   1 
ATOM   2201  O OP2   . DG  A 1 109 ? 27.241  88.472  26.714  1.00   162.88 ? 109 DG  I OP2   1 
ATOM   2202  O "O5'" . DG  A 1 109 ? 28.603  89.895  28.234  1.00   161.70 ? 109 DG  I "O5'" 1 
ATOM   2203  C "C5'" . DG  A 1 109 ? 29.308  91.077  28.589  1.00   135.04 ? 109 DG  I "C5'" 1 
ATOM   2204  C "C4'" . DG  A 1 109 ? 29.513  91.153  30.091  1.00   136.68 ? 109 DG  I "C4'" 1 
ATOM   2205  O "O4'" . DG  A 1 109 ? 28.223  91.256  30.752  1.00   163.86 ? 109 DG  I "O4'" 1 
ATOM   2206  C "C3'" . DG  A 1 109 ? 30.211  89.943  30.710  1.00   138.74 ? 109 DG  I "C3'" 1 
ATOM   2207  O "O3'" . DG  A 1 109 ? 31.083  90.367  31.746  1.00   146.82 ? 109 DG  I "O3'" 1 
ATOM   2208  C "C2'" . DG  A 1 109 ? 29.048  89.121  31.258  1.00   141.56 ? 109 DG  I "C2'" 1 
ATOM   2209  C "C1'" . DG  A 1 109 ? 28.083  90.214  31.694  1.00   151.41 ? 109 DG  I "C1'" 1 
ATOM   2210  N N9    . DG  A 1 109 ? 26.686  89.787  31.707  1.00   148.36 ? 109 DG  I N9    1 
ATOM   2211  C C8    . DG  A 1 109 ? 26.051  89.008  30.770  1.00   150.22 ? 109 DG  I C8    1 
ATOM   2212  N N7    . DG  A 1 109 ? 24.795  88.789  31.043  1.00   159.90 ? 109 DG  I N7    1 
ATOM   2213  C C5    . DG  A 1 109 ? 24.582  89.467  32.237  1.00   159.40 ? 109 DG  I C5    1 
ATOM   2214  C C6    . DG  A 1 109 ? 23.408  89.591  33.019  1.00   155.12 ? 109 DG  I C6    1 
ATOM   2215  O O6    . DG  A 1 109 ? 22.287  89.109  32.803  1.00   126.23 ? 109 DG  I O6    1 
ATOM   2216  N N1    . DG  A 1 109 ? 23.625  90.367  34.155  1.00   168.77 ? 109 DG  I N1    1 
ATOM   2217  C C2    . DG  A 1 109 ? 24.824  90.948  34.493  1.00   161.70 ? 109 DG  I C2    1 
ATOM   2218  N N2    . DG  A 1 109 ? 24.839  91.663  35.629  1.00   126.59 ? 109 DG  I N2    1 
ATOM   2219  N N3    . DG  A 1 109 ? 25.932  90.840  33.769  1.00   169.06 ? 109 DG  I N3    1 
ATOM   2220  C C4    . DG  A 1 109 ? 25.737  90.087  32.658  1.00   158.49 ? 109 DG  I C4    1 
ATOM   2221  P P     . DG  A 1 110 ? 32.589  89.811  31.816  1.00   147.71 ? 110 DG  I P     1 
ATOM   2222  O OP1   . DG  A 1 110 ? 33.268  90.190  30.558  1.00   136.79 ? 110 DG  I OP1   1 
ATOM   2223  O OP2   . DG  A 1 110 ? 32.525  88.388  32.218  1.00   141.16 ? 110 DG  I OP2   1 
ATOM   2224  O "O5'" . DG  A 1 110 ? 33.242  90.630  33.026  1.00   169.29 ? 110 DG  I "O5'" 1 
ATOM   2225  C "C5'" . DG  A 1 110 ? 33.230  92.055  33.011  1.00   142.13 ? 110 DG  I "C5'" 1 
ATOM   2226  C "C4'" . DG  A 1 110 ? 32.700  92.609  34.324  1.00   133.90 ? 110 DG  I "C4'" 1 
ATOM   2227  O "O4'" . DG  A 1 110 ? 31.297  92.258  34.470  1.00   151.11 ? 110 DG  I "O4'" 1 
ATOM   2228  C "C3'" . DG  A 1 110 ? 33.399  92.091  35.579  1.00   115.91 ? 110 DG  I "C3'" 1 
ATOM   2229  O "O3'" . DG  A 1 110 ? 33.531  93.139  36.531  1.00   131.12 ? 110 DG  I "O3'" 1 
ATOM   2230  C "C2'" . DG  A 1 110 ? 32.455  91.000  36.075  1.00   126.08 ? 110 DG  I "C2'" 1 
ATOM   2231  C "C1'" . DG  A 1 110 ? 31.097  91.565  35.685  1.00   140.78 ? 110 DG  I "C1'" 1 
ATOM   2232  N N9    . DG  A 1 110 ? 30.081  90.539  35.466  1.00   138.34 ? 110 DG  I N9    1 
ATOM   2233  C C8    . DG  A 1 110 ? 30.105  89.542  34.521  1.00   154.47 ? 110 DG  I C8    1 
ATOM   2234  N N7    . DG  A 1 110 ? 29.057  88.767  34.554  1.00   152.88 ? 110 DG  I N7    1 
ATOM   2235  C C5    . DG  A 1 110 ? 28.285  89.284  35.585  1.00   146.01 ? 110 DG  I C5    1 
ATOM   2236  C C6    . DG  A 1 110 ? 27.032  88.857  36.086  1.00   154.67 ? 110 DG  I C6    1 
ATOM   2237  O O6    . DG  A 1 110 ? 26.335  87.905  35.703  1.00   154.00 ? 110 DG  I O6    1 
ATOM   2238  N N1    . DG  A 1 110 ? 26.600  89.657  37.141  1.00   148.46 ? 110 DG  I N1    1 
ATOM   2239  C C2    . DG  A 1 110 ? 27.290  90.733  37.646  1.00   141.74 ? 110 DG  I C2    1 
ATOM   2240  N N2    . DG  A 1 110 ? 26.711  91.384  38.665  1.00   154.27 ? 110 DG  I N2    1 
ATOM   2241  N N3    . DG  A 1 110 ? 28.465  91.144  37.185  1.00   128.63 ? 110 DG  I N3    1 
ATOM   2242  C C4    . DG  A 1 110 ? 28.900  90.375  36.158  1.00   127.32 ? 110 DG  I C4    1 
ATOM   2243  P P     . DG  A 1 111 ? 34.574  93.003  37.745  1.00   127.56 ? 111 DG  I P     1 
ATOM   2244  O OP1   . DG  A 1 111 ? 34.913  94.369  38.202  1.00   134.02 ? 111 DG  I OP1   1 
ATOM   2245  O OP2   . DG  A 1 111 ? 35.648  92.083  37.311  1.00   131.66 ? 111 DG  I OP2   1 
ATOM   2246  O "O5'" . DG  A 1 111 ? 33.736  92.271  38.893  1.00   118.28 ? 111 DG  I "O5'" 1 
ATOM   2247  C "C5'" . DG  A 1 111 ? 32.622  92.926  39.484  1.00   116.70 ? 111 DG  I "C5'" 1 
ATOM   2248  C "C4'" . DG  A 1 111 ? 31.814  91.964  40.338  1.00   127.41 ? 111 DG  I "C4'" 1 
ATOM   2249  O "O4'" . DG  A 1 111 ? 31.188  90.963  39.491  1.00   133.80 ? 111 DG  I "O4'" 1 
ATOM   2250  C "C3'" . DG  A 1 111 ? 32.617  91.184  41.384  1.00   130.22 ? 111 DG  I "C3'" 1 
ATOM   2251  O "O3'" . DG  A 1 111 ? 31.867  91.092  42.585  1.00   141.43 ? 111 DG  I "O3'" 1 
ATOM   2252  C "C2'" . DG  A 1 111 ? 32.780  89.814  40.732  1.00   107.45 ? 111 DG  I "C2'" 1 
ATOM   2253  C "C1'" . DG  A 1 111 ? 31.444  89.687  40.027  1.00   129.53 ? 111 DG  I "C1'" 1 
ATOM   2254  N N9    . DG  A 1 111 ? 31.432  88.711  38.943  1.00   135.75 ? 111 DG  I N9    1 
ATOM   2255  C C8    . DG  A 1 111 ? 32.474  88.377  38.112  1.00   113.01 ? 111 DG  I C8    1 
ATOM   2256  N N7    . DG  A 1 111 ? 32.162  87.469  37.229  1.00   126.02 ? 111 DG  I N7    1 
ATOM   2257  C C5    . DG  A 1 111 ? 30.828  87.181  37.494  1.00   143.69 ? 111 DG  I C5    1 
ATOM   2258  C C6    . DG  A 1 111 ? 29.947  86.271  36.863  1.00   144.51 ? 111 DG  I C6    1 
ATOM   2259  O O6    . DG  A 1 111 ? 30.178  85.513  35.911  1.00   153.73 ? 111 DG  I O6    1 
ATOM   2260  N N1    . DG  A 1 111 ? 28.680  86.292  37.445  1.00   142.65 ? 111 DG  I N1    1 
ATOM   2261  C C2    . DG  A 1 111 ? 28.314  87.092  38.503  1.00   137.58 ? 111 DG  I C2    1 
ATOM   2262  N N2    . DG  A 1 111 ? 27.047  86.974  38.927  1.00   143.89 ? 111 DG  I N2    1 
ATOM   2263  N N3    . DG  A 1 111 ? 29.129  87.948  39.101  1.00   136.80 ? 111 DG  I N3    1 
ATOM   2264  C C4    . DG  A 1 111 ? 30.366  87.939  38.546  1.00   146.06 ? 111 DG  I C4    1 
ATOM   2265  P P     . DG  A 1 112 ? 32.381  91.817  43.922  1.00   135.73 ? 112 DG  I P     1 
ATOM   2266  O OP1   . DG  A 1 112 ? 32.850  93.171  43.552  1.00   120.29 ? 112 DG  I OP1   1 
ATOM   2267  O OP2   . DG  A 1 112 ? 33.304  90.879  44.599  1.00   115.21 ? 112 DG  I OP2   1 
ATOM   2268  O "O5'" . DG  A 1 112 ? 31.061  91.944  44.819  1.00   102.75 ? 112 DG  I "O5'" 1 
ATOM   2269  C "C5'" . DG  A 1 112 ? 29.799  92.205  44.206  1.00   96.76  ? 112 DG  I "C5'" 1 
ATOM   2270  C "C4'" . DG  A 1 112 ? 28.750  91.217  44.692  1.00   112.51 ? 112 DG  I "C4'" 1 
ATOM   2271  O "O4'" . DG  A 1 112 ? 28.589  90.154  43.709  1.00   143.47 ? 112 DG  I "O4'" 1 
ATOM   2272  C "C3'" . DG  A 1 112 ? 29.094  90.513  46.004  1.00   127.76 ? 112 DG  I "C3'" 1 
ATOM   2273  O "O3'" . DG  A 1 112 ? 27.913  90.259  46.755  1.00   131.67 ? 112 DG  I "O3'" 1 
ATOM   2274  C "C2'" . DG  A 1 112 ? 29.713  89.216  45.515  1.00   155.06 ? 112 DG  I "C2'" 1 
ATOM   2275  C "C1'" . DG  A 1 112 ? 28.803  88.910  44.341  1.00   153.29 ? 112 DG  I "C1'" 1 
ATOM   2276  N N9    . DG  A 1 112 ? 29.380  87.975  43.381  1.00   155.00 ? 112 DG  I N9    1 
ATOM   2277  C C8    . DG  A 1 112 ? 30.684  87.927  42.952  1.00   142.87 ? 112 DG  I C8    1 
ATOM   2278  N N7    . DG  A 1 112 ? 30.914  86.973  42.093  1.00   142.22 ? 112 DG  I N7    1 
ATOM   2279  C C5    . DG  A 1 112 ? 29.684  86.345  41.945  1.00   150.04 ? 112 DG  I C5    1 
ATOM   2280  C C6    . DG  A 1 112 ? 29.315  85.239  41.143  1.00   150.68 ? 112 DG  I C6    1 
ATOM   2281  O O6    . DG  A 1 112 ? 30.028  84.576  40.377  1.00   144.86 ? 112 DG  I O6    1 
ATOM   2282  N N1    . DG  A 1 112 ? 27.966  84.922  41.291  1.00   155.54 ? 112 DG  I N1    1 
ATOM   2283  C C2    . DG  A 1 112 ? 27.086  85.589  42.111  1.00   158.11 ? 112 DG  I C2    1 
ATOM   2284  N N2    . DG  A 1 112 ? 25.824  85.137  42.121  1.00   145.33 ? 112 DG  I N2    1 
ATOM   2285  N N3    . DG  A 1 112 ? 27.419  86.627  42.868  1.00   167.58 ? 112 DG  I N3    1 
ATOM   2286  C C4    . DG  A 1 112 ? 28.730  86.948  42.735  1.00   162.28 ? 112 DG  I C4    1 
ATOM   2287  P P     . DA  A 1 113 ? 27.991  90.177  48.357  1.00   144.99 ? 113 DA  I P     1 
ATOM   2288  O OP1   . DA  A 1 113 ? 27.179  91.292  48.892  1.00   84.84  ? 113 DA  I OP1   1 
ATOM   2289  O OP2   . DA  A 1 113 ? 29.418  90.060  48.731  1.00   142.61 ? 113 DA  I OP2   1 
ATOM   2290  O "O5'" . DA  A 1 113 ? 27.262  88.800  48.738  1.00   163.22 ? 113 DA  I "O5'" 1 
ATOM   2291  C "C5'" . DA  A 1 113 ? 25.891  88.616  48.418  1.00   147.34 ? 113 DA  I "C5'" 1 
ATOM   2292  C "C4'" . DA  A 1 113 ? 25.512  87.144  48.290  1.00   153.24 ? 113 DA  I "C4'" 1 
ATOM   2293  O "O4'" . DA  A 1 113 ? 26.136  86.533  47.127  1.00   147.39 ? 113 DA  I "O4'" 1 
ATOM   2294  C "C3'" . DA  A 1 113 ? 25.906  86.288  49.493  1.00   151.50 ? 113 DA  I "C3'" 1 
ATOM   2295  O "O3'" . DA  A 1 113 ? 24.860  85.386  49.819  1.00   152.35 ? 113 DA  I "O3'" 1 
ATOM   2296  C "C2'" . DA  A 1 113 ? 27.154  85.535  49.028  1.00   131.59 ? 113 DA  I "C2'" 1 
ATOM   2297  C "C1'" . DA  A 1 113 ? 26.964  85.450  47.518  1.00   146.19 ? 113 DA  I "C1'" 1 
ATOM   2298  N N9    . DA  A 1 113 ? 28.211  85.455  46.756  1.00   153.97 ? 113 DA  I N9    1 
ATOM   2299  C C8    . DA  A 1 113 ? 29.263  86.311  46.896  1.00   152.41 ? 113 DA  I C8    1 
ATOM   2300  N N7    . DA  A 1 113 ? 30.258  86.068  46.072  1.00   159.26 ? 113 DA  I N7    1 
ATOM   2301  C C5    . DA  A 1 113 ? 29.824  84.977  45.338  1.00   164.40 ? 113 DA  I C5    1 
ATOM   2302  C C6    . DA  A 1 113 ? 30.417  84.233  44.297  1.00   154.51 ? 113 DA  I C6    1 
ATOM   2303  N N6    . DA  A 1 113 ? 31.630  84.500  43.800  1.00   143.36 ? 113 DA  I N6    1 
ATOM   2304  N N1    . DA  A 1 113 ? 29.712  83.203  43.784  1.00   144.51 ? 113 DA  I N1    1 
ATOM   2305  C C2    . DA  A 1 113 ? 28.499  82.940  44.283  1.00   142.39 ? 113 DA  I C2    1 
ATOM   2306  N N3    . DA  A 1 113 ? 27.839  83.565  45.258  1.00   148.80 ? 113 DA  I N3    1 
ATOM   2307  C C4    . DA  A 1 113 ? 28.564  84.585  45.747  1.00   160.99 ? 113 DA  I C4    1 
ATOM   2308  P P     . DT  A 1 114 ? 25.036  84.360  51.045  1.00   172.14 ? 114 DT  I P     1 
ATOM   2309  O OP1   . DT  A 1 114 ? 23.704  84.153  51.653  1.00   156.46 ? 114 DT  I OP1   1 
ATOM   2310  O OP2   . DT  A 1 114 ? 26.157  84.829  51.891  1.00   117.42 ? 114 DT  I OP2   1 
ATOM   2311  O "O5'" . DT  A 1 114 ? 25.486  83.003  50.334  1.00   168.07 ? 114 DT  I "O5'" 1 
ATOM   2312  C "C5'" . DT  A 1 114 ? 24.710  82.486  49.267  1.00   161.07 ? 114 DT  I "C5'" 1 
ATOM   2313  C "C4'" . DT  A 1 114 ? 25.305  81.197  48.735  1.00   160.14 ? 114 DT  I "C4'" 1 
ATOM   2314  O "O4'" . DT  A 1 114 ? 26.423  81.489  47.861  1.00   156.12 ? 114 DT  I "O4'" 1 
ATOM   2315  C "C3'" . DT  A 1 114 ? 25.830  80.225  49.801  1.00   170.67 ? 114 DT  I "C3'" 1 
ATOM   2316  O "O3'" . DT  A 1 114 ? 25.153  78.970  49.657  1.00   186.31 ? 114 DT  I "O3'" 1 
ATOM   2317  C "C2'" . DT  A 1 114 ? 27.334  80.126  49.494  1.00   156.47 ? 114 DT  I "C2'" 1 
ATOM   2318  C "C1'" . DT  A 1 114 ? 27.379  80.477  48.018  1.00   157.33 ? 114 DT  I "C1'" 1 
ATOM   2319  N N1    . DT  A 1 114 ? 28.703  80.992  47.563  1.00   148.37 ? 114 DT  I N1    1 
ATOM   2320  C C2    . DT  A 1 114 ? 29.274  80.468  46.426  1.00   152.77 ? 114 DT  I C2    1 
ATOM   2321  O O2    . DT  A 1 114 ? 28.749  79.596  45.756  1.00   156.93 ? 114 DT  I O2    1 
ATOM   2322  N N3    . DT  A 1 114 ? 30.487  81.007  46.094  1.00   148.81 ? 114 DT  I N3    1 
ATOM   2323  C C4    . DT  A 1 114 ? 31.176  81.995  46.773  1.00   155.63 ? 114 DT  I C4    1 
ATOM   2324  O O4    . DT  A 1 114 ? 32.266  82.413  46.394  1.00   166.99 ? 114 DT  I O4    1 
ATOM   2325  C C5    . DT  A 1 114 ? 30.524  82.500  47.958  1.00   149.78 ? 114 DT  I C5    1 
ATOM   2326  C C7    . DT  A 1 114 ? 31.175  83.574  48.778  1.00   147.13 ? 114 DT  I C7    1 
ATOM   2327  C C6    . DT  A 1 114 ? 29.333  81.979  48.292  1.00   144.41 ? 114 DT  I C6    1 
ATOM   2328  P P     . DT  A 1 115 ? 25.512  77.683  50.556  1.00   198.12 ? 115 DT  I P     1 
ATOM   2329  O OP1   . DT  A 1 115 ? 24.263  77.283  51.240  1.00   200.25 ? 115 DT  I OP1   1 
ATOM   2330  O OP2   . DT  A 1 115 ? 26.725  77.914  51.373  1.00   154.76 ? 115 DT  I OP2   1 
ATOM   2331  O "O5'" . DT  A 1 115 ? 25.850  76.580  49.451  1.00   186.24 ? 115 DT  I "O5'" 1 
ATOM   2332  C "C5'" . DT  A 1 115 ? 26.817  76.876  48.456  1.00   170.92 ? 115 DT  I "C5'" 1 
ATOM   2333  C "C4'" . DT  A 1 115 ? 27.245  75.634  47.707  1.00   168.06 ? 115 DT  I "C4'" 1 
ATOM   2334  O "O4'" . DT  A 1 115 ? 28.336  75.970  46.823  1.00   170.55 ? 115 DT  I "O4'" 1 
ATOM   2335  C "C3'" . DT  A 1 115 ? 27.725  74.490  48.583  1.00   181.72 ? 115 DT  I "C3'" 1 
ATOM   2336  O "O3'" . DT  A 1 115 ? 27.203  73.258  48.102  1.00   196.29 ? 115 DT  I "O3'" 1 
ATOM   2337  C "C2'" . DT  A 1 115 ? 29.252  74.545  48.502  1.00   179.57 ? 115 DT  I "C2'" 1 
ATOM   2338  C "C1'" . DT  A 1 115 ? 29.545  75.390  47.262  1.00   180.54 ? 115 DT  I "C1'" 1 
ATOM   2339  N N1    . DT  A 1 115 ? 30.516  76.490  47.534  1.00   184.01 ? 115 DT  I N1    1 
ATOM   2340  C C2    . DT  A 1 115 ? 31.349  76.926  46.529  1.00   175.38 ? 115 DT  I C2    1 
ATOM   2341  O O2    . DT  A 1 115 ? 31.335  76.464  45.402  1.00   164.74 ? 115 DT  I O2    1 
ATOM   2342  N N3    . DT  A 1 115 ? 32.202  77.936  46.891  1.00   167.54 ? 115 DT  I N3    1 
ATOM   2343  C C4    . DT  A 1 115 ? 32.307  78.537  48.133  1.00   171.39 ? 115 DT  I C4    1 
ATOM   2344  O O4    . DT  A 1 115 ? 33.107  79.439  48.361  1.00   153.86 ? 115 DT  I O4    1 
ATOM   2345  C C5    . DT  A 1 115 ? 31.408  78.030  49.143  1.00   180.36 ? 115 DT  I C5    1 
ATOM   2346  C C7    . DT  A 1 115 ? 31.427  78.603  50.529  1.00   162.74 ? 115 DT  I C7    1 
ATOM   2347  C C6    . DT  A 1 115 ? 30.568  77.042  48.799  1.00   183.21 ? 115 DT  I C6    1 
ATOM   2348  P P     . DA  A 1 116 ? 27.157  71.970  49.059  1.00   195.15 ? 116 DA  I P     1 
ATOM   2349  O OP1   . DA  A 1 116 ? 25.758  71.488  49.096  1.00   193.58 ? 116 DA  I OP1   1 
ATOM   2350  O OP2   . DA  A 1 116 ? 27.850  72.311  50.322  1.00   171.13 ? 116 DA  I OP2   1 
ATOM   2351  O "O5'" . DA  A 1 116 ? 28.052  70.896  48.286  1.00   185.63 ? 116 DA  I "O5'" 1 
ATOM   2352  C "C5'" . DA  A 1 116 ? 28.993  70.117  49.000  1.00   186.17 ? 116 DA  I "C5'" 1 
ATOM   2353  C "C4'" . DA  A 1 116 ? 30.341  70.136  48.306  1.00   187.98 ? 116 DA  I "C4'" 1 
ATOM   2354  O "O4'" . DA  A 1 116 ? 30.850  71.497  48.268  1.00   183.30 ? 116 DA  I "O4'" 1 
ATOM   2355  C "C3'" . DA  A 1 116 ? 31.421  69.291  48.984  1.00   192.70 ? 116 DA  I "C3'" 1 
ATOM   2356  O "O3'" . DA  A 1 116 ? 32.108  68.512  48.017  1.00   192.26 ? 116 DA  I "O3'" 1 
ATOM   2357  C "C2'" . DA  A 1 116 ? 32.339  70.329  49.628  1.00   197.62 ? 116 DA  I "C2'" 1 
ATOM   2358  C "C1'" . DA  A 1 116 ? 32.197  71.503  48.675  1.00   191.41 ? 116 DA  I "C1'" 1 
ATOM   2359  N N9    . DA  A 1 116 ? 32.494  72.794  49.294  1.00   179.50 ? 116 DA  I N9    1 
ATOM   2360  C C8    . DA  A 1 116 ? 31.814  73.393  50.317  1.00   167.68 ? 116 DA  I C8    1 
ATOM   2361  N N7    . DA  A 1 116 ? 32.308  74.555  50.672  1.00   164.32 ? 116 DA  I N7    1 
ATOM   2362  C C5    . DA  A 1 116 ? 33.391  74.729  49.827  1.00   169.09 ? 116 DA  I C5    1 
ATOM   2363  C C6    . DA  A 1 116 ? 34.337  75.765  49.697  1.00   168.54 ? 116 DA  I C6    1 
ATOM   2364  N N6    . DA  A 1 116 ? 34.333  76.865  50.457  1.00   166.32 ? 116 DA  I N6    1 
ATOM   2365  N N1    . DA  A 1 116 ? 35.291  75.626  48.753  1.00   174.55 ? 116 DA  I N1    1 
ATOM   2366  C C2    . DA  A 1 116 ? 35.292  74.523  47.994  1.00   178.75 ? 116 DA  I C2    1 
ATOM   2367  N N3    . DA  A 1 116 ? 34.457  73.485  48.023  1.00   171.15 ? 116 DA  I N3    1 
ATOM   2368  C C4    . DA  A 1 116 ? 33.521  73.652  48.971  1.00   173.39 ? 116 DA  I C4    1 
ATOM   2369  P P     . DC  A 1 117 ? 32.678  67.062  48.411  1.00   175.96 ? 117 DC  I P     1 
ATOM   2370  O OP1   . DC  A 1 117 ? 32.234  66.106  47.373  1.00   168.27 ? 117 DC  I OP1   1 
ATOM   2371  O OP2   . DC  A 1 117 ? 32.337  66.819  49.831  1.00   150.42 ? 117 DC  I OP2   1 
ATOM   2372  O "O5'" . DC  A 1 117 ? 34.265  67.238  48.313  1.00   187.15 ? 117 DC  I "O5'" 1 
ATOM   2373  C "C5'" . DC  A 1 117 ? 34.862  67.612  47.078  1.00   181.42 ? 117 DC  I "C5'" 1 
ATOM   2374  C "C4'" . DC  A 1 117 ? 36.274  68.128  47.296  1.00   181.62 ? 117 DC  I "C4'" 1 
ATOM   2375  O "O4'" . DC  A 1 117 ? 36.223  69.477  47.830  1.00   172.79 ? 117 DC  I "O4'" 1 
ATOM   2376  C "C3'" . DC  A 1 117 ? 37.117  67.308  48.274  1.00   192.91 ? 117 DC  I "C3'" 1 
ATOM   2377  O "O3'" . DC  A 1 117 ? 38.420  67.107  47.742  1.00   190.84 ? 117 DC  I "O3'" 1 
ATOM   2378  C "C2'" . DC  A 1 117 ? 37.149  68.173  49.533  1.00   185.04 ? 117 DC  I "C2'" 1 
ATOM   2379  C "C1'" . DC  A 1 117 ? 37.072  69.575  48.949  1.00   175.36 ? 117 DC  I "C1'" 1 
ATOM   2380  N N1    . DC  A 1 117 ? 36.496  70.578  49.888  1.00   174.18 ? 117 DC  I N1    1 
ATOM   2381  C C2    . DC  A 1 117 ? 36.862  71.924  49.775  1.00   180.44 ? 117 DC  I C2    1 
ATOM   2382  O O2    . DC  A 1 117 ? 37.661  72.260  48.892  1.00   170.36 ? 117 DC  I O2    1 
ATOM   2383  N N3    . DC  A 1 117 ? 36.328  72.824  50.637  1.00   181.61 ? 117 DC  I N3    1 
ATOM   2384  C C4    . DC  A 1 117 ? 35.469  72.422  51.576  1.00   174.91 ? 117 DC  I C4    1 
ATOM   2385  N N4    . DC  A 1 117 ? 34.969  73.345  52.403  1.00   173.95 ? 117 DC  I N4    1 
ATOM   2386  C C5    . DC  A 1 117 ? 35.085  71.055  51.707  1.00   160.04 ? 117 DC  I C5    1 
ATOM   2387  C C6    . DC  A 1 117 ? 35.618  70.177  50.852  1.00   168.29 ? 117 DC  I C6    1 
ATOM   2388  P P     . DT  A 1 118 ? 39.424  66.064  48.438  1.00   185.24 ? 118 DT  I P     1 
ATOM   2389  O OP1   . DT  A 1 118 ? 40.205  65.410  47.364  1.00   196.98 ? 118 DT  I OP1   1 
ATOM   2390  O OP2   . DT  A 1 118 ? 38.637  65.241  49.383  1.00   176.43 ? 118 DT  I OP2   1 
ATOM   2391  O "O5'" . DT  A 1 118 ? 40.404  66.992  49.294  1.00   168.59 ? 118 DT  I "O5'" 1 
ATOM   2392  C "C5'" . DT  A 1 118 ? 41.178  67.991  48.644  1.00   164.96 ? 118 DT  I "C5'" 1 
ATOM   2393  C "C4'" . DT  A 1 118 ? 41.928  68.837  49.656  1.00   173.68 ? 118 DT  I "C4'" 1 
ATOM   2394  O "O4'" . DT  A 1 118 ? 41.016  69.780  50.281  1.00   186.35 ? 118 DT  I "O4'" 1 
ATOM   2395  C "C3'" . DT  A 1 118 ? 42.581  68.054  50.802  1.00   179.50 ? 118 DT  I "C3'" 1 
ATOM   2396  O "O3'" . DT  A 1 118 ? 43.899  68.529  51.014  1.00   186.84 ? 118 DT  I "O3'" 1 
ATOM   2397  C "C2'" . DT  A 1 118 ? 41.683  68.370  51.996  1.00   186.03 ? 118 DT  I "C2'" 1 
ATOM   2398  C "C1'" . DT  A 1 118 ? 41.260  69.789  51.665  1.00   184.04 ? 118 DT  I "C1'" 1 
ATOM   2399  N N1    . DT  A 1 118 ? 40.027  70.235  52.379  1.00   172.01 ? 118 DT  I N1    1 
ATOM   2400  C C2    . DT  A 1 118 ? 39.440  71.431  52.031  1.00   167.37 ? 118 DT  I C2    1 
ATOM   2401  O O2    . DT  A 1 118 ? 39.869  72.157  51.152  1.00   171.72 ? 118 DT  I O2    1 
ATOM   2402  N N3    . DT  A 1 118 ? 38.320  71.748  52.752  1.00   168.63 ? 118 DT  I N3    1 
ATOM   2403  C C4    . DT  A 1 118 ? 37.743  71.009  53.768  1.00   173.68 ? 118 DT  I C4    1 
ATOM   2404  O O4    . DT  A 1 118 ? 36.733  71.381  54.358  1.00   182.44 ? 118 DT  I O4    1 
ATOM   2405  C C5    . DT  A 1 118 ? 38.410  69.769  54.086  1.00   179.39 ? 118 DT  I C5    1 
ATOM   2406  C C7    . DT  A 1 118 ? 37.876  68.881  55.170  1.00   162.71 ? 118 DT  I C7    1 
ATOM   2407  C C6    . DT  A 1 118 ? 39.508  69.448  53.386  1.00   178.96 ? 118 DT  I C6    1 
ATOM   2408  P P     . DC  A 1 119 ? 45.155  67.537  50.876  1.00   188.31 ? 119 DC  I P     1 
ATOM   2409  O OP1   . DC  A 1 119 ? 44.930  66.687  49.686  1.00   190.89 ? 119 DC  I OP1   1 
ATOM   2410  O OP2   . DC  A 1 119 ? 45.384  66.911  52.198  1.00   141.77 ? 119 DC  I OP2   1 
ATOM   2411  O "O5'" . DC  A 1 119 ? 46.378  68.525  50.582  1.00   185.28 ? 119 DC  I "O5'" 1 
ATOM   2412  C "C5'" . DC  A 1 119 ? 46.251  69.526  49.577  1.00   170.93 ? 119 DC  I "C5'" 1 
ATOM   2413  C "C4'" . DC  A 1 119 ? 46.291  70.918  50.187  1.00   175.50 ? 119 DC  I "C4'" 1 
ATOM   2414  O "O4'" . DC  A 1 119 ? 45.096  71.139  50.987  1.00   169.93 ? 119 DC  I "O4'" 1 
ATOM   2415  C "C3'" . DC  A 1 119 ? 47.476  71.181  51.120  1.00   170.26 ? 119 DC  I "C3'" 1 
ATOM   2416  O "O3'" . DC  A 1 119 ? 47.992  72.482  50.884  1.00   167.82 ? 119 DC  I "O3'" 1 
ATOM   2417  C "C2'" . DC  A 1 119 ? 46.849  71.072  52.509  1.00   156.80 ? 119 DC  I "C2'" 1 
ATOM   2418  C "C1'" . DC  A 1 119 ? 45.475  71.656  52.240  1.00   157.21 ? 119 DC  I "C1'" 1 
ATOM   2419  N N1    . DC  A 1 119 ? 44.446  71.268  53.247  1.00   168.23 ? 119 DC  I N1    1 
ATOM   2420  C C2    . DC  A 1 119 ? 43.286  72.038  53.385  1.00   181.75 ? 119 DC  I C2    1 
ATOM   2421  O O2    . DC  A 1 119 ? 43.139  73.039  52.672  1.00   178.88 ? 119 DC  I O2    1 
ATOM   2422  N N3    . DC  A 1 119 ? 42.359  71.671  54.305  1.00   179.76 ? 119 DC  I N3    1 
ATOM   2423  C C4    . DC  A 1 119 ? 42.556  70.586  55.055  1.00   163.99 ? 119 DC  I C4    1 
ATOM   2424  N N4    . DC  A 1 119 ? 41.614  70.262  55.946  1.00   150.50 ? 119 DC  I N4    1 
ATOM   2425  C C5    . DC  A 1 119 ? 43.729  69.785  54.925  1.00   166.01 ? 119 DC  I C5    1 
ATOM   2426  C C6    . DC  A 1 119 ? 44.637  70.157  54.016  1.00   168.72 ? 119 DC  I C6    1 
ATOM   2427  P P     . DC  A 1 120 ? 49.558  72.781  51.077  1.00   147.05 ? 120 DC  I P     1 
ATOM   2428  O OP1   . DC  A 1 120 ? 50.030  73.504  49.875  1.00   131.55 ? 120 DC  I OP1   1 
ATOM   2429  O OP2   . DC  A 1 120 ? 50.210  71.516  51.482  1.00   152.42 ? 120 DC  I OP2   1 
ATOM   2430  O "O5'" . DC  A 1 120 ? 49.603  73.773  52.329  1.00   148.81 ? 120 DC  I "O5'" 1 
ATOM   2431  C "C5'" . DC  A 1 120 ? 48.834  74.968  52.314  1.00   144.06 ? 120 DC  I "C5'" 1 
ATOM   2432  C "C4'" . DC  A 1 120 ? 48.613  75.482  53.725  1.00   148.53 ? 120 DC  I "C4'" 1 
ATOM   2433  O "O4'" . DC  A 1 120 ? 47.663  74.624  54.413  1.00   156.45 ? 120 DC  I "O4'" 1 
ATOM   2434  C "C3'" . DC  A 1 120 ? 49.865  75.518  54.604  1.00   159.95 ? 120 DC  I "C3'" 1 
ATOM   2435  O "O3'" . DC  A 1 120 ? 49.865  76.695  55.392  1.00   166.63 ? 120 DC  I "O3'" 1 
ATOM   2436  C "C2'" . DC  A 1 120 ? 49.711  74.273  55.471  1.00   157.17 ? 120 DC  I "C2'" 1 
ATOM   2437  C "C1'" . DC  A 1 120 ? 48.204  74.233  55.655  1.00   163.78 ? 120 DC  I "C1'" 1 
ATOM   2438  N N1    . DC  A 1 120 ? 47.679  72.883  56.005  1.00   170.08 ? 120 DC  I N1    1 
ATOM   2439  C C2    . DC  A 1 120 ? 46.329  72.730  56.341  1.00   161.65 ? 120 DC  I C2    1 
ATOM   2440  O O2    . DC  A 1 120 ? 45.590  73.722  56.335  1.00   156.38 ? 120 DC  I O2    1 
ATOM   2441  N N3    . DC  A 1 120 ? 45.870  71.495  56.663  1.00   161.11 ? 120 DC  I N3    1 
ATOM   2442  C C4    . DC  A 1 120 ? 46.700  70.450  56.657  1.00   165.36 ? 120 DC  I C4    1 
ATOM   2443  N N4    . DC  A 1 120 ? 46.201  69.253  56.979  1.00   157.04 ? 120 DC  I N4    1 
ATOM   2444  C C5    . DC  A 1 120 ? 48.078  70.587  56.320  1.00   167.70 ? 120 DC  I C5    1 
ATOM   2445  C C6    . DC  A 1 120 ? 48.520  71.809  56.005  1.00   166.88 ? 120 DC  I C6    1 
ATOM   2446  P P     . DC  A 1 121 ? 51.250  77.366  55.853  1.00   166.82 ? 121 DC  I P     1 
ATOM   2447  O OP1   . DC  A 1 121 ? 51.920  77.900  54.646  1.00   142.04 ? 121 DC  I OP1   1 
ATOM   2448  O OP2   . DC  A 1 121 ? 51.957  76.398  56.720  1.00   145.89 ? 121 DC  I OP2   1 
ATOM   2449  O "O5'" . DC  A 1 121 ? 50.782  78.585  56.773  1.00   158.07 ? 121 DC  I "O5'" 1 
ATOM   2450  C "C5'" . DC  A 1 121 ? 49.552  79.240  56.498  1.00   129.76 ? 121 DC  I "C5'" 1 
ATOM   2451  C "C4'" . DC  A 1 121 ? 48.554  79.011  57.620  1.00   141.71 ? 121 DC  I "C4'" 1 
ATOM   2452  O "O4'" . DC  A 1 121 ? 48.183  77.608  57.679  1.00   147.65 ? 121 DC  I "O4'" 1 
ATOM   2453  C "C3'" . DC  A 1 121 ? 49.056  79.376  59.023  1.00   151.56 ? 121 DC  I "C3'" 1 
ATOM   2454  O "O3'" . DC  A 1 121 ? 48.120  80.229  59.659  1.00   148.79 ? 121 DC  I "O3'" 1 
ATOM   2455  C "C2'" . DC  A 1 121 ? 49.153  78.026  59.738  1.00   143.18 ? 121 DC  I "C2'" 1 
ATOM   2456  C "C1'" . DC  A 1 121 ? 48.067  77.240  59.029  1.00   143.33 ? 121 DC  I "C1'" 1 
ATOM   2457  N N1    . DC  A 1 121 ? 48.218  75.761  59.147  1.00   158.07 ? 121 DC  I N1    1 
ATOM   2458  C C2    . DC  A 1 121 ? 47.119  74.985  59.529  1.00   159.23 ? 121 DC  I C2    1 
ATOM   2459  O O2    . DC  A 1 121 ? 46.038  75.542  59.756  1.00   143.59 ? 121 DC  I O2    1 
ATOM   2460  N N3    . DC  A 1 121 ? 47.269  73.641  59.636  1.00   162.25 ? 121 DC  I N3    1 
ATOM   2461  C C4    . DC  A 1 121 ? 48.452  73.079  59.383  1.00   150.99 ? 121 DC  I C4    1 
ATOM   2462  N N4    . DC  A 1 121 ? 48.552  71.752  59.502  1.00   143.53 ? 121 DC  I N4    1 
ATOM   2463  C C5    . DC  A 1 121 ? 49.586  73.855  58.996  1.00   148.12 ? 121 DC  I C5    1 
ATOM   2464  C C6    . DC  A 1 121 ? 49.426  75.179  58.894  1.00   159.63 ? 121 DC  I C6    1 
ATOM   2465  P P     . DT  A 1 122 ? 48.625  81.417  60.613  1.00   132.68 ? 122 DT  I P     1 
ATOM   2466  O OP1   . DT  A 1 122 ? 47.874  82.626  60.214  1.00   136.55 ? 122 DT  I OP1   1 
ATOM   2467  O OP2   . DT  A 1 122 ? 50.105  81.424  60.590  1.00   136.96 ? 122 DT  I OP2   1 
ATOM   2468  O "O5'" . DT  A 1 122 ? 48.158  80.963  62.074  1.00   118.72 ? 122 DT  I "O5'" 1 
ATOM   2469  C "C5'" . DT  A 1 122 ? 46.774  80.911  62.388  1.00   116.44 ? 122 DT  I "C5'" 1 
ATOM   2470  C "C4'" . DT  A 1 122 ? 46.488  79.829  63.414  1.00   120.08 ? 122 DT  I "C4'" 1 
ATOM   2471  O "O4'" . DT  A 1 122 ? 46.961  78.563  62.925  1.00   160.65 ? 122 DT  I "O4'" 1 
ATOM   2472  C "C3'" . DT  A 1 122 ? 47.165  80.018  64.769  1.00   111.24 ? 122 DT  I "C3'" 1 
ATOM   2473  O "O3'" . DT  A 1 122 ? 46.229  80.553  65.700  1.00   116.19 ? 122 DT  I "O3'" 1 
ATOM   2474  C "C2'" . DT  A 1 122 ? 47.626  78.602  65.173  1.00   153.99 ? 122 DT  I "C2'" 1 
ATOM   2475  C "C1'" . DT  A 1 122 ? 47.145  77.714  64.024  1.00   164.96 ? 122 DT  I "C1'" 1 
ATOM   2476  N N1    . DT  A 1 122 ? 48.118  76.647  63.642  1.00   156.03 ? 122 DT  I N1    1 
ATOM   2477  C C2    . DT  A 1 122 ? 47.773  75.327  63.818  1.00   145.70 ? 122 DT  I C2    1 
ATOM   2478  O O2    . DT  A 1 122 ? 46.702  74.971  64.276  1.00   150.05 ? 122 DT  I O2    1 
ATOM   2479  N N3    . DT  A 1 122 ? 48.733  74.429  63.435  1.00   160.11 ? 122 DT  I N3    1 
ATOM   2480  C C4    . DT  A 1 122 ? 49.979  74.712  62.906  1.00   163.61 ? 122 DT  I C4    1 
ATOM   2481  O O4    . DT  A 1 122 ? 50.775  73.832  62.592  1.00   153.68 ? 122 DT  I O4    1 
ATOM   2482  C C5    . DT  A 1 122 ? 50.278  76.116  62.747  1.00   162.79 ? 122 DT  I C5    1 
ATOM   2483  C C7    . DT  A 1 122 ? 51.599  76.547  62.183  1.00   147.09 ? 122 DT  I C7    1 
ATOM   2484  C C6    . DT  A 1 122 ? 49.344  77.005  63.119  1.00   162.17 ? 122 DT  I C6    1 
ATOM   2485  P P     . DA  A 1 123 ? 46.677  80.897  67.205  1.00   140.52 ? 123 DA  I P     1 
ATOM   2486  O OP1   . DA  A 1 123 ? 45.952  82.115  67.625  1.00   133.16 ? 123 DA  I OP1   1 
ATOM   2487  O OP2   . DA  A 1 123 ? 48.156  80.873  67.267  1.00   144.13 ? 123 DA  I OP2   1 
ATOM   2488  O "O5'" . DA  A 1 123 ? 46.121  79.664  68.057  1.00   157.89 ? 123 DA  I "O5'" 1 
ATOM   2489  C "C5'" . DA  A 1 123 ? 44.730  79.354  68.033  1.00   146.77 ? 123 DA  I "C5'" 1 
ATOM   2490  C "C4'" . DA  A 1 123 ? 44.446  78.058  68.774  1.00   152.71 ? 123 DA  I "C4'" 1 
ATOM   2491  O "O4'" . DA  A 1 123 ? 45.227  76.984  68.191  1.00   151.76 ? 123 DA  I "O4'" 1 
ATOM   2492  C "C3'" . DA  A 1 123 ? 44.793  78.072  70.258  1.00   152.70 ? 123 DA  I "C3'" 1 
ATOM   2493  O "O3'" . DA  A 1 123 ? 43.870  77.272  70.984  1.00   145.07 ? 123 DA  I "O3'" 1 
ATOM   2494  C "C2'" . DA  A 1 123 ? 46.200  77.481  70.292  1.00   142.61 ? 123 DA  I "C2'" 1 
ATOM   2495  C "C1'" . DA  A 1 123 ? 46.173  76.497  69.125  1.00   152.65 ? 123 DA  I "C1'" 1 
ATOM   2496  N N9    . DA  A 1 123 ? 47.460  76.376  68.446  1.00   151.57 ? 123 DA  I N9    1 
ATOM   2497  C C8    . DA  A 1 123 ? 48.405  77.353  68.297  1.00   165.77 ? 123 DA  I C8    1 
ATOM   2498  N N7    . DA  A 1 123 ? 49.470  76.964  67.637  1.00   164.54 ? 123 DA  I N7    1 
ATOM   2499  C C5    . DA  A 1 123 ? 49.205  75.639  67.331  1.00   151.10 ? 123 DA  I C5    1 
ATOM   2500  C C6    . DA  A 1 123 ? 49.944  74.660  66.639  1.00   150.03 ? 123 DA  I C6    1 
ATOM   2501  N N6    . DA  A 1 123 ? 51.152  74.887  66.112  1.00   151.49 ? 123 DA  I N6    1 
ATOM   2502  N N1    . DA  A 1 123 ? 49.392  73.436  66.510  1.00   147.79 ? 123 DA  I N1    1 
ATOM   2503  C C2    . DA  A 1 123 ? 48.183  73.215  67.040  1.00   146.59 ? 123 DA  I C2    1 
ATOM   2504  N N3    . DA  A 1 123 ? 47.394  74.054  67.710  1.00   137.86 ? 123 DA  I N3    1 
ATOM   2505  C C4    . DA  A 1 123 ? 47.970  75.261  67.822  1.00   142.22 ? 123 DA  I C4    1 
ATOM   2506  P P     . DG  A 1 124 ? 43.839  77.333  72.589  1.00   147.86 ? 124 DG  I P     1 
ATOM   2507  O OP1   . DG  A 1 124 ? 42.432  77.174  73.019  1.00   129.43 ? 124 DG  I OP1   1 
ATOM   2508  O OP2   . DG  A 1 124 ? 44.607  78.526  73.009  1.00   144.32 ? 124 DG  I OP2   1 
ATOM   2509  O "O5'" . DG  A 1 124 ? 44.662  76.038  73.035  1.00   153.74 ? 124 DG  I "O5'" 1 
ATOM   2510  C "C5'" . DG  A 1 124 ? 44.191  74.745  72.680  1.00   151.54 ? 124 DG  I "C5'" 1 
ATOM   2511  C "C4'" . DG  A 1 124 ? 45.224  73.682  73.008  1.00   162.81 ? 124 DG  I "C4'" 1 
ATOM   2512  O "O4'" . DG  A 1 124 ? 46.293  73.716  72.026  1.00   157.53 ? 124 DG  I "O4'" 1 
ATOM   2513  C "C3'" . DG  A 1 124 ? 45.893  73.828  74.379  1.00   176.10 ? 124 DG  I "C3'" 1 
ATOM   2514  O "O3'" . DG  A 1 124 ? 45.887  72.575  75.055  1.00   179.12 ? 124 DG  I "O3'" 1 
ATOM   2515  C "C2'" . DG  A 1 124 ? 47.315  74.281  74.037  1.00   160.32 ? 124 DG  I "C2'" 1 
ATOM   2516  C "C1'" . DG  A 1 124 ? 47.530  73.620  72.688  1.00   160.97 ? 124 DG  I "C1'" 1 
ATOM   2517  N N9    . DG  A 1 124 ? 48.547  74.276  71.872  1.00   155.55 ? 124 DG  I N9    1 
ATOM   2518  C C8    . DG  A 1 124 ? 48.731  75.628  71.709  1.00   159.25 ? 124 DG  I C8    1 
ATOM   2519  N N7    . DG  A 1 124 ? 49.724  75.926  70.918  1.00   158.15 ? 124 DG  I N7    1 
ATOM   2520  C C5    . DG  A 1 124 ? 50.232  74.693  70.531  1.00   149.67 ? 124 DG  I C5    1 
ATOM   2521  C C6    . DG  A 1 124 ? 51.316  74.382  69.676  1.00   158.56 ? 124 DG  I C6    1 
ATOM   2522  O O6    . DG  A 1 124 ? 52.065  75.162  69.072  1.00   154.21 ? 124 DG  I O6    1 
ATOM   2523  N N1    . DG  A 1 124 ? 51.495  73.006  69.551  1.00   167.35 ? 124 DG  I N1    1 
ATOM   2524  C C2    . DG  A 1 124 ? 50.725  72.053  70.174  1.00   165.76 ? 124 DG  I C2    1 
ATOM   2525  N N2    . DG  A 1 124 ? 51.051  70.774  69.933  1.00   154.35 ? 124 DG  I N2    1 
ATOM   2526  N N3    . DG  A 1 124 ? 49.706  72.331  70.978  1.00   165.94 ? 124 DG  I N3    1 
ATOM   2527  C C4    . DG  A 1 124 ? 49.519  73.667  71.110  1.00   154.09 ? 124 DG  I C4    1 
ATOM   2528  P P     . DT  A 1 125 ? 46.130  72.501  76.643  1.00   175.52 ? 125 DT  I P     1 
ATOM   2529  O OP1   . DT  A 1 125 ? 44.888  71.982  77.258  1.00   163.56 ? 125 DT  I OP1   1 
ATOM   2530  O OP2   . DT  A 1 125 ? 46.684  73.797  77.094  1.00   159.28 ? 125 DT  I OP2   1 
ATOM   2531  O "O5'" . DT  A 1 125 ? 47.281  71.402  76.794  1.00   175.85 ? 125 DT  I "O5'" 1 
ATOM   2532  C "C5'" . DT  A 1 125 ? 48.374  71.400  75.886  1.00   175.50 ? 125 DT  I "C5'" 1 
ATOM   2533  C "C4'" . DT  A 1 125 ? 49.521  70.564  76.416  1.00   162.73 ? 125 DT  I "C4'" 1 
ATOM   2534  O "O4'" . DT  A 1 125 ? 50.641  70.662  75.503  1.00   163.74 ? 125 DT  I "O4'" 1 
ATOM   2535  C "C3'" . DT  A 1 125 ? 50.070  71.014  77.758  1.00   167.63 ? 125 DT  I "C3'" 1 
ATOM   2536  O "O3'" . DT  A 1 125 ? 50.717  69.926  78.401  1.00   177.04 ? 125 DT  I "O3'" 1 
ATOM   2537  C "C2'" . DT  A 1 125 ? 51.066  72.090  77.344  1.00   169.86 ? 125 DT  I "C2'" 1 
ATOM   2538  C "C1'" . DT  A 1 125 ? 51.638  71.508  76.051  1.00   170.80 ? 125 DT  I "C1'" 1 
ATOM   2539  N N1    . DT  A 1 125 ? 51.986  72.547  75.038  1.00   172.56 ? 125 DT  I N1    1 
ATOM   2540  C C2    . DT  A 1 125 ? 52.899  72.251  74.053  1.00   158.55 ? 125 DT  I C2    1 
ATOM   2541  O O2    . DT  A 1 125 ? 53.447  71.168  73.955  1.00   166.54 ? 125 DT  I O2    1 
ATOM   2542  N N3    . DT  A 1 125 ? 53.149  73.274  73.178  1.00   151.07 ? 125 DT  I N3    1 
ATOM   2543  C C4    . DT  A 1 125 ? 52.590  74.539  73.189  1.00   169.91 ? 125 DT  I C4    1 
ATOM   2544  O O4    . DT  A 1 125 ? 52.880  75.392  72.357  1.00   165.74 ? 125 DT  I O4    1 
ATOM   2545  C C5    . DT  A 1 125 ? 51.641  74.785  74.250  1.00   178.13 ? 125 DT  I C5    1 
ATOM   2546  C C7    . DT  A 1 125 ? 50.969  76.121  74.367  1.00   161.67 ? 125 DT  I C7    1 
ATOM   2547  C C6    . DT  A 1 125 ? 51.389  73.790  75.113  1.00   176.90 ? 125 DT  I C6    1 
ATOM   2548  P P     . DC  A 1 126 ? 50.957  69.943  79.990  1.00   188.39 ? 126 DC  I P     1 
ATOM   2549  O OP1   . DC  A 1 126 ? 50.062  68.928  80.589  1.00   167.14 ? 126 DC  I OP1   1 
ATOM   2550  O OP2   . DC  A 1 126 ? 50.889  71.347  80.453  1.00   168.60 ? 126 DC  I OP2   1 
ATOM   2551  O "O5'" . DC  A 1 126 ? 52.470  69.451  80.144  1.00   171.75 ? 126 DC  I "O5'" 1 
ATOM   2552  C "C5'" . DC  A 1 126 ? 52.903  68.282  79.462  1.00   175.41 ? 126 DC  I "C5'" 1 
ATOM   2553  C "C4'" . DC  A 1 126 ? 54.298  68.471  78.897  1.00   162.99 ? 126 DC  I "C4'" 1 
ATOM   2554  O "O4'" . DC  A 1 126 ? 54.316  69.626  78.019  1.00   145.33 ? 126 DC  I "O4'" 1 
ATOM   2555  C "C3'" . DC  A 1 126 ? 55.393  68.705  79.941  1.00   186.23 ? 126 DC  I "C3'" 1 
ATOM   2556  O "O3'" . DC  A 1 126 ? 56.506  67.860  79.675  1.00   199.26 ? 126 DC  I "O3'" 1 
ATOM   2557  C "C2'" . DC  A 1 126 ? 55.752  70.182  79.767  1.00   177.13 ? 126 DC  I "C2'" 1 
ATOM   2558  C "C1'" . DC  A 1 126 ? 55.460  70.399  78.292  1.00   168.77 ? 126 DC  I "C1'" 1 
ATOM   2559  N N1    . DC  A 1 126 ? 55.167  71.819  77.946  1.00   165.82 ? 126 DC  I N1    1 
ATOM   2560  C C2    . DC  A 1 126 ? 55.767  72.396  76.821  1.00   153.05 ? 126 DC  I C2    1 
ATOM   2561  O O2    . DC  A 1 126 ? 56.530  71.714  76.127  1.00   135.21 ? 126 DC  I O2    1 
ATOM   2562  N N3    . DC  A 1 126 ? 55.490  73.689  76.521  1.00   159.84 ? 126 DC  I N3    1 
ATOM   2563  C C4    . DC  A 1 126 ? 54.660  74.391  77.295  1.00   169.69 ? 126 DC  I C4    1 
ATOM   2564  N N4    . DC  A 1 126 ? 54.419  75.663  76.959  1.00   163.63 ? 126 DC  I N4    1 
ATOM   2565  C C5    . DC  A 1 126 ? 54.042  73.821  78.446  1.00   177.88 ? 126 DC  I C5    1 
ATOM   2566  C C6    . DC  A 1 126 ? 54.322  72.546  78.732  1.00   173.70 ? 126 DC  I C6    1 
ATOM   2567  P P     . DT  A 1 127 ? 57.670  67.687  80.769  1.00   189.74 ? 127 DT  I P     1 
ATOM   2568  O OP1   . DT  A 1 127 ? 58.274  66.351  80.573  1.00   182.00 ? 127 DT  I OP1   1 
ATOM   2569  O OP2   . DT  A 1 127 ? 57.108  68.057  82.088  1.00   168.53 ? 127 DT  I OP2   1 
ATOM   2570  O "O5'" . DT  A 1 127 ? 58.741  68.803  80.366  1.00   161.80 ? 127 DT  I "O5'" 1 
ATOM   2571  C "C5'" . DT  A 1 127 ? 59.299  68.814  79.057  1.00   151.66 ? 127 DT  I "C5'" 1 
ATOM   2572  C "C4'" . DT  A 1 127 ? 60.224  70.004  78.881  1.00   170.84 ? 127 DT  I "C4'" 1 
ATOM   2573  O "O4'" . DT  A 1 127 ? 59.462  71.221  78.777  1.00   192.62 ? 127 DT  I "O4'" 1 
ATOM   2574  C "C3'" . DT  A 1 127 ? 61.218  70.249  80.025  1.00   166.69 ? 127 DT  I "C3'" 1 
ATOM   2575  O "O3'" . DT  A 1 127 ? 62.535  69.912  79.610  1.00   152.85 ? 127 DT  I "O3'" 1 
ATOM   2576  C "C2'" . DT  A 1 127 ? 61.073  71.755  80.327  1.00   167.67 ? 127 DT  I "C2'" 1 
ATOM   2577  C "C1'" . DT  A 1 127 ? 60.341  72.258  79.092  1.00   177.34 ? 127 DT  I "C1'" 1 
ATOM   2578  N N1    . DT  A 1 127 ? 59.549  73.494  79.333  1.00   177.50 ? 127 DT  I N1    1 
ATOM   2579  C C2    . DT  A 1 127 ? 59.737  74.583  78.515  1.00   159.24 ? 127 DT  I C2    1 
ATOM   2580  O O2    . DT  A 1 127 ? 60.532  74.595  77.592  1.00   121.48 ? 127 DT  I O2    1 
ATOM   2581  N N3    . DT  A 1 127 ? 58.959  75.668  78.821  1.00   176.66 ? 127 DT  I N3    1 
ATOM   2582  C C4    . DT  A 1 127 ? 58.029  75.770  79.840  1.00   170.83 ? 127 DT  I C4    1 
ATOM   2583  O O4    . DT  A 1 127 ? 57.376  76.790  80.035  1.00   158.06 ? 127 DT  I O4    1 
ATOM   2584  C C5    . DT  A 1 127 ? 57.879  74.590  80.659  1.00   178.00 ? 127 DT  I C5    1 
ATOM   2585  C C7    . DT  A 1 127 ? 56.900  74.580  81.796  1.00   165.72 ? 127 DT  I C7    1 
ATOM   2586  C C6    . DT  A 1 127 ? 58.637  73.522  80.369  1.00   188.66 ? 127 DT  I C6    1 
ATOM   2587  P P     . DC  A 1 128 ? 63.640  69.480  80.693  1.00   176.15 ? 128 DC  I P     1 
ATOM   2588  O OP1   . DC  A 1 128 ? 64.150  68.146  80.307  1.00   193.07 ? 128 DC  I OP1   1 
ATOM   2589  O OP2   . DC  A 1 128 ? 63.053  69.684  82.036  1.00   166.12 ? 128 DC  I OP2   1 
ATOM   2590  O "O5'" . DC  A 1 128 ? 64.808  70.557  80.502  1.00   168.13 ? 128 DC  I "O5'" 1 
ATOM   2591  C "C5'" . DC  A 1 128 ? 64.564  71.926  80.796  1.00   168.71 ? 128 DC  I "C5'" 1 
ATOM   2592  C "C4'" . DC  A 1 128 ? 65.198  72.825  79.750  1.00   171.02 ? 128 DC  I "C4'" 1 
ATOM   2593  O "O4'" . DC  A 1 128 ? 64.237  73.829  79.330  1.00   180.33 ? 128 DC  I "O4'" 1 
ATOM   2594  C "C3'" . DC  A 1 128 ? 66.420  73.597  80.228  1.00   156.75 ? 128 DC  I "C3'" 1 
ATOM   2595  O "O3'" . DC  A 1 128 ? 67.321  73.802  79.148  1.00   146.96 ? 128 DC  I "O3'" 1 
ATOM   2596  C "C2'" . DC  A 1 128 ? 65.812  74.910  80.707  1.00   171.95 ? 128 DC  I "C2'" 1 
ATOM   2597  C "C1'" . DC  A 1 128 ? 64.699  75.118  79.687  1.00   176.25 ? 128 DC  I "C1'" 1 
ATOM   2598  N N1    . DC  A 1 128 ? 63.547  75.901  80.220  1.00   177.79 ? 128 DC  I N1    1 
ATOM   2599  C C2    . DC  A 1 128 ? 63.577  77.299  80.165  1.00   166.69 ? 128 DC  I C2    1 
ATOM   2600  O O2    . DC  A 1 128 ? 64.562  77.862  79.671  1.00   149.18 ? 128 DC  I O2    1 
ATOM   2601  N N3    . DC  A 1 128 ? 62.522  77.997  80.655  1.00   164.14 ? 128 DC  I N3    1 
ATOM   2602  C C4    . DC  A 1 128 ? 61.479  77.351  81.179  1.00   167.24 ? 128 DC  I C4    1 
ATOM   2603  N N4    . DC  A 1 128 ? 60.463  78.081  81.649  1.00   173.26 ? 128 DC  I N4    1 
ATOM   2604  C C5    . DC  A 1 128 ? 61.431  75.927  81.244  1.00   162.67 ? 128 DC  I C5    1 
ATOM   2605  C C6    . DC  A 1 128 ? 62.477  75.249  80.758  1.00   173.01 ? 128 DC  I C6    1 
ATOM   2606  P P     . DC  A 1 129 ? 68.733  74.525  79.406  1.00   170.31 ? 129 DC  I P     1 
ATOM   2607  O OP1   . DC  A 1 129 ? 69.672  74.081  78.352  1.00   157.23 ? 129 DC  I OP1   1 
ATOM   2608  O OP2   . DC  A 1 129 ? 69.078  74.335  80.832  1.00   166.49 ? 129 DC  I OP2   1 
ATOM   2609  O "O5'" . DC  A 1 129 ? 68.412  76.076  79.189  1.00   198.87 ? 129 DC  I "O5'" 1 
ATOM   2610  C "C5'" . DC  A 1 129 ? 69.397  77.054  79.489  1.00   194.83 ? 129 DC  I "C5'" 1 
ATOM   2611  C "C4'" . DC  A 1 129 ? 68.893  78.444  79.147  1.00   170.09 ? 129 DC  I "C4'" 1 
ATOM   2612  O "O4'" . DC  A 1 129 ? 67.541  78.592  79.621  1.00   147.96 ? 129 DC  I "O4'" 1 
ATOM   2613  C "C3'" . DC  A 1 129 ? 69.682  79.587  79.785  1.00   154.99 ? 129 DC  I "C3'" 1 
ATOM   2614  O "O3'" . DC  A 1 129 ? 70.573  80.232  78.821  1.00   147.57 ? 129 DC  I "O3'" 1 
ATOM   2615  C "C2'" . DC  A 1 129 ? 68.618  80.539  80.361  1.00   146.18 ? 129 DC  I "C2'" 1 
ATOM   2616  C "C1'" . DC  A 1 129 ? 67.297  79.950  79.870  1.00   148.03 ? 129 DC  I "C1'" 1 
ATOM   2617  N N1    . DC  A 1 129 ? 66.195  80.051  80.869  1.00   165.35 ? 129 DC  I N1    1 
ATOM   2618  C C2    . DC  A 1 129 ? 65.169  80.985  80.679  1.00   167.45 ? 129 DC  I C2    1 
ATOM   2619  O O2    . DC  A 1 129 ? 65.194  81.716  79.680  1.00   146.52 ? 129 DC  I O2    1 
ATOM   2620  N N3    . DC  A 1 129 ? 64.174  81.062  81.598  1.00   168.09 ? 129 DC  I N3    1 
ATOM   2621  C C4    . DC  A 1 129 ? 64.183  80.257  82.662  1.00   169.84 ? 129 DC  I C4    1 
ATOM   2622  N N4    . DC  A 1 129 ? 63.181  80.369  83.541  1.00   156.59 ? 129 DC  I N4    1 
ATOM   2623  C C5    . DC  A 1 129 ? 65.219  79.300  82.872  1.00   168.40 ? 129 DC  I C5    1 
ATOM   2624  C C6    . DC  A 1 129 ? 66.195  79.233  81.961  1.00   160.05 ? 129 DC  I C6    1 
ATOM   2625  P P     . DA  A 1 130 ? 70.055  80.908  77.446  1.00   157.17 ? 130 DA  I P     1 
ATOM   2626  O OP1   . DA  A 1 130 ? 69.284  79.951  76.622  1.00   130.78 ? 130 DA  I OP1   1 
ATOM   2627  O OP2   . DA  A 1 130 ? 71.255  81.533  76.849  1.00   107.14 ? 130 DA  I OP2   1 
ATOM   2628  O "O5'" . DA  A 1 130 ? 69.109  82.112  77.907  1.00   178.43 ? 130 DA  I "O5'" 1 
ATOM   2629  C "C5'" . DA  A 1 130 ? 68.287  82.775  76.952  1.00   147.76 ? 130 DA  I "C5'" 1 
ATOM   2630  C "C4'" . DA  A 1 130 ? 67.789  84.107  77.488  1.00   116.89 ? 130 DA  I "C4'" 1 
ATOM   2631  O "O4'" . DA  A 1 130 ? 67.027  83.892  78.708  1.00   133.94 ? 130 DA  I "O4'" 1 
ATOM   2632  C "C3'" . DA  A 1 130 ? 68.883  85.115  77.850  1.00   114.17 ? 130 DA  I "C3'" 1 
ATOM   2633  O "O3'" . DA  A 1 130 ? 68.461  86.421  77.494  1.00   129.81 ? 130 DA  I "O3'" 1 
ATOM   2634  C "C2'" . DA  A 1 130 ? 68.980  84.970  79.365  1.00   118.44 ? 130 DA  I "C2'" 1 
ATOM   2635  C "C1'" . DA  A 1 130 ? 67.519  84.749  79.713  1.00   138.21 ? 130 DA  I "C1'" 1 
ATOM   2636  N N9    . DA  A 1 130 ? 67.302  84.121  81.012  1.00   150.69 ? 130 DA  I N9    1 
ATOM   2637  C C8    . DA  A 1 130 ? 68.233  83.498  81.796  1.00   154.59 ? 130 DA  I C8    1 
ATOM   2638  N N7    . DA  A 1 130 ? 67.746  83.024  82.919  1.00   162.56 ? 130 DA  I N7    1 
ATOM   2639  C C5    . DA  A 1 130 ? 66.405  83.364  82.870  1.00   159.81 ? 130 DA  I C5    1 
ATOM   2640  C C6    . DA  A 1 130 ? 65.336  83.150  83.763  1.00   155.37 ? 130 DA  I C6    1 
ATOM   2641  N N6    . DA  A 1 130 ? 65.467  82.509  84.929  1.00   147.00 ? 130 DA  I N6    1 
ATOM   2642  N N1    . DA  A 1 130 ? 64.122  83.620  83.408  1.00   154.37 ? 130 DA  I N1    1 
ATOM   2643  C C2    . DA  A 1 130 ? 63.995  84.261  82.241  1.00   158.69 ? 130 DA  I C2    1 
ATOM   2644  N N3    . DA  A 1 130 ? 64.921  84.520  81.322  1.00   163.05 ? 130 DA  I N3    1 
ATOM   2645  C C4    . DA  A 1 130 ? 66.115  84.042  81.701  1.00   159.38 ? 130 DA  I C4    1 
ATOM   2646  P P     . DG  A 1 131 ? 68.812  87.036  76.052  1.00   139.84 ? 131 DG  I P     1 
ATOM   2647  O OP1   . DG  A 1 131 ? 68.872  85.923  75.079  1.00   124.16 ? 131 DG  I OP1   1 
ATOM   2648  O OP2   . DG  A 1 131 ? 69.979  87.930  76.217  1.00   133.65 ? 131 DG  I OP2   1 
ATOM   2649  O "O5'" . DG  A 1 131 ? 67.542  87.951  75.715  1.00   143.58 ? 131 DG  I "O5'" 1 
ATOM   2650  C "C5'" . DG  A 1 131 ? 66.273  87.347  75.477  1.00   132.14 ? 131 DG  I "C5'" 1 
ATOM   2651  C "C4'" . DG  A 1 131 ? 65.206  87.928  76.391  1.00   115.97 ? 131 DG  I "C4'" 1 
ATOM   2652  O "O4'" . DG  A 1 131 ? 65.427  87.476  77.754  1.00   102.22 ? 131 DG  I "O4'" 1 
ATOM   2653  C "C3'" . DG  A 1 131 ? 65.155  89.456  76.451  1.00   149.77 ? 131 DG  I "C3'" 1 
ATOM   2654  O "O3'" . DG  A 1 131 ? 63.800  89.895  76.442  1.00   157.11 ? 131 DG  I "O3'" 1 
ATOM   2655  C "C2'" . DG  A 1 131 ? 65.842  89.776  77.778  1.00   137.28 ? 131 DG  I "C2'" 1 
ATOM   2656  C "C1'" . DG  A 1 131 ? 65.432  88.583  78.626  1.00   126.02 ? 131 DG  I "C1'" 1 
ATOM   2657  N N9    . DG  A 1 131 ? 66.357  88.301  79.719  1.00   138.35 ? 131 DG  I N9    1 
ATOM   2658  C C8    . DG  A 1 131 ? 67.729  88.336  79.671  1.00   147.91 ? 131 DG  I C8    1 
ATOM   2659  N N7    . DG  A 1 131 ? 68.298  88.030  80.804  1.00   150.67 ? 131 DG  I N7    1 
ATOM   2660  C C5    . DG  A 1 131 ? 67.234  87.775  81.659  1.00   160.60 ? 131 DG  I C5    1 
ATOM   2661  C C6    . DG  A 1 131 ? 67.231  87.395  83.022  1.00   171.42 ? 131 DG  I C6    1 
ATOM   2662  O O6    . DG  A 1 131 ? 68.203  87.206  83.768  1.00   180.09 ? 131 DG  I O6    1 
ATOM   2663  N N1    . DG  A 1 131 ? 65.936  87.239  83.511  1.00   158.75 ? 131 DG  I N1    1 
ATOM   2664  C C2    . DG  A 1 131 ? 64.790  87.426  82.776  1.00   139.85 ? 131 DG  I C2    1 
ATOM   2665  N N2    . DG  A 1 131 ? 63.632  87.228  83.421  1.00   141.34 ? 131 DG  I N2    1 
ATOM   2666  N N3    . DG  A 1 131 ? 64.778  87.780  81.497  1.00   123.03 ? 131 DG  I N3    1 
ATOM   2667  C C4    . DG  A 1 131 ? 66.031  87.937  81.006  1.00   141.73 ? 131 DG  I C4    1 
ATOM   2668  P P     . DG  A 1 132 ? 63.448  91.459  76.332  1.00   123.99 ? 132 DG  I P     1 
ATOM   2669  O OP1   . DG  A 1 132 ? 62.305  91.587  75.401  1.00   93.30  ? 132 DG  I OP1   1 
ATOM   2670  O OP2   . DG  A 1 132 ? 64.700  92.200  76.060  1.00   112.44 ? 132 DG  I OP2   1 
ATOM   2671  O "O5'" . DG  A 1 132 ? 62.958  91.844  77.806  1.00   111.83 ? 132 DG  I "O5'" 1 
ATOM   2672  C "C5'" . DG  A 1 132 ? 61.807  91.211  78.358  1.00   101.06 ? 132 DG  I "C5'" 1 
ATOM   2673  C "C4'" . DG  A 1 132 ? 61.549  91.669  79.787  1.00   118.56 ? 132 DG  I "C4'" 1 
ATOM   2674  O "O4'" . DG  A 1 132 ? 62.585  91.129  80.660  1.00   119.18 ? 132 DG  I "O4'" 1 
ATOM   2675  C "C3'" . DG  A 1 132 ? 61.592  93.187  80.006  1.00   121.63 ? 132 DG  I "C3'" 1 
ATOM   2676  O "O3'" . DG  A 1 132 ? 60.690  93.534  81.047  1.00   123.89 ? 132 DG  I "O3'" 1 
ATOM   2677  C "C2'" . DG  A 1 132 ? 63.031  93.383  80.465  1.00   129.13 ? 132 DG  I "C2'" 1 
ATOM   2678  C "C1'" . DG  A 1 132 ? 63.141  92.195  81.394  1.00   129.28 ? 132 DG  I "C1'" 1 
ATOM   2679  N N9    . DG  A 1 132 ? 64.510  91.856  81.771  1.00   142.64 ? 132 DG  I N9    1 
ATOM   2680  C C8    . DG  A 1 132 ? 65.662  92.201  81.107  1.00   138.88 ? 132 DG  I C8    1 
ATOM   2681  N N7    . DG  A 1 132 ? 66.746  91.771  81.691  1.00   143.54 ? 132 DG  I N7    1 
ATOM   2682  C C5    . DG  A 1 132 ? 66.284  91.117  82.826  1.00   149.58 ? 132 DG  I C5    1 
ATOM   2683  C C6    . DG  A 1 132 ? 67.000  90.454  83.851  1.00   152.07 ? 132 DG  I C6    1 
ATOM   2684  O O6    . DG  A 1 132 ? 68.226  90.306  83.959  1.00   145.05 ? 132 DG  I O6    1 
ATOM   2685  N N1    . DG  A 1 132 ? 66.147  89.925  84.817  1.00   154.81 ? 132 DG  I N1    1 
ATOM   2686  C C2    . DG  A 1 132 ? 64.776  90.027  84.796  1.00   151.85 ? 132 DG  I C2    1 
ATOM   2687  N N2    . DG  A 1 132 ? 64.121  89.454  85.817  1.00   155.56 ? 132 DG  I N2    1 
ATOM   2688  N N3    . DG  A 1 132 ? 64.093  90.647  83.842  1.00   145.64 ? 132 DG  I N3    1 
ATOM   2689  C C4    . DG  A 1 132 ? 64.910  91.166  82.893  1.00   147.38 ? 132 DG  I C4    1 
ATOM   2690  P P     . DC  A 1 133 ? 60.220  95.057  81.258  1.00   115.99 ? 133 DC  I P     1 
ATOM   2691  O OP1   . DC  A 1 133 ? 58.853  95.172  80.707  1.00   111.90 ? 133 DC  I OP1   1 
ATOM   2692  O OP2   . DC  A 1 133 ? 61.285  95.959  80.763  1.00   115.49 ? 133 DC  I OP2   1 
ATOM   2693  O "O5'" . DC  A 1 133 ? 60.140  95.209  82.849  1.00   123.35 ? 133 DC  I "O5'" 1 
ATOM   2694  C "C5'" . DC  A 1 133 ? 59.219  94.414  83.591  1.00   127.69 ? 133 DC  I "C5'" 1 
ATOM   2695  C "C4'" . DC  A 1 133 ? 59.855  93.880  84.863  1.00   123.94 ? 133 DC  I "C4'" 1 
ATOM   2696  O "O4'" . DC  A 1 133 ? 61.118  93.264  84.548  1.00   139.12 ? 133 DC  I "O4'" 1 
ATOM   2697  C "C3'" . DC  A 1 133 ? 60.189  94.930  85.905  1.00   134.65 ? 133 DC  I "C3'" 1 
ATOM   2698  O "O3'" . DC  A 1 133 ? 59.047  95.170  86.724  1.00   156.19 ? 133 DC  I "O3'" 1 
ATOM   2699  C "C2'" . DC  A 1 133 ? 61.319  94.269  86.700  1.00   124.14 ? 133 DC  I "C2'" 1 
ATOM   2700  C "C1'" . DC  A 1 133 ? 61.966  93.321  85.679  1.00   137.43 ? 133 DC  I "C1'" 1 
ATOM   2701  N N1    . DC  A 1 133 ? 63.324  93.752  85.231  1.00   158.99 ? 133 DC  I N1    1 
ATOM   2702  C C2    . DC  A 1 133 ? 64.460  93.231  85.862  1.00   159.15 ? 133 DC  I C2    1 
ATOM   2703  O O2    . DC  A 1 133 ? 64.318  92.422  86.788  1.00   153.33 ? 133 DC  I O2    1 
ATOM   2704  N N3    . DC  A 1 133 ? 65.686  93.631  85.441  1.00   151.23 ? 133 DC  I N3    1 
ATOM   2705  C C4    . DC  A 1 133 ? 65.796  94.505  84.439  1.00   147.23 ? 133 DC  I C4    1 
ATOM   2706  N N4    . DC  A 1 133 ? 67.025  94.869  84.058  1.00   141.90 ? 133 DC  I N4    1 
ATOM   2707  C C5    . DC  A 1 133 ? 64.650  95.045  83.782  1.00   144.08 ? 133 DC  I C5    1 
ATOM   2708  C C6    . DC  A 1 133 ? 63.447  94.644  84.206  1.00   149.68 ? 133 DC  I C6    1 
ATOM   2709  P P     . DA  A 1 134 ? 58.922  96.526  87.577  1.00   150.91 ? 134 DA  I P     1 
ATOM   2710  O OP1   . DA  A 1 134 ? 57.505  96.667  87.982  1.00   136.14 ? 134 DA  I OP1   1 
ATOM   2711  O OP2   . DA  A 1 134 ? 59.578  97.610  86.813  1.00   121.16 ? 134 DA  I OP2   1 
ATOM   2712  O "O5'" . DA  A 1 134 ? 59.800  96.239  88.882  1.00   148.58 ? 134 DA  I "O5'" 1 
ATOM   2713  C "C5'" . DA  A 1 134 ? 59.493  95.124  89.711  1.00   143.14 ? 134 DA  I "C5'" 1 
ATOM   2714  C "C4'" . DA  A 1 134 ? 60.589  94.892  90.734  1.00   150.37 ? 134 DA  I "C4'" 1 
ATOM   2715  O "O4'" . DA  A 1 134 ? 61.818  94.521  90.054  1.00   166.35 ? 134 DA  I "O4'" 1 
ATOM   2716  C "C3'" . DA  A 1 134 ? 60.930  96.107  91.602  1.00   154.97 ? 134 DA  I "C3'" 1 
ATOM   2717  O "O3'" . DA  A 1 134 ? 61.049  95.715  92.962  1.00   148.41 ? 134 DA  I "O3'" 1 
ATOM   2718  C "C2'" . DA  A 1 134 ? 62.268  96.584  91.037  1.00   160.73 ? 134 DA  I "C2'" 1 
ATOM   2719  C "C1'" . DA  A 1 134 ? 62.885  95.276  90.576  1.00   162.28 ? 134 DA  I "C1'" 1 
ATOM   2720  N N9    . DA  A 1 134 ? 63.894  95.444  89.533  1.00   155.56 ? 134 DA  I N9    1 
ATOM   2721  C C8    . DA  A 1 134 ? 63.788  96.196  88.396  1.00   154.29 ? 134 DA  I C8    1 
ATOM   2722  N N7    . DA  A 1 134 ? 64.859  96.165  87.639  1.00   152.61 ? 134 DA  I N7    1 
ATOM   2723  C C5    . DA  A 1 134 ? 65.729  95.335  88.327  1.00   154.43 ? 134 DA  I C5    1 
ATOM   2724  C C6    . DA  A 1 134 ? 67.038  94.894  88.051  1.00   160.44 ? 134 DA  I C6    1 
ATOM   2725  N N6    . DA  A 1 134 ? 67.720  95.251  86.959  1.00   160.45 ? 134 DA  I N6    1 
ATOM   2726  N N1    . DA  A 1 134 ? 67.621  94.070  88.946  1.00   165.30 ? 134 DA  I N1    1 
ATOM   2727  C C2    . DA  A 1 134 ? 66.935  93.716  90.040  1.00   162.43 ? 134 DA  I C2    1 
ATOM   2728  N N3    . DA  A 1 134 ? 65.703  94.064  90.405  1.00   147.83 ? 134 DA  I N3    1 
ATOM   2729  C C4    . DA  A 1 134 ? 65.150  94.882  89.497  1.00   148.12 ? 134 DA  I C4    1 
ATOM   2730  P P     . DC  A 1 135 ? 61.367  96.811  94.093  1.00   169.58 ? 135 DC  I P     1 
ATOM   2731  O OP1   . DC  A 1 135 ? 60.817  96.305  95.371  1.00   174.95 ? 135 DC  I OP1   1 
ATOM   2732  O OP2   . DC  A 1 135 ? 60.937  98.131  93.580  1.00   160.51 ? 135 DC  I OP2   1 
ATOM   2733  O "O5'" . DC  A 1 135 ? 62.964  96.815  94.182  1.00   172.53 ? 135 DC  I "O5'" 1 
ATOM   2734  C "C5'" . DC  A 1 135 ? 63.658  95.611  94.483  1.00   171.62 ? 135 DC  I "C5'" 1 
ATOM   2735  C "C4'" . DC  A 1 135 ? 65.158  95.801  94.356  1.00   178.11 ? 135 DC  I "C4'" 1 
ATOM   2736  O "O4'" . DC  A 1 135 ? 65.550  95.678  92.976  1.00   184.18 ? 135 DC  I "O4'" 1 
ATOM   2737  C "C3'" . DC  A 1 135 ? 65.671  97.166  94.767  1.00   175.46 ? 135 DC  I "C3'" 1 
ATOM   2738  O "O3'" . DC  A 1 135 ? 65.861  97.210  96.178  1.00   175.37 ? 135 DC  I "O3'" 1 
ATOM   2739  C "C2'" . DC  A 1 135 ? 67.002  97.256  94.014  1.00   183.34 ? 135 DC  I "C2'" 1 
ATOM   2740  C "C1'" . DC  A 1 135 ? 66.773  96.365  92.783  1.00   180.91 ? 135 DC  I "C1'" 1 
ATOM   2741  N N1    . DC  A 1 135 ? 66.702  97.122  91.499  1.00   169.30 ? 135 DC  I N1    1 
ATOM   2742  C C2    . DC  A 1 135 ? 67.768  97.051  90.595  1.00   153.83 ? 135 DC  I C2    1 
ATOM   2743  O O2    . DC  A 1 135 ? 68.753  96.357  90.877  1.00   133.38 ? 135 DC  I O2    1 
ATOM   2744  N N3    . DC  A 1 135 ? 67.690  97.744  89.433  1.00   165.85 ? 135 DC  I N3    1 
ATOM   2745  C C4    . DC  A 1 135 ? 66.611  98.482  89.166  1.00   172.37 ? 135 DC  I C4    1 
ATOM   2746  N N4    . DC  A 1 135 ? 66.579  99.148  88.007  1.00   169.85 ? 135 DC  I N4    1 
ATOM   2747  C C5    . DC  A 1 135 ? 65.515  98.568  90.075  1.00   166.42 ? 135 DC  I C5    1 
ATOM   2748  C C6    . DC  A 1 135 ? 65.603  97.880  91.218  1.00   162.85 ? 135 DC  I C6    1 
ATOM   2749  P P     . DG  A 1 136 ? 66.317  98.576  96.891  1.00   168.17 ? 136 DG  I P     1 
ATOM   2750  O OP1   . DG  A 1 136 ? 65.992  98.459  98.330  1.00   163.91 ? 136 DG  I OP1   1 
ATOM   2751  O OP2   . DG  A 1 136 ? 65.763  99.699  96.102  1.00   168.30 ? 136 DG  I OP2   1 
ATOM   2752  O "O5'" . DG  A 1 136 ? 67.908  98.586  96.714  1.00   156.86 ? 136 DG  I "O5'" 1 
ATOM   2753  C "C5'" . DG  A 1 136 ? 68.595  99.814  96.509  1.00   158.16 ? 136 DG  I "C5'" 1 
ATOM   2754  C "C4'" . DG  A 1 136 ? 69.990  99.567  95.964  1.00   169.01 ? 136 DG  I "C4'" 1 
ATOM   2755  O "O4'" . DG  A 1 136 ? 69.900  98.812  94.731  1.00   157.26 ? 136 DG  I "O4'" 1 
ATOM   2756  C "C3'" . DG  A 1 136 ? 70.761  100.819 95.593  1.00   179.56 ? 136 DG  I "C3'" 1 
ATOM   2757  O "O3'" . DG  A 1 136 ? 71.404  101.384 96.763  1.00   169.79 ? 136 DG  I "O3'" 1 
ATOM   2758  C "C2'" . DG  A 1 136 ? 71.749  100.298 94.551  1.00   179.44 ? 136 DG  I "C2'" 1 
ATOM   2759  C "C1'" . DG  A 1 136 ? 70.931  99.216  93.842  1.00   173.06 ? 136 DG  I "C1'" 1 
ATOM   2760  N N9    . DG  A 1 136 ? 70.324  99.668  92.591  1.00   167.29 ? 136 DG  I N9    1 
ATOM   2761  C C8    . DG  A 1 136 ? 68.989  99.886  92.349  1.00   163.87 ? 136 DG  I C8    1 
ATOM   2762  N N7    . DG  A 1 136 ? 68.740  100.290 91.134  1.00   162.18 ? 136 DG  I N7    1 
ATOM   2763  C C5    . DG  A 1 136 ? 69.990  100.344 90.530  1.00   169.69 ? 136 DG  I C5    1 
ATOM   2764  C C6    . DG  A 1 136 ? 70.351  100.715 89.212  1.00   161.42 ? 136 DG  I C6    1 
ATOM   2765  O O6    . DG  A 1 136 ? 69.612  101.081 88.287  1.00   144.25 ? 136 DG  I O6    1 
ATOM   2766  N N1    . DG  A 1 136 ? 71.727  100.631 89.011  1.00   160.80 ? 136 DG  I N1    1 
ATOM   2767  C C2    . DG  A 1 136 ? 72.639  100.239 89.963  1.00   164.89 ? 136 DG  I C2    1 
ATOM   2768  N N2    . DG  A 1 136 ? 73.925  100.220 89.583  1.00   142.29 ? 136 DG  I N2    1 
ATOM   2769  N N3    . DG  A 1 136 ? 72.313  99.888  91.202  1.00   179.47 ? 136 DG  I N3    1 
ATOM   2770  C C4    . DG  A 1 136 ? 70.976  99.965  91.414  1.00   177.38 ? 136 DG  I C4    1 
ATOM   2771  P P     . DT  A 1 137 ? 72.903  100.984 97.204  1.00   176.29 ? 137 DT  I P     1 
ATOM   2772  O OP1   . DT  A 1 137 ? 73.088  99.517  97.111  1.00   165.67 ? 137 DT  I OP1   1 
ATOM   2773  O OP2   . DT  A 1 137 ? 73.124  101.635 98.514  1.00   176.08 ? 137 DT  I OP2   1 
ATOM   2774  O "O5'" . DT  A 1 137 ? 73.845  101.741 96.151  1.00   176.00 ? 137 DT  I "O5'" 1 
ATOM   2775  C "C5'" . DT  A 1 137 ? 75.246  101.491 96.141  1.00   169.91 ? 137 DT  I "C5'" 1 
ATOM   2776  C "C4'" . DT  A 1 137 ? 75.888  102.035 94.875  1.00   175.44 ? 137 DT  I "C4'" 1 
ATOM   2777  O "O4'" . DT  A 1 137 ? 74.918  102.035 93.794  1.00   174.84 ? 137 DT  I "O4'" 1 
ATOM   2778  C "C3'" . DT  A 1 137 ? 76.415  103.473 94.977  1.00   175.52 ? 137 DT  I "C3'" 1 
ATOM   2779  O "O3'" . DT  A 1 137 ? 77.743  103.544 94.466  1.00   162.97 ? 137 DT  I "O3'" 1 
ATOM   2780  C "C2'" . DT  A 1 137 ? 75.441  104.275 94.113  1.00   180.84 ? 137 DT  I "C2'" 1 
ATOM   2781  C "C1'" . DT  A 1 137 ? 75.037  103.240 93.080  1.00   178.40 ? 137 DT  I "C1'" 1 
ATOM   2782  N N1    . DT  A 1 137 ? 73.737  103.538 92.412  1.00   174.86 ? 137 DT  I N1    1 
ATOM   2783  C C2    . DT  A 1 137 ? 73.729  103.864 91.075  1.00   161.53 ? 137 DT  I C2    1 
ATOM   2784  O O2    . DT  A 1 137 ? 74.740  103.918 90.396  1.00   136.60 ? 137 DT  I O2    1 
ATOM   2785  N N3    . DT  A 1 137 ? 72.488  104.124 90.556  1.00   161.24 ? 137 DT  I N3    1 
ATOM   2786  C C4    . DT  A 1 137 ? 71.279  104.093 91.227  1.00   154.14 ? 137 DT  I C4    1 
ATOM   2787  O O4    . DT  A 1 137 ? 70.213  104.343 90.673  1.00   136.21 ? 137 DT  I O4    1 
ATOM   2788  C C5    . DT  A 1 137 ? 71.357  103.747 92.626  1.00   162.59 ? 137 DT  I C5    1 
ATOM   2789  C C7    . DT  A 1 137 ? 70.110  103.683 93.455  1.00   147.63 ? 137 DT  I C7    1 
ATOM   2790  C C6    . DT  A 1 137 ? 72.568  103.490 93.146  1.00   173.21 ? 137 DT  I C6    1 
ATOM   2791  P P     . DG  A 1 138 ? 78.687  104.791 94.838  1.00   165.50 ? 138 DG  I P     1 
ATOM   2792  O OP1   . DG  A 1 138 ? 80.034  104.257 95.137  1.00   194.39 ? 138 DG  I OP1   1 
ATOM   2793  O OP2   . DG  A 1 138 ? 77.975  105.604 95.850  1.00   154.27 ? 138 DG  I OP2   1 
ATOM   2794  O "O5'" . DG  A 1 138 ? 78.761  105.644 93.484  1.00   177.46 ? 138 DG  I "O5'" 1 
ATOM   2795  C "C5'" . DG  A 1 138 ? 79.549  105.180 92.391  1.00   164.47 ? 138 DG  I "C5'" 1 
ATOM   2796  C "C4'" . DG  A 1 138 ? 79.301  106.012 91.143  1.00   177.04 ? 138 DG  I "C4'" 1 
ATOM   2797  O "O4'" . DG  A 1 138 ? 77.876  106.058 90.861  1.00   185.46 ? 138 DG  I "O4'" 1 
ATOM   2798  C "C3'" . DG  A 1 138 ? 79.763  107.471 91.223  1.00   167.05 ? 138 DG  I "C3'" 1 
ATOM   2799  O "O3'" . DG  A 1 138 ? 80.350  107.861 89.984  1.00   161.84 ? 138 DG  I "O3'" 1 
ATOM   2800  C "C2'" . DG  A 1 138 ? 78.462  108.225 91.481  1.00   163.29 ? 138 DG  I "C2'" 1 
ATOM   2801  C "C1'" . DG  A 1 138 ? 77.484  107.398 90.666  1.00   166.67 ? 138 DG  I "C1'" 1 
ATOM   2802  N N9    . DG  A 1 138 ? 76.094  107.547 91.085  1.00   153.41 ? 138 DG  I N9    1 
ATOM   2803  C C8    . DG  A 1 138 ? 75.632  107.773 92.359  1.00   143.75 ? 138 DG  I C8    1 
ATOM   2804  N N7    . DG  A 1 138 ? 74.333  107.864 92.431  1.00   145.97 ? 138 DG  I N7    1 
ATOM   2805  C C5    . DG  A 1 138 ? 73.906  107.686 91.120  1.00   160.62 ? 138 DG  I C5    1 
ATOM   2806  C C6    . DG  A 1 138 ? 72.598  107.682 90.578  1.00   161.98 ? 138 DG  I C6    1 
ATOM   2807  O O6    . DG  A 1 138 ? 71.521  107.840 91.171  1.00   149.75 ? 138 DG  I O6    1 
ATOM   2808  N N1    . DG  A 1 138 ? 72.611  107.467 89.201  1.00   160.12 ? 138 DG  I N1    1 
ATOM   2809  C C2    . DG  A 1 138 ? 73.745  107.280 88.444  1.00   141.74 ? 138 DG  I C2    1 
ATOM   2810  N N2    . DG  A 1 138 ? 73.559  107.088 87.130  1.00   100.65 ? 138 DG  I N2    1 
ATOM   2811  N N3    . DG  A 1 138 ? 74.975  107.283 88.940  1.00   148.55 ? 138 DG  I N3    1 
ATOM   2812  C C4    . DG  A 1 138 ? 74.979  107.491 90.280  1.00   157.53 ? 138 DG  I C4    1 
ATOM   2813  P P     . DT  A 1 139 ? 81.371  109.101 89.919  1.00   185.03 ? 139 DT  I P     1 
ATOM   2814  O OP1   . DT  A 1 139 ? 82.732  108.545 89.749  1.00   191.83 ? 139 DT  I OP1   1 
ATOM   2815  O OP2   . DT  A 1 139 ? 81.083  109.998 91.061  1.00   164.30 ? 139 DT  I OP2   1 
ATOM   2816  O "O5'" . DT  A 1 139 ? 80.960  109.868 88.575  1.00   179.07 ? 139 DT  I "O5'" 1 
ATOM   2817  C "C5'" . DT  A 1 139 ? 81.173  109.250 87.309  1.00   167.27 ? 139 DT  I "C5'" 1 
ATOM   2818  C "C4'" . DT  A 1 139 ? 80.050  109.587 86.341  1.00   161.08 ? 139 DT  I "C4'" 1 
ATOM   2819  O "O4'" . DT  A 1 139 ? 78.778  109.541 87.041  1.00   172.03 ? 139 DT  I "O4'" 1 
ATOM   2820  C "C3'" . DT  A 1 139 ? 80.132  110.973 85.703  1.00   132.05 ? 139 DT  I "C3'" 1 
ATOM   2821  O "O3'" . DT  A 1 139 ? 79.676  110.912 84.352  1.00   140.15 ? 139 DT  I "O3'" 1 
ATOM   2822  C "C2'" . DT  A 1 139 ? 79.199  111.806 86.577  1.00   145.07 ? 139 DT  I "C2'" 1 
ATOM   2823  C "C1'" . DT  A 1 139 ? 78.124  110.789 86.939  1.00   159.39 ? 139 DT  I "C1'" 1 
ATOM   2824  N N1    . DT  A 1 139 ? 77.444  111.073 88.241  1.00   166.16 ? 139 DT  I N1    1 
ATOM   2825  C C2    . DT  A 1 139 ? 76.071  111.009 88.313  1.00   150.84 ? 139 DT  I C2    1 
ATOM   2826  O O2    . DT  A 1 139 ? 75.364  110.730 87.360  1.00   147.69 ? 139 DT  I O2    1 
ATOM   2827  N N3    . DT  A 1 139 ? 75.549  111.285 89.549  1.00   138.83 ? 139 DT  I N3    1 
ATOM   2828  C C4    . DT  A 1 139 ? 76.247  111.612 90.697  1.00   137.02 ? 139 DT  I C4    1 
ATOM   2829  O O4    . DT  A 1 139 ? 75.685  111.844 91.763  1.00   123.56 ? 139 DT  I O4    1 
ATOM   2830  C C5    . DT  A 1 139 ? 77.682  111.663 90.554  1.00   157.23 ? 139 DT  I C5    1 
ATOM   2831  C C7    . DT  A 1 139 ? 78.546  112.008 91.731  1.00   159.67 ? 139 DT  I C7    1 
ATOM   2832  C C6    . DT  A 1 139 ? 78.206  111.394 89.347  1.00   166.42 ? 139 DT  I C6    1 
ATOM   2833  P P     . DC  A 1 140 ? 80.023  112.095 83.319  1.00   163.72 ? 140 DC  I P     1 
ATOM   2834  O OP1   . DC  A 1 140 ? 80.054  111.514 81.958  1.00   125.94 ? 140 DC  I OP1   1 
ATOM   2835  O OP2   . DC  A 1 140 ? 81.206  112.815 83.841  1.00   141.13 ? 140 DC  I OP2   1 
ATOM   2836  O "O5'" . DC  A 1 140 ? 78.765  113.077 83.432  1.00   170.59 ? 140 DC  I "O5'" 1 
ATOM   2837  C "C5'" . DC  A 1 140 ? 77.462  112.605 83.103  1.00   158.13 ? 140 DC  I "C5'" 1 
ATOM   2838  C "C4'" . DC  A 1 140 ? 76.420  113.672 83.383  1.00   126.13 ? 140 DC  I "C4'" 1 
ATOM   2839  O "O4'" . DC  A 1 140 ? 76.234  113.800 84.810  1.00   132.97 ? 140 DC  I "O4'" 1 
ATOM   2840  C "C3'" . DC  A 1 140 ? 76.767  115.069 82.858  1.00   116.25 ? 140 DC  I "C3'" 1 
ATOM   2841  O "O3'" . DC  A 1 140 ? 75.719  115.543 82.017  1.00   142.23 ? 140 DC  I "O3'" 1 
ATOM   2842  C "C2'" . DC  A 1 140 ? 76.929  115.928 84.118  1.00   118.89 ? 140 DC  I "C2'" 1 
ATOM   2843  C "C1'" . DC  A 1 140 ? 76.126  115.158 85.155  1.00   136.03 ? 140 DC  I "C1'" 1 
ATOM   2844  N N1    . DC  A 1 140 ? 76.634  115.326 86.546  1.00   136.88 ? 140 DC  I N1    1 
ATOM   2845  C C2    . DC  A 1 140 ? 76.045  114.603 87.590  1.00   124.36 ? 140 DC  I C2    1 
ATOM   2846  O O2    . DC  A 1 140 ? 75.107  113.836 87.341  1.00   99.81  ? 140 DC  I O2    1 
ATOM   2847  N N3    . DC  A 1 140 ? 76.519  114.768 88.849  1.00   130.31 ? 140 DC  I N3    1 
ATOM   2848  C C4    . DC  A 1 140 ? 77.532  115.606 89.078  1.00   144.65 ? 140 DC  I C4    1 
ATOM   2849  N N4    . DC  A 1 140 ? 77.965  115.735 90.336  1.00   155.98 ? 140 DC  I N4    1 
ATOM   2850  C C5    . DC  A 1 140 ? 78.145  116.349 88.026  1.00   142.17 ? 140 DC  I C5    1 
ATOM   2851  C C6    . DC  A 1 140 ? 77.670  116.179 86.789  1.00   127.44 ? 140 DC  I C6    1 
ATOM   2852  P P     . DA  A 1 141 ? 75.987  115.895 80.472  1.00   130.07 ? 141 DA  I P     1 
ATOM   2853  O OP1   . DA  A 1 141 ? 76.437  114.653 79.803  1.00   121.10 ? 141 DA  I OP1   1 
ATOM   2854  O OP2   . DA  A 1 141 ? 76.827  117.112 80.420  1.00   104.24 ? 141 DA  I OP2   1 
ATOM   2855  O "O5'" . DA  A 1 141 ? 74.532  116.273 79.923  1.00   137.93 ? 141 DA  I "O5'" 1 
ATOM   2856  C "C5'" . DA  A 1 141 ? 73.455  115.362 80.114  1.00   133.28 ? 141 DA  I "C5'" 1 
ATOM   2857  C "C4'" . DA  A 1 141 ? 72.227  116.053 80.693  1.00   110.26 ? 141 DA  I "C4'" 1 
ATOM   2858  O "O4'" . DA  A 1 141 ? 72.450  116.361 82.096  1.00   110.10 ? 141 DA  I "O4'" 1 
ATOM   2859  C "C3'" . DA  A 1 141 ? 71.842  117.374 80.031  1.00   106.30 ? 141 DA  I "C3'" 1 
ATOM   2860  O "O3'" . DA  A 1 141 ? 70.418  117.490 79.991  1.00   102.47 ? 141 DA  I "O3'" 1 
ATOM   2861  C "C2'" . DA  A 1 141 ? 72.476  118.418 80.946  1.00   115.13 ? 141 DA  I "C2'" 1 
ATOM   2862  C "C1'" . DA  A 1 141 ? 72.359  117.756 82.310  1.00   104.41 ? 141 DA  I "C1'" 1 
ATOM   2863  N N9    . DA  A 1 141 ? 73.405  118.163 83.244  1.00   94.63  ? 141 DA  I N9    1 
ATOM   2864  C C8    . DA  A 1 141 ? 74.552  118.845 82.949  1.00   105.07 ? 141 DA  I C8    1 
ATOM   2865  N N7    . DA  A 1 141 ? 75.310  119.083 83.993  1.00   110.95 ? 141 DA  I N7    1 
ATOM   2866  C C5    . DA  A 1 141 ? 74.610  118.518 85.046  1.00   114.56 ? 141 DA  I C5    1 
ATOM   2867  C C6    . DA  A 1 141 ? 74.880  118.431 86.427  1.00   124.68 ? 141 DA  I C6    1 
ATOM   2868  N N6    . DA  A 1 141 ? 75.978  118.936 86.997  1.00   118.64 ? 141 DA  I N6    1 
ATOM   2869  N N1    . DA  A 1 141 ? 73.972  117.801 87.202  1.00   136.15 ? 141 DA  I N1    1 
ATOM   2870  C C2    . DA  A 1 141 ? 72.872  117.298 86.628  1.00   133.40 ? 141 DA  I C2    1 
ATOM   2871  N N3    . DA  A 1 141 ? 72.511  117.318 85.346  1.00   121.72 ? 141 DA  I N3    1 
ATOM   2872  C C4    . DA  A 1 141 ? 73.432  117.950 84.602  1.00   108.86 ? 141 DA  I C4    1 
ATOM   2873  P P     . DG  A 1 142 ? 69.708  118.837 79.471  1.00   101.89 ? 142 DG  I P     1 
ATOM   2874  O OP1   . DG  A 1 142 ? 68.479  118.427 78.757  1.00   106.80 ? 142 DG  I OP1   1 
ATOM   2875  O OP2   . DG  A 1 142 ? 70.703  119.680 78.772  1.00   109.38 ? 142 DG  I OP2   1 
ATOM   2876  O "O5'" . DG  A 1 142 ? 69.274  119.577 80.820  1.00   113.42 ? 142 DG  I "O5'" 1 
ATOM   2877  C "C5'" . DG  A 1 142 ? 68.435  118.902 81.750  1.00   125.47 ? 142 DG  I "C5'" 1 
ATOM   2878  C "C4'" . DG  A 1 142 ? 68.330  119.673 83.053  1.00   124.15 ? 142 DG  I "C4'" 1 
ATOM   2879  O "O4'" . DG  A 1 142 ? 69.631  119.737 83.693  1.00   115.89 ? 142 DG  I "O4'" 1 
ATOM   2880  C "C3'" . DG  A 1 142 ? 67.846  121.120 82.917  1.00   134.48 ? 142 DG  I "C3'" 1 
ATOM   2881  O "O3'" . DG  A 1 142 ? 66.826  121.375 83.874  1.00   141.10 ? 142 DG  I "O3'" 1 
ATOM   2882  C "C2'" . DG  A 1 142 ? 69.103  121.944 83.202  1.00   124.44 ? 142 DG  I "C2'" 1 
ATOM   2883  C "C1'" . DG  A 1 142 ? 69.837  121.040 84.176  1.00   125.31 ? 142 DG  I "C1'" 1 
ATOM   2884  N N9    . DG  A 1 142 ? 71.273  121.293 84.245  1.00   125.69 ? 142 DG  I N9    1 
ATOM   2885  C C8    . DG  A 1 142 ? 72.120  121.556 83.195  1.00   120.89 ? 142 DG  I C8    1 
ATOM   2886  N N7    . DG  A 1 142 ? 73.358  121.743 83.560  1.00   124.02 ? 142 DG  I N7    1 
ATOM   2887  C C5    . DG  A 1 142 ? 73.332  121.595 84.942  1.00   132.37 ? 142 DG  I C5    1 
ATOM   2888  C C6    . DG  A 1 142 ? 74.380  121.687 85.890  1.00   140.96 ? 142 DG  I C6    1 
ATOM   2889  O O6    . DG  A 1 142 ? 75.580  121.924 85.689  1.00   142.48 ? 142 DG  I O6    1 
ATOM   2890  N N1    . DG  A 1 142 ? 73.922  121.467 87.187  1.00   136.92 ? 142 DG  I N1    1 
ATOM   2891  C C2    . DG  A 1 142 ? 72.618  121.196 87.525  1.00   125.99 ? 142 DG  I C2    1 
ATOM   2892  N N2    . DG  A 1 142 ? 72.368  121.015 88.830  1.00   133.15 ? 142 DG  I N2    1 
ATOM   2893  N N3    . DG  A 1 142 ? 71.626  121.108 86.647  1.00   117.15 ? 142 DG  I N3    1 
ATOM   2894  C C4    . DG  A 1 142 ? 72.056  121.317 85.379  1.00   126.50 ? 142 DG  I C4    1 
ATOM   2895  P P     . DA  A 1 143 ? 65.823  122.618 83.690  1.00   146.83 ? 143 DA  I P     1 
ATOM   2896  O OP1   . DA  A 1 143 ? 64.450  122.072 83.607  1.00   143.67 ? 143 DA  I OP1   1 
ATOM   2897  O OP2   . DA  A 1 143 ? 66.341  123.478 82.603  1.00   92.83  ? 143 DA  I OP2   1 
ATOM   2898  O "O5'" . DA  A 1 143 ? 65.975  123.424 85.061  1.00   121.82 ? 143 DA  I "O5'" 1 
ATOM   2899  C "C5'" . DA  A 1 143 ? 65.991  122.720 86.296  1.00   116.27 ? 143 DA  I "C5'" 1 
ATOM   2900  C "C4'" . DA  A 1 143 ? 66.689  123.534 87.369  1.00   133.48 ? 143 DA  I "C4'" 1 
ATOM   2901  O "O4'" . DA  A 1 143 ? 68.126  123.384 87.237  1.00   143.58 ? 143 DA  I "O4'" 1 
ATOM   2902  C "C3'" . DA  A 1 143 ? 66.405  125.038 87.319  1.00   153.52 ? 143 DA  I "C3'" 1 
ATOM   2903  O "O3'" . DA  A 1 143 ? 65.975  125.492 88.592  1.00   155.38 ? 143 DA  I "O3'" 1 
ATOM   2904  C "C2'" . DA  A 1 143 ? 67.748  125.660 86.918  1.00   144.20 ? 143 DA  I "C2'" 1 
ATOM   2905  C "C1'" . DA  A 1 143 ? 68.741  124.633 87.434  1.00   146.30 ? 143 DA  I "C1'" 1 
ATOM   2906  N N9    . DA  A 1 143 ? 70.014  124.643 86.715  1.00   128.77 ? 143 DA  I N9    1 
ATOM   2907  C C8    . DA  A 1 143 ? 70.219  124.331 85.401  1.00   128.18 ? 143 DA  I C8    1 
ATOM   2908  N N7    . DA  A 1 143 ? 71.472  124.428 85.022  1.00   121.41 ? 143 DA  I N7    1 
ATOM   2909  C C5    . DA  A 1 143 ? 72.134  124.832 86.168  1.00   135.33 ? 143 DA  I C5    1 
ATOM   2910  C C6    . DA  A 1 143 ? 73.490  125.113 86.432  1.00   141.77 ? 143 DA  I C6    1 
ATOM   2911  N N6    . DA  A 1 143 ? 74.455  125.022 85.509  1.00   120.03 ? 143 DA  I N6    1 
ATOM   2912  N N1    . DA  A 1 143 ? 73.818  125.493 87.685  1.00   147.04 ? 143 DA  I N1    1 
ATOM   2913  C C2    . DA  A 1 143 ? 72.849  125.584 88.605  1.00   148.86 ? 143 DA  I C2    1 
ATOM   2914  N N3    . DA  A 1 143 ? 71.544  125.345 88.477  1.00   143.31 ? 143 DA  I N3    1 
ATOM   2915  C C4    . DA  A 1 143 ? 71.250  124.970 87.222  1.00   134.64 ? 143 DA  I C4    1 
ATOM   2916  P P     . DT  A 1 144 ? 65.523  127.020 88.795  1.00   166.90 ? 144 DT  I P     1 
ATOM   2917  O OP1   . DT  A 1 144 ? 64.477  127.043 89.840  1.00   184.68 ? 144 DT  I OP1   1 
ATOM   2918  O OP2   . DT  A 1 144 ? 65.241  127.594 87.460  1.00   146.94 ? 144 DT  I OP2   1 
ATOM   2919  O "O5'" . DT  A 1 144 ? 66.837  127.727 89.365  1.00   150.56 ? 144 DT  I "O5'" 1 
ATOM   2920  C "C5'" . DT  A 1 144 ? 67.516  127.160 90.478  1.00   153.46 ? 144 DT  I "C5'" 1 
ATOM   2921  C "C4'" . DT  A 1 144 ? 68.693  128.024 90.884  1.00   149.92 ? 144 DT  I "C4'" 1 
ATOM   2922  O "O4'" . DT  A 1 144 ? 69.809  127.771 89.999  1.00   153.00 ? 144 DT  I "O4'" 1 
ATOM   2923  C "C3'" . DT  A 1 144 ? 68.429  129.532 90.828  1.00   147.36 ? 144 DT  I "C3'" 1 
ATOM   2924  O "O3'" . DT  A 1 144 ? 68.656  130.111 92.103  1.00   143.57 ? 144 DT  I "O3'" 1 
ATOM   2925  C "C2'" . DT  A 1 144 ? 69.419  130.057 89.780  1.00   143.77 ? 144 DT  I "C2'" 1 
ATOM   2926  C "C1'" . DT  A 1 144 ? 70.488  128.976 89.765  1.00   150.64 ? 144 DT  I "C1'" 1 
ATOM   2927  N N1    . DT  A 1 144 ? 71.199  128.868 88.461  1.00   146.91 ? 144 DT  I N1    1 
ATOM   2928  C C2    . DT  A 1 144 ? 72.542  129.160 88.399  1.00   140.44 ? 144 DT  I C2    1 
ATOM   2929  O O2    . DT  A 1 144 ? 73.195  129.506 89.367  1.00   131.59 ? 144 DT  I O2    1 
ATOM   2930  N N3    . DT  A 1 144 ? 73.099  129.030 87.155  1.00   143.08 ? 144 DT  I N3    1 
ATOM   2931  C C4    . DT  A 1 144 ? 72.460  128.646 85.990  1.00   150.46 ? 144 DT  I C4    1 
ATOM   2932  O O4    . DT  A 1 144 ? 73.049  128.559 84.917  1.00   150.42 ? 144 DT  I O4    1 
ATOM   2933  C C5    . DT  A 1 144 ? 71.052  128.355 86.124  1.00   141.14 ? 144 DT  I C5    1 
ATOM   2934  C C7    . DT  A 1 144 ? 70.251  127.928 84.930  1.00   121.71 ? 144 DT  I C7    1 
ATOM   2935  C C6    . DT  A 1 144 ? 70.496  128.479 87.339  1.00   142.00 ? 144 DT  I C6    1 
ATOM   2936  P P     . DA  A 1 145 ? 68.288  131.651 92.365  1.00   159.67 ? 145 DA  I P     1 
ATOM   2937  O OP1   . DA  A 1 145 ? 67.820  131.770 93.764  1.00   181.21 ? 145 DA  I OP1   1 
ATOM   2938  O OP2   . DA  A 1 145 ? 67.418  132.106 91.258  1.00   153.55 ? 145 DA  I OP2   1 
ATOM   2939  O "O5'" . DA  A 1 145 ? 69.690  132.403 92.224  1.00   154.16 ? 145 DA  I "O5'" 1 
ATOM   2940  C "C5'" . DA  A 1 145 ? 70.812  131.956 92.975  1.00   153.57 ? 145 DA  I "C5'" 1 
ATOM   2941  C "C4'" . DA  A 1 145 ? 72.025  132.823 92.696  1.00   145.26 ? 145 DA  I "C4'" 1 
ATOM   2942  O "O4'" . DA  A 1 145 ? 72.654  132.395 91.459  1.00   147.64 ? 145 DA  I "O4'" 1 
ATOM   2943  C "C3'" . DA  A 1 145 ? 71.723  134.310 92.532  1.00   150.73 ? 145 DA  I "C3'" 1 
ATOM   2944  O "O3'" . DA  A 1 145 ? 72.723  135.084 93.172  1.00   164.87 ? 145 DA  I "O3'" 1 
ATOM   2945  C "C2'" . DA  A 1 145 ? 71.740  134.509 91.018  1.00   155.45 ? 145 DA  I "C2'" 1 
ATOM   2946  C "C1'" . DA  A 1 145 ? 72.779  133.489 90.578  1.00   156.53 ? 145 DA  I "C1'" 1 
ATOM   2947  N N9    . DA  A 1 145 ? 72.572  133.006 89.216  1.00   163.74 ? 145 DA  I N9    1 
ATOM   2948  C C8    . DA  A 1 145 ? 71.381  132.671 88.635  1.00   160.60 ? 145 DA  I C8    1 
ATOM   2949  N N7    . DA  A 1 145 ? 71.493  132.265 87.392  1.00   154.34 ? 145 DA  I N7    1 
ATOM   2950  C C5    . DA  A 1 145 ? 72.853  132.340 87.140  1.00   158.32 ? 145 DA  I C5    1 
ATOM   2951  C C6    . DA  A 1 145 ? 73.623  132.045 85.998  1.00   165.07 ? 145 DA  I C6    1 
ATOM   2952  N N6    . DA  A 1 145 ? 73.099  131.597 84.852  1.00   160.72 ? 145 DA  I N6    1 
ATOM   2953  N N1    . DA  A 1 145 ? 74.957  132.229 86.079  1.00   172.21 ? 145 DA  I N1    1 
ATOM   2954  C C2    . DA  A 1 145 ? 75.478  132.677 87.228  1.00   167.92 ? 145 DA  I C2    1 
ATOM   2955  N N3    . DA  A 1 145 ? 74.856  132.987 88.366  1.00   160.81 ? 145 DA  I N3    1 
ATOM   2956  C C4    . DA  A 1 145 ? 73.533  132.794 88.254  1.00   159.88 ? 145 DA  I C4    1 
ATOM   2957  P P     . DT  A 1 146 ? 72.407  136.591 93.630  1.00   167.71 ? 146 DT  I P     1 
ATOM   2958  O OP1   . DT  A 1 146 ? 72.652  136.679 95.087  1.00   150.20 ? 146 DT  I OP1   1 
ATOM   2959  O OP2   . DT  A 1 146 ? 71.080  136.958 93.085  1.00   156.96 ? 146 DT  I OP2   1 
ATOM   2960  O "O5'" . DT  A 1 146 ? 73.511  137.456 92.864  1.00   162.05 ? 146 DT  I "O5'" 1 
ATOM   2961  C "C5'" . DT  A 1 146 ? 74.888  137.151 93.035  1.00   164.01 ? 146 DT  I "C5'" 1 
ATOM   2962  C "C4'" . DT  A 1 146 ? 75.676  137.476 91.779  1.00   168.25 ? 146 DT  I "C4'" 1 
ATOM   2963  O "O4'" . DT  A 1 146 ? 75.222  136.638 90.683  1.00   165.89 ? 146 DT  I "O4'" 1 
ATOM   2964  C "C3'" . DT  A 1 146 ? 75.555  138.924 91.290  1.00   161.65 ? 146 DT  I "C3'" 1 
ATOM   2965  O "O3'" . DT  A 1 146 ? 76.848  139.456 91.038  1.00   159.91 ? 146 DT  I "O3'" 1 
ATOM   2966  C "C2'" . DT  A 1 146 ? 74.737  138.801 90.003  1.00   171.17 ? 146 DT  I "C2'" 1 
ATOM   2967  C "C1'" . DT  A 1 146 ? 75.143  137.421 89.520  1.00   166.45 ? 146 DT  I "C1'" 1 
ATOM   2968  N N1    . DT  A 1 146 ? 74.162  136.801 88.585  1.00   156.61 ? 146 DT  I N1    1 
ATOM   2969  C C2    . DT  A 1 146 ? 74.623  136.041 87.535  1.00   160.45 ? 146 DT  I C2    1 
ATOM   2970  O O2    . DT  A 1 146 ? 75.806  135.837 87.327  1.00   157.52 ? 146 DT  I O2    1 
ATOM   2971  N N3    . DT  A 1 146 ? 73.644  135.519 86.732  1.00   164.63 ? 146 DT  I N3    1 
ATOM   2972  C C4    . DT  A 1 146 ? 72.278  135.680 86.870  1.00   172.85 ? 146 DT  I C4    1 
ATOM   2973  O O4    . DT  A 1 146 ? 71.476  135.169 86.094  1.00   167.36 ? 146 DT  I O4    1 
ATOM   2974  C C5    . DT  A 1 146 ? 71.861  136.492 87.989  1.00   167.80 ? 146 DT  I C5    1 
ATOM   2975  C C7    . DT  A 1 146 ? 70.402  136.739 88.240  1.00   144.54 ? 146 DT  I C7    1 
ATOM   2976  C C6    . DT  A 1 146 ? 72.812  137.009 88.782  1.00   153.17 ? 146 DT  I C6    1 
ATOM   2977  P P     . DA  A 1 147 ? 77.046  141.032 90.793  1.00   192.98 ? 147 DA  I P     1 
ATOM   2978  O OP1   . DA  A 1 147 ? 78.138  141.484 91.683  1.00   203.02 ? 147 DA  I OP1   1 
ATOM   2979  O OP2   . DA  A 1 147 ? 75.719  141.684 90.873  1.00   195.02 ? 147 DA  I OP2   1 
ATOM   2980  O "O5'" . DA  A 1 147 ? 77.549  141.123 89.277  1.00   185.50 ? 147 DA  I "O5'" 1 
ATOM   2981  C "C5'" . DA  A 1 147 ? 78.807  140.563 88.913  1.00   170.61 ? 147 DA  I "C5'" 1 
ATOM   2982  C "C4'" . DA  A 1 147 ? 78.967  140.516 87.404  1.00   167.29 ? 147 DA  I "C4'" 1 
ATOM   2983  O "O4'" . DA  A 1 147 ? 78.017  139.571 86.841  1.00   170.92 ? 147 DA  I "O4'" 1 
ATOM   2984  C "C3'" . DA  A 1 147 ? 78.724  141.845 86.680  1.00   183.76 ? 147 DA  I "C3'" 1 
ATOM   2985  O "O3'" . DA  A 1 147 ? 79.691  142.017 85.646  1.00   183.31 ? 147 DA  I "O3'" 1 
ATOM   2986  C "C2'" . DA  A 1 147 ? 77.319  141.670 86.109  1.00   181.26 ? 147 DA  I "C2'" 1 
ATOM   2987  C "C1'" . DA  A 1 147 ? 77.322  140.187 85.781  1.00   179.84 ? 147 DA  I "C1'" 1 
ATOM   2988  N N9    . DA  A 1 147 ? 75.986  139.605 85.692  1.00   167.21 ? 147 DA  I N9    1 
ATOM   2989  C C8    . DA  A 1 147 ? 75.034  139.568 86.672  1.00   167.35 ? 147 DA  I C8    1 
ATOM   2990  N N7    . DA  A 1 147 ? 73.920  138.979 86.306  1.00   150.70 ? 147 DA  I N7    1 
ATOM   2991  C C5    . DA  A 1 147 ? 74.157  138.606 84.994  1.00   153.24 ? 147 DA  I C5    1 
ATOM   2992  C C6    . DA  A 1 147 ? 73.367  137.939 84.038  1.00   154.16 ? 147 DA  I C6    1 
ATOM   2993  N N6    . DA  A 1 147 ? 72.122  137.515 84.279  1.00   143.97 ? 147 DA  I N6    1 
ATOM   2994  N N1    . DA  A 1 147 ? 73.907  137.723 82.821  1.00   154.13 ? 147 DA  I N1    1 
ATOM   2995  C C2    . DA  A 1 147 ? 75.154  138.149 82.584  1.00   147.02 ? 147 DA  I C2    1 
ATOM   2996  N N3    . DA  A 1 147 ? 75.991  138.785 83.400  1.00   145.08 ? 147 DA  I N3    1 
ATOM   2997  C C4    . DA  A 1 147 ? 75.427  138.985 84.600  1.00   156.20 ? 147 DA  I C4    1 
ATOM   2998  P P     . DT  A 1 148 ? 79.893  143.450 84.944  1.00   182.49 ? 148 DT  I P     1 
ATOM   2999  O OP1   . DT  A 1 148 ? 81.312  143.831 85.116  1.00   181.16 ? 148 DT  I OP1   1 
ATOM   3000  O OP2   . DT  A 1 148 ? 78.830  144.359 85.427  1.00   178.08 ? 148 DT  I OP2   1 
ATOM   3001  O "O5'" . DT  A 1 148 ? 79.626  143.158 83.394  1.00   179.64 ? 148 DT  I "O5'" 1 
ATOM   3002  C "C5'" . DT  A 1 148 ? 79.096  141.900 82.990  1.00   185.08 ? 148 DT  I "C5'" 1 
ATOM   3003  C "C4'" . DT  A 1 148 ? 78.420  142.002 81.635  1.00   188.32 ? 148 DT  I "C4'" 1 
ATOM   3004  O "O4'" . DT  A 1 148 ? 77.107  141.380 81.704  1.00   185.94 ? 148 DT  I "O4'" 1 
ATOM   3005  C "C3'" . DT  A 1 148 ? 78.172  143.425 81.141  1.00   189.54 ? 148 DT  I "C3'" 1 
ATOM   3006  O "O3'" . DT  A 1 148 ? 78.215  143.451 79.723  1.00   193.76 ? 148 DT  I "O3'" 1 
ATOM   3007  C "C2'" . DT  A 1 148 ? 76.761  143.692 81.647  1.00   174.28 ? 148 DT  I "C2'" 1 
ATOM   3008  C "C1'" . DT  A 1 148 ? 76.117  142.339 81.393  1.00   178.01 ? 148 DT  I "C1'" 1 
ATOM   3009  N N1    . DT  A 1 148 ? 74.913  142.078 82.229  1.00   172.04 ? 148 DT  I N1    1 
ATOM   3010  C C2    . DT  A 1 148 ? 73.895  141.309 81.716  1.00   165.39 ? 148 DT  I C2    1 
ATOM   3011  O O2    . DT  A 1 148 ? 73.926  140.818 80.602  1.00   153.63 ? 148 DT  I O2    1 
ATOM   3012  N N3    . DT  A 1 148 ? 72.831  141.130 82.560  1.00   165.37 ? 148 DT  I N3    1 
ATOM   3013  C C4    . DT  A 1 148 ? 72.686  141.636 83.839  1.00   163.94 ? 148 DT  I C4    1 
ATOM   3014  O O4    . DT  A 1 148 ? 71.689  141.419 84.521  1.00   148.09 ? 148 DT  I O4    1 
ATOM   3015  C C5    . DT  A 1 148 ? 73.790  142.437 84.316  1.00   166.27 ? 148 DT  I C5    1 
ATOM   3016  C C7    . DT  A 1 148 ? 73.747  143.039 85.689  1.00   153.26 ? 148 DT  I C7    1 
ATOM   3017  C C6    . DT  A 1 148 ? 74.837  142.618 83.497  1.00   166.07 ? 148 DT  I C6    1 
ATOM   3018  P P     . DA  A 1 149 ? 79.452  144.130 78.954  1.00   195.72 ? 149 DA  I P     1 
ATOM   3019  O OP1   . DA  A 1 149 ? 80.679  143.406 79.355  1.00   165.79 ? 149 DA  I OP1   1 
ATOM   3020  O OP2   . DA  A 1 149 ? 79.362  145.594 79.151  1.00   179.48 ? 149 DA  I OP2   1 
ATOM   3021  O "O5'" . DA  A 1 149 ? 79.149  143.821 77.414  1.00   191.11 ? 149 DA  I "O5'" 1 
ATOM   3022  C "C5'" . DA  A 1 149 ? 79.104  142.473 76.958  1.00   173.68 ? 149 DA  I "C5'" 1 
ATOM   3023  C "C4'" . DA  A 1 149 ? 77.831  142.201 76.173  1.00   156.36 ? 149 DA  I "C4'" 1 
ATOM   3024  O "O4'" . DA  A 1 149 ? 76.703  142.111 77.081  1.00   142.56 ? 149 DA  I "O4'" 1 
ATOM   3025  C "C3'" . DA  A 1 149 ? 77.461  143.270 75.134  1.00   167.39 ? 149 DA  I "C3'" 1 
ATOM   3026  O "O3'" . DA  A 1 149 ? 77.240  142.658 73.867  1.00   169.21 ? 149 DA  I "O3'" 1 
ATOM   3027  C "C2'" . DA  A 1 149 ? 76.176  143.890 75.690  1.00   157.69 ? 149 DA  I "C2'" 1 
ATOM   3028  C "C1'" . DA  A 1 149 ? 75.596  142.735 76.484  1.00   161.66 ? 149 DA  I "C1'" 1 
ATOM   3029  N N9    . DA  A 1 149 ? 74.667  143.156 77.529  1.00   161.55 ? 149 DA  I N9    1 
ATOM   3030  C C8    . DA  A 1 149 ? 74.939  143.960 78.600  1.00   163.73 ? 149 DA  I C8    1 
ATOM   3031  N N7    . DA  A 1 149 ? 73.903  144.175 79.377  1.00   164.50 ? 149 DA  I N7    1 
ATOM   3032  C C5    . DA  A 1 149 ? 72.880  143.464 78.771  1.00   155.53 ? 149 DA  I C5    1 
ATOM   3033  C C6    . DA  A 1 149 ? 71.522  143.285 79.102  1.00   150.98 ? 149 DA  I C6    1 
ATOM   3034  N N6    . DA  A 1 149 ? 70.947  143.836 80.176  1.00   137.67 ? 149 DA  I N6    1 
ATOM   3035  N N1    . DA  A 1 149 ? 70.776  142.514 78.284  1.00   159.78 ? 149 DA  I N1    1 
ATOM   3036  C C2    . DA  A 1 149 ? 71.355  141.964 77.210  1.00   163.81 ? 149 DA  I C2    1 
ATOM   3037  N N3    . DA  A 1 149 ? 72.618  142.060 76.797  1.00   162.97 ? 149 DA  I N3    1 
ATOM   3038  C C4    . DA  A 1 149 ? 73.334  142.832 77.630  1.00   157.97 ? 149 DA  I C4    1 
ATOM   3039  P P     . DC  A 1 150 ? 76.821  143.546 72.592  1.00   181.29 ? 150 DC  I P     1 
ATOM   3040  O OP1   . DC  A 1 150 ? 77.462  142.939 71.406  1.00   175.78 ? 150 DC  I OP1   1 
ATOM   3041  O OP2   . DC  A 1 150 ? 77.072  144.971 72.907  1.00   137.19 ? 150 DC  I OP2   1 
ATOM   3042  O "O5'" . DC  A 1 150 ? 75.239  143.331 72.480  1.00   177.21 ? 150 DC  I "O5'" 1 
ATOM   3043  C "C5'" . DC  A 1 150 ? 74.716  142.019 72.301  1.00   158.52 ? 150 DC  I "C5'" 1 
ATOM   3044  C "C4'" . DC  A 1 150 ? 73.198  142.021 72.366  1.00   150.45 ? 150 DC  I "C4'" 1 
ATOM   3045  O "O4'" . DC  A 1 150 ? 72.763  142.521 73.653  1.00   149.36 ? 150 DC  I "O4'" 1 
ATOM   3046  C "C3'" . DC  A 1 150 ? 72.499  142.885 71.309  1.00   144.22 ? 150 DC  I "C3'" 1 
ATOM   3047  O "O3'" . DC  A 1 150 ? 71.622  142.078 70.530  1.00   134.90 ? 150 DC  I "O3'" 1 
ATOM   3048  C "C2'" . DC  A 1 150 ? 71.732  143.936 72.124  1.00   127.59 ? 150 DC  I "C2'" 1 
ATOM   3049  C "C1'" . DC  A 1 150 ? 71.581  143.255 73.474  1.00   135.84 ? 150 DC  I "C1'" 1 
ATOM   3050  N N1    . DC  A 1 150 ? 71.440  144.209 74.608  1.00   134.81 ? 150 DC  I N1    1 
ATOM   3051  C C2    . DC  A 1 150 ? 70.195  144.368 75.229  1.00   149.53 ? 150 DC  I C2    1 
ATOM   3052  O O2    . DC  A 1 150 ? 69.231  143.707 74.824  1.00   142.90 ? 150 DC  I O2    1 
ATOM   3053  N N3    . DC  A 1 150 ? 70.083  145.240 76.261  1.00   152.96 ? 150 DC  I N3    1 
ATOM   3054  C C4    . DC  A 1 150 ? 71.148  145.933 76.669  1.00   145.45 ? 150 DC  I C4    1 
ATOM   3055  N N4    . DC  A 1 150 ? 70.988  146.781 77.690  1.00   133.93 ? 150 DC  I N4    1 
ATOM   3056  C C5    . DC  A 1 150 ? 72.424  145.786 76.048  1.00   136.86 ? 150 DC  I C5    1 
ATOM   3057  C C6    . DC  A 1 150 ? 72.522  144.922 75.032  1.00   132.46 ? 150 DC  I C6    1 
ATOM   3058  P P     . DA  A 1 151 ? 70.758  142.722 69.336  1.00   148.84 ? 151 DA  I P     1 
ATOM   3059  O OP1   . DA  A 1 151 ? 70.655  141.703 68.268  1.00   161.99 ? 151 DA  I OP1   1 
ATOM   3060  O OP2   . DA  A 1 151 ? 71.312  144.058 69.020  1.00   133.54 ? 151 DA  I OP2   1 
ATOM   3061  O "O5'" . DA  A 1 151 ? 69.310  142.923 69.983  1.00   159.21 ? 151 DA  I "O5'" 1 
ATOM   3062  C "C5'" . DA  A 1 151 ? 68.632  141.809 70.555  1.00   137.95 ? 151 DA  I "C5'" 1 
ATOM   3063  C "C4'" . DA  A 1 151 ? 67.299  142.229 71.147  1.00   128.56 ? 151 DA  I "C4'" 1 
ATOM   3064  O "O4'" . DA  A 1 151 ? 67.524  143.075 72.306  1.00   141.35 ? 151 DA  I "O4'" 1 
ATOM   3065  C "C3'" . DA  A 1 151 ? 66.392  143.017 70.203  1.00   129.72 ? 151 DA  I "C3'" 1 
ATOM   3066  O "O3'" . DA  A 1 151 ? 65.062  142.524 70.289  1.00   149.03 ? 151 DA  I "O3'" 1 
ATOM   3067  C "C2'" . DA  A 1 151 ? 66.499  144.456 70.714  1.00   128.26 ? 151 DA  I "C2'" 1 
ATOM   3068  C "C1'" . DA  A 1 151 ? 66.760  144.255 72.199  1.00   141.83 ? 151 DA  I "C1'" 1 
ATOM   3069  N N9    . DA  A 1 151 ? 67.521  145.346 72.802  1.00   137.30 ? 151 DA  I N9    1 
ATOM   3070  C C8    . DA  A 1 151 ? 68.778  145.757 72.458  1.00   141.53 ? 151 DA  I C8    1 
ATOM   3071  N N7    . DA  A 1 151 ? 69.219  146.766 73.170  1.00   153.88 ? 151 DA  I N7    1 
ATOM   3072  C C5    . DA  A 1 151 ? 68.180  147.038 74.043  1.00   145.37 ? 151 DA  I C5    1 
ATOM   3073  C C6    . DA  A 1 151 ? 68.023  148.000 75.061  1.00   145.27 ? 151 DA  I C6    1 
ATOM   3074  N N6    . DA  A 1 151 ? 68.961  148.899 75.375  1.00   142.69 ? 151 DA  I N6    1 
ATOM   3075  N N1    . DA  A 1 151 ? 66.861  148.001 75.746  1.00   143.14 ? 151 DA  I N1    1 
ATOM   3076  C C2    . DA  A 1 151 ? 65.925  147.100 75.429  1.00   149.06 ? 151 DA  I C2    1 
ATOM   3077  N N3    . DA  A 1 151 ? 65.957  146.148 74.494  1.00   142.78 ? 151 DA  I N3    1 
ATOM   3078  C C4    . DA  A 1 151 ? 67.124  146.172 73.831  1.00   138.89 ? 151 DA  I C4    1 
ATOM   3079  P P     . DT  A 1 152 ? 63.925  143.059 69.287  1.00   170.16 ? 152 DT  I P     1 
ATOM   3080  O OP1   . DT  A 1 152 ? 63.145  141.886 68.832  1.00   121.18 ? 152 DT  I OP1   1 
ATOM   3081  O OP2   . DT  A 1 152 ? 64.559  143.947 68.287  1.00   150.49 ? 152 DT  I OP2   1 
ATOM   3082  O "O5'" . DT  A 1 152 ? 62.995  143.953 70.229  1.00   148.61 ? 152 DT  I "O5'" 1 
ATOM   3083  C "C5'" . DT  A 1 152 ? 62.555  143.432 71.475  1.00   126.27 ? 152 DT  I "C5'" 1 
ATOM   3084  C "C4'" . DT  A 1 152 ? 61.908  144.513 72.319  1.00   135.66 ? 152 DT  I "C4'" 1 
ATOM   3085  O "O4'" . DT  A 1 152 ? 62.916  145.427 72.805  1.00   122.33 ? 152 DT  I "O4'" 1 
ATOM   3086  C "C3'" . DT  A 1 152 ? 60.870  145.373 71.587  1.00   133.43 ? 152 DT  I "C3'" 1 
ATOM   3087  O "O3'" . DT  A 1 152 ? 59.594  145.205 72.191  1.00   130.94 ? 152 DT  I "O3'" 1 
ATOM   3088  C "C2'" . DT  A 1 152 ? 61.388  146.813 71.742  1.00   133.72 ? 152 DT  I "C2'" 1 
ATOM   3089  C "C1'" . DT  A 1 152 ? 62.333  146.694 72.927  1.00   127.63 ? 152 DT  I "C1'" 1 
ATOM   3090  N N1    . DT  A 1 152 ? 63.413  147.721 72.940  1.00   129.86 ? 152 DT  I N1    1 
ATOM   3091  C C2    . DT  A 1 152 ? 63.450  148.640 73.962  1.00   135.02 ? 152 DT  I C2    1 
ATOM   3092  O O2    . DT  A 1 152 ? 62.642  148.659 74.873  1.00   120.98 ? 152 DT  I O2    1 
ATOM   3093  N N3    . DT  A 1 152 ? 64.480  149.540 73.884  1.00   140.05 ? 152 DT  I N3    1 
ATOM   3094  C C4    . DT  A 1 152 ? 65.454  149.614 72.906  1.00   131.41 ? 152 DT  I C4    1 
ATOM   3095  O O4    . DT  A 1 152 ? 66.339  150.463 72.924  1.00   138.23 ? 152 DT  I O4    1 
ATOM   3096  C C5    . DT  A 1 152 ? 65.355  148.622 71.861  1.00   127.63 ? 152 DT  I C5    1 
ATOM   3097  C C7    . DT  A 1 152 ? 66.356  148.602 70.744  1.00   131.36 ? 152 DT  I C7    1 
ATOM   3098  C C6    . DT  A 1 152 ? 64.351  147.734 71.928  1.00   129.15 ? 152 DT  I C6    1 
ATOM   3099  P P     . DC  A 1 153 ? 58.277  145.795 71.486  1.00   125.63 ? 153 DC  I P     1 
ATOM   3100  O OP1   . DC  A 1 153 ? 57.185  144.819 71.693  1.00   154.82 ? 153 DC  I OP1   1 
ATOM   3101  O OP2   . DC  A 1 153 ? 58.641  146.209 70.112  1.00   113.73 ? 153 DC  I OP2   1 
ATOM   3102  O "O5'" . DC  A 1 153 ? 57.953  147.111 72.333  1.00   112.29 ? 153 DC  I "O5'" 1 
ATOM   3103  C "C5'" . DC  A 1 153 ? 57.782  147.018 73.740  1.00   120.00 ? 153 DC  I "C5'" 1 
ATOM   3104  C "C4'" . DC  A 1 153 ? 57.900  148.384 74.390  1.00   116.97 ? 153 DC  I "C4'" 1 
ATOM   3105  O "O4'" . DC  A 1 153 ? 59.219  148.921 74.146  1.00   107.57 ? 153 DC  I "O4'" 1 
ATOM   3106  C "C3'" . DC  A 1 153 ? 56.908  149.430 73.874  1.00   110.37 ? 153 DC  I "C3'" 1 
ATOM   3107  O "O3'" . DC  A 1 153 ? 56.034  149.829 74.923  1.00   109.12 ? 153 DC  I "O3'" 1 
ATOM   3108  C "C2'" . DC  A 1 153 ? 57.785  150.595 73.387  1.00   120.25 ? 153 DC  I "C2'" 1 
ATOM   3109  C "C1'" . DC  A 1 153 ? 59.129  150.314 74.043  1.00   105.96 ? 153 DC  I "C1'" 1 
ATOM   3110  N N1    . DC  A 1 153 ? 60.288  150.799 73.242  1.00   119.49 ? 153 DC  I N1    1 
ATOM   3111  C C2    . DC  A 1 153 ? 61.136  151.780 73.770  1.00   126.65 ? 153 DC  I C2    1 
ATOM   3112  O O2    . DC  A 1 153 ? 60.910  152.228 74.901  1.00   114.59 ? 153 DC  I O2    1 
ATOM   3113  N N3    . DC  A 1 153 ? 62.185  152.210 73.026  1.00   137.61 ? 153 DC  I N3    1 
ATOM   3114  C C4    . DC  A 1 153 ? 62.395  151.701 71.810  1.00   140.90 ? 153 DC  I C4    1 
ATOM   3115  N N4    . DC  A 1 153 ? 63.442  152.156 71.114  1.00   139.99 ? 153 DC  I N4    1 
ATOM   3116  C C5    . DC  A 1 153 ? 61.541  150.702 71.255  1.00   122.15 ? 153 DC  I C5    1 
ATOM   3117  C C6    . DC  A 1 153 ? 60.510  150.285 71.998  1.00   111.84 ? 153 DC  I C6    1 
ATOM   3118  P P     . DC  A 1 154 ? 54.805  150.820 74.625  1.00   82.00  ? 154 DC  I P     1 
ATOM   3119  O OP1   . DC  A 1 154 ? 53.768  150.566 75.649  1.00   76.67  ? 154 DC  I OP1   1 
ATOM   3120  O OP2   . DC  A 1 154 ? 54.464  150.703 73.191  1.00   82.50  ? 154 DC  I OP2   1 
ATOM   3121  O "O5'" . DC  A 1 154 ? 55.427  152.274 74.863  1.00   99.43  ? 154 DC  I "O5'" 1 
ATOM   3122  C "C5'" . DC  A 1 154 ? 56.172  152.541 76.048  1.00   100.98 ? 154 DC  I "C5'" 1 
ATOM   3123  C "C4'" . DC  A 1 154 ? 56.831  153.907 75.977  1.00   110.91 ? 154 DC  I "C4'" 1 
ATOM   3124  O "O4'" . DC  A 1 154 ? 57.929  153.866 75.040  1.00   111.02 ? 154 DC  I "O4'" 1 
ATOM   3125  C "C3'" . DC  A 1 154 ? 55.912  155.041 75.513  1.00   124.78 ? 154 DC  I "C3'" 1 
ATOM   3126  O "O3'" . DC  A 1 154 ? 55.751  155.999 76.556  1.00   135.88 ? 154 DC  I "O3'" 1 
ATOM   3127  C "C2'" . DC  A 1 154 ? 56.621  155.644 74.289  1.00   122.23 ? 154 DC  I "C2'" 1 
ATOM   3128  C "C1'" . DC  A 1 154 ? 58.044  155.117 74.421  1.00   121.57 ? 154 DC  I "C1'" 1 
ATOM   3129  N N1    . DC  A 1 154 ? 58.730  154.932 73.109  1.00   124.38 ? 154 DC  I N1    1 
ATOM   3130  C C2    . DC  A 1 154 ? 59.875  155.679 72.813  1.00   131.50 ? 154 DC  I C2    1 
ATOM   3131  O O2    . DC  A 1 154 ? 60.305  156.482 73.650  1.00   132.12 ? 154 DC  I O2    1 
ATOM   3132  N N3    . DC  A 1 154 ? 60.484  155.498 71.615  1.00   133.77 ? 154 DC  I N3    1 
ATOM   3133  C C4    . DC  A 1 154 ? 59.990  154.621 70.739  1.00   127.36 ? 154 DC  I C4    1 
ATOM   3134  N N4    . DC  A 1 154 ? 60.624  154.477 69.571  1.00   136.38 ? 154 DC  I N4    1 
ATOM   3135  C C5    . DC  A 1 154 ? 58.823  153.853 71.023  1.00   109.13 ? 154 DC  I C5    1 
ATOM   3136  C C6    . DC  A 1 154 ? 58.231  154.039 72.207  1.00   115.89 ? 154 DC  I C6    1 
ATOM   3137  P P     . DT  A 1 155 ? 54.329  156.713 76.786  1.00   100.28 ? 155 DT  I P     1 
ATOM   3138  O OP1   . DT  A 1 155 ? 53.848  156.348 78.137  1.00   107.53 ? 155 DT  I OP1   1 
ATOM   3139  O OP2   . DT  A 1 155 ? 53.490  156.430 75.600  1.00   106.11 ? 155 DT  I OP2   1 
ATOM   3140  O "O5'" . DT  A 1 155 ? 54.679  158.270 76.771  1.00   77.95  ? 155 DT  I "O5'" 1 
ATOM   3141  C "C5'" . DT  A 1 155 ? 55.490  158.794 75.735  1.00   106.38 ? 155 DT  I "C5'" 1 
ATOM   3142  C "C4'" . DT  A 1 155 ? 56.636  159.603 76.308  1.00   106.25 ? 155 DT  I "C4'" 1 
ATOM   3143  O "O4'" . DT  A 1 155 ? 57.859  159.255 75.618  1.00   100.93 ? 155 DT  I "O4'" 1 
ATOM   3144  C "C3'" . DT  A 1 155 ? 56.499  161.104 76.138  1.00   125.68 ? 155 DT  I "C3'" 1 
ATOM   3145  O "O3'" . DT  A 1 155 ? 57.240  161.780 77.143  1.00   143.58 ? 155 DT  I "O3'" 1 
ATOM   3146  C "C2'" . DT  A 1 155 ? 57.094  161.328 74.753  1.00   127.86 ? 155 DT  I "C2'" 1 
ATOM   3147  C "C1'" . DT  A 1 155 ? 58.208  160.280 74.704  1.00   131.57 ? 155 DT  I "C1'" 1 
ATOM   3148  N N1    . DT  A 1 155 ? 58.386  159.666 73.357  1.00   125.01 ? 155 DT  I N1    1 
ATOM   3149  C C2    . DT  A 1 155 ? 59.654  159.528 72.841  1.00   141.45 ? 155 DT  I C2    1 
ATOM   3150  O O2    . DT  A 1 155 ? 60.657  159.884 73.432  1.00   143.84 ? 155 DT  I O2    1 
ATOM   3151  N N3    . DT  A 1 155 ? 59.707  158.953 71.600  1.00   153.19 ? 155 DT  I N3    1 
ATOM   3152  C C4    . DT  A 1 155 ? 58.641  158.511 70.836  1.00   154.38 ? 155 DT  I C4    1 
ATOM   3153  O O4    . DT  A 1 155 ? 58.792  158.006 69.728  1.00   156.83 ? 155 DT  I O4    1 
ATOM   3154  C C5    . DT  A 1 155 ? 57.338  158.686 71.436  1.00   136.37 ? 155 DT  I C5    1 
ATOM   3155  C C7    . DT  A 1 155 ? 56.105  158.245 70.704  1.00   114.03 ? 155 DT  I C7    1 
ATOM   3156  C C6    . DT  A 1 155 ? 57.275  159.248 72.652  1.00   119.86 ? 155 DT  I C6    1 
ATOM   3157  P P     . DG  A 1 156 ? 56.872  163.296 77.531  1.00   145.74 ? 156 DG  I P     1 
ATOM   3158  O OP1   . DG  A 1 156 ? 57.313  163.518 78.927  1.00   118.30 ? 156 DG  I OP1   1 
ATOM   3159  O OP2   . DG  A 1 156 ? 55.457  163.522 77.160  1.00   72.20  ? 156 DG  I OP2   1 
ATOM   3160  O "O5'" . DG  A 1 156 ? 57.788  164.172 76.556  1.00   139.58 ? 156 DG  I "O5'" 1 
ATOM   3161  C "C5'" . DG  A 1 156 ? 59.201  164.161 76.716  1.00   134.08 ? 156 DG  I "C5'" 1 
ATOM   3162  C "C4'" . DG  A 1 156 ? 59.900  164.647 75.459  1.00   149.94 ? 156 DG  I "C4'" 1 
ATOM   3163  O "O4'" . DG  A 1 156 ? 59.670  163.713 74.376  1.00   114.13 ? 156 DG  I "O4'" 1 
ATOM   3164  C "C3'" . DG  A 1 156 ? 59.445  166.021 74.943  1.00   176.97 ? 156 DG  I "C3'" 1 
ATOM   3165  O "O3'" . DG  A 1 156 ? 60.561  166.906 74.873  1.00   163.09 ? 156 DG  I "O3'" 1 
ATOM   3166  C "C2'" . DG  A 1 156 ? 58.868  165.725 73.552  1.00   175.32 ? 156 DG  I "C2'" 1 
ATOM   3167  C "C1'" . DG  A 1 156 ? 59.584  164.440 73.180  1.00   152.03 ? 156 DG  I "C1'" 1 
ATOM   3168  N N9    . DG  A 1 156 ? 58.869  163.640 72.192  1.00   150.32 ? 156 DG  I N9    1 
ATOM   3169  C C8    . DG  A 1 156 ? 57.516  163.410 72.133  1.00   159.79 ? 156 DG  I C8    1 
ATOM   3170  N N7    . DG  A 1 156 ? 57.161  162.654 71.131  1.00   158.81 ? 156 DG  I N7    1 
ATOM   3171  C C5    . DG  A 1 156 ? 58.355  162.367 70.483  1.00   155.36 ? 156 DG  I C5    1 
ATOM   3172  C C6    . DG  A 1 156 ? 58.601  161.589 69.327  1.00   156.24 ? 156 DG  I C6    1 
ATOM   3173  O O6    . DG  A 1 156 ? 57.784  160.979 68.624  1.00   164.63 ? 156 DG  I O6    1 
ATOM   3174  N N1    . DG  A 1 156 ? 59.957  161.556 69.008  1.00   164.12 ? 156 DG  I N1    1 
ATOM   3175  C C2    . DG  A 1 156 ? 60.948  162.195 69.716  1.00   173.29 ? 156 DG  I C2    1 
ATOM   3176  N N2    . DG  A 1 156 ? 62.198  162.048 69.256  1.00   176.07 ? 156 DG  I N2    1 
ATOM   3177  N N3    . DG  A 1 156 ? 60.729  162.926 70.800  1.00   161.37 ? 156 DG  I N3    1 
ATOM   3178  C C4    . DG  A 1 156 ? 59.415  162.968 71.124  1.00   152.43 ? 156 DG  I C4    1 
ATOM   3179  P P     . DT  A 1 157 ? 60.385  168.406 74.319  1.00   153.28 ? 157 DT  I P     1 
ATOM   3180  O OP1   . DT  A 1 157 ? 61.287  169.267 75.114  1.00   175.82 ? 157 DT  I OP1   1 
