data_4QMH
# 
_entry.id   4QMH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4QMH         
RCSB  RCSB086240   
WWPDB D_1000086240 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4QMI . unspecified 
PDB 4QMJ . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4QMH 
_pdbx_database_status.recvd_initial_deposition_date   2014-06-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fox, J.C.'    1 
'Howard, A.E.' 2 
'Currie, J.D.' 3 
'Rogers, S.L.' 4 
'Slep, K.C.'   5 
# 
_citation.id                        primary 
_citation.title                     'The XMAP215 family drives microtubule polymerization using a structurally diverse TOG array.' 
_citation.journal_abbrev            Mol.Biol.Cell 
_citation.journal_volume            25 
_citation.page_first                2375 
_citation.page_last                 2392 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1059-1524 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24966168 
_citation.pdbx_database_id_DOI      10.1091/mbc.E13-08-0501 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fox, J.C.'    1 
primary 'Howard, A.E.' 2 
primary 'Currie, J.D.' 3 
primary 'Rogers, S.L.' 4 
primary 'Slep, K.C.'   5 
# 
_cell.entry_id           4QMH 
_cell.length_a           31.788 
_cell.length_b           32.613 
_cell.length_c           59.795 
_cell.angle_alpha        100.05 
_cell.angle_beta         95.23 
_cell.angle_gamma        109.95 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4QMH 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man LP04448p      26303.529 1   ? ? 'TOG domain 4' ? 
2 non-polymer syn 'SULFATE ION' 96.063    1   ? ? ?              ? 
3 water       nat water         18.015    401 ? ? ?              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Mini spindles, isoform C' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIISEARLIKPSIGDLAPALAHRLVDSNAKIAQTTLAI
CEQLATAMGAGCRNHVRNLFPGFLHALGDNKSFVRAAALNCINSFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLA
DKLPGLPPKSVSKEDIHSMVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRALDKQKPASKKDILAALEKARPNL
P
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIISEARLIKPSIGDLAPALAHRLVDSNAKIAQTTLAI
CEQLATAMGAGCRNHVRNLFPGFLHALGDNKSFVRAAALNCINSFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLA
DKLPGLPPKSVSKEDIHSMVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRALDKQKPASKKDILAALEKARPNL
P
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   MET n 
1 6   ALA n 
1 7   ASP n 
1 8   LEU n 
1 9   LEU n 
1 10  PRO n 
1 11  ARG n 
1 12  VAL n 
1 13  ASP n 
1 14  ILE n 
1 15  ALA n 
1 16  PRO n 
1 17  GLN n 
1 18  ILE n 
1 19  THR n 
1 20  GLU n 
1 21  ALA n 
1 22  LEU n 
1 23  LEU n 
1 24  LYS n 
1 25  GLU n 
1 26  MET n 
1 27  SER n 
1 28  ASP n 
1 29  LYS n 
1 30  ASP n 
1 31  TRP n 
1 32  LYS n 
1 33  THR n 
1 34  ARG n 
1 35  ASN n 
1 36  GLU n 
1 37  GLY n 
1 38  LEU n 
1 39  THR n 
1 40  LYS n 
1 41  LEU n 
1 42  GLN n 
1 43  ALA n 
1 44  ILE n 
1 45  ILE n 
1 46  SER n 
1 47  GLU n 
1 48  ALA n 
1 49  ARG n 
1 50  LEU n 
1 51  ILE n 
1 52  LYS n 
1 53  PRO n 
1 54  SER n 
1 55  ILE n 
1 56  GLY n 
1 57  ASP n 
1 58  LEU n 
1 59  ALA n 
1 60  PRO n 
1 61  ALA n 
1 62  LEU n 
1 63  ALA n 
1 64  HIS n 
1 65  ARG n 
1 66  LEU n 
1 67  VAL n 
1 68  ASP n 
1 69  SER n 
1 70  ASN n 
1 71  ALA n 
1 72  LYS n 
1 73  ILE n 
1 74  ALA n 
1 75  GLN n 
1 76  THR n 
1 77  THR n 
1 78  LEU n 
1 79  ALA n 
1 80  ILE n 
1 81  CYS n 
1 82  GLU n 
1 83  GLN n 
1 84  LEU n 
1 85  ALA n 
1 86  THR n 
1 87  ALA n 
1 88  MET n 
1 89  GLY n 
1 90  ALA n 
1 91  GLY n 
1 92  CYS n 
1 93  ARG n 
1 94  ASN n 
1 95  HIS n 
1 96  VAL n 
1 97  ARG n 
1 98  ASN n 
1 99  LEU n 
1 100 PHE n 
1 101 PRO n 
1 102 GLY n 
1 103 PHE n 
1 104 LEU n 
1 105 HIS n 
1 106 ALA n 
1 107 LEU n 
1 108 GLY n 
1 109 ASP n 
1 110 ASN n 
1 111 LYS n 
1 112 SER n 
1 113 PHE n 
1 114 VAL n 
1 115 ARG n 
1 116 ALA n 
1 117 ALA n 
1 118 ALA n 
1 119 LEU n 
1 120 ASN n 
1 121 CYS n 
1 122 ILE n 
1 123 ASN n 
1 124 SER n 
1 125 PHE n 
1 126 GLY n 
1 127 GLU n 
1 128 LYS n 
1 129 GLY n 
1 130 GLY n 
1 131 TYR n 
1 132 LYS n 
1 133 GLU n 
1 134 PHE n 
1 135 PHE n 
1 136 GLU n 
1 137 SER n 
1 138 GLU n 
1 139 MET n 
1 140 ILE n 
1 141 ALA n 
1 142 ASP n 
1 143 ALA n 
1 144 LEU n 
1 145 LYS n 
1 146 GLY n 
1 147 GLY n 
1 148 SER n 
1 149 PRO n 
1 150 ALA n 
1 151 LEU n 
1 152 LYS n 
1 153 THR n 
1 154 GLU n 
1 155 LEU n 
1 156 TRP n 
1 157 ALA n 
1 158 TRP n 
1 159 LEU n 
1 160 ALA n 
1 161 ASP n 
1 162 LYS n 
1 163 LEU n 
1 164 PRO n 
1 165 GLY n 
1 166 LEU n 
1 167 PRO n 
1 168 PRO n 
1 169 LYS n 
1 170 SER n 
1 171 VAL n 
1 172 SER n 
1 173 LYS n 
1 174 GLU n 
1 175 ASP n 
1 176 ILE n 
1 177 HIS n 
1 178 SER n 
1 179 MET n 
1 180 VAL n 
1 181 PRO n 
1 182 HIS n 
1 183 LEU n 
1 184 TYR n 
1 185 ALA n 
1 186 HIS n 
1 187 ILE n 
1 188 CYS n 
1 189 ASP n 
1 190 ARG n 
1 191 ASN n 
1 192 ALA n 
1 193 ASP n 
1 194 VAL n 
1 195 ARG n 
1 196 LYS n 
1 197 ASN n 
1 198 ALA n 
1 199 ASN n 
1 200 GLU n 
1 201 ALA n 
1 202 VAL n 
1 203 LEU n 
1 204 GLY n 
1 205 ILE n 
1 206 MET n 
1 207 ILE n 
1 208 HIS n 
1 209 LEU n 
1 210 GLY n 
1 211 PHE n 
1 212 ASP n 
1 213 ALA n 
1 214 MET n 
1 215 ASN n 
1 216 ARG n 
1 217 ALA n 
1 218 LEU n 
1 219 ASP n 
1 220 LYS n 
1 221 GLN n 
1 222 LYS n 
1 223 PRO n 
1 224 ALA n 
1 225 SER n 
1 226 LYS n 
1 227 LYS n 
1 228 ASP n 
1 229 ILE n 
1 230 LEU n 
1 231 ALA n 
1 232 ALA n 
1 233 LEU n 
1 234 GLU n 
1 235 LYS n 
1 236 ALA n 
1 237 ARG n 
1 238 PRO n 
1 239 ASN n 
1 240 LEU n 
1 241 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Fruit fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CG5000, CG5000 Dmel_CG5000, Dmel_CG5000, msps' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 De3 Plyss' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9VEZ3_DROME 
_struct_ref.pdbx_db_accession          Q9VEZ3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIISEARLIKPSIGDLAPALAHRLVDSNAKIAQTTLAICEQL
ATAMGAGCRNHVRNLFPGFLHALGDNKSFVRAAALNCINSFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLP
GLPPKSVSKEDIHSMVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRALDKQKPASKKDILAALEKARPNLP
;
_struct_ref.pdbx_align_begin           848 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4QMH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 241 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9VEZ3 
_struct_ref_seq.db_align_beg                  848 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1084 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       848 
_struct_ref_seq.pdbx_auth_seq_align_end       1084 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4QMH GLY A 1 ? UNP Q9VEZ3 ? ? 'EXPRESSION TAG' 844 1 
1 4QMH SER A 2 ? UNP Q9VEZ3 ? ? 'EXPRESSION TAG' 845 2 
1 4QMH HIS A 3 ? UNP Q9VEZ3 ? ? 'EXPRESSION TAG' 846 3 
1 4QMH MET A 4 ? UNP Q9VEZ3 ? ? 'EXPRESSION TAG' 847 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4QMH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.15 
_exptl_crystal.density_percent_sol   42.85 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
;15 mg/ml protein concentration, 21% PEG 4000, 100 mM Tris pH 8.5, and 400 mM Li2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 293.15K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2007-09-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double flat crystal, Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.12714 1.0 
2 0.97957 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '1.12714, 0.97957' 
# 
_reflns.entry_id                     4QMH 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             70 
_reflns.d_resolution_high            1.65 
_reflns.number_obs                   25054 
_reflns.number_all                   45402 
_reflns.percent_possible_obs         95.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.021 
_reflns.pdbx_netI_over_sigmaI        33 
_reflns.B_iso_Wilson_estimate        18.2 
_reflns.pdbx_redundancy              1.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.65 
_reflns_shell.d_res_low              1.71 
_reflns_shell.percent_possible_all   88.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.117 
_reflns_shell.meanI_over_sigI_obs    5.7 
_reflns_shell.pdbx_redundancy        1.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2355 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4QMH 
_refine.ls_number_reflns_obs                     24711 
_refine.ls_number_reflns_all                     24711 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.05 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.907 
_refine.ls_d_res_high                            1.652 
_refine.ls_percent_reflns_obs                    93.85 
_refine.ls_R_factor_obs                          0.1593 
_refine.ls_R_factor_all                          0.1593 
_refine.ls_R_factor_R_work                       0.1568 
_refine.ls_R_factor_R_free                       0.1870 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.98 
_refine.ls_number_reflns_R_free                  1971 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.6406 
_refine.aniso_B[2][2]                            1.6385 
_refine.aniso_B[3][3]                            -0.9978 
_refine.aniso_B[1][2]                            0.6933 
_refine.aniso_B[1][3]                            -1.0468 
_refine.aniso_B[2][3]                            -0.1227 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.372 
_refine.solvent_model_param_bsol                 42.103 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.72 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'Random 10%' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.18 
_refine.pdbx_overall_phase_error                 18.49 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1805 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             401 
_refine_hist.number_atoms_total               2211 
_refine_hist.d_res_high                       1.652 
_refine_hist.d_res_low                        29.907 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.006  ? ? 1843 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.003  ? ? 2491 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 10.046 ? ? 694  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.061  ? ? 281  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 323  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.6516 1.6929  1420 0.2097 81.00 0.3015 . . 118 . . . . 'X-RAY DIFFRACTION' 
. 1.6929 1.7387  1507 0.1964 88.00 0.2267 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 1.7387 1.7899  1564 0.1932 90.00 0.2500 . . 126 . . . . 'X-RAY DIFFRACTION' 
. 1.7899 1.8476  1629 0.1665 93.00 0.1981 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 1.8476 1.9136  1595 0.1522 93.00 0.1799 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 1.9136 1.9903  1622 0.1540 94.00 0.1810 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 1.9903 2.0808  1644 0.1575 95.00 0.2139 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 2.0808 2.1905  1649 0.1542 96.00 0.2297 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 2.1905 2.3277  1680 0.1596 96.00 0.1833 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 2.3277 2.5073  1680 0.1467 97.00 0.1903 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 2.5073 2.7595  1650 0.1578 97.00 0.1771 . . 138 . . . . 'X-RAY DIFFRACTION' 
. 2.7595 3.1584  1695 0.1583 98.00 0.1910 . . 150 . . . . 'X-RAY DIFFRACTION' 
. 3.1584 3.9778  1704 0.1376 98.00 0.1604 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 3.9778 29.9119 1701 0.1574 98.00 0.1537 . . 143 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4QMH 
_struct.title                     'The XMAP215 family drives microtubule polymerization using a structurally diverse TOG array' 
_struct.pdbx_descriptor           LP04448p 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4QMH 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'PROTEIN BINDING, TOG DOMAIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE A 14  ? ILE A 18  ? ILE A 857  ILE A 861  5 ? 5  
HELX_P HELX_P2  2  THR A 19  ? SER A 27  ? THR A 862  SER A 870  1 ? 9  
HELX_P HELX_P3  3  ASP A 30  ? ARG A 49  ? ASP A 873  ARG A 892  1 ? 20 
HELX_P HELX_P4  4  ASP A 57  ? VAL A 67  ? ASP A 900  VAL A 910  1 ? 11 
HELX_P HELX_P5  5  ASN A 70  ? GLY A 89  ? ASN A 913  GLY A 932  1 ? 20 
HELX_P HELX_P6  6  ALA A 90  ? ASN A 94  ? ALA A 933  ASN A 937  5 ? 5  
HELX_P HELX_P7  7  HIS A 95  ? LEU A 107 ? HIS A 938  LEU A 950  1 ? 13 
HELX_P HELX_P8  8  LYS A 111 ? GLY A 130 ? LYS A 954  GLY A 973  1 ? 20 
HELX_P HELX_P9  9  TYR A 131 ? PHE A 135 ? TYR A 974  PHE A 978  5 ? 5  
HELX_P HELX_P10 10 GLU A 138 ? GLY A 146 ? GLU A 981  GLY A 989  1 ? 9  
HELX_P HELX_P11 11 SER A 148 ? LEU A 163 ? SER A 991  LEU A 1006 1 ? 16 
HELX_P HELX_P12 12 PRO A 164 ? LEU A 166 ? PRO A 1007 LEU A 1009 5 ? 3  
HELX_P HELX_P13 13 PRO A 167 ? VAL A 171 ? PRO A 1010 VAL A 1014 5 ? 5  
HELX_P HELX_P14 14 SER A 172 ? ILE A 187 ? SER A 1015 ILE A 1030 1 ? 16 
HELX_P HELX_P15 15 ASN A 191 ? GLY A 210 ? ASN A 1034 GLY A 1053 1 ? 20 
HELX_P HELX_P16 16 GLY A 210 ? LYS A 222 ? GLY A 1053 LYS A 1065 1 ? 13 
HELX_P HELX_P17 17 SER A 225 ? ARG A 237 ? SER A 1068 ARG A 1080 1 ? 13 
HELX_P HELX_P18 18 PRO A 238 ? LEU A 240 ? PRO A 1081 LEU A 1083 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'BINDING SITE FOR RESIDUE SO4 A 1101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 GLY A 130 ? GLY A 973  . ? 1_555 ? 
2 AC1 8 TYR A 131 ? TYR A 974  . ? 1_555 ? 
3 AC1 8 LYS A 132 ? LYS A 975  . ? 1_555 ? 
4 AC1 8 SER A 170 ? SER A 1013 . ? 1_555 ? 
5 AC1 8 HOH C .   ? HOH A 1474 . ? 1_555 ? 
6 AC1 8 HOH C .   ? HOH A 1523 . ? 1_555 ? 
7 AC1 8 HOH C .   ? HOH A 1535 . ? 1_555 ? 
8 AC1 8 HOH C .   ? HOH A 1563 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4QMH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4QMH 
_atom_sites.fract_transf_matrix[1][1]   0.031458 
_atom_sites.fract_transf_matrix[1][2]   0.011419 
_atom_sites.fract_transf_matrix[1][3]   0.005526 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.032620 
_atom_sites.fract_transf_matrix[2][3]   0.007346 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017214 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 6   ? 41.498 -4.384  5.382   1.00 26.31 ? 849  ALA A N   1 
ATOM   2    C CA  . ALA A 1 6   ? 40.523 -5.218  4.676   1.00 24.08 ? 849  ALA A CA  1 
ATOM   3    C C   . ALA A 1 6   ? 40.471 -6.640  5.234   1.00 22.69 ? 849  ALA A C   1 
ATOM   4    O O   . ALA A 1 6   ? 41.503 -7.205  5.619   1.00 23.79 ? 849  ALA A O   1 
ATOM   5    C CB  . ALA A 1 6   ? 40.833 -5.254  3.185   1.00 25.72 ? 849  ALA A CB  1 
ATOM   6    N N   . ASP A 1 7   ? 39.267 -7.212  5.286   1.00 13.62 ? 850  ASP A N   1 
ATOM   7    C CA  . ASP A 1 7   ? 39.128 -8.624  5.634   1.00 10.81 ? 850  ASP A CA  1 
ATOM   8    C C   . ASP A 1 7   ? 39.671 -9.501  4.500   1.00 7.90  ? 850  ASP A C   1 
ATOM   9    O O   . ASP A 1 7   ? 40.206 -8.984  3.509   1.00 13.14 ? 850  ASP A O   1 
ATOM   10   C CB  . ASP A 1 7   ? 37.679 -8.975  6.022   1.00 11.39 ? 850  ASP A CB  1 
ATOM   11   C CG  . ASP A 1 7   ? 36.681 -8.784  4.882   1.00 13.28 ? 850  ASP A CG  1 
ATOM   12   O OD1 . ASP A 1 7   ? 37.065 -8.904  3.700   1.00 10.29 ? 850  ASP A OD1 1 
ATOM   13   O OD2 . ASP A 1 7   ? 35.496 -8.524  5.179   1.00 16.97 ? 850  ASP A OD2 1 
ATOM   14   N N   . LEU A 1 8   ? 39.566 -10.818 4.652   1.00 7.61  ? 851  LEU A N   1 
ATOM   15   C CA  . LEU A 1 8   ? 40.129 -11.760 3.689   1.00 9.96  ? 851  LEU A CA  1 
ATOM   16   C C   . LEU A 1 8   ? 39.060 -12.385 2.797   1.00 11.23 ? 851  LEU A C   1 
ATOM   17   O O   . LEU A 1 8   ? 39.312 -13.386 2.124   1.00 12.06 ? 851  LEU A O   1 
ATOM   18   C CB  . LEU A 1 8   ? 40.911 -12.859 4.413   1.00 9.48  ? 851  LEU A CB  1 
ATOM   19   C CG  . LEU A 1 8   ? 42.123 -12.365 5.198   1.00 15.16 ? 851  LEU A CG  1 
ATOM   20   C CD1 . LEU A 1 8   ? 42.826 -13.536 5.853   1.00 14.82 ? 851  LEU A CD1 1 
ATOM   21   C CD2 . LEU A 1 8   ? 43.070 -11.629 4.282   1.00 18.69 ? 851  LEU A CD2 1 
ATOM   22   N N   . LEU A 1 9   ? 37.869 -11.795 2.791   1.00 10.68 ? 852  LEU A N   1 
ATOM   23   C CA  . LEU A 1 9   ? 36.823 -12.242 1.870   1.00 8.38  ? 852  LEU A CA  1 
ATOM   24   C C   . LEU A 1 9   ? 37.177 -11.872 0.437   1.00 9.72  ? 852  LEU A C   1 
ATOM   25   O O   . LEU A 1 9   ? 37.816 -10.841 0.184   1.00 13.25 ? 852  LEU A O   1 
ATOM   26   C CB  . LEU A 1 9   ? 35.484 -11.619 2.242   1.00 9.79  ? 852  LEU A CB  1 
ATOM   27   C CG  . LEU A 1 9   ? 34.786 -12.264 3.436   1.00 10.52 ? 852  LEU A CG  1 
ATOM   28   C CD1 . LEU A 1 9   ? 33.724 -11.352 3.996   1.00 11.97 ? 852  LEU A CD1 1 
ATOM   29   C CD2 . LEU A 1 9   ? 34.216 -13.627 3.013   1.00 10.88 ? 852  LEU A CD2 1 
ATOM   30   N N   . PRO A 1 10  ? 36.745 -12.698 -0.523  1.00 12.16 ? 853  PRO A N   1 
ATOM   31   C CA  . PRO A 1 10  ? 36.979 -12.319 -1.913  1.00 14.22 ? 853  PRO A CA  1 
ATOM   32   C C   . PRO A 1 10  ? 36.041 -11.176 -2.243  1.00 15.25 ? 853  PRO A C   1 
ATOM   33   O O   . PRO A 1 10  ? 34.815 -11.282 -2.069  1.00 15.68 ? 853  PRO A O   1 
ATOM   34   C CB  . PRO A 1 10  ? 36.624 -13.591 -2.692  1.00 20.01 ? 853  PRO A CB  1 
ATOM   35   C CG  . PRO A 1 10  ? 35.704 -14.348 -1.792  1.00 22.69 ? 853  PRO A CG  1 
ATOM   36   C CD  . PRO A 1 10  ? 36.081 -14.005 -0.385  1.00 20.22 ? 853  PRO A CD  1 
ATOM   37   N N   . ARG A 1 11  ? 36.620 -10.065 -2.666  1.00 10.99 ? 854  ARG A N   1 
ATOM   38   C CA  . ARG A 1 11  ? 35.831 -8.874  -2.927  1.00 9.12  ? 854  ARG A CA  1 
ATOM   39   C C   . ARG A 1 11  ? 36.066 -8.366  -4.337  1.00 11.17 ? 854  ARG A C   1 
ATOM   40   O O   . ARG A 1 11  ? 37.207 -8.271  -4.798  1.00 14.70 ? 854  ARG A O   1 
ATOM   41   C CB  . ARG A 1 11  ? 36.135 -7.776  -1.897  1.00 10.58 ? 854  ARG A CB  1 
ATOM   42   C CG  . ARG A 1 11  ? 35.745 -8.164  -0.473  1.00 12.48 ? 854  ARG A CG  1 
ATOM   43   C CD  . ARG A 1 11  ? 36.050 -7.066  0.556   1.00 8.69  ? 854  ARG A CD  1 
ATOM   44   N NE  . ARG A 1 11  ? 35.462 -7.449  1.833   1.00 7.47  ? 854  ARG A NE  1 
ATOM   45   C CZ  . ARG A 1 11  ? 34.177 -7.281  2.139   1.00 7.65  ? 854  ARG A CZ  1 
ATOM   46   N NH1 . ARG A 1 11  ? 33.339 -6.708  1.273   1.00 9.66  ? 854  ARG A NH1 1 
ATOM   47   N NH2 . ARG A 1 11  ? 33.728 -7.694  3.310   1.00 11.09 ? 854  ARG A NH2 1 
ATOM   48   N N   . VAL A 1 12  ? 34.971 -8.050  -5.021  1.00 9.29  ? 855  VAL A N   1 
ATOM   49   C CA  . VAL A 1 12  ? 35.037 -7.540  -6.384  1.00 16.03 ? 855  VAL A CA  1 
ATOM   50   C C   . VAL A 1 12  ? 35.288 -6.036  -6.366  1.00 14.12 ? 855  VAL A C   1 
ATOM   51   O O   . VAL A 1 12  ? 34.645 -5.305  -5.619  1.00 13.05 ? 855  VAL A O   1 
ATOM   52   C CB  . VAL A 1 12  ? 33.717 -7.819  -7.133  1.00 15.01 ? 855  VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 12  ? 33.735 -7.190  -8.526  1.00 18.42 ? 855  VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 12  ? 33.448 -9.321  -7.214  1.00 18.57 ? 855  VAL A CG2 1 
ATOM   55   N N   . ASP A 1 13  ? 36.223 -5.573  -7.191  1.00 13.50 ? 856  ASP A N   1 
ATOM   56   C CA  . ASP A 1 13  ? 36.400 -4.144  -7.382  1.00 12.46 ? 856  ASP A CA  1 
ATOM   57   C C   . ASP A 1 13  ? 35.419 -3.685  -8.460  1.00 14.91 ? 856  ASP A C   1 
ATOM   58   O O   . ASP A 1 13  ? 35.597 -4.008  -9.633  1.00 14.22 ? 856  ASP A O   1 
ATOM   59   C CB  . ASP A 1 13  ? 37.840 -3.833  -7.800  1.00 16.77 ? 856  ASP A CB  1 
ATOM   60   C CG  . ASP A 1 13  ? 38.089 -2.349  -7.982  1.00 16.56 ? 856  ASP A CG  1 
ATOM   61   O OD1 . ASP A 1 13  ? 37.209 -1.538  -7.618  1.00 15.26 ? 856  ASP A OD1 1 
ATOM   62   O OD2 . ASP A 1 13  ? 39.174 -1.991  -8.488  1.00 21.97 ? 856  ASP A OD2 1 
ATOM   63   N N   . ILE A 1 14  ? 34.382 -2.950  -8.069  1.00 11.49 ? 857  ILE A N   1 
ATOM   64   C CA  . ILE A 1 14  ? 33.392 -2.488  -9.048  1.00 12.64 ? 857  ILE A CA  1 
ATOM   65   C C   . ILE A 1 14  ? 33.719 -1.117  -9.636  1.00 10.59 ? 857  ILE A C   1 
ATOM   66   O O   . ILE A 1 14  ? 32.974 -0.603  -10.467 1.00 11.89 ? 857  ILE A O   1 
ATOM   67   C CB  . ILE A 1 14  ? 31.948 -2.473  -8.489  1.00 13.54 ? 857  ILE A CB  1 
ATOM   68   C CG1 . ILE A 1 14  ? 31.824 -1.498  -7.318  1.00 11.87 ? 857  ILE A CG1 1 
ATOM   69   C CG2 . ILE A 1 14  ? 31.503 -3.884  -8.119  1.00 11.30 ? 857  ILE A CG2 1 
ATOM   70   C CD1 . ILE A 1 14  ? 30.378 -1.220  -6.916  1.00 13.17 ? 857  ILE A CD1 1 
ATOM   71   N N   . ALA A 1 15  ? 34.825 -0.518  -9.209  1.00 12.00 ? 858  ALA A N   1 
ATOM   72   C CA  . ALA A 1 15  ? 35.195 0.794   -9.738  1.00 13.42 ? 858  ALA A CA  1 
ATOM   73   C C   . ALA A 1 15  ? 35.162 0.863   -11.271 1.00 10.79 ? 858  ALA A C   1 
ATOM   74   O O   . ALA A 1 15  ? 34.649 1.826   -11.824 1.00 14.61 ? 858  ALA A O   1 
ATOM   75   C CB  . ALA A 1 15  ? 36.544 1.249   -9.202  1.00 13.52 ? 858  ALA A CB  1 
ATOM   76   N N   . PRO A 1 16  ? 35.722 -0.147  -11.960 1.00 14.74 ? 859  PRO A N   1 
ATOM   77   C CA  . PRO A 1 16  ? 35.698 -0.089  -13.427 1.00 14.80 ? 859  PRO A CA  1 
ATOM   78   C C   . PRO A 1 16  ? 34.286 -0.027  -14.019 1.00 13.51 ? 859  PRO A C   1 
ATOM   79   O O   . PRO A 1 16  ? 34.129 0.432   -15.151 1.00 16.58 ? 859  PRO A O   1 
ATOM   80   C CB  . PRO A 1 16  ? 36.380 -1.397  -13.834 1.00 19.54 ? 859  PRO A CB  1 
ATOM   81   C CG  . PRO A 1 16  ? 37.318 -1.678  -12.714 1.00 16.40 ? 859  PRO A CG  1 
ATOM   82   C CD  . PRO A 1 16  ? 36.564 -1.257  -11.476 1.00 12.43 ? 859  PRO A CD  1 
ATOM   83   N N   . GLN A 1 17  ? 33.283 -0.475  -13.266 1.00 12.09 ? 860  GLN A N   1 
ATOM   84   C CA  . GLN A 1 17  ? 31.899 -0.472  -13.753 1.00 12.12 ? 860  GLN A CA  1 
ATOM   85   C C   . GLN A 1 17  ? 31.196 0.856   -13.490 1.00 12.88 ? 860  GLN A C   1 
ATOM   86   O O   . GLN A 1 17  ? 30.110 1.108   -14.024 1.00 13.07 ? 860  GLN A O   1 
ATOM   87   C CB  . GLN A 1 17  ? 31.096 -1.608  -13.106 1.00 12.31 ? 860  GLN A CB  1 