ATOM   3181  O OP2   . DT  A 1 157 ? 58.942  168.727 74.256  1.00   137.57 ? 157 DT  I OP2   1 
ATOM   3182  O "O5'" . DT  A 1 157 ? 60.949  168.330 72.822  1.00   167.36 ? 157 DT  I "O5'" 1 
ATOM   3183  C "C5'" . DT  A 1 157 ? 62.326  168.041 72.599  1.00   169.72 ? 157 DT  I "C5'" 1 
ATOM   3184  C "C4'" . DT  A 1 157 ? 62.674  168.128 71.123  1.00   175.71 ? 157 DT  I "C4'" 1 
ATOM   3185  O "O4'" . DT  A 1 157 ? 62.074  167.014 70.410  1.00   174.97 ? 157 DT  I "O4'" 1 
ATOM   3186  C "C3'" . DT  A 1 157 ? 62.193  169.400 70.412  1.00   190.42 ? 157 DT  I "C3'" 1 
ATOM   3187  O "O3'" . DT  A 1 157 ? 63.246  169.940 69.616  1.00   189.56 ? 157 DT  I "O3'" 1 
ATOM   3188  C "C2'" . DT  A 1 157 ? 61.035  168.903 69.547  1.00   187.91 ? 157 DT  I "C2'" 1 
ATOM   3189  C "C1'" . DT  A 1 157 ? 61.493  167.493 69.223  1.00   179.19 ? 157 DT  I "C1'" 1 
ATOM   3190  N N1    . DT  A 1 157 ? 60.384  166.582 68.830  1.00   172.15 ? 157 DT  I N1    1 
ATOM   3191  C C2    . DT  A 1 157 ? 60.591  165.672 67.822  1.00   167.28 ? 157 DT  I C2    1 
ATOM   3192  O O2    . DT  A 1 157 ? 61.650  165.563 67.230  1.00   146.05 ? 157 DT  I O2    1 
ATOM   3193  N N3    . DT  A 1 157 ? 59.510  164.883 67.532  1.00   166.19 ? 157 DT  I N3    1 
ATOM   3194  C C4    . DT  A 1 157 ? 58.266  164.917 68.135  1.00   163.46 ? 157 DT  I C4    1 
ATOM   3195  O O4    . DT  A 1 157 ? 57.355  164.166 67.802  1.00   160.02 ? 157 DT  I O4    1 
ATOM   3196  C C5    . DT  A 1 157 ? 58.114  165.899 69.183  1.00   170.45 ? 157 DT  I C5    1 
ATOM   3197  C C7    . DT  A 1 157 ? 56.809  166.031 69.911  1.00   166.25 ? 157 DT  I C7    1 
ATOM   3198  C C6    . DT  A 1 157 ? 59.168  166.676 69.475  1.00   169.91 ? 157 DT  I C6    1 
ATOM   3199  P P     . DG  A 1 158 ? 63.049  171.333 68.836  1.00   203.89 ? 158 DG  I P     1 
ATOM   3200  O OP1   . DG  A 1 158 ? 64.307  172.097 68.980  1.00   216.35 ? 158 DG  I OP1   1 
ATOM   3201  O OP2   . DG  A 1 158 ? 61.774  171.941 69.279  1.00   183.92 ? 158 DG  I OP2   1 
ATOM   3202  O "O5'" . DG  A 1 158 ? 62.888  170.899 67.304  1.00   182.16 ? 158 DG  I "O5'" 1 
ATOM   3203  C "C5'" . DG  A 1 158 ? 64.002  170.357 66.600  1.00   173.99 ? 158 DG  I "C5'" 1 
ATOM   3204  C "C4'" . DG  A 1 158 ? 63.569  169.737 65.282  1.00   174.99 ? 158 DG  I "C4'" 1 
ATOM   3205  O "O4'" . DG  A 1 158 ? 62.513  168.766 65.519  1.00   176.92 ? 158 DG  I "O4'" 1 
ATOM   3206  C "C3'" . DG  A 1 158 ? 63.011  170.719 64.246  1.00   177.41 ? 158 DG  I "C3'" 1 
ATOM   3207  O "O3'" . DG  A 1 158 ? 63.471  170.355 62.943  1.00   189.82 ? 158 DG  I "O3'" 1 
ATOM   3208  C "C2'" . DG  A 1 158 ? 61.505  170.521 64.380  1.00   171.05 ? 158 DG  I "C2'" 1 
ATOM   3209  C "C1'" . DG  A 1 158 ? 61.444  169.028 64.640  1.00   179.48 ? 158 DG  I "C1'" 1 
ATOM   3210  N N9    . DG  A 1 158 ? 60.199  168.587 65.260  1.00   192.38 ? 158 DG  I N9    1 
ATOM   3211  C C8    . DG  A 1 158 ? 59.639  169.054 66.425  1.00   186.63 ? 158 DG  I C8    1 
ATOM   3212  N N7    . DG  A 1 158 ? 58.514  168.469 66.731  1.00   174.50 ? 158 DG  I N7    1 
ATOM   3213  C C5    . DG  A 1 158 ? 58.314  167.556 65.703  1.00   174.75 ? 158 DG  I C5    1 
ATOM   3214  C C6    . DG  A 1 158 ? 57.260  166.636 65.492  1.00   167.07 ? 158 DG  I C6    1 
ATOM   3215  O O6    . DG  A 1 158 ? 56.260  166.438 66.196  1.00   171.17 ? 158 DG  I O6    1 
ATOM   3216  N N1    . DG  A 1 158 ? 57.446  165.898 64.325  1.00   162.87 ? 158 DG  I N1    1 
ATOM   3217  C C2    . DG  A 1 158 ? 58.515  166.034 63.471  1.00   165.74 ? 158 DG  I C2    1 
ATOM   3218  N N2    . DG  A 1 158 ? 58.521  165.236 62.394  1.00   163.57 ? 158 DG  I N2    1 
ATOM   3219  N N3    . DG  A 1 158 ? 59.508  166.893 63.657  1.00   172.74 ? 158 DG  I N3    1 
ATOM   3220  C C4    . DG  A 1 158 ? 59.342  167.618 64.789  1.00   182.77 ? 158 DG  I C4    1 
ATOM   3221  P P     . DC  A 1 159 ? 63.309  171.364 61.699  1.00   190.01 ? 159 DC  I P     1 
ATOM   3222  O OP1   . DC  A 1 159 ? 64.670  171.683 61.214  1.00   163.31 ? 159 DC  I OP1   1 
ATOM   3223  O OP2   . DC  A 1 159 ? 62.399  172.461 62.095  1.00   189.25 ? 159 DC  I OP2   1 
ATOM   3224  O "O5'" . DC  A 1 159 ? 62.564  170.484 60.587  1.00   176.39 ? 159 DC  I "O5'" 1 
ATOM   3225  C "C5'" . DC  A 1 159 ? 61.470  169.652 60.958  1.00   170.08 ? 159 DC  I "C5'" 1 
ATOM   3226  C "C4'" . DC  A 1 159 ? 60.529  169.428 59.789  1.00   169.27 ? 159 DC  I "C4'" 1 
ATOM   3227  O "O4'" . DC  A 1 159 ? 59.261  168.943 60.291  1.00   150.84 ? 159 DC  I "O4'" 1 
ATOM   3228  C "C3'" . DC  A 1 159 ? 60.178  170.678 59.002  1.00   182.99 ? 159 DC  I "C3'" 1 
ATOM   3229  O "O3'" . DC  A 1 159 ? 59.737  170.323 57.696  1.00   180.12 ? 159 DC  I "O3'" 1 
ATOM   3230  C "C2'" . DC  A 1 159 ? 59.042  171.259 59.833  1.00   189.50 ? 159 DC  I "C2'" 1 
ATOM   3231  C "C1'" . DC  A 1 159 ? 58.310  169.996 60.291  1.00   168.96 ? 159 DC  I "C1'" 1 
ATOM   3232  N N1    . DC  A 1 159 ? 57.732  170.115 61.660  1.00   176.00 ? 159 DC  I N1    1 
ATOM   3233  C C2    . DC  A 1 159 ? 56.573  169.405 61.988  1.00   169.16 ? 159 DC  I C2    1 
ATOM   3234  O O2    . DC  A 1 159 ? 56.048  168.680 61.135  1.00   163.16 ? 159 DC  I O2    1 
ATOM   3235  N N3    . DC  A 1 159 ? 56.059  169.528 63.238  1.00   172.19 ? 159 DC  I N3    1 
ATOM   3236  C C4    . DC  A 1 159 ? 56.657  170.321 64.131  1.00   171.67 ? 159 DC  I C4    1 
ATOM   3237  N N4    . DC  A 1 159 ? 56.114  170.411 65.349  1.00   167.43 ? 159 DC  I N4    1 
ATOM   3238  C C5    . DC  A 1 159 ? 57.837  171.056 63.813  1.00   155.83 ? 159 DC  I C5    1 
ATOM   3239  C C6    . DC  A 1 159 ? 58.334  170.925 62.579  1.00   167.67 ? 159 DC  I C6    1 
ATOM   3240  P P     . DA  A 1 160 ? 59.706  171.421 56.523  1.00   181.91 ? 160 DA  I P     1 
ATOM   3241  O OP1   . DA  A 1 160 ? 61.107  171.787 56.219  1.00   202.70 ? 160 DA  I OP1   1 
ATOM   3242  O OP2   . DA  A 1 160 ? 58.738  172.474 56.900  1.00   145.28 ? 160 DA  I OP2   1 
ATOM   3243  O "O5'" . DA  A 1 160 ? 59.097  170.630 55.274  1.00   187.77 ? 160 DA  I "O5'" 1 
ATOM   3244  C "C5'" . DA  A 1 160 ? 58.344  171.328 54.287  1.00   182.06 ? 160 DA  I "C5'" 1 
ATOM   3245  C "C4'" . DA  A 1 160 ? 57.159  170.497 53.829  1.00   185.25 ? 160 DA  I "C4'" 1 
ATOM   3246  O "O4'" . DA  A 1 160 ? 56.581  169.812 54.971  1.00   184.47 ? 160 DA  I "O4'" 1 
ATOM   3247  C "C3'" . DA  A 1 160 ? 56.016  171.293 53.214  1.00   167.39 ? 160 DA  I "C3'" 1 
ATOM   3248  O "O3'" . DA  A 1 160 ? 55.312  170.486 52.273  1.00   136.50 ? 160 DA  I "O3'" 1 
ATOM   3249  C "C2'" . DA  A 1 160 ? 55.158  171.606 54.432  1.00   151.99 ? 160 DA  I "C2'" 1 
ATOM   3250  C "C1'" . DA  A 1 160 ? 55.280  170.309 55.221  1.00   151.13 ? 160 DA  I "C1'" 1 
ATOM   3251  N N9    . DA  A 1 160 ? 55.120  170.485 56.660  1.00   142.90 ? 160 DA  I N9    1 
ATOM   3252  C C8    . DA  A 1 160 ? 55.951  171.166 57.505  1.00   147.29 ? 160 DA  I C8    1 
ATOM   3253  N N7    . DA  A 1 160 ? 55.555  171.159 58.756  1.00   147.19 ? 160 DA  I N7    1 
ATOM   3254  C C5    . DA  A 1 160 ? 54.385  170.418 58.730  1.00   147.30 ? 160 DA  I C5    1 
ATOM   3255  C C6    . DA  A 1 160 ? 53.476  170.043 59.738  1.00   146.65 ? 160 DA  I C6    1 
ATOM   3256  N N6    . DA  A 1 160 ? 53.622  170.380 61.023  1.00   149.95 ? 160 DA  I N6    1 
ATOM   3257  N N1    . DA  A 1 160 ? 52.409  169.303 59.372  1.00   142.54 ? 160 DA  I N1    1 
ATOM   3258  C C2    . DA  A 1 160 ? 52.265  168.967 58.085  1.00   140.37 ? 160 DA  I C2    1 
ATOM   3259  N N3    . DA  A 1 160 ? 53.050  169.262 57.051  1.00   143.96 ? 160 DA  I N3    1 
ATOM   3260  C C4    . DA  A 1 160 ? 54.102  169.997 57.445  1.00   148.24 ? 160 DA  I C4    1 
ATOM   3261  P P     . DT  A 1 161 ? 54.202  171.142 51.313  1.00   101.78 ? 161 DT  I P     1 
ATOM   3262  O OP1   . DT  A 1 161 ? 53.901  170.165 50.243  1.00   107.92 ? 161 DT  I OP1   1 
ATOM   3263  O OP2   . DT  A 1 161 ? 54.658  172.503 50.957  1.00   135.90 ? 161 DT  I OP2   1 
ATOM   3264  O "O5'" . DT  A 1 161 ? 52.916  171.280 52.255  1.00   116.29 ? 161 DT  I "O5'" 1 
ATOM   3265  C "C5'" . DT  A 1 161 ? 51.856  172.154 51.893  1.00   110.61 ? 161 DT  I "C5'" 1 
ATOM   3266  C "C4'" . DT  A 1 161 ? 50.573  171.761 52.602  1.00   109.95 ? 161 DT  I "C4'" 1 
ATOM   3267  O "O4'" . DT  A 1 161 ? 50.871  171.393 53.974  1.00   105.06 ? 161 DT  I "O4'" 1 
ATOM   3268  C "C3'" . DT  A 1 161 ? 49.522  172.860 52.689  1.00   135.41 ? 161 DT  I "C3'" 1 
ATOM   3269  O "O3'" . DT  A 1 161 ? 48.221  172.285 52.673  1.00   133.65 ? 161 DT  I "O3'" 1 
ATOM   3270  C "C2'" . DT  A 1 161 ? 49.831  173.497 54.038  1.00   131.20 ? 161 DT  I "C2'" 1 
ATOM   3271  C "C1'" . DT  A 1 161 ? 50.211  172.274 54.861  1.00   116.47 ? 161 DT  I "C1'" 1 
ATOM   3272  N N1    . DT  A 1 161 ? 51.132  172.577 55.990  1.00   135.25 ? 161 DT  I N1    1 
ATOM   3273  C C2    . DT  A 1 161 ? 50.915  171.983 57.210  1.00   142.84 ? 161 DT  I C2    1 
ATOM   3274  O O2    . DT  A 1 161 ? 49.996  171.213 57.424  1.00   123.82 ? 161 DT  I O2    1 
ATOM   3275  N N3    . DT  A 1 161 ? 51.821  172.322 58.180  1.00   164.77 ? 161 DT  I N3    1 
ATOM   3276  C C4    . DT  A 1 161 ? 52.900  173.180 58.054  1.00   174.47 ? 161 DT  I C4    1 
ATOM   3277  O O4    . DT  A 1 161 ? 53.657  173.424 58.989  1.00   166.62 ? 161 DT  I O4    1 
ATOM   3278  C C5    . DT  A 1 161 ? 53.070  173.770 56.747  1.00   172.22 ? 161 DT  I C5    1 
ATOM   3279  C C7    . DT  A 1 161 ? 54.204  174.718 56.488  1.00   154.59 ? 161 DT  I C7    1 
ATOM   3280  C C6    . DT  A 1 161 ? 52.188  173.443 55.789  1.00   152.76 ? 161 DT  I C6    1 
ATOM   3281  P P     . DG  A 1 162 ? 47.128  172.779 51.604  1.00   129.50 ? 162 DG  I P     1 
ATOM   3282  O OP1   . DG  A 1 162 ? 46.472  171.574 51.048  1.00   112.31 ? 162 DG  I OP1   1 
ATOM   3283  O OP2   . DG  A 1 162 ? 47.784  173.747 50.697  1.00   110.87 ? 162 DG  I OP2   1 
ATOM   3284  O "O5'" . DG  A 1 162 ? 46.061  173.578 52.486  1.00   114.69 ? 162 DG  I "O5'" 1 
ATOM   3285  C "C5'" . DG  A 1 162 ? 46.458  174.729 53.222  1.00   123.27 ? 162 DG  I "C5'" 1 
ATOM   3286  C "C4'" . DG  A 1 162 ? 45.784  174.749 54.580  1.00   122.85 ? 162 DG  I "C4'" 1 
ATOM   3287  O "O4'" . DG  A 1 162 ? 46.591  174.018 55.535  1.00   118.29 ? 162 DG  I "O4'" 1 
ATOM   3288  C "C3'" . DG  A 1 162 ? 45.626  176.122 55.203  1.00   148.17 ? 162 DG  I "C3'" 1 
ATOM   3289  O "O3'" . DG  A 1 162 ? 44.480  176.812 54.654  1.00   113.33 ? 162 DG  I "O3'" 1 
ATOM   3290  C "C2'" . DG  A 1 162 ? 45.467  175.768 56.677  1.00   129.40 ? 162 DG  I "C2'" 1 
ATOM   3291  C "C1'" . DG  A 1 162 ? 46.452  174.606 56.822  1.00   113.12 ? 162 DG  I "C1'" 1 
ATOM   3292  N N9    . DG  A 1 162 ? 47.768  175.025 57.300  1.00   146.35 ? 162 DG  I N9    1 
ATOM   3293  C C8    . DG  A 1 162 ? 48.543  176.049 56.807  1.00   139.94 ? 162 DG  I C8    1 
ATOM   3294  N N7    . DG  A 1 162 ? 49.671  176.200 57.441  1.00   143.08 ? 162 DG  I N7    1 
ATOM   3295  C C5    . DG  A 1 162 ? 49.643  175.218 58.421  1.00   154.56 ? 162 DG  I C5    1 
ATOM   3296  C C6    . DG  A 1 162 ? 50.597  174.898 59.415  1.00   159.61 ? 162 DG  I C6    1 
ATOM   3297  O O6    . DG  A 1 162 ? 51.691  175.438 59.631  1.00   172.01 ? 162 DG  I O6    1 
ATOM   3298  N N1    . DG  A 1 162 ? 50.179  173.830 60.205  1.00   144.62 ? 162 DG  I N1    1 
ATOM   3299  C C2    . DG  A 1 162 ? 48.989  173.160 60.052  1.00   155.75 ? 162 DG  I C2    1 
ATOM   3300  N N2    . DG  A 1 162 ? 48.759  172.157 60.908  1.00   156.92 ? 162 DG  I N2    1 
ATOM   3301  N N3    . DG  A 1 162 ? 48.086  173.451 59.126  1.00   167.82 ? 162 DG  I N3    1 
ATOM   3302  C C4    . DG  A 1 162 ? 48.478  174.487 58.349  1.00   157.60 ? 162 DG  I C4    1 
ATOM   3303  P P     . DT  A 1 163 ? 42.977  176.506 55.145  1.00   102.06 ? 163 DT  I P     1 
ATOM   3304  O OP1   . DT  A 1 163 ? 42.779  175.048 55.309  1.00   128.51 ? 163 DT  I OP1   1 
ATOM   3305  O OP2   . DT  A 1 163 ? 42.093  177.246 54.221  1.00   101.05 ? 163 DT  I OP2   1 
ATOM   3306  O "O5'" . DT  A 1 163 ? 42.862  177.227 56.568  1.00   91.96  ? 163 DT  I "O5'" 1 
ATOM   3307  C "C5'" . DT  A 1 163 ? 42.093  176.627 57.603  1.00   102.46 ? 163 DT  I "C5'" 1 
ATOM   3308  C "C4'" . DT  A 1 163 ? 42.325  177.330 58.927  1.00   95.02  ? 163 DT  I "C4'" 1 
ATOM   3309  O "O4'" . DT  A 1 163 ? 43.711  177.176 59.327  1.00   110.94 ? 163 DT  I "O4'" 1 
ATOM   3310  C "C3'" . DT  A 1 163 ? 42.049  178.836 58.914  1.00   120.24 ? 163 DT  I "C3'" 1 
ATOM   3311  O "O3'" . DT  A 1 163 ? 41.269  179.195 60.043  1.00   111.46 ? 163 DT  I "O3'" 1 
ATOM   3312  C "C2'" . DT  A 1 163 ? 43.445  179.456 58.978  1.00   130.11 ? 163 DT  I "C2'" 1 
ATOM   3313  C "C1'" . DT  A 1 163 ? 44.194  178.414 59.786  1.00   100.68 ? 163 DT  I "C1'" 1 
ATOM   3314  N N1    . DT  A 1 163 ? 45.667  178.452 59.594  1.00   119.02 ? 163 DT  I N1    1 
ATOM   3315  C C2    . DT  A 1 163 ? 46.484  178.026 60.612  1.00   142.29 ? 163 DT  I C2    1 
ATOM   3316  O O2    . DT  A 1 163 ? 46.060  177.610 61.676  1.00   130.22 ? 163 DT  I O2    1 
ATOM   3317  N N3    . DT  A 1 163 ? 47.824  178.101 60.341  1.00   159.00 ? 163 DT  I N3    1 
ATOM   3318  C C4    . DT  A 1 163 ? 48.416  178.552 59.175  1.00   153.12 ? 163 DT  I C4    1 
ATOM   3319  O O4    . DT  A 1 163 ? 49.634  178.584 59.028  1.00   160.44 ? 163 DT  I O4    1 
ATOM   3320  C C5    . DT  A 1 163 ? 47.501  178.989 58.146  1.00   139.56 ? 163 DT  I C5    1 
ATOM   3321  C C7    . DT  A 1 163 ? 48.026  179.502 56.837  1.00   116.18 ? 163 DT  I C7    1 
ATOM   3322  C C6    . DT  A 1 163 ? 46.185  178.919 58.403  1.00   127.16 ? 163 DT  I C6    1 
ATOM   3323  P P     . DA  A 1 164 ? 40.168  180.357 59.919  1.00   115.26 ? 164 DA  I P     1 
ATOM   3324  O OP1   . DA  A 1 164 ? 38.858  179.713 59.675  1.00   142.40 ? 164 DA  I OP1   1 
ATOM   3325  O OP2   . DA  A 1 164 ? 40.689  181.356 58.959  1.00   109.82 ? 164 DA  I OP2   1 
ATOM   3326  O "O5'" . DA  A 1 164 ? 40.152  181.029 61.368  1.00   113.41 ? 164 DA  I "O5'" 1 
ATOM   3327  C "C5'" . DA  A 1 164 ? 40.383  182.425 61.502  1.00   162.34 ? 164 DA  I "C5'" 1 
ATOM   3328  C "C4'" . DA  A 1 164 ? 41.345  182.701 62.641  1.00   156.27 ? 164 DA  I "C4'" 1 
ATOM   3329  O "O4'" . DA  A 1 164 ? 42.471  181.798 62.549  1.00   115.43 ? 164 DA  I "O4'" 1 
ATOM   3330  C "C3'" . DA  A 1 164 ? 41.968  184.085 62.637  1.00   155.54 ? 164 DA  I "C3'" 1 
ATOM   3331  O "O3'" . DA  A 1 164 ? 41.075  185.053 63.233  1.00   142.34 ? 164 DA  I "O3'" 1 
ATOM   3332  C "C2'" . DA  A 1 164 ? 43.237  183.861 63.454  1.00   152.21 ? 164 DA  I "C2'" 1 
ATOM   3333  C "C1'" . DA  A 1 164 ? 43.635  182.439 63.047  1.00   139.33 ? 164 DA  I "C1'" 1 
ATOM   3334  N N9    . DA  A 1 164 ? 44.671  182.401 62.020  1.00   123.60 ? 164 DA  I N9    1 
ATOM   3335  C C8    . DA  A 1 164 ? 44.649  183.016 60.799  1.00   120.01 ? 164 DA  I C8    1 
ATOM   3336  N N7    . DA  A 1 164 ? 45.730  182.811 60.084  1.00   125.01 ? 164 DA  I N7    1 
ATOM   3337  C C5    . DA  A 1 164 ? 46.515  182.008 60.894  1.00   141.35 ? 164 DA  I C5    1 
ATOM   3338  C C6    . DA  A 1 164 ? 47.791  181.438 60.716  1.00   152.98 ? 164 DA  I C6    1 
ATOM   3339  N N6    . DA  A 1 164 ? 48.525  181.606 59.611  1.00   143.46 ? 164 DA  I N6    1 
ATOM   3340  N N1    . DA  A 1 164 ? 48.286  180.688 61.723  1.00   156.63 ? 164 DA  I N1    1 
ATOM   3341  C C2    . DA  A 1 164 ? 47.548  180.522 62.828  1.00   152.14 ? 164 DA  I C2    1 
ATOM   3342  N N3    . DA  A 1 164 ? 46.342  181.008 63.109  1.00   151.91 ? 164 DA  I N3    1 
ATOM   3343  C C4    . DA  A 1 164 ? 45.877  181.748 62.092  1.00   140.73 ? 164 DA  I C4    1 
ATOM   3344  P P     . DA  A 1 165 ? 40.952  185.237 64.830  1.00   156.85 ? 165 DA  I P     1 
ATOM   3345  O OP1   . DA  A 1 165 ? 40.936  183.915 65.495  1.00   161.81 ? 165 DA  I OP1   1 
ATOM   3346  O OP2   . DA  A 1 165 ? 39.812  186.154 65.046  1.00   165.74 ? 165 DA  I OP2   1 
ATOM   3347  O "O5'" . DA  A 1 165 ? 42.276  186.036 65.247  1.00   151.56 ? 165 DA  I "O5'" 1 
ATOM   3348  C "C5'" . DA  A 1 165 ? 42.814  185.877 66.555  1.00   154.62 ? 165 DA  I "C5'" 1 
ATOM   3349  C "C4'" . DA  A 1 165 ? 44.196  186.501 66.659  1.00   167.45 ? 165 DA  I "C4'" 1 
ATOM   3350  O "O4'" . DA  A 1 165 ? 45.080  185.908 65.669  1.00   165.83 ? 165 DA  I "O4'" 1 
ATOM   3351  C "C3'" . DA  A 1 165 ? 44.248  188.015 66.423  1.00   185.79 ? 165 DA  I "C3'" 1 
ATOM   3352  O "O3'" . DA  A 1 165 ? 45.089  188.625 67.397  1.00   191.02 ? 165 DA  I "O3'" 1 
ATOM   3353  C "C2'" . DA  A 1 165 ? 44.849  188.125 65.023  1.00   172.03 ? 165 DA  I "C2'" 1 
ATOM   3354  C "C1'" . DA  A 1 165 ? 45.789  186.935 65.019  1.00   163.12 ? 165 DA  I "C1'" 1 
ATOM   3355  N N9    . DA  A 1 165 ? 46.156  186.484 63.681  1.00   161.02 ? 165 DA  I N9    1 
ATOM   3356  C C8    . DA  A 1 165 ? 45.463  186.690 62.521  1.00   160.39 ? 165 DA  I C8    1 
ATOM   3357  N N7    . DA  A 1 165 ? 46.038  186.172 61.462  1.00   173.92 ? 165 DA  I N7    1 
ATOM   3358  C C5    . DA  A 1 165 ? 47.189  185.584 61.961  1.00   171.51 ? 165 DA  I C5    1 
ATOM   3359  C C6    . DA  A 1 165 ? 48.234  184.868 61.345  1.00   164.07 ? 165 DA  I C6    1 
ATOM   3360  N N6    . DA  A 1 165 ? 48.280  184.615 60.033  1.00   158.42 ? 165 DA  I N6    1 
ATOM   3361  N N1    . DA  A 1 165 ? 49.234  184.420 62.132  1.00   166.80 ? 165 DA  I N1    1 
ATOM   3362  C C2    . DA  A 1 165 ? 49.186  184.676 63.445  1.00   171.82 ? 165 DA  I C2    1 
ATOM   3363  N N3    . DA  A 1 165 ? 48.259  185.338 64.136  1.00   174.56 ? 165 DA  I N3    1 
ATOM   3364  C C4    . DA  A 1 165 ? 47.279  185.770 63.327  1.00   169.47 ? 165 DA  I C4    1 
ATOM   3365  P P     . DG  A 1 166 ? 44.994  190.204 67.681  1.00   191.84 ? 166 DG  I P     1 
ATOM   3366  O OP1   . DG  A 1 166 ? 44.519  190.377 69.072  1.00   189.50 ? 166 DG  I OP1   1 
ATOM   3367  O OP2   . DG  A 1 166 ? 44.246  190.830 66.567  1.00   163.85 ? 166 DG  I OP2   1 
ATOM   3368  O "O5'" . DG  A 1 166 ? 46.512  190.700 67.590  1.00   177.51 ? 166 DG  I "O5'" 1 
ATOM   3369  C "C5'" . DG  A 1 166 ? 47.316  190.319 66.480  1.00   174.23 ? 166 DG  I "C5'" 1 
ATOM   3370  C "C4'" . DG  A 1 166 ? 48.374  191.368 66.192  1.00   185.14 ? 166 DG  I "C4'" 1 
ATOM   3371  O "O4'" . DG  A 1 166 ? 49.105  190.991 65.001  1.00   172.84 ? 166 DG  I "O4'" 1 
ATOM   3372  C "C3'" . DG  A 1 166 ? 47.833  192.754 65.891  1.00   184.06 ? 166 DG  I "C3'" 1 
ATOM   3373  O "O3'" . DG  A 1 166 ? 48.831  193.734 66.150  1.00   157.13 ? 166 DG  I "O3'" 1 
ATOM   3374  C "C2'" . DG  A 1 166 ? 47.523  192.653 64.403  1.00   174.19 ? 166 DG  I "C2'" 1 
ATOM   3375  C "C1'" . DG  A 1 166 ? 48.666  191.770 63.901  1.00   165.84 ? 166 DG  I "C1'" 1 
ATOM   3376  N N9    . DG  A 1 166 ? 48.272  190.867 62.823  1.00   178.46 ? 166 DG  I N9    1 
ATOM   3377  C C8    . DG  A 1 166 ? 47.115  190.918 62.083  1.00   172.78 ? 166 DG  I C8    1 
ATOM   3378  N N7    . DG  A 1 166 ? 47.031  189.979 61.183  1.00   170.04 ? 166 DG  I N7    1 
ATOM   3379  C C5    . DG  A 1 166 ? 48.209  189.258 61.334  1.00   186.34 ? 166 DG  I C5    1 
ATOM   3380  C C6    . DG  A 1 166 ? 48.679  188.123 60.632  1.00   180.07 ? 166 DG  I C6    1 
ATOM   3381  O O6    . DG  A 1 166 ? 48.127  187.509 59.707  1.00   158.18 ? 166 DG  I O6    1 
ATOM   3382  N N1    . DG  A 1 166 ? 49.922  187.704 61.101  1.00   185.81 ? 166 DG  I N1    1 
ATOM   3383  C C2    . DG  A 1 166 ? 50.621  188.306 62.121  1.00   181.85 ? 166 DG  I C2    1 
ATOM   3384  N N2    . DG  A 1 166 ? 51.806  187.761 62.432  1.00   169.18 ? 166 DG  I N2    1 
ATOM   3385  N N3    . DG  A 1 166 ? 50.194  189.373 62.785  1.00   181.43 ? 166 DG  I N3    1 
ATOM   3386  C C4    . DG  A 1 166 ? 48.984  189.792 62.340  1.00   188.64 ? 166 DG  I C4    1 
ATOM   3387  P P     . DA  B 2 1   ? 54.764  190.277 52.408  1.00   206.19 ? 1   DA  J P     1 
ATOM   3388  O OP1   . DA  B 2 1   ? 55.230  190.470 51.016  1.00   170.66 ? 1   DA  J OP1   1 
ATOM   3389  O OP2   . DA  B 2 1   ? 53.515  189.542 52.690  1.00   193.64 ? 1   DA  J OP2   1 
ATOM   3390  O "O5'" . DA  B 2 1   ? 55.904  189.565 53.264  1.00   210.17 ? 1   DA  J "O5'" 1 
ATOM   3391  C "C5'" . DA  B 2 1   ? 56.741  190.344 54.050  1.00   197.73 ? 1   DA  J "C5'" 1 
ATOM   3392  C "C4'" . DA  B 2 1   ? 56.926  189.770 55.446  1.00   216.18 ? 1   DA  J "C4'" 1 
ATOM   3393  O "O4'" . DA  B 2 1   ? 55.767  190.127 56.254  1.00   214.78 ? 1   DA  J "O4'" 1 
ATOM   3394  C "C3'" . DA  B 2 1   ? 57.005  188.233 55.504  1.00   229.33 ? 1   DA  J "C3'" 1 
ATOM   3395  O "O3'" . DA  B 2 1   ? 57.902  187.731 56.502  1.00   240.18 ? 1   DA  J "O3'" 1 
ATOM   3396  C "C2'" . DA  B 2 1   ? 55.587  187.834 55.880  1.00   215.05 ? 1   DA  J "C2'" 1 
ATOM   3397  C "C1'" . DA  B 2 1   ? 55.149  188.972 56.800  1.00   213.99 ? 1   DA  J "C1'" 1 
ATOM   3398  N N9    . DA  B 2 1   ? 53.695  189.101 56.849  1.00   190.62 ? 1   DA  J N9    1 
ATOM   3399  C C8    . DA  B 2 1   ? 52.823  189.266 55.818  1.00   174.06 ? 1   DA  J C8    1 
ATOM   3400  N N7    . DA  B 2 1   ? 51.581  189.463 56.202  1.00   163.18 ? 1   DA  J N7    1 
ATOM   3401  C C5    . DA  B 2 1   ? 51.699  189.701 57.555  1.00   173.31 ? 1   DA  J C5    1 
ATOM   3402  C C6    . DA  B 2 1   ? 50.765  190.061 58.551  1.00   180.53 ? 1   DA  J C6    1 
ATOM   3403  N N6    . DA  B 2 1   ? 49.466  190.246 58.313  1.00   180.83 ? 1   DA  J N6    1 
ATOM   3404  N N1    . DA  B 2 1   ? 51.224  190.222 59.808  1.00   172.19 ? 1   DA  J N1    1 
ATOM   3405  C C2    . DA  B 2 1   ? 52.526  190.035 60.046  1.00   167.65 ? 1   DA  J C2    1 
ATOM   3406  N N3    . DA  B 2 1   ? 53.490  189.698 59.195  1.00   177.87 ? 1   DA  J N3    1 
ATOM   3407  C C4    . DA  B 2 1   ? 53.005  189.536 57.958  1.00   180.69 ? 1   DA  J C4    1 
ATOM   3408  P P     . DC  B 2 2   ? 58.646  188.654 57.584  1.00   235.25 ? 2   DC  J P     1 
ATOM   3409  O OP1   . DC  B 2 2   ? 57.698  189.483 58.357  1.00   218.11 ? 2   DC  J OP1   1 
ATOM   3410  O OP2   . DC  B 2 2   ? 59.794  189.269 56.888  1.00   205.54 ? 2   DC  J OP2   1 
ATOM   3411  O "O5'" . DC  B 2 2   ? 59.215  187.579 58.623  1.00   220.24 ? 2   DC  J "O5'" 1 
ATOM   3412  C "C5'" . DC  B 2 2   ? 59.267  187.896 60.008  1.00   212.29 ? 2   DC  J "C5'" 1 
ATOM   3413  C "C4'" . DC  B 2 2   ? 58.145  187.214 60.781  1.00   210.12 ? 2   DC  J "C4'" 1 
ATOM   3414  O "O4'" . DC  B 2 2   ? 56.891  187.350 60.074  1.00   207.32 ? 2   DC  J "O4'" 1 
ATOM   3415  C "C3'" . DC  B 2 2   ? 58.322  185.705 61.011  1.00   207.75 ? 2   DC  J "C3'" 1 
ATOM   3416  O "O3'" . DC  B 2 2   ? 58.598  185.412 62.400  1.00   219.10 ? 2   DC  J "O3'" 1 
ATOM   3417  C "C2'" . DC  B 2 2   ? 56.990  185.082 60.549  1.00   207.07 ? 2   DC  J "C2'" 1 
ATOM   3418  C "C1'" . DC  B 2 2   ? 56.070  186.291 60.487  1.00   203.96 ? 2   DC  J "C1'" 1 
ATOM   3419  N N1    . DC  B 2 2   ? 54.922  186.142 59.546  1.00   206.60 ? 2   DC  J N1    1 
ATOM   3420  C C2    . DC  B 2 2   ? 53.680  186.688 59.888  1.00   202.83 ? 2   DC  J C2    1 
ATOM   3421  O O2    . DC  B 2 2   ? 53.566  187.299 60.958  1.00   199.02 ? 2   DC  J O2    1 
ATOM   3422  N N3    . DC  B 2 2   ? 52.639  186.540 59.033  1.00   193.44 ? 2   DC  J N3    1 
ATOM   3423  C C4    . DC  B 2 2   ? 52.804  185.875 57.890  1.00   190.65 ? 2   DC  J C4    1 
ATOM   3424  N N4    . DC  B 2 2   ? 51.747  185.754 57.079  1.00   182.86 ? 2   DC  J N4    1 
ATOM   3425  C C5    . DC  B 2 2   ? 54.058  185.299 57.529  1.00   191.72 ? 2   DC  J C5    1 
ATOM   3426  C C6    . DC  B 2 2   ? 55.080  185.454 58.379  1.00   199.00 ? 2   DC  J C6    1 
ATOM   3427  P P     . DT  B 2 3   ? 58.067  186.354 63.598  1.00   216.86 ? 3   DT  J P     1 
ATOM   3428  O OP1   . DT  B 2 3   ? 56.632  186.665 63.433  1.00   189.44 ? 3   DT  J OP1   1 
ATOM   3429  O OP2   . DT  B 2 3   ? 59.050  187.444 63.782  1.00   208.79 ? 3   DT  J OP2   1 
ATOM   3430  O "O5'" . DT  B 2 3   ? 58.167  185.411 64.883  1.00   217.05 ? 3   DT  J "O5'" 1 
ATOM   3431  C "C5'" . DT  B 2 3   ? 57.302  185.630 65.993  1.00   199.73 ? 3   DT  J "C5'" 1 
ATOM   3432  C "C4'" . DT  B 2 3   ? 56.241  184.546 66.076  1.00   191.76 ? 3   DT  J "C4'" 1 
ATOM   3433  O "O4'" . DT  B 2 3   ? 55.240  184.764 65.068  1.00   203.74 ? 3   DT  J "O4'" 1 
ATOM   3434  C "C3'" . DT  B 2 3   ? 56.748  183.127 65.824  1.00   188.73 ? 3   DT  J "C3'" 1 
ATOM   3435  O "O3'" . DT  B 2 3   ? 57.042  182.434 67.068  1.00   186.11 ? 3   DT  J "O3'" 1 
ATOM   3436  C "C2'" . DT  B 2 3   ? 55.619  182.444 65.022  1.00   194.55 ? 3   DT  J "C2'" 1 
ATOM   3437  C "C1'" . DT  B 2 3   ? 54.571  183.549 64.856  1.00   204.34 ? 3   DT  J "C1'" 1 
ATOM   3438  N N1    . DT  B 2 3   ? 53.933  183.577 63.506  1.00   195.85 ? 3   DT  J N1    1 
ATOM   3439  C C2    . DT  B 2 3   ? 52.822  184.363 63.302  1.00   184.28 ? 3   DT  J C2    1 
ATOM   3440  O O2    . DT  B 2 3   ? 52.325  185.056 64.172  1.00   164.71 ? 3   DT  J O2    1 
ATOM   3441  N N3    . DT  B 2 3   ? 52.311  184.313 62.033  1.00   191.92 ? 3   DT  J N3    1 
ATOM   3442  C C4    . DT  B 2 3   ? 52.787  183.568 60.968  1.00   184.94 ? 3   DT  J C4    1 
ATOM   3443  O O4    . DT  B 2 3   ? 52.257  183.590 59.862  1.00   177.59 ? 3   DT  J O4    1 
ATOM   3444  C C5    . DT  B 2 3   ? 53.952  182.763 61.251  1.00   171.42 ? 3   DT  J C5    1 
ATOM   3445  C C7    . DT  B 2 3   ? 54.559  181.912 60.175  1.00   158.00 ? 3   DT  J C7    1 
ATOM   3446  C C6    . DT  B 2 3   ? 54.461  182.804 62.491  1.00   182.05 ? 3   DT  J C6    1 
ATOM   3447  P P     . DT  B 2 4   ? 56.149  182.615 68.400  1.00   194.86 ? 4   DT  J P     1 
ATOM   3448  O OP1   . DT  B 2 4   ? 56.417  183.933 69.018  1.00   186.72 ? 4   DT  J OP1   1 
ATOM   3449  O OP2   . DT  B 2 4   ? 56.385  181.401 69.210  1.00   192.88 ? 4   DT  J OP2   1 
ATOM   3450  O "O5'" . DT  B 2 4   ? 54.633  182.534 67.895  1.00   207.80 ? 4   DT  J "O5'" 1 
ATOM   3451  C "C5'" . DT  B 2 4   ? 53.572  182.902 68.767  1.00   199.99 ? 4   DT  J "C5'" 1 
ATOM   3452  C "C4'" . DT  B 2 4   ? 52.380  181.976 68.596  1.00   182.71 ? 4   DT  J "C4'" 1 
ATOM   3453  O "O4'" . DT  B 2 4   ? 51.936  181.996 67.218  1.00   181.82 ? 4   DT  J "O4'" 1 
ATOM   3454  C "C3'" . DT  B 2 4   ? 52.642  180.502 68.940  1.00   175.07 ? 4   DT  J "C3'" 1 
ATOM   3455  O "O3'" . DT  B 2 4   ? 51.746  180.076 69.964  1.00   188.54 ? 4   DT  J "O3'" 1 
ATOM   3456  C "C2'" . DT  B 2 4   ? 52.393  179.758 67.622  1.00   169.05 ? 4   DT  J "C2'" 1 
ATOM   3457  C "C1'" . DT  B 2 4   ? 51.476  180.715 66.882  1.00   183.76 ? 4   DT  J "C1'" 1 
ATOM   3458  N N1    . DT  B 2 4   ? 51.523  180.558 65.400  1.00   183.08 ? 4   DT  J N1    1 
ATOM   3459  C C2    . DT  B 2 4   ? 50.442  180.951 64.649  1.00   170.07 ? 4   DT  J C2    1 
ATOM   3460  O O2    . DT  B 2 4   ? 49.435  181.438 65.132  1.00   166.21 ? 4   DT  J O2    1 
ATOM   3461  N N3    . DT  B 2 4   ? 50.583  180.760 63.300  1.00   159.29 ? 4   DT  J N3    1 
ATOM   3462  C C4    . DT  B 2 4   ? 51.671  180.219 62.642  1.00   171.98 ? 4   DT  J C4    1 
ATOM   3463  O O4    . DT  B 2 4   ? 51.700  180.087 61.422  1.00   162.78 ? 4   DT  J O4    1 
ATOM   3464  C C5    . DT  B 2 4   ? 52.771  179.823 63.489  1.00   183.25 ? 4   DT  J C5    1 
ATOM   3465  C C7    . DT  B 2 4   ? 54.008  179.224 62.889  1.00   169.72 ? 4   DT  J C7    1 
ATOM   3466  C C6    . DT  B 2 4   ? 52.644  180.008 64.813  1.00   182.11 ? 4   DT  J C6    1 
ATOM   3467  P P     . DA  B 2 5   ? 51.745  178.550 70.472  1.00   178.60 ? 5   DA  J P     1 
ATOM   3468  O OP1   . DA  B 2 5   ? 51.415  178.569 71.914  1.00   168.72 ? 5   DA  J OP1   1 
ATOM   3469  O OP2   . DA  B 2 5   ? 52.995  177.897 70.022  1.00   125.32 ? 5   DA  J OP2   1 
ATOM   3470  O "O5'" . DA  B 2 5   ? 50.522  177.887 69.682  1.00   176.48 ? 5   DA  J "O5'" 1 
ATOM   3471  C "C5'" . DA  B 2 5   ? 49.200  178.391 69.866  1.00   170.29 ? 5   DA  J "C5'" 1 
ATOM   3472  C "C4'" . DA  B 2 5   ? 48.182  177.538 69.126  1.00   159.34 ? 5   DA  J "C4'" 1 
ATOM   3473  O "O4'" . DA  B 2 5   ? 48.365  177.698 67.695  1.00   156.12 ? 5   DA  J "O4'" 1 
ATOM   3474  C "C3'" . DA  B 2 5   ? 48.272  176.039 69.403  1.00   146.88 ? 5   DA  J "C3'" 1 
ATOM   3475  O "O3'" . DA  B 2 5   ? 46.969  175.474 69.474  1.00   141.99 ? 5   DA  J "O3'" 1 
ATOM   3476  C "C2'" . DA  B 2 5   ? 49.048  175.509 68.201  1.00   136.31 ? 5   DA  J "C2'" 1 
ATOM   3477  C "C1'" . DA  B 2 5   ? 48.578  176.440 67.092  1.00   143.43 ? 5   DA  J "C1'" 1 
ATOM   3478  N N9    . DA  B 2 5   ? 49.559  176.606 66.024  1.00   146.29 ? 5   DA  J N9    1 
ATOM   3479  C C8    . DA  B 2 5   ? 50.868  176.975 66.159  1.00   156.06 ? 5   DA  J C8    1 
ATOM   3480  N N7    . DA  B 2 5   ? 51.519  177.044 65.023  1.00   159.54 ? 5   DA  J N7    1 
ATOM   3481  C C5    . DA  B 2 5   ? 50.571  176.698 64.075  1.00   158.38 ? 5   DA  J C5    1 
ATOM   3482  C C6    . DA  B 2 5   ? 50.630  176.582 62.673  1.00   161.08 ? 5   DA  J C6    1 
ATOM   3483  N N6    . DA  B 2 5   ? 51.737  176.817 61.960  1.00   158.43 ? 5   DA  J N6    1 
ATOM   3484  N N1    . DA  B 2 5   ? 49.503  176.215 62.029  1.00   156.15 ? 5   DA  J N1    1 
ATOM   3485  C C2    . DA  B 2 5   ? 48.398  175.980 62.746  1.00   137.38 ? 5   DA  J C2    1 
ATOM   3486  N N3    . DA  B 2 5   ? 48.220  176.058 64.063  1.00   128.90 ? 5   DA  J N3    1 
ATOM   3487  C C4    . DA  B 2 5   ? 49.356  176.425 64.675  1.00   145.53 ? 5   DA  J C4    1 
ATOM   3488  P P     . DC  B 2 6   ? 46.488  174.729 70.814  1.00   171.22 ? 6   DC  J P     1 
ATOM   3489  O OP1   . DC  B 2 6   ? 45.427  175.559 71.429  1.00   178.88 ? 6   DC  J OP1   1 
ATOM   3490  O OP2   . DC  B 2 6   ? 47.698  174.382 71.592  1.00   141.10 ? 6   DC  J OP2   1 
ATOM   3491  O "O5'" . DC  B 2 6   ? 45.836  173.366 70.291  1.00   156.30 ? 6   DC  J "O5'" 1 
ATOM   3492  C "C5'" . DC  B 2 6   ? 46.556  172.528 69.396  1.00   132.79 ? 6   DC  J "C5'" 1 
ATOM   3493  C "C4'" . DC  B 2 6   ? 45.783  172.337 68.103  1.00   128.79 ? 6   DC  J "C4'" 1 
ATOM   3494  O "O4'" . DC  B 2 6   ? 46.473  173.012 67.019  1.00   112.33 ? 6   DC  J "O4'" 1 
ATOM   3495  C "C3'" . DC  B 2 6   ? 45.613  170.883 67.660  1.00   119.70 ? 6   DC  J "C3'" 1 
ATOM   3496  O "O3'" . DC  B 2 6   ? 44.294  170.675 67.173  1.00   123.65 ? 6   DC  J "O3'" 1 
ATOM   3497  C "C2'" . DC  B 2 6   ? 46.650  170.734 66.551  1.00   112.91 ? 6   DC  J "C2'" 1 
ATOM   3498  C "C1'" . DC  B 2 6   ? 46.638  172.123 65.940  1.00   94.35  ? 6   DC  J "C1'" 1 
ATOM   3499  N N1    . DC  B 2 6   ? 47.897  172.471 65.234  1.00   114.46 ? 6   DC  J N1    1 
ATOM   3500  C C2    . DC  B 2 6   ? 47.955  172.375 63.841  1.00   138.02 ? 6   DC  J C2    1 
ATOM   3501  O O2    . DC  B 2 6   ? 46.952  172.001 63.220  1.00   116.37 ? 6   DC  J O2    1 
ATOM   3502  N N3    . DC  B 2 6   ? 49.113  172.696 63.209  1.00   160.65 ? 6   DC  J N3    1 
ATOM   3503  C C4    . DC  B 2 6   ? 50.172  173.095 63.916  1.00   152.05 ? 6   DC  J C4    1 
ATOM   3504  N N4    . DC  B 2 6   ? 51.292  173.400 63.249  1.00   128.85 ? 6   DC  J N4    1 
ATOM   3505  C C5    . DC  B 2 6   ? 50.130  173.198 65.338  1.00   142.86 ? 6   DC  J C5    1 
ATOM   3506  C C6    . DC  B 2 6   ? 48.984  172.878 65.948  1.00   123.81 ? 6   DC  J C6    1 
ATOM   3507  P P     . DA  B 2 7   ? 43.601  169.232 67.313  1.00   127.97 ? 7   DA  J P     1 
ATOM   3508  O OP1   . DA  B 2 7   ? 42.169  169.391 66.976  1.00   120.55 ? 7   DA  J OP1   1 
ATOM   3509  O OP2   . DA  B 2 7   ? 43.992  168.666 68.623  1.00   141.49 ? 7   DA  J OP2   1 
ATOM   3510  O "O5'" . DA  B 2 7   ? 44.304  168.357 66.174  1.00   127.86 ? 7   DA  J "O5'" 1 
ATOM   3511  C "C5'" . DA  B 2 7   ? 44.061  168.647 64.805  1.00   117.35 ? 7   DA  J "C5'" 1 
ATOM   3512  C "C4'" . DA  B 2 7   ? 44.889  167.747 63.907  1.00   112.24 ? 7   DA  J "C4'" 1 
ATOM   3513  O "O4'" . DA  B 2 7   ? 46.178  168.366 63.647  1.00   113.12 ? 7   DA  J "O4'" 1 
ATOM   3514  C "C3'" . DA  B 2 7   ? 45.191  166.359 64.479  1.00   110.75 ? 7   DA  J "C3'" 1 
ATOM   3515  O "O3'" . DA  B 2 7   ? 45.034  165.377 63.463  1.00   119.73 ? 7   DA  J "O3'" 1 
ATOM   3516  C "C2'" . DA  B 2 7   ? 46.648  166.478 64.923  1.00   125.75 ? 7   DA  J "C2'" 1 
ATOM   3517  C "C1'" . DA  B 2 7   ? 47.198  167.423 63.871  1.00   130.29 ? 7   DA  J "C1'" 1 
ATOM   3518  N N9    . DA  B 2 7   ? 48.404  168.128 64.293  1.00   140.91 ? 7   DA  J N9    1 
ATOM   3519  C C8    . DA  B 2 7   ? 48.856  168.301 65.572  1.00   132.61 ? 7   DA  J C8    1 
ATOM   3520  N N7    . DA  B 2 7   ? 49.977  168.978 65.651  1.00   140.49 ? 7   DA  J N7    1 
ATOM   3521  C C5    . DA  B 2 7   ? 50.283  169.268 64.331  1.00   153.39 ? 7   DA  J C5    1 
ATOM   3522  C C6    . DA  B 2 7   ? 51.353  169.966 63.734  1.00   162.38 ? 7   DA  J C6    1 
ATOM   3523  N N6    . DA  B 2 7   ? 52.352  170.520 64.430  1.00   155.61 ? 7   DA  J N6    1 
ATOM   3524  N N1    . DA  B 2 7   ? 51.356  170.072 62.389  1.00   156.66 ? 7   DA  J N1    1 
ATOM   3525  C C2    . DA  B 2 7   ? 50.354  169.517 61.696  1.00   140.70 ? 7   DA  J C2    1 
ATOM   3526  N N3    . DA  B 2 7   ? 49.300  168.839 62.144  1.00   130.95 ? 7   DA  J N3    1 
ATOM   3527  C C4    . DA  B 2 7   ? 49.324  168.750 63.482  1.00   141.14 ? 7   DA  J C4    1 
ATOM   3528  P P     . DT  B 2 8   ? 45.048  163.811 63.826  1.00   126.24 ? 8   DT  J P     1 
ATOM   3529  O OP1   . DT  B 2 8   ? 43.779  163.238 63.327  1.00   115.18 ? 8   DT  J OP1   1 
ATOM   3530  O OP2   . DT  B 2 8   ? 45.404  163.654 65.254  1.00   114.24 ? 8   DT  J OP2   1 
ATOM   3531  O "O5'" . DT  B 2 8   ? 46.250  163.232 62.943  1.00   134.75 ? 8   DT  J "O5'" 1 
ATOM   3532  C "C5'" . DT  B 2 8   ? 46.134  163.215 61.525  1.00   124.09 ? 8   DT  J "C5'" 1 
ATOM   3533  C "C4'" . DT  B 2 8   ? 47.474  163.480 60.859  1.00   142.28 ? 8   DT  J "C4'" 1 
ATOM   3534  O "O4'" . DT  B 2 8   ? 48.059  164.681 61.398  1.00   152.67 ? 8   DT  J "O4'" 1 
ATOM   3535  C "C3'" . DT  B 2 8   ? 48.531  162.420 61.087  1.00   127.80 ? 8   DT  J "C3'" 1 
ATOM   3536  O "O3'" . DT  B 2 8   ? 48.357  161.358 60.162  1.00   138.09 ? 8   DT  J "O3'" 1 
ATOM   3537  C "C2'" . DT  B 2 8   ? 49.826  163.191 60.819  1.00   121.95 ? 8   DT  J "C2'" 1 
ATOM   3538  C "C1'" . DT  B 2 8   ? 49.462  164.631 61.215  1.00   143.09 ? 8   DT  J "C1'" 1 
ATOM   3539  N N1    . DT  B 2 8   ? 50.127  165.093 62.468  1.00   145.79 ? 8   DT  J N1    1 
ATOM   3540  C C2    . DT  B 2 8   ? 51.067  166.094 62.397  1.00   148.74 ? 8   DT  J C2    1 
ATOM   3541  O O2    . DT  B 2 8   ? 51.391  166.633 61.353  1.00   140.09 ? 8   DT  J O2    1 
ATOM   3542  N N3    . DT  B 2 8   ? 51.620  166.446 63.599  1.00   149.76 ? 8   DT  J N3    1 
ATOM   3543  C C4    . DT  B 2 8   ? 51.335  165.907 64.840  1.00   149.43 ? 8   DT  J C4    1 
ATOM   3544  O O4    . DT  B 2 8   ? 51.888  166.292 65.865  1.00   158.96 ? 8   DT  J O4    1 
ATOM   3545  C C5    . DT  B 2 8   ? 50.340  164.860 64.844  1.00   130.97 ? 8   DT  J C5    1 
ATOM   3546  C C7    . DT  B 2 8   ? 49.946  164.198 66.131  1.00   108.94 ? 8   DT  J C7    1 
ATOM   3547  C C6    . DT  B 2 8   ? 49.792  164.507 63.671  1.00   136.28 ? 8   DT  J C6    1 
ATOM   3548  P P     . DG  B 2 9   ? 48.979  159.909 60.471  1.00   150.50 ? 9   DG  J P     1 
ATOM   3549  O OP1   . DG  B 2 9   ? 48.326  158.935 59.568  1.00   107.14 ? 9   DG  J OP1   1 
ATOM   3550  O OP2   . DG  B 2 9   ? 48.928  159.706 61.936  1.00   131.06 ? 9   DG  J OP2   1 
ATOM   3551  O "O5'" . DG  B 2 9   ? 50.516  160.055 60.048  1.00   167.43 ? 9   DG  J "O5'" 1 
ATOM   3552  C "C5'" . DG  B 2 9   ? 50.856  160.358 58.700  1.00   151.03 ? 9   DG  J "C5'" 1 
ATOM   3553  C "C4'" . DG  B 2 9   ? 52.348  160.606 58.557  1.00   149.28 ? 9   DG  J "C4'" 1 
ATOM   3554  O "O4'" . DG  B 2 9   ? 52.691  161.887 59.152  1.00   152.69 ? 9   DG  J "O4'" 1 
ATOM   3555  C "C3'" . DG  B 2 9   ? 53.247  159.567 59.233  1.00   155.20 ? 9   DG  J "C3'" 1 
ATOM   3556  O "O3'" . DG  B 2 9   ? 54.338  159.248 58.378  1.00   177.93 ? 9   DG  J "O3'" 1 
ATOM   3557  C "C2'" . DG  B 2 9   ? 53.718  160.287 60.495  1.00   150.03 ? 9   DG  J "C2'" 1 
ATOM   3558  C "C1'" . DG  B 2 9   ? 53.799  161.721 60.005  1.00   143.18 ? 9   DG  J "C1'" 1 
ATOM   3559  N N9    . DG  B 2 9   ? 53.716  162.708 61.077  1.00   154.32 ? 9   DG  J N9    1 
ATOM   3560  C C8    . DG  B 2 9   ? 52.987  162.609 62.238  1.00   145.77 ? 9   DG  J C8    1 
ATOM   3561  N N7    . DG  B 2 9   ? 53.107  163.649 63.017  1.00   150.59 ? 9   DG  J N7    1 
ATOM   3562  C C5    . DG  B 2 9   ? 53.971  164.492 62.329  1.00   166.38 ? 9   DG  J C5    1 
ATOM   3563  C C6    . DG  B 2 9   ? 54.470  165.770 62.679  1.00   163.70 ? 9   DG  J C6    1 
ATOM   3564  O O6    . DG  B 2 9   ? 54.238  166.432 63.701  1.00   138.00 ? 9   DG  J O6    1 
ATOM   3565  N N1    . DG  B 2 9   ? 55.318  166.278 61.698  1.00   175.69 ? 9   DG  J N1    1 
ATOM   3566  C C2    . DG  B 2 9   ? 55.644  165.633 60.528  1.00   172.55 ? 9   DG  J C2    1 
ATOM   3567  N N2    . DG  B 2 9   ? 56.480  166.282 59.705  1.00   171.96 ? 9   DG  J N2    1 
ATOM   3568  N N3    . DG  B 2 9   ? 55.184  164.435 60.188  1.00   163.40 ? 9   DG  J N3    1 
ATOM   3569  C C4    . DG  B 2 9   ? 54.355  163.927 61.133  1.00   164.91 ? 9   DG  J C4    1 
ATOM   3570  P P     . DC  B 2 10  ? 55.199  157.909 58.609  1.00   167.20 ? 10  DC  J P     1 
ATOM   3571  O OP1   . DC  B 2 10  ? 54.665  156.877 57.693  1.00   141.83 ? 10  DC  J OP1   1 
ATOM   3572  O OP2   . DC  B 2 10  ? 55.273  157.631 60.060  1.00   143.68 ? 10  DC  J OP2   1 
ATOM   3573  O "O5'" . DC  B 2 10  ? 56.664  158.321 58.121  1.00   157.50 ? 10  DC  J "O5'" 1 
ATOM   3574  C "C5'" . DC  B 2 10  ? 57.037  159.695 58.089  1.00   152.71 ? 10  DC  J "C5'" 1 
ATOM   3575  C "C4'" . DC  B 2 10  ? 58.307  159.932 58.883  1.00   141.51 ? 10  DC  J "C4'" 1 
ATOM   3576  O "O4'" . DC  B 2 10  ? 58.050  160.903 59.934  1.00   145.83 ? 10  DC  J "O4'" 1 
ATOM   3577  C "C3'" . DC  B 2 10  ? 58.867  158.699 59.589  1.00   166.48 ? 10  DC  J "C3'" 1 
ATOM   3578  O "O3'" . DC  B 2 10  ? 60.281  158.776 59.629  1.00   177.96 ? 10  DC  J "O3'" 1 
ATOM   3579  C "C2'" . DC  B 2 10  ? 58.271  158.827 60.984  1.00   161.60 ? 10  DC  J "C2'" 1 
ATOM   3580  C "C1'" . DC  B 2 10  ? 58.355  160.331 61.189  1.00   160.15 ? 10  DC  J "C1'" 1 
ATOM   3581  N N1    . DC  B 2 10  ? 57.396  160.856 62.201  1.00   162.29 ? 10  DC  J N1    1 
ATOM   3582  C C2    . DC  B 2 10  ? 57.475  162.195 62.596  1.00   164.36 ? 10  DC  J C2    1 
ATOM   3583  O O2    . DC  B 2 10  ? 58.340  162.922 62.092  1.00   148.10 ? 10  DC  J O2    1 
ATOM   3584  N N3    . DC  B 2 10  ? 56.597  162.660 63.519  1.00   174.29 ? 10  DC  J N3    1 
ATOM   3585  C C4    . DC  B 2 10  ? 55.678  161.843 64.038  1.00   167.16 ? 10  DC  J C4    1 
ATOM   3586  N N4    . DC  B 2 10  ? 54.834  162.347 64.945  1.00   153.76 ? 10  DC  J N4    1 
ATOM   3587  C C5    . DC  B 2 10  ? 55.584  160.474 63.649  1.00   148.79 ? 10  DC  J C5    1 
ATOM   3588  C C6    . DC  B 2 10  ? 56.455  160.027 62.738  1.00   144.28 ? 10  DC  J C6    1 
ATOM   3589  P P     . DA  B 2 11  ? 61.178  157.474 59.348  1.00   162.02 ? 11  DA  J P     1 
ATOM   3590  O OP1   . DA  B 2 11  ? 61.189  157.238 57.886  1.00   135.90 ? 11  DA  J OP1   1 
ATOM   3591  O OP2   . DA  B 2 11  ? 60.725  156.404 60.264  1.00   141.23 ? 11  DA  J OP2   1 
ATOM   3592  O "O5'" . DA  B 2 11  ? 62.639  157.926 59.810  1.00   172.10 ? 11  DA  J "O5'" 1 
ATOM   3593  C "C5'" . DA  B 2 11  ? 63.138  159.201 59.426  1.00   160.81 ? 11  DA  J "C5'" 1 
ATOM   3594  C "C4'" . DA  B 2 11  ? 63.840  159.878 60.589  1.00   165.64 ? 11  DA  J "C4'" 1 
ATOM   3595  O "O4'" . DA  B 2 11  ? 62.869  160.594 61.401  1.00   160.67 ? 11  DA  J "O4'" 1 
ATOM   3596  C "C3'" . DA  B 2 11  ? 64.575  158.929 61.543  1.00   185.16 ? 11  DA  J "C3'" 1 
ATOM   3597  O "O3'" . DA  B 2 11  ? 65.850  159.464 61.866  1.00   173.49 ? 11  DA  J "O3'" 1 
ATOM   3598  C "C2'" . DA  B 2 11  ? 63.659  158.891 62.767  1.00   177.25 ? 11  DA  J "C2'" 1 
ATOM   3599  C "C1'" . DA  B 2 11  ? 63.103  160.301 62.757  1.00   160.59 ? 11  DA  J "C1'" 1 
ATOM   3600  N N9    . DA  B 2 11  ? 61.851  160.440 63.496  1.00   161.86 ? 11  DA  J N9    1 
ATOM   3601  C C8    . DA  B 2 11  ? 60.915  159.470 63.723  1.00   160.79 ? 11  DA  J C8    1 
ATOM   3602  N N7    . DA  B 2 11  ? 59.887  159.881 64.427  1.00   168.95 ? 11  DA  J N7    1 
ATOM   3603  C C5    . DA  B 2 11  ? 60.169  161.213 64.681  1.00   176.34 ? 11  DA  J C5    1 
ATOM   3604  C C6    . DA  B 2 11  ? 59.470  162.215 65.383  1.00   168.57 ? 11  DA  J C6    1 
ATOM   3605  N N6    . DA  B 2 11  ? 58.292  162.010 65.980  1.00   157.71 ? 11  DA  J N6    1 
ATOM   3606  N N1    . DA  B 2 11  ? 60.032  163.441 65.448  1.00   170.70 ? 11  DA  J N1    1 
ATOM   3607  C C2    . DA  B 2 11  ? 61.212  163.642 64.849  1.00   158.28 ? 11  DA  J C2    1 
ATOM   3608  N N3    . DA  B 2 11  ? 61.962  162.781 64.163  1.00   152.88 ? 11  DA  J N3    1 
ATOM   3609  C C4    . DA  B 2 11  ? 61.378  161.573 64.116  1.00   171.81 ? 11  DA  J C4    1 
ATOM   3610  P P     . DC  B 2 12  ? 66.993  158.531 62.505  1.00   134.83 ? 12  DC  J P     1 
ATOM   3611  O OP1   . DC  B 2 12  ? 67.921  158.166 61.413  1.00   144.19 ? 12  DC  J OP1   1 
ATOM   3612  O OP2   . DC  B 2 12  ? 66.354  157.464 63.307  1.00   113.88 ? 12  DC  J OP2   1 
ATOM   3613  O "O5'" . DC  B 2 12  ? 67.746  159.512 63.517  1.00   158.50 ? 12  DC  J "O5'" 1 
ATOM   3614  C "C5'" . DC  B 2 12  ? 67.038  160.598 64.105  1.00   147.96 ? 12  DC  J "C5'" 1 
ATOM   3615  C "C4'" . DC  B 2 12  ? 67.080  160.513 65.619  1.00   150.18 ? 12  DC  J "C4'" 1 
ATOM   3616  O "O4'" . DC  B 2 12  ? 65.724  160.527 66.143  1.00   161.99 ? 12  DC  J "O4'" 1 
ATOM   3617  C "C3'" . DC  B 2 12  ? 67.734  159.248 66.176  1.00   180.82 ? 12  DC  J "C3'" 1 
ATOM   3618  O "O3'" . DC  B 2 12  ? 68.494  159.571 67.331  1.00   197.54 ? 12  DC  J "O3'" 1 
ATOM   3619  C "C2'" . DC  B 2 12  ? 66.535  158.374 66.527  1.00   172.55 ? 12  DC  J "C2'" 1 
ATOM   3620  C "C1'" . DC  B 2 12  ? 65.541  159.421 66.999  1.00   168.41 ? 12  DC  J "C1'" 1 
ATOM   3621  N N1    . DC  B 2 12  ? 64.116  158.977 66.920  1.00   179.66 ? 12  DC  J N1    1 
ATOM   3622  C C2    . DC  B 2 12  ? 63.085  159.894 67.163  1.00   182.51 ? 12  DC  J C2    1 
ATOM   3623  O O2    . DC  B 2 12  ? 63.369  161.067 67.436  1.00   172.81 ? 12  DC  J O2    1 
ATOM   3624  N N3    . DC  B 2 12  ? 61.798  159.468 67.091  1.00   178.97 ? 12  DC  J N3    1 
ATOM   3625  C C4    . DC  B 2 12  ? 61.530  158.195 66.794  1.00   165.10 ? 12  DC  J C4    1 
ATOM   3626  N N4    . DC  B 2 12  ? 60.247  157.824 66.734  1.00   137.10 ? 12  DC  J N4    1 
ATOM   3627  C C5    . DC  B 2 12  ? 62.566  157.247 66.547  1.00   165.85 ? 12  DC  J C5    1 
ATOM   3628  C C6    . DC  B 2 12  ? 63.830  157.676 66.621  1.00   169.40 ? 12  DC  J C6    1 
ATOM   3629  P P     . DA  B 2 13  ? 69.853  158.781 67.662  1.00   186.53 ? 13  DA  J P     1 
ATOM   3630  O OP1   . DA  B 2 13  ? 70.833  159.110 66.603  1.00   172.15 ? 13  DA  J OP1   1 
ATOM   3631  O OP2   . DA  B 2 13  ? 69.501  157.368 67.929  1.00   177.34 ? 13  DA  J OP2   1 
ATOM   3632  O "O5'" . DA  B 2 13  ? 70.341  159.431 69.038  1.00   147.28 ? 13  DA  J "O5'" 1 
ATOM   3633  C "C5'" . DA  B 2 13  ? 70.477  160.842 69.146  1.00   151.66 ? 13  DA  J "C5'" 1 
ATOM   3634  C "C4'" . DA  B 2 13  ? 69.426  161.417 70.079  1.00   157.72 ? 13  DA  J "C4'" 1 
ATOM   3635  O "O4'" . DA  B 2 13  ? 68.107  161.222 69.511  1.00   188.30 ? 13  DA  J "O4'" 1 
ATOM   3636  C "C3'" . DA  B 2 13  ? 69.356  160.763 71.444  1.00   169.00 ? 13  DA  J "C3'" 1 
ATOM   3637  O "O3'" . DA  B 2 13  ? 70.312  161.350 72.318  1.00   190.76 ? 13  DA  J "O3'" 1 
ATOM   3638  C "C2'" . DA  B 2 13  ? 67.930  161.091 71.868  1.00   181.90 ? 13  DA  J "C2'" 1 
ATOM   3639  C "C1'" . DA  B 2 13  ? 67.172  160.964 70.547  1.00   185.37 ? 13  DA  J "C1'" 1 
ATOM   3640  N N9    . DA  B 2 13  ? 66.587  159.641 70.334  1.00   186.06 ? 13  DA  J N9    1 
ATOM   3641  C C8    . DA  B 2 13  ? 67.234  158.508 69.925  1.00   182.89 ? 13  DA  J C8    1 
ATOM   3642  N N7    . DA  B 2 13  ? 66.451  157.460 69.817  1.00   179.15 ? 13  DA  J N7    1 
ATOM   3643  C C5    . DA  B 2 13  ? 65.203  157.938 70.182  1.00   183.11 ? 13  DA  J C5    1 
ATOM   3644  C C6    . DA  B 2 13  ? 63.940  157.319 70.277  1.00   174.28 ? 13  DA  J C6    1 
ATOM   3645  N N6    . DA  B 2 13  ? 63.728  156.029 69.996  1.00   159.43 ? 13  DA  J N6    1 
ATOM   3646  N N1    . DA  B 2 13  ? 62.899  158.082 70.672  1.00   169.42 ? 13  DA  J N1    1 
ATOM   3647  C C2    . DA  B 2 13  ? 63.114  159.373 70.952  1.00   179.00 ? 13  DA  J C2    1 
ATOM   3648  N N3    . DA  B 2 13  ? 64.253  160.064 70.900  1.00   174.04 ? 13  DA  J N3    1 
ATOM   3649  C C4    . DA  B 2 13  ? 65.269  159.281 70.504  1.00   180.87 ? 13  DA  J C4    1 
ATOM   3650  P P     . DG  B 2 14  ? 71.092  160.439 73.389  1.00   195.32 ? 14  DG  J P     1 
ATOM   3651  O OP1   . DG  B 2 14  ? 72.099  161.291 74.059  1.00   171.29 ? 14  DG  J OP1   1 
ATOM   3652  O OP2   . DG  B 2 14  ? 71.516  159.200 72.701  1.00   175.91 ? 14  DG  J OP2   1 
ATOM   3653  O "O5'" . DG  B 2 14  ? 69.962  160.046 74.450  1.00   186.50 ? 14  DG  J "O5'" 1 
ATOM   3654  C "C5'" . DG  B 2 14  ? 69.250  161.066 75.140  1.00   182.67 ? 14  DG  J "C5'" 1 
ATOM   3655  C "C4'" . DG  B 2 14  ? 67.987  160.507 75.768  1.00   194.50 ? 14  DG  J "C4'" 1 
ATOM   3656  O "O4'" . DG  B 2 14  ? 67.026  160.180 74.734  1.00   202.39 ? 14  DG  J "O4'" 1 
ATOM   3657  C "C3'" . DG  B 2 14  ? 68.180  159.216 76.537  1.00   184.58 ? 14  DG  J "C3'" 1 
ATOM   3658  O "O3'" . DG  B 2 14  ? 68.596  159.504 77.858  1.00   187.90 ? 14  DG  J "O3'" 1 
ATOM   3659  C "C2'" . DG  B 2 14  ? 66.776  158.624 76.501  1.00   180.91 ? 14  DG  J "C2'" 1 
ATOM   3660  C "C1'" . DG  B 2 14  ? 66.321  159.002 75.091  1.00   179.59 ? 14  DG  J "C1'" 1 
ATOM   3661  N N9    . DG  B 2 14  ? 66.600  157.971 74.094  1.00   169.89 ? 14  DG  J N9    1 
ATOM   3662  C C8    . DG  B 2 14  ? 67.753  157.819 73.360  1.00   172.31 ? 14  DG  J C8    1 
ATOM   3663  N N7    . DG  B 2 14  ? 67.719  156.801 72.545  1.00   174.43 ? 14  DG  J N7    1 
ATOM   3664  C C5    . DG  B 2 14  ? 66.464  156.241 72.751  1.00   169.83 ? 14  DG  J C5    1 
ATOM   3665  C C6    . DG  B 2 14  ? 65.858  155.113 72.147  1.00   147.19 ? 14  DG  J C6    1 
ATOM   3666  O O6    . DG  B 2 14  ? 66.327  154.360 71.282  1.00   127.18 ? 14  DG  J O6    1 
ATOM   3667  N N1    . DG  B 2 14  ? 64.577  154.890 72.643  1.00   145.55 ? 14  DG  J N1    1 
ATOM   3668  C C2    . DG  B 2 14  ? 63.958  155.660 73.599  1.00   160.97 ? 14  DG  J C2    1 
ATOM   3669  N N2    . DG  B 2 14  ? 62.720  155.287 73.953  1.00   151.28 ? 14  DG  J N2    1 
ATOM   3670  N N3    . DG  B 2 14  ? 64.515  156.719 74.174  1.00   172.80 ? 14  DG  J N3    1 
ATOM   3671  C C4    . DG  B 2 14  ? 65.764  156.950 73.702  1.00   171.35 ? 14  DG  J C4    1 
ATOM   3672  P P     . DG  B 2 15  ? 70.082  159.126 78.334  1.00   204.27 ? 15  DG  J P     1 
ATOM   3673  O OP1   . DG  B 2 15  ? 70.833  160.390 78.501  1.00   173.95 ? 15  DG  J OP1   1 
ATOM   3674  O OP2   . DG  B 2 15  ? 70.596  158.081 77.420  1.00   190.76 ? 15  DG  J OP2   1 
ATOM   3675  O "O5'" . DG  B 2 15  ? 69.862  158.461 79.771  1.00   195.89 ? 15  DG  J "O5'" 1 
ATOM   3676  C "C5'" . DG  B 2 15  ? 69.044  159.114 80.729  1.00   178.38 ? 15  DG  J "C5'" 1 
ATOM   3677  C "C4'" . DG  B 2 15  ? 67.720  158.389 80.896  1.00   168.26 ? 15  DG  J "C4'" 1 
ATOM   3678  O "O4'" . DG  B 2 15  ? 67.275  157.874 79.610  1.00   163.65 ? 15  DG  J "O4'" 1 
ATOM   3679  C "C3'" . DG  B 2 15  ? 67.756  157.188 81.838  1.00   168.97 ? 15  DG  J "C3'" 1 
ATOM   3680  O "O3'" . DG  B 2 15  ? 66.550  157.132 82.575  1.00   172.83 ? 15  DG  J "O3'" 1 
ATOM   3681  C "C2'" . DG  B 2 15  ? 67.876  156.009 80.878  1.00   158.41 ? 15  DG  J "C2'" 1 
ATOM   3682  C "C1'" . DG  B 2 15  ? 67.022  156.491 79.717  1.00   166.59 ? 15  DG  J "C1'" 1 
ATOM   3683  N N9    . DG  B 2 15  ? 67.352  155.853 78.444  1.00   173.37 ? 15  DG  J N9    1 
ATOM   3684  C C8    . DG  B 2 15  ? 68.587  155.791 77.845  1.00   172.51 ? 15  DG  J C8    1 
ATOM   3685  N N7    . DG  B 2 15  ? 68.581  155.154 76.707  1.00   168.53 ? 15  DG  J N7    1 
ATOM   3686  C C5    . DG  B 2 15  ? 67.258  154.766 76.539  1.00   163.59 ? 15  DG  J C5    1 
ATOM   3687  C C6    . DG  B 2 15  ? 66.646  154.043 75.487  1.00   158.43 ? 15  DG  J C6    1 
ATOM   3688  O O6    . DG  B 2 15  ? 67.170  153.584 74.463  1.00   154.79 ? 15  DG  J O6    1 
ATOM   3689  N N1    . DG  B 2 15  ? 65.283  153.864 75.710  1.00   148.45 ? 15  DG  J N1    1 
ATOM   3690  C C2    . DG  B 2 15  ? 64.598  154.328 76.808  1.00   159.49 ? 15  DG  J C2    1 
ATOM   3691  N N2    . DG  B 2 15  ? 63.285  154.057 76.846  1.00   163.09 ? 15  DG  J N2    1 
ATOM   3692  N N3    . DG  B 2 15  ? 65.159  155.007 77.801  1.00   158.82 ? 15  DG  J N3    1 
ATOM   3693  C C4    . DG  B 2 15  ? 66.487  155.189 77.600  1.00   162.27 ? 15  DG  J C4    1 
ATOM   3694  P P     . DA  B 2 16  ? 66.520  156.474 84.039  1.00   188.05 ? 16  DA  J P     1 
ATOM   3695  O OP1   . DA  B 2 16  ? 67.033  157.479 84.996  1.00   176.78 ? 16  DA  J OP1   1 
ATOM   3696  O OP2   . DA  B 2 16  ? 67.165  155.145 83.956  1.00   173.33 ? 16  DA  J OP2   1 
ATOM   3697  O "O5'" . DA  B 2 16  ? 64.959  156.255 84.309  1.00   196.85 ? 16  DA  J "O5'" 1 
ATOM   3698  C "C5'" . DA  B 2 16  ? 64.058  156.169 83.207  1.00   175.74 ? 16  DA  J "C5'" 1 
ATOM   3699  C "C4'" . DA  B 2 16  ? 63.625  154.734 82.974  1.00   165.79 ? 16  DA  J "C4'" 1 
ATOM   3700  O "O4'" . DA  B 2 16  ? 63.976  154.329 81.627  1.00   156.39 ? 16  DA  J "O4'" 1 
ATOM   3701  C "C3'" . DA  B 2 16  ? 64.271  153.703 83.910  1.00   167.59 ? 16  DA  J "C3'" 1 
ATOM   3702  O "O3'" . DA  B 2 16  ? 63.264  153.042 84.675  1.00   161.08 ? 16  DA  J "O3'" 1 
ATOM   3703  C "C2'" . DA  B 2 16  ? 65.006  152.743 82.964  1.00   144.10 ? 16  DA  J "C2'" 1 
ATOM   3704  C "C1'" . DA  B 2 16  ? 64.290  152.964 81.646  1.00   146.44 ? 16  DA  J "C1'" 1 
ATOM   3705  N N9    . DA  B 2 16  ? 65.119  152.644 80.489  1.00   151.41 ? 16  DA  J N9    1 
ATOM   3706  C C8    . DA  B 2 16  ? 66.439  152.950 80.314  1.00   144.83 ? 16  DA  J C8    1 
ATOM   3707  N N7    . DA  B 2 16  ? 66.937  152.522 79.178  1.00   148.37 ? 16  DA  J N7    1 
ATOM   3708  C C5    . DA  B 2 16  ? 65.871  151.885 78.567  1.00   152.92 ? 16  DA  J C5    1 
ATOM   3709  C C6    . DA  B 2 16  ? 65.745  151.217 77.333  1.00   141.06 ? 16  DA  J C6    1 
ATOM   3710  N N6    . DA  B 2 16  ? 66.750  151.081 76.463  1.00   123.02 ? 16  DA  J N6    1 
ATOM   3711  N N1    . DA  B 2 16  ? 64.540  150.692 77.026  1.00   151.02 ? 16  DA  J N1    1 
ATOM   3712  C C2    . DA  B 2 16  ? 63.534  150.832 77.898  1.00   150.31 ? 16  DA  J C2    1 
ATOM   3713  N N3    . DA  B 2 16  ? 63.532  151.435 79.087  1.00   154.48 ? 16  DA  J N3    1 
ATOM   3714  C C4    . DA  B 2 16  ? 64.742  151.946 79.364  1.00   159.95 ? 16  DA  J C4    1 
ATOM   3715  P P     . DT  B 2 17  ? 63.515  151.580 85.298  1.00   190.46 ? 17  DT  J P     1 
ATOM   3716  O OP1   . DT  B 2 17  ? 62.514  151.419 86.376  1.00   167.03 ? 17  DT  J OP1   1 
ATOM   3717  O OP2   . DT  B 2 17  ? 64.947  151.395 85.626  1.00   182.59 ? 17  DT  J OP2   1 
ATOM   3718  O "O5'" . DT  B 2 17  ? 63.100  150.596 84.108  1.00   165.24 ? 17  DT  J "O5'" 1 
ATOM   3719  C "C5'" . DT  B 2 17  ? 61.793  150.691 83.579  1.00   147.80 ? 17  DT  J "C5'" 1 
ATOM   3720  C "C4'" . DT  B 2 17  ? 61.452  149.535 82.655  1.00   143.34 ? 17  DT  J "C4'" 1 
ATOM   3721  O "O4'" . DT  B 2 17  ? 62.338  149.547 81.496  1.00   137.70 ? 17  DT  J "O4'" 1 
ATOM   3722  C "C3'" . DT  B 2 17  ? 61.618  148.151 83.272  1.00   145.67 ? 17  DT  J "C3'" 1 
ATOM   3723  O "O3'" . DT  B 2 17  ? 60.652  147.269 82.737  1.00   145.71 ? 17  DT  J "O3'" 1 
ATOM   3724  C "C2'" . DT  B 2 17  ? 63.031  147.760 82.859  1.00   140.56 ? 17  DT  J "C2'" 1 
ATOM   3725  C "C1'" . DT  B 2 17  ? 63.102  148.352 81.463  1.00   140.78 ? 17  DT  J "C1'" 1 
ATOM   3726  N N1    . DT  B 2 17  ? 64.493  148.664 81.016  1.00   144.72 ? 17  DT  J N1    1 
ATOM   3727  C C2    . DT  B 2 17  ? 64.855  148.406 79.713  1.00   140.90 ? 17  DT  J C2    1 
ATOM   3728  O O2    . DT  B 2 17  ? 64.095  147.928 78.891  1.00   141.59 ? 17  DT  J O2    1 
ATOM   3729  N N3    . DT  B 2 17  ? 66.152  148.722 79.405  1.00   124.40 ? 17  DT  J N3    1 
ATOM   3730  C C4    . DT  B 2 17  ? 67.103  149.263 80.250  1.00   138.61 ? 17  DT  J C4    1 
ATOM   3731  O O4    . DT  B 2 17  ? 68.245  149.515 79.878  1.00   127.36 ? 17  DT  J O4    1 
ATOM   3732  C C5    . DT  B 2 17  ? 66.658  149.511 81.602  1.00   151.87 ? 17  DT  J C5    1 
ATOM   3733  C C7    . DT  B 2 17  ? 67.602  150.096 82.611  1.00   145.90 ? 17  DT  J C7    1 
ATOM   3734  C C6    . DT  B 2 17  ? 65.390  149.202 81.916  1.00   142.53 ? 17  DT  J C6    1 
ATOM   3735  P P     . DG  B 2 18  ? 60.263  145.947 83.557  1.00   170.94 ? 18  DG  J P     1 
ATOM   3736  O OP1   . DG  B 2 18  ? 58.810  146.002 83.833  1.00   177.70 ? 18  DG  J OP1   1 
ATOM   3737  O OP2   . DG  B 2 18  ? 61.217  145.811 84.680  1.00   130.77 ? 18  DG  J OP2   1 
ATOM   3738  O "O5'" . DG  B 2 18  ? 60.552  144.762 82.525  1.00   149.15 ? 18  DG  J "O5'" 1 
ATOM   3739  C "C5'" . DG  B 2 18  ? 59.940  144.811 81.234  1.00   150.84 ? 18  DG  J "C5'" 1 
ATOM   3740  C "C4'" . DG  B 2 18  ? 60.665  143.961 80.203  1.00   125.90 ? 18  DG  J "C4'" 1 
ATOM   3741  O "O4'" . DG  B 2 18  ? 61.972  144.514 79.886  1.00   114.08 ? 18  DG  J "O4'" 1 
ATOM   3742  C "C3'" . DG  B 2 18  ? 60.910  142.519 80.633  1.00   128.16 ? 18  DG  J "C3'" 1 
ATOM   3743  O "O3'" . DG  B 2 18  ? 60.874  141.686 79.496  1.00   110.41 ? 18  DG  J "O3'" 1 
ATOM   3744  C "C2'" . DG  B 2 18  ? 62.335  142.599 81.185  1.00   142.83 ? 18  DG  J "C2'" 1 
ATOM   3745  C "C1'" . DG  B 2 18  ? 62.951  143.534 80.158  1.00   140.97 ? 18  DG  J "C1'" 1 
ATOM   3746  N N9    . DG  B 2 18  ? 64.205  144.178 80.543  1.00   150.42 ? 18  DG  J N9    1 
ATOM   3747  C C8    . DG  B 2 18  ? 64.592  144.582 81.797  1.00   151.87 ? 18  DG  J C8    1 
ATOM   3748  N N7    . DG  B 2 18  ? 65.788  145.107 81.826  1.00   153.44 ? 18  DG  J N7    1 
ATOM   3749  C C5    . DG  B 2 18  ? 66.234  145.012 80.512  1.00   149.64 ? 18  DG  J C5    1 
ATOM   3750  C C6    . DG  B 2 18  ? 67.464  145.408 79.932  1.00   146.85 ? 18  DG  J C6    1 
ATOM   3751  O O6    . DG  B 2 18  ? 68.437  145.941 80.483  1.00   142.47 ? 18  DG  J O6    1 
ATOM   3752  N N1    . DG  B 2 18  ? 67.504  145.130 78.567  1.00   149.43 ? 18  DG  J N1    1 
ATOM   3753  C C2    . DG  B 2 18  ? 66.485  144.543 77.854  1.00   144.70 ? 18  DG  J C2    1 
ATOM   3754  N N2    . DG  B 2 18  ? 66.708  144.350 76.546  1.00   133.19 ? 18  DG  J N2    1 
ATOM   3755  N N3    . DG  B 2 18  ? 65.330  144.168 78.386  1.00   144.06 ? 18  DG  J N3    1 
ATOM   3756  C C4    . DG  B 2 18  ? 65.275  144.433 79.715  1.00   147.85 ? 18  DG  J C4    1 
ATOM   3757  P P     . DT  B 2 19  ? 60.681  140.100 79.651  1.00   124.61 ? 19  DT  J P     1 
ATOM   3758  O OP1   . DT  B 2 19  ? 59.291  139.771 79.269  1.00   127.09 ? 19  DT  J OP1   1 
ATOM   3759  O OP2   . DT  B 2 19  ? 61.190  139.692 80.979  1.00   138.95 ? 19  DT  J OP2   1 
ATOM   3760  O "O5'" . DT  B 2 19  ? 61.663  139.508 78.542  1.00   136.40 ? 19  DT  J "O5'" 1 
ATOM   3761  C "C5'" . DT  B 2 19  ? 61.773  140.160 77.285  1.00   131.79 ? 19  DT  J "C5'" 1 
ATOM   3762  C "C4'" . DT  B 2 19  ? 63.156  139.960 76.703  1.00   137.67 ? 19  DT  J "C4'" 1 
ATOM   3763  O "O4'" . DT  B 2 19  ? 64.088  140.838 77.361  1.00   133.79 ? 19  DT  J "O4'" 1 
ATOM   3764  C "C3'" . DT  B 2 19  ? 63.723  138.553 76.883  1.00   148.84 ? 19  DT  J "C3'" 1 
ATOM   3765  O "O3'" . DT  B 2 19  ? 63.657  137.841 75.654  1.00   159.67 ? 19  DT  J "O3'" 1 
ATOM   3766  C "C2'" . DT  B 2 19  ? 65.178  138.770 77.342  1.00   150.32 ? 19  DT  J "C2'" 1 
ATOM   3767  C "C1'" . DT  B 2 19  ? 65.368  140.281 77.240  1.00   149.65 ? 19  DT  J "C1'" 1 
ATOM   3768  N N1    . DT  B 2 19  ? 66.236  140.841 78.313  1.00   142.72 ? 19  DT  J N1    1 
ATOM   3769  C C2    . DT  B 2 19  ? 67.452  141.389 77.977  1.00   151.89 ? 19  DT  J C2    1 
ATOM   3770  O O2    . DT  B 2 19  ? 67.864  141.452 76.832  1.00   149.88 ? 19  DT  J O2    1 
ATOM   3771  N N3    . DT  B 2 19  ? 68.175  141.870 79.036  1.00   157.85 ? 19  DT  J N3    1 
ATOM   3772  C C4    . DT  B 2 19  ? 67.813  141.855 80.371  1.00   158.43 ? 19  DT  J C4    1 
ATOM   3773  O O4    . DT  B 2 19  ? 68.534  142.313 81.252  1.00   162.82 ? 19  DT  J O4    1 
ATOM   3774  C C5    . DT  B 2 19  ? 66.527  141.261 80.655  1.00   143.48 ? 19  DT  J C5    1 
ATOM   3775  C C7    . DT  B 2 19  ? 66.026  141.188 82.067  1.00   145.68 ? 19  DT  J C7    1 
ATOM   3776  C C6    . DT  B 2 19  ? 65.810  140.788 79.625  1.00   132.16 ? 19  DT  J C6    1 
ATOM   3777  P P     . DA  B 2 20  ? 63.971  136.265 75.615  1.00   151.77 ? 20  DA  J P     1 
ATOM   3778  O OP1   . DA  B 2 20  ? 63.338  135.709 74.398  1.00   105.87 ? 20  DA  J OP1   1 
ATOM   3779  O OP2   . DA  B 2 20  ? 63.630  135.708 76.942  1.00   130.07 ? 20  DA  J OP2   1 
ATOM   3780  O "O5'" . DA  B 2 20  ? 65.561  136.201 75.447  1.00   176.21 ? 20  DA  J "O5'" 1 
ATOM   3781  C "C5'" . DA  B 2 20  ? 66.198  136.980 74.440  1.00   164.72 ? 20  DA  J "C5'" 1 
ATOM   3782  C "C4'" . DA  B 2 20  ? 67.692  137.074 74.690  1.00   145.31 ? 20  DA  J "C4'" 1 
ATOM   3783  O "O4'" . DA  B 2 20  ? 67.938  137.814 75.915  1.00   145.68 ? 20  DA  J "O4'" 1 
ATOM   3784  C "C3'" . DA  B 2 20  ? 68.406  135.729 74.849  1.00   158.19 ? 20  DA  J "C3'" 1 
ATOM   3785  O "O3'" . DA  B 2 20  ? 69.557  135.694 74.018  1.00   158.87 ? 20  DA  J "O3'" 1 
ATOM   3786  C "C2'" . DA  B 2 20  ? 68.781  135.687 76.332  1.00   157.05 ? 20  DA  J "C2'" 1 
ATOM   3787  C "C1'" . DA  B 2 20  ? 68.942  137.162 76.652  1.00   156.24 ? 20  DA  J "C1'" 1 
ATOM   3788  N N9    . DA  B 2 20  ? 68.760  137.472 78.069  1.00   159.38 ? 20  DA  J N9    1 
ATOM   3789  C C8    . DA  B 2 20  ? 67.740  137.055 78.879  1.00   146.01 ? 20  DA  J C8    1 
ATOM   3790  N N7    . DA  B 2 20  ? 67.836  137.486 80.115  1.00   150.77 ? 20  DA  J N7    1 
ATOM   3791  C C5    . DA  B 2 20  ? 69.000  138.237 80.116  1.00   167.75 ? 20  DA  J C5    1 
ATOM   3792  C C6    . DA  B 2 20  ? 69.660  138.964 81.128  1.00   167.97 ? 20  DA  J C6    1 
ATOM   3793  N N6    . DA  B 2 20  ? 69.212  139.051 82.384  1.00   169.18 ? 20  DA  J N6    1 
ATOM   3794  N N1    . DA  B 2 20  ? 70.802  139.601 80.796  1.00   156.79 ? 20  DA  J N1    1 
ATOM   3795  C C2    . DA  B 2 20  ? 71.248  139.511 79.537  1.00   158.09 ? 20  DA  J C2    1 
ATOM   3796  N N3    . DA  B 2 20  ? 70.716  138.860 78.503  1.00   151.36 ? 20  DA  J N3    1 
ATOM   3797  C C4    . DA  B 2 20  ? 69.583  138.238 78.863  1.00   161.56 ? 20  DA  J C4    1 
ATOM   3798  P P     . DT  B 2 21  ? 70.342  134.313 73.774  1.00   167.24 ? 21  DT  J P     1 
ATOM   3799  O OP1   . DT  B 2 21  ? 70.527  134.163 72.314  1.00   154.70 ? 21  DT  J OP1   1 
ATOM   3800  O OP2   . DT  B 2 21  ? 69.658  133.246 74.539  1.00   162.38 ? 21  DT  J OP2   1 
ATOM   3801  O "O5'" . DT  B 2 21  ? 71.770  134.572 74.443  1.00   147.35 ? 21  DT  J "O5'" 1 
ATOM   3802  C "C5'" . DT  B 2 21  ? 72.614  135.587 73.921  1.00   142.35 ? 21  DT  J "C5'" 1 
ATOM   3803  C "C4'" . DT  B 2 21  ? 73.616  136.052 74.961  1.00   171.19 ? 21  DT  J "C4'" 1 
ATOM   3804  O "O4'" . DT  B 2 21  ? 72.922  136.623 76.086  1.00   172.72 ? 21  DT  J "O4'" 1 
ATOM   3805  C "C3'" . DT  B 2 21  ? 74.465  134.959 75.575  1.00   172.76 ? 21  DT  J "C3'" 1 
ATOM   3806  O "O3'" . DT  B 2 21  ? 75.569  134.667 74.728  1.00   181.62 ? 21  DT  J "O3'" 1 
ATOM   3807  C "C2'" . DT  B 2 21  ? 74.920  135.605 76.886  1.00   167.56 ? 21  DT  J "C2'" 1 
ATOM   3808  C "C1'" . DT  B 2 21  ? 73.770  136.568 77.218  1.00   161.09 ? 21  DT  J "C1'" 1 
ATOM   3809  N N1    . DT  B 2 21  ? 72.972  136.152 78.403  1.00   155.33 ? 21  DT  J N1    1 
ATOM   3810  C C2    . DT  B 2 21  ? 73.216  136.750 79.615  1.00   154.17 ? 21  DT  J C2    1 
ATOM   3811  O O2    . DT  B 2 21  ? 74.055  137.618 79.772  1.00   151.89 ? 21  DT  J O2    1 
ATOM   3812  N N3    . DT  B 2 21  ? 72.435  136.298 80.645  1.00   152.63 ? 21  DT  J N3    1 
ATOM   3813  C C4    . DT  B 2 21  ? 71.456  135.324 80.585  1.00   157.82 ? 21  DT  J C4    1 
ATOM   3814  O O4    . DT  B 2 21  ? 70.806  134.985 81.568  1.00   161.90 ? 21  DT  J O4    1 
ATOM   3815  C C5    . DT  B 2 21  ? 71.252  134.733 79.282  1.00   154.17 ? 21  DT  J C5    1 
ATOM   3816  C C7    . DT  B 2 21  ? 70.217  133.664 79.093  1.00   123.97 ? 21  DT  J C7    1 
ATOM   3817  C C6    . DT  B 2 21  ? 72.013  135.169 78.266  1.00   155.91 ? 21  DT  J C6    1 
ATOM   3818  P P     . DA  B 2 22  ? 76.338  133.262 74.858  1.00   162.32 ? 22  DA  J P     1 
ATOM   3819  O OP1   . DA  B 2 22  ? 77.181  133.098 73.653  1.00   179.67 ? 22  DA  J OP1   1 
ATOM   3820  O OP2   . DA  B 2 22  ? 75.334  132.230 75.201  1.00   125.85 ? 22  DA  J OP2   1 
ATOM   3821  O "O5'" . DA  B 2 22  ? 77.289  133.462 76.129  1.00   151.52 ? 22  DA  J "O5'" 1 
ATOM   3822  C "C5'" . DA  B 2 22  ? 78.204  134.550 76.166  1.00   141.06 ? 22  DA  J "C5'" 1 
ATOM   3823  C "C4'" . DA  B 2 22  ? 78.922  134.603 77.502  1.00   163.33 ? 22  DA  J "C4'" 1 
ATOM   3824  O "O4'" . DA  B 2 22  ? 77.983  134.968 78.549  1.00   149.44 ? 22  DA  J "O4'" 1 
ATOM   3825  C "C3'" . DA  B 2 22  ? 79.563  133.283 77.942  1.00   181.72 ? 22  DA  J "C3'" 1 
ATOM   3826  O "O3'" . DA  B 2 22  ? 80.897  133.514 78.371  1.00   186.36 ? 22  DA  J "O3'" 1 
ATOM   3827  C "C2'" . DA  B 2 22  ? 78.674  132.816 79.096  1.00   162.50 ? 22  DA  J "C2'" 1 
ATOM   3828  C "C1'" . DA  B 2 22  ? 78.200  134.141 79.666  1.00   167.47 ? 22  DA  J "C1'" 1 
ATOM   3829  N N9    . DA  B 2 22  ? 76.957  134.040 80.425  1.00   169.21 ? 22  DA  J N9    1 
ATOM   3830  C C8    . DA  B 2 22  ? 75.785  133.465 80.018  1.00   161.02 ? 22  DA  J C8    1 
ATOM   3831  N N7    . DA  B 2 22  ? 74.829  133.520 80.916  1.00   167.06 ? 22  DA  J N7    1 
ATOM   3832  C C5    . DA  B 2 22  ? 75.414  134.176 81.986  1.00   169.42 ? 22  DA  J C5    1 
ATOM   3833  C C6    . DA  B 2 22  ? 74.926  134.550 83.255  1.00   163.76 ? 22  DA  J C6    1 
ATOM   3834  N N6    . DA  B 2 22  ? 73.678  134.299 83.666  1.00   148.96 ? 22  DA  J N6    1 
ATOM   3835  N N1    . DA  B 2 22  ? 75.772  135.193 84.087  1.00   160.86 ? 22  DA  J N1    1 
ATOM   3836  C C2    . DA  B 2 22  ? 77.020  135.443 83.671  1.00   147.86 ? 22  DA  J C2    1 
ATOM   3837  N N3    . DA  B 2 22  ? 77.591  135.142 82.506  1.00   157.45 ? 22  DA  J N3    1 
ATOM   3838  C C4    . DA  B 2 22  ? 76.726  134.504 81.701  1.00   170.09 ? 22  DA  J C4    1 
ATOM   3839  P P     . DT  B 2 23  ? 81.908  132.280 78.566  1.00   179.57 ? 23  DT  J P     1 
ATOM   3840  O OP1   . DT  B 2 23  ? 83.220  132.687 78.018  1.00   173.15 ? 23  DT  J OP1   1 
ATOM   3841  O OP2   . DT  B 2 23  ? 81.240  131.063 78.052  1.00   171.92 ? 23  DT  J OP2   1 
ATOM   3842  O "O5'" . DT  B 2 23  ? 82.030  132.139 80.154  1.00   183.33 ? 23  DT  J "O5'" 1 
ATOM   3843  C "C5'" . DT  B 2 23  ? 82.381  133.271 80.938  1.00   170.68 ? 23  DT  J "C5'" 1 
ATOM   3844  C "C4'" . DT  B 2 23  ? 82.167  132.995 82.415  1.00   167.17 ? 23  DT  J "C4'" 1 
ATOM   3845  O "O4'" . DT  B 2 23  ? 80.745  132.902 82.696  1.00   174.78 ? 23  DT  J "O4'" 1 
ATOM   3846  C "C3'" . DT  B 2 23  ? 82.793  131.697 82.930  1.00   165.73 ? 23  DT  J "C3'" 1 
ATOM   3847  O "O3'" . DT  B 2 23  ? 83.483  131.947 84.145  1.00   162.54 ? 23  DT  J "O3'" 1 
ATOM   3848  C "C2'" . DT  B 2 23  ? 81.589  130.777 83.142  1.00   162.32 ? 23  DT  J "C2'" 1 
ATOM   3849  C "C1'" . DT  B 2 23  ? 80.503  131.775 83.502  1.00   160.39 ? 23  DT  J "C1'" 1 
ATOM   3850  N N1    . DT  B 2 23  ? 79.125  131.280 83.222  1.00   160.74 ? 23  DT  J N1    1 
ATOM   3851  C C2    . DT  B 2 23  ? 78.079  131.731 83.993  1.00   163.67 ? 23  DT  J C2    1 
ATOM   3852  O O2    . DT  B 2 23  ? 78.216  132.527 84.905  1.00   161.91 ? 23  DT  J O2    1 
ATOM   3853  N N3    . DT  B 2 23  ? 76.856  131.215 83.655  1.00   162.71 ? 23  DT  J N3    1 
ATOM   3854  C C4    . DT  B 2 23  ? 76.580  130.311 82.646  1.00   166.41 ? 23  DT  J C4    1 
ATOM   3855  O O4    . DT  B 2 23  ? 75.444  129.906 82.420  1.00   156.35 ? 23  DT  J O4    1 
ATOM   3856  C C5    . DT  B 2 23  ? 77.722  129.877 81.876  1.00   173.26 ? 23  DT  J C5    1 
ATOM   3857  C C7    . DT  B 2 23  ? 77.549  128.896 80.754  1.00   157.13 ? 23  DT  J C7    1 
ATOM   3858  C C6    . DT  B 2 23  ? 78.925  130.376 82.198  1.00   165.31 ? 23  DT  J C6    1 
ATOM   3859  P P     . DA  B 2 24  ? 84.464  130.839 84.771  1.00   176.20 ? 24  DA  J P     1 
ATOM   3860  O OP1   . DA  B 2 24  ? 85.759  131.501 85.043  1.00   183.17 ? 24  DA  J OP1   1 
ATOM   3861  O OP2   . DA  B 2 24  ? 84.423  129.635 83.913  1.00   153.28 ? 24  DA  J OP2   1 
ATOM   3862  O "O5'" . DA  B 2 24  ? 83.774  130.474 86.165  1.00   158.40 ? 24  DA  J "O5'" 1 
ATOM   3863  C "C5'" . DA  B 2 24  ? 83.451  131.509 87.085  1.00   156.37 ? 24  DA  J "C5'" 1 
ATOM   3864  C "C4'" . DA  B 2 24  ? 82.628  130.968 88.238  1.00   130.42 ? 24  DA  J "C4'" 1 
ATOM   3865  O "O4'" . DA  B 2 24  ? 81.241  130.847 87.829  1.00   145.90 ? 24  DA  J "O4'" 1 
ATOM   3866  C "C3'" . DA  B 2 24  ? 83.057  129.589 88.740  1.00   136.04 ? 24  DA  J "C3'" 1 
ATOM   3867  O "O3'" . DA  B 2 24  ? 83.160  129.601 90.157  1.00   154.79 ? 24  DA  J "O3'" 1 
ATOM   3868  C "C2'" . DA  B 2 24  ? 81.939  128.660 88.259  1.00   144.71 ? 24  DA  J "C2'" 1 
ATOM   3869  C "C1'" . DA  B 2 24  ? 80.740  129.592 88.221  1.00   137.98 ? 24  DA  J "C1'" 1 
ATOM   3870  N N9    . DA  B 2 24  ? 79.721  129.184 87.257  1.00   135.95 ? 24  DA  J N9    1 
ATOM   3871  C C8    . DA  B 2 24  ? 79.929  128.701 85.995  1.00   147.44 ? 24  DA  J C8    1 
ATOM   3872  N N7    . DA  B 2 24  ? 78.824  128.415 85.348  1.00   152.35 ? 24  DA  J N7    1 
ATOM   3873  C C5    . DA  B 2 24  ? 77.821  128.734 86.248  1.00   153.50 ? 24  DA  J C5    1 
ATOM   3874  C C6    . DA  B 2 24  ? 76.415  128.659 86.168  1.00   155.98 ? 24  DA  J C6    1 
ATOM   3875  N N6    . DA  B 2 24  ? 75.761  128.219 85.088  1.00   150.87 ? 24  DA  J N6    1 
ATOM   3876  N N1    . DA  B 2 24  ? 75.706  129.057 87.245  1.00   151.30 ? 24  DA  J N1    1 
ATOM   3877  C C2    . DA  B 2 24  ? 76.364  129.497 88.324  1.00   156.36 ? 24  DA  J C2    1 
ATOM   3878  N N3    . DA  B 2 24  ? 77.678  129.612 88.516  1.00   151.52 ? 24  DA  J N3    1 
ATOM   3879  C C4    . DA  B 2 24  ? 78.356  129.210 87.430  1.00   140.48 ? 24  DA  J C4    1 
ATOM   3880  P P     . DT  B 2 25  ? 83.688  128.304 90.945  1.00   165.10 ? 25  DT  J P     1 
ATOM   3881  O OP1   . DT  B 2 25  ? 84.489  128.780 92.096  1.00   135.94 ? 25  DT  J OP1   1 
ATOM   3882  O OP2   . DT  B 2 25  ? 84.294  127.375 89.963  1.00   107.49 ? 25  DT  J OP2   1 
ATOM   3883  O "O5'" . DT  B 2 25  ? 82.347  127.635 91.496  1.00   135.28 ? 25  DT  J "O5'" 1 
ATOM   3884  C "C5'" . DT  B 2 25  ? 81.389  128.439 92.168  1.00   121.53 ? 25  DT  J "C5'" 1 
ATOM   3885  C "C4'" . DT  B 2 25  ? 80.094  127.679 92.371  1.00   125.23 ? 25  DT  J "C4'" 1 
ATOM   3886  O "O4'" . DT  B 2 25  ? 79.369  127.611 91.132  1.00   122.70 ? 25  DT  J "O4'" 1 
ATOM   3887  C "C3'" . DT  B 2 25  ? 80.260  126.228 92.816  1.00   115.09 ? 25  DT  J "C3'" 1 
ATOM   3888  O "O3'" . DT  B 2 25  ? 80.081  126.136 94.232  1.00   132.23 ? 25  DT  J "O3'" 1 
ATOM   3889  C "C2'" . DT  B 2 25  ? 79.168  125.461 92.038  1.00   132.49 ? 25  DT  J "C2'" 1 
ATOM   3890  C "C1'" . DT  B 2 25  ? 78.459  126.552 91.232  1.00   130.71 ? 25  DT  J "C1'" 1 
ATOM   3891  N N1    . DT  B 2 25  ? 78.064  126.124 89.856  1.00   135.43 ? 25  DT  J N1    1 
ATOM   3892  C C2    . DT  B 2 25  ? 76.728  126.046 89.533  1.00   141.20 ? 25  DT  J C2    1 
ATOM   3893  O O2    . DT  B 2 25  ? 75.835  126.316 90.317  1.00   140.48 ? 25  DT  J O2    1 
ATOM   3894  N N3    . DT  B 2 25  ? 76.471  125.641 88.251  1.00   134.43 ? 25  DT  J N3    1 
ATOM   3895  C C4    . DT  B 2 25  ? 77.395  125.311 87.278  1.00   140.26 ? 25  DT  J C4    1 
ATOM   3896  O O4    . DT  B 2 25  ? 77.063  124.957 86.150  1.00   134.83 ? 25  DT  J O4    1 
ATOM   3897  C C5    . DT  B 2 25  ? 78.779  125.411 87.681  1.00   146.84 ? 25  DT  J C5    1 
ATOM   3898  C C7    . DT  B 2 25  ? 79.874  125.078 86.711  1.00   150.36 ? 25  DT  J C7    1 
ATOM   3899  C C6    . DT  B 2 25  ? 79.043  125.807 88.936  1.00   131.52 ? 25  DT  J C6    1 
ATOM   3900  P P     . DC  B 2 26  ? 80.024  124.706 94.966  1.00   110.84 ? 26  DC  J P     1 
ATOM   3901  O OP1   . DC  B 2 26  ? 80.344  124.914 96.396  1.00   86.01  ? 26  DC  J OP1   1 
ATOM   3902  O OP2   . DC  B 2 26  ? 80.822  123.751 94.165  1.00   80.37  ? 26  DC  J OP2   1 
ATOM   3903  O "O5'" . DC  B 2 26  ? 78.488  124.288 94.841  1.00   118.97 ? 26  DC  J "O5'" 1 
ATOM   3904  C "C5'" . DC  B 2 26  ? 77.466  125.225 95.171  1.00   124.34 ? 26  DC  J "C5'" 1 
ATOM   3905  C "C4'" . DC  B 2 26  ? 76.105  124.630 94.885  1.00   126.44 ? 26  DC  J "C4'" 1 
ATOM   3906  O "O4'" . DC  B 2 26  ? 75.946  124.480 93.454  1.00   120.82 ? 26  DC  J "O4'" 1 
ATOM   3907  C "C3'" . DC  B 2 26  ? 75.861  123.247 95.494  1.00   128.86 ? 26  DC  J "C3'" 1 
ATOM   3908  O "O3'" . DC  B 2 26  ? 74.641  123.253 96.224  1.00   144.41 ? 26  DC  J "O3'" 1 
ATOM   3909  C "C2'" . DC  B 2 26  ? 75.810  122.313 94.281  1.00   140.95 ? 26  DC  J "C2'" 1 
ATOM   3910  C "C1'" . DC  B 2 26  ? 75.334  123.248 93.183  1.00   139.03 ? 26  DC  J "C1'" 1 
ATOM   3911  N N1    . DC  B 2 26  ? 75.766  122.825 91.824  1.00   129.88 ? 26  DC  J N1    1 
ATOM   3912  C C2    . DC  B 2 26  ? 74.978  123.146 90.715  1.00   136.99 ? 26  DC  J C2    1 
ATOM   3913  O O2    . DC  B 2 26  ? 73.916  123.754 90.887  1.00   148.02 ? 26  DC  J O2    1 
ATOM   3914  N N3    . DC  B 2 26  ? 75.393  122.761 89.483  1.00   136.36 ? 26  DC  J N3    1 
ATOM   3915  C C4    . DC  B 2 26  ? 76.545  122.102 89.341  1.00   124.21 ? 26  DC  J C4    1 
ATOM   3916  N N4    . DC  B 2 26  ? 76.915  121.747 88.106  1.00   116.37 ? 26  DC  J N4    1 
ATOM   3917  C C5    . DC  B 2 26  ? 77.368  121.779 90.459  1.00   114.69 ? 26  DC  J C5    1 
ATOM   3918  C C6    . DC  B 2 26  ? 76.947  122.161 91.668  1.00   115.55 ? 26  DC  J C6    1 
ATOM   3919  P P     . DT  B 2 27  ? 74.271  122.039 97.209  1.00   146.09 ? 27  DT  J P     1 
ATOM   3920  O OP1   . DT  B 2 27  ? 73.692  122.638 98.433  1.00   109.25 ? 27  DT  J OP1   1 
ATOM   3921  O OP2   . DT  B 2 27  ? 75.452  121.152 97.308  1.00   114.87 ? 27  DT  J OP2   1 
ATOM   3922  O "O5'" . DT  B 2 27  ? 73.119  121.254 96.423  1.00   145.60 ? 27  DT  J "O5'" 1 
ATOM   3923  C "C5'" . DT  B 2 27  ? 71.941  121.948 96.026  1.00   143.92 ? 27  DT  J "C5'" 1 
ATOM   3924  C "C4'" . DT  B 2 27  ? 71.174  121.169 94.972  1.00   137.35 ? 27  DT  J "C4'" 1 
ATOM   3925  O "O4'" . DT  B 2 27  ? 72.008  120.973 93.801  1.00   145.23 ? 27  DT  J "O4'" 1 
ATOM   3926  C "C3'" . DT  B 2 27  ? 70.705  119.772 95.402  1.00   133.93 ? 27  DT  J "C3'" 1 
ATOM   3927  O "O3'" . DT  B 2 27  ? 69.309  119.633 95.157  1.00   125.57 ? 27  DT  J "O3'" 1 
ATOM   3928  C "C2'" . DT  B 2 27  ? 71.527  118.824 94.522  1.00   134.76 ? 27  DT  J "C2'" 1 
ATOM   3929  C "C1'" . DT  B 2 27  ? 71.767  119.686 93.296  1.00   152.03 ? 27  DT  J "C1'" 1 
ATOM   3930  N N1    . DT  B 2 27  ? 72.939  119.261 92.477  1.00   141.78 ? 27  DT  J N1    1 
ATOM   3931  C C2    . DT  B 2 27  ? 72.738  118.861 91.176  1.00   132.82 ? 27  DT  J C2    1 
ATOM   3932  O O2    . DT  B 2 27  ? 71.641  118.837 90.647  1.00   123.92 ? 27  DT  J O2    1 
ATOM   3933  N N3    . DT  B 2 27  ? 73.874  118.490 90.508  1.00   137.74 ? 27  DT  J N3    1 
ATOM   3934  C C4    . DT  B 2 27  ? 75.166  118.477 91.001  1.00   143.99 ? 27  DT  J C4    1 
ATOM   3935  O O4    . DT  B 2 27  ? 76.125  118.124 90.321  1.00   126.31 ? 27  DT  J O4    1 
ATOM   3936  C C5    . DT  B 2 27  ? 75.308  118.905 92.373  1.00   152.30 ? 27  DT  J C5    1 
ATOM   3937  C C7    . DT  B 2 27  ? 76.663  118.931 93.018  1.00   131.49 ? 27  DT  J C7    1 
ATOM   3938  C C6    . DT  B 2 27  ? 74.201  119.273 93.037  1.00   145.02 ? 27  DT  J C6    1 
ATOM   3939  P P     . DG  B 2 28  ? 68.499  118.388 95.769  1.00   149.24 ? 28  DG  J P     1 
ATOM   3940  O OP1   . DG  B 2 28  ? 67.119  118.843 96.044  1.00   155.34 ? 28  DG  J OP1   1 
ATOM   3941  O OP2   . DG  B 2 28  ? 69.316  117.813 96.860  1.00   156.70 ? 28  DG  J OP2   1 
ATOM   3942  O "O5'" . DG  B 2 28  ? 68.457  117.324 94.574  1.00   113.46 ? 28  DG  J "O5'" 1 
ATOM   3943  C "C5'" . DG  B 2 28  ? 67.555  117.506 93.487  1.00   109.92 ? 28  DG  J "C5'" 1 
ATOM   3944  C "C4'" . DG  B 2 28  ? 67.652  116.355 92.499  1.00   107.42 ? 28  DG  J "C4'" 1 
ATOM   3945  O "O4'" . DG  B 2 28  ? 68.987  116.314 91.932  1.00   116.34 ? 28  DG  J "O4'" 1 
ATOM   3946  C "C3'" . DG  B 2 28  ? 67.408  114.966 93.093  1.00   119.00 ? 28  DG  J "C3'" 1 
ATOM   3947  O "O3'" . DG  B 2 28  ? 66.758  114.129 92.140  1.00   124.34 ? 28  DG  J "O3'" 1 
ATOM   3948  C "C2'" . DG  B 2 28  ? 68.823  114.475 93.368  1.00   106.37 ? 28  DG  J "C2'" 1 
ATOM   3949  C "C1'" . DG  B 2 28  ? 69.559  115.046 92.166  1.00   122.25 ? 28  DG  J "C1'" 1 
ATOM   3950  N N9    . DG  B 2 28  ? 70.992  115.216 92.380  1.00   136.74 ? 28  DG  J N9    1 
ATOM   3951  C C8    . DG  B 2 28  ? 71.625  115.510 93.563  1.00   132.91 ? 28  DG  J C8    1 
ATOM   3952  N N7    . DG  B 2 28  ? 72.920  115.603 93.449  1.00   119.85 ? 28  DG  J N7    1 
ATOM   3953  C C5    . DG  B 2 28  ? 73.161  115.355 92.104  1.00   128.52 ? 28  DG  J C5    1 
ATOM   3954  C C6    . DG  B 2 28  ? 74.380  115.320 91.388  1.00   149.63 ? 28  DG  J C6    1 
ATOM   3955  O O6    . DG  B 2 28  ? 75.528  115.508 91.815  1.00   161.24 ? 28  DG  J O6    1 
ATOM   3956  N N1    . DG  B 2 28  ? 74.178  115.033 90.040  1.00   149.33 ? 28  DG  J N1    1 
ATOM   3957  C C2    . DG  B 2 28  ? 72.953  114.807 89.459  1.00   136.07 ? 28  DG  J C2    1 
ATOM   3958  N N2    . DG  B 2 28  ? 72.957  114.544 88.145  1.00   133.17 ? 28  DG  J N2    1 
ATOM   3959  N N3    . DG  B 2 28  ? 71.803  114.837 90.119  1.00   123.77 ? 28  DG  J N3    1 
ATOM   3960  C C4    . DG  B 2 28  ? 71.983  115.116 91.433  1.00   127.60 ? 28  DG  J C4    1 
ATOM   3961  P P     . DA  B 2 29  ? 65.280  114.473 91.610  1.00   127.64 ? 29  DA  J P     1 
ATOM   3962  O OP1   . DA  B 2 29  ? 64.619  115.346 92.606  1.00   143.51 ? 29  DA  J OP1   1 
ATOM   3963  O OP2   . DA  B 2 29  ? 64.639  113.196 91.223  1.00   88.97  ? 29  DA  J OP2   1 
ATOM   3964  O "O5'" . DA  B 2 29  ? 65.542  115.312 90.273  1.00   136.38 ? 29  DA  J "O5'" 1 
ATOM   3965  C "C5'" . DA  B 2 29  ? 64.747  115.079 89.119  1.00   131.07 ? 29  DA  J "C5'" 1 
ATOM   3966  C "C4'" . DA  B 2 29  ? 65.556  114.399 88.026  1.00   119.56 ? 29  DA  J "C4'" 1 
ATOM   3967  O "O4'" . DA  B 2 29  ? 66.933  114.232 88.461  1.00   109.57 ? 29  DA  J "O4'" 1 
ATOM   3968  C "C3'" . DA  B 2 29  ? 65.061  113.003 87.626  1.00   110.53 ? 29  DA  J "C3'" 1 
ATOM   3969  O "O3'" . DA  B 2 29  ? 64.939  112.917 86.213  1.00   103.85 ? 29  DA  J "O3'" 1 
ATOM   3970  C "C2'" . DA  B 2 29  ? 66.153  112.072 88.152  1.00   87.78  ? 29  DA  J "C2'" 1 
ATOM   3971  C "C1'" . DA  B 2 29  ? 67.378  112.960 88.062  1.00   115.35 ? 29  DA  J "C1'" 1 
ATOM   3972  N N9    . DA  B 2 29  ? 68.468  112.535 88.940  1.00   141.34 ? 29  DA  J N9    1 
ATOM   3973  C C8    . DA  B 2 29  ? 68.419  112.373 90.296  1.00   142.48 ? 29  DA  J C8    1 
ATOM   3974  N N7    . DA  B 2 29  ? 69.552  111.971 90.823  1.00   135.96 ? 29  DA  J N7    1 
ATOM   3975  C C5    . DA  B 2 29  ? 70.402  111.856 89.737  1.00   131.75 ? 29  DA  J C5    1 
ATOM   3976  C C6    . DA  B 2 29  ? 71.752  111.469 89.625  1.00   131.13 ? 29  DA  J C6    1 
ATOM   3977  N N6    . DA  B 2 29  ? 72.505  111.114 90.670  1.00   133.10 ? 29  DA  J N6    1 
ATOM   3978  N N1    . DA  B 2 29  ? 72.300  111.461 88.392  1.00   137.77 ? 29  DA  J N1    1 
ATOM   3979  C C2    . DA  B 2 29  ? 71.543  111.819 87.347  1.00   143.21 ? 29  DA  J C2    1 
ATOM   3980  N N3    . DA  B 2 29  ? 70.266  112.200 87.328  1.00   142.94 ? 29  DA  J N3    1 
ATOM   3981  C C4    . DA  B 2 29  ? 69.750  112.197 88.567  1.00   140.59 ? 29  DA  J C4    1 
ATOM   3982  P P     . DC  B 2 30  ? 64.295  111.613 85.527  1.00   103.82 ? 30  DC  J P     1 
ATOM   3983  O OP1   . DC  B 2 30  ? 63.324  112.081 84.513  1.00   90.87  ? 30  DC  J OP1   1 
ATOM   3984  O OP2   . DC  B 2 30  ? 63.847  110.686 86.590  1.00   85.95  ? 30  DC  J OP2   1 
ATOM   3985  O "O5'" . DC  B 2 30  ? 65.532  110.929 84.783  1.00   132.12 ? 30  DC  J "O5'" 1 
ATOM   3986  C "C5'" . DC  B 2 30  ? 66.393  111.721 83.974  1.00   122.01 ? 30  DC  J "C5'" 1 
ATOM   3987  C "C4'" . DC  B 2 30  ? 67.656  110.958 83.612  1.00   118.09 ? 30  DC  J "C4'" 1 
ATOM   3988  O "O4'" . DC  B 2 30  ? 68.470  110.759 84.796  1.00   122.81 ? 30  DC  J "O4'" 1 
ATOM   3989  C "C3'" . DC  B 2 30  ? 67.434  109.575 83.008  1.00   118.87 ? 30  DC  J "C3'" 1 
ATOM   3990  O "O3'" . DC  B 2 30  ? 68.390  109.351 81.982  1.00   127.81 ? 30  DC  J "O3'" 1 
ATOM   3991  C "C2'" . DC  B 2 30  ? 67.650  108.640 84.199  1.00   99.47  ? 30  DC  J "C2'" 1 
ATOM   3992  C "C1'" . DC  B 2 30  ? 68.723  109.382 84.985  1.00   119.09 ? 30  DC  J "C1'" 1 
ATOM   3993  N N1    . DC  B 2 30  ? 68.694  109.106 86.450  1.00   129.73 ? 30  DC  J N1    1 
ATOM   3994  C C2    . DC  B 2 30  ? 69.893  108.902 87.141  1.00   122.74 ? 30  DC  J C2    1 
ATOM   3995  O O2    . DC  B 2 30  ? 70.961  108.942 86.519  1.00   125.15 ? 30  DC  J O2    1 
ATOM   3996  N N3    . DC  B 2 30  ? 69.850  108.662 88.475  1.00   111.97 ? 30  DC  J N3    1 
ATOM   3997  C C4    . DC  B 2 30  ? 68.677  108.626 89.109  1.00   119.00 ? 30  DC  J C4    1 
ATOM   3998  N N4    . DC  B 2 30  ? 68.684  108.385 90.424  1.00   135.79 ? 30  DC  J N4    1 
ATOM   3999  C C5    . DC  B 2 30  ? 67.445  108.833 88.423  1.00   125.28 ? 30  DC  J C5    1 
ATOM   4000  C C6    . DC  B 2 30  ? 67.500  109.068 87.108  1.00   130.52 ? 30  DC  J C6    1 
ATOM   4001  P P     . DA  B 2 31  ? 68.123  108.260 80.833  1.00   131.63 ? 31  DA  J P     1 
ATOM   4002  O OP1   . DA  B 2 31  ? 68.069  108.974 79.537  1.00   107.32 ? 31  DA  J OP1   1 
ATOM   4003  O OP2   . DA  B 2 31  ? 66.990  107.406 81.258  1.00   110.13 ? 31  DA  J OP2   1 
ATOM   4004  O "O5'" . DA  B 2 31  ? 69.446  107.368 80.872  1.00   151.23 ? 31  DA  J "O5'" 1 
ATOM   4005  C "C5'" . DA  B 2 31  ? 70.722  107.998 80.846  1.00   138.10 ? 31  DA  J "C5'" 1 
ATOM   4006  C "C4'" . DA  B 2 31  ? 71.819  107.012 81.196  1.00   125.26 ? 31  DA  J "C4'" 1 
ATOM   4007  O "O4'" . DA  B 2 31  ? 71.779  106.755 82.624  1.00   100.04 ? 31  DA  J "O4'" 1 
ATOM   4008  C "C3'" . DA  B 2 31  ? 71.706  105.649 80.519  1.00   129.44 ? 31  DA  J "C3'" 1 
ATOM   4009  O "O3'" . DA  B 2 31  ? 73.002  105.165 80.179  1.00   138.25 ? 31  DA  J "O3'" 1 
ATOM   4010  C "C2'" . DA  B 2 31  ? 71.021  104.788 81.578  1.00   128.97 ? 31  DA  J "C2'" 1 
ATOM   4011  C "C1'" . DA  B 2 31  ? 71.552  105.384 82.874  1.00   137.58 ? 31  DA  J "C1'" 1 
ATOM   4012  N N9    . DA  B 2 31  ? 70.588  105.289 83.966  1.00   134.69 ? 31  DA  J N9    1 
ATOM   4013  C C8    . DA  B 2 31  ? 69.247  105.543 83.897  1.00   137.45 ? 31  DA  J C8    1 
ATOM   4014  N N7    . DA  B 2 31  ? 68.618  105.385 85.037  1.00   140.87 ? 31  DA  J N7    1 
ATOM   4015  C C5    . DA  B 2 31  ? 69.618  105.010 85.918  1.00   130.97 ? 31  DA  J C5    1 
ATOM   4016  C C6    . DA  B 2 31  ? 69.604  104.696 87.290  1.00   129.27 ? 31  DA  J C6    1 
ATOM   4017  N N6    . DA  B 2 31  ? 68.495  104.714 88.037  1.00   131.45 ? 31  DA  J N6    1 
ATOM   4018  N N1    . DA  B 2 31  ? 70.776  104.362 87.866  1.00   137.30 ? 31  DA  J N1    1 
ATOM   4019  C C2    . DA  B 2 31  ? 71.883  104.346 87.116  1.00   139.73 ? 31  DA  J C2    1 
ATOM   4020  N N3    . DA  B 2 31  ? 72.022  104.621 85.820  1.00   141.15 ? 31  DA  J N3    1 
ATOM   4021  C C4    . DA  B 2 31  ? 70.841  104.950 85.275  1.00   134.03 ? 31  DA  J C4    1 
ATOM   4022  P P     . DC  B 2 32  ? 73.177  103.847 79.276  1.00   134.22 ? 32  DC  J P     1 
ATOM   4023  O OP1   . DC  B 2 32  ? 74.119  104.183 78.186  1.00   115.99 ? 32  DC  J OP1   1 
ATOM   4024  O OP2   . DC  B 2 32  ? 71.835  103.316 78.946  1.00   92.13  ? 32  DC  J OP2   1 
ATOM   4025  O "O5'" . DC  B 2 32  ? 73.894  102.814 80.264  1.00   135.76 ? 32  DC  J "O5'" 1 
ATOM   4026  C "C5'" . DC  B 2 32  ? 75.100  103.190 80.918  1.00   131.70 ? 32  DC  J "C5'" 1 
ATOM   4027  C "C4'" . DC  B 2 32  ? 75.149  102.638 82.331  1.00   123.75 ? 32  DC  J "C4'" 1 
ATOM   4028  O "O4'" . DC  B 2 32  ? 73.928  102.974 83.024  1.00   121.27 ? 32  DC  J "O4'" 1 
ATOM   4029  C "C3'" . DC  B 2 32  ? 75.239  101.129 82.426  1.00   143.80 ? 32  DC  J "C3'" 1 
ATOM   4030  O "O3'" . DC  B 2 32  ? 76.599  100.719 82.316  1.00   162.06 ? 32  DC  J "O3'" 1 
ATOM   4031  C "C2'" . DC  B 2 32  ? 74.680  100.862 83.823  1.00   145.62 ? 32  DC  J "C2'" 1 
ATOM   4032  C "C1'" . DC  B 2 32  ? 73.637  101.976 83.987  1.00   110.00 ? 32  DC  J "C1'" 1 
ATOM   4033  N N1    . DC  B 2 32  ? 72.229  101.516 83.790  1.00   138.17 ? 32  DC  J N1    1 
ATOM   4034  C C2    . DC  B 2 32  ? 71.431  101.238 84.906  1.00   148.03 ? 32  DC  J C2    1 
ATOM   4035  O O2    . DC  B 2 32  ? 71.908  101.379 86.039  1.00   139.86 ? 32  DC  J O2    1 
ATOM   4036  N N3    . DC  B 2 32  ? 70.154  100.821 84.713  1.00   145.41 ? 32  DC  J N3    1 
ATOM   4037  C C4    . DC  B 2 32  ? 69.677  100.681 83.475  1.00   144.44 ? 32  DC  J C4    1 
ATOM   4038  N N4    . DC  B 2 32  ? 68.412  100.268 83.335  1.00   138.65 ? 32  DC  J N4    1 
ATOM   4039  C C5    . DC  B 2 32  ? 70.474  100.959 82.326  1.00   141.60 ? 32  DC  J C5    1 
ATOM   4040  C C6    . DC  B 2 32  ? 71.731  101.370 82.528  1.00   137.61 ? 32  DC  J C6    1 
ATOM   4041  P P     . DG  B 2 33  ? 76.984  99.159  82.364  1.00   163.99 ? 33  DG  J P     1 
ATOM   4042  O OP1   . DG  B 2 33  ? 78.288  99.004  81.681  1.00   141.12 ? 33  DG  J OP1   1 
ATOM   4043  O OP2   . DG  B 2 33  ? 75.811  98.386  81.897  1.00   116.01 ? 33  DG  J OP2   1 
ATOM   4044  O "O5'" . DG  B 2 33  ? 77.180  98.865  83.925  1.00   168.13 ? 33  DG  J "O5'" 1 
ATOM   4045  C "C5'" . DG  B 2 33  ? 77.249  97.527  84.396  1.00   163.35 ? 33  DG  J "C5'" 1 
ATOM   4046  C "C4'" . DG  B 2 33  ? 77.305  97.496  85.912  1.00   160.57 ? 33  DG  J "C4'" 1 
ATOM   4047  O "O4'" . DG  B 2 33  ? 76.421  98.518  86.446  1.00   158.27 ? 33  DG  J "O4'" 1 
ATOM   4048  C "C3'" . DG  B 2 33  ? 76.848  96.188  86.543  1.00   172.37 ? 33  DG  J "C3'" 1 
ATOM   4049  O "O3'" . DG  B 2 33  ? 77.959  95.321  86.729  1.00   165.31 ? 33  DG  J "O3'" 1 
ATOM   4050  C "C2'" . DG  B 2 33  ? 76.270  96.653  87.874  1.00   176.84 ? 33  DG  J "C2'" 1 
ATOM   4051  C "C1'" . DG  B 2 33  ? 75.617  97.970  87.474  1.00   166.21 ? 33  DG  J "C1'" 1 
ATOM   4052  N N9    . DG  B 2 33  ? 74.257  97.815  86.962  1.00   158.79 ? 33  DG  J N9    1 
ATOM   4053  C C8    . DG  B 2 33  ? 73.844  97.944  85.658  1.00   149.93 ? 33  DG  J C8    1 
ATOM   4054  N N7    . DG  B 2 33  ? 72.565  97.750  85.496  1.00   150.16 ? 33  DG  J N7    1 
ATOM   4055  C C5    . DG  B 2 33  ? 72.099  97.472  86.774  1.00   161.75 ? 33  DG  J C5    1 
ATOM   4056  C C6    . DG  B 2 33  ? 70.789  97.178  87.222  1.00   169.00 ? 33  DG  J C6    1 
ATOM   4057  O O6    . DG  B 2 33  ? 69.748  97.102  86.555  1.00   164.47 ? 33  DG  J O6    1 
ATOM   4058  N N1    . DG  B 2 33  ? 70.752  96.960  88.598  1.00   179.98 ? 33  DG  J N1    1 
ATOM   4059  C C2    . DG  B 2 33  ? 71.843  97.018  89.433  1.00   179.48 ? 33  DG  J C2    1 
ATOM   4060  N N2    . DG  B 2 33  ? 71.610  96.778  90.732  1.00   178.04 ? 33  DG  J N2    1 
ATOM   4061  N N3    . DG  B 2 33  ? 73.076  97.293  89.026  1.00   174.37 ? 33  DG  J N3    1 
ATOM   4062  C C4    . DG  B 2 33  ? 73.128  97.509  87.689  1.00   167.02 ? 33  DG  J C4    1 
ATOM   4063  P P     . DT  B 2 34  ? 77.809  93.747  86.445  1.00   167.89 ? 34  DT  J P     1 
ATOM   4064  O OP1   . DT  B 2 34  ? 79.160  93.147  86.510  1.00   169.39 ? 34  DT  J OP1   1 
ATOM   4065  O OP2   . DT  B 2 34  ? 76.995  93.591  85.220  1.00   166.90 ? 34  DT  J OP2   1 
ATOM   4066  O "O5'" . DT  B 2 34  ? 76.945  93.213  87.681  1.00   182.72 ? 34  DT  J "O5'" 1 
ATOM   4067  C "C5'" . DT  B 2 34  ? 77.443  93.348  89.007  1.00   184.27 ? 34  DT  J "C5'" 1 
ATOM   4068  C "C4'" . DT  B 2 34  ? 76.326  93.198  90.024  1.00   203.35 ? 34  DT  J "C4'" 1 
ATOM   4069  O "O4'" . DT  B 2 34  ? 75.273  94.147  89.730  1.00   200.44 ? 34  DT  J "O4'" 1 
ATOM   4070  C "C3'" . DT  B 2 34  ? 75.638  91.845  90.031  1.00   202.92 ? 34  DT  J "C3'" 1 
ATOM   4071  O "O3'" . DT  B 2 34  ? 76.355  90.940  90.866  1.00   193.11 ? 34  DT  J "O3'" 1 
ATOM   4072  C "C2'" . DT  B 2 34  ? 74.271  92.183  90.618  1.00   204.51 ? 34  DT  J "C2'" 1 
ATOM   4073  C "C1'" . DT  B 2 34  ? 74.014  93.589  90.067  1.00   204.95 ? 34  DT  J "C1'" 1 
ATOM   4074  N N1    . DT  B 2 34  ? 73.141  93.609  88.856  1.00   202.38 ? 34  DT  J N1    1 
ATOM   4075  C C2    . DT  B 2 34  ? 71.781  93.461  89.005  1.00   188.34 ? 34  DT  J C2    1 
ATOM   4076  O O2    . DT  B 2 34  ? 71.239  93.309  90.085  1.00   180.27 ? 34  DT  J O2    1 
ATOM   4077  N N3    . DT  B 2 34  ? 71.070  93.495  87.834  1.00   180.03 ? 34  DT  J N3    1 
ATOM   4078  C C4    . DT  B 2 34  ? 71.572  93.661  86.556  1.00   180.14 ? 34  DT  J C4    1 
ATOM   4079  O O4    . DT  B 2 34  ? 70.850  93.678  85.564  1.00   166.43 ? 34  DT  J O4    1 
ATOM   4080  C C5    . DT  B 2 34  ? 73.006  93.811  86.470  1.00   185.90 ? 34  DT  J C5    1 
ATOM   4081  C C7    . DT  B 2 34  ? 73.667  93.998  85.136  1.00   163.77 ? 34  DT  J C7    1 
ATOM   4082  C C6    . DT  B 2 34  ? 73.712  93.779  87.611  1.00   193.73 ? 34  DT  J C6    1 
ATOM   4083  P P     . DG  B 2 35  ? 75.926  89.393  90.943  1.00   191.02 ? 35  DG  J P     1 
ATOM   4084  O OP1   . DG  B 2 35  ? 77.072  88.637  91.496  1.00   209.25 ? 35  DG  J OP1   1 
ATOM   4085  O OP2   . DG  B 2 35  ? 75.363  89.018  89.627  1.00   179.89 ? 35  DG  J OP2   1 
ATOM   4086  O "O5'" . DG  B 2 35  ? 74.734  89.377  92.010  1.00   171.08 ? 35  DG  J "O5'" 1 
ATOM   4087  C "C5'" . DG  B 2 35  ? 74.024  88.171  92.268  1.00   176.08 ? 35  DG  J "C5'" 1 
ATOM   4088  C "C4'" . DG  B 2 35  ? 72.654  88.471  92.848  1.00   186.37 ? 35  DG  J "C4'" 1 
ATOM   4089  O "O4'" . DG  B 2 35  ? 71.994  89.463  92.025  1.00   197.67 ? 35  DG  J "O4'" 1 
ATOM   4090  C "C3'" . DG  B 2 35  ? 71.701  87.288  92.880  1.00   181.59 ? 35  DG  J "C3'" 1 
ATOM   4091  O "O3'" . DG  B 2 35  ? 70.723  87.478  93.894  1.00   183.86 ? 35  DG  J "O3'" 1 
ATOM   4092  C "C2'" . DG  B 2 35  ? 71.080  87.344  91.491  1.00   176.70 ? 35  DG  J "C2'" 1 
ATOM   4093  C "C1'" . DG  B 2 35  ? 70.972  88.851  91.256  1.00   191.59 ? 35  DG  J "C1'" 1 
ATOM   4094  N N9    . DG  B 2 35  ? 71.157  89.233  89.859  1.00   192.87 ? 35  DG  J N9    1 
ATOM   4095  C C8    . DG  B 2 35  ? 72.309  89.122  89.118  1.00   195.35 ? 35  DG  J C8    1 
ATOM   4096  N N7    . DG  B 2 35  ? 72.181  89.543  87.891  1.00   184.99 ? 35  DG  J N7    1 
ATOM   4097  C C5    . DG  B 2 35  ? 70.859  89.961  87.812  1.00   188.33 ? 35  DG  J C5    1 
ATOM   4098  C C6    . DG  B 2 35  ? 70.142  90.514  86.725  1.00   190.54 ? 35  DG  J C6    1 
ATOM   4099  O O6    . DG  B 2 35  ? 70.549  90.751  85.579  1.00   187.71 ? 35  DG  J O6    1 
ATOM   4100  N N1    . DG  B 2 35  ? 68.823  90.800  87.069  1.00   185.52 ? 35  DG  J N1    1 
ATOM   4101  C C2    . DG  B 2 35  ? 68.267  90.579  88.308  1.00   176.50 ? 35  DG  J C2    1 
ATOM   4102  N N2    . DG  B 2 35  ? 66.978  90.918  88.449  1.00   154.64 ? 35  DG  J N2    1 
ATOM   4103  N N3    . DG  B 2 35  ? 68.928  90.060  89.335  1.00   183.92 ? 35  DG  J N3    1 
ATOM   4104  C C4    . DG  B 2 35  ? 70.215  89.777  89.016  1.00   190.48 ? 35  DG  J C4    1 
ATOM   4105  P P     . DC  B 2 36  ? 69.777  86.258  94.341  1.00   182.55 ? 36  DC  J P     1 
ATOM   4106  O OP1   . DC  B 2 36  ? 69.349  86.508  95.735  1.00   168.21 ? 36  DC  J OP1   1 
ATOM   4107  O OP2   . DC  B 2 36  ? 70.479  85.001  93.999  1.00   181.66 ? 36  DC  J OP2   1 
ATOM   4108  O "O5'" . DC  B 2 36  ? 68.505  86.381  93.379  1.00   176.32 ? 36  DC  J "O5'" 1 
ATOM   4109  C "C5'" . DC  B 2 36  ? 67.587  87.456  93.547  1.00   183.37 ? 36  DC  J "C5'" 1 
ATOM   4110  C "C4'" . DC  B 2 36  ? 66.412  87.318  92.594  1.00   181.97 ? 36  DC  J "C4'" 1 
ATOM   4111  O "O4'" . DC  B 2 36  ? 66.812  87.735  91.261  1.00   177.75 ? 36  DC  J "O4'" 1 
ATOM   4112  C "C3'" . DC  B 2 36  ? 65.858  85.897  92.449  1.00   174.27 ? 36  DC  J "C3'" 1 
ATOM   4113  O "O3'" . DC  B 2 36  ? 64.438  85.927  92.436  1.00   171.06 ? 36  DC  J "O3'" 1 
ATOM   4114  C "C2'" . DC  B 2 36  ? 66.418  85.441  91.104  1.00   170.42 ? 36  DC  J "C2'" 1 
ATOM   4115  C "C1'" . DC  B 2 36  ? 66.437  86.747  90.329  1.00   170.28 ? 36  DC  J "C1'" 1 
ATOM   4116  N N1    . DC  B 2 36  ? 67.416  86.758  89.207  1.00   187.42 ? 36  DC  J N1    1 
ATOM   4117  C C2    . DC  B 2 36  ? 67.151  87.519  88.064  1.00   174.90 ? 36  DC  J C2    1 
ATOM   4118  O O2    . DC  B 2 36  ? 66.104  88.176  88.006  1.00   145.81 ? 36  DC  J O2    1 
ATOM   4119  N N3    . DC  B 2 36  ? 68.052  87.516  87.050  1.00   190.85 ? 36  DC  J N3    1 
ATOM   4120  C C4    . DC  B 2 36  ? 69.170  86.793  87.152  1.00   190.71 ? 36  DC  J C4    1 
ATOM   4121  N N4    . DC  B 2 36  ? 70.029  86.822  86.127  1.00   182.83 ? 36  DC  J N4    1 
ATOM   4122  C C5    . DC  B 2 36  ? 69.456  86.010  88.309  1.00   191.46 ? 36  DC  J C5    1 
ATOM   4123  C C6    . DC  B 2 36  ? 68.560  86.021  89.301  1.00   194.91 ? 36  DC  J C6    1 
ATOM   4124  P P     . DC  B 2 37  ? 63.596  84.645  92.916  1.00   179.25 ? 37  DC  J P     1 
ATOM   4125  O OP1   . DC  B 2 37  ? 63.209  84.863  94.328  1.00   184.67 ? 37  DC  J OP1   1 
ATOM   4126  O OP2   . DC  B 2 37  ? 64.357  83.432  92.542  1.00   161.91 ? 37  DC  J OP2   1 
ATOM   4127  O "O5'" . DC  B 2 37  ? 62.280  84.692  92.009  1.00   165.37 ? 37  DC  J "O5'" 1 
ATOM   4128  C "C5'" . DC  B 2 37  ? 61.464  85.857  92.001  1.00   157.00 ? 37  DC  J "C5'" 1 
ATOM   4129  C "C4'" . DC  B 2 37  ? 60.854  86.083  90.629  1.00   152.28 ? 37  DC  J "C4'" 1 
ATOM   4130  O "O4'" . DC  B 2 37  ? 61.908  86.345  89.665  1.00   153.36 ? 37  DC  J "O4'" 1 
ATOM   4131  C "C3'" . DC  B 2 37  ? 60.054  84.907  90.072  1.00   150.12 ? 37  DC  J "C3'" 1 
ATOM   4132  O "O3'" . DC  B 2 37  ? 58.920  85.386  89.365  1.00   168.22 ? 37  DC  J "O3'" 1 
ATOM   4133  C "C2'" . DC  B 2 37  ? 61.049  84.228  89.136  1.00   158.62 ? 37  DC  J "C2'" 1 
ATOM   4134  C "C1'" . DC  B 2 37  ? 61.827  85.421  88.601  1.00   165.21 ? 37  DC  J "C1'" 1 
ATOM   4135  N N1    . DC  B 2 37  ? 63.212  85.081  88.168  1.00   171.47 ? 37  DC  J N1    1 
ATOM   4136  C C2    . DC  B 2 37  ? 63.849  85.869  87.203  1.00   172.17 ? 37  DC  J C2    1 
ATOM   4137  O O2    . DC  B 2 37  ? 63.249  86.839  86.724  1.00   168.00 ? 37  DC  J O2    1 
ATOM   4138  N N3    . DC  B 2 37  ? 65.109  85.546  86.821  1.00   172.31 ? 37  DC  J N3    1 
ATOM   4139  C C4    . DC  B 2 37  ? 65.723  84.493  87.363  1.00   172.81 ? 37  DC  J C4    1 
ATOM   4140  N N4    . DC  B 2 37  ? 66.965  84.214  86.954  1.00   175.86 ? 37  DC  J N4    1 
ATOM   4141  C C5    . DC  B 2 37  ? 65.089  83.677  88.346  1.00   160.51 ? 37  DC  J C5    1 
ATOM   4142  C C6    . DC  B 2 37  ? 63.847  84.005  88.716  1.00   158.66 ? 37  DC  J C6    1 
ATOM   4143  P P     . DT  B 2 38  ? 57.526  84.591  89.437  1.00   175.77 ? 38  DT  J P     1 
ATOM   4144  O OP1   . DT  B 2 38  ? 56.680  85.251  90.456  1.00   141.47 ? 38  DT  J OP1   1 
ATOM   4145  O OP2   . DT  B 2 38  ? 57.841  83.150  89.560  1.00   173.26 ? 38  DT  J OP2   1 
ATOM   4146  O "O5'" . DT  B 2 38  ? 56.879  84.827  87.994  1.00   175.26 ? 38  DT  J "O5'" 1 
ATOM   4147  C "C5'" . DT  B 2 38  ? 56.807  86.142  87.454  1.00   165.02 ? 38  DT  J "C5'" 1 
ATOM   4148  C "C4'" . DT  B 2 38  ? 57.161  86.140  85.976  1.00   172.25 ? 38  DT  J "C4'" 1 
ATOM   4149  O "O4'" . DT  B 2 38  ? 58.568  85.818  85.813  1.00   186.97 ? 38  DT  J "O4'" 1 
ATOM   4150  C "C3'" . DT  B 2 38  ? 56.390  85.129  85.128  1.00   161.93 ? 38  DT  J "C3'" 1 
ATOM   4151  O "O3'" . DT  B 2 38  ? 56.042  85.710  83.879  1.00   156.71 ? 38  DT  J "O3'" 1 
ATOM   4152  C "C2'" . DT  B 2 38  ? 57.388  83.986  84.957  1.00   163.24 ? 38  DT  J "C2'" 1 
ATOM   4153  C "C1'" . DT  B 2 38  ? 58.709  84.737  84.917  1.00   172.27 ? 38  DT  J "C1'" 1 
ATOM   4154  N N1    . DT  B 2 38  ? 59.877  83.915  85.352  1.00   176.11 ? 38  DT  J N1    1 
ATOM   4155  C C2    . DT  B 2 38  ? 61.150  84.347  85.063  1.00   168.66 ? 38  DT  J C2    1 
ATOM   4156  O O2    . DT  B 2 38  ? 61.384  85.381  84.463  1.00   170.82 ? 38  DT  J O2    1 
ATOM   4157  N N3    . DT  B 2 38  ? 62.149  83.522  85.505  1.00   150.10 ? 38  DT  J N3    1 
ATOM   4158  C C4    . DT  B 2 38  ? 62.006  82.331  86.192  1.00   153.41 ? 38  DT  J C4    1 
ATOM   4159  O O4    . DT  B 2 38  ? 62.969  81.659  86.547  1.00   153.23 ? 38  DT  J O4    1 
ATOM   4160  C C5    . DT  B 2 38  ? 60.644  81.934  86.463  1.00   162.03 ? 38  DT  J C5    1 