ATOM   88   C CG  . GLN A 1 17  ? 31.560 -3.005  -13.496 1.00 11.17 ? 860  GLN A CG  1 
ATOM   89   C CD  . GLN A 1 17  ? 30.597 -4.088  -13.032 1.00 9.29  ? 860  GLN A CD  1 
ATOM   90   O OE1 . GLN A 1 17  ? 29.491 -4.227  -13.559 1.00 20.15 ? 860  GLN A OE1 1 
ATOM   91   N NE2 . GLN A 1 17  ? 31.020 -4.865  -12.051 1.00 10.94 ? 860  GLN A NE2 1 
ATOM   92   N N   . ILE A 1 18  ? 31.807 1.701   -12.665 1.00 11.16 ? 861  ILE A N   1 
ATOM   93   C CA  . ILE A 1 18  ? 31.256 3.029   -12.416 1.00 10.01 ? 861  ILE A CA  1 
ATOM   94   C C   . ILE A 1 18  ? 31.761 3.975   -13.503 1.00 15.29 ? 861  ILE A C   1 
ATOM   95   O O   . ILE A 1 18  ? 32.654 4.794   -13.283 1.00 14.48 ? 861  ILE A O   1 
ATOM   96   C CB  . ILE A 1 18  ? 31.611 3.564   -11.021 1.00 13.89 ? 861  ILE A CB  1 
ATOM   97   C CG1 . ILE A 1 18  ? 31.337 2.501   -9.952  1.00 13.30 ? 861  ILE A CG1 1 
ATOM   98   C CG2 . ILE A 1 18  ? 30.826 4.835   -10.726 1.00 12.34 ? 861  ILE A CG2 1 
ATOM   99   C CD1 . ILE A 1 18  ? 29.917 1.986   -9.954  1.00 12.40 ? 861  ILE A CD1 1 
ATOM   100  N N   . THR A 1 19  ? 31.162 3.858   -14.679 1.00 10.28 ? 862  THR A N   1 
ATOM   101  C CA  . THR A 1 19  ? 31.632 4.574   -15.856 1.00 10.67 ? 862  THR A CA  1 
ATOM   102  C C   . THR A 1 19  ? 31.115 6.008   -15.898 1.00 12.69 ? 862  THR A C   1 
ATOM   103  O O   . THR A 1 19  ? 30.171 6.367   -15.196 1.00 13.65 ? 862  THR A O   1 
ATOM   104  C CB  . THR A 1 19  ? 31.151 3.875   -17.119 1.00 15.97 ? 862  THR A CB  1 
ATOM   105  O OG1 . THR A 1 19  ? 29.717 3.886   -17.136 1.00 14.67 ? 862  THR A OG1 1 
ATOM   106  C CG2 . THR A 1 19  ? 31.659 2.430   -17.167 1.00 13.05 ? 862  THR A CG2 1 
ATOM   107  N N   . GLU A 1 20  ? 31.733 6.837   -16.732 1.00 14.73 ? 863  GLU A N   1 
ATOM   108  C CA  . GLU A 1 20  ? 31.233 8.189   -16.916 1.00 13.14 ? 863  GLU A CA  1 
ATOM   109  C C   . GLU A 1 20  ? 29.789 8.154   -17.407 1.00 16.91 ? 863  GLU A C   1 
ATOM   110  O O   . GLU A 1 20  ? 28.972 9.005   -17.029 1.00 15.68 ? 863  GLU A O   1 
ATOM   111  C CB  . GLU A 1 20  ? 32.097 8.945   -17.925 1.00 17.66 ? 863  GLU A CB  1 
ATOM   112  C CG  . GLU A 1 20  ? 33.505 9.238   -17.439 1.00 25.14 ? 863  GLU A CG  1 
ATOM   113  C CD  . GLU A 1 20  ? 33.546 10.325  -16.387 1.00 41.32 ? 863  GLU A CD  1 
ATOM   114  O OE1 . GLU A 1 20  ? 32.551 11.068  -16.263 1.00 43.63 ? 863  GLU A OE1 1 
ATOM   115  O OE2 . GLU A 1 20  ? 34.572 10.436  -15.683 1.00 49.86 ? 863  GLU A OE2 1 
ATOM   116  N N   . ALA A 1 21  ? 29.481 7.174   -18.253 1.00 12.90 ? 864  ALA A N   1 
ATOM   117  C CA  . ALA A 1 21  ? 28.135 7.062   -18.815 1.00 18.64 ? 864  ALA A CA  1 
ATOM   118  C C   . ALA A 1 21  ? 27.107 6.765   -17.728 1.00 15.06 ? 864  ALA A C   1 
ATOM   119  O O   . ALA A 1 21  ? 26.017 7.342   -17.724 1.00 14.51 ? 864  ALA A O   1 
ATOM   120  C CB  . ALA A 1 21  ? 28.083 5.994   -19.902 1.00 17.28 ? 864  ALA A CB  1 
ATOM   121  N N   . LEU A 1 22  ? 27.449 5.851   -16.825 1.00 12.82 ? 865  LEU A N   1 
ATOM   122  C CA  . LEU A 1 22  ? 26.550 5.520   -15.724 1.00 10.48 ? 865  LEU A CA  1 
ATOM   123  C C   . LEU A 1 22  ? 26.322 6.751   -14.851 1.00 12.05 ? 865  LEU A C   1 
ATOM   124  O O   . LEU A 1 22  ? 25.192 7.069   -14.510 1.00 10.72 ? 865  LEU A O   1 
ATOM   125  C CB  . LEU A 1 22  ? 27.100 4.365   -14.888 1.00 11.70 ? 865  LEU A CB  1 
ATOM   126  C CG  . LEU A 1 22  ? 26.301 4.061   -13.621 1.00 10.71 ? 865  LEU A CG  1 
ATOM   127  C CD1 . LEU A 1 22  ? 24.890 3.577   -13.970 1.00 13.63 ? 865  LEU A CD1 1 
ATOM   128  C CD2 . LEU A 1 22  ? 27.036 3.031   -12.786 1.00 11.91 ? 865  LEU A CD2 1 
ATOM   129  N N   . LEU A 1 23  ? 27.395 7.459   -14.501 1.00 10.65 ? 866  LEU A N   1 
ATOM   130  C CA  . LEU A 1 23  ? 27.249 8.653   -13.677 1.00 11.40 ? 866  LEU A CA  1 
ATOM   131  C C   . LEU A 1 23  ? 26.433 9.736   -14.374 1.00 9.72  ? 866  LEU A C   1 
ATOM   132  O O   . LEU A 1 23  ? 25.638 10.433  -13.750 1.00 14.42 ? 866  LEU A O   1 
ATOM   133  C CB  . LEU A 1 23  ? 28.614 9.195   -13.259 1.00 13.91 ? 866  LEU A CB  1 
ATOM   134  C CG  . LEU A 1 23  ? 29.426 8.226   -12.402 1.00 11.75 ? 866  LEU A CG  1 
ATOM   135  C CD1 . LEU A 1 23  ? 30.790 8.836   -12.065 1.00 15.72 ? 866  LEU A CD1 1 
ATOM   136  C CD2 . LEU A 1 23  ? 28.666 7.855   -11.127 1.00 15.98 ? 866  LEU A CD2 1 
ATOM   137  N N   . LYS A 1 24  ? 26.626 9.871   -15.679 1.00 11.92 ? 867  LYS A N   1 
ATOM   138  C CA  . LYS A 1 24  ? 25.853 10.833  -16.444 1.00 12.66 ? 867  LYS A CA  1 
ATOM   139  C C   . LYS A 1 24  ? 24.367 10.476  -16.457 1.00 13.13 ? 867  LYS A C   1 
ATOM   140  O O   . LYS A 1 24  ? 23.513 11.355  -16.312 1.00 18.41 ? 867  LYS A O   1 
ATOM   141  C CB  . LYS A 1 24  ? 26.390 10.918  -17.870 1.00 15.92 ? 867  LYS A CB  1 
ATOM   142  C CG  . LYS A 1 24  ? 25.659 11.936  -18.737 1.00 21.73 ? 867  LYS A CG  1 
ATOM   143  C CD  . LYS A 1 24  ? 26.325 12.053  -20.099 1.00 22.89 ? 867  LYS A CD  1 
ATOM   144  C CE  . LYS A 1 24  ? 25.376 12.662  -21.127 1.00 30.19 ? 867  LYS A CE  1 
ATOM   145  N NZ  . LYS A 1 24  ? 25.977 12.655  -22.498 1.00 39.79 ? 867  LYS A NZ  1 
ATOM   146  N N   . GLU A 1 25  ? 24.059 9.191   -16.621 1.00 12.68 ? 868  GLU A N   1 
ATOM   147  C CA  . GLU A 1 25  ? 22.661 8.750   -16.585 1.00 12.09 ? 868  GLU A CA  1 
ATOM   148  C C   . GLU A 1 25  ? 22.049 9.023   -15.212 1.00 12.48 ? 868  GLU A C   1 
ATOM   149  O O   . GLU A 1 25  ? 20.925 9.517   -15.106 1.00 13.69 ? 868  GLU A O   1 
ATOM   150  C CB  . GLU A 1 25  ? 22.528 7.265   -16.925 1.00 15.06 ? 868  GLU A CB  1 
ATOM   151  C CG  . GLU A 1 25  ? 21.076 6.851   -17.110 1.00 16.65 ? 868  GLU A CG  1 
ATOM   152  C CD  . GLU A 1 25  ? 20.927 5.459   -17.684 1.00 21.51 ? 868  GLU A CD  1 
ATOM   153  O OE1 . GLU A 1 25  ? 21.695 4.565   -17.285 1.00 24.08 ? 868  GLU A OE1 1 
ATOM   154  O OE2 . GLU A 1 25  ? 20.035 5.267   -18.535 1.00 29.73 ? 868  GLU A OE2 1 
ATOM   155  N N   . MET A 1 26  ? 22.803 8.710   -14.163 1.00 9.48  ? 869  MET A N   1 
ATOM   156  C CA  . MET A 1 26  ? 22.351 8.938   -12.790 1.00 7.44  ? 869  MET A CA  1 
ATOM   157  C C   . MET A 1 26  ? 22.038 10.406  -12.491 1.00 10.42 ? 869  MET A C   1 
ATOM   158  O O   . MET A 1 26  ? 21.237 10.700  -11.600 1.00 10.04 ? 869  MET A O   1 
ATOM   159  C CB  . MET A 1 26  ? 23.395 8.420   -11.786 1.00 11.02 ? 869  MET A CB  1 
ATOM   160  C CG  . MET A 1 26  ? 23.462 6.904   -11.689 1.00 10.08 ? 869  MET A CG  1 
ATOM   161  S SD  . MET A 1 26  ? 24.815 6.345   -10.640 1.00 14.13 ? 869  MET A SD  1 
ATOM   162  C CE  . MET A 1 26  ? 24.394 7.148   -9.094  1.00 11.66 ? 869  MET A CE  1 
ATOM   163  N N   . SER A 1 27  ? 22.674 11.325  -13.216 1.00 11.48 ? 870  SER A N   1 
ATOM   164  C CA  . SER A 1 27  ? 22.476 12.751  -12.952 1.00 13.36 ? 870  SER A CA  1 
ATOM   165  C C   . SER A 1 27  ? 21.690 13.481  -14.054 1.00 14.07 ? 870  SER A C   1 
ATOM   166  O O   . SER A 1 27  ? 21.701 14.711  -14.125 1.00 18.45 ? 870  SER A O   1 
ATOM   167  C CB  . SER A 1 27  ? 23.818 13.446  -12.683 1.00 15.94 ? 870  SER A CB  1 
ATOM   168  O OG  . SER A 1 27  ? 24.695 13.327  -13.790 1.00 20.12 ? 870  SER A OG  1 
ATOM   169  N N   . ASP A 1 28  ? 21.007 12.719  -14.903 1.00 15.61 ? 871  ASP A N   1 
ATOM   170  C CA  . ASP A 1 28  ? 20.181 13.296  -15.970 1.00 14.57 ? 871  ASP A CA  1 
ATOM   171  C C   . ASP A 1 28  ? 19.125 14.248  -15.402 1.00 13.38 ? 871  ASP A C   1 
ATOM   172  O O   . ASP A 1 28  ? 18.716 14.109  -14.258 1.00 13.72 ? 871  ASP A O   1 
ATOM   173  C CB  . ASP A 1 28  ? 19.504 12.171  -16.744 1.00 14.50 ? 871  ASP A CB  1 
ATOM   174  C CG  . ASP A 1 28  ? 18.898 12.640  -18.054 1.00 18.03 ? 871  ASP A CG  1 
ATOM   175  O OD1 . ASP A 1 28  ? 19.627 12.670  -19.062 1.00 21.08 ? 871  ASP A OD1 1 
ATOM   176  O OD2 . ASP A 1 28  ? 17.698 12.977  -18.074 1.00 17.48 ? 871  ASP A OD2 1 
ATOM   177  N N   . LYS A 1 29  ? 18.679 15.212  -16.205 1.00 17.72 ? 872  LYS A N   1 
ATOM   178  C CA  . LYS A 1 29  ? 17.630 16.135  -15.773 1.00 20.26 ? 872  LYS A CA  1 
ATOM   179  C C   . LYS A 1 29  ? 16.267 15.451  -15.560 1.00 13.69 ? 872  LYS A C   1 
ATOM   180  O O   . LYS A 1 29  ? 15.428 15.955  -14.808 1.00 14.67 ? 872  LYS A O   1 
ATOM   181  C CB  . LYS A 1 29  ? 17.495 17.290  -16.772 1.00 25.17 ? 872  LYS A CB  1 
ATOM   182  C CG  . LYS A 1 29  ? 17.335 16.824  -18.208 1.00 35.13 ? 872  LYS A CG  1 
ATOM   183  C CD  . LYS A 1 29  ? 17.393 17.988  -19.183 1.00 44.94 ? 872  LYS A CD  1 