ATOM   4161  C C7    . DT  B 2 38  ? 60.361  80.660  87.202  1.00   169.47 ? 38  DT  J C7    1 
ATOM   4162  C C6    . DT  B 2 38  ? 59.657  82.736  86.035  1.00   160.33 ? 38  DT  J C6    1 
ATOM   4163  P P     . DG  B 2 39  ? 54.567  86.304  83.650  1.00   163.39 ? 39  DG  J P     1 
ATOM   4164  O OP1   . DG  B 2 39  ? 54.241  87.157  84.814  1.00   175.27 ? 39  DG  J OP1   1 
ATOM   4165  O OP2   . DG  B 2 39  ? 53.679  85.175  83.295  1.00   135.08 ? 39  DG  J OP2   1 
ATOM   4166  O "O5'" . DG  B 2 39  ? 54.719  87.233  82.357  1.00   172.69 ? 39  DG  J "O5'" 1 
ATOM   4167  C "C5'" . DG  B 2 39  ? 54.555  86.678  81.058  1.00   152.78 ? 39  DG  J "C5'" 1 
ATOM   4168  C "C4'" . DG  B 2 39  ? 55.889  86.565  80.338  1.00   146.31 ? 39  DG  J "C4'" 1 
ATOM   4169  O "O4'" . DG  B 2 39  ? 56.798  85.730  81.101  1.00   155.35 ? 39  DG  J "O4'" 1 
ATOM   4170  C "C3'" . DG  B 2 39  ? 55.828  85.962  78.940  1.00   143.72 ? 39  DG  J "C3'" 1 
ATOM   4171  O "O3'" . DG  B 2 39  ? 56.791  86.591  78.105  1.00   164.26 ? 39  DG  J "O3'" 1 
ATOM   4172  C "C2'" . DG  B 2 39  ? 56.176  84.497  79.181  1.00   153.03 ? 39  DG  J "C2'" 1 
ATOM   4173  C "C1'" . DG  B 2 39  ? 57.157  84.590  80.344  1.00   163.84 ? 39  DG  J "C1'" 1 
ATOM   4174  N N9    . DG  B 2 39  ? 57.154  83.424  81.223  1.00   175.49 ? 39  DG  J N9    1 
ATOM   4175  C C8    . DG  B 2 39  ? 56.058  82.778  81.742  1.00   174.28 ? 39  DG  J C8    1 
ATOM   4176  N N7    . DG  B 2 39  ? 56.365  81.756  82.492  1.00   168.36 ? 39  DG  J N7    1 
ATOM   4177  C C5    . DG  B 2 39  ? 57.753  81.710  82.453  1.00   168.55 ? 39  DG  J C5    1 
ATOM   4178  C C6    . DG  B 2 39  ? 58.654  80.813  83.075  1.00   171.06 ? 39  DG  J C6    1 
ATOM   4179  O O6    . DG  B 2 39  ? 58.395  79.847  83.806  1.00   171.29 ? 39  DG  J O6    1 
ATOM   4180  N N1    . DG  B 2 39  ? 59.977  81.125  82.777  1.00   169.50 ? 39  DG  J N1    1 
ATOM   4181  C C2    . DG  B 2 39  ? 60.378  82.170  81.980  1.00   155.87 ? 39  DG  J C2    1 
ATOM   4182  N N2    . DG  B 2 39  ? 61.698  82.309  81.807  1.00   133.77 ? 39  DG  J N2    1 
ATOM   4183  N N3    . DG  B 2 39  ? 59.546  83.018  81.393  1.00   156.80 ? 39  DG  J N3    1 
ATOM   4184  C C4    . DG  B 2 39  ? 58.253  82.729  81.673  1.00   167.08 ? 39  DG  J C4    1 
ATOM   4185  P P     . DG  B 2 40  ? 56.340  87.320  76.746  1.00   136.81 ? 40  DG  J P     1 
ATOM   4186  O OP1   . DG  B 2 40  ? 56.637  88.759  76.910  1.00   88.87  ? 40  DG  J OP1   1 
ATOM   4187  O OP2   . DG  B 2 40  ? 54.968  86.877  76.419  1.00   128.10 ? 40  DG  J OP2   1 
ATOM   4188  O "O5'" . DG  B 2 40  ? 57.322  86.713  75.639  1.00   158.75 ? 40  DG  J "O5'" 1 
ATOM   4189  C "C5'" . DG  B 2 40  ? 58.719  86.982  75.701  1.00   163.29 ? 40  DG  J "C5'" 1 
ATOM   4190  C "C4'" . DG  B 2 40  ? 59.518  85.848  75.082  1.00   150.97 ? 40  DG  J "C4'" 1 
ATOM   4191  O "O4'" . DG  B 2 40  ? 59.593  84.737  76.016  1.00   170.06 ? 40  DG  J "O4'" 1 
ATOM   4192  C "C3'" . DG  B 2 40  ? 58.936  85.275  73.788  1.00   141.25 ? 40  DG  J "C3'" 1 
ATOM   4193  O "O3'" . DG  B 2 40  ? 59.987  84.981  72.872  1.00   137.11 ? 40  DG  J "O3'" 1 
ATOM   4194  C "C2'" . DG  B 2 40  ? 58.235  84.005  74.263  1.00   135.03 ? 40  DG  J "C2'" 1 
ATOM   4195  C "C1'" . DG  B 2 40  ? 59.165  83.555  75.377  1.00   160.14 ? 40  DG  J "C1'" 1 
ATOM   4196  N N9    . DG  B 2 40  ? 58.521  82.698  76.368  1.00   160.95 ? 40  DG  J N9    1 
ATOM   4197  C C8    . DG  B 2 40  ? 57.172  82.499  76.536  1.00   165.74 ? 40  DG  J C8    1 
ATOM   4198  N N7    . DG  B 2 40  ? 56.885  81.675  77.506  1.00   175.06 ? 40  DG  J N7    1 
ATOM   4199  C C5    . DG  B 2 40  ? 58.123  81.305  78.015  1.00   169.18 ? 40  DG  J C5    1 
ATOM   4200  C C6    . DG  B 2 40  ? 58.446  80.430  79.079  1.00   164.05 ? 40  DG  J C6    1 
ATOM   4201  O O6    . DG  B 2 40  ? 57.675  79.789  79.806  1.00   154.68 ? 40  DG  J O6    1 
ATOM   4202  N N1    . DG  B 2 40  ? 59.823  80.333  79.267  1.00   167.67 ? 40  DG  J N1    1 
ATOM   4203  C C2    . DG  B 2 40  ? 60.767  80.998  78.520  1.00   164.40 ? 40  DG  J C2    1 
ATOM   4204  N N2    . DG  B 2 40  ? 62.048  80.778  78.850  1.00   171.19 ? 40  DG  J N2    1 
ATOM   4205  N N3    . DG  B 2 40  ? 60.478  81.821  77.520  1.00   152.83 ? 40  DG  J N3    1 
ATOM   4206  C C4    . DG  B 2 40  ? 59.141  81.926  77.325  1.00   163.10 ? 40  DG  J C4    1 
ATOM   4207  P P     . DA  B 2 41  ? 59.755  85.150  71.291  1.00   157.58 ? 41  DA  J P     1 
ATOM   4208  O OP1   . DA  B 2 41  ? 60.776  86.096  70.786  1.00   112.58 ? 41  DA  J OP1   1 
ATOM   4209  O OP2   . DA  B 2 41  ? 58.316  85.413  71.069  1.00   138.01 ? 41  DA  J OP2   1 
ATOM   4210  O "O5'" . DA  B 2 41  ? 60.067  83.699  70.698  1.00   167.42 ? 41  DA  J "O5'" 1 
ATOM   4211  C "C5'" . DA  B 2 41  ? 59.934  82.554  71.525  1.00   161.85 ? 41  DA  J "C5'" 1 
ATOM   4212  C "C4'" . DA  B 2 41  ? 61.280  81.892  71.740  1.00   151.60 ? 41  DA  J "C4'" 1 
ATOM   4213  O "O4'" . DA  B 2 41  ? 61.312  81.273  73.045  1.00   145.45 ? 41  DA  J "O4'" 1 
ATOM   4214  C "C3'" . DA  B 2 41  ? 61.597  80.778  70.767  1.00   134.74 ? 41  DA  J "C3'" 1 
ATOM   4215  O "O3'" . DA  B 2 41  ? 63.000  80.621  70.646  1.00   157.61 ? 41  DA  J "O3'" 1 
ATOM   4216  C "C2'" . DA  B 2 41  ? 60.946  79.567  71.431  1.00   149.91 ? 41  DA  J "C2'" 1 
ATOM   4217  C "C1'" . DA  B 2 41  ? 61.087  79.881  72.924  1.00   145.85 ? 41  DA  J "C1'" 1 
ATOM   4218  N N9    . DA  B 2 41  ? 59.898  79.543  73.701  1.00   158.48 ? 41  DA  J N9    1 
ATOM   4219  C C8    . DA  B 2 41  ? 58.604  79.879  73.415  1.00   158.39 ? 41  DA  J C8    1 
ATOM   4220  N N7    . DA  B 2 41  ? 57.736  79.442  74.296  1.00   143.76 ? 41  DA  J N7    1 
ATOM   4221  C C5    . DA  B 2 41  ? 58.515  78.776  75.227  1.00   161.72 ? 41  DA  J C5    1 
ATOM   4222  C C6    . DA  B 2 41  ? 58.195  78.086  76.412  1.00   166.38 ? 41  DA  J C6    1 
ATOM   4223  N N6    . DA  B 2 41  ? 56.946  77.954  76.872  1.00   161.99 ? 41  DA  J N6    1 
ATOM   4224  N N1    . DA  B 2 41  ? 59.211  77.535  77.109  1.00   180.40 ? 41  DA  J N1    1 
ATOM   4225  C C2    . DA  B 2 41  ? 60.459  77.669  76.645  1.00   173.24 ? 41  DA  J C2    1 
ATOM   4226  N N3    . DA  B 2 41  ? 60.883  78.293  75.546  1.00   167.26 ? 41  DA  J N3    1 
ATOM   4227  C C4    . DA  B 2 41  ? 59.851  78.829  74.876  1.00   167.32 ? 41  DA  J C4    1 
ATOM   4228  P P     . DG  B 2 42  ? 63.630  80.083  69.271  1.00   158.82 ? 42  DG  J P     1 
ATOM   4229  O OP1   . DG  B 2 42  ? 65.044  80.514  69.229  1.00   142.75 ? 42  DG  J OP1   1 
ATOM   4230  O OP2   . DG  B 2 42  ? 62.712  80.474  68.178  1.00   110.17 ? 42  DG  J OP2   1 
ATOM   4231  O "O5'" . DG  B 2 42  ? 63.566  78.491  69.421  1.00   164.27 ? 42  DG  J "O5'" 1 
ATOM   4232  C "C5'" . DG  B 2 42  ? 64.163  77.859  70.550  1.00   131.20 ? 42  DG  J "C5'" 1 
ATOM   4233  C "C4'" . DG  B 2 42  ? 63.634  76.445  70.724  1.00   146.75 ? 42  DG  J "C4'" 1 
ATOM   4234  O "O4'" . DG  B 2 42  ? 62.406  76.469  71.492  1.00   167.48 ? 42  DG  J "O4'" 1 
ATOM   4235  C "C3'" . DG  B 2 42  ? 63.310  75.706  69.419  1.00   157.74 ? 42  DG  J "C3'" 1 
ATOM   4236  O "O3'" . DG  B 2 42  ? 64.049  74.495  69.352  1.00   157.18 ? 42  DG  J "O3'" 1 
ATOM   4237  C "C2'" . DG  B 2 42  ? 61.800  75.443  69.499  1.00   156.05 ? 42  DG  J "C2'" 1 
ATOM   4238  C "C1'" . DG  B 2 42  ? 61.552  75.471  70.998  1.00   156.26 ? 42  DG  J "C1'" 1 
ATOM   4239  N N9    . DG  B 2 42  ? 60.177  75.810  71.357  1.00   149.54 ? 42  DG  J N9    1 
ATOM   4240  C C8    . DG  B 2 42  ? 59.348  76.697  70.713  1.00   151.67 ? 42  DG  J C8    1 
ATOM   4241  N N7    . DG  B 2 42  ? 58.169  76.798  71.261  1.00   155.87 ? 42  DG  J N7    1 
ATOM   4242  C C5    . DG  B 2 42  ? 58.217  75.921  72.337  1.00   162.66 ? 42  DG  J C5    1 
ATOM   4243  C C6    . DG  B 2 42  ? 57.228  75.603  73.299  1.00   164.84 ? 42  DG  J C6    1 
ATOM   4244  O O6    . DG  B 2 42  ? 56.077  76.051  73.394  1.00   162.65 ? 42  DG  J O6    1 
ATOM   4245  N N1    . DG  B 2 42  ? 57.688  74.663  74.219  1.00   160.82 ? 42  DG  J N1    1 
ATOM   4246  C C2    . DG  B 2 42  ? 58.942  74.100  74.208  1.00   157.10 ? 42  DG  J C2    1 
ATOM   4247  N N2    . DG  B 2 42  ? 59.202  73.211  75.178  1.00   153.64 ? 42  DG  J N2    1 
ATOM   4248  N N3    . DG  B 2 42  ? 59.878  74.389  73.312  1.00   158.31 ? 42  DG  J N3    1 
ATOM   4249  C C4    . DG  B 2 42  ? 59.446  75.303  72.409  1.00   159.86 ? 42  DG  J C4    1 
ATOM   4250  P P     . DA  B 2 43  ? 64.037  73.616  68.007  1.00   156.72 ? 43  DA  J P     1 
ATOM   4251  O OP1   . DA  B 2 43  ? 65.335  72.909  67.932  1.00   165.72 ? 43  DA  J OP1   1 
ATOM   4252  O OP2   . DA  B 2 43  ? 63.613  74.494  66.894  1.00   129.10 ? 43  DA  J OP2   1 
ATOM   4253  O "O5'" . DA  B 2 43  ? 62.880  72.539  68.260  1.00   163.12 ? 43  DA  J "O5'" 1 
ATOM   4254  C "C5'" . DA  B 2 43  ? 63.025  71.577  69.299  1.00   159.12 ? 43  DA  J "C5'" 1 
ATOM   4255  C "C4'" . DA  B 2 43  ? 61.795  70.691  69.405  1.00   159.90 ? 43  DA  J "C4'" 1 
ATOM   4256  O "O4'" . DA  B 2 43  ? 60.702  71.430  69.998  1.00   170.50 ? 43  DA  J "O4'" 1 
ATOM   4257  C "C3'" . DA  B 2 43  ? 61.293  70.138  68.070  1.00   153.78 ? 43  DA  J "C3'" 1 
ATOM   4258  O "O3'" . DA  B 2 43  ? 61.295  68.713  68.107  1.00   156.75 ? 43  DA  J "O3'" 1 
ATOM   4259  C "C2'" . DA  B 2 43  ? 59.871  70.693  67.909  1.00   166.83 ? 43  DA  J "C2'" 1 
ATOM   4260  C "C1'" . DA  B 2 43  ? 59.503  71.163  69.310  1.00   168.53 ? 43  DA  J "C1'" 1 
ATOM   4261  N N9    . DA  B 2 43  ? 58.657  72.354  69.334  1.00   154.50 ? 43  DA  J N9    1 
ATOM   4262  C C8    . DA  B 2 43  ? 58.897  73.552  68.721  1.00   140.49 ? 43  DA  J C8    1 
ATOM   4263  N N7    . DA  B 2 43  ? 57.950  74.442  68.912  1.00   160.40 ? 43  DA  J N7    1 
ATOM   4264  C C5    . DA  B 2 43  ? 57.022  73.777  69.699  1.00   170.03 ? 43  DA  J C5    1 
ATOM   4265  C C6    . DA  B 2 43  ? 55.784  74.171  70.248  1.00   170.83 ? 43  DA  J C6    1 
ATOM   4266  N N6    . DA  B 2 43  ? 55.254  75.386  70.073  1.00   169.18 ? 43  DA  J N6    1 
ATOM   4267  N N1    . DA  B 2 43  ? 55.110  73.263  70.986  1.00   149.36 ? 43  DA  J N1    1 
ATOM   4268  C C2    . DA  B 2 43  ? 55.643  72.048  71.158  1.00   135.43 ? 43  DA  J C2    1 
ATOM   4269  N N3    . DA  B 2 43  ? 56.794  71.565  70.694  1.00   143.51 ? 43  DA  J N3    1 
ATOM   4270  C C4    . DA  B 2 43  ? 57.441  72.489  69.965  1.00   156.27 ? 43  DA  J C4    1 
ATOM   4271  P P     . DC  B 2 44  ? 60.792  67.864  66.837  1.00   183.13 ? 44  DC  J P     1 
ATOM   4272  O OP1   . DC  B 2 44  ? 61.407  66.521  66.933  1.00   173.13 ? 44  DC  J OP1   1 
ATOM   4273  O OP2   . DC  B 2 44  ? 61.012  68.684  65.625  1.00   160.37 ? 44  DC  J OP2   1 
ATOM   4274  O "O5'" . DC  B 2 44  ? 59.212  67.725  67.068  1.00   175.00 ? 44  DC  J "O5'" 1 
ATOM   4275  C "C5'" . DC  B 2 44  ? 58.719  67.200  68.296  1.00   150.64 ? 44  DC  J "C5'" 1 
ATOM   4276  C "C4'" . DC  B 2 44  ? 57.211  67.359  68.396  1.00   151.33 ? 44  DC  J "C4'" 1 
ATOM   4277  O "O4'" . DC  B 2 44  ? 56.869  68.756  68.472  1.00   174.66 ? 44  DC  J "O4'" 1 
ATOM   4278  C "C3'" . DC  B 2 44  ? 56.414  66.804  67.210  1.00   159.41 ? 44  DC  J "C3'" 1 
ATOM   4279  O "O3'" . DC  B 2 44  ? 55.742  65.610  67.592  1.00   171.55 ? 44  DC  J "O3'" 1 
ATOM   4280  C "C2'" . DC  B 2 44  ? 55.416  67.923  66.853  1.00   181.64 ? 44  DC  J "C2'" 1 
ATOM   4281  C "C1'" . DC  B 2 44  ? 55.551  68.897  68.018  1.00   185.43 ? 44  DC  J "C1'" 1 
ATOM   4282  N N1    . DC  B 2 44  ? 55.319  70.321  67.635  1.00   175.59 ? 44  DC  J N1    1 
ATOM   4283  C C2    . DC  B 2 44  ? 54.214  71.005  68.154  1.00   154.68 ? 44  DC  J C2    1 
ATOM   4284  O O2    . DC  B 2 44  ? 53.449  70.417  68.929  1.00   137.70 ? 44  DC  J O2    1 
ATOM   4285  N N3    . DC  B 2 44  ? 54.013  72.297  67.794  1.00   150.22 ? 44  DC  J N3    1 
ATOM   4286  C C4    . DC  B 2 44  ? 54.861  72.896  66.956  1.00   155.43 ? 44  DC  J C4    1 
ATOM   4287  N N4    . DC  B 2 44  ? 54.622  74.171  66.631  1.00   158.85 ? 44  DC  J N4    1 
ATOM   4288  C C5    . DC  B 2 44  ? 55.991  72.215  66.415  1.00   150.98 ? 44  DC  J C5    1 
ATOM   4289  C C6    . DC  B 2 44  ? 56.179  70.941  66.777  1.00   162.14 ? 44  DC  J C6    1 
ATOM   4290  P P     . DT  B 2 45  ? 55.058  64.674  66.478  1.00   201.38 ? 45  DT  J P     1 
ATOM   4291  O OP1   . DT  B 2 45  ? 55.380  63.271  66.820  1.00   198.27 ? 45  DT  J OP1   1 
ATOM   4292  O OP2   . DT  B 2 45  ? 55.425  65.206  65.147  1.00   184.70 ? 45  DT  J OP2   1 
ATOM   4293  O "O5'" . DT  B 2 45  ? 53.489  64.907  66.686  1.00   178.46 ? 45  DT  J "O5'" 1 
ATOM   4294  C "C5'" . DT  B 2 45  ? 52.878  64.557  67.923  1.00   166.85 ? 45  DT  J "C5'" 1 
ATOM   4295  C "C4'" . DT  B 2 45  ? 51.571  65.306  68.118  1.00   173.24 ? 45  DT  J "C4'" 1 
ATOM   4296  O "O4'" . DT  B 2 45  ? 51.799  66.716  67.948  1.00   184.33 ? 45  DT  J "O4'" 1 
ATOM   4297  C "C3'" . DT  B 2 45  ? 50.475  64.967  67.117  1.00   175.69 ? 45  DT  J "C3'" 1 
ATOM   4298  O "O3'" . DT  B 2 45  ? 49.634  63.945  67.640  1.00   172.66 ? 45  DT  J "O3'" 1 
ATOM   4299  C "C2'" . DT  B 2 45  ? 49.700  66.286  66.953  1.00   184.59 ? 45  DT  J "C2'" 1 
ATOM   4300  C "C1'" . DT  B 2 45  ? 50.571  67.333  67.654  1.00   184.63 ? 45  DT  J "C1'" 1 
ATOM   4301  N N1    . DT  B 2 45  ? 50.820  68.537  66.817  1.00   175.49 ? 45  DT  J N1    1 
ATOM   4302  C C2    . DT  B 2 45  ? 49.946  69.596  66.892  1.00   159.83 ? 45  DT  J C2    1 
ATOM   4303  O O2    . DT  B 2 45  ? 48.975  69.610  67.628  1.00   143.28 ? 45  DT  J O2    1 
ATOM   4304  N N3    . DT  B 2 45  ? 50.256  70.652  66.077  1.00   157.91 ? 45  DT  J N3    1 
ATOM   4305  C C4    . DT  B 2 45  ? 51.326  70.749  65.206  1.00   161.70 ? 45  DT  J C4    1 
ATOM   4306  O O4    . DT  B 2 45  ? 51.519  71.742  64.513  1.00   164.75 ? 45  DT  J O4    1 
ATOM   4307  C C5    . DT  B 2 45  ? 52.199  69.599  65.170  1.00   159.40 ? 45  DT  J C5    1 
ATOM   4308  C C7    . DT  B 2 45  ? 53.394  69.588  64.263  1.00   142.17 ? 45  DT  J C7    1 
ATOM   4309  C C6    . DT  B 2 45  ? 51.905  68.559  65.966  1.00   166.28 ? 45  DT  J C6    1 
ATOM   4310  P P     . DA  B 2 46  ? 48.579  63.198  66.683  1.00   163.19 ? 46  DA  J P     1 
ATOM   4311  O OP1   . DA  B 2 46  ? 48.145  61.960  67.367  1.00   183.02 ? 46  DA  J OP1   1 
ATOM   4312  O OP2   . DA  B 2 46  ? 49.179  63.123  65.333  1.00   132.02 ? 46  DA  J OP2   1 
ATOM   4313  O "O5'" . DA  B 2 46  ? 47.339  64.208  66.607  1.00   182.82 ? 46  DA  J "O5'" 1 
ATOM   4314  C "C5'" . DA  B 2 46  ? 46.693  64.637  67.802  1.00   177.56 ? 46  DA  J "C5'" 1 
ATOM   4315  C "C4'" . DA  B 2 46  ? 45.748  65.794  67.521  1.00   165.05 ? 46  DA  J "C4'" 1 
ATOM   4316  O "O4'" . DA  B 2 46  ? 46.491  66.903  66.946  1.00   167.73 ? 46  DA  J "O4'" 1 
ATOM   4317  C "C3'" . DA  B 2 46  ? 44.621  65.482  66.536  1.00   160.94 ? 46  DA  J "C3'" 1 
ATOM   4318  O "O3'" . DA  B 2 46  ? 43.411  66.065  66.987  1.00   159.24 ? 46  DA  J "O3'" 1 
ATOM   4319  C "C2'" . DA  B 2 46  ? 45.100  66.131  65.240  1.00   160.56 ? 46  DA  J "C2'" 1 
ATOM   4320  C "C1'" . DA  B 2 46  ? 45.844  67.343  65.773  1.00   161.51 ? 46  DA  J "C1'" 1 
ATOM   4321  N N9    . DA  B 2 46  ? 46.849  67.861  64.849  1.00   168.86 ? 46  DA  J N9    1 
ATOM   4322  C C8    . DA  B 2 46  ? 47.803  67.144  64.180  1.00   160.61 ? 46  DA  J C8    1 
ATOM   4323  N N7    . DA  B 2 46  ? 48.573  67.877  63.411  1.00   151.71 ? 46  DA  J N7    1 
ATOM   4324  C C5    . DA  B 2 46  ? 48.091  69.164  63.586  1.00   169.64 ? 46  DA  J C5    1 
ATOM   4325  C C6    . DA  B 2 46  ? 48.480  70.405  63.044  1.00   160.19 ? 46  DA  J C6    1 
ATOM   4326  N N6    . DA  B 2 46  ? 49.490  70.547  62.180  1.00   146.76 ? 46  DA  J N6    1 
ATOM   4327  N N1    . DA  B 2 46  ? 47.788  71.499  63.427  1.00   153.66 ? 46  DA  J N1    1 
ATOM   4328  C C2    . DA  B 2 46  ? 46.778  71.353  64.294  1.00   151.43 ? 46  DA  J C2    1 
ATOM   4329  N N3    . DA  B 2 46  ? 46.321  70.241  64.868  1.00   162.45 ? 46  DA  J N3    1 
ATOM   4330  C C4    . DA  B 2 46  ? 47.028  69.172  64.469  1.00   174.42 ? 46  DA  J C4    1 
ATOM   4331  P P     . DG  B 2 47  ? 42.006  65.357  66.667  1.00   170.24 ? 47  DG  J P     1 
ATOM   4332  O OP1   . DG  B 2 47  ? 41.583  64.626  67.882  1.00   187.82 ? 47  DG  J OP1   1 
ATOM   4333  O OP2   . DG  B 2 47  ? 42.148  64.637  65.382  1.00   125.36 ? 47  DG  J OP2   1 
ATOM   4334  O "O5'" . DG  B 2 47  ? 41.010  66.582  66.426  1.00   177.94 ? 47  DG  J "O5'" 1 
ATOM   4335  C "C5'" . DG  B 2 47  ? 41.032  67.697  67.306  1.00   163.92 ? 47  DG  J "C5'" 1 
ATOM   4336  C "C4'" . DG  B 2 47  ? 40.811  68.985  66.538  1.00   159.73 ? 47  DG  J "C4'" 1 
ATOM   4337  O "O4'" . DG  B 2 47  ? 41.973  69.269  65.727  1.00   170.47 ? 47  DG  J "O4'" 1 
ATOM   4338  C "C3'" . DG  B 2 47  ? 39.614  68.965  65.581  1.00   156.82 ? 47  DG  J "C3'" 1 
ATOM   4339  O "O3'" . DG  B 2 47  ? 38.650  69.927  65.992  1.00   163.56 ? 47  DG  J "O3'" 1 
ATOM   4340  C "C2'" . DG  B 2 47  ? 40.210  69.298  64.203  1.00   149.20 ? 47  DG  J "C2'" 1 
ATOM   4341  C "C1'" . DG  B 2 47  ? 41.560  69.908  64.549  1.00   162.05 ? 47  DG  J "C1'" 1 
ATOM   4342  N N9    . DG  B 2 47  ? 42.577  69.686  63.524  1.00   154.67 ? 47  DG  J N9    1 
ATOM   4343  C C8    . DG  B 2 47  ? 42.925  68.486  62.952  1.00   164.58 ? 47  DG  J C8    1 
ATOM   4344  N N7    . DG  B 2 47  ? 43.871  68.590  62.060  1.00   164.92 ? 47  DG  J N7    1 
ATOM   4345  C C5    . DG  B 2 47  ? 44.171  69.946  62.038  1.00   163.08 ? 47  DG  J C5    1 
ATOM   4346  C C6    . DG  B 2 47  ? 45.119  70.657  61.265  1.00   157.48 ? 47  DG  J C6    1 
ATOM   4347  O O6    . DG  B 2 47  ? 45.907  70.214  60.417  1.00   152.13 ? 47  DG  J O6    1 
ATOM   4348  N N1    . DG  B 2 47  ? 45.100  72.020  61.552  1.00   157.06 ? 47  DG  J N1    1 
ATOM   4349  C C2    . DG  B 2 47  ? 44.270  72.619  62.470  1.00   165.16 ? 47  DG  J C2    1 
ATOM   4350  N N2    . DG  B 2 47  ? 44.398  73.946  62.611  1.00   154.91 ? 47  DG  J N2    1 
ATOM   4351  N N3    . DG  B 2 47  ? 43.378  71.963  63.202  1.00   175.75 ? 47  DG  J N3    1 
ATOM   4352  C C4    . DG  B 2 47  ? 43.383  70.635  62.934  1.00   167.29 ? 47  DG  J C4    1 
ATOM   4353  P P     . DG  B 2 48  ? 37.316  70.164  65.127  1.00   172.26 ? 48  DG  J P     1 
ATOM   4354  O OP1   . DG  B 2 48  ? 36.265  70.648  66.050  1.00   148.10 ? 48  DG  J OP1   1 
ATOM   4355  O OP2   . DG  B 2 48  ? 37.069  68.953  64.311  1.00   134.50 ? 48  DG  J OP2   1 
ATOM   4356  O "O5'" . DG  B 2 48  ? 37.717  71.355  64.139  1.00   175.58 ? 48  DG  J "O5'" 1 
ATOM   4357  C "C5'" . DG  B 2 48  ? 38.401  72.496  64.647  1.00   163.64 ? 48  DG  J "C5'" 1 
ATOM   4358  C "C4'" . DG  B 2 48  ? 38.783  73.439  63.522  1.00   146.86 ? 48  DG  J "C4'" 1 
ATOM   4359  O "O4'" . DG  B 2 48  ? 39.879  72.869  62.761  1.00   140.62 ? 48  DG  J "O4'" 1 
ATOM   4360  C "C3'" . DG  B 2 48  ? 37.663  73.728  62.525  1.00   160.12 ? 48  DG  J "C3'" 1 
ATOM   4361  O "O3'" . DG  B 2 48  ? 37.624  75.115  62.217  1.00   164.45 ? 48  DG  J "O3'" 1 
ATOM   4362  C "C2'" . DG  B 2 48  ? 38.034  72.882  61.307  1.00   157.64 ? 48  DG  J "C2'" 1 
ATOM   4363  C "C1'" . DG  B 2 48  ? 39.553  72.835  61.390  1.00   148.63 ? 48  DG  J "C1'" 1 
ATOM   4364  N N9    . DG  B 2 48  ? 40.120  71.616  60.818  1.00   174.19 ? 48  DG  J N9    1 
ATOM   4365  C C8    . DG  B 2 48  ? 39.614  70.343  60.927  1.00   166.47 ? 48  DG  J C8    1 
ATOM   4366  N N7    . DG  B 2 48  ? 40.331  69.444  60.313  1.00   169.77 ? 48  DG  J N7    1 
ATOM   4367  C C5    . DG  B 2 48  ? 41.382  70.165  59.761  1.00   172.14 ? 48  DG  J C5    1 
ATOM   4368  C C6    . DG  B 2 48  ? 42.478  69.725  58.982  1.00   164.66 ? 48  DG  J C6    1 
ATOM   4369  O O6    . DG  B 2 48  ? 42.746  68.573  58.614  1.00   167.79 ? 48  DG  J O6    1 
ATOM   4370  N N1    . DG  B 2 48  ? 43.313  70.781  58.625  1.00   152.04 ? 48  DG  J N1    1 
ATOM   4371  C C2    . DG  B 2 48  ? 43.114  72.094  58.977  1.00   157.18 ? 48  DG  J C2    1 
ATOM   4372  N N2    . DG  B 2 48  ? 44.029  72.970  58.539  1.00   164.13 ? 48  DG  J N2    1 
ATOM   4373  N N3    . DG  B 2 48  ? 42.090  72.521  59.707  1.00   165.39 ? 48  DG  J N3    1 
ATOM   4374  C C4    . DG  B 2 48  ? 41.267  71.505  60.063  1.00   175.39 ? 48  DG  J C4    1 
ATOM   4375  P P     . DG  B 2 49  ? 36.330  75.985  62.606  1.00   146.40 ? 49  DG  J P     1 
ATOM   4376  O OP1   . DG  B 2 49  ? 36.196  75.947  64.080  1.00   119.10 ? 49  DG  J OP1   1 
ATOM   4377  O OP2   . DG  B 2 49  ? 35.210  75.537  61.750  1.00   155.76 ? 49  DG  J OP2   1 
ATOM   4378  O "O5'" . DG  B 2 49  ? 36.717  77.472  62.167  1.00   157.39 ? 49  DG  J "O5'" 1 
ATOM   4379  C "C5'" . DG  B 2 49  ? 37.779  78.149  62.820  1.00   147.41 ? 49  DG  J "C5'" 1 
ATOM   4380  C "C4'" . DG  B 2 49  ? 38.861  78.535  61.829  1.00   156.41 ? 49  DG  J "C4'" 1 
ATOM   4381  O "O4'" . DG  B 2 49  ? 39.330  77.349  61.133  1.00   151.42 ? 49  DG  J "O4'" 1 
ATOM   4382  C "C3'" . DG  B 2 49  ? 38.427  79.524  60.747  1.00   168.09 ? 49  DG  J "C3'" 1 
ATOM   4383  O "O3'" . DG  B 2 49  ? 39.447  80.494  60.537  1.00   164.58 ? 49  DG  J "O3'" 1 
ATOM   4384  C "C2'" . DG  B 2 49  ? 38.231  78.639  59.518  1.00   161.27 ? 49  DG  J "C2'" 1 
ATOM   4385  C "C1'" . DG  B 2 49  ? 39.281  77.562  59.739  1.00   148.12 ? 49  DG  J "C1'" 1 
ATOM   4386  N N9    . DG  B 2 49  ? 38.953  76.295  59.091  1.00   166.62 ? 49  DG  J N9    1 
ATOM   4387  C C8    . DG  B 2 49  ? 37.758  75.620  59.156  1.00   161.65 ? 49  DG  J C8    1 
ATOM   4388  N N7    . DG  B 2 49  ? 37.750  74.509  58.472  1.00   164.54 ? 49  DG  J N7    1 
ATOM   4389  C C5    . DG  B 2 49  ? 39.022  74.442  57.918  1.00   173.41 ? 49  DG  J C5    1 
ATOM   4390  C C6    . DG  B 2 49  ? 39.599  73.459  57.079  1.00   171.66 ? 49  DG  J C6    1 
ATOM   4391  O O6    . DG  B 2 49  ? 39.081  72.419  56.645  1.00   168.44 ? 49  DG  J O6    1 
ATOM   4392  N N1    . DG  B 2 49  ? 40.913  73.775  56.743  1.00   155.93 ? 49  DG  J N1    1 
ATOM   4393  C C2    . DG  B 2 49  ? 41.584  74.898  57.165  1.00   151.32 ? 49  DG  J C2    1 
ATOM   4394  N N2    . DG  B 2 49  ? 42.847  75.031  56.736  1.00   157.07 ? 49  DG  J N2    1 
ATOM   4395  N N3    . DG  B 2 49  ? 41.055  75.827  57.952  1.00   160.06 ? 49  DG  J N3    1 
ATOM   4396  C C4    . DG  B 2 49  ? 39.775  75.534  58.289  1.00   169.34 ? 49  DG  J C4    1 
ATOM   4397  P P     . DA  B 2 50  ? 39.137  81.820  59.684  1.00   163.51 ? 50  DA  J P     1 
ATOM   4398  O OP1   . DA  B 2 50  ? 39.758  82.962  60.390  1.00   135.53 ? 50  DA  J OP1   1 
ATOM   4399  O OP2   . DA  B 2 50  ? 37.686  81.841  59.392  1.00   145.80 ? 50  DA  J OP2   1 
ATOM   4400  O "O5'" . DA  B 2 50  ? 39.915  81.578  58.306  1.00   150.39 ? 50  DA  J "O5'" 1 
ATOM   4401  C "C5'" . DA  B 2 50  ? 41.329  81.436  58.308  1.00   131.31 ? 50  DA  J "C5'" 1 
ATOM   4402  C "C4'" . DA  B 2 50  ? 41.817  80.822  57.008  1.00   146.35 ? 50  DA  J "C4'" 1 
ATOM   4403  O "O4'" . DA  B 2 50  ? 41.223  79.508  56.835  1.00   154.98 ? 50  DA  J "O4'" 1 
ATOM   4404  C "C3'" . DA  B 2 50  ? 41.475  81.615  55.741  1.00   134.60 ? 50  DA  J "C3'" 1 
ATOM   4405  O "O3'" . DA  B 2 50  ? 42.614  81.683  54.892  1.00   129.93 ? 50  DA  J "O3'" 1 
ATOM   4406  C "C2'" . DA  B 2 50  ? 40.355  80.793  55.105  1.00   138.54 ? 50  DA  J "C2'" 1 
ATOM   4407  C "C1'" . DA  B 2 50  ? 40.753  79.387  55.514  1.00   153.91 ? 50  DA  J "C1'" 1 
ATOM   4408  N N9    . DA  B 2 50  ? 39.647  78.436  55.493  1.00   161.13 ? 50  DA  J N9    1 
ATOM   4409  C C8    . DA  B 2 50  ? 38.393  78.617  56.006  1.00   165.39 ? 50  DA  J C8    1 
ATOM   4410  N N7    . DA  B 2 50  ? 37.598  77.586  55.838  1.00   170.59 ? 50  DA  J N7    1 
ATOM   4411  C C5    . DA  B 2 50  ? 38.387  76.665  55.168  1.00   177.64 ? 50  DA  J C5    1 
ATOM   4412  C C6    . DA  B 2 50  ? 38.132  75.361  54.696  1.00   174.77 ? 50  DA  J C6    1 
ATOM   4413  N N6    . DA  B 2 50  ? 36.955  74.743  54.840  1.00   158.06 ? 50  DA  J N6    1 
ATOM   4414  N N1    . DA  B 2 50  ? 39.138  74.716  54.069  1.00   175.97 ? 50  DA  J N1    1 
ATOM   4415  C C2    . DA  B 2 50  ? 40.315  75.338  53.927  1.00   163.82 ? 50  DA  J C2    1 
ATOM   4416  N N3    . DA  B 2 50  ? 40.672  76.557  54.327  1.00   161.84 ? 50  DA  J N3    1 
ATOM   4417  C C4    . DA  B 2 50  ? 39.652  77.173  54.947  1.00   171.24 ? 50  DA  J C4    1 
ATOM   4418  P P     . DG  B 2 51  ? 42.693  82.780  53.720  1.00   142.14 ? 51  DG  J P     1 
ATOM   4419  O OP1   . DG  B 2 51  ? 43.820  83.686  54.034  1.00   143.32 ? 51  DG  J OP1   1 
ATOM   4420  O OP2   . DG  B 2 51  ? 41.339  83.339  53.514  1.00   147.66 ? 51  DG  J OP2   1 
ATOM   4421  O "O5'" . DG  B 2 51  ? 43.072  81.924  52.423  1.00   150.83 ? 51  DG  J "O5'" 1 
ATOM   4422  C "C5'" . DG  B 2 51  ? 44.304  81.216  52.378  1.00   150.50 ? 51  DG  J "C5'" 1 
ATOM   4423  C "C4'" . DG  B 2 51  ? 44.261  80.123  51.325  1.00   153.06 ? 51  DG  J "C4'" 1 
ATOM   4424  O "O4'" . DG  B 2 51  ? 43.254  79.143  51.686  1.00   159.26 ? 51  DG  J "O4'" 1 
ATOM   4425  C "C3'" . DG  B 2 51  ? 43.915  80.599  49.912  1.00   156.79 ? 51  DG  J "C3'" 1 
ATOM   4426  O "O3'" . DG  B 2 51  ? 44.814  80.026  48.971  1.00   163.24 ? 51  DG  J "O3'" 1 
ATOM   4427  C "C2'" . DG  B 2 51  ? 42.484  80.104  49.702  1.00   150.42 ? 51  DG  J "C2'" 1 
ATOM   4428  C "C1'" . DG  B 2 51  ? 42.453  78.854  50.566  1.00   157.85 ? 51  DG  J "C1'" 1 
ATOM   4429  N N9    . DG  B 2 51  ? 41.114  78.508  51.036  1.00   164.73 ? 51  DG  J N9    1 
ATOM   4430  C C8    . DG  B 2 51  ? 40.282  79.284  51.805  1.00   168.28 ? 51  DG  J C8    1 
ATOM   4431  N N7    . DG  B 2 51  ? 39.140  78.715  52.073  1.00   171.89 ? 51  DG  J N7    1 
ATOM   4432  C C5    . DG  B 2 51  ? 39.219  77.480  51.442  1.00   175.65 ? 51  DG  J C5    1 
ATOM   4433  C C6    . DG  B 2 51  ? 38.276  76.426  51.382  1.00   184.48 ? 51  DG  J C6    1 
ATOM   4434  O O6    . DG  B 2 51  ? 37.148  76.373  51.893  1.00   175.29 ? 51  DG  J O6    1 
ATOM   4435  N N1    . DG  B 2 51  ? 38.754  75.349  50.638  1.00   194.38 ? 51  DG  J N1    1 
ATOM   4436  C C2    . DG  B 2 51  ? 39.986  75.299  50.029  1.00   193.63 ? 51  DG  J C2    1 
ATOM   4437  N N2    . DG  B 2 51  ? 40.270  74.176  49.354  1.00   185.08 ? 51  DG  J N2    1 
ATOM   4438  N N3    . DG  B 2 51  ? 40.879  76.281  50.077  1.00   186.62 ? 51  DG  J N3    1 
ATOM   4439  C C4    . DG  B 2 51  ? 40.428  77.337  50.799  1.00   176.37 ? 51  DG  J C4    1 
ATOM   4440  P P     . DT  B 2 52  ? 44.800  80.514  47.440  1.00   186.65 ? 52  DT  J P     1 
ATOM   4441  O OP1   . DT  B 2 52  ? 46.174  80.365  46.911  1.00   140.52 ? 52  DT  J OP1   1 
ATOM   4442  O OP2   . DT  B 2 52  ? 44.135  81.835  47.395  1.00   175.83 ? 52  DT  J OP2   1 
ATOM   4443  O "O5'" . DT  B 2 52  ? 43.846  79.456  46.711  1.00   189.33 ? 52  DT  J "O5'" 1 
ATOM   4444  C "C5'" . DT  B 2 52  ? 44.202  78.079  46.694  1.00   174.85 ? 52  DT  J "C5'" 1 
ATOM   4445  C "C4'" . DT  B 2 52  ? 43.118  77.240  46.041  1.00   170.55 ? 52  DT  J "C4'" 1 
ATOM   4446  O "O4'" . DT  B 2 52  ? 42.040  77.027  46.968  1.00   156.83 ? 52  DT  J "O4'" 1 
ATOM   4447  C "C3'" . DT  B 2 52  ? 42.447  77.870  44.837  1.00   186.63 ? 52  DT  J "C3'" 1 
ATOM   4448  O "O3'" . DT  B 2 52  ? 43.220  77.629  43.665  1.00   201.44 ? 52  DT  J "O3'" 1 
ATOM   4449  C "C2'" . DT  B 2 52  ? 41.101  77.137  44.783  1.00   186.03 ? 52  DT  J "C2'" 1 
ATOM   4450  C "C1'" . DT  B 2 52  ? 40.878  76.688  46.237  1.00   185.74 ? 52  DT  J "C1'" 1 
ATOM   4451  N N1    . DT  B 2 52  ? 39.695  77.325  46.884  1.00   188.22 ? 52  DT  J N1    1 
ATOM   4452  C C2    . DT  B 2 52  ? 38.529  76.604  47.009  1.00   177.85 ? 52  DT  J C2    1 
ATOM   4453  O O2    . DT  B 2 52  ? 38.408  75.457  46.618  1.00   178.27 ? 52  DT  J O2    1 
ATOM   4454  N N3    . DT  B 2 52  ? 37.502  77.277  47.614  1.00   164.21 ? 52  DT  J N3    1 
ATOM   4455  C C4    . DT  B 2 52  ? 37.522  78.573  48.096  1.00   174.38 ? 52  DT  J C4    1 
ATOM   4456  O O4    . DT  B 2 52  ? 36.544  79.091  48.625  1.00   190.45 ? 52  DT  J O4    1 
ATOM   4457  C C5    . DT  B 2 52  ? 38.774  79.274  47.932  1.00   173.50 ? 52  DT  J C5    1 
ATOM   4458  C C7    . DT  B 2 52  ? 38.917  80.686  48.416  1.00   168.67 ? 52  DT  J C7    1 
ATOM   4459  C C6    . DT  B 2 52  ? 39.788  78.624  47.340  1.00   179.87 ? 52  DT  J C6    1 
ATOM   4460  P P     . DA  B 2 53  ? 42.888  78.409  42.299  1.00   188.11 ? 53  DA  J P     1 
ATOM   4461  O OP1   . DA  B 2 53  ? 44.088  78.335  41.436  1.00   155.68 ? 53  DA  J OP1   1 
ATOM   4462  O OP2   . DA  B 2 53  ? 42.322  79.727  42.662  1.00   180.33 ? 53  DA  J OP2   1 
ATOM   4463  O "O5'" . DA  B 2 53  ? 41.718  77.543  41.635  1.00   183.45 ? 53  DA  J "O5'" 1 
ATOM   4464  C "C5'" . DA  B 2 53  ? 41.914  76.156  41.384  1.00   186.16 ? 53  DA  J "C5'" 1 
ATOM   4465  C "C4'" . DA  B 2 53  ? 40.595  75.467  41.084  1.00   186.22 ? 53  DA  J "C4'" 1 
ATOM   4466  O "O4'" . DA  B 2 53  ? 39.672  75.684  42.186  1.00   188.48 ? 53  DA  J "O4'" 1 
ATOM   4467  C "C3'" . DA  B 2 53  ? 39.877  75.961  39.826  1.00   198.09 ? 53  DA  J "C3'" 1 
ATOM   4468  O "O3'" . DA  B 2 53  ? 39.317  74.859  39.122  1.00   216.00 ? 53  DA  J "O3'" 1 
ATOM   4469  C "C2'" . DA  B 2 53  ? 38.791  76.877  40.385  1.00   198.22 ? 53  DA  J "C2'" 1 
ATOM   4470  C "C1'" . DA  B 2 53  ? 38.449  76.174  41.687  1.00   195.34 ? 53  DA  J "C1'" 1 
ATOM   4471  N N9    . DA  B 2 53  ? 37.854  77.057  42.686  1.00   191.54 ? 53  DA  J N9    1 
ATOM   4472  C C8    . DA  B 2 53  ? 38.293  78.298  43.055  1.00   184.52 ? 53  DA  J C8    1 
ATOM   4473  N N7    . DA  B 2 53  ? 37.557  78.867  43.981  1.00   177.70 ? 53  DA  J N7    1 
ATOM   4474  C C5    . DA  B 2 53  ? 36.565  77.934  44.236  1.00   184.81 ? 53  DA  J C5    1 
ATOM   4475  C C6    . DA  B 2 53  ? 35.467  77.931  45.121  1.00   177.38 ? 53  DA  J C6    1 
ATOM   4476  N N6    . DA  B 2 53  ? 35.182  78.946  45.943  1.00   162.67 ? 53  DA  J N6    1 
ATOM   4477  N N1    . DA  B 2 53  ? 34.672  76.842  45.126  1.00   183.94 ? 53  DA  J N1    1 
ATOM   4478  C C2    . DA  B 2 53  ? 34.960  75.828  44.301  1.00   189.56 ? 53  DA  J C2    1 
ATOM   4479  N N3    . DA  B 2 53  ? 35.961  75.715  43.429  1.00   171.04 ? 53  DA  J N3    1 
ATOM   4480  C C4    . DA  B 2 53  ? 36.733  76.812  43.446  1.00   184.24 ? 53  DA  J C4    1 
ATOM   4481  P P     . DA  B 2 54  ? 38.522  75.096  37.745  1.00   237.12 ? 54  DA  J P     1 
ATOM   4482  O OP1   . DA  B 2 54  ? 38.668  73.869  36.931  1.00   210.95 ? 54  DA  J OP1   1 
ATOM   4483  O OP2   . DA  B 2 54  ? 38.952  76.399  37.191  1.00   225.61 ? 54  DA  J OP2   1 
ATOM   4484  O "O5'" . DA  B 2 54  ? 36.993  75.231  38.201  1.00   212.15 ? 54  DA  J "O5'" 1 
ATOM   4485  C "C5'" . DA  B 2 54  ? 36.363  74.154  38.885  1.00   189.09 ? 54  DA  J "C5'" 1 
ATOM   4486  C "C4'" . DA  B 2 54  ? 34.939  74.511  39.278  1.00   183.42 ? 54  DA  J "C4'" 1 
ATOM   4487  O "O4'" . DA  B 2 54  ? 34.955  75.483  40.358  1.00   196.44 ? 54  DA  J "O4'" 1 
ATOM   4488  C "C3'" . DA  B 2 54  ? 34.083  75.125  38.162  1.00   192.73 ? 54  DA  J "C3'" 1 
ATOM   4489  O "O3'" . DA  B 2 54  ? 32.824  74.462  38.105  1.00   195.00 ? 54  DA  J "O3'" 1 
ATOM   4490  C "C2'" . DA  B 2 54  ? 33.927  76.584  38.597  1.00   196.56 ? 54  DA  J "C2'" 1 
ATOM   4491  C "C1'" . DA  B 2 54  ? 33.966  76.449  40.106  1.00   198.29 ? 54  DA  J "C1'" 1 
ATOM   4492  N N9    . DA  B 2 54  ? 34.322  77.686  40.796  1.00   202.31 ? 54  DA  J N9    1 
ATOM   4493  C C8    . DA  B 2 54  ? 35.455  78.432  40.624  1.00   196.66 ? 54  DA  J C8    1 
ATOM   4494  N N7    . DA  B 2 54  ? 35.503  79.503  41.382  1.00   181.91 ? 54  DA  J N7    1 
ATOM   4495  C C5    . DA  B 2 54  ? 34.319  79.456  42.100  1.00   177.58 ? 54  DA  J C5    1 
ATOM   4496  C C6    . DA  B 2 54  ? 33.767  80.307  43.079  1.00   165.01 ? 54  DA  J C6    1 
ATOM   4497  N N6    . DA  B 2 54  ? 34.370  81.418  43.514  1.00   157.57 ? 54  DA  J N6    1 
ATOM   4498  N N1    . DA  B 2 54  ? 32.566  79.971  43.594  1.00   165.94 ? 54  DA  J N1    1 
ATOM   4499  C C2    . DA  B 2 54  ? 31.965  78.858  43.157  1.00   167.23 ? 54  DA  J C2    1 
ATOM   4500  N N3    . DA  B 2 54  ? 32.384  77.982  42.244  1.00   166.19 ? 54  DA  J N3    1 
ATOM   4501  C C4    . DA  B 2 54  ? 33.579  78.343  41.750  1.00   181.44 ? 54  DA  J C4    1 
ATOM   4502  P P     . DT  B 2 55  ? 31.820  74.704  36.871  1.00   196.01 ? 55  DT  J P     1 
ATOM   4503  O OP1   . DT  B 2 55  ? 31.608  73.392  36.221  1.00   186.14 ? 55  DT  J OP1   1 
ATOM   4504  O OP2   . DT  B 2 55  ? 32.309  75.844  36.065  1.00   184.48 ? 55  DT  J OP2   1 
ATOM   4505  O "O5'" . DT  B 2 55  ? 30.455  75.146  37.579  1.00   178.04 ? 55  DT  J "O5'" 1 
ATOM   4506  C "C5'" . DT  B 2 55  ? 29.795  74.244  38.460  1.00   179.30 ? 55  DT  J "C5'" 1 
ATOM   4507  C "C4'" . DT  B 2 55  ? 28.791  74.970  39.338  1.00   160.03 ? 55  DT  J "C4'" 1 
ATOM   4508  O "O4'" . DT  B 2 55  ? 29.483  75.863  40.236  1.00   153.46 ? 55  DT  J "O4'" 1 
ATOM   4509  C "C3'" . DT  B 2 55  ? 27.818  75.865  38.600  1.00   149.79 ? 55  DT  J "C3'" 1 
ATOM   4510  O "O3'" . DT  B 2 55  ? 26.734  75.096  38.095  1.00   137.18 ? 55  DT  J "O3'" 1 
ATOM   4511  C "C2'" . DT  B 2 55  ? 27.366  76.819  39.706  1.00   162.30 ? 55  DT  J "C2'" 1 
ATOM   4512  C "C1'" . DT  B 2 55  ? 28.619  76.933  40.585  1.00   167.17 ? 55  DT  J "C1'" 1 
ATOM   4513  N N1    . DT  B 2 55  ? 29.354  78.221  40.413  1.00   174.70 ? 55  DT  J N1    1 
ATOM   4514  C C2    . DT  B 2 55  ? 29.142  79.241  41.312  1.00   156.86 ? 55  DT  J C2    1 
ATOM   4515  O O2    . DT  B 2 55  ? 28.379  79.149  42.258  1.00   133.51 ? 55  DT  J O2    1 
ATOM   4516  N N3    . DT  B 2 55  ? 29.862  80.379  41.067  1.00   150.49 ? 55  DT  J N3    1 
ATOM   4517  C C4    . DT  B 2 55  ? 30.754  80.597  40.032  1.00   156.19 ? 55  DT  J C4    1 
ATOM   4518  O O4    . DT  B 2 55  ? 31.353  81.659  39.895  1.00   153.13 ? 55  DT  J O4    1 
ATOM   4519  C C5    . DT  B 2 55  ? 30.928  79.489  39.124  1.00   171.15 ? 55  DT  J C5    1 
ATOM   4520  C C7    . DT  B 2 55  ? 31.870  79.607  37.962  1.00   168.13 ? 55  DT  J C7    1 
ATOM   4521  C C6    . DT  B 2 55  ? 30.229  78.368  39.355  1.00   177.95 ? 55  DT  J C6    1 
ATOM   4522  P P     . DC  B 2 56  ? 25.573  75.805  37.242  1.00   178.61 ? 56  DC  J P     1 
ATOM   4523  O OP1   . DC  B 2 56  ? 24.940  74.770  36.394  1.00   183.74 ? 56  DC  J OP1   1 
ATOM   4524  O OP2   . DC  B 2 56  ? 26.149  77.019  36.620  1.00   149.22 ? 56  DC  J OP2   1 
ATOM   4525  O "O5'" . DC  B 2 56  ? 24.522  76.279  38.350  1.00   187.97 ? 56  DC  J "O5'" 1 
ATOM   4526  C "C5'" . DC  B 2 56  ? 23.560  77.276  38.039  1.00   183.27 ? 56  DC  J "C5'" 1 
ATOM   4527  C "C4'" . DC  B 2 56  ? 23.248  78.115  39.265  1.00   177.62 ? 56  DC  J "C4'" 1 
ATOM   4528  O "O4'" . DC  B 2 56  ? 24.465  78.756  39.737  1.00   173.61 ? 56  DC  J "O4'" 1 
ATOM   4529  C "C3'" . DC  B 2 56  ? 22.241  79.239  39.036  1.00   153.90 ? 56  DC  J "C3'" 1 
ATOM   4530  O "O3'" . DC  B 2 56  ? 21.416  79.390  40.182  1.00   154.39 ? 56  DC  J "O3'" 1 
ATOM   4531  C "C2'" . DC  B 2 56  ? 23.135  80.456  38.822  1.00   136.82 ? 56  DC  J "C2'" 1 
ATOM   4532  C "C1'" . DC  B 2 56  ? 24.285  80.156  39.771  1.00   152.24 ? 56  DC  J "C1'" 1 
ATOM   4533  N N1    . DC  B 2 56  ? 25.566  80.808  39.374  1.00   147.26 ? 56  DC  J N1    1 
ATOM   4534  C C2    . DC  B 2 56  ? 26.144  81.769  40.210  1.00   143.85 ? 56  DC  J C2    1 
ATOM   4535  O O2    . DC  B 2 56  ? 25.582  82.060  41.273  1.00   147.45 ? 56  DC  J O2    1 
ATOM   4536  N N3    . DC  B 2 56  ? 27.307  82.354  39.832  1.00   145.74 ? 56  DC  J N3    1 
ATOM   4537  C C4    . DC  B 2 56  ? 27.882  82.012  38.677  1.00   151.81 ? 56  DC  J C4    1 
ATOM   4538  N N4    . DC  B 2 56  ? 29.028  82.615  38.346  1.00   160.38 ? 56  DC  J N4    1 
ATOM   4539  C C5    . DC  B 2 56  ? 27.307  81.036  37.811  1.00   148.48 ? 56  DC  J C5    1 
ATOM   4540  C C6    . DC  B 2 56  ? 26.160  80.466  38.195  1.00   153.63 ? 56  DC  J C6    1 
ATOM   4541  P P     . DC  B 2 57  ? 19.937  80.002  40.037  1.00   149.89 ? 57  DC  J P     1 
ATOM   4542  O OP1   . DC  B 2 57  ? 19.206  79.718  41.292  1.00   109.29 ? 57  DC  J OP1   1 
ATOM   4543  O OP2   . DC  B 2 57  ? 19.386  79.538  38.744  1.00   133.85 ? 57  DC  J OP2   1 
ATOM   4544  O "O5'" . DC  B 2 57  ? 20.187  81.578  39.922  1.00   176.70 ? 57  DC  J "O5'" 1 
ATOM   4545  C "C5'" . DC  B 2 57  ? 20.881  82.267  40.958  1.00   154.59 ? 57  DC  J "C5'" 1 
ATOM   4546  C "C4'" . DC  B 2 57  ? 21.221  83.683  40.528  1.00   118.72 ? 57  DC  J "C4'" 1 
ATOM   4547  O "O4'" . DC  B 2 57  ? 22.544  83.715  39.940  1.00   120.26 ? 57  DC  J "O4'" 1 
ATOM   4548  C "C3'" . DC  B 2 57  ? 20.271  84.288  39.487  1.00   123.61 ? 57  DC  J "C3'" 1 
ATOM   4549  O "O3'" . DC  B 2 57  ? 19.799  85.546  39.940  1.00   140.20 ? 57  DC  J "O3'" 1 
ATOM   4550  C "C2'" . DC  B 2 57  ? 21.143  84.433  38.234  1.00   118.49 ? 57  DC  J "C2'" 1 
ATOM   4551  C "C1'" . DC  B 2 57  ? 22.527  84.585  38.838  1.00   127.46 ? 57  DC  J "C1'" 1 
ATOM   4552  N N1    . DC  B 2 57  ? 23.633  84.204  37.912  1.00   148.64 ? 57  DC  J N1    1 
ATOM   4553  C C2    . DC  B 2 57  ? 24.923  84.703  38.130  1.00   146.06 ? 57  DC  J C2    1 
ATOM   4554  O O2    . DC  B 2 57  ? 25.124  85.452  39.095  1.00   139.62 ? 57  DC  J O2    1 
ATOM   4555  N N3    . DC  B 2 57  ? 25.917  84.350  37.279  1.00   137.25 ? 57  DC  J N3    1 
ATOM   4556  C C4    . DC  B 2 57  ? 25.659  83.540  36.250  1.00   147.77 ? 57  DC  J C4    1 
ATOM   4557  N N4    . DC  B 2 57  ? 26.672  83.219  35.438  1.00   125.01 ? 57  DC  J N4    1 
ATOM   4558  C C5    . DC  B 2 57  ? 24.352  83.022  36.010  1.00   160.86 ? 57  DC  J C5    1 
ATOM   4559  C C6    . DC  B 2 57  ? 23.379  83.378  36.856  1.00   145.20 ? 57  DC  J C6    1 
ATOM   4560  P P     . DC  B 2 58  ? 18.396  85.653  40.716  1.00   149.95 ? 58  DC  J P     1 
ATOM   4561  O OP1   . DC  B 2 58  ? 18.164  84.370  41.417  1.00   114.03 ? 58  DC  J OP1   1 
ATOM   4562  O OP2   . DC  B 2 58  ? 17.388  86.158  39.758  1.00   157.87 ? 58  DC  J OP2   1 
ATOM   4563  O "O5'" . DC  B 2 58  ? 18.654  86.798  41.802  1.00   146.55 ? 58  DC  J "O5'" 1 
ATOM   4564  C "C5'" . DC  B 2 58  ? 19.612  86.592  42.833  1.00   145.00 ? 58  DC  J "C5'" 1 
ATOM   4565  C "C4'" . DC  B 2 58  ? 20.568  87.769  42.929  1.00   133.71 ? 58  DC  J "C4'" 1 
ATOM   4566  O "O4'" . DC  B 2 58  ? 21.584  87.660  41.899  1.00   130.62 ? 58  DC  J "O4'" 1 
ATOM   4567  C "C3'" . DC  B 2 58  ? 19.922  89.147  42.756  1.00   139.40 ? 58  DC  J "C3'" 1 
ATOM   4568  O "O3'" . DC  B 2 58  ? 20.361  90.018  43.792  1.00   155.95 ? 58  DC  J "O3'" 1 
ATOM   4569  C "C2'" . DC  B 2 58  ? 20.414  89.607  41.382  1.00   137.86 ? 58  DC  J "C2'" 1 
ATOM   4570  C "C1'" . DC  B 2 58  ? 21.762  88.913  41.286  1.00   141.49 ? 58  DC  J "C1'" 1 
ATOM   4571  N N1    . DC  B 2 58  ? 22.223  88.690  39.883  1.00   151.53 ? 58  DC  J N1    1 
ATOM   4572  C C2    . DC  B 2 58  ? 23.551  88.967  39.537  1.00   139.88 ? 58  DC  J C2    1 
ATOM   4573  O O2    . DC  B 2 58  ? 24.324  89.393  40.404  1.00   137.22 ? 58  DC  J O2    1 
ATOM   4574  N N3    . DC  B 2 58  ? 23.953  88.757  38.259  1.00   135.50 ? 58  DC  J N3    1 
ATOM   4575  C C4    . DC  B 2 58  ? 23.089  88.296  37.353  1.00   130.35 ? 58  DC  J C4    1 
ATOM   4576  N N4    . DC  B 2 58  ? 23.532  88.104  36.106  1.00   105.51 ? 58  DC  J N4    1 
ATOM   4577  C C5    . DC  B 2 58  ? 21.732  88.009  37.686  1.00   138.13 ? 58  DC  J C5    1 
ATOM   4578  C C6    . DC  B 2 58  ? 21.346  88.219  38.950  1.00   146.01 ? 58  DC  J C6    1 
ATOM   4579  P P     . DC  B 2 59  ? 19.735  91.490  43.938  1.00   147.96 ? 59  DC  J P     1 
ATOM   4580  O OP1   . DC  B 2 59  ? 19.762  91.844  45.375  1.00   99.27  ? 59  DC  J OP1   1 
ATOM   4581  O OP2   . DC  B 2 59  ? 18.453  91.516  43.198  1.00   150.92 ? 59  DC  J OP2   1 
ATOM   4582  O "O5'" . DC  B 2 59  ? 20.772  92.421  43.156  1.00   116.02 ? 59  DC  J "O5'" 1 
ATOM   4583  C "C5'" . DC  B 2 59  ? 22.161  92.316  43.435  1.00   111.03 ? 59  DC  J "C5'" 1 
ATOM   4584  C "C4'" . DC  B 2 59  ? 22.981  93.055  42.394  1.00   127.80 ? 59  DC  J "C4'" 1 
ATOM   4585  O "O4'" . DC  B 2 59  ? 22.875  92.379  41.114  1.00   132.07 ? 59  DC  J "O4'" 1 
ATOM   4586  C "C3'" . DC  B 2 59  ? 22.557  94.508  42.146  1.00   130.89 ? 59  DC  J "C3'" 1 
ATOM   4587  O "O3'" . DC  B 2 59  ? 23.702  95.348  42.134  1.00   131.36 ? 59  DC  J "O3'" 1 
ATOM   4588  C "C2'" . DC  B 2 59  ? 21.894  94.452  40.771  1.00   129.11 ? 59  DC  J "C2'" 1 
ATOM   4589  C "C1'" . DC  B 2 59  ? 22.687  93.342  40.108  1.00   137.21 ? 59  DC  J "C1'" 1 
ATOM   4590  N N1    . DC  B 2 59  ? 21.984  92.710  38.957  1.00   146.74 ? 59  DC  J N1    1 
ATOM   4591  C C2    . DC  B 2 59  ? 22.661  92.533  37.745  1.00   142.14 ? 59  DC  J C2    1 
ATOM   4592  O O2    . DC  B 2 59  ? 23.840  92.899  37.654  1.00   134.35 ? 59  DC  J O2    1 
ATOM   4593  N N3    . DC  B 2 59  ? 22.006  91.961  36.705  1.00   136.41 ? 59  DC  J N3    1 
ATOM   4594  C C4    . DC  B 2 59  ? 20.736  91.580  36.843  1.00   131.65 ? 59  DC  J C4    1 
ATOM   4595  N N4    . DC  B 2 59  ? 20.133  91.021  35.790  1.00   118.73 ? 59  DC  J N4    1 
ATOM   4596  C C5    . DC  B 2 59  ? 20.028  91.755  38.069  1.00   144.98 ? 59  DC  J C5    1 
ATOM   4597  C C6    . DC  B 2 59  ? 20.683  92.320  39.088  1.00   147.20 ? 59  DC  J C6    1 
ATOM   4598  P P     . DT  B 2 60  ? 23.558  96.922  42.422  1.00   108.11 ? 60  DT  J P     1 
ATOM   4599  O OP1   . DT  B 2 60  ? 24.082  97.165  43.783  1.00   126.44 ? 60  DT  J OP1   1 
ATOM   4600  O OP2   . DT  B 2 60  ? 22.179  97.336  42.081  1.00   116.15 ? 60  DT  J OP2   1 
ATOM   4601  O "O5'" . DT  B 2 60  ? 24.550  97.593  41.363  1.00   104.67 ? 60  DT  J "O5'" 1 
ATOM   4602  C "C5'" . DT  B 2 60  ? 25.921  97.223  41.350  1.00   117.21 ? 60  DT  J "C5'" 1 
ATOM   4603  C "C4'" . DT  B 2 60  ? 26.492  97.307  39.946  1.00   125.04 ? 60  DT  J "C4'" 1 
ATOM   4604  O "O4'" . DT  B 2 60  ? 25.760  96.422  39.070  1.00   126.05 ? 60  DT  J "O4'" 1 
ATOM   4605  C "C3'" . DT  B 2 60  ? 26.430  98.696  39.301  1.00   120.41 ? 60  DT  J "C3'" 1 
ATOM   4606  O "O3'" . DT  B 2 60  ? 27.746  99.171  39.061  1.00   117.82 ? 60  DT  J "O3'" 1 
ATOM   4607  C "C2'" . DT  B 2 60  ? 25.656  98.483  37.990  1.00   127.43 ? 60  DT  J "C2'" 1 
ATOM   4608  C "C1'" . DT  B 2 60  ? 25.747  96.978  37.783  1.00   137.18 ? 60  DT  J "C1'" 1 
ATOM   4609  N N1    . DT  B 2 60  ? 24.589  96.410  37.037  1.00   140.63 ? 60  DT  J N1    1 
ATOM   4610  C C2    . DT  B 2 60  ? 24.795  95.854  35.795  1.00   139.81 ? 60  DT  J C2    1 
ATOM   4611  O O2    . DT  B 2 60  ? 25.888  95.795  35.261  1.00   131.32 ? 60  DT  J O2    1 
ATOM   4612  N N3    . DT  B 2 60  ? 23.666  95.362  35.195  1.00   141.87 ? 60  DT  J N3    1 
ATOM   4613  C C4    . DT  B 2 60  ? 22.378  95.373  35.701  1.00   144.48 ? 60  DT  J C4    1 
ATOM   4614  O O4    . DT  B 2 60  ? 21.426  94.906  35.084  1.00   157.96 ? 60  DT  J O4    1 
ATOM   4615  C C5    . DT  B 2 60  ? 22.232  95.972  37.007  1.00   124.82 ? 60  DT  J C5    1 
ATOM   4616  C C7    . DT  B 2 60  ? 20.883  96.041  37.658  1.00   97.58  ? 60  DT  J C7    1 
ATOM   4617  C C6    . DT  B 2 60  ? 23.332  96.456  37.604  1.00   131.15 ? 60  DT  J C6    1 
ATOM   4618  P P     . DT  B 2 61  ? 27.990  100.651 38.488  1.00   147.83 ? 61  DT  J P     1 
ATOM   4619  O OP1   . DT  B 2 61  ? 29.325  101.093 38.951  1.00   112.89 ? 61  DT  J OP1   1 
ATOM   4620  O OP2   . DT  B 2 61  ? 26.794  101.465 38.799  1.00   147.95 ? 61  DT  J OP2   1 
ATOM   4621  O "O5'" . DT  B 2 61  ? 28.045  100.439 36.905  1.00   137.94 ? 61  DT  J "O5'" 1 
ATOM   4622  C "C5'" . DT  B 2 61  ? 28.952  99.495  36.352  1.00   131.42 ? 61  DT  J "C5'" 1 
ATOM   4623  C "C4'" . DT  B 2 61  ? 28.648  99.252  34.886  1.00   131.53 ? 61  DT  J "C4'" 1 
ATOM   4624  O "O4'" . DT  B 2 61  ? 27.384  98.556  34.760  1.00   122.53 ? 61  DT  J "O4'" 1 
ATOM   4625  C "C3'" . DT  B 2 61  ? 28.528  100.520 34.034  1.00   133.03 ? 61  DT  J "C3'" 1 
ATOM   4626  O "O3'" . DT  B 2 61  ? 29.444  100.468 32.951  1.00   113.33 ? 61  DT  J "O3'" 1 
ATOM   4627  C "C2'" . DT  B 2 61  ? 27.073  100.515 33.548  1.00   128.93 ? 61  DT  J "C2'" 1 
ATOM   4628  C "C1'" . DT  B 2 61  ? 26.709  99.042  33.631  1.00   124.38 ? 61  DT  J "C1'" 1 
ATOM   4629  N N1    . DT  B 2 61  ? 25.251  98.800  33.811  1.00   122.91 ? 61  DT  J N1    1 
ATOM   4630  C C2    . DT  B 2 61  ? 24.624  97.858  33.030  1.00   141.20 ? 61  DT  J C2    1 
ATOM   4631  O O2    . DT  B 2 61  ? 25.204  97.196  32.188  1.00   142.04 ? 61  DT  J O2    1 
ATOM   4632  N N3    . DT  B 2 61  ? 23.283  97.715  33.272  1.00   139.21 ? 61  DT  J N3    1 
ATOM   4633  C C4    . DT  B 2 61  ? 22.522  98.406  34.197  1.00   139.18 ? 61  DT  J C4    1 
ATOM   4634  O O4    . DT  B 2 61  ? 21.320  98.205  34.341  1.00   135.38 ? 61  DT  J O4    1 
ATOM   4635  C C5    . DT  B 2 61  ? 23.242  99.381  34.983  1.00   145.03 ? 61  DT  J C5    1 
ATOM   4636  C C7    . DT  B 2 61  ? 22.523  100.194 36.019  1.00   145.54 ? 61  DT  J C7    1 
ATOM   4637  C C6    . DT  B 2 61  ? 24.556  99.530  34.753  1.00   132.21 ? 61  DT  J C6    1 
ATOM   4638  P P     . DG  B 2 62  ? 29.687  101.769 32.041  1.00   135.07 ? 62  DG  J P     1 
ATOM   4639  O OP1   . DG  B 2 62  ? 31.057  101.678 31.488  1.00   119.16 ? 62  DG  J OP1   1 
ATOM   4640  O OP2   . DG  B 2 62  ? 29.291  102.953 32.836  1.00   132.53 ? 62  DG  J OP2   1 
ATOM   4641  O "O5'" . DG  B 2 62  ? 28.632  101.604 30.849  1.00   167.25 ? 62  DG  J "O5'" 1 
ATOM   4642  C "C5'" . DG  B 2 62  ? 28.743  100.503 29.955  1.00   168.18 ? 62  DG  J "C5'" 1 
ATOM   4643  C "C4'" . DG  B 2 62  ? 27.491  100.353 29.108  1.00   162.63 ? 62  DG  J "C4'" 1 
ATOM   4644  O "O4'" . DG  B 2 62  ? 26.401  99.881  29.924  1.00   147.09 ? 62  DG  J "O4'" 1 
ATOM   4645  C "C3'" . DG  B 2 62  ? 26.958  101.634 28.502  1.00   156.81 ? 62  DG  J "C3'" 1 
ATOM   4646  O "O3'" . DG  B 2 62  ? 27.659  101.944 27.302  1.00   154.43 ? 62  DG  J "O3'" 1 
ATOM   4647  C "C2'" . DG  B 2 62  ? 25.501  101.269 28.216  1.00   137.98 ? 62  DG  J "C2'" 1 
ATOM   4648  C "C1'" . DG  B 2 62  ? 25.182  100.218 29.287  1.00   134.61 ? 62  DG  J "C1'" 1 
ATOM   4649  N N9    . DG  B 2 62  ? 24.229  100.685 30.289  1.00   139.63 ? 62  DG  J N9    1 
ATOM   4650  C C8    . DG  B 2 62  ? 24.487  101.504 31.363  1.00   141.00 ? 62  DG  J C8    1 
ATOM   4651  N N7    . DG  B 2 62  ? 23.431  101.759 32.086  1.00   149.33 ? 62  DG  J N7    1 
ATOM   4652  C C5    . DG  B 2 62  ? 22.407  101.069 31.449  1.00   157.01 ? 62  DG  J C5    1 
ATOM   4653  C C6    . DG  B 2 62  ? 21.032  100.969 31.775  1.00   147.30 ? 62  DG  J C6    1 
ATOM   4654  O O6    . DG  B 2 62  ? 20.428  101.490 32.723  1.00   135.14 ? 62  DG  J O6    1 
ATOM   4655  N N1    . DG  B 2 62  ? 20.343  100.169 30.866  1.00   142.52 ? 62  DG  J N1    1 
ATOM   4656  C C2    . DG  B 2 62  ? 20.911  99.544  29.781  1.00   147.66 ? 62  DG  J C2    1 
ATOM   4657  N N2    . DG  B 2 62  ? 20.086  98.813  29.018  1.00   154.23 ? 62  DG  J N2    1 
ATOM   4658  N N3    . DG  B 2 62  ? 22.197  99.628  29.465  1.00   141.81 ? 62  DG  J N3    1 
ATOM   4659  C C4    . DG  B 2 62  ? 22.882  100.405 30.340  1.00   151.80 ? 62  DG  J C4    1 
ATOM   4660  P P     . DG  B 2 63  ? 27.486  103.388 26.616  1.00   163.09 ? 63  DG  J P     1 
ATOM   4661  O OP1   . DG  B 2 63  ? 28.551  103.529 25.598  1.00   126.50 ? 63  DG  J OP1   1 
ATOM   4662  O OP2   . DG  B 2 63  ? 27.374  104.387 27.702  1.00   171.67 ? 63  DG  J OP2   1 
ATOM   4663  O "O5'" . DG  B 2 63  ? 26.065  103.304 25.876  1.00   166.23 ? 63  DG  J "O5'" 1 
ATOM   4664  C "C5'" . DG  B 2 63  ? 25.914  102.483 24.723  1.00   156.64 ? 63  DG  J "C5'" 1 
ATOM   4665  C "C4'" . DG  B 2 63  ? 24.450  102.161 24.457  1.00   162.66 ? 63  DG  J "C4'" 1 
ATOM   4666  O "O4'" . DG  B 2 63  ? 23.842  101.606 25.645  1.00   152.74 ? 63  DG  J "O4'" 1 
ATOM   4667  C "C3'" . DG  B 2 63  ? 23.566  103.345 24.122  1.00   177.59 ? 63  DG  J "C3'" 1 
ATOM   4668  O "O3'" . DG  B 2 63  ? 23.705  103.697 22.750  1.00   189.36 ? 63  DG  J "O3'" 1 
ATOM   4669  C "C2'" . DG  B 2 63  ? 22.183  102.772 24.410  1.00   166.94 ? 63  DG  J "C2'" 1 
ATOM   4670  C "C1'" . DG  B 2 63  ? 22.447  101.870 25.618  1.00   153.93 ? 63  DG  J "C1'" 1 
ATOM   4671  N N9    . DG  B 2 63  ? 22.045  102.478 26.884  1.00   142.89 ? 63  DG  J N9    1 
ATOM   4672  C C8    . DG  B 2 63  ? 22.813  103.259 27.713  1.00   137.01 ? 63  DG  J C8    1 
ATOM   4673  N N7    . DG  B 2 63  ? 22.177  103.671 28.775  1.00   141.63 ? 63  DG  J N7    1 
ATOM   4674  C C5    . DG  B 2 63  ? 20.902  103.136 28.637  1.00   146.55 ? 63  DG  J C5    1 
ATOM   4675  C C6    . DG  B 2 63  ? 19.770  103.242 29.482  1.00   154.31 ? 63  DG  J C6    1 
ATOM   4676  O O6    . DG  B 2 63  ? 19.668  103.852 30.555  1.00   159.08 ? 63  DG  J O6    1 
ATOM   4677  N N1    . DG  B 2 63  ? 18.677  102.546 28.970  1.00   155.47 ? 63  DG  J N1    1 
ATOM   4678  C C2    . DG  B 2 63  ? 18.679  101.837 27.792  1.00   153.27 ? 63  DG  J C2    1 
ATOM   4679  N N2    . DG  B 2 63  ? 17.529  101.230 27.461  1.00   142.34 ? 63  DG  J N2    1 
ATOM   4680  N N3    . DG  B 2 63  ? 19.732  101.729 26.992  1.00   148.17 ? 63  DG  J N3    1 
ATOM   4681  C C4    . DG  B 2 63  ? 20.804  102.402 27.476  1.00   144.66 ? 63  DG  J C4    1 
ATOM   4682  P P     . DC  B 2 64  ? 23.244  105.151 22.239  1.00   180.37 ? 64  DC  J P     1 
ATOM   4683  O OP1   . DC  B 2 64  ? 23.629  105.265 20.814  1.00   168.15 ? 64  DC  J OP1   1 
ATOM   4684  O OP2   . DC  B 2 64  ? 23.736  106.147 23.216  1.00   172.00 ? 64  DC  J OP2   1 
ATOM   4685  O "O5'" . DC  B 2 64  ? 21.646  105.116 22.339  1.00   170.34 ? 64  DC  J "O5'" 1 
ATOM   4686  C "C5'" . DC  B 2 64  ? 20.898  104.259 21.481  1.00   173.16 ? 64  DC  J "C5'" 1 
ATOM   4687  C "C4'" . DC  B 2 64  ? 19.460  104.125 21.956  1.00   172.70 ? 64  DC  J "C4'" 1 
ATOM   4688  O "O4'" . DC  B 2 64  ? 19.436  103.795 23.361  1.00   167.36 ? 64  DC  J "O4'" 1 
ATOM   4689  C "C3'" . DC  B 2 64  ? 18.626  105.386 21.856  1.00   175.65 ? 64  DC  J "C3'" 1 
ATOM   4690  O "O3'" . DC  B 2 64  ? 18.114  105.519 20.535  1.00   180.97 ? 64  DC  J "O3'" 1 
ATOM   4691  C "C2'" . DC  B 2 64  ? 17.515  105.110 22.869  1.00   167.40 ? 64  DC  J "C2'" 1 
ATOM   4692  C "C1'" . DC  B 2 64  ? 18.231  104.274 23.936  1.00   159.20 ? 64  DC  J "C1'" 1 
ATOM   4693  N N1    . DC  B 2 64  ? 18.559  105.040 25.175  1.00   149.40 ? 64  DC  J N1    1 
ATOM   4694  C C2    . DC  B 2 64  ? 17.656  105.047 26.244  1.00   136.79 ? 64  DC  J C2    1 
ATOM   4695  O O2    . DC  B 2 64  ? 16.597  104.415 26.143  1.00   131.81 ? 64  DC  J O2    1 
ATOM   4696  N N3    . DC  B 2 64  ? 17.967  105.747 27.362  1.00   127.94 ? 64  DC  J N3    1 
ATOM   4697  C C4    . DC  B 2 64  ? 19.118  106.416 27.432  1.00   141.38 ? 64  DC  J C4    1 
ATOM   4698  N N4    . DC  B 2 64  ? 19.381  107.091 28.555  1.00   152.01 ? 64  DC  J N4    1 
ATOM   4699  C C5    . DC  B 2 64  ? 20.052  106.421 26.353  1.00   150.91 ? 64  DC  J C5    1 
ATOM   4700  C C6    . DC  B 2 64  ? 19.735  105.727 25.255  1.00   146.80 ? 64  DC  J C6    1 
ATOM   4701  P P     . DG  B 2 65  ? 17.012  106.639 20.195  1.00   197.47 ? 65  DG  J P     1 
ATOM   4702  O OP1   . DG  B 2 65  ? 17.045  106.866 18.734  1.00   194.73 ? 65  DG  J OP1   1 
ATOM   4703  O OP2   . DG  B 2 65  ? 17.215  107.780 21.116  1.00   188.28 ? 65  DG  J OP2   1 
ATOM   4704  O "O5'" . DG  B 2 65  ? 15.626  105.935 20.570  1.00   190.14 ? 65  DG  J "O5'" 1 
ATOM   4705  C "C5'" . DG  B 2 65  ? 14.403  106.541 20.201  1.00   175.29 ? 65  DG  J "C5'" 1 
ATOM   4706  C "C4'" . DG  B 2 65  ? 13.723  107.176 21.400  1.00   164.21 ? 65  DG  J "C4'" 1 
ATOM   4707  O "O4'" . DG  B 2 65  ? 14.488  106.933 22.594  1.00   171.57 ? 65  DG  J "O4'" 1 
ATOM   4708  C "C3'" . DG  B 2 65  ? 13.613  108.684 21.350  1.00   155.63 ? 65  DG  J "C3'" 1 
ATOM   4709  O "O3'" . DG  B 2 65  ? 12.471  109.062 20.594  1.00   156.81 ? 65  DG  J "O3'" 1 
ATOM   4710  C "C2'" . DG  B 2 65  ? 13.459  109.058 22.831  1.00   160.84 ? 65  DG  J "C2'" 1 
ATOM   4711  C "C1'" . DG  B 2 65  ? 14.059  107.855 23.574  1.00   163.23 ? 65  DG  J "C1'" 1 
ATOM   4712  N N9    . DG  B 2 65  ? 15.184  108.211 24.436  1.00   164.82 ? 65  DG  J N9    1 
ATOM   4713  C C8    . DG  B 2 65  ? 16.484  108.443 24.056  1.00   158.03 ? 65  DG  J C8    1 
ATOM   4714  N N7    . DG  B 2 65  ? 17.269  108.754 25.052  1.00   136.55 ? 65  DG  J N7    1 
ATOM   4715  C C5    . DG  B 2 65  ? 16.434  108.732 26.163  1.00   155.23 ? 65  DG  J C5    1 
ATOM   4716  C C6    . DG  B 2 65  ? 16.720  108.988 27.526  1.00   153.23 ? 65  DG  J C6    1 
ATOM   4717  O O6    . DG  B 2 65  ? 17.806  109.295 28.038  1.00   144.42 ? 65  DG  J O6    1 
ATOM   4718  N N1    . DG  B 2 65  ? 15.586  108.858 28.325  1.00   148.87 ? 65  DG  J N1    1 
ATOM   4719  C C2    . DG  B 2 65  ? 14.334  108.522 27.864  1.00   140.56 ? 65  DG  J C2    1 
ATOM   4720  N N2    . DG  B 2 65  ? 13.363  108.445 28.785  1.00   138.38 ? 65  DG  J N2    1 
ATOM   4721  N N3    . DG  B 2 65  ? 14.053  108.280 26.591  1.00   143.86 ? 65  DG  J N3    1 
ATOM   4722  C C4    . DG  B 2 65  ? 15.147  108.403 25.800  1.00   158.70 ? 65  DG  J C4    1 
ATOM   4723  P P     . DG  B 2 66  ? 12.107  110.615 20.397  1.00   179.15 ? 66  DG  J P     1 
ATOM   4724  O OP1   . DG  B 2 66  ? 11.282  110.726 19.174  1.00   168.84 ? 66  DG  J OP1   1 
ATOM   4725  O OP2   . DG  B 2 66  ? 13.363  111.390 20.510  1.00   157.05 ? 66  DG  J OP2   1 
ATOM   4726  O "O5'" . DG  B 2 66  ? 11.197  110.957 21.667  1.00   165.28 ? 66  DG  J "O5'" 1 
ATOM   4727  C "C5'" . DG  B 2 66  ? 10.187  110.044 22.073  1.00   149.39 ? 66  DG  J "C5'" 1 
ATOM   4728  C "C4'" . DG  B 2 66  ? 9.445   110.541 23.303  1.00   154.22 ? 66  DG  J "C4'" 1 
ATOM   4729  O "O4'" . DG  B 2 66  ? 10.295  110.439 24.477  1.00   151.04 ? 66  DG  J "O4'" 1 
ATOM   4730  C "C3'" . DG  B 2 66  ? 8.982   111.990 23.235  1.00   157.75 ? 66  DG  J "C3'" 1 
ATOM   4731  O "O3'" . DG  B 2 66  ? 7.713   112.116 23.865  1.00   164.54 ? 66  DG  J "O3'" 1 
ATOM   4732  C "C2'" . DG  B 2 66  ? 10.066  112.756 23.997  1.00   148.43 ? 66  DG  J "C2'" 1 
ATOM   4733  C "C1'" . DG  B 2 66  ? 10.572  111.725 25.003  1.00   159.41 ? 66  DG  J "C1'" 1 
ATOM   4734  N N9    . DG  B 2 66  ? 12.001  111.834 25.293  1.00   163.41 ? 66  DG  J N9    1 
ATOM   4735  C C8    . DG  B 2 66  ? 13.023  112.003 24.389  1.00   159.10 ? 66  DG  J C8    1 
ATOM   4736  N N7    . DG  B 2 66  ? 14.202  112.075 24.944  1.00   144.34 ? 66  DG  J N7    1 
ATOM   4737  C C5    . DG  B 2 66  ? 13.946  111.952 26.304  1.00   150.41 ? 66  DG  J C5    1 
ATOM   4738  C C6    . DG  B 2 66  ? 14.837  111.958 27.404  1.00   146.12 ? 66  DG  J C6    1 
ATOM   4739  O O6    . DG  B 2 66  ? 16.070  112.077 27.393  1.00   138.41 ? 66  DG  J O6    1 
ATOM   4740  N N1    . DG  B 2 66  ? 14.163  111.806 28.614  1.00   153.46 ? 66  DG  J N1    1 
ATOM   4741  C C2    . DG  B 2 66  ? 12.801  111.667 28.744  1.00   147.83 ? 66  DG  J C2    1 
ATOM   4742  N N2    . DG  B 2 66  ? 12.334  111.532 29.994  1.00   142.75 ? 66  DG  J N2    1 
ATOM   4743  N N3    . DG  B 2 66  ? 11.955  111.659 27.721  1.00   145.36 ? 66  DG  J N3    1 
ATOM   4744  C C4    . DG  B 2 66  ? 12.596  111.806 26.536  1.00   156.55 ? 66  DG  J C4    1 
ATOM   4745  P P     . DT  B 2 67  ? 7.004   113.552 23.997  1.00   166.26 ? 67  DT  J P     1 
ATOM   4746  O OP1   . DT  B 2 67  ? 5.546   113.331 23.878  1.00   151.29 ? 67  DT  J OP1   1 
ATOM   4747  O OP2   . DT  B 2 67  ? 7.673   114.500 23.077  1.00   129.82 ? 67  DT  J OP2   1 
ATOM   4748  O "O5'" . DT  B 2 67  ? 7.330   113.994 25.498  1.00   178.39 ? 67  DT  J "O5'" 1 
ATOM   4749  C "C5'" . DT  B 2 67  ? 6.987   113.131 26.578  1.00   169.65 ? 67  DT  J "C5'" 1 
ATOM   4750  C "C4'" . DT  B 2 67  ? 7.283   113.790 27.912  1.00   150.60 ? 67  DT  J "C4'" 1 
ATOM   4751  O "O4'" . DT  B 2 67  ? 8.710   113.752 28.171  1.00   147.75 ? 67  DT  J "O4'" 1 
ATOM   4752  C "C3'" . DT  B 2 67  ? 6.865   115.260 28.012  1.00   144.54 ? 67  DT  J "C3'" 1 
ATOM   4753  O "O3'" . DT  B 2 67  ? 6.120   115.477 29.205  1.00   131.05 ? 67  DT  J "O3'" 1 
ATOM   4754  C "C2'" . DT  B 2 67  ? 8.196   116.016 28.027  1.00   129.42 ? 67  DT  J "C2'" 1 
ATOM   4755  C "C1'" . DT  B 2 67  ? 9.121   114.999 28.672  1.00   138.22 ? 67  DT  J "C1'" 1 
ATOM   4756  N N1    . DT  B 2 67  ? 10.556  115.201 28.330  1.00   132.82 ? 67  DT  J N1    1 
ATOM   4757  C C2    . DT  B 2 67  ? 11.487  115.268 29.341  1.00   132.52 ? 67  DT  J C2    1 
ATOM   4758  O O2    . DT  B 2 67  ? 11.202  115.162 30.520  1.00   123.89 ? 67  DT  J O2    1 
ATOM   4759  N N3    . DT  B 2 67  ? 12.776  115.460 28.919  1.00   132.99 ? 67  DT  J N3    1 
ATOM   4760  C C4    . DT  B 2 67  ? 13.217  115.593 27.616  1.00   123.03 ? 67  DT  J C4    1 
ATOM   4761  O O4    . DT  B 2 67  ? 14.400  115.764 27.338  1.00   120.41 ? 67  DT  J O4    1 
ATOM   4762  C C5    . DT  B 2 67  ? 12.189  115.516 26.605  1.00   126.95 ? 67  DT  J C5    1 
ATOM   4763  C C7    . DT  B 2 67  ? 12.547  115.646 25.154  1.00   126.99 ? 67  DT  J C7    1 
ATOM   4764  C C6    . DT  B 2 67  ? 10.923  115.327 27.006  1.00   132.25 ? 67  DT  J C6    1 
ATOM   4765  P P     . DT  B 2 68  ? 5.535   116.936 29.540  1.00   128.97 ? 68  DT  J P     1 
ATOM   4766  O OP1   . DT  B 2 68  ? 4.365   116.760 30.429  1.00   81.89  ? 68  DT  J OP1   1 
ATOM   4767  O OP2   . DT  B 2 68  ? 5.388   117.664 28.260  1.00   127.05 ? 68  DT  J OP2   1 
ATOM   4768  O "O5'" . DT  B 2 68  ? 6.711   117.637 30.367  1.00   138.31 ? 68  DT  J "O5'" 1 
ATOM   4769  C "C5'" . DT  B 2 68  ? 7.325   116.945 31.449  1.00   145.34 ? 68  DT  J "C5'" 1 
ATOM   4770  C "C4'" . DT  B 2 68  ? 8.541   117.700 31.955  1.00   121.12 ? 68  DT  J "C4'" 1 
ATOM   4771  O "O4'" . DT  B 2 68  ? 9.635   117.555 31.016  1.00   122.40 ? 68  DT  J "O4'" 1 
ATOM   4772  C "C3'" . DT  B 2 68  ? 8.334   119.207 32.144  1.00   123.66 ? 68  DT  J "C3'" 1 
ATOM   4773  O "O3'" . DT  B 2 68  ? 8.696   119.581 33.463  1.00   121.79 ? 68  DT  J "O3'" 1 
ATOM   4774  C "C2'" . DT  B 2 68  ? 9.263   119.843 31.104  1.00   124.05 ? 68  DT  J "C2'" 1 
ATOM   4775  C "C1'" . DT  B 2 68  ? 10.328  118.773 30.943  1.00   124.25 ? 68  DT  J "C1'" 1 
ATOM   4776  N N1    . DT  B 2 68  ? 11.049  118.837 29.640  1.00   124.97 ? 68  DT  J N1    1 
ATOM   4777  C C2    . DT  B 2 68  ? 12.424  118.802 29.630  1.00   125.80 ? 68  DT  J C2    1 
ATOM   4778  O O2    . DT  B 2 68  ? 13.096  118.715 30.642  1.00   129.91 ? 68  DT  J O2    1 
ATOM   4779  N N3    . DT  B 2 68  ? 12.990  118.869 28.386  1.00   117.57 ? 68  DT  J N3    1 
ATOM   4780  C C4    . DT  B 2 68  ? 12.332  118.968 27.173  1.00   124.51 ? 68  DT  J C4    1 
ATOM   4781  O O4    . DT  B 2 68  ? 12.932  119.023 26.105  1.00   121.69 ? 68  DT  J O4    1 
ATOM   4782  C C5    . DT  B 2 68  ? 10.890  119.002 27.254  1.00   138.56 ? 68  DT  J C5    1 
ATOM   4783  C C7    . DT  B 2 68  ? 10.067  119.108 26.004  1.00   137.88 ? 68  DT  J C7    1 
ATOM   4784  C C6    . DT  B 2 68  ? 10.325  118.937 28.469  1.00   133.54 ? 68  DT  J C6    1 
ATOM   4785  P P     . DA  B 2 69  ? 7.574   120.087 34.495  1.00   132.88 ? 69  DA  J P     1 
ATOM   4786  O OP1   . DA  B 2 69  ? 6.482   119.087 34.494  1.00   125.79 ? 69  DA  J OP1   1 
ATOM   4787  O OP2   . DA  B 2 69  ? 7.278   121.502 34.179  1.00   126.61 ? 69  DA  J OP2   1 
ATOM   4788  O "O5'" . DA  B 2 69  ? 8.310   120.037 35.912  1.00   135.08 ? 69  DA  J "O5'" 1 
ATOM   4789  C "C5'" . DA  B 2 69  ? 8.765   118.794 36.429  1.00   125.24 ? 69  DA  J "C5'" 1 
ATOM   4790  C "C4'" . DA  B 2 69  ? 10.266  118.817 36.650  1.00   136.70 ? 69  DA  J "C4'" 1 
ATOM   4791  O "O4'" . DA  B 2 69  ? 10.941  119.034 35.381  1.00   134.50 ? 69  DA  J "O4'" 1 
ATOM   4792  C "C3'" . DA  B 2 69  ? 10.766  119.915 37.593  1.00   144.70 ? 69  DA  J "C3'" 1 
ATOM   4793  O "O3'" . DA  B 2 69  ? 11.733  119.382 38.490  1.00   154.69 ? 69  DA  J "O3'" 1 
ATOM   4794  C "C2'" . DA  B 2 69  ? 11.385  120.941 36.644  1.00   138.11 ? 69  DA  J "C2'" 1 
ATOM   4795  C "C1'" . DA  B 2 69  ? 11.908  120.046 35.534  1.00   129.37 ? 69  DA  J "C1'" 1 
ATOM   4796  N N9    . DA  B 2 69  ? 12.072  120.735 34.256  1.00   121.25 ? 69  DA  J N9    1 
ATOM   4797  C C8    . DA  B 2 69  ? 11.163  121.546 33.634  1.00   112.97 ? 69  DA  J C8    1 
ATOM   4798  N N7    . DA  B 2 69  ? 11.585  122.033 32.490  1.00   117.71 ? 69  DA  J N7    1 
ATOM   4799  C C5    . DA  B 2 69  ? 12.859  121.503 32.352  1.00   127.14 ? 69  DA  J C5    1 
ATOM   4800  C C6    . DA  B 2 69  ? 13.841  121.638 31.349  1.00   116.36 ? 69  DA  J C6    1 
ATOM   4801  N N6    . DA  B 2 69  ? 13.675  122.379 30.249  1.00   110.11 ? 69  DA  J N6    1 
ATOM   4802  N N1    . DA  B 2 69  ? 15.005  120.976 31.521  1.00   102.80 ? 69  DA  J N1    1 
ATOM   4803  C C2    . DA  B 2 69  ? 15.169  120.234 32.623  1.00   110.78 ? 69  DA  J C2    1 
ATOM   4804  N N3    . DA  B 2 69  ? 14.322  120.033 33.632  1.00   111.78 ? 69  DA  J N3    1 
ATOM   4805  C C4    . DA  B 2 69  ? 13.175  120.702 33.433  1.00   122.84 ? 69  DA  J C4    1 
ATOM   4806  P P     . DA  B 2 70  ? 12.362  120.304 39.647  1.00   147.59 ? 70  DA  J P     1 
ATOM   4807  O OP1   . DA  B 2 70  ? 12.691  119.423 40.791  1.00   73.02  ? 70  DA  J OP1   1 
ATOM   4808  O OP2   . DA  B 2 70  ? 11.461  121.462 39.843  1.00   135.66 ? 70  DA  J OP2   1 
ATOM   4809  O "O5'" . DA  B 2 70  ? 13.724  120.845 39.005  1.00   130.49 ? 70  DA  J "O5'" 1 
ATOM   4810  C "C5'" . DA  B 2 70  ? 14.709  119.922 38.558  1.00   118.47 ? 70  DA  J "C5'" 1 
ATOM   4811  C "C4'" . DA  B 2 70  ? 15.851  120.638 37.860  1.00   101.98 ? 70  DA  J "C4'" 1 
ATOM   4812  O "O4'" . DA  B 2 70  ? 15.407  121.124 36.563  1.00   112.82 ? 70  DA  J "O4'" 1 
ATOM   4813  C "C3'" . DA  B 2 70  ? 16.407  121.859 38.602  1.00   105.43 ? 70  DA  J "C3'" 1 
ATOM   4814  O "O3'" . DA  B 2 70  ? 17.825  121.861 38.515  1.00   118.93 ? 70  DA  J "O3'" 1 
ATOM   4815  C "C2'" . DA  B 2 70  ? 15.803  123.029 37.830  1.00   113.16 ? 70  DA  J "C2'" 1 
ATOM   4816  C "C1'" . DA  B 2 70  ? 15.797  122.469 36.421  1.00   111.93 ? 70  DA  J "C1'" 1 
ATOM   4817  N N9    . DA  B 2 70  ? 14.860  123.144 35.530  1.00   117.07 ? 70  DA  J N9    1 
ATOM   4818  C C8    . DA  B 2 70  ? 13.553  123.451 35.786  1.00   111.35 ? 70  DA  J C8    1 
ATOM   4819  N N7    . DA  B 2 70  ? 12.951  124.066 34.796  1.00   109.68 ? 70  DA  J N7    1 
ATOM   4820  C C5    . DA  B 2 70  ? 13.934  124.174 33.826  1.00   111.10 ? 70  DA  J C5    1 
ATOM   4821  C C6    . DA  B 2 70  ? 13.933  124.730 32.531  1.00   125.07 ? 70  DA  J C6    1 
ATOM   4822  N N6    . DA  B 2 70  ? 12.861  125.306 31.978  1.00   147.20 ? 70  DA  J N6    1 
ATOM   4823  N N1    . DA  B 2 70  ? 15.081  124.669 31.825  1.00   105.77 ? 70  DA  J N1    1 
ATOM   4824  C C2    . DA  B 2 70  ? 16.151  124.089 32.381  1.00   109.39 ? 70  DA  J C2    1 
ATOM   4825  N N3    . DA  B 2 70  ? 16.272  123.535 33.586  1.00   110.63 ? 70  DA  J N3    1 
ATOM   4826  C C4    . DA  B 2 70  ? 15.116  123.610 34.263  1.00   108.22 ? 70  DA  J C4    1 
ATOM   4827  P P     . DA  B 2 71  ? 18.711  122.847 39.425  1.00   99.32  ? 71  DA  J P     1 
ATOM   4828  O OP1   . DA  B 2 71  ? 19.396  122.009 40.435  1.00   79.04  ? 71  DA  J OP1   1 
ATOM   4829  O OP2   . DA  B 2 71  ? 17.881  123.990 39.866  1.00   86.93  ? 71  DA  J OP2   1 
ATOM   4830  O "O5'" . DA  B 2 71  ? 19.805  123.407 38.403  1.00   80.47  ? 71  DA  J "O5'" 1 
ATOM   4831  C "C5'" . DA  B 2 71  ? 20.489  122.504 37.547  1.00   75.99  ? 71  DA  J "C5'" 1 
ATOM   4832  C "C4'" . DA  B 2 71  ? 21.224  123.233 36.434  1.00   81.71  ? 71  DA  J "C4'" 1 
ATOM   4833  O "O4'" . DA  B 2 71  ? 20.278  123.760 35.465  1.00   104.24 ? 71  DA  J "O4'" 1 
ATOM   4834  C "C3'" . DA  B 2 71  ? 22.065  124.421 36.886  1.00   74.98  ? 71  DA  J "C3'" 1 
ATOM   4835  O "O3'" . DA  B 2 71  ? 23.229  124.520 36.072  1.00   85.11  ? 71  DA  J "O3'" 1 
ATOM   4836  C "C2'" . DA  B 2 71  ? 21.129  125.610 36.675  1.00   89.09  ? 71  DA  J "C2'" 1 
ATOM   4837  C "C1'" . DA  B 2 71  ? 20.332  125.175 35.451  1.00   107.36 ? 71  DA  J "C1'" 1 
ATOM   4838  N N9    . DA  B 2 71  ? 18.973  125.709 35.399  1.00   107.33 ? 71  DA  J N9    1 
ATOM   4839  C C8    . DA  B 2 71  ? 18.084  125.812 36.433  1.00   110.00 ? 71  DA  J C8    1 
ATOM   4840  N N7    . DA  B 2 71  ? 16.936  126.350 36.091  1.00   120.04 ? 71  DA  J N7    1 
ATOM   4841  C C5    . DA  B 2 71  ? 17.089  126.636 34.744  1.00   112.00 ? 71  DA  J C5    1 
ATOM   4842  C C6    . DA  B 2 71  ? 16.230  127.222 33.792  1.00   107.41 ? 71  DA  J C6    1 
ATOM   4843  N N6    . DA  B 2 71  ? 14.992  127.640 34.076  1.00   102.76 ? 71  DA  J N6    1 
ATOM   4844  N N1    . DA  B 2 71  ? 16.694  127.362 32.533  1.00   109.59 ? 71  DA  J N1    1 
ATOM   4845  C C2    . DA  B 2 71  ? 17.934  126.945 32.252  1.00   104.24 ? 71  DA  J C2    1 
ATOM   4846  N N3    . DA  B 2 71  ? 18.831  126.380 33.059  1.00   97.37  ? 71  DA  J N3    1 
ATOM   4847  C C4    . DA  B 2 71  ? 18.341  126.253 34.303  1.00   106.43 ? 71  DA  J C4    1 
ATOM   4848  P P     . DA  B 2 72  ? 24.263  125.736 36.261  1.00   97.91  ? 72  DA  J P     1 
ATOM   4849  O OP1   . DA  B 2 72  ? 25.619  125.211 35.987  1.00   99.35  ? 72  DA  J OP1   1 
ATOM   4850  O OP2   . DA  B 2 72  ? 23.992  126.402 37.554  1.00   103.84 ? 72  DA  J OP2   1 
ATOM   4851  O "O5'" . DA  B 2 72  ? 23.872  126.743 35.085  1.00   92.69  ? 72  DA  J "O5'" 1 
ATOM   4852  C "C5'" . DA  B 2 72  ? 23.918  126.298 33.737  1.00   107.28 ? 72  DA  J "C5'" 1 
ATOM   4853  C "C4'" . DA  B 2 72  ? 23.546  127.419 32.787  1.00   112.26 ? 72  DA  J "C4'" 1 
ATOM   4854  O "O4'" . DA  B 2 72  ? 22.120  127.666 32.866  1.00   92.65  ? 72  DA  J "O4'" 1 
ATOM   4855  C "C3'" . DA  B 2 72  ? 24.235  128.756 33.069  1.00   97.10  ? 72  DA  J "C3'" 1 
ATOM   4856  O "O3'" . DA  B 2 72  ? 24.790  129.277 31.874  1.00   68.92  ? 72  DA  J "O3'" 1 
ATOM   4857  C "C2'" . DA  B 2 72  ? 23.109  129.645 33.605  1.00   97.05  ? 72  DA  J "C2'" 1 
ATOM   4858  C "C1'" . DA  B 2 72  ? 21.886  129.049 32.928  1.00   93.92  ? 72  DA  J "C1'" 1 
ATOM   4859  N N9    . DA  B 2 72  ? 20.648  129.270 33.668  1.00   90.92  ? 72  DA  J N9    1 
ATOM   4860  C C8    . DA  B 2 72  ? 20.374  128.881 34.949  1.00   102.15 ? 72  DA  J C8    1 
ATOM   4861  N N7    . DA  B 2 72  ? 19.172  129.214 35.357  1.00   119.83 ? 72  DA  J N7    1 
ATOM   4862  C C5    . DA  B 2 72  ? 18.619  129.865 34.267  1.00   115.44 ? 72  DA  J C5    1 
ATOM   4863  C C6    . DA  B 2 72  ? 17.360  130.461 34.055  1.00   112.60 ? 72  DA  J C6    1 
ATOM   4864  N N6    . DA  B 2 72  ? 16.397  130.494 34.981  1.00   115.34 ? 72  DA  J N6    1 
ATOM   4865  N N1    . DA  B 2 72  ? 17.130  131.024 32.850  1.00   110.80 ? 72  DA  J N1    1 
ATOM   4866  C C2    . DA  B 2 72  ? 18.098  130.989 31.926  1.00   108.61 ? 72  DA  J C2    1 
ATOM   4867  N N3    . DA  B 2 72  ? 19.317  130.459 32.009  1.00   117.26 ? 72  DA  J N3    1 
ATOM   4868  C C4    . DA  B 2 72  ? 19.516  129.907 33.216  1.00   111.58 ? 72  DA  J C4    1 
ATOM   4869  P P     . DC  B 2 73  ? 26.028  130.299 31.942  1.00   129.29 ? 73  DC  J P     1 
ATOM   4870  O OP1   . DC  B 2 73  ? 27.060  129.830 30.989  1.00   123.78 ? 73  DC  J OP1   1 
ATOM   4871  O OP2   . DC  B 2 73  ? 26.375  130.487 33.368  1.00   116.02 ? 73  DC  J OP2   1 
ATOM   4872  O "O5'" . DC  B 2 73  ? 25.412  131.672 31.406  1.00   117.28 ? 73  DC  J "O5'" 1 
ATOM   4873  C "C5'" . DC  B 2 73  ? 24.713  131.697 30.172  1.00   110.73 ? 73  DC  J "C5'" 1 
ATOM   4874  C "C4'" . DC  B 2 73  ? 23.807  132.909 30.094  1.00   117.94 ? 73  DC  J "C4'" 1 
ATOM   4875  O "O4'" . DC  B 2 73  ? 22.649  132.705 30.937  1.00   111.59 ? 73  DC  J "O4'" 1 
ATOM   4876  C "C3'" . DC  B 2 73  ? 24.448  134.221 30.560  1.00   113.29 ? 73  DC  J "C3'" 1 
ATOM   4877  O "O3'" . DC  B 2 73  ? 24.529  135.137 29.473  1.00   117.70 ? 73  DC  J "O3'" 1 
ATOM   4878  C "C2'" . DC  B 2 73  ? 23.515  134.734 31.669  1.00   126.24 ? 73  DC  J "C2'" 1 
ATOM   4879  C "C1'" . DC  B 2 73  ? 22.233  133.951 31.422  1.00   123.49 ? 73  DC  J "C1'" 1 
ATOM   4880  N N1    . DC  B 2 73  ? 21.414  133.740 32.654  1.00   102.67 ? 73  DC  J N1    1 
ATOM   4881  C C2    . DC  B 2 73  ? 20.064  134.111 32.661  1.00   112.06 ? 73  DC  J C2    1 
ATOM   4882  O O2    . DC  B 2 73  ? 19.568  134.604 31.641  1.00   115.85 ? 73  DC  J O2    1 
ATOM   4883  N N3    . DC  B 2 73  ? 19.335  133.916 33.788  1.00   109.77 ? 73  DC  J N3    1 
ATOM   4884  C C4    . DC  B 2 73  ? 19.906  133.383 34.869  1.00   111.72 ? 73  DC  J C4    1 
ATOM   4885  N N4    . DC  B 2 73  ? 19.146  133.211 35.956  1.00   102.95 ? 73  DC  J N4    1 
ATOM   4886  C C5    . DC  B 2 73  ? 21.280  133.001 34.882  1.00   103.03 ? 73  DC  J C5    1 
ATOM   4887  C C6    . DC  B 2 73  ? 21.989  133.197 33.765  1.00   100.59 ? 73  DC  J C6    1 
ATOM   4888  P P     . DG  B 2 74  ? 25.348  136.512 29.627  1.00   158.40 ? 74  DG  J P     1 
ATOM   4889  O OP1   . DG  B 2 74  ? 26.072  136.740 28.357  1.00   150.18 ? 74  DG  J OP1   1 
ATOM   4890  O OP2   . DG  B 2 74  ? 26.102  136.454 30.899  1.00   151.61 ? 74  DG  J OP2   1 
ATOM   4891  O "O5'" . DG  B 2 74  ? 24.202  137.621 29.773  1.00   133.53 ? 74  DG  J "O5'" 1 
ATOM   4892  C "C5'" . DG  B 2 74  ? 23.063  137.557 28.930  1.00   119.38 ? 74  DG  J "C5'" 1 
ATOM   4893  C "C4'" . DG  B 2 74  ? 21.887  138.316 29.519  1.00   120.10 ? 74  DG  J "C4'" 1 
ATOM   4894  O "O4'" . DG  B 2 74  ? 21.273  137.530 30.573  1.00   122.78 ? 74  DG  J "O4'" 1 
ATOM   4895  C "C3'" . DG  B 2 74  ? 22.223  139.674 30.154  1.00   135.66 ? 74  DG  J "C3'" 1 
ATOM   4896  O "O3'" . DG  B 2 74  ? 21.429  140.690 29.540  1.00   135.59 ? 74  DG  J "O3'" 1 
ATOM   4897  C "C2'" . DG  B 2 74  ? 21.889  139.492 31.638  1.00   137.84 ? 74  DG  J "C2'" 1 
ATOM   4898  C "C1'" . DG  B 2 74  ? 20.840  138.404 31.584  1.00   135.10 ? 74  DG  J "C1'" 1 
ATOM   4899  N N9    . DG  B 2 74  ? 20.716  137.659 32.832  1.00   132.68 ? 74  DG  J N9    1 
ATOM   4900  C C8    . DG  B 2 74  ? 21.672  136.872 33.424  1.00   120.13 ? 74  DG  J C8    1 
ATOM   4901  N N7    . DG  B 2 74  ? 21.280  136.329 34.542  1.00   124.06 ? 74  DG  J N7    1 
ATOM   4902  C C5    . DG  B 2 74  ? 19.981  136.792 34.707  1.00   135.85 ? 74  DG  J C5    1 
ATOM   4903  C C6    . DG  B 2 74  ? 19.049  136.540 35.740  1.00   132.16 ? 74  DG  J C6    1 
ATOM   4904  O O6    . DG  B 2 74  ? 19.193  135.832 36.746  1.00   136.70 ? 74  DG  J O6    1 
ATOM   4905  N N1    . DG  B 2 74  ? 17.845  137.206 35.522  1.00   117.40 ? 74  DG  J N1    1 
ATOM   4906  C C2    . DG  B 2 74  ? 17.577  138.012 34.441  1.00   118.60 ? 74  DG  J C2    1 
ATOM   4907  N N2    . DG  B 2 74  ? 16.359  138.569 34.403  1.00   118.62 ? 74  DG  J N2    1 
ATOM   4908  N N3    . DG  B 2 74  ? 18.442  138.256 33.465  1.00   130.40 ? 74  DG  J N3    1 
ATOM   4909  C C4    . DG  B 2 74  ? 19.620  137.614 33.663  1.00   140.52 ? 74  DG  J C4    1 
ATOM   4910  P P     . DC  B 2 75  ? 21.712  142.253 29.798  1.00   131.77 ? 75  DC  J P     1 
ATOM   4911  O OP1   . DC  B 2 75  ? 22.406  142.767 28.597  1.00   123.54 ? 75  DC  J OP1   1 
ATOM   4912  O OP2   . DC  B 2 75  ? 22.327  142.450 31.129  1.00   125.68 ? 75  DC  J OP2   1 
ATOM   4913  O "O5'" . DC  B 2 75  ? 20.238  142.875 29.840  1.00   135.78 ? 75  DC  J "O5'" 1 
ATOM   4914  C "C5'" . DC  B 2 75  ? 19.129  142.059 30.238  1.00   128.51 ? 75  DC  J "C5'" 1 
ATOM   4915  C "C4'" . DC  B 2 75  ? 18.472  142.567 31.512  1.00   141.99 ? 75  DC  J "C4'" 1 
ATOM   4916  O "O4'" . DC  B 2 75  ? 18.691  141.627 32.597  1.00   154.23 ? 75  DC  J "O4'" 1 
ATOM   4917  C "C3'" . DC  B 2 75  ? 18.975  143.923 32.023  1.00   151.11 ? 75  DC  J "C3'" 1 
ATOM   4918  O "O3'" . DC  B 2 75  ? 17.864  144.730 32.375  1.00   140.54 ? 75  DC  J "O3'" 1 
ATOM   4919  C "C2'" . DC  B 2 75  ? 19.793  143.542 33.259  1.00   132.16 ? 75  DC  J "C2'" 1 
ATOM   4920  C "C1'" . DC  B 2 75  ? 18.989  142.359 33.758  1.00   136.68 ? 75  DC  J "C1'" 1 
ATOM   4921  N N1    . DC  B 2 75  ? 19.723  141.475 34.705  1.00   136.55 ? 75  DC  J N1    1 
ATOM   4922  C C2    . DC  B 2 75  ? 19.032  140.870 35.762  1.00   128.84 ? 75  DC  J C2    1 
ATOM   4923  O O2    . DC  B 2 75  ? 17.820  141.084 35.892  1.00   109.17 ? 75  DC  J O2    1 
ATOM   4924  N N3    . DC  B 2 75  ? 19.712  140.064 36.614  1.00   126.96 ? 75  DC  J N3    1 
ATOM   4925  C C4    . DC  B 2 75  ? 21.019  139.859 36.439  1.00   131.16 ? 75  DC  J C4    1 
ATOM   4926  N N4    . DC  B 2 75  ? 21.648  139.057 37.305  1.00   121.73 ? 75  DC  J N4    1 
ATOM   4927  C C5    . DC  B 2 75  ? 21.739  140.466 35.368  1.00   141.41 ? 75  DC  J C5    1 
ATOM   4928  C C6    . DC  B 2 75  ? 21.058  141.259 34.534  1.00   139.03 ? 75  DC  J C6    1 
ATOM   4929  P P     . DG  B 2 76  ? 17.879  146.306 32.072  1.00   131.05 ? 76  DG  J P     1 
ATOM   4930  O OP1   . DG  B 2 76  ? 16.505  146.700 31.686  1.00   149.89 ? 76  DG  J OP1   1 
ATOM   4931  O OP2   . DG  B 2 76  ? 19.008  146.577 31.155  1.00   121.53 ? 76  DG  J OP2   1 
ATOM   4932  O "O5'" . DG  B 2 76  ? 18.229  146.967 33.484  1.00   142.18 ? 76  DG  J "O5'" 1 
ATOM   4933  C "C5'" . DG  B 2 76  ? 17.331  147.898 34.069  1.00   144.47 ? 76  DG  J "C5'" 1 
ATOM   4934  C "C4'" . DG  B 2 76  ? 16.763  147.378 35.381  1.00   132.19 ? 76  DG  J "C4'" 1 
ATOM   4935  O "O4'" . DG  B 2 76  ? 17.425  146.139 35.763  1.00   130.48 ? 76  DG  J "O4'" 1 
ATOM   4936  C "C3'" . DG  B 2 76  ? 16.927  148.331 36.568  1.00   115.06 ? 76  DG  J "C3'" 1 
ATOM   4937  O "O3'" . DG  B 2 76  ? 15.727  148.371 37.320  1.00   116.08 ? 76  DG  J "O3'" 1 
ATOM   4938  C "C2'" . DG  B 2 76  ? 18.064  147.696 37.365  1.00   130.92 ? 76  DG  J "C2'" 1 
ATOM   4939  C "C1'" . DG  B 2 76  ? 17.780  146.227 37.123  1.00   130.67 ? 76  DG  J "C1'" 1 
ATOM   4940  N N9    . DG  B 2 76  ? 18.918  145.347 37.379  1.00   129.68 ? 76  DG  J N9    1 
ATOM   4941  C C8    . DG  B 2 76  ? 20.223  145.553 37.003  1.00   131.31 ? 76  DG  J C8    1 
ATOM   4942  N N7    . DG  B 2 76  ? 21.032  144.611 37.398  1.00   125.83 ? 76  DG  J N7    1 
ATOM   4943  C C5    . DG  B 2 76  ? 20.223  143.752 38.130  1.00   126.65 ? 76  DG  J C5    1 
ATOM   4944  C C6    . DG  B 2 76  ? 20.548  142.560 38.819  1.00   130.19 ? 76  DG  J C6    1 
ATOM   4945  O O6    . DG  B 2 76  ? 21.654  142.008 38.919  1.00   115.73 ? 76  DG  J O6    1 
ATOM   4946  N N1    . DG  B 2 76  ? 19.429  141.998 39.432  1.00   134.19 ? 76  DG  J N1    1 
ATOM   4947  C C2    . DG  B 2 76  ? 18.160  142.524 39.387  1.00   119.26 ? 76  DG  J C2    1 
ATOM   4948  N N2    . DG  B 2 76  ? 17.210  141.840 40.042  1.00   91.54  ? 76  DG  J N2    1 
ATOM   4949  N N3    . DG  B 2 76  ? 17.843  143.642 38.746  1.00   118.70 ? 76  DG  J N3    1 
ATOM   4950  C C4    . DG  B 2 76  ? 18.921  144.201 38.143  1.00   120.97 ? 76  DG  J C4    1 
ATOM   4951  P P     . DG  B 2 77  ? 15.060  149.781 37.698  1.00   130.76 ? 77  DG  J P     1 
ATOM   4952  O OP1   . DG  B 2 77  ? 13.625  149.716 37.335  1.00   130.78 ? 77  DG  J OP1   1 
ATOM   4953  O OP2   . DG  B 2 77  ? 15.923  150.842 37.133  1.00   97.24  ? 77  DG  J OP2   1 
ATOM   4954  O "O5'" . DG  B 2 77  ? 15.187  149.850 39.289  1.00   113.48 ? 77  DG  J "O5'" 1 
ATOM   4955  C "C5'" . DG  B 2 77  ? 14.644  148.810 40.096  1.00   110.84 ? 77  DG  J "C5'" 1 
ATOM   4956  C "C4'" . DG  B 2 77  ? 15.260  148.830 41.484  1.00   106.72 ? 77  DG  J "C4'" 1 
ATOM   4957  O "O4'" . DG  B 2 77  ? 16.399  147.929 41.525  1.00   95.28  ? 77  DG  J "O4'" 1 
ATOM   4958  C "C3'" . DG  B 2 77  ? 15.787  150.197 41.935  1.00   110.28 ? 77  DG  J "C3'" 1 
ATOM   4959  O "O3'" . DG  B 2 77  ? 15.627  150.361 43.351  1.00   98.09  ? 77  DG  J "O3'" 1 
ATOM   4960  C "C2'" . DG  B 2 77  ? 17.266  150.096 41.575  1.00   119.62 ? 77  DG  J "C2'" 1 
ATOM   4961  C "C1'" . DG  B 2 77  ? 17.540  148.644 41.942  1.00   115.90 ? 77  DG  J "C1'" 1 
ATOM   4962  N N9    . DG  B 2 77  ? 18.717  148.075 41.290  1.00   111.08 ? 77  DG  J N9    1 
ATOM   4963  C C8    . DG  B 2 77  ? 19.529  148.684 40.363  1.00   99.84  ? 77  DG  J C8    1 
ATOM   4964  N N7    . DG  B 2 77  ? 20.513  147.929 39.960  1.00   114.53 ? 77  DG  J N7    1 
ATOM   4965  C C5    . DG  B 2 77  ? 20.346  146.744 40.667  1.00   130.44 ? 77  DG  J C5    1 
ATOM   4966  C C6    . DG  B 2 77  ? 21.112  145.552 40.647  1.00   121.44 ? 77  DG  J C6    1 
ATOM   4967  O O6    . DG  B 2 77  ? 22.124  145.301 39.979  1.00   122.46 ? 77  DG  J O6    1 
ATOM   4968  N N1    . DG  B 2 77  ? 20.597  144.593 41.516  1.00   95.80  ? 77  DG  J N1    1 
ATOM   4969  C C2    . DG  B 2 77  ? 19.483  144.763 42.304  1.00   99.51  ? 77  DG  J C2    1 
ATOM   4970  N N2    . DG  B 2 77  ? 19.140  143.724 43.078  1.00   101.51 ? 77  DG  J N2    1 
ATOM   4971  N N3    . DG  B 2 77  ? 18.756  145.874 42.333  1.00   92.32  ? 77  DG  J N3    1 
ATOM   4972  C C4    . DG  B 2 77  ? 19.245  146.818 41.491  1.00   115.10 ? 77  DG  J C4    1 
ATOM   4973  P P     . DG  B 2 78  ? 14.176  150.434 44.050  1.00   128.27 ? 78  DG  J P     1 
ATOM   4974  O OP1   . DG  B 2 78  ? 13.097  150.222 43.060  1.00   134.78 ? 78  DG  J OP1   1 
ATOM   4975  O OP2   . DG  B 2 78  ? 14.168  151.672 44.860  1.00   106.37 ? 78  DG  J OP2   1 
ATOM   4976  O "O5'" . DG  B 2 78  ? 14.221  149.204 45.071  1.00   108.61 ? 78  DG  J "O5'" 1 
ATOM   4977  C "C5'" . DG  B 2 78  ? 15.294  148.285 44.971  1.00   105.21 ? 78  DG  J "C5'" 1 
ATOM   4978  C "C4'" . DG  B 2 78  ? 15.396  147.379 46.176  1.00   92.34  ? 78  DG  J "C4'" 1 
ATOM   4979  O "O4'" . DG  B 2 78  ? 16.723  146.819 46.130  1.00   82.97  ? 78  DG  J "O4'" 1 
ATOM   4980  C "C3'" . DG  B 2 78  ? 15.407  148.088 47.512  1.00   97.35  ? 78  DG  J "C3'" 1 
ATOM   4981  O "O3'" . DG  B 2 78  ? 15.513  147.134 48.554  1.00   94.55  ? 78  DG  J "O3'" 1 
ATOM   4982  C "C2'" . DG  B 2 78  ? 16.721  148.824 47.369  1.00   86.01  ? 78  DG  J "C2'" 1 
ATOM   4983  C "C1'" . DG  B 2 78  ? 17.604  147.691 46.830  1.00   85.27  ? 78  DG  J "C1'" 1 
ATOM   4984  N N9    . DG  B 2 78  ? 18.600  148.183 45.883  1.00   84.83  ? 78  DG  J N9    1 
ATOM   4985  C C8    . DG  B 2 78  ? 18.589  149.399 45.242  1.00   92.91  ? 78  DG  J C8    1 
ATOM   4986  N N7    . DG  B 2 78  ? 19.597  149.573 44.436  1.00   97.93  ? 78  DG  J N7    1 
ATOM   4987  C C5    . DG  B 2 78  ? 20.310  148.385 44.523  1.00   99.86  ? 78  DG  J C5    1 
ATOM   4988  C C6    . DG  B 2 78  ? 21.497  147.987 43.864  1.00   100.71 ? 78  DG  J C6    1 
ATOM   4989  O O6    . DG  B 2 78  ? 22.173  148.627 43.047  1.00   91.26  ? 78  DG  J O6    1 
ATOM   4990  N N1    . DG  B 2 78  ? 21.885  146.703 44.235  1.00   108.47 ? 78  DG  J N1    1 
ATOM   4991  C C2    . DG  B 2 78  ? 21.210  145.905 45.130  1.00   124.72 ? 78  DG  J C2    1 
ATOM   4992  N N2    . DG  B 2 78  ? 21.739  144.694 45.362  1.00   129.39 ? 78  DG  J N2    1 
ATOM   4993  N N3    . DG  B 2 78  ? 20.095  146.266 45.755  1.00   115.71 ? 78  DG  J N3    1 
ATOM   4994  C C4    . DG  B 2 78  ? 19.704  147.514 45.404  1.00   97.73  ? 78  DG  J C4    1 
ATOM   4995  P P     . DG  B 2 79  ? 14.651  147.304 49.899  1.00   91.84  ? 79  DG  J P     1 
ATOM   4996  O OP1   . DG  B 2 79  ? 13.257  146.904 49.607  1.00   95.29  ? 79  DG  J OP1   1 
ATOM   4997  O OP2   . DG  B 2 79  ? 14.937  148.649 50.447  1.00   79.21  ? 79  DG  J OP2   1 
ATOM   4998  O "O5'" . DG  B 2 79  ? 15.291  146.234 50.896  1.00   115.53 ? 79  DG  J "O5'" 1 
ATOM   4999  C "C5'" . DG  B 2 79  ? 15.683  144.958 50.411  1.00   94.35  ? 79  DG  J "C5'" 1 
ATOM   5000  C "C4'" . DG  B 2 79  ? 17.124  144.662 50.784  1.00   99.72  ? 79  DG  J "C4'" 1 
ATOM   5001  O "O4'" . DG  B 2 79  ? 18.019  145.435 49.941  1.00   95.34  ? 79  DG  J "O4'" 1 
ATOM   5002  C "C3'" . DG  B 2 79  ? 17.498  144.997 52.231  1.00   91.41  ? 79  DG  J "C3'" 1 
ATOM   5003  O "O3'" . DG  B 2 79  ? 18.157  143.889 52.825  1.00   69.56  ? 79  DG  J "O3'" 1 
ATOM   5004  C "C2'" . DG  B 2 79  ? 18.426  146.209 52.099  1.00   68.67  ? 79  DG  J "C2'" 1 
ATOM   5005  C "C1'" . DG  B 2 79  ? 19.044  145.984 50.731  1.00   73.19  ? 79  DG  J "C1'" 1 
ATOM   5006  N N9    . DG  B 2 79  ? 19.512  147.213 50.098  1.00   79.72  ? 79  DG  J N9    1 
ATOM   5007  C C8    . DG  B 2 79  ? 18.956  148.465 50.212  1.00   84.49  ? 79  DG  J C8    1 
ATOM   5008  N N7    . DG  B 2 79  ? 19.591  149.379 49.531  1.00   85.20  ? 79  DG  J N7    1 
ATOM   5009  C C5    . DG  B 2 79  ? 20.635  148.689 48.927  1.00   84.75  ? 79  DG  J C5    1 
ATOM   5010  C C6    . DG  B 2 79  ? 21.658  149.155 48.066  1.00   86.64  ? 79  DG  J C6    1 
ATOM   5011  O O6    . DG  B 2 79  ? 21.849  150.306 47.654  1.00   97.99  ? 79  DG  J O6    1 
ATOM   5012  N N1    . DG  B 2 79  ? 22.514  148.128 47.679  1.00   92.81  ? 79  DG  J N1    1 
ATOM   5013  C C2    . DG  B 2 79  ? 22.396  146.816 48.075  1.00   116.65 ? 79  DG  J C2    1 
ATOM   5014  N N2    . DG  B 2 79  ? 23.319  145.967 47.598  1.00   125.92 ? 79  DG  J N2    1 
ATOM   5015  N N3    . DG  B 2 79  ? 21.441  146.366 48.881  1.00   97.16  ? 79  DG  J N3    1 
ATOM   5016  C C4    . DG  B 2 79  ? 20.600  147.355 49.267  1.00   82.60  ? 79  DG  J C4    1 
ATOM   5017  P P     . DG  B 2 80  ? 18.488  143.877 54.397  1.00   88.07  ? 80  DG  J P     1 
ATOM   5018  O OP1   . DG  B 2 80  ? 17.969  142.598 54.935  1.00   75.22  ? 80  DG  J OP1   1 
ATOM   5019  O OP2   . DG  B 2 80  ? 18.051  145.157 55.000  1.00   50.98  ? 80  DG  J OP2   1 
ATOM   5020  O "O5'" . DG  B 2 80  ? 20.084  143.827 54.436  1.00   72.06  ? 80  DG  J "O5'" 1 
ATOM   5021  C "C5'" . DG  B 2 80  ? 20.762  142.761 53.792  1.00   64.77  ? 80  DG  J "C5'" 1 
ATOM   5022  C "C4'" . DG  B 2 80  ? 22.099  143.218 53.243  1.00   69.49  ? 80  DG  J "C4'" 1 
ATOM   5023  O "O4'" . DG  B 2 80  ? 21.948  144.489 52.593  1.00   65.47  ? 80  DG  J "O4'" 1 
ATOM   5024  C "C3'" . DG  B 2 80  ? 23.186  143.438 54.290  1.00   78.27  ? 80  DG  J "C3'" 1 
ATOM   5025  O "O3'" . DG  B 2 80  ? 24.032  142.295 54.348  1.00   70.79  ? 80  DG  J "O3'" 1 
ATOM   5026  C "C2'" . DG  B 2 80  ? 23.947  144.686 53.796  1.00   70.83  ? 80  DG  J "C2'" 1 
ATOM   5027  C "C1'" . DG  B 2 80  ? 23.216  145.077 52.511  1.00   59.91  ? 80  DG  J "C1'" 1 
ATOM   5028  N N9    . DG  B 2 80  ? 23.052  146.516 52.343  1.00   74.35  ? 80  DG  J N9    1 
ATOM   5029  C C8    . DG  B 2 80  ? 22.161  147.332 52.998  1.00   81.39  ? 80  DG  J C8    1 
ATOM   5030  N N7    . DG  B 2 80  ? 22.242  148.584 52.639  1.00   75.14  ? 80  DG  J N7    1 
ATOM   5031  C C5    . DG  B 2 80  ? 23.252  148.600 51.685  1.00   93.80  ? 80  DG  J C5    1 
ATOM   5032  C C6    . DG  B 2 80  ? 23.787  149.679 50.938  1.00   96.77  ? 80  DG  J C6    1 
ATOM   5033  O O6    . DG  B 2 80  ? 23.462  150.874 50.975  1.00   85.96  ? 80  DG  J O6    1 
ATOM   5034  N N1    . DG  B 2 80  ? 24.800  149.258 50.078  1.00   101.63 ? 80  DG  J N1    1 
ATOM   5035  C C2    . DG  B 2 80  ? 25.240  147.959 49.956  1.00   105.83 ? 80  DG  J C2    1 
ATOM   5036  N N2    . DG  B 2 80  ? 26.228  147.747 49.073  1.00   107.61 ? 80  DG  J N2    1 
ATOM   5037  N N3    . DG  B 2 80  ? 24.748  146.940 50.650  1.00   86.91  ? 80  DG  J N3    1 
ATOM   5038  C C4    . DG  B 2 80  ? 23.760  147.333 51.492  1.00   91.44  ? 80  DG  J C4    1 
ATOM   5039  P P     . DA  B 2 81  ? 25.135  142.158 55.508  1.00   62.69  ? 81  DA  J P     1 
ATOM   5040  O OP1   . DA  B 2 81  ? 25.401  140.713 55.688  1.00   61.22  ? 81  DA  J OP1   1 
ATOM   5041  O OP2   . DA  B 2 81  ? 24.701  142.983 56.658  1.00   66.66  ? 81  DA  J OP2   1 
ATOM   5042  O "O5'" . DA  B 2 81  ? 26.436  142.841 54.881  1.00   54.77  ? 81  DA  J "O5'" 1 
ATOM   5043  C "C5'" . DA  B 2 81  ? 27.022  142.294 53.709  1.00   58.13  ? 81  DA  J "C5'" 1 
ATOM   5044  C "C4'" . DA  B 2 81  ? 28.224  143.108 53.275  1.00   45.62  ? 81  DA  J "C4'" 1 
ATOM   5045  O "O4'" . DA  B 2 81  ? 27.791  144.428 52.853  1.00   62.04  ? 81  DA  J "O4'" 1 
ATOM   5046  C "C3'" . DA  B 2 81  ? 29.278  143.328 54.356  1.00   56.98  ? 81  DA  J "C3'" 1 
ATOM   5047  O "O3'" . DA  B 2 81  ? 30.576  143.210 53.792  1.00   78.15  ? 81  DA  J "O3'" 1 
ATOM   5048  C "C2'" . DA  B 2 81  ? 28.997  144.750 54.839  1.00   82.99  ? 81  DA  J "C2'" 1 
ATOM   5049  C "C1'" . DA  B 2 81  ? 28.492  145.421 53.570  1.00   67.22  ? 81  DA  J "C1'" 1 
ATOM   5050  N N9    . DA  B 2 81  ? 27.579  146.533 53.824  1.00   61.41  ? 81  DA  J N9    1 
ATOM   5051  C C8    . DA  B 2 81  ? 26.572  146.574 54.747  1.00   60.96  ? 81  DA  J C8    1 
ATOM   5052  N N7    . DA  B 2 81  ? 25.904  147.704 54.752  1.00   63.08  ? 81  DA  J N7    1 
ATOM   5053  C C5    . DA  B 2 81  ? 26.516  148.456 53.764  1.00   73.82  ? 81  DA  J C5    1 
ATOM   5054  C C6    . DA  B 2 81  ? 26.276  149.756 53.275  1.00   78.52  ? 81  DA  J C6    1 
ATOM   5055  N N6    . DA  B 2 81  ? 25.310  150.552 53.746  1.00   79.32  ? 81  DA  J N6    1 
ATOM   5056  N N1    . DA  B 2 81  ? 27.071  150.207 52.281  1.00   61.62  ? 81  DA  J N1    1 
ATOM   5057  C C2    . DA  B 2 81  ? 28.037  149.406 51.813  1.00   63.44  ? 81  DA  J C2    1 
ATOM   5058  N N3    . DA  B 2 81  ? 28.357  148.168 52.192  1.00   68.61  ? 81  DA  J N3    1 
ATOM   5059  C C4    . DA  B 2 81  ? 27.551  147.748 53.180  1.00   67.94  ? 81  DA  J C4    1 
ATOM   5060  P P     . DC  B 2 82  ? 31.881  143.308 54.724  1.00   99.56  ? 82  DC  J P     1 
ATOM   5061  O OP1   . DC  B 2 82  ? 32.946  142.508 54.077  1.00   89.88  ? 82  DC  J OP1   1 
ATOM   5062  O OP2   . DC  B 2 82  ? 31.478  143.019 56.120  1.00   67.16  ? 82  DC  J OP2   1 
ATOM   5063  O "O5'" . DC  B 2 82  ? 32.283  144.850 54.643  1.00   47.78  ? 82  DC  J "O5'" 1 
ATOM   5064  C "C5'" . DC  B 2 82  ? 32.318  145.500 53.385  1.00   62.44  ? 82  DC  J "C5'" 1 
ATOM   5065  C "C4'" . DC  B 2 82  ? 32.607  146.976 53.558  1.00   65.13  ? 82  DC  J "C4'" 1 
ATOM   5066  O "O4'" . DC  B 2 82  ? 31.379  147.685 53.860  1.00   69.30  ? 82  DC  J "O4'" 1 
ATOM   5067  C "C3'" . DC  B 2 82  ? 33.585  147.309 54.689  1.00   61.55  ? 82  DC  J "C3'" 1 
ATOM   5068  O "O3'" . DC  B 2 82  ? 34.622  148.138 54.192  1.00   78.56  ? 82  DC  J "O3'" 1 
ATOM   5069  C "C2'" . DC  B 2 82  ? 32.718  148.041 55.718  1.00   63.00  ? 82  DC  J "C2'" 1 
ATOM   5070  C "C1'" . DC  B 2 82  ? 31.648  148.656 54.836  1.00   61.10  ? 82  DC  J "C1'" 1 
ATOM   5071  N N1    . DC  B 2 82  ? 30.385  148.969 55.559  1.00   56.55  ? 82  DC  J N1    1 
ATOM   5072  C C2    . DC  B 2 82  ? 29.715  150.167 55.291  1.00   64.31  ? 82  DC  J C2    1 
ATOM   5073  O O2    . DC  B 2 82  ? 30.183  150.944 54.448  1.00   59.46  ? 82  DC  J O2    1 
ATOM   5074  N N3    . DC  B 2 82  ? 28.568  150.441 55.960  1.00   64.61  ? 82  DC  J N3    1 
ATOM   5075  C C4    . DC  B 2 82  ? 28.097  149.576 56.859  1.00   59.46  ? 82  DC  J C4    1 
ATOM   5076  N N4    . DC  B 2 82  ? 26.962  149.889 57.494  1.00   46.62  ? 82  DC  J N4    1 
ATOM   5077  C C5    . DC  B 2 82  ? 28.768  148.352 57.147  1.00   67.15  ? 82  DC  J C5    1 
ATOM   5078  C C6    . DC  B 2 82  ? 29.898  148.093 56.481  1.00   51.98  ? 82  DC  J C6    1 
ATOM   5079  P P     . DA  B 2 83  ? 35.988  148.323 55.017  1.00   73.54  ? 83  DA  J P     1 
ATOM   5080  O OP1   . DA  B 2 83  ? 37.091  147.847 54.151  1.00   50.45  ? 83  DA  J OP1   1 
ATOM   5081  O OP2   . DA  B 2 83  ? 35.804  147.753 56.373  1.00   54.47  ? 83  DA  J OP2   1 
ATOM   5082  O "O5'" . DA  B 2 83  ? 36.116  149.908 55.160  1.00   79.85  ? 83  DA  J "O5'" 1 
ATOM   5083  C "C5'" . DA  B 2 83  ? 36.022  150.724 54.000  1.00   89.88  ? 83  DA  J "C5'" 1 
ATOM   5084  C "C4'" . DA  B 2 83  ? 35.613  152.135 54.368  1.00   71.66  ? 83  DA  J "C4'" 1 
ATOM   5085  O "O4'" . DA  B 2 83  ? 34.245  152.132 54.853  1.00   66.55  ? 83  DA  J "O4'" 1 
ATOM   5086  C "C3'" . DA  B 2 83  ? 36.458  152.775 55.469  1.00   77.59  ? 83  DA  J "C3'" 1 
ATOM   5087  O "O3'" . DA  B 2 83  ? 36.790  154.102 55.116  1.00   81.06  ? 83  DA  J "O3'" 1 
ATOM   5088  C "C2'" . DA  B 2 83  ? 35.548  152.729 56.695  1.00   80.54  ? 83  DA  J "C2'" 1 
ATOM   5089  C "C1'" . DA  B 2 83  ? 34.172  152.846 56.064  1.00   75.64  ? 83  DA  J "C1'" 1 
ATOM   5090  N N9    . DA  B 2 83  ? 33.115  152.263 56.878  1.00   63.54  ? 83  DA  J N9    1 
ATOM   5091  C C8    . DA  B 2 83  ? 33.081  151.001 57.399  1.00   62.94  ? 83  DA  J C8    1 
ATOM   5092  N N7    . DA  B 2 83  ? 32.001  150.746 58.097  1.00   79.63  ? 83  DA  J N7    1 
ATOM   5093  C C5    . DA  B 2 83  ? 31.275  151.925 58.030  1.00   79.20  ? 83  DA  J C5    1 
ATOM   5094  C C6    . DA  B 2 83  ? 30.031  152.305 58.567  1.00   63.90  ? 83  DA  J C6    1 
ATOM   5095  N N6    . DA  B 2 83  ? 29.273  151.492 59.309  1.00   56.51  ? 83  DA  J N6    1 
ATOM   5096  N N1    . DA  B 2 83  ? 29.595  153.557 58.312  1.00   65.24  ? 83  DA  J N1    1 
ATOM   5097  C C2    . DA  B 2 83  ? 30.359  154.368 57.568  1.00   61.83  ? 83  DA  J C2    1 
ATOM   5098  N N3    . DA  B 2 83  ? 31.544  154.123 57.010  1.00   62.69  ? 83  DA  J N3    1 
ATOM   5099  C C4    . DA  B 2 83  ? 31.949  152.871 57.282  1.00   75.08  ? 83  DA  J C4    1 
ATOM   5100  P P     . DG  B 2 84  ? 37.956  154.867 55.909  1.00   94.58  ? 84  DG  J P     1 
ATOM   5101  O OP1   . DG  B 2 84  ? 38.773  155.613 54.923  1.00   60.18  ? 84  DG  J OP1   1 
ATOM   5102  O OP2   . DG  B 2 84  ? 38.586  153.885 56.818  1.00   73.46  ? 84  DG  J OP2   1 
ATOM   5103  O "O5'" . DG  B 2 84  ? 37.169  155.911 56.823  1.00   85.71  ? 84  DG  J "O5'" 1 
ATOM   5104  C "C5'" . DG  B 2 84  ? 36.301  156.862 56.229  1.00   82.12  ? 84  DG  J "C5'" 1 
ATOM   5105  C "C4'" . DG  B 2 84  ? 35.431  157.511 57.286  1.00   83.54  ? 84  DG  J "C4'" 1 
ATOM   5106  O "O4'" . DG  B 2 84  ? 34.434  156.587 57.768  1.00   92.90  ? 84  DG  J "O4'" 1 
ATOM   5107  C "C3'" . DG  B 2 84  ? 36.203  158.012 58.505  1.00   74.01  ? 84  DG  J "C3'" 1 
ATOM   5108  O "O3'" . DG  B 2 84  ? 36.093  159.416 58.585  1.00   48.23  ? 84  DG  J "O3'" 1 
ATOM   5109  C "C2'" . DG  B 2 84  ? 35.513  157.336 59.707  1.00   76.65  ? 84  DG  J "C2'" 1 
ATOM   5110  C "C1'" . DG  B 2 84  ? 34.193  156.857 59.123  1.00   71.73  ? 84  DG  J "C1'" 1 
ATOM   5111  N N9    . DG  B 2 84  ? 33.642  155.668 59.759  1.00   58.44  ? 84  DG  J N9    1 
ATOM   5112  C C8    . DG  B 2 84  ? 34.263  154.456 59.929  1.00   78.40  ? 84  DG  J C8    1 
ATOM   5113  N N7    . DG  B 2 84  ? 33.523  153.576 60.545  1.00   74.14  ? 84  DG  J N7    1 
ATOM   5114  C C5    . DG  B 2 84  ? 32.341  154.255 60.814  1.00   82.80  ? 84  DG  J C5    1 
ATOM   5115  C C6    . DG  B 2 84  ? 31.167  153.814 61.469  1.00   91.85  ? 84  DG  J C6    1 
ATOM   5116  O O6    . DG  B 2 84  ? 30.934  152.700 61.953  1.00   109.70 ? 84  DG  J O6    1 
ATOM   5117  N N1    . DG  B 2 84  ? 30.201  154.818 61.532  1.00   81.15  ? 84  DG  J N1    1 
ATOM   5118  C C2    . DG  B 2 84  ? 30.354  156.088 61.026  1.00   93.65  ? 84  DG  J C2    1 
ATOM   5119  N N2    . DG  B 2 84  ? 29.311  156.919 61.182  1.00   88.62  ? 84  DG  J N2    1 
ATOM   5120  N N3    . DG  B 2 84  ? 31.452  156.515 60.408  1.00   80.11  ? 84  DG  J N3    1 
ATOM   5121  C C4    . DG  B 2 84  ? 32.401  155.546 60.340  1.00   70.87  ? 84  DG  J C4    1 
ATOM   5122  P P     . DC  B 2 85  ? 36.973  160.235 59.649  1.00   90.64  ? 85  DC  J P     1 
ATOM   5123  O OP1   . DC  B 2 85  ? 37.779  161.206 58.873  1.00   75.63  ? 85  DC  J OP1   1 
ATOM   5124  O OP2   . DC  B 2 85  ? 37.661  159.286 60.551  1.00   104.53 ? 85  DC  J OP2   1 
ATOM   5125  O "O5'" . DC  B 2 85  ? 35.895  161.040 60.509  1.00   83.52  ? 85  DC  J "O5'" 1 
ATOM   5126  C "C5'" . DC  B 2 85  ? 34.539  161.127 60.093  1.00   70.54  ? 85  DC  J "C5'" 1 
ATOM   5127  C "C4'" . DC  B 2 85  ? 33.650  161.327 61.304  1.00   70.36  ? 85  DC  J "C4'" 1 
ATOM   5128  O "O4'" . DC  B 2 85  ? 33.034  160.061 61.677  1.00   77.40  ? 85  DC  J "O4'" 1 
ATOM   5129  C "C3'" . DC  B 2 85  ? 34.396  161.813 62.553  1.00   72.54  ? 85  DC  J "C3'" 1 
ATOM   5130  O "O3'" . DC  B 2 85  ? 33.631  162.774 63.259  1.00   85.02  ? 85  DC  J "O3'" 1 
ATOM   5131  C "C2'" . DC  B 2 85  ? 34.547  160.533 63.366  1.00   102.59 ? 85  DC  J "C2'" 1 
ATOM   5132  C "C1'" . DC  B 2 85  ? 33.226  159.860 63.057  1.00   87.58  ? 85  DC  J "C1'" 1 
ATOM   5133  N N1    . DC  B 2 85  ? 33.221  158.400 63.351  1.00   83.89  ? 85  DC  J N1    1 
ATOM   5134  C C2    . DC  B 2 85  ? 32.080  157.819 63.904  1.00   76.28  ? 85  DC  J C2    1 
ATOM   5135  O O2    . DC  B 2 85  ? 31.092  158.529 64.125  1.00   78.67  ? 85  DC  J O2    1 
ATOM   5136  N N3    . DC  B 2 85  ? 32.087  156.492 64.179  1.00   78.65  ? 85  DC  J N3    1 
ATOM   5137  C C4    . DC  B 2 85  ? 33.175  155.763 63.925  1.00   76.36  ? 85  DC  J C4    1 
ATOM   5138  N N4    . DC  B 2 85  ? 33.133  154.459 64.212  1.00   80.34  ? 85  DC  J N4    1 
ATOM   5139  C C5    . DC  B 2 85  ? 34.353  156.340 63.364  1.00   68.70  ? 85  DC  J C5    1 
ATOM   5140  C C6    . DC  B 2 85  ? 34.333  157.651 63.099  1.00   79.69  ? 85  DC  J C6    1 
ATOM   5141  P P     . DG  B 2 86  ? 34.333  163.671 64.394  1.00   102.12 ? 86  DG  J P     1 
ATOM   5142  O OP1   . DG  B 2 86  ? 34.177  165.087 63.991  1.00   85.48  ? 86  DG  J OP1   1 
ATOM   5143  O OP2   . DG  B 2 86  ? 35.684  163.144 64.685  1.00   128.99 ? 86  DG  J OP2   1 
ATOM   5144  O "O5'" . DG  B 2 86  ? 33.428  163.425 65.683  1.00   92.58  ? 86  DG  J "O5'" 1 
ATOM   5145  C "C5'" . DG  B 2 86  ? 32.032  163.626 65.613  1.00   104.70 ? 86  DG  J "C5'" 1 
ATOM   5146  C "C4'" . DG  B 2 86  ? 31.323  163.029 66.817  1.00   104.81 ? 86  DG  J "C4'" 1 
ATOM   5147  O "O4'" . DG  B 2 86  ? 31.312  161.574 66.737  1.00   99.23  ? 86  DG  J "O4'" 1 
ATOM   5148  C "C3'" . DG  B 2 86  ? 31.968  163.369 68.158  1.00   86.63  ? 86  DG  J "C3'" 1 
ATOM   5149  O "O3'" . DG  B 2 86  ? 30.981  163.483 69.152  1.00   97.91  ? 86  DG  J "O3'" 1 
ATOM   5150  C "C2'" . DG  B 2 86  ? 32.848  162.144 68.410  1.00   87.41  ? 86  DG  J "C2'" 1 
ATOM   5151  C "C1'" . DG  B 2 86  ? 31.949  161.036 67.879  1.00   97.12  ? 86  DG  J "C1'" 1 
ATOM   5152  N N9    . DG  B 2 86  ? 32.649  159.804 67.509  1.00   87.70  ? 86  DG  J N9    1 
ATOM   5153  C C8    . DG  B 2 86  ? 33.731  159.679 66.671  1.00   71.40  ? 86  DG  J C8    1 
ATOM   5154  N N7    . DG  B 2 86  ? 34.136  158.446 66.525  1.00   60.01  ? 86  DG  J N7    1 
ATOM   5155  C C5    . DG  B 2 86  ? 33.259  157.703 67.307  1.00   80.62  ? 86  DG  J C5    1 
ATOM   5156  C C6    . DG  B 2 86  ? 33.198  156.303 67.540  1.00   79.38  ? 86  DG  J C6    1 
ATOM   5157  O O6    . DG  B 2 86  ? 33.930  155.415 67.085  1.00   75.55  ? 86  DG  J O6    1 
ATOM   5158  N N1    . DG  B 2 86  ? 32.154  155.967 68.397  1.00   77.90  ? 86  DG  J N1    1 
ATOM   5159  C C2    . DG  B 2 86  ? 31.278  156.866 68.959  1.00   98.59  ? 86  DG  J C2    1 
ATOM   5160  N N2    . DG  B 2 86  ? 30.335  156.352 69.763  1.00   94.95  ? 86  DG  J N2    1 
ATOM   5161  N N3    . DG  B 2 86  ? 31.324  158.178 68.751  1.00   104.03 ? 86  DG  J N3    1 
ATOM   5162  C C4    . DG  B 2 86  ? 32.336  158.523 67.917  1.00   90.44  ? 86  DG  J C4    1 
ATOM   5163  P P     . DC  B 2 87  ? 31.230  164.439 70.417  1.00   120.88 ? 87  DC  J P     1 
ATOM   5164  O OP1   . DC  B 2 87  ? 30.349  165.620 70.281  1.00   146.09 ? 87  DC  J OP1   1 
ATOM   5165  O OP2   . DC  B 2 87  ? 32.691  164.627 70.558  1.00   105.62 ? 87  DC  J OP2   1 
ATOM   5166  O "O5'" . DC  B 2 87  ? 30.726  163.558 71.646  1.00   108.79 ? 87  DC  J "O5'" 1 
ATOM   5167  C "C5'" . DC  B 2 87  ? 29.573  162.749 71.493  1.00   118.94 ? 87  DC  J "C5'" 1 
ATOM   5168  C "C4'" . DC  B 2 87  ? 29.764  161.408 72.172  1.00   121.60 ? 87  DC  J "C4'" 1 
ATOM   5169  O "O4'" . DC  B 2 87  ? 30.628  160.575 71.383  1.00   105.83 ? 87  DC  J "O4'" 1 
ATOM   5170  C "C3'" . DC  B 2 87  ? 30.445  161.468 73.529  1.00   121.26 ? 87  DC  J "C3'" 1 
ATOM   5171  O "O3'" . DC  B 2 87  ? 29.471  161.611 74.553  1.00   132.34 ? 87  DC  J "O3'" 1 
ATOM   5172  C "C2'" . DC  B 2 87  ? 31.176  160.117 73.628  1.00   112.88 ? 87  DC  J "C2'" 1 
ATOM   5173  C "C1'" . DC  B 2 87  ? 31.071  159.532 72.215  1.00   106.96 ? 87  DC  J "C1'" 1 
ATOM   5174  N N1    . DC  B 2 87  ? 32.362  158.998 71.699  1.00   89.42  ? 87  DC  J N1    1 
ATOM   5175  C C2    . DC  B 2 87  ? 32.634  157.632 71.817  1.00   81.27  ? 87  DC  J C2    1 
ATOM   5176  O O2    . DC  B 2 87  ? 31.787  156.893 72.336  1.00   71.11  ? 87  DC  J O2    1 
ATOM   5177  N N3    . DC  B 2 87  ? 33.814  157.155 71.353  1.00   80.50  ? 87  DC  J N3    1 
ATOM   5178  C C4    . DC  B 2 87  ? 34.698  157.985 70.800  1.00   77.52  ? 87  DC  J C4    1 
ATOM   5179  N N4    . DC  B 2 87  ? 35.848  157.468 70.357  1.00   89.81  ? 87  DC  J N4    1 
ATOM   5180  C C5    . DC  B 2 87  ? 34.442  159.383 70.677  1.00   87.09  ? 87  DC  J C5    1 
ATOM   5181  C C6    . DC  B 2 87  ? 33.274  159.842 71.138  1.00   93.24  ? 87  DC  J C6    1 
ATOM   5182  P P     . DG  B 2 88  ? 29.916  161.629 76.096  1.00   140.38 ? 88  DG  J P     1 
ATOM   5183  O OP1   . DG  B 2 88  ? 28.878  162.361 76.854  1.00   166.18 ? 88  DG  J OP1   1 
ATOM   5184  O OP2   . DG  B 2 88  ? 31.327  162.076 76.159  1.00   76.95  ? 88  DG  J OP2   1 
ATOM   5185  O "O5'" . DG  B 2 88  ? 29.870  160.090 76.520  1.00   131.16 ? 88  DG  J "O5'" 1 
ATOM   5186  C "C5'" . DG  B 2 88  ? 28.780  159.271 76.108  1.00   134.34 ? 88  DG  J "C5'" 1 
ATOM   5187  C "C4'" . DG  B 2 88  ? 28.995  157.833 76.543  1.00   134.70 ? 88  DG  J "C4'" 1 
ATOM   5188  O "O4'" . DG  B 2 88  ? 30.123  157.267 75.822  1.00   107.94 ? 88  DG  J "O4'" 1 
ATOM   5189  C "C3'" . DG  B 2 88  ? 29.299  157.654 78.025  1.00   116.61 ? 88  DG  J "C3'" 1 
ATOM   5190  O "O3'" . DG  B 2 88  ? 28.640  156.499 78.522  1.00   111.63 ? 88  DG  J "O3'" 1 
ATOM   5191  C "C2'" . DG  B 2 88  ? 30.821  157.511 78.062  1.00   93.64  ? 88  DG  J "C2'" 1 
ATOM   5192  C "C1'" . DG  B 2 88  ? 31.119  156.835 76.728  1.00   108.63 ? 88  DG  J "C1'" 1 
ATOM   5193  N N9    . DG  B 2 88  ? 32.425  157.194 76.174  1.00   95.24  ? 88  DG  J N9    1 
ATOM   5194  C C8    . DG  B 2 88  ? 32.914  158.461 75.968  1.00   82.33  ? 88  DG  J C8    1 
ATOM   5195  N N7    . DG  B 2 88  ? 34.111  158.482 75.452  1.00   59.94  ? 88  DG  J N7    1 
ATOM   5196  C C5    . DG  B 2 88  ? 34.441  157.143 75.304  1.00   82.70  ? 88  DG  J C5    1 
ATOM   5197  C C6    . DG  B 2 88  ? 35.619  156.547 74.794  1.00   94.61  ? 88  DG  J C6    1 
ATOM   5198  O O6    . DG  B 2 88  ? 36.634  157.107 74.359  1.00   95.31  ? 88  DG  J O6    1 
ATOM   5199  N N1    . DG  B 2 88  ? 35.547  155.155 74.820  1.00   100.07 ? 88  DG  J N1    1 
ATOM   5200  C C2    . DG  B 2 88  ? 34.471  154.432 75.280  1.00   91.80  ? 88  DG  J C2    1 
ATOM   5201  N N2    . DG  B 2 88  ? 34.587  153.097 75.225  1.00   66.47  ? 88  DG  J N2    1 
ATOM   5202  N N3    . DG  B 2 88  ? 33.359  154.978 75.760  1.00   107.55 ? 88  DG  J N3    1 
ATOM   5203  C C4    . DG  B 2 88  ? 33.414  156.334 75.742  1.00   105.57 ? 88  DG  J C4    1 
ATOM   5204  P P     . DT  B 2 89  ? 28.760  156.106 80.075  1.00   140.47 ? 89  DT  J P     1 
ATOM   5205  O OP1   . DT  B 2 89  ? 27.567  155.302 80.428  1.00   79.34  ? 89  DT  J OP1   1 
ATOM   5206  O OP2   . DT  B 2 89  ? 29.070  157.340 80.831  1.00   102.46 ? 89  DT  J OP2   1 
ATOM   5207  O "O5'" . DT  B 2 89  ? 30.054  155.168 80.118  1.00   137.78 ? 89  DT  J "O5'" 1 
ATOM   5208  C "C5'" . DT  B 2 89  ? 30.076  153.965 79.362  1.00   110.64 ? 89  DT  J "C5'" 1 
ATOM   5209  C "C4'" . DT  B 2 89  ? 31.464  153.356 79.360  1.00   87.86  ? 89  DT  J "C4'" 1 
ATOM   5210  O "O4'" . DT  B 2 89  ? 32.396  154.210 78.662  1.00   98.85  ? 89  DT  J "O4'" 1 
ATOM   5211  C "C3'" . DT  B 2 89  ? 32.046  153.128 80.756  1.00   80.65  ? 89  DT  J "C3'" 1 
ATOM   5212  O "O3'" . DT  B 2 89  ? 32.173  151.737 81.002  1.00   100.19 ? 89  DT  J "O3'" 1 
ATOM   5213  C "C2'" . DT  B 2 89  ? 33.410  153.835 80.742  1.00   82.45  ? 89  DT  J "C2'" 1 
ATOM   5214  C "C1'" . DT  B 2 89  ? 33.659  154.092 79.265  1.00   78.86  ? 89  DT  J "C1'" 1 
ATOM   5215  N N1    . DT  B 2 89  ? 34.466  155.311 78.992  1.00   81.72  ? 89  DT  J N1    1 
ATOM   5216  C C2    . DT  B 2 89  ? 35.757  155.164 78.547  1.00   95.74  ? 89  DT  J C2    1 
ATOM   5217  O O2    . DT  B 2 89  ? 36.270  154.079 78.342  1.00   103.77 ? 89  DT  J O2    1 
ATOM   5218  N N3    . DT  B 2 89  ? 36.428  156.338 78.331  1.00   101.93 ? 89  DT  J N3    1 
ATOM   5219  C C4    . DT  B 2 89  ? 35.949  157.620 78.523  1.00   92.70  ? 89  DT  J C4    1 
ATOM   5220  O O4    . DT  B 2 89  ? 36.633  158.615 78.302  1.00   65.72  ? 89  DT  J O4    1 
ATOM   5221  C C5    . DT  B 2 89  ? 34.588  157.705 79.003  1.00   111.59 ? 89  DT  J C5    1 
ATOM   5222  C C7    . DT  B 2 89  ? 33.956  159.043 79.251  1.00   117.86 ? 89  DT  J C7    1 
ATOM   5223  C C6    . DT  B 2 89  ? 33.922  156.558 79.217  1.00   99.41  ? 89  DT  J C6    1 
ATOM   5224  P P     . DA  B 2 90  ? 31.130  150.961 81.943  1.00   103.20 ? 90  DA  J P     1 
ATOM   5225  O OP1   . DA  B 2 90  ? 29.815  150.990 81.264  1.00   103.78 ? 90  DA  J OP1   1 
ATOM   5226  O OP2   . DA  B 2 90  ? 31.272  151.490 83.318  1.00   97.72  ? 90  DA  J OP2   1 
ATOM   5227  O "O5'" . DA  B 2 90  ? 31.670  149.455 81.935  1.00   103.29 ? 90  DA  J "O5'" 1 
ATOM   5228  C "C5'" . DA  B 2 90  ? 31.629  148.694 80.731  1.00   95.79  ? 90  DA  J "C5'" 1 
ATOM   5229  C "C4'" . DA  B 2 90  ? 33.023  148.486 80.157  1.00   86.74  ? 90  DA  J "C4'" 1 
ATOM   5230  O "O4'" . DA  B 2 90  ? 33.752  149.741 80.158  1.00   81.31  ? 90  DA  J "O4'" 1 
ATOM   5231  C "C3'" . DA  B 2 90  ? 33.905  147.503 80.935  1.00   74.82  ? 90  DA  J "C3'" 1 
ATOM   5232  O "O3'" . DA  B 2 90  ? 34.567  146.652 80.034  1.00   72.93  ? 90  DA  J "O3'" 1 
ATOM   5233  C "C2'" . DA  B 2 90  ? 34.896  148.421 81.646  1.00   73.49  ? 90  DA  J "C2'" 1 
ATOM   5234  C "C1'" . DA  B 2 90  ? 35.064  149.488 80.590  1.00   64.31  ? 90  DA  J "C1'" 1 
ATOM   5235  N N9    . DA  B 2 90  ? 35.620  150.729 81.108  1.00   70.40  ? 90  DA  J N9    1 
ATOM   5236  C C8    . DA  B 2 90  ? 35.151  151.466 82.158  1.00   84.66  ? 90  DA  J C8    1 
ATOM   5237  N N7    . DA  B 2 90  ? 35.840  152.558 82.388  1.00   78.64  ? 90  DA  J N7    1 
ATOM   5238  C C5    . DA  B 2 90  ? 36.815  152.546 81.405  1.00   89.11  ? 90  DA  J C5    1 
ATOM   5239  C C6    . DA  B 2 90  ? 37.865  153.433 81.100  1.00   100.37 ? 90  DA  J C6    1 
ATOM   5240  N N6    . DA  B 2 90  ? 38.101  154.553 81.787  1.00   97.48  ? 90  DA  J N6    1 
ATOM   5241  N N1    . DA  B 2 90  ? 38.661  153.126 80.054  1.00   103.21 ? 90  DA  J N1    1 
ATOM   5242  C C2    . DA  B 2 90  ? 38.416  152.004 79.365  1.00   104.46 ? 90  DA  J C2    1 
ATOM   5243  N N3    . DA  B 2 90  ? 37.461  151.094 79.558  1.00   91.94  ? 90  DA  J N3    1 
ATOM   5244  C C4    . DA  B 2 90  ? 36.688  151.428 80.603  1.00   82.02  ? 90  DA  J C4    1 
ATOM   5245  P P     . DC  B 2 91  ? 35.006  145.182 80.496  1.00   90.29  ? 91  DC  J P     1 
ATOM   5246  O OP1   . DC  B 2 91  ? 34.446  144.261 79.484  1.00   74.80  ? 91  DC  J OP1   1 
ATOM   5247  O OP2   . DC  B 2 91  ? 34.652  145.025 81.925  1.00   72.89  ? 91  DC  J OP2   1 
ATOM   5248  O "O5'" . DC  B 2 91  ? 36.604  145.206 80.392  1.00   78.70  ? 91  DC  J "O5'" 1 
ATOM   5249  C "C5'" . DC  B 2 91  ? 37.232  145.452 79.143  1.00   63.57  ? 91  DC  J "C5'" 1 
ATOM   5250  C "C4'" . DC  B 2 91  ? 38.627  146.018 79.343  1.00   54.11  ? 91  DC  J "C4'" 1 
ATOM   5251  O "O4'" . DC  B 2 91  ? 38.532  147.320 79.951  1.00   61.74  ? 91  DC  J "O4'" 1 
ATOM   5252  C "C3'" . DC  B 2 91  ? 39.544  145.190 80.251  1.00   52.10  ? 91  DC  J "C3'" 1 
ATOM   5253  O "O3'" . DC  B 2 91  ? 40.615  144.635 79.483  1.00   70.77  ? 91  DC  J "O3'" 1 
ATOM   5254  C "C2'" . DC  B 2 91  ? 40.053  146.190 81.306  1.00   64.75  ? 91  DC  J "C2'" 1 
ATOM   5255  C "C1'" . DC  B 2 91  ? 39.684  147.542 80.712  1.00   67.91  ? 91  DC  J "C1'" 1 
ATOM   5256  N N1    . DC  B 2 91  ? 39.372  148.578 81.742  1.00   85.30  ? 91  DC  J N1    1 
ATOM   5257  C C2    . DC  B 2 91  ? 40.006  149.826 81.685  1.00   83.30  ? 91  DC  J C2    1 
ATOM   5258  O O2    . DC  B 2 91  ? 40.814  150.052 80.775  1.00   69.61  ? 91  DC  J O2    1 
ATOM   5259  N N3    . DC  B 2 91  ? 39.712  150.755 82.629  1.00   80.09  ? 91  DC  J N3    1 
ATOM   5260  C C4    . DC  B 2 91  ? 38.833  150.473 83.592  1.00   88.03  ? 91  DC  J C4    1 
ATOM   5261  N N4    . DC  B 2 91  ? 38.576  151.420 84.500  1.00   85.10  ? 91  DC  J N4    1 
ATOM   5262  C C5    . DC  B 2 91  ? 38.179  149.207 83.667  1.00   86.74  ? 91  DC  J C5    1 
ATOM   5263  C C6    . DC  B 2 91  ? 38.475  148.299 82.732  1.00   66.75  ? 91  DC  J C6    1 
ATOM   5264  P P     . DG  B 2 92  ? 41.723  143.687 80.166  1.00   67.82  ? 92  DG  J P     1 
ATOM   5265  O OP1   . DG  B 2 92  ? 42.039  142.605 79.209  1.00   66.73  ? 92  DG  J OP1   1 
ATOM   5266  O OP2   . DG  B 2 92  ? 41.264  143.332 81.527  1.00   77.05  ? 92  DG  J OP2   1 
ATOM   5267  O "O5'" . DG  B 2 92  ? 43.001  144.640 80.295  1.00   41.85  ? 92  DG  J "O5'" 1 
ATOM   5268  C "C5'" . DG  B 2 92  ? 43.295  145.566 79.253  1.00   64.56  ? 92  DG  J "C5'" 1 
ATOM   5269  C "C4'" . DG  B 2 92  ? 44.308  146.593 79.720  1.00   74.69  ? 92  DG  J "C4'" 1 
ATOM   5270  O "O4'" . DG  B 2 92  ? 43.646  147.551 80.566  1.00   81.97  ? 92  DG  J "O4'" 1 
ATOM   5271  C "C3'" . DG  B 2 92  ? 45.477  146.035 80.537  1.00   70.53  ? 92  DG  J "C3'" 1 
ATOM   5272  O "O3'" . DG  B 2 92  ? 46.704  146.245 79.834  1.00   60.53  ? 92  DG  J "O3'" 1 
ATOM   5273  C "C2'" . DG  B 2 92  ? 45.423  146.790 81.874  1.00   72.59  ? 92  DG  J "C2'" 1 
ATOM   5274  C "C1'" . DG  B 2 92  ? 44.529  147.982 81.562  1.00   62.97  ? 92  DG  J "C1'" 1 
ATOM   5275  N N9    . DG  B 2 92  ? 43.716  148.393 82.696  1.00   56.93  ? 92  DG  J N9    1 
ATOM   5276  C C8    . DG  B 2 92  ? 42.775  147.634 83.348  1.00   72.84  ? 92  DG  J C8    1 
ATOM   5277  N N7    . DG  B 2 92  ? 42.190  148.260 84.327  1.00   81.23  ? 92  DG  J N7    1 
ATOM   5278  C C5    . DG  B 2 92  ? 42.779  149.516 84.325  1.00   92.32  ? 92  DG  J C5    1 
ATOM   5279  C C6    . DG  B 2 92  ? 42.548  150.627 85.166  1.00   113.39 ? 92  DG  J C6    1 
ATOM   5280  O O6    . DG  B 2 92  ? 41.748  150.723 86.106  1.00   117.40 ? 92  DG  J O6    1 
ATOM   5281  N N1    . DG  B 2 92  ? 43.359  151.709 84.825  1.00   119.82 ? 92  DG  J N1    1 
ATOM   5282  C C2    . DG  B 2 92  ? 44.278  151.712 83.801  1.00   111.75 ? 92  DG  J C2    1 
ATOM   5283  N N2    . DG  B 2 92  ? 44.968  152.849 83.625  1.00   103.81 ? 92  DG  J N2    1 
ATOM   5284  N N3    . DG  B 2 92  ? 44.505  150.674 83.005  1.00   94.29  ? 92  DG  J N3    1 
ATOM   5285  C C4    . DG  B 2 92  ? 43.721  149.614 83.325  1.00   79.89  ? 92  DG  J C4    1 
ATOM   5286  P P     . DT  B 2 93  ? 48.082  145.629 80.386  1.00   72.29  ? 93  DT  J P     1 
ATOM   5287  O OP1   . DT  B 2 93  ? 49.006  145.543 79.232  1.00   59.80  ? 93  DT  J OP1   1 
ATOM   5288  O OP2   . DT  B 2 93  ? 47.765  144.410 81.166  1.00   62.96  ? 93  DT  J OP2   1 
ATOM   5289  O "O5'" . DT  B 2 93  ? 48.636  146.750 81.386  1.00   54.75  ? 93  DT  J "O5'" 1 
ATOM   5290  C "C5'" . DT  B 2 93  ? 49.180  147.957 80.865  1.00   52.05  ? 93  DT  J "C5'" 1 
ATOM   5291  C "C4'" . DT  B 2 93  ? 49.534  148.927 81.981  1.00   67.28  ? 93  DT  J "C4'" 1 
ATOM   5292  O "O4'" . DT  B 2 93  ? 48.351  149.225 82.763  1.00   93.91  ? 93  DT  J "O4'" 1 
ATOM   5293  C "C3'" . DT  B 2 93  ? 50.591  148.428 82.972  1.00   72.02  ? 93  DT  J "C3'" 1 
ATOM   5294  O "O3'" . DT  B 2 93  ? 51.611  149.413 83.125  1.00   88.19  ? 93  DT  J "O3'" 1 
ATOM   5295  C "C2'" . DT  B 2 93  ? 49.806  148.215 84.271  1.00   53.14  ? 93  DT  J "C2'" 1 
ATOM   5296  C "C1'" . DT  B 2 93  ? 48.687  149.231 84.127  1.00   73.55  ? 93  DT  J "C1'" 1 
ATOM   5297  N N1    . DT  B 2 93  ? 47.465  148.893 84.914  1.00   72.97  ? 93  DT  J N1    1 
ATOM   5298  C C2    . DT  B 2 93  ? 46.785  149.897 85.569  1.00   81.37  ? 93  DT  J C2    1 
ATOM   5299  O O2    . DT  B 2 93  ? 47.130  151.066 85.546  1.00   74.82  ? 93  DT  J O2    1 
ATOM   5300  N N3    . DT  B 2 93  ? 45.677  149.483 86.257  1.00   72.32  ? 93  DT  J N3    1 
ATOM   5301  C C4    . DT  B 2 93  ? 45.188  148.195 86.354  1.00   92.63  ? 93  DT  J C4    1 
ATOM   5302  O O4    . DT  B 2 93  ? 44.180  147.924 87.000  1.00   100.06 ? 93  DT  J O4    1 
ATOM   5303  C C5    . DT  B 2 93  ? 45.946  147.189 85.642  1.00   84.59  ? 93  DT  J C5    1 
ATOM   5304  C C7    . DT  B 2 93  ? 45.513  145.752 85.674  1.00   75.75  ? 93  DT  J C7    1 
ATOM   5305  C C6    . DT  B 2 93  ? 47.035  147.584 84.964  1.00   56.19  ? 93  DT  J C6    1 
ATOM   5306  P P     . DG  B 2 94  ? 52.993  149.045 83.860  1.00   75.78  ? 94  DG  J P     1 
ATOM   5307  O OP1   . DG  B 2 94  ? 54.058  149.894 83.280  1.00   65.78  ? 94  DG  J OP1   1 
ATOM   5308  O OP2   . DG  B 2 94  ? 53.132  147.571 83.848  1.00   57.80  ? 94  DG  J OP2   1 
ATOM   5309  O "O5'" . DG  B 2 94  ? 52.743  149.490 85.373  1.00   68.42  ? 94  DG  J "O5'" 1 
ATOM   5310  C "C5'" . DG  B 2 94  ? 52.403  150.835 85.668  1.00   72.36  ? 94  DG  J "C5'" 1 
ATOM   5311  C "C4'" . DG  B 2 94  ? 52.030  150.978 87.129  1.00   85.20  ? 94  DG  J "C4'" 1 
ATOM   5312  O "O4'" . DG  B 2 94  ? 50.679  150.527 87.327  1.00   86.89  ? 94  DG  J "O4'" 1 
ATOM   5313  C "C3'" . DG  B 2 94  ? 52.891  150.137 88.066  1.00   85.10  ? 94  DG  J "C3'" 1 
ATOM   5314  O "O3'" . DG  B 2 94  ? 53.891  150.960 88.672  1.00   108.07 ? 94  DG  J "O3'" 1 
ATOM   5315  C "C2'" . DG  B 2 94  ? 51.914  149.532 89.087  1.00   79.53  ? 94  DG  J "C2'" 1 
ATOM   5316  C "C1'" . DG  B 2 94  ? 50.543  150.028 88.633  1.00   71.65  ? 94  DG  J "C1'" 1 
ATOM   5317  N N9    . DG  B 2 94  ? 49.520  148.990 88.613  1.00   58.80  ? 94  DG  J N9    1 
ATOM   5318  C C8    . DG  B 2 94  ? 49.621  147.741 88.053  1.00   70.89  ? 94  DG  J C8    1 
ATOM   5319  N N7    . DG  B 2 94  ? 48.547  147.018 88.197  1.00   80.49  ? 94  DG  J N7    1 
ATOM   5320  C C5    . DG  B 2 94  ? 47.686  147.831 88.921  1.00   90.06  ? 94  DG  J C5    1 
ATOM   5321  C C6    . DG  B 2 94  ? 46.372  147.583 89.384  1.00   104.36 ? 94  DG  J C6    1 
ATOM   5322  O O6    . DG  B 2 94  ? 45.688  146.559 89.240  1.00   91.58  ? 94  DG  J O6    1 
ATOM   5323  N N1    . DG  B 2 94  ? 45.856  148.677 90.078  1.00   101.90 ? 94  DG  J N1    1 
ATOM   5324  C C2    . DG  B 2 94  ? 46.528  149.858 90.296  1.00   88.66  ? 94  DG  J C2    1 
ATOM   5325  N N2    . DG  B 2 94  ? 45.869  150.798 90.987  1.00   94.48  ? 94  DG  J N2    1 
ATOM   5326  N N3    . DG  B 2 94  ? 47.760  150.101 89.868  1.00   82.37  ? 94  DG  J N3    1 
ATOM   5327  C C4    . DG  B 2 94  ? 48.274  149.047 89.190  1.00   79.77  ? 94  DG  J C4    1 
ATOM   5328  P P     . DC  B 2 95  ? 54.810  150.400 89.866  1.00   100.35 ? 95  DC  J P     1 
ATOM   5329  O OP1   . DC  B 2 95  ? 56.043  151.219 89.885  1.00   101.89 ? 95  DC  J OP1   1 
ATOM   5330  O OP2   . DC  B 2 95  ? 54.909  148.930 89.726  1.00   94.31  ? 95  DC  J OP2   1 
ATOM   5331  O "O5'" . DC  B 2 95  ? 53.962  150.715 91.185  1.00   79.21  ? 95  DC  J "O5'" 1 
ATOM   5332  C "C5'" . DC  B 2 95  ? 53.461  152.028 91.414  1.00   65.99  ? 95  DC  J "C5'" 1 
ATOM   5333  C "C4'" . DC  B 2 95  ? 52.609  152.068 92.669  1.00   83.99  ? 95  DC  J "C4'" 1 
ATOM   5334  O "O4'" . DC  B 2 95  ? 51.384  151.314 92.453  1.00   84.01  ? 95  DC  J "O4'" 1 
ATOM   5335  C "C3'" . DC  B 2 95  ? 53.267  151.465 93.913  1.00   109.94 ? 95  DC  J "C3'" 1 
ATOM   5336  O "O3'" . DC  B 2 95  ? 53.030  152.298 95.042  1.00   124.80 ? 95  DC  J "O3'" 1 
ATOM   5337  C "C2'" . DC  B 2 95  ? 52.575  150.112 94.056  1.00   92.96  ? 95  DC  J "C2'" 1 
ATOM   5338  C "C1'" . DC  B 2 95  ? 51.186  150.425 93.528  1.00   88.63  ? 95  DC  J "C1'" 1 
ATOM   5339  N N1    . DC  B 2 95  ? 50.455  149.223 93.027  1.00   87.10  ? 95  DC  J N1    1 
ATOM   5340  C C2    . DC  B 2 95  ? 49.102  149.049 93.344  1.00   92.50  ? 95  DC  J C2    1 
ATOM   5341  O O2    . DC  B 2 95  ? 48.529  149.901 94.033  1.00   113.56 ? 95  DC  J O2    1 
ATOM   5342  N N3    . DC  B 2 95  ? 48.456  147.950 92.883  1.00   79.98  ? 95  DC  J N3    1 
ATOM   5343  C C4    . DC  B 2 95  ? 49.109  147.053 92.143  1.00   96.20  ? 95  DC  J C4    1 
ATOM   5344  N N4    . DC  B 2 95  ? 48.430  145.984 91.711  1.00   93.61  ? 95  DC  J N4    1 
ATOM   5345  C C5    . DC  B 2 95  ? 50.488  147.211 91.812  1.00   92.60  ? 95  DC  J C5    1 
ATOM   5346  C C6    . DC  B 2 95  ? 51.115  148.298 92.272  1.00   93.13  ? 95  DC  J C6    1 
ATOM   5347  P P     . DG  B 2 96  ? 53.902  152.117 96.381  1.00   122.68 ? 96  DG  J P     1 
ATOM   5348  O OP1   . DG  B 2 96  ? 54.457  153.444 96.729  1.00   114.95 ? 96  DG  J OP1   1 
ATOM   5349  O OP2   . DG  B 2 96  ? 54.814  150.967 96.188  1.00   99.20  ? 96  DG  J OP2   1 
ATOM   5350  O "O5'" . DG  B 2 96  ? 52.823  151.700 97.484  1.00   118.86 ? 96  DG  J "O5'" 1 
ATOM   5351  C "C5'" . DG  B 2 96  ? 51.722  152.558 97.756  1.00   123.33 ? 96  DG  J "C5'" 1 
ATOM   5352  C "C4'" . DG  B 2 96  ? 50.607  151.801 98.452  1.00   115.49 ? 96  DG  J "C4'" 1 
ATOM   5353  O "O4'" . DG  B 2 96  ? 50.084  150.780 97.561  1.00   97.44  ? 96  DG  J "O4'" 1 
ATOM   5354  C "C3'" . DG  B 2 96  ? 51.018  151.079 99.738  1.00   113.67 ? 96  DG  J "C3'" 1 
ATOM   5355  O "O3'" . DG  B 2 96  ? 50.033  151.286 100.746 1.00   118.01 ? 96  DG  J "O3'" 1 
ATOM   5356  C "C2'" . DG  B 2 96  ? 51.088  149.614 99.311  1.00   115.06 ? 96  DG  J "C2'" 1 
ATOM   5357  C "C1'" . DG  B 2 96  ? 50.001  149.556 98.253  1.00   112.94 ? 96  DG  J "C1'" 1 
ATOM   5358  N N9    . DG  B 2 96  ? 50.177  148.466 97.299  1.00   108.07 ? 96  DG  J N9    1 
ATOM   5359  C C8    . DG  B 2 96  ? 51.271  148.232 96.502  1.00   110.84 ? 96  DG  J C8    1 
ATOM   5360  N N7    . DG  B 2 96  ? 51.149  147.176 95.747  1.00   98.27  ? 96  DG  J N7    1 
ATOM   5361  C C5    . DG  B 2 96  ? 49.894  146.675 96.064  1.00   97.61  ? 96  DG  J C5    1 
ATOM   5362  C C6    . DG  B 2 96  ? 49.212  145.539 95.564  1.00   96.51  ? 96  DG  J C6    1 
ATOM   5363  O O6    . DG  B 2 96  ? 49.596  144.725 94.713  1.00   76.75  ? 96  DG  J O6    1 
ATOM   5364  N N1    . DG  B 2 96  ? 47.959  145.390 96.155  1.00   111.05 ? 96  DG  J N1    1 
ATOM   5365  C C2    . DG  B 2 96  ? 47.433  146.232 97.108  1.00   121.44 ? 96  DG  J C2    1 
ATOM   5366  N N2    . DG  B 2 96  ? 46.208  145.925 97.561  1.00   123.69 ? 96  DG  J N2    1 
ATOM   5367  N N3    . DG  B 2 96  ? 48.062  147.299 97.585  1.00   101.78 ? 96  DG  J N3    1 
ATOM   5368  C C4    . DG  B 2 96  ? 49.283  147.458 97.019  1.00   96.10  ? 96  DG  J C4    1 
ATOM   5369  P P     . DT  B 2 97  ? 50.246  150.704 102.229 1.00   139.01 ? 97  DT  J P     1 
ATOM   5370  O OP1   . DT  B 2 97  ? 49.778  151.740 103.176 1.00   149.50 ? 97  DT  J OP1   1 
ATOM   5371  O OP2   . DT  B 2 97  ? 51.631  150.189 102.338 1.00   105.10 ? 97  DT  J OP2   1 
ATOM   5372  O "O5'" . DT  B 2 97  ? 49.241  149.460 102.297 1.00   106.05 ? 97  DT  J "O5'" 1 
ATOM   5373  C "C5'" . DT  B 2 97  ? 47.857  149.658 102.034 1.00   102.04 ? 97  DT  J "C5'" 1 
ATOM   5374  C "C4'" . DT  B 2 97  ? 47.132  148.331 101.888 1.00   114.48 ? 97  DT  J "C4'" 1 
ATOM   5375  O "O4'" . DT  B 2 97  ? 47.709  147.576 100.800 1.00   99.80  ? 97  DT  J "O4'" 1 
ATOM   5376  C "C3'" . DT  B 2 97  ? 47.190  147.417 103.119 1.00   107.65 ? 97  DT  J "C3'" 1 
ATOM   5377  O "O3'" . DT  B 2 97  ? 45.880  147.220 103.643 1.00   116.60 ? 97  DT  J "O3'" 1 
ATOM   5378  C "C2'" . DT  B 2 97  ? 47.794  146.104 102.597 1.00   90.12  ? 97  DT  J "C2'" 1 
ATOM   5379  C "C1'" . DT  B 2 97  ? 47.581  146.213 101.095 1.00   104.61 ? 97  DT  J "C1'" 1 
ATOM   5380  N N1    . DT  B 2 97  ? 48.588  145.455 100.298 1.00   109.82 ? 97  DT  J N1    1 
ATOM   5381  C C2    . DT  B 2 97  ? 48.268  144.201 99.828  1.00   105.23 ? 97  DT  J C2    1 
ATOM   5382  O O2    . DT  B 2 97  ? 47.190  143.668 100.023 1.00   103.34 ? 97  DT  J O2    1 
ATOM   5383  N N3    . DT  B 2 97  ? 49.261  143.588 99.112  1.00   94.95  ? 97  DT  J N3    1 
ATOM   5384  C C4    . DT  B 2 97  ? 50.517  144.091 98.826  1.00   91.90  ? 97  DT  J C4    1 
ATOM   5385  O O4    . DT  B 2 97  ? 51.342  143.460 98.172  1.00   78.51  ? 97  DT  J O4    1 
ATOM   5386  C C5    . DT  B 2 97  ? 50.789  145.410 99.349  1.00   93.46  ? 97  DT  J C5    1 
ATOM   5387  C C7    . DT  B 2 97  ? 52.118  146.060 99.103  1.00   81.49  ? 97  DT  J C7    1 
ATOM   5388  C C6    . DT  B 2 97  ? 49.823  146.020 100.053 1.00   101.40 ? 97  DT  J C6    1 
ATOM   5389  P P     . DT  B 2 98  ? 45.667  146.398 105.008 1.00   114.80 ? 98  DT  J P     1 
ATOM   5390  O OP1   . DT  B 2 98  ? 44.477  146.957 105.688 1.00   116.17 ? 98  DT  J OP1   1 
ATOM   5391  O OP2   . DT  B 2 98  ? 46.966  146.340 105.715 1.00   119.66 ? 98  DT  J OP2   1 
ATOM   5392  O "O5'" . DT  B 2 98  ? 45.321  144.921 104.511 1.00   97.77  ? 98  DT  J "O5'" 1 
ATOM   5393  C "C5'" . DT  B 2 98  ? 44.210  144.709 103.657 1.00   84.50  ? 98  DT  J "C5'" 1 
ATOM   5394  C "C4'" . DT  B 2 98  ? 44.199  143.286 103.134 1.00   97.19  ? 98  DT  J "C4'" 1 
ATOM   5395  O "O4'" . DT  B 2 98  ? 45.394  143.047 102.359 1.00   115.71 ? 98  DT  J "O4'" 1 
ATOM   5396  C "C3'" . DT  B 2 98  ? 44.164  142.198 104.214 1.00   81.96  ? 98  DT  J "C3'" 1 
ATOM   5397  O "O3'" . DT  B 2 98  ? 42.965  141.442 104.092 1.00   82.24  ? 98  DT  J "O3'" 1 
ATOM   5398  C "C2'" . DT  B 2 98  ? 45.413  141.341 103.944 1.00   60.83  ? 98  DT  J "C2'" 1 
ATOM   5399  C "C1'" . DT  B 2 98  ? 45.766  141.705 102.510 1.00   86.37  ? 98  DT  J "C1'" 1 
ATOM   5400  N N1    . DT  B 2 98  ? 47.220  141.583 102.202 1.00   84.54  ? 98  DT  J N1    1 
ATOM   5401  C C2    . DT  B 2 98  ? 47.648  140.557 101.396 1.00   90.34  ? 98  DT  J C2    1 
ATOM   5402  O O2    . DT  B 2 98  ? 46.897  139.732 100.914 1.00   88.71  ? 98  DT  J O2    1 
ATOM   5403  N N3    . DT  B 2 98  ? 48.998  140.532 101.170 1.00   109.67 ? 98  DT  J N3    1 
ATOM   5404  C C4    . DT  B 2 98  ? 49.944  141.415 101.659 1.00   108.18 ? 98  DT  J C4    1 
ATOM   5405  O O4    . DT  B 2 98  ? 51.140  141.310 101.398 1.00   106.85 ? 98  DT  J O4    1 
ATOM   5406  C C5    . DT  B 2 98  ? 49.427  142.470 102.497 1.00   83.66  ? 98  DT  J C5    1 
ATOM   5407  C C7    . DT  B 2 98  ? 50.357  143.488 103.086 1.00   90.61  ? 98  DT  J C7    1 
ATOM   5408  C C6    . DT  B 2 98  ? 48.106  142.502 102.727 1.00   87.92  ? 98  DT  J C6    1 
ATOM   5409  P P     . DT  B 2 99  ? 42.574  140.339 105.194 1.00   89.52  ? 99  DT  J P     1 
ATOM   5410  O OP1   . DT  B 2 99  ? 41.145  140.519 105.529 1.00   127.93 ? 99  DT  J OP1   1 
ATOM   5411  O OP2   . DT  B 2 99  ? 43.588  140.371 106.272 1.00   86.74  ? 99  DT  J OP2   1 
ATOM   5412  O "O5'" . DT  B 2 99  ? 42.758  138.958 104.416 1.00   108.81 ? 99  DT  J "O5'" 1 
ATOM   5413  C "C5'" . DT  B 2 99  ? 42.130  138.747 103.151 1.00   98.07  ? 99  DT  J "C5'" 1 
ATOM   5414  C "C4'" . DT  B 2 99  ? 42.779  137.574 102.444 1.00   86.95  ? 99  DT  J "C4'" 1 
ATOM   5415  O "O4'" . DT  B 2 99  ? 44.148  137.902 102.054 1.00   66.82  ? 99  DT  J "O4'" 1 
ATOM   5416  C "C3'" . DT  B 2 99  ? 42.904  136.299 103.280 1.00   83.34  ? 99  DT  J "C3'" 1 
ATOM   5417  O "O3'" . DT  B 2 99  ? 42.708  135.185 102.470 1.00   68.99  ? 99  DT  J "O3'" 1 
ATOM   5418  C "C2'" . DT  B 2 99  ? 44.334  136.342 103.733 1.00   90.62  ? 99  DT  J "C2'" 1 
ATOM   5419  C "C1'" . DT  B 2 99  ? 44.965  136.822 102.458 1.00   78.89  ? 99  DT  J "C1'" 1 
ATOM   5420  N N1    . DT  B 2 99  ? 46.364  137.225 102.623 1.00   100.69 ? 99  DT  J N1    1 
ATOM   5421  C C2    . DT  B 2 99  ? 47.261  136.949 101.621 1.00   102.60 ? 99  DT  J C2    1 
ATOM   5422  O O2    . DT  B 2 99  ? 46.945  136.424 100.568 1.00   113.35 ? 99  DT  J O2    1 
ATOM   5423  N N3    . DT  B 2 99  ? 48.545  137.335 101.886 1.00   95.04  ? 99  DT  J N3    1 
ATOM   5424  C C4    . DT  B 2 99  ? 49.014  137.936 103.040 1.00   104.18 ? 99  DT  J C4    1 
ATOM   5425  O O4    . DT  B 2 99  ? 50.191  138.246 103.187 1.00   100.72 ? 99  DT  J O4    1 
ATOM   5426  C C5    . DT  B 2 99  ? 48.019  138.174 104.061 1.00   109.75 ? 99  DT  J C5    1 
ATOM   5427  C C7    . DT  B 2 99  ? 48.405  138.821 105.358 1.00   110.83 ? 99  DT  J C7    1 
ATOM   5428  C C6    . DT  B 2 99  ? 46.760  137.800 103.809 1.00   100.69 ? 99  DT  J C6    1 
ATOM   5429  P P     . DA  B 2 100 ? 41.545  134.129 102.751 1.00   103.62 ? 100 DA  J P     1 
ATOM   5430  O OP1   . DA  B 2 100 ? 40.425  134.432 101.831 1.00   83.16  ? 100 DA  J OP1   1 
ATOM   5431  O OP2   . DA  B 2 100 ? 41.303  134.059 104.210 1.00   98.65  ? 100 DA  J OP2   1 
ATOM   5432  O "O5'" . DA  B 2 100 ? 42.243  132.771 102.276 1.00   117.54 ? 100 DA  J "O5'" 1 
ATOM   5433  C "C5'" . DA  B 2 100 ? 42.704  132.689 100.938 1.00   99.84  ? 100 DA  J "C5'" 1 
ATOM   5434  C "C4'" . DA  B 2 100 ? 44.078  132.031 100.772 1.00   89.48  ? 100 DA  J "C4'" 1 
ATOM   5435  O "O4'" . DA  B 2 100 ? 45.184  132.884 101.223 1.00   93.61  ? 100 DA  J "O4'" 1 
ATOM   5436  C "C3'" . DA  B 2 100 ? 44.240  130.711 101.520 1.00   78.21  ? 100 DA  J "C3'" 1 
ATOM   5437  O "O3'" . DA  B 2 100 ? 45.007  129.844 100.752 1.00   73.51  ? 100 DA  J "O3'" 1 
ATOM   5438  C "C2'" . DA  B 2 100 ? 45.025  131.114 102.770 1.00   98.09  ? 100 DA  J "C2'" 1 
ATOM   5439  C "C1'" . DA  B 2 100 ? 45.947  132.187 102.204 1.00   96.27  ? 100 DA  J "C1'" 1 
ATOM   5440  N N9    . DA  B 2 100 ? 46.552  133.090 103.197 1.00   95.95  ? 100 DA  J N9    1 
ATOM   5441  C C8    . DA  B 2 100 ? 45.924  133.752 104.207 1.00   109.73 ? 100 DA  J C8    1 
ATOM   5442  N N7    . DA  B 2 100 ? 46.725  134.494 104.941 1.00   101.95 ? 100 DA  J N7    1 
ATOM   5443  C C5    . DA  B 2 100 ? 47.970  134.309 104.370 1.00   87.00  ? 100 DA  J C5    1 
ATOM   5444  C C6    . DA  B 2 100 ? 49.247  134.822 104.685 1.00   102.62 ? 100 DA  J C6    1 
ATOM   5445  N N6    . DA  B 2 100 ? 49.473  135.663 105.700 1.00   117.88 ? 100 DA  J N6    1 
ATOM   5446  N N1    . DA  B 2 100 ? 50.283  134.435 103.915 1.00   102.65 ? 100 DA  J N1    1 
ATOM   5447  C C2    . DA  B 2 100 ? 50.051  133.594 102.902 1.00   101.30 ? 100 DA  J C2    1 
ATOM   5448  N N3    . DA  B 2 100 ? 48.900  133.046 102.509 1.00   97.71  ? 100 DA  J N3    1 
ATOM   5449  C C4    . DA  B 2 100 ? 47.887  133.447 103.292 1.00   82.96  ? 100 DA  J C4    1 
ATOM   5450  P P     . DA  B 2 101 ? 44.273  128.655 99.971  1.00   63.39  ? 101 DA  J P     1 
ATOM   5451  O OP1   . DA  B 2 101 ? 42.949  129.165 99.548  1.00   74.47  ? 101 DA  J OP1   1 
ATOM   5452  O OP2   . DA  B 2 101 ? 44.352  127.457 100.834 1.00   83.98  ? 101 DA  J OP2   1 
ATOM   5453  O "O5'" . DA  B 2 101 ? 45.179  128.436 98.677  1.00   80.36  ? 101 DA  J "O5'" 1 
ATOM   5454  C "C5'" . DA  B 2 101 ? 45.562  129.553 97.887  1.00   83.12  ? 101 DA  J "C5'" 1 
ATOM   5455  C "C4'" . DA  B 2 101 ? 47.036  129.484 97.550  1.00   75.91  ? 101 DA  J "C4'" 1 
ATOM   5456  O "O4'" . DA  B 2 101 ? 47.801  130.087 98.624  1.00   80.56  ? 101 DA  J "O4'" 1 
ATOM   5457  C "C3'" . DA  B 2 101 ? 47.584  128.068 97.376  1.00   84.95  ? 101 DA  J "C3'" 1 
ATOM   5458  O "O3'" . DA  B 2 101 ? 48.482  128.024 96.277  1.00   91.86  ? 101 DA  J "O3'" 1 
ATOM   5459  C "C2'" . DA  B 2 101 ? 48.295  127.797 98.700  1.00   68.61  ? 101 DA  J "C2'" 1 
ATOM   5460  C "C1'" . DA  B 2 101 ? 48.786  129.187 99.077  1.00   88.08  ? 101 DA  J "C1'" 1 
ATOM   5461  N N9    . DA  B 2 101 ? 48.956  129.374 100.517 1.00   94.71  ? 101 DA  J N9    1 
ATOM   5462  C C8    . DA  B 2 101 ? 48.078  129.024 101.504 1.00   79.37  ? 101 DA  J C8    1 
ATOM   5463  N N7    . DA  B 2 101 ? 48.497  129.314 102.713 1.00   67.60  ? 101 DA  J N7    1 
ATOM   5464  C C5    . DA  B 2 101 ? 49.735  129.897 102.505 1.00   74.55  ? 101 DA  J C5    1 
ATOM   5465  C C6    . DA  B 2 101 ? 50.695  130.424 103.389 1.00   89.56  ? 101 DA  J C6    1 
ATOM   5466  N N6    . DA  B 2 101 ? 50.539  130.447 104.717 1.00   108.52 ? 101 DA  J N6    1 
ATOM   5467  N N1    . DA  B 2 101 ? 51.825  130.933 102.854 1.00   84.84  ? 101 DA  J N1    1 
ATOM   5468  C C2    . DA  B 2 101 ? 51.977  130.910 101.525 1.00   86.50  ? 101 DA  J C2    1 
ATOM   5469  N N3    . DA  B 2 101 ? 51.147  130.441 100.595 1.00   80.33  ? 101 DA  J N3    1 
ATOM   5470  C C4    . DA  B 2 101 ? 50.034  129.944 101.157 1.00   86.56  ? 101 DA  J C4    1 
ATOM   5471  P P     . DG  B 2 102 ? 49.036  126.614 95.743  1.00   71.75  ? 102 DG  J P     1 
ATOM   5472  O OP1   . DG  B 2 102 ? 49.228  126.723 94.280  1.00   78.50  ? 102 DG  J OP1   1 
ATOM   5473  O OP2   . DG  B 2 102 ? 48.171  125.547 96.293  1.00   36.00  ? 102 DG  J OP2   1 
ATOM   5474  O "O5'" . DG  B 2 102 ? 50.473  126.499 96.429  1.00   90.90  ? 102 DG  J "O5'" 1 
ATOM   5475  C "C5'" . DG  B 2 102 ? 51.402  127.568 96.303  1.00   68.65  ? 102 DG  J "C5'" 1 
ATOM   5476  C "C4'" . DG  B 2 102 ? 52.636  127.307 97.145  1.00   93.83  ? 102 DG  J "C4'" 1 
ATOM   5477  O "O4'" . DG  B 2 102 ? 52.370  127.661 98.527  1.00   81.14  ? 102 DG  J "O4'" 1 
ATOM   5478  C "C3'" . DG  B 2 102 ? 53.113  125.853 97.153  1.00   112.04 ? 102 DG  J "C3'" 1 
ATOM   5479  O "O3'" . DG  B 2 102 ? 54.519  125.806 96.952  1.00   121.32 ? 102 DG  J "O3'" 1 
ATOM   5480  C "C2'" . DG  B 2 102 ? 52.717  125.350 98.544  1.00   88.66  ? 102 DG  J "C2'" 1 
ATOM   5481  C "C1'" . DG  B 2 102 ? 52.801  126.621 99.373  1.00   77.69  ? 102 DG  J "C1'" 1 
ATOM   5482  N N9    . DG  B 2 102 ? 51.940  126.604 100.551 1.00   76.97  ? 102 DG  J N9    1 
ATOM   5483  C C8    . DG  B 2 102 ? 50.638  126.169 100.619 1.00   93.43  ? 102 DG  J C8    1 
ATOM   5484  N N7    . DG  B 2 102 ? 50.115  126.277 101.809 1.00   93.51  ? 102 DG  J N7    1 
ATOM   5485  C C5    . DG  B 2 102 ? 51.136  126.821 102.579 1.00   94.95  ? 102 DG  J C5    1 
ATOM   5486  C C6    . DG  B 2 102 ? 51.159  127.163 103.953 1.00   93.99  ? 102 DG  J C6    1 
ATOM   5487  O O6    . DG  B 2 102 ? 50.250  127.051 104.788 1.00   80.79  ? 102 DG  J O6    1 
ATOM   5488  N N1    . DG  B 2 102 ? 52.394  127.686 104.332 1.00   93.64  ? 102 DG  J N1    1 
ATOM   5489  C C2    . DG  B 2 102 ? 53.468  127.854 103.488 1.00   92.59  ? 102 DG  J C2    1 
ATOM   5490  N N2    . DG  B 2 102 ? 54.577  128.370 104.033 1.00   97.58  ? 102 DG  J N2    1 
ATOM   5491  N N3    . DG  B 2 102 ? 53.458  127.537 102.201 1.00   72.30  ? 102 DG  J N3    1 
ATOM   5492  C C4    . DG  B 2 102 ? 52.265  127.028 101.817 1.00   76.55  ? 102 DG  J C4    1 
ATOM   5493  P P     . DC  B 2 103 ? 55.273  124.395 96.800  1.00   98.57  ? 103 DC  J P     1 
ATOM   5494  O OP1   . DC  B 2 103 ? 56.314  124.556 95.762  1.00   92.40  ? 103 DC  J OP1   1 
ATOM   5495  O OP2   . DC  B 2 103 ? 54.251  123.333 96.653  1.00   77.32  ? 103 DC  J OP2   1 
ATOM   5496  O "O5'" . DC  B 2 103 ? 55.988  124.202 98.215  1.00   93.75  ? 103 DC  J "O5'" 1 
ATOM   5497  C "C5'" . DC  B 2 103 ? 56.767  125.260 98.767  1.00   79.35  ? 103 DC  J "C5'" 1 
ATOM   5498  C "C4'" . DC  B 2 103 ? 57.330  124.856 100.114 1.00   86.72  ? 103 DC  J "C4'" 1 
ATOM   5499  O "O4'" . DC  B 2 103 ? 56.363  125.153 101.157 1.00   90.82  ? 103 DC  J "O4'" 1 
ATOM   5500  C "C3'" . DC  B 2 103 ? 57.656  123.365 100.246 1.00   114.70 ? 103 DC  J "C3'" 1 
ATOM   5501  O "O3'" . DC  B 2 103 ? 58.937  123.188 100.833 1.00   109.66 ? 103 DC  J "O3'" 1 
ATOM   5502  C "C2'" . DC  B 2 103 ? 56.546  122.836 101.151 1.00   98.39  ? 103 DC  J "C2'" 1 
ATOM   5503  C "C1'" . DC  B 2 103 ? 56.269  124.048 102.021 1.00   88.30  ? 103 DC  J "C1'" 1 
ATOM   5504  N N1    . DC  B 2 103 ? 54.915  124.031 102.645 1.00   87.57  ? 103 DC  J N1    1 
ATOM   5505  C C2    . DC  B 2 103 ? 54.732  124.585 103.914 1.00   83.77  ? 103 DC  J C2    1 
ATOM   5506  O O2    . DC  B 2 103 ? 55.698  125.096 104.494 1.00   78.18  ? 103 DC  J O2    1 
ATOM   5507  N N3    . DC  B 2 103 ? 53.496  124.552 104.473 1.00   92.79  ? 103 DC  J N3    1 
ATOM   5508  C C4    . DC  B 2 103 ? 52.480  123.992 103.815 1.00   85.67  ? 103 DC  J C4    1 
ATOM   5509  N N4    . DC  B 2 103 ? 51.281  123.984 104.406 1.00   81.59  ? 103 DC  J N4    1 
ATOM   5510  C C5    . DC  B 2 103 ? 52.648  123.416 102.522 1.00   85.80  ? 103 DC  J C5    1 
ATOM   5511  C C6    . DC  B 2 103 ? 53.871  123.455 101.981 1.00   95.96  ? 103 DC  J C6    1 
ATOM   5512  P P     . DG  B 2 104 ? 59.625  121.736 100.830 1.00   102.45 ? 104 DG  J P     1 
ATOM   5513  O OP1   . DG  B 2 104 ? 61.054  121.924 100.495 1.00   110.82 ? 104 DG  J OP1   1 
ATOM   5514  O OP2   . DG  B 2 104 ? 58.785  120.833 100.011 1.00   80.70  ? 104 DG  J OP2   1 
ATOM   5515  O "O5'" . DG  B 2 104 ? 59.513  121.253 102.348 1.00   88.15  ? 104 DG  J "O5'" 1 
ATOM   5516  C "C5'" . DG  B 2 104 ? 60.459  121.705 103.301 1.00   86.80  ? 104 DG  J "C5'" 1 
ATOM   5517  C "C4'" . DG  B 2 104 ? 60.049  121.298 104.701 1.00   88.66  ? 104 DG  J "C4'" 1 
ATOM   5518  O "O4'" . DG  B 2 104 ? 58.929  122.105 105.135 1.00   52.09  ? 104 DG  J "O4'" 1 
ATOM   5519  C "C3'" . DG  B 2 104 ? 59.547  119.872 104.844 1.00   89.70  ? 104 DG  J "C3'" 1 
ATOM   5520  O "O3'" . DG  B 2 104 ? 60.647  118.918 104.912 1.00   98.28  ? 104 DG  J "O3'" 1 
ATOM   5521  C "C2'" . DG  B 2 104 ? 58.756  119.961 106.138 1.00   88.50  ? 104 DG  J "C2'" 1 
ATOM   5522  C "C1'" . DG  B 2 104 ? 58.123  121.348 106.028 1.00   81.55  ? 104 DG  J "C1'" 1 
ATOM   5523  N N9    . DG  B 2 104 ? 56.754  121.311 105.524 1.00   95.73  ? 104 DG  J N9    1 
ATOM   5524  C C8    . DG  B 2 104 ? 56.348  121.373 104.214 1.00   103.17 ? 104 DG  J C8    1 
ATOM   5525  N N7    . DG  B 2 104 ? 55.053  121.308 104.068 1.00   97.37  ? 104 DG  J N7    1 
ATOM   5526  C C5    . DG  B 2 104 ? 54.571  121.187 105.365 1.00   98.83  ? 104 DG  J C5    1 
ATOM   5527  C C6    . DG  B 2 104 ? 53.242  121.075 105.838 1.00   109.08 ? 104 DG  J C6    1 
ATOM   5528  O O6    . DG  B 2 104 ? 52.190  121.060 105.181 1.00   97.30  ? 104 DG  J O6    1 
ATOM   5529  N N1    . DG  B 2 104 ? 53.199  120.973 107.228 1.00   121.93 ? 104 DG  J N1    1 
ATOM   5530  C C2    . DG  B 2 104 ? 54.303  120.980 108.050 1.00   98.28  ? 104 DG  J C2    1 
ATOM   5531  N N2    . DG  B 2 104 ? 54.069  120.869 109.364 1.00   110.69 ? 104 DG  J N2    1 
ATOM   5532  N N3    . DG  B 2 104 ? 55.548  121.084 107.618 1.00   80.87  ? 104 DG  J N3    1 
ATOM   5533  C C4    . DG  B 2 104 ? 55.607  121.184 106.271 1.00   87.64  ? 104 DG  J C4    1 
ATOM   5534  P P     . DG  B 2 105 ? 61.604  118.775 106.205 1.00   80.78  ? 105 DG  J P     1 
ATOM   5535  O OP1   . DG  B 2 105 ? 62.051  120.104 106.676 1.00   79.65  ? 105 DG  J OP1   1 
ATOM   5536  O OP2   . DG  B 2 105 ? 62.622  117.770 105.835 1.00   93.53  ? 105 DG  J OP2   1 
ATOM   5537  O "O5'" . DG  B 2 105 ? 60.687  118.104 107.333 1.00   75.35  ? 105 DG  J "O5'" 1 
ATOM   5538  C "C5'" . DG  B 2 105 ? 60.795  118.556 108.678 1.00   65.49  ? 105 DG  J "C5'" 1 
ATOM   5539  C "C4'" . DG  B 2 105 ? 59.596  118.126 109.505 1.00   69.50  ? 105 DG  J "C4'" 1 
ATOM   5540  O "O4'" . DG  B 2 105 ? 58.370  118.504 108.844 1.00   80.77  ? 105 DG  J "O4'" 1 
ATOM   5541  C "C3'" . DG  B 2 105 ? 59.489  116.621 109.761 1.00   81.07  ? 105 DG  J "C3'" 1 
ATOM   5542  O "O3'" . DG  B 2 105 ? 59.679  116.362 111.141 1.00   65.82  ? 105 DG  J "O3'" 1 
ATOM   5543  C "C2'" . DG  B 2 105 ? 58.067  116.247 109.301 1.00   87.52  ? 105 DG  J "C2'" 1 
ATOM   5544  C "C1'" . DG  B 2 105 ? 57.372  117.599 109.227 1.00   98.81  ? 105 DG  J "C1'" 1 
ATOM   5545  N N9    . DG  B 2 105 ? 56.286  117.649 108.247 1.00   106.29 ? 105 DG  J N9    1 
ATOM   5546  C C8    . DG  B 2 105 ? 56.405  117.660 106.879 1.00   109.46 ? 105 DG  J C8    1 
ATOM   5547  N N7    . DG  B 2 105 ? 55.259  117.708 106.256 1.00   102.83 ? 105 DG  J N7    1 
ATOM   5548  C C5    . DG  B 2 105 ? 54.319  117.730 107.277 1.00   102.46 ? 105 DG  J C5    1 
ATOM   5549  C C6    . DG  B 2 105 ? 52.905  117.782 107.213 1.00   114.78 ? 105 DG  J C6    1 
ATOM   5550  O O6    . DG  B 2 105 ? 52.183  117.818 106.207 1.00   110.63 ? 105 DG  J O6    1 
ATOM   5551  N N1    . DG  B 2 105 ? 52.332  117.788 108.482 1.00   126.63 ? 105 DG  J N1    1 
ATOM   5552  C C2    . DG  B 2 105 ? 53.035  117.750 109.663 1.00   132.74 ? 105 DG  J C2    1 
ATOM   5553  N N2    . DG  B 2 105 ? 52.306  117.764 110.789 1.00   140.53 ? 105 DG  J N2    1 
ATOM   5554  N N3    . DG  B 2 105 ? 54.360  117.701 109.737 1.00   112.17 ? 105 DG  J N3    1 
ATOM   5555  C C4    . DG  B 2 105 ? 54.934  117.694 108.509 1.00   101.16 ? 105 DG  J C4    1 
ATOM   5556  P P     . DT  B 2 106 ? 59.765  114.852 111.678 1.00   86.78  ? 106 DT  J P     1 
ATOM   5557  O OP1   . DT  B 2 106 ? 60.437  114.890 112.995 1.00   85.99  ? 106 DT  J OP1   1 
ATOM   5558  O OP2   . DT  B 2 106 ? 60.298  114.005 110.587 1.00   83.46  ? 106 DT  J OP2   1 
ATOM   5559  O "O5'" . DT  B 2 106 ? 58.240  114.450 111.913 1.00   79.71  ? 106 DT  J "O5'" 1 
ATOM   5560  C "C5'" . DT  B 2 106 ? 57.431  115.248 112.758 1.00   103.07 ? 106 DT  J "C5'" 1 
ATOM   5561  C "C4'" . DT  B 2 106 ? 56.108  114.565 113.029 1.00   103.20 ? 106 DT  J "C4'" 1 
ATOM   5562  O "O4'" . DT  B 2 106 ? 55.133  114.967 112.029 1.00   106.59 ? 106 DT  J "O4'" 1 
ATOM   5563  C "C3'" . DT  B 2 106 ? 56.152  113.034 112.987 1.00   102.11 ? 106 DT  J "C3'" 1 
ATOM   5564  O "O3'" . DT  B 2 106 ? 55.353  112.515 114.034 1.00   126.71 ? 106 DT  J "O3'" 1 
ATOM   5565  C "C2'" . DT  B 2 106 ? 55.547  112.723 111.622 1.00   114.22 ? 106 DT  J "C2'" 1 
ATOM   5566  C "C1'" . DT  B 2 106 ? 54.499  113.815 111.531 1.00   110.41 ? 106 DT  J "C1'" 1 
ATOM   5567  N N1    . DT  B 2 106 ? 54.023  114.076 110.148 1.00   109.00 ? 106 DT  J N1    1 
ATOM   5568  C C2    . DT  B 2 106 ? 52.687  114.314 109.935 1.00   111.78 ? 106 DT  J C2    1 
ATOM   5569  O O2    . DT  B 2 106 ? 51.861  114.334 110.831 1.00   98.82  ? 106 DT  J O2    1 
ATOM   5570  N N3    . DT  B 2 106 ? 52.348  114.536 108.627 1.00   122.73 ? 106 DT  J N3    1 
ATOM   5571  C C4    . DT  B 2 106 ? 53.194  114.537 107.533 1.00   108.61 ? 106 DT  J C4    1 
ATOM   5572  O O4    . DT  B 2 106 ? 52.793  114.748 106.393 1.00   104.62 ? 106 DT  J O4    1 
ATOM   5573  C C5    . DT  B 2 106 ? 54.582  114.276 107.827 1.00   114.82 ? 106 DT  J C5    1 
ATOM   5574  C C7    . DT  B 2 106 ? 55.595  114.252 106.721 1.00   125.35 ? 106 DT  J C7    1 
ATOM   5575  C C6    . DT  B 2 106 ? 54.926  114.058 109.105 1.00   120.12 ? 106 DT  J C6    1 
ATOM   5576  P P     . DG  B 2 107 ? 55.435  110.966 114.458 1.00   118.86 ? 107 DG  J P     1 
ATOM   5577  O OP1   . DG  B 2 107 ? 56.620  110.790 115.326 1.00   134.94 ? 107 DG  J OP1   1 
ATOM   5578  O OP2   . DG  B 2 107 ? 55.286  110.123 113.251 1.00   81.57  ? 107 DG  J OP2   1 
ATOM   5579  O "O5'" . DG  B 2 107 ? 54.121  110.775 115.344 1.00   121.60 ? 107 DG  J "O5'" 1 
ATOM   5580  C "C5'" . DG  B 2 107 ? 53.444  111.924 115.859 1.00   130.20 ? 107 DG  J "C5'" 1 
ATOM   5581  C "C4'" . DG  B 2 107 ? 51.950  111.836 115.602 1.00   126.16 ? 107 DG  J "C4'" 1 
ATOM   5582  O "O4'" . DG  B 2 107 ? 51.659  112.245 114.234 1.00   117.30 ? 107 DG  J "O4'" 1 
ATOM   5583  C "C3'" . DG  B 2 107 ? 51.360  110.437 115.752 1.00   142.51 ? 107 DG  J "C3'" 1 
ATOM   5584  O "O3'" . DG  B 2 107 ? 50.068  110.506 116.325 1.00   157.58 ? 107 DG  J "O3'" 1 
ATOM   5585  C "C2'" . DG  B 2 107 ? 51.296  109.950 114.315 1.00   132.51 ? 107 DG  J "C2'" 1 
ATOM   5586  C "C1'" . DG  B 2 107 ? 50.915  111.230 113.596 1.00   122.66 ? 107 DG  J "C1'" 1 
ATOM   5587  N N9    . DG  B 2 107 ? 51.249  111.220 112.174 1.00   129.13 ? 107 DG  J N9    1 
ATOM   5588  C C8    . DG  B 2 107 ? 52.502  111.120 111.621 1.00   138.42 ? 107 DG  J C8    1 
ATOM   5589  N N7    . DG  B 2 107 ? 52.500  111.134 110.317 1.00   129.16 ? 107 DG  J N7    1 
ATOM   5590  C C5    . DG  B 2 107 ? 51.158  111.244 109.980 1.00   127.39 ? 107 DG  J C5    1 
ATOM   5591  C C6    . DG  B 2 107 ? 50.540  111.302 108.709 1.00   116.41 ? 107 DG  J C6    1 
ATOM   5592  O O6    . DG  B 2 107 ? 51.076  111.269 107.593 1.00   113.05 ? 107 DG  J O6    1 
ATOM   5593  N N1    . DG  B 2 107 ? 49.156  111.410 108.812 1.00   120.46 ? 107 DG  J N1    1 
ATOM   5594  C C2    . DG  B 2 107 ? 48.457  111.455 109.996 1.00   123.96 ? 107 DG  J C2    1 
ATOM   5595  N N2    . DG  B 2 107 ? 47.124  111.562 109.894 1.00   112.44 ? 107 DG  J N2    1 
ATOM   5596  N N3    . DG  B 2 107 ? 49.024  111.401 111.196 1.00   135.16 ? 107 DG  J N3    1 
ATOM   5597  C C4    . DG  B 2 107 ? 50.373  111.297 111.112 1.00   132.83 ? 107 DG  J C4    1 
ATOM   5598  P P     . DC  B 2 108 ? 49.409  109.183 116.952 1.00   148.79 ? 108 DC  J P     1 
ATOM   5599  O OP1   . DC  B 2 108 ? 48.614  109.588 118.132 1.00   115.00 ? 108 DC  J OP1   1 
ATOM   5600  O OP2   . DC  B 2 108 ? 50.490  108.182 117.098 1.00   134.38 ? 108 DC  J OP2   1 
ATOM   5601  O "O5'" . DC  B 2 108 ? 48.421  108.644 115.812 1.00   110.79 ? 108 DC  J "O5'" 1 
ATOM   5602  C "C5'" . DC  B 2 108 ? 47.116  109.198 115.676 1.00   128.43 ? 108 DC  J "C5'" 1 
ATOM   5603  C "C4'" . DC  B 2 108 ? 46.380  108.580 114.497 1.00   109.54 ? 108 DC  J "C4'" 1 
ATOM   5604  O "O4'" . DC  B 2 108 ? 47.013  108.898 113.225 1.00   112.57 ? 108 DC  J "O4'" 1 
ATOM   5605  C "C3'" . DC  B 2 108 ? 46.287  107.058 114.568 1.00   124.94 ? 108 DC  J "C3'" 1 
ATOM   5606  O "O3'" . DC  B 2 108 ? 45.057  106.601 114.089 1.00   124.05 ? 108 DC  J "O3'" 1 
ATOM   5607  C "C2'" . DC  B 2 108 ? 47.378  106.607 113.600 1.00   133.08 ? 108 DC  J "C2'" 1 
ATOM   5608  C "C1'" . DC  B 2 108 ? 47.299  107.695 112.536 1.00   125.76 ? 108 DC  J "C1'" 1 
ATOM   5609  N N1    . DC  B 2 108 ? 48.508  107.833 111.666 1.00   128.40 ? 108 DC  J N1    1 
ATOM   5610  C C2    . DC  B 2 108 ? 48.364  107.717 110.278 1.00   106.19 ? 108 DC  J C2    1 
ATOM   5611  O O2    . DC  B 2 108 ? 47.234  107.570 109.801 1.00   105.02 ? 108 DC  J O2    1 
ATOM   5612  N N3    . DC  B 2 108 ? 49.461  107.820 109.491 1.00   110.90 ? 108 DC  J N3    1 
ATOM   5613  C C4    . DC  B 2 108 ? 50.662  107.988 110.042 1.00   133.31 ? 108 DC  J C4    1 
ATOM   5614  N N4    . DC  B 2 108 ? 51.719  108.076 109.227 1.00   126.92 ? 108 DC  J N4    1 
ATOM   5615  C C5    . DC  B 2 108 ? 50.833  108.072 111.455 1.00   142.33 ? 108 DC  J C5    1 
ATOM   5616  C C6    . DC  B 2 108 ? 49.739  107.977 112.221 1.00   144.57 ? 108 DC  J C6    1 
ATOM   5617  P P     . DT  B 2 109 ? 44.401  105.267 114.695 1.00   146.73 ? 109 DT  J P     1 
ATOM   5618  O OP1   . DT  B 2 109 ? 43.541  105.667 115.832 1.00   105.74 ? 109 DT  J OP1   1 
ATOM   5619  O OP2   . DT  B 2 109 ? 45.473  104.265 114.891 1.00   127.36 ? 109 DT  J OP2   1 
ATOM   5620  O "O5'" . DT  B 2 109 ? 43.479  104.777 113.493 1.00   154.88 ? 109 DT  J "O5'" 1 
ATOM   5621  C "C5'" . DT  B 2 109 ? 42.745  105.703 112.728 1.00   131.01 ? 109 DT  J "C5'" 1 
ATOM   5622  C "C4'" . DT  B 2 109 ? 42.986  105.422 111.257 1.00   126.56 ? 109 DT  J "C4'" 1 
ATOM   5623  O "O4'" . DT  B 2 109 ? 44.384  105.597 110.952 1.00   133.69 ? 109 DT  J "O4'" 1 
ATOM   5624  C "C3'" . DT  B 2 109 ? 42.623  104.009 110.786 1.00   112.56 ? 109 DT  J "C3'" 1 
ATOM   5625  O "O3'" . DT  B 2 109 ? 41.515  104.064 109.917 1.00   121.25 ? 109 DT  J "O3'" 1 
ATOM   5626  C "C2'" . DT  B 2 109 ? 43.888  103.503 110.063 1.00   108.09 ? 109 DT  J "C2'" 1 
ATOM   5627  C "C1'" . DT  B 2 109 ? 44.694  104.781 109.861 1.00   127.30 ? 109 DT  J "C1'" 1 
ATOM   5628  N N1    . DT  B 2 109 ? 46.173  104.577 109.806 1.00   112.50 ? 109 DT  J N1    1 
ATOM   5629  C C2    . DT  B 2 109 ? 46.809  104.692 108.595 1.00   109.46 ? 109 DT  J C2    1 
ATOM   5630  O O2    . DT  B 2 109 ? 46.226  104.966 107.566 1.00   93.55  ? 109 DT  J O2    1 
ATOM   5631  N N3    . DT  B 2 109 ? 48.161  104.492 108.633 1.00   124.18 ? 109 DT  J N3    1 
ATOM   5632  C C4    . DT  B 2 109 ? 48.928  104.183 109.739 1.00   138.73 ? 109 DT  J C4    1 
ATOM   5633  O O4    . DT  B 2 109 ? 50.143  104.018 109.670 1.00   140.05 ? 109 DT  J O4    1 
ATOM   5634  C C5    . DT  B 2 109 ? 48.201  104.069 110.982 1.00   134.63 ? 109 DT  J C5    1 
ATOM   5635  C C7    . DT  B 2 109 ? 48.929  103.734 112.251 1.00   130.40 ? 109 DT  J C7    1 
ATOM   5636  C C6    . DT  B 2 109 ? 46.871  104.268 110.957 1.00   119.91 ? 109 DT  J C6    1 
ATOM   5637  P P     . DA  B 2 110 ? 40.048  103.662 110.422 1.00   115.51 ? 110 DA  J P     1 
ATOM   5638  O OP1   . DA  B 2 110 ? 39.669  104.601 111.501 1.00   117.75 ? 110 DA  J OP1   1 
ATOM   5639  O OP2   . DA  B 2 110 ? 40.034  102.203 110.673 1.00   96.79  ? 110 DA  J OP2   1 
ATOM   5640  O "O5'" . DA  B 2 110 ? 39.144  103.950 109.137 1.00   151.93 ? 110 DA  J "O5'" 1 
ATOM   5641  C "C5'" . DA  B 2 110 ? 39.139  105.251 108.553 1.00   120.36 ? 110 DA  J "C5'" 1 
ATOM   5642  C "C4'" . DA  B 2 110 ? 39.418  105.186 107.057 1.00   113.22 ? 110 DA  J "C4'" 1 
ATOM   5643  O "O4'" . DA  B 2 110 ? 40.815  104.879 106.798 1.00   107.03 ? 110 DA  J "O4'" 1 
ATOM   5644  C "C3'" . DA  B 2 110 ? 38.597  104.150 106.298 1.00   127.45 ? 110 DA  J "C3'" 1 
ATOM   5645  O "O3'" . DA  B 2 110 ? 38.155  104.702 105.062 1.00   121.65 ? 110 DA  J "O3'" 1 
ATOM   5646  C "C2'" . DA  B 2 110 ? 39.567  102.983 106.096 1.00   98.40  ? 110 DA  J "C2'" 1 
ATOM   5647  C "C1'" . DA  B 2 110 ? 40.920  103.683 106.046 1.00   113.94 ? 110 DA  J "C1'" 1 
ATOM   5648  N N9    . DA  B 2 110 ? 42.040  102.888 106.548 1.00   122.94 ? 110 DA  J N9    1 
ATOM   5649  C C8    . DA  B 2 110 ? 41.993  101.874 107.464 1.00   124.54 ? 110 DA  J C8    1 
ATOM   5650  N N7    . DA  B 2 110 ? 43.162  101.326 107.706 1.00   116.05 ? 110 DA  J N7    1 
ATOM   5651  C C5    . DA  B 2 110 ? 44.030  102.009 106.870 1.00   118.89 ? 110 DA  J C5    1 
ATOM   5652  C C6    . DA  B 2 110 ? 45.417  101.900 106.645 1.00   124.20 ? 110 DA  J C6    1 
ATOM   5653  N N6    . DA  B 2 110 ? 46.198  101.018 107.277 1.00   134.74 ? 110 DA  J N6    1 
ATOM   5654  N N1    . DA  B 2 110 ? 45.973  102.735 105.740 1.00   108.82 ? 110 DA  J N1    1 
ATOM   5655  C C2    . DA  B 2 110 ? 45.188  103.615 105.107 1.00   104.81 ? 110 DA  J C2    1 
ATOM   5656  N N3    . DA  B 2 110 ? 43.877  103.813 105.238 1.00   122.36 ? 110 DA  J N3    1 
ATOM   5657  C C4    . DA  B 2 110 ? 43.353  102.968 106.142 1.00   124.73 ? 110 DA  J C4    1 
ATOM   5658  P P     . DG  B 2 111 ? 37.374  103.793 103.992 1.00   111.51 ? 111 DG  J P     1 
ATOM   5659  O OP1   . DG  B 2 111 ? 36.597  104.717 103.136 1.00   113.72 ? 111 DG  J OP1   1 
ATOM   5660  O OP2   . DG  B 2 111 ? 36.687  102.702 104.719 1.00   100.96 ? 111 DG  J OP2   1 
ATOM   5661  O "O5'" . DG  B 2 111 ? 38.542  103.144 103.114 1.00   96.86  ? 111 DG  J "O5'" 1 
ATOM   5662  C "C5'" . DG  B 2 111 ? 39.498  103.982 102.480 1.00   111.77 ? 111 DG  J "C5'" 1 
ATOM   5663  C "C4'" . DG  B 2 111 ? 40.503  103.160 101.695 1.00   95.19  ? 111 DG  J "C4'" 1 
ATOM   5664  O "O4'" . DG  B 2 111 ? 41.434  102.518 102.607 1.00   99.77  ? 111 DG  J "O4'" 1 
ATOM   5665  C "C3'" . DG  B 2 111 ? 39.901  102.038 100.846 1.00   88.20  ? 111 DG  J "C3'" 1 
ATOM   5666  O "O3'" . DG  B 2 111 ? 40.553  101.992 99.593  1.00   92.79  ? 111 DG  J "O3'" 1 
ATOM   5667  C "C2'" . DG  B 2 111 ? 40.199  100.788 101.668 1.00   92.64  ? 111 DG  J "C2'" 1 
ATOM   5668  C "C1'" . DG  B 2 111 ? 41.543  101.157 102.267 1.00   105.76 ? 111 DG  J "C1'" 1 
ATOM   5669  N N9    . DG  B 2 111 ? 41.883  100.398 103.466 1.00   120.40 ? 111 DG  J N9    1 
ATOM   5670  C C8    . DG  B 2 111 ? 41.014  99.905  104.409 1.00   130.71 ? 111 DG  J C8    1 
ATOM   5671  N N7    . DG  B 2 111 ? 41.608  99.262  105.376 1.00   140.96 ? 111 DG  J N7    1 
ATOM   5672  C C5    . DG  B 2 111 ? 42.957  99.333  105.053 1.00   123.35 ? 111 DG  J C5    1 
ATOM   5673  C C6    . DG  B 2 111 ? 44.085  98.816  105.731 1.00   123.41 ? 111 DG  J C6    1 
ATOM   5674  O O6    . DG  B 2 111 ? 44.116  98.171  106.789 1.00   131.13 ? 111 DG  J O6    1 
ATOM   5675  N N1    . DG  B 2 111 ? 45.270  99.112  105.062 1.00   126.43 ? 111 DG  J N1    1 
ATOM   5676  C C2    . DG  B 2 111 ? 45.353  99.821  103.886 1.00   123.08 ? 111 DG  J C2    1 
ATOM   5677  N N2    . DG  B 2 111 ? 46.585  100.007 103.389 1.00   120.41 ? 111 DG  J N2    1 
ATOM   5678  N N3    . DG  B 2 111 ? 44.304  100.310 103.240 1.00   120.51 ? 111 DG  J N3    1 
ATOM   5679  C C4    . DG  B 2 111 ? 43.142  100.029 103.880 1.00   121.33 ? 111 DG  J C4    1 
ATOM   5680  P P     . DA  B 2 112 ? 39.791  101.429 98.296  1.00   111.29 ? 112 DA  J P     1 
ATOM   5681  O OP1   . DA  B 2 112 ? 38.916  102.507 97.784  1.00   96.70  ? 112 DA  J OP1   1 
ATOM   5682  O OP2   . DA  B 2 112 ? 39.212  100.109 98.635  1.00   80.45  ? 112 DA  J OP2   1 
ATOM   5683  O "O5'" . DA  B 2 112 ? 40.975  101.188 97.252  1.00   122.89 ? 112 DA  J "O5'" 1 
ATOM   5684  C "C5'" . DA  B 2 112 ? 42.083  102.081 97.226  1.00   101.33 ? 112 DA  J "C5'" 1 
ATOM   5685  C "C4'" . DA  B 2 112 ? 43.394  101.317 97.260  1.00   102.06 ? 112 DA  J "C4'" 1 
ATOM   5686  O "O4'" . DA  B 2 112 ? 43.582  100.720 98.571  1.00   108.39 ? 112 DA  J "O4'" 1 
ATOM   5687  C "C3'" . DA  B 2 112 ? 43.501  100.171 96.253  1.00   108.59 ? 112 DA  J "C3'" 1 
ATOM   5688  O "O3'" . DA  B 2 112 ? 44.795  100.163 95.674  1.00   119.85 ? 112 DA  J "O3'" 1 
ATOM   5689  C "C2'" . DA  B 2 112 ? 43.265  98.929  97.110  1.00   89.71  ? 112 DA  J "C2'" 1 
ATOM   5690  C "C1'" . DA  B 2 112 ? 43.898  99.354  98.423  1.00   115.33 ? 112 DA  J "C1'" 1 
ATOM   5691  N N9    . DA  B 2 112 ? 43.388  98.630  99.584  1.00   114.71 ? 112 DA  J N9    1 
ATOM   5692  C C8    . DA  B 2 112 ? 42.078  98.415  99.913  1.00   95.11  ? 112 DA  J C8    1 
ATOM   5693  N N7    . DA  B 2 112 ? 41.917  97.731  101.022 1.00   102.50 ? 112 DA  J N7    1 
ATOM   5694  C C5    . DA  B 2 112 ? 43.210  97.481  101.450 1.00   118.18 ? 112 DA  J C5    1 
ATOM   5695  C C6    . DA  B 2 112 ? 43.726  96.797  102.570 1.00   125.98 ? 112 DA  J C6    1 
ATOM   5696  N N6    . DA  B 2 112 ? 42.957  96.218  103.498 1.00   132.23 ? 112 DA  J N6    1 
ATOM   5697  N N1    . DA  B 2 112 ? 45.067  96.732  102.699 1.00   121.16 ? 112 DA  J N1    1 
ATOM   5698  C C2    . DA  B 2 112 ? 45.834  97.311  101.768 1.00   119.32 ? 112 DA  J C2    1 
ATOM   5699  N N3    . DA  B 2 112 ? 45.466  97.980  100.677 1.00   117.24 ? 112 DA  J N3    1 
ATOM   5700  C C4    . DA  B 2 112 ? 44.129  98.028  100.576 1.00   113.89 ? 112 DA  J C4    1 
ATOM   5701  P P     . DG  B 2 113 ? 45.057  99.383  94.296  1.00   120.03 ? 113 DG  J P     1 
ATOM   5702  O OP1   . DG  B 2 113 ? 45.937  100.235 93.464  1.00   99.61  ? 113 DG  J OP1   1 
ATOM   5703  O OP2   . DG  B 2 113 ? 43.744  98.941  93.772  1.00   93.77  ? 113 DG  J OP2   1 
ATOM   5704  O "O5'" . DG  B 2 113 ? 45.869  98.083  94.746  1.00   113.66 ? 113 DG  J "O5'" 1 
ATOM   5705  C "C5'" . DG  B 2 113 ? 47.105  98.226  95.431  1.00   108.81 ? 113 DG  J "C5'" 1 
ATOM   5706  C "C4'" . DG  B 2 113 ? 47.492  96.932  96.119  1.00   120.84 ? 113 DG  J "C4'" 1 
ATOM   5707  O "O4'" . DG  B 2 113 ? 46.576  96.669  97.198  1.00   97.49  ? 113 DG  J "O4'" 1 
ATOM   5708  C "C3'" . DG  B 2 113 ? 47.448  95.689  95.225  1.00   136.48 ? 113 DG  J "C3'" 1 
ATOM   5709  O "O3'" . DG  B 2 113 ? 48.773  95.254  94.934  1.00   147.59 ? 113 DG  J "O3'" 1 
ATOM   5710  C "C2'" . DG  B 2 113 ? 46.670  94.642  96.044  1.00   125.07 ? 113 DG  J "C2'" 1 
ATOM   5711  C "C1'" . DG  B 2 113 ? 46.545  95.288  97.421  1.00   115.36 ? 113 DG  J "C1'" 1 
ATOM   5712  N N9    . DG  B 2 113 ? 45.300  94.960  98.107  1.00   123.82 ? 113 DG  J N9    1 
ATOM   5713  C C8    . DG  B 2 113 ? 44.030  95.005  97.584  1.00   142.66 ? 113 DG  J C8    1 
ATOM   5714  N N7    . DG  B 2 113 ? 43.105  94.657  98.435  1.00   145.75 ? 113 DG  J N7    1 
ATOM   5715  C C5    . DG  B 2 113 ? 43.805  94.362  99.598  1.00   130.43 ? 113 DG  J C5    1 
ATOM   5716  C C6    . DG  B 2 113 ? 43.335  93.929  100.860 1.00   124.67 ? 113 DG  J C6    1 
ATOM   5717  O O6    . DG  B 2 113 ? 42.167  93.713  101.212 1.00   126.58 ? 113 DG  J O6    1 
ATOM   5718  N N1    . DG  B 2 113 ? 44.380  93.747  101.763 1.00   120.42 ? 113 DG  J N1    1 
ATOM   5719  C C2    . DG  B 2 113 ? 45.709  93.955  101.481 1.00   120.39 ? 113 DG  J C2    1 
ATOM   5720  N N2    . DG  B 2 113 ? 46.571  93.727  102.482 1.00   131.37 ? 113 DG  J N2    1 
ATOM   5721  N N3    . DG  B 2 113 ? 46.162  94.362  100.303 1.00   118.79 ? 113 DG  J N3    1 
ATOM   5722  C C4    . DG  B 2 113 ? 45.158  94.545  99.412  1.00   121.19 ? 113 DG  J C4    1 
ATOM   5723  P P     . DC  B 2 114 ? 49.021  94.047  93.902  1.00   132.63 ? 114 DC  J P     1 
ATOM   5724  O OP1   . DC  B 2 114 ? 50.361  94.234  93.304  1.00   144.24 ? 114 DC  J OP1   1 
ATOM   5725  O OP2   . DC  B 2 114 ? 47.833  93.949  93.025  1.00   128.37 ? 114 DC  J OP2   1 
ATOM   5726  O "O5'" . DC  B 2 114 ? 49.048  92.750  94.834  1.00   139.05 ? 114 DC  J "O5'" 1 
ATOM   5727  C "C5'" . DC  B 2 114 ? 49.869  92.729  95.996  1.00   153.41 ? 114 DC  J "C5'" 1 
ATOM   5728  C "C4'" . DC  B 2 114 ? 49.505  91.557  96.887  1.00   159.06 ? 114 DC  J "C4'" 1 
ATOM   5729  O "O4'" . DC  B 2 114 ? 48.242  91.810  97.530  1.00   133.29 ? 114 DC  J "O4'" 1 
ATOM   5730  C "C3'" . DC  B 2 114 ? 49.337  90.219  96.162  1.00   166.64 ? 114 DC  J "C3'" 1 
ATOM   5731  O "O3'" . DC  B 2 114 ? 50.452  89.375  96.430  1.00   185.41 ? 114 DC  J "O3'" 1 
ATOM   5732  C "C2'" . DC  B 2 114 ? 48.022  89.636  96.717  1.00   158.40 ? 114 DC  J "C2'" 1 
ATOM   5733  C "C1'" . DC  B 2 114 ? 47.681  90.574  97.871  1.00   144.04 ? 114 DC  J "C1'" 1 
ATOM   5734  N N1    . DC  B 2 114 ? 46.217  90.764  98.068  1.00   137.57 ? 114 DC  J N1    1 
ATOM   5735  C C2    . DC  B 2 114 ? 45.667  90.636  99.347  1.00   137.56 ? 114 DC  J C2    1 
ATOM   5736  O O2    . DC  B 2 114 ? 46.409  90.361  100.298 1.00   127.22 ? 114 DC  J O2    1 
ATOM   5737  N N3    . DC  B 2 114 ? 44.331  90.814  99.508  1.00   142.04 ? 114 DC  J N3    1 
ATOM   5738  C C4    . DC  B 2 114 ? 43.565  91.109  98.456  1.00   128.33 ? 114 DC  J C4    1 
ATOM   5739  N N4    . DC  B 2 114 ? 42.255  91.275  98.663  1.00   121.93 ? 114 DC  J N4    1 
ATOM   5740  C C5    . DC  B 2 114 ? 44.109  91.246  97.145  1.00   131.65 ? 114 DC  J C5    1 
ATOM   5741  C C6    . DC  B 2 114 ? 45.426  91.068  96.999  1.00   143.87 ? 114 DC  J C6    1 
ATOM   5742  P P     . DT  B 2 115 ? 50.570  87.935  95.726  1.00   182.20 ? 115 DT  J P     1 
ATOM   5743  O OP1   . DT  B 2 115 ? 52.009  87.611  95.605  1.00   169.97 ? 115 DT  J OP1   1 
ATOM   5744  O OP2   . DT  B 2 115 ? 49.715  87.948  94.518  1.00   155.92 ? 115 DT  J OP2   1 
ATOM   5745  O "O5'" . DT  B 2 115 ? 49.908  86.939  96.787  1.00   151.16 ? 115 DT  J "O5'" 1 
ATOM   5746  C "C5'" . DT  B 2 115 ? 50.357  86.944  98.135  1.00   133.32 ? 115 DT  J "C5'" 1 
ATOM   5747  C "C4'" . DT  B 2 115 ? 49.529  85.997  98.982  1.00   152.24 ? 115 DT  J "C4'" 1 
ATOM   5748  O "O4'" . DT  B 2 115 ? 48.204  86.550  99.178  1.00   147.56 ? 115 DT  J "O4'" 1 
ATOM   5749  C "C3'" . DT  B 2 115 ? 49.333  84.600  98.383  1.00   179.72 ? 115 DT  J "C3'" 1 
ATOM   5750  O "O3'" . DT  B 2 115 ? 49.717  83.609  99.328  1.00   195.17 ? 115 DT  J "O3'" 1 
ATOM   5751  C "C2'" . DT  B 2 115 ? 47.834  84.536  98.067  1.00   167.75 ? 115 DT  J "C2'" 1 
ATOM   5752  C "C1'" . DT  B 2 115 ? 47.252  85.522  99.066  1.00   149.54 ? 115 DT  J "C1'" 1 
ATOM   5753  N N1    . DT  B 2 115 ? 45.960  86.122  98.626  1.00   151.89 ? 115 DT  J N1    1 
ATOM   5754  C C2    . DT  B 2 115 ? 44.878  86.087  99.474  1.00   152.85 ? 115 DT  J C2    1 
ATOM   5755  O O2    . DT  B 2 115 ? 44.915  85.587  100.584 1.00   155.70 ? 115 DT  J O2    1 
ATOM   5756  N N3    . DT  B 2 115 ? 43.740  86.665  98.975  1.00   151.01 ? 115 DT  J N3    1 
ATOM   5757  C C4    . DT  B 2 115 ? 43.580  87.261  97.737  1.00   147.17 ? 115 DT  J C4    1 
ATOM   5758  O O4    . DT  B 2 115 ? 42.515  87.753  97.378  1.00   140.62 ? 115 DT  J O4    1 
ATOM   5759  C C5    . DT  B 2 115 ? 44.753  87.263  96.896  1.00   150.17 ? 115 DT  J C5    1 
ATOM   5760  C C7    . DT  B 2 115 ? 44.701  87.881  95.530  1.00   127.31 ? 115 DT  J C7    1 
ATOM   5761  C C6    . DT  B 2 115 ? 45.873  86.700  97.375  1.00   156.64 ? 115 DT  J C6    1 
ATOM   5762  P P     . DG  B 2 116 ? 49.727  82.055  98.918  1.00   171.21 ? 116 DG  J P     1 
ATOM   5763  O OP1   . DG  B 2 116 ? 50.790  81.394  99.706  1.00   155.16 ? 116 DG  J OP1   1 
ATOM   5764  O OP2   . DG  B 2 116 ? 49.749  81.972  97.440  1.00   124.68 ? 116 DG  J OP2   1 
ATOM   5765  O "O5'" . DG  B 2 116 ? 48.306  81.523  99.423  1.00   172.01 ? 116 DG  J "O5'" 1 
ATOM   5766  C "C5'" . DG  B 2 116 ? 47.903  81.753  100.769 1.00   164.47 ? 116 DG  J "C5'" 1 
ATOM   5767  C "C4'" . DG  B 2 116 ? 46.482  81.274  100.999 1.00   170.14 ? 116 DG  J "C4'" 1 
ATOM   5768  O "O4'" . DG  B 2 116 ? 45.545  82.212  100.404 1.00   171.33 ? 116 DG  J "O4'" 1 
ATOM   5769  C "C3'" . DG  B 2 116 ? 46.155  79.903  100.396 1.00   180.59 ? 116 DG  J "C3'" 1 
ATOM   5770  O "O3'" . DG  B 2 116 ? 45.454  79.111  101.346 1.00   198.18 ? 116 DG  J "O3'" 1 
ATOM   5771  C "C2'" . DG  B 2 116 ? 45.275  80.246  99.195  1.00   161.71 ? 116 DG  J "C2'" 1 
ATOM   5772  C "C1'" . DG  B 2 116 ? 44.566  81.492  99.696  1.00   171.26 ? 116 DG  J "C1'" 1 
ATOM   5773  N N9    . DG  B 2 116 ? 44.039  82.339  98.630  1.00   174.08 ? 116 DG  J N9    1 
ATOM   5774  C C8    . DG  B 2 116 ? 44.718  82.805  97.529  1.00   165.94 ? 116 DG  J C8    1 
ATOM   5775  N N7    . DG  B 2 116 ? 43.985  83.543  96.741  1.00   177.22 ? 116 DG  J N7    1 
ATOM   5776  C C5    . DG  B 2 116 ? 42.740  83.569  97.359  1.00   185.55 ? 116 DG  J C5    1 
ATOM   5777  C C6    . DG  B 2 116 ? 41.540  84.214  96.969  1.00   177.18 ? 116 DG  J C6    1 
ATOM   5778  O O6    . DG  B 2 116 ? 41.333  84.913  95.966  1.00   151.13 ? 116 DG  J O6    1 
ATOM   5779  N N1    . DG  B 2 116 ? 40.512  83.984  97.880  1.00   171.33 ? 116 DG  J N1    1 
ATOM   5780  C C2    . DG  B 2 116 ? 40.629  83.227  99.023  1.00   166.34 ? 116 DG  J C2    1 
ATOM   5781  N N2    . DG  B 2 116 ? 39.526  83.120  99.779  1.00   168.95 ? 116 DG  J N2    1 
ATOM   5782  N N3    . DG  B 2 116 ? 41.746  82.619  99.400  1.00   153.42 ? 116 DG  J N3    1 
ATOM   5783  C C4    . DG  B 2 116 ? 42.758  82.833  98.523  1.00   174.06 ? 116 DG  J C4    1 
ATOM   5784  P P     . DT  B 2 117 ? 45.816  77.556  101.528 1.00   183.95 ? 117 DT  J P     1 
ATOM   5785  O OP1   . DT  B 2 117 ? 46.553  77.414  102.804 1.00   156.28 ? 117 DT  J OP1   1 
ATOM   5786  O OP2   . DT  B 2 117 ? 46.430  77.087  100.266 1.00   162.69 ? 117 DT  J OP2   1 
ATOM   5787  O "O5'" . DT  B 2 117 ? 44.391  76.845  101.676 1.00   167.63 ? 117 DT  J "O5'" 1 
ATOM   5788  C "C5'" . DT  B 2 117 ? 43.427  76.957  100.635 1.00   169.23 ? 117 DT  J "C5'" 1 
ATOM   5789  C "C4'" . DT  B 2 117 ? 42.181  77.674  101.126 1.00   164.67 ? 117 DT  J "C4'" 1 
ATOM   5790  O "O4'" . DT  B 2 117 ? 42.188  79.042  100.640 1.00   160.58 ? 117 DT  J "O4'" 1 
ATOM   5791  C "C3'" . DT  B 2 117 ? 40.871  77.078  100.636 1.00   158.91 ? 117 DT  J "C3'" 1 
ATOM   5792  O "O3'" . DT  B 2 117 ? 40.417  76.087  101.551 1.00   158.62 ? 117 DT  J "O3'" 1 
ATOM   5793  C "C2'" . DT  B 2 117 ? 39.948  78.290  100.623 1.00   159.01 ? 117 DT  J "C2'" 1 
ATOM   5794  C "C1'" . DT  B 2 117 ? 40.895  79.402  100.184 1.00   152.60 ? 117 DT  J "C1'" 1 
ATOM   5795  N N1    . DT  B 2 117 ? 40.952  79.599  98.700  1.00   158.02 ? 117 DT  J N1    1 
ATOM   5796  C C2    . DT  B 2 117 ? 39.843  80.073  98.033  1.00   158.97 ? 117 DT  J C2    1 
ATOM   5797  O O2    . DT  B 2 117 ? 38.791  80.342  98.586  1.00   161.97 ? 117 DT  J O2    1 
ATOM   5798  N N3    . DT  B 2 117 ? 40.009  80.219  96.682  1.00   165.50 ? 117 DT  J N3    1 
ATOM   5799  C C4    . DT  B 2 117 ? 41.147  79.950  95.944  1.00   167.60 ? 117 DT  J C4    1 
ATOM   5800  O O4    . DT  B 2 117 ? 41.197  80.114  94.729  1.00   175.59 ? 117 DT  J O4    1 
ATOM   5801  C C5    . DT  B 2 117 ? 42.272  79.460  96.703  1.00   167.79 ? 117 DT  J C5    1 
ATOM   5802  C C7    . DT  B 2 117 ? 43.563  79.133  96.013  1.00   167.91 ? 117 DT  J C7    1 
ATOM   5803  C C6    . DT  B 2 117 ? 42.122  79.312  98.027  1.00   171.72 ? 117 DT  J C6    1 
ATOM   5804  P P     . DC  B 2 118 ? 39.912  74.659  101.015 1.00   162.48 ? 118 DC  J P     1 
ATOM   5805  O OP1   . DC  B 2 118 ? 39.572  73.830  102.194 1.00   140.77 ? 118 DC  J OP1   1 
ATOM   5806  O OP2   . DC  B 2 118 ? 40.904  74.171  100.031 1.00   151.25 ? 118 DC  J OP2   1 
ATOM   5807  O "O5'" . DC  B 2 118 ? 38.567  74.998  100.220 1.00   172.56 ? 118 DC  J "O5'" 1 
ATOM   5808  C "C5'" . DC  B 2 118 ? 37.505  75.684  100.874 1.00   160.56 ? 118 DC  J "C5'" 1 
ATOM   5809  C "C4'" . DC  B 2 118 ? 36.416  76.055  99.885  1.00   150.10 ? 118 DC  J "C4'" 1 
ATOM   5810  O "O4'" . DC  B 2 118 ? 36.977  76.884  98.830  1.00   161.53 ? 118 DC  J "O4'" 1 
ATOM   5811  C "C3'" . DC  B 2 118 ? 35.754  74.868  99.184  1.00   164.56 ? 118 DC  J "C3'" 1 
ATOM   5812  O "O3'" . DC  B 2 118 ? 34.361  75.092  99.067  1.00   176.01 ? 118 DC  J "O3'" 1 
ATOM   5813  C "C2'" . DC  B 2 118 ? 36.431  74.853  97.817  1.00   167.26 ? 118 DC  J "C2'" 1 
ATOM   5814  C "C1'" . DC  B 2 118 ? 36.644  76.337  97.574  1.00   163.02 ? 118 DC  J "C1'" 1 
ATOM   5815  N N1    . DC  B 2 118 ? 37.749  76.626  96.617  1.00   170.26 ? 118 DC  J N1    1 
ATOM   5816  C C2    . DC  B 2 118 ? 37.586  77.625  95.652  1.00   155.57 ? 118 DC  J C2    1 
ATOM   5817  O O2    . DC  B 2 118 ? 36.526  78.261  95.615  1.00   144.43 ? 118 DC  J O2    1 
ATOM   5818  N N3    . DC  B 2 118 ? 38.600  77.871  94.786  1.00   169.02 ? 118 DC  J N3    1 
ATOM   5819  C C4    . DC  B 2 118 ? 39.729  77.162  94.860  1.00   162.62 ? 118 DC  J C4    1 
ATOM   5820  N N4    . DC  B 2 118 ? 40.700  77.440  93.984  1.00   153.72 ? 118 DC  J N4    1 
ATOM   5821  C C5    . DC  B 2 118 ? 39.911  76.137  95.834  1.00   154.94 ? 118 DC  J C5    1 
ATOM   5822  C C6    . DC  B 2 118 ? 38.905  75.904  96.683  1.00   169.23 ? 118 DC  J C6    1 
ATOM   5823  P P     . DT  B 2 119 ? 33.326  73.882  99.274  1.00   172.94 ? 119 DT  J P     1 
ATOM   5824  O OP1   . DT  B 2 119 ? 33.446  73.424  100.676 1.00   161.49 ? 119 DT  J OP1   1 
ATOM   5825  O OP2   . DT  B 2 119 ? 33.525  72.922  98.165  1.00   118.13 ? 119 DT  J OP2   1 
ATOM   5826  O "O5'" . DT  B 2 119 ? 31.900  74.574  99.077  1.00   173.61 ? 119 DT  J "O5'" 1 
ATOM   5827  C "C5'" . DT  B 2 119 ? 31.632  75.823  99.698  1.00   160.36 ? 119 DT  J "C5'" 1 
ATOM   5828  C "C4'" . DT  B 2 119 ? 31.090  76.824  98.693  1.00   168.23 ? 119 DT  J "C4'" 1 
ATOM   5829  O "O4'" . DT  B 2 119 ? 32.148  77.218  97.777  1.00   158.59 ? 119 DT  J "O4'" 1 
ATOM   5830  C "C3'" . DT  B 2 119 ? 29.945  76.304  97.820  1.00   172.23 ? 119 DT  J "C3'" 1 
ATOM   5831  O "O3'" . DT  B 2 119 ? 28.952  77.309  97.684  1.00   178.55 ? 119 DT  J "O3'" 1 
ATOM   5832  C "C2'" . DT  B 2 119 ? 30.631  76.004  96.488  1.00   149.08 ? 119 DT  J "C2'" 1 
ATOM   5833  C "C1'" . DT  B 2 119 ? 31.689  77.091  96.450  1.00   154.84 ? 119 DT  J "C1'" 1 
ATOM   5834  N N1    . DT  B 2 119 ? 32.852  76.762  95.573  1.00   155.87 ? 119 DT  J N1    1 
ATOM   5835  C C2    . DT  B 2 119 ? 33.430  77.757  94.820  1.00   147.43 ? 119 DT  J C2    1 
ATOM   5836  O O2    . DT  B 2 119 ? 33.043  78.911  94.829  1.00   131.13 ? 119 DT  J O2    1 
ATOM   5837  N N3    . DT  B 2 119 ? 34.488  77.351  94.050  1.00   159.92 ? 119 DT  J N3    1 
ATOM   5838  C C4    . DT  B 2 119 ? 35.015  76.074  93.959  1.00   159.23 ? 119 DT  J C4    1 
ATOM   5839  O O4    . DT  B 2 119 ? 35.971  75.808  93.236  1.00   122.61 ? 119 DT  J O4    1 
ATOM   5840  C C5    . DT  B 2 119 ? 34.360  75.077  94.774  1.00   171.59 ? 119 DT  J C5    1 
ATOM   5841  C C7    . DT  B 2 119 ? 34.841  73.656  94.759  1.00   169.98 ? 119 DT  J C7    1 
ATOM   5842  C C6    . DT  B 2 119 ? 33.322  75.465  95.532  1.00   164.42 ? 119 DT  J C6    1 
ATOM   5843  P P     . DA  B 2 120 ? 27.524  76.958  97.037  1.00   195.03 ? 120 DA  J P     1 
ATOM   5844  O OP1   . DA  B 2 120 ? 26.485  77.593  97.877  1.00   183.76 ? 120 DA  J OP1   1 
ATOM   5845  O OP2   . DA  B 2 120 ? 27.477  75.500  96.785  1.00   170.39 ? 120 DA  J OP2   1 
ATOM   5846  O "O5'" . DA  B 2 120 ? 27.563  77.698  95.622  1.00   180.92 ? 120 DA  J "O5'" 1 
ATOM   5847  C "C5'" . DA  B 2 120 ? 27.958  79.062  95.549  1.00   167.24 ? 120 DA  J "C5'" 1 
ATOM   5848  C "C4'" . DA  B 2 120 ? 28.300  79.451  94.123  1.00   170.37 ? 120 DA  J "C4'" 1 
ATOM   5849  O "O4'" . DA  B 2 120 ? 29.475  78.716  93.686  1.00   158.69 ? 120 DA  J "O4'" 1 
ATOM   5850  C "C3'" . DA  B 2 120 ? 27.209  79.155  93.094  1.00   168.77 ? 120 DA  J "C3'" 1 
ATOM   5851  O "O3'" . DA  B 2 120 ? 27.142  80.207  92.148  1.00   165.27 ? 120 DA  J "O3'" 1 
ATOM   5852  C "C2'" . DA  B 2 120 ? 27.692  77.861  92.447  1.00   149.67 ? 120 DA  J "C2'" 1 
ATOM   5853  C "C1'" . DA  B 2 120 ? 29.196  78.069  92.465  1.00   140.06 ? 120 DA  J "C1'" 1 
ATOM   5854  N N9    . DA  B 2 120 ? 29.957  76.825  92.413  1.00   139.12 ? 120 DA  J N9    1 
ATOM   5855  C C8    . DA  B 2 120 ? 29.661  75.651  93.047  1.00   143.57 ? 120 DA  J C8    1 
ATOM   5856  N N7    . DA  B 2 120 ? 30.528  74.693  92.816  1.00   159.57 ? 120 DA  J N7    1 
ATOM   5857  C C5    . DA  B 2 120 ? 31.458  75.281  91.974  1.00   156.25 ? 120 DA  J C5    1 
ATOM   5858  C C6    . DA  B 2 120 ? 32.631  74.793  91.364  1.00   150.68 ? 120 DA  J C6    1 
ATOM   5859  N N6    . DA  B 2 120 ? 33.078  73.543  91.525  1.00   142.78 ? 120 DA  J N6    1 
ATOM   5860  N N1    . DA  B 2 120 ? 33.329  75.642  90.581  1.00   147.61 ? 120 DA  J N1    1 
ATOM   5861  C C2    . DA  B 2 120 ? 32.878  76.892  90.423  1.00   142.75 ? 120 DA  J C2    1 
ATOM   5862  N N3    . DA  B 2 120 ? 31.793  77.463  90.943  1.00   147.26 ? 120 DA  J N3    1 
ATOM   5863  C C4    . DA  B 2 120 ? 31.120  76.596  91.715  1.00   152.13 ? 120 DA  J C4    1 
ATOM   5864  P P     . DC  B 2 121 ? 25.724  80.675  91.556  1.00   167.66 ? 121 DC  J P     1 
ATOM   5865  O OP1   . DC  B 2 121 ? 25.170  81.702  92.467  1.00   161.78 ? 121 DC  J OP1   1 
ATOM   5866  O OP2   . DC  B 2 121 ? 24.941  79.456  91.253  1.00   159.26 ? 121 DC  J OP2   1 
ATOM   5867  O "O5'" . DC  B 2 121 ? 26.108  81.365  90.167  1.00   162.34 ? 121 DC  J "O5'" 1 
ATOM   5868  C "C5'" . DC  B 2 121 ? 27.273  82.173  90.079  1.00   154.34 ? 121 DC  J "C5'" 1 
ATOM   5869  C "C4'" . DC  B 2 121 ? 28.126  81.761  88.892  1.00   149.98 ? 121 DC  J "C4'" 1 
ATOM   5870  O "O4'" . DC  B 2 121 ? 28.725  80.463  89.147  1.00   146.99 ? 121 DC  J "O4'" 1 
ATOM   5871  C "C3'" . DC  B 2 121 ? 27.370  81.629  87.568  1.00   152.00 ? 121 DC  J "C3'" 1 
ATOM   5872  O "O3'" . DC  B 2 121 ? 28.129  82.211  86.522  1.00   153.42 ? 121 DC  J "O3'" 1 
ATOM   5873  C "C2'" . DC  B 2 121 ? 27.239  80.118  87.387  1.00   139.86 ? 121 DC  J "C2'" 1 
ATOM   5874  C "C1'" . DC  B 2 121 ? 28.527  79.632  88.027  1.00   146.68 ? 121 DC  J "C1'" 1 
ATOM   5875  N N1    . DC  B 2 121 ? 28.469  78.216  88.487  1.00   153.60 ? 121 DC  J N1    1 
ATOM   5876  C C2    . DC  B 2 121 ? 29.641  77.452  88.524  1.00   154.88 ? 121 DC  J C2    1 
ATOM   5877  O O2    . DC  B 2 121 ? 30.709  77.970  88.177  1.00   153.73 ? 121 DC  J O2    1 
ATOM   5878  N N3    . DC  B 2 121 ? 29.571  76.164  88.943  1.00   152.92 ? 121 DC  J N3    1 
ATOM   5879  C C4    . DC  B 2 121 ? 28.399  75.643  89.309  1.00   153.89 ? 121 DC  J C4    1 
ATOM   5880  N N4    . DC  B 2 121 ? 28.380  74.369  89.714  1.00   157.55 ? 121 DC  J N4    1 
ATOM   5881  C C5    . DC  B 2 121 ? 27.194  76.405  89.275  1.00   148.94 ? 121 DC  J C5    1 
ATOM   5882  C C6    . DC  B 2 121 ? 27.275  77.674  88.861  1.00   146.39 ? 121 DC  J C6    1 
ATOM   5883  P P     . DG  B 2 122 ? 27.398  83.009  85.335  1.00   153.47 ? 122 DG  J P     1 
ATOM   5884  O OP1   . DG  B 2 122 ? 27.715  84.443  85.523  1.00   139.69 ? 122 DG  J OP1   1 
ATOM   5885  O OP2   . DG  B 2 122 ? 25.988  82.560  85.290  1.00   128.24 ? 122 DG  J OP2   1 
ATOM   5886  O "O5'" . DG  B 2 122 ? 28.121  82.464  84.017  1.00   102.31 ? 122 DG  J "O5'" 1 
ATOM   5887  C "C5'" . DG  B 2 122 ? 29.535  82.527  83.911  1.00   100.04 ? 122 DG  J "C5'" 1 
ATOM   5888  C "C4'" . DG  B 2 122 ? 30.047  81.433  82.997  1.00   108.65 ? 122 DG  J "C4'" 1 
ATOM   5889  O "O4'" . DG  B 2 122 ? 29.932  80.164  83.692  1.00   141.10 ? 122 DG  J "O4'" 1 
ATOM   5890  C "C3'" . DG  B 2 122 ? 29.279  81.259  81.678  1.00   111.24 ? 122 DG  J "C3'" 1 
ATOM   5891  O "O3'" . DG  B 2 122 ? 30.200  81.109  80.600  1.00   127.62 ? 122 DG  J "O3'" 1 
ATOM   5892  C "C2'" . DG  B 2 122 ? 28.475  79.983  81.919  1.00   143.63 ? 122 DG  J "C2'" 1 
ATOM   5893  C "C1'" . DG  B 2 122 ? 29.432  79.205  82.801  1.00   149.60 ? 122 DG  J "C1'" 1 
ATOM   5894  N N9    . DG  B 2 122 ? 28.761  78.175  83.586  1.00   140.63 ? 122 DG  J N9    1 
ATOM   5895  C C8    . DG  B 2 122 ? 27.499  78.245  84.126  1.00   132.23 ? 122 DG  J C8    1 
ATOM   5896  N N7    . DG  B 2 122 ? 27.159  77.179  84.792  1.00   127.22 ? 122 DG  J N7    1 
ATOM   5897  C C5    . DG  B 2 122 ? 28.271  76.353  84.702  1.00   149.76 ? 122 DG  J C5    1 
ATOM   5898  C C6    . DG  B 2 122 ? 28.490  75.061  85.234  1.00   159.92 ? 122 DG  J C6    1 
ATOM   5899  O O6    . DG  B 2 122 ? 27.718  74.370  85.913  1.00   144.35 ? 122 DG  J O6    1 
ATOM   5900  N N1    . DG  B 2 122 ? 29.756  74.579  84.908  1.00   167.28 ? 122 DG  J N1    1 
ATOM   5901  C C2    . DG  B 2 122 ? 30.690  75.259  84.162  1.00   159.32 ? 122 DG  J C2    1 
ATOM   5902  N N2    . DG  B 2 122 ? 31.855  74.630  83.951  1.00   163.50 ? 122 DG  J N2    1 
ATOM   5903  N N3    . DG  B 2 122 ? 30.496  76.472  83.657  1.00   147.66 ? 122 DG  J N3    1 
ATOM   5904  C C4    . DG  B 2 122 ? 29.268  76.955  83.966  1.00   141.15 ? 122 DG  J C4    1 
ATOM   5905  P P     . DA  B 2 123 ? 29.724  81.288  79.073  1.00   131.14 ? 123 DA  J P     1 
ATOM   5906  O OP1   . DA  B 2 123 ? 30.092  82.655  78.647  1.00   136.22 ? 123 DA  J OP1   1 
ATOM   5907  O OP2   . DA  B 2 123 ? 28.318  80.846  78.951  1.00   109.38 ? 123 DA  J OP2   1 
ATOM   5908  O "O5'" . DA  B 2 123 ? 30.640  80.248  78.272  1.00   152.41 ? 123 DA  J "O5'" 1 
ATOM   5909  C "C5'" . DA  B 2 123 ? 32.061  80.364  78.326  1.00   141.53 ? 123 DA  J "C5'" 1 
ATOM   5910  C "C4'" . DA  B 2 123 ? 32.728  79.001  78.219  1.00   124.62 ? 123 DA  J "C4'" 1 
ATOM   5911  O "O4'" . DA  B 2 123 ? 32.212  78.125  79.258  1.00   121.68 ? 123 DA  J "O4'" 1 
ATOM   5912  C "C3'" . DA  B 2 123 ? 32.500  78.266  76.899  1.00   139.45 ? 123 DA  J "C3'" 1 
ATOM   5913  O "O3'" . DA  B 2 123 ? 33.676  77.555  76.527  1.00   151.01 ? 123 DA  J "O3'" 1 
ATOM   5914  C "C2'" . DA  B 2 123 ? 31.359  77.315  77.235  1.00   144.48 ? 123 DA  J "C2'" 1 
ATOM   5915  C "C1'" . DA  B 2 123 ? 31.688  76.952  78.675  1.00   137.76 ? 123 DA  J "C1'" 1 
ATOM   5916  N N9    . DA  B 2 123 ? 30.524  76.530  79.448  1.00   147.72 ? 123 DA  J N9    1 
ATOM   5917  C C8    . DA  B 2 123 ? 29.455  77.299  79.816  1.00   144.61 ? 123 DA  J C8    1 
ATOM   5918  N N7    . DA  B 2 123 ? 28.550  76.651  80.511  1.00   150.21 ? 123 DA  J N7    1 
ATOM   5919  C C5    . DA  B 2 123 ? 29.060  75.366  80.605  1.00   155.83 ? 123 DA  J C5    1 
ATOM   5920  C C6    . DA  B 2 123 ? 28.576  74.194  81.221  1.00   147.64 ? 123 DA  J C6    1 
ATOM   5921  N N6    . DA  B 2 123 ? 27.416  74.137  81.884  1.00   141.98 ? 123 DA  J N6    1 
ATOM   5922  N N1    . DA  B 2 123 ? 29.332  73.081  81.128  1.00   150.83 ? 123 DA  J N1    1 
ATOM   5923  C C2    . DA  B 2 123 ? 30.493  73.143  80.464  1.00   151.71 ? 123 DA  J C2    1 
ATOM   5924  N N3    . DA  B 2 123 ? 31.051  74.183  79.846  1.00   156.56 ? 123 DA  J N3    1 
ATOM   5925  C C4    . DA  B 2 123 ? 30.276  75.274  79.955  1.00   157.73 ? 123 DA  J C4    1 
ATOM   5926  P P     . DC  B 2 124 ? 33.794  76.896  75.066  1.00   173.78 ? 124 DC  J P     1 
ATOM   5927  O OP1   . DC  B 2 124 ? 35.234  76.737  74.761  1.00   154.73 ? 124 DC  J OP1   1 
ATOM   5928  O OP2   . DC  B 2 124 ? 32.930  77.673  74.150  1.00   161.37 ? 124 DC  J OP2   1 
ATOM   5929  O "O5'" . DC  B 2 124 ? 33.145  75.443  75.240  1.00   165.65 ? 124 DC  J "O5'" 1 
ATOM   5930  C "C5'" . DC  B 2 124 ? 33.878  74.409  75.891  1.00   157.12 ? 124 DC  J "C5'" 1 
ATOM   5931  C "C4'" . DC  B 2 124 ? 33.049  73.140  75.998  1.00   156.03 ? 124 DC  J "C4'" 1 
ATOM   5932  O "O4'" . DC  B 2 124 ? 32.045  73.305  77.020  1.00   160.99 ? 124 DC  J "O4'" 1 
ATOM   5933  C "C3'" . DC  B 2 124 ? 32.268  72.775  74.750  1.00   159.34 ? 124 DC  J "C3'" 1 
ATOM   5934  O "O3'" . DC  B 2 124 ? 33.095  72.031  73.861  1.00   176.09 ? 124 DC  J "O3'" 1 
ATOM   5935  C "C2'" . DC  B 2 124 ? 31.134  71.917  75.311  1.00   158.94 ? 124 DC  J "C2'" 1 
ATOM   5936  C "C1'" . DC  B 2 124 ? 30.923  72.495  76.717  1.00   166.55 ? 124 DC  J "C1'" 1 
ATOM   5937  N N1    . DC  B 2 124 ? 29.685  73.324  76.850  1.00   174.32 ? 124 DC  J N1    1 
ATOM   5938  C C2    . DC  B 2 124 ? 28.629  72.866  77.646  1.00   170.21 ? 124 DC  J C2    1 
ATOM   5939  O O2    . DC  B 2 124 ? 28.737  71.778  78.226  1.00   155.40 ? 124 DC  J O2    1 
ATOM   5940  N N3    . DC  B 2 124 ? 27.514  73.631  77.760  1.00   172.20 ? 124 DC  J N3    1 
ATOM   5941  C C4    . DC  B 2 124 ? 27.436  74.799  77.119  1.00   173.79 ? 124 DC  J C4    1 
ATOM   5942  N N4    . DC  B 2 124 ? 26.317  75.518  77.261  1.00   167.62 ? 124 DC  J N4    1 
ATOM   5943  C C5    . DC  B 2 124 ? 28.503  75.282  76.304  1.00   172.86 ? 124 DC  J C5    1 
ATOM   5944  C C6    . DC  B 2 124 ? 29.596  74.519  76.199  1.00   166.92 ? 124 DC  J C6    1 
ATOM   5945  P P     . DC  B 2 125 ? 32.643  71.803  72.335  1.00   152.36 ? 125 DC  J P     1 
ATOM   5946  O OP1   . DC  B 2 125 ? 33.850  71.441  71.559  1.00   133.52 ? 125 DC  J OP1   1 
ATOM   5947  O OP2   . DC  B 2 125 ? 31.827  72.968  71.927  1.00   135.33 ? 125 DC  J OP2   1 
ATOM   5948  O "O5'" . DC  B 2 125 ? 31.676  70.532  72.405  1.00   181.91 ? 125 DC  J "O5'" 1 
ATOM   5949  C "C5'" . DC  B 2 125 ? 32.165  69.293  72.906  1.00   181.18 ? 125 DC  J "C5'" 1 
ATOM   5950  C "C4'" . DC  B 2 125 ? 31.032  68.303  73.102  1.00   169.68 ? 125 DC  J "C4'" 1 
ATOM   5951  O "O4'" . DC  B 2 125 ? 30.129  68.792  74.128  1.00   171.23 ? 125 DC  J "O4'" 1 
ATOM   5952  C "C3'" . DC  B 2 125 ? 30.173  68.046  71.859  1.00   165.29 ? 125 DC  J "C3'" 1 
ATOM   5953  O "O3'" . DC  B 2 125 ? 30.005  66.646  71.663  1.00   161.76 ? 125 DC  J "O3'" 1 
ATOM   5954  C "C2'" . DC  B 2 125 ? 28.846  68.734  72.186  1.00   158.88 ? 125 DC  J "C2'" 1 
ATOM   5955  C "C1'" . DC  B 2 125 ? 28.801  68.618  73.699  1.00   164.99 ? 125 DC  J "C1'" 1 
ATOM   5956  N N1    . DC  B 2 125 ? 27.951  69.655  74.349  1.00   175.06 ? 125 DC  J N1    1 
ATOM   5957  C C2    . DC  B 2 125 ? 27.107  69.297  75.405  1.00   178.43 ? 125 DC  J C2    1 
ATOM   5958  O O2    . DC  B 2 125 ? 27.085  68.121  75.787  1.00   182.43 ? 125 DC  J O2    1 
ATOM   5959  N N3    . DC  B 2 125 ? 26.337  70.252  75.983  1.00   179.27 ? 125 DC  J N3    1 
ATOM   5960  C C4    . DC  B 2 125 ? 26.390  71.510  75.542  1.00   182.30 ? 125 DC  J C4    1 
ATOM   5961  N N4    . DC  B 2 125 ? 25.612  72.417  76.143  1.00   176.78 ? 125 DC  J N4    1 
ATOM   5962  C C5    . DC  B 2 125 ? 27.243  71.894  74.465  1.00   183.57 ? 125 DC  J C5    1 
ATOM   5963  C C6    . DC  B 2 125 ? 27.997  70.944  73.903  1.00   179.99 ? 125 DC  J C6    1 
ATOM   5964  P P     . DA  B 2 126 ? 29.169  66.098  70.404  1.00   154.92 ? 126 DA  J P     1 
ATOM   5965  O OP1   . DA  B 2 126 ? 29.715  64.769  70.049  1.00   144.37 ? 126 DA  J OP1   1 
ATOM   5966  O OP2   . DA  B 2 126 ? 29.121  67.168  69.383  1.00   126.96 ? 126 DA  J OP2   1 
ATOM   5967  O "O5'" . DA  B 2 126 ? 27.692  65.903  70.984  1.00   150.77 ? 126 DA  J "O5'" 1 
ATOM   5968  C "C5'" . DA  B 2 126 ? 27.476  65.049  72.100  1.00   130.68 ? 126 DA  J "C5'" 1 
ATOM   5969  C "C4'" . DA  B 2 126 ? 25.999  64.963  72.438  1.00   152.34 ? 126 DA  J "C4'" 1 
ATOM   5970  O "O4'" . DA  B 2 126 ? 25.590  66.161  73.148  1.00   169.17 ? 126 DA  J "O4'" 1 
ATOM   5971  C "C3'" . DA  B 2 126 ? 25.066  64.839  71.230  1.00   173.51 ? 126 DA  J "C3'" 1 
ATOM   5972  O "O3'" . DA  B 2 126 ? 24.090  63.834  71.471  1.00   185.17 ? 126 DA  J "O3'" 1 
ATOM   5973  C "C2'" . DA  B 2 126 ? 24.430  66.225  71.127  1.00   175.69 ? 126 DA  J "C2'" 1 
ATOM   5974  C "C1'" . DA  B 2 126 ? 24.399  66.654  72.583  1.00   174.78 ? 126 DA  J "C1'" 1 
ATOM   5975  N N9    . DA  B 2 126 ? 24.363  68.103  72.763  1.00   183.46 ? 126 DA  J N9    1 
ATOM   5976  C C8    . DA  B 2 126 ? 25.299  69.009  72.346  1.00   181.83 ? 126 DA  J C8    1 
ATOM   5977  N N7    . DA  B 2 126 ? 25.003  70.252  72.645  1.00   178.04 ? 126 DA  J N7    1 
ATOM   5978  C C5    . DA  B 2 126 ? 23.789  70.154  73.304  1.00   189.06 ? 126 DA  J C5    1 
ATOM   5979  C C6    . DA  B 2 126 ? 22.940  71.122  73.879  1.00   185.25 ? 126 DA  J C6    1 
ATOM   5980  N N6    . DA  B 2 126 ? 23.207  72.431  73.875  1.00   179.01 ? 126 DA  J N6    1 
ATOM   5981  N N1    . DA  B 2 126 ? 21.801  70.688  74.460  1.00   187.29 ? 126 DA  J N1    1 
ATOM   5982  C C2    . DA  B 2 126 ? 21.536  69.376  74.461  1.00   188.48 ? 126 DA  J C2    1 
ATOM   5983  N N3    . DA  B 2 126 ? 22.255  68.375  73.955  1.00   193.02 ? 126 DA  J N3    1 
ATOM   5984  C C4    . DA  B 2 126 ? 23.380  68.837  73.385  1.00   193.53 ? 126 DA  J C4    1 
ATOM   5985  P P     . DA  B 2 127 ? 23.193  63.270  70.263  1.00   187.08 ? 127 DA  J P     1 
ATOM   5986  O OP1   . DA  B 2 127 ? 23.172  61.795  70.373  1.00   171.14 ? 127 DA  J OP1   1 
ATOM   5987  O OP2   . DA  B 2 127 ? 23.663  63.906  69.011  1.00   168.44 ? 127 DA  J OP2   1 
ATOM   5988  O "O5'" . DA  B 2 127 ? 21.730  63.833  70.580  1.00   181.47 ? 127 DA  J "O5'" 1 
ATOM   5989  C "C5'" . DA  B 2 127 ? 21.116  63.543  71.830  1.00   172.67 ? 127 DA  J "C5'" 1 
ATOM   5990  C "C4'" . DA  B 2 127 ? 19.826  64.327  71.999  1.00   175.09 ? 127 DA  J "C4'" 1 
ATOM   5991  O "O4'" . DA  B 2 127 ? 20.125  65.746  72.082  1.00   189.38 ? 127 DA  J "O4'" 1 
ATOM   5992  C "C3'" . DA  B 2 127 ? 18.817  64.170  70.859  1.00   176.34 ? 127 DA  J "C3'" 1 
ATOM   5993  O "O3'" . DA  B 2 127 ? 17.506  64.028  71.391  1.00   180.65 ? 127 DA  J "O3'" 1 
ATOM   5994  C "C2'" . DA  B 2 127 ? 18.964  65.474  70.078  1.00   177.11 ? 127 DA  J "C2'" 1 
ATOM   5995  C "C1'" . DA  B 2 127 ? 19.293  66.453  71.192  1.00   191.15 ? 127 DA  J "C1'" 1 
ATOM   5996  N N9    . DA  B 2 127 ? 20.005  67.644  70.737  1.00   193.34 ? 127 DA  J N9    1 
ATOM   5997  C C8    . DA  B 2 127 ? 20.960  67.712  69.761  1.00   189.74 ? 127 DA  J C8    1 
ATOM   5998  N N7    . DA  B 2 127 ? 21.430  68.922  69.563  1.00   173.09 ? 127 DA  J N7    1 
ATOM   5999  C C5    . DA  B 2 127 ? 20.734  69.701  70.473  1.00   174.97 ? 127 DA  J C5    1 
ATOM   6000  C C6    . DA  B 2 127 ? 20.771  71.079  70.766  1.00   172.51 ? 127 DA  J C6    1 
ATOM   6001  N N6    . DA  B 2 127 ? 21.574  71.944  70.139  1.00   171.33 ? 127 DA  J N6    1 
ATOM   6002  N N1    . DA  B 2 127 ? 19.946  71.534  71.733  1.00   178.48 ? 127 DA  J N1    1 
ATOM   6003  C C2    . DA  B 2 127 ? 19.143  70.665  72.358  1.00   181.62 ? 127 DA  J C2    1 
ATOM   6004  N N3    . DA  B 2 127 ? 19.021  69.352  72.170  1.00   168.63 ? 127 DA  J N3    1 
ATOM   6005  C C4    . DA  B 2 127 ? 19.852  68.929  71.205  1.00   179.85 ? 127 DA  J C4    1 
ATOM   6006  P P     . DT  B 2 128 ? 16.370  63.261  70.552  1.00   185.14 ? 128 DT  J P     1 
ATOM   6007  O OP1   . DT  B 2 128 ? 15.827  62.186  71.413  1.00   186.35 ? 128 DT  J OP1   1 
ATOM   6008  O OP2   . DT  B 2 128 ? 16.936  62.929  69.226  1.00   167.72 ? 128 DT  J OP2   1 
ATOM   6009  O "O5'" . DT  B 2 128 ? 15.238  64.371  70.339  1.00   200.31 ? 128 DT  J "O5'" 1 
ATOM   6010  C "C5'" . DT  B 2 128 ? 14.583  64.942  71.466  1.00   194.37 ? 128 DT  J "C5'" 1 
ATOM   6011  C "C4'" . DT  B 2 128 ? 14.084  66.340  71.149  1.00   185.23 ? 128 DT  J "C4'" 1 
ATOM   6012  O "O4'" . DT  B 2 128 ? 15.188  67.190  70.784  1.00   196.52 ? 128 DT  J "O4'" 1 
ATOM   6013  C "C3'" . DT  B 2 128 ? 13.093  66.439  69.984  1.00   173.32 ? 128 DT  J "C3'" 1 
ATOM   6014  O "O3'" . DT  B 2 128 ? 11.782  66.691  70.477  1.00   184.00 ? 128 DT  J "O3'" 1 
ATOM   6015  C "C2'" . DT  B 2 128 ? 13.628  67.604  69.125  1.00   165.91 ? 128 DT  J "C2'" 1 
ATOM   6016  C "C1'" . DT  B 2 128 ? 14.662  68.249  70.040  1.00   181.03 ? 128 DT  J "C1'" 1 
ATOM   6017  N N1    . DT  B 2 128 ? 15.778  68.904  69.302  1.00   182.18 ? 128 DT  J N1    1 
ATOM   6018  C C2    . DT  B 2 128 ? 16.169  70.174  69.659  1.00   166.71 ? 128 DT  J C2    1 
ATOM   6019  O O2    . DT  B 2 128 ? 15.646  70.805  70.560  1.00   147.40 ? 128 DT  J O2    1 
ATOM   6020  N N3    . DT  B 2 128 ? 17.203  70.683  68.919  1.00   172.88 ? 128 DT  J N3    1 
ATOM   6021  C C4    . DT  B 2 128 ? 17.871  70.062  67.878  1.00   170.36 ? 128 DT  J C4    1 
ATOM   6022  O O4    . DT  B 2 128 ? 18.791  70.604  67.272  1.00   159.49 ? 128 DT  J O4    1 
ATOM   6023  C C5    . DT  B 2 128 ? 17.411  68.733  67.556  1.00   178.12 ? 128 DT  J C5    1 
ATOM   6024  C C7    . DT  B 2 128 ? 18.059  67.960  66.446  1.00   189.37 ? 128 DT  J C7    1 
ATOM   6025  C C6    . DT  B 2 128 ? 16.399  68.224  68.275  1.00   181.27 ? 128 DT  J C6    1 
ATOM   6026  P P     . DT  B 2 129 ? 10.545  66.836  69.461  1.00   194.39 ? 129 DT  J P     1 
ATOM   6027  O OP1   . DT  B 2 129 ? 9.314   66.474  70.199  1.00   190.47 ? 129 DT  J OP1   1 
ATOM   6028  O OP2   . DT  B 2 129 ? 10.892  66.120  68.214  1.00   190.99 ? 129 DT  J OP2   1 
ATOM   6029  O "O5'" . DT  B 2 129 ? 10.505  68.399  69.134  1.00   176.26 ? 129 DT  J "O5'" 1 
ATOM   6030  C "C5'" . DT  B 2 129 ? 10.560  69.346  70.194  1.00   176.21 ? 129 DT  J "C5'" 1 
ATOM   6031  C "C4'" . DT  B 2 129 ? 10.555  70.764  69.654  1.00   151.80 ? 129 DT  J "C4'" 1 
ATOM   6032  O "O4'" . DT  B 2 129 ? 11.839  71.063  69.040  1.00   156.75 ? 129 DT  J "O4'" 1 
ATOM   6033  C "C3'" . DT  B 2 129 ? 9.499   71.044  68.583  1.00   144.18 ? 129 DT  J "C3'" 1 
ATOM   6034  O "O3'" . DT  B 2 129 ? 8.954   72.336  68.777  1.00   153.71 ? 129 DT  J "O3'" 1 
ATOM   6035  C "C2'" . DT  B 2 129 ? 10.308  70.979  67.290  1.00   139.91 ? 129 DT  J "C2'" 1 
ATOM   6036  C "C1'" . DT  B 2 129 ? 11.624  71.582  67.749  1.00   144.93 ? 129 DT  J "C1'" 1 
ATOM   6037  N N1    . DT  B 2 129 ? 12.788  71.223  66.890  1.00   155.65 ? 129 DT  J N1    1 
ATOM   6038  C C2    . DT  B 2 129 ? 13.712  72.191  66.573  1.00   159.41 ? 129 DT  J C2    1 
ATOM   6039  O O2    . DT  B 2 129 ? 13.633  73.342  66.962  1.00   162.23 ? 129 DT  J O2    1 
ATOM   6040  N N3    . DT  B 2 129 ? 14.743  71.762  65.779  1.00   160.59 ? 129 DT  J N3    1 
ATOM   6041  C C4    . DT  B 2 129 ? 14.938  70.488  65.280  1.00   167.26 ? 129 DT  J C4    1 
ATOM   6042  O O4    . DT  B 2 129 ? 15.898  70.200  64.573  1.00   155.31 ? 129 DT  J O4    1 
ATOM   6043  C C5    . DT  B 2 129 ? 13.931  69.519  65.650  1.00   174.50 ? 129 DT  J C5    1 
ATOM   6044  C C7    . DT  B 2 129 ? 14.035  68.102  65.168  1.00   157.73 ? 129 DT  J C7    1 
ATOM   6045  C C6    . DT  B 2 129 ? 12.917  69.929  66.427  1.00   170.87 ? 129 DT  J C6    1 
ATOM   6046  P P     . DG  B 2 130 ? 7.671   72.561  69.718  1.00   164.17 ? 130 DG  J P     1 
ATOM   6047  O OP1   . DG  B 2 130 ? 7.986   72.047  71.070  1.00   128.57 ? 130 DG  J OP1   1 
ATOM   6048  O OP2   . DG  B 2 130 ? 6.481   72.059  68.996  1.00   138.92 ? 130 DG  J OP2   1 
ATOM   6049  O "O5'" . DG  B 2 130 ? 7.561   74.152  69.788  1.00   167.75 ? 130 DG  J "O5'" 1 
ATOM   6050  C "C5'" . DG  B 2 130 ? 8.580   74.902  70.440  1.00   153.17 ? 130 DG  J "C5'" 1 
ATOM   6051  C "C4'" . DG  B 2 130 ? 9.032   76.069  69.578  1.00   121.04 ? 130 DG  J "C4'" 1 
ATOM   6052  O "O4'" . DG  B 2 130 ? 9.837   75.561  68.478  1.00   119.26 ? 130 DG  J "O4'" 1 
ATOM   6053  C "C3'" . DG  B 2 130 ? 7.909   76.873  68.926  1.00   146.12 ? 130 DG  J "C3'" 1 
ATOM   6054  O "O3'" . DG  B 2 130 ? 8.296   78.230  68.814  1.00   149.91 ? 130 DG  J "O3'" 1 
ATOM   6055  C "C2'" . DG  B 2 130 ? 7.801   76.219  67.554  1.00   151.38 ? 130 DG  J "C2'" 1 
ATOM   6056  C "C1'" . DG  B 2 130 ? 9.267   75.964  67.252  1.00   129.52 ? 130 DG  J "C1'" 1 
ATOM   6057  N N9    . DG  B 2 130 ? 9.477   74.894  66.281  1.00   143.95 ? 130 DG  J N9    1 
ATOM   6058  C C8    . DG  B 2 130 ? 8.597   73.890  65.957  1.00   138.42 ? 130 DG  J C8    1 
ATOM   6059  N N7    . DG  B 2 130 ? 9.055   73.067  65.056  1.00   149.85 ? 130 DG  J N7    1 
ATOM   6060  C C5    . DG  B 2 130 ? 10.323  73.554  64.764  1.00   163.36 ? 130 DG  J C5    1 
ATOM   6061  C C6    . DG  B 2 130 ? 11.298  73.072  63.858  1.00   162.91 ? 130 DG  J C6    1 
ATOM   6062  O O6    . DG  B 2 130 ? 11.230  72.088  63.109  1.00   162.59 ? 130 DG  J O6    1 
ATOM   6063  N N1    . DG  B 2 130 ? 12.446  73.862  63.868  1.00   153.48 ? 130 DG  J N1    1 
ATOM   6064  C C2    . DG  B 2 130 ? 12.628  74.975  64.654  1.00   145.49 ? 130 DG  J C2    1 
ATOM   6065  N N2    . DG  B 2 130 ? 13.804  75.605  64.525  1.00   138.95 ? 130 DG  J N2    1 
ATOM   6066  N N3    . DG  B 2 130 ? 11.724  75.436  65.509  1.00   153.02 ? 130 DG  J N3    1 
ATOM   6067  C C4    . DG  B 2 130 ? 10.599  74.679  65.510  1.00   159.74 ? 130 DG  J C4    1 
ATOM   6068  P P     . DA  B 2 131 ? 7.451   79.377  69.554  1.00   164.34 ? 131 DA  J P     1 
ATOM   6069  O OP1   . DA  B 2 131 ? 7.202   78.928  70.942  1.00   137.12 ? 131 DA  J OP1   1 
ATOM   6070  O OP2   . DA  B 2 131 ? 6.311   79.729  68.677  1.00   121.91 ? 131 DA  J OP2   1 
ATOM   6071  O "O5'" . DA  B 2 131 ? 8.454   80.624  69.583  1.00   162.44 ? 131 DA  J "O5'" 1 
ATOM   6072  C "C5'" . DA  B 2 131 ? 9.743   80.487  70.174  1.00   123.79 ? 131 DA  J "C5'" 1 
ATOM   6073  C "C4'" . DA  B 2 131 ? 10.830  80.964  69.226  1.00   115.06 ? 131 DA  J "C4'" 1 
ATOM   6074  O "O4'" . DA  B 2 131 ? 11.017  79.986  68.167  1.00   106.07 ? 131 DA  J "O4'" 1 
ATOM   6075  C "C3'" . DA  B 2 131 ? 10.546  82.294  68.528  1.00   137.50 ? 131 DA  J "C3'" 1 
ATOM   6076  O "O3'" . DA  B 2 131 ? 11.740  83.061  68.439  1.00   140.08 ? 131 DA  J "O3'" 1 
ATOM   6077  C "C2'" . DA  B 2 131 ? 10.056  81.862  67.150  1.00   136.53 ? 131 DA  J "C2'" 1 
ATOM   6078  C "C1'" . DA  B 2 131 ? 10.891  80.614  66.910  1.00   127.04 ? 131 DA  J "C1'" 1 
ATOM   6079  N N9    . DA  B 2 131 ? 10.275  79.671  65.983  1.00   147.67 ? 131 DA  J N9    1 
ATOM   6080  C C8    . DA  B 2 131 ? 8.976   79.243  65.984  1.00   140.33 ? 131 DA  J C8    1 
ATOM   6081  N N7    . DA  B 2 131 ? 8.700   78.388  65.028  1.00   134.79 ? 131 DA  J N7    1 
ATOM   6082  C C5    . DA  B 2 131 ? 9.901   78.245  64.353  1.00   146.91 ? 131 DA  J C5    1 
ATOM   6083  C C6    . DA  B 2 131 ? 10.275  77.475  63.235  1.00   153.93 ? 131 DA  J C6    1 
ATOM   6084  N N6    . DA  B 2 131 ? 9.431   76.672  62.580  1.00   145.83 ? 131 DA  J N6    1 
ATOM   6085  N N1    . DA  B 2 131 ? 11.555  77.562  62.815  1.00   162.49 ? 131 DA  J N1    1 
ATOM   6086  C C2    . DA  B 2 131 ? 12.396  78.367  63.474  1.00   153.42 ? 131 DA  J C2    1 
ATOM   6087  N N3    . DA  B 2 131 ? 12.161  79.137  64.535  1.00   147.64 ? 131 DA  J N3    1 
ATOM   6088  C C4    . DA  B 2 131 ? 10.882  79.029  64.928  1.00   149.60 ? 131 DA  J C4    1 
ATOM   6089  P P     . DG  B 2 132 ? 11.667  84.632  68.111  1.00   117.90 ? 132 DG  J P     1 
ATOM   6090  O OP1   . DG  B 2 132 ? 12.702  85.308  68.925  1.00   79.19  ? 132 DG  J OP1   1 
ATOM   6091  O OP2   . DG  B 2 132 ? 10.250  85.046  68.222  1.00   104.25 ? 132 DG  J OP2   1 
ATOM   6092  O "O5'" . DG  B 2 132 ? 12.080  84.722  66.568  1.00   113.43 ? 132 DG  J "O5'" 1 
ATOM   6093  C "C5'" . DG  B 2 132 ? 13.400  84.375  66.165  1.00   113.50 ? 132 DG  J "C5'" 1 
ATOM   6094  C "C4'" . DG  B 2 132 ? 13.493  84.254  64.654  1.00   107.03 ? 132 DG  J "C4'" 1 
ATOM   6095  O "O4'" . DG  B 2 132 ? 12.622  83.184  64.197  1.00   139.60 ? 132 DG  J "O4'" 1 
ATOM   6096  C "C3'" . DG  B 2 132 ? 13.073  85.501  63.873  1.00   119.97 ? 132 DG  J "C3'" 1 
ATOM   6097  O "O3'" . DG  B 2 132 ? 13.928  85.675  62.753  1.00   111.25 ? 132 DG  J "O3'" 1 
ATOM   6098  C "C2'" . DG  B 2 132 ? 11.652  85.161  63.435  1.00   139.46 ? 132 DG  J "C2'" 1 
ATOM   6099  C "C1'" . DG  B 2 132 ? 11.783  83.672  63.174  1.00   145.26 ? 132 DG  J "C1'" 1 
ATOM   6100  N N9    . DG  B 2 132 ? 10.513  82.955  63.227  1.00   154.96 ? 132 DG  J N9    1 
ATOM   6101  C C8    . DG  B 2 132 ? 9.424   83.255  64.009  1.00   147.94 ? 132 DG  J C8    1 
ATOM   6102  N N7    . DG  B 2 132 ? 8.424   82.435  63.842  1.00   145.03 ? 132 DG  J N7    1 
ATOM   6103  C C5    . DG  B 2 132 ? 8.878   81.534  62.887  1.00   151.42 ? 132 DG  J C5    1 
ATOM   6104  C C6    . DG  B 2 132 ? 8.229   80.419  62.306  1.00   149.46 ? 132 DG  J C6    1 
ATOM   6105  O O6    . DG  B 2 132 ? 7.087   79.993  62.529  1.00   138.33 ? 132 DG  J O6    1 
ATOM   6106  N N1    . DG  B 2 132 ? 9.046   79.775  61.378  1.00   150.58 ? 132 DG  J N1    1 
ATOM   6107  C C2    . DG  B 2 132 ? 10.326  80.160  61.054  1.00   146.04 ? 132 DG  J C2    1 
ATOM   6108  N N2    . DG  B 2 132 ? 10.958  79.415  60.136  1.00   141.06 ? 132 DG  J N2    1 
ATOM   6109  N N3    . DG  B 2 132 ? 10.944  81.203  61.592  1.00   144.55 ? 132 DG  J N3    1 
ATOM   6110  C C4    . DG  B 2 132 ? 10.162  81.841  62.497  1.00   150.99 ? 132 DG  J C4    1 
ATOM   6111  P P     . DC  B 2 133 ? 14.090  87.117  62.063  1.00   126.08 ? 133 DC  J P     1 
ATOM   6112  O OP1   . DC  B 2 133 ? 15.189  87.825  62.756  1.00   139.73 ? 133 DC  J OP1   1 
ATOM   6113  O OP2   . DC  B 2 133 ? 12.752  87.745  61.967  1.00   97.85  ? 133 DC  J OP2   1 
ATOM   6114  O "O5'" . DC  B 2 133 ? 14.563  86.770  60.578  1.00   129.26 ? 133 DC  J "O5'" 1 
ATOM   6115  C "C5'" . DC  B 2 133 ? 15.501  85.724  60.358  1.00   130.99 ? 133 DC  J "C5'" 1 
ATOM   6116  C "C4'" . DC  B 2 133 ? 15.224  85.023  59.041  1.00   126.21 ? 133 DC  J "C4'" 1 
ATOM   6117  O "O4'" . DC  B 2 133 ? 14.092  84.124  59.196  1.00   121.92 ? 133 DC  J "O4'" 1 
ATOM   6118  C "C3'" . DC  B 2 133 ? 14.871  85.955  57.882  1.00   114.33 ? 133 DC  J "C3'" 1 
ATOM   6119  O "O3'" . DC  B 2 133 ? 15.506  85.517  56.693  1.00   112.07 ? 133 DC  J "O3'" 1 
ATOM   6120  C "C2'" . DC  B 2 133 ? 13.354  85.828  57.785  1.00   120.89 ? 133 DC  J "C2'" 1 
ATOM   6121  C "C1'" . DC  B 2 133 ? 13.148  84.376  58.180  1.00   121.67 ? 133 DC  J "C1'" 1 