ATOM   184  C CE  . LYS A 1 29  ? 17.504 17.496  -20.617 1.00 51.51 ? 872  LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 29  ? 17.803 18.617  -21.554 1.00 58.46 ? 872  LYS A NZ  1 
ATOM   186  N N   . ASP A 1 30  ? 16.059 14.305  -16.206 1.00 16.10 ? 873  ASP A N   1 
ATOM   187  C CA  . ASP A 1 30  ? 14.792 13.574  -16.111 1.00 15.14 ? 873  ASP A CA  1 
ATOM   188  C C   . ASP A 1 30  ? 14.855 12.519  -15.019 1.00 13.88 ? 873  ASP A C   1 
ATOM   189  O O   . ASP A 1 30  ? 15.695 11.633  -15.075 1.00 15.23 ? 873  ASP A O   1 
ATOM   190  C CB  . ASP A 1 30  ? 14.468 12.908  -17.449 1.00 18.87 ? 873  ASP A CB  1 
ATOM   191  C CG  . ASP A 1 30  ? 13.248 11.988  -17.380 1.00 31.80 ? 873  ASP A CG  1 
ATOM   192  O OD1 . ASP A 1 30  ? 12.339 12.211  -16.549 1.00 27.61 ? 873  ASP A OD1 1 
ATOM   193  O OD2 . ASP A 1 30  ? 13.197 11.032  -18.180 1.00 41.15 ? 873  ASP A OD2 1 
ATOM   194  N N   . TRP A 1 31  ? 13.966 12.605  -14.032 1.00 13.20 ? 874  TRP A N   1 
ATOM   195  C CA  . TRP A 1 31  ? 14.031 11.667  -12.910 1.00 12.13 ? 874  TRP A CA  1 
ATOM   196  C C   . TRP A 1 31  ? 13.916 10.204  -13.352 1.00 9.69  ? 874  TRP A C   1 
ATOM   197  O O   . TRP A 1 31  ? 14.555 9.331   -12.764 1.00 12.47 ? 874  TRP A O   1 
ATOM   198  C CB  . TRP A 1 31  ? 12.993 12.005  -11.829 1.00 13.53 ? 874  TRP A CB  1 
ATOM   199  C CG  . TRP A 1 31  ? 11.611 11.567  -12.146 1.00 17.89 ? 874  TRP A CG  1 
ATOM   200  C CD1 . TRP A 1 31  ? 10.637 12.301  -12.758 1.00 19.70 ? 874  TRP A CD1 1 
ATOM   201  C CD2 . TRP A 1 31  ? 11.029 10.293  -11.847 1.00 18.13 ? 874  TRP A CD2 1 
ATOM   202  N NE1 . TRP A 1 31  ? 9.486  11.556  -12.869 1.00 19.12 ? 874  TRP A NE1 1 
ATOM   203  C CE2 . TRP A 1 31  ? 9.700  10.321  -12.315 1.00 20.04 ? 874  TRP A CE2 1 
ATOM   204  C CE3 . TRP A 1 31  ? 11.503 9.132   -11.226 1.00 21.83 ? 874  TRP A CE3 1 
ATOM   205  C CZ2 . TRP A 1 31  ? 8.841  9.231   -12.187 1.00 21.49 ? 874  TRP A CZ2 1 
ATOM   206  C CZ3 . TRP A 1 31  ? 10.651 8.051   -11.102 1.00 23.07 ? 874  TRP A CZ3 1 
ATOM   207  C CH2 . TRP A 1 31  ? 9.334  8.108   -11.579 1.00 24.99 ? 874  TRP A CH2 1 
ATOM   208  N N   . LYS A 1 32  ? 13.130 9.930   -14.394 1.00 12.39 ? 875  LYS A N   1 
ATOM   209  C CA  . LYS A 1 32  ? 12.998 8.552   -14.863 1.00 12.28 ? 875  LYS A CA  1 
ATOM   210  C C   . LYS A 1 32  ? 14.332 8.029   -15.372 1.00 10.76 ? 875  LYS A C   1 
ATOM   211  O O   . LYS A 1 32  ? 14.643 6.854   -15.207 1.00 14.27 ? 875  LYS A O   1 
ATOM   212  C CB  . LYS A 1 32  ? 11.906 8.429   -15.930 1.00 18.72 ? 875  LYS A CB  1 
ATOM   213  C CG  . LYS A 1 32  ? 10.525 8.675   -15.376 1.00 20.24 ? 875  LYS A CG  1 
ATOM   214  C CD  . LYS A 1 32  ? 9.449  8.483   -16.422 1.00 26.97 ? 875  LYS A CD  1 
ATOM   215  C CE  . LYS A 1 32  ? 8.073  8.669   -15.808 1.00 35.35 ? 875  LYS A CE  1 
ATOM   216  N NZ  . LYS A 1 32  ? 6.995  8.655   -16.834 1.00 34.70 ? 875  LYS A NZ  1 
ATOM   217  N N   . THR A 1 33  ? 15.131 8.910   -15.968 1.00 9.52  ? 876  THR A N   1 
ATOM   218  C CA  . THR A 1 33  ? 16.449 8.514   -16.454 1.00 12.26 ? 876  THR A CA  1 
ATOM   219  C C   . THR A 1 33  ? 17.433 8.310   -15.303 1.00 11.07 ? 876  THR A C   1 
ATOM   220  O O   . THR A 1 33  ? 18.205 7.354   -15.311 1.00 11.18 ? 876  THR A O   1 
ATOM   221  C CB  . THR A 1 33  ? 17.000 9.532   -17.454 1.00 16.37 ? 876  THR A CB  1 
ATOM   222  O OG1 . THR A 1 33  ? 16.086 9.629   -18.558 1.00 18.79 ? 876  THR A OG1 1 
ATOM   223  C CG2 . THR A 1 33  ? 18.368 9.101   -17.967 1.00 17.57 ? 876  THR A CG2 1 
ATOM   224  N N   . ARG A 1 34  ? 17.411 9.202   -14.316 1.00 14.15 ? 877  ARG A N   1 
ATOM   225  C CA  . ARG A 1 34  ? 18.194 8.973   -13.099 1.00 9.50  ? 877  ARG A CA  1 
ATOM   226  C C   . ARG A 1 34  ? 17.847 7.615   -12.481 1.00 9.08  ? 877  ARG A C   1 
ATOM   227  O O   . ARG A 1 34  ? 18.716 6.891   -11.996 1.00 9.66  ? 877  ARG A O   1 
ATOM   228  C CB  . ARG A 1 34  ? 17.966 10.086  -12.062 1.00 8.95  ? 877  ARG A CB  1 
ATOM   229  C CG  . ARG A 1 34  ? 18.161 11.487  -12.623 1.00 11.11 ? 877  ARG A CG  1 
ATOM   230  C CD  . ARG A 1 34  ? 18.548 12.487  -11.549 1.00 9.93  ? 877  ARG A CD  1 
ATOM   231  N NE  . ARG A 1 34  ? 17.420 12.968  -10.751 1.00 10.88 ? 877  ARG A NE  1 
ATOM   232  C CZ  . ARG A 1 34  ? 16.484 13.802  -11.206 1.00 11.16 ? 877  ARG A CZ  1 
ATOM   233  N NH1 . ARG A 1 34  ? 16.505 14.207  -12.473 1.00 11.62 ? 877  ARG A NH1 1 
ATOM   234  N NH2 . ARG A 1 34  ? 15.508 14.205  -10.403 1.00 12.87 ? 877  ARG A NH2 1 
ATOM   235  N N   . ASN A 1 35  ? 16.568 7.269   -12.500 1.00 9.92  ? 878  ASN A N   1 
ATOM   236  C CA  . ASN A 1 35  ? 16.143 6.010   -11.908 1.00 11.08 ? 878  ASN A CA  1 
ATOM   237  C C   . ASN A 1 35  ? 16.713 4.819   -12.668 1.00 10.93 ? 878  ASN A C   1 
ATOM   238  O O   . ASN A 1 35  ? 17.097 3.814   -12.073 1.00 11.21 ? 878  ASN A O   1 
ATOM   239  C CB  . ASN A 1 35  ? 14.619 5.921   -11.876 1.00 12.05 ? 878  ASN A CB  1 
ATOM   240  C CG  . ASN A 1 35  ? 14.135 4.664   -11.188 1.00 17.48 ? 878  ASN A CG  1 
ATOM   241  O OD1 . ASN A 1 35  ? 14.416 4.455   -10.014 1.00 17.26 ? 878  ASN A OD1 1 
ATOM   242  N ND2 . ASN A 1 35  ? 13.405 3.820   -11.917 1.00 17.12 ? 878  ASN A ND2 1 
ATOM   243  N N   . GLU A 1 36  ? 16.761 4.943   -13.988 1.00 11.32 ? 879  GLU A N   1 
ATOM   244  C CA  . GLU A 1 36  ? 17.366 3.908   -14.815 1.00 11.74 ? 879  GLU A CA  1 
ATOM   245  C C   . GLU A 1 36  ? 18.829 3.701   -14.447 1.00 10.47 ? 879  GLU A C   1 
ATOM   246  O O   . GLU A 1 36  ? 19.322 2.570   -14.447 1.00 12.93 ? 879  GLU A O   1 
ATOM   247  C CB  . GLU A 1 36  ? 17.225 4.241   -16.299 1.00 15.36 ? 879  GLU A CB  1 
ATOM   248  C CG  . GLU A 1 36  ? 15.786 4.232   -16.799 1.00 17.25 ? 879  GLU A CG  1 
ATOM   249  C CD  . GLU A 1 36  ? 15.135 2.866   -16.693 1.00 19.04 ? 879  GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 36  ? 15.865 1.852   -16.729 1.00 22.32 ? 879  GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 36  ? 13.892 2.809   -16.586 1.00 26.43 ? 879  GLU A OE2 1 
ATOM   252  N N   . GLY A 1 37  ? 19.524 4.792   -14.142 1.00 10.60 ? 880  GLY A N   1 
ATOM   253  C CA  . GLY A 1 37  ? 20.903 4.710   -13.700 1.00 9.36  ? 880  GLY A CA  1 
ATOM   254  C C   . GLY A 1 37  ? 21.010 3.951   -12.399 1.00 7.84  ? 880  GLY A C   1 
ATOM   255  O O   . GLY A 1 37  ? 21.865 3.079   -12.241 1.00 9.75  ? 880  GLY A O   1 
ATOM   256  N N   . LEU A 1 38  ? 20.149 4.290   -11.446 1.00 8.58  ? 881  LEU A N   1 
ATOM   257  C CA  . LEU A 1 38  ? 20.156 3.583   -10.171 1.00 8.83  ? 881  LEU A CA  1 
ATOM   258  C C   . LEU A 1 38  ? 19.799 2.113   -10.367 1.00 7.81  ? 881  LEU A C   1 
ATOM   259  O O   . LEU A 1 38  ? 20.326 1.255   -9.668  1.00 10.96 ? 881  LEU A O   1 
ATOM   260  C CB  . LEU A 1 38  ? 19.200 4.243   -9.180  1.00 10.03 ? 881  LEU A CB  1 
ATOM   261  C CG  . LEU A 1 38  ? 19.552 5.685   -8.815  1.00 11.02 ? 881  LEU A CG  1 
ATOM   262  C CD1 . LEU A 1 38  ? 18.487 6.259   -7.878  1.00 11.12 ? 881  LEU A CD1 1 
ATOM   263  C CD2 . LEU A 1 38  ? 20.918 5.750   -8.186  1.00 12.45 ? 881  LEU A CD2 1 
ATOM   264  N N   . THR A 1 39  ? 18.927 1.821   -11.330 1.00 10.66 ? 882  THR A N   1 
ATOM   265  C CA  . THR A 1 39  ? 18.560 0.429   -11.599 1.00 13.57 ? 882  THR A CA  1 
ATOM   266  C C   . THR A 1 39  ? 19.780 -0.365  -12.040 1.00 11.74 ? 882  THR A C   1 
ATOM   267  O O   . THR A 1 39  ? 19.995 -1.493  -11.585 1.00 12.53 ? 882  THR A O   1 
ATOM   268  C CB  . THR A 1 39  ? 17.447 0.316   -12.647 1.00 13.66 ? 882  THR A CB  1 
ATOM   269  O OG1 . THR A 1 39  ? 16.229 0.804   -12.080 1.00 16.57 ? 882  THR A OG1 1 
ATOM   270  C CG2 . THR A 1 39  ? 17.237 -1.140  -13.061 1.00 16.63 ? 882  THR A CG2 1 
ATOM   271  N N   . LYS A 1 40  ? 20.585 0.230   -12.912 1.00 8.37  ? 883  LYS A N   1 
ATOM   272  C CA  . LYS A 1 40  ? 21.811 -0.420  -13.377 1.00 8.38  ? 883  LYS A CA  1 
ATOM   273  C C   . LYS A 1 40  ? 22.791 -0.600  -12.221 1.00 11.48 ? 883  LYS A C   1 
ATOM   274  O O   . LYS A 1 40  ? 23.432 -1.644  -12.103 1.00 12.97 ? 883  LYS A O   1 
ATOM   275  C CB  . LYS A 1 40  ? 22.476 0.389   -14.490 1.00 8.68  ? 883  LYS A CB  1 
ATOM   276  C CG  . LYS A 1 40  ? 21.695 0.413   -15.815 1.00 10.53 ? 883  LYS A CG  1 
ATOM   277  C CD  . LYS A 1 40  ? 22.456 1.226   -16.856 1.00 16.24 ? 883  LYS A CD  1 
ATOM   278  C CE  . LYS A 1 40  ? 21.778 1.196   -18.211 1.00 19.12 ? 883  LYS A CE  1 
ATOM   279  N NZ  . LYS A 1 40  ? 20.517 1.974   -18.232 1.00 16.80 ? 883  LYS A NZ  1 
ATOM   280  N N   . LEU A 1 41  ? 22.891 0.427   -11.374 1.00 10.76 ? 884  LEU A N   1 
ATOM   281  C CA  . LEU A 1 41  ? 23.786 0.406   -10.223 1.00 9.49  ? 884  LEU A CA  1 
ATOM   282  C C   . LEU A 1 41  ? 23.426 -0.714  -9.254  1.00 7.55  ? 884  LEU A C   1 
ATOM   283  O O   . LEU A 1 41  ? 24.296 -1.424  -8.755  1.00 8.78  ? 884  LEU A O   1 
ATOM   284  C CB  . LEU A 1 41  ? 23.740 1.756   -9.493  1.00 6.14  ? 884  LEU A CB  1 
ATOM   285  C CG  . LEU A 1 41  ? 24.613 1.776   -8.238  1.00 7.79  ? 884  LEU A CG  1 
ATOM   286  C CD1 . LEU A 1 41  ? 26.068 1.504   -8.578  1.00 13.19 ? 884  LEU A CD1 1 
ATOM   287  C CD2 . LEU A 1 41  ? 24.471 3.094   -7.529  1.00 7.85  ? 884  LEU A CD2 1 
ATOM   288  N N   . GLN A 1 42  ? 22.132 -0.878  -9.003  1.00 9.73  ? 885  GLN A N   1 
ATOM   289  C CA  . GLN A 1 42  ? 21.656 -1.900  -8.085  1.00 9.65  ? 885  GLN A CA  1 
ATOM   290  C C   . GLN A 1 42  ? 22.073 -3.279  -8.578  1.00 11.02 ? 885  GLN A C   1 
ATOM   291  O O   . GLN A 1 42  ? 22.482 -4.126  -7.790  1.00 12.65 ? 885  GLN A O   1 
ATOM   292  C CB  . GLN A 1 42  ? 20.140 -1.817  -7.954  1.00 13.26 ? 885  GLN A CB  1 
ATOM   293  C CG  . GLN A 1 42  ? 19.567 -2.627  -6.794  1.00 27.06 ? 885  GLN A CG  1 
ATOM   294  C CD  . GLN A 1 42  ? 19.483 -4.120  -7.070  1.00 33.58 ? 885  GLN A CD  1 
ATOM   295  O OE1 . GLN A 1 42  ? 19.472 -4.931  -6.139  1.00 29.76 ? 885  GLN A OE1 1 
ATOM   296  N NE2 . GLN A 1 42  ? 19.395 -4.492  -8.347  1.00 24.85 ? 885  GLN A NE2 1 
ATOM   297  N N   . ALA A 1 43  ? 21.990 -3.485  -9.893  1.00 10.71 ? 886  ALA A N   1 
ATOM   298  C CA  . ALA A 1 43  ? 22.335 -4.771  -10.493 1.00 13.01 ? 886  ALA A CA  1 
ATOM   299  C C   . ALA A 1 43  ? 23.841 -5.038  -10.415 1.00 14.17 ? 886  ALA A C   1 
ATOM   300  O O   . ALA A 1 43  ? 24.271 -6.185  -10.224 1.00 13.42 ? 886  ALA A O   1 
ATOM   301  C CB  . ALA A 1 43  ? 21.824 -4.855  -11.934 1.00 12.44 ? 886  ALA A CB  1 
ATOM   302  N N   . ILE A 1 44  ? 24.636 -3.981  -10.571 1.00 12.44 ? 887  ILE A N   1 
ATOM   303  C CA  . ILE A 1 44  ? 26.092 -4.088  -10.478 1.00 11.21 ? 887  ILE A CA  1 
ATOM   304  C C   . ILE A 1 44  ? 26.487 -4.551  -9.083  1.00 10.75 ? 887  ILE A C   1 
ATOM   305  O O   . ILE A 1 44  ? 27.300 -5.470  -8.928  1.00 11.45 ? 887  ILE A O   1 
ATOM   306  C CB  . ILE A 1 44  ? 26.797 -2.739  -10.781 1.00 7.57  ? 887  ILE A CB  1 
ATOM   307  C CG1 . ILE A 1 44  ? 26.755 -2.420  -12.277 1.00 13.42 ? 887  ILE A CG1 1 
ATOM   308  C CG2 . ILE A 1 44  ? 28.245 -2.795  -10.324 1.00 9.94  ? 887  ILE A CG2 1 
ATOM   309  C CD1 . ILE A 1 44  ? 27.066 -0.972  -12.590 1.00 13.54 ? 887  ILE A CD1 1 
ATOM   310  N N   . ILE A 1 45  ? 25.900 -3.921  -8.065  1.00 9.90  ? 888  ILE A N   1 
ATOM   311  C CA  . ILE A 1 45  ? 26.190 -4.298  -6.686  1.00 7.89  ? 888  ILE A CA  1 
ATOM   312  C C   . ILE A 1 45  ? 25.700 -5.717  -6.371  1.00 11.53 ? 888  ILE A C   1 
ATOM   313  O O   . ILE A 1 45  ? 26.435 -6.517  -5.788  1.00 11.35 ? 888  ILE A O   1 
ATOM   314  C CB  . ILE A 1 45  ? 25.606 -3.279  -5.670  1.00 7.72  ? 888  ILE A CB  1 
ATOM   315  C CG1 . ILE A 1 45  ? 26.183 -1.888  -5.940  1.00 9.65  ? 888  ILE A CG1 1 
ATOM   316  C CG2 . ILE A 1 45  ? 25.911 -3.742  -4.247  1.00 8.76  ? 888  ILE A CG2 1 
ATOM   317  C CD1 . ILE A 1 45  ? 25.396 -0.762  -5.300  1.00 11.29 ? 888  ILE A CD1 1 
ATOM   318  N N   . SER A 1 46  ? 24.464 -6.035  -6.756  1.00 11.49 ? 889  SER A N   1 
ATOM   319  C CA  . SER A 1 46  ? 23.904 -7.362  -6.512  1.00 13.55 ? 889  SER A CA  1 
ATOM   320  C C   . SER A 1 46  ? 24.738 -8.476  -7.136  1.00 12.44 ? 889  SER A C   1 
ATOM   321  O O   . SER A 1 46  ? 24.952 -9.530  -6.527  1.00 15.79 ? 889  SER A O   1 
ATOM   322  C CB  . SER A 1 46  ? 22.476 -7.444  -7.063  1.00 16.30 ? 889  SER A CB  1 
ATOM   323  O OG  . SER A 1 46  ? 21.583 -6.749  -6.214  1.00 31.07 ? 889  SER A OG  1 
ATOM   324  N N   . GLU A 1 47  ? 25.193 -8.249  -8.361  1.00 10.32 ? 890  GLU A N   1 
ATOM   325  C CA  . GLU A 1 47  ? 25.938 -9.275  -9.089  1.00 11.89 ? 890  GLU A CA  1 
ATOM   326  C C   . GLU A 1 47  ? 27.303 -9.511  -8.438  1.00 14.21 ? 890  GLU A C   1 
ATOM   327  O O   . GLU A 1 47  ? 27.780 -10.645 -8.375  1.00 15.64 ? 890  GLU A O   1 
ATOM   328  C CB  . GLU A 1 47  ? 26.109 -8.867  -10.556 1.00 15.17 ? 890  GLU A CB  1 
ATOM   329  C CG  . GLU A 1 47  ? 26.971 -9.831  -11.386 1.00 24.37 ? 890  GLU A CG  1 
ATOM   330  C CD  . GLU A 1 47  ? 26.364 -11.225 -11.536 1.00 47.49 ? 890  GLU A CD  1 
ATOM   331  O OE1 . GLU A 1 47  ? 25.225 -11.450 -11.070 1.00 52.27 ? 890  GLU A OE1 1 
ATOM   332  O OE2 . GLU A 1 47  ? 27.033 -12.100 -12.131 1.00 57.68 ? 890  GLU A OE2 1 
ATOM   333  N N   . ALA A 1 48  ? 27.933 -8.444  -7.951  1.00 13.82 ? 891  ALA A N   1 
ATOM   334  C CA  . ALA A 1 48  ? 29.215 -8.578  -7.265  1.00 11.16 ? 891  ALA A CA  1 
ATOM   335  C C   . ALA A 1 48  ? 29.082 -9.208  -5.869  1.00 10.75 ? 891  ALA A C   1 
ATOM   336  O O   . ALA A 1 48  ? 29.933 -10.002 -5.443  1.00 11.82 ? 891  ALA A O   1 
ATOM   337  C CB  . ALA A 1 48  ? 29.916 -7.220  -7.185  1.00 10.36 ? 891  ALA A CB  1 
ATOM   338  N N   . ARG A 1 49  ? 27.996 -8.849  -5.187  1.00 11.18 ? 892  ARG A N   1 
ATOM   339  C CA  . ARG A 1 49  ? 27.679 -9.263  -3.813  1.00 9.61  ? 892  ARG A CA  1 
ATOM   340  C C   . ARG A 1 49  ? 28.596 -8.652  -2.750  1.00 10.09 ? 892  ARG A C   1 
ATOM   341  O O   . ARG A 1 49  ? 28.126 -7.932  -1.872  1.00 9.49  ? 892  ARG A O   1 
ATOM   342  C CB  . ARG A 1 49  ? 27.591 -10.780 -3.635  1.00 9.93  ? 892  ARG A CB  1 
ATOM   343  C CG  . ARG A 1 49  ? 27.098 -11.145 -2.236  1.00 12.69 ? 892  ARG A CG  1 
ATOM   344  C CD  . ARG A 1 49  ? 26.930 -12.639 -2.058  1.00 14.19 ? 892  ARG A CD  1 
ATOM   345  N NE  . ARG A 1 49  ? 26.554 -12.963 -0.691  1.00 17.80 ? 892  ARG A NE  1 
ATOM   346  C CZ  . ARG A 1 49  ? 26.548 -14.194 -0.194  1.00 22.40 ? 892  ARG A CZ  1 
ATOM   347  N NH1 . ARG A 1 49  ? 26.901 -15.219 -0.963  1.00 18.07 ? 892  ARG A NH1 1 
ATOM   348  N NH2 . ARG A 1 49  ? 26.195 -14.401 1.072   1.00 22.42 ? 892  ARG A NH2 1 
ATOM   349  N N   . LEU A 1 50  ? 29.884 -8.967  -2.816  1.00 8.62  ? 893  LEU A N   1 
ATOM   350  C CA  . LEU A 1 50  ? 30.857 -8.377  -1.895  1.00 6.41  ? 893  LEU A CA  1 
ATOM   351  C C   . LEU A 1 50  ? 31.868 -7.579  -2.691  1.00 8.24  ? 893  LEU A C   1 
ATOM   352  O O   . LEU A 1 50  ? 32.416 -8.072  -3.674  1.00 10.18 ? 893  LEU A O   1 
ATOM   353  C CB  . LEU A 1 50  ? 31.567 -9.449  -1.063  1.00 9.00  ? 893  LEU A CB  1 
ATOM   354  C CG  . LEU A 1 50  ? 30.703 -10.366 -0.197  1.00 9.54  ? 893  LEU A CG  1 
ATOM   355  C CD1 . LEU A 1 50  ? 31.608 -11.292 0.611   1.00 10.85 ? 893  LEU A CD1 1 
ATOM   356  C CD2 . LEU A 1 50  ? 29.750 -9.587  0.714   1.00 10.71 ? 893  LEU A CD2 1 
ATOM   357  N N   . ILE A 1 51  ? 32.105 -6.337  -2.271  1.00 7.89  ? 894  ILE A N   1 
ATOM   358  C CA  . ILE A 1 51  ? 32.920 -5.411  -3.059  1.00 5.99  ? 894  ILE A CA  1 
ATOM   359  C C   . ILE A 1 51  ? 34.030 -4.743  -2.245  1.00 10.82 ? 894  ILE A C   1 
ATOM   360  O O   . ILE A 1 51  ? 33.974 -4.690  -1.019  1.00 11.12 ? 894  ILE A O   1 
ATOM   361  C CB  . ILE A 1 51  ? 32.055 -4.320  -3.750  1.00 5.83  ? 894  ILE A CB  1 
ATOM   362  C CG1 . ILE A 1 51  ? 31.406 -3.389  -2.713  1.00 9.37  ? 894  ILE A CG1 1 
ATOM   363  C CG2 . ILE A 1 51  ? 30.973 -4.951  -4.638  1.00 8.09  ? 894  ILE A CG2 1 
ATOM   364  C CD1 . ILE A 1 51  ? 30.535 -2.314  -3.311  1.00 10.45 ? 894  ILE A CD1 1 
ATOM   365  N N   . LYS A 1 52  ? 35.041 -4.247  -2.949  1.00 12.35 ? 895  LYS A N   1 
ATOM   366  C CA  . LYS A 1 52  ? 36.103 -3.463  -2.340  1.00 10.43 ? 895  LYS A CA  1 
ATOM   367  C C   . LYS A 1 52  ? 35.582 -2.048  -2.100  1.00 8.68  ? 895  LYS A C   1 
ATOM   368  O O   . LYS A 1 52  ? 34.538 -1.671  -2.622  1.00 8.38  ? 895  LYS A O   1 
ATOM   369  C CB  . LYS A 1 52  ? 37.317 -3.422  -3.274  1.00 12.18 ? 895  LYS A CB  1 
ATOM   370  C CG  . LYS A 1 52  ? 37.856 -4.780  -3.652  1.00 17.07 ? 895  LYS A CG  1 
ATOM   371  C CD  . LYS A 1 52  ? 39.243 -4.648  -4.263  1.00 19.41 ? 895  LYS A CD  1 
ATOM   372  C CE  . LYS A 1 52  ? 39.752 -5.991  -4.781  1.00 31.63 ? 895  LYS A CE  1 
ATOM   373  N NZ  . LYS A 1 52  ? 39.782 -7.037  -3.723  1.00 35.60 ? 895  LYS A NZ  1 
ATOM   374  N N   . PRO A 1 53  ? 36.305 -1.252  -1.302  1.00 9.02  ? 896  PRO A N   1 
ATOM   375  C CA  . PRO A 1 53  ? 35.851 0.115   -1.016  1.00 12.81 ? 896  PRO A CA  1 