ATOM   6122  N N1    . DC  B 2 133 ? 11.785  84.094  58.716  1.00   141.18 ? 133 DC  J N1    1 
ATOM   6123  C C2    . DC  B 2 133 ? 11.048  83.020  58.204  1.00   147.23 ? 133 DC  J C2    1 
ATOM   6124  O O2    . DC  B 2 133 ? 11.545  82.317  57.315  1.00   151.70 ? 133 DC  J O2    1 
ATOM   6125  N N3    . DC  B 2 133 ? 9.809   82.779  58.699  1.00   147.82 ? 133 DC  J N3    1 
ATOM   6126  C C4    . DC  B 2 133 ? 9.309   83.561  59.658  1.00   141.46 ? 133 DC  J C4    1 
ATOM   6127  N N4    . DC  B 2 133 ? 8.084   83.285  60.115  1.00   145.32 ? 133 DC  J N4    1 
ATOM   6128  C C5    . DC  B 2 133 ? 10.044  84.661  60.190  1.00   134.33 ? 133 DC  J C5    1 
ATOM   6129  C C6    . DC  B 2 133 ? 11.265  84.889  59.694  1.00   141.57 ? 133 DC  J C6    1 
ATOM   6130  P P     . DG  B 2 134 ? 15.804  86.560  55.508  1.00   148.75 ? 134 DG  J P     1 
ATOM   6131  O OP1   . DG  B 2 134 ? 17.270  86.676  55.358  1.00   128.79 ? 134 DG  J OP1   1 
ATOM   6132  O OP2   . DG  B 2 134 ? 14.998  87.774  55.766  1.00   144.93 ? 134 DG  J OP2   1 
ATOM   6133  O "O5'" . DG  B 2 134 ? 15.198  85.847  54.213  1.00   152.05 ? 134 DG  J "O5'" 1 
ATOM   6134  C "C5'" . DG  B 2 134 ? 15.494  84.482  53.946  1.00   147.90 ? 134 DG  J "C5'" 1 
ATOM   6135  C "C4'" . DG  B 2 134 ? 14.520  83.908  52.932  1.00   147.75 ? 134 DG  J "C4'" 1 
ATOM   6136  O "O4'" . DG  B 2 134 ? 13.292  83.517  53.602  1.00   152.13 ? 134 DG  J "O4'" 1 
ATOM   6137  C "C3'" . DG  B 2 134 ? 14.110  84.867  51.818  1.00   159.54 ? 134 DG  J "C3'" 1 
ATOM   6138  O "O3'" . DG  B 2 134 ? 14.001  84.164  50.586  1.00   139.05 ? 134 DG  J "O3'" 1 
ATOM   6139  C "C2'" . DG  B 2 134 ? 12.758  85.396  52.294  1.00   159.08 ? 134 DG  J "C2'" 1 
ATOM   6140  C "C1'" . DG  B 2 134 ? 12.189  84.191  53.031  1.00   153.44 ? 134 DG  J "C1'" 1 
ATOM   6141  N N9    . DG  B 2 134 ? 11.272  84.553  54.108  1.00   144.12 ? 134 DG  J N9    1 
ATOM   6142  C C8    . DG  B 2 134 ? 11.476  85.502  55.077  1.00   143.66 ? 134 DG  J C8    1 
ATOM   6143  N N7    . DG  B 2 134 ? 10.486  85.610  55.918  1.00   143.55 ? 134 DG  J N7    1 
ATOM   6144  C C5    . DG  B 2 134 ? 9.564   84.670  55.480  1.00   138.15 ? 134 DG  J C5    1 
ATOM   6145  C C6    . DG  B 2 134 ? 8.293   84.331  56.000  1.00   132.07 ? 134 DG  J C6    1 
ATOM   6146  O O6    . DG  B 2 134 ? 7.713   84.813  56.982  1.00   116.79 ? 134 DG  J O6    1 
ATOM   6147  N N1    . DG  B 2 134 ? 7.684   83.324  55.255  1.00   147.22 ? 134 DG  J N1    1 
ATOM   6148  C C2    . DG  B 2 134 ? 8.235   82.722  54.148  1.00   154.29 ? 134 DG  J C2    1 
ATOM   6149  N N2    . DG  B 2 134 ? 7.497   81.768  53.563  1.00   150.35 ? 134 DG  J N2    1 
ATOM   6150  N N3    . DG  B 2 134 ? 9.427   83.029  53.652  1.00   169.65 ? 134 DG  J N3    1 
ATOM   6151  C C4    . DG  B 2 134 ? 10.032  84.009  54.366  1.00   153.60 ? 134 DG  J C4    1 
ATOM   6152  P P     . DG  B 2 135 ? 13.600  84.946  49.240  1.00   146.84 ? 135 DG  J P     1 
ATOM   6153  O OP1   . DG  B 2 135 ? 14.000  84.102  48.093  1.00   161.14 ? 135 DG  J OP1   1 
ATOM   6154  O OP2   . DG  B 2 135 ? 14.115  86.330  49.350  1.00   142.71 ? 135 DG  J OP2   1 
ATOM   6155  O "O5'" . DG  B 2 135 ? 12.005  85.016  49.307  1.00   150.86 ? 135 DG  J "O5'" 1 
ATOM   6156  C "C5'" . DG  B 2 135 ? 11.247  85.203  48.127  1.00   165.58 ? 135 DG  J "C5'" 1 
ATOM   6157  C "C4'" . DG  B 2 135 ? 10.108  84.204  48.074  1.00   170.42 ? 135 DG  J "C4'" 1 
ATOM   6158  O "O4'" . DG  B 2 135 ? 9.621   83.954  49.420  1.00   155.47 ? 135 DG  J "O4'" 1 
ATOM   6159  C "C3'" . DG  B 2 135 ? 8.897   84.645  47.259  1.00   175.37 ? 135 DG  J "C3'" 1 
ATOM   6160  O "O3'" . DG  B 2 135 ? 8.339   83.526  46.580  1.00   189.40 ? 135 DG  J "O3'" 1 
ATOM   6161  C "C2'" . DG  B 2 135 ? 7.952   85.193  48.325  1.00   176.93 ? 135 DG  J "C2'" 1 
ATOM   6162  C "C1'" . DG  B 2 135 ? 8.251   84.282  49.508  1.00   169.92 ? 135 DG  J "C1'" 1 
ATOM   6163  N N9    . DG  B 2 135 ? 8.009   84.917  50.801  1.00   162.02 ? 135 DG  J N9    1 
ATOM   6164  C C8    . DG  B 2 135 ? 8.809   85.842  51.429  1.00   150.36 ? 135 DG  J C8    1 
ATOM   6165  N N7    . DG  B 2 135 ? 8.337   86.242  52.578  1.00   147.15 ? 135 DG  J N7    1 
ATOM   6166  C C5    . DG  B 2 135 ? 7.147   85.539  52.721  1.00   163.28 ? 135 DG  J C5    1 
ATOM   6167  C C6    . DG  B 2 135 ? 6.196   85.559  53.769  1.00   156.05 ? 135 DG  J C6    1 
ATOM   6168  O O6    . DG  B 2 135 ? 6.220   86.223  54.815  1.00   152.19 ? 135 DG  J O6    1 
ATOM   6169  N N1    . DG  B 2 135 ? 5.134   84.694  53.519  1.00   151.55 ? 135 DG  J N1    1 
ATOM   6170  C C2    . DG  B 2 135 ? 5.005   83.911  52.396  1.00   165.83 ? 135 DG  J C2    1 
ATOM   6171  N N2    . DG  B 2 135 ? 3.909   83.141  52.332  1.00   162.15 ? 135 DG  J N2    1 
ATOM   6172  N N3    . DG  B 2 135 ? 5.888   83.883  51.405  1.00   173.74 ? 135 DG  J N3    1 
ATOM   6173  C C4    . DG  B 2 135 ? 6.930   84.720  51.635  1.00   167.85 ? 135 DG  J C4    1 
ATOM   6174  P P     . DC  B 2 136 ? 6.960   83.665  45.767  1.00   209.34 ? 136 DC  J P     1 
ATOM   6175  O OP1   . DC  B 2 136 ? 6.958   82.626  44.713  1.00   190.84 ? 136 DC  J OP1   1 
ATOM   6176  O OP2   . DC  B 2 136 ? 6.786   85.087  45.391  1.00   193.58 ? 136 DC  J OP2   1 
ATOM   6177  O "O5'" . DC  B 2 136 ? 5.844   83.297  46.851  1.00   200.40 ? 136 DC  J "O5'" 1 
ATOM   6178  C "C5'" . DC  B 2 136 ? 4.605   82.746  46.437  1.00   201.29 ? 136 DC  J "C5'" 1 
ATOM   6179  C "C4'" . DC  B 2 136 ? 3.462   83.694  46.746  1.00   200.11 ? 136 DC  J "C4'" 1 
ATOM   6180  O "O4'" . DC  B 2 136 ? 3.577   84.159  48.102  1.00   187.01 ? 136 DC  J "O4'" 1 
ATOM   6181  C "C3'" . DC  B 2 136 ? 3.441   84.966  45.920  1.00   190.23 ? 136 DC  J "C3'" 1 
ATOM   6182  O "O3'" . DC  B 2 136 ? 2.771   84.741  44.656  1.00   196.36 ? 136 DC  J "O3'" 1 
ATOM   6183  C "C2'" . DC  B 2 136 ? 2.689   85.955  46.820  1.00   189.42 ? 136 DC  J "C2'" 1 
ATOM   6184  C "C1'" . DC  B 2 136 ? 2.854   85.366  48.229  1.00   184.93 ? 136 DC  J "C1'" 1 
ATOM   6185  N N1    . DC  B 2 136 ? 3.580   86.268  49.171  1.00   180.78 ? 136 DC  J N1    1 
ATOM   6186  C C2    . DC  B 2 136 ? 3.025   86.547  50.425  1.00   171.25 ? 136 DC  J C2    1 
ATOM   6187  O O2    . DC  B 2 136 ? 1.945   86.030  50.735  1.00   163.81 ? 136 DC  J O2    1 
ATOM   6188  N N3    . DC  B 2 136 ? 3.692   87.373  51.268  1.00   156.07 ? 136 DC  J N3    1 
ATOM   6189  C C4    . DC  B 2 136 ? 4.856   87.910  50.896  1.00   157.18 ? 136 DC  J C4    1 
ATOM   6190  N N4    . DC  B 2 136 ? 5.476   88.718  51.761  1.00   152.13 ? 136 DC  J N4    1 
ATOM   6191  C C5    . DC  B 2 136 ? 5.434   87.641  49.620  1.00   159.88 ? 136 DC  J C5    1 
ATOM   6192  C C6    . DC  B 2 136 ? 4.768   86.824  48.797  1.00   168.71 ? 136 DC  J C6    1 
ATOM   6193  P P     . DC  B 2 137 ? 1.163   84.718  44.529  1.00   192.24 ? 137 DC  J P     1 
ATOM   6194  O OP1   . DC  B 2 137 ? 0.578   83.994  45.680  1.00   159.89 ? 137 DC  J OP1   1 
ATOM   6195  O OP2   . DC  B 2 137 ? 0.866   84.232  43.164  1.00   197.65 ? 137 DC  J OP2   1 
ATOM   6196  O "O5'" . DC  B 2 137 ? 0.740   86.264  44.562  1.00   165.34 ? 137 DC  J "O5'" 1 
ATOM   6197  C "C5'" . DC  B 2 137 ? -0.624  86.642  44.382  1.00   168.09 ? 137 DC  J "C5'" 1 
ATOM   6198  C "C4'" . DC  B 2 137 ? -1.422  86.429  45.657  1.00   183.15 ? 137 DC  J "C4'" 1 
ATOM   6199  O "O4'" . DC  B 2 137 ? -0.517  86.350  46.783  1.00   174.86 ? 137 DC  J "O4'" 1 
ATOM   6200  C "C3'" . DC  B 2 137 ? -2.397  87.545  45.993  1.00   176.72 ? 137 DC  J "C3'" 1 
ATOM   6201  O "O3'" . DC  B 2 137 ? -3.659  87.272  45.399  1.00   180.70 ? 137 DC  J "O3'" 1 
ATOM   6202  C "C2'" . DC  B 2 137 ? -2.472  87.483  47.517  1.00   160.44 ? 137 DC  J "C2'" 1 
ATOM   6203  C "C1'" . DC  B 2 137 ? -1.067  87.018  47.903  1.00   166.35 ? 137 DC  J "C1'" 1 
ATOM   6204  N N1    . DC  B 2 137 ? -0.142  88.124  48.294  1.00   176.80 ? 137 DC  J N1    1 
ATOM   6205  C C2    . DC  B 2 137 ? -0.094  88.550  49.626  1.00   174.45 ? 137 DC  J C2    1 
ATOM   6206  O O2    . DC  B 2 137 ? -0.831  88.008  50.459  1.00   173.73 ? 137 DC  J O2    1 
ATOM   6207  N N3    . DC  B 2 137 ? 0.757   89.550  49.964  1.00   161.86 ? 137 DC  J N3    1 
ATOM   6208  C C4    . DC  B 2 137 ? 1.535   90.108  49.035  1.00   159.88 ? 137 DC  J C4    1 
ATOM   6209  N N4    . DC  B 2 137 ? 2.359   91.087  49.416  1.00   139.19 ? 137 DC  J N4    1 
ATOM   6210  C C5    . DC  B 2 137 ? 1.504   89.685  47.674  1.00   169.96 ? 137 DC  J C5    1 
ATOM   6211  C C6    . DC  B 2 137 ? 0.660   88.700  47.352  1.00   171.88 ? 137 DC  J C6    1 
ATOM   6212  P P     . DT  B 2 138 ? -4.741  88.445  45.226  1.00   189.00 ? 138 DT  J P     1 
ATOM   6213  O OP1   . DT  B 2 138 ? -5.777  87.969  44.283  1.00   180.55 ? 138 DT  J OP1   1 
ATOM   6214  O OP2   . DT  B 2 138 ? -4.005  89.697  44.944  1.00   191.85 ? 138 DT  J OP2   1 
ATOM   6215  O "O5'" . DT  B 2 138 ? -5.393  88.581  46.679  1.00   168.44 ? 138 DT  J "O5'" 1 
ATOM   6216  C "C5'" . DT  B 2 138 ? -6.303  89.632  46.946  1.00   174.19 ? 138 DT  J "C5'" 1 
ATOM   6217  C "C4'" . DT  B 2 138 ? -6.097  90.177  48.345  1.00   171.43 ? 138 DT  J "C4'" 1 
ATOM   6218  O "O4'" . DT  B 2 138 ? -4.677  90.336  48.602  1.00   172.68 ? 138 DT  J "O4'" 1 
ATOM   6219  C "C3'" . DT  B 2 138 ? -6.734  91.540  48.600  1.00   162.62 ? 138 DT  J "C3'" 1 
ATOM   6220  O "O3'" . DT  B 2 138 ? -7.332  91.560  49.884  1.00   171.51 ? 138 DT  J "O3'" 1 
ATOM   6221  C "C2'" . DT  B 2 138 ? -5.553  92.505  48.510  1.00   150.46 ? 138 DT  J "C2'" 1 
ATOM   6222  C "C1'" . DT  B 2 138 ? -4.414  91.649  49.041  1.00   165.28 ? 138 DT  J "C1'" 1 
ATOM   6223  N N1    . DT  B 2 138 ? -3.074  92.055  48.526  1.00   164.96 ? 138 DT  J N1    1 
ATOM   6224  C C2    . DT  B 2 138 ? -2.278  92.878  49.290  1.00   149.76 ? 138 DT  J C2    1 
ATOM   6225  O O2    . DT  B 2 138 ? -2.609  93.305  50.381  1.00   129.63 ? 138 DT  J O2    1 
ATOM   6226  N N3    . DT  B 2 138 ? -1.069  93.187  48.725  1.00   147.66 ? 138 DT  J N3    1 
ATOM   6227  C C4    . DT  B 2 138 ? -0.586  92.763  47.500  1.00   152.97 ? 138 DT  J C4    1 
ATOM   6228  O O4    . DT  B 2 138 ? 0.518   93.095  47.079  1.00   139.31 ? 138 DT  J O4    1 
ATOM   6229  C C5    . DT  B 2 138 ? -1.471  91.902  46.752  1.00   161.57 ? 138 DT  J C5    1 
ATOM   6230  C C7    . DT  B 2 138 ? -1.056  91.379  45.408  1.00   165.76 ? 138 DT  J C7    1 
ATOM   6231  C C6    . DT  B 2 138 ? -2.657  91.593  47.295  1.00   163.48 ? 138 DT  J C6    1 
ATOM   6232  P P     . DC  B 2 139 ? -8.773  92.238  50.088  1.00   192.89 ? 139 DC  J P     1 
ATOM   6233  O OP1   . DC  B 2 139 ? -9.485  91.482  51.142  1.00   170.53 ? 139 DC  J OP1   1 
ATOM   6234  O OP2   . DC  B 2 139 ? -9.386  92.394  48.749  1.00   162.80 ? 139 DC  J OP2   1 
ATOM   6235  O "O5'" . DC  B 2 139 ? -8.428  93.698  50.636  1.00   185.92 ? 139 DC  J "O5'" 1 
ATOM   6236  C "C5'" . DC  B 2 139 ? -7.615  93.847  51.792  1.00   168.99 ? 139 DC  J "C5'" 1 
ATOM   6237  C "C4'" . DC  B 2 139 ? -7.075  95.262  51.891  1.00   142.34 ? 139 DC  J "C4'" 1 
ATOM   6238  O "O4'" . DC  B 2 139 ? -5.844  95.370  51.129  1.00   151.46 ? 139 DC  J "O4'" 1 
ATOM   6239  C "C3'" . DC  B 2 139 ? -8.009  96.346  51.349  1.00   133.32 ? 139 DC  J "C3'" 1 
ATOM   6240  O "O3'" . DC  B 2 139 ? -7.988  97.471  52.210  1.00   145.33 ? 139 DC  J "O3'" 1 
ATOM   6241  C "C2'" . DC  B 2 139 ? -7.399  96.677  49.989  1.00   130.17 ? 139 DC  J "C2'" 1 
ATOM   6242  C "C1'" . DC  B 2 139 ? -5.920  96.493  50.281  1.00   148.46 ? 139 DC  J "C1'" 1 
ATOM   6243  N N1    . DC  B 2 139 ? -5.094  96.230  49.069  1.00   154.93 ? 139 DC  J N1    1 
ATOM   6244  C C2    . DC  B 2 139 ? -3.700  96.162  49.182  1.00   147.09 ? 139 DC  J C2    1 
ATOM   6245  O O2    . DC  B 2 139 ? -3.176  96.321  50.291  1.00   134.16 ? 139 DC  J O2    1 
ATOM   6246  N N3    . DC  B 2 139 ? -2.963  95.924  48.069  1.00   145.23 ? 139 DC  J N3    1 
ATOM   6247  C C4    . DC  B 2 139 ? -3.566  95.759  46.891  1.00   151.99 ? 139 DC  J C4    1 
ATOM   6248  N N4    . DC  B 2 139 ? -2.797  95.526  45.822  1.00   153.04 ? 139 DC  J N4    1 
ATOM   6249  C C5    . DC  B 2 139 ? -4.984  95.825  46.756  1.00   160.48 ? 139 DC  J C5    1 
ATOM   6250  C C6    . DC  B 2 139 ? -5.701  96.061  47.859  1.00   154.23 ? 139 DC  J C6    1 
ATOM   6251  P P     . DG  B 2 140 ? -9.109  97.646  53.348  1.00   150.57 ? 140 DG  J P     1 
ATOM   6252  O OP1   . DG  B 2 140 ? -9.211  96.369  54.088  1.00   107.50 ? 140 DG  J OP1   1 
ATOM   6253  O OP2   . DG  B 2 140 ? -10.312 98.221  52.707  1.00   131.33 ? 140 DG  J OP2   1 
ATOM   6254  O "O5'" . DG  B 2 140 ? -8.488  98.759  54.316  1.00   171.50 ? 140 DG  J "O5'" 1 
ATOM   6255  C "C5'" . DG  B 2 140 ? -7.227  98.534  54.944  1.00   158.48 ? 140 DG  J "C5'" 1 
ATOM   6256  C "C4'" . DG  B 2 140 ? -6.262  99.675  54.660  1.00   141.27 ? 140 DG  J "C4'" 1 
ATOM   6257  O "O4'" . DG  B 2 140 ? -5.702  99.526  53.328  1.00   123.14 ? 140 DG  J "O4'" 1 
ATOM   6258  C "C3'" . DG  B 2 140 ? -6.876  101.075 54.711  1.00   143.62 ? 140 DG  J "C3'" 1 
ATOM   6259  O "O3'" . DG  B 2 140 ? -5.981  101.972 55.351  1.00   141.54 ? 140 DG  J "O3'" 1 
ATOM   6260  C "C2'" . DG  B 2 140 ? -7.055  101.426 53.235  1.00   130.26 ? 140 DG  J "C2'" 1 
ATOM   6261  C "C1'" . DG  B 2 140 ? -5.851  100.735 52.617  1.00   129.79 ? 140 DG  J "C1'" 1 
ATOM   6262  N N9    . DG  B 2 140 ? -6.022  100.420 51.203  1.00   133.85 ? 140 DG  J N9    1 
ATOM   6263  C C8    . DG  B 2 140 ? -7.201  100.143 50.554  1.00   146.38 ? 140 DG  J C8    1 
ATOM   6264  N N7    . DG  B 2 140 ? -7.049  99.894  49.284  1.00   149.65 ? 140 DG  J N7    1 
ATOM   6265  C C5    . DG  B 2 140 ? -5.681  100.011 49.075  1.00   148.95 ? 140 DG  J C5    1 
ATOM   6266  C C6    . DG  B 2 140 ? -4.924  99.850  47.891  1.00   149.60 ? 140 DG  J C6    1 
ATOM   6267  O O6    . DG  B 2 140 ? -5.326  99.563  46.755  1.00   148.97 ? 140 DG  J O6    1 
ATOM   6268  N N1    . DG  B 2 140 ? -3.565  100.058 48.116  1.00   147.71 ? 140 DG  J N1    1 
ATOM   6269  C C2    . DG  B 2 140 ? -3.010  100.379 49.332  1.00   150.22 ? 140 DG  J C2    1 
ATOM   6270  N N2    . DG  B 2 140 ? -1.679  100.541 49.352  1.00   158.48 ? 140 DG  J N2    1 
ATOM   6271  N N3    . DG  B 2 140 ? -3.709  100.533 50.450  1.00   134.02 ? 140 DG  J N3    1 
ATOM   6272  C C4    . DG  B 2 140 ? -5.034  100.334 50.247  1.00   136.46 ? 140 DG  J C4    1 
ATOM   6273  P P     . DG  B 2 141 ? -6.504  102.946 56.517  1.00   120.21 ? 141 DG  J P     1 
ATOM   6274  O OP1   . DG  B 2 141 ? -6.854  102.105 57.683  1.00   125.70 ? 141 DG  J OP1   1 
ATOM   6275  O OP2   . DG  B 2 141 ? -7.518  103.848 55.928  1.00   97.99  ? 141 DG  J OP2   1 
ATOM   6276  O "O5'" . DG  B 2 141 ? -5.218  103.825 56.882  1.00   153.72 ? 141 DG  J "O5'" 1 
ATOM   6277  C "C5'" . DG  B 2 141 ? -3.989  103.186 57.221  1.00   154.42 ? 141 DG  J "C5'" 1 
ATOM   6278  C "C4'" . DG  B 2 141 ? -2.847  103.712 56.367  1.00   138.54 ? 141 DG  J "C4'" 1 
ATOM   6279  O "O4'" . DG  B 2 141 ? -3.085  103.374 54.973  1.00   138.42 ? 141 DG  J "O4'" 1 
ATOM   6280  C "C3'" . DG  B 2 141 ? -2.654  105.230 56.402  1.00   145.22 ? 141 DG  J "C3'" 1 
ATOM   6281  O "O3'" . DG  B 2 141 ? -1.267  105.545 56.360  1.00   128.69 ? 141 DG  J "O3'" 1 
ATOM   6282  C "C2'" . DG  B 2 141 ? -3.364  105.686 55.134  1.00   146.84 ? 141 DG  J "C2'" 1 
ATOM   6283  C "C1'" . DG  B 2 141 ? -3.031  104.546 54.189  1.00   136.87 ? 141 DG  J "C1'" 1 
ATOM   6284  N N9    . DG  B 2 141 ? -3.973  104.416 53.083  1.00   142.76 ? 141 DG  J N9    1 
ATOM   6285  C C8    . DG  B 2 141 ? -5.344  104.469 53.152  1.00   135.94 ? 141 DG  J C8    1 
ATOM   6286  N N7    . DG  B 2 141 ? -5.928  104.325 51.995  1.00   136.07 ? 141 DG  J N7    1 
ATOM   6287  C C5    . DG  B 2 141 ? -4.875  104.168 51.101  1.00   143.35 ? 141 DG  J C5    1 
ATOM   6288  C C6    . DG  B 2 141 ? -4.891  103.973 49.700  1.00   140.72 ? 141 DG  J C6    1 
ATOM   6289  O O6    . DG  B 2 141 ? -5.871  103.897 48.947  1.00   145.05 ? 141 DG  J O6    1 
ATOM   6290  N N1    . DG  B 2 141 ? -3.603  103.862 49.181  1.00   152.99 ? 141 DG  J N1    1 
ATOM   6291  C C2    . DG  B 2 141 ? -2.447  103.930 49.923  1.00   152.61 ? 141 DG  J C2    1 
ATOM   6292  N N2    . DG  B 2 141 ? -1.296  103.803 49.245  1.00   141.18 ? 141 DG  J N2    1 
ATOM   6293  N N3    . DG  B 2 141 ? -2.419  104.114 51.236  1.00   144.86 ? 141 DG  J N3    1 
ATOM   6294  C C4    . DG  B 2 141 ? -3.666  104.224 51.756  1.00   144.90 ? 141 DG  J C4    1 
ATOM   6295  P P     . DC  B 2 142 ? -0.761  107.034 56.698  1.00   109.06 ? 142 DC  J P     1 
ATOM   6296  O OP1   . DC  B 2 142 ? 0.205   106.932 57.812  1.00   79.24  ? 142 DC  J OP1   1 
ATOM   6297  O OP2   . DC  B 2 142 ? -1.944  107.910 56.842  1.00   124.30 ? 142 DC  J OP2   1 
ATOM   6298  O "O5'" . DC  B 2 142 ? 0.028   107.482 55.381  1.00   112.95 ? 142 DC  J "O5'" 1 
ATOM   6299  C "C5'" . DC  B 2 142 ? 0.692   106.510 54.583  1.00   118.58 ? 142 DC  J "C5'" 1 
ATOM   6300  C "C4'" . DC  B 2 142 ? 0.495   106.785 53.101  1.00   118.27 ? 142 DC  J "C4'" 1 
ATOM   6301  O "O4'" . DC  B 2 142 ? -0.873  106.535 52.713  1.00   136.36 ? 142 DC  J "O4'" 1 
ATOM   6302  C "C3'" . DC  B 2 142 ? 0.788   108.227 52.661  1.00   116.63 ? 142 DC  J "C3'" 1 
ATOM   6303  O "O3'" . DC  B 2 142 ? 1.944   108.255 51.839  1.00   121.00 ? 142 DC  J "O3'" 1 
ATOM   6304  C "C2'" . DC  B 2 142 ? -0.470  108.648 51.880  1.00   135.70 ? 142 DC  J "C2'" 1 
ATOM   6305  C "C1'" . DC  B 2 142 ? -1.118  107.309 51.572  1.00   146.33 ? 142 DC  J "C1'" 1 
ATOM   6306  N N1    . DC  B 2 142 ? -2.591  107.390 51.334  1.00   153.93 ? 142 DC  J N1    1 
ATOM   6307  C C2    . DC  B 2 142 ? -3.095  107.141 50.052  1.00   149.76 ? 142 DC  J C2    1 
ATOM   6308  O O2    . DC  B 2 142 ? -2.310  106.850 49.140  1.00   144.67 ? 142 DC  J O2    1 
ATOM   6309  N N3    . DC  B 2 142 ? -4.434  107.220 49.846  1.00   151.06 ? 142 DC  J N3    1 
ATOM   6310  C C4    . DC  B 2 142 ? -5.247  107.537 50.854  1.00   155.23 ? 142 DC  J C4    1 
ATOM   6311  N N4    . DC  B 2 142 ? -6.559  107.605 50.602  1.00   135.30 ? 142 DC  J N4    1 
ATOM   6312  C C5    . DC  B 2 142 ? -4.751  107.799 52.166  1.00   159.28 ? 142 DC  J C5    1 
ATOM   6313  C C6    . DC  B 2 142 ? -3.429  107.719 52.357  1.00   151.93 ? 142 DC  J C6    1 
ATOM   6314  P P     . DA  B 2 143 ? 2.778   109.617 51.662  1.00   141.03 ? 143 DA  J P     1 
ATOM   6315  O OP1   . DA  B 2 143 ? 4.150   109.369 52.160  1.00   121.67 ? 143 DA  J OP1   1 
ATOM   6316  O OP2   . DA  B 2 143 ? 1.976   110.721 52.237  1.00   126.78 ? 143 DA  J OP2   1 
ATOM   6317  O "O5'" . DA  B 2 143 ? 2.835   109.822 50.078  1.00   158.27 ? 143 DA  J "O5'" 1 
ATOM   6318  C "C5'" . DA  B 2 143 ? 3.377   108.800 49.251  1.00   145.18 ? 143 DA  J "C5'" 1 
ATOM   6319  C "C4'" . DA  B 2 143 ? 2.756   108.833 47.866  1.00   160.54 ? 143 DA  J "C4'" 1 
ATOM   6320  O "O4'" . DA  B 2 143 ? 1.317   108.666 47.974  1.00   159.56 ? 143 DA  J "O4'" 1 
ATOM   6321  C "C3'" . DA  B 2 143 ? 2.977   110.130 47.086  1.00   169.60 ? 143 DA  J "C3'" 1 
ATOM   6322  O "O3'" . DA  B 2 143 ? 3.247   109.833 45.722  1.00   164.47 ? 143 DA  J "O3'" 1 
ATOM   6323  C "C2'" . DA  B 2 143 ? 1.649   110.866 47.249  1.00   161.65 ? 143 DA  J "C2'" 1 
ATOM   6324  C "C1'" . DA  B 2 143 ? 0.662   109.711 47.288  1.00   153.15 ? 143 DA  J "C1'" 1 
ATOM   6325  N N9    . DA  B 2 143 ? -0.574  110.026 47.999  1.00   150.39 ? 143 DA  J N9    1 
ATOM   6326  C C8    . DA  B 2 143 ? -0.695  110.709 49.178  1.00   146.94 ? 143 DA  J C8    1 
ATOM   6327  N N7    . DA  B 2 143 ? -1.934  110.844 49.587  1.00   135.78 ? 143 DA  J N7    1 
ATOM   6328  C C5    . DA  B 2 143 ? -2.678  110.205 48.609  1.00   136.86 ? 143 DA  J C5    1 
ATOM   6329  C C6    . DA  B 2 143 ? -4.062  109.999 48.453  1.00   145.99 ? 143 DA  J C6    1 
ATOM   6330  N N6    . DA  B 2 143 ? -4.974  110.435 49.328  1.00   160.46 ? 143 DA  J N6    1 
ATOM   6331  N N1    . DA  B 2 143 ? -4.474  109.322 47.361  1.00   147.38 ? 143 DA  J N1    1 
ATOM   6332  C C2    . DA  B 2 143 ? -3.558  108.886 46.488  1.00   137.23 ? 143 DA  J C2    1 
ATOM   6333  N N3    . DA  B 2 143 ? -2.234  109.020 46.527  1.00   120.54 ? 143 DA  J N3    1 
ATOM   6334  C C4    . DA  B 2 143 ? -1.855  109.696 47.622  1.00   139.75 ? 143 DA  J C4    1 
ATOM   6335  P P     . DC  B 2 144 ? 3.701   110.998 44.713  1.00   175.22 ? 144 DC  J P     1 
ATOM   6336  O OP1   . DC  B 2 144 ? 4.720   110.424 43.807  1.00   161.48 ? 144 DC  J OP1   1 
ATOM   6337  O OP2   . DC  B 2 144 ? 4.025   112.200 45.516  1.00   134.67 ? 144 DC  J OP2   1 
ATOM   6338  O "O5'" . DC  B 2 144 ? 2.377   111.311 43.870  1.00   184.56 ? 144 DC  J "O5'" 1 
ATOM   6339  C "C5'" . DC  B 2 144 ? 1.791   110.292 43.064  1.00   172.16 ? 144 DC  J "C5'" 1 
ATOM   6340  C "C4'" . DC  B 2 144 ? 0.458   110.747 42.497  1.00   158.18 ? 144 DC  J "C4'" 1 
ATOM   6341  O "O4'" . DC  B 2 144 ? -0.528  110.820 43.556  1.00   136.32 ? 144 DC  J "O4'" 1 
ATOM   6342  C "C3'" . DC  B 2 144 ? 0.479   112.127 41.828  1.00   181.07 ? 144 DC  J "C3'" 1 
ATOM   6343  O "O3'" . DC  B 2 144 ? -0.089  112.045 40.525  1.00   194.34 ? 144 DC  J "O3'" 1 
ATOM   6344  C "C2'" . DC  B 2 144 ? -0.363  113.006 42.758  1.00   169.70 ? 144 DC  J "C2'" 1 
ATOM   6345  C "C1'" . DC  B 2 144 ? -1.292  111.989 43.397  1.00   157.23 ? 144 DC  J "C1'" 1 
ATOM   6346  N N1    . DC  B 2 144 ? -1.813  112.404 44.729  1.00   155.14 ? 144 DC  J N1    1 
ATOM   6347  C C2    . DC  B 2 144 ? -3.131  112.095 45.083  1.00   154.21 ? 144 DC  J C2    1 
ATOM   6348  O O2    . DC  B 2 144 ? -3.845  111.487 44.276  1.00   149.38 ? 144 DC  J O2    1 
ATOM   6349  N N3    . DC  B 2 144 ? -3.592  112.479 46.299  1.00   155.42 ? 144 DC  J N3    1 
ATOM   6350  C C4    . DC  B 2 144 ? -2.790  113.135 47.140  1.00   149.65 ? 144 DC  J C4    1 
ATOM   6351  N N4    . DC  B 2 144 ? -3.289  113.491 48.328  1.00   136.88 ? 144 DC  J N4    1 
ATOM   6352  C C5    . DC  B 2 144 ? -1.443  113.456 46.799  1.00   147.62 ? 144 DC  J C5    1 
ATOM   6353  C C6    . DC  B 2 144 ? -1.000  113.074 45.596  1.00   149.11 ? 144 DC  J C6    1 
ATOM   6354  P P     . DC  B 2 145 ? 0.124   113.242 39.473  1.00   196.26 ? 145 DC  J P     1 
ATOM   6355  O OP1   . DC  B 2 145 ? 0.130   112.644 38.119  1.00   160.16 ? 145 DC  J OP1   1 
ATOM   6356  O OP2   . DC  B 2 145 ? 1.282   114.041 39.930  1.00   192.40 ? 145 DC  J OP2   1 
ATOM   6357  O "O5'" . DC  B 2 145 ? -1.193  114.139 39.633  1.00   181.19 ? 145 DC  J "O5'" 1 
ATOM   6358  C "C5'" . DC  B 2 145 ? -2.427  113.686 39.088  1.00   179.53 ? 145 DC  J "C5'" 1 
ATOM   6359  C "C4'" . DC  B 2 145 ? -3.571  114.613 39.468  1.00   176.78 ? 145 DC  J "C4'" 1 
ATOM   6360  O "O4'" . DC  B 2 145 ? -3.793  114.561 40.901  1.00   177.50 ? 145 DC  J "O4'" 1 
ATOM   6361  C "C3'" . DC  B 2 145 ? -3.364  116.096 39.121  1.00   181.32 ? 145 DC  J "C3'" 1 
ATOM   6362  O "O3'" . DC  B 2 145 ? -4.487  116.580 38.385  1.00   192.10 ? 145 DC  J "O3'" 1 
ATOM   6363  C "C2'" . DC  B 2 145 ? -3.256  116.774 40.490  1.00   167.12 ? 145 DC  J "C2'" 1 
ATOM   6364  C "C1'" . DC  B 2 145 ? -4.104  115.854 41.346  1.00   181.31 ? 145 DC  J "C1'" 1 
ATOM   6365  N N1    . DC  B 2 145 ? -3.811  115.951 42.803  1.00   182.08 ? 145 DC  J N1    1 
ATOM   6366  C C2    . DC  B 2 145 ? -4.848  115.790 43.728  1.00   174.20 ? 145 DC  J C2    1 
ATOM   6367  O O2    . DC  B 2 145 ? -5.992  115.560 43.317  1.00   164.67 ? 145 DC  J O2    1 
ATOM   6368  N N3    . DC  B 2 145 ? -4.569  115.887 45.051  1.00   156.28 ? 145 DC  J N3    1 
ATOM   6369  C C4    . DC  B 2 145 ? -3.323  116.136 45.454  1.00   164.14 ? 145 DC  J C4    1 
ATOM   6370  N N4    . DC  B 2 145 ? -3.097  116.223 46.769  1.00   155.45 ? 145 DC  J N4    1 
ATOM   6371  C C5    . DC  B 2 145 ? -2.252  116.307 44.526  1.00   161.57 ? 145 DC  J C5    1 
ATOM   6372  C C6    . DC  B 2 145 ? -2.539  116.209 43.224  1.00   161.25 ? 145 DC  J C6    1 
ATOM   6373  P P     . DG  B 2 146 ? -4.414  117.984 37.601  1.00   194.85 ? 146 DG  J P     1 
ATOM   6374  O OP1   . DG  B 2 146 ? -4.533  117.682 36.158  1.00   187.83 ? 146 DG  J OP1   1 
ATOM   6375  O OP2   . DG  B 2 146 ? -3.244  118.747 38.089  1.00   165.64 ? 146 DG  J OP2   1 
ATOM   6376  O "O5'" . DG  B 2 146 ? -5.739  118.751 38.071  1.00   162.45 ? 146 DG  J "O5'" 1 
ATOM   6377  C "C5'" . DG  B 2 146 ? -7.005  118.365 37.547  1.00   156.38 ? 146 DG  J "C5'" 1 
ATOM   6378  C "C4'" . DG  B 2 146 ? -8.104  118.543 38.580  1.00   157.72 ? 146 DG  J "C4'" 1 
ATOM   6379  O "O4'" . DG  B 2 146 ? -7.772  117.798 39.773  1.00   161.29 ? 146 DG  J "O4'" 1 
ATOM   6380  C "C3'" . DG  B 2 146 ? -8.317  119.967 39.061  1.00   167.20 ? 146 DG  J "C3'" 1 
ATOM   6381  O "O3'" . DG  B 2 146 ? -9.192  120.654 38.172  1.00   179.41 ? 146 DG  J "O3'" 1 
ATOM   6382  C "C2'" . DG  B 2 146 ? -8.968  119.748 40.424  1.00   162.61 ? 146 DG  J "C2'" 1 
ATOM   6383  C "C1'" . DG  B 2 146 ? -8.287  118.466 40.913  1.00   166.49 ? 146 DG  J "C1'" 1 
ATOM   6384  N N9    . DG  B 2 146 ? -7.191  118.707 41.847  1.00   183.66 ? 146 DG  J N9    1 
ATOM   6385  C C8    . DG  B 2 146 ? -5.879  118.971 41.535  1.00   179.11 ? 146 DG  J C8    1 
ATOM   6386  N N7    . DG  B 2 146 ? -5.120  119.144 42.582  1.00   172.38 ? 146 DG  J N7    1 
ATOM   6387  C C5    . DG  B 2 146 ? -5.984  118.984 43.658  1.00   179.35 ? 146 DG  J C5    1 
ATOM   6388  C C6    . DG  B 2 146 ? -5.732  119.057 45.049  1.00   173.03 ? 146 DG  J C6    1 
ATOM   6389  O O6    . DG  B 2 146 ? -4.659  119.288 45.623  1.00   175.52 ? 146 DG  J O6    1 
ATOM   6390  N N1    . DG  B 2 146 ? -6.886  118.833 45.795  1.00   172.34 ? 146 DG  J N1    1 
ATOM   6391  C C2    . DG  B 2 146 ? -8.127  118.570 45.264  1.00   179.86 ? 146 DG  J C2    1 
ATOM   6392  N N2    . DG  B 2 146 ? -9.121  118.380 46.144  1.00   174.51 ? 146 DG  J N2    1 
ATOM   6393  N N3    . DG  B 2 146 ? -8.377  118.497 43.963  1.00   184.14 ? 146 DG  J N3    1 
ATOM   6394  C C4    . DG  B 2 146 ? -7.262  118.714 43.222  1.00   183.93 ? 146 DG  J C4    1 
ATOM   6395  P P     . DG  B 2 147 ? -9.243  122.260 38.162  1.00   160.99 ? 147 DG  J P     1 
ATOM   6396  O OP1   . DG  B 2 147 ? -9.921  122.680 36.915  1.00   165.85 ? 147 DG  J OP1   1 
ATOM   6397  O OP2   . DG  B 2 147 ? -7.883  122.757 38.464  1.00   166.21 ? 147 DG  J OP2   1 
ATOM   6398  O "O5'" . DG  B 2 147 ? -10.182 122.626 39.404  1.00   150.30 ? 147 DG  J "O5'" 1 
ATOM   6399  C "C5'" . DG  B 2 147 ? -11.516 122.132 39.459  1.00   160.85 ? 147 DG  J "C5'" 1 
ATOM   6400  C "C4'" . DG  B 2 147 ? -12.131 122.396 40.822  1.00   170.45 ? 147 DG  J "C4'" 1 
ATOM   6401  O "O4'" . DG  B 2 147 ? -11.251 121.880 41.857  1.00   169.05 ? 147 DG  J "O4'" 1 
ATOM   6402  C "C3'" . DG  B 2 147 ? -12.354 123.871 41.153  1.00   180.46 ? 147 DG  J "C3'" 1 
ATOM   6403  O "O3'" . DG  B 2 147 ? -13.566 124.033 41.883  1.00   176.26 ? 147 DG  J "O3'" 1 
ATOM   6404  C "C2'" . DG  B 2 147 ? -11.136 124.220 42.002  1.00   195.09 ? 147 DG  J "C2'" 1 
ATOM   6405  C "C1'" . DG  B 2 147 ? -10.891 122.916 42.746  1.00   183.03 ? 147 DG  J "C1'" 1 
ATOM   6406  N N9    . DG  B 2 147 ? -9.496  122.730 43.137  1.00   187.40 ? 147 DG  J N9    1 
ATOM   6407  C C8    . DG  B 2 147 ? -8.395  122.763 42.314  1.00   183.11 ? 147 DG  J C8    1 
ATOM   6408  N N7    . DG  B 2 147 ? -7.270  122.568 42.944  1.00   174.45 ? 147 DG  J N7    1 
ATOM   6409  C C5    . DG  B 2 147 ? -7.647  122.397 44.269  1.00   175.70 ? 147 DG  J C5    1 
ATOM   6410  C C6    . DG  B 2 147 ? -6.857  122.151 45.417  1.00   171.84 ? 147 DG  J C6    1 
ATOM   6411  O O6    . DG  B 2 147 ? -5.626  122.034 45.491  1.00   171.53 ? 147 DG  J O6    1 
ATOM   6412  N N1    . DG  B 2 147 ? -7.637  122.042 46.566  1.00   171.48 ? 147 DG  J N1    1 
ATOM   6413  C C2    . DG  B 2 147 ? -9.007  122.156 46.600  1.00   169.56 ? 147 DG  J C2    1 
ATOM   6414  N N2    . DG  B 2 147 ? -9.585  122.022 47.802  1.00   153.64 ? 147 DG  J N2    1 
ATOM   6415  N N3    . DG  B 2 147 ? -9.759  122.386 45.531  1.00   178.20 ? 147 DG  J N3    1 
ATOM   6416  C C4    . DG  B 2 147 ? -9.014  122.495 44.405  1.00   181.03 ? 147 DG  J C4    1 
ATOM   6417  P P     . DG  B 2 148 ? -14.343 125.441 41.857  1.00   197.84 ? 148 DG  J P     1 
ATOM   6418  O OP1   . DG  B 2 148 ? -15.541 125.309 42.715  1.00   176.56 ? 148 DG  J OP1   1 
ATOM   6419  O OP2   . DG  B 2 148 ? -14.500 125.837 40.440  1.00   177.34 ? 148 DG  J OP2   1 
ATOM   6420  O "O5'" . DG  B 2 148 ? -13.308 126.461 42.532  1.00   193.48 ? 148 DG  J "O5'" 1 
ATOM   6421  C "C5'" . DG  B 2 148 ? -13.776 127.509 43.374  1.00   177.29 ? 148 DG  J "C5'" 1 
ATOM   6422  C "C4'" . DG  B 2 148 ? -13.869 127.040 44.815  1.00   187.55 ? 148 DG  J "C4'" 1 
ATOM   6423  O "O4'" . DG  B 2 148 ? -12.746 126.167 45.117  1.00   191.33 ? 148 DG  J "O4'" 1 
ATOM   6424  C "C3'" . DG  B 2 148 ? -13.830 128.153 45.861  1.00   185.32 ? 148 DG  J "C3'" 1 
ATOM   6425  O "O3'" . DG  B 2 148 ? -14.707 127.841 46.935  1.00   194.03 ? 148 DG  J "O3'" 1 
ATOM   6426  C "C2'" . DG  B 2 148 ? -12.373 128.142 46.309  1.00   182.25 ? 148 DG  J "C2'" 1 
ATOM   6427  C "C1'" . DG  B 2 148 ? -12.057 126.658 46.247  1.00   175.62 ? 148 DG  J "C1'" 1 
ATOM   6428  N N9    . DG  B 2 148 ? -10.635 126.366 46.089  1.00   176.82 ? 148 DG  J N9    1 
ATOM   6429  C C8    . DG  B 2 148 ? -9.900  126.428 44.929  1.00   192.75 ? 148 DG  J C8    1 
ATOM   6430  N N7    . DG  B 2 148 ? -8.645  126.108 45.090  1.00   184.84 ? 148 DG  J N7    1 
ATOM   6431  C C5    . DG  B 2 148 ? -8.541  125.812 46.443  1.00   183.52 ? 148 DG  J C5    1 
ATOM   6432  C C6    . DG  B 2 148 ? -7.419  125.402 47.203  1.00   178.85 ? 148 DG  J C6    1 
ATOM   6433  O O6    . DG  B 2 148 ? -6.257  125.212 46.816  1.00   170.84 ? 148 DG  J O6    1 
ATOM   6434  N N1    . DG  B 2 148 ? -7.747  125.208 48.543  1.00   178.42 ? 148 DG  J N1    1 
ATOM   6435  C C2    . DG  B 2 148 ? -9.000  125.389 49.080  1.00   184.75 ? 148 DG  J C2    1 
ATOM   6436  N N2    . DG  B 2 148 ? -9.122  125.152 50.395  1.00   167.48 ? 148 DG  J N2    1 
ATOM   6437  N N3    . DG  B 2 148 ? -10.060 125.773 48.379  1.00   183.90 ? 148 DG  J N3    1 
ATOM   6438  C C4    . DG  B 2 148 ? -9.757  125.965 47.072  1.00   181.26 ? 148 DG  J C4    1 
ATOM   6439  P P     . DA  B 2 149 ? -15.235 129.003 47.912  1.00   186.78 ? 149 DA  J P     1 
ATOM   6440  O OP1   . DA  B 2 149 ? -16.452 128.501 48.587  1.00   173.36 ? 149 DA  J OP1   1 
ATOM   6441  O OP2   . DA  B 2 149 ? -15.290 130.257 47.130  1.00   200.50 ? 149 DA  J OP2   1 
ATOM   6442  O "O5'" . DA  B 2 149 ? -14.070 129.152 48.999  1.00   186.70 ? 149 DA  J "O5'" 1 
ATOM   6443  C "C5'" . DA  B 2 149 ? -13.848 128.115 49.947  1.00   189.46 ? 149 DA  J "C5'" 1 
ATOM   6444  C "C4'" . DA  B 2 149 ? -12.699 128.463 50.877  1.00   188.27 ? 149 DA  J "C4'" 1 
ATOM   6445  O "O4'" . DA  B 2 149 ? -11.434 128.213 50.208  1.00   181.36 ? 149 DA  J "O4'" 1 
ATOM   6446  C "C3'" . DA  B 2 149 ? -12.657 129.922 51.342  1.00   194.50 ? 149 DA  J "C3'" 1 
ATOM   6447  O "O3'" . DA  B 2 149 ? -12.369 129.976 52.733  1.00   203.00 ? 149 DA  J "O3'" 1 
ATOM   6448  C "C2'" . DA  B 2 149 ? -11.524 130.522 50.510  1.00   181.44 ? 149 DA  J "C2'" 1 
ATOM   6449  C "C1'" . DA  B 2 149 ? -10.593 129.331 50.364  1.00   177.77 ? 149 DA  J "C1'" 1 
ATOM   6450  N N9    . DA  B 2 149 ? -9.715  129.416 49.200  1.00   177.62 ? 149 DA  J N9    1 
ATOM   6451  C C8    . DA  B 2 149 ? -10.042 129.872 47.954  1.00   171.66 ? 149 DA  J C8    1 
ATOM   6452  N N7    . DA  B 2 149 ? -9.048  129.831 47.098  1.00   178.03 ? 149 DA  J N7    1 
ATOM   6453  C C5    . DA  B 2 149 ? -7.996  129.315 47.835  1.00   180.65 ? 149 DA  J C5    1 
ATOM   6454  C C6    . DA  B 2 149 ? -6.657  129.026 47.504  1.00   165.82 ? 149 DA  J C6    1 
ATOM   6455  N N6    . DA  B 2 149 ? -6.139  129.228 46.288  1.00   154.73 ? 149 DA  J N6    1 
ATOM   6456  N N1    . DA  B 2 149 ? -5.869  128.518 48.475  1.00   158.05 ? 149 DA  J N1    1 
ATOM   6457  C C2    . DA  B 2 149 ? -6.392  128.318 49.690  1.00   160.75 ? 149 DA  J C2    1 
ATOM   6458  N N3    . DA  B 2 149 ? -7.631  128.550 50.119  1.00   176.10 ? 149 DA  J N3    1 
ATOM   6459  C C4    . DA  B 2 149 ? -8.390  129.053 49.133  1.00   183.81 ? 149 DA  J C4    1 
ATOM   6460  P P     . DT  B 2 150 ? -12.697 131.300 53.583  1.00   201.24 ? 150 DT  J P     1 
ATOM   6461  O OP1   . DT  B 2 150 ? -13.719 130.940 54.592  1.00   180.18 ? 150 DT  J OP1   1 
ATOM   6462  O OP2   . DT  B 2 150 ? -12.962 132.407 52.638  1.00   163.45 ? 150 DT  J OP2   1 
ATOM   6463  O "O5'" . DT  B 2 150 ? -11.322 131.613 54.335  1.00   177.55 ? 150 DT  J "O5'" 1 
ATOM   6464  C "C5'" . DT  B 2 150 ? -10.701 130.602 55.119  1.00   159.38 ? 150 DT  J "C5'" 1 
ATOM   6465  C "C4'" . DT  B 2 150 ? -9.201  130.821 55.199  1.00   166.31 ? 150 DT  J "C4'" 1 
ATOM   6466  O "O4'" . DT  B 2 150 ? -8.610  130.638 53.892  1.00   147.30 ? 150 DT  J "O4'" 1 
ATOM   6467  C "C3'" . DT  B 2 150 ? -8.771  132.217 55.668  1.00   176.75 ? 150 DT  J "C3'" 1 
ATOM   6468  O "O3'" . DT  B 2 150 ? -8.051  132.120 56.892  1.00   176.96 ? 150 DT  J "O3'" 1 
ATOM   6469  C "C2'" . DT  B 2 150 ? -7.887  132.751 54.531  1.00   161.43 ? 150 DT  J "C2'" 1 
ATOM   6470  C "C1'" . DT  B 2 150 ? -7.497  131.482 53.790  1.00   158.14 ? 150 DT  J "C1'" 1 
ATOM   6471  N N1    . DT  B 2 150 ? -7.194  131.706 52.347  1.00   167.49 ? 150 DT  J N1    1 
ATOM   6472  C C2    . DT  B 2 150 ? -5.949  131.377 51.863  1.00   175.75 ? 150 DT  J C2    1 
ATOM   6473  O O2    . DT  B 2 150 ? -5.068  130.899 52.555  1.00   174.59 ? 150 DT  J O2    1 
ATOM   6474  N N3    . DT  B 2 150 ? -5.771  131.626 50.528  1.00   172.75 ? 150 DT  J N3    1 
ATOM   6475  C C4    . DT  B 2 150 ? -6.692  132.163 49.647  1.00   165.67 ? 150 DT  J C4    1 
ATOM   6476  O O4    . DT  B 2 150 ? -6.435  132.348 48.461  1.00   154.03 ? 150 DT  J O4    1 
ATOM   6477  C C5    . DT  B 2 150 ? -7.977  132.489 50.220  1.00   156.88 ? 150 DT  J C5    1 
ATOM   6478  C C7    . DT  B 2 150 ? -9.057  133.077 49.363  1.00   143.48 ? 150 DT  J C7    1 
ATOM   6479  C C6    . DT  B 2 150 ? -8.163  132.249 51.528  1.00   159.91 ? 150 DT  J C6    1 
ATOM   6480  P P     . DT  B 2 151 ? -7.530  133.447 57.633  1.00   169.01 ? 151 DT  J P     1 
ATOM   6481  O OP1   . DT  B 2 151 ? -7.476  133.156 59.083  1.00   121.18 ? 151 DT  J OP1   1 
ATOM   6482  O OP2   . DT  B 2 151 ? -8.336  134.587 57.141  1.00   150.01 ? 151 DT  J OP2   1 
ATOM   6483  O "O5'" . DT  B 2 151 ? -6.037  133.629 57.085  1.00   160.02 ? 151 DT  J "O5'" 1 
ATOM   6484  C "C5'" . DT  B 2 151 ? -5.109  132.556 57.190  1.00   150.42 ? 151 DT  J "C5'" 1 
ATOM   6485  C "C4'" . DT  B 2 151 ? -3.796  132.904 56.510  1.00   137.49 ? 151 DT  J "C4'" 1 
ATOM   6486  O "O4'" . DT  B 2 151 ? -4.012  133.061 55.084  1.00   141.73 ? 151 DT  J "O4'" 1 
ATOM   6487  C "C3'" . DT  B 2 151 ? -3.138  134.202 56.993  1.00   145.31 ? 151 DT  J "C3'" 1 
ATOM   6488  O "O3'" . DT  B 2 151 ? -1.779  133.959 57.339  1.00   127.68 ? 151 DT  J "O3'" 1 
ATOM   6489  C "C2'" . DT  B 2 151 ? -3.255  135.144 55.791  1.00   151.62 ? 151 DT  J "C2'" 1 
ATOM   6490  C "C1'" . DT  B 2 151 ? -3.271  134.165 54.630  1.00   154.18 ? 151 DT  J "C1'" 1 
ATOM   6491  N N1    . DT  B 2 151 ? -3.923  134.704 53.400  1.00   153.97 ? 151 DT  J N1    1 
ATOM   6492  C C2    . DT  B 2 151 ? -3.157  134.945 52.283  1.00   143.50 ? 151 DT  J C2    1 
ATOM   6493  O O2    . DT  B 2 151 ? -1.957  134.738 52.240  1.00   132.40 ? 151 DT  J O2    1 
ATOM   6494  N N3    . DT  B 2 151 ? -3.848  135.439 51.209  1.00   142.91 ? 151 DT  J N3    1 
ATOM   6495  C C4    . DT  B 2 151 ? -5.202  135.712 51.141  1.00   143.48 ? 151 DT  J C4    1 
ATOM   6496  O O4    . DT  B 2 151 ? -5.732  136.155 50.127  1.00   125.97 ? 151 DT  J O4    1 
ATOM   6497  C C5    . DT  B 2 151 ? -5.949  135.438 52.346  1.00   152.52 ? 151 DT  J C5    1 
ATOM   6498  C C7    . DT  B 2 151 ? -7.426  135.696 52.393  1.00   143.59 ? 151 DT  J C7    1 
ATOM   6499  C C6    . DT  B 2 151 ? -5.281  134.954 53.405  1.00   155.45 ? 151 DT  J C6    1 
ATOM   6500  P P     . DC  B 2 152 ? -0.942  135.062 58.156  1.00   144.77 ? 152 DC  J P     1 
ATOM   6501  O OP1   . DC  B 2 152 ? -0.016  134.345 59.060  1.00   134.86 ? 152 DC  J OP1   1 
ATOM   6502  O OP2   . DC  B 2 152 ? -1.903  136.041 58.710  1.00   165.08 ? 152 DC  J OP2   1 
ATOM   6503  O "O5'" . DC  B 2 152 ? -0.085  135.803 57.029  1.00   110.37 ? 152 DC  J "O5'" 1 
ATOM   6504  C "C5'" . DC  B 2 152 ? 0.861   135.068 56.267  1.00   130.82 ? 152 DC  J "C5'" 1 
ATOM   6505  C "C4'" . DC  B 2 152 ? 1.263   135.833 55.021  1.00   133.60 ? 152 DC  J "C4'" 1 
ATOM   6506  O "O4'" . DC  B 2 152 ? 0.100   136.081 54.214  1.00   137.23 ? 152 DC  J "O4'" 1 
ATOM   6507  C "C3'" . DC  B 2 152 ? 1.883   137.207 55.279  1.00   134.52 ? 152 DC  J "C3'" 1 
ATOM   6508  O "O3'" . DC  B 2 152 ? 3.292   137.146 55.080  1.00   125.02 ? 152 DC  J "O3'" 1 
ATOM   6509  C "C2'" . DC  B 2 152 ? 1.203   138.142 54.260  1.00   129.28 ? 152 DC  J "C2'" 1 
ATOM   6510  C "C1'" . DC  B 2 152 ? 0.359   137.197 53.409  1.00   130.85 ? 152 DC  J "C1'" 1 
ATOM   6511  N N1    . DC  B 2 152 ? -0.943  137.783 52.980  1.00   128.83 ? 152 DC  J N1    1 
ATOM   6512  C C2    . DC  B 2 152 ? -1.097  138.239 51.666  1.00   134.24 ? 152 DC  J C2    1 
ATOM   6513  O O2    . DC  B 2 152 ? -0.145  138.149 50.881  1.00   123.46 ? 152 DC  J O2    1 
ATOM   6514  N N3    . DC  B 2 152 ? -2.288  138.769 51.291  1.00   143.95 ? 152 DC  J N3    1 
ATOM   6515  C C4    . DC  B 2 152 ? -3.289  138.849 52.169  1.00   146.02 ? 152 DC  J C4    1 
ATOM   6516  N N4    . DC  B 2 152 ? -4.444  139.379 51.753  1.00   133.10 ? 152 DC  J N4    1 
ATOM   6517  C C5    . DC  B 2 152 ? -3.151  138.388 53.512  1.00   144.03 ? 152 DC  J C5    1 
ATOM   6518  C C6    . DC  B 2 152 ? -1.972  137.868 53.870  1.00   132.20 ? 152 DC  J C6    1 
ATOM   6519  P P     . DT  B 2 153 ? 4.208   138.440 55.342  1.00   120.05 ? 153 DT  J P     1 
ATOM   6520  O OP1   . DT  B 2 153 ? 5.556   137.959 55.719  1.00   123.19 ? 153 DT  J OP1   1 
ATOM   6521  O OP2   . DT  B 2 153 ? 3.473   139.350 56.250  1.00   118.96 ? 153 DT  J OP2   1 
ATOM   6522  O "O5'" . DT  B 2 153 ? 4.292   139.140 53.907  1.00   97.96  ? 153 DT  J "O5'" 1 
ATOM   6523  C "C5'" . DT  B 2 153 ? 4.587   138.359 52.755  1.00   101.05 ? 153 DT  J "C5'" 1 
ATOM   6524  C "C4'" . DT  B 2 153 ? 4.599   139.220 51.506  1.00   104.60 ? 153 DT  J "C4'" 1 
ATOM   6525  O "O4'" . DT  B 2 153 ? 3.236   139.539 51.117  1.00   115.67 ? 153 DT  J "O4'" 1 
ATOM   6526  C "C3'" . DT  B 2 153 ? 5.326   140.557 51.649  1.00   91.41  ? 153 DT  J "C3'" 1 
ATOM   6527  O "O3'" . DT  B 2 153 ? 6.109   140.808 50.494  1.00   61.65  ? 153 DT  J "O3'" 1 
ATOM   6528  C "C2'" . DT  B 2 153 ? 4.187   141.564 51.784  1.00   115.01 ? 153 DT  J "C2'" 1 
ATOM   6529  C "C1'" . DT  B 2 153 ? 3.118   140.929 50.912  1.00   116.05 ? 153 DT  J "C1'" 1 
ATOM   6530  N N1    . DT  B 2 153 ? 1.735   141.341 51.273  1.00   117.24 ? 153 DT  J N1    1 
ATOM   6531  C C2    . DT  B 2 153 ? 0.894   141.808 50.291  1.00   128.20 ? 153 DT  J C2    1 
ATOM   6532  O O2    . DT  B 2 153 ? 1.222   141.904 49.122  1.00   134.03 ? 153 DT  J O2    1 
ATOM   6533  N N3    . DT  B 2 153 ? -0.355  142.159 50.728  1.00   134.89 ? 153 DT  J N3    1 
ATOM   6534  C C4    . DT  B 2 153 ? -0.836  142.093 52.023  1.00   134.53 ? 153 DT  J C4    1 
ATOM   6535  O O4    . DT  B 2 153 ? -1.978  142.433 52.318  1.00   149.01 ? 153 DT  J O4    1 
ATOM   6536  C C5    . DT  B 2 153 ? 0.099   141.595 53.004  1.00   120.58 ? 153 DT  J C5    1 
ATOM   6537  C C7    . DT  B 2 153 ? -0.308  141.478 54.443  1.00   131.29 ? 153 DT  J C7    1 
ATOM   6538  C C6    . DT  B 2 153 ? 1.324   141.249 52.586  1.00   121.64 ? 153 DT  J C6    1 
ATOM   6539  P P     . DC  B 2 154 ? 7.147   142.033 50.479  1.00   94.22  ? 154 DC  J P     1 
ATOM   6540  O OP1   . DC  B 2 154 ? 8.282   141.635 49.618  1.00   104.21 ? 154 DC  J OP1   1 
ATOM   6541  O OP2   . DC  B 2 154 ? 7.385   142.437 51.883  1.00   100.65 ? 154 DC  J OP2   1 
ATOM   6542  O "O5'" . DC  B 2 154 ? 6.342   143.217 49.763  1.00   124.94 ? 154 DC  J "O5'" 1 
ATOM   6543  C "C5'" . DC  B 2 154 ? 6.113   143.172 48.358  1.00   121.85 ? 154 DC  J "C5'" 1 
ATOM   6544  C "C4'" . DC  B 2 154 ? 5.180   144.288 47.923  1.00   119.98 ? 154 DC  J "C4'" 1 
ATOM   6545  O "O4'" . DC  B 2 154 ? 3.834   143.988 48.350  1.00   105.36 ? 154 DC  J "O4'" 1 
ATOM   6546  C "C3'" . DC  B 2 154 ? 5.473   145.645 48.534  1.00   121.96 ? 154 DC  J "C3'" 1 
ATOM   6547  O "O3'" . DC  B 2 154 ? 6.540   146.350 47.816  1.00   115.64 ? 154 DC  J "O3'" 1 
ATOM   6548  C "C2'" . DC  B 2 154 ? 4.121   146.354 48.448  1.00   127.86 ? 154 DC  J "C2'" 1 
ATOM   6549  C "C1'" . DC  B 2 154 ? 3.115   145.195 48.530  1.00   112.28 ? 154 DC  J "C1'" 1 
ATOM   6550  N N1    . DC  B 2 154 ? 2.382   145.130 49.829  1.00   123.11 ? 154 DC  J N1    1 
ATOM   6551  C C2    . DC  B 2 154 ? 0.993   145.296 49.848  1.00   138.58 ? 154 DC  J C2    1 
ATOM   6552  O O2    . DC  B 2 154 ? 0.394   145.488 48.782  1.00   144.47 ? 154 DC  J O2    1 
ATOM   6553  N N3    . DC  B 2 154 ? 0.340   145.239 51.036  1.00   142.39 ? 154 DC  J N3    1 
ATOM   6554  C C4    . DC  B 2 154 ? 1.023   145.030 52.163  1.00   139.08 ? 154 DC  J C4    1 
ATOM   6555  N N4    . DC  B 2 154 ? 0.336   144.982 53.310  1.00   134.24 ? 154 DC  J N4    1 
ATOM   6556  C C5    . DC  B 2 154 ? 2.439   144.862 52.165  1.00   136.34 ? 154 DC  J C5    1 
ATOM   6557  C C6    . DC  B 2 154 ? 3.071   144.920 50.988  1.00   129.80 ? 154 DC  J C6    1 
ATOM   6558  P P     . DC  B 2 155 ? 6.534   146.584 46.217  1.00   114.39 ? 155 DC  J P     1 
ATOM   6559  O OP1   . DC  B 2 155 ? 6.528   145.301 45.480  1.00   143.17 ? 155 DC  J OP1   1 
ATOM   6560  O OP2   . DC  B 2 155 ? 7.645   147.525 45.960  1.00   86.15  ? 155 DC  J OP2   1 
ATOM   6561  O "O5'" . DC  B 2 155 ? 5.190   147.398 45.919  1.00   134.33 ? 155 DC  J "O5'" 1 
ATOM   6562  C "C5'" . DC  B 2 155 ? 4.688   147.487 44.589  1.00   118.88 ? 155 DC  J "C5'" 1 
ATOM   6563  C "C4'" . DC  B 2 155 ? 3.631   148.573 44.481  1.00   122.40 ? 155 DC  J "C4'" 1 
ATOM   6564  O "O4'" . DC  B 2 155 ? 2.707   148.468 45.599  1.00   135.42 ? 155 DC  J "O4'" 1 
ATOM   6565  C "C3'" . DC  B 2 155 ? 4.167   150.003 44.521  1.00   139.46 ? 155 DC  J "C3'" 1 
ATOM   6566  O "O3'" . DC  B 2 155 ? 3.368   150.839 43.695  1.00   160.96 ? 155 DC  J "O3'" 1 
ATOM   6567  C "C2'" . DC  B 2 155 ? 4.010   150.368 45.991  1.00   133.37 ? 155 DC  J "C2'" 1 
ATOM   6568  C "C1'" . DC  B 2 155 ? 2.688   149.689 46.310  1.00   124.70 ? 155 DC  J "C1'" 1 
ATOM   6569  N N1    . DC  B 2 155 ? 2.495   149.399 47.759  1.00   108.74 ? 155 DC  J N1    1 
ATOM   6570  C C2    . DC  B 2 155 ? 1.347   148.721 48.184  1.00   125.78 ? 155 DC  J C2    1 
ATOM   6571  O O2    . DC  B 2 155 ? 0.508   148.370 47.345  1.00   119.56 ? 155 DC  J O2    1 
ATOM   6572  N N3    . DC  B 2 155 ? 1.187   148.467 49.507  1.00   135.67 ? 155 DC  J N3    1 
ATOM   6573  C C4    . DC  B 2 155 ? 2.114   148.862 50.380  1.00   132.93 ? 155 DC  J C4    1 
ATOM   6574  N N4    . DC  B 2 155 ? 1.912   148.589 51.673  1.00   122.28 ? 155 DC  J N4    1 
ATOM   6575  C C5    . DC  B 2 155 ? 3.289   149.555 49.966  1.00   141.46 ? 155 DC  J C5    1 
ATOM   6576  C C6    . DC  B 2 155 ? 3.436   149.801 48.660  1.00   122.88 ? 155 DC  J C6    1 
ATOM   6577  P P     . DA  B 2 156 ? 4.032   151.650 42.478  1.00   164.10 ? 156 DA  J P     1 
ATOM   6578  O OP1   . DA  B 2 156 ? 4.607   150.661 41.538  1.00   153.83 ? 156 DA  J OP1   1 
ATOM   6579  O OP2   . DA  B 2 156 ? 4.895   152.703 43.060  1.00   136.47 ? 156 DA  J OP2   1 
ATOM   6580  O "O5'" . DA  B 2 156 ? 2.789   152.372 41.776  1.00   177.87 ? 156 DA  J "O5'" 1 
ATOM   6581  C "C5'" . DA  B 2 156 ? 2.265   153.577 42.324  1.00   182.33 ? 156 DA  J "C5'" 1 
ATOM   6582  C "C4'" . DA  B 2 156 ? 0.837   153.386 42.805  1.00   179.87 ? 156 DA  J "C4'" 1 
ATOM   6583  O "O4'" . DA  B 2 156 ? 0.792   152.308 43.778  1.00   139.01 ? 156 DA  J "O4'" 1 
ATOM   6584  C "C3'" . DA  B 2 156 ? 0.236   154.601 43.502  1.00   184.94 ? 156 DA  J "C3'" 1 
ATOM   6585  O "O3'" . DA  B 2 156 ? -0.459  155.440 42.537  1.00   169.28 ? 156 DA  J "O3'" 1 
ATOM   6586  C "C2'" . DA  B 2 156 ? -0.682  153.977 44.550  1.00   175.29 ? 156 DA  J "C2'" 1 
ATOM   6587  C "C1'" . DA  B 2 156 ? 0.096   152.725 44.938  1.00   137.26 ? 156 DA  J "C1'" 1 
ATOM   6588  N N9    . DA  B 2 156 ? 1.070   152.941 46.007  1.00   156.63 ? 156 DA  J N9    1 
ATOM   6589  C C8    . DA  B 2 156 ? 2.375   153.327 45.867  1.00   166.68 ? 156 DA  J C8    1 
ATOM   6590  N N7    . DA  B 2 156 ? 3.021   153.437 47.003  1.00   172.30 ? 156 DA  J N7    1 
ATOM   6591  C C5    . DA  B 2 156 ? 2.077   153.100 47.957  1.00   168.73 ? 156 DA  J C5    1 
ATOM   6592  C C6    . DA  B 2 156 ? 2.136   153.019 49.363  1.00   156.24 ? 156 DA  J C6    1 
ATOM   6593  N N6    . DA  B 2 156 ? 3.237   153.294 50.071  1.00   137.57 ? 156 DA  J N6    1 
ATOM   6594  N N1    . DA  B 2 156 ? 1.015   152.655 50.016  1.00   155.67 ? 156 DA  J N1    1 
ATOM   6595  C C2    . DA  B 2 156 ? -0.084  152.384 49.305  1.00   150.75 ? 156 DA  J C2    1 
ATOM   6596  N N3    . DA  B 2 156 ? -0.263  152.421 47.983  1.00   144.03 ? 156 DA  J N3    1 
ATOM   6597  C C4    . DA  B 2 156 ? 0.868   152.790 47.362  1.00   162.45 ? 156 DA  J C4    1 
ATOM   6598  P P     . DG  B 2 157 ? -2.063  155.434 42.372  1.00   160.56 ? 157 DG  J P     1 
ATOM   6599  O OP1   . DG  B 2 157 ? -2.567  154.047 42.241  1.00   149.62 ? 157 DG  J OP1   1 
ATOM   6600  O OP2   . DG  B 2 157 ? -2.351  156.389 41.280  1.00   161.47 ? 157 DG  J OP2   1 
ATOM   6601  O "O5'" . DG  B 2 157 ? -2.602  156.113 43.717  1.00   156.16 ? 157 DG  J "O5'" 1 
ATOM   6602  C "C5'" . DG  B 2 157 ? -3.854  155.720 44.263  1.00   148.27 ? 157 DG  J "C5'" 1 
ATOM   6603  C "C4'" . DG  B 2 157 ? -4.075  156.370 45.617  1.00   156.01 ? 157 DG  J "C4'" 1 
ATOM   6604  O "O4'" . DG  B 2 157 ? -2.981  156.020 46.513  1.00   159.86 ? 157 DG  J "O4'" 1 
ATOM   6605  C "C3'" . DG  B 2 157 ? -4.123  157.902 45.599  1.00   167.33 ? 157 DG  J "C3'" 1 
ATOM   6606  O "O3'" . DG  B 2 157 ? -5.095  158.366 46.529  1.00   163.93 ? 157 DG  J "O3'" 1 
ATOM   6607  C "C2'" . DG  B 2 157 ? -2.717  158.278 46.049  1.00   165.22 ? 157 DG  J "C2'" 1 
ATOM   6608  C "C1'" . DG  B 2 157 ? -2.469  157.200 47.085  1.00   160.56 ? 157 DG  J "C1'" 1 
ATOM   6609  N N9    . DG  B 2 157 ? -1.059  157.011 47.406  1.00   171.44 ? 157 DG  J N9    1 
ATOM   6610  C C8    . DG  B 2 157 ? 0.018   157.287 46.599  1.00   179.93 ? 157 DG  J C8    1 
ATOM   6611  N N7    . DG  B 2 157 ? 1.167   157.028 47.160  1.00   184.74 ? 157 DG  J N7    1 
ATOM   6612  C C5    . DG  B 2 157 ? 0.830   156.556 48.422  1.00   181.49 ? 157 DG  J C5    1 
ATOM   6613  C C6    . DG  B 2 157 ? 1.659   156.121 49.482  1.00   180.21 ? 157 DG  J C6    1 
ATOM   6614  O O6    . DG  B 2 157 ? 2.896   156.059 49.514  1.00   176.43 ? 157 DG  J O6    1 
ATOM   6615  N N1    . DG  B 2 157 ? 0.913   155.721 50.589  1.00   178.21 ? 157 DG  J N1    1 
ATOM   6616  C C2    . DG  B 2 157 ? -0.460  155.744 50.662  1.00   164.55 ? 157 DG  J C2    1 
ATOM   6617  N N2    . DG  B 2 157 ? -1.002  155.322 51.814  1.00   161.76 ? 157 DG  J N2    1 
ATOM   6618  N N3    . DG  B 2 157 ? -1.249  156.153 49.675  1.00   145.46 ? 157 DG  J N3    1 
ATOM   6619  C C4    . DG  B 2 157 ? -0.536  156.543 48.590  1.00   170.57 ? 157 DG  J C4    1 
ATOM   6620  P P     . DG  B 2 158 ? -6.228  159.411 46.075  1.00   153.25 ? 158 DG  J P     1 
ATOM   6621  O OP1   . DG  B 2 158 ? -7.374  159.254 46.998  1.00   164.03 ? 158 DG  J OP1   1 
ATOM   6622  O OP2   . DG  B 2 158 ? -6.427  159.237 44.619  1.00   118.21 ? 158 DG  J OP2   1 
ATOM   6623  O "O5'" . DG  B 2 158 ? -5.566  160.855 46.304  1.00   163.73 ? 158 DG  J "O5'" 1 
ATOM   6624  C "C5'" . DG  B 2 158 ? -4.519  161.041 47.261  1.00   160.08 ? 158 DG  J "C5'" 1 
ATOM   6625  C "C4'" . DG  B 2 158 ? -4.996  160.746 48.672  1.00   159.55 ? 158 DG  J "C4'" 1 
ATOM   6626  O "O4'" . DG  B 2 158 ? -4.440  159.477 49.106  1.00   159.30 ? 158 DG  J "O4'" 1 
ATOM   6627  C "C3'" . DG  B 2 158 ? -4.556  161.762 49.716  1.00   176.39 ? 158 DG  J "C3'" 1 
ATOM   6628  O "O3'" . DG  B 2 158 ? -5.539  162.824 49.831  1.00   197.75 ? 158 DG  J "O3'" 1 
ATOM   6629  C "C2'" . DG  B 2 158 ? -4.427  160.913 50.978  1.00   166.42 ? 158 DG  J "C2'" 1 
ATOM   6630  C "C1'" . DG  B 2 158 ? -3.909  159.596 50.414  1.00   164.27 ? 158 DG  J "C1'" 1 
ATOM   6631  N N9    . DG  B 2 158 ? -2.450  159.525 50.336  1.00   178.96 ? 158 DG  J N9    1 
ATOM   6632  C C8    . DG  B 2 158 ? -1.656  159.893 49.275  1.00   179.34 ? 158 DG  J C8    1 
ATOM   6633  N N7    . DG  B 2 158 ? -0.382  159.716 49.492  1.00   174.08 ? 158 DG  J N7    1 
ATOM   6634  C C5    . DG  B 2 158 ? -0.325  159.197 50.779  1.00   179.80 ? 158 DG  J C5    1 
ATOM   6635  C C6    . DG  B 2 158 ? 0.792   158.807 51.556  1.00   176.09 ? 158 DG  J C6    1 
ATOM   6636  O O6    . DG  B 2 158 ? 1.993   158.845 51.249  1.00   162.52 ? 158 DG  J O6    1 
ATOM   6637  N N1    . DG  B 2 158 ? 0.408   158.334 52.809  1.00   173.80 ? 158 DG  J N1    1 
ATOM   6638  C C2    . DG  B 2 158 ? -0.890  158.248 53.254  1.00   161.81 ? 158 DG  J C2    1 
ATOM   6639  N N2    . DG  B 2 158 ? -1.064  157.766 54.492  1.00   164.21 ? 158 DG  J N2    1 
ATOM   6640  N N3    . DG  B 2 158 ? -1.946  158.610 52.536  1.00   162.26 ? 158 DG  J N3    1 
ATOM   6641  C C4    . DG  B 2 158 ? -1.589  159.074 51.313  1.00   175.94 ? 158 DG  J C4    1 
ATOM   6642  P P     . DG  B 2 159 ? -6.694  162.817 50.956  1.00   196.19 ? 159 DG  J P     1 
ATOM   6643  O OP1   . DG  B 2 159 ? -7.345  161.488 51.014  1.00   171.50 ? 159 DG  J OP1   1 
ATOM   6644  O OP2   . DG  B 2 159 ? -7.541  163.996 50.672  1.00   165.45 ? 159 DG  J OP2   1 
ATOM   6645  O "O5'" . DG  B 2 159 ? -5.919  163.136 52.320  1.00   179.84 ? 159 DG  J "O5'" 1 
ATOM   6646  C "C5'" . DG  B 2 159 ? -6.438  162.675 53.560  1.00   165.59 ? 159 DG  J "C5'" 1 
ATOM   6647  C "C4'" . DG  B 2 159 ? -5.378  162.749 54.645  1.00   176.10 ? 159 DG  J "C4'" 1 
ATOM   6648  O "O4'" . DG  B 2 159 ? -4.130  162.198 54.142  1.00   185.30 ? 159 DG  J "O4'" 1 
ATOM   6649  C "C3'" . DG  B 2 159 ? -5.049  164.160 55.135  1.00   173.83 ? 159 DG  J "C3'" 1 
ATOM   6650  O "O3'" . DG  B 2 159 ? -4.843  164.150 56.542  1.00   190.17 ? 159 DG  J "O3'" 1 
ATOM   6651  C "C2'" . DG  B 2 159 ? -3.763  164.491 54.386  1.00   167.97 ? 159 DG  J "C2'" 1 
ATOM   6652  C "C1'" . DG  B 2 159 ? -3.090  163.130 54.340  1.00   181.76 ? 159 DG  J "C1'" 1 
ATOM   6653  N N9    . DG  B 2 159 ? -2.127  162.998 53.252  1.00   178.25 ? 159 DG  J N9    1 
ATOM   6654  C C8    . DG  B 2 159 ? -2.300  163.380 51.944  1.00   169.26 ? 159 DG  J C8    1 
ATOM   6655  N N7    . DG  B 2 159 ? -1.262  163.142 51.191  1.00   165.85 ? 159 DG  J N7    1 
ATOM   6656  C C5    . DG  B 2 159 ? -0.340  162.567 52.055  1.00   174.47 ? 159 DG  J C5    1 
ATOM   6657  C C6    . DG  B 2 159 ? 0.973   162.101 51.808  1.00   181.30 ? 159 DG  J C6    1 
ATOM   6658  O O6    . DG  B 2 159 ? 1.599   162.103 50.738  1.00   181.27 ? 159 DG  J O6    1 
ATOM   6659  N N1    . DG  B 2 159 ? 1.565   161.590 52.961  1.00   180.67 ? 159 DG  J N1    1 
ATOM   6660  C C2    . DG  B 2 159 ? 0.963   161.538 54.197  1.00   179.69 ? 159 DG  J C2    1 
ATOM   6661  N N2    . DG  B 2 159 ? 1.692   161.011 55.191  1.00   171.80 ? 159 DG  J N2    1 
ATOM   6662  N N3    . DG  B 2 159 ? -0.267  161.973 54.442  1.00   173.97 ? 159 DG  J N3    1 
ATOM   6663  C C4    . DG  B 2 159 ? -0.856  162.473 53.329  1.00   176.40 ? 159 DG  J C4    1 
ATOM   6664  P P     . DC  B 2 160 ? -4.846  165.526 57.374  1.00   206.68 ? 160 DC  J P     1 
ATOM   6665  O OP1   . DC  B 2 160 ? -5.919  165.427 58.388  1.00   227.90 ? 160 DC  J OP1   1 
ATOM   6666  O OP2   . DC  B 2 160 ? -4.849  166.650 56.412  1.00   180.06 ? 160 DC  J OP2   1 
ATOM   6667  O "O5'" . DC  B 2 160 ? -3.432  165.523 58.122  1.00   179.84 ? 160 DC  J "O5'" 1 
ATOM   6668  C "C5'" . DC  B 2 160 ? -3.146  164.525 59.095  1.00   176.92 ? 160 DC  J "C5'" 1 
ATOM   6669  C "C4'" . DC  B 2 160 ? -1.689  164.586 59.521  1.00   178.23 ? 160 DC  J "C4'" 1 
ATOM   6670  O "O4'" . DC  B 2 160 ? -0.844  164.139 58.428  1.00   167.34 ? 160 DC  J "O4'" 1 
ATOM   6671  C "C3'" . DC  B 2 160 ? -1.187  165.978 59.911  1.00   187.14 ? 160 DC  J "C3'" 1 
ATOM   6672  O "O3'" . DC  B 2 160 ? -0.412  165.902 61.101  1.00   190.78 ? 160 DC  J "O3'" 1 
ATOM   6673  C "C2'" . DC  B 2 160 ? -0.336  166.399 58.713  1.00   175.45 ? 160 DC  J "C2'" 1 
ATOM   6674  C "C1'" . DC  B 2 160 ? 0.202   165.061 58.235  1.00   167.90 ? 160 DC  J "C1'" 1 
ATOM   6675  N N1    . DC  B 2 160 ? 0.577   165.055 56.795  1.00   165.29 ? 160 DC  J N1    1 
ATOM   6676  C C2    . DC  B 2 160 ? 1.803   164.508 56.400  1.00   176.95 ? 160 DC  J C2    1 
ATOM   6677  O O2    . DC  B 2 160 ? 2.556   164.033 57.260  1.00   176.79 ? 160 DC  J O2    1 
ATOM   6678  N N3    . DC  B 2 160 ? 2.130   164.513 55.084  1.00   176.66 ? 160 DC  J N3    1 
ATOM   6679  C C4    . DC  B 2 160 ? 1.290   165.034 54.189  1.00   170.83 ? 160 DC  J C4    1 
ATOM   6680  N N4    . DC  B 2 160 ? 1.656   165.017 52.903  1.00   164.86 ? 160 DC  J N4    1 
ATOM   6681  C C5    . DC  B 2 160 ? 0.037   165.598 54.573  1.00   171.21 ? 160 DC  J C5    1 
ATOM   6682  C C6    . DC  B 2 160 ? -0.275  165.588 55.873  1.00   163.36 ? 160 DC  J C6    1 
ATOM   6683  P P     . DG  B 2 161 ? 0.061   167.245 61.845  1.00   205.43 ? 161 DG  J P     1 
ATOM   6684  O OP1   . DG  B 2 161 ? 0.041   166.981 63.301  1.00   185.42 ? 161 DG  J OP1   1 
ATOM   6685  O OP2   . DG  B 2 161 ? -0.725  168.370 61.289  1.00   204.79 ? 161 DG  J OP2   1 
ATOM   6686  O "O5'" . DG  B 2 161 ? 1.578   167.432 61.375  1.00   178.37 ? 161 DG  J "O5'" 1 
ATOM   6687  C "C5'" . DG  B 2 161 ? 2.554   166.458 61.725  1.00   174.06 ? 161 DG  J "C5'" 1 
ATOM   6688  C "C4'" . DG  B 2 161 ? 3.907   166.808 61.131  1.00   173.49 ? 161 DG  J "C4'" 1 
ATOM   6689  O "O4'" . DG  B 2 161 ? 3.899   166.539 59.703  1.00   172.17 ? 161 DG  J "O4'" 1 
ATOM   6690  C "C3'" . DG  B 2 161 ? 4.325   168.274 61.287  1.00   169.69 ? 161 DG  J "C3'" 1 
ATOM   6691  O "O3'" . DG  B 2 161 ? 5.693   168.349 61.673  1.00   174.47 ? 161 DG  J "O3'" 1 
ATOM   6692  C "C2'" . DG  B 2 161 ? 4.106   168.849 59.889  1.00   163.46 ? 161 DG  J "C2'" 1 
ATOM   6693  C "C1'" . DG  B 2 161 ? 4.434   167.647 59.021  1.00   169.69 ? 161 DG  J "C1'" 1 
ATOM   6694  N N9    . DG  B 2 161 ? 3.842   167.709 57.688  1.00   160.74 ? 161 DG  J N9    1 
ATOM   6695  C C8    . DG  B 2 161 ? 2.590   168.167 57.357  1.00   158.31 ? 161 DG  J C8    1 
ATOM   6696  N N7    . DG  B 2 161 ? 2.334   168.103 56.080  1.00   157.60 ? 161 DG  J N7    1 
ATOM   6697  C C5    . DG  B 2 161 ? 3.491   167.567 55.527  1.00   156.06 ? 161 DG  J C5    1 
ATOM   6698  C C6    . DG  B 2 161 ? 3.803   167.265 54.180  1.00   147.24 ? 161 DG  J C6    1 
ATOM   6699  O O6    . DG  B 2 161 ? 3.096   167.416 53.174  1.00   137.38 ? 161 DG  J O6    1 
ATOM   6700  N N1    . DG  B 2 161 ? 5.085   166.735 54.055  1.00   155.14 ? 161 DG  J N1    1 
ATOM   6701  C C2    . DG  B 2 161 ? 5.954   166.524 55.099  1.00   171.41 ? 161 DG  J C2    1 
ATOM   6702  N N2    . DG  B 2 161 ? 7.149   166.003 54.782  1.00   169.26 ? 161 DG  J N2    1 
ATOM   6703  N N3    . DG  B 2 161 ? 5.673   166.802 56.366  1.00   168.41 ? 161 DG  J N3    1 
ATOM   6704  C C4    . DG  B 2 161 ? 4.428   167.319 56.504  1.00   158.66 ? 161 DG  J C4    1 
ATOM   6705  P P     . DG  B 2 162 ? 6.263   169.665 62.399  1.00   188.36 ? 162 DG  J P     1 
ATOM   6706  O OP1   . DG  B 2 162 ? 6.504   169.322 63.819  1.00   176.28 ? 162 DG  J OP1   1 
ATOM   6707  O OP2   . DG  B 2 162 ? 5.375   170.799 62.061  1.00   168.12 ? 162 DG  J OP2   1 
ATOM   6708  O "O5'" . DG  B 2 162 ? 7.673   169.917 61.683  1.00   190.72 ? 162 DG  J "O5'" 1 
ATOM   6709  C "C5'" . DG  B 2 162 ? 8.722   168.962 61.821  1.00   187.72 ? 162 DG  J "C5'" 1 
ATOM   6710  C "C4'" . DG  B 2 162 ? 9.478   168.795 60.514  1.00   172.28 ? 162 DG  J "C4'" 1 
ATOM   6711  O "O4'" . DG  B 2 162 ? 8.557   168.399 59.478  1.00   180.11 ? 162 DG  J "O4'" 1 
ATOM   6712  C "C3'" . DG  B 2 162 ? 10.139  170.056 59.988  1.00   143.95 ? 162 DG  J "C3'" 1 
ATOM   6713  O "O3'" . DG  B 2 162 ? 11.440  170.189 60.549  1.00   133.69 ? 162 DG  J "O3'" 1 
ATOM   6714  C "C2'" . DG  B 2 162 ? 10.210  169.796 58.483  1.00   149.87 ? 162 DG  J "C2'" 1 
ATOM   6715  C "C1'" . DG  B 2 162 ? 9.002   168.889 58.227  1.00   164.41 ? 162 DG  J "C1'" 1 
ATOM   6716  N N9    . DG  B 2 162 ? 7.887   169.563 57.567  1.00   159.70 ? 162 DG  J N9    1 
ATOM   6717  C C8    . DG  B 2 162 ? 6.798   170.146 58.168  1.00   144.80 ? 162 DG  J C8    1 
ATOM   6718  N N7    . DG  B 2 162 ? 5.955   170.669 57.321  1.00   133.90 ? 162 DG  J N7    1 
ATOM   6719  C C5    . DG  B 2 162 ? 6.521   170.416 56.078  1.00   149.14 ? 162 DG  J C5    1 
ATOM   6720  C C6    . DG  B 2 162 ? 6.060   170.745 54.781  1.00   148.18 ? 162 DG  J C6    1 
ATOM   6721  O O6    . DG  B 2 162 ? 5.027   171.352 54.466  1.00   146.67 ? 162 DG  J O6    1 
ATOM   6722  N N1    . DG  B 2 162 ? 6.938   170.305 53.794  1.00   150.83 ? 162 DG  J N1    1 
ATOM   6723  C C2    . DG  B 2 162 ? 8.111   169.627 54.030  1.00   148.14 ? 162 DG  J C2    1 
ATOM   6724  N N2    . DG  B 2 162 ? 8.825   169.281 52.949  1.00   134.12 ? 162 DG  J N2    1 
ATOM   6725  N N3    . DG  B 2 162 ? 8.554   169.310 55.240  1.00   154.21 ? 162 DG  J N3    1 
ATOM   6726  C C4    . DG  B 2 162 ? 7.710   169.735 56.213  1.00   161.03 ? 162 DG  J C4    1 
ATOM   6727  P P     . DC  B 2 163 ? 12.076  171.645 60.786  1.00   169.93 ? 163 DC  J P     1 
ATOM   6728  O OP1   . DC  B 2 163 ? 13.327  171.471 61.556  1.00   139.93 ? 163 DC  J OP1   1 
ATOM   6729  O OP2   . DC  B 2 163 ? 11.002  172.515 61.314  1.00   180.05 ? 163 DC  J OP2   1 
ATOM   6730  O "O5'" . DC  B 2 163 ? 12.437  172.160 59.312  1.00   163.74 ? 163 DC  J "O5'" 1 
ATOM   6731  C "C5'" . DC  B 2 163 ? 13.439  171.498 58.544  1.00   149.07 ? 163 DC  J "C5'" 1 
ATOM   6732  C "C4'" . DC  B 2 163 ? 13.572  172.140 57.173  1.00   147.71 ? 163 DC  J "C4'" 1 
ATOM   6733  O "O4'" . DC  B 2 163 ? 12.321  171.990 56.448  1.00   143.74 ? 163 DC  J "O4'" 1 
ATOM   6734  C "C3'" . DC  B 2 163 ? 13.880  173.642 57.196  1.00   151.27 ? 163 DC  J "C3'" 1 
ATOM   6735  O "O3'" . DC  B 2 163 ? 14.948  173.950 56.305  1.00   145.69 ? 163 DC  J "O3'" 1 
ATOM   6736  C "C2'" . DC  B 2 163 ? 12.573  174.289 56.746  1.00   146.61 ? 163 DC  J "C2'" 1 
ATOM   6737  C "C1'" . DC  B 2 163 ? 11.980  173.217 55.849  1.00   148.05 ? 163 DC  J "C1'" 1 
ATOM   6738  N N1    . DC  B 2 163 ? 10.498  173.313 55.744  1.00   143.12 ? 163 DC  J N1    1 
ATOM   6739  C C2    . DC  B 2 163 ? 9.894   173.390 54.484  1.00   142.71 ? 163 DC  J C2    1 
ATOM   6740  O O2    . DC  B 2 163 ? 10.603  173.350 53.471  1.00   142.81 ? 163 DC  J O2    1 
ATOM   6741  N N3    . DC  B 2 163 ? 8.544   173.494 54.409  1.00   131.10 ? 163 DC  J N3    1 
ATOM   6742  C C4    . DC  B 2 163 ? 7.814   173.533 55.525  1.00   130.55 ? 163 DC  J C4    1 
ATOM   6743  N N4    . DC  B 2 163 ? 6.488   173.640 55.402  1.00   119.48 ? 163 DC  J N4    1 
ATOM   6744  C C5    . DC  B 2 163 ? 8.413   173.466 56.817  1.00   138.84 ? 163 DC  J C5    1 
ATOM   6745  C C6    . DC  B 2 163 ? 9.744   173.363 56.879  1.00   136.62 ? 163 DC  J C6    1 
ATOM   6746  P P     . DC  B 2 164 ? 15.787  175.310 56.496  1.00   195.18 ? 164 DC  J P     1 
ATOM   6747  O OP1   . DC  B 2 164 ? 16.478  175.215 57.802  1.00   173.35 ? 164 DC  J OP1   1 
ATOM   6748  O OP2   . DC  B 2 164 ? 14.874  176.448 56.248  1.00   174.62 ? 164 DC  J OP2   1 
ATOM   6749  O "O5'" . DC  B 2 164 ? 16.885  175.258 55.328  1.00   195.86 ? 164 DC  J "O5'" 1 
ATOM   6750  C "C5'" . DC  B 2 164 ? 16.799  176.144 54.205  1.00   181.10 ? 164 DC  J "C5'" 1 
ATOM   6751  C "C4'" . DC  B 2 164 ? 16.800  175.362 52.898  1.00   158.82 ? 164 DC  J "C4'" 1 
ATOM   6752  O "O4'" . DC  B 2 164 ? 15.546  174.655 52.762  1.00   150.31 ? 164 DC  J "O4'" 1 
ATOM   6753  C "C3'" . DC  B 2 164 ? 16.964  176.206 51.636  1.00   155.30 ? 164 DC  J "C3'" 1 
ATOM   6754  O "O3'" . DC  B 2 164 ? 17.927  175.599 50.719  1.00   159.02 ? 164 DC  J "O3'" 1 
ATOM   6755  C "C2'" . DC  B 2 164 ? 15.552  176.330 51.058  1.00   170.06 ? 164 DC  J "C2'" 1 
ATOM   6756  C "C1'" . DC  B 2 164 ? 14.749  175.224 51.742  1.00   157.34 ? 164 DC  J "C1'" 1 
ATOM   6757  N N1    . DC  B 2 164 ? 13.471  175.713 52.342  1.00   146.86 ? 164 DC  J N1    1 
ATOM   6758  C C2    . DC  B 2 164 ? 12.262  175.468 51.685  1.00   150.47 ? 164 DC  J C2    1 
ATOM   6759  O O2    . DC  B 2 164 ? 12.270  174.841 50.619  1.00   148.33 ? 164 DC  J O2    1 
ATOM   6760  N N3    . DC  B 2 164 ? 11.111  175.924 52.241  1.00   158.63 ? 164 DC  J N3    1 
ATOM   6761  C C4    . DC  B 2 164 ? 11.145  176.596 53.393  1.00   151.01 ? 164 DC  J C4    1 
ATOM   6762  N N4    . DC  B 2 164 ? 9.986   177.025 53.903  1.00   138.92 ? 164 DC  J N4    1 
ATOM   6763  C C5    . DC  B 2 164 ? 12.369  176.858 54.073  1.00   142.22 ? 164 DC  J C5    1 
ATOM   6764  C C6    . DC  B 2 164 ? 13.495  176.406 53.514  1.00   136.23 ? 164 DC  J C6    1 
ATOM   6765  P P     . DA  B 2 165 ? 17.491  174.751 49.416  1.00   164.06 ? 165 DA  J P     1 
ATOM   6766  O OP1   . DA  B 2 165 ? 16.587  173.649 49.811  1.00   155.07 ? 165 DA  J OP1   1 
ATOM   6767  O OP2   . DA  B 2 165 ? 18.752  174.409 48.723  1.00   148.44 ? 165 DA  J OP2   1 
ATOM   6768  O "O5'" . DA  B 2 165 ? 16.726  175.795 48.468  1.00   160.44 ? 165 DA  J "O5'" 1 
ATOM   6769  C "C5'" . DA  B 2 165 ? 15.786  175.319 47.509  1.00   146.49 ? 165 DA  J "C5'" 1 
ATOM   6770  C "C4'" . DA  B 2 165 ? 14.835  176.420 47.061  1.00   139.54 ? 165 DA  J "C4'" 1 
ATOM   6771  O "O4'" . DA  B 2 165 ? 13.982  176.831 48.164  1.00   127.31 ? 165 DA  J "O4'" 1 
ATOM   6772  C "C3'" . DA  B 2 165 ? 15.502  177.703 46.541  1.00   158.79 ? 165 DA  J "C3'" 1 
ATOM   6773  O "O3'" . DA  B 2 165 ? 14.970  178.029 45.258  1.00   150.58 ? 165 DA  J "O3'" 1 
ATOM   6774  C "C2'" . DA  B 2 165 ? 15.123  178.755 47.589  1.00   148.51 ? 165 DA  J "C2'" 1 
ATOM   6775  C "C1'" . DA  B 2 165 ? 13.788  178.219 48.068  1.00   137.71 ? 165 DA  J "C1'" 1 
ATOM   6776  N N9    . DA  B 2 165 ? 13.370  178.739 49.369  1.00   141.91 ? 165 DA  J N9    1 
ATOM   6777  C C8    . DA  B 2 165 ? 14.175  179.190 50.377  1.00   140.49 ? 165 DA  J C8    1 
ATOM   6778  N N7    . DA  B 2 165 ? 13.519  179.603 51.435  1.00   141.36 ? 165 DA  J N7    1 
ATOM   6779  C C5    . DA  B 2 165 ? 12.189  179.422 51.093  1.00   147.56 ? 165 DA  J C5    1 
ATOM   6780  C C6    . DA  B 2 165 ? 10.987  179.672 51.785  1.00   144.43 ? 165 DA  J C6    1 
ATOM   6781  N N6    . DA  B 2 165 ? 10.941  180.182 53.021  1.00   144.19 ? 165 DA  J N6    1 
ATOM   6782  N N1    . DA  B 2 165 ? 9.831   179.377 51.157  1.00   133.18 ? 165 DA  J N1    1 
ATOM   6783  C C2    . DA  B 2 165 ? 9.881   178.871 49.919  1.00   134.08 ? 165 DA  J C2    1 
ATOM   6784  N N3    . DA  B 2 165 ? 10.946  178.589 49.170  1.00   130.53 ? 165 DA  J N3    1 
ATOM   6785  C C4    . DA  B 2 165 ? 12.079  178.892 49.821  1.00   139.86 ? 165 DA  J C4    1 
ATOM   6786  P P     . DG  B 2 166 ? 15.370  179.406 44.530  1.00   134.01 ? 166 DG  J P     1 
ATOM   6787  O OP1   . DG  B 2 166 ? 15.158  179.210 43.078  1.00   92.44  ? 166 DG  J OP1   1 
ATOM   6788  O OP2   . DG  B 2 166 ? 16.700  179.823 45.028  1.00   69.06  ? 166 DG  J OP2   1 
ATOM   6789  O "O5'" . DG  B 2 166 ? 14.285  180.454 45.069  1.00   162.71 ? 166 DG  J "O5'" 1 
ATOM   6790  C "C5'" . DG  B 2 166 ? 12.898  180.123 45.040  1.00   148.55 ? 166 DG  J "C5'" 1 
ATOM   6791  C "C4'" . DG  B 2 166 ? 12.040  181.329 45.384  1.00   137.38 ? 166 DG  J "C4'" 1 
ATOM   6792  O "O4'" . DG  B 2 166 ? 11.967  181.494 46.826  1.00   125.83 ? 166 DG  J "O4'" 1 
ATOM   6793  C "C3'" . DG  B 2 166 ? 12.545  182.669 44.831  1.00   134.66 ? 166 DG  J "C3'" 1 
ATOM   6794  O "O3'" . DG  B 2 166 ? 11.463  183.396 44.277  1.00   100.63 ? 166 DG  J "O3'" 1 
ATOM   6795  C "C2'" . DG  B 2 166 ? 13.097  183.367 46.071  1.00   134.43 ? 166 DG  J "C2'" 1 
ATOM   6796  C "C1'" . DG  B 2 166 ? 12.129  182.859 47.120  1.00   135.57 ? 166 DG  J "C1'" 1 
ATOM   6797  N N9    . DG  B 2 166 ? 12.605  183.004 48.491  1.00   132.61 ? 166 DG  J N9    1 
ATOM   6798  C C8    . DG  B 2 166 ? 13.906  183.139 48.911  1.00   134.49 ? 166 DG  J C8    1 
ATOM   6799  N N7    . DG  B 2 166 ? 14.023  183.258 50.205  1.00   136.88 ? 166 DG  J N7    1 
ATOM   6800  C C5    . DG  B 2 166 ? 12.714  183.203 50.670  1.00   144.06 ? 166 DG  J C5    1 
ATOM   6801  C C6    . DG  B 2 166 ? 12.209  183.279 51.991  1.00   141.08 ? 166 DG  J C6    1 
ATOM   6802  O O6    . DG  B 2 166 ? 12.840  183.415 53.049  1.00   140.00 ? 166 DG  J O6    1 
ATOM   6803  N N1    . DG  B 2 166 ? 10.819  183.180 52.016  1.00   126.07 ? 166 DG  J N1    1 
ATOM   6804  C C2    . DG  B 2 166 ? 10.023  183.027 50.906  1.00   121.52 ? 166 DG  J C2    1 
ATOM   6805  N N2    . DG  B 2 166 ? 8.706   182.951 51.126  1.00   119.32 ? 166 DG  J N2    1 
ATOM   6806  N N3    . DG  B 2 166 ? 10.483  182.951 49.667  1.00   110.55 ? 166 DG  J N3    1 
ATOM   6807  C C4    . DG  B 2 166 ? 11.832  183.049 49.625  1.00   133.56 ? 166 DG  J C4    1 
ATOM   6808  N N     . PRO C 3 38  ? 57.456  159.298 85.537  1.00   125.09 ? 38  PRO A N     1 
ATOM   6809  C CA    . PRO C 3 38  ? 57.175  157.866 85.693  1.00   121.59 ? 38  PRO A CA    1 
ATOM   6810  C C     . PRO C 3 38  ? 57.121  157.127 84.356  1.00   115.60 ? 38  PRO A C     1 
ATOM   6811  O O     . PRO C 3 38  ? 56.920  157.745 83.310  1.00   123.49 ? 38  PRO A O     1 
ATOM   6812  C CB    . PRO C 3 38  ? 55.807  157.851 86.383  1.00   118.95 ? 38  PRO A CB    1 
ATOM   6813  C CG    . PRO C 3 38  ? 55.188  159.160 86.029  1.00   126.22 ? 38  PRO A CG    1 
ATOM   6814  C CD    . PRO C 3 38  ? 56.323  160.135 85.966  1.00   115.53 ? 38  PRO A CD    1 
ATOM   6815  N N     . HIS C 3 39  ? 57.309  155.812 84.405  1.00   94.98  ? 39  HIS A N     1 
ATOM   6816  C CA    . HIS C 3 39  ? 57.301  154.962 83.218  1.00   107.02 ? 39  HIS A CA    1 
ATOM   6817  C C     . HIS C 3 39  ? 55.996  154.156 83.274  1.00   110.20 ? 39  HIS A C     1 
ATOM   6818  O O     . HIS C 3 39  ? 55.783  153.395 84.218  1.00   115.75 ? 39  HIS A O     1 
ATOM   6819  C CB    . HIS C 3 39  ? 58.549  154.078 83.193  1.00   96.05  ? 39  HIS A CB    1 
ATOM   6820  C CG    . HIS C 3 39  ? 58.551  153.051 82.107  1.00   103.22 ? 39  HIS A CG    1 
ATOM   6821  N ND1   . HIS C 3 39  ? 58.748  153.378 80.783  1.00   78.54  ? 39  HIS A ND1   1 
ATOM   6822  C CD2   . HIS C 3 39  ? 58.414  151.705 82.147  1.00   117.45 ? 39  HIS A CD2   1 
ATOM   6823  C CE1   . HIS C 3 39  ? 58.717  152.280 80.051  1.00   84.20  ? 39  HIS A CE1   1 
ATOM   6824  N NE2   . HIS C 3 39  ? 58.518  151.251 80.854  1.00   115.69 ? 39  HIS A NE2   1 
ATOM   6825  N N     . ARG C 3 40  ? 55.125  154.313 82.277  1.00   77.34  ? 40  ARG A N     1 
ATOM   6826  C CA    . ARG C 3 40  ? 53.865  153.560 82.269  1.00   102.31 ? 40  ARG A CA    1 
ATOM   6827  C C     . ARG C 3 40  ? 53.425  152.771 81.026  1.00   123.67 ? 40  ARG A C     1 
ATOM   6828  O O     . ARG C 3 40  ? 52.329  152.207 81.042  1.00   132.08 ? 40  ARG A O     1 
ATOM   6829  C CB    . ARG C 3 40  ? 52.733  154.543 82.585  1.00   115.54 ? 40  ARG A CB    1 
ATOM   6830  C CG    . ARG C 3 40  ? 52.612  154.959 84.039  1.00   116.42 ? 40  ARG A CG    1 
ATOM   6831  C CD    . ARG C 3 40  ? 51.592  154.110 84.769  1.00   92.57  ? 40  ARG A CD    1 
ATOM   6832  N NE    . ARG C 3 40  ? 50.308  154.089 84.076  1.00   61.93  ? 40  ARG A NE    1 
ATOM   6833  C CZ    . ARG C 3 40  ? 49.237  153.433 84.511  1.00   87.80  ? 40  ARG A CZ    1 
ATOM   6834  N NH1   . ARG C 3 40  ? 49.292  152.746 85.644  1.00   75.96  ? 40  ARG A NH1   1 
ATOM   6835  N NH2   . ARG C 3 40  ? 48.108  153.467 83.816  1.00   103.51 ? 40  ARG A NH2   1 
ATOM   6836  N N     . TYR C 3 41  ? 54.241  152.712 79.974  1.00   108.40 ? 41  TYR A N     1 
ATOM   6837  C CA    . TYR C 3 41  ? 53.922  151.885 78.799  1.00   104.27 ? 41  TYR A CA    1 
ATOM   6838  C C     . TYR C 3 41  ? 52.558  152.260 78.208  1.00   121.05 ? 41  TYR A C     1 
ATOM   6839  O O     . TYR C 3 41  ? 52.129  153.413 78.271  1.00   139.37 ? 41  TYR A O     1 
ATOM   6840  C CB    . TYR C 3 41  ? 53.895  150.384 79.137  1.00   94.25  ? 41  TYR A CB    1 
ATOM   6841  C CG    . TYR C 3 41  ? 55.228  149.699 79.348  1.00   122.91 ? 41  TYR A CG    1 
ATOM   6842  C CD1   . TYR C 3 41  ? 56.006  149.302 78.266  1.00   130.38 ? 41  TYR A CD1   1 
ATOM   6843  C CD2   . TYR C 3 41  ? 55.673  149.379 80.624  1.00   111.22 ? 41  TYR A CD2   1 
ATOM   6844  C CE1   . TYR C 3 41  ? 57.214  148.653 78.452  1.00   100.94 ? 41  TYR A CE1   1 
ATOM   6845  C CE2   . TYR C 3 41  ? 56.875  148.722 80.820  1.00   108.92 ? 41  TYR A CE2   1 
ATOM   6846  C CZ    . TYR C 3 41  ? 57.643  148.366 79.730  1.00   102.14 ? 41  TYR A CZ    1 
ATOM   6847  O OH    . TYR C 3 41  ? 58.842  147.720 79.919  1.00   102.99 ? 41  TYR A OH    1 
ATOM   6848  N N     . ARG C 3 42  ? 51.889  151.260 77.639  1.00   81.50  ? 42  ARG A N     1 
ATOM   6849  C CA    . ARG C 3 42  ? 50.555  151.400 77.048  1.00   80.90  ? 42  ARG A CA    1 
ATOM   6850  C C     . ARG C 3 42  ? 49.745  150.122 77.237  1.00   88.74  ? 42  ARG A C     1 
ATOM   6851  O O     . ARG C 3 42  ? 50.308  149.026 77.245  1.00   86.77  ? 42  ARG A O     1 
ATOM   6852  C CB    . ARG C 3 42  ? 50.598  151.736 75.551  1.00   100.44 ? 42  ARG A CB    1 
ATOM   6853  C CG    . ARG C 3 42  ? 51.399  152.945 75.118  1.00   91.30  ? 42  ARG A CG    1 
ATOM   6854  C CD    . ARG C 3 42  ? 51.503  152.941 73.598  1.00   86.66  ? 42  ARG A CD    1 
ATOM   6855  N NE    . ARG C 3 42  ? 51.920  154.227 73.052  1.00   125.39 ? 42  ARG A NE    1 
ATOM   6856  C CZ    . ARG C 3 42  ? 51.092  155.074 72.445  1.00   123.91 ? 42  ARG A CZ    1 
ATOM   6857  N NH1   . ARG C 3 42  ? 49.810  154.761 72.303  1.00   93.80  ? 42  ARG A NH1   1 
ATOM   6858  N NH2   . ARG C 3 42  ? 51.543  156.230 71.977  1.00   138.51 ? 42  ARG A NH2   1 
ATOM   6859  N N     . PRO C 3 43  ? 48.420  150.263 77.412  1.00   84.76  ? 43  PRO A N     1 
ATOM   6860  C CA    . PRO C 3 43  ? 47.513  149.123 77.577  1.00   62.32  ? 43  PRO A CA    1 
ATOM   6861  C C     . PRO C 3 43  ? 47.695  148.102 76.457  1.00   76.41  ? 43  PRO A C     1 
ATOM   6862  O O     . PRO C 3 43  ? 47.600  148.458 75.281  1.00   67.81  ? 43  PRO A O     1 
ATOM   6863  C CB    . PRO C 3 43  ? 46.126  149.766 77.519  1.00   47.33  ? 43  PRO A CB    1 
ATOM   6864  C CG    . PRO C 3 43  ? 46.342  151.146 78.014  1.00   77.66  ? 43  PRO A CG    1 
ATOM   6865  C CD    . PRO C 3 43  ? 47.708  151.548 77.525  1.00   91.23  ? 43  PRO A CD    1 
ATOM   6866  N N     . GLY C 3 44  ? 47.967  146.854 76.820  1.00   80.12  ? 44  GLY A N     1 
ATOM   6867  C CA    . GLY C 3 44  ? 48.160  145.805 75.837  1.00   58.19  ? 44  GLY A CA    1 
ATOM   6868  C C     . GLY C 3 44  ? 49.607  145.369 75.734  1.00   67.97  ? 44  GLY A C     1 
ATOM   6869  O O     . GLY C 3 44  ? 49.888  144.222 75.375  1.00   59.10  ? 44  GLY A O     1 
ATOM   6870  N N     . THR C 3 45  ? 50.529  146.281 76.035  1.00   64.78  ? 45  THR A N     1 
ATOM   6871  C CA    . THR C 3 45  ? 51.952  145.972 75.955  1.00   61.08  ? 45  THR A CA    1 
ATOM   6872  C C     . THR C 3 45  ? 52.298  144.871 76.953  1.00   61.77  ? 45  THR A C     1 
ATOM   6873  O O     . THR C 3 45  ? 52.896  143.858 76.586  1.00   57.21  ? 45  THR A O     1 
ATOM   6874  C CB    . THR C 3 45  ? 52.827  147.211 76.224  1.00   63.19  ? 45  THR A CB    1 
ATOM   6875  O OG1   . THR C 3 45  ? 52.579  148.203 75.221  1.00   53.60  ? 45  THR A OG1   1 
ATOM   6876  C CG2   . THR C 3 45  ? 54.297  146.838 76.196  1.00   78.48  ? 45  THR A CG2   1 
ATOM   6877  N N     . VAL C 3 46  ? 51.930  145.077 78.215  1.00   58.38  ? 46  VAL A N     1 
ATOM   6878  C CA    . VAL C 3 46  ? 52.162  144.067 79.239  1.00   42.24  ? 46  VAL A CA    1 
ATOM   6879  C C     . VAL C 3 46  ? 51.335  142.828 78.928  1.00   41.59  ? 46  VAL A C     1 
ATOM   6880  O O     . VAL C 3 46  ? 51.771  141.703 79.155  1.00   47.94  ? 46  VAL A O     1 
ATOM   6881  C CB    . VAL C 3 46  ? 51.805  144.585 80.646  1.00   44.50  ? 46  VAL A CB    1 
ATOM   6882  C CG1   . VAL C 3 46  ? 52.099  143.526 81.700  1.00   59.03  ? 46  VAL A CG1   1 
ATOM   6883  C CG2   . VAL C 3 46  ? 52.560  145.870 80.947  1.00   69.89  ? 46  VAL A CG2   1 
ATOM   6884  N N     . ALA C 3 47  ? 50.141  143.055 78.389  1.00   62.12  ? 47  ALA A N     1 
ATOM   6885  C CA    . ALA C 3 47  ? 49.234  141.980 77.995  1.00   65.02  ? 47  ALA A CA    1 
ATOM   6886  C C     . ALA C 3 47  ? 49.889  141.024 77.009  1.00   52.18  ? 47  ALA A C     1 
ATOM   6887  O O     . ALA C 3 47  ? 49.898  139.810 77.218  1.00   48.92  ? 47  ALA A O     1 
ATOM   6888  C CB    . ALA C 3 47  ? 47.955  142.554 77.404  1.00   65.06  ? 47  ALA A CB    1 
ATOM   6889  N N     . LEU C 3 48  ? 50.428  141.587 75.931  1.00   55.28  ? 48  LEU A N     1 
ATOM   6890  C CA    . LEU C 3 48  ? 51.115  140.811 74.904  1.00   62.41  ? 48  LEU A CA    1 
ATOM   6891  C C     . LEU C 3 48  ? 52.317  140.068 75.478  1.00   52.88  ? 48  LEU A C     1 
ATOM   6892  O O     . LEU C 3 48  ? 52.589  138.928 75.104  1.00   44.88  ? 48  LEU A O     1 
ATOM   6893  C CB    . LEU C 3 48  ? 51.558  141.726 73.761  1.00   58.10  ? 48  LEU A CB    1 
ATOM   6894  C CG    . LEU C 3 48  ? 51.336  141.229 72.331  1.00   79.72  ? 48  LEU A CG    1 
ATOM   6895  C CD1   . LEU C 3 48  ? 49.850  141.136 72.016  1.00   69.71  ? 48  LEU A CD1   1 
ATOM   6896  C CD2   . LEU C 3 48  ? 52.039  142.140 71.339  1.00   94.36  ? 48  LEU A CD2   1 
ATOM   6897  N N     . ARG C 3 49  ? 53.031  140.730 76.385  1.00   66.83  ? 49  ARG A N     1 
ATOM   6898  C CA    . ARG C 3 49  ? 54.193  140.144 77.046  1.00   57.39  ? 49  ARG A CA    1 
ATOM   6899  C C     . ARG C 3 49  ? 53.823  138.887 77.824  1.00   52.48  ? 49  ARG A C     1 
ATOM   6900  O O     . ARG C 3 49  ? 54.570  137.910 77.847  1.00   45.66  ? 49  ARG A O     1 
ATOM   6901  C CB    . ARG C 3 49  ? 54.829  141.155 78.000  1.00   64.16  ? 49  ARG A CB    1 
ATOM   6902  C CG    . ARG C 3 49  ? 56.167  140.721 78.563  1.00   78.44  ? 49  ARG A CG    1 
ATOM   6903  C CD    . ARG C 3 49  ? 56.946  141.912 79.084  1.00   82.42  ? 49  ARG A CD    1 
ATOM   6904  N NE    . ARG C 3 49  ? 56.924  143.032 78.152  1.00   76.67  ? 49  ARG A NE    1 
ATOM   6905  C CZ    . ARG C 3 49  ? 56.863  144.304 78.525  1.00   87.05  ? 49  ARG A CZ    1 
ATOM   6906  N NH1   . ARG C 3 49  ? 56.814  144.616 79.813  1.00   81.64  ? 49  ARG A NH1   1 
ATOM   6907  N NH2   . ARG C 3 49  ? 56.848  145.265 77.612  1.00   111.01 ? 49  ARG A NH2   1 
ATOM   6908  N N     . GLU C 3 50  ? 52.651  138.929 78.450  1.00   55.54  ? 50  GLU A N     1 
ATOM   6909  C CA    . GLU C 3 50  ? 52.115  137.797 79.190  1.00   42.03  ? 50  GLU A CA    1 
ATOM   6910  C C     . GLU C 3 50  ? 51.726  136.655 78.262  1.00   55.47  ? 50  GLU A C     1 
ATOM   6911  O O     . GLU C 3 50  ? 51.961  135.489 78.574  1.00   57.18  ? 50  GLU A O     1 
ATOM   6912  C CB    . GLU C 3 50  ? 50.902  138.230 80.017  1.00   52.90  ? 50  GLU A CB    1 
ATOM   6913  C CG    . GLU C 3 50  ? 51.194  139.289 81.065  1.00   72.63  ? 50  GLU A CG    1 
ATOM   6914  C CD    . GLU C 3 50  ? 49.980  139.614 81.918  1.00   97.59  ? 50  GLU A CD    1 
ATOM   6915  O OE1   . GLU C 3 50  ? 49.145  138.711 82.139  1.00   81.80  ? 50  GLU A OE1   1 
ATOM   6916  O OE2   . GLU C 3 50  ? 49.854  140.777 82.358  1.00   118.35 ? 50  GLU A OE2   1 
ATOM   6917  N N     . ILE C 3 51  ? 51.137  136.996 77.118  1.00   60.89  ? 51  ILE A N     1 
ATOM   6918  C CA    . ILE C 3 51  ? 50.762  135.991 76.132  1.00   60.30  ? 51  ILE A CA    1 
ATOM   6919  C C     . ILE C 3 51  ? 51.972  135.197 75.685  1.00   69.76  ? 51  ILE A C     1 
ATOM   6920  O O     . ILE C 3 51  ? 51.978  133.967 75.732  1.00   67.71  ? 51  ILE A O     1 
ATOM   6921  C CB    . ILE C 3 51  ? 50.127  136.638 74.886  1.00   57.79  ? 51  ILE A CB    1 
ATOM   6922  C CG1   . ILE C 3 51  ? 48.864  137.410 75.261  1.00   51.81  ? 51  ILE A CG1   1 
ATOM   6923  C CG2   . ILE C 3 51  ? 49.819  135.584 73.833  1.00   71.11  ? 51  ILE A CG2   1 
ATOM   6924  C CD1   . ILE C 3 51  ? 48.133  137.977 74.072  1.00   45.88  ? 51  ILE A CD1   1 
ATOM   6925  N N     . ARG C 3 52  ? 52.993  135.927 75.253  1.00   76.96  ? 52  ARG A N     1 
ATOM   6926  C CA    . ARG C 3 52  ? 54.244  135.343 74.796  1.00   72.84  ? 52  ARG A CA    1 
ATOM   6927  C C     . ARG C 3 52  ? 54.888  134.519 75.912  1.00   65.50  ? 52  ARG A C     1 
ATOM   6928  O O     . ARG C 3 52  ? 55.449  133.451 75.666  1.00   79.16  ? 52  ARG A O     1 
ATOM   6929  C CB    . ARG C 3 52  ? 55.165  136.454 74.296  1.00   50.28  ? 52  ARG A CB    1 
ATOM   6930  C CG    . ARG C 3 52  ? 56.254  136.024 73.335  1.00   82.81  ? 52  ARG A CG    1 
ATOM   6931  C CD    . ARG C 3 52  ? 57.202  137.185 73.052  1.00   107.89 ? 52  ARG A CD    1 
ATOM   6932  N NE    . ARG C 3 52  ? 56.638  138.091 72.050  1.00   107.72 ? 52  ARG A NE    1 
ATOM   6933  C CZ    . ARG C 3 52  ? 55.932  139.185 72.330  1.00   92.72  ? 52  ARG A CZ    1 
ATOM   6934  N NH1   . ARG C 3 52  ? 55.704  139.531 73.589  1.00   61.29  ? 52  ARG A NH1   1 
ATOM   6935  N NH2   . ARG C 3 52  ? 55.458  139.942 71.347  1.00   56.02  ? 52  ARG A NH2   1 
ATOM   6936  N N     . ARG C 3 53  ? 54.781  135.022 77.142  1.00   55.06  ? 53  ARG A N     1 
ATOM   6937  C CA    . ARG C 3 53  ? 55.353  134.369 78.322  1.00   56.80  ? 53  ARG A CA    1 
ATOM   6938  C C     . ARG C 3 53  ? 54.744  132.999 78.637  1.00   43.62  ? 53  ARG A C     1 
ATOM   6939  O O     . ARG C 3 53  ? 55.460  132.005 78.711  1.00   56.36  ? 53  ARG A O     1 
ATOM   6940  C CB    . ARG C 3 53  ? 55.173  135.267 79.543  1.00   60.32  ? 53  ARG A CB    1 
ATOM   6941  C CG    . ARG C 3 53  ? 55.431  134.584 80.875  1.00   44.94  ? 53  ARG A CG    1 
ATOM   6942  C CD    . ARG C 3 53  ? 55.112  135.548 82.002  1.00   65.86  ? 53  ARG A CD    1 
ATOM   6943  N NE    . ARG C 3 53  ? 55.222  134.930 83.319  1.00   88.43  ? 53  ARG A NE    1 
ATOM   6944  C CZ    . ARG C 3 53  ? 55.048  135.587 84.462  1.00   102.04 ? 53  ARG A CZ    1 
ATOM   6945  N NH1   . ARG C 3 53  ? 54.713  136.872 84.447  1.00   119.27 ? 53  ARG A NH1   1 
ATOM   6946  N NH2   . ARG C 3 53  ? 55.163  134.951 85.620  1.00   81.46  ? 53  ARG A NH2   1 
ATOM   6947  N N     . TYR C 3 54  ? 53.424  132.954 78.823  1.00   42.44  ? 54  TYR A N     1 
ATOM   6948  C CA    . TYR C 3 54  ? 52.736  131.730 79.253  1.00   51.08  ? 54  TYR A CA    1 
ATOM   6949  C C     . TYR C 3 54  ? 52.611  130.700 78.136  1.00   56.33  ? 54  TYR A C     1 
ATOM   6950  O O     . TYR C 3 54  ? 52.440  129.508 78.399  1.00   56.32  ? 54  TYR A O     1 
ATOM   6951  C CB    . TYR C 3 54  ? 51.343  132.040 79.822  1.00   57.72  ? 54  TYR A CB    1 
ATOM   6952  C CG    . TYR C 3 54  ? 51.355  132.864 81.094  1.00   51.17  ? 54  TYR A CG    1 
ATOM   6953  C CD1   . TYR C 3 54  ? 51.785  132.314 82.298  1.00   39.54  ? 54  TYR A CD1   1 
ATOM   6954  C CD2   . TYR C 3 54  ? 50.920  134.182 81.095  1.00   52.81  ? 54  TYR A CD2   1 
ATOM   6955  C CE1   . TYR C 3 54  ? 51.796  133.063 83.463  1.00   57.03  ? 54  TYR A CE1   1 
ATOM   6956  C CE2   . TYR C 3 54  ? 50.928  134.939 82.254  1.00   73.80  ? 54  TYR A CE2   1 
ATOM   6957  C CZ    . TYR C 3 54  ? 51.366  134.375 83.436  1.00   79.92  ? 54  TYR A CZ    1 
ATOM   6958  O OH    . TYR C 3 54  ? 51.373  135.127 84.589  1.00   69.37  ? 54  TYR A OH    1 
ATOM   6959  N N     . GLN C 3 55  ? 52.705  131.159 76.893  1.00   51.80  ? 55  GLN A N     1 
ATOM   6960  C CA    . GLN C 3 55  ? 52.704  130.253 75.752  1.00   59.68  ? 55  GLN A CA    1 
ATOM   6961  C C     . GLN C 3 55  ? 54.051  129.557 75.638  1.00   60.34  ? 55  GLN A C     1 
ATOM   6962  O O     . GLN C 3 55  ? 54.166  128.499 75.017  1.00   52.41  ? 55  GLN A O     1 
ATOM   6963  C CB    . GLN C 3 55  ? 52.388  131.012 74.461  1.00   63.40  ? 55  GLN A CB    1 
ATOM   6964  C CG    . GLN C 3 55  ? 50.924  131.392 74.302  1.00   67.22  ? 55  GLN A CG    1 
ATOM   6965  C CD    . GLN C 3 55  ? 50.629  132.022 72.955  1.00   57.56  ? 55  GLN A CD    1 
ATOM   6966  O OE1   . GLN C 3 55  ? 51.537  132.297 72.173  1.00   67.64  ? 55  GLN A OE1   1 
ATOM   6967  N NE2   . GLN C 3 55  ? 49.353  132.259 72.681  1.00   72.10  ? 55  GLN A NE2   1 
ATOM   6968  N N     . LYS C 3 56  ? 55.065  130.152 76.258  1.00   74.54  ? 56  LYS A N     1 
ATOM   6969  C CA    . LYS C 3 56  ? 56.408  129.592 76.230  1.00   73.71  ? 56  LYS A CA    1 
ATOM   6970  C C     . LYS C 3 56  ? 56.598  128.592 77.367  1.00   54.54  ? 56  LYS A C     1 
ATOM   6971  O O     . LYS C 3 56  ? 57.301  127.594 77.212  1.00   68.61  ? 56  LYS A O     1 
ATOM   6972  C CB    . LYS C 3 56  ? 57.457  130.704 76.309  1.00   52.85  ? 56  LYS A CB    1 
ATOM   6973  C CG    . LYS C 3 56  ? 58.891  130.212 76.201  1.00   77.35  ? 56  LYS A CG    1 
ATOM   6974  C CD    . LYS C 3 56  ? 59.867  131.373 76.104  1.00   102.38 ? 56  LYS A CD    1 
ATOM   6975  C CE    . LYS C 3 56  ? 61.275  130.887 75.801  1.00   103.35 ? 56  LYS A CE    1 
ATOM   6976  N NZ    . LYS C 3 56  ? 62.213  132.021 75.576  1.00   125.30 ? 56  LYS A NZ    1 
ATOM   6977  N N     . SER C 3 57  ? 55.958  128.852 78.504  1.00   47.07  ? 57  SER A N     1 
ATOM   6978  C CA    . SER C 3 57  ? 56.098  127.977 79.663  1.00   56.60  ? 57  SER A CA    1 
ATOM   6979  C C     . SER C 3 57  ? 55.024  126.892 79.661  1.00   66.11  ? 57  SER A C     1 
ATOM   6980  O O     . SER C 3 57  ? 54.092  126.934 78.855  1.00   63.26  ? 57  SER A O     1 
ATOM   6981  C CB    . SER C 3 57  ? 56.027  128.787 80.958  1.00   67.70  ? 57  SER A CB    1 
ATOM   6982  O OG    . SER C 3 57  ? 54.791  129.473 81.065  1.00   64.20  ? 57  SER A OG    1 
ATOM   6983  N N     . THR C 3 58  ? 55.152  125.929 80.572  1.00   64.05  ? 58  THR A N     1 
ATOM   6984  C CA    . THR C 3 58  ? 54.237  124.789 80.621  1.00   70.61  ? 58  THR A CA    1 
ATOM   6985  C C     . THR C 3 58  ? 53.768  124.421 82.026  1.00   72.18  ? 58  THR A C     1 
ATOM   6986  O O     . THR C 3 58  ? 53.363  123.283 82.262  1.00   77.77  ? 58  THR A O     1 
ATOM   6987  C CB    . THR C 3 58  ? 54.881  123.528 80.008  1.00   80.34  ? 58  THR A CB    1 
ATOM   6988  O OG1   . THR C 3 58  ? 56.026  123.150 80.784  1.00   87.84  ? 58  THR A OG1   1 
ATOM   6989  C CG2   . THR C 3 58  ? 55.310  123.777 78.574  1.00   78.83  ? 58  THR A CG2   1 
ATOM   6990  N N     . GLU C 3 59  ? 53.807  125.371 82.953  1.00   73.24  ? 59  GLU A N     1 
ATOM   6991  C CA    . GLU C 3 59  ? 53.383  125.095 84.323  1.00   80.25  ? 59  GLU A CA    1 
ATOM   6992  C C     . GLU C 3 59  ? 51.893  125.354 84.485  1.00   69.67  ? 59  GLU A C     1 
ATOM   6993  O O     . GLU C 3 59  ? 51.318  126.167 83.759  1.00   68.71  ? 59  GLU A O     1 
ATOM   6994  C CB    . GLU C 3 59  ? 54.179  125.937 85.325  1.00   77.97  ? 59  GLU A CB    1 
ATOM   6995  C CG    . GLU C 3 59  ? 53.618  127.328 85.611  1.00   37.95  ? 59  GLU A CG    1 
ATOM   6996  C CD    . GLU C 3 59  ? 53.902  128.333 84.508  1.00   79.46  ? 59  GLU A CD    1 
ATOM   6997  O OE1   . GLU C 3 59  ? 53.748  129.545 84.762  1.00   96.97  ? 59  GLU A OE1   1 
ATOM   6998  O OE2   . GLU C 3 59  ? 54.143  127.919 83.355  1.00   89.43  ? 59  GLU A OE2   1 
ATOM   6999  N N     . LEU C 3 60  ? 51.269  124.647 85.425  1.00   63.83  ? 60  LEU A N     1 
ATOM   7000  C CA    . LEU C 3 60  ? 49.845  124.828 85.681  1.00   64.09  ? 60  LEU A CA    1 
ATOM   7001  C C     . LEU C 3 60  ? 49.583  126.240 86.192  1.00   64.46  ? 60  LEU A C     1 
ATOM   7002  O O     . LEU C 3 60  ? 50.318  126.757 87.034  1.00   72.42  ? 60  LEU A O     1 
ATOM   7003  C CB    . LEU C 3 60  ? 49.339  123.793 86.686  1.00   57.55  ? 60  LEU A CB    1 
ATOM   7004  C CG    . LEU C 3 60  ? 49.345  122.333 86.228  1.00   61.55  ? 60  LEU A CG    1 
ATOM   7005  C CD1   . LEU C 3 60  ? 49.192  121.392 87.414  1.00   63.62  ? 60  LEU A CD1   1 
ATOM   7006  C CD2   . LEU C 3 60  ? 48.244  122.093 85.208  1.00   57.33  ? 60  LEU A CD2   1 
ATOM   7007  N N     . LEU C 3 61  ? 48.526  126.855 85.675  1.00   53.71  ? 61  LEU A N     1 
ATOM   7008  C CA    . LEU C 3 61  ? 48.240  128.253 85.957  1.00   56.48  ? 61  LEU A CA    1 
ATOM   7009  C C     . LEU C 3 61  ? 47.177  128.459 87.029  1.00   59.05  ? 61  LEU A C     1 
ATOM   7010  O O     . LEU C 3 61  ? 46.960  129.579 87.494  1.00   44.68  ? 61  LEU A O     1 
ATOM   7011  C CB    . LEU C 3 61  ? 47.820  128.952 84.668  1.00   49.75  ? 61  LEU A CB    1 
ATOM   7012  C CG    . LEU C 3 61  ? 48.746  128.709 83.480  1.00   45.15  ? 61  LEU A CG    1 
ATOM   7013  C CD1   . LEU C 3 61  ? 48.195  129.360 82.228  1.00   64.33  ? 61  LEU A CD1   1 
ATOM   7014  C CD2   . LEU C 3 61  ? 50.121  129.260 83.801  1.00   47.19  ? 61  LEU A CD2   1 
ATOM   7015  N N     . ILE C 3 62  ? 46.524  127.379 87.434  1.00   57.74  ? 62  ILE A N     1 
ATOM   7016  C CA    . ILE C 3 62  ? 45.543  127.476 88.499  1.00   60.61  ? 62  ILE A CA    1 
ATOM   7017  C C     . ILE C 3 62  ? 46.218  127.042 89.796  1.00   66.15  ? 62  ILE A C     1 
ATOM   7018  O O     . ILE C 3 62  ? 47.082  126.165 89.787  1.00   57.57  ? 62  ILE A O     1 
ATOM   7019  C CB    . ILE C 3 62  ? 44.302  126.611 88.195  1.00   61.57  ? 62  ILE A CB    1 
ATOM   7020  C CG1   . ILE C 3 62  ? 43.693  127.028 86.853  1.00   41.00  ? 62  ILE A CG1   1 
ATOM   7021  C CG2   . ILE C 3 62  ? 43.275  126.701 89.322  1.00   58.38  ? 62  ILE A CG2   1 
ATOM   7022  C CD1   . ILE C 3 62  ? 42.485  126.222 86.448  1.00   48.03  ? 62  ILE A CD1   1 
ATOM   7023  N N     . ARG C 3 63  ? 45.835  127.664 90.906  1.00   77.79  ? 63  ARG A N     1 
ATOM   7024  C CA    . ARG C 3 63  ? 46.429  127.331 92.191  1.00   51.94  ? 63  ARG A CA    1 
ATOM   7025  C C     . ARG C 3 63  ? 45.984  125.935 92.619  1.00   58.59  ? 63  ARG A C     1 
ATOM   7026  O O     . ARG C 3 63  ? 44.789  125.640 92.668  1.00   61.65  ? 63  ARG A O     1 
ATOM   7027  C CB    . ARG C 3 63  ? 46.054  128.375 93.243  1.00   46.21  ? 63  ARG A CB    1 
ATOM   7028  C CG    . ARG C 3 63  ? 46.759  129.712 93.050  1.00   57.51  ? 63  ARG A CG    1 
ATOM   7029  C CD    . ARG C 3 63  ? 48.233  129.630 93.405  1.00   76.90  ? 63  ARG A CD    1 
ATOM   7030  N NE    . ARG C 3 63  ? 49.062  130.427 92.502  1.00   84.91  ? 63  ARG A NE    1 
ATOM   7031  C CZ    . ARG C 3 63  ? 49.792  129.917 91.515  1.00   89.00  ? 63  ARG A CZ    1 
ATOM   7032  N NH1   . ARG C 3 63  ? 49.799  128.608 91.300  1.00   99.12  ? 63  ARG A NH1   1 
ATOM   7033  N NH2   . ARG C 3 63  ? 50.516  130.715 90.740  1.00   69.97  ? 63  ARG A NH2   1 
ATOM   7034  N N     . LYS C 3 64  ? 46.964  125.082 92.900  1.00   67.57  ? 64  LYS A N     1 
ATOM   7035  C CA    . LYS C 3 64  ? 46.751  123.672 93.227  1.00   56.39  ? 64  LYS A CA    1 
ATOM   7036  C C     . LYS C 3 64  ? 45.681  123.433 94.293  1.00   51.32  ? 64  LYS A C     1 
ATOM   7037  O O     . LYS C 3 64  ? 44.653  122.813 94.021  1.00   54.13  ? 64  LYS A O     1 
ATOM   7038  C CB    . LYS C 3 64  ? 48.074  123.032 93.649  1.00   65.94  ? 64  LYS A CB    1 
ATOM   7039  C CG    . LYS C 3 64  ? 49.133  123.080 92.556  1.00   59.55  ? 64  LYS A CG    1 
ATOM   7040  C CD    . LYS C 3 64  ? 50.419  122.393 92.976  1.00   95.11  ? 64  LYS A CD    1 
ATOM   7041  C CE    . LYS C 3 64  ? 51.553  122.738 92.024  1.00   117.87 ? 64  LYS A CE    1 
ATOM   7042  N NZ    . LYS C 3 64  ? 52.854  122.173 92.475  1.00   110.82 ? 64  LYS A NZ    1 
ATOM   7043  N N     . LEU C 3 65  ? 45.940  123.912 95.505  1.00   63.74  ? 65  LEU A N     1 
ATOM   7044  C CA    . LEU C 3 65  ? 45.069  123.661 96.655  1.00   76.68  ? 65  LEU A CA    1 
ATOM   7045  C C     . LEU C 3 65  ? 43.609  124.138 96.465  1.00   76.01  ? 65  LEU A C     1 
ATOM   7046  O O     . LEU C 3 65  ? 42.690  123.352 96.712  1.00   63.18  ? 65  LEU A O     1 
ATOM   7047  C CB    . LEU C 3 65  ? 45.690  124.287 97.914  1.00   66.23  ? 65  LEU A CB    1 
ATOM   7048  C CG    . LEU C 3 65  ? 45.033  124.011 99.265  1.00   77.89  ? 65  LEU A CG    1 
ATOM   7049  C CD1   . LEU C 3 65  ? 44.990  122.516 99.535  1.00   93.79  ? 65  LEU A CD1   1 
ATOM   7050  C CD2   . LEU C 3 65  ? 45.807  124.721 100.360 1.00   69.77  ? 65  LEU A CD2   1 
ATOM   7051  N N     . PRO C 3 66  ? 43.379  125.414 96.069  1.00   70.43  ? 66  PRO A N     1 
ATOM   7052  C CA    . PRO C 3 66  ? 41.992  125.854 95.848  1.00   42.26  ? 66  PRO A CA    1 
ATOM   7053  C C     . PRO C 3 66  ? 41.226  124.941 94.894  1.00   45.45  ? 66  PRO A C     1 
ATOM   7054  O O     . PRO C 3 66  ? 40.051  124.649 95.110  1.00   60.47  ? 66  PRO A O     1 
ATOM   7055  C CB    . PRO C 3 66  ? 42.156  127.245 95.233  1.00   41.68  ? 66  PRO A CB    1 
ATOM   7056  C CG    . PRO C 3 66  ? 43.438  127.730 95.752  1.00   44.24  ? 66  PRO A CG    1 
ATOM   7057  C CD    . PRO C 3 66  ? 44.328  126.524 95.851  1.00   69.23  ? 66  PRO A CD    1 
ATOM   7058  N N     . PHE C 3 67  ? 41.915  124.492 93.850  1.00   46.13  ? 67  PHE A N     1 
ATOM   7059  C CA    . PHE C 3 67  ? 41.345  123.613 92.836  1.00   51.17  ? 67  PHE A CA    1 
ATOM   7060  C C     . PHE C 3 67  ? 41.039  122.233 93.409  1.00   46.33  ? 67  PHE A C     1 
ATOM   7061  O O     . PHE C 3 67  ? 40.033  121.616 93.062  1.00   45.46  ? 67  PHE A O     1 
ATOM   7062  C CB    . PHE C 3 67  ? 42.302  123.491 91.645  1.00   52.81  ? 67  PHE A CB    1 
ATOM   7063  C CG    . PHE C 3 67  ? 41.805  122.585 90.552  1.00   52.26  ? 67  PHE A CG    1 
ATOM   7064  C CD1   . PHE C 3 67  ? 42.094  121.229 90.567  1.00   46.82  ? 67  PHE A CD1   1 
ATOM   7065  C CD2   . PHE C 3 67  ? 41.055  123.093 89.505  1.00   46.09  ? 67  PHE A CD2   1 
ATOM   7066  C CE1   . PHE C 3 67  ? 41.636  120.397 89.566  1.00   39.08  ? 67  PHE A CE1   1 
ATOM   7067  C CE2   . PHE C 3 67  ? 40.596  122.266 88.499  1.00   38.61  ? 67  PHE A CE2   1 
ATOM   7068  C CZ    . PHE C 3 67  ? 40.887  120.917 88.530  1.00   48.77  ? 67  PHE A CZ    1 
ATOM   7069  N N     . GLN C 3 68  ? 41.916  121.752 94.281  1.00   53.97  ? 68  GLN A N     1 
ATOM   7070  C CA    . GLN C 3 68  ? 41.749  120.445 94.901  1.00   58.89  ? 68  GLN A CA    1 
ATOM   7071  C C     . GLN C 3 68  ? 40.493  120.410 95.772  1.00   63.95  ? 68  GLN A C     1 
ATOM   7072  O O     . GLN C 3 68  ? 39.830  119.378 95.881  1.00   54.60  ? 68  GLN A O     1 
ATOM   7073  C CB    . GLN C 3 68  ? 42.989  120.096 95.731  1.00   67.30  ? 68  GLN A CB    1 
ATOM   7074  C CG    . GLN C 3 68  ? 42.931  118.744 96.417  1.00   92.24  ? 68  GLN A CG    1 
ATOM   7075  C CD    . GLN C 3 68  ? 44.224  118.398 97.132  1.00   104.86 ? 68  GLN A CD    1 
ATOM   7076  O OE1   . GLN C 3 68  ? 44.228  118.116 98.331  1.00   102.49 ? 68  GLN A OE1   1 
ATOM   7077  N NE2   . GLN C 3 68  ? 45.331  118.414 96.397  1.00   111.57 ? 68  GLN A NE2   1 
ATOM   7078  N N     . ARG C 3 69  ? 40.163  121.547 96.377  1.00   86.09  ? 69  ARG A N     1 
ATOM   7079  C CA    . ARG C 3 69  ? 38.949  121.669 97.180  1.00   87.21  ? 69  ARG A CA    1 
ATOM   7080  C C     . ARG C 3 69  ? 37.717  121.674 96.280  1.00   78.21  ? 69  ARG A C     1 
ATOM   7081  O O     . ARG C 3 69  ? 36.685  121.088 96.611  1.00   77.15  ? 69  ARG A O     1 
ATOM   7082  C CB    . ARG C 3 69  ? 38.986  122.947 98.021  1.00   89.24  ? 69  ARG A CB    1 
ATOM   7083  C CG    . ARG C 3 69  ? 40.084  122.974 99.071  1.00   91.68  ? 69  ARG A CG    1 
ATOM   7084  C CD    . ARG C 3 69  ? 39.873  124.108 100.060 1.00   85.47  ? 69  ARG A CD    1 
ATOM   7085  N NE    . ARG C 3 69  ? 39.977  125.417 99.422  1.00   83.78  ? 69  ARG A NE    1 
ATOM   7086  C CZ    . ARG C 3 69  ? 41.061  126.184 99.459  1.00   65.16  ? 69  ARG A CZ    1 
ATOM   7087  N NH1   . ARG C 3 69  ? 42.147  125.771 100.098 1.00   67.16  ? 69  ARG A NH1   1 
ATOM   7088  N NH2   . ARG C 3 69  ? 41.063  127.363 98.850  1.00   61.77  ? 69  ARG A NH2   1 
ATOM   7089  N N     . LEU C 3 70  ? 37.845  122.343 95.138  1.00   73.62  ? 70  LEU A N     1 
ATOM   7090  C CA    . LEU C 3 70  ? 36.794  122.406 94.128  1.00   62.21  ? 70  LEU A CA    1 
ATOM   7091  C C     . LEU C 3 70  ? 36.408  121.017 93.622  1.00   63.98  ? 70  LEU A C     1 
ATOM   7092  O O     . LEU C 3 70  ? 35.226  120.716 93.450  1.00   65.35  ? 70  LEU A O     1 
ATOM   7093  C CB    . LEU C 3 70  ? 37.238  123.287 92.957  1.00   48.80  ? 70  LEU A CB    1 
ATOM   7094  C CG    . LEU C 3 70  ? 36.288  123.381 91.761  1.00   54.02  ? 70  LEU A CG    1 
ATOM   7095  C CD1   . LEU C 3 70  ? 34.951  123.977 92.173  1.00   85.74  ? 70  LEU A CD1   1 
ATOM   7096  C CD2   . LEU C 3 70  ? 36.920  124.194 90.641  1.00   48.77  ? 70  LEU A CD2   1 
ATOM   7097  N N     . VAL C 3 71  ? 37.413  120.183 93.378  1.00   53.72  ? 71  VAL A N     1 
ATOM   7098  C CA    . VAL C 3 71  ? 37.198  118.817 92.913  1.00   54.94  ? 71  VAL A CA    1 
ATOM   7099  C C     . VAL C 3 71  ? 36.363  117.995 93.897  1.00   63.33  ? 71  VAL A C     1 
ATOM   7100  O O     . VAL C 3 71  ? 35.375  117.373 93.504  1.00   54.58  ? 71  VAL A O     1 
ATOM   7101  C CB    . VAL C 3 71  ? 38.541  118.105 92.663  1.00   62.78  ? 71  VAL A CB    1 
ATOM   7102  C CG1   . VAL C 3 71  ? 38.338  116.601 92.541  1.00   80.03  ? 71  VAL A CG1   1 
ATOM   7103  C CG2   . VAL C 3 71  ? 39.205  118.659 91.414  1.00   49.22  ? 71  VAL A CG2   1 
ATOM   7104  N N     . ARG C 3 72  ? 36.757  117.996 95.168  1.00   69.40  ? 72  ARG A N     1 
ATOM   7105  C CA    . ARG C 3 72  ? 36.045  117.229 96.190  1.00   71.83  ? 72  ARG A CA    1 
ATOM   7106  C C     . ARG C 3 72  ? 34.605  117.699 96.372  1.00   82.88  ? 72  ARG A C     1 
ATOM   7107  O O     . ARG C 3 72  ? 33.710  116.877 96.573  1.00   75.43  ? 72  ARG A O     1 
ATOM   7108  C CB    . ARG C 3 72  ? 36.788  117.242 97.528  1.00   81.14  ? 72  ARG A CB    1 
ATOM   7109  C CG    . ARG C 3 72  ? 38.180  116.631 97.459  1.00   93.32  ? 72  ARG A CG    1 
ATOM   7110  C CD    . ARG C 3 72  ? 38.875  116.656 98.809  1.00   113.19 ? 72  ARG A CD    1 
ATOM   7111  N NE    . ARG C 3 72  ? 40.249  116.168 98.726  1.00   89.68  ? 72  ARG A NE    1 
ATOM   7112  C CZ    . ARG C 3 72  ? 41.327  116.922 98.901  1.00   88.83  ? 72  ARG A CZ    1 
ATOM   7113  N NH1   . ARG C 3 72  ? 41.200  118.213 99.178  1.00   86.55  ? 72  ARG A NH1   1 
ATOM   7114  N NH2   . ARG C 3 72  ? 42.534  116.381 98.805  1.00   94.43  ? 72  ARG A NH2   1 
ATOM   7115  N N     . GLU C 3 73  ? 34.383  119.010 96.315  1.00   83.01  ? 73  GLU A N     1 
ATOM   7116  C CA    . GLU C 3 73  ? 33.033  119.552 96.449  1.00   82.77  ? 73  GLU A CA    1 
ATOM   7117  C C     . GLU C 3 73  ? 32.137  119.013 95.347  1.00   75.40  ? 73  GLU A C     1 
ATOM   7118  O O     . GLU C 3 73  ? 31.035  118.535 95.612  1.00   71.34  ? 73  GLU A O     1 
ATOM   7119  C CB    . GLU C 3 73  ? 33.033  121.077 96.374  1.00   85.32  ? 73  GLU A CB    1 
ATOM   7120  C CG    . GLU C 3 73  ? 31.629  121.651 96.216  1.00   100.24 ? 73  GLU A CG    1 
ATOM   7121  C CD    . GLU C 3 73  ? 31.608  123.161 96.175  1.00   129.37 ? 73  GLU A CD    1 
ATOM   7122  O OE1   . GLU C 3 73  ? 32.529  123.779 96.739  1.00   145.25 ? 73  GLU A OE1   1 
ATOM   7123  O OE2   . GLU C 3 73  ? 30.671  123.729 95.574  1.00   117.99 ? 73  GLU A OE2   1 
ATOM   7124  N N     . ILE C 3 74  ? 32.604  119.118 94.109  1.00   72.49  ? 74  ILE A N     1 
ATOM   7125  C CA    . ILE C 3 74  ? 31.857  118.612 92.970  1.00   59.50  ? 74  ILE A CA    1 
ATOM   7126  C C     . ILE C 3 74  ? 31.657  117.106 93.149  1.00   71.19  ? 74  ILE A C     1 
ATOM   7127  O O     . ILE C 3 74  ? 30.615  116.555 92.788  1.00   82.70  ? 74  ILE A O     1 
ATOM   7128  C CB    . ILE C 3 74  ? 32.590  118.911 91.645  1.00   56.91  ? 74  ILE A CB    1 
ATOM   7129  C CG1   . ILE C 3 74  ? 32.581  120.414 91.359  1.00   59.12  ? 74  ILE A CG1   1 
ATOM   7130  C CG2   . ILE C 3 74  ? 31.994  118.111 90.492  1.00   58.78  ? 74  ILE A CG2   1 
ATOM   7131  C CD1   . ILE C 3 74  ? 33.248  120.792 90.059  1.00   50.73  ? 74  ILE A CD1   1 
ATOM   7132  N N     . ALA C 3 75  ? 32.654  116.453 93.744  1.00   65.59  ? 75  ALA A N     1 
ATOM   7133  C CA    . ALA C 3 75  ? 32.633  115.005 93.927  1.00   66.36  ? 75  ALA A CA    1 
ATOM   7134  C C     . ALA C 3 75  ? 31.618  114.591 94.992  1.00   83.90  ? 75  ALA A C     1 
ATOM   7135  O O     . ALA C 3 75  ? 31.150  113.451 95.002  1.00   91.86  ? 75  ALA A O     1 
ATOM   7136  C CB    . ALA C 3 75  ? 34.017  114.502 94.295  1.00   71.83  ? 75  ALA A CB    1 
ATOM   7137  N N     . GLN C 3 76  ? 31.299  115.520 95.890  1.00   82.01  ? 76  GLN A N     1 
ATOM   7138  C CA    . GLN C 3 76  ? 30.351  115.278 96.977  1.00   80.80  ? 76  GLN A CA    1 
ATOM   7139  C C     . GLN C 3 76  ? 29.014  114.781 96.439  1.00   80.61  ? 76  GLN A C     1 
ATOM   7140  O O     . GLN C 3 76  ? 28.361  113.932 97.044  1.00   87.02  ? 76  GLN A O     1 
ATOM   7141  C CB    . GLN C 3 76  ? 30.132  116.549 97.805  1.00   88.89  ? 76  GLN A CB    1 
ATOM   7142  C CG    . GLN C 3 76  ? 31.290  116.933 98.715  1.00   114.39 ? 76  GLN A CG    1 
ATOM   7143  C CD    . GLN C 3 76  ? 31.422  116.022 99.922  1.00   122.59 ? 76  GLN A CD    1 
ATOM   7144  O OE1   . GLN C 3 76  ? 30.523  115.237 100.224 1.00   110.03 ? 76  GLN A OE1   1 
ATOM   7145  N NE2   . GLN C 3 76  ? 32.546  116.130 100.623 1.00   106.63 ? 76  GLN A NE2   1 
ATOM   7146  N N     . ASP C 3 77  ? 28.624  115.320 95.288  1.00   83.43  ? 77  ASP A N     1 
ATOM   7147  C CA    . ASP C 3 77  ? 27.319  115.044 94.699  1.00   94.58  ? 77  ASP A CA    1 
ATOM   7148  C C     . ASP C 3 77  ? 27.211  113.661 94.054  1.00   81.53  ? 77  ASP A C     1 
ATOM   7149  O O     . ASP C 3 77  ? 26.180  113.325 93.472  1.00   88.34  ? 77  ASP A O     1 
ATOM   7150  C CB    . ASP C 3 77  ? 27.002  116.115 93.652  1.00   99.92  ? 77  ASP A CB    1 
ATOM   7151  C CG    . ASP C 3 77  ? 27.045  117.520 94.226  1.00   107.78 ? 77  ASP A CG    1 
ATOM   7152  O OD1   . ASP C 3 77  ? 27.513  117.682 95.374  1.00   69.39  ? 77  ASP A OD1   1 
ATOM   7153  O OD2   . ASP C 3 77  ? 26.622  118.463 93.525  1.00   145.91 ? 77  ASP A OD2   1 
ATOM   7154  N N     . PHE C 3 78  ? 28.268  112.862 94.156  1.00   69.77  ? 78  PHE A N     1 
ATOM   7155  C CA    . PHE C 3 78  ? 28.276  111.540 93.539  1.00   76.02  ? 78  PHE A CA    1 
ATOM   7156  C C     . PHE C 3 78  ? 28.403  110.438 94.584  1.00   92.17  ? 78  PHE A C     1 
ATOM   7157  O O     . PHE C 3 78  ? 27.700  109.428 94.532  1.00   95.81  ? 78  PHE A O     1 
ATOM   7158  C CB    . PHE C 3 78  ? 29.419  111.425 92.529  1.00   81.17  ? 78  PHE A CB    1 
ATOM   7159  C CG    . PHE C 3 78  ? 29.400  112.483 91.466  1.00   77.55  ? 78  PHE A CG    1 
ATOM   7160  C CD1   . PHE C 3 78  ? 28.392  112.511 90.517  1.00   65.03  ? 78  PHE A CD1   1 
ATOM   7161  C CD2   . PHE C 3 78  ? 30.388  113.453 91.417  1.00   78.45  ? 78  PHE A CD2   1 
ATOM   7162  C CE1   . PHE C 3 78  ? 28.372  113.482 89.536  1.00   52.89  ? 78  PHE A CE1   1 
ATOM   7163  C CE2   . PHE C 3 78  ? 30.372  114.428 90.438  1.00   73.34  ? 78  PHE A CE2   1 
ATOM   7164  C CZ    . PHE C 3 78  ? 29.362  114.442 89.497  1.00   67.35  ? 78  PHE A CZ    1 
ATOM   7165  N N     . LYS C 3 79  ? 29.311  110.644 95.531  1.00   93.27  ? 79  LYS A N     1 
ATOM   7166  C CA    . LYS C 3 79  ? 29.537  109.693 96.611  1.00   80.16  ? 79  LYS A CA    1 
ATOM   7167  C C     . LYS C 3 79  ? 30.042  110.382 97.871  1.00   91.88  ? 79  LYS A C     1 
ATOM   7168  O O     . LYS C 3 79  ? 30.886  111.277 97.808  1.00   84.14  ? 79  LYS A O     1 
ATOM   7169  C CB    . LYS C 3 79  ? 30.528  108.610 96.183  1.00   103.71 ? 79  LYS A CB    1 
ATOM   7170  C CG    . LYS C 3 79  ? 30.610  107.439 97.152  1.00   111.54 ? 79  LYS A CG    1 
ATOM   7171  C CD    . LYS C 3 79  ? 31.459  106.306 96.598  1.00   92.43  ? 79  LYS A CD    1 
ATOM   7172  C CE    . LYS C 3 79  ? 31.451  105.108 97.533  1.00   96.31  ? 79  LYS A CE    1 
ATOM   7173  N NZ    . LYS C 3 79  ? 32.381  104.040 97.074  1.00   107.82 ? 79  LYS A NZ    1 
ATOM   7174  N N     . THR C 3 80  ? 29.516  109.963 99.016  1.00   103.75 ? 80  THR A N     1 
ATOM   7175  C CA    . THR C 3 80  ? 29.866  110.578 100.287 1.00   122.66 ? 80  THR A CA    1 
ATOM   7176  C C     . THR C 3 80  ? 31.196  109.993 100.757 1.00   131.63 ? 80  THR A C     1 
ATOM   7177  O O     . THR C 3 80  ? 31.432  108.789 100.628 1.00   123.21 ? 80  THR A O     1 
ATOM   7178  C CB    . THR C 3 80  ? 28.776  110.360 101.355 1.00   119.52 ? 80  THR A CB    1 
ATOM   7179  O OG1   . THR C 3 80  ? 29.291  110.706 102.647 1.00   140.75 ? 80  THR A OG1   1 
ATOM   7180  C CG2   . THR C 3 80  ? 28.315  108.909 101.367 1.00   114.97 ? 80  THR A CG2   1 
ATOM   7181  N N     . ASP C 3 81  ? 32.060  110.856 101.286 1.00   106.73 ? 81  ASP A N     1 
ATOM   7182  C CA    . ASP C 3 81  ? 33.363  110.454 101.814 1.00   103.51 ? 81  ASP A CA    1 
ATOM   7183  C C     . ASP C 3 81  ? 34.243  109.760 100.767 1.00   114.25 ? 81  ASP A C     1 
ATOM   7184  O O     . ASP C 3 81  ? 34.645  108.607 100.929 1.00   96.15  ? 81  ASP A O     1 
ATOM   7185  C CB    . ASP C 3 81  ? 33.188  109.544 103.035 1.00   134.65 ? 81  ASP A CB    1 
ATOM   7186  C CG    . ASP C 3 81  ? 34.480  109.347 103.807 1.00   170.01 ? 81  ASP A CG    1 
ATOM   7187  O OD1   . ASP C 3 81  ? 35.315  110.277 103.818 1.00   173.35 ? 81  ASP A OD1   1 
ATOM   7188  O OD2   . ASP C 3 81  ? 34.662  108.263 104.400 1.00   180.95 ? 81  ASP A OD2   1 
ATOM   7189  N N     . LEU C 3 82  ? 34.517  110.481 99.683  1.00   115.33 ? 82  LEU A N     1 
ATOM   7190  C CA    . LEU C 3 82  ? 35.391  110.010 98.610  1.00   80.79  ? 82  LEU A CA    1 
ATOM   7191  C C     . LEU C 3 82  ? 36.843  110.327 98.952  1.00   86.64  ? 82  LEU A C     1 
ATOM   7192  O O     . LEU C 3 82  ? 37.140  111.387 99.506  1.00   75.25  ? 82  LEU A O     1 
ATOM   7193  C CB    . LEU C 3 82  ? 35.015  110.634 97.266  1.00   73.00  ? 82  LEU A CB    1 
ATOM   7194  C CG    . LEU C 3 82  ? 33.876  109.956 96.507  1.00   88.51  ? 82  LEU A CG    1 
ATOM   7195  C CD1   . LEU C 3 82  ? 33.450  110.791 95.310  1.00   79.86  ? 82  LEU A CD1   1 
ATOM   7196  C CD2   . LEU C 3 82  ? 34.298  108.563 96.067  1.00   63.08  ? 82  LEU A CD2   1 
ATOM   7197  N N     . ARG C 3 83  ? 37.742  109.407 98.620  1.00   92.94  ? 83  ARG A N     1 
ATOM   7198  C CA    . ARG C 3 83  ? 39.170  109.658 98.767  1.00   89.93  ? 83  ARG A CA    1 
ATOM   7199  C C     . ARG C 3 83  ? 39.825  109.842 97.398  1.00   68.93  ? 83  ARG A C     1 
ATOM   7200  O O     . ARG C 3 83  ? 39.387  109.254 96.410  1.00   56.58  ? 83  ARG A O     1 
ATOM   7201  C CB    . ARG C 3 83  ? 39.824  108.485 99.503  1.00   92.49  ? 83  ARG A CB    1 
ATOM   7202  C CG    . ARG C 3 83  ? 41.020  108.831 100.364 1.00   95.25  ? 83  ARG A CG    1 
ATOM   7203  C CD    . ARG C 3 83  ? 41.221  107.766 101.436 1.00   121.75 ? 83  ARG A CD    1 
ATOM   7204  N NE    . ARG C 3 83  ? 40.083  107.660 102.345 1.00   139.08 ? 83  ARG A NE    1 
ATOM   7205  C CZ    . ARG C 3 83  ? 39.966  108.334 103.484 1.00   138.84 ? 83  ARG A CZ    1 
ATOM   7206  N NH1   . ARG C 3 83  ? 40.927  109.163 103.869 1.00   103.73 ? 83  ARG A NH1   1 
ATOM   7207  N NH2   . ARG C 3 83  ? 38.889  108.174 104.243 1.00   124.46 ? 83  ARG A NH2   1 
ATOM   7208  N N     . PHE C 3 84  ? 40.870  110.662 97.338  1.00   53.04  ? 84  PHE A N     1 
ATOM   7209  C CA    . PHE C 3 84  ? 41.525  110.940 96.063  1.00   65.91  ? 84  PHE A CA    1 
ATOM   7210  C C     . PHE C 3 84  ? 43.023  110.648 96.075  1.00   72.05  ? 84  PHE A C     1 
ATOM   7211  O O     . PHE C 3 84  ? 43.739  111.061 96.988  1.00   56.44  ? 84  PHE A O     1 
ATOM   7212  C CB    . PHE C 3 84  ? 41.311  112.407 95.679  1.00   85.91  ? 84  PHE A CB    1 
ATOM   7213  C CG    . PHE C 3 84  ? 39.953  112.702 95.114  1.00   80.47  ? 84  PHE A CG    1 
ATOM   7214  C CD1   . PHE C 3 84  ? 39.422  111.924 94.102  1.00   72.85  ? 84  PHE A CD1   1 
ATOM   7215  C CD2   . PHE C 3 84  ? 39.205  113.762 95.599  1.00   84.84  ? 84  PHE A CD2   1 
ATOM   7216  C CE1   . PHE C 3 84  ? 38.173  112.200 93.580  1.00   64.18  ? 84  PHE A CE1   1 
ATOM   7217  C CE2   . PHE C 3 84  ? 37.955  114.039 95.084  1.00   84.17  ? 84  PHE A CE2   1 
ATOM   7218  C CZ    . PHE C 3 84  ? 37.439  113.256 94.073  1.00   83.45  ? 84  PHE A CZ    1 
ATOM   7219  N N     . GLN C 3 85  ? 43.498  109.953 95.047  1.00   64.80  ? 85  GLN A N     1 
ATOM   7220  C CA    . GLN C 3 85  ? 44.929  109.846 94.802  1.00   72.92  ? 85  GLN A CA    1 
ATOM   7221  C C     . GLN C 3 85  ? 45.469  111.216 94.413  1.00   59.58  ? 85  GLN A C     1 
ATOM   7222  O O     . GLN C 3 85  ? 44.785  111.973 93.727  1.00   57.02  ? 85  GLN A O     1 
ATOM   7223  C CB    . GLN C 3 85  ? 45.236  108.820 93.710  1.00   86.38  ? 85  GLN A CB    1 
ATOM   7224  C CG    . GLN C 3 85  ? 45.127  107.373 94.165  1.00   84.58  ? 85  GLN A CG    1 
ATOM   7225  C CD    . GLN C 3 85  ? 45.525  106.389 93.082  1.00   91.33  ? 85  GLN A CD    1 
ATOM   7226  O OE1   . GLN C 3 85  ? 45.660  106.754 91.914  1.00   100.57 ? 85  GLN A OE1   1 
ATOM   7227  N NE2   . GLN C 3 85  ? 45.712  105.131 93.465  1.00   87.64  ? 85  GLN A NE2   1 
ATOM   7228  N N     . SER C 3 86  ? 46.676  111.542 94.864  1.00   80.60  ? 86  SER A N     1 
ATOM   7229  C CA    . SER C 3 86  ? 47.286  112.829 94.538  1.00   75.92  ? 86  SER A CA    1 
ATOM   7230  C C     . SER C 3 86  ? 47.324  113.024 93.026  1.00   69.67  ? 86  SER A C     1 
ATOM   7231  O O     . SER C 3 86  ? 47.039  114.109 92.519  1.00   80.11  ? 86  SER A O     1 
ATOM   7232  C CB    . SER C 3 86  ? 48.698  112.927 95.121  1.00   81.10  ? 86  SER A CB    1 
ATOM   7233  O OG    . SER C 3 86  ? 48.682  112.774 96.529  1.00   108.31 ? 86  SER A OG    1 
ATOM   7234  N N     . SER C 3 87  ? 47.676  111.957 92.316  1.00   77.44  ? 87  SER A N     1 
ATOM   7235  C CA    . SER C 3 87  ? 47.791  111.988 90.863  1.00   81.74  ? 87  SER A CA    1 
ATOM   7236  C C     . SER C 3 87  ? 46.436  112.174 90.183  1.00   72.30  ? 87  SER A C     1 
ATOM   7237  O O     . SER C 3 87  ? 46.355  112.733 89.088  1.00   68.63  ? 87  SER A O     1 
ATOM   7238  C CB    . SER C 3 87  ? 48.457  110.704 90.357  1.00   103.48 ? 87  SER A CB    1 
ATOM   7239  O OG    . SER C 3 87  ? 47.848  109.552 90.919  1.00   82.02  ? 87  SER A OG    1 
ATOM   7240  N N     . ALA C 3 88  ? 45.375  111.695 90.826  1.00   59.30  ? 88  ALA A N     1 
ATOM   7241  C CA    . ALA C 3 88  ? 44.029  111.851 90.286  1.00   53.95  ? 88  ALA A CA    1 
ATOM   7242  C C     . ALA C 3 88  ? 43.616  113.319 90.238  1.00   57.37  ? 88  ALA A C     1 
ATOM   7243  O O     . ALA C 3 88  ? 42.979  113.763 89.284  1.00   58.80  ? 88  ALA A O     1 
ATOM   7244  C CB    . ALA C 3 88  ? 43.032  111.047 91.107  1.00   58.42  ? 88  ALA A CB    1 
ATOM   7245  N N     . VAL C 3 89  ? 43.987  114.069 91.271  1.00   58.76  ? 89  VAL A N     1 
ATOM   7246  C CA    . VAL C 3 89  ? 43.684  115.493 91.324  1.00   46.12  ? 89  VAL A CA    1 
ATOM   7247  C C     . VAL C 3 89  ? 44.515  116.250 90.294  1.00   61.64  ? 89  VAL A C     1 
ATOM   7248  O O     . VAL C 3 89  ? 44.037  117.200 89.673  1.00   76.41  ? 89  VAL A O     1 
ATOM   7249  C CB    . VAL C 3 89  ? 43.944  116.076 92.728  1.00   57.36  ? 89  VAL A CB    1 
ATOM   7250  C CG1   . VAL C 3 89  ? 43.567  117.548 92.775  1.00   64.57  ? 89  VAL A CG1   1 
ATOM   7251  C CG2   . VAL C 3 89  ? 43.170  115.294 93.777  1.00   62.39  ? 89  VAL A CG2   1 
ATOM   7252  N N     . MET C 3 90  ? 45.757  115.814 90.106  1.00   60.85  ? 90  MET A N     1 
ATOM   7253  C CA    . MET C 3 90  ? 46.640  116.440 89.131  1.00   48.22  ? 90  MET A CA    1 
ATOM   7254  C C     . MET C 3 90  ? 46.149  116.176 87.717  1.00   47.16  ? 90  MET A C     1 
ATOM   7255  O O     . MET C 3 90  ? 46.148  117.074 86.875  1.00   54.33  ? 90  MET A O     1 
ATOM   7256  C CB    . MET C 3 90  ? 48.074  115.936 89.291  1.00   55.16  ? 90  MET A CB    1 
ATOM   7257  C CG    . MET C 3 90  ? 48.778  116.462 90.526  1.00   54.06  ? 90  MET A CG    1 
ATOM   7258  S SD    . MET C 3 90  ? 48.796  118.263 90.547  1.00   94.13  ? 90  MET A SD    1 
ATOM   7259  C CE    . MET C 3 90  ? 49.746  118.579 92.033  1.00   113.07 ? 90  MET A CE    1 
ATOM   7260  N N     . ALA C 3 91  ? 45.749  114.935 87.457  1.00   38.39  ? 91  ALA A N     1 
ATOM   7261  C CA    . ALA C 3 91  ? 45.232  114.572 86.146  1.00   45.64  ? 91  ALA A CA    1 
ATOM   7262  C C     . ALA C 3 91  ? 44.010  115.413 85.802  1.00   56.31  ? 91  ALA A C     1 
ATOM   7263  O O     . ALA C 3 91  ? 43.805  115.786 84.647  1.00   62.87  ? 91  ALA A O     1 
ATOM   7264  C CB    . ALA C 3 91  ? 44.891  113.092 86.099  1.00   50.21  ? 91  ALA A CB    1 
ATOM   7265  N N     . LEU C 3 92  ? 43.201  115.719 86.812  1.00   70.07  ? 92  LEU A N     1 
ATOM   7266  C CA    . LEU C 3 92  ? 42.025  116.550 86.600  1.00   63.68  ? 92  LEU A CA    1 
ATOM   7267  C C     . LEU C 3 92  ? 42.414  117.989 86.288  1.00   47.88  ? 92  LEU A C     1 
ATOM   7268  O O     . LEU C 3 92  ? 41.846  118.606 85.390  1.00   54.72  ? 92  LEU A O     1 
ATOM   7269  C CB    . LEU C 3 92  ? 41.113  116.511 87.829  1.00   56.30  ? 92  LEU A CB    1 
ATOM   7270  C CG    . LEU C 3 92  ? 40.232  115.270 87.987  1.00   40.75  ? 92  LEU A CG    1 
ATOM   7271  C CD1   . LEU C 3 92  ? 39.569  115.260 89.352  1.00   46.45  ? 92  LEU A CD1   1 
ATOM   7272  C CD2   . LEU C 3 92  ? 39.193  115.203 86.883  1.00   66.64  ? 92  LEU A CD2   1 
ATOM   7273  N N     . GLN C 3 93  ? 43.383  118.517 87.032  1.00   36.86  ? 93  GLN A N     1 
ATOM   7274  C CA    . GLN C 3 93  ? 43.833  119.891 86.836  1.00   44.06  ? 93  GLN A CA    1 
ATOM   7275  C C     . GLN C 3 93  ? 44.531  120.069 85.492  1.00   51.30  ? 93  GLN A C     1 
ATOM   7276  O O     . GLN C 3 93  ? 44.338  121.080 84.812  1.00   40.50  ? 93  GLN A O     1 
ATOM   7277  C CB    . GLN C 3 93  ? 44.743  120.343 87.979  1.00   43.13  ? 93  GLN A CB    1 
ATOM   7278  C CG    . GLN C 3 93  ? 45.022  121.840 87.950  1.00   44.02  ? 93  GLN A CG    1 
ATOM   7279  C CD    . GLN C 3 93  ? 45.795  122.327 89.156  1.00   45.14  ? 93  GLN A CD    1 
ATOM   7280  O OE1   . GLN C 3 93  ? 46.163  121.544 90.032  1.00   58.94  ? 93  GLN A OE1   1 
ATOM   7281  N NE2   . GLN C 3 93  ? 46.031  123.632 89.216  1.00   44.16  ? 93  GLN A NE2   1 
ATOM   7282  N N     . GLU C 3 94  ? 45.356  119.089 85.127  1.00   51.36  ? 94  GLU A N     1 
ATOM   7283  C CA    . GLU C 3 94  ? 46.024  119.086 83.830  1.00   52.66  ? 94  GLU A CA    1 
ATOM   7284  C C     . GLU C 3 94  ? 44.993  119.133 82.711  1.00   50.86  ? 94  GLU A C     1 
ATOM   7285  O O     . GLU C 3 94  ? 45.096  119.941 81.788  1.00   52.78  ? 94  GLU A O     1 
ATOM   7286  C CB    . GLU C 3 94  ? 46.918  117.851 83.680  1.00   36.43  ? 94  GLU A CB    1 
ATOM   7287  C CG    . GLU C 3 94  ? 48.228  117.900 84.472  1.00   70.90  ? 94  GLU A CG    1 
ATOM   7288  C CD    . GLU C 3 94  ? 49.219  118.937 83.950  1.00   77.34  ? 94  GLU A CD    1 
ATOM   7289  O OE1   . GLU C 3 94  ? 49.015  119.471 82.838  1.00   61.22  ? 94  GLU A OE1   1 
ATOM   7290  O OE2   . GLU C 3 94  ? 50.210  119.219 84.658  1.00   67.81  ? 94  GLU A OE2   1 
ATOM   7291  N N     . ALA C 3 95  ? 44.001  118.255 82.806  1.00   43.28  ? 95  ALA A N     1 
ATOM   7292  C CA    . ALA C 3 95  ? 42.931  118.169 81.818  1.00   46.60  ? 95  ALA A CA    1 
ATOM   7293  C C     . ALA C 3 95  ? 42.053  119.423 81.800  1.00   53.59  ? 95  ALA A C     1 
ATOM   7294  O O     . ALA C 3 95  ? 41.594  119.855 80.742  1.00   52.94  ? 95  ALA A O     1 
ATOM   7295  C CB    . ALA C 3 95  ? 42.080  116.936 82.079  1.00   41.60  ? 95  ALA A CB    1 
ATOM   7296  N N     . SER C 3 96  ? 41.826  120.002 82.976  1.00   58.35  ? 96  SER A N     1 
ATOM   7297  C CA    . SER C 3 96  ? 40.979  121.185 83.109  1.00   46.70  ? 96  SER A CA    1 
ATOM   7298  C C     . SER C 3 96  ? 41.596  122.418 82.460  1.00   48.85  ? 96  SER A C     1 
ATOM   7299  O O     . SER C 3 96  ? 40.920  123.138 81.727  1.00   60.99  ? 96  SER A O     1 
ATOM   7300  C CB    . SER C 3 96  ? 40.688  121.468 84.584  1.00   48.49  ? 96  SER A CB    1 
ATOM   7301  O OG    . SER C 3 96  ? 39.875  120.450 85.142  1.00   53.89  ? 96  SER A OG    1 
ATOM   7302  N N     . GLU C 3 97  ? 42.874  122.661 82.733  1.00   48.08  ? 97  GLU A N     1 
ATOM   7303  C CA    . GLU C 3 97  ? 43.563  123.821 82.174  1.00   49.97  ? 97  GLU A CA    1 
ATOM   7304  C C     . GLU C 3 97  ? 43.727  123.672 80.666  1.00   55.23  ? 97  GLU A C     1 
ATOM   7305  O O     . GLU C 3 97  ? 43.565  124.637 79.920  1.00   48.39  ? 97  GLU A O     1 
ATOM   7306  C CB    . GLU C 3 97  ? 44.926  124.032 82.835  1.00   61.24  ? 97  GLU A CB    1 
ATOM   7307  C CG    . GLU C 3 97  ? 44.863  124.339 84.321  1.00   68.94  ? 97  GLU A CG    1 
ATOM   7308  C CD    . GLU C 3 97  ? 46.147  124.963 84.838  1.00   74.40  ? 97  GLU A CD    1 
ATOM   7309  O OE1   . GLU C 3 97  ? 46.976  125.397 84.008  1.00   62.14  ? 97  GLU A OE1   1 
ATOM   7310  O OE2   . GLU C 3 97  ? 46.326  125.025 86.072  1.00   76.55  ? 97  GLU A OE2   1 
ATOM   7311  N N     . ALA C 3 98  ? 44.058  122.462 80.228  1.00   57.64  ? 98  ALA A N     1 
ATOM   7312  C CA    . ALA C 3 98  ? 44.188  122.168 78.805  1.00   57.24  ? 98  ALA A CA    1 
ATOM   7313  C C     . ALA C 3 98  ? 42.882  122.419 78.057  1.00   52.36  ? 98  ALA A C     1 
ATOM   7314  O O     . ALA C 3 98  ? 42.897  122.901 76.924  1.00   67.57  ? 98  ALA A O     1 
ATOM   7315  C CB    . ALA C 3 98  ? 44.640  120.730 78.604  1.00   78.58  ? 98  ALA A CB    1 
ATOM   7316  N N     . TYR C 3 99  ? 41.758  122.095 78.688  1.00   48.85  ? 99  TYR A N     1 
ATOM   7317  C CA    . TYR C 3 99  ? 40.447  122.318 78.082  1.00   55.73  ? 99  TYR A CA    1 
ATOM   7318  C C     . TYR C 3 99  ? 40.150  123.805 77.939  1.00   48.55  ? 99  TYR A C     1 
ATOM   7319  O O     . TYR C 3 99  ? 39.761  124.275 76.870  1.00   51.57  ? 99  TYR A O     1 
ATOM   7320  C CB    . TYR C 3 99  ? 39.335  121.653 78.898  1.00   53.20  ? 99  TYR A CB    1 
ATOM   7321  C CG    . TYR C 3 99  ? 37.946  122.120 78.508  1.00   43.80  ? 99  TYR A CG    1 
ATOM   7322  C CD1   . TYR C 3 99  ? 37.290  121.569 77.415  1.00   42.66  ? 99  TYR A CD1   1 
ATOM   7323  C CD2   . TYR C 3 99  ? 37.291  123.110 79.233  1.00   55.84  ? 99  TYR A CD2   1 
ATOM   7324  C CE1   . TYR C 3 99  ? 36.024  121.993 77.051  1.00   69.78  ? 99  TYR A CE1   1 
ATOM   7325  C CE2   . TYR C 3 99  ? 36.023  123.542 78.876  1.00   61.05  ? 99  TYR A CE2   1 
ATOM   7326  C CZ    . TYR C 3 99  ? 35.394  122.979 77.784  1.00   80.03  ? 99  TYR A CZ    1 
ATOM   7327  O OH    . TYR C 3 99  ? 34.132  123.400 77.425  1.00   55.19  ? 99  TYR A OH    1 
ATOM   7328  N N     . LEU C 3 100 ? 40.332  124.534 79.034  1.00   43.36  ? 100 LEU A N     1 
ATOM   7329  C CA    . LEU C 3 100 ? 40.054  125.963 79.075  1.00   45.44  ? 100 LEU A CA    1 
ATOM   7330  C C     . LEU C 3 100 ? 40.965  126.757 78.146  1.00   39.11  ? 100 LEU A C     1 
ATOM   7331  O O     . LEU C 3 100 ? 40.501  127.651 77.442  1.00   47.28  ? 100 LEU A O     1 
ATOM   7332  C CB    . LEU C 3 100 ? 40.193  126.483 80.509  1.00   52.11  ? 100 LEU A CB    1 
ATOM   7333  C CG    . LEU C 3 100 ? 39.111  126.042 81.500  1.00   42.56  ? 100 LEU A CG    1 
ATOM   7334  C CD1   . LEU C 3 100 ? 39.421  126.554 82.896  1.00   35.92  ? 100 LEU A CD1   1 
ATOM   7335  C CD2   . LEU C 3 100 ? 37.738  126.510 81.048  1.00   45.12  ? 100 LEU A CD2   1 
ATOM   7336  N N     . VAL C 3 101 ? 42.256  126.437 78.156  1.00   42.87  ? 101 VAL A N     1 
ATOM   7337  C CA    . VAL C 3 101 ? 43.224  127.112 77.293  1.00   56.73  ? 101 VAL A CA    1 
ATOM   7338  C C     . VAL C 3 101 ? 42.813  127.007 75.826  1.00   54.29  ? 101 VAL A C     1 
ATOM   7339  O O     . VAL C 3 101 ? 42.805  128.008 75.106  1.00   69.75  ? 101 VAL A O     1 
ATOM   7340  C CB    . VAL C 3 101 ? 44.647  126.558 77.474  1.00   56.83  ? 101 VAL A CB    1 
ATOM   7341  C CG1   . VAL C 3 101 ? 45.520  126.964 76.302  1.00   64.50  ? 101 VAL A CG1   1 
ATOM   7342  C CG2   . VAL C 3 101 ? 45.251  127.077 78.767  1.00   54.58  ? 101 VAL A CG2   1 
ATOM   7343  N N     . GLY C 3 102 ? 42.476  125.798 75.386  1.00   41.84  ? 102 GLY A N     1 
ATOM   7344  C CA    . GLY C 3 102 ? 42.040  125.592 74.017  1.00   56.03  ? 102 GLY A CA    1 
ATOM   7345  C C     . GLY C 3 102 ? 40.757  126.357 73.748  1.00   49.42  ? 102 GLY A C     1 
ATOM   7346  O O     . GLY C 3 102 ? 40.584  126.935 72.675  1.00   43.04  ? 102 GLY A O     1 
ATOM   7347  N N     . LEU C 3 103 ? 39.852  126.349 74.723  1.00   51.44  ? 103 LEU A N     1 
ATOM   7348  C CA    . LEU C 3 103 ? 38.595  127.084 74.615  1.00   52.13  ? 103 LEU A CA    1 
ATOM   7349  C C     . LEU C 3 103 ? 38.825  128.583 74.422  1.00   40.94  ? 103 LEU A C     1 
ATOM   7350  O O     . LEU C 3 103 ? 38.106  129.239 73.669  1.00   37.26  ? 103 LEU A O     1 
ATOM   7351  C CB    . LEU C 3 103 ? 37.731  126.847 75.855  1.00   34.49  ? 103 LEU A CB    1 
ATOM   7352  C CG    . LEU C 3 103 ? 36.396  127.593 75.920  1.00   29.58  ? 103 LEU A CG    1 
ATOM   7353  C CD1   . LEU C 3 103 ? 35.531  127.305 74.704  1.00   38.01  ? 103 LEU A CD1   1 
ATOM   7354  C CD2   . LEU C 3 103 ? 35.659  127.234 77.199  1.00   53.26  ? 103 LEU A CD2   1 
ATOM   7355  N N     . PHE C 3 104 ? 39.830  129.121 75.103  1.00   39.09  ? 104 PHE A N     1 
ATOM   7356  C CA    . PHE C 3 104 ? 40.155  130.534 74.966  1.00   48.67  ? 104 PHE A CA    1 
ATOM   7357  C C     . PHE C 3 104 ? 40.698  130.835 73.572  1.00   61.62  ? 104 PHE A C     1 
ATOM   7358  O O     . PHE C 3 104 ? 40.470  131.919 73.032  1.00   75.42  ? 104 PHE A O     1 
ATOM   7359  C CB    . PHE C 3 104 ? 41.148  130.965 76.048  1.00   43.26  ? 104 PHE A CB    1 
ATOM   7360  C CG    . PHE C 3 104 ? 40.495  131.276 77.368  1.00   62.61  ? 104 PHE A CG    1 
ATOM   7361  C CD1   . PHE C 3 104 ? 39.623  132.349 77.489  1.00   64.20  ? 104 PHE A CD1   1 
ATOM   7362  C CD2   . PHE C 3 104 ? 40.743  130.492 78.483  1.00   49.85  ? 104 PHE A CD2   1 
ATOM   7363  C CE1   . PHE C 3 104 ? 39.012  132.637 78.698  1.00   39.57  ? 104 PHE A CE1   1 
ATOM   7364  C CE2   . PHE C 3 104 ? 40.135  130.774 79.697  1.00   62.60  ? 104 PHE A CE2   1 
ATOM   7365  C CZ    . PHE C 3 104 ? 39.269  131.849 79.804  1.00   42.59  ? 104 PHE A CZ    1 
ATOM   7366  N N     . GLU C 3 105 ? 41.427  129.879 73.002  1.00   55.95  ? 105 GLU A N     1 
ATOM   7367  C CA    . GLU C 3 105 ? 41.927  130.004 71.635  1.00   59.72  ? 105 GLU A CA    1 
ATOM   7368  C C     . GLU C 3 105 ? 40.771  130.166 70.654  1.00   60.21  ? 105 GLU A C     1 
ATOM   7369  O O     . GLU C 3 105 ? 40.829  130.991 69.742  1.00   62.70  ? 105 GLU A O     1 
ATOM   7370  C CB    . GLU C 3 105 ? 42.797  128.808 71.245  1.00   79.21  ? 105 GLU A CB    1 
ATOM   7371  C CG    . GLU C 3 105 ? 44.017  128.609 72.132  1.00   89.41  ? 105 GLU A CG    1 
ATOM   7372  C CD    . GLU C 3 105 ? 44.828  127.389 71.740  1.00   89.11  ? 105 GLU A CD    1 
ATOM   7373  O OE1   . GLU C 3 105 ? 44.483  126.745 70.726  1.00   101.22 ? 105 GLU A OE1   1 
ATOM   7374  O OE2   . GLU C 3 105 ? 45.819  127.084 72.437  1.00   82.06  ? 105 GLU A OE2   1 
ATOM   7375  N N     . ASP C 3 106 ? 39.723  129.370 70.847  1.00   58.31  ? 106 ASP A N     1 
ATOM   7376  C CA    . ASP C 3 106 ? 38.541  129.440 69.996  1.00   50.44  ? 106 ASP A CA    1 
ATOM   7377  C C     . ASP C 3 106 ? 37.739  130.700 70.288  1.00   48.25  ? 106 ASP A C     1 
ATOM   7378  O O     . ASP C 3 106 ? 37.238  131.350 69.370  1.00   56.67  ? 106 ASP A O     1 
ATOM   7379  C CB    . ASP C 3 106 ? 37.655  128.210 70.203  1.00   54.96  ? 106 ASP A CB    1 
ATOM   7380  C CG    . ASP C 3 106 ? 38.309  126.929 69.726  1.00   87.87  ? 106 ASP A CG    1 
ATOM   7381  O OD1   . ASP C 3 106 ? 39.450  126.993 69.221  1.00   99.87  ? 106 ASP A OD1   1 
ATOM   7382  O OD2   . ASP C 3 106 ? 37.683  125.855 69.867  1.00   79.07  ? 106 ASP A OD2   1 
ATOM   7383  N N     . THR C 3 107 ? 37.619  131.039 71.568  1.00   47.97  ? 107 THR A N     1 
ATOM   7384  C CA    . THR C 3 107 ? 36.943  132.265 71.980  1.00   60.77  ? 107 THR A CA    1 
ATOM   7385  C C     . THR C 3 107 ? 37.610  133.487 71.350  1.00   54.86  ? 107 THR A C     1 
ATOM   7386  O O     . THR C 3 107 ? 36.939  134.439 70.947  1.00   46.40  ? 107 THR A O     1 
ATOM   7387  C CB    . THR C 3 107 ? 36.939  132.410 73.516  1.00   61.35  ? 107 THR A CB    1 
ATOM   7388  O OG1   . THR C 3 107 ? 36.232  131.308 74.098  1.00   56.57  ? 107 THR A OG1   1 
ATOM   7389  C CG2   . THR C 3 107 ? 36.278  133.714 73.941  1.00   52.75  ? 107 THR A CG2   1 
ATOM   7390  N N     . ASN C 3 108 ? 38.935  133.443 71.259  1.00   42.53  ? 108 ASN A N     1 
ATOM   7391  C CA    . ASN C 3 108 ? 39.700  134.540 70.686  1.00   39.85  ? 108 ASN A CA    1 
ATOM   7392  C C     . ASN C 3 108 ? 39.372  134.723 69.211  1.00   43.09  ? 108 ASN A C     1 
ATOM   7393  O O     . ASN C 3 108 ? 39.186  135.844 68.741  1.00   43.15  ? 108 ASN A O     1 
ATOM   7394  C CB    . ASN C 3 108 ? 41.199  134.310 70.871  1.00   55.02  ? 108 ASN A CB    1 
ATOM   7395  C CG    . ASN C 3 108 ? 42.002  135.595 70.770  1.00   60.67  ? 108 ASN A CG    1 
ATOM   7396  O OD1   . ASN C 3 108 ? 41.512  136.676 71.097  1.00   38.35  ? 108 ASN A OD1   1 
ATOM   7397  N ND2   . ASN C 3 108 ? 43.244  135.481 70.315  1.00   92.37  ? 108 ASN A ND2   1 
ATOM   7398  N N     . LEU C 3 109 ? 39.315  133.611 68.483  1.00   52.20  ? 109 LEU A N     1 
ATOM   7399  C CA    . LEU C 3 109 ? 39.014  133.646 67.056  1.00   66.21  ? 109 LEU A CA    1 
ATOM   7400  C C     . LEU C 3 109 ? 37.619  134.201 66.801  1.00   67.66  ? 109 LEU A C     1 
ATOM   7401  O O     . LEU C 3 109 ? 37.377  134.866 65.794  1.00   64.66  ? 109 LEU A O     1 
ATOM   7402  C CB    . LEU C 3 109 ? 39.129  132.246 66.444  1.00   41.63  ? 109 LEU A CB    1 
ATOM   7403  C CG    . LEU C 3 109 ? 40.500  131.569 66.468  1.00   63.75  ? 109 LEU A CG    1 
ATOM   7404  C CD1   . LEU C 3 109 ? 40.413  130.182 65.853  1.00   73.91  ? 109 LEU A CD1   1 
ATOM   7405  C CD2   . LEU C 3 109 ? 41.539  132.415 65.747  1.00   81.75  ? 109 LEU A CD2   1 
ATOM   7406  N N     . CYS C 3 110 ? 36.708  133.929 67.728  1.00   54.68  ? 110 CYS A N     1 
ATOM   7407  C CA    . CYS C 3 110 ? 35.341  134.408 67.607  1.00   41.29  ? 110 CYS A CA    1 
ATOM   7408  C C     . CYS C 3 110 ? 35.274  135.916 67.818  1.00   46.17  ? 110 CYS A C     1 
ATOM   7409  O O     . CYS C 3 110 ? 34.600  136.624 67.071  1.00   56.47  ? 110 CYS A O     1 
ATOM   7410  C CB    . CYS C 3 110 ? 34.439  133.684 68.605  1.00   54.67  ? 110 CYS A CB    1 
ATOM   7411  S SG    . CYS C 3 110 ? 34.133  131.946 68.183  1.00   58.78  ? 110 CYS A SG    1 
ATOM   7412  N N     . ALA C 3 111 ? 35.965  136.395 68.848  1.00   50.61  ? 111 ALA A N     1 
ATOM   7413  C CA    . ALA C 3 111 ? 36.064  137.828 69.115  1.00   49.77  ? 111 ALA A CA    1 
ATOM   7414  C C     . ALA C 3 111 ? 36.654  138.582 67.932  1.00   40.22  ? 111 ALA A C     1 
ATOM   7415  O O     . ALA C 3 111 ? 36.091  139.576 67.474  1.00   40.67  ? 111 ALA A O     1 
ATOM   7416  C CB    . ALA C 3 111 ? 36.898  138.078 70.364  1.00   44.10  ? 111 ALA A CB    1 
ATOM   7417  N N     . ILE C 3 112 ? 37.794  138.096 67.449  1.00   44.81  ? 112 ILE A N     1 
ATOM   7418  C CA    . ILE C 3 112 ? 38.478  138.684 66.301  1.00   48.93  ? 112 ILE A CA    1 
ATOM   7419  C C     . ILE C 3 112 ? 37.596  138.682 65.057  1.00   51.30  ? 112 ILE A C     1 
ATOM   7420  O O     . ILE C 3 112 ? 37.596  139.640 64.279  1.00   42.00  ? 112 ILE A O     1 
ATOM   7421  C CB    . ILE C 3 112 ? 39.789  137.929 66.003  1.00   46.32  ? 112 ILE A CB    1 
ATOM   7422  C CG1   . ILE C 3 112 ? 40.774  138.102 67.160  1.00   49.15  ? 112 ILE A CG1   1 
ATOM   7423  C CG2   . ILE C 3 112 ? 40.407  138.404 64.698  1.00   55.56  ? 112 ILE A CG2   1 
ATOM   7424  C CD1   . ILE C 3 112 ? 42.052  137.323 66.986  1.00   61.55  ? 112 ILE A CD1   1 
ATOM   7425  N N     . HIS C 3 113 ? 36.836  137.604 64.888  1.00   58.43  ? 113 HIS A N     1 
ATOM   7426  C CA    . HIS C 3 113 ? 35.923  137.467 63.759  1.00   63.50  ? 113 HIS A CA    1 
ATOM   7427  C C     . HIS C 3 113 ? 34.896  138.594 63.755  1.00   47.00  ? 113 HIS A C     1 
ATOM   7428  O O     . HIS C 3 113 ? 34.464  139.055 62.700  1.00   42.94  ? 113 HIS A O     1 
ATOM   7429  C CB    . HIS C 3 113 ? 35.222  136.112 63.786  1.00   49.88  ? 113 HIS A CB    1 
ATOM   7430  C CG    . HIS C 3 113 ? 34.262  135.913 62.656  1.00   50.04  ? 113 HIS A CG    1 
ATOM   7431  N ND1   . HIS C 3 113 ? 34.671  135.547 61.392  1.00   53.95  ? 113 HIS A ND1   1 
ATOM   7432  C CD2   . HIS C 3 113 ? 32.914  136.018 62.599  1.00   66.16  ? 113 HIS A CD2   1 
ATOM   7433  C CE1   . HIS C 3 113 ? 33.617  135.441 60.604  1.00   57.98  ? 113 HIS A CE1   1 
ATOM   7434  N NE2   . HIS C 3 113 ? 32.538  135.720 61.312  1.00   64.22  ? 113 HIS A NE2   1 
ATOM   7435  N N     . ALA C 3 114 ? 34.505  139.022 64.950  1.00   43.11  ? 114 ALA A N     1 
ATOM   7436  C CA    . ALA C 3 114 ? 33.538  140.098 65.100  1.00   56.38  ? 114 ALA A CA    1 
ATOM   7437  C C     . ALA C 3 114 ? 34.238  141.454 65.138  1.00   51.53  ? 114 ALA A C     1 
ATOM   7438  O O     . ALA C 3 114 ? 33.689  142.428 65.657  1.00   51.23  ? 114 ALA A O     1 
ATOM   7439  C CB    . ALA C 3 114 ? 32.708  139.890 66.358  1.00   68.96  ? 114 ALA A CB    1 
ATOM   7440  N N     . LYS C 3 115 ? 35.451  141.499 64.589  1.00   43.10  ? 115 LYS A N     1 
ATOM   7441  C CA    . LYS C 3 115 ? 36.263  142.714 64.542  1.00   43.29  ? 115 LYS A CA    1 
ATOM   7442  C C     . LYS C 3 115 ? 36.489  143.315 65.926  1.00   56.00  ? 115 LYS A C     1 
ATOM   7443  O O     . LYS C 3 115 ? 36.354  144.524 66.117  1.00   88.76  ? 115 LYS A O     1 
ATOM   7444  C CB    . LYS C 3 115 ? 35.620  143.752 63.620  1.00   70.12  ? 115 LYS A CB    1 
ATOM   7445  C CG    . LYS C 3 115 ? 35.394  143.264 62.199  1.00   68.90  ? 115 LYS A CG    1 
ATOM   7446  C CD    . LYS C 3 115 ? 36.713  143.005 61.491  1.00   95.11  ? 115 LYS A CD    1 
ATOM   7447  C CE    . LYS C 3 115 ? 36.494  142.622 60.037  1.00   124.18 ? 115 LYS A CE    1 
ATOM   7448  N NZ    . LYS C 3 115 ? 35.843  143.720 59.268  1.00   141.33 ? 115 LYS A NZ    1 
ATOM   7449  N N     . ARG C 3 116 ? 36.838  142.465 66.885  1.00   49.68  ? 116 ARG A N     1 
ATOM   7450  C CA    . ARG C 3 116 ? 37.172  142.912 68.232  1.00   40.57  ? 116 ARG A CA    1 
ATOM   7451  C C     . ARG C 3 116 ? 38.485  142.296 68.695  1.00   51.77  ? 116 ARG A C     1 
ATOM   7452  O O     . ARG C 3 116 ? 38.984  141.347 68.092  1.00   68.87  ? 116 ARG A O     1 
ATOM   7453  C CB    . ARG C 3 116 ? 36.057  142.552 69.216  1.00   26.52  ? 116 ARG A CB    1 
ATOM   7454  C CG    . ARG C 3 116 ? 34.800  143.386 69.079  1.00   50.29  ? 116 ARG A CG    1 
ATOM   7455  C CD    . ARG C 3 116 ? 33.785  143.034 70.159  1.00   60.79  ? 116 ARG A CD    1 
ATOM   7456  N NE    . ARG C 3 116 ? 33.064  141.801 69.856  1.00   57.87  ? 116 ARG A NE    1 
ATOM   7457  C CZ    . ARG C 3 116 ? 33.308  140.629 70.433  1.00   54.59  ? 116 ARG A CZ    1 
ATOM   7458  N NH1   . ARG C 3 116 ? 34.256  140.523 71.354  1.00   35.85  ? 116 ARG A NH1   1 
ATOM   7459  N NH2   . ARG C 3 116 ? 32.600  139.561 70.090  1.00   61.54  ? 116 ARG A NH2   1 
ATOM   7460  N N     . VAL C 3 117 ? 39.048  142.846 69.764  1.00   44.75  ? 117 VAL A N     1 
ATOM   7461  C CA    . VAL C 3 117 ? 40.262  142.291 70.341  1.00   35.25  ? 117 VAL A CA    1 
ATOM   7462  C C     . VAL C 3 117 ? 39.982  141.923 71.789  1.00   39.88  ? 117 VAL A C     1 
ATOM   7463  O O     . VAL C 3 117 ? 40.862  141.447 72.506  1.00   52.39  ? 117 VAL A O     1 
ATOM   7464  C CB    . VAL C 3 117 ? 41.443  143.279 70.271  1.00   33.20  ? 117 VAL A CB    1 
ATOM   7465  C CG1   . VAL C 3 117 ? 41.807  143.566 68.823  1.00   38.88  ? 117 VAL A CG1   1 
ATOM   7466  C CG2   . VAL C 3 117 ? 41.106  144.568 70.997  1.00   43.44  ? 117 VAL A CG2   1 
ATOM   7467  N N     . THR C 3 118 ? 38.738  142.143 72.205  1.00   38.47  ? 118 THR A N     1 
ATOM   7468  C CA    . THR C 3 118 ? 38.303  141.840 73.563  1.00   44.10  ? 118 THR A CA    1 
ATOM   7469  C C     . THR C 3 118 ? 37.341  140.660 73.588  1.00   32.33  ? 118 THR A C     1 
ATOM   7470  O O     . THR C 3 118 ? 36.248  140.744 73.031  1.00   41.09  ? 118 THR A O     1 
ATOM   7471  C CB    . THR C 3 118 ? 37.611  143.050 74.216  1.00   48.38  ? 118 THR A CB    1 
ATOM   7472  O OG1   . THR C 3 118 ? 38.460  144.202 74.130  1.00   47.01  ? 118 THR A OG1   1 
ATOM   7473  C CG2   . THR C 3 118 ? 37.291  142.759 75.675  1.00   58.85  ? 118 THR A CG2   1 
ATOM   7474  N N     . ILE C 3 119 ? 37.736  139.560 74.222  1.00   40.62  ? 119 ILE A N     1 
ATOM   7475  C CA    . ILE C 3 119 ? 36.832  138.421 74.328  1.00   46.60  ? 119 ILE A CA    1 
ATOM   7476  C C     . ILE C 3 119 ? 35.672  138.768 75.257  1.00   47.62  ? 119 ILE A C     1 
ATOM   7477  O O     . ILE C 3 119 ? 35.851  139.399 76.299  1.00   55.44  ? 119 ILE A O     1 
ATOM   7478  C CB    . ILE C 3 119 ? 37.546  137.140 74.821  1.00   45.39  ? 119 ILE A CB    1 
ATOM   7479  C CG1   . ILE C 3 119 ? 38.075  137.311 76.247  1.00   45.37  ? 119 ILE A CG1   1 
ATOM   7480  C CG2   . ILE C 3 119 ? 38.676  136.769 73.877  1.00   53.54  ? 119 ILE A CG2   1 
ATOM   7481  C CD1   . ILE C 3 119 ? 38.584  136.027 76.863  1.00   46.63  ? 119 ILE A CD1   1 
ATOM   7482  N N     . MET C 3 120 ? 34.475  138.371 74.846  1.00   44.86  ? 120 MET A N     1 
ATOM   7483  C CA    . MET C 3 120 ? 33.257  138.655 75.590  1.00   45.36  ? 120 MET A CA    1 
ATOM   7484  C C     . MET C 3 120 ? 32.443  137.382 75.793  1.00   65.42  ? 120 MET A C     1 
ATOM   7485  O O     . MET C 3 120 ? 32.697  136.380 75.127  1.00   49.11  ? 120 MET A O     1 
ATOM   7486  C CB    . MET C 3 120 ? 32.426  139.718 74.860  1.00   54.61  ? 120 MET A CB    1 
ATOM   7487  C CG    . MET C 3 120 ? 33.173  141.000 74.561  1.00   49.23  ? 120 MET A CG    1 
ATOM   7488  S SD    . MET C 3 120 ? 32.136  142.192 73.703  1.00   61.89  ? 120 MET A SD    1 
ATOM   7489  C CE    . MET C 3 120 ? 33.140  143.670 73.850  1.00   77.28  ? 120 MET A CE    1 
ATOM   7490  N N     . PRO C 3 121 ? 31.493  137.401 76.745  1.00   75.34  ? 121 PRO A N     1 
ATOM   7491  C CA    . PRO C 3 121 ? 30.646  136.234 77.007  1.00   64.08  ? 121 PRO A CA    1 
ATOM   7492  C C     . PRO C 3 121 ? 30.048  135.646 75.731  1.00   72.84  ? 121 PRO A C     1 
ATOM   7493  O O     . PRO C 3 121 ? 29.997  134.427 75.579  1.00   67.92  ? 121 PRO A O     1 
ATOM   7494  C CB    . PRO C 3 121 ? 29.553  136.801 77.911  1.00   92.13  ? 121 PRO A CB    1 
ATOM   7495  C CG    . PRO C 3 121 ? 30.233  137.879 78.654  1.00   89.83  ? 121 PRO A CG    1 
ATOM   7496  C CD    . PRO C 3 121 ? 31.222  138.490 77.704  1.00   72.03  ? 121 PRO A CD    1 
ATOM   7497  N N     . LYS C 3 122 ? 29.602  136.514 74.828  1.00   92.63  ? 122 LYS A N     1 
ATOM   7498  C CA    . LYS C 3 122 ? 28.995  136.084 73.573  1.00   86.94  ? 122 LYS A CA    1 
ATOM   7499  C C     . LYS C 3 122 ? 29.989  135.351 72.671  1.00   73.58  ? 122 LYS A C     1 
ATOM   7500  O O     . LYS C 3 122 ? 29.599  134.553 71.817  1.00   82.50  ? 122 LYS A O     1 
ATOM   7501  C CB    . LYS C 3 122 ? 28.428  137.308 72.843  1.00   84.28  ? 122 LYS A CB    1 
ATOM   7502  C CG    . LYS C 3 122 ? 27.820  137.035 71.478  1.00   127.02 ? 122 LYS A CG    1 
ATOM   7503  C CD    . LYS C 3 122 ? 27.549  138.327 70.711  1.00   144.89 ? 122 LYS A CD    1 
ATOM   7504  C CE    . LYS C 3 122 ? 28.817  139.159 70.519  1.00   118.76 ? 122 LYS A CE    1 
ATOM   7505  N NZ    . LYS C 3 122 ? 29.006  140.196 71.575  1.00   110.44 ? 122 LYS A NZ    1 
ATOM   7506  N N     . ASP C 3 123 ? 31.276  135.603 72.886  1.00   64.46  ? 123 ASP A N     1 
ATOM   7507  C CA    . ASP C 3 123 ? 32.336  134.914 72.155  1.00   53.02  ? 123 ASP A CA    1 
ATOM   7508  C C     . ASP C 3 123 ? 32.496  133.466 72.614  1.00   57.68  ? 123 ASP A C     1 
ATOM   7509  O O     . ASP C 3 123 ? 32.646  132.558 71.796  1.00   56.90  ? 123 ASP A O     1 
ATOM   7510  C CB    . ASP C 3 123 ? 33.651  135.674 72.294  1.00   56.75  ? 123 ASP A CB    1 
ATOM   7511  C CG    . ASP C 3 123 ? 33.622  137.006 71.577  1.00   53.49  ? 123 ASP A CG    1 
ATOM   7512  O OD1   . ASP C 3 123 ? 32.981  137.088 70.508  1.00   56.11  ? 123 ASP A OD1   1 
ATOM   7513  O OD2   . ASP C 3 123 ? 34.218  137.976 72.089  1.00   51.63  ? 123 ASP A OD2   1 
ATOM   7514  N N     . ILE C 3 124 ? 32.467  133.263 73.928  1.00   55.03  ? 124 ILE A N     1 
ATOM   7515  C CA    . ILE C 3 124 ? 32.550  131.926 74.508  1.00   47.28  ? 124 ILE A CA    1 
ATOM   7516  C C     . ILE C 3 124 ? 31.356  131.081 74.086  1.00   50.28  ? 124 ILE A C     1 
ATOM   7517  O O     . ILE C 3 124 ? 31.497  129.899 73.775  1.00   46.13  ? 124 ILE A O     1 
ATOM   7518  C CB    . ILE C 3 124 ? 32.607  131.965 76.052  1.00   39.98  ? 124 ILE A CB    1 
ATOM   7519  C CG1   . ILE C 3 124 ? 33.850  132.707 76.536  1.00   37.82  ? 124 ILE A CG1   1 
ATOM   7520  C CG2   . ILE C 3 124 ? 32.607  130.561 76.626  1.00   45.43  ? 124 ILE A CG2   1 
ATOM   7521  C CD1   . ILE C 3 124 ? 34.010  132.678 78.045  1.00   28.78  ? 124 ILE A CD1   1 
ATOM   7522  N N     . GLN C 3 125 ? 30.185  131.704 74.043  1.00   58.19  ? 125 GLN A N     1 
ATOM   7523  C CA    . GLN C 3 125 ? 28.961  130.991 73.709  1.00   66.47  ? 125 GLN A CA    1 
ATOM   7524  C C     . GLN C 3 125 ? 28.982  130.471 72.279  1.00   58.82  ? 125 GLN A C     1 
ATOM   7525  O O     . GLN C 3 125 ? 28.563  129.343 72.025  1.00   57.91  ? 125 GLN A O     1 
ATOM   7526  C CB    . GLN C 3 125 ? 27.741  131.900 73.904  1.00   90.53  ? 125 GLN A CB    1 
ATOM   7527  C CG    . GLN C 3 125 ? 27.547  132.436 75.317  1.00   84.78  ? 125 GLN A CG    1 
ATOM   7528  C CD    . GLN C 3 125 ? 27.066  131.377 76.295  1.00   128.42 ? 125 GLN A CD    1 
ATOM   7529  O OE1   . GLN C 3 125 ? 26.789  130.238 75.914  1.00   137.66 ? 125 GLN A OE1   1 
ATOM   7530  N NE2   . GLN C 3 125 ? 26.955  131.754 77.563  1.00   130.85 ? 125 GLN A NE2   1 
ATOM   7531  N N     . LEU C 3 126 ? 29.455  131.292 71.345  1.00   72.62  ? 126 LEU A N     1 
ATOM   7532  C CA    . LEU C 3 126 ? 29.545  130.861 69.953  1.00   67.15  ? 126 LEU A CA    1 
ATOM   7533  C C     . LEU C 3 126 ? 30.508  129.694 69.770  1.00   50.58  ? 126 LEU A C     1 
ATOM   7534  O O     . LEU C 3 126 ? 30.171  128.704 69.120  1.00   50.30  ? 126 LEU A O     1 
ATOM   7535  C CB    . LEU C 3 126 ? 29.984  132.025 69.062  1.00   48.66  ? 126 LEU A CB    1 
ATOM   7536  C CG    . LEU C 3 126 ? 30.324  131.661 67.614  1.00   36.15  ? 126 LEU A CG    1 
ATOM   7537  C CD1   . LEU C 3 126 ? 29.136  131.001 66.920  1.00   40.92  ? 126 LEU A CD1   1 
ATOM   7538  C CD2   . LEU C 3 126 ? 30.792  132.881 66.843  1.00   43.53  ? 126 LEU A CD2   1 
ATOM   7539  N N     . ALA C 3 127 ? 31.707  129.823 70.333  1.00   52.79  ? 127 ALA A N     1 
ATOM   7540  C CA    . ALA C 3 127 ? 32.718  128.774 70.231  1.00   60.37  ? 127 ALA A CA    1 
ATOM   7541  C C     . ALA C 3 127 ? 32.205  127.437 70.759  1.00   50.41  ? 127 ALA A C     1 
ATOM   7542  O O     . ALA C 3 127 ? 32.319  126.408 70.098  1.00   48.53  ? 127 ALA A O     1 
ATOM   7543  C CB    . ALA C 3 127 ? 33.981  129.186 70.975  1.00   57.48  ? 127 ALA A CB    1 
ATOM   7544  N N     . ARG C 3 128 ? 31.625  127.475 71.953  1.00   45.35  ? 128 ARG A N     1 
ATOM   7545  C CA    . ARG C 3 128 ? 31.101  126.280 72.604  1.00   43.29  ? 128 ARG A CA    1 
ATOM   7546  C C     . ARG C 3 128 ? 29.922  125.681 71.855  1.00   49.47  ? 128 ARG A C     1 
ATOM   7547  O O     . ARG C 3 128 ? 29.766  124.464 71.814  1.00   65.41  ? 128 ARG A O     1 
ATOM   7548  C CB    . ARG C 3 128 ? 30.715  126.564 74.058  1.00   61.20  ? 128 ARG A CB    1 
ATOM   7549  C CG    . ARG C 3 128 ? 31.885  127.015 74.921  1.00   64.34  ? 128 ARG A CG    1 
ATOM   7550  C CD    . ARG C 3 128 ? 31.497  127.128 76.384  1.00   58.95  ? 128 ARG A CD    1 
ATOM   7551  N NE    . ARG C 3 128 ? 31.024  125.852 76.911  1.00   62.87  ? 128 ARG A NE    1 
ATOM   7552  C CZ    . ARG C 3 128 ? 29.829  125.663 77.460  1.00   54.06  ? 128 ARG A CZ    1 
ATOM   7553  N NH1   . ARG C 3 128 ? 28.977  126.674 77.559  1.00   83.89  ? 128 ARG A NH1   1 
ATOM   7554  N NH2   . ARG C 3 128 ? 29.490  124.464 77.912  1.00   42.85  ? 128 ARG A NH2   1 
ATOM   7555  N N     . ARG C 3 129 ? 29.088  126.536 71.270  1.00   61.79  ? 129 ARG A N     1 
ATOM   7556  C CA    . ARG C 3 129 ? 27.950  126.055 70.498  1.00   56.65  ? 129 ARG A CA    1 
ATOM   7557  C C     . ARG C 3 129 ? 28.394  125.248 69.284  1.00   60.65  ? 129 ARG A C     1 
ATOM   7558  O O     . ARG C 3 129 ? 27.884  124.150 69.062  1.00   81.72  ? 129 ARG A O     1 
ATOM   7559  C CB    . ARG C 3 129 ? 27.083  127.241 70.061  1.00   44.96  ? 129 ARG A CB    1 
ATOM   7560  C CG    . ARG C 3 129 ? 26.205  127.010 68.835  1.00   78.42  ? 129 ARG A CG    1 
ATOM   7561  C CD    . ARG C 3 129 ? 25.173  125.910 69.036  1.00   100.88 ? 129 ARG A CD    1 
ATOM   7562  N NE    . ARG C 3 129 ? 24.352  125.730 67.841  1.00   119.25 ? 129 ARG A NE    1 
ATOM   7563  C CZ    . ARG C 3 129 ? 24.677  124.938 66.823  1.00   131.13 ? 129 ARG A CZ    1 
ATOM   7564  N NH1   . ARG C 3 129 ? 23.869  124.835 65.776  1.00   144.80 ? 129 ARG A NH1   1 
ATOM   7565  N NH2   . ARG C 3 129 ? 25.810  124.249 66.850  1.00   110.40 ? 129 ARG A NH2   1 
ATOM   7566  N N     . ILE C 3 130 ? 29.320  125.778 68.491  1.00   61.48  ? 130 ILE A N     1 
ATOM   7567  C CA    . ILE C 3 130 ? 29.823  125.020 67.351  1.00   64.43  ? 130 ILE A CA    1 
ATOM   7568  C C     . ILE C 3 130 ? 30.445  123.707 67.832  1.00   61.19  ? 130 ILE A C     1 
ATOM   7569  O O     . ILE C 3 130 ? 30.269  122.652 67.222  1.00   60.44  ? 130 ILE A O     1 
ATOM   7570  C CB    . ILE C 3 130 ? 30.860  125.831 66.551  1.00   57.49  ? 130 ILE A CB    1 
ATOM   7571  C CG1   . ILE C 3 130 ? 30.239  127.138 66.055  1.00   29.69  ? 130 ILE A CG1   1 
ATOM   7572  C CG2   . ILE C 3 130 ? 31.398  125.014 65.386  1.00   80.70  ? 130 ILE A CG2   1 
ATOM   7573  C CD1   . ILE C 3 130 ? 31.190  128.006 65.274  1.00   46.33  ? 130 ILE A CD1   1 
ATOM   7574  N N     . ARG C 3 131 ? 31.170  123.800 68.944  1.00   64.99  ? 131 ARG A N     1 
ATOM   7575  C CA    . ARG C 3 131 ? 31.822  122.659 69.579  1.00   55.26  ? 131 ARG A CA    1 
ATOM   7576  C C     . ARG C 3 131 ? 30.825  121.623 70.095  1.00   55.92  ? 131 ARG A C     1 
ATOM   7577  O O     . ARG C 3 131 ? 31.041  120.420 69.964  1.00   47.86  ? 131 ARG A O     1 
ATOM   7578  C CB    . ARG C 3 131 ? 32.724  123.152 70.716  1.00   66.04  ? 131 ARG A CB    1 
ATOM   7579  C CG    . ARG C 3 131 ? 34.012  123.776 70.206  1.00   71.28  ? 131 ARG A CG    1 
ATOM   7580  C CD    . ARG C 3 131 ? 34.976  124.202 71.306  1.00   73.76  ? 131 ARG A CD    1 
ATOM   7581  N NE    . ARG C 3 131 ? 35.508  123.080 72.070  1.00   99.95  ? 131 ARG A NE    1 
ATOM   7582  C CZ    . ARG C 3 131 ? 36.241  123.215 73.169  1.00   85.83  ? 131 ARG A CZ    1 
ATOM   7583  N NH1   . ARG C 3 131 ? 36.545  124.424 73.618  1.00   75.02  ? 131 ARG A NH1   1 
ATOM   7584  N NH2   . ARG C 3 131 ? 36.688  122.144 73.808  1.00   99.85  ? 131 ARG A NH2   1 
ATOM   7585  N N     . GLY C 3 132 ? 29.738  122.110 70.689  1.00   65.19  ? 132 GLY A N     1 
ATOM   7586  C CA    . GLY C 3 132 ? 28.706  121.260 71.257  1.00   48.34  ? 132 GLY A CA    1 
ATOM   7587  C C     . GLY C 3 132 ? 28.620  121.451 72.762  1.00   63.74  ? 132 GLY A C     1 
ATOM   7588  O O     . GLY C 3 132 ? 29.415  122.197 73.337  1.00   57.73  ? 132 GLY A O     1 
ATOM   7589  N N     . GLU C 3 133 ? 27.654  120.786 73.396  1.00   101.69 ? 133 GLU A N     1 
ATOM   7590  C CA    . GLU C 3 133 ? 27.452  120.877 74.846  1.00   102.14 ? 133 GLU A CA    1 
ATOM   7591  C C     . GLU C 3 133 ? 27.178  122.309 75.300  1.00   83.95  ? 133 GLU A C     1 
ATOM   7592  O O     . GLU C 3 133 ? 27.954  122.881 76.066  1.00   91.81  ? 133 GLU A O     1 
ATOM   7593  C CB    . GLU C 3 133 ? 28.650  120.306 75.614  1.00   136.51 ? 133 GLU A CB    1 
ATOM   7594  C CG    . GLU C 3 133 ? 28.339  120.001 77.079  1.00   137.77 ? 133 GLU A CG    1 
ATOM   7595  C CD    . GLU C 3 133 ? 29.494  119.348 77.809  1.00   141.52 ? 133 GLU A CD    1 
ATOM   7596  O OE1   . GLU C 3 133 ? 30.604  119.282 77.240  1.00   139.61 ? 133 GLU A OE1   1 
ATOM   7597  O OE2   . GLU C 3 133 ? 29.291  118.903 78.959  1.00   142.57 ? 133 GLU A OE2   1 
ATOM   7598  N N     . ARG C 3 134 ? 26.096  122.898 74.801  1.00   100.24 ? 134 ARG A N     1 
ATOM   7599  C CA    . ARG C 3 134 ? 25.742  124.266 75.168  1.00   103.60 ? 134 ARG A CA    1 
ATOM   7600  C C     . ARG C 3 134 ? 25.509  124.381 76.670  1.00   83.58  ? 134 ARG A C     1 
ATOM   7601  O O     . ARG C 3 134 ? 24.938  123.481 77.290  1.00   70.29  ? 134 ARG A O     1 
ATOM   7602  C CB    . ARG C 3 134 ? 24.490  124.721 74.418  1.00   110.92 ? 134 ARG A CB    1 
ATOM   7603  C CG    . ARG C 3 134 ? 24.457  124.334 72.952  1.00   123.93 ? 134 ARG A CG    1 
ATOM   7604  C CD    . ARG C 3 134 ? 23.046  124.453 72.402  1.00   116.95 ? 134 ARG A CD    1 
ATOM   7605  N NE    . ARG C 3 134 ? 22.655  125.844 72.197  1.00   98.85  ? 134 ARG A NE    1 
ATOM   7606  C CZ    . ARG C 3 134 ? 21.403  126.248 72.016  1.00   109.85 ? 134 ARG A CZ    1 
ATOM   7607  N NH1   . ARG C 3 134 ? 20.413  125.369 72.040  1.00   96.78  ? 134 ARG A NH1   1 
ATOM   7608  N NH2   . ARG C 3 134 ? 21.139  127.535 71.836  1.00   151.17 ? 134 ARG A NH2   1 
ATOM   7609  N N     . ALA C 3 135 ? 25.968  125.495 77.239  1.00   85.42  ? 135 ALA A N     1 
ATOM   7610  C CA    . ALA C 3 135 ? 25.925  125.735 78.679  1.00   89.43  ? 135 ALA A CA    1 
ATOM   7611  C C     . ALA C 3 135 ? 26.638  124.626 79.451  1.00   102.88 ? 135 ALA A C     1 
ATOM   7612  O O     . ALA C 3 135 ? 25.999  123.771 80.065  1.00   97.47  ? 135 ALA A O     1 
ATOM   7613  C CB    . ALA C 3 135 ? 24.492  125.875 79.152  1.00   114.66 ? 135 ALA A CB    1 
ATOM   7614  N N     . ASN D 4 25  ? 33.330  128.412 97.590  1.00   141.15 ? 25  ASN B N     1 
ATOM   7615  C CA    . ASN D 4 25  ? 34.744  128.188 97.311  1.00   164.33 ? 25  ASN B CA    1 
ATOM   7616  C C     . ASN D 4 25  ? 35.032  128.111 95.814  1.00   145.09 ? 25  ASN B C     1 
ATOM   7617  O O     . ASN D 4 25  ? 36.192  128.104 95.399  1.00   125.48 ? 25  ASN B O     1 
ATOM   7618  C CB    . ASN D 4 25  ? 35.234  126.922 98.013  1.00   185.24 ? 25  ASN B CB    1 
ATOM   7619  C CG    . ASN D 4 25  ? 34.246  125.787 97.916  1.00   171.51 ? 25  ASN B CG    1 
ATOM   7620  O OD1   . ASN D 4 25  ? 33.167  125.836 98.509  1.00   167.10 ? 25  ASN B OD1   1 
ATOM   7621  N ND2   . ASN D 4 25  ? 34.605  124.751 97.166  1.00   144.38 ? 25  ASN B ND2   1 
ATOM   7622  N N     . ILE D 4 26  ? 33.976  128.047 95.006  1.00   138.50 ? 26  ILE B N     1 
ATOM   7623  C CA    . ILE D 4 26  ? 34.129  127.995 93.555  1.00   133.30 ? 26  ILE B CA    1 
ATOM   7624  C C     . ILE D 4 26  ? 34.655  129.353 93.101  1.00   119.26 ? 26  ILE B C     1 
ATOM   7625  O O     . ILE D 4 26  ? 35.183  129.503 92.004  1.00   89.42  ? 26  ILE B O     1 
ATOM   7626  C CB    . ILE D 4 26  ? 32.810  127.650 92.829  1.00   143.26 ? 26  ILE B CB    1 
ATOM   7627  C CG1   . ILE D 4 26  ? 33.094  127.249 91.378  1.00   112.45 ? 26  ILE B CG1   1 
ATOM   7628  C CG2   . ILE D 4 26  ? 31.830  128.816 92.894  1.00   131.37 ? 26  ILE B CG2   1 
ATOM   7629  C CD1   . ILE D 4 26  ? 31.871  126.828 90.605  1.00   90.24  ? 26  ILE B CD1   1 
ATOM   7630  N N     . GLN D 4 27  ? 34.484  130.345 93.969  1.00   119.67 ? 27  GLN B N     1 
ATOM   7631  C CA    . GLN D 4 27  ? 34.996  131.691 93.760  1.00   96.62  ? 27  GLN B CA    1 
ATOM   7632  C C     . GLN D 4 27  ? 36.516  131.688 93.914  1.00   93.20  ? 27  GLN B C     1 
ATOM   7633  O O     . GLN D 4 27  ? 37.182  132.676 93.609  1.00   101.85 ? 27  GLN B O     1 
ATOM   7634  C CB    . GLN D 4 27  ? 34.355  132.674 94.740  1.00   120.12 ? 27  GLN B CB    1 
ATOM   7635  C CG    . GLN D 4 27  ? 32.856  132.867 94.539  1.00   140.31 ? 27  GLN B CG    1 
ATOM   7636  C CD    . GLN D 4 27  ? 32.498  133.292 93.126  1.00   122.16 ? 27  GLN B CD    1 
ATOM   7637  O OE1   . GLN D 4 27  ? 33.225  134.057 92.491  1.00   117.90 ? 27  GLN B OE1   1 
ATOM   7638  N NE2   . GLN D 4 27  ? 31.371  132.795 92.627  1.00   92.91  ? 27  GLN B NE2   1 
ATOM   7639  N N     . GLY D 4 28  ? 37.049  130.565 94.394  1.00   98.82  ? 28  GLY B N     1 
ATOM   7640  C CA    . GLY D 4 28  ? 38.481  130.368 94.543  1.00   80.30  ? 28  GLY B CA    1 
ATOM   7641  C C     . GLY D 4 28  ? 39.257  130.402 93.238  1.00   77.03  ? 28  GLY B C     1 
ATOM   7642  O O     . GLY D 4 28  ? 40.372  130.917 93.206  1.00   73.15  ? 28  GLY B O     1 
ATOM   7643  N N     . ILE D 4 29  ? 38.702  129.835 92.171  1.00   76.13  ? 29  ILE B N     1 
ATOM   7644  C CA    . ILE D 4 29  ? 39.346  129.951 90.866  1.00   62.12  ? 29  ILE B CA    1 
ATOM   7645  C C     . ILE D 4 29  ? 39.185  131.415 90.446  1.00   44.64  ? 29  ILE B C     1 
ATOM   7646  O O     . ILE D 4 29  ? 38.163  131.826 89.902  1.00   43.07  ? 29  ILE B O     1 
ATOM   7647  C CB    . ILE D 4 29  ? 38.766  128.968 89.824  1.00   49.05  ? 29  ILE B CB    1 
ATOM   7648  C CG1   . ILE D 4 29  ? 37.241  128.972 89.853  1.00   90.85  ? 29  ILE B CG1   1 
ATOM   7649  C CG2   . ILE D 4 29  ? 39.247  127.557 90.107  1.00   47.46  ? 29  ILE B CG2   1 
ATOM   7650  C CD1   . ILE D 4 29  ? 36.604  128.143 88.765  1.00   117.91 ? 29  ILE B CD1   1 
ATOM   7651  N N     . THR D 4 30  ? 40.229  132.194 90.708  1.00   59.73  ? 30  THR B N     1 
ATOM   7652  C CA    . THR D 4 30  ? 40.185  133.650 90.600  1.00   55.03  ? 30  THR B CA    1 
ATOM   7653  C C     . THR D 4 30  ? 40.560  134.252 89.252  1.00   46.42  ? 30  THR B C     1 
ATOM   7654  O O     . THR D 4 30  ? 41.026  133.573 88.341  1.00   63.03  ? 30  THR B O     1 
ATOM   7655  C CB    . THR D 4 30  ? 41.108  134.303 91.650  1.00   61.97  ? 30  THR B CB    1 
ATOM   7656  O OG1   . THR D 4 30  ? 42.440  133.795 91.505  1.00   56.06  ? 30  THR B OG1   1 
ATOM   7657  C CG2   . THR D 4 30  ? 40.605  134.023 93.056  1.00   73.23  ? 30  THR B CG2   1 
ATOM   7658  N N     . LYS D 4 31  ? 40.342  135.559 89.168  1.00   50.24  ? 31  LYS B N     1 
ATOM   7659  C CA    . LYS D 4 31  ? 40.672  136.374 88.006  1.00   56.83  ? 31  LYS B CA    1 
ATOM   7660  C C     . LYS D 4 31  ? 42.127  136.231 87.544  1.00   57.49  ? 31  LYS B C     1 
ATOM   7661  O O     . LYS D 4 31  ? 42.354  135.929 86.374  1.00   68.13  ? 31  LYS B O     1 
ATOM   7662  C CB    . LYS D 4 31  ? 40.354  137.846 88.313  1.00   67.88  ? 31  LYS B CB    1 
ATOM   7663  C CG    . LYS D 4 31  ? 40.565  138.816 87.169  1.00   57.00  ? 31  LYS B CG    1 
ATOM   7664  C CD    . LYS D 4 31  ? 40.662  140.235 87.709  1.00   78.43  ? 31  LYS B CD    1 
ATOM   7665  C CE    . LYS D 4 31  ? 40.570  141.275 86.608  1.00   103.73 ? 31  LYS B CE    1 
ATOM   7666  N NZ    . LYS D 4 31  ? 40.650  142.657 87.162  1.00   78.59  ? 31  LYS B NZ    1 
ATOM   7667  N N     . PRO D 4 32  ? 43.116  136.442 88.439  1.00   63.16  ? 32  PRO B N     1 
ATOM   7668  C CA    . PRO D 4 32  ? 44.493  136.349 87.934  1.00   66.06  ? 32  PRO B CA    1 
ATOM   7669  C C     . PRO D 4 32  ? 44.846  134.952 87.418  1.00   51.19  ? 32  PRO B C     1 
ATOM   7670  O O     . PRO D 4 32  ? 45.699  134.830 86.542  1.00   55.43  ? 32  PRO B O     1 
ATOM   7671  C CB    . PRO D 4 32  ? 45.346  136.709 89.158  1.00   80.30  ? 32  PRO B CB    1 
ATOM   7672  C CG    . PRO D 4 32  ? 44.417  137.419 90.089  1.00   61.43  ? 32  PRO B CG    1 
ATOM   7673  C CD    . PRO D 4 32  ? 43.097  136.757 89.879  1.00   59.57  ? 32  PRO B CD    1 
ATOM   7674  N N     . ALA D 4 33  ? 44.191  133.921 87.946  1.00   43.11  ? 33  ALA B N     1 
ATOM   7675  C CA    . ALA D 4 33  ? 44.430  132.552 87.501  1.00   49.55  ? 33  ALA B CA    1 
ATOM   7676  C C     . ALA D 4 33  ? 43.755  132.344 86.150  1.00   42.61  ? 33  ALA B C     1 
ATOM   7677  O O     . ALA D 4 33  ? 44.281  131.671 85.269  1.00   44.53  ? 33  ALA B O     1 
ATOM   7678  C CB    . ALA D 4 33  ? 43.915  131.553 88.523  1.00   56.98  ? 33  ALA B CB    1 
ATOM   7679  N N     . ILE D 4 34  ? 42.551  132.879 86.016  1.00   48.17  ? 34  ILE B N     1 
ATOM   7680  C CA    . ILE D 4 34  ? 41.810  132.787 84.768  1.00   51.44  ? 34  ILE B CA    1 
ATOM   7681  C C     . ILE D 4 34  ? 42.531  133.581 83.676  1.00   48.21  ? 34  ILE B C     1 
ATOM   7682  O O     . ILE D 4 34  ? 42.707  133.096 82.557  1.00   45.56  ? 34  ILE B O     1 
ATOM   7683  C CB    . ILE D 4 34  ? 40.358  133.272 84.922  1.00   48.28  ? 34  ILE B CB    1 
ATOM   7684  C CG1   . ILE D 4 34  ? 39.586  132.307 85.823  1.00   44.71  ? 34  ILE B CG1   1 
ATOM   7685  C CG2   . ILE D 4 34  ? 39.670  133.339 83.570  1.00   43.42  ? 34  ILE B CG2   1 
ATOM   7686  C CD1   . ILE D 4 34  ? 38.155  132.716 86.082  1.00   62.34  ? 34  ILE B CD1   1 
ATOM   7687  N N     . ARG D 4 35  ? 42.954  134.798 84.009  1.00   48.54  ? 35  ARG B N     1 
ATOM   7688  C CA    . ARG D 4 35  ? 43.629  135.659 83.041  1.00   53.59  ? 35  ARG B CA    1 
ATOM   7689  C C     . ARG D 4 35  ? 44.949  135.118 82.490  1.00   61.27  ? 35  ARG B C     1 
ATOM   7690  O O     . ARG D 4 35  ? 45.291  135.417 81.348  1.00   63.12  ? 35  ARG B O     1 
ATOM   7691  C CB    . ARG D 4 35  ? 43.898  137.016 83.708  1.00   56.35  ? 35  ARG B CB    1 
ATOM   7692  C CG    . ARG D 4 35  ? 42.662  137.871 83.922  1.00   85.91  ? 35  ARG B CG    1 
ATOM   7693  C CD    . ARG D 4 35  ? 42.998  139.288 84.390  1.00   92.39  ? 35  ARG B CD    1 
ATOM   7694  N NE    . ARG D 4 35  ? 44.251  139.814 83.859  1.00   95.61  ? 35  ARG B NE    1 
ATOM   7695  C CZ    . ARG D 4 35  ? 44.334  140.652 82.832  1.00   99.99  ? 35  ARG B CZ    1 
ATOM   7696  N NH1   . ARG D 4 35  ? 43.232  141.070 82.223  1.00   98.95  ? 35  ARG B NH1   1 
ATOM   7697  N NH2   . ARG D 4 35  ? 45.519  141.080 82.421  1.00   100.44 ? 35  ARG B NH2   1 
ATOM   7698  N N     . ARG D 4 36  ? 45.687  134.324 83.265  1.00   53.28  ? 36  ARG B N     1 
ATOM   7699  C CA    . ARG D 4 36  ? 46.900  133.701 82.727  1.00   48.39  ? 36  ARG B CA    1 
ATOM   7700  C C     . ARG D 4 36  ? 46.538  132.687 81.640  1.00   44.66  ? 36  ARG B C     1 
ATOM   7701  O O     . ARG D 4 36  ? 47.120  132.694 80.556  1.00   58.64  ? 36  ARG B O     1 
ATOM   7702  C CB    . ARG D 4 36  ? 47.790  133.064 83.801  1.00   51.93  ? 36  ARG B CB    1 
ATOM   7703  C CG    . ARG D 4 36  ? 47.120  132.354 84.931  1.00   58.11  ? 36  ARG B CG    1 
ATOM   7704  C CD    . ARG D 4 36  ? 48.106  132.144 86.074  1.00   53.25  ? 36  ARG B CD    1 
ATOM   7705  N NE    . ARG D 4 36  ? 48.432  133.357 86.809  1.00   52.01  ? 36  ARG B NE    1 
ATOM   7706  C CZ    . ARG D 4 36  ? 48.158  133.533 88.097  1.00   66.91  ? 36  ARG B CZ    1 
ATOM   7707  N NH1   . ARG D 4 36  ? 47.561  132.567 88.789  1.00   36.84  ? 36  ARG B NH1   1 
ATOM   7708  N NH2   . ARG D 4 36  ? 48.486  134.668 88.698  1.00   93.31  ? 36  ARG B NH2   1 
ATOM   7709  N N     . LEU D 4 37  ? 45.597  131.800 81.955  1.00   36.39  ? 37  LEU B N     1 
ATOM   7710  C CA    . LEU D 4 37  ? 45.094  130.822 80.989  1.00   46.24  ? 37  LEU B CA    1 
ATOM   7711  C C     . LEU D 4 37  ? 44.656  131.476 79.684  1.00   56.04  ? 37  LEU B C     1 
ATOM   7712  O O     . LEU D 4 37  ? 44.946  130.958 78.604  1.00   49.76  ? 37  LEU B O     1 
ATOM   7713  C CB    . LEU D 4 37  ? 43.916  130.038 81.575  1.00   42.42  ? 37  LEU B CB    1 
ATOM   7714  C CG    . LEU D 4 37  ? 44.152  129.134 82.785  1.00   50.28  ? 37  LEU B CG    1 
ATOM   7715  C CD1   . LEU D 4 37  ? 42.831  128.824 83.473  1.00   44.37  ? 37  LEU B CD1   1 
ATOM   7716  C CD2   . LEU D 4 37  ? 44.850  127.852 82.367  1.00   65.54  ? 37  LEU B CD2   1 
ATOM   7717  N N     . ALA D 4 38  ? 43.953  132.601 79.781  1.00   57.33  ? 38  ALA B N     1 
ATOM   7718  C CA    . ALA D 4 38  ? 43.516  133.311 78.586  1.00   44.08  ? 38  ALA B CA    1 
ATOM   7719  C C     . ALA D 4 38  ? 44.738  133.780 77.802  1.00   57.33  ? 38  ALA B C     1 
ATOM   7720  O O     . ALA D 4 38  ? 44.774  133.674 76.576  1.00   68.04  ? 38  ALA B O     1 
ATOM   7721  C CB    . ALA D 4 38  ? 42.630  134.476 78.951  1.00   27.99  ? 38  ALA B CB    1 
ATOM   7722  N N     . ARG D 4 39  ? 45.733  134.297 78.521  1.00   55.35  ? 39  ARG B N     1 
ATOM   7723  C CA    . ARG D 4 39  ? 46.979  134.754 77.910  1.00   52.28  ? 39  ARG B CA    1 
ATOM   7724  C C     . ARG D 4 39  ? 47.643  133.619 77.138  1.00   51.76  ? 39  ARG B C     1 
ATOM   7725  O O     . ARG D 4 39  ? 48.129  133.810 76.024  1.00   51.28  ? 39  ARG B O     1 
ATOM   7726  C CB    . ARG D 4 39  ? 47.943  135.311 78.961  1.00   46.28  ? 39  ARG B CB    1 
ATOM   7727  C CG    . ARG D 4 39  ? 47.531  136.636 79.585  1.00   44.10  ? 39  ARG B CG    1 
ATOM   7728  C CD    . ARG D 4 39  ? 47.631  137.759 78.566  1.00   55.22  ? 39  ARG B CD    1 
ATOM   7729  N NE    . ARG D 4 39  ? 47.353  139.076 79.134  1.00   68.73  ? 39  ARG B NE    1 
ATOM   7730  C CZ    . ARG D 4 39  ? 46.174  139.687 79.077  1.00   87.59  ? 39  ARG B CZ    1 
ATOM   7731  N NH1   . ARG D 4 39  ? 45.143  139.101 78.481  1.00   83.04  ? 39  ARG B NH1   1 
ATOM   7732  N NH2   . ARG D 4 39  ? 46.024  140.886 79.621  1.00   68.52  ? 39  ARG B NH2   1 
ATOM   7733  N N     . ARG D 4 40  ? 47.650  132.434 77.741  1.00   49.68  ? 40  ARG B N     1 
ATOM   7734  C CA    . ARG D 4 40  ? 48.208  131.248 77.105  1.00   61.37  ? 40  ARG B CA    1 
ATOM   7735  C C     . ARG D 4 40  ? 47.363  130.839 75.903  1.00   70.29  ? 40  ARG B C     1 
ATOM   7736  O O     . ARG D 4 40  ? 47.860  130.211 74.965  1.00   85.62  ? 40  ARG B O     1 
ATOM   7737  C CB    . ARG D 4 40  ? 48.304  130.098 78.115  1.00   59.27  ? 40  ARG B CB    1 
ATOM   7738  C CG    . ARG D 4 40  ? 48.784  128.776 77.536  1.00   49.65  ? 40  ARG B CG    1 
ATOM   7739  C CD    . ARG D 4 40  ? 49.061  127.752 78.625  1.00   56.54  ? 40  ARG B CD    1 
ATOM   7740  N NE    . ARG D 4 40  ? 50.228  128.101 79.430  1.00   63.24  ? 40  ARG B NE    1 
ATOM   7741  C CZ    . ARG D 4 40  ? 50.610  127.439 80.518  1.00   68.34  ? 40  ARG B CZ    1 
ATOM   7742  N NH1   . ARG D 4 40  ? 49.912  126.391 80.941  1.00   59.86  ? 40  ARG B NH1   1 
ATOM   7743  N NH2   . ARG D 4 40  ? 51.688  127.825 81.188  1.00   59.73  ? 40  ARG B NH2   1 
ATOM   7744  N N     . GLY D 4 41  ? 46.090  131.217 75.919  1.00   59.77  ? 41  GLY B N     1 
ATOM   7745  C CA    . GLY D 4 41  ? 45.215  130.935 74.798  1.00   65.92  ? 41  GLY B CA    1 
ATOM   7746  C C     . GLY D 4 41  ? 45.422  131.964 73.704  1.00   60.75  ? 41  GLY B C     1 
ATOM   7747  O O     . GLY D 4 41  ? 44.910  131.823 72.594  1.00   72.80  ? 41  GLY B O     1 
ATOM   7748  N N     . GLY D 4 42  ? 46.186  133.004 74.024  1.00   51.50  ? 42  GLY B N     1 
ATOM   7749  C CA    . GLY D 4 42  ? 46.512  134.040 73.063  1.00   58.65  ? 42  GLY B CA    1 
ATOM   7750  C C     . GLY D 4 42  ? 45.617  135.256 73.183  1.00   55.42  ? 42  GLY B C     1 
ATOM   7751  O O     . GLY D 4 42  ? 45.671  136.158 72.347  1.00   63.10  ? 42  GLY B O     1 
ATOM   7752  N N     . VAL D 4 43  ? 44.801  135.286 74.231  1.00   50.27  ? 43  VAL B N     1 
ATOM   7753  C CA    . VAL D 4 43  ? 43.869  136.388 74.452  1.00   44.71  ? 43  VAL B CA    1 
ATOM   7754  C C     . VAL D 4 43  ? 44.592  137.628 74.970  1.00   47.72  ? 43  VAL B C     1 
ATOM   7755  O O     . VAL D 4 43  ? 45.456  137.534 75.841  1.00   48.97  ? 43  VAL B O     1 
ATOM   7756  C CB    . VAL D 4 43  ? 42.766  135.987 75.446  1.00   51.08  ? 43  VAL B CB    1 
ATOM   7757  C CG1   . VAL D 4 43  ? 41.796  137.136 75.662  1.00   56.51  ? 43  VAL B CG1   1 
ATOM   7758  C CG2   . VAL D 4 43  ? 42.035  134.746 74.948  1.00   54.26  ? 43  VAL B CG2   1 
ATOM   7759  N N     . LYS D 4 44  ? 44.223  138.791 74.438  1.00   55.20  ? 44  LYS B N     1 
ATOM   7760  C CA    . LYS D 4 44  ? 44.890  140.044 74.777  1.00   51.95  ? 44  LYS B CA    1 
ATOM   7761  C C     . LYS D 4 44  ? 44.002  140.937 75.646  1.00   57.10  ? 44  LYS B C     1 
ATOM   7762  O O     . LYS D 4 44  ? 44.493  141.624 76.543  1.00   60.84  ? 44  LYS B O     1 
ATOM   7763  C CB    . LYS D 4 44  ? 45.317  140.774 73.502  1.00   42.65  ? 44  LYS B CB    1 
ATOM   7764  C CG    . LYS D 4 44  ? 45.930  142.144 73.725  1.00   51.96  ? 44  LYS B CG    1 
ATOM   7765  C CD    . LYS D 4 44  ? 46.267  142.808 72.399  1.00   46.84  ? 44  LYS B CD    1 
ATOM   7766  C CE    . LYS D 4 44  ? 46.803  144.214 72.602  1.00   39.81  ? 44  LYS B CE    1 
ATOM   7767  N NZ    . LYS D 4 44  ? 47.182  144.849 71.311  1.00   48.42  ? 44  LYS B NZ    1 
ATOM   7768  N N     . ARG D 4 45  ? 42.697  140.918 75.389  1.00   52.91  ? 45  ARG B N     1 
ATOM   7769  C CA    . ARG D 4 45  ? 41.759  141.732 76.160  1.00   48.00  ? 45  ARG B CA    1 
ATOM   7770  C C     . ARG D 4 45  ? 40.559  140.909 76.609  1.00   47.77  ? 45  ARG B C     1 
ATOM   7771  O O     . ARG D 4 45  ? 40.006  140.118 75.846  1.00   45.28  ? 45  ARG B O     1 
ATOM   7772  C CB    . ARG D 4 45  ? 41.280  142.944 75.362  1.00   46.72  ? 45  ARG B CB    1 
ATOM   7773  C CG    . ARG D 4 45  ? 41.801  144.269 75.887  1.00   55.15  ? 45  ARG B CG    1 
ATOM   7774  C CD    . ARG D 4 45  ? 41.507  145.399 74.921  1.00   64.21  ? 45  ARG B CD    1 
ATOM   7775  N NE    . ARG D 4 45  ? 40.128  145.865 75.057  1.00   68.89  ? 45  ARG B NE    1 
ATOM   7776  C CZ    . ARG D 4 45  ? 39.739  146.820 75.896  1.00   64.92  ? 45  ARG B CZ    1 
ATOM   7777  N NH1   . ARG D 4 45  ? 40.625  147.420 76.683  1.00   44.97  ? 45  ARG B NH1   1 
ATOM   7778  N NH2   . ARG D 4 45  ? 38.461  147.175 75.950  1.00   48.74  ? 45  ARG B NH2   1 
ATOM   7779  N N     . ILE D 4 46  ? 40.163  141.115 77.862  1.00   55.45  ? 46  ILE B N     1 
ATOM   7780  C CA    . ILE D 4 46  ? 39.153  140.288 78.509  1.00   57.28  ? 46  ILE B CA    1 
ATOM   7781  C C     . ILE D 4 46  ? 38.050  141.105 79.169  1.00   55.56  ? 46  ILE B C     1 
ATOM   7782  O O     . ILE D 4 46  ? 38.316  141.963 80.011  1.00   57.75  ? 46  ILE B O     1 
ATOM   7783  C CB    . ILE D 4 46  ? 39.780  139.387 79.592  1.00   53.84  ? 46  ILE B CB    1 
ATOM   7784  C CG1   . ILE D 4 46  ? 40.919  138.550 79.016  1.00   42.63  ? 46  ILE B CG1   1 
ATOM   7785  C CG2   . ILE D 4 46  ? 38.726  138.492 80.222  1.00   62.82  ? 46  ILE B CG2   1 
ATOM   7786  C CD1   . ILE D 4 46  ? 41.605  137.698 80.051  1.00   61.27  ? 46  ILE B CD1   1 
ATOM   7787  N N     . SER D 4 47  ? 36.811  140.832 78.777  1.00   44.47  ? 47  SER B N     1 
ATOM   7788  C CA    . SER D 4 47  ? 35.650  141.461 79.390  1.00   55.35  ? 47  SER B CA    1 
ATOM   7789  C C     . SER D 4 47  ? 35.472  140.971 80.825  1.00   64.86  ? 47  SER B C     1 
ATOM   7790  O O     . SER D 4 47  ? 35.697  139.798 81.113  1.00   62.20  ? 47  SER B O     1 
ATOM   7791  C CB    . SER D 4 47  ? 34.390  141.176 78.573  1.00   73.60  ? 47  SER B CB    1 
ATOM   7792  O OG    . SER D 4 47  ? 33.233  141.638 79.246  1.00   79.42  ? 47  SER B OG    1 
ATOM   7793  N N     . GLY D 4 48  ? 35.092  141.873 81.727  1.00   60.23  ? 48  GLY B N     1 
ATOM   7794  C CA    . GLY D 4 48  ? 34.929  141.524 83.129  1.00   57.54  ? 48  GLY B CA    1 
ATOM   7795  C C     . GLY D 4 48  ? 33.925  140.412 83.381  1.00   65.56  ? 48  GLY B C     1 
ATOM   7796  O O     . GLY D 4 48  ? 33.997  139.711 84.389  1.00   79.83  ? 48  GLY B O     1 
ATOM   7797  N N     . LEU D 4 49  ? 32.968  140.266 82.473  1.00   58.23  ? 49  LEU B N     1 
ATOM   7798  C CA    . LEU D 4 49  ? 31.924  139.257 82.610  1.00   63.63  ? 49  LEU B CA    1 
ATOM   7799  C C     . LEU D 4 49  ? 32.447  137.849 82.309  1.00   61.89  ? 49  LEU B C     1 
ATOM   7800  O O     . LEU D 4 49  ? 31.804  136.855 82.643  1.00   83.74  ? 49  LEU B O     1 
ATOM   7801  C CB    . LEU D 4 49  ? 30.728  139.587 81.711  1.00   84.93  ? 49  LEU B CB    1 
ATOM   7802  C CG    . LEU D 4 49  ? 30.036  140.944 81.900  1.00   84.88  ? 49  LEU B CG    1 
ATOM   7803  C CD1   . LEU D 4 49  ? 30.692  142.053 81.085  1.00   79.04  ? 49  LEU B CD1   1 
ATOM   7804  C CD2   . LEU D 4 49  ? 28.555  140.837 81.565  1.00   98.44  ? 49  LEU B CD2   1 
ATOM   7805  N N     . ILE D 4 50  ? 33.614  137.776 81.673  1.00   61.77  ? 50  ILE B N     1 
ATOM   7806  C CA    . ILE D 4 50  ? 34.215  136.502 81.271  1.00   74.67  ? 50  ILE B CA    1 
ATOM   7807  C C     . ILE D 4 50  ? 34.532  135.585 82.454  1.00   56.53  ? 50  ILE B C     1 
ATOM   7808  O O     . ILE D 4 50  ? 34.350  134.366 82.378  1.00   53.87  ? 50  ILE B O     1 
ATOM   7809  C CB    . ILE D 4 50  ? 35.531  136.750 80.475  1.00   48.52  ? 50  ILE B CB    1 
ATOM   7810  C CG1   . ILE D 4 50  ? 35.234  137.223 79.051  1.00   55.02  ? 50  ILE B CG1   1 
ATOM   7811  C CG2   . ILE D 4 50  ? 36.428  135.519 80.470  1.00   36.64  ? 50  ILE B CG2   1 
ATOM   7812  C CD1   . ILE D 4 50  ? 34.628  136.168 78.174  1.00   64.36  ? 50  ILE B CD1   1 
ATOM   7813  N N     . TYR D 4 51  ? 34.965  136.183 83.556  1.00   49.22  ? 51  TYR B N     1 
ATOM   7814  C CA    . TYR D 4 51  ? 35.461  135.432 84.705  1.00   43.94  ? 51  TYR B CA    1 
ATOM   7815  C C     . TYR D 4 51  ? 34.419  134.512 85.347  1.00   55.35  ? 51  TYR B C     1 
ATOM   7816  O O     . TYR D 4 51  ? 34.712  133.346 85.608  1.00   64.21  ? 51  TYR B O     1 
ATOM   7817  C CB    . TYR D 4 51  ? 36.041  136.397 85.738  1.00   56.90  ? 51  TYR B CB    1 
ATOM   7818  C CG    . TYR D 4 51  ? 37.075  137.322 85.133  1.00   54.41  ? 51  TYR B CG    1 
ATOM   7819  C CD1   . TYR D 4 51  ? 38.325  136.847 84.762  1.00   50.95  ? 51  TYR B CD1   1 
ATOM   7820  C CD2   . TYR D 4 51  ? 36.800  138.666 84.926  1.00   77.95  ? 51  TYR B CD2   1 
ATOM   7821  C CE1   . TYR D 4 51  ? 39.268  137.683 84.200  1.00   57.38  ? 51  TYR B CE1   1 
ATOM   7822  C CE2   . TYR D 4 51  ? 37.739  139.512 84.367  1.00   65.65  ? 51  TYR B CE2   1 
ATOM   7823  C CZ    . TYR D 4 51  ? 38.972  139.017 84.008  1.00   66.87  ? 51  TYR B CZ    1 
ATOM   7824  O OH    . TYR D 4 51  ? 39.906  139.860 83.449  1.00   78.67  ? 51  TYR B OH    1 
ATOM   7825  N N     . GLU D 4 52  ? 33.215  135.019 85.605  1.00   51.79  ? 52  GLU B N     1 
ATOM   7826  C CA    . GLU D 4 52  ? 32.157  134.167 86.150  1.00   55.74  ? 52  GLU B CA    1 
ATOM   7827  C C     . GLU D 4 52  ? 31.734  133.080 85.163  1.00   60.25  ? 52  GLU B C     1 
ATOM   7828  O O     . GLU D 4 52  ? 31.466  131.948 85.566  1.00   61.33  ? 52  GLU B O     1 
ATOM   7829  C CB    . GLU D 4 52  ? 30.945  135.003 86.559  1.00   60.78  ? 52  GLU B CB    1 
ATOM   7830  C CG    . GLU D 4 52  ? 30.986  135.480 88.003  1.00   99.92  ? 52  GLU B CG    1 
ATOM   7831  C CD    . GLU D 4 52  ? 30.993  134.329 88.999  1.00   76.63  ? 52  GLU B CD    1 
ATOM   7832  O OE1   . GLU D 4 52  ? 30.393  133.274 88.698  1.00   60.25  ? 52  GLU B OE1   1 
ATOM   7833  O OE2   . GLU D 4 52  ? 31.599  134.478 90.082  1.00   63.84  ? 52  GLU B OE2   1 
ATOM   7834  N N     . GLU D 4 53  ? 31.666  133.426 83.880  1.00   63.93  ? 53  GLU B N     1 
ATOM   7835  C CA    . GLU D 4 53  ? 31.290  132.464 82.844  1.00   68.47  ? 53  GLU B CA    1 
ATOM   7836  C C     . GLU D 4 53  ? 32.281  131.316 82.789  1.00   62.51  ? 53  GLU B C     1 
ATOM   7837  O O     . GLU D 4 53  ? 31.907  130.160 82.581  1.00   52.94  ? 53  GLU B O     1 
ATOM   7838  C CB    . GLU D 4 53  ? 31.186  133.104 81.465  1.00   66.36  ? 53  GLU B CB    1 
ATOM   7839  C CG    . GLU D 4 53  ? 30.524  132.162 80.464  1.00   50.41  ? 53  GLU B CG    1 
ATOM   7840  C CD    . GLU D 4 53  ? 29.726  132.882 79.412  1.00   72.76  ? 53  GLU B CD    1 
ATOM   7841  O OE1   . GLU D 4 53  ? 29.890  134.109 79.291  1.00   95.77  ? 53  GLU B OE1   1 
ATOM   7842  O OE2   . GLU D 4 53  ? 28.943  132.219 78.701  1.00   87.78  ? 53  GLU B OE2   1 
ATOM   7843  N N     . THR D 4 54  ? 33.550  131.650 82.988  1.00   51.46  ? 54  THR B N     1 
ATOM   7844  C CA    . THR D 4 54  ? 34.609  130.662 82.944  1.00   45.21  ? 54  THR B CA    1 
ATOM   7845  C C     . THR D 4 54  ? 34.460  129.731 84.136  1.00   54.18  ? 54  THR B C     1 
ATOM   7846  O O     . THR D 4 54  ? 34.646  128.522 84.004  1.00   55.04  ? 54  THR B O     1 
ATOM   7847  C CB    . THR D 4 54  ? 35.994  131.322 82.951  1.00   49.76  ? 54  THR B CB    1 
ATOM   7848  O OG1   . THR D 4 54  ? 36.119  132.172 81.805  1.00   54.73  ? 54  THR B OG1   1 
ATOM   7849  C CG2   . THR D 4 54  ? 37.092  130.270 82.922  1.00   54.68  ? 54  THR B CG2   1 
ATOM   7850  N N     . ARG D 4 55  ? 34.169  130.285 85.308  1.00   42.21  ? 55  ARG B N     1 
ATOM   7851  C CA    . ARG D 4 55  ? 33.963  129.441 86.474  1.00   39.85  ? 55  ARG B CA    1 
ATOM   7852  C C     . ARG D 4 55  ? 32.835  128.445 86.195  1.00   43.21  ? 55  ARG B C     1 
ATOM   7853  O O     . ARG D 4 55  ? 32.920  127.275 86.568  1.00   39.61  ? 55  ARG B O     1 
ATOM   7854  C CB    . ARG D 4 55  ? 33.655  130.286 87.708  1.00   42.42  ? 55  ARG B CB    1 
ATOM   7855  C CG    . ARG D 4 55  ? 34.789  131.212 88.084  1.00   50.94  ? 55  ARG B CG    1 
ATOM   7856  C CD    . ARG D 4 55  ? 34.569  131.876 89.426  1.00   50.21  ? 55  ARG B CD    1 
ATOM   7857  N NE    . ARG D 4 55  ? 35.615  132.857 89.692  1.00   48.72  ? 55  ARG B NE    1 
ATOM   7858  C CZ    . ARG D 4 55  ? 35.491  134.159 89.464  1.00   55.28  ? 55  ARG B CZ    1 
ATOM   7859  N NH1   . ARG D 4 55  ? 34.362  134.641 88.966  1.00   69.65  ? 55  ARG B NH1   1 
ATOM   7860  N NH2   . ARG D 4 55  ? 36.495  134.980 89.736  1.00   78.47  ? 55  ARG B NH2   1 
ATOM   7861  N N     . GLY D 4 56  ? 31.777  128.919 85.540  1.00   43.44  ? 56  GLY B N     1 
ATOM   7862  C CA    . GLY D 4 56  ? 30.657  128.061 85.193  1.00   57.75  ? 56  GLY B CA    1 
ATOM   7863  C C     . GLY D 4 56  ? 30.939  126.974 84.170  1.00   48.32  ? 56  GLY B C     1 
ATOM   7864  O O     . GLY D 4 56  ? 30.518  125.832 84.351  1.00   58.50  ? 56  GLY B O     1 
ATOM   7865  N N     . VAL D 4 57  ? 31.641  127.324 83.094  1.00   48.70  ? 57  VAL B N     1 
ATOM   7866  C CA    . VAL D 4 57  ? 32.017  126.344 82.072  1.00   58.43  ? 57  VAL B CA    1 
ATOM   7867  C C     . VAL D 4 57  ? 32.913  125.272 82.699  1.00   56.74  ? 57  VAL B C     1 
ATOM   7868  O O     . VAL D 4 57  ? 32.739  124.079 82.441  1.00   45.35  ? 57  VAL B O     1 
ATOM   7869  C CB    . VAL D 4 57  ? 32.689  126.983 80.815  1.00   41.51  ? 57  VAL B CB    1 
ATOM   7870  C CG1   . VAL D 4 57  ? 33.905  127.789 81.165  1.00   40.85  ? 57  VAL B CG1   1 
ATOM   7871  C CG2   . VAL D 4 57  ? 33.058  125.905 79.805  1.00   57.07  ? 57  VAL B CG2   1 
ATOM   7872  N N     . LEU D 4 58  ? 33.870  125.705 83.520  1.00   49.81  ? 58  LEU B N     1 
ATOM   7873  C CA    . LEU D 4 58  ? 34.796  124.790 84.180  1.00   40.91  ? 58  LEU B CA    1 
ATOM   7874  C C     . LEU D 4 58  ? 34.078  123.820 85.108  1.00   46.13  ? 58  LEU B C     1 
ATOM   7875  O O     . LEU D 4 58  ? 34.412  122.635 85.128  1.00   59.76  ? 58  LEU B O     1 
ATOM   7876  C CB    . LEU D 4 58  ? 35.843  125.573 84.974  1.00   40.23  ? 58  LEU B CB    1 
ATOM   7877  C CG    . LEU D 4 58  ? 36.865  124.735 85.746  1.00   44.01  ? 58  LEU B CG    1 
ATOM   7878  C CD1   . LEU D 4 58  ? 37.619  123.805 84.807  1.00   73.16  ? 58  LEU B CD1   1 
ATOM   7879  C CD2   . LEU D 4 58  ? 37.830  125.622 86.516  1.00   43.57  ? 58  LEU B CD2   1 
ATOM   7880  N N     . LYS D 4 59  ? 33.117  124.314 85.886  1.00   42.74  ? 59  LYS B N     1 
ATOM   7881  C CA    . LYS D 4 59  ? 32.361  123.449 86.790  1.00   32.60  ? 59  LYS B CA    1 
ATOM   7882  C C     . LYS D 4 59  ? 31.694  122.333 86.003  1.00   46.47  ? 59  LYS B C     1 
ATOM   7883  O O     . LYS D 4 59  ? 31.807  121.160 86.356  1.00   55.45  ? 59  LYS B O     1 
ATOM   7884  C CB    . LYS D 4 59  ? 31.310  124.217 87.584  1.00   56.98  ? 59  LYS B CB    1 
ATOM   7885  C CG    . LYS D 4 59  ? 30.796  123.414 88.778  1.00   99.12  ? 59  LYS B CG    1 
ATOM   7886  C CD    . LYS D 4 59  ? 29.745  124.159 89.578  1.00   123.40 ? 59  LYS B CD    1 
ATOM   7887  C CE    . LYS D 4 59  ? 29.311  123.363 90.803  1.00   93.87  ? 59  LYS B CE    1 
ATOM   7888  N NZ    . LYS D 4 59  ? 30.439  123.085 91.735  1.00   110.20 ? 59  LYS B NZ    1 
ATOM   7889  N N     . VAL D 4 60  ? 31.002  122.717 84.932  1.00   44.23  ? 60  VAL B N     1 
ATOM   7890  C CA    . VAL D 4 60  ? 30.344  121.769 84.040  1.00   51.85  ? 60  VAL B CA    1 
ATOM   7891  C C     . VAL D 4 60  ? 31.335  120.727 83.543  1.00   62.36  ? 60  VAL B C     1 
ATOM   7892  O O     . VAL D 4 60  ? 31.075  119.526 83.629  1.00   75.48  ? 60  VAL B O     1 
ATOM   7893  C CB    . VAL D 4 60  ? 29.716  122.483 82.831  1.00   44.53  ? 60  VAL B CB    1 
ATOM   7894  C CG1   . VAL D 4 60  ? 29.202  121.470 81.819  1.00   54.96  ? 60  VAL B CG1   1 
ATOM   7895  C CG2   . VAL D 4 60  ? 28.599  123.390 83.284  1.00   77.90  ? 60  VAL B CG2   1 
ATOM   7896  N N     . PHE D 4 61  ? 32.462  121.194 83.017  1.00   59.46  ? 61  PHE B N     1 
ATOM   7897  C CA    . PHE D 4 61  ? 33.502  120.308 82.514  1.00   58.11  ? 61  PHE B CA    1 
ATOM   7898  C C     . PHE D 4 61  ? 33.894  119.303 83.587  1.00   58.12  ? 61  PHE B C     1 
ATOM   7899  O O     . PHE D 4 61  ? 33.917  118.095 83.352  1.00   58.84  ? 61  PHE B O     1 
ATOM   7900  C CB    . PHE D 4 61  ? 34.729  121.108 82.062  1.00   52.75  ? 61  PHE B CB    1 
ATOM   7901  C CG    . PHE D 4 61  ? 35.870  120.250 81.583  1.00   63.19  ? 61  PHE B CG    1 
ATOM   7902  C CD1   . PHE D 4 61  ? 35.963  119.875 80.252  1.00   59.47  ? 61  PHE B CD1   1 
ATOM   7903  C CD2   . PHE D 4 61  ? 36.860  119.834 82.461  1.00   54.52  ? 61  PHE B CD2   1 
ATOM   7904  C CE1   . PHE D 4 61  ? 37.010  119.089 79.811  1.00   62.55  ? 61  PHE B CE1   1 
ATOM   7905  C CE2   . PHE D 4 61  ? 37.909  119.049 82.026  1.00   51.40  ? 61  PHE B CE2   1 
ATOM   7906  C CZ    . PHE D 4 61  ? 37.986  118.677 80.700  1.00   61.90  ? 61  PHE B CZ    1 
ATOM   7907  N N     . LEU D 4 62  ? 34.198  119.822 84.770  1.00   54.11  ? 62  LEU B N     1 
ATOM   7908  C CA    . LEU D 4 62  ? 34.598  118.991 85.892  1.00   56.17  ? 62  LEU B CA    1 
ATOM   7909  C C     . LEU D 4 62  ? 33.499  118.028 86.333  1.00   56.62  ? 62  LEU B C     1 
ATOM   7910  O O     . LEU D 4 62  ? 33.778  116.862 86.594  1.00   71.92  ? 62  LEU B O     1 
ATOM   7911  C CB    . LEU D 4 62  ? 35.030  119.872 87.066  1.00   48.94  ? 62  LEU B CB    1 
ATOM   7912  C CG    . LEU D 4 62  ? 36.451  120.434 86.959  1.00   41.10  ? 62  LEU B CG    1 
ATOM   7913  C CD1   . LEU D 4 62  ? 36.734  121.435 88.068  1.00   38.55  ? 62  LEU B CD1   1 
ATOM   7914  C CD2   . LEU D 4 62  ? 37.473  119.308 86.980  1.00   50.31  ? 62  LEU B CD2   1 
ATOM   7915  N N     . GLU D 4 63  ? 32.256  118.501 86.390  1.00   46.68  ? 63  GLU B N     1 
ATOM   7916  C CA    . GLU D 4 63  ? 31.124  117.645 86.758  1.00   56.98  ? 63  GLU B CA    1 
ATOM   7917  C C     . GLU D 4 63  ? 31.036  116.392 85.889  1.00   56.32  ? 63  GLU B C     1 
ATOM   7918  O O     . GLU D 4 63  ? 30.892  115.288 86.405  1.00   63.21  ? 63  GLU B O     1 
ATOM   7919  C CB    . GLU D 4 63  ? 29.815  118.432 86.685  1.00   82.18  ? 63  GLU B CB    1 
ATOM   7920  C CG    . GLU D 4 63  ? 29.659  119.460 87.797  1.00   80.29  ? 63  GLU B CG    1 
ATOM   7921  C CD    . GLU D 4 63  ? 28.441  120.341 87.616  1.00   91.90  ? 63  GLU B CD    1 
ATOM   7922  O OE1   . GLU D 4 63  ? 27.740  120.185 86.593  1.00   89.01  ? 63  GLU B OE1   1 
ATOM   7923  O OE2   . GLU D 4 63  ? 28.191  121.195 88.493  1.00   96.90  ? 63  GLU B OE2   1 
ATOM   7924  N N     . ASN D 4 64  ? 31.115  116.573 84.574  1.00   65.59  ? 64  ASN B N     1 
ATOM   7925  C CA    . ASN D 4 64  ? 31.027  115.467 83.620  1.00   74.93  ? 64  ASN B CA    1 
ATOM   7926  C C     . ASN D 4 64  ? 32.153  114.450 83.808  1.00   76.07  ? 64  ASN B C     1 
ATOM   7927  O O     . ASN D 4 64  ? 31.912  113.242 83.864  1.00   63.55  ? 64  ASN B O     1 
ATOM   7928  C CB    . ASN D 4 64  ? 31.019  115.988 82.183  1.00   75.61  ? 64  ASN B CB    1 
ATOM   7929  C CG    . ASN D 4 64  ? 29.807  116.847 81.884  1.00   84.97  ? 64  ASN B CG    1 
ATOM   7930  O OD1   . ASN D 4 64  ? 28.783  116.350 81.415  1.00   91.82  ? 64  ASN B OD1   1 
ATOM   7931  N ND2   . ASN D 4 64  ? 29.914  118.141 82.156  1.00   91.32  ? 64  ASN B ND2   1 
ATOM   7932  N N     . VAL D 4 65  ? 33.382  114.946 83.904  1.00   61.21  ? 65  VAL B N     1 
ATOM   7933  C CA    . VAL D 4 65  ? 34.549  114.083 84.022  1.00   61.68  ? 65  VAL B CA    1 
ATOM   7934  C C     . VAL D 4 65  ? 34.557  113.388 85.379  1.00   64.15  ? 65  VAL B C     1 
ATOM   7935  O O     . VAL D 4 65  ? 34.769  112.178 85.455  1.00   72.83  ? 65  VAL B O     1 
ATOM   7936  C CB    . VAL D 4 65  ? 35.859  114.878 83.851  1.00   77.51  ? 65  VAL B CB    1 
ATOM   7937  C CG1   . VAL D 4 65  ? 37.069  113.964 84.023  1.00   43.82  ? 65  VAL B CG1   1 
ATOM   7938  C CG2   . VAL D 4 65  ? 35.889  115.569 82.496  1.00   82.96  ? 65  VAL B CG2   1 
ATOM   7939  N N     . ILE D 4 66  ? 34.331  114.151 86.444  1.00   52.18  ? 66  ILE B N     1 
ATOM   7940  C CA    . ILE D 4 66  ? 34.309  113.584 87.787  1.00   41.81  ? 66  ILE B CA    1 
ATOM   7941  C C     . ILE D 4 66  ? 33.193  112.543 87.891  1.00   42.93  ? 66  ILE B C     1 
ATOM   7942  O O     . ILE D 4 66  ? 33.355  111.522 88.560  1.00   46.56  ? 66  ILE B O     1 
ATOM   7943  C CB    . ILE D 4 66  ? 34.132  114.677 88.864  1.00   49.87  ? 66  ILE B CB    1 
ATOM   7944  C CG1   . ILE D 4 66  ? 35.361  115.592 88.883  1.00   51.54  ? 66  ILE B CG1   1 
ATOM   7945  C CG2   . ILE D 4 66  ? 33.934  114.061 90.241  1.00   37.39  ? 66  ILE B CG2   1 
ATOM   7946  C CD1   . ILE D 4 66  ? 35.304  116.692 89.922  1.00   30.89  ? 66  ILE B CD1   1 
ATOM   7947  N N     . ARG D 4 67  ? 32.068  112.799 87.226  1.00   50.04  ? 67  ARG B N     1 
ATOM   7948  C CA    . ARG D 4 67  ? 30.943  111.863 87.241  1.00   56.08  ? 67  ARG B CA    1 
ATOM   7949  C C     . ARG D 4 67  ? 31.342  110.495 86.707  1.00   61.82  ? 67  ARG B C     1 
ATOM   7950  O O     . ARG D 4 67  ? 31.092  109.470 87.343  1.00   64.22  ? 67  ARG B O     1 
ATOM   7951  C CB    . ARG D 4 67  ? 29.771  112.385 86.409  1.00   48.84  ? 67  ARG B CB    1 
ATOM   7952  C CG    . ARG D 4 67  ? 28.509  111.546 86.555  1.00   42.46  ? 67  ARG B CG    1 
ATOM   7953  C CD    . ARG D 4 67  ? 27.457  111.894 85.510  1.00   54.58  ? 67  ARG B CD    1 
ATOM   7954  N NE    . ARG D 4 67  ? 27.079  113.303 85.539  1.00   100.05 ? 67  ARG B NE    1 
ATOM   7955  C CZ    . ARG D 4 67  ? 27.398  114.180 84.592  1.00   103.80 ? 67  ARG B CZ    1 
ATOM   7956  N NH1   . ARG D 4 67  ? 28.100  113.792 83.536  1.00   92.02  ? 67  ARG B NH1   1 
ATOM   7957  N NH2   . ARG D 4 67  ? 27.012  115.445 84.700  1.00   111.55 ? 67  ARG B NH2   1 
ATOM   7958  N N     . ASP D 4 68  ? 31.965  110.490 85.533  1.00   51.67  ? 68  ASP B N     1 
ATOM   7959  C CA    . ASP D 4 68  ? 32.420  109.248 84.925  1.00   58.57  ? 68  ASP B CA    1 
ATOM   7960  C C     . ASP D 4 68  ? 33.536  108.605 85.742  1.00   60.51  ? 68  ASP B C     1 
ATOM   7961  O O     . ASP D 4 68  ? 33.579  107.384 85.889  1.00   61.51  ? 68  ASP B O     1 
ATOM   7962  C CB    . ASP D 4 68  ? 32.895  109.506 83.493  1.00   78.75  ? 68  ASP B CB    1 
ATOM   7963  C CG    . ASP D 4 68  ? 31.751  109.820 82.546  1.00   82.66  ? 68  ASP B CG    1 
ATOM   7964  O OD1   . ASP D 4 68  ? 30.614  110.009 83.028  1.00   83.74  ? 68  ASP B OD1   1 
ATOM   7965  O OD2   . ASP D 4 68  ? 31.990  109.888 81.321  1.00   82.69  ? 68  ASP B OD2   1 
ATOM   7966  N N     . ALA D 4 69  ? 34.434  109.432 86.270  1.00   55.53  ? 69  ALA B N     1 
ATOM   7967  C CA    . ALA D 4 69  ? 35.523  108.952 87.114  1.00   51.73  ? 69  ALA B CA    1 
ATOM   7968  C C     . ALA D 4 69  ? 34.998  108.150 88.301  1.00   56.33  ? 69  ALA B C     1 
ATOM   7969  O O     . ALA D 4 69  ? 35.431  107.022 88.540  1.00   64.32  ? 69  ALA B O     1 
ATOM   7970  C CB    . ALA D 4 69  ? 36.372  110.116 87.596  1.00   45.76  ? 69  ALA B CB    1 
ATOM   7971  N N     . VAL D 4 70  ? 34.063  108.744 89.039  1.00   51.92  ? 70  VAL B N     1 
ATOM   7972  C CA    . VAL D 4 70  ? 33.472  108.101 90.208  1.00   53.76  ? 70  VAL B CA    1 
ATOM   7973  C C     . VAL D 4 70  ? 32.711  106.836 89.812  1.00   59.19  ? 70  VAL B C     1 
ATOM   7974  O O     . VAL D 4 70  ? 32.700  105.846 90.546  1.00   65.83  ? 70  VAL B O     1 
ATOM   7975  C CB    . VAL D 4 70  ? 32.532  109.070 90.956  1.00   44.90  ? 70  VAL B CB    1 
ATOM   7976  C CG1   . VAL D 4 70  ? 31.787  108.354 92.074  1.00   65.52  ? 70  VAL B CG1   1 
ATOM   7977  C CG2   . VAL D 4 70  ? 33.321  110.243 91.518  1.00   47.00  ? 70  VAL B CG2   1 
ATOM   7978  N N     . THR D 4 71  ? 32.096  106.869 88.634  1.00   53.97  ? 71  THR B N     1 
ATOM   7979  C CA    . THR D 4 71  ? 31.368  105.716 88.114  1.00   63.32  ? 71  THR B CA    1 
ATOM   7980  C C     . THR D 4 71  ? 32.310  104.526 87.929  1.00   68.11  ? 71  THR B C     1 
ATOM   7981  O O     . THR D 4 71  ? 31.954  103.386 88.234  1.00   70.12  ? 71  THR B O     1 
ATOM   7982  C CB    . THR D 4 71  ? 30.665  106.041 86.781  1.00   65.52  ? 71  THR B CB    1 
ATOM   7983  O OG1   . THR D 4 71  ? 29.732  107.111 86.980  1.00   60.11  ? 71  THR B OG1   1 
ATOM   7984  C CG2   . THR D 4 71  ? 29.921  104.823 86.257  1.00   63.89  ? 71  THR B CG2   1 
ATOM   7985  N N     . TYR D 4 72  ? 33.517  104.803 87.440  1.00   63.40  ? 72  TYR B N     1 
ATOM   7986  C CA    . TYR D 4 72  ? 34.556  103.783 87.336  1.00   65.43  ? 72  TYR B CA    1 
ATOM   7987  C C     . TYR D 4 72  ? 34.991  103.303 88.714  1.00   73.19  ? 72  TYR B C     1 
ATOM   7988  O O     . TYR D 4 72  ? 35.236  102.115 88.917  1.00   84.16  ? 72  TYR B O     1 
ATOM   7989  C CB    . TYR D 4 72  ? 35.776  104.309 86.573  1.00   68.87  ? 72  TYR B CB    1 
ATOM   7990  C CG    . TYR D 4 72  ? 35.613  104.374 85.070  1.00   65.03  ? 72  TYR B CG    1 
ATOM   7991  C CD1   . TYR D 4 72  ? 35.605  103.214 84.305  1.00   67.34  ? 72  TYR B CD1   1 
ATOM   7992  C CD2   . TYR D 4 72  ? 35.513  105.591 84.413  1.00   57.96  ? 72  TYR B CD2   1 
ATOM   7993  C CE1   . TYR D 4 72  ? 35.471  103.265 82.930  1.00   70.51  ? 72  TYR B CE1   1 
ATOM   7994  C CE2   . TYR D 4 72  ? 35.377  105.654 83.038  1.00   66.84  ? 72  TYR B CE2   1 
ATOM   7995  C CZ    . TYR D 4 72  ? 35.358  104.487 82.301  1.00   79.43  ? 72  TYR B CZ    1 
ATOM   7996  O OH    . TYR D 4 72  ? 35.225  104.542 80.932  1.00   75.28  ? 72  TYR B OH    1 
ATOM   7997  N N     . THR D 4 73  ? 35.092  104.238 89.653  1.00   73.76  ? 73  THR B N     1 
ATOM   7998  C CA    . THR D 4 73  ? 35.527  103.937 91.013  1.00   69.83  ? 73  THR B CA    1 
ATOM   7999  C C     . THR D 4 73  ? 34.566  102.971 91.697  1.00   68.54  ? 73  THR B C     1 
ATOM   8000  O O     . THR D 4 73  ? 34.986  102.021 92.357  1.00   80.36  ? 73  THR B O     1 
ATOM   8001  C CB    . THR D 4 73  ? 35.648  105.217 91.865  1.00   63.07  ? 73  THR B CB    1 
ATOM   8002  O OG1   . THR D 4 73  ? 36.409  106.201 91.152  1.00   69.38  ? 73  THR B OG1   1 
ATOM   8003  C CG2   . THR D 4 73  ? 36.333  104.916 93.189  1.00   60.69  ? 73  THR B CG2   1 
ATOM   8004  N N     . GLU D 4 74  ? 33.273  103.219 91.527  1.00   58.98  ? 74  GLU B N     1 
ATOM   8005  C CA    . GLU D 4 74  ? 32.240  102.394 92.139  1.00   73.28  ? 74  GLU B CA    1 
ATOM   8006  C C     . GLU D 4 74  ? 32.158  100.996 91.527  1.00   71.70  ? 74  GLU B C     1 
ATOM   8007  O O     . GLU D 4 74  ? 31.843  100.031 92.224  1.00   88.73  ? 74  GLU B O     1 
ATOM   8008  C CB    . GLU D 4 74  ? 30.882  103.089 92.027  1.00   86.50  ? 74  GLU B CB    1 
ATOM   8009  C CG    . GLU D 4 74  ? 30.767  104.346 92.870  1.00   77.75  ? 74  GLU B CG    1 
ATOM   8010  C CD    . GLU D 4 74  ? 29.452  105.067 92.661  1.00   95.33  ? 74  GLU B CD    1 
ATOM   8011  O OE1   . GLU D 4 74  ? 28.893  104.974 91.548  1.00   98.82  ? 74  GLU B OE1   1 
ATOM   8012  O OE2   . GLU D 4 74  ? 28.981  105.731 93.608  1.00   121.52 ? 74  GLU B OE2   1 
ATOM   8013  N N     . HIS D 4 75  ? 32.435  100.886 90.232  1.00   69.24  ? 75  HIS B N     1 
ATOM   8014  C CA    . HIS D 4 75  ? 32.422  99.584  89.571  1.00   78.10  ? 75  HIS B CA    1 
ATOM   8015  C C     . HIS D 4 75  ? 33.520  98.685  90.127  1.00   88.35  ? 75  HIS B C     1 
ATOM   8016  O O     . HIS D 4 75  ? 33.342  97.473  90.248  1.00   89.58  ? 75  HIS B O     1 
ATOM   8017  C CB    . HIS D 4 75  ? 32.589  99.743  88.059  1.00   81.58  ? 75  HIS B CB    1 
ATOM   8018  C CG    . HIS D 4 75  ? 32.619  98.443  87.315  1.00   85.57  ? 75  HIS B CG    1 
ATOM   8019  N ND1   . HIS D 4 75  ? 31.474  97.788  86.914  1.00   93.60  ? 75  HIS B ND1   1 
ATOM   8020  C CD2   . HIS D 4 75  ? 33.655  97.678  86.899  1.00   90.76  ? 75  HIS B CD2   1 
ATOM   8021  C CE1   . HIS D 4 75  ? 31.805  96.675  86.284  1.00   95.22  ? 75  HIS B CE1   1 
ATOM   8022  N NE2   . HIS D 4 75  ? 33.122  96.584  86.261  1.00   79.33  ? 75  HIS B NE2   1 
ATOM   8023  N N     . ALA D 4 76  ? 34.654  99.289  90.465  1.00   95.38  ? 76  ALA B N     1 
ATOM   8024  C CA    . ALA D 4 76  ? 35.784  98.557  91.026  1.00   86.84  ? 76  ALA B CA    1 
ATOM   8025  C C     . ALA D 4 76  ? 35.578  98.302  92.516  1.00   87.42  ? 76  ALA B C     1 
ATOM   8026  O O     . ALA D 4 76  ? 36.431  97.702  93.173  1.00   86.03  ? 76  ALA B O     1 
ATOM   8027  C CB    . ALA D 4 76  ? 37.079  99.318  90.791  1.00   99.42  ? 76  ALA B CB    1 
ATOM   8028  N N     . LYS D 4 77  ? 34.446  98.776  93.033  1.00   97.44  ? 77  LYS B N     1 
ATOM   8029  C CA    . LYS D 4 77  ? 34.099  98.665  94.450  1.00   95.75  ? 77  LYS B CA    1 
ATOM   8030  C C     . LYS D 4 77  ? 35.143  99.338  95.331  1.00   87.73  ? 77  LYS B C     1 
ATOM   8031  O O     . LYS D 4 77  ? 35.523  98.803  96.373  1.00   104.34 ? 77  LYS B O     1 
ATOM   8032  C CB    . LYS D 4 77  ? 33.933  97.200  94.869  1.00   110.50 ? 77  LYS B CB    1 
ATOM   8033  C CG    . LYS D 4 77  ? 32.757  96.485  94.230  1.00   123.92 ? 77  LYS B CG    1 
ATOM   8034  C CD    . LYS D 4 77  ? 32.751  95.014  94.612  1.00   132.82 ? 77  LYS B CD    1 
ATOM   8035  C CE    . LYS D 4 77  ? 31.603  94.271  93.950  1.00   156.76 ? 77  LYS B CE    1 
ATOM   8036  N NZ    . LYS D 4 77  ? 31.670  92.807  94.215  1.00   164.83 ? 77  LYS B NZ    1 
ATOM   8037  N N     . ARG D 4 78  ? 35.597  100.515 94.917  1.00   72.44  ? 78  ARG B N     1 
ATOM   8038  C CA    . ARG D 4 78  ? 36.592  101.245 95.690  1.00   79.11  ? 78  ARG B CA    1 
ATOM   8039  C C     . ARG D 4 78  ? 36.005  102.530 96.254  1.00   84.79  ? 78  ARG B C     1 
ATOM   8040  O O     . ARG D 4 78  ? 35.026  103.065 95.732  1.00   73.00  ? 78  ARG B O     1 
ATOM   8041  C CB    . ARG D 4 78  ? 37.823  101.559 94.837  1.00   71.99  ? 78  ARG B CB    1 
ATOM   8042  C CG    . ARG D 4 78  ? 38.737  100.367 94.614  1.00   92.68  ? 78  ARG B CG    1 
ATOM   8043  C CD    . ARG D 4 78  ? 40.017  100.768 93.897  1.00   118.45 ? 78  ARG B CD    1 
ATOM   8044  N NE    . ARG D 4 78  ? 39.851  100.825 92.448  1.00   125.28 ? 78  ARG B NE    1 
ATOM   8045  C CZ    . ARG D 4 78  ? 39.622  101.942 91.766  1.00   119.09 ? 78  ARG B CZ    1 
ATOM   8046  N NH1   . ARG D 4 78  ? 39.539  103.104 92.400  1.00   94.44  ? 78  ARG B NH1   1 
ATOM   8047  N NH2   . ARG D 4 78  ? 39.481  101.899 90.448  1.00   127.61 ? 78  ARG B NH2   1 
ATOM   8048  N N     . LYS D 4 79  ? 36.615  103.022 97.326  1.00   75.16  ? 79  LYS B N     1 
ATOM   8049  C CA    . LYS D 4 79  ? 36.201  104.278 97.928  1.00   71.71  ? 79  LYS B CA    1 
ATOM   8050  C C     . LYS D 4 79  ? 37.198  105.380 97.596  1.00   72.03  ? 79  LYS B C     1 
ATOM   8051  O O     . LYS D 4 79  ? 37.023  106.532 97.994  1.00   81.63  ? 79  LYS B O     1 
ATOM   8052  C CB    . LYS D 4 79  ? 36.025  104.113 99.436  1.00   86.08  ? 79  LYS B CB    1 
ATOM   8053  C CG    . LYS D 4 79  ? 34.973  103.067 99.785  1.00   85.97  ? 79  LYS B CG    1 
ATOM   8054  C CD    . LYS D 4 79  ? 34.703  102.984 101.275 1.00   106.49 ? 79  LYS B CD    1 
ATOM   8055  C CE    . LYS D 4 79  ? 33.590  101.988 101.567 1.00   96.51  ? 79  LYS B CE    1 
ATOM   8056  N NZ    . LYS D 4 79  ? 33.288  101.890 103.021 1.00   101.72 ? 79  LYS B NZ    1 
ATOM   8057  N N     . THR D 4 80  ? 38.253  105.015 96.875  1.00   69.31  ? 80  THR B N     1 
ATOM   8058  C CA    . THR D 4 80  ? 39.277  105.981 96.507  1.00   83.53  ? 80  THR B CA    1 
ATOM   8059  C C     . THR D 4 80  ? 39.353  106.071 94.989  1.00   75.82  ? 80  THR B C     1 
ATOM   8060  O O     . THR D 4 80  ? 39.580  105.069 94.308  1.00   75.86  ? 80  THR B O     1 
ATOM   8061  C CB    . THR D 4 80  ? 40.662  105.593 97.065  1.00   87.21  ? 80  THR B CB    1 
ATOM   8062  O OG1   . THR D 4 80  ? 40.586  105.439 98.488  1.00   100.52 ? 80  THR B OG1   1 
ATOM   8063  C CG2   . THR D 4 80  ? 41.696  106.658 96.724  1.00   71.12  ? 80  THR B CG2   1 
ATOM   8064  N N     . VAL D 4 81  ? 39.157  107.275 94.463  1.00   70.25  ? 81  VAL B N     1 
ATOM   8065  C CA    . VAL D 4 81  ? 39.303  107.527 93.034  1.00   81.61  ? 81  VAL B CA    1 
ATOM   8066  C C     . VAL D 4 81  ? 40.767  107.496 92.615  1.00   76.38  ? 81  VAL B C     1 
ATOM   8067  O O     . VAL D 4 81  ? 41.561  108.326 93.060  1.00   56.71  ? 81  VAL B O     1 
ATOM   8068  C CB    . VAL D 4 81  ? 38.682  108.871 92.629  1.00   60.10  ? 81  VAL B CB    1 
ATOM   8069  C CG1   . VAL D 4 81  ? 38.894  109.126 91.146  1.00   73.72  ? 81  VAL B CG1   1 
ATOM   8070  C CG2   . VAL D 4 81  ? 37.202  108.890 92.971  1.00   54.43  ? 81  VAL B CG2   1 
ATOM   8071  N N     . THR D 4 82  ? 41.129  106.545 91.761  1.00   70.71  ? 82  THR B N     1 
ATOM   8072  C CA    . THR D 4 82  ? 42.509  106.460 91.307  1.00   76.11  ? 82  THR B CA    1 
ATOM   8073  C C     . THR D 4 82  ? 42.699  107.304 90.055  1.00   68.10  ? 82  THR B C     1 
ATOM   8074  O O     . THR D 4 82  ? 41.731  107.744 89.436  1.00   69.83  ? 82  THR B O     1 
ATOM   8075  C CB    . THR D 4 82  ? 42.947  105.005 91.029  1.00   85.26  ? 82  THR B CB    1 
ATOM   8076  O OG1   . THR D 4 82  ? 44.284  104.997 90.511  1.00   83.38  ? 82  THR B OG1   1 
ATOM   8077  C CG2   . THR D 4 82  ? 42.023  104.340 90.031  1.00   65.50  ? 82  THR B CG2   1 
ATOM   8078  N N     . ALA D 4 83  ? 43.958  107.522 89.694  1.00   60.72  ? 83  ALA B N     1 
ATOM   8079  C CA    . ALA D 4 83  ? 44.320  108.308 88.522  1.00   61.90  ? 83  ALA B CA    1 
ATOM   8080  C C     . ALA D 4 83  ? 43.806  107.669 87.238  1.00   53.40  ? 83  ALA B C     1 
ATOM   8081  O O     . ALA D 4 83  ? 43.433  108.362 86.292  1.00   56.36  ? 83  ALA B O     1 