ATOM   376  C C   . PRO A 1 53  ? 36.039 1.088   -2.179  1.00 7.50  ? 896  PRO A C   1 
ATOM   377  O O   . PRO A 1 53  ? 35.526 2.202   -2.138  1.00 14.35 ? 896  PRO A O   1 
ATOM   378  C CB  . PRO A 1 53  ? 36.754 0.547   0.151   1.00 15.42 ? 896  PRO A CB  1 
ATOM   379  C CG  . PRO A 1 53  ? 37.332 -0.707  0.701   1.00 17.19 ? 896  PRO A CG  1 
ATOM   380  C CD  . PRO A 1 53  ? 37.448 -1.640  -0.456  1.00 13.39 ? 896  PRO A CD  1 
ATOM   381  N N   . SER A 1 54  ? 36.784 0.676   -3.197  1.00 11.23 ? 897  SER A N   1 
ATOM   382  C CA  . SER A 1 54  ? 37.062 1.531   -4.347  1.00 12.31 ? 897  SER A CA  1 
ATOM   383  C C   . SER A 1 54  ? 35.871 1.560   -5.304  1.00 11.73 ? 897  SER A C   1 
ATOM   384  O O   . SER A 1 54  ? 35.578 0.565   -5.978  1.00 12.68 ? 897  SER A O   1 
ATOM   385  C CB  . SER A 1 54  ? 38.311 1.026   -5.074  1.00 14.31 ? 897  SER A CB  1 
ATOM   386  O OG  . SER A 1 54  ? 38.249 -0.374  -5.306  1.00 14.94 ? 897  SER A OG  1 
ATOM   387  N N   . ILE A 1 55  ? 35.183 2.696   -5.366  1.00 7.70  ? 898  ILE A N   1 
ATOM   388  C CA  . ILE A 1 55  ? 33.997 2.801   -6.214  1.00 9.42  ? 898  ILE A CA  1 
ATOM   389  C C   . ILE A 1 55  ? 34.056 4.006   -7.149  1.00 11.77 ? 898  ILE A C   1 
ATOM   390  O O   . ILE A 1 55  ? 33.032 4.573   -7.524  1.00 11.25 ? 898  ILE A O   1 
ATOM   391  C CB  . ILE A 1 55  ? 32.694 2.803   -5.362  1.00 10.65 ? 898  ILE A CB  1 
ATOM   392  C CG1 . ILE A 1 55  ? 32.752 3.885   -4.273  1.00 11.79 ? 898  ILE A CG1 1 
ATOM   393  C CG2 . ILE A 1 55  ? 32.470 1.417   -4.754  1.00 10.87 ? 898  ILE A CG2 1 
ATOM   394  C CD1 . ILE A 1 55  ? 31.479 3.994   -3.440  1.00 12.87 ? 898  ILE A CD1 1 
ATOM   395  N N   . GLY A 1 56  ? 35.267 4.376   -7.554  1.00 14.75 ? 899  GLY A N   1 
ATOM   396  C CA  . GLY A 1 56  ? 35.432 5.478   -8.483  1.00 14.82 ? 899  GLY A CA  1 
ATOM   397  C C   . GLY A 1 56  ? 34.855 6.747   -7.884  1.00 10.62 ? 899  GLY A C   1 
ATOM   398  O O   . GLY A 1 56  ? 35.149 7.080   -6.733  1.00 13.99 ? 899  GLY A O   1 
ATOM   399  N N   . ASP A 1 57  ? 34.026 7.452   -8.653  1.00 14.68 ? 900  ASP A N   1 
ATOM   400  C CA  . ASP A 1 57  ? 33.393 8.676   -8.178  1.00 15.50 ? 900  ASP A CA  1 
ATOM   401  C C   . ASP A 1 57  ? 31.945 8.455   -7.732  1.00 15.43 ? 900  ASP A C   1 
ATOM   402  O O   . ASP A 1 57  ? 31.144 9.391   -7.708  1.00 13.77 ? 900  ASP A O   1 
ATOM   403  C CB  . ASP A 1 57  ? 33.439 9.757   -9.271  1.00 21.49 ? 900  ASP A CB  1 
ATOM   404  C CG  . ASP A 1 57  ? 34.860 10.136  -9.672  1.00 28.15 ? 900  ASP A CG  1 
ATOM   405  O OD1 . ASP A 1 57  ? 35.735 10.152  -8.795  1.00 22.53 ? 900  ASP A OD1 1 
ATOM   406  O OD2 . ASP A 1 57  ? 35.095 10.409  -10.867 1.00 36.30 ? 900  ASP A OD2 1 
ATOM   407  N N   . LEU A 1 58  ? 31.611 7.218   -7.384  1.00 13.83 ? 901  LEU A N   1 
ATOM   408  C CA  . LEU A 1 58  ? 30.230 6.886   -7.061  1.00 10.26 ? 901  LEU A CA  1 
ATOM   409  C C   . LEU A 1 58  ? 29.704 7.583   -5.801  1.00 11.29 ? 901  LEU A C   1 
ATOM   410  O O   . LEU A 1 58  ? 28.534 7.956   -5.751  1.00 11.31 ? 901  LEU A O   1 
ATOM   411  C CB  . LEU A 1 58  ? 30.053 5.375   -6.906  1.00 14.50 ? 901  LEU A CB  1 
ATOM   412  C CG  . LEU A 1 58  ? 28.640 4.904   -6.560  1.00 6.48  ? 901  LEU A CG  1 
ATOM   413  C CD1 . LEU A 1 58  ? 27.654 5.308   -7.674  1.00 6.51  ? 901  LEU A CD1 1 
ATOM   414  C CD2 . LEU A 1 58  ? 28.637 3.402   -6.334  1.00 7.49  ? 901  LEU A CD2 1 
ATOM   415  N N   . ALA A 1 59  ? 30.546 7.749   -4.778  1.00 10.73 ? 902  ALA A N   1 
ATOM   416  C CA  . ALA A 1 59  ? 30.049 8.276   -3.502  1.00 11.48 ? 902  ALA A CA  1 
ATOM   417  C C   . ALA A 1 59  ? 29.492 9.695   -3.605  1.00 10.94 ? 902  ALA A C   1 
ATOM   418  O O   . ALA A 1 59  ? 28.388 9.957   -3.140  1.00 10.23 ? 902  ALA A O   1 
ATOM   419  C CB  . ALA A 1 59  ? 31.108 8.159   -2.380  1.00 14.25 ? 902  ALA A CB  1 
ATOM   420  N N   . PRO A 1 60  ? 30.238 10.618  -4.232  1.00 11.20 ? 903  PRO A N   1 
ATOM   421  C CA  . PRO A 1 60  ? 29.662 11.958  -4.382  1.00 14.94 ? 903  PRO A CA  1 
ATOM   422  C C   . PRO A 1 60  ? 28.416 11.940  -5.272  1.00 12.55 ? 903  PRO A C   1 
ATOM   423  O O   . PRO A 1 60  ? 27.470 12.696  -5.034  1.00 12.91 ? 903  PRO A O   1 
ATOM   424  C CB  . PRO A 1 60  ? 30.788 12.758  -5.040  1.00 16.19 ? 903  PRO A CB  1 
ATOM   425  C CG  . PRO A 1 60  ? 32.041 11.986  -4.760  1.00 21.80 ? 903  PRO A CG  1 
ATOM   426  C CD  . PRO A 1 60  ? 31.633 10.547  -4.700  1.00 15.83 ? 903  PRO A CD  1 
ATOM   427  N N   . ALA A 1 61  ? 28.415 11.062  -6.268  1.00 11.33 ? 904  ALA A N   1 
ATOM   428  C CA  . ALA A 1 61  ? 27.257 10.908  -7.143  1.00 10.45 ? 904  ALA A CA  1 
ATOM   429  C C   . ALA A 1 61  ? 26.031 10.476  -6.346  1.00 11.18 ? 904  ALA A C   1 
ATOM   430  O O   . ALA A 1 61  ? 24.952 11.036  -6.516  1.00 10.10 ? 904  ALA A O   1 
ATOM   431  C CB  . ALA A 1 61  ? 27.551 9.909   -8.249  1.00 9.77  ? 904  ALA A CB  1 
ATOM   432  N N   . LEU A 1 62  ? 26.204 9.480   -5.476  1.00 8.04  ? 905  LEU A N   1 
ATOM   433  C CA  . LEU A 1 62  ? 25.100 9.030   -4.624  1.00 5.36  ? 905  LEU A CA  1 
ATOM   434  C C   . LEU A 1 62  ? 24.653 10.095  -3.633  1.00 7.50  ? 905  LEU A C   1 
ATOM   435  O O   . LEU A 1 62  ? 23.468 10.187  -3.306  1.00 8.73  ? 905  LEU A O   1 
ATOM   436  C CB  . LEU A 1 62  ? 25.467 7.756   -3.861  1.00 6.24  ? 905  LEU A CB  1 
ATOM   437  C CG  . LEU A 1 62  ? 25.547 6.475   -4.689  1.00 8.44  ? 905  LEU A CG  1 
ATOM   438  C CD1 . LEU A 1 62  ? 26.041 5.330   -3.825  1.00 12.37 ? 905  LEU A CD1 1 
ATOM   439  C CD2 . LEU A 1 62  ? 24.170 6.161   -5.260  1.00 10.82 ? 905  LEU A CD2 1 
ATOM   440  N N   . ALA A 1 63  ? 25.599 10.892  -3.155  1.00 12.20 ? 906  ALA A N   1 
ATOM   441  C CA  . ALA A 1 63  ? 25.273 11.952  -2.205  1.00 12.85 ? 906  ALA A CA  1 
ATOM   442  C C   . ALA A 1 63  ? 24.247 12.924  -2.805  1.00 9.34  ? 906  ALA A C   1 
ATOM   443  O O   . ALA A 1 63  ? 23.258 13.294  -2.148  1.00 11.38 ? 906  ALA A O   1 
ATOM   444  C CB  . ALA A 1 63  ? 26.535 12.678  -1.773  1.00 10.36 ? 906  ALA A CB  1 
ATOM   445  N N   . HIS A 1 64  ? 24.456 13.304  -4.059  1.00 11.77 ? 907  HIS A N   1 
ATOM   446  C CA  . HIS A 1 64  ? 23.493 14.158  -4.744  1.00 14.93 ? 907  HIS A CA  1 
ATOM   447  C C   . HIS A 1 64  ? 22.117 13.489  -4.848  1.00 12.17 ? 907  HIS A C   1 
ATOM   448  O O   . HIS A 1 64  ? 21.076 14.146  -4.723  1.00 13.81 ? 907  HIS A O   1 
ATOM   449  C CB  . HIS A 1 64  ? 23.994 14.529  -6.140  1.00 12.67 ? 907  HIS A CB  1 
ATOM   450  C CG  . HIS A 1 64  ? 25.036 15.602  -6.152  1.00 26.99 ? 907  HIS A CG  1 
ATOM   451  N ND1 . HIS A 1 64  ? 26.377 15.334  -6.318  1.00 35.45 ? 907  HIS A ND1 1 
ATOM   452  C CD2 . HIS A 1 64  ? 24.932 16.947  -6.041  1.00 31.51 ? 907  HIS A CD2 1 
ATOM   453  C CE1 . HIS A 1 64  ? 27.056 16.467  -6.300  1.00 40.93 ? 907  HIS A CE1 1 
ATOM   454  N NE2 . HIS A 1 64  ? 26.203 17.461  -6.132  1.00 36.63 ? 907  HIS A NE2 1 
ATOM   455  N N   . ARG A 1 65  ? 22.098 12.181  -5.094  1.00 9.43  ? 908  ARG A N   1 
ATOM   456  C CA  . ARG A 1 65  ? 20.812 11.495  -5.230  1.00 8.29  ? 908  ARG A CA  1 
ATOM   457  C C   . ARG A 1 65  ? 20.074 11.337  -3.894  1.00 8.06  ? 908  ARG A C   1 
ATOM   458  O O   . ARG A 1 65  ? 18.846 11.274  -3.857  1.00 8.39  ? 908  ARG A O   1 
ATOM   459  C CB  . ARG A 1 65  ? 20.994 10.143  -5.946  1.00 5.60  ? 908  ARG A CB  1 
ATOM   460  C CG  . ARG A 1 65  ? 21.700 10.278  -7.306  1.00 7.27  ? 908  ARG A CG  1 
ATOM   461  C CD  . ARG A 1 65  ? 20.801 10.762  -8.459  1.00 10.22 ? 908  ARG A CD  1 
ATOM   462  N NE  . ARG A 1 65  ? 20.305 12.131  -8.313  1.00 9.24  ? 908  ARG A NE  1 
ATOM   463  C CZ  . ARG A 1 65  ? 20.978 13.229  -8.648  1.00 17.39 ? 908  ARG A CZ  1 
ATOM   464  N NH1 . ARG A 1 65  ? 22.203 13.147  -9.153  1.00 16.25 ? 908  ARG A NH1 1 
ATOM   465  N NH2 . ARG A 1 65  ? 20.413 14.421  -8.493  1.00 19.66 ? 908  ARG A NH2 1 
ATOM   466  N N   . LEU A 1 66  ? 20.821 11.285  -2.791  1.00 8.95  ? 909  LEU A N   1 
ATOM   467  C CA  . LEU A 1 66  ? 20.207 11.211  -1.470  1.00 9.59  ? 909  LEU A CA  1 
ATOM   468  C C   . LEU A 1 66  ? 19.371 12.460  -1.195  1.00 7.54  ? 909  LEU A C   1 
ATOM   469  O O   . LEU A 1 66  ? 18.406 12.404  -0.434  1.00 12.36 ? 909  LEU A O   1 
ATOM   470  C CB  . LEU A 1 66  ? 21.288 11.066  -0.386  1.00 12.62 ? 909  LEU A CB  1 
ATOM   471  C CG  . LEU A 1 66  ? 21.924 9.681   -0.233  1.00 6.49  ? 909  LEU A CG  1 