ATOM   8082  C CB    . ALA D 4 83  ? 45.827  108.492 88.455  1.00   81.62  ? 83  ALA B CB    1 
ATOM   8083  N N     . MET D 4 84  ? 43.802  106.343 87.210  1.00   50.96  ? 84  MET B N     1 
ATOM   8084  C CA    . MET D 4 84  ? 43.338  105.603 86.047  1.00   65.33  ? 84  MET B CA    1 
ATOM   8085  C C     . MET D 4 84  ? 41.853  105.880 85.798  1.00   64.35  ? 84  MET B C     1 
ATOM   8086  O O     . MET D 4 84  ? 41.418  105.985 84.650  1.00   68.07  ? 84  MET B O     1 
ATOM   8087  C CB    . MET D 4 84  ? 43.588  104.109 86.247  1.00   91.18  ? 84  MET B CB    1 
ATOM   8088  C CG    . MET D 4 84  ? 45.055  103.727 86.113  1.00   99.63  ? 84  MET B CG    1 
ATOM   8089  S SD    . MET D 4 84  ? 45.815  104.282 84.580  1.00   108.13 ? 84  MET B SD    1 
ATOM   8090  C CE    . MET D 4 84  ? 44.766  103.467 83.393  1.00   66.55  ? 84  MET B CE    1 
ATOM   8091  N N     . ASP D 4 85  ? 41.083  105.978 86.880  1.00   68.44  ? 85  ASP B N     1 
ATOM   8092  C CA    . ASP D 4 85  ? 39.655  106.299 86.814  1.00   71.08  ? 85  ASP B CA    1 
ATOM   8093  C C     . ASP D 4 85  ? 39.422  107.613 86.080  1.00   57.21  ? 85  ASP B C     1 
ATOM   8094  O O     . ASP D 4 85  ? 38.489  107.743 85.289  1.00   66.82  ? 85  ASP B O     1 
ATOM   8095  C CB    . ASP D 4 85  ? 39.036  106.377 88.213  1.00   74.52  ? 85  ASP B CB    1 
ATOM   8096  C CG    . ASP D 4 85  ? 38.985  105.036 88.906  1.00   68.57  ? 85  ASP B CG    1 
ATOM   8097  O OD1   . ASP D 4 85  ? 39.103  104.002 88.216  1.00   94.31  ? 85  ASP B OD1   1 
ATOM   8098  O OD2   . ASP D 4 85  ? 38.827  105.016 90.144  1.00   65.66  ? 85  ASP B OD2   1 
ATOM   8099  N N     . VAL D 4 86  ? 40.286  108.583 86.353  1.00   37.07  ? 86  VAL B N     1 
ATOM   8100  C CA    . VAL D 4 86  ? 40.212  109.891 85.724  1.00   38.85  ? 86  VAL B CA    1 
ATOM   8101  C C     . VAL D 4 86  ? 40.637  109.773 84.264  1.00   48.17  ? 86  VAL B C     1 
ATOM   8102  O O     . VAL D 4 86  ? 40.032  110.383 83.379  1.00   35.17  ? 86  VAL B O     1 
ATOM   8103  C CB    . VAL D 4 86  ? 41.113  110.911 86.455  1.00   34.16  ? 86  VAL B CB    1 
ATOM   8104  C CG1   . VAL D 4 86  ? 41.127  112.245 85.723  1.00   26.88  ? 86  VAL B CG1   1 
ATOM   8105  C CG2   . VAL D 4 86  ? 40.647  111.095 87.887  1.00   26.37  ? 86  VAL B CG2   1 
ATOM   8106  N N     . VAL D 4 87  ? 41.668  108.972 84.019  1.00   59.12  ? 87  VAL B N     1 
ATOM   8107  C CA    . VAL D 4 87  ? 42.178  108.760 82.670  1.00   51.82  ? 87  VAL B CA    1 
ATOM   8108  C C     . VAL D 4 87  ? 41.115  108.069 81.816  1.00   62.02  ? 87  VAL B C     1 
ATOM   8109  O O     . VAL D 4 87  ? 40.828  108.510 80.702  1.00   78.21  ? 87  VAL B O     1 
ATOM   8110  C CB    . VAL D 4 87  ? 43.470  107.929 82.673  1.00   53.78  ? 87  VAL B CB    1 
ATOM   8111  C CG1   . VAL D 4 87  ? 43.787  107.432 81.270  1.00   56.96  ? 87  VAL B CG1   1 
ATOM   8112  C CG2   . VAL D 4 87  ? 44.623  108.759 83.217  1.00   62.68  ? 87  VAL B CG2   1 
ATOM   8113  N N     . TYR D 4 88  ? 40.541  106.985 82.334  1.00   53.74  ? 88  TYR B N     1 
ATOM   8114  C CA    . TYR D 4 88  ? 39.487  106.269 81.619  1.00   52.06  ? 88  TYR B CA    1 
ATOM   8115  C C     . TYR D 4 88  ? 38.297  107.177 81.325  1.00   69.79  ? 88  TYR B C     1 
ATOM   8116  O O     . TYR D 4 88  ? 37.686  107.086 80.260  1.00   75.26  ? 88  TYR B O     1 
ATOM   8117  C CB    . TYR D 4 88  ? 38.997  105.060 82.420  1.00   77.37  ? 88  TYR B CB    1 
ATOM   8118  C CG    . TYR D 4 88  ? 40.012  103.964 82.641  1.00   86.35  ? 88  TYR B CG    1 
ATOM   8119  C CD1   . TYR D 4 88  ? 40.954  103.656 81.672  1.00   86.24  ? 88  TYR B CD1   1 
ATOM   8120  C CD2   . TYR D 4 88  ? 40.003  103.214 83.810  1.00   98.60  ? 88  TYR B CD2   1 
ATOM   8121  C CE1   . TYR D 4 88  ? 41.872  102.647 81.870  1.00   88.98  ? 88  TYR B CE1   1 
ATOM   8122  C CE2   . TYR D 4 88  ? 40.916  102.202 84.017  1.00   100.97 ? 88  TYR B CE2   1 
ATOM   8123  C CZ    . TYR D 4 88  ? 41.848  101.920 83.044  1.00   103.92 ? 88  TYR B CZ    1 
ATOM   8124  O OH    . TYR D 4 88  ? 42.761  100.911 83.249  1.00   121.89 ? 88  TYR B OH    1 
ATOM   8125  N N     . ALA D 4 89  ? 37.974  108.049 82.277  1.00   74.33  ? 89  ALA B N     1 
ATOM   8126  C CA    . ALA D 4 89  ? 36.873  108.992 82.116  1.00   49.18  ? 89  ALA B CA    1 
ATOM   8127  C C     . ALA D 4 89  ? 37.152  109.960 80.973  1.00   54.41  ? 89  ALA B C     1 
ATOM   8128  O O     . ALA D 4 89  ? 36.298  110.185 80.117  1.00   76.37  ? 89  ALA B O     1 
ATOM   8129  C CB    . ALA D 4 89  ? 36.633  109.753 83.410  1.00   44.48  ? 89  ALA B CB    1 
ATOM   8130  N N     . LEU D 4 90  ? 38.355  110.527 80.966  1.00   39.30  ? 90  LEU B N     1 
ATOM   8131  C CA    . LEU D 4 90  ? 38.757  111.470 79.929  1.00   50.40  ? 90  LEU B CA    1 
ATOM   8132  C C     . LEU D 4 90  ? 38.767  110.821 78.552  1.00   68.47  ? 90  LEU B C     1 
ATOM   8133  O O     . LEU D 4 90  ? 38.388  111.446 77.561  1.00   72.12  ? 90  LEU B O     1 
ATOM   8134  C CB    . LEU D 4 90  ? 40.135  112.060 80.229  1.00   52.64  ? 90  LEU B CB    1 
ATOM   8135  C CG    . LEU D 4 90  ? 40.235  113.052 81.387  1.00   55.98  ? 90  LEU B CG    1 
ATOM   8136  C CD1   . LEU D 4 90  ? 41.691  113.306 81.744  1.00   43.85  ? 90  LEU B CD1   1 
ATOM   8137  C CD2   . LEU D 4 90  ? 39.531  114.352 81.031  1.00   53.22  ? 90  LEU B CD2   1 
ATOM   8138  N N     . LYS D 4 91  ? 39.209  109.568 78.492  1.00   68.11  ? 91  LYS B N     1 
ATOM   8139  C CA    . LYS D 4 91  ? 39.229  108.840 77.233  1.00   71.09  ? 91  LYS B CA    1 
ATOM   8140  C C     . LYS D 4 91  ? 37.806  108.637 76.722  1.00   81.31  ? 91  LYS B C     1 
ATOM   8141  O O     . LYS D 4 91  ? 37.552  108.767 75.524  1.00   107.15 ? 91  LYS B O     1 
ATOM   8142  C CB    . LYS D 4 91  ? 39.940  107.495 77.408  1.00   68.21  ? 91  LYS B CB    1 
ATOM   8143  C CG    . LYS D 4 91  ? 40.001  106.639 76.152  1.00   87.38  ? 91  LYS B CG    1 
ATOM   8144  C CD    . LYS D 4 91  ? 41.231  105.742 76.167  1.00   63.30  ? 91  LYS B CD    1 
ATOM   8145  C CE    . LYS D 4 91  ? 41.455  105.077 74.818  1.00   83.71  ? 91  LYS B CE    1 
ATOM   8146  N NZ    . LYS D 4 91  ? 40.355  104.133 74.472  1.00   106.42 ? 91  LYS B NZ    1 
ATOM   8147  N N     . ARG D 4 92  ? 36.887  108.308 77.626  1.00   51.72  ? 92  ARG B N     1 
ATOM   8148  C CA    . ARG D 4 92  ? 35.490  108.101 77.249  1.00   76.85  ? 92  ARG B CA    1 
ATOM   8149  C C     . ARG D 4 92  ? 34.867  109.325 76.584  1.00   91.71  ? 92  ARG B C     1 
ATOM   8150  O O     . ARG D 4 92  ? 33.917  109.205 75.810  1.00   121.79 ? 92  ARG B O     1 
ATOM   8151  C CB    . ARG D 4 92  ? 34.646  107.703 78.459  1.00   89.30  ? 92  ARG B CB    1 
ATOM   8152  C CG    . ARG D 4 92  ? 33.683  106.571 78.157  1.00   63.55  ? 92  ARG B CG    1 
ATOM   8153  C CD    . ARG D 4 92  ? 32.492  106.606 79.094  1.00   89.76  ? 92  ARG B CD    1 
ATOM   8154  N NE    . ARG D 4 92  ? 31.710  107.830 78.924  1.00   135.48 ? 92  ARG B NE    1 
ATOM   8155  C CZ    . ARG D 4 92  ? 30.846  108.046 77.935  1.00   147.63 ? 92  ARG B CZ    1 
ATOM   8156  N NH1   . ARG D 4 92  ? 30.655  107.125 77.003  1.00   149.40 ? 92  ARG B NH1   1 
ATOM   8157  N NH2   . ARG D 4 92  ? 30.183  109.194 77.870  1.00   115.76 ? 92  ARG B NH2   1 
ATOM   8158  N N     . GLN D 4 93  ? 35.404  110.502 76.885  1.00   74.02  ? 93  GLN B N     1 
ATOM   8159  C CA    . GLN D 4 93  ? 34.828  111.744 76.389  1.00   78.63  ? 93  GLN B CA    1 
ATOM   8160  C C     . GLN D 4 93  ? 35.683  112.319 75.269  1.00   83.14  ? 93  GLN B C     1 
ATOM   8161  O O     . GLN D 4 93  ? 35.518  113.473 74.873  1.00   68.03  ? 93  GLN B O     1 
ATOM   8162  C CB    . GLN D 4 93  ? 34.691  112.757 77.527  1.00   80.37  ? 93  GLN B CB    1 
ATOM   8163  C CG    . GLN D 4 93  ? 33.960  112.218 78.749  1.00   81.30  ? 93  GLN B CG    1 
ATOM   8164  C CD    . GLN D 4 93  ? 33.748  113.275 79.816  1.00   108.02 ? 93  GLN B CD    1 
ATOM   8165  O OE1   . GLN D 4 93  ? 34.262  114.390 79.716  1.00   82.12  ? 93  GLN B OE1   1 
ATOM   8166  N NE2   . GLN D 4 93  ? 32.991  112.926 80.850  1.00   122.54 ? 93  GLN B NE2   1 
ATOM   8167  N N     . GLY D 4 94  ? 36.602  111.499 74.768  1.00   95.16  ? 94  GLY B N     1 
ATOM   8168  C CA    . GLY D 4 94  ? 37.475  111.886 73.676  1.00   87.75  ? 94  GLY B CA    1 
ATOM   8169  C C     . GLY D 4 94  ? 38.502  112.933 74.058  1.00   96.80  ? 94  GLY B C     1 
ATOM   8170  O O     . GLY D 4 94  ? 38.880  113.764 73.231  1.00   101.71 ? 94  GLY B O     1 
ATOM   8171  N N     . ARG D 4 95  ? 38.959  112.900 75.306  1.00   83.14  ? 95  ARG B N     1 
ATOM   8172  C CA    . ARG D 4 95  ? 39.993  113.829 75.749  1.00   70.31  ? 95  ARG B CA    1 
ATOM   8173  C C     . ARG D 4 95  ? 41.128  113.104 76.467  1.00   75.33  ? 95  ARG B C     1 
ATOM   8174  O O     . ARG D 4 95  ? 41.496  113.459 77.587  1.00   82.25  ? 95  ARG B O     1 
ATOM   8175  C CB    . ARG D 4 95  ? 39.396  114.912 76.649  1.00   72.88  ? 95  ARG B CB    1 
ATOM   8176  C CG    . ARG D 4 95  ? 38.266  115.689 75.991  1.00   75.08  ? 95  ARG B CG    1 
ATOM   8177  C CD    . ARG D 4 95  ? 37.856  116.893 76.814  1.00   63.77  ? 95  ARG B CD    1 
ATOM   8178  N NE    . ARG D 4 95  ? 38.859  117.948 76.710  1.00   72.18  ? 95  ARG B NE    1 
ATOM   8179  C CZ    . ARG D 4 95  ? 38.940  118.801 75.692  1.00   73.78  ? 95  ARG B CZ    1 
ATOM   8180  N NH1   . ARG D 4 95  ? 38.071  118.726 74.690  1.00   46.00  ? 95  ARG B NH1   1 
ATOM   8181  N NH2   . ARG D 4 95  ? 39.885  119.733 75.678  1.00   48.86  ? 95  ARG B NH2   1 
ATOM   8182  N N     . THR D 4 96  ? 41.660  112.083 75.801  1.00   81.10  ? 96  THR B N     1 
ATOM   8183  C CA    . THR D 4 96  ? 42.748  111.241 76.299  1.00   72.91  ? 96  THR B CA    1 
ATOM   8184  C C     . THR D 4 96  ? 43.917  112.057 76.872  1.00   69.03  ? 96  THR B C     1 
ATOM   8185  O O     . THR D 4 96  ? 44.291  113.090 76.316  1.00   62.92  ? 96  THR B O     1 
ATOM   8186  C CB    . THR D 4 96  ? 43.264  110.311 75.177  1.00   60.93  ? 96  THR B CB    1 
ATOM   8187  O OG1   . THR D 4 96  ? 42.193  109.477 74.718  1.00   56.30  ? 96  THR B OG1   1 
ATOM   8188  C CG2   . THR D 4 96  ? 44.406  109.435 75.667  1.00   83.59  ? 96  THR B CG2   1 
ATOM   8189  N N     . LEU D 4 97  ? 44.494  111.584 77.976  1.00   52.28  ? 97  LEU B N     1 
ATOM   8190  C CA    . LEU D 4 97  ? 45.610  112.277 78.614  1.00   42.72  ? 97  LEU B CA    1 
ATOM   8191  C C     . LEU D 4 97  ? 46.822  111.363 78.786  1.00   55.28  ? 97  LEU B C     1 
ATOM   8192  O O     . LEU D 4 97  ? 46.722  110.251 79.305  1.00   58.50  ? 97  LEU B O     1 
ATOM   8193  C CB    . LEU D 4 97  ? 45.179  112.827 79.976  1.00   50.06  ? 97  LEU B CB    1 
ATOM   8194  C CG    . LEU D 4 97  ? 46.192  113.644 80.782  1.00   49.98  ? 97  LEU B CG    1 
ATOM   8195  C CD1   . LEU D 4 97  ? 46.612  114.904 80.039  1.00   45.91  ? 97  LEU B CD1   1 
ATOM   8196  C CD2   . LEU D 4 97  ? 45.632  113.983 82.155  1.00   36.32  ? 97  LEU B CD2   1 
ATOM   8197  N N     . TYR D 4 98  ? 47.970  111.868 78.347  1.00   56.67  ? 98  TYR B N     1 
ATOM   8198  C CA    . TYR D 4 98  ? 49.253  111.179 78.446  1.00   59.33  ? 98  TYR B CA    1 
ATOM   8199  C C     . TYR D 4 98  ? 50.084  111.741 79.599  1.00   61.99  ? 98  TYR B C     1 
ATOM   8200  O O     . TYR D 4 98  ? 50.132  112.954 79.790  1.00   43.32  ? 98  TYR B O     1 
ATOM   8201  C CB    . TYR D 4 98  ? 50.017  111.314 77.128  1.00   68.08  ? 98  TYR B CB    1 
ATOM   8202  C CG    . TYR D 4 98  ? 49.457  110.479 75.995  1.00   54.33  ? 98  TYR B CG    1 
ATOM   8203  C CD1   . TYR D 4 98  ? 48.376  109.630 76.194  1.00   51.79  ? 98  TYR B CD1   1 
ATOM   8204  C CD2   . TYR D 4 98  ? 49.992  110.568 74.716  1.00   52.75  ? 98  TYR B CD2   1 
ATOM   8205  C CE1   . TYR D 4 98  ? 47.857  108.880 75.156  1.00   64.63  ? 98  TYR B CE1   1 
ATOM   8206  C CE2   . TYR D 4 98  ? 49.481  109.822 73.674  1.00   54.27  ? 98  TYR B CE2   1 
ATOM   8207  C CZ    . TYR D 4 98  ? 48.415  108.981 73.898  1.00   58.41  ? 98  TYR B CZ    1 
ATOM   8208  O OH    . TYR D 4 98  ? 47.908  108.243 72.856  1.00   46.57  ? 98  TYR B OH    1 
ATOM   8209  N N     . GLY D 4 99  ? 50.755  110.869 80.350  1.00   68.86  ? 99  GLY B N     1 
ATOM   8210  C CA    . GLY D 4 99  ? 51.683  111.321 81.375  1.00   53.29  ? 99  GLY B CA    1 
ATOM   8211  C C     . GLY D 4 99  ? 51.148  111.044 82.765  1.00   56.29  ? 99  GLY B C     1 
ATOM   8212  O O     . GLY D 4 99  ? 51.505  111.704 83.740  1.00   66.70  ? 99  GLY B O     1 
ATOM   8213  N N     . PHE D 4 100 ? 50.286  110.038 82.838  1.00   60.37  ? 100 PHE B N     1 
ATOM   8214  C CA    . PHE D 4 100 ? 49.683  109.570 84.081  1.00   79.39  ? 100 PHE B CA    1 
ATOM   8215  C C     . PHE D 4 100 ? 49.478  108.066 83.966  1.00   81.06  ? 100 PHE B C     1 
ATOM   8216  O O     . PHE D 4 100 ? 48.938  107.418 84.863  1.00   73.86  ? 100 PHE B O     1 
ATOM   8217  C CB    . PHE D 4 100 ? 48.372  110.300 84.379  1.00   79.98  ? 100 PHE B CB    1 
ATOM   8218  C CG    . PHE D 4 100 ? 48.564  111.730 84.806  1.00   63.32  ? 100 PHE B CG    1 
ATOM   8219  C CD1   . PHE D 4 100 ? 48.857  112.035 86.126  1.00   51.10  ? 100 PHE B CD1   1 
ATOM   8220  C CD2   . PHE D 4 100 ? 48.461  112.765 83.891  1.00   43.50  ? 100 PHE B CD2   1 
ATOM   8221  C CE1   . PHE D 4 100 ? 49.040  113.345 86.527  1.00   52.14  ? 100 PHE B CE1   1 
ATOM   8222  C CE2   . PHE D 4 100 ? 48.643  114.077 84.285  1.00   59.12  ? 100 PHE B CE2   1 
ATOM   8223  C CZ    . PHE D 4 100 ? 48.933  114.368 85.606  1.00   61.71  ? 100 PHE B CZ    1 
ATOM   8224  N N     . GLY D 4 101 ? 49.919  107.531 82.831  1.00   92.55  ? 101 GLY B N     1 
ATOM   8225  C CA    . GLY D 4 101 ? 49.769  106.127 82.504  1.00   87.80  ? 101 GLY B CA    1 
ATOM   8226  C C     . GLY D 4 101 ? 48.683  105.896 81.477  1.00   86.08  ? 101 GLY B C     1 
ATOM   8227  O O     . GLY D 4 101 ? 48.697  106.513 80.414  1.00   123.57 ? 101 GLY B O     1 
ATOM   8228  N N     . GLY D 4 102 ? 47.750  105.003 81.776  1.00   74.23  ? 102 GLY B N     1 
ATOM   8229  C CA    . GLY D 4 102 ? 46.710  104.671 80.821  1.00   96.77  ? 102 GLY B CA    1 
ATOM   8230  C C     . GLY D 4 102 ? 47.205  103.719 79.749  1.00   99.21  ? 102 GLY B C     1 
ATOM   8231  O O     . GLY D 4 102 ? 48.270  103.922 79.163  1.00   74.36  ? 102 GLY B O     1 
ATOM   8232  N N     . LYS E 5 14  ? 9.622   77.123  77.857  1.00   82.25  ? 14  LYS C N     1 
ATOM   8233  C CA    . LYS E 5 14  ? 9.254   78.531  77.953  1.00   141.37 ? 14  LYS C CA    1 
ATOM   8234  C C     . LYS E 5 14  ? 10.391  79.423  77.469  1.00   165.28 ? 14  LYS C C     1 
ATOM   8235  O O     . LYS E 5 14  ? 11.526  79.281  77.928  1.00   162.57 ? 14  LYS C O     1 
ATOM   8236  C CB    . LYS E 5 14  ? 8.898   78.886  79.399  1.00   157.21 ? 14  LYS C CB    1 
ATOM   8237  C CG    . LYS E 5 14  ? 7.937   77.914  80.067  1.00   160.11 ? 14  LYS C CG    1 
ATOM   8238  C CD    . LYS E 5 14  ? 7.600   78.352  81.487  1.00   151.77 ? 14  LYS C CD    1 
ATOM   8239  C CE    . LYS E 5 14  ? 7.238   79.827  81.555  1.00   135.83 ? 14  LYS C CE    1 
ATOM   8240  N NZ    . LYS E 5 14  ? 6.047   80.149  80.723  1.00   141.83 ? 14  LYS C NZ    1 
ATOM   8241  N N     . SER E 5 15  ? 10.093  80.321  76.530  1.00   171.35 ? 15  SER C N     1 
ATOM   8242  C CA    . SER E 5 15  ? 11.115  81.202  75.963  1.00   152.70 ? 15  SER C CA    1 
ATOM   8243  C C     . SER E 5 15  ? 11.824  81.987  77.065  1.00   140.12 ? 15  SER C C     1 
ATOM   8244  O O     . SER E 5 15  ? 11.210  82.343  78.072  1.00   136.39 ? 15  SER C O     1 
ATOM   8245  C CB    . SER E 5 15  ? 10.494  82.159  74.942  1.00   139.79 ? 15  SER C CB    1 
ATOM   8246  O OG    . SER E 5 15  ? 11.425  83.144  74.532  1.00   134.57 ? 15  SER C OG    1 
ATOM   8247  N N     . ARG E 5 16  ? 13.111  82.256  76.879  1.00   132.94 ? 16  ARG C N     1 
ATOM   8248  C CA    . ARG E 5 16  ? 13.857  83.053  77.847  1.00   139.67 ? 16  ARG C CA    1 
ATOM   8249  C C     . ARG E 5 16  ? 13.408  84.517  77.900  1.00   136.91 ? 16  ARG C C     1 
ATOM   8250  O O     . ARG E 5 16  ? 13.556  85.179  78.927  1.00   134.75 ? 16  ARG C O     1 
ATOM   8251  C CB    . ARG E 5 16  ? 15.351  82.963  77.536  1.00   142.30 ? 16  ARG C CB    1 
ATOM   8252  C CG    . ARG E 5 16  ? 15.983  81.678  78.048  1.00   131.80 ? 16  ARG C CG    1 
ATOM   8253  C CD    . ARG E 5 16  ? 17.498  81.703  77.980  1.00   139.59 ? 16  ARG C CD    1 
ATOM   8254  N NE    . ARG E 5 16  ? 18.053  80.371  78.210  1.00   166.06 ? 16  ARG C NE    1 
ATOM   8255  C CZ    . ARG E 5 16  ? 19.348  80.078  78.159  1.00   169.44 ? 16  ARG C CZ    1 
ATOM   8256  N NH1   . ARG E 5 16  ? 20.235  81.024  77.882  1.00   153.57 ? 16  ARG C NH1   1 
ATOM   8257  N NH2   . ARG E 5 16  ? 19.757  78.836  78.385  1.00   178.15 ? 16  ARG C NH2   1 
ATOM   8258  N N     . SER E 5 17  ? 12.872  85.015  76.788  1.00   142.68 ? 17  SER C N     1 
ATOM   8259  C CA    . SER E 5 17  ? 12.373  86.389  76.711  1.00   123.60 ? 17  SER C CA    1 
ATOM   8260  C C     . SER E 5 17  ? 11.217  86.632  77.677  1.00   128.41 ? 17  SER C C     1 
ATOM   8261  O O     . SER E 5 17  ? 11.156  87.653  78.362  1.00   120.01 ? 17  SER C O     1 
ATOM   8262  C CB    . SER E 5 17  ? 11.936  86.721  75.283  1.00   119.31 ? 17  SER C CB    1 
ATOM   8263  O OG    . SER E 5 17  ? 10.829  85.927  74.891  1.00   134.39 ? 17  SER C OG    1 
ATOM   8264  N N     . ASN E 5 18  ? 10.304  85.667  77.712  1.00   129.19 ? 18  ASN C N     1 
ATOM   8265  C CA    . ASN E 5 18  ? 9.107   85.717  78.541  1.00   124.17 ? 18  ASN C CA    1 
ATOM   8266  C C     . ASN E 5 18  ? 9.407   85.680  80.034  1.00   128.03 ? 18  ASN C C     1 
ATOM   8267  O O     . ASN E 5 18  ? 8.712   86.308  80.832  1.00   140.13 ? 18  ASN C O     1 
ATOM   8268  C CB    . ASN E 5 18  ? 8.163   84.574  78.169  1.00   138.72 ? 18  ASN C CB    1 
ATOM   8269  C CG    . ASN E 5 18  ? 7.639   84.693  76.751  1.00   132.02 ? 18  ASN C CG    1 
ATOM   8270  O OD1   . ASN E 5 18  ? 7.805   83.786  75.936  1.00   145.84 ? 18  ASN C OD1   1 
ATOM   8271  N ND2   . ASN E 5 18  ? 7.006   85.821  76.448  1.00   102.81 ? 18  ASN C ND2   1 
ATOM   8272  N N     . ARG E 5 19  ? 10.441  84.933  80.405  1.00   116.78 ? 19  ARG C N     1 
ATOM   8273  C CA    . ARG E 5 19  ? 10.853  84.840  81.798  1.00   127.34 ? 19  ARG C CA    1 
ATOM   8274  C C     . ARG E 5 19  ? 11.337  86.182  82.340  1.00   122.11 ? 19  ARG C C     1 
ATOM   8275  O O     . ARG E 5 19  ? 11.217  86.452  83.535  1.00   134.16 ? 19  ARG C O     1 
ATOM   8276  C CB    . ARG E 5 19  ? 11.954  83.785  81.941  1.00   145.56 ? 19  ARG C CB    1 
ATOM   8277  C CG    . ARG E 5 19  ? 12.341  83.456  83.368  1.00   129.11 ? 19  ARG C CG    1 
ATOM   8278  C CD    . ARG E 5 19  ? 13.426  82.394  83.403  1.00   115.57 ? 19  ARG C CD    1 
ATOM   8279  N NE    . ARG E 5 19  ? 13.019  81.185  82.695  1.00   135.94 ? 19  ARG C NE    1 
ATOM   8280  C CZ    . ARG E 5 19  ? 13.790  80.113  82.542  1.00   144.81 ? 19  ARG C CZ    1 
ATOM   8281  N NH1   . ARG E 5 19  ? 15.015  80.098  83.050  1.00   146.36 ? 19  ARG C NH1   1 
ATOM   8282  N NH2   . ARG E 5 19  ? 13.336  79.057  81.881  1.00   152.71 ? 19  ARG C NH2   1 
ATOM   8283  N N     . ALA E 5 20  ? 11.861  87.029  81.462  1.00   122.58 ? 20  ALA C N     1 
ATOM   8284  C CA    . ALA E 5 20  ? 12.338  88.341  81.880  1.00   133.61 ? 20  ALA C CA    1 
ATOM   8285  C C     . ALA E 5 20  ? 11.289  89.396  81.543  1.00   131.24 ? 20  ALA C C     1 
ATOM   8286  O O     . ALA E 5 20  ? 11.459  90.580  81.837  1.00   107.64 ? 20  ALA C O     1 
ATOM   8287  C CB    . ALA E 5 20  ? 13.665  88.668  81.215  1.00   105.61 ? 20  ALA C CB    1 
ATOM   8288  N N     . GLY E 5 21  ? 10.201  88.943  80.929  1.00   128.05 ? 21  GLY C N     1 
ATOM   8289  C CA    . GLY E 5 21  ? 9.111   89.810  80.520  1.00   115.25 ? 21  GLY C CA    1 
ATOM   8290  C C     . GLY E 5 21  ? 9.562   90.815  79.479  1.00   116.20 ? 21  GLY C C     1 
ATOM   8291  O O     . GLY E 5 21  ? 9.179   91.984  79.523  1.00   115.95 ? 21  GLY C O     1 
ATOM   8292  N N     . LEU E 5 22  ? 10.376  90.354  78.535  1.00   113.39 ? 22  LEU C N     1 
ATOM   8293  C CA    . LEU E 5 22  ? 10.921  91.232  77.509  1.00   103.78 ? 22  LEU C CA    1 
ATOM   8294  C C     . LEU E 5 22  ? 10.406  90.873  76.118  1.00   103.69 ? 22  LEU C C     1 
ATOM   8295  O O     . LEU E 5 22  ? 10.017  89.735  75.861  1.00   118.64 ? 22  LEU C O     1 
ATOM   8296  C CB    . LEU E 5 22  ? 12.450  91.193  77.534  1.00   104.08 ? 22  LEU C CB    1 
ATOM   8297  C CG    . LEU E 5 22  ? 13.097  91.757  78.802  1.00   106.70 ? 22  LEU C CG    1 
ATOM   8298  C CD1   . LEU E 5 22  ? 14.615  91.705  78.713  1.00   83.10  ? 22  LEU C CD1   1 
ATOM   8299  C CD2   . LEU E 5 22  ? 12.618  93.176  79.082  1.00   106.88 ? 22  LEU C CD2   1 
ATOM   8300  N N     . GLN E 5 23  ? 10.414  91.856  75.225  1.00   109.19 ? 23  GLN C N     1 
ATOM   8301  C CA    . GLN E 5 23  ? 10.072  91.642  73.823  1.00   114.65 ? 23  GLN C CA    1 
ATOM   8302  C C     . GLN E 5 23  ? 11.317  91.313  73.012  1.00   110.39 ? 23  GLN C C     1 
ATOM   8303  O O     . GLN E 5 23  ? 11.289  90.459  72.126  1.00   114.98 ? 23  GLN C O     1 
ATOM   8304  C CB    . GLN E 5 23  ? 9.362   92.866  73.246  1.00   104.74 ? 23  GLN C CB    1 
ATOM   8305  C CG    . GLN E 5 23  ? 8.074   93.201  73.970  1.00   109.65 ? 23  GLN C CG    1 
ATOM   8306  C CD    . GLN E 5 23  ? 7.058   92.080  73.877  1.00   112.52 ? 23  GLN C CD    1 
ATOM   8307  O OE1   . GLN E 5 23  ? 6.499   91.648  74.886  1.00   121.00 ? 23  GLN C OE1   1 
ATOM   8308  N NE2   . GLN E 5 23  ? 6.814   91.600  72.663  1.00   99.48  ? 23  GLN C NE2   1 
ATOM   8309  N N     . PHE E 5 24  ? 12.409  92.004  73.322  1.00   111.48 ? 24  PHE C N     1 
ATOM   8310  C CA    . PHE E 5 24  ? 13.681  91.784  72.649  1.00   102.19 ? 24  PHE C CA    1 
ATOM   8311  C C     . PHE E 5 24  ? 14.253  90.409  72.991  1.00   112.17 ? 24  PHE C C     1 
ATOM   8312  O O     . PHE E 5 24  ? 14.056  89.907  74.098  1.00   121.80 ? 24  PHE C O     1 
ATOM   8313  C CB    . PHE E 5 24  ? 14.678  92.887  73.017  1.00   79.48  ? 24  PHE C CB    1 
ATOM   8314  C CG    . PHE E 5 24  ? 14.540  94.126  72.181  1.00   90.91  ? 24  PHE C CG    1 
ATOM   8315  C CD1   . PHE E 5 24  ? 13.502  94.252  71.273  1.00   107.28 ? 24  PHE C CD1   1 
ATOM   8316  C CD2   . PHE E 5 24  ? 15.459  95.155  72.287  1.00   91.66  ? 24  PHE C CD2   1 
ATOM   8317  C CE1   . PHE E 5 24  ? 13.373  95.386  70.497  1.00   101.97 ? 24  PHE C CE1   1 
ATOM   8318  C CE2   . PHE E 5 24  ? 15.337  96.292  71.512  1.00   105.63 ? 24  PHE C CE2   1 
ATOM   8319  C CZ    . PHE E 5 24  ? 14.292  96.407  70.616  1.00   110.47 ? 24  PHE C CZ    1 
ATOM   8320  N N     . PRO E 5 25  ? 14.966  89.797  72.032  1.00   85.99  ? 25  PRO C N     1 
ATOM   8321  C CA    . PRO E 5 25  ? 15.436  88.412  72.128  1.00   78.47  ? 25  PRO C CA    1 
ATOM   8322  C C     . PRO E 5 25  ? 16.616  88.242  73.079  1.00   106.17 ? 25  PRO C C     1 
ATOM   8323  O O     . PRO E 5 25  ? 17.756  88.545  72.730  1.00   114.55 ? 25  PRO C O     1 
ATOM   8324  C CB    . PRO E 5 25  ? 15.839  88.084  70.691  1.00   85.82  ? 25  PRO C CB    1 
ATOM   8325  C CG    . PRO E 5 25  ? 16.246  89.385  70.118  1.00   93.93  ? 25  PRO C CG    1 
ATOM   8326  C CD    . PRO E 5 25  ? 15.359  90.418  70.753  1.00   81.37  ? 25  PRO C CD    1 
ATOM   8327  N N     . VAL E 5 26  ? 16.320  87.760  74.282  1.00   113.93 ? 26  VAL C N     1 
ATOM   8328  C CA    . VAL E 5 26  ? 17.336  87.474  75.288  1.00   111.42 ? 26  VAL C CA    1 
ATOM   8329  C C     . VAL E 5 26  ? 18.333  86.463  74.732  1.00   96.22  ? 26  VAL C C     1 
ATOM   8330  O O     . VAL E 5 26  ? 19.544  86.602  74.914  1.00   95.17  ? 26  VAL C O     1 
ATOM   8331  C CB    . VAL E 5 26  ? 16.709  86.927  76.586  1.00   107.55 ? 26  VAL C CB    1 
ATOM   8332  C CG1   . VAL E 5 26  ? 17.790  86.470  77.553  1.00   125.13 ? 26  VAL C CG1   1 
ATOM   8333  C CG2   . VAL E 5 26  ? 15.823  87.979  77.232  1.00   95.57  ? 26  VAL C CG2   1 
ATOM   8334  N N     . GLY E 5 27  ? 17.812  85.452  74.047  1.00   83.56  ? 27  GLY C N     1 
ATOM   8335  C CA    . GLY E 5 27  ? 18.632  84.401  73.476  1.00   86.65  ? 27  GLY C CA    1 
ATOM   8336  C C     . GLY E 5 27  ? 19.593  84.921  72.422  1.00   85.50  ? 27  GLY C C     1 
ATOM   8337  O O     . GLY E 5 27  ? 20.776  84.580  72.437  1.00   87.15  ? 27  GLY C O     1 
ATOM   8338  N N     . ARG E 5 28  ? 19.091  85.743  71.503  1.00   84.47  ? 28  ARG C N     1 
ATOM   8339  C CA    . ARG E 5 28  ? 19.935  86.314  70.456  1.00   106.35 ? 28  ARG C CA    1 
ATOM   8340  C C     . ARG E 5 28  ? 21.044  87.201  71.013  1.00   91.63  ? 28  ARG C C     1 
ATOM   8341  O O     . ARG E 5 28  ? 22.191  87.110  70.581  1.00   86.55  ? 28  ARG C O     1 
ATOM   8342  C CB    . ARG E 5 28  ? 19.089  87.137  69.480  1.00   102.47 ? 28  ARG C CB    1 
ATOM   8343  C CG    . ARG E 5 28  ? 18.391  86.350  68.388  1.00   103.70 ? 28  ARG C CG    1 
ATOM   8344  C CD    . ARG E 5 28  ? 19.090  86.556  67.054  1.00   116.33 ? 28  ARG C CD    1 
ATOM   8345  N NE    . ARG E 5 28  ? 18.243  86.186  65.924  1.00   119.83 ? 28  ARG C NE    1 
ATOM   8346  C CZ    . ARG E 5 28  ? 17.425  87.029  65.301  1.00   109.28 ? 28  ARG C CZ    1 
ATOM   8347  N NH1   . ARG E 5 28  ? 17.345  88.291  65.698  1.00   89.72  ? 28  ARG C NH1   1 
ATOM   8348  N NH2   . ARG E 5 28  ? 16.690  86.610  64.280  1.00   117.89 ? 28  ARG C NH2   1 
ATOM   8349  N N     . ILE E 5 29  ? 20.695  88.059  71.968  1.00   97.51  ? 29  ILE C N     1 
ATOM   8350  C CA    . ILE E 5 29  ? 21.671  88.932  72.617  1.00   102.87 ? 29  ILE C CA    1 
ATOM   8351  C C     . ILE E 5 29  ? 22.772  88.123  73.307  1.00   110.10 ? 29  ILE C C     1 
ATOM   8352  O O     . ILE E 5 29  ? 23.954  88.468  73.226  1.00   102.84 ? 29  ILE C O     1 
ATOM   8353  C CB    . ILE E 5 29  ? 20.985  89.879  73.634  1.00   106.90 ? 29  ILE C CB    1 
ATOM   8354  C CG1   . ILE E 5 29  ? 20.580  91.192  72.956  1.00   96.89  ? 29  ILE C CG1   1 
ATOM   8355  C CG2   . ILE E 5 29  ? 21.916  90.209  74.787  1.00   120.66 ? 29  ILE C CG2   1 
ATOM   8356  C CD1   . ILE E 5 29  ? 19.522  91.057  71.884  1.00   71.58  ? 29  ILE C CD1   1 
ATOM   8357  N N     . HIS E 5 30  ? 22.374  87.034  73.959  1.00   112.37 ? 30  HIS C N     1 
ATOM   8358  C CA    . HIS E 5 30  ? 23.308  86.151  74.651  1.00   97.83  ? 30  HIS C CA    1 
ATOM   8359  C C     . HIS E 5 30  ? 24.309  85.545  73.673  1.00   100.20 ? 30  HIS C C     1 
ATOM   8360  O O     . HIS E 5 30  ? 25.501  85.448  73.965  1.00   100.55 ? 30  HIS C O     1 
ATOM   8361  C CB    . HIS E 5 30  ? 22.555  85.048  75.395  1.00   101.50 ? 30  HIS C CB    1 
ATOM   8362  C CG    . HIS E 5 30  ? 23.448  84.073  76.097  1.00   125.29 ? 30  HIS C CG    1 
ATOM   8363  N ND1   . HIS E 5 30  ? 24.582  84.461  76.778  1.00   129.07 ? 30  HIS C ND1   1 
ATOM   8364  C CD2   . HIS E 5 30  ? 23.371  82.728  76.231  1.00   134.82 ? 30  HIS C CD2   1 
ATOM   8365  C CE1   . HIS E 5 30  ? 25.167  83.397  77.297  1.00   136.85 ? 30  HIS C CE1   1 
ATOM   8366  N NE2   . HIS E 5 30  ? 24.452  82.332  76.980  1.00   143.03 ? 30  HIS C NE2   1 
ATOM   8367  N N     . ARG E 5 31  ? 23.809  85.138  72.510  1.00   89.88  ? 31  ARG C N     1 
ATOM   8368  C CA    . ARG E 5 31  ? 24.642  84.546  71.469  1.00   106.17 ? 31  ARG C CA    1 
ATOM   8369  C C     . ARG E 5 31  ? 25.606  85.591  70.906  1.00   111.54 ? 31  ARG C C     1 
ATOM   8370  O O     . ARG E 5 31  ? 26.803  85.332  70.764  1.00   81.10  ? 31  ARG C O     1 
ATOM   8371  C CB    . ARG E 5 31  ? 23.756  83.955  70.368  1.00   88.79  ? 31  ARG C CB    1 
ATOM   8372  C CG    . ARG E 5 31  ? 24.480  83.100  69.345  1.00   91.43  ? 31  ARG C CG    1 
ATOM   8373  C CD    . ARG E 5 31  ? 23.724  83.084  68.023  1.00   91.76  ? 31  ARG C CD    1 
ATOM   8374  N NE    . ARG E 5 31  ? 23.787  84.353  67.305  1.00   91.04  ? 31  ARG C NE    1 
ATOM   8375  C CZ    . ARG E 5 31  ? 24.781  84.702  66.496  1.00   116.72 ? 31  ARG C CZ    1 
ATOM   8376  N NH1   . ARG E 5 31  ? 25.799  83.875  66.298  1.00   136.06 ? 31  ARG C NH1   1 
ATOM   8377  N NH2   . ARG E 5 31  ? 24.759  85.877  65.882  1.00   96.40  ? 31  ARG C NH2   1 
ATOM   8378  N N     . LEU E 5 32  ? 25.070  86.764  70.579  1.00   114.95 ? 32  LEU C N     1 
ATOM   8379  C CA    . LEU E 5 32  ? 25.858  87.880  70.058  1.00   93.51  ? 32  LEU C CA    1 
ATOM   8380  C C     . LEU E 5 32  ? 27.003  88.248  70.998  1.00   107.02 ? 32  LEU C C     1 
ATOM   8381  O O     . LEU E 5 32  ? 28.088  88.628  70.557  1.00   124.35 ? 32  LEU C O     1 
ATOM   8382  C CB    . LEU E 5 32  ? 24.967  89.097  69.815  1.00   84.20  ? 32  LEU C CB    1 
ATOM   8383  C CG    . LEU E 5 32  ? 23.948  88.979  68.685  1.00   100.07 ? 32  LEU C CG    1 
ATOM   8384  C CD1   . LEU E 5 32  ? 23.114  90.238  68.595  1.00   111.54 ? 32  LEU C CD1   1 
ATOM   8385  C CD2   . LEU E 5 32  ? 24.668  88.732  67.373  1.00   101.78 ? 32  LEU C CD2   1 
ATOM   8386  N N     . LEU E 5 33  ? 26.745  88.135  72.297  1.00   95.66  ? 33  LEU C N     1 
ATOM   8387  C CA    . LEU E 5 33  ? 27.743  88.424  73.320  1.00   106.18 ? 33  LEU C CA    1 
ATOM   8388  C C     . LEU E 5 33  ? 28.858  87.382  73.296  1.00   115.79 ? 33  LEU C C     1 
ATOM   8389  O O     . LEU E 5 33  ? 30.039  87.727  73.353  1.00   112.86 ? 33  LEU C O     1 
ATOM   8390  C CB    . LEU E 5 33  ? 27.095  88.478  74.704  1.00   110.70 ? 33  LEU C CB    1 
ATOM   8391  C CG    . LEU E 5 33  ? 26.365  89.779  75.045  1.00   99.48  ? 33  LEU C CG    1 
ATOM   8392  C CD1   . LEU E 5 33  ? 25.604  89.648  76.356  1.00   89.87  ? 33  LEU C CD1   1 
ATOM   8393  C CD2   . LEU E 5 33  ? 27.344  90.942  75.100  1.00   84.69  ? 33  LEU C CD2   1 
ATOM   8394  N N     . ARG E 5 34  ? 28.478  86.111  73.219  1.00   102.85 ? 34  ARG C N     1 
ATOM   8395  C CA    . ARG E 5 34  ? 29.449  85.024  73.194  1.00   102.62 ? 34  ARG C CA    1 
ATOM   8396  C C     . ARG E 5 34  ? 30.348  85.093  71.964  1.00   94.12  ? 34  ARG C C     1 
ATOM   8397  O O     . ARG E 5 34  ? 31.563  84.918  72.063  1.00   81.69  ? 34  ARG C O     1 
ATOM   8398  C CB    . ARG E 5 34  ? 28.746  83.665  73.217  1.00   114.02 ? 34  ARG C CB    1 
ATOM   8399  C CG    . ARG E 5 34  ? 28.110  83.274  74.538  1.00   124.86 ? 34  ARG C CG    1 
ATOM   8400  C CD    . ARG E 5 34  ? 27.685  81.812  74.486  1.00   136.46 ? 34  ARG C CD    1 
ATOM   8401  N NE    . ARG E 5 34  ? 27.255  81.299  75.783  1.00   168.58 ? 34  ARG C NE    1 
ATOM   8402  C CZ    . ARG E 5 34  ? 26.811  80.062  75.981  1.00   179.09 ? 34  ARG C CZ    1 
ATOM   8403  N NH1   . ARG E 5 34  ? 26.743  79.210  74.966  1.00   172.65 ? 34  ARG C NH1   1 
ATOM   8404  N NH2   . ARG E 5 34  ? 26.437  79.673  77.193  1.00   176.00 ? 34  ARG C NH2   1 
ATOM   8405  N N     . LYS E 5 35  ? 29.751  85.353  70.806  1.00   96.03  ? 35  LYS C N     1 
ATOM   8406  C CA    . LYS E 5 35  ? 30.503  85.354  69.559  1.00   99.42  ? 35  LYS C CA    1 
ATOM   8407  C C     . LYS E 5 35  ? 30.952  86.754  69.155  1.00   105.49 ? 35  LYS C C     1 
ATOM   8408  O O     . LYS E 5 35  ? 31.236  87.001  67.983  1.00   118.22 ? 35  LYS C O     1 
ATOM   8409  C CB    . LYS E 5 35  ? 29.655  84.757  68.433  1.00   98.45  ? 35  LYS C CB    1 
ATOM   8410  C CG    . LYS E 5 35  ? 29.222  83.317  68.652  1.00   111.86 ? 35  LYS C CG    1 
ATOM   8411  C CD    . LYS E 5 35  ? 30.389  82.401  68.970  1.00   113.83 ? 35  LYS C CD    1 
ATOM   8412  C CE    . LYS E 5 35  ? 29.894  80.998  69.289  1.00   66.77  ? 35  LYS C CE    1 
ATOM   8413  N NZ    . LYS E 5 35  ? 31.002  80.086  69.675  1.00   82.33  ? 35  LYS C NZ    1 
ATOM   8414  N N     . GLY E 5 36  ? 31.022  87.672  70.114  1.00   96.70  ? 36  GLY C N     1 
ATOM   8415  C CA    . GLY E 5 36  ? 31.366  89.042  69.783  1.00   119.22 ? 36  GLY C CA    1 
ATOM   8416  C C     . GLY E 5 36  ? 32.731  89.520  70.239  1.00   113.58 ? 36  GLY C C     1 
ATOM   8417  O O     . GLY E 5 36  ? 33.061  90.693  70.059  1.00   113.86 ? 36  GLY C O     1 
ATOM   8418  N N     . ASN E 5 37  ? 33.513  88.623  70.837  1.00   103.46 ? 37  ASN C N     1 
ATOM   8419  C CA    . ASN E 5 37  ? 34.852  88.961  71.320  1.00   111.96 ? 37  ASN C CA    1 
ATOM   8420  C C     . ASN E 5 37  ? 34.832  90.067  72.374  1.00   122.88 ? 37  ASN C C     1 
ATOM   8421  O O     . ASN E 5 37  ? 35.448  91.117  72.189  1.00   130.55 ? 37  ASN C O     1 
ATOM   8422  C CB    . ASN E 5 37  ? 35.766  89.355  70.156  1.00   127.22 ? 37  ASN C CB    1 
ATOM   8423  C CG    . ASN E 5 37  ? 35.866  88.269  69.102  1.00   129.65 ? 37  ASN C CG    1 
ATOM   8424  O OD1   . ASN E 5 37  ? 35.122  88.269  68.122  1.00   133.02 ? 37  ASN C OD1   1 
ATOM   8425  N ND2   . ASN E 5 37  ? 36.787  87.334  69.303  1.00   129.39 ? 37  ASN C ND2   1 
ATOM   8426  N N     . TYR E 5 38  ? 34.128  89.836  73.477  1.00   117.42 ? 38  TYR C N     1 
ATOM   8427  C CA    . TYR E 5 38  ? 34.049  90.835  74.538  1.00   118.97 ? 38  TYR C CA    1 
ATOM   8428  C C     . TYR E 5 38  ? 34.672  90.321  75.831  1.00   119.05 ? 38  TYR C C     1 
ATOM   8429  O O     . TYR E 5 38  ? 35.302  91.079  76.569  1.00   107.63 ? 38  TYR C O     1 
ATOM   8430  C CB    . TYR E 5 38  ? 32.595  91.243  74.785  1.00   115.69 ? 38  TYR C CB    1 
ATOM   8431  C CG    . TYR E 5 38  ? 31.916  91.880  73.593  1.00   113.97 ? 38  TYR C CG    1 
ATOM   8432  C CD1   . TYR E 5 38  ? 32.252  93.164  73.181  1.00   110.86 ? 38  TYR C CD1   1 
ATOM   8433  C CD2   . TYR E 5 38  ? 30.932  91.203  72.885  1.00   116.96 ? 38  TYR C CD2   1 
ATOM   8434  C CE1   . TYR E 5 38  ? 31.632  93.752  72.094  1.00   92.97  ? 38  TYR C CE1   1 
ATOM   8435  C CE2   . TYR E 5 38  ? 30.305  91.783  71.797  1.00   119.04 ? 38  TYR C CE2   1 
ATOM   8436  C CZ    . TYR E 5 38  ? 30.660  93.057  71.406  1.00   108.53 ? 38  TYR C CZ    1 
ATOM   8437  O OH    . TYR E 5 38  ? 30.041  93.638  70.322  1.00   100.69 ? 38  TYR C OH    1 
ATOM   8438  N N     . ALA E 5 39  ? 34.495  89.031  76.097  1.00   122.29 ? 39  ALA C N     1 
ATOM   8439  C CA    . ALA E 5 39  ? 35.060  88.405  77.286  1.00   121.70 ? 39  ALA C CA    1 
ATOM   8440  C C     . ALA E 5 39  ? 35.089  86.893  77.130  1.00   120.58 ? 39  ALA C C     1 
ATOM   8441  O O     . ALA E 5 39  ? 34.369  86.333  76.304  1.00   123.31 ? 39  ALA C O     1 
ATOM   8442  C CB    . ALA E 5 39  ? 34.272  88.791  78.524  1.00   130.44 ? 39  ALA C CB    1 
ATOM   8443  N N     . GLU E 5 40  ? 35.935  86.241  77.922  1.00   112.31 ? 40  GLU C N     1 
ATOM   8444  C CA    . GLU E 5 40  ? 36.024  84.787  77.918  1.00   127.42 ? 40  GLU C CA    1 
ATOM   8445  C C     . GLU E 5 40  ? 34.682  84.152  78.263  1.00   131.58 ? 40  GLU C C     1 
ATOM   8446  O O     . GLU E 5 40  ? 34.298  83.134  77.688  1.00   124.20 ? 40  GLU C O     1 
ATOM   8447  C CB    . GLU E 5 40  ? 37.104  84.315  78.892  1.00   133.18 ? 40  GLU C CB    1 
ATOM   8448  C CG    . GLU E 5 40  ? 38.516  84.590  78.404  1.00   156.23 ? 40  GLU C CG    1 
ATOM   8449  C CD    . GLU E 5 40  ? 38.769  84.038  77.013  1.00   166.80 ? 40  GLU C CD    1 
ATOM   8450  O OE1   . GLU E 5 40  ? 39.395  84.747  76.197  1.00   164.78 ? 40  GLU C OE1   1 
ATOM   8451  O OE2   . GLU E 5 40  ? 38.346  82.895  76.736  1.00   162.31 ? 40  GLU C OE2   1 
ATOM   8452  N N     . ARG E 5 41  ? 33.970  84.765  79.205  1.00   137.93 ? 41  ARG C N     1 
ATOM   8453  C CA    . ARG E 5 41  ? 32.695  84.236  79.677  1.00   132.16 ? 41  ARG C CA    1 
ATOM   8454  C C     . ARG E 5 41  ? 31.663  85.352  79.813  1.00   118.32 ? 41  ARG C C     1 
ATOM   8455  O O     . ARG E 5 41  ? 32.011  86.519  79.992  1.00   102.93 ? 41  ARG C O     1 
ATOM   8456  C CB    . ARG E 5 41  ? 32.860  83.501  81.014  1.00   133.20 ? 41  ARG C CB    1 
ATOM   8457  C CG    . ARG E 5 41  ? 34.127  82.662  81.130  1.00   130.73 ? 41  ARG C CG    1 
ATOM   8458  C CD    . ARG E 5 41  ? 34.074  81.710  82.315  1.00   123.71 ? 41  ARG C CD    1 
ATOM   8459  N NE    . ARG E 5 41  ? 33.626  82.364  83.540  1.00   133.98 ? 41  ARG C NE    1 
ATOM   8460  C CZ    . ARG E 5 41  ? 33.301  81.715  84.653  1.00   156.73 ? 41  ARG C CZ    1 
ATOM   8461  N NH1   . ARG E 5 41  ? 33.375  80.391  84.697  1.00   152.65 ? 41  ARG C NH1   1 
ATOM   8462  N NH2   . ARG E 5 41  ? 32.901  82.388  85.724  1.00   156.71 ? 41  ARG C NH2   1 
ATOM   8463  N N     . VAL E 5 42  ? 30.390  84.977  79.729  1.00   124.68 ? 42  VAL C N     1 
ATOM   8464  C CA    . VAL E 5 42  ? 29.285  85.923  79.837  1.00   103.17 ? 42  VAL C CA    1 
ATOM   8465  C C     . VAL E 5 42  ? 28.313  85.505  80.934  1.00   104.80 ? 42  VAL C C     1 
ATOM   8466  O O     . VAL E 5 42  ? 27.811  84.380  80.935  1.00   111.81 ? 42  VAL C O     1 
ATOM   8467  C CB    . VAL E 5 42  ? 28.515  86.046  78.505  1.00   100.62 ? 42  VAL C CB    1 
ATOM   8468  C CG1   . VAL E 5 42  ? 27.279  86.916  78.680  1.00   102.09 ? 42  VAL C CG1   1 
ATOM   8469  C CG2   . VAL E 5 42  ? 29.418  86.598  77.414  1.00   89.83  ? 42  VAL C CG2   1 
ATOM   8470  N N     . GLY E 5 43  ? 28.054  86.417  81.866  1.00   106.62 ? 43  GLY C N     1 
ATOM   8471  C CA    . GLY E 5 43  ? 27.162  86.141  82.976  1.00   111.95 ? 43  GLY C CA    1 
ATOM   8472  C C     . GLY E 5 43  ? 25.734  85.867  82.548  1.00   102.77 ? 43  GLY C C     1 
ATOM   8473  O O     . GLY E 5 43  ? 25.318  86.249  81.454  1.00   97.19  ? 43  GLY C O     1 
ATOM   8474  N N     . ALA E 5 44  ? 24.985  85.192  83.414  1.00   107.19 ? 44  ALA C N     1 
ATOM   8475  C CA    . ALA E 5 44  ? 23.611  84.809  83.110  1.00   126.35 ? 44  ALA C CA    1 
ATOM   8476  C C     . ALA E 5 44  ? 22.684  86.017  83.045  1.00   109.29 ? 44  ALA C C     1 
ATOM   8477  O O     . ALA E 5 44  ? 21.712  86.021  82.287  1.00   98.77  ? 44  ALA C O     1 
ATOM   8478  C CB    . ALA E 5 44  ? 23.103  83.811  84.141  1.00   158.33 ? 44  ALA C CB    1 
ATOM   8479  N N     . GLY E 5 45  ? 22.987  87.039  83.839  1.00   104.95 ? 45  GLY C N     1 
ATOM   8480  C CA    . GLY E 5 45  ? 22.143  88.218  83.914  1.00   96.95  ? 45  GLY C CA    1 
ATOM   8481  C C     . GLY E 5 45  ? 22.474  89.274  82.877  1.00   101.07 ? 45  GLY C C     1 
ATOM   8482  O O     . GLY E 5 45  ? 21.660  90.157  82.605  1.00   90.44  ? 45  GLY C O     1 
ATOM   8483  N N     . ALA E 5 46  ? 23.672  89.185  82.304  1.00   104.69 ? 46  ALA C N     1 
ATOM   8484  C CA    . ALA E 5 46  ? 24.132  90.153  81.309  1.00   91.26  ? 46  ALA C CA    1 
ATOM   8485  C C     . ALA E 5 46  ? 23.161  90.305  80.124  1.00   99.05  ? 46  ALA C C     1 
ATOM   8486  O O     . ALA E 5 46  ? 22.774  91.428  79.800  1.00   108.53 ? 46  ALA C O     1 
ATOM   8487  C CB    . ALA E 5 46  ? 25.533  89.785  80.814  1.00   83.66  ? 46  ALA C CB    1 
ATOM   8488  N N     . PRO E 5 47  ? 22.774  89.192  79.461  1.00   95.69  ? 47  PRO C N     1 
ATOM   8489  C CA    . PRO E 5 47  ? 21.874  89.365  78.313  1.00   99.46  ? 47  PRO C CA    1 
ATOM   8490  C C     . PRO E 5 47  ? 20.523  89.962  78.708  1.00   93.03  ? 47  PRO C C     1 
ATOM   8491  O O     . PRO E 5 47  ? 19.982  90.801  77.986  1.00   89.14  ? 47  PRO C O     1 
ATOM   8492  C CB    . PRO E 5 47  ? 21.709  87.940  77.773  1.00   106.56 ? 47  PRO C CB    1 
ATOM   8493  C CG    . PRO E 5 47  ? 21.997  87.062  78.926  1.00   103.92 ? 47  PRO C CG    1 
ATOM   8494  C CD    . PRO E 5 47  ? 23.063  87.764  79.702  1.00   95.26  ? 47  PRO C CD    1 
ATOM   8495  N N     . VAL E 5 48  ? 19.993  89.523  79.845  1.00   87.58  ? 48  VAL C N     1 
ATOM   8496  C CA    . VAL E 5 48  ? 18.722  90.020  80.363  1.00   98.50  ? 48  VAL C CA    1 
ATOM   8497  C C     . VAL E 5 48  ? 18.760  91.524  80.632  1.00   88.56  ? 48  VAL C C     1 
ATOM   8498  O O     . VAL E 5 48  ? 17.853  92.256  80.234  1.00   79.56  ? 48  VAL C O     1 
ATOM   8499  C CB    . VAL E 5 48  ? 18.328  89.282  81.660  1.00   104.71 ? 48  VAL C CB    1 
ATOM   8500  C CG1   . VAL E 5 48  ? 17.069  89.884  82.257  1.00   106.15 ? 48  VAL C CG1   1 
ATOM   8501  C CG2   . VAL E 5 48  ? 18.133  87.800  81.387  1.00   98.21  ? 48  VAL C CG2   1 
ATOM   8502  N N     . TYR E 5 49  ? 19.812  91.980  81.306  1.00   89.30  ? 49  TYR C N     1 
ATOM   8503  C CA    . TYR E 5 49  ? 19.958  93.393  81.641  1.00   86.81  ? 49  TYR C CA    1 
ATOM   8504  C C     . TYR E 5 49  ? 20.070  94.219  80.364  1.00   82.63  ? 49  TYR C C     1 
ATOM   8505  O O     . TYR E 5 49  ? 19.455  95.276  80.239  1.00   85.30  ? 49  TYR C O     1 
ATOM   8506  C CB    . TYR E 5 49  ? 21.181  93.617  82.538  1.00   78.23  ? 49  TYR C CB    1 
ATOM   8507  C CG    . TYR E 5 49  ? 21.146  94.908  83.331  1.00   75.95  ? 49  TYR C CG    1 
ATOM   8508  C CD1   . TYR E 5 49  ? 21.206  96.143  82.695  1.00   67.99  ? 49  TYR C CD1   1 
ATOM   8509  C CD2   . TYR E 5 49  ? 21.051  94.891  84.717  1.00   90.19  ? 49  TYR C CD2   1 
ATOM   8510  C CE1   . TYR E 5 49  ? 21.174  97.323  83.416  1.00   65.76  ? 49  TYR C CE1   1 
ATOM   8511  C CE2   . TYR E 5 49  ? 21.018  96.067  85.446  1.00   85.51  ? 49  TYR C CE2   1 
ATOM   8512  C CZ    . TYR E 5 49  ? 21.080  97.278  84.790  1.00   68.58  ? 49  TYR C CZ    1 
ATOM   8513  O OH    . TYR E 5 49  ? 21.048  98.449  85.510  1.00   62.95  ? 49  TYR C OH    1 
ATOM   8514  N N     . LEU E 5 50  ? 20.858  93.721  79.418  1.00   87.30  ? 50  LEU C N     1 
ATOM   8515  C CA    . LEU E 5 50  ? 21.106  94.418  78.163  1.00   67.00  ? 50  LEU C CA    1 
ATOM   8516  C C     . LEU E 5 50  ? 19.866  94.513  77.280  1.00   58.54  ? 50  LEU C C     1 
ATOM   8517  O O     . LEU E 5 50  ? 19.562  95.580  76.752  1.00   67.47  ? 50  LEU C O     1 
ATOM   8518  C CB    . LEU E 5 50  ? 22.234  93.727  77.396  1.00   87.32  ? 50  LEU C CB    1 
ATOM   8519  C CG    . LEU E 5 50  ? 22.669  94.387  76.089  1.00   69.64  ? 50  LEU C CG    1 
ATOM   8520  C CD1   . LEU E 5 50  ? 22.998  95.842  76.316  1.00   60.97  ? 50  LEU C CD1   1 
ATOM   8521  C CD2   . LEU E 5 50  ? 23.868  93.656  75.517  1.00   66.10  ? 50  LEU C CD2   1 
ATOM   8522  N N     . ALA E 5 51  ? 19.157  93.400  77.119  1.00   64.88  ? 51  ALA C N     1 
ATOM   8523  C CA    . ALA E 5 51  ? 17.940  93.379  76.309  1.00   86.18  ? 51  ALA C CA    1 
ATOM   8524  C C     . ALA E 5 51  ? 16.870  94.337  76.839  1.00   79.30  ? 51  ALA C C     1 
ATOM   8525  O O     . ALA E 5 51  ? 16.162  94.976  76.060  1.00   57.91  ? 51  ALA C O     1 
ATOM   8526  C CB    . ALA E 5 51  ? 17.385  91.963  76.235  1.00   75.21  ? 51  ALA C CB    1 
ATOM   8527  N N     . ALA E 5 52  ? 16.753  94.427  78.160  1.00   82.67  ? 52  ALA C N     1 
ATOM   8528  C CA    . ALA E 5 52  ? 15.804  95.342  78.787  1.00   74.08  ? 52  ALA C CA    1 
ATOM   8529  C C     . ALA E 5 52  ? 16.126  96.795  78.458  1.00   78.33  ? 52  ALA C C     1 
ATOM   8530  O O     . ALA E 5 52  ? 15.232  97.588  78.158  1.00   82.63  ? 52  ALA C O     1 
ATOM   8531  C CB    . ALA E 5 52  ? 15.789  95.139  80.288  1.00   81.27  ? 52  ALA C CB    1 
ATOM   8532  N N     . VAL E 5 53  ? 17.410  97.133  78.523  1.00   84.47  ? 53  VAL C N     1 
ATOM   8533  C CA    . VAL E 5 53  ? 17.874  98.484  78.228  1.00   70.76  ? 53  VAL C CA    1 
ATOM   8534  C C     . VAL E 5 53  ? 17.671  98.811  76.755  1.00   68.53  ? 53  VAL C C     1 
ATOM   8535  O O     . VAL E 5 53  ? 17.242  99.911  76.406  1.00   89.62  ? 53  VAL C O     1 
ATOM   8536  C CB    . VAL E 5 53  ? 19.360  98.660  78.600  1.00   61.65  ? 53  VAL C CB    1 
ATOM   8537  C CG1   . VAL E 5 53  ? 19.890  99.992  78.095  1.00   94.33  ? 53  VAL C CG1   1 
ATOM   8538  C CG2   . VAL E 5 53  ? 19.545  98.547  80.105  1.00   72.57  ? 53  VAL C CG2   1 
ATOM   8539  N N     . MET E 5 54  ? 17.969  97.844  75.895  1.00   59.91  ? 54  MET C N     1 
ATOM   8540  C CA    . MET E 5 54  ? 17.762  98.011  74.464  1.00   70.17  ? 54  MET C CA    1 
ATOM   8541  C C     . MET E 5 54  ? 16.280  98.209  74.162  1.00   76.11  ? 54  MET C C     1 
ATOM   8542  O O     . MET E 5 54  ? 15.904  99.069  73.364  1.00   56.77  ? 54  MET C O     1 
ATOM   8543  C CB    . MET E 5 54  ? 18.293  96.792  73.709  1.00   80.95  ? 54  MET C CB    1 
ATOM   8544  C CG    . MET E 5 54  ? 19.802  96.641  73.741  1.00   87.40  ? 54  MET C CG    1 
ATOM   8545  S SD    . MET E 5 54  ? 20.334  95.111  72.955  1.00   74.73  ? 54  MET C SD    1 
ATOM   8546  C CE    . MET E 5 54  ? 19.548  95.265  71.352  1.00   105.27 ? 54  MET C CE    1 
ATOM   8547  N N     . GLU E 5 55  ? 15.446  97.401  74.809  1.00   85.93  ? 55  GLU C N     1 
ATOM   8548  C CA    . GLU E 5 55  ? 14.000  97.488  74.643  1.00   83.29  ? 55  GLU C CA    1 
ATOM   8549  C C     . GLU E 5 55  ? 13.441  98.822  75.113  1.00   78.66  ? 55  GLU C C     1 
ATOM   8550  O O     . GLU E 5 55  ? 12.566  99.400  74.468  1.00   83.61  ? 55  GLU C O     1 
ATOM   8551  C CB    . GLU E 5 55  ? 13.301  96.353  75.395  1.00   85.08  ? 55  GLU C CB    1 
ATOM   8552  C CG    . GLU E 5 55  ? 11.788  96.367  75.244  1.00   85.33  ? 55  GLU C CG    1 
ATOM   8553  C CD    . GLU E 5 55  ? 11.120  95.171  75.891  1.00   101.11 ? 55  GLU C CD    1 
ATOM   8554  O OE1   . GLU E 5 55  ? 9.899   95.237  76.145  1.00   128.27 ? 55  GLU C OE1   1 
ATOM   8555  O OE2   . GLU E 5 55  ? 11.814  94.166  76.143  1.00   90.77  ? 55  GLU C OE2   1 
ATOM   8556  N N     . TYR E 5 56  ? 13.950  99.305  76.243  1.00   67.67  ? 56  TYR C N     1 
ATOM   8557  C CA    . TYR E 5 56  ? 13.498  100.573 76.794  1.00   74.98  ? 56  TYR C CA    1 
ATOM   8558  C C     . TYR E 5 56  ? 13.793  101.723 75.841  1.00   77.87  ? 56  TYR C C     1 
ATOM   8559  O O     . TYR E 5 56  ? 12.913  102.538 75.556  1.00   87.01  ? 56  TYR C O     1 
ATOM   8560  C CB    . TYR E 5 56  ? 14.146  100.838 78.156  1.00   71.81  ? 56  TYR C CB    1 
ATOM   8561  C CG    . TYR E 5 56  ? 14.010  102.273 78.617  1.00   83.14  ? 56  TYR C CG    1 
ATOM   8562  C CD1   . TYR E 5 56  ? 12.803  102.741 79.123  1.00   78.36  ? 56  TYR C CD1   1 
ATOM   8563  C CD2   . TYR E 5 56  ? 15.079  103.157 78.548  1.00   87.01  ? 56  TYR C CD2   1 
ATOM   8564  C CE1   . TYR E 5 56  ? 12.661  104.047 79.545  1.00   69.57  ? 56  TYR C CE1   1 
ATOM   8565  C CE2   . TYR E 5 56  ? 14.946  104.470 78.968  1.00   97.49  ? 56  TYR C CE2   1 
ATOM   8566  C CZ    . TYR E 5 56  ? 13.734  104.908 79.466  1.00   97.39  ? 56  TYR C CZ    1 
ATOM   8567  O OH    . TYR E 5 56  ? 13.590  106.210 79.888  1.00   98.67  ? 56  TYR C OH    1 
ATOM   8568  N N     . LEU E 5 57  ? 15.031  101.795 75.360  1.00   64.58  ? 57  LEU C N     1 
ATOM   8569  C CA    . LEU E 5 57  ? 15.419  102.854 74.435  1.00   69.92  ? 57  LEU C CA    1 
ATOM   8570  C C     . LEU E 5 57  ? 14.609  102.772 73.146  1.00   69.88  ? 57  LEU C C     1 
ATOM   8571  O O     . LEU E 5 57  ? 14.209  103.794 72.588  1.00   72.37  ? 57  LEU C O     1 
ATOM   8572  C CB    . LEU E 5 57  ? 16.915  102.776 74.128  1.00   74.89  ? 57  LEU C CB    1 
ATOM   8573  C CG    . LEU E 5 57  ? 17.855  103.148 75.276  1.00   63.77  ? 57  LEU C CG    1 
ATOM   8574  C CD1   . LEU E 5 57  ? 19.298  102.829 74.917  1.00   48.03  ? 57  LEU C CD1   1 
ATOM   8575  C CD2   . LEU E 5 57  ? 17.699  104.617 75.642  1.00   66.84  ? 57  LEU C CD2   1 
ATOM   8576  N N     . ALA E 5 58  ? 14.380  101.549 72.676  1.00   67.55  ? 58  ALA C N     1 
ATOM   8577  C CA    . ALA E 5 58  ? 13.570  101.325 71.485  1.00   71.16  ? 58  ALA C CA    1 
ATOM   8578  C C     . ALA E 5 58  ? 12.140  101.804 71.713  1.00   69.04  ? 58  ALA C C     1 
ATOM   8579  O O     . ALA E 5 58  ? 11.536  102.433 70.848  1.00   62.63  ? 58  ALA C O     1 
ATOM   8580  C CB    . ALA E 5 58  ? 13.585  99.856  71.101  1.00   91.68  ? 58  ALA C CB    1 
ATOM   8581  N N     . ALA E 5 59  ? 11.618  101.512 72.900  1.00   67.67  ? 59  ALA C N     1 
ATOM   8582  C CA    . ALA E 5 59  ? 10.269  101.909 73.281  1.00   59.98  ? 59  ALA C CA    1 
ATOM   8583  C C     . ALA E 5 59  ? 10.165  103.421 73.410  1.00   73.98  ? 59  ALA C C     1 
ATOM   8584  O O     . ALA E 5 59  ? 9.186   104.025 72.974  1.00   78.50  ? 59  ALA C O     1 
ATOM   8585  C CB    . ALA E 5 59  ? 9.867   101.237 74.584  1.00   69.15  ? 59  ALA C CB    1 
ATOM   8586  N N     . GLU E 5 60  ? 11.184  104.018 74.020  1.00   79.92  ? 60  GLU C N     1 
ATOM   8587  C CA    . GLU E 5 60  ? 11.237  105.458 74.245  1.00   69.87  ? 60  GLU C CA    1 
ATOM   8588  C C     . GLU E 5 60  ? 11.134  106.236 72.935  1.00   68.07  ? 60  GLU C C     1 
ATOM   8589  O O     . GLU E 5 60  ? 10.419  107.234 72.853  1.00   75.89  ? 60  GLU C O     1 
ATOM   8590  C CB    . GLU E 5 60  ? 12.518  105.838 74.987  1.00   63.68  ? 60  GLU C CB    1 
ATOM   8591  C CG    . GLU E 5 60  ? 12.460  107.212 75.631  1.00   88.25  ? 60  GLU C CG    1 
ATOM   8592  C CD    . GLU E 5 60  ? 11.287  107.356 76.587  1.00   109.93 ? 60  GLU C CD    1 
ATOM   8593  O OE1   . GLU E 5 60  ? 10.978  106.380 77.305  1.00   107.12 ? 60  GLU C OE1   1 
ATOM   8594  O OE2   . GLU E 5 60  ? 10.671  108.443 76.617  1.00   110.99 ? 60  GLU C OE2   1 
ATOM   8595  N N     . VAL E 5 61  ? 11.850  105.777 71.914  1.00   58.85  ? 61  VAL C N     1 
ATOM   8596  C CA    . VAL E 5 61  ? 11.860  106.459 70.626  1.00   63.65  ? 61  VAL C CA    1 
ATOM   8597  C C     . VAL E 5 61  ? 10.574  106.146 69.866  1.00   62.41  ? 61  VAL C C     1 
ATOM   8598  O O     . VAL E 5 61  ? 9.988   107.027 69.237  1.00   74.11  ? 61  VAL C O     1 
ATOM   8599  C CB    . VAL E 5 61  ? 13.080  106.050 69.777  1.00   69.50  ? 61  VAL C CB    1 
ATOM   8600  C CG1   . VAL E 5 61  ? 12.999  106.667 68.386  1.00   56.35  ? 61  VAL C CG1   1 
ATOM   8601  C CG2   . VAL E 5 61  ? 14.367  106.466 70.469  1.00   78.76  ? 61  VAL C CG2   1 
ATOM   8602  N N     . LEU E 5 62  ? 10.128  104.897 69.943  1.00   56.00  ? 62  LEU C N     1 
ATOM   8603  C CA    . LEU E 5 62  ? 8.908   104.480 69.261  1.00   70.71  ? 62  LEU C CA    1 
ATOM   8604  C C     . LEU E 5 62  ? 7.708   105.217 69.853  1.00   73.72  ? 62  LEU C C     1 
ATOM   8605  O O     . LEU E 5 62  ? 6.719   105.471 69.163  1.00   59.58  ? 62  LEU C O     1 
ATOM   8606  C CB    . LEU E 5 62  ? 8.718   102.965 69.359  1.00   68.65  ? 62  LEU C CB    1 
ATOM   8607  C CG    . LEU E 5 62  ? 9.580   102.139 68.398  1.00   69.14  ? 62  LEU C CG    1 
ATOM   8608  C CD1   . LEU E 5 62  ? 9.227   100.663 68.475  1.00   57.74  ? 62  LEU C CD1   1 
ATOM   8609  C CD2   . LEU E 5 62  ? 9.437   102.654 66.971  1.00   56.23  ? 62  LEU C CD2   1 
ATOM   8610  N N     . GLU E 5 63  ? 7.804   105.553 71.136  1.00   82.14  ? 63  GLU C N     1 
ATOM   8611  C CA    . GLU E 5 63  ? 6.757   106.303 71.817  1.00   69.73  ? 63  GLU C CA    1 
ATOM   8612  C C     . GLU E 5 63  ? 6.663   107.739 71.322  1.00   74.47  ? 63  GLU C C     1 
ATOM   8613  O O     . GLU E 5 63  ? 5.589   108.213 70.949  1.00   58.03  ? 63  GLU C O     1 
ATOM   8614  C CB    . GLU E 5 63  ? 7.061   106.321 73.318  1.00   81.45  ? 63  GLU C CB    1 
ATOM   8615  C CG    . GLU E 5 63  ? 6.061   107.035 74.203  1.00   87.78  ? 63  GLU C CG    1 
ATOM   8616  C CD    . GLU E 5 63  ? 5.051   106.104 74.817  1.00   119.57 ? 63  GLU C CD    1 
ATOM   8617  O OE1   . GLU E 5 63  ? 4.103   106.606 75.449  1.00   109.76 ? 63  GLU C OE1   1 
ATOM   8618  O OE2   . GLU E 5 63  ? 5.237   104.874 74.716  1.00   142.66 ? 63  GLU C OE2   1 
ATOM   8619  N N     . LEU E 5 64  ? 7.804   108.420 71.326  1.00   84.23  ? 64  LEU C N     1 
ATOM   8620  C CA    . LEU E 5 64  ? 7.910   109.794 70.847  1.00   73.58  ? 64  LEU C CA    1 
ATOM   8621  C C     . LEU E 5 64  ? 7.593   109.935 69.362  1.00   72.35  ? 64  LEU C C     1 
ATOM   8622  O O     . LEU E 5 64  ? 6.943   110.892 68.942  1.00   75.80  ? 64  LEU C O     1 
ATOM   8623  C CB    . LEU E 5 64  ? 9.296   110.348 71.162  1.00   74.42  ? 64  LEU C CB    1 
ATOM   8624  C CG    . LEU E 5 64  ? 9.483   110.468 72.677  1.00   76.07  ? 64  LEU C CG    1 
ATOM   8625  C CD1   . LEU E 5 64  ? 10.901  110.856 73.038  1.00   94.00  ? 64  LEU C CD1   1 
ATOM   8626  C CD2   . LEU E 5 64  ? 8.484   111.455 73.262  1.00   81.11  ? 64  LEU C CD2   1 
ATOM   8627  N N     . ALA E 5 65  ? 8.063   108.972 68.574  1.00   73.85  ? 65  ALA C N     1 
ATOM   8628  C CA    . ALA E 5 65  ? 7.796   108.948 67.142  1.00   83.53  ? 65  ALA C CA    1 
ATOM   8629  C C     . ALA E 5 65  ? 6.309   108.804 66.846  1.00   84.92  ? 65  ALA C C     1 
ATOM   8630  O O     . ALA E 5 65  ? 5.768   109.532 66.008  1.00   65.66  ? 65  ALA C O     1 
ATOM   8631  C CB    . ALA E 5 65  ? 8.573   107.824 66.478  1.00   59.85  ? 65  ALA C CB    1 
ATOM   8632  N N     . GLY E 5 66  ? 5.658   107.856 67.516  1.00   71.59  ? 66  GLY C N     1 
ATOM   8633  C CA    . GLY E 5 66  ? 4.231   107.658 67.339  1.00   68.77  ? 66  GLY C CA    1 
ATOM   8634  C C     . GLY E 5 66  ? 3.452   108.937 67.569  1.00   71.95  ? 66  GLY C C     1 
ATOM   8635  O O     . GLY E 5 66  ? 2.589   109.291 66.769  1.00   78.50  ? 66  GLY C O     1 
ATOM   8636  N N     . ASN E 5 67  ? 3.748   109.625 68.668  1.00   65.69  ? 67  ASN C N     1 
ATOM   8637  C CA    . ASN E 5 67  ? 3.122   110.912 68.950  1.00   61.26  ? 67  ASN C CA    1 
ATOM   8638  C C     . ASN E 5 67  ? 3.360   111.924 67.832  1.00   65.95  ? 67  ASN C C     1 
ATOM   8639  O O     . ASN E 5 67  ? 2.465   112.685 67.467  1.00   73.28  ? 67  ASN C O     1 
ATOM   8640  C CB    . ASN E 5 67  ? 3.634   111.474 70.278  1.00   72.12  ? 67  ASN C CB    1 
ATOM   8641  C CG    . ASN E 5 67  ? 3.317   110.572 71.456  1.00   68.68  ? 67  ASN C CG    1 
ATOM   8642  O OD1   . ASN E 5 67  ? 2.485   109.671 71.356  1.00   67.64  ? 67  ASN C OD1   1 
ATOM   8643  N ND2   . ASN E 5 67  ? 3.979   110.813 72.581  1.00   76.97  ? 67  ASN C ND2   1 
ATOM   8644  N N     . ALA E 5 68  ? 4.579   111.919 67.300  1.00   64.07  ? 68  ALA C N     1 
ATOM   8645  C CA    . ALA E 5 68  ? 4.985   112.837 66.236  1.00   69.09  ? 68  ALA C CA    1 
ATOM   8646  C C     . ALA E 5 68  ? 4.226   112.653 64.922  1.00   65.98  ? 68  ALA C C     1 
ATOM   8647  O O     . ALA E 5 68  ? 3.840   113.630 64.281  1.00   57.91  ? 68  ALA C O     1 
ATOM   8648  C CB    . ALA E 5 68  ? 6.480   112.705 65.987  1.00   72.53  ? 68  ALA C CB    1 
ATOM   8649  N N     . ALA E 5 69  ? 4.026   111.401 64.523  1.00   67.01  ? 69  ALA C N     1 
ATOM   8650  C CA    . ALA E 5 69  ? 3.269   111.082 63.315  1.00   72.84  ? 69  ALA C CA    1 
ATOM   8651  C C     . ALA E 5 69  ? 1.806   111.504 63.423  1.00   77.34  ? 69  ALA C C     1 
ATOM   8652  O O     . ALA E 5 69  ? 1.222   112.039 62.479  1.00   77.32  ? 69  ALA C O     1 
ATOM   8653  C CB    . ALA E 5 69  ? 3.364   109.592 63.021  1.00   61.10  ? 69  ALA C CB    1 
ATOM   8654  N N     . ARG E 5 70  ? 1.232   111.254 64.591  1.00   77.22  ? 70  ARG C N     1 
ATOM   8655  C CA    . ARG E 5 70  ? -0.149  111.598 64.903  1.00   73.63  ? 70  ARG C CA    1 
ATOM   8656  C C     . ARG E 5 70  ? -0.346  113.112 64.818  1.00   70.67  ? 70  ARG C C     1 
ATOM   8657  O O     . ARG E 5 70  ? -1.386  113.582 64.361  1.00   103.79 ? 70  ARG C O     1 
ATOM   8658  C CB    . ARG E 5 70  ? -0.547  111.015 66.257  1.00   83.17  ? 70  ARG C CB    1 
ATOM   8659  C CG    . ARG E 5 70  ? -0.489  109.486 66.183  1.00   104.84 ? 70  ARG C CG    1 
ATOM   8660  C CD    . ARG E 5 70  ? -1.176  108.728 67.301  1.00   118.18 ? 70  ARG C CD    1 
ATOM   8661  N NE    . ARG E 5 70  ? -2.604  109.009 67.363  1.00   108.62 ? 70  ARG C NE    1 
ATOM   8662  C CZ    . ARG E 5 70  ? -3.419  108.501 68.280  1.00   113.94 ? 70  ARG C CZ    1 
ATOM   8663  N NH1   . ARG E 5 70  ? -2.946  107.679 69.207  1.00   110.69 ? 70  ARG C NH1   1 
ATOM   8664  N NH2   . ARG E 5 70  ? -4.709  108.808 68.265  1.00   123.47 ? 70  ARG C NH2   1 
ATOM   8665  N N     . ASP E 5 71  ? 0.656   113.868 65.259  1.00   76.91  ? 71  ASP C N     1 
ATOM   8666  C CA    . ASP E 5 71  ? 0.590   115.329 65.266  1.00   79.68  ? 71  ASP C CA    1 
ATOM   8667  C C     . ASP E 5 71  ? 0.581   115.868 63.838  1.00   82.62  ? 71  ASP C C     1 
ATOM   8668  O O     . ASP E 5 71  ? 0.164   117.001 63.599  1.00   90.49  ? 71  ASP C O     1 
ATOM   8669  C CB    . ASP E 5 71  ? 1.766   115.939 66.034  1.00   62.50  ? 71  ASP C CB    1 
ATOM   8670  C CG    . ASP E 5 71  ? 1.718   115.637 67.513  1.00   88.82  ? 71  ASP C CG    1 
ATOM   8671  O OD1   . ASP E 5 71  ? 0.651   115.203 67.995  1.00   102.81 ? 71  ASP C OD1   1 
ATOM   8672  O OD2   . ASP E 5 71  ? 2.744   115.843 68.196  1.00   87.90  ? 71  ASP C OD2   1 
ATOM   8673  N N     . ASN E 5 72  ? 1.044   115.060 62.890  1.00   83.82  ? 72  ASN C N     1 
ATOM   8674  C CA    . ASN E 5 72  ? 1.039   115.465 61.491  1.00   96.47  ? 72  ASN C CA    1 
ATOM   8675  C C     . ASN E 5 72  ? -0.085  114.720 60.772  1.00   103.09 ? 72  ASN C C     1 
ATOM   8676  O O     . ASN E 5 72  ? -0.130  114.652 59.543  1.00   109.74 ? 72  ASN C O     1 
ATOM   8677  C CB    . ASN E 5 72  ? 2.396   115.172 60.844  1.00   100.47 ? 72  ASN C CB    1 
ATOM   8678  C CG    . ASN E 5 72  ? 2.664   116.030 59.621  1.00   114.65 ? 72  ASN C CG    1 
ATOM   8679  O OD1   . ASN E 5 72  ? 2.118   115.791 58.544  1.00   110.05 ? 72  ASN C OD1   1 
ATOM   8680  N ND2   . ASN E 5 72  ? 3.516   117.037 59.782  1.00   131.25 ? 72  ASN C ND2   1 
ATOM   8681  N N     . LYS E 5 73  ? -0.976  114.148 61.580  1.00   87.42  ? 73  LYS C N     1 
ATOM   8682  C CA    . LYS E 5 73  ? -2.195  113.474 61.130  1.00   94.06  ? 73  LYS C CA    1 
ATOM   8683  C C     . LYS E 5 73  ? -1.918  112.206 60.329  1.00   101.52 ? 73  LYS C C     1 
ATOM   8684  O O     . LYS E 5 73  ? -2.667  111.862 59.415  1.00   114.07 ? 73  LYS C O     1 
ATOM   8685  C CB    . LYS E 5 73  ? -3.074  114.433 60.319  1.00   90.27  ? 73  LYS C CB    1 
ATOM   8686  C CG    . LYS E 5 73  ? -3.509  115.666 61.100  1.00   101.26 ? 73  LYS C CG    1 
ATOM   8687  C CD    . LYS E 5 73  ? -4.470  116.532 60.299  1.00   106.04 ? 73  LYS C CD    1 
ATOM   8688  C CE    . LYS E 5 73  ? -3.751  117.291 59.198  1.00   103.09 ? 73  LYS C CE    1 
ATOM   8689  N NZ    . LYS E 5 73  ? -2.799  118.293 59.753  1.00   104.30 ? 73  LYS C NZ    1 
ATOM   8690  N N     . LYS E 5 74  ? -0.841  111.514 60.680  1.00   84.42  ? 74  LYS C N     1 
ATOM   8691  C CA    . LYS E 5 74  ? -0.505  110.249 60.041  1.00   66.90  ? 74  LYS C CA    1 
ATOM   8692  C C     . LYS E 5 74  ? -0.466  109.134 61.082  1.00   85.85  ? 74  LYS C C     1 
ATOM   8693  O O     . LYS E 5 74  ? -0.190  109.375 62.257  1.00   83.41  ? 74  LYS C O     1 
ATOM   8694  C CB    . LYS E 5 74  ? 0.809   110.365 59.270  1.00   65.77  ? 74  LYS C CB    1 
ATOM   8695  C CG    . LYS E 5 74  ? 0.763   111.492 58.243  1.00   90.52  ? 74  LYS C CG    1 
ATOM   8696  C CD    . LYS E 5 74  ? 1.879   111.414 57.218  1.00   118.60 ? 74  LYS C CD    1 
ATOM   8697  C CE    . LYS E 5 74  ? 1.809   112.605 56.269  1.00   106.26 ? 74  LYS C CE    1 
ATOM   8698  N NZ    . LYS E 5 74  ? 2.912   112.611 55.269  1.00   103.58 ? 74  LYS C NZ    1 
ATOM   8699  N N     . THR E 5 75  ? -0.745  107.913 60.642  1.00   103.15 ? 75  THR C N     1 
ATOM   8700  C CA    . THR E 5 75  ? -0.724  106.750 61.522  1.00   96.21  ? 75  THR C CA    1 
ATOM   8701  C C     . THR E 5 75  ? 0.483   105.852 61.281  1.00   91.85  ? 75  THR C C     1 
ATOM   8702  O O     . THR E 5 75  ? 0.773   104.967 62.080  1.00   86.41  ? 75  THR C O     1 
ATOM   8703  C CB    . THR E 5 75  ? -2.003  105.905 61.362  1.00   99.13  ? 75  THR C CB    1 
ATOM   8704  O OG1   . THR E 5 75  ? -2.055  104.909 62.391  1.00   120.34 ? 75  THR C OG1   1 
ATOM   8705  C CG2   . THR E 5 75  ? -2.027  105.224 60.003  1.00   106.85 ? 75  THR C CG2   1 
ATOM   8706  N N     . ARG E 5 76  ? 1.189   106.076 60.182  1.00   93.34  ? 76  ARG C N     1 
ATOM   8707  C CA    . ARG E 5 76  ? 2.391   105.303 59.909  1.00   89.72  ? 76  ARG C CA    1 
ATOM   8708  C C     . ARG E 5 76  ? 3.641   106.165 60.098  1.00   86.28  ? 76  ARG C C     1 
ATOM   8709  O O     . ARG E 5 76  ? 3.740   107.273 59.570  1.00   104.20 ? 76  ARG C O     1 
ATOM   8710  C CB    . ARG E 5 76  ? 2.304   104.709 58.506  1.00   100.27 ? 76  ARG C CB    1 
ATOM   8711  C CG    . ARG E 5 76  ? 3.389   103.728 58.146  1.00   109.85 ? 76  ARG C CG    1 
ATOM   8712  C CD    . ARG E 5 76  ? 3.503   103.599 56.637  1.00   131.72 ? 76  ARG C CD    1 
ATOM   8713  N NE    . ARG E 5 76  ? 2.210   103.299 56.010  1.00   145.50 ? 76  ARG C NE    1 
ATOM   8714  C CZ    . ARG E 5 76  ? 1.447   102.234 56.262  1.00   134.24 ? 76  ARG C CZ    1 
ATOM   8715  N NH1   . ARG E 5 76  ? 1.803   101.328 57.165  1.00   118.33 ? 76  ARG C NH1   1 
ATOM   8716  N NH2   . ARG E 5 76  ? 0.296   102.086 55.618  1.00   127.97 ? 76  ARG C NH2   1 
ATOM   8717  N N     . ILE E 5 77  ? 4.589   105.634 60.864  1.00   73.15  ? 77  ILE C N     1 
ATOM   8718  C CA    . ILE E 5 77  ? 5.848   106.310 61.170  1.00   67.76  ? 77  ILE C CA    1 
ATOM   8719  C C     . ILE E 5 77  ? 6.798   106.362 59.977  1.00   66.97  ? 77  ILE C C     1 
ATOM   8720  O O     . ILE E 5 77  ? 6.991   105.372 59.272  1.00   76.09  ? 77  ILE C O     1 
ATOM   8721  C CB    . ILE E 5 77  ? 6.559   105.616 62.357  1.00   59.37  ? 77  ILE C CB    1 
ATOM   8722  C CG1   . ILE E 5 77  ? 5.728   105.765 63.634  1.00   51.44  ? 77  ILE C CG1   1 
ATOM   8723  C CG2   . ILE E 5 77  ? 7.968   106.161 62.556  1.00   42.41  ? 77  ILE C CG2   1 
ATOM   8724  C CD1   . ILE E 5 77  ? 6.278   105.000 64.814  1.00   61.10  ? 77  ILE C CD1   1 
ATOM   8725  N N     . ILE E 5 78  ? 7.391   107.535 59.764  1.00   67.12  ? 78  ILE C N     1 
ATOM   8726  C CA    . ILE E 5 78  ? 8.371   107.721 58.709  1.00   71.50  ? 78  ILE C CA    1 
ATOM   8727  C C     . ILE E 5 78  ? 9.640   108.356 59.308  1.00   88.70  ? 78  ILE C C     1 
ATOM   8728  O O     . ILE E 5 78  ? 9.571   108.907 60.409  1.00   77.85  ? 78  ILE C O     1 
ATOM   8729  C CB    . ILE E 5 78  ? 7.681   108.625 57.611  1.00   68.95  ? 78  ILE C CB    1 
ATOM   8730  C CG1   . ILE E 5 78  ? 6.918   107.772 56.593  1.00   109.59 ? 78  ILE C CG1   1 
ATOM   8731  C CG2   . ILE E 5 78  ? 8.608   109.658 56.954  1.00   87.07  ? 78  ILE C CG2   1 
ATOM   8732  C CD1   . ILE E 5 78  ? 6.261   108.582 55.492  1.00   99.20  ? 78  ILE C CD1   1 
ATOM   8733  N N     . PRO E 5 79  ? 10.803  108.260 58.613  1.00   102.78 ? 79  PRO C N     1 
ATOM   8734  C CA    . PRO E 5 79  ? 12.068  108.828 59.113  1.00   83.50  ? 79  PRO C CA    1 
ATOM   8735  C C     . PRO E 5 79  ? 11.938  110.219 59.733  1.00   84.62  ? 79  PRO C C     1 
ATOM   8736  O O     . PRO E 5 79  ? 12.548  110.502 60.766  1.00   79.63  ? 79  PRO C O     1 
ATOM   8737  C CB    . PRO E 5 79  ? 12.955  108.844 57.868  1.00   67.56  ? 79  PRO C CB    1 
ATOM   8738  C CG    . PRO E 5 79  ? 12.499  107.649 57.114  1.00   91.55  ? 79  PRO C CG    1 
ATOM   8739  C CD    . PRO E 5 79  ? 11.023  107.496 57.368  1.00   101.85 ? 79  PRO C CD    1 
ATOM   8740  N N     . ARG E 5 80  ? 11.149  111.069 59.083  1.00   85.34  ? 80  ARG C N     1 
ATOM   8741  C CA    . ARG E 5 80  ? 10.901  112.434 59.532  1.00   70.27  ? 80  ARG C CA    1 
ATOM   8742  C C     . ARG E 5 80  ? 10.378  112.466 60.966  1.00   65.43  ? 80  ARG C C     1 
ATOM   8743  O O     . ARG E 5 80  ? 10.819  113.283 61.774  1.00   73.47  ? 80  ARG C O     1 
ATOM   8744  C CB    . ARG E 5 80  ? 9.917   113.137 58.595  1.00   81.99  ? 80  ARG C CB    1 
ATOM   8745  C CG    . ARG E 5 80  ? 9.541   114.546 59.033  1.00   88.74  ? 80  ARG C CG    1 
ATOM   8746  C CD    . ARG E 5 80  ? 10.782  115.411 59.204  1.00   65.85  ? 80  ARG C CD    1 
ATOM   8747  N NE    . ARG E 5 80  ? 10.460  116.825 59.369  1.00   85.71  ? 80  ARG C NE    1 
ATOM   8748  C CZ    . ARG E 5 80  ? 11.368  117.788 59.497  1.00   89.78  ? 80  ARG C CZ    1 
ATOM   8749  N NH1   . ARG E 5 80  ? 12.660  117.490 59.481  1.00   71.90  ? 80  ARG C NH1   1 
ATOM   8750  N NH2   . ARG E 5 80  ? 10.985  119.049 59.642  1.00   93.72  ? 80  ARG C NH2   1 
ATOM   8751  N N     . HIS E 5 81  ? 9.438   111.580 61.279  1.00   48.05  ? 81  HIS C N     1 
ATOM   8752  C CA    . HIS E 5 81  ? 8.866   111.535 62.620  1.00   53.69  ? 81  HIS C CA    1 
ATOM   8753  C C     . HIS E 5 81  ? 9.911   111.132 63.655  1.00   59.51  ? 81  HIS C C     1 
ATOM   8754  O O     . HIS E 5 81  ? 9.891   111.622 64.781  1.00   63.02  ? 81  HIS C O     1 
ATOM   8755  C CB    . HIS E 5 81  ? 7.683   110.564 62.677  1.00   69.90  ? 81  HIS C CB    1 
ATOM   8756  C CG    . HIS E 5 81  ? 6.605   110.856 61.680  1.00   75.18  ? 81  HIS C CG    1 
ATOM   8757  N ND1   . HIS E 5 81  ? 6.029   109.878 60.898  1.00   68.72  ? 81  HIS C ND1   1 
ATOM   8758  C CD2   . HIS E 5 81  ? 5.987   112.014 61.347  1.00   91.73  ? 81  HIS C CD2   1 
ATOM   8759  C CE1   . HIS E 5 81  ? 5.109   110.421 60.122  1.00   77.71  ? 81  HIS C CE1   1 
ATOM   8760  N NE2   . HIS E 5 81  ? 5.062   111.717 60.376  1.00   88.80  ? 81  HIS C NE2   1 
ATOM   8761  N N     . LEU E 5 82  ? 10.825  110.245 63.275  1.00   69.39  ? 82  LEU C N     1 
ATOM   8762  C CA    . LEU E 5 82  ? 11.920  109.870 64.164  1.00   68.41  ? 82  LEU C CA    1 
ATOM   8763  C C     . LEU E 5 82  ? 12.847  111.047 64.442  1.00   61.61  ? 82  LEU C C     1 
ATOM   8764  O O     . LEU E 5 82  ? 13.201  111.304 65.591  1.00   61.82  ? 82  LEU C O     1 
ATOM   8765  C CB    . LEU E 5 82  ? 12.726  108.705 63.579  1.00   74.98  ? 82  LEU C CB    1 
ATOM   8766  C CG    . LEU E 5 82  ? 12.048  107.336 63.492  1.00   63.18  ? 82  LEU C CG    1 
ATOM   8767  C CD1   . LEU E 5 82  ? 12.958  106.334 62.812  1.00   50.42  ? 82  LEU C CD1   1 
ATOM   8768  C CD2   . LEU E 5 82  ? 11.688  106.848 64.882  1.00   44.90  ? 82  LEU C CD2   1 
ATOM   8769  N N     . GLN E 5 83  ? 13.229  111.763 63.389  1.00   75.36  ? 83  GLN C N     1 
ATOM   8770  C CA    . GLN E 5 83  ? 14.098  112.928 63.529  1.00   73.68  ? 83  GLN C CA    1 
ATOM   8771  C C     . GLN E 5 83  ? 13.470  113.987 64.432  1.00   71.86  ? 83  GLN C C     1 
ATOM   8772  O O     . GLN E 5 83  ? 14.136  114.540 65.307  1.00   70.81  ? 83  GLN C O     1 
ATOM   8773  C CB    . GLN E 5 83  ? 14.408  113.525 62.151  1.00   67.94  ? 83  GLN C CB    1 
ATOM   8774  C CG    . GLN E 5 83  ? 15.187  114.841 62.163  1.00   81.45  ? 83  GLN C CG    1 
ATOM   8775  C CD    . GLN E 5 83  ? 16.654  114.683 62.554  1.00   95.57  ? 83  GLN C CD    1 
ATOM   8776  O OE1   . GLN E 5 83  ? 17.051  113.698 63.176  1.00   84.32  ? 83  GLN C OE1   1 
ATOM   8777  N NE2   . GLN E 5 83  ? 17.468  115.664 62.178  1.00   82.44  ? 83  GLN C NE2   1 
ATOM   8778  N N     . LEU E 5 84  ? 12.188  114.266 64.214  1.00   83.64  ? 84  LEU C N     1 
ATOM   8779  C CA    . LEU E 5 84  ? 11.466  115.244 65.023  1.00   78.90  ? 84  LEU C CA    1 
ATOM   8780  C C     . LEU E 5 84  ? 11.365  114.813 66.486  1.00   68.43  ? 84  LEU C C     1 
ATOM   8781  O O     . LEU E 5 84  ? 11.604  115.605 67.398  1.00   58.81  ? 84  LEU C O     1 
ATOM   8782  C CB    . LEU E 5 84  ? 10.062  115.468 64.455  1.00   69.47  ? 84  LEU C CB    1 
ATOM   8783  C CG    . LEU E 5 84  ? 9.962   116.159 63.094  1.00   62.00  ? 84  LEU C CG    1 
ATOM   8784  C CD1   . LEU E 5 84  ? 8.529   116.140 62.594  1.00   83.72  ? 84  LEU C CD1   1 
ATOM   8785  C CD2   . LEU E 5 84  ? 10.482  117.583 63.178  1.00   83.20  ? 84  LEU C CD2   1 
ATOM   8786  N N     . ALA E 5 85  ? 11.008  113.547 66.689  1.00   61.93  ? 85  ALA C N     1 
ATOM   8787  C CA    . ALA E 5 85  ? 10.890  112.952 68.020  1.00   73.86  ? 85  ALA C CA    1 
ATOM   8788  C C     . ALA E 5 85  ? 12.165  113.057 68.850  1.00   74.06  ? 85  ALA C C     1 
ATOM   8789  O O     . ALA E 5 85  ? 12.125  113.424 70.024  1.00   71.40  ? 85  ALA C O     1 
ATOM   8790  C CB    . ALA E 5 85  ? 10.473  111.492 67.900  1.00   84.10  ? 85  ALA C CB    1 
ATOM   8791  N N     . ILE E 5 86  ? 13.293  112.736 68.226  1.00   75.20  ? 86  ILE C N     1 
ATOM   8792  C CA    . ILE E 5 86  ? 14.581  112.716 68.911  1.00   62.18  ? 86  ILE C CA    1 
ATOM   8793  C C     . ILE E 5 86  ? 15.104  114.112 69.224  1.00   63.86  ? 86  ILE C C     1 
ATOM   8794  O O     . ILE E 5 86  ? 15.424  114.415 70.374  1.00   65.35  ? 86  ILE C O     1 
ATOM   8795  C CB    . ILE E 5 86  ? 15.634  111.967 68.076  1.00   53.47  ? 86  ILE C CB    1 
ATOM   8796  C CG1   . ILE E 5 86  ? 15.213  110.508 67.881  1.00   51.95  ? 86  ILE C CG1   1 
ATOM   8797  C CG2   . ILE E 5 86  ? 16.995  112.040 68.745  1.00   67.45  ? 86  ILE C CG2   1 
ATOM   8798  C CD1   . ILE E 5 86  ? 15.949  109.803 66.765  1.00   48.32  ? 86  ILE C CD1   1 
ATOM   8799  N N     . ARG E 5 87  ? 15.188  114.960 68.204  1.00   48.03  ? 87  ARG C N     1 
ATOM   8800  C CA    . ARG E 5 87  ? 15.796  116.277 68.358  1.00   53.91  ? 87  ARG C CA    1 
ATOM   8801  C C     . ARG E 5 87  ? 14.982  117.198 69.266  1.00   60.52  ? 87  ARG C C     1 
ATOM   8802  O O     . ARG E 5 87  ? 15.484  118.226 69.723  1.00   69.99  ? 87  ARG C O     1 
ATOM   8803  C CB    . ARG E 5 87  ? 15.986  116.941 66.996  1.00   61.97  ? 87  ARG C CB    1 
ATOM   8804  C CG    . ARG E 5 87  ? 16.797  116.145 65.983  1.00   65.63  ? 87  ARG C CG    1 
ATOM   8805  C CD    . ARG E 5 87  ? 18.077  115.604 66.586  1.00   80.41  ? 87  ARG C CD    1 
ATOM   8806  N NE    . ARG E 5 87  ? 18.688  114.578 65.748  1.00   84.52  ? 87  ARG C NE    1 
ATOM   8807  C CZ    . ARG E 5 87  ? 19.799  113.922 66.068  1.00   89.25  ? 87  ARG C CZ    1 
ATOM   8808  N NH1   . ARG E 5 87  ? 20.421  114.186 67.208  1.00   84.65  ? 87  ARG C NH1   1 
ATOM   8809  N NH2   . ARG E 5 87  ? 20.289  113.004 65.248  1.00   93.74  ? 87  ARG C NH2   1 
ATOM   8810  N N     . ASN E 5 88  ? 13.730  116.832 69.526  1.00   65.08  ? 88  ASN C N     1 
ATOM   8811  C CA    . ASN E 5 88  ? 12.881  117.616 70.418  1.00   72.71  ? 88  ASN C CA    1 
ATOM   8812  C C     . ASN E 5 88  ? 12.933  117.103 71.850  1.00   71.88  ? 88  ASN C C     1 
ATOM   8813  O O     . ASN E 5 88  ? 12.517  117.790 72.781  1.00   87.43  ? 88  ASN C O     1 
ATOM   8814  C CB    . ASN E 5 88  ? 11.434  117.619 69.922  1.00   62.54  ? 88  ASN C CB    1 
ATOM   8815  C CG    . ASN E 5 88  ? 11.205  118.613 68.803  1.00   66.63  ? 88  ASN C CG    1 
ATOM   8816  O OD1   . ASN E 5 88  ? 11.740  119.721 68.824  1.00   58.95  ? 88  ASN C OD1   1 
ATOM   8817  N ND2   . ASN E 5 88  ? 10.406  118.223 67.817  1.00   88.51  ? 88  ASN C ND2   1 
ATOM   8818  N N     . ASP E 5 89  ? 13.449  115.891 72.019  1.00   68.49  ? 89  ASP C N     1 
ATOM   8819  C CA    . ASP E 5 89  ? 13.609  115.314 73.345  1.00   70.18  ? 89  ASP C CA    1 
ATOM   8820  C C     . ASP E 5 89  ? 15.040  115.507 73.818  1.00   61.30  ? 89  ASP C C     1 
ATOM   8821  O O     . ASP E 5 89  ? 15.950  114.825 73.346  1.00   63.44  ? 89  ASP C O     1 
ATOM   8822  C CB    . ASP E 5 89  ? 13.240  113.831 73.356  1.00   76.93  ? 89  ASP C CB    1 
ATOM   8823  C CG    . ASP E 5 89  ? 13.139  113.272 74.764  1.00   73.21  ? 89  ASP C CG    1 
ATOM   8824  O OD1   . ASP E 5 89  ? 12.102  113.508 75.419  1.00   108.03 ? 89  ASP C OD1   1 
ATOM   8825  O OD2   . ASP E 5 89  ? 14.089  112.599 75.216  1.00   56.10  ? 89  ASP C OD2   1 
ATOM   8826  N N     . GLU E 5 90  ? 15.219  116.456 74.735  1.00   71.30  ? 90  GLU C N     1 
ATOM   8827  C CA    . GLU E 5 90  ? 16.522  116.838 75.278  1.00   82.05  ? 90  GLU C CA    1 
ATOM   8828  C C     . GLU E 5 90  ? 17.457  115.660 75.531  1.00   83.66  ? 90  GLU C C     1 
ATOM   8829  O O     . GLU E 5 90  ? 18.621  115.690 75.129  1.00   82.51  ? 90  GLU C O     1 
ATOM   8830  C CB    . GLU E 5 90  ? 16.353  117.629 76.576  1.00   106.40 ? 90  GLU C CB    1 
ATOM   8831  C CG    . GLU E 5 90  ? 17.676  118.100 77.173  1.00   103.52 ? 90  GLU C CG    1 
ATOM   8832  C CD    . GLU E 5 90  ? 17.519  118.716 78.550  1.00   135.78 ? 90  GLU C CD    1 
ATOM   8833  O OE1   . GLU E 5 90  ? 16.400  118.664 79.103  1.00   156.94 ? 90  GLU C OE1   1 
ATOM   8834  O OE2   . GLU E 5 90  ? 18.516  119.252 79.080  1.00   147.56 ? 90  GLU C OE2   1 
ATOM   8835  N N     . GLU E 5 91  ? 16.954  114.630 76.204  1.00   73.27  ? 91  GLU C N     1 
ATOM   8836  C CA    . GLU E 5 91  ? 17.796  113.500 76.568  1.00   71.77  ? 91  GLU C CA    1 
ATOM   8837  C C     . GLU E 5 91  ? 18.190  112.660 75.351  1.00   52.85  ? 91  GLU C C     1 
ATOM   8838  O O     . GLU E 5 91  ? 19.360  112.317 75.188  1.00   63.88  ? 91  GLU C O     1 
ATOM   8839  C CB    . GLU E 5 91  ? 17.064  112.618 77.584  1.00   79.36  ? 91  GLU C CB    1 
ATOM   8840  C CG    . GLU E 5 91  ? 16.887  113.241 78.963  1.00   76.11  ? 91  GLU C CG    1 
ATOM   8841  C CD    . GLU E 5 91  ? 18.188  113.374 79.723  1.00   84.34  ? 91  GLU C CD    1 
ATOM   8842  O OE1   . GLU E 5 91  ? 19.124  112.602 79.436  1.00   98.45  ? 91  GLU C OE1   1 
ATOM   8843  O OE2   . GLU E 5 91  ? 18.273  114.246 80.612  1.00   101.60 ? 91  GLU C OE2   1 
ATOM   8844  N N     . LEU E 5 92  ? 17.221  112.325 74.503  1.00   51.69  ? 92  LEU C N     1 
ATOM   8845  C CA    . LEU E 5 92  ? 17.507  111.568 73.282  1.00   63.50  ? 92  LEU C CA    1 
ATOM   8846  C C     . LEU E 5 92  ? 18.428  112.301 72.311  1.00   62.51  ? 92  LEU C C     1 
ATOM   8847  O O     . LEU E 5 92  ? 19.274  111.685 71.663  1.00   64.35  ? 92  LEU C O     1 
ATOM   8848  C CB    . LEU E 5 92  ? 16.216  111.183 72.560  1.00   62.15  ? 92  LEU C CB    1 
ATOM   8849  C CG    . LEU E 5 92  ? 15.479  109.981 73.147  1.00   56.54  ? 92  LEU C CG    1 
ATOM   8850  C CD1   . LEU E 5 92  ? 14.173  109.754 72.415  1.00   57.09  ? 92  LEU C CD1   1 
ATOM   8851  C CD2   . LEU E 5 92  ? 16.359  108.747 73.070  1.00   48.43  ? 92  LEU C CD2   1 
ATOM   8852  N N     . ASN E 5 93  ? 18.247  113.613 72.205  1.00   60.97  ? 93  ASN C N     1 
ATOM   8853  C CA    . ASN E 5 93  ? 19.101  114.439 71.359  1.00   56.45  ? 93  ASN C CA    1 
ATOM   8854  C C     . ASN E 5 93  ? 20.565  114.321 71.753  1.00   72.43  ? 93  ASN C C     1 
ATOM   8855  O O     . ASN E 5 93  ? 21.437  114.161 70.899  1.00   83.75  ? 93  ASN C O     1 
ATOM   8856  C CB    . ASN E 5 93  ? 18.657  115.901 71.422  1.00   56.08  ? 93  ASN C CB    1 
ATOM   8857  C CG    . ASN E 5 93  ? 19.368  116.766 70.407  1.00   58.64  ? 93  ASN C CG    1 
ATOM   8858  O OD1   . ASN E 5 93  ? 19.627  116.337 69.284  1.00   52.85  ? 93  ASN C OD1   1 
ATOM   8859  N ND2   . ASN E 5 93  ? 19.684  117.996 70.795  1.00   108.85 ? 93  ASN C ND2   1 
ATOM   8860  N N     . LYS E 5 94  ? 20.826  114.416 73.051  1.00   73.47  ? 94  LYS C N     1 
ATOM   8861  C CA    . LYS E 5 94  ? 22.180  114.306 73.572  1.00   73.53  ? 94  LYS C CA    1 
ATOM   8862  C C     . LYS E 5 94  ? 22.738  112.924 73.242  1.00   57.85  ? 94  LYS C C     1 
ATOM   8863  O O     . LYS E 5 94  ? 23.860  112.798 72.753  1.00   78.51  ? 94  LYS C O     1 
ATOM   8864  C CB    . LYS E 5 94  ? 22.194  114.578 75.078  1.00   93.28  ? 94  LYS C CB    1 
ATOM   8865  C CG    . LYS E 5 94  ? 23.575  114.647 75.703  1.00   99.91  ? 94  LYS C CG    1 
ATOM   8866  C CD    . LYS E 5 94  ? 23.583  115.600 76.893  1.00   119.69 ? 94  LYS C CD    1 
ATOM   8867  C CE    . LYS E 5 94  ? 22.427  115.330 77.843  1.00   125.99 ? 94  LYS C CE    1 
ATOM   8868  N NZ    . LYS E 5 94  ? 22.416  116.277 78.993  1.00   146.33 ? 94  LYS C NZ    1 
ATOM   8869  N N     . LEU E 5 95  ? 21.942  111.896 73.522  1.00   59.55  ? 95  LEU C N     1 
ATOM   8870  C CA    . LEU E 5 95  ? 22.310  110.507 73.252  1.00   62.90  ? 95  LEU C CA    1 
ATOM   8871  C C     . LEU E 5 95  ? 22.645  110.240 71.787  1.00   57.01  ? 95  LEU C C     1 
ATOM   8872  O O     . LEU E 5 95  ? 23.525  109.438 71.476  1.00   69.25  ? 95  LEU C O     1 
ATOM   8873  C CB    . LEU E 5 95  ? 21.170  109.576 73.680  1.00   55.80  ? 95  LEU C CB    1 
ATOM   8874  C CG    . LEU E 5 95  ? 21.314  108.086 73.357  1.00   46.88  ? 95  LEU C CG    1 
ATOM   8875  C CD1   . LEU E 5 95  ? 22.551  107.496 74.022  1.00   100.40 ? 95  LEU C CD1   1 
ATOM   8876  C CD2   . LEU E 5 95  ? 20.064  107.317 73.752  1.00   40.43  ? 95  LEU C CD2   1 
ATOM   8877  N N     . LEU E 5 96  ? 21.950  110.936 70.894  1.00   64.82  ? 96  LEU C N     1 
ATOM   8878  C CA    . LEU E 5 96  ? 22.151  110.783 69.456  1.00   63.62  ? 96  LEU C CA    1 
ATOM   8879  C C     . LEU E 5 96  ? 22.681  112.061 68.820  1.00   66.35  ? 96  LEU C C     1 
ATOM   8880  O O     . LEU E 5 96  ? 22.268  112.443 67.726  1.00   80.99  ? 96  LEU C O     1 
ATOM   8881  C CB    . LEU E 5 96  ? 20.844  110.363 68.785  1.00   46.23  ? 96  LEU C CB    1 
ATOM   8882  C CG    . LEU E 5 96  ? 20.213  109.077 69.321  1.00   49.54  ? 96  LEU C CG    1 
ATOM   8883  C CD1   . LEU E 5 96  ? 18.881  108.815 68.648  1.00   69.78  ? 96  LEU C CD1   1 
ATOM   8884  C CD2   . LEU E 5 96  ? 21.152  107.898 69.127  1.00   71.68  ? 96  LEU C CD2   1 
ATOM   8885  N N     . SER E 5 97  ? 23.607  112.713 69.512  1.00   59.22  ? 97  SER C N     1 
ATOM   8886  C CA    . SER E 5 97  ? 24.176  113.970 69.046  1.00   78.82  ? 97  SER C CA    1 
ATOM   8887  C C     . SER E 5 97  ? 25.109  113.809 67.844  1.00   95.24  ? 97  SER C C     1 
ATOM   8888  O O     . SER E 5 97  ? 25.330  114.765 67.098  1.00   98.65  ? 97  SER C O     1 
ATOM   8889  C CB    . SER E 5 97  ? 24.924  114.656 70.192  1.00   94.46  ? 97  SER C CB    1 
ATOM   8890  O OG    . SER E 5 97  ? 25.856  113.774 70.795  1.00   84.45  ? 97  SER C OG    1 
ATOM   8891  N N     . GLY E 5 98  ? 25.653  112.612 67.649  1.00   81.01  ? 98  GLY C N     1 
ATOM   8892  C CA    . GLY E 5 98  ? 26.533  112.379 66.517  1.00   99.15  ? 98  GLY C CA    1 
ATOM   8893  C C     . GLY E 5 98  ? 26.020  111.383 65.496  1.00   74.57  ? 98  GLY C C     1 
ATOM   8894  O O     . GLY E 5 98  ? 26.802  110.768 64.770  1.00   83.93  ? 98  GLY C O     1 
ATOM   8895  N N     . VAL E 5 99  ? 24.703  111.220 65.437  1.00   66.34  ? 99  VAL C N     1 
ATOM   8896  C CA    . VAL E 5 99  ? 24.083  110.342 64.450  1.00   70.60  ? 99  VAL C CA    1 
ATOM   8897  C C     . VAL E 5 99  ? 23.269  111.138 63.430  1.00   82.91  ? 99  VAL C C     1 
ATOM   8898  O O     . VAL E 5 99  ? 22.673  112.168 63.755  1.00   101.49 ? 99  VAL C O     1 
ATOM   8899  C CB    . VAL E 5 99  ? 23.190  109.265 65.109  1.00   67.69  ? 99  VAL C CB    1 
ATOM   8900  C CG1   . VAL E 5 99  ? 21.825  109.820 65.463  1.00   79.33  ? 99  VAL C CG1   1 
ATOM   8901  C CG2   . VAL E 5 99  ? 23.041  108.080 64.179  1.00   63.58  ? 99  VAL C CG2   1 
ATOM   8902  N N     . THR E 5 100 ? 23.296  110.687 62.181  1.00   85.52  ? 100 THR C N     1 
ATOM   8903  C CA    . THR E 5 100 ? 22.530  111.328 61.121  1.00   86.79  ? 100 THR C CA    1 
ATOM   8904  C C     . THR E 5 100 ? 21.463  110.364 60.609  1.00   72.20  ? 100 THR C C     1 
ATOM   8905  O O     . THR E 5 100 ? 21.771  109.255 60.173  1.00   74.45  ? 100 THR C O     1 
ATOM   8906  C CB    . THR E 5 100 ? 23.429  111.783 59.953  1.00   99.59  ? 100 THR C CB    1 
ATOM   8907  O OG1   . THR E 5 100 ? 24.300  110.712 59.568  1.00   101.07 ? 100 THR C OG1   1 
ATOM   8908  C CG2   . THR E 5 100 ? 24.267  112.985 60.363  1.00   106.28 ? 100 THR C CG2   1 
ATOM   8909  N N     . ILE E 5 101 ? 20.206  110.789 60.688  1.00   67.47  ? 101 ILE C N     1 
ATOM   8910  C CA    . ILE E 5 101 ? 19.076  109.966 60.263  1.00   65.59  ? 101 ILE C CA    1 
ATOM   8911  C C     . ILE E 5 101 ? 18.690  110.237 58.813  1.00   58.54  ? 101 ILE C C     1 
ATOM   8912  O O     . ILE E 5 101 ? 18.302  111.350 58.459  1.00   52.21  ? 101 ILE C O     1 
ATOM   8913  C CB    . ILE E 5 101 ? 17.846  110.192 61.166  1.00   78.10  ? 101 ILE C CB    1 
ATOM   8914  C CG1   . ILE E 5 101 ? 18.138  109.738 62.598  1.00   77.91  ? 101 ILE C CG1   1 
ATOM   8915  C CG2   . ILE E 5 101 ? 16.663  109.413 60.657  1.00   56.30  ? 101 ILE C CG2   1 
ATOM   8916  C CD1   . ILE E 5 101 ? 18.636  110.834 63.510  1.00   87.98  ? 101 ILE C CD1   1 
ATOM   8917  N N     . ALA E 5 102 ? 18.808  109.205 57.980  1.00   75.15  ? 102 ALA C N     1 
ATOM   8918  C CA    . ALA E 5 102 ? 18.535  109.321 56.550  1.00   82.70  ? 102 ALA C CA    1 
ATOM   8919  C C     . ALA E 5 102 ? 17.090  109.718 56.264  1.00   83.32  ? 102 ALA C C     1 
ATOM   8920  O O     . ALA E 5 102 ? 16.152  109.166 56.842  1.00   81.69  ? 102 ALA C O     1 
ATOM   8921  C CB    . ALA E 5 102 ? 18.867  108.014 55.846  1.00   79.58  ? 102 ALA C CB    1 
ATOM   8922  N N     . GLN E 5 103 ? 16.939  110.688 55.366  1.00   85.88  ? 103 GLN C N     1 
ATOM   8923  C CA    . GLN E 5 103 ? 15.643  111.215 54.947  1.00   86.73  ? 103 GLN C CA    1 
ATOM   8924  C C     . GLN E 5 103 ? 14.868  111.758 56.143  1.00   71.67  ? 103 GLN C C     1 
ATOM   8925  O O     . GLN E 5 103 ? 13.640  111.691 56.183  1.00   87.49  ? 103 GLN C O     1 
ATOM   8926  C CB    . GLN E 5 103 ? 14.827  110.133 54.226  1.00   105.93 ? 103 GLN C CB    1 
ATOM   8927  C CG    . GLN E 5 103 ? 13.805  110.659 53.224  1.00   98.79  ? 103 GLN C CG    1 
ATOM   8928  C CD    . GLN E 5 103 ? 14.446  111.226 51.971  1.00   118.06 ? 103 GLN C CD    1 
ATOM   8929  O OE1   . GLN E 5 103 ? 15.623  110.988 51.698  1.00   110.65 ? 103 GLN C OE1   1 
ATOM   8930  N NE2   . GLN E 5 103 ? 13.670  111.981 51.201  1.00   115.13 ? 103 GLN C NE2   1 
ATOM   8931  N N     . GLY E 5 104 ? 15.591  112.294 57.121  1.00   75.21  ? 104 GLY C N     1 
ATOM   8932  C CA    . GLY E 5 104 ? 14.960  112.792 58.327  1.00   72.38  ? 104 GLY C CA    1 
ATOM   8933  C C     . GLY E 5 104 ? 14.759  114.292 58.294  1.00   77.47  ? 104 GLY C C     1 
ATOM   8934  O O     . GLY E 5 104 ? 13.895  114.827 58.986  1.00   94.97  ? 104 GLY C O     1 
ATOM   8935  N N     . GLY E 5 105 ? 15.568  114.971 57.486  1.00   65.43  ? 105 GLY C N     1 
ATOM   8936  C CA    . GLY E 5 105 ? 15.503  116.415 57.374  1.00   73.70  ? 105 GLY C CA    1 
ATOM   8937  C C     . GLY E 5 105 ? 15.962  117.061 58.667  1.00   78.45  ? 105 GLY C C     1 
ATOM   8938  O O     . GLY E 5 105 ? 16.671  116.439 59.461  1.00   66.82  ? 105 GLY C O     1 
ATOM   8939  N N     . VAL E 5 106 ? 15.564  118.312 58.880  1.00   72.91  ? 106 VAL C N     1 
ATOM   8940  C CA    . VAL E 5 106 ? 15.935  119.035 60.092  1.00   64.11  ? 106 VAL C CA    1 
ATOM   8941  C C     . VAL E 5 106 ? 14.719  119.746 60.678  1.00   77.30  ? 106 VAL C C     1 
ATOM   8942  O O     . VAL E 5 106 ? 13.701  119.909 60.006  1.00   84.86  ? 106 VAL C O     1 
ATOM   8943  C CB    . VAL E 5 106 ? 17.048  120.076 59.829  1.00   41.58  ? 106 VAL C CB    1 
ATOM   8944  C CG1   . VAL E 5 106 ? 18.278  119.422 59.225  1.00   74.36  ? 106 VAL C CG1   1 
ATOM   8945  C CG2   . VAL E 5 106 ? 16.533  121.194 58.937  1.00   41.68  ? 106 VAL C CG2   1 
ATOM   8946  N N     . LEU E 5 107 ? 14.827  120.156 61.938  1.00   61.87  ? 107 LEU C N     1 
ATOM   8947  C CA    . LEU E 5 107 ? 13.788  120.954 62.585  1.00   64.52  ? 107 LEU C CA    1 
ATOM   8948  C C     . LEU E 5 107 ? 13.798  122.401 62.110  1.00   72.72  ? 107 LEU C C     1 
ATOM   8949  O O     . LEU E 5 107 ? 14.857  123.013 61.981  1.00   75.06  ? 107 LEU C O     1 
ATOM   8950  C CB    . LEU E 5 107 ? 13.890  120.895 64.113  1.00   62.75  ? 107 LEU C CB    1 
ATOM   8951  C CG    . LEU E 5 107 ? 13.633  119.577 64.859  1.00   53.31  ? 107 LEU C CG    1 
ATOM   8952  C CD1   . LEU E 5 107 ? 14.401  118.378 64.323  1.00   93.40  ? 107 LEU C CD1   1 
ATOM   8953  C CD2   . LEU E 5 107 ? 13.896  119.772 66.347  1.00   79.03  ? 107 LEU C CD2   1 
ATOM   8954  N N     . PRO E 5 108 ? 12.604  122.948 61.850  1.00   75.04  ? 108 PRO C N     1 
ATOM   8955  C CA    . PRO E 5 108 ? 12.433  124.356 61.486  1.00   85.02  ? 108 PRO C CA    1 
ATOM   8956  C C     . PRO E 5 108 ? 12.953  125.326 62.543  1.00   75.15  ? 108 PRO C C     1 
ATOM   8957  O O     . PRO E 5 108 ? 12.388  125.422 63.632  1.00   86.21  ? 108 PRO C O     1 
ATOM   8958  C CB    . PRO E 5 108 ? 10.913  124.494 61.346  1.00   97.14  ? 108 PRO C CB    1 
ATOM   8959  C CG    . PRO E 5 108 ? 10.440  123.128 61.004  1.00   85.09  ? 108 PRO C CG    1 
ATOM   8960  C CD    . PRO E 5 108 ? 11.342  122.194 61.757  1.00   76.19  ? 108 PRO C CD    1 
ATOM   8961  N N     . ASN E 5 109 ? 14.033  126.028 62.216  1.00   73.10  ? 109 ASN C N     1 
ATOM   8962  C CA    . ASN E 5 109 ? 14.607  127.022 63.115  1.00   81.97  ? 109 ASN C CA    1 
ATOM   8963  C C     . ASN E 5 109 ? 15.214  128.173 62.311  1.00   68.53  ? 109 ASN C C     1 
ATOM   8964  O O     . ASN E 5 109 ? 16.263  128.038 61.683  1.00   61.78  ? 109 ASN C O     1 
ATOM   8965  C CB    . ASN E 5 109 ? 15.644  126.384 64.053  1.00   101.20 ? 109 ASN C CB    1 
ATOM   8966  C CG    . ASN E 5 109 ? 16.859  125.838 63.319  1.00   111.65 ? 109 ASN C CG    1 
ATOM   8967  O OD1   . ASN E 5 109 ? 16.740  125.261 62.237  1.00   116.33 ? 109 ASN C OD1   1 
ATOM   8968  N ND2   . ASN E 5 109 ? 18.038  126.025 63.905  1.00   82.98  ? 109 ASN C ND2   1 
ATOM   8969  N N     . ILE E 5 110 ? 14.527  129.309 62.315  1.00   64.55  ? 110 ILE C N     1 
ATOM   8970  C CA    . ILE E 5 110 ? 15.040  130.494 61.644  1.00   65.24  ? 110 ILE C CA    1 
ATOM   8971  C C     . ILE E 5 110 ? 15.516  131.523 62.661  1.00   74.97  ? 110 ILE C C     1 
ATOM   8972  O O     . ILE E 5 110 ? 14.759  131.936 63.540  1.00   86.63  ? 110 ILE C O     1 
ATOM   8973  C CB    . ILE E 5 110 ? 13.974  131.135 60.726  1.00   80.66  ? 110 ILE C CB    1 
ATOM   8974  C CG1   . ILE E 5 110 ? 13.565  130.170 59.608  1.00   83.22  ? 110 ILE C CG1   1 
ATOM   8975  C CG2   . ILE E 5 110 ? 14.493  132.433 60.130  1.00   99.55  ? 110 ILE C CG2   1 
ATOM   8976  C CD1   . ILE E 5 110 ? 12.379  129.283 59.946  1.00   94.27  ? 110 ILE C CD1   1 
ATOM   8977  N N     . GLN E 5 111 ? 16.779  131.918 62.542  1.00   56.87  ? 111 GLN C N     1 
ATOM   8978  C CA    . GLN E 5 111 ? 17.375  132.899 63.442  1.00   76.00  ? 111 GLN C CA    1 
ATOM   8979  C C     . GLN E 5 111 ? 16.594  134.213 63.435  1.00   91.14  ? 111 GLN C C     1 
ATOM   8980  O O     . GLN E 5 111 ? 16.222  134.721 62.375  1.00   89.22  ? 111 GLN C O     1 
ATOM   8981  C CB    . GLN E 5 111 ? 18.841  133.131 63.087  1.00   88.95  ? 111 GLN C CB    1 
ATOM   8982  C CG    . GLN E 5 111 ? 19.728  131.932 63.353  1.00   73.10  ? 111 GLN C CG    1 
ATOM   8983  C CD    . GLN E 5 111 ? 19.775  131.573 64.823  1.00   77.47  ? 111 GLN C CD    1 
ATOM   8984  O OE1   . GLN E 5 111 ? 19.997  132.432 65.674  1.00   96.26  ? 111 GLN C OE1   1 
ATOM   8985  N NE2   . GLN E 5 111 ? 19.558  130.300 65.130  1.00   100.10 ? 111 GLN C NE2   1 
ATOM   8986  N N     . ALA E 5 112 ? 16.350  134.740 64.630  1.00   81.10  ? 112 ALA C N     1 
ATOM   8987  C CA    . ALA E 5 112 ? 15.524  135.928 64.839  1.00   77.84  ? 112 ALA C CA    1 
ATOM   8988  C C     . ALA E 5 112 ? 15.856  137.165 63.991  1.00   70.86  ? 112 ALA C C     1 
ATOM   8989  O O     . ALA E 5 112 ? 14.946  137.802 63.459  1.00   74.28  ? 112 ALA C O     1 
ATOM   8990  C CB    . ALA E 5 112 ? 15.570  136.308 66.313  1.00   76.38  ? 112 ALA C CB    1 
ATOM   8991  N N     . VAL E 5 113 ? 17.135  137.511 63.862  1.00   59.03  ? 113 VAL C N     1 
ATOM   8992  C CA    . VAL E 5 113 ? 17.505  138.728 63.132  1.00   85.99  ? 113 VAL C CA    1 
ATOM   8993  C C     . VAL E 5 113 ? 17.141  138.709 61.641  1.00   85.02  ? 113 VAL C C     1 
ATOM   8994  O O     . VAL E 5 113 ? 16.992  139.765 61.025  1.00   74.15  ? 113 VAL C O     1 
ATOM   8995  C CB    . VAL E 5 113 ? 19.018  139.031 63.277  1.00   81.74  ? 113 VAL C CB    1 
ATOM   8996  C CG1   . VAL E 5 113 ? 19.383  139.230 64.741  1.00   91.32  ? 113 VAL C CG1   1 
ATOM   8997  C CG2   . VAL E 5 113 ? 19.856  137.932 62.658  1.00   76.89  ? 113 VAL C CG2   1 
ATOM   8998  N N     . LEU E 5 114 ? 16.999  137.520 61.064  1.00   87.83  ? 114 LEU C N     1 
ATOM   8999  C CA    . LEU E 5 114 ? 16.682  137.394 59.640  1.00   91.97  ? 114 LEU C CA    1 
ATOM   9000  C C     . LEU E 5 114 ? 15.218  137.699 59.347  1.00   102.52 ? 114 LEU C C     1 
ATOM   9001  O O     . LEU E 5 114 ? 14.862  138.003 58.207  1.00   91.13  ? 114 LEU C O     1 
ATOM   9002  C CB    . LEU E 5 114 ? 17.031  136.004 59.086  1.00   81.59  ? 114 LEU C CB    1 
ATOM   9003  C CG    . LEU E 5 114 ? 18.451  135.425 59.094  1.00   60.93  ? 114 LEU C CG    1 
ATOM   9004  C CD1   . LEU E 5 114 ? 19.042  135.293 60.464  1.00   83.43  ? 114 LEU C CD1   1 
ATOM   9005  C CD2   . LEU E 5 114 ? 18.449  134.073 58.402  1.00   88.45  ? 114 LEU C CD2   1 
ATOM   9006  N N     . LEU E 5 115 ? 14.370  137.614 60.367  1.00   97.60  ? 115 LEU C N     1 
ATOM   9007  C CA    . LEU E 5 115 ? 12.959  137.920 60.179  1.00   88.70  ? 115 LEU C CA    1 
ATOM   9008  C C     . LEU E 5 115 ? 12.744  139.420 59.990  1.00   106.75 ? 115 LEU C C     1 
ATOM   9009  O O     . LEU E 5 115 ? 13.518  140.231 60.497  1.00   112.63 ? 115 LEU C O     1 
ATOM   9010  C CB    . LEU E 5 115 ? 12.156  137.414 61.381  1.00   76.09  ? 115 LEU C CB    1 
ATOM   9011  C CG    . LEU E 5 115 ? 12.225  135.908 61.639  1.00   76.28  ? 115 LEU C CG    1 
ATOM   9012  C CD1   . LEU E 5 115 ? 11.604  135.559 62.984  1.00   84.54  ? 115 LEU C CD1   1 
ATOM   9013  C CD2   . LEU E 5 115 ? 11.552  135.136 60.517  1.00   97.55  ? 115 LEU C CD2   1 
ATOM   9014  N N     . PRO E 5 116 ? 11.679  139.790 59.258  1.00   102.76 ? 116 PRO C N     1 
ATOM   9015  C CA    . PRO E 5 116 ? 11.365  141.191 58.960  1.00   101.22 ? 116 PRO C CA    1 
ATOM   9016  C C     . PRO E 5 116 ? 10.462  141.861 59.992  1.00   134.67 ? 116 PRO C C     1 
ATOM   9017  O O     . PRO E 5 116 ? 9.817   141.179 60.791  1.00   123.40 ? 116 PRO C O     1 
ATOM   9018  C CB    . PRO E 5 116 ? 10.661  141.093 57.609  1.00   114.97 ? 116 PRO C CB    1 
ATOM   9019  C CG    . PRO E 5 116 ? 9.928   139.796 57.692  1.00   91.42  ? 116 PRO C CG    1 
ATOM   9020  C CD    . PRO E 5 116 ? 10.789  138.869 58.526  1.00   78.73  ? 116 PRO C CD    1 
ATOM   9021  N N     . LYS E 5 117 ? 10.419  143.190 59.958  1.00   141.94 ? 117 LYS C N     1 
ATOM   9022  C CA    . LYS E 5 117 ? 9.594   143.970 60.874  1.00   136.82 ? 117 LYS C CA    1 
ATOM   9023  C C     . LYS E 5 117 ? 9.468   145.410 60.389  1.00   126.13 ? 117 LYS C C     1 
ATOM   9024  O O     . LYS E 5 117 ? 10.407  145.967 59.820  1.00   125.89 ? 117 LYS C O     1 
ATOM   9025  C CB    . LYS E 5 117 ? 10.172  143.945 62.290  1.00   138.10 ? 117 LYS C CB    1 
ATOM   9026  C CG    . LYS E 5 117 ? 9.317   144.675 63.315  1.00   133.28 ? 117 LYS C CG    1 
ATOM   9027  C CD    . LYS E 5 117 ? 7.919   144.079 63.391  1.00   137.92 ? 117 LYS C CD    1 
ATOM   9028  C CE    . LYS E 5 117 ? 7.049   144.833 64.384  1.00   140.77 ? 117 LYS C CE    1 
ATOM   9029  N NZ    . LYS E 5 117 ? 7.628   144.818 65.756  1.00   130.92 ? 117 LYS C NZ    1 
ATOM   9030  N N     . LYS F 6 29  ? 20.088  81.660  51.802  1.00   161.61 ? 29  LYS D N     1 
ATOM   9031  C CA    . LYS F 6 29  ? 20.556  82.976  52.222  1.00   153.21 ? 29  LYS D CA    1 
ATOM   9032  C C     . LYS F 6 29  ? 19.667  83.590  53.291  1.00   155.89 ? 29  LYS D C     1 
ATOM   9033  O O     . LYS F 6 29  ? 18.556  84.025  52.986  1.00   164.21 ? 29  LYS D O     1 
ATOM   9034  C CB    . LYS F 6 29  ? 20.603  83.948  51.037  1.00   160.52 ? 29  LYS D CB    1 
ATOM   9035  C CG    . LYS F 6 29  ? 21.161  83.409  49.738  1.00   173.51 ? 29  LYS D CG    1 
ATOM   9036  C CD    . LYS F 6 29  ? 21.048  84.483  48.659  1.00   150.47 ? 29  LYS D CD    1 
ATOM   9037  C CE    . LYS F 6 29  ? 21.657  84.047  47.337  1.00   126.07 ? 29  LYS D CE    1 
ATOM   9038  N NZ    . LYS F 6 29  ? 21.577  85.132  46.316  1.00   72.19  ? 29  LYS D NZ    1 
ATOM   9039  N N     . ARG F 6 30  ? 20.125  83.633  54.538  1.00   152.40 ? 30  ARG D N     1 
ATOM   9040  C CA    . ARG F 6 30  ? 19.265  84.186  55.574  1.00   149.58 ? 30  ARG D CA    1 
ATOM   9041  C C     . ARG F 6 30  ? 20.002  85.205  56.430  1.00   140.00 ? 30  ARG D C     1 
ATOM   9042  O O     . ARG F 6 30  ? 21.051  84.912  57.006  1.00   138.79 ? 30  ARG D O     1 
ATOM   9043  C CB    . ARG F 6 30  ? 18.697  83.085  56.476  1.00   132.99 ? 30  ARG D CB    1 
ATOM   9044  C CG    . ARG F 6 30  ? 19.713  82.115  57.054  1.00   145.59 ? 30  ARG D CG    1 
ATOM   9045  C CD    . ARG F 6 30  ? 19.002  81.150  57.984  1.00   162.93 ? 30  ARG D CD    1 
ATOM   9046  N NE    . ARG F 6 30  ? 17.949  80.423  57.282  1.00   182.89 ? 30  ARG D NE    1 
ATOM   9047  C CZ    . ARG F 6 30  ? 17.154  79.520  57.846  1.00   184.44 ? 30  ARG D CZ    1 
ATOM   9048  N NH1   . ARG F 6 30  ? 17.258  79.251  59.139  1.00   177.30 ? 30  ARG D NH1   1 
ATOM   9049  N NH2   . ARG F 6 30  ? 16.227  78.913  57.120  1.00   170.38 ? 30  ARG D NH2   1 
ATOM   9050  N N     . LYS F 6 31  ? 19.455  86.414  56.492  1.00   134.10 ? 31  LYS D N     1 
ATOM   9051  C CA    . LYS F 6 31  ? 20.009  87.463  57.339  1.00   139.09 ? 31  LYS D CA    1 
ATOM   9052  C C     . LYS F 6 31  ? 19.078  87.796  58.487  1.00   126.50 ? 31  LYS D C     1 
ATOM   9053  O O     . LYS F 6 31  ? 17.909  88.098  58.260  1.00   124.56 ? 31  LYS D O     1 
ATOM   9054  C CB    . LYS F 6 31  ? 20.287  88.733  56.557  1.00   137.34 ? 31  LYS D CB    1 
ATOM   9055  C CG    . LYS F 6 31  ? 20.733  89.886  57.449  1.00   120.91 ? 31  LYS D CG    1 
ATOM   9056  C CD    . LYS F 6 31  ? 19.831  91.091  57.311  1.00   138.80 ? 31  LYS D CD    1 
ATOM   9057  C CE    . LYS F 6 31  ? 20.372  92.267  58.095  1.00   137.37 ? 31  LYS D CE    1 
ATOM   9058  N NZ    . LYS F 6 31  ? 21.779  92.559  57.712  1.00   151.34 ? 31  LYS D NZ    1 
ATOM   9059  N N     . GLU F 6 32  ? 19.575  87.742  59.714  1.00   137.80 ? 32  GLU D N     1 
ATOM   9060  C CA    . GLU F 6 32  ? 18.707  87.952  60.861  1.00   132.87 ? 32  GLU D CA    1 
ATOM   9061  C C     . GLU F 6 32  ? 18.663  89.447  61.185  1.00   115.28 ? 32  GLU D C     1 
ATOM   9062  O O     . GLU F 6 32  ? 19.568  90.194  60.804  1.00   110.50 ? 32  GLU D O     1 