ATOM   472  C CD1 . LEU A 1 66  ? 23.112 9.719   0.722   1.00 6.92  ? 909  LEU A CD1 1 
ATOM   473  C CD2 . LEU A 1 66  ? 20.875 8.703   0.264   1.00 9.78  ? 909  LEU A CD2 1 
ATOM   474  N N   . VAL A 1 67  ? 19.781 13.574  -1.801  1.00 10.58 ? 910  VAL A N   1 
ATOM   475  C CA  . VAL A 1 67  ? 19.061 14.851  -1.678  1.00 11.56 ? 910  VAL A CA  1 
ATOM   476  C C   . VAL A 1 67  ? 18.417 15.261  -3.003  1.00 10.78 ? 910  VAL A C   1 
ATOM   477  O O   . VAL A 1 67  ? 18.319 16.446  -3.339  1.00 12.03 ? 910  VAL A O   1 
ATOM   478  C CB  . VAL A 1 67  ? 19.985 15.987  -1.167  1.00 14.31 ? 910  VAL A CB  1 
ATOM   479  C CG1 . VAL A 1 67  ? 20.548 15.622  0.193   1.00 18.19 ? 910  VAL A CG1 1 
ATOM   480  C CG2 . VAL A 1 67  ? 21.108 16.290  -2.158  1.00 14.88 ? 910  VAL A CG2 1 
ATOM   481  N N   . ASP A 1 68  ? 17.986 14.262  -3.766  1.00 12.38 ? 911  ASP A N   1 
ATOM   482  C CA  . ASP A 1 68  ? 17.327 14.509  -5.041  1.00 8.77  ? 911  ASP A CA  1 
ATOM   483  C C   . ASP A 1 68  ? 16.033 15.286  -4.824  1.00 10.64 ? 911  ASP A C   1 
ATOM   484  O O   . ASP A 1 68  ? 15.373 15.136  -3.801  1.00 12.94 ? 911  ASP A O   1 
ATOM   485  C CB  . ASP A 1 68  ? 17.014 13.172  -5.717  1.00 10.79 ? 911  ASP A CB  1 
ATOM   486  C CG  . ASP A 1 68  ? 16.818 13.303  -7.217  1.00 11.08 ? 911  ASP A CG  1 
ATOM   487  O OD1 . ASP A 1 68  ? 15.693 13.616  -7.651  1.00 11.48 ? 911  ASP A OD1 1 
ATOM   488  O OD2 . ASP A 1 68  ? 17.790 13.069  -7.960  1.00 10.44 ? 911  ASP A OD2 1 
ATOM   489  N N   . SER A 1 69  ? 15.648 16.085  -5.814  1.00 15.90 ? 912  SER A N   1 
ATOM   490  C CA  . SER A 1 69  ? 14.397 16.828  -5.726  1.00 14.42 ? 912  SER A CA  1 
ATOM   491  C C   . SER A 1 69  ? 13.184 15.920  -5.962  1.00 15.30 ? 912  SER A C   1 
ATOM   492  O O   . SER A 1 69  ? 12.053 16.268  -5.628  1.00 16.81 ? 912  SER A O   1 
ATOM   493  C CB  . SER A 1 69  ? 14.409 18.003  -6.701  1.00 18.72 ? 912  SER A CB  1 
ATOM   494  O OG  . SER A 1 69  ? 14.642 17.548  -8.023  1.00 19.35 ? 912  SER A OG  1 
ATOM   495  N N   . ASN A 1 70  ? 13.429 14.742  -6.526  1.00 12.19 ? 913  ASN A N   1 
ATOM   496  C CA  . ASN A 1 70  ? 12.381 13.747  -6.688  1.00 13.62 ? 913  ASN A CA  1 
ATOM   497  C C   . ASN A 1 70  ? 12.421 12.745  -5.535  1.00 15.06 ? 913  ASN A C   1 
ATOM   498  O O   . ASN A 1 70  ? 13.449 12.118  -5.284  1.00 13.47 ? 913  ASN A O   1 
ATOM   499  C CB  . ASN A 1 70  ? 12.536 13.042  -8.032  1.00 14.26 ? 913  ASN A CB  1 
ATOM   500  C CG  . ASN A 1 70  ? 11.450 12.017  -8.279  1.00 13.17 ? 913  ASN A CG  1 
ATOM   501  O OD1 . ASN A 1 70  ? 11.483 10.922  -7.716  1.00 17.66 ? 913  ASN A OD1 1 
ATOM   502  N ND2 . ASN A 1 70  ? 10.482 12.362  -9.136  1.00 14.71 ? 913  ASN A ND2 1 
ATOM   503  N N   . ALA A 1 71  ? 11.308 12.614  -4.821  1.00 13.31 ? 914  ALA A N   1 
ATOM   504  C CA  . ALA A 1 71  ? 11.251 11.771  -3.624  1.00 11.52 ? 914  ALA A CA  1 
ATOM   505  C C   . ALA A 1 71  ? 11.533 10.299  -3.908  1.00 11.75 ? 914  ALA A C   1 
ATOM   506  O O   . ALA A 1 71  ? 12.189 9.623   -3.114  1.00 17.22 ? 914  ALA A O   1 
ATOM   507  C CB  . ALA A 1 71  ? 9.901  11.928  -2.930  1.00 20.12 ? 914  ALA A CB  1 
ATOM   508  N N   . LYS A 1 72  ? 11.025 9.797   -5.029  1.00 12.95 ? 915  LYS A N   1 
ATOM   509  C CA  . LYS A 1 72  ? 11.258 8.405   -5.410  1.00 11.41 ? 915  LYS A CA  1 
ATOM   510  C C   . LYS A 1 72  ? 12.748 8.110   -5.562  1.00 8.91  ? 915  LYS A C   1 
ATOM   511  O O   . LYS A 1 72  ? 13.241 7.087   -5.090  1.00 12.56 ? 915  LYS A O   1 
ATOM   512  C CB  . LYS A 1 72  ? 10.509 8.066   -6.701  1.00 13.61 ? 915  LYS A CB  1 
ATOM   513  C CG  . LYS A 1 72  ? 8.994  8.233   -6.590  1.00 22.29 ? 915  LYS A CG  1 
ATOM   514  C CD  . LYS A 1 72  ? 8.317  8.070   -7.946  1.00 34.41 ? 915  LYS A CD  1 
ATOM   515  C CE  . LYS A 1 72  ? 6.811  8.286   -7.859  1.00 36.78 ? 915  LYS A CE  1 
ATOM   516  N NZ  . LYS A 1 72  ? 6.205  8.333   -9.219  1.00 41.29 ? 915  LYS A NZ  1 
ATOM   517  N N   . ILE A 1 73  ? 13.463 9.013   -6.226  1.00 8.69  ? 916  ILE A N   1 
ATOM   518  C CA  . ILE A 1 73  ? 14.902 8.845   -6.407  1.00 9.27  ? 916  ILE A CA  1 
ATOM   519  C C   . ILE A 1 73  ? 15.628 8.871   -5.060  1.00 10.43 ? 916  ILE A C   1 
ATOM   520  O O   . ILE A 1 73  ? 16.499 8.045   -4.796  1.00 9.74  ? 916  ILE A O   1 
ATOM   521  C CB  . ILE A 1 73  ? 15.495 9.946   -7.311  1.00 9.19  ? 916  ILE A CB  1 
ATOM   522  C CG1 . ILE A 1 73  ? 14.925 9.861   -8.729  1.00 12.02 ? 916  ILE A CG1 1 
ATOM   523  C CG2 . ILE A 1 73  ? 17.016 9.854   -7.341  1.00 11.01 ? 916  ILE A CG2 1 
ATOM   524  C CD1 . ILE A 1 73  ? 15.291 8.564   -9.460  1.00 10.72 ? 916  ILE A CD1 1 
ATOM   525  N N   . ALA A 1 74  ? 15.264 9.826   -4.209  1.00 9.98  ? 917  ALA A N   1 
ATOM   526  C CA  . ALA A 1 74  ? 15.888 9.941   -2.897  1.00 11.34 ? 917  ALA A CA  1 
ATOM   527  C C   . ALA A 1 74  ? 15.684 8.678   -2.061  1.00 12.42 ? 917  ALA A C   1 
ATOM   528  O O   . ALA A 1 74  ? 16.601 8.224   -1.370  1.00 10.46 ? 917  ALA A O   1 
ATOM   529  C CB  . ALA A 1 74  ? 15.359 11.172  -2.161  1.00 13.57 ? 917  ALA A CB  1 
ATOM   530  N N   . GLN A 1 75  ? 14.481 8.116   -2.120  1.00 9.90  ? 918  GLN A N   1 
ATOM   531  C CA  . GLN A 1 75  ? 14.173 6.897   -1.390  1.00 14.33 ? 918  GLN A CA  1 
ATOM   532  C C   . GLN A 1 75  ? 14.917 5.692   -1.957  1.00 11.58 ? 918  GLN A C   1 
ATOM   533  O O   . GLN A 1 75  ? 15.476 4.888   -1.212  1.00 13.48 ? 918  GLN A O   1 
ATOM   534  C CB  . GLN A 1 75  ? 12.670 6.659   -1.381  1.00 14.22 ? 918  GLN A CB  1 
ATOM   535  C CG  . GLN A 1 75  ? 11.938 7.738   -0.601  1.00 15.38 ? 918  GLN A CG  1 
ATOM   536  C CD  . GLN A 1 75  ? 10.485 7.854   -0.984  1.00 16.72 ? 918  GLN A CD  1 
ATOM   537  O OE1 . GLN A 1 75  ? 9.937  6.976   -1.652  1.00 19.71 ? 918  GLN A OE1 1 
ATOM   538  N NE2 . GLN A 1 75  ? 9.846  8.949   -0.565  1.00 17.26 ? 918  GLN A NE2 1 
ATOM   539  N N   . THR A 1 76  ? 14.939 5.585   -3.281  1.00 8.82  ? 919  THR A N   1 
ATOM   540  C CA  . THR A 1 76  ? 15.648 4.498   -3.940  1.00 11.24 ? 919  THR A CA  1 
ATOM   541  C C   . THR A 1 76  ? 17.126 4.546   -3.571  1.00 9.59  ? 919  THR A C   1 
ATOM   542  O O   . THR A 1 76  ? 17.764 3.506   -3.335  1.00 11.16 ? 919  THR A O   1 
ATOM   543  C CB  . THR A 1 76  ? 15.476 4.563   -5.472  1.00 11.89 ? 919  THR A CB  1 
ATOM   544  O OG1 . THR A 1 76  ? 14.090 4.372   -5.794  1.00 14.78 ? 919  THR A OG1 1 
ATOM   545  C CG2 . THR A 1 76  ? 16.299 3.464   -6.157  1.00 12.15 ? 919  THR A CG2 1 
ATOM   546  N N   . THR A 1 77  ? 17.672 5.755   -3.517  1.00 7.35  ? 920  THR A N   1 
ATOM   547  C CA  . THR A 1 77  ? 19.083 5.940   -3.199  1.00 8.05  ? 920  THR A CA  1 
ATOM   548  C C   . THR A 1 77  ? 19.404 5.473   -1.774  1.00 9.64  ? 920  THR A C   1 
ATOM   549  O O   . THR A 1 77  ? 20.457 4.882   -1.536  1.00 8.23  ? 920  THR A O   1 
ATOM   550  C CB  . THR A 1 77  ? 19.538 7.401   -3.452  1.00 7.32  ? 920  THR A CB  1 
ATOM   551  O OG1 . THR A 1 77  ? 19.255 7.760   -4.812  1.00 7.92  ? 920  THR A OG1 1 
ATOM   552  C CG2 . THR A 1 77  ? 21.009 7.580   -3.175  1.00 9.57  ? 920  THR A CG2 1 
ATOM   553  N N   . LEU A 1 78  ? 18.500 5.709   -0.821  1.00 8.92  ? 921  LEU A N   1 
ATOM   554  C CA  . LEU A 1 78  ? 18.715 5.194   0.530   1.00 7.70  ? 921  LEU A CA  1 
ATOM   555  C C   . LEU A 1 78  ? 18.829 3.671   0.506   1.00 9.14  ? 921  LEU A C   1 
ATOM   556  O O   . LEU A 1 78  ? 19.728 3.105   1.128   1.00 9.36  ? 921  LEU A O   1 
ATOM   557  C CB  . LEU A 1 78  ? 17.603 5.634   1.486   1.00 9.51  ? 921  LEU A CB  1 
ATOM   558  C CG  . LEU A 1 78  ? 17.612 7.114   1.873   1.00 13.70 ? 921  LEU A CG  1 
ATOM   559  C CD1 . LEU A 1 78  ? 16.245 7.506   2.437   1.00 13.32 ? 921  LEU A CD1 1 
ATOM   560  C CD2 . LEU A 1 78  ? 18.742 7.438   2.868   1.00 10.95 ? 921  LEU A CD2 1 
ATOM   561  N N   . ALA A 1 79  ? 17.923 3.021   -0.225  1.00 10.51 ? 922  ALA A N   1 
ATOM   562  C CA  . ALA A 1 79  ? 17.954 1.567   -0.373  1.00 11.25 ? 922  ALA A CA  1 
ATOM   563  C C   . ALA A 1 79  ? 19.277 1.118   -0.973  1.00 10.63 ? 922  ALA A C   1 
ATOM   564  O O   . ALA A 1 79  ? 19.874 0.139   -0.521  1.00 10.92 ? 922  ALA A O   1 
ATOM   565  C CB  . ALA A 1 79  ? 16.784 1.091   -1.239  1.00 12.94 ? 922  ALA A CB  1 
ATOM   566  N N   . ILE A 1 80  ? 19.738 1.820   -2.004  1.00 9.24  ? 923  ILE A N   1 
ATOM   567  C CA  . ILE A 1 80  ? 21.022 1.469   -2.616  1.00 8.65  ? 923  ILE A CA  1 
ATOM   568  C C   . ILE A 1 80  ? 22.198 1.637   -1.662  1.00 11.84 ? 923  ILE A C   1 