ATOM   9063  C CB    . GLU F 6 32  ? 19.212  87.143  62.059  1.00   137.14 ? 32  GLU D CB    1 
ATOM   9064  C CG    . GLU F 6 32  ? 20.563  87.614  62.586  1.00   145.71 ? 32  GLU D CG    1 
ATOM   9065  C CD    . GLU F 6 32  ? 21.149  86.673  63.623  1.00   113.67 ? 32  GLU D CD    1 
ATOM   9066  O OE1   . GLU F 6 32  ? 20.616  85.556  63.787  1.00   107.91 ? 32  GLU D OE1   1 
ATOM   9067  O OE2   . GLU F 6 32  ? 22.147  87.049  64.274  1.00   111.20 ? 32  GLU D OE2   1 
ATOM   9068  N N     . SER F 6 33  ? 17.621  89.887  61.886  1.00   112.43 ? 33  SER D N     1 
ATOM   9069  C CA    . SER F 6 33  ? 17.539  91.281  62.326  1.00   117.00 ? 33  SER D CA    1 
ATOM   9070  C C     . SER F 6 33  ? 16.553  91.500  63.471  1.00   103.41 ? 33  SER D C     1 
ATOM   9071  O O     . SER F 6 33  ? 15.775  90.609  63.813  1.00   92.08  ? 33  SER D O     1 
ATOM   9072  C CB    . SER F 6 33  ? 17.147  92.181  61.151  1.00   119.53 ? 33  SER D CB    1 
ATOM   9073  O OG    . SER F 6 33  ? 15.792  91.980  60.791  1.00   88.34  ? 33  SER D OG    1 
ATOM   9074  N N     . TYR F 6 34  ? 16.593  92.692  64.063  1.00   109.01 ? 34  TYR D N     1 
ATOM   9075  C CA    . TYR F 6 34  ? 15.680  93.033  65.150  1.00   100.94 ? 34  TYR D CA    1 
ATOM   9076  C C     . TYR F 6 34  ? 14.324  93.491  64.620  1.00   104.96 ? 34  TYR D C     1 
ATOM   9077  O O     . TYR F 6 34  ? 13.523  94.053  65.366  1.00   100.47 ? 34  TYR D O     1 
ATOM   9078  C CB    . TYR F 6 34  ? 16.278  94.124  66.041  1.00   83.37  ? 34  TYR D CB    1 
ATOM   9079  C CG    . TYR F 6 34  ? 17.552  93.726  66.746  1.00   90.22  ? 34  TYR D CG    1 
ATOM   9080  C CD1   . TYR F 6 34  ? 17.513  93.113  67.990  1.00   95.75  ? 34  TYR D CD1   1 
ATOM   9081  C CD2   . TYR F 6 34  ? 18.793  93.970  66.172  1.00   103.66 ? 34  TYR D CD2   1 
ATOM   9082  C CE1   . TYR F 6 34  ? 18.674  92.748  68.643  1.00   114.34 ? 34  TYR D CE1   1 
ATOM   9083  C CE2   . TYR F 6 34  ? 19.961  93.609  66.818  1.00   108.97 ? 34  TYR D CE2   1 
ATOM   9084  C CZ    . TYR F 6 34  ? 19.894  92.998  68.053  1.00   110.92 ? 34  TYR D CZ    1 
ATOM   9085  O OH    . TYR F 6 34  ? 21.050  92.637  68.703  1.00   90.60  ? 34  TYR D OH    1 
ATOM   9086  N N     . ALA F 6 35  ? 14.087  93.262  63.330  1.00   99.02  ? 35  ALA D N     1 
ATOM   9087  C CA    . ALA F 6 35  ? 12.870  93.712  62.652  1.00   115.06 ? 35  ALA D CA    1 
ATOM   9088  C C     . ALA F 6 35  ? 11.588  93.348  63.399  1.00   102.97 ? 35  ALA D C     1 
ATOM   9089  O O     . ALA F 6 35  ? 10.773  94.213  63.721  1.00   83.01  ? 35  ALA D O     1 
ATOM   9090  C CB    . ALA F 6 35  ? 12.823  93.147  61.238  1.00   115.41 ? 35  ALA D CB    1 
ATOM   9091  N N     . ILE F 6 36  ? 11.425  92.056  63.663  1.00   98.40  ? 36  ILE D N     1 
ATOM   9092  C CA    . ILE F 6 36  ? 10.212  91.527  64.274  1.00   101.74 ? 36  ILE D CA    1 
ATOM   9093  C C     . ILE F 6 36  ? 10.009  91.995  65.720  1.00   99.49  ? 36  ILE D C     1 
ATOM   9094  O O     . ILE F 6 36  ? 8.876   92.178  66.169  1.00   83.64  ? 36  ILE D O     1 
ATOM   9095  C CB    . ILE F 6 36  ? 10.227  89.974  64.226  1.00   108.37 ? 36  ILE D CB    1 
ATOM   9096  C CG1   . ILE F 6 36  ? 8.954   89.385  64.837  1.00   137.53 ? 36  ILE D CG1   1 
ATOM   9097  C CG2   . ILE F 6 36  ? 11.465  89.418  64.921  1.00   103.83 ? 36  ILE D CG2   1 
ATOM   9098  C CD1   . ILE F 6 36  ? 8.853   87.881  64.690  1.00   127.07 ? 36  ILE D CD1   1 
ATOM   9099  N N     . TYR F 6 37  ? 11.108  92.210  66.436  1.00   93.33  ? 37  TYR D N     1 
ATOM   9100  C CA    . TYR F 6 37  ? 11.043  92.643  67.828  1.00   101.89 ? 37  TYR D CA    1 
ATOM   9101  C C     . TYR F 6 37  ? 10.651  94.112  67.997  1.00   104.04 ? 37  TYR D C     1 
ATOM   9102  O O     . TYR F 6 37  ? 9.892   94.458  68.902  1.00   110.27 ? 37  TYR D O     1 
ATOM   9103  C CB    . TYR F 6 37  ? 12.387  92.381  68.508  1.00   96.48  ? 37  TYR D CB    1 
ATOM   9104  C CG    . TYR F 6 37  ? 12.952  91.011  68.209  1.00   91.10  ? 37  TYR D CG    1 
ATOM   9105  C CD1   . TYR F 6 37  ? 12.393  89.870  68.766  1.00   102.87 ? 37  TYR D CD1   1 
ATOM   9106  C CD2   . TYR F 6 37  ? 14.035  90.859  67.354  1.00   109.37 ? 37  TYR D CD2   1 
ATOM   9107  C CE1   . TYR F 6 37  ? 12.905  88.614  68.489  1.00   113.03 ? 37  TYR D CE1   1 
ATOM   9108  C CE2   . TYR F 6 37  ? 14.552  89.609  67.069  1.00   113.23 ? 37  TYR D CE2   1 
ATOM   9109  C CZ    . TYR F 6 37  ? 13.984  88.490  67.639  1.00   101.01 ? 37  TYR D CZ    1 
ATOM   9110  O OH    . TYR F 6 37  ? 14.500  87.246  67.359  1.00   88.39  ? 37  TYR D OH    1 
ATOM   9111  N N     . ILE F 6 38  ? 11.171  94.967  67.122  1.00   91.75  ? 38  ILE D N     1 
ATOM   9112  C CA    . ILE F 6 38  ? 10.836  96.390  67.129  1.00   94.81  ? 38  ILE D CA    1 
ATOM   9113  C C     . ILE F 6 38  ? 9.350   96.637  66.867  1.00   82.04  ? 38  ILE D C     1 
ATOM   9114  O O     . ILE F 6 38  ? 8.751   97.548  67.443  1.00   78.46  ? 38  ILE D O     1 
ATOM   9115  C CB    . ILE F 6 38  ? 11.683  97.162  66.094  1.00   102.35 ? 38  ILE D CB    1 
ATOM   9116  C CG1   . ILE F 6 38  ? 13.169  97.034  66.433  1.00   112.12 ? 38  ILE D CG1   1 
ATOM   9117  C CG2   . ILE F 6 38  ? 11.291  98.632  66.050  1.00   76.46  ? 38  ILE D CG2   1 
ATOM   9118  C CD1   . ILE F 6 38  ? 14.081  97.784  65.490  1.00   110.81 ? 38  ILE D CD1   1 
ATOM   9119  N N     . TYR F 6 39  ? 8.752   95.806  66.022  1.00   77.28  ? 39  TYR D N     1 
ATOM   9120  C CA    . TYR F 6 39  ? 7.340   95.950  65.689  1.00   81.79  ? 39  TYR D CA    1 
ATOM   9121  C C     . TYR F 6 39  ? 6.452   95.564  66.864  1.00   80.59  ? 39  TYR D C     1 
ATOM   9122  O O     . TYR F 6 39  ? 5.447   96.224  67.132  1.00   74.10  ? 39  TYR D O     1 
ATOM   9123  C CB    . TYR F 6 39  ? 6.994   95.099  64.466  1.00   88.52  ? 39  TYR D CB    1 
ATOM   9124  C CG    . TYR F 6 39  ? 5.758   95.551  63.723  1.00   85.39  ? 39  TYR D CG    1 
ATOM   9125  C CD1   . TYR F 6 39  ? 5.832   96.520  62.730  1.00   93.09  ? 39  TYR D CD1   1 
ATOM   9126  C CD2   . TYR F 6 39  ? 4.517   94.996  64.004  1.00   85.12  ? 39  TYR D CD2   1 
ATOM   9127  C CE1   . TYR F 6 39  ? 4.703   96.931  62.047  1.00   87.13  ? 39  TYR D CE1   1 
ATOM   9128  C CE2   . TYR F 6 39  ? 3.385   95.396  63.325  1.00   89.88  ? 39  TYR D CE2   1 
ATOM   9129  C CZ    . TYR F 6 39  ? 3.482   96.365  62.349  1.00   106.57 ? 39  TYR D CZ    1 
ATOM   9130  O OH    . TYR F 6 39  ? 2.354   96.769  61.671  1.00   121.62 ? 39  TYR D OH    1 
ATOM   9131  N N     . LYS F 6 40  ? 6.818   94.487  67.550  1.00   87.96  ? 40  LYS D N     1 
ATOM   9132  C CA    . LYS F 6 40  ? 6.082   94.043  68.727  1.00   90.97  ? 40  LYS D CA    1 
ATOM   9133  C C     . LYS F 6 40  ? 6.091   95.126  69.804  1.00   79.62  ? 40  LYS D C     1 
ATOM   9134  O O     . LYS F 6 40  ? 5.087   95.349  70.482  1.00   81.04  ? 40  LYS D O     1 
ATOM   9135  C CB    . LYS F 6 40  ? 6.658   92.730  69.263  1.00   94.53  ? 40  LYS D CB    1 
ATOM   9136  C CG    . LYS F 6 40  ? 6.414   91.548  68.331  1.00   86.74  ? 40  LYS D CG    1 
ATOM   9137  C CD    . LYS F 6 40  ? 7.022   90.257  68.853  1.00   90.08  ? 40  LYS D CD    1 
ATOM   9138  C CE    . LYS F 6 40  ? 6.132   89.621  69.912  1.00   96.35  ? 40  LYS D CE    1 
ATOM   9139  N NZ    . LYS F 6 40  ? 6.658   88.308  70.377  1.00   72.33  ? 40  LYS D NZ    1 
ATOM   9140  N N     . VAL F 6 41  ? 7.232   95.793  69.956  1.00   84.11  ? 41  VAL D N     1 
ATOM   9141  C CA    . VAL F 6 41  ? 7.367   96.891  70.912  1.00   101.30 ? 41  VAL D CA    1 
ATOM   9142  C C     . VAL F 6 41  ? 6.538   98.105  70.480  1.00   88.91  ? 41  VAL D C     1 
ATOM   9143  O O     . VAL F 6 41  ? 5.905   98.762  71.310  1.00   61.23  ? 41  VAL D O     1 
ATOM   9144  C CB    . VAL F 6 41  ? 8.845   97.308  71.081  1.00   87.89  ? 41  VAL D CB    1 
ATOM   9145  C CG1   . VAL F 6 41  ? 8.958   98.537  71.970  1.00   80.16  ? 41  VAL D CG1   1 
ATOM   9146  C CG2   . VAL F 6 41  ? 9.655   96.161  71.661  1.00   85.86  ? 41  VAL D CG2   1 
ATOM   9147  N N     . LEU F 6 42  ? 6.542   98.390  69.179  1.00   85.93  ? 42  LEU D N     1 
ATOM   9148  C CA    . LEU F 6 42  ? 5.776   99.504  68.625  1.00   85.18  ? 42  LEU D CA    1 
ATOM   9149  C C     . LEU F 6 42  ? 4.296   99.310  68.910  1.00   80.96  ? 42  LEU D C     1 
ATOM   9150  O O     . LEU F 6 42  ? 3.572   100.259 69.211  1.00   89.45  ? 42  LEU D O     1 
ATOM   9151  C CB    . LEU F 6 42  ? 6.008   99.629  67.116  1.00   100.88 ? 42  LEU D CB    1 
ATOM   9152  C CG    . LEU F 6 42  ? 5.157   100.660 66.367  1.00   91.60  ? 42  LEU D CG    1 
ATOM   9153  C CD1   . LEU F 6 42  ? 5.265   102.038 67.012  1.00   72.85  ? 42  LEU D CD1   1 
ATOM   9154  C CD2   . LEU F 6 42  ? 5.536   100.717 64.893  1.00   74.80  ? 42  LEU D CD2   1 
ATOM   9155  N N     . LYS F 6 43  ? 3.861   98.061  68.814  1.00   90.12  ? 43  LYS D N     1 
ATOM   9156  C CA    . LYS F 6 43  ? 2.464   97.707  69.000  1.00   93.06  ? 43  LYS D CA    1 
ATOM   9157  C C     . LYS F 6 43  ? 2.063   97.795  70.462  1.00   96.19  ? 43  LYS D C     1 
ATOM   9158  O O     . LYS F 6 43  ? 0.880   97.879  70.770  1.00   94.09  ? 43  LYS D O     1 
ATOM   9159  C CB    . LYS F 6 43  ? 2.180   96.308  68.450  1.00   91.21  ? 43  LYS D CB    1 
ATOM   9160  C CG    . LYS F 6 43  ? 2.136   96.256  66.932  1.00   96.70  ? 43  LYS D CG    1 
ATOM   9161  C CD    . LYS F 6 43  ? 1.112   97.258  66.407  1.00   100.94 ? 43  LYS D CD    1 
ATOM   9162  C CE    . LYS F 6 43  ? 1.345   97.603  64.947  1.00   96.64  ? 43  LYS D CE    1 
ATOM   9163  N NZ    . LYS F 6 43  ? 0.348   98.585  64.442  1.00   80.19  ? 43  LYS D NZ    1 
ATOM   9164  N N     . GLN F 6 44  ? 3.047   97.775  71.359  1.00   86.46  ? 44  GLN D N     1 
ATOM   9165  C CA    . GLN F 6 44  ? 2.772   97.916  72.784  1.00   79.20  ? 44  GLN D CA    1 
ATOM   9166  C C     . GLN F 6 44  ? 2.596   99.375  73.204  1.00   83.67  ? 44  GLN D C     1 
ATOM   9167  O O     . GLN F 6 44  ? 1.860   99.669  74.144  1.00   100.89 ? 44  GLN D O     1 
ATOM   9168  C CB    . GLN F 6 44  ? 3.902   97.285  73.601  1.00   66.58  ? 44  GLN D CB    1 
ATOM   9169  C CG    . GLN F 6 44  ? 3.962   95.769  73.526  1.00   104.55 ? 44  GLN D CG    1 
ATOM   9170  C CD    . GLN F 6 44  ? 5.062   95.186  74.395  1.00   120.44 ? 44  GLN D CD    1 
ATOM   9171  O OE1   . GLN F 6 44  ? 4.936   94.078  74.914  1.00   138.26 ? 44  GLN D OE1   1 
ATOM   9172  N NE2   . GLN F 6 44  ? 6.149   95.933  74.554  1.00   112.23 ? 44  GLN D NE2   1 
ATOM   9173  N N     . VAL F 6 45  ? 3.286   100.284 72.525  1.00   91.67  ? 45  VAL D N     1 
ATOM   9174  C CA    . VAL F 6 45  ? 3.254   101.695 72.905  1.00   92.91  ? 45  VAL D CA    1 
ATOM   9175  C C     . VAL F 6 45  ? 2.211   102.479 72.104  1.00   90.02  ? 45  VAL D C     1 
ATOM   9176  O O     . VAL F 6 45  ? 1.637   103.452 72.592  1.00   101.09 ? 45  VAL D O     1 
ATOM   9177  C CB    . VAL F 6 45  ? 4.640   102.361 72.740  1.00   92.62  ? 45  VAL D CB    1 
ATOM   9178  C CG1   . VAL F 6 45  ? 5.627   101.784 73.746  1.00   82.23  ? 45  VAL D CG1   1 
ATOM   9179  C CG2   . VAL F 6 45  ? 5.158   102.196 71.319  1.00   89.06  ? 45  VAL D CG2   1 
ATOM   9180  N N     . HIS F 6 46  ? 1.971   102.030 70.874  1.00   80.51  ? 46  HIS D N     1 
ATOM   9181  C CA    . HIS F 6 46  ? 0.993   102.622 69.960  1.00   80.01  ? 46  HIS D CA    1 
ATOM   9182  C C     . HIS F 6 46  ? 0.446   101.583 68.983  1.00   102.52 ? 46  HIS D C     1 
ATOM   9183  O O     . HIS F 6 46  ? 0.940   101.459 67.863  1.00   111.81 ? 46  HIS D O     1 
ATOM   9184  C CB    . HIS F 6 46  ? 1.586   103.794 69.168  1.00   73.80  ? 46  HIS D CB    1 
ATOM   9185  C CG    . HIS F 6 46  ? 1.961   104.980 70.000  1.00   76.72  ? 46  HIS D CG    1 
ATOM   9186  N ND1   . HIS F 6 46  ? 3.109   105.032 70.761  1.00   115.03 ? 46  HIS D ND1   1 
ATOM   9187  C CD2   . HIS F 6 46  ? 1.341   106.171 70.176  1.00   64.27  ? 46  HIS D CD2   1 
ATOM   9188  C CE1   . HIS F 6 46  ? 3.176   106.199 71.375  1.00   80.18  ? 46  HIS D CE1   1 
ATOM   9189  N NE2   . HIS F 6 46  ? 2.115   106.909 71.037  1.00   67.08  ? 46  HIS D NE2   1 
ATOM   9190  N N     . PRO F 6 47  ? -0.575  100.828 69.413  1.00   103.37 ? 47  PRO D N     1 
ATOM   9191  C CA    . PRO F 6 47  ? -1.166  99.704  68.674  1.00   107.05 ? 47  PRO D CA    1 
ATOM   9192  C C     . PRO F 6 47  ? -1.703  100.053 67.275  1.00   120.46 ? 47  PRO D C     1 
ATOM   9193  O O     . PRO F 6 47  ? -1.713  99.160  66.427  1.00   122.66 ? 47  PRO D O     1 
ATOM   9194  C CB    . PRO F 6 47  ? -2.306  99.240  69.593  1.00   109.39 ? 47  PRO D CB    1 
ATOM   9195  C CG    . PRO F 6 47  ? -2.550  100.373 70.530  1.00   90.21  ? 47  PRO D CG    1 
ATOM   9196  C CD    . PRO F 6 47  ? -1.226  101.026 70.719  1.00   92.38  ? 47  PRO D CD    1 
ATOM   9197  N N     . ASP F 6 48  ? -2.137  101.287 67.021  1.00   113.69 ? 48  ASP D N     1 
ATOM   9198  C CA    . ASP F 6 48  ? -2.702  101.611 65.706  1.00   114.34 ? 48  ASP D CA    1 
ATOM   9199  C C     . ASP F 6 48  ? -1.710  102.347 64.829  1.00   102.72 ? 48  ASP D C     1 
ATOM   9200  O O     . ASP F 6 48  ? -2.097  103.003 63.863  1.00   113.92 ? 48  ASP D O     1 
ATOM   9201  C CB    . ASP F 6 48  ? -3.959  102.474 65.813  1.00   135.67 ? 48  ASP D CB    1 
ATOM   9202  C CG    . ASP F 6 48  ? -3.683  103.850 66.412  1.00   135.11 ? 48  ASP D CG    1 
ATOM   9203  O OD1   . ASP F 6 48  ? -2.562  104.092 66.908  1.00   111.28 ? 48  ASP D OD1   1 
ATOM   9204  O OD2   . ASP F 6 48  ? -4.599  104.700 66.382  1.00   135.24 ? 48  ASP D OD2   1 
ATOM   9205  N N     . THR F 6 49  ? -0.431  102.238 65.155  1.00   99.41  ? 49  THR D N     1 
ATOM   9206  C CA    . THR F 6 49  ? 0.574   102.944 64.384  1.00   96.32  ? 49  THR D CA    1 
ATOM   9207  C C     . THR F 6 49  ? 1.547   101.952 63.788  1.00   104.94 ? 49  THR D C     1 
ATOM   9208  O O     . THR F 6 49  ? 1.994   101.013 64.448  1.00   99.83  ? 49  THR D O     1 
ATOM   9209  C CB    . THR F 6 49  ? 1.349   103.974 65.228  1.00   94.93  ? 49  THR D CB    1 
ATOM   9210  O OG1   . THR F 6 49  ? 2.184   103.292 66.170  1.00   113.88 ? 49  THR D OG1   1 
ATOM   9211  C CG2   . THR F 6 49  ? 0.391   104.902 65.963  1.00   95.65  ? 49  THR D CG2   1 
ATOM   9212  N N     . GLY F 6 50  ? 1.867   102.177 62.521  1.00   113.55 ? 50  GLY D N     1 
ATOM   9213  C CA    . GLY F 6 50  ? 2.807   101.345 61.808  1.00   100.59 ? 50  GLY D CA    1 
ATOM   9214  C C     . GLY F 6 50  ? 4.104   102.074 61.563  1.00   78.21  ? 50  GLY D C     1 
ATOM   9215  O O     . GLY F 6 50  ? 4.323   103.171 62.077  1.00   97.32  ? 50  GLY D O     1 
ATOM   9216  N N     . ILE F 6 51  ? 4.970   101.458 60.774  1.00   57.23  ? 51  ILE D N     1 
ATOM   9217  C CA    . ILE F 6 51  ? 6.275   102.027 60.505  1.00   71.64  ? 51  ILE D CA    1 
ATOM   9218  C C     . ILE F 6 51  ? 6.768   101.608 59.120  1.00   73.50  ? 51  ILE D C     1 
ATOM   9219  O O     . ILE F 6 51  ? 6.637   100.452 58.716  1.00   76.40  ? 51  ILE D O     1 
ATOM   9220  C CB    . ILE F 6 51  ? 7.281   101.621 61.606  1.00   68.20  ? 51  ILE D CB    1 
ATOM   9221  C CG1   . ILE F 6 51  ? 8.590   102.391 61.458  1.00   67.95  ? 51  ILE D CG1   1 
ATOM   9222  C CG2   . ILE F 6 51  ? 7.532   100.128 61.592  1.00   89.35  ? 51  ILE D CG2   1 
ATOM   9223  C CD1   . ILE F 6 51  ? 9.602   102.089 62.540  1.00   77.33  ? 51  ILE D CD1   1 
ATOM   9224  N N     . SER F 6 52  ? 7.295   102.572 58.376  1.00   74.49  ? 52  SER D N     1 
ATOM   9225  C CA    . SER F 6 52  ? 7.800   102.299 57.040  1.00   85.38  ? 52  SER D CA    1 
ATOM   9226  C C     . SER F 6 52  ? 9.112   101.532 57.124  1.00   110.05 ? 52  SER D C     1 
ATOM   9227  O O     . SER F 6 52  ? 9.821   101.610 58.127  1.00   109.20 ? 52  SER D O     1 
ATOM   9228  C CB    . SER F 6 52  ? 7.991   103.603 56.261  1.00   96.06  ? 52  SER D CB    1 
ATOM   9229  O OG    . SER F 6 52  ? 8.782   103.400 55.103  1.00   107.43 ? 52  SER D OG    1 
ATOM   9230  N N     . SER F 6 53  ? 9.414   100.778 56.072  1.00   128.33 ? 53  SER D N     1 
ATOM   9231  C CA    . SER F 6 53  ? 10.606  99.936  56.035  1.00   109.10 ? 53  SER D CA    1 
ATOM   9232  C C     . SER F 6 53  ? 11.873  100.754 56.254  1.00   114.03 ? 53  SER D C     1 
ATOM   9233  O O     . SER F 6 53  ? 12.784  100.322 56.961  1.00   105.97 ? 53  SER D O     1 
ATOM   9234  C CB    . SER F 6 53  ? 10.687  99.183  54.707  1.00   100.71 ? 53  SER D CB    1 
ATOM   9235  O OG    . SER F 6 53  ? 9.600   98.285  54.567  1.00   118.85 ? 53  SER D OG    1 
ATOM   9236  N N     . LYS F 6 54  ? 11.924  101.936 55.645  1.00   123.95 ? 54  LYS D N     1 
ATOM   9237  C CA    . LYS F 6 54  ? 13.070  102.822 55.801  1.00   116.06 ? 54  LYS D CA    1 
ATOM   9238  C C     . LYS F 6 54  ? 13.187  103.277 57.251  1.00   96.70  ? 54  LYS D C     1 
ATOM   9239  O O     . LYS F 6 54  ? 14.287  103.381 57.792  1.00   101.15 ? 54  LYS D O     1 
ATOM   9240  C CB    . LYS F 6 54  ? 12.938  104.030 54.871  1.00   124.41 ? 54  LYS D CB    1 
ATOM   9241  C CG    . LYS F 6 54  ? 14.201  104.384 54.102  1.00   150.77 ? 54  LYS D CG    1 
ATOM   9242  C CD    . LYS F 6 54  ? 15.272  104.957 55.015  1.00   129.87 ? 54  LYS D CD    1 
ATOM   9243  C CE    . LYS F 6 54  ? 16.392  105.594 54.209  1.00   129.17 ? 54  LYS D CE    1 
ATOM   9244  N NZ    . LYS F 6 54  ? 15.873  106.618 53.258  1.00   120.76 ? 54  LYS D NZ    1 
ATOM   9245  N N     . ALA F 6 55  ? 12.044  103.542 57.873  1.00   83.47  ? 55  ALA D N     1 
ATOM   9246  C CA    . ALA F 6 55  ? 12.004  103.956 59.270  1.00   76.17  ? 55  ALA D CA    1 
ATOM   9247  C C     . ALA F 6 55  ? 12.394  102.776 60.160  1.00   76.93  ? 55  ALA D C     1 
ATOM   9248  O O     . ALA F 6 55  ? 13.070  102.944 61.176  1.00   65.01  ? 55  ALA D O     1 
ATOM   9249  C CB    . ALA F 6 55  ? 10.635  104.490 59.633  1.00   79.48  ? 55  ALA D CB    1 
ATOM   9250  N N     . MET F 6 56  ? 11.949  101.585 59.767  1.00   88.29  ? 56  MET D N     1 
ATOM   9251  C CA    . MET F 6 56  ? 12.277  100.346 60.470  1.00   78.47  ? 56  MET D CA    1 
ATOM   9252  C C     . MET F 6 56  ? 13.765  100.047 60.384  1.00   83.55  ? 56  MET D C     1 
ATOM   9253  O O     . MET F 6 56  ? 14.370  99.571  61.346  1.00   85.22  ? 56  MET D O     1 
ATOM   9254  C CB    . MET F 6 56  ? 11.478  99.168  59.906  1.00   53.39  ? 56  MET D CB    1 
ATOM   9255  C CG    . MET F 6 56  ? 11.852  97.827  60.526  1.00   78.67  ? 56  MET D CG    1 
ATOM   9256  S SD    . MET F 6 56  ? 11.590  97.681  62.306  1.00   121.93 ? 56  MET D SD    1 
ATOM   9257  C CE    . MET F 6 56  ? 9.807   97.620  62.399  1.00   91.01  ? 56  MET D CE    1 
ATOM   9258  N N     . SER F 6 57  ? 14.344  100.327 59.222  1.00   79.49  ? 57  SER D N     1 
ATOM   9259  C CA    . SER F 6 57  ? 15.775  100.165 59.017  1.00   87.60  ? 57  SER D CA    1 
ATOM   9260  C C     . SER F 6 57  ? 16.536  101.040 60.001  1.00   78.36  ? 57  SER D C     1 
ATOM   9261  O O     . SER F 6 57  ? 17.446  100.575 60.688  1.00   75.24  ? 57  SER D O     1 
ATOM   9262  C CB    . SER F 6 57  ? 16.162  100.518 57.580  1.00   100.70 ? 57  SER D CB    1 
ATOM   9263  O OG    . SER F 6 57  ? 17.569  100.479 57.408  1.00   115.19 ? 57  SER D OG    1 
ATOM   9264  N N     . ILE F 6 58  ? 16.168  102.316 60.040  1.00   74.70  ? 58  ILE D N     1 
ATOM   9265  C CA    . ILE F 6 58  ? 16.746  103.265 60.982  1.00   75.59  ? 58  ILE D CA    1 
ATOM   9266  C C     . ILE F 6 58  ? 16.647  102.755 62.423  1.00   76.37  ? 58  ILE D C     1 
ATOM   9267  O O     . ILE F 6 58  ? 17.603  102.858 63.194  1.00   78.74  ? 58  ILE D O     1 
ATOM   9268  C CB    . ILE F 6 58  ? 16.028  104.623 60.865  1.00   52.93  ? 58  ILE D CB    1 
ATOM   9269  C CG1   . ILE F 6 58  ? 16.290  105.240 59.489  1.00   65.93  ? 58  ILE D CG1   1 
ATOM   9270  C CG2   . ILE F 6 58  ? 16.411  105.544 62.016  1.00   51.08  ? 58  ILE D CG2   1 
ATOM   9271  C CD1   . ILE F 6 58  ? 15.492  106.485 59.215  1.00   80.57  ? 58  ILE D CD1   1 
ATOM   9272  N N     . MET F 6 59  ? 15.491  102.199 62.780  1.00   71.92  ? 59  MET D N     1 
ATOM   9273  C CA    . MET F 6 59  ? 15.296  101.614 64.106  1.00   64.41  ? 59  MET D CA    1 
ATOM   9274  C C     . MET F 6 59  ? 16.185  100.394 64.336  1.00   79.06  ? 59  MET D C     1 
ATOM   9275  O O     . MET F 6 59  ? 16.713  100.196 65.432  1.00   73.59  ? 59  MET D O     1 
ATOM   9276  C CB    . MET F 6 59  ? 13.829  101.237 64.322  1.00   69.05  ? 59  MET D CB    1 
ATOM   9277  C CG    . MET F 6 59  ? 12.929  102.419 64.632  1.00   77.67  ? 59  MET D CG    1 
ATOM   9278  S SD    . MET F 6 59  ? 13.471  103.314 66.107  1.00   73.88  ? 59  MET D SD    1 
ATOM   9279  C CE    . MET F 6 59  ? 13.312  102.045 67.362  1.00   51.73  ? 59  MET D CE    1 
ATOM   9280  N N     . ASN F 6 60  ? 16.343  99.578  63.297  1.00   66.87  ? 60  ASN D N     1 
ATOM   9281  C CA    . ASN F 6 60  ? 17.183  98.391  63.384  1.00   72.70  ? 60  ASN D CA    1 
ATOM   9282  C C     . ASN F 6 60  ? 18.648  98.767  63.537  1.00   84.55  ? 60  ASN D C     1 
ATOM   9283  O O     . ASN F 6 60  ? 19.393  98.125  64.276  1.00   85.13  ? 60  ASN D O     1 
ATOM   9284  C CB    . ASN F 6 60  ? 16.994  97.504  62.153  1.00   92.76  ? 60  ASN D CB    1 
ATOM   9285  C CG    . ASN F 6 60  ? 17.651  96.143  62.307  1.00   108.08 ? 60  ASN D CG    1 
ATOM   9286  O OD1   . ASN F 6 60  ? 17.326  95.385  63.222  1.00   107.78 ? 60  ASN D OD1   1 
ATOM   9287  N ND2   . ASN F 6 60  ? 18.582  95.828  61.413  1.00   75.16  ? 60  ASN D ND2   1 
ATOM   9288  N N     . SER F 6 61  ? 19.069  99.791  62.806  1.00   73.32  ? 61  SER D N     1 
ATOM   9289  C CA    . SER F 6 61  ? 20.437  100.263 62.914  1.00   70.17  ? 61  SER D CA    1 
ATOM   9290  C C     . SER F 6 61  ? 20.695  100.821 64.310  1.00   80.51  ? 61  SER D C     1 
ATOM   9291  O O     . SER F 6 61  ? 21.774  100.639 64.870  1.00   83.69  ? 61  SER D O     1 
ATOM   9292  C CB    . SER F 6 61  ? 20.725  101.329 61.854  1.00   89.53  ? 61  SER D CB    1 
ATOM   9293  O OG    . SER F 6 61  ? 20.563  100.807 60.547  1.00   95.14  ? 61  SER D OG    1 
ATOM   9294  N N     . PHE F 6 62  ? 19.693  101.501 64.864  1.00   88.69  ? 62  PHE D N     1 
ATOM   9295  C CA    . PHE F 6 62  ? 19.810  102.092 66.194  1.00   77.12  ? 62  PHE D CA    1 
ATOM   9296  C C     . PHE F 6 62  ? 19.987  101.068 67.317  1.00   76.76  ? 62  PHE D C     1 
ATOM   9297  O O     . PHE F 6 62  ? 20.851  101.236 68.178  1.00   78.12  ? 62  PHE D O     1 
ATOM   9298  C CB    . PHE F 6 62  ? 18.571  102.954 66.466  1.00   76.68  ? 62  PHE D CB    1 
ATOM   9299  C CG    . PHE F 6 62  ? 18.422  103.384 67.899  1.00   87.03  ? 62  PHE D CG    1 
ATOM   9300  C CD1   . PHE F 6 62  ? 19.188  104.420 68.407  1.00   77.45  ? 62  PHE D CD1   1 
ATOM   9301  C CD2   . PHE F 6 62  ? 17.506  102.762 68.732  1.00   80.30  ? 62  PHE D CD2   1 
ATOM   9302  C CE1   . PHE F 6 62  ? 19.049  104.824 69.721  1.00   72.84  ? 62  PHE D CE1   1 
ATOM   9303  C CE2   . PHE F 6 62  ? 17.363  103.160 70.049  1.00   72.89  ? 62  PHE D CE2   1 
ATOM   9304  C CZ    . PHE F 6 62  ? 18.135  104.192 70.544  1.00   69.42  ? 62  PHE D CZ    1 
ATOM   9305  N N     . VAL F 6 63  ? 19.175  100.012 67.308  1.00   82.10  ? 63  VAL D N     1 
ATOM   9306  C CA    . VAL F 6 63  ? 19.266  98.971  68.335  1.00   87.79  ? 63  VAL D CA    1 
ATOM   9307  C C     . VAL F 6 63  ? 20.611  98.248  68.254  1.00   77.98  ? 63  VAL D C     1 
ATOM   9308  O O     . VAL F 6 63  ? 21.263  98.005  69.269  1.00   70.01  ? 63  VAL D O     1 
ATOM   9309  C CB    . VAL F 6 63  ? 18.093  97.956  68.256  1.00   90.57  ? 63  VAL D CB    1 
ATOM   9310  C CG1   . VAL F 6 63  ? 16.809  98.594  68.769  1.00   78.63  ? 63  VAL D CG1   1 
ATOM   9311  C CG2   . VAL F 6 63  ? 17.898  97.432  66.849  1.00   91.73  ? 63  VAL D CG2   1 
ATOM   9312  N N     . ASN F 6 64  ? 21.006  97.907  67.029  1.00   89.29  ? 64  ASN D N     1 
ATOM   9313  C CA    . ASN F 6 64  ? 22.279  97.253  66.746  1.00   96.71  ? 64  ASN D CA    1 
ATOM   9314  C C     . ASN F 6 64  ? 23.449  98.132  67.170  1.00   81.37  ? 64  ASN D C     1 
ATOM   9315  O O     . ASN F 6 64  ? 24.464  97.644  67.665  1.00   83.59  ? 64  ASN D O     1 
ATOM   9316  C CB    . ASN F 6 64  ? 22.381  96.904  65.261  1.00   103.44 ? 64  ASN D CB    1 
ATOM   9317  C CG    . ASN F 6 64  ? 22.874  95.488  65.029  1.00   128.89 ? 64  ASN D CG    1 
ATOM   9318  O OD1   . ASN F 6 64  ? 23.830  95.038  65.662  1.00   138.07 ? 64  ASN D OD1   1 
ATOM   9319  N ND2   . ASN F 6 64  ? 22.217  94.773  64.122  1.00   113.26 ? 64  ASN D ND2   1 
ATOM   9320  N N     . ASP F 6 65  ? 23.292  99.433  66.960  1.00   84.55  ? 65  ASP D N     1 
ATOM   9321  C CA    . ASP F 6 65  ? 24.298  100.412 67.343  1.00   90.45  ? 65  ASP D CA    1 
ATOM   9322  C C     . ASP F 6 65  ? 24.447  100.376 68.859  1.00   90.26  ? 65  ASP D C     1 
ATOM   9323  O O     . ASP F 6 65  ? 25.531  100.098 69.373  1.00   88.61  ? 65  ASP D O     1 
ATOM   9324  C CB    . ASP F 6 65  ? 23.921  101.816 66.865  1.00   88.01  ? 65  ASP D CB    1 
ATOM   9325  C CG    . ASP F 6 65  ? 25.040  102.823 67.070  1.00   90.32  ? 65  ASP D CG    1 
ATOM   9326  O OD1   . ASP F 6 65  ? 26.168  102.404 67.404  1.00   100.65 ? 65  ASP D OD1   1 
ATOM   9327  O OD2   . ASP F 6 65  ? 24.793  104.035 66.896  1.00   90.93  ? 65  ASP D OD2   1 
ATOM   9328  N N     . ILE F 6 66  ? 23.351  100.651 69.562  1.00   86.40  ? 66  ILE D N     1 
ATOM   9329  C CA    . ILE F 6 66  ? 23.326  100.652 71.024  1.00   75.72  ? 66  ILE D CA    1 
ATOM   9330  C C     . ILE F 6 66  ? 23.899  99.358  71.600  1.00   71.84  ? 66  ILE D C     1 
ATOM   9331  O O     . ILE F 6 66  ? 24.635  99.391  72.588  1.00   75.77  ? 66  ILE D O     1 
ATOM   9332  C CB    . ILE F 6 66  ? 21.887  100.854 71.548  1.00   68.58  ? 66  ILE D CB    1 
ATOM   9333  C CG1   . ILE F 6 66  ? 21.409  102.275 71.248  1.00   84.62  ? 66  ILE D CG1   1 
ATOM   9334  C CG2   . ILE F 6 66  ? 21.805  100.583 73.040  1.00   67.90  ? 66  ILE D CG2   1 
ATOM   9335  C CD1   . ILE F 6 66  ? 22.241  103.350 71.914  1.00   74.93  ? 66  ILE D CD1   1 
ATOM   9336  N N     . PHE F 6 67  ? 23.567  98.226  70.985  1.00   77.54  ? 67  PHE D N     1 
ATOM   9337  C CA    . PHE F 6 67  ? 24.120  96.943  71.411  1.00   84.22  ? 67  PHE D CA    1 
ATOM   9338  C C     . PHE F 6 67  ? 25.645  96.995  71.409  1.00   83.23  ? 67  PHE D C     1 
ATOM   9339  O O     . PHE F 6 67  ? 26.294  96.686  72.411  1.00   60.61  ? 67  PHE D O     1 
ATOM   9340  C CB    . PHE F 6 67  ? 23.641  95.810  70.500  1.00   89.28  ? 67  PHE D CB    1 
ATOM   9341  C CG    . PHE F 6 67  ? 24.177  94.460  70.886  1.00   100.18 ? 67  PHE D CG    1 
ATOM   9342  C CD1   . PHE F 6 67  ? 23.598  93.733  71.914  1.00   105.92 ? 67  PHE D CD1   1 
ATOM   9343  C CD2   . PHE F 6 67  ? 25.279  93.927  70.233  1.00   93.62  ? 67  PHE D CD2   1 
ATOM   9344  C CE1   . PHE F 6 67  ? 24.099  92.494  72.272  1.00   87.10  ? 67  PHE D CE1   1 
ATOM   9345  C CE2   . PHE F 6 67  ? 25.784  92.693  70.590  1.00   103.42 ? 67  PHE D CE2   1 
ATOM   9346  C CZ    . PHE F 6 67  ? 25.194  91.977  71.613  1.00   100.11 ? 67  PHE D CZ    1 
ATOM   9347  N N     . GLU F 6 68  ? 26.200  97.387  70.266  1.00   90.97  ? 68  GLU D N     1 
ATOM   9348  C CA    . GLU F 6 68  ? 27.643  97.445  70.064  1.00   83.72  ? 68  GLU D CA    1 
ATOM   9349  C C     . GLU F 6 68  ? 28.316  98.447  71.001  1.00   69.67  ? 68  GLU D C     1 
ATOM   9350  O O     . GLU F 6 68  ? 29.407  98.198  71.513  1.00   64.37  ? 68  GLU D O     1 
ATOM   9351  C CB    . GLU F 6 68  ? 27.950  97.808  68.609  1.00   87.78  ? 68  GLU D CB    1 
ATOM   9352  C CG    . GLU F 6 68  ? 27.567  96.734  67.602  1.00   92.09  ? 68  GLU D CG    1 
ATOM   9353  C CD    . GLU F 6 68  ? 27.760  97.188  66.166  1.00   107.87 ? 68  GLU D CD    1 
ATOM   9354  O OE1   . GLU F 6 68  ? 28.003  98.395  65.949  1.00   94.90  ? 68  GLU D OE1   1 
ATOM   9355  O OE2   . GLU F 6 68  ? 27.664  96.340  65.254  1.00   93.99  ? 68  GLU D OE2   1 
ATOM   9356  N N     . ARG F 6 69  ? 27.657  99.583  71.208  1.00   72.59  ? 69  ARG D N     1 
ATOM   9357  C CA    . ARG F 6 69  ? 28.143  100.623 72.110  1.00   72.62  ? 69  ARG D CA    1 
ATOM   9358  C C     . ARG F 6 69  ? 28.285  100.131 73.551  1.00   79.27  ? 69  ARG D C     1 
ATOM   9359  O O     . ARG F 6 69  ? 29.339  100.286 74.170  1.00   92.31  ? 69  ARG D O     1 
ATOM   9360  C CB    . ARG F 6 69  ? 27.195  101.825 72.051  1.00   83.44  ? 69  ARG D CB    1 
ATOM   9361  C CG    . ARG F 6 69  ? 27.106  102.456 70.666  1.00   82.51  ? 69  ARG D CG    1 
ATOM   9362  C CD    . ARG F 6 69  ? 26.414  103.811 70.671  1.00   89.35  ? 69  ARG D CD    1 
ATOM   9363  N NE    . ARG F 6 69  ? 26.638  104.566 71.899  1.00   123.64 ? 69  ARG D NE    1 
ATOM   9364  C CZ    . ARG F 6 69  ? 26.153  105.784 72.118  1.00   119.92 ? 69  ARG D CZ    1 
ATOM   9365  N NH1   . ARG F 6 69  ? 25.414  106.381 71.191  1.00   78.00  ? 69  ARG D NH1   1 
ATOM   9366  N NH2   . ARG F 6 69  ? 26.404  106.405 73.263  1.00   116.19 ? 69  ARG D NH2   1 
ATOM   9367  N N     . ILE F 6 70  ? 27.214  99.544  74.074  1.00   74.60  ? 70  ILE D N     1 
ATOM   9368  C CA    . ILE F 6 70  ? 27.161  99.056  75.454  1.00   84.65  ? 70  ILE D CA    1 
ATOM   9369  C C     . ILE F 6 70  ? 28.141  97.911  75.723  1.00   85.40  ? 70  ILE D C     1 
ATOM   9370  O O     . ILE F 6 70  ? 28.865  97.913  76.720  1.00   89.23  ? 70  ILE D O     1 
ATOM   9371  C CB    . ILE F 6 70  ? 25.740  98.609  75.840  1.00   82.14  ? 70  ILE D CB    1 
ATOM   9372  C CG1   . ILE F 6 70  ? 24.804  99.819  75.884  1.00   79.35  ? 70  ILE D CG1   1 
ATOM   9373  C CG2   . ILE F 6 70  ? 25.752  97.913  77.192  1.00   67.06  ? 70  ILE D CG2   1 
ATOM   9374  C CD1   . ILE F 6 70  ? 23.354  99.471  76.145  1.00   58.60  ? 70  ILE D CD1   1 
ATOM   9375  N N     . ALA F 6 71  ? 28.172  96.954  74.803  1.00   79.18  ? 71  ALA D N     1 
ATOM   9376  C CA    . ALA F 6 71  ? 29.034  95.780  74.906  1.00   83.48  ? 71  ALA D CA    1 
ATOM   9377  C C     . ALA F 6 71  ? 30.520  96.124  74.859  1.00   78.80  ? 71  ALA D C     1 
ATOM   9378  O O     . ALA F 6 71  ? 31.314  95.526  75.585  1.00   87.71  ? 71  ALA D O     1 
ATOM   9379  C CB    . ALA F 6 71  ? 28.692  94.788  73.806  1.00   95.20  ? 71  ALA D CB    1 
ATOM   9380  N N     . ALA F 6 72  ? 30.899  97.070  74.006  1.00   73.45  ? 72  ALA D N     1 
ATOM   9381  C CA    . ALA F 6 72  ? 32.296  97.477  73.906  1.00   74.90  ? 72  ALA D CA    1 
ATOM   9382  C C     . ALA F 6 72  ? 32.774  98.018  75.251  1.00   83.38  ? 72  ALA D C     1 
ATOM   9383  O O     . ALA F 6 72  ? 33.852  97.657  75.722  1.00   86.21  ? 72  ALA D O     1 
ATOM   9384  C CB    . ALA F 6 72  ? 32.477  98.518  72.815  1.00   87.92  ? 72  ALA D CB    1 
ATOM   9385  N N     . GLU F 6 73  ? 31.977  98.888  75.863  1.00   103.16 ? 73  GLU D N     1 
ATOM   9386  C CA    . GLU F 6 73  ? 32.326  99.459  77.162  1.00   101.68 ? 73  GLU D CA    1 
ATOM   9387  C C     . GLU F 6 73  ? 32.378  98.409  78.265  1.00   87.58  ? 73  GLU D C     1 
ATOM   9388  O O     . GLU F 6 73  ? 33.302  98.408  79.078  1.00   91.56  ? 73  GLU D O     1 
ATOM   9389  C CB    . GLU F 6 73  ? 31.351  100.567 77.557  1.00   103.32 ? 73  GLU D CB    1 
ATOM   9390  C CG    . GLU F 6 73  ? 31.794  101.328 78.800  1.00   80.37  ? 73  GLU D CG    1 
ATOM   9391  C CD    . GLU F 6 73  ? 33.073  102.113 78.587  1.00   96.24  ? 73  GLU D CD    1 
ATOM   9392  O OE1   . GLU F 6 73  ? 33.319  102.563 77.448  1.00   125.89 ? 73  GLU D OE1   1 
ATOM   9393  O OE2   . GLU F 6 73  ? 33.839  102.267 79.561  1.00   74.23  ? 73  GLU D OE2   1 
ATOM   9394  N N     . ALA F 6 74  ? 31.385  97.524  78.298  1.00   77.89  ? 74  ALA D N     1 
ATOM   9395  C CA    . ALA F 6 74  ? 31.374  96.449  79.282  1.00   87.55  ? 74  ALA D CA    1 
ATOM   9396  C C     . ALA F 6 74  ? 32.615  95.582  79.109  1.00   100.84 ? 74  ALA D C     1 
ATOM   9397  O O     . ALA F 6 74  ? 33.204  95.123  80.088  1.00   102.09 ? 74  ALA D O     1 
ATOM   9398  C CB    . ALA F 6 74  ? 30.112  95.613  79.150  1.00   71.56  ? 74  ALA D CB    1 
ATOM   9399  N N     . SER F 6 75  ? 33.013  95.381  77.856  1.00   98.72  ? 75  SER D N     1 
ATOM   9400  C CA    . SER F 6 75  ? 34.217  94.624  77.541  1.00   101.35 ? 75  SER D CA    1 
ATOM   9401  C C     . SER F 6 75  ? 35.424  95.314  78.172  1.00   94.73  ? 75  SER D C     1 
ATOM   9402  O O     . SER F 6 75  ? 36.252  94.675  78.823  1.00   81.56  ? 75  SER D O     1 
ATOM   9403  C CB    . SER F 6 75  ? 34.396  94.490  76.028  1.00   78.73  ? 75  SER D CB    1 
ATOM   9404  O OG    . SER F 6 75  ? 35.594  93.804  75.711  1.00   103.40 ? 75  SER D OG    1 
ATOM   9405  N N     . ARG F 6 76  ? 35.514  96.625  77.963  1.00   90.72  ? 76  ARG D N     1 
ATOM   9406  C CA    . ARG F 6 76  ? 36.593  97.427  78.524  1.00   79.37  ? 76  ARG D CA    1 
ATOM   9407  C C     . ARG F 6 76  ? 36.551  97.440  80.048  1.00   92.28  ? 76  ARG D C     1 
ATOM   9408  O O     . ARG F 6 76  ? 37.593  97.400  80.703  1.00   108.20 ? 76  ARG D O     1 
ATOM   9409  C CB    . ARG F 6 76  ? 36.522  98.862  77.998  1.00   92.65  ? 76  ARG D CB    1 
ATOM   9410  C CG    . ARG F 6 76  ? 37.349  99.121  76.752  1.00   89.80  ? 76  ARG D CG    1 
ATOM   9411  C CD    . ARG F 6 76  ? 36.888  100.392 76.055  1.00   92.84  ? 76  ARG D CD    1 
ATOM   9412  N NE    . ARG F 6 76  ? 37.388  100.483 74.686  1.00   129.28 ? 76  ARG D NE    1 
ATOM   9413  C CZ    . ARG F 6 76  ? 36.734  101.073 73.691  1.00   131.19 ? 76  ARG D CZ    1 
ATOM   9414  N NH1   . ARG F 6 76  ? 35.546  101.621 73.908  1.00   112.08 ? 76  ARG D NH1   1 
ATOM   9415  N NH2   . ARG F 6 76  ? 37.266  101.112 72.476  1.00   121.79 ? 76  ARG D NH2   1 
ATOM   9416  N N     . LEU F 6 77  ? 35.344  97.510  80.607  1.00   90.30  ? 77  LEU D N     1 
ATOM   9417  C CA    . LEU F 6 77  ? 35.169  97.512  82.057  1.00   96.01  ? 77  LEU D CA    1 
ATOM   9418  C C     . LEU F 6 77  ? 35.716  96.232  82.673  1.00   110.59 ? 77  LEU D C     1 
ATOM   9419  O O     . LEU F 6 77  ? 36.437  96.269  83.669  1.00   116.01 ? 77  LEU D O     1 
ATOM   9420  C CB    . LEU F 6 77  ? 33.695  97.684  82.425  1.00   78.95  ? 77  LEU D CB    1 
ATOM   9421  C CG    . LEU F 6 77  ? 33.128  99.099  82.306  1.00   88.77  ? 77  LEU D CG    1 
ATOM   9422  C CD1   . LEU F 6 77  ? 31.614  99.080  82.425  1.00   93.34  ? 77  LEU D CD1   1 
ATOM   9423  C CD2   . LEU F 6 77  ? 33.740  100.006 83.360  1.00   98.26  ? 77  LEU D CD2   1 
ATOM   9424  N N     . ALA F 6 78  ? 35.364  95.104  82.064  1.00   98.95  ? 78  ALA D N     1 
ATOM   9425  C CA    . ALA F 6 78  ? 35.832  93.795  82.501  1.00   97.82  ? 78  ALA D CA    1 
ATOM   9426  C C     . ALA F 6 78  ? 37.348  93.705  82.390  1.00   90.14  ? 78  ALA D C     1 
ATOM   9427  O O     . ALA F 6 78  ? 38.010  93.051  83.194  1.00   110.35 ? 78  ALA D O     1 
ATOM   9428  C CB    . ALA F 6 78  ? 35.172  92.695  81.689  1.00   106.27 ? 78  ALA D CB    1 
ATOM   9429  N N     . HIS F 6 79  ? 37.887  94.347  81.363  1.00   89.87  ? 79  HIS D N     1 
ATOM   9430  C CA    . HIS F 6 79  ? 39.323  94.353  81.129  1.00   108.74 ? 79  HIS D CA    1 
ATOM   9431  C C     . HIS F 6 79  ? 40.091  95.188  82.156  1.00   102.57 ? 79  HIS D C     1 
ATOM   9432  O O     . HIS F 6 79  ? 41.079  94.720  82.723  1.00   98.84  ? 79  HIS D O     1 
ATOM   9433  C CB    . HIS F 6 79  ? 39.624  94.864  79.719  1.00   110.49 ? 79  HIS D CB    1 
ATOM   9434  C CG    . HIS F 6 79  ? 41.084  94.924  79.400  1.00   119.18 ? 79  HIS D CG    1 
ATOM   9435  N ND1   . HIS F 6 79  ? 41.828  93.801  79.109  1.00   107.23 ? 79  HIS D ND1   1 
ATOM   9436  C CD2   . HIS F 6 79  ? 41.941  95.971  79.329  1.00   128.32 ? 79  HIS D CD2   1 
ATOM   9437  C CE1   . HIS F 6 79  ? 43.078  94.153  78.871  1.00   127.82 ? 79  HIS D CE1   1 
ATOM   9438  N NE2   . HIS F 6 79  ? 43.174  95.464  78.998  1.00   135.67 ? 79  HIS D NE2   1 
ATOM   9439  N N     . TYR F 6 80  ? 39.646  96.423  82.380  1.00   98.89  ? 80  TYR D N     1 
ATOM   9440  C CA    . TYR F 6 80  ? 40.313  97.323  83.322  1.00   112.85 ? 80  TYR D CA    1 
ATOM   9441  C C     . TYR F 6 80  ? 40.471  96.750  84.733  1.00   102.26 ? 80  TYR D C     1 
ATOM   9442  O O     . TYR F 6 80  ? 41.447  97.046  85.423  1.00   93.48  ? 80  TYR D O     1 
ATOM   9443  C CB    . TYR F 6 80  ? 39.539  98.641  83.427  1.00   111.59 ? 80  TYR D CB    1 
ATOM   9444  C CG    . TYR F 6 80  ? 39.531  99.484  82.171  1.00   115.84 ? 80  TYR D CG    1 
ATOM   9445  C CD1   . TYR F 6 80  ? 40.573  99.424  81.255  1.00   111.22 ? 80  TYR D CD1   1 
ATOM   9446  C CD2   . TYR F 6 80  ? 38.482  100.361 81.915  1.00   97.51  ? 80  TYR D CD2   1 
ATOM   9447  C CE1   . TYR F 6 80  ? 40.560  100.200 80.108  1.00   118.61 ? 80  TYR D CE1   1 
ATOM   9448  C CE2   . TYR F 6 80  ? 38.462  101.142 80.778  1.00   81.20  ? 80  TYR D CE2   1 
ATOM   9449  C CZ    . TYR F 6 80  ? 39.503  101.061 79.879  1.00   109.20 ? 80  TYR D CZ    1 
ATOM   9450  O OH    . TYR F 6 80  ? 39.482  101.839 78.743  1.00   92.08  ? 80  TYR D OH    1 
ATOM   9451  N N     . ASN F 6 81  ? 39.514  95.931  85.156  1.00   102.41 ? 81  ASN D N     1 
ATOM   9452  C CA    . ASN F 6 81  ? 39.541  95.343  86.494  1.00   118.95 ? 81  ASN D CA    1 
ATOM   9453  C C     . ASN F 6 81  ? 39.984  93.876  86.477  1.00   117.57 ? 81  ASN D C     1 
ATOM   9454  O O     . ASN F 6 81  ? 39.719  93.134  87.424  1.00   84.22  ? 81  ASN D O     1 
ATOM   9455  C CB    . ASN F 6 81  ? 38.184  95.503  87.194  1.00   101.10 ? 81  ASN D CB    1 
ATOM   9456  C CG    . ASN F 6 81  ? 37.077  94.717  86.531  1.00   134.81 ? 81  ASN D CG    1 
ATOM   9457  O OD1   . ASN F 6 81  ? 37.207  94.280  85.393  1.00   138.31 ? 81  ASN D OD1   1 
ATOM   9458  N ND2   . ASN F 6 81  ? 35.969  94.543  87.242  1.00   150.19 ? 81  ASN D ND2   1 
ATOM   9459  N N     . LYS F 6 82  ? 40.666  93.478  85.402  1.00   113.97 ? 82  LYS D N     1 
ATOM   9460  C CA    . LYS F 6 82  ? 41.243  92.136  85.289  1.00   99.73  ? 82  LYS D CA    1 
ATOM   9461  C C     . LYS F 6 82  ? 40.251  91.014  85.584  1.00   103.89 ? 82  LYS D C     1 
ATOM   9462  O O     . LYS F 6 82  ? 40.567  90.065  86.303  1.00   131.06 ? 82  LYS D O     1 
ATOM   9463  C CB    . LYS F 6 82  ? 42.451  91.994  86.222  1.00   104.96 ? 82  LYS D CB    1 
ATOM   9464  C CG    . LYS F 6 82  ? 43.572  92.991  85.984  1.00   95.53  ? 82  LYS D CG    1 
ATOM   9465  C CD    . LYS F 6 82  ? 44.226  92.763  84.629  1.00   91.02  ? 82  LYS D CD    1 
ATOM   9466  C CE    . LYS F 6 82  ? 45.330  93.776  84.367  1.00   113.55 ? 82  LYS D CE    1 
ATOM   9467  N NZ    . LYS F 6 82  ? 46.030  93.514  83.077  1.00   81.72  ? 82  LYS D NZ    1 
ATOM   9468  N N     . ARG F 6 83  ? 39.051  91.129  85.025  1.00   95.74  ? 83  ARG D N     1 
ATOM   9469  C CA    . ARG F 6 83  ? 38.062  90.066  85.135  1.00   107.12 ? 83  ARG D CA    1 
ATOM   9470  C C     . ARG F 6 83  ? 37.688  89.544  83.747  1.00   100.33 ? 83  ARG D C     1 
ATOM   9471  O O     . ARG F 6 83  ? 37.671  90.294  82.773  1.00   95.62  ? 83  ARG D O     1 
ATOM   9472  C CB    . ARG F 6 83  ? 36.825  90.574  85.877  1.00   88.07  ? 83  ARG D CB    1 
ATOM   9473  C CG    . ARG F 6 83  ? 36.974  90.534  87.389  1.00   88.02  ? 83  ARG D CG    1 
ATOM   9474  C CD    . ARG F 6 83  ? 35.762  91.113  88.094  1.00   111.09 ? 83  ARG D CD    1 
ATOM   9475  N NE    . ARG F 6 83  ? 35.742  90.757  89.510  1.00   153.03 ? 83  ARG D NE    1 
ATOM   9476  C CZ    . ARG F 6 83  ? 35.174  91.494  90.459  1.00   176.25 ? 83  ARG D CZ    1 
ATOM   9477  N NH1   . ARG F 6 83  ? 34.580  92.638  90.148  1.00   178.17 ? 83  ARG D NH1   1 
ATOM   9478  N NH2   . ARG F 6 83  ? 35.205  91.091  91.722  1.00   170.87 ? 83  ARG D NH2   1 
ATOM   9479  N N     . SER F 6 84  ? 37.393  88.250  83.669  1.00   104.59 ? 84  SER D N     1 
ATOM   9480  C CA    . SER F 6 84  ? 37.100  87.594  82.396  1.00   122.04 ? 84  SER D CA    1 
ATOM   9481  C C     . SER F 6 84  ? 35.628  87.219  82.245  1.00   125.38 ? 84  SER D C     1 
ATOM   9482  O O     . SER F 6 84  ? 35.283  86.336  81.461  1.00   118.36 ? 84  SER D O     1 
ATOM   9483  C CB    . SER F 6 84  ? 37.969  86.344  82.237  1.00   127.95 ? 84  SER D CB    1 
ATOM   9484  O OG    . SER F 6 84  ? 39.333  86.632  82.493  1.00   126.32 ? 84  SER D OG    1 
ATOM   9485  N N     . THR F 6 85  ? 34.766  87.894  82.996  1.00   127.62 ? 85  THR D N     1 
ATOM   9486  C CA    . THR F 6 85  ? 33.333  87.631  82.938  1.00   113.87 ? 85  THR D CA    1 
ATOM   9487  C C     . THR F 6 85  ? 32.529  88.921  82.801  1.00   111.45 ? 85  THR D C     1 
ATOM   9488  O O     . THR F 6 85  ? 32.703  89.857  83.581  1.00   104.49 ? 85  THR D O     1 
ATOM   9489  C CB    . THR F 6 85  ? 32.854  86.863  84.183  1.00   116.16 ? 85  THR D CB    1 
ATOM   9490  O OG1   . THR F 6 85  ? 33.587  85.636  84.299  1.00   126.13 ? 85  THR D OG1   1 
ATOM   9491  C CG2   . THR F 6 85  ? 31.371  86.551  84.079  1.00   115.77 ? 85  THR D CG2   1 
ATOM   9492  N N     . ILE F 6 86  ? 31.649  88.961  81.804  1.00   119.90 ? 86  ILE D N     1 
ATOM   9493  C CA    . ILE F 6 86  ? 30.724  90.078  81.648  1.00   106.32 ? 86  ILE D CA    1 
ATOM   9494  C C     . ILE F 6 86  ? 29.446  89.802  82.424  1.00   98.89  ? 86  ILE D C     1 
ATOM   9495  O O     . ILE F 6 86  ? 28.626  88.972  82.030  1.00   121.66 ? 86  ILE D O     1 
ATOM   9496  C CB    . ILE F 6 86  ? 30.366  90.331  80.167  1.00   90.08  ? 86  ILE D CB    1 
ATOM   9497  C CG1   . ILE F 6 86  ? 31.571  90.875  79.405  1.00   102.71 ? 86  ILE D CG1   1 
ATOM   9498  C CG2   . ILE F 6 86  ? 29.197  91.299  80.053  1.00   83.46  ? 86  ILE D CG2   1 
ATOM   9499  C CD1   . ILE F 6 86  ? 32.056  92.199  79.916  1.00   106.80 ? 86  ILE D CD1   1 
ATOM   9500  N N     . THR F 6 87  ? 29.300  90.490  83.551  1.00   90.02  ? 87  THR D N     1 
ATOM   9501  C CA    . THR F 6 87  ? 28.145  90.309  84.415  1.00   101.58 ? 87  THR D CA    1 
ATOM   9502  C C     . THR F 6 87  ? 27.196  91.489  84.288  1.00   103.14 ? 87  THR D C     1 
ATOM   9503  O O     . THR F 6 87  ? 27.465  92.437  83.549  1.00   97.73  ? 87  THR D O     1 
ATOM   9504  C CB    . THR F 6 87  ? 28.556  90.160  85.892  1.00   111.58 ? 87  THR D CB    1 
ATOM   9505  O OG1   . THR F 6 87  ? 28.946  91.437  86.413  1.00   107.86 ? 87  THR D OG1   1 
ATOM   9506  C CG2   . THR F 6 87  ? 29.714  89.186  86.030  1.00   137.26 ? 87  THR D CG2   1 
ATOM   9507  N N     . SER F 6 88  ? 26.081  91.418  85.006  1.00   105.67 ? 88  SER D N     1 
ATOM   9508  C CA    . SER F 6 88  ? 25.085  92.483  85.005  1.00   101.96 ? 88  SER D CA    1 
ATOM   9509  C C     . SER F 6 88  ? 25.686  93.802  85.492  1.00   89.59  ? 88  SER D C     1 
ATOM   9510  O O     . SER F 6 88  ? 25.171  94.878  85.193  1.00   81.60  ? 88  SER D O     1 
ATOM   9511  C CB    . SER F 6 88  ? 23.891  92.093  85.878  1.00   117.85 ? 88  SER D CB    1 
ATOM   9512  O OG    . SER F 6 88  ? 23.388  90.820  85.511  1.00   105.53 ? 88  SER D OG    1 
ATOM   9513  N N     . ARG F 6 89  ? 26.786  93.706  86.235  1.00   86.85  ? 89  ARG D N     1 
ATOM   9514  C CA    . ARG F 6 89  ? 27.448  94.879  86.790  1.00   95.27  ? 89  ARG D CA    1 
ATOM   9515  C C     . ARG F 6 89  ? 28.157  95.709  85.729  1.00   94.63  ? 89  ARG D C     1 
ATOM   9516  O O     . ARG F 6 89  ? 28.063  96.937  85.727  1.00   68.92  ? 89  ARG D O     1 
ATOM   9517  C CB    . ARG F 6 89  ? 28.465  94.457  87.854  1.00   98.71  ? 89  ARG D CB    1 
ATOM   9518  C CG    . ARG F 6 89  ? 28.810  95.545  88.859  1.00   119.17 ? 89  ARG D CG    1 
ATOM   9519  C CD    . ARG F 6 89  ? 29.710  95.012  89.962  1.00   108.20 ? 89  ARG D CD    1 
ATOM   9520  N NE    . ARG F 6 89  ? 29.775  95.915  91.107  1.00   113.98 ? 89  ARG D NE    1 
ATOM   9521  C CZ    . ARG F 6 89  ? 28.971  95.846  92.163  1.00   144.62 ? 89  ARG D CZ    1 
ATOM   9522  N NH1   . ARG F 6 89  ? 28.032  94.911  92.225  1.00   144.43 ? 89  ARG D NH1   1 
ATOM   9523  N NH2   . ARG F 6 89  ? 29.106  96.712  93.158  1.00   143.82 ? 89  ARG D NH2   1 
ATOM   9524  N N     . GLU F 6 90  ? 28.878  95.040  84.835  1.00   109.34 ? 90  GLU D N     1 
ATOM   9525  C CA    . GLU F 6 90  ? 29.538  95.735  83.738  1.00   99.92  ? 90  GLU D CA    1 
ATOM   9526  C C     . GLU F 6 90  ? 28.526  96.405  82.816  1.00   89.52  ? 90  GLU D C     1 
ATOM   9527  O O     . GLU F 6 90  ? 28.747  97.526  82.359  1.00   86.93  ? 90  GLU D O     1 
ATOM   9528  C CB    . GLU F 6 90  ? 30.418  94.763  82.948  1.00   113.89 ? 90  GLU D CB    1 
ATOM   9529  C CG    . GLU F 6 90  ? 31.732  94.418  83.639  1.00   111.25 ? 90  GLU D CG    1 
ATOM   9530  C CD    . GLU F 6 90  ? 31.540  93.535  84.860  1.00   106.13 ? 90  GLU D CD    1 
ATOM   9531  O OE1   . GLU F 6 90  ? 30.493  92.859  84.949  1.00   91.05  ? 90  GLU D OE1   1 
ATOM   9532  O OE2   . GLU F 6 90  ? 32.433  93.529  85.734  1.00   108.59 ? 90  GLU D OE2   1 
ATOM   9533  N N     . ILE F 6 91  ? 27.425  95.710  82.540  1.00   80.32  ? 91  ILE D N     1 
ATOM   9534  C CA    . ILE F 6 91  ? 26.355  96.265  81.718  1.00   73.37  ? 91  ILE D CA    1 
ATOM   9535  C C     . ILE F 6 91  ? 25.776  97.531  82.345  1.00   78.15  ? 91  ILE D C     1 
ATOM   9536  O O     . ILE F 6 91  ? 25.592  98.547  81.672  1.00   71.63  ? 91  ILE D O     1 
ATOM   9537  C CB    . ILE F 6 91  ? 25.231  95.240  81.494  1.00   82.27  ? 91  ILE D CB    1 
ATOM   9538  C CG1   . ILE F 6 91  ? 25.784  93.993  80.804  1.00   87.99  ? 91  ILE D CG1   1 
ATOM   9539  C CG2   . ILE F 6 91  ? 24.121  95.841  80.649  1.00   85.10  ? 91  ILE D CG2   1 
ATOM   9540  C CD1   . ILE F 6 91  ? 26.301  94.255  79.404  1.00   63.50  ? 91  ILE D CD1   1 
ATOM   9541  N N     . GLN F 6 92  ? 25.495  97.453  83.643  1.00   71.70  ? 92  GLN D N     1 
ATOM   9542  C CA    . GLN F 6 92  ? 24.913  98.564  84.391  1.00   75.43  ? 92  GLN D CA    1 
ATOM   9543  C C     . GLN F 6 92  ? 25.822  99.788  84.416  1.00   65.15  ? 92  GLN D C     1 
ATOM   9544  O O     . GLN F 6 92  ? 25.385  100.903 84.132  1.00   71.75  ? 92  GLN D O     1 
ATOM   9545  C CB    . GLN F 6 92  ? 24.582  98.133  85.820  1.00   74.79  ? 92  GLN D CB    1 
ATOM   9546  C CG    . GLN F 6 92  ? 23.978  99.243  86.663  1.00   74.63  ? 92  GLN D CG    1 
ATOM   9547  C CD    . GLN F 6 92  ? 23.584  98.778  88.048  1.00   85.95  ? 92  GLN D CD    1 
ATOM   9548  O OE1   . GLN F 6 92  ? 24.248  99.096  89.034  1.00   110.12 ? 92  GLN D OE1   1 
ATOM   9549  N NE2   . GLN F 6 92  ? 22.493  98.026  88.130  1.00   84.36  ? 92  GLN D NE2   1 
ATOM   9550  N N     . THR F 6 93  ? 27.085  99.568  84.767  1.00   66.35  ? 93  THR D N     1 
ATOM   9551  C CA    . THR F 6 93  ? 28.080  100.634 84.816  1.00   68.99  ? 93  THR D CA    1 
ATOM   9552  C C     . THR F 6 93  ? 28.242  101.267 83.441  1.00   80.12  ? 93  THR D C     1 
ATOM   9553  O O     . THR F 6 93  ? 28.367  102.487 83.318  1.00   90.21  ? 93  THR D O     1 
ATOM   9554  C CB    . THR F 6 93  ? 29.444  100.116 85.312  1.00   79.93  ? 93  THR D CB    1 
ATOM   9555  O OG1   . THR F 6 93  ? 29.290  99.520  86.606  1.00   82.01  ? 93  THR D OG1   1 
ATOM   9556  C CG2   . THR F 6 93  ? 30.450  101.254 85.404  1.00   57.38  ? 93  THR D CG2   1 
ATOM   9557  N N     . ALA F 6 94  ? 28.240  100.426 82.411  1.00   74.19  ? 94  ALA D N     1 
ATOM   9558  C CA    . ALA F 6 94  ? 28.326  100.889 81.032  1.00   78.69  ? 94  ALA D CA    1 
ATOM   9559  C C     . ALA F 6 94  ? 27.184  101.846 80.718  1.00   78.02  ? 94  ALA D C     1 
ATOM   9560  O O     . ALA F 6 94  ? 27.397  102.906 80.130  1.00   86.70  ? 94  ALA D O     1 
ATOM   9561  C CB    . ALA F 6 94  ? 28.311  99.714  80.069  1.00   80.31  ? 94  ALA D CB    1 
ATOM   9562  N N     . VAL F 6 95  ? 25.972  101.467 81.114  1.00   76.35  ? 95  VAL D N     1 
ATOM   9563  C CA    . VAL F 6 95  ? 24.804  102.313 80.904  1.00   62.04  ? 95  VAL D CA    1 
ATOM   9564  C C     . VAL F 6 95  ? 24.961  103.668 81.589  1.00   57.83  ? 95  VAL D C     1 
ATOM   9565  O O     . VAL F 6 95  ? 24.668  104.706 80.994  1.00   63.73  ? 95  VAL D O     1 
ATOM   9566  C CB    . VAL F 6 95  ? 23.518  101.625 81.417  1.00   59.52  ? 95  VAL D CB    1 
ATOM   9567  C CG1   . VAL F 6 95  ? 22.408  102.640 81.646  1.00   69.63  ? 95  VAL D CG1   1 
ATOM   9568  C CG2   . VAL F 6 95  ? 23.069  100.545 80.441  1.00   66.09  ? 95  VAL D CG2   1 
ATOM   9569  N N     . ARG F 6 96  ? 25.432  103.660 82.832  1.00   73.42  ? 96  ARG D N     1 
ATOM   9570  C CA    . ARG F 6 96  ? 25.632  104.902 83.574  1.00   76.22  ? 96  ARG D CA    1 
ATOM   9571  C C     . ARG F 6 96  ? 26.606  105.825 82.843  1.00   75.50  ? 96  ARG D C     1 
ATOM   9572  O O     . ARG F 6 96  ? 26.468  107.049 82.889  1.00   83.44  ? 96  ARG D O     1 
ATOM   9573  C CB    . ARG F 6 96  ? 26.118  104.621 85.000  1.00   60.07  ? 96  ARG D CB    1 
ATOM   9574  C CG    . ARG F 6 96  ? 25.023  104.064 85.904  1.00   62.74  ? 96  ARG D CG    1 
ATOM   9575  C CD    . ARG F 6 96  ? 25.520  103.720 87.302  1.00   73.54  ? 96  ARG D CD    1 
ATOM   9576  N NE    . ARG F 6 96  ? 26.120  104.871 87.973  1.00   106.25 ? 96  ARG D NE    1 
ATOM   9577  C CZ    . ARG F 6 96  ? 26.991  104.786 88.974  1.00   98.58  ? 96  ARG D CZ    1 
ATOM   9578  N NH1   . ARG F 6 96  ? 27.365  103.599 89.435  1.00   94.70  ? 96  ARG D NH1   1 
ATOM   9579  N NH2   . ARG F 6 96  ? 27.484  105.890 89.522  1.00   72.58  ? 96  ARG D NH2   1 
ATOM   9580  N N     . LEU F 6 97  ? 27.592  105.231 82.176  1.00   72.73  ? 97  LEU D N     1 
ATOM   9581  C CA    . LEU F 6 97  ? 28.592  106.000 81.440  1.00   82.19  ? 97  LEU D CA    1 
ATOM   9582  C C     . LEU F 6 97  ? 28.104  106.505 80.078  1.00   83.07  ? 97  LEU D C     1 
ATOM   9583  O O     . LEU F 6 97  ? 28.420  107.629 79.688  1.00   86.93  ? 97  LEU D O     1 
ATOM   9584  C CB    . LEU F 6 97  ? 29.856  105.157 81.251  1.00   85.61  ? 97  LEU D CB    1 
ATOM   9585  C CG    . LEU F 6 97  ? 30.623  104.807 82.529  1.00   89.45  ? 97  LEU D CG    1 
ATOM   9586  C CD1   . LEU F 6 97  ? 31.638  103.705 82.270  1.00   77.37  ? 97  LEU D CD1   1 
ATOM   9587  C CD2   . LEU F 6 97  ? 31.305  106.046 83.094  1.00   71.51  ? 97  LEU D CD2   1 
ATOM   9588  N N     . LEU F 6 98  ? 27.342  105.685 79.358  1.00   77.83  ? 98  LEU D N     1 
ATOM   9589  C CA    . LEU F 6 98  ? 26.987  106.009 77.975  1.00   79.12  ? 98  LEU D CA    1 
ATOM   9590  C C     . LEU F 6 98  ? 25.727  106.869 77.851  1.00   84.82  ? 98  LEU D C     1 
ATOM   9591  O O     . LEU F 6 98  ? 25.657  107.767 77.010  1.00   81.30  ? 98  LEU D O     1 
ATOM   9592  C CB    . LEU F 6 98  ? 26.801  104.724 77.167  1.00   72.77  ? 98  LEU D CB    1 
ATOM   9593  C CG    . LEU F 6 98  ? 27.990  103.768 77.073  1.00   84.41  ? 98  LEU D CG    1 
ATOM   9594  C CD1   . LEU F 6 98  ? 27.562  102.473 76.416  1.00   90.90  ? 98  LEU D CD1   1 
ATOM   9595  C CD2   . LEU F 6 98  ? 29.122  104.399 76.291  1.00   93.40  ? 98  LEU D CD2   1 
ATOM   9596  N N     . LEU F 6 99  ? 24.733  106.585 78.687  1.00   73.64  ? 99  LEU D N     1 
ATOM   9597  C CA    . LEU F 6 99  ? 23.445  107.278 78.623  1.00   98.05  ? 99  LEU D CA    1 
ATOM   9598  C C     . LEU F 6 99  ? 23.386  108.490 79.548  1.00   99.39  ? 99  LEU D C     1 
ATOM   9599  O O     . LEU F 6 99  ? 23.798  108.423 80.707  1.00   81.54  ? 99  LEU D O     1 
ATOM   9600  C CB    . LEU F 6 99  ? 22.273  106.326 78.904  1.00   71.24  ? 99  LEU D CB    1 
ATOM   9601  C CG    . LEU F 6 99  ? 22.093  105.052 78.062  1.00   56.64  ? 99  LEU D CG    1 
ATOM   9602  C CD1   . LEU F 6 99  ? 23.126  103.969 78.307  1.00   87.58  ? 99  LEU D CD1   1 
ATOM   9603  C CD2   . LEU F 6 99  ? 20.687  104.499 78.265  1.00   88.02  ? 99  LEU D CD2   1 
ATOM   9604  N N     . PRO F 6 100 ? 22.878  109.611 79.017  1.00   89.38  ? 100 PRO D N     1 
ATOM   9605  C CA    . PRO F 6 100 ? 22.766  110.906 79.695  1.00   86.88  ? 100 PRO D CA    1 
ATOM   9606  C C     . PRO F 6 100 ? 21.656  110.977 80.737  1.00   69.23  ? 100 PRO D C     1 
ATOM   9607  O O     . PRO F 6 100 ? 20.549  110.509 80.477  1.00   75.49  ? 100 PRO D O     1 
ATOM   9608  C CB    . PRO F 6 100 ? 22.450  111.876 78.547  1.00   107.29 ? 100 PRO D CB    1 
ATOM   9609  C CG    . PRO F 6 100 ? 22.758  111.137 77.286  1.00   87.30  ? 100 PRO D CG    1 
ATOM   9610  C CD    . PRO F 6 100 ? 22.492  109.708 77.600  1.00   71.95  ? 100 PRO D CD    1 
ATOM   9611  N N     . GLY F 6 101 ? 21.978  111.530 81.905  1.00   81.26  ? 101 GLY D N     1 
ATOM   9612  C CA    . GLY F 6 101 ? 21.008  111.830 82.948  1.00   82.98  ? 101 GLY D CA    1 
ATOM   9613  C C     . GLY F 6 101 ? 19.869  110.866 83.217  1.00   79.38  ? 101 GLY D C     1 
ATOM   9614  O O     . GLY F 6 101 ? 20.079  109.693 83.524  1.00   84.59  ? 101 GLY D O     1 
ATOM   9615  N N     . GLU F 6 102 ? 18.652  111.392 83.103  1.00   78.91  ? 102 GLU D N     1 
ATOM   9616  C CA    . GLU F 6 102 ? 17.428  110.672 83.445  1.00   79.62  ? 102 GLU D CA    1 
ATOM   9617  C C     . GLU F 6 102 ? 17.233  109.389 82.633  1.00   66.07  ? 102 GLU D C     1 
ATOM   9618  O O     . GLU F 6 102 ? 16.607  108.443 83.107  1.00   77.27  ? 102 GLU D O     1 
ATOM   9619  C CB    . GLU F 6 102 ? 16.225  111.599 83.254  1.00   82.76  ? 102 GLU D CB    1 
ATOM   9620  C CG    . GLU F 6 102 ? 15.008  111.235 84.086  1.00   114.33 ? 102 GLU D CG    1 
ATOM   9621  C CD    . GLU F 6 102 ? 15.169  111.584 85.555  1.00   127.69 ? 102 GLU D CD    1 
ATOM   9622  O OE1   . GLU F 6 102 ? 14.327  111.142 86.366  1.00   114.59 ? 102 GLU D OE1   1 
ATOM   9623  O OE2   . GLU F 6 102 ? 16.134  112.300 85.901  1.00   130.10 ? 102 GLU D OE2   1 
ATOM   9624  N N     . LEU F 6 103 ? 17.758  109.369 81.410  1.00   70.44  ? 103 LEU D N     1 
ATOM   9625  C CA    . LEU F 6 103 ? 17.707  108.184 80.553  1.00   67.11  ? 103 LEU D CA    1 
ATOM   9626  C C     . LEU F 6 103 ? 18.352  106.978 81.228  1.00   71.75  ? 103 LEU D C     1 
ATOM   9627  O O     . LEU F 6 103 ? 17.834  105.864 81.166  1.00   64.46  ? 103 LEU D O     1 
ATOM   9628  C CB    . LEU F 6 103 ? 18.386  108.450 79.209  1.00   69.43  ? 103 LEU D CB    1 
ATOM   9629  C CG    . LEU F 6 103 ? 17.472  108.941 78.088  1.00   68.85  ? 103 LEU D CG    1 
ATOM   9630  C CD1   . LEU F 6 103 ? 18.274  109.219 76.829  1.00   84.02  ? 103 LEU D CD1   1 
ATOM   9631  C CD2   . LEU F 6 103 ? 16.381  107.917 77.814  1.00   70.79  ? 103 LEU D CD2   1 
ATOM   9632  N N     . ALA F 6 104 ? 19.483  107.225 81.880  1.00   75.11  ? 104 ALA D N     1 
ATOM   9633  C CA    . ALA F 6 104 ? 20.237  106.193 82.581  1.00   57.54  ? 104 ALA D CA    1 
ATOM   9634  C C     . ALA F 6 104 ? 19.459  105.708 83.796  1.00   68.39  ? 104 ALA D C     1 
ATOM   9635  O O     . ALA F 6 104 ? 19.400  104.508 84.058  1.00   70.16  ? 104 ALA D O     1 
ATOM   9636  C CB    . ALA F 6 104 ? 21.602  106.715 82.995  1.00   69.94  ? 104 ALA D CB    1 
ATOM   9637  N N     . LYS F 6 105 ? 18.870  106.644 84.535  1.00   60.31  ? 105 LYS D N     1 
ATOM   9638  C CA    . LYS F 6 105 ? 18.113  106.317 85.738  1.00   65.76  ? 105 LYS D CA    1 
ATOM   9639  C C     . LYS F 6 105 ? 16.984  105.336 85.416  1.00   64.82  ? 105 LYS D C     1 
ATOM   9640  O O     . LYS F 6 105 ? 16.774  104.367 86.144  1.00   67.91  ? 105 LYS D O     1 
ATOM   9641  C CB    . LYS F 6 105 ? 17.546  107.587 86.377  1.00   67.04  ? 105 LYS D CB    1 
ATOM   9642  C CG    . LYS F 6 105 ? 18.605  108.588 86.815  1.00   93.50  ? 105 LYS D CG    1 
ATOM   9643  C CD    . LYS F 6 105 ? 17.980  109.806 87.482  1.00   116.50 ? 105 LYS D CD    1 
ATOM   9644  C CE    . LYS F 6 105 ? 19.034  110.851 87.825  1.00   130.04 ? 105 LYS D CE    1 
ATOM   9645  N NZ    . LYS F 6 105 ? 18.434  112.073 88.434  1.00   120.47 ? 105 LYS D NZ    1 
ATOM   9646  N N     . HIS F 6 106 ? 16.265  105.582 84.326  1.00   58.78  ? 106 HIS D N     1 
ATOM   9647  C CA    . HIS F 6 106 ? 15.166  104.703 83.934  1.00   72.49  ? 106 HIS D CA    1 
ATOM   9648  C C     . HIS F 6 106 ? 15.681  103.415 83.294  1.00   78.35  ? 106 HIS D C     1 
ATOM   9649  O O     . HIS F 6 106 ? 15.060  102.360 83.419  1.00   92.97  ? 106 HIS D O     1 
ATOM   9650  C CB    . HIS F 6 106 ? 14.209  105.410 82.971  1.00   87.92  ? 106 HIS D CB    1 
ATOM   9651  C CG    . HIS F 6 106 ? 13.437  106.530 83.594  1.00   71.97  ? 106 HIS D CG    1 
ATOM   9652  N ND1   . HIS F 6 106 ? 13.999  107.753 83.890  1.00   88.43  ? 106 HIS D ND1   1 
ATOM   9653  C CD2   . HIS F 6 106 ? 12.142  106.609 83.979  1.00   75.75  ? 106 HIS D CD2   1 
ATOM   9654  C CE1   . HIS F 6 106 ? 13.083  108.536 84.430  1.00   83.60  ? 106 HIS D CE1   1 
ATOM   9655  N NE2   . HIS F 6 106 ? 11.947  107.866 84.495  1.00   100.94 ? 106 HIS D NE2   1 
ATOM   9656  N N     . ALA F 6 107 ? 16.814  103.506 82.607  1.00   77.40  ? 107 ALA D N     1 
ATOM   9657  C CA    . ALA F 6 107 ? 17.442  102.330 82.015  1.00   70.61  ? 107 ALA D CA    1 
ATOM   9658  C C     . ALA F 6 107 ? 17.896  101.352 83.092  1.00   61.89  ? 107 ALA D C     1 
ATOM   9659  O O     . ALA F 6 107 ? 17.679  100.146 82.978  1.00   58.79  ? 107 ALA D O     1 
ATOM   9660  C CB    . ALA F 6 107 ? 18.619  102.736 81.139  1.00   71.54  ? 107 ALA D CB    1 
ATOM   9661  N N     . VAL F 6 108 ? 18.529  101.880 84.135  1.00   71.59  ? 108 VAL D N     1 
ATOM   9662  C CA    . VAL F 6 108 ? 18.982  101.067 85.259  1.00   76.88  ? 108 VAL D CA    1 
ATOM   9663  C C     . VAL F 6 108 ? 17.818  100.409 86.004  1.00   61.80  ? 108 VAL D C     1 
ATOM   9664  O O     . VAL F 6 108 ? 17.922  99.261  86.439  1.00   58.25  ? 108 VAL D O     1 
ATOM   9665  C CB    . VAL F 6 108 ? 19.818  101.918 86.251  1.00   78.47  ? 108 VAL D CB    1 
ATOM   9666  C CG1   . VAL F 6 108 ? 20.109  101.145 87.531  1.00   109.35 ? 108 VAL D CG1   1 
ATOM   9667  C CG2   . VAL F 6 108 ? 21.116  102.377 85.597  1.00   46.54  ? 108 VAL D CG2   1 
ATOM   9668  N N     . SER F 6 109 ? 16.706  101.127 86.127  1.00   69.53  ? 109 SER D N     1 
ATOM   9669  C CA    . SER F 6 109 ? 15.505  100.573 86.751  1.00   81.64  ? 109 SER D CA    1 
ATOM   9670  C C     . SER F 6 109 ? 15.019  99.341  85.997  1.00   78.95  ? 109 SER D C     1 
ATOM   9671  O O     . SER F 6 109 ? 14.746  98.301  86.595  1.00   84.75  ? 109 SER D O     1 
ATOM   9672  C CB    . SER F 6 109 ? 14.388  101.618 86.816  1.00   62.93  ? 109 SER D CB    1 
ATOM   9673  O OG    . SER F 6 109 ? 13.816  101.836 85.539  1.00   93.10  ? 109 SER D OG    1 
ATOM   9674  N N     . GLU F 6 110 ? 14.912  99.473  84.678  1.00   84.71  ? 110 GLU D N     1 
ATOM   9675  C CA    . GLU F 6 110 ? 14.429  98.394  83.825  1.00   84.25  ? 110 GLU D CA    1 
ATOM   9676  C C     . GLU F 6 110 ? 15.369  97.190  83.837  1.00   84.69  ? 110 GLU D C     1 
ATOM   9677  O O     . GLU F 6 110 ? 14.916  96.047  83.905  1.00   93.64  ? 110 GLU D O     1 
ATOM   9678  C CB    . GLU F 6 110 ? 14.239  98.895  82.392  1.00   90.76  ? 110 GLU D CB    1 
ATOM   9679  C CG    . GLU F 6 110 ? 13.124  99.918  82.232  1.00   71.16  ? 110 GLU D CG    1 
ATOM   9680  C CD    . GLU F 6 110 ? 11.759  99.357  82.584  1.00   116.42 ? 110 GLU D CD    1 
ATOM   9681  O OE1   . GLU F 6 110 ? 10.886  100.142 83.012  1.00   143.54 ? 110 GLU D OE1   1 
ATOM   9682  O OE2   . GLU F 6 110 ? 11.554  98.135  82.428  1.00   111.30 ? 110 GLU D OE2   1 
ATOM   9683  N N     . GLY F 6 111 ? 16.672  97.448  83.751  1.00   82.54  ? 111 GLY D N     1 
ATOM   9684  C CA    . GLY F 6 111 ? 17.660  96.383  83.792  1.00   81.52  ? 111 GLY D CA    1 
ATOM   9685  C C     . GLY F 6 111 ? 17.582  95.589  85.082  1.00   70.92  ? 111 GLY D C     1 
ATOM   9686  O O     . GLY F 6 111 ? 17.708  94.366  85.079  1.00   78.89  ? 111 GLY D O     1 
ATOM   9687  N N     . THR F 6 112 ? 17.378  96.297  86.188  1.00   70.82  ? 112 THR D N     1 
ATOM   9688  C CA    . THR F 6 112 ? 17.263  95.678  87.504  1.00   79.38  ? 112 THR D CA    1 
ATOM   9689  C C     . THR F 6 112 ? 16.013  94.805  87.539  1.00   92.65  ? 112 THR D C     1 
ATOM   9690  O O     . THR F 6 112 ? 16.055  93.638  87.934  1.00   74.80  ? 112 THR D O     1 
ATOM   9691  C CB    . THR F 6 112 ? 17.199  96.731  88.626  1.00   85.77  ? 112 THR D CB    1 
ATOM   9692  O OG1   . THR F 6 112 ? 18.446  97.434  88.699  1.00   77.54  ? 112 THR D OG1   1 
ATOM   9693  C CG2   . THR F 6 112 ? 16.915  96.066  89.964  1.00   121.78 ? 112 THR D CG2   1 
ATOM   9694  N N     . LYS F 6 113 ? 14.904  95.414  87.127  1.00   101.19 ? 113 LYS D N     1 
ATOM   9695  C CA    . LYS F 6 113 ? 13.597  94.771  87.035  1.00   80.51  ? 113 LYS D CA    1 
ATOM   9696  C C     . LYS F 6 113 ? 13.689  93.460  86.263  1.00   77.08  ? 113 LYS D C     1 
ATOM   9697  O O     . LYS F 6 113 ? 13.302  92.406  86.764  1.00   102.88 ? 113 LYS D O     1 
ATOM   9698  C CB    . LYS F 6 113 ? 12.608  95.722  86.356  1.00   109.77 ? 113 LYS D CB    1 
ATOM   9699  C CG    . LYS F 6 113 ? 11.322  95.090  85.859  1.00   127.57 ? 113 LYS D CG    1 
ATOM   9700  C CD    . LYS F 6 113 ? 10.384  96.164  85.320  1.00   115.18 ? 113 LYS D CD    1 
ATOM   9701  C CE    . LYS F 6 113 ? 10.066  97.217  86.372  1.00   116.19 ? 113 LYS D CE    1 
ATOM   9702  N NZ    . LYS F 6 113 ? 9.073   98.216  85.881  1.00   57.91  ? 113 LYS D NZ    1 
ATOM   9703  N N     . ALA F 6 114 ? 14.191  93.551  85.036  1.00   78.61  ? 114 ALA D N     1 
ATOM   9704  C CA    . ALA F 6 114 ? 14.329  92.411  84.133  1.00   92.21  ? 114 ALA D CA    1 
ATOM   9705  C C     . ALA F 6 114 ? 15.051  91.233  84.784  1.00   104.10 ? 114 ALA D C     1 
ATOM   9706  O O     . ALA F 6 114 ? 14.550  90.107  84.781  1.00   116.19 ? 114 ALA D O     1 
ATOM   9707  C CB    . ALA F 6 114 ? 15.054  92.832  82.873  1.00   100.57 ? 114 ALA D CB    1 
ATOM   9708  N N     . VAL F 6 115 ? 16.234  91.504  85.328  1.00   87.17  ? 115 VAL D N     1 
ATOM   9709  C CA    . VAL F 6 115 ? 17.052  90.486  85.980  1.00   96.62  ? 115 VAL D CA    1 
ATOM   9710  C C     . VAL F 6 115 ? 16.320  89.814  87.140  1.00   104.81 ? 115 VAL D C     1 
ATOM   9711  O O     . VAL F 6 115 ? 16.357  88.591  87.277  1.00   100.23 ? 115 VAL D O     1 
ATOM   9712  C CB    . VAL F 6 115 ? 18.378  91.089  86.498  1.00   96.78  ? 115 VAL D CB    1 
ATOM   9713  C CG1   . VAL F 6 115 ? 19.104  90.107  87.408  1.00   100.03 ? 115 VAL D CG1   1 
ATOM   9714  C CG2   . VAL F 6 115 ? 19.265  91.496  85.333  1.00   99.52  ? 115 VAL D CG2   1 
ATOM   9715  N N     . THR F 6 116 ? 15.640  90.610  87.958  1.00   103.47 ? 116 THR D N     1 
ATOM   9716  C CA    . THR F 6 116 ? 14.858  90.073  89.069  1.00   109.73 ? 116 THR D CA    1 
ATOM   9717  C C     . THR F 6 116 ? 13.788  89.101  88.577  1.00   112.05 ? 116 THR D C     1 
ATOM   9718  O O     . THR F 6 116 ? 13.776  87.936  88.978  1.00   111.14 ? 116 THR D O     1 
ATOM   9719  C CB    . THR F 6 116 ? 14.185  91.188  89.893  1.00   76.18  ? 116 THR D CB    1 
ATOM   9720  O OG1   . THR F 6 116 ? 13.503  92.090  89.015  1.00   114.38 ? 116 THR D OG1   1 
ATOM   9721  C CG2   . THR F 6 116 ? 15.222  91.956  90.698  1.00   52.48  ? 116 THR D CG2   1 
ATOM   9722  N N     . LYS F 6 117 ? 12.885  89.587  87.730  1.00   121.14 ? 117 LYS D N     1 
ATOM   9723  C CA    . LYS F 6 117 ? 11.816  88.754  87.184  1.00   116.70 ? 117 LYS D CA    1 
ATOM   9724  C C     . LYS F 6 117 ? 12.334  87.472  86.534  1.00   120.83 ? 117 LYS D C     1 
ATOM   9725  O O     . LYS F 6 117 ? 11.710  86.417  86.654  1.00   126.57 ? 117 LYS D O     1 
ATOM   9726  C CB    . LYS F 6 117 ? 11.010  89.543  86.148  1.00   119.97 ? 117 LYS D CB    1 
ATOM   9727  C CG    . LYS F 6 117 ? 10.401  90.837  86.663  1.00   127.25 ? 117 LYS D CG    1 
ATOM   9728  C CD    . LYS F 6 117 ? 9.774   91.666  85.544  1.00   147.61 ? 117 LYS D CD    1 
ATOM   9729  C CE    . LYS F 6 117 ? 8.332   91.256  85.240  1.00   164.71 ? 117 LYS D CE    1 
ATOM   9730  N NZ    . LYS F 6 117 ? 8.152   89.821  84.874  1.00   141.98 ? 117 LYS D NZ    1 
ATOM   9731  N N     . TYR F 6 118 ? 13.468  87.567  85.843  1.00   112.20 ? 118 TYR D N     1 
ATOM   9732  C CA    . TYR F 6 118 ? 14.028  86.412  85.147  1.00   121.25 ? 118 TYR D CA    1 
ATOM   9733  C C     . TYR F 6 118 ? 14.512  85.353  86.138  1.00   123.51 ? 118 TYR D C     1 
ATOM   9734  O O     . TYR F 6 118 ? 14.268  84.159  85.966  1.00   111.00 ? 118 TYR D O     1 
ATOM   9735  C CB    . TYR F 6 118 ? 15.171  86.868  84.233  1.00   121.96 ? 118 TYR D CB    1 
ATOM   9736  C CG    . TYR F 6 118 ? 15.975  85.758  83.591  1.00   115.76 ? 118 TYR D CG    1 
ATOM   9737  C CD1   . TYR F 6 118 ? 15.538  85.144  82.424  1.00   111.11 ? 118 TYR D CD1   1 
ATOM   9738  C CD2   . TYR F 6 118 ? 17.184  85.343  84.136  1.00   96.27  ? 118 TYR D CD2   1 
ATOM   9739  C CE1   . TYR F 6 118 ? 16.272  84.137  81.827  1.00   111.79 ? 118 TYR D CE1   1 
ATOM   9740  C CE2   . TYR F 6 118 ? 17.925  84.336  83.546  1.00   116.40 ? 118 TYR D CE2   1 
ATOM   9741  C CZ    . TYR F 6 118 ? 17.465  83.737  82.392  1.00   126.38 ? 118 TYR D CZ    1 
ATOM   9742  O OH    . TYR F 6 118 ? 18.199  82.735  81.801  1.00   136.24 ? 118 TYR D OH    1 
ATOM   9743  N N     . THR F 6 119 ? 15.200  85.816  87.177  1.00   123.48 ? 119 THR D N     1 
ATOM   9744  C CA    . THR F 6 119 ? 15.797  84.949  88.192  1.00   133.52 ? 119 THR D CA    1 
ATOM   9745  C C     . THR F 6 119 ? 14.795  84.305  89.151  1.00   126.08 ? 119 THR D C     1 
ATOM   9746  O O     . THR F 6 119 ? 15.164  83.438  89.943  1.00   129.09 ? 119 THR D O     1 
ATOM   9747  C CB    . THR F 6 119 ? 16.844  85.714  89.029  1.00   139.33 ? 119 THR D CB    1 
ATOM   9748  O OG1   . THR F 6 119 ? 16.256  86.907  89.563  1.00   128.68 ? 119 THR D OG1   1 
ATOM   9749  C CG2   . THR F 6 119 ? 18.044  86.087  88.171  1.00   113.30 ? 119 THR D CG2   1 
ATOM   9750  N N     . SER F 6 120 ? 13.533  84.720  89.083  1.00   125.01 ? 120 SER D N     1 
ATOM   9751  C CA    . SER F 6 120 ? 12.508  84.150  89.956  1.00   144.83 ? 120 SER D CA    1 
ATOM   9752  C C     . SER F 6 120 ? 11.589  83.123  89.296  1.00   151.55 ? 120 SER D C     1 
ATOM   9753  O O     . SER F 6 120 ? 10.720  82.555  89.957  1.00   155.31 ? 120 SER D O     1 
ATOM   9754  C CB    . SER F 6 120 ? 11.656  85.277  90.546  1.00   111.87 ? 120 SER D CB    1 
ATOM   9755  O OG    . SER F 6 120 ? 10.967  85.982  89.528  1.00   105.74 ? 120 SER D OG    1 
ATOM   9756  N N     . SER F 6 121 ? 11.772  82.882  88.003  1.00   143.42 ? 121 SER D N     1 
ATOM   9757  C CA    . SER F 6 121 ? 10.942  81.905  87.307  1.00   126.20 ? 121 SER D CA    1 
ATOM   9758  C C     . SER F 6 121 ? 11.751  80.665  86.942  1.00   129.80 ? 121 SER D C     1 
ATOM   9759  O O     . SER F 6 121 ? 12.590  80.209  87.718  1.00   113.58 ? 121 SER D O     1 
ATOM   9760  C CB    . SER F 6 121 ? 10.317  82.519  86.054  1.00   113.56 ? 121 SER D CB    1 
ATOM   9761  O OG    . SER F 6 121 ? 9.864   83.838  86.305  1.00   119.21 ? 121 SER D OG    1 
ATOM   9762  N N     . PRO G 3 38  ? 4.192   144.661 36.887  1.00   135.29 ? 38  PRO E N     1 
ATOM   9763  C CA    . PRO G 3 38  ? 4.855   143.415 37.287  1.00   135.06 ? 38  PRO E CA    1 
ATOM   9764  C C     . PRO G 3 38  ? 4.933   143.267 38.805  1.00   142.82 ? 38  PRO E C     1 
ATOM   9765  O O     . PRO G 3 38  ? 4.875   144.265 39.523  1.00   133.65 ? 38  PRO E O     1 
ATOM   9766  C CB    . PRO G 3 38  ? 6.254   143.550 36.679  1.00   121.08 ? 38  PRO E CB    1 
ATOM   9767  C CG    . PRO G 3 38  ? 6.462   145.021 36.532  1.00   139.34 ? 38  PRO E CG    1 
ATOM   9768  C CD    . PRO G 3 38  ? 5.114   145.585 36.204  1.00   133.19 ? 38  PRO E CD    1 
ATOM   9769  N N     . HIS G 3 39  ? 5.062   142.032 39.280  1.00   152.48 ? 39  HIS E N     1 
ATOM   9770  C CA    . HIS G 3 39  ? 5.125   141.759 40.712  1.00   151.70 ? 39  HIS E CA    1 
ATOM   9771  C C     . HIS G 3 39  ? 6.534   141.287 41.082  1.00   142.37 ? 39  HIS E C     1 
ATOM   9772  O O     . HIS G 3 39  ? 7.013   140.288 40.543  1.00   129.71 ? 39  HIS E O     1 
ATOM   9773  C CB    . HIS G 3 39  ? 4.076   140.718 41.101  1.00   125.23 ? 39  HIS E CB    1 
ATOM   9774  C CG    . HIS G 3 39  ? 4.074   140.378 42.556  1.00   115.59 ? 39  HIS E CG    1 
ATOM   9775  N ND1   . HIS G 3 39  ? 3.581   141.236 43.515  1.00   123.58 ? 39  HIS E ND1   1 
ATOM   9776  C CD2   . HIS G 3 39  ? 4.500   139.278 43.219  1.00   114.78 ? 39  HIS E CD2   1 
ATOM   9777  C CE1   . HIS G 3 39  ? 3.701   140.679 44.706  1.00   125.86 ? 39  HIS E CE1   1 
ATOM   9778  N NE2   . HIS G 3 39  ? 4.255   139.490 44.554  1.00   135.09 ? 39  HIS E NE2   1 
ATOM   9779  N N     . ARG G 3 40  ? 7.196   141.994 41.995  1.00   128.37 ? 40  ARG E N     1 
ATOM   9780  C CA    . ARG G 3 40  ? 8.589   141.679 42.317  1.00   128.51 ? 40  ARG E CA    1 
ATOM   9781  C C     . ARG G 3 40  ? 8.972   141.487 43.788  1.00   132.44 ? 40  ARG E C     1 
ATOM   9782  O O     . ARG G 3 40  ? 10.145  141.231 44.070  1.00   129.12 ? 40  ARG E O     1 
ATOM   9783  C CB    . ARG G 3 40  ? 9.486   142.788 41.756  1.00   130.18 ? 40  ARG E CB    1 
ATOM   9784  C CG    . ARG G 3 40  ? 9.604   142.834 40.246  1.00   126.67 ? 40  ARG E CG    1 
ATOM   9785  C CD    . ARG G 3 40  ? 10.846  142.087 39.807  1.00   93.15  ? 40  ARG E CD    1 
ATOM   9786  N NE    . ARG G 3 40  ? 12.028  142.571 40.515  1.00   91.92  ? 40  ARG E NE    1 
ATOM   9787  C CZ    . ARG G 3 40  ? 13.256  142.099 40.333  1.00   100.04 ? 40  ARG E CZ    1 
ATOM   9788  N NH1   . ARG G 3 40  ? 13.472  141.119 39.466  1.00   88.19  ? 40  ARG E NH1   1 
ATOM   9789  N NH2   . ARG G 3 40  ? 14.270  142.602 41.024  1.00   114.47 ? 40  ARG E NH2   1 
ATOM   9790  N N     . TYR G 3 41  ? 8.018   141.589 44.713  1.00   123.60 ? 41  TYR E N     1 
ATOM   9791  C CA    . TYR G 3 41  ? 8.309   141.361 46.136  1.00   117.81 ? 41  TYR E CA    1 
ATOM   9792  C C     . TYR G 3 41  ? 9.461   142.249 46.609  1.00   136.15 ? 41  TYR E C     1 
ATOM   9793  O O     . TYR G 3 41  ? 9.625   143.376 46.140  1.00   153.73 ? 41  TYR E O     1 
ATOM   9794  C CB    . TYR G 3 41  ? 8.637   139.890 46.436  1.00   66.06  ? 41  TYR E CB    1 
ATOM   9795  C CG    . TYR G 3 41  ? 7.460   138.942 46.376  1.00   92.53  ? 41  TYR E CG    1 
ATOM   9796  C CD1   . TYR G 3 41  ? 6.551   138.876 47.426  1.00   94.56  ? 41  TYR E CD1   1 
ATOM   9797  C CD2   . TYR G 3 41  ? 7.280   138.081 45.303  1.00   99.92  ? 41  TYR E CD2   1 
ATOM   9798  C CE1   . TYR G 3 41  ? 5.479   138.006 47.394  1.00   76.01  ? 41  TYR E CE1   1 
ATOM   9799  C CE2   . TYR G 3 41  ? 6.212   137.200 45.264  1.00   89.59  ? 41  TYR E CE2   1 
ATOM   9800  C CZ    . TYR G 3 41  ? 5.314   137.169 46.313  1.00   76.98  ? 41  TYR E CZ    1 
ATOM   9801  O OH    . TYR G 3 41  ? 4.246   136.303 46.285  1.00   92.98  ? 41  TYR E OH    1 
ATOM   9802  N N     . ARG G 3 42  ? 10.256  141.727 47.538  1.00   108.91 ? 42  ARG E N     1 
ATOM   9803  C CA    . ARG G 3 42  ? 11.416  142.440 48.062  1.00   87.46  ? 42  ARG E CA    1 
ATOM   9804  C C     . ARG G 3 42  ? 12.523  141.432 48.340  1.00   88.54  ? 42  ARG E C     1 
ATOM   9805  O O     . ARG G 3 42  ? 12.238  140.295 48.715  1.00   81.78  ? 42  ARG E O     1 
ATOM   9806  C CB    . ARG G 3 42  ? 11.063  143.214 49.333  1.00   86.15  ? 42  ARG E CB    1 
ATOM   9807  C CG    . ARG G 3 42  ? 10.316  144.515 49.093  1.00   80.55  ? 42  ARG E CG    1 
ATOM   9808  C CD    . ARG G 3 42  ? 9.956   145.185 50.406  1.00   114.29 ? 42  ARG E CD    1 
ATOM   9809  N NE    . ARG G 3 42  ? 9.459   146.544 50.212  1.00   130.17 ? 42  ARG E NE    1 
ATOM   9810  C CZ    . ARG G 3 42  ? 9.001   147.317 51.192  1.00   157.08 ? 42  ARG E CZ    1 
ATOM   9811  N NH1   . ARG G 3 42  ? 8.979   146.867 52.440  1.00   164.99 ? 42  ARG E NH1   1 
ATOM   9812  N NH2   . ARG G 3 42  ? 8.568   148.542 50.926  1.00   158.16 ? 42  ARG E NH2   1 
ATOM   9813  N N     . PRO G 3 43  ? 13.789  141.841 48.149  1.00   104.26 ? 43  PRO E N     1 
ATOM   9814  C CA    . PRO G 3 43  ? 14.934  140.965 48.427  1.00   86.75  ? 43  PRO E CA    1 
ATOM   9815  C C     . PRO G 3 43  ? 14.910  140.352 49.825  1.00   74.14  ? 43  PRO E C     1 
ATOM   9816  O O     . PRO G 3 43  ? 14.879  141.075 50.821  1.00   65.09  ? 43  PRO E O     1 
ATOM   9817  C CB    . PRO G 3 43  ? 16.133  141.905 48.275  1.00   73.83  ? 43  PRO E CB    1 
ATOM   9818  C CG    . PRO G 3 43  ? 15.672  142.939 47.311  1.00   76.01  ? 43  PRO E CG    1 
ATOM   9819  C CD    . PRO G 3 43  ? 14.210  143.142 47.598  1.00   92.92  ? 43  PRO E CD    1 
ATOM   9820  N N     . GLY G 3 44  ? 14.928  139.026 49.888  1.00   82.34  ? 44  GLY E N     1 
ATOM   9821  C CA    . GLY G 3 44  ? 14.915  138.324 51.156  1.00   80.12  ? 44  GLY E CA    1 
ATOM   9822  C C     . GLY G 3 44  ? 13.592  137.637 51.435  1.00   73.94  ? 44  GLY E C     1 
ATOM   9823  O O     . GLY G 3 44  ? 13.548  136.597 52.089  1.00   65.11  ? 44  GLY E O     1 
ATOM   9824  N N     . THR G 3 45  ? 12.513  138.219 50.918  1.00   75.91  ? 45  THR E N     1 
ATOM   9825  C CA    . THR G 3 45  ? 11.167  137.700 51.142  1.00   71.22  ? 45  THR E CA    1 
ATOM   9826  C C     . THR G 3 45  ? 10.978  136.298 50.571  1.00   64.17  ? 45  THR E C     1 
ATOM   9827  O O     . THR G 3 45  ? 10.468  135.406 51.251  1.00   69.71  ? 45  THR E O     1 
ATOM   9828  C CB    . THR G 3 45  ? 10.106  138.635 50.534  1.00   83.43  ? 45  THR E CB    1 
ATOM   9829  O OG1   . THR G 3 45  ? 10.181  139.920 51.165  1.00   94.05  ? 45  THR E OG1   1 
ATOM   9830  C CG2   . THR G 3 45  ? 8.711   138.057 50.716  1.00   66.91  ? 45  THR E CG2   1 
ATOM   9831  N N     . VAL G 3 46  ? 11.391  136.107 49.324  1.00   50.54  ? 46  VAL E N     1 
ATOM   9832  C CA    . VAL G 3 46  ? 11.277  134.802 48.688  1.00   56.13  ? 46  VAL E CA    1 
ATOM   9833  C C     . VAL G 3 46  ? 12.253  133.825 49.334  1.00   70.32  ? 46  VAL E C     1 
ATOM   9834  O O     . VAL G 3 46  ? 11.966  132.634 49.449  1.00   70.67  ? 46  VAL E O     1 
ATOM   9835  C CB    . VAL G 3 46  ? 11.547  134.883 47.172  1.00   79.03  ? 46  VAL E CB    1 
ATOM   9836  C CG1   . VAL G 3 46  ? 11.302  133.534 46.509  1.00   66.05  ? 46  VAL E CG1   1 
ATOM   9837  C CG2   . VAL G 3 46  ? 10.674  135.955 46.537  1.00   96.06  ? 46  VAL E CG2   1 
ATOM   9838  N N     . ALA G 3 47  ? 13.399  134.345 49.771  1.00   77.77  ? 47  ALA E N     1 
ATOM   9839  C CA    . ALA G 3 47  ? 14.416  133.542 50.447  1.00   58.76  ? 47  ALA E CA    1 
ATOM   9840  C C     . ALA G 3 47  ? 13.884  132.865 51.709  1.00   72.61  ? 47  ALA E C     1 
ATOM   9841  O O     . ALA G 3 47  ? 14.055  131.658 51.884  1.00   72.69  ? 47  ALA E O     1 
ATOM   9842  C CB    . ALA G 3 47  ? 15.619  134.402 50.785  1.00   58.30  ? 47  ALA E CB    1 
ATOM   9843  N N     . LEU G 3 48  ? 13.242  133.640 52.583  1.00   69.82  ? 48  LEU E N     1 
ATOM   9844  C CA    . LEU G 3 48  ? 12.649  133.087 53.802  1.00   74.15  ? 48  LEU E CA    1 
ATOM   9845  C C     . LEU G 3 48  ? 11.622  132.020 53.464  1.00   81.62  ? 48  LEU E C     1 
ATOM   9846  O O     . LEU G 3 48  ? 11.494  131.017 54.169  1.00   81.92  ? 48  LEU E O     1 
ATOM   9847  C CB    . LEU G 3 48  ? 11.993  134.176 54.658  1.00   50.91  ? 48  LEU E CB    1 
ATOM   9848  C CG    . LEU G 3 48  ? 12.823  135.095 55.560  1.00   52.20  ? 48  LEU E CG    1 
ATOM   9849  C CD1   . LEU G 3 48  ? 14.147  135.483 54.943  1.00   74.06  ? 48  LEU E CD1   1 
ATOM   9850  C CD2   . LEU G 3 48  ? 12.020  136.336 55.928  1.00   87.01  ? 48  LEU E CD2   1 
ATOM   9851  N N     . ARG G 3 49  ? 10.889  132.251 52.383  1.00   64.64  ? 49  ARG E N     1 
ATOM   9852  C CA    . ARG G 3 49  ? 9.889   131.302 51.935  1.00   80.21  ? 49  ARG E CA    1 
ATOM   9853  C C     . ARG G 3 49  ? 10.564  129.991 51.536  1.00   81.70  ? 49  ARG E C     1 
ATOM   9854  O O     . ARG G 3 49  ? 10.055  128.908 51.830  1.00   74.54  ? 49  ARG E O     1 
ATOM   9855  C CB    . ARG G 3 49  ? 9.102   131.905 50.772  1.00   81.64  ? 49  ARG E CB    1 
ATOM   9856  C CG    . ARG G 3 49  ? 7.839   131.172 50.389  1.00   89.54  ? 49  ARG E CG    1 
ATOM   9857  C CD    . ARG G 3 49  ? 6.960   132.073 49.536  1.00   90.33  ? 49  ARG E CD    1 
ATOM   9858  N NE    . ARG G 3 49  ? 7.598   132.433 48.273  1.00   99.12  ? 49  ARG E NE    1 
ATOM   9859  C CZ    . ARG G 3 49  ? 7.415   133.594 47.651  1.00   89.50  ? 49  ARG E CZ    1 
ATOM   9860  N NH1   . ARG G 3 49  ? 6.624   134.515 48.186  1.00   86.19  ? 49  ARG E NH1   1 
ATOM   9861  N NH2   . ARG G 3 49  ? 8.032   133.843 46.503  1.00   63.32  ? 49  ARG E NH2   1 
ATOM   9862  N N     . GLU G 3 50  ? 11.711  130.096 50.869  1.00   67.93  ? 50  GLU E N     1 
ATOM   9863  C CA    . GLU G 3 50  ? 12.493  128.920 50.503  1.00   55.69  ? 50  GLU E CA    1 
ATOM   9864  C C     . GLU G 3 50  ? 13.047  128.200 51.733  1.00   81.86  ? 50  GLU E C     1 
ATOM   9865  O O     . GLU G 3 50  ? 12.953  126.978 51.840  1.00   84.58  ? 50  GLU E O     1 
ATOM   9866  C CB    . GLU G 3 50  ? 13.639  129.303 49.565  1.00   69.24  ? 50  GLU E CB    1 
ATOM   9867  C CG    . GLU G 3 50  ? 13.199  129.967 48.271  1.00   80.54  ? 50  GLU E CG    1 
ATOM   9868  C CD    . GLU G 3 50  ? 14.352  130.191 47.309  1.00   87.12  ? 50  GLU E CD    1 
ATOM   9869  O OE1   . GLU G 3 50  ? 14.294  131.158 46.520  1.00   67.93  ? 50  GLU E OE1   1 
ATOM   9870  O OE2   . GLU G 3 50  ? 15.311  129.389 47.329  1.00   100.71 ? 50  GLU E OE2   1 
ATOM   9871  N N     . ILE G 3 51  ? 13.619  128.975 52.657  1.00   81.89  ? 51  ILE E N     1 
ATOM   9872  C CA    . ILE G 3 51  ? 14.162  128.451 53.914  1.00   74.38  ? 51  ILE E CA    1 
ATOM   9873  C C     . ILE G 3 51  ? 13.165  127.573 54.654  1.00   68.51  ? 51  ILE E C     1 
ATOM   9874  O O     . ILE G 3 51  ? 13.465  126.442 55.032  1.00   61.77  ? 51  ILE E O     1 
ATOM   9875  C CB    . ILE G 3 51  ? 14.598  129.592 54.862  1.00   66.13  ? 51  ILE E CB    1 
ATOM   9876  C CG1   . ILE G 3 51  ? 15.750  130.391 54.251  1.00   70.01  ? 51  ILE E CG1   1 
ATOM   9877  C CG2   . ILE G 3 51  ? 15.015  129.033 56.212  1.00   75.54  ? 51  ILE E CG2   1 
ATOM   9878  C CD1   . ILE G 3 51  ? 16.285  131.485 55.152  1.00   54.07  ? 51  ILE E CD1   1 
ATOM   9879  N N     . ARG G 3 52  ? 11.973  128.120 54.844  1.00   79.54  ? 52  ARG E N     1 
ATOM   9880  C CA    . ARG G 3 52  ? 10.887  127.450 55.539  1.00   73.93  ? 52  ARG E CA    1 
ATOM   9881  C C     . ARG G 3 52  ? 10.486  126.198 54.762  1.00   75.19  ? 52  ARG E C     1 
ATOM   9882  O O     . ARG G 3 52  ? 10.214  125.151 55.354  1.00   74.69  ? 52  ARG E O     1 
ATOM   9883  C CB    . ARG G 3 52  ? 9.734   128.430 55.742  1.00   79.35  ? 52  ARG E CB    1 
ATOM   9884  C CG    . ARG G 3 52  ? 8.764   128.068 56.847  1.00   104.73 ? 52  ARG E CG    1 
ATOM   9885  C CD    . ARG G 3 52  ? 7.523   128.942 56.765  1.00   93.91  ? 52  ARG E CD    1 
ATOM   9886  N NE    . ARG G 3 52  ? 7.777   130.238 57.400  1.00   114.68 ? 52  ARG E NE    1 
ATOM   9887  C CZ    . ARG G 3 52  ? 8.193   131.332 56.765  1.00   109.40 ? 52  ARG E CZ    1 
ATOM   9888  N NH1   . ARG G 3 52  ? 8.405   131.312 55.457  1.00   100.37 ? 52  ARG E NH1   1 
ATOM   9889  N NH2   . ARG G 3 52  ? 8.394   132.456 57.443  1.00   76.96  ? 52  ARG E NH2   1 
ATOM   9890  N N     . ARG G 3 53  ? 10.434  126.325 53.438  1.00   72.91  ? 53  ARG E N     1 
ATOM   9891  C CA    . ARG G 3 53  ? 10.038  125.232 52.551  1.00   87.02  ? 53  ARG E CA    1 
ATOM   9892  C C     . ARG G 3 53  ? 10.902  123.978 52.694  1.00   82.63  ? 53  ARG E C     1 
ATOM   9893  O O     . ARG G 3 53  ? 10.385  122.867 52.828  1.00   60.99  ? 53  ARG E O     1 
ATOM   9894  C CB    . ARG G 3 53  ? 10.099  125.697 51.098  1.00   83.57  ? 53  ARG E CB    1 
ATOM   9895  C CG    . ARG G 3 53  ? 9.836   124.598 50.084  1.00   89.90  ? 53  ARG E CG    1 
ATOM   9896  C CD    . ARG G 3 53  ? 10.268  125.026 48.695  1.00   105.18 ? 53  ARG E CD    1 
ATOM   9897  N NE    . ARG G 3 53  ? 10.169  123.938 47.726  1.00   112.44 ? 53  ARG E NE    1 
ATOM   9898  C CZ    . ARG G 3 53  ? 10.458  124.065 46.435  1.00   112.40 ? 53  ARG E CZ    1 
ATOM   9899  N NH1   . ARG G 3 53  ? 10.873  125.232 45.960  1.00   95.31  ? 53  ARG E NH1   1 
ATOM   9900  N NH2   . ARG G 3 53  ? 10.340  123.025 45.621  1.00   92.99  ? 53  ARG E NH2   1 
ATOM   9901  N N     . TYR G 3 54  ? 12.218  124.166 52.671  1.00   84.46  ? 54  TYR E N     1 
ATOM   9902  C CA    . TYR G 3 54  ? 13.157  123.048 52.662  1.00   72.79  ? 54  TYR E CA    1 
ATOM   9903  C C     . TYR G 3 54  ? 13.387  122.488 54.060  1.00   70.34  ? 54  TYR E C     1 
ATOM   9904  O O     . TYR G 3 54  ? 13.768  121.329 54.216  1.00   86.47  ? 54  TYR E O     1 
ATOM   9905  C CB    . TYR G 3 54  ? 14.493  123.462 52.043  1.00   64.47  ? 54  TYR E CB    1 
ATOM   9906  C CG    . TYR G 3 54  ? 14.409  123.824 50.576  1.00   78.02  ? 54  TYR E CG    1 
ATOM   9907  C CD1   . TYR G 3 54  ? 14.135  122.856 49.617  1.00   82.61  ? 54  TYR E CD1   1 
ATOM   9908  C CD2   . TYR G 3 54  ? 14.637  125.123 50.145  1.00   86.67  ? 54  TYR E CD2   1 
ATOM   9909  C CE1   . TYR G 3 54  ? 14.065  123.179 48.274  1.00   92.71  ? 54  TYR E CE1   1 
ATOM   9910  C CE2   . TYR G 3 54  ? 14.572  125.456 48.805  1.00   90.11  ? 54  TYR E CE2   1 
ATOM   9911  C CZ    . TYR G 3 54  ? 14.286  124.480 47.874  1.00   95.66  ? 54  TYR E CZ    1 
ATOM   9912  O OH    . TYR G 3 54  ? 14.221  124.808 46.539  1.00   98.00  ? 54  TYR E OH    1 
ATOM   9913  N N     . GLN G 3 55  ? 13.144  123.310 55.074  1.00   71.51  ? 55  GLN E N     1 
ATOM   9914  C CA    . GLN G 3 55  ? 13.210  122.847 56.454  1.00   64.25  ? 55  GLN E CA    1 
ATOM   9915  C C     . GLN G 3 55  ? 11.980  122.007 56.776  1.00   78.65  ? 55  GLN E C     1 
ATOM   9916  O O     . GLN G 3 55  ? 11.938  121.311 57.791  1.00   76.59  ? 55  GLN E O     1 
ATOM   9917  C CB    . GLN G 3 55  ? 13.311  124.034 57.413  1.00   61.56  ? 55  GLN E CB    1 
ATOM   9918  C CG    . GLN G 3 55  ? 14.684  124.682 57.465  1.00   59.45  ? 55  GLN E CG    1 
ATOM   9919  C CD    . GLN G 3 55  ? 14.777  125.764 58.525  1.00   69.01  ? 55  GLN E CD    1 
ATOM   9920  O OE1   . GLN G 3 55  ? 13.781  126.120 59.154  1.00   64.87  ? 55  GLN E OE1   1 
ATOM   9921  N NE2   . GLN G 3 55  ? 15.977  126.300 58.720  1.00   78.39  ? 55  GLN E NE2   1 
ATOM   9922  N N     . LYS G 3 56  ? 10.981  122.074 55.901  1.00   87.40  ? 56  LYS E N     1 
ATOM   9923  C CA    . LYS G 3 56  ? 9.739   121.340 56.098  1.00   95.63  ? 56  LYS E CA    1 
ATOM   9924  C C     . LYS G 3 56  ? 9.796   119.988 55.395  1.00   92.30  ? 56  LYS E C     1 
ATOM   9925  O O     . LYS G 3 56  ? 9.118   119.039 55.791  1.00   80.55  ? 56  LYS E O     1 
ATOM   9926  C CB    . LYS G 3 56  ? 8.548   122.150 55.577  1.00   72.70  ? 56  LYS E CB    1 
ATOM   9927  C CG    . LYS G 3 56  ? 7.193   121.601 55.986  1.00   63.91  ? 56  LYS E CG    1 
ATOM   9928  C CD    . LYS G 3 56  ? 6.067   122.506 55.518  1.00   100.42 ? 56  LYS E CD    1 
ATOM   9929  C CE    . LYS G 3 56  ? 4.744   122.115 56.159  1.00   125.16 ? 56  LYS E CE    1 
ATOM   9930  N NZ    . LYS G 3 56  ? 3.649   123.060 55.803  1.00   123.57 ? 56  LYS E NZ    1 
ATOM   9931  N N     . SER G 3 57  ? 10.618  119.905 54.353  1.00   98.45  ? 57  SER E N     1 
ATOM   9932  C CA    . SER G 3 57  ? 10.722  118.684 53.565  1.00   105.86 ? 57  SER E CA    1 
ATOM   9933  C C     . SER G 3 57  ? 11.990  117.908 53.912  1.00   102.20 ? 57  SER E C     1 
ATOM   9934  O O     . SER G 3 57  ? 12.774  118.337 54.760  1.00   87.48  ? 57  SER E O     1 
ATOM   9935  C CB    . SER G 3 57  ? 10.686  119.013 52.073  1.00   85.92  ? 57  SER E CB    1 
ATOM   9936  O OG    . SER G 3 57  ? 11.712  119.927 51.728  1.00   75.78  ? 57  SER E OG    1 
ATOM   9937  N N     . THR G 3 58  ? 12.196  116.773 53.246  1.00   103.26 ? 58  THR E N     1 
ATOM   9938  C CA    . THR G 3 58  ? 13.342  115.913 53.541  1.00   98.65  ? 58  THR E CA    1 
ATOM   9939  C C     . THR G 3 58  ? 14.031  115.362 52.292  1.00   91.34  ? 58  THR E C     1 
ATOM   9940  O O     . THR G 3 58  ? 15.014  114.627 52.399  1.00   78.61  ? 58  THR E O     1 
ATOM   9941  C CB    . THR G 3 58  ? 12.932  114.707 54.424  1.00   100.23 ? 58  THR E CB    1 
ATOM   9942  O OG1   . THR G 3 58  ? 12.032  113.863 53.696  1.00   104.84 ? 58  THR E OG1   1 
ATOM   9943  C CG2   . THR G 3 58  ? 12.254  115.164 55.711  1.00   84.54  ? 58  THR E CG2   1 
ATOM   9944  N N     . GLU G 3 59  ? 13.516  115.707 51.114  1.00   99.54  ? 59  GLU E N     1 
ATOM   9945  C CA    . GLU G 3 59  ? 14.085  115.218 49.858  1.00   94.72  ? 59  GLU E CA    1 
ATOM   9946  C C     . GLU G 3 59  ? 15.506  115.741 49.672  1.00   84.79  ? 59  GLU E C     1 
ATOM   9947  O O     . GLU G 3 59  ? 15.873  116.779 50.224  1.00   73.96  ? 59  GLU E O     1 
ATOM   9948  C CB    . GLU G 3 59  ? 13.215  115.614 48.658  1.00   105.22 ? 59  GLU E CB    1 
ATOM   9949  C CG    . GLU G 3 59  ? 13.506  116.988 48.056  1.00   98.66  ? 59  GLU E CG    1 
ATOM   9950  C CD    . GLU G 3 59  ? 12.876  118.131 48.825  1.00   93.84  ? 59  GLU E CD    1 
ATOM   9951  O OE1   . GLU G 3 59  ? 12.425  119.102 48.181  1.00   70.38  ? 59  GLU E OE1   1 
ATOM   9952  O OE2   . GLU G 3 59  ? 12.722  118.011 50.055  1.00   107.66 ? 59  GLU E OE2   1 
ATOM   9953  N N     . LEU G 3 60  ? 16.303  115.018 48.893  1.00   91.06  ? 60  LEU E N     1 
ATOM   9954  C CA    . LEU G 3 60  ? 17.667  115.443 48.605  1.00   82.58  ? 60  LEU E CA    1 
ATOM   9955  C C     . LEU G 3 60  ? 17.670  116.666 47.697  1.00   66.69  ? 60  LEU E C     1 
ATOM   9956  O O     . LEU G 3 60  ? 16.852  116.785 46.787  1.00   68.51  ? 60  LEU E O     1 
ATOM   9957  C CB    . LEU G 3 60  ? 18.470  114.305 47.973  1.00   73.64  ? 60  LEU E CB    1 
ATOM   9958  C CG    . LEU G 3 60  ? 18.734  113.111 48.892  1.00   71.47  ? 60  LEU E CG    1 
ATOM   9959  C CD1   . LEU G 3 60  ? 19.584  112.064 48.191  1.00   96.07  ? 60  LEU E CD1   1 
ATOM   9960  C CD2   . LEU G 3 60  ? 19.398  113.571 50.177  1.00   60.56  ? 60  LEU E CD2   1 
ATOM   9961  N N     . LEU G 3 61  ? 18.599  117.576 47.965  1.00   63.13  ? 61  LEU E N     1 
ATOM   9962  C CA    . LEU G 3 61  ? 18.627  118.873 47.307  1.00   62.19  ? 61  LEU E CA    1 
ATOM   9963  C C     . LEU G 3 61  ? 19.675  118.934 46.196  1.00   72.48  ? 61  LEU E C     1 
ATOM   9964  O O     . LEU G 3 61  ? 19.717  119.886 45.420  1.00   76.41  ? 61  LEU E O     1 
ATOM   9965  C CB    . LEU G 3 61  ? 18.893  119.966 48.343  1.00   72.36  ? 61  LEU E CB    1 
ATOM   9966  C CG    . LEU G 3 61  ? 17.931  119.990 49.536  1.00   66.60  ? 61  LEU E CG    1 
ATOM   9967  C CD1   . LEU G 3 61  ? 18.328  121.066 50.535  1.00   65.29  ? 61  LEU E CD1   1 
ATOM   9968  C CD2   . LEU G 3 61  ? 16.495  120.186 49.076  1.00   75.89  ? 61  LEU E CD2   1 
ATOM   9969  N N     . ILE G 3 62  ? 20.517  117.911 46.117  1.00   85.57  ? 62  ILE E N     1 
ATOM   9970  C CA    . ILE G 3 62  ? 21.516  117.823 45.057  1.00   87.04  ? 62  ILE E CA    1 
ATOM   9971  C C     . ILE G 3 62  ? 21.052  116.880 43.945  1.00   97.42  ? 62  ILE E C     1 
ATOM   9972  O O     . ILE G 3 62  ? 20.423  115.856 44.217  1.00   80.51  ? 62  ILE E O     1 
ATOM   9973  C CB    . ILE G 3 62  ? 22.881  117.346 45.614  1.00   75.10  ? 62  ILE E CB    1 
ATOM   9974  C CG1   . ILE G 3 62  ? 23.413  118.340 46.648  1.00   70.45  ? 62  ILE E CG1   1 
ATOM   9975  C CG2   . ILE G 3 62  ? 23.898  117.151 44.498  1.00   69.31  ? 62  ILE E CG2   1 
ATOM   9976  C CD1   . ILE G 3 62  ? 24.726  117.923 47.277  1.00   37.32  ? 62  ILE E CD1   1 
ATOM   9977  N N     . ARG G 3 63  ? 21.345  117.245 42.697  1.00   106.85 ? 63  ARG E N     1 
ATOM   9978  C CA    . ARG G 3 63  ? 21.004  116.419 41.541  1.00   108.44 ? 63  ARG E CA    1 
ATOM   9979  C C     . ARG G 3 63  ? 21.671  115.054 41.663  1.00   97.51  ? 63  ARG E C     1 
ATOM   9980  O O     . ARG G 3 63  ? 22.881  114.952 41.869  1.00   76.14  ? 63  ARG E O     1 
ATOM   9981  C CB    . ARG G 3 63  ? 21.411  117.122 40.244  1.00   108.55 ? 63  ARG E CB    1 
ATOM   9982  C CG    . ARG G 3 63  ? 20.542  118.321 39.827  1.00   97.35  ? 63  ARG E CG    1 
ATOM   9983  C CD    . ARG G 3 63  ? 19.092  117.949 39.447  1.00   106.97 ? 63  ARG E CD    1 
ATOM   9984  N NE    . ARG G 3 63  ? 18.309  117.315 40.506  1.00   94.29  ? 63  ARG E NE    1 
ATOM   9985  C CZ    . ARG G 3 63  ? 17.353  117.921 41.200  1.00   101.86 ? 63  ARG E CZ    1 
ATOM   9986  N NH1   . ARG G 3 63  ? 17.047  119.186 40.951  1.00   123.31 ? 63  ARG E NH1   1 
ATOM   9987  N NH2   . ARG G 3 63  ? 16.697  117.256 42.142  1.00   92.31  ? 63  ARG E NH2   1 
ATOM   9988  N N     . LYS G 3 64  ? 20.860  114.009 41.532  1.00   98.82  ? 64  LYS E N     1 
ATOM   9989  C CA    . LYS G 3 64  ? 21.300  112.645 41.788  1.00   97.06  ? 64  LYS E CA    1 
ATOM   9990  C C     . LYS G 3 64  ? 22.433  112.178 40.875  1.00   112.74 ? 64  LYS E C     1 
ATOM   9991  O O     . LYS G 3 64  ? 23.472  111.718 41.352  1.00   93.16  ? 64  LYS E O     1 
ATOM   9992  C CB    . LYS G 3 64  ? 20.102  111.706 41.624  1.00   102.03 ? 64  LYS E CB    1 
ATOM   9993  C CG    . LYS G 3 64  ? 19.049  111.833 42.716  1.00   88.40  ? 64  LYS E CG    1 
ATOM   9994  C CD    . LYS G 3 64  ? 19.433  111.133 43.999  1.00   115.98 ? 64  LYS E CD    1 
ATOM   9995  C CE    . LYS G 3 64  ? 18.229  111.046 44.926  1.00   117.12 ? 64  LYS E CE    1 
ATOM   9996  N NZ    . LYS G 3 64  ? 17.187  110.117 44.407  1.00   112.75 ? 64  LYS E NZ    1 
ATOM   9997  N N     . LEU G 3 65  ? 22.226  112.295 39.566  1.00   128.28 ? 65  LEU E N     1 
ATOM   9998  C CA    . LEU G 3 65  ? 23.210  111.831 38.586  1.00   128.93 ? 65  LEU E CA    1 
ATOM   9999  C C     . LEU G 3 65  ? 24.571  112.563 38.662  1.00   97.20  ? 65  LEU E C     1 
ATOM   10000 O O     . LEU G 3 65  ? 25.607  111.901 38.740  1.00   81.63  ? 65  LEU E O     1 
ATOM   10001 C CB    . LEU G 3 65  ? 22.626  111.903 37.166  1.00   116.10 ? 65  LEU E CB    1 
ATOM   10002 C CG    . LEU G 3 65  ? 23.479  111.296 36.051  1.00   106.38 ? 65  LEU E CG    1 
ATOM   10003 C CD1   . LEU G 3 65  ? 23.747  109.823 36.326  1.00   108.59 ? 65  LEU E CD1   1 
ATOM   10004 C CD2   . LEU G 3 65  ? 22.798  111.470 34.703  1.00   117.62 ? 65  LEU E CD2   1 
ATOM   10005 N N     . PRO G 3 66  ? 24.577  113.919 38.627  1.00   82.81  ? 66  PRO E N     1 
ATOM   10006 C CA    . PRO G 3 66  ? 25.842  114.662 38.755  1.00   85.43  ? 66  PRO E CA    1 
ATOM   10007 C C     . PRO G 3 66  ? 26.674  114.295 39.979  1.00   90.13  ? 66  PRO E C     1 
ATOM   10008 O O     . PRO G 3 66  ? 27.900  114.223 39.889  1.00   89.90  ? 66  PRO E O     1 
ATOM   10009 C CB    . PRO G 3 66  ? 25.385  116.117 38.850  1.00   81.41  ? 66  PRO E CB    1 
ATOM   10010 C CG    . PRO G 3 66  ? 24.118  116.155 38.120  1.00   102.69 ? 66  PRO E CG    1 
ATOM   10011 C CD    . PRO G 3 66  ? 23.448  114.838 38.382  1.00   80.11  ? 66  PRO E CD    1 
ATOM   10012 N N     . PHE G 3 67  ? 26.011  114.084 41.110  1.00   97.94  ? 67  PHE E N     1 
ATOM   10013 C CA    . PHE G 3 67  ? 26.698  113.716 42.341  1.00   97.70  ? 67  PHE E CA    1 
ATOM   10014 C C     . PHE G 3 67  ? 27.375  112.361 42.181  1.00   88.61  ? 67  PHE E C     1 
ATOM   10015 O O     . PHE G 3 67  ? 28.505  112.164 42.630  1.00   72.39  ? 67  PHE E O     1 
ATOM   10016 C CB    . PHE G 3 67  ? 25.717  113.700 43.518  1.00   93.66  ? 67  PHE E CB    1 
ATOM   10017 C CG    . PHE G 3 67  ? 26.340  113.293 44.823  1.00   95.54  ? 67  PHE E CG    1 
ATOM   10018 C CD1   . PHE G 3 67  ? 26.924  114.239 45.649  1.00   87.19  ? 67  PHE E CD1   1 
ATOM   10019 C CD2   . PHE G 3 67  ? 26.323  111.969 45.234  1.00   90.60  ? 67  PHE E CD2   1 
ATOM   10020 C CE1   . PHE G 3 67  ? 27.496  113.870 46.851  1.00   92.39  ? 67  PHE E CE1   1 
ATOM   10021 C CE2   . PHE G 3 67  ? 26.893  111.595 46.435  1.00   80.06  ? 67  PHE E CE2   1 
ATOM   10022 C CZ    . PHE G 3 67  ? 27.480  112.547 47.245  1.00   86.79  ? 67  PHE E CZ    1 
ATOM   10023 N N     . GLN G 3 68  ? 26.671  111.431 41.545  1.00   94.90  ? 68  GLN E N     1 
ATOM   10024 C CA    . GLN G 3 68  ? 27.178  110.081 41.328  1.00   111.90 ? 68  GLN E CA    1 
ATOM   10025 C C     . GLN G 3 68  ? 28.477  110.087 40.520  1.00   91.27  ? 68  GLN E C     1 
ATOM   10026 O O     . GLN G 3 68  ? 29.403  109.329 40.812  1.00   66.56  ? 68  GLN E O     1 
ATOM   10027 C CB    . GLN G 3 68  ? 26.122  109.227 40.626  1.00   104.59 ? 68  GLN E CB    1 
ATOM   10028 C CG    . GLN G 3 68  ? 26.540  107.787 40.403  1.00   98.23  ? 68  GLN E CG    1 
ATOM   10029 C CD    . GLN G 3 68  ? 25.425  106.946 39.825  1.00   105.80 ? 68  GLN E CD    1 
ATOM   10030 O OE1   . GLN G 3 68  ? 24.813  106.139 40.525  1.00   124.80 ? 68  GLN E OE1   1 
ATOM   10031 N NE2   . GLN G 3 68  ? 25.153  107.130 38.538  1.00   108.98 ? 68  GLN E NE2   1 
ATOM   10032 N N     . ARG G 3 69  ? 28.536  110.945 39.505  1.00   77.71  ? 69  ARG E N     1 
ATOM   10033 C CA    . ARG G 3 69  ? 29.735  111.083 38.684  1.00   96.28  ? 69  ARG E CA    1 
ATOM   10034 C C     . ARG G 3 69  ? 30.897  111.646 39.496  1.00   100.11 ? 69  ARG E C     1 
ATOM   10035 O O     . ARG G 3 69  ? 32.044  111.225 39.334  1.00   91.26  ? 69  ARG E O     1 
ATOM   10036 C CB    . ARG G 3 69  ? 29.460  111.980 37.475  1.00   84.48  ? 69  ARG E CB    1 
ATOM   10037 C CG    . ARG G 3 69  ? 28.412  111.431 36.522  1.00   88.91  ? 69  ARG E CG    1 
ATOM   10038 C CD    . ARG G 3 69  ? 28.385  112.215 35.220  1.00   77.32  ? 69  ARG E CD    1 
ATOM   10039 N NE    . ARG G 3 69  ? 27.980  113.601 35.427  1.00   64.30  ? 69  ARG E NE    1 
ATOM   10040 C CZ    . ARG G 3 69  ? 26.773  114.075 35.136  1.00   95.15  ? 69  ARG E CZ    1 
ATOM   10041 N NH1   . ARG G 3 69  ? 25.846  113.271 34.630  1.00   85.58  ? 69  ARG E NH1   1 
ATOM   10042 N NH2   . ARG G 3 69  ? 26.490  115.353 35.355  1.00   109.05 ? 69  ARG E NH2