ATOM   569  O O   . ILE A 1 80  ? 23.119 0.816   -1.646  1.00 10.69 ? 923  ILE A O   1 
ATOM   570  C CB  . ILE A 1 80  ? 21.270 2.274   -3.900  1.00 12.76 ? 923  ILE A CB  1 
ATOM   571  C CG1 . ILE A 1 80  ? 20.358 1.759   -5.014  1.00 22.05 ? 923  ILE A CG1 1 
ATOM   572  C CG2 . ILE A 1 80  ? 22.728 2.159   -4.324  1.00 10.70 ? 923  ILE A CG2 1 
ATOM   573  C CD1 . ILE A 1 80  ? 20.299 2.673   -6.216  1.00 23.84 ? 923  ILE A CD1 1 
ATOM   574  N N   . CYS A 1 81  ? 22.170 2.689   -0.850  1.00 9.05  ? 924  CYS A N   1 
ATOM   575  C CA  . CYS A 1 81  ? 23.254 2.899   0.100   1.00 7.94  ? 924  CYS A CA  1 
ATOM   576  C C   . CYS A 1 81  ? 23.280 1.799   1.154   1.00 11.39 ? 924  CYS A C   1 
ATOM   577  O O   . CYS A 1 81  ? 24.346 1.401   1.601   1.00 10.37 ? 924  CYS A O   1 
ATOM   578  C CB  . CYS A 1 81  ? 23.164 4.279   0.755   1.00 9.58  ? 924  CYS A CB  1 
ATOM   579  S SG  . CYS A 1 81  ? 23.574 5.611   -0.368  1.00 10.47 ? 924  CYS A SG  1 
ATOM   580  N N   . GLU A 1 82  ? 22.114 1.299   1.542   1.00 7.36  ? 925  GLU A N   1 
ATOM   581  C CA  . GLU A 1 82  ? 22.078 0.205   2.505   1.00 13.66 ? 925  GLU A CA  1 
ATOM   582  C C   . GLU A 1 82  ? 22.677 -1.042  1.863   1.00 15.30 ? 925  GLU A C   1 
ATOM   583  O O   . GLU A 1 82  ? 23.483 -1.738  2.485   1.00 12.24 ? 925  GLU A O   1 
ATOM   584  C CB  . GLU A 1 82  ? 20.662 -0.063  3.020   1.00 21.44 ? 925  GLU A CB  1 
ATOM   585  C CG  . GLU A 1 82  ? 20.653 -0.815  4.345   1.00 35.19 ? 925  GLU A CG  1 
ATOM   586  C CD  . GLU A 1 82  ? 19.271 -0.934  4.954   1.00 40.71 ? 925  GLU A CD  1 
ATOM   587  O OE1 . GLU A 1 82  ? 18.448 -0.013  4.766   1.00 40.56 ? 925  GLU A OE1 1 
ATOM   588  O OE2 . GLU A 1 82  ? 19.009 -1.956  5.623   1.00 40.83 ? 925  GLU A OE2 1 
ATOM   589  N N   . GLN A 1 83  ? 22.308 -1.285  0.607   1.00 9.61  ? 926  GLN A N   1 
ATOM   590  C CA  . GLN A 1 83  ? 22.858 -2.392  -0.174  1.00 9.82  ? 926  GLN A CA  1 
ATOM   591  C C   . GLN A 1 83  ? 24.382 -2.253  -0.290  1.00 11.90 ? 926  GLN A C   1 
ATOM   592  O O   . GLN A 1 83  ? 25.125 -3.234  -0.169  1.00 9.82  ? 926  GLN A O   1 
ATOM   593  C CB  . GLN A 1 83  ? 22.195 -2.414  -1.554  1.00 12.84 ? 926  GLN A CB  1 
ATOM   594  C CG  . GLN A 1 83  ? 22.737 -3.437  -2.532  1.00 19.89 ? 926  GLN A CG  1 
ATOM   595  C CD  . GLN A 1 83  ? 22.163 -3.264  -3.932  1.00 22.95 ? 926  GLN A CD  1 
ATOM   596  O OE1 . GLN A 1 83  ? 21.498 -2.269  -4.233  1.00 23.04 ? 926  GLN A OE1 1 
ATOM   597  N NE2 . GLN A 1 83  ? 22.413 -4.238  -4.792  1.00 16.01 ? 926  GLN A NE2 1 
ATOM   598  N N   . LEU A 1 84  ? 24.848 -1.029  -0.508  1.00 10.78 ? 927  LEU A N   1 
ATOM   599  C CA  . LEU A 1 84  ? 26.272 -0.786  -0.653  1.00 9.06  ? 927  LEU A CA  1 
ATOM   600  C C   . LEU A 1 84  ? 27.000 -1.102  0.653   1.00 9.87  ? 927  LEU A C   1 
ATOM   601  O O   . LEU A 1 84  ? 28.087 -1.697  0.658   1.00 11.05 ? 927  LEU A O   1 
ATOM   602  C CB  . LEU A 1 84  ? 26.516 0.672   -1.082  1.00 11.29 ? 927  LEU A CB  1 
ATOM   603  C CG  . LEU A 1 84  ? 27.915 1.051   -1.568  1.00 14.55 ? 927  LEU A CG  1 
ATOM   604  C CD1 . LEU A 1 84  ? 28.197 0.505   -2.973  1.00 12.45 ? 927  LEU A CD1 1 
ATOM   605  C CD2 . LEU A 1 84  ? 28.067 2.562   -1.556  1.00 19.08 ? 927  LEU A CD2 1 
ATOM   606  N N   . ALA A 1 85  ? 26.400 -0.715  1.775   1.00 9.14  ? 928  ALA A N   1 
ATOM   607  C CA  . ALA A 1 85  ? 27.025 -0.969  3.070   1.00 12.62 ? 928  ALA A CA  1 
ATOM   608  C C   . ALA A 1 85  ? 27.220 -2.463  3.277   1.00 10.02 ? 928  ALA A C   1 
ATOM   609  O O   . ALA A 1 85  ? 28.290 -2.915  3.681   1.00 8.74  ? 928  ALA A O   1 
ATOM   610  C CB  . ALA A 1 85  ? 26.177 -0.394  4.194   1.00 10.91 ? 928  ALA A CB  1 
ATOM   611  N N   . THR A 1 86  ? 26.168 -3.221  3.001   1.00 10.05 ? 929  THR A N   1 
ATOM   612  C CA  . THR A 1 86  ? 26.213 -4.665  3.175   1.00 8.25  ? 929  THR A CA  1 
ATOM   613  C C   . THR A 1 86  ? 27.303 -5.277  2.294   1.00 9.14  ? 929  THR A C   1 
ATOM   614  O O   . THR A 1 86  ? 28.061 -6.135  2.740   1.00 12.47 ? 929  THR A O   1 
ATOM   615  C CB  . THR A 1 86  ? 24.844 -5.292  2.866   1.00 10.59 ? 929  THR A CB  1 
ATOM   616  O OG1 . THR A 1 86  ? 23.881 -4.811  3.821   1.00 14.34 ? 929  THR A OG1 1 
ATOM   617  C CG2 . THR A 1 86  ? 24.924 -6.821  2.931   1.00 11.96 ? 929  THR A CG2 1 
ATOM   618  N N   . ALA A 1 87  ? 27.381 -4.822  1.050   1.00 11.15 ? 930  ALA A N   1 
ATOM   619  C CA  . ALA A 1 87  ? 28.372 -5.342  0.105   1.00 9.38  ? 930  ALA A CA  1 
ATOM   620  C C   . ALA A 1 87  ? 29.810 -4.987  0.491   1.00 7.71  ? 930  ALA A C   1 
ATOM   621  O O   . ALA A 1 87  ? 30.751 -5.733  0.211   1.00 7.65  ? 930  ALA A O   1 
ATOM   622  C CB  . ALA A 1 87  ? 28.057 -4.827  -1.322  1.00 7.95  ? 930  ALA A CB  1 
ATOM   623  N N   . MET A 1 88  ? 29.983 -3.844  1.144   1.00 8.20  ? 931  MET A N   1 
ATOM   624  C CA  . MET A 1 88  ? 31.323 -3.298  1.384   1.00 7.75  ? 931  MET A CA  1 
ATOM   625  C C   . MET A 1 88  ? 31.877 -3.665  2.758   1.00 9.35  ? 931  MET A C   1 
ATOM   626  O O   . MET A 1 88  ? 33.093 -3.644  2.970   1.00 11.04 ? 931  MET A O   1 
ATOM   627  C CB  . MET A 1 88  ? 31.278 -1.777  1.228   1.00 12.61 ? 931  MET A CB  1 
ATOM   628  C CG  . MET A 1 88  ? 32.537 -1.169  0.687   1.00 19.81 ? 931  MET A CG  1 
ATOM   629  S SD  . MET A 1 88  ? 32.295 0.589   0.376   1.00 17.08 ? 931  MET A SD  1 
ATOM   630  C CE  . MET A 1 88  ? 31.699 0.613   -1.305  1.00 16.07 ? 931  MET A CE  1 
ATOM   631  N N   . GLY A 1 89  ? 30.994 -4.002  3.691   1.00 8.36  ? 932  GLY A N   1 
ATOM   632  C CA  . GLY A 1 89  ? 31.435 -4.328  5.038   1.00 8.86  ? 932  GLY A CA  1 
ATOM   633  C C   . GLY A 1 89  ? 32.216 -3.165  5.638   1.00 15.25 ? 932  GLY A C   1 
ATOM   634  O O   . GLY A 1 89  ? 31.794 -2.020  5.502   1.00 13.30 ? 932  GLY A O   1 
ATOM   635  N N   . ALA A 1 90  ? 33.348 -3.452  6.285   1.00 11.31 ? 933  ALA A N   1 
ATOM   636  C CA  . ALA A 1 90  ? 34.128 -2.409  6.972   1.00 15.30 ? 933  ALA A CA  1 
ATOM   637  C C   . ALA A 1 90  ? 34.567 -1.270  6.051   1.00 13.31 ? 933  ALA A C   1 
ATOM   638  O O   . ALA A 1 90  ? 34.809 -0.158  6.506   1.00 12.66 ? 933  ALA A O   1 
ATOM   639  C CB  . ALA A 1 90  ? 35.338 -3.018  7.670   1.00 16.33 ? 933  ALA A CB  1 
ATOM   640  N N   . GLY A 1 91  ? 34.678 -1.551  4.759   1.00 10.78 ? 934  GLY A N   1 
ATOM   641  C CA  . GLY A 1 91  ? 35.098 -0.544  3.805   1.00 12.67 ? 934  GLY A CA  1 
ATOM   642  C C   . GLY A 1 91  ? 34.123 0.609   3.690   1.00 9.29  ? 934  GLY A C   1 
ATOM   643  O O   . GLY A 1 91  ? 34.453 1.649   3.138   1.00 11.52 ? 934  GLY A O   1 
ATOM   644  N N   . CYS A 1 92  ? 32.908 0.439   4.193   1.00 9.73  ? 935  CYS A N   1 
ATOM   645  C CA  . CYS A 1 92  ? 31.925 1.502   4.038   1.00 9.08  ? 935  CYS A CA  1 
ATOM   646  C C   . CYS A 1 92  ? 32.330 2.783   4.781   1.00 9.46  ? 935  CYS A C   1 
ATOM   647  O O   . CYS A 1 92  ? 31.866 3.859   4.427   1.00 10.76 ? 935  CYS A O   1 
ATOM   648  C CB  . CYS A 1 92  ? 30.517 1.046   4.425   1.00 13.07 ? 935  CYS A CB  1 
ATOM   649  S SG  . CYS A 1 92  ? 30.284 0.785   6.198   1.00 14.46 ? 935  CYS A SG  1 
ATOM   650  N N   . ARG A 1 93  ? 33.211 2.677   5.777   1.00 9.68  ? 936  ARG A N   1 
ATOM   651  C CA  . ARG A 1 93  ? 33.638 3.875   6.521   1.00 11.00 ? 936  ARG A CA  1 
ATOM   652  C C   . ARG A 1 93  ? 34.299 4.888   5.587   1.00 11.95 ? 936  ARG A C   1 
ATOM   653  O O   . ARG A 1 93  ? 34.341 6.095   5.880   1.00 12.84 ? 936  ARG A O   1 
ATOM   654  C CB  . ARG A 1 93  ? 34.595 3.516   7.664   1.00 13.69 ? 936  ARG A CB  1 
ATOM   655  C CG  . ARG A 1 93  ? 35.949 3.025   7.200   1.00 13.90 ? 936  ARG A CG  1 
ATOM   656  C CD  . ARG A 1 93  ? 36.956 2.958   8.352   1.00 26.64 ? 936  ARG A CD  1 
ATOM   657  N NE  . ARG A 1 93  ? 38.284 2.538   7.903   1.00 37.65 ? 936  ARG A NE  1 
ATOM   658  C CZ  . ARG A 1 93  ? 39.409 2.720   8.595   1.00 38.24 ? 936  ARG A CZ  1 
ATOM   659  N NH1 . ARG A 1 93  ? 39.382 3.325   9.776   1.00 41.99 ? 936  ARG A NH1 1 
ATOM   660  N NH2 . ARG A 1 93  ? 40.568 2.300   8.104   1.00 33.81 ? 936  ARG A NH2 1 
ATOM   661  N N   . ASN A 1 94  ? 34.828 4.394   4.468   1.00 9.59  ? 937  ASN A N   1 
ATOM   662  C CA  . ASN A 1 94  ? 35.521 5.247   3.506   1.00 8.87  ? 937  ASN A CA  1 
ATOM   663  C C   . ASN A 1 94  ? 34.633 6.310   2.886   1.00 11.64 ? 937  ASN A C   1 
ATOM   664  O O   . ASN A 1 94  ? 35.128 7.307   2.357   1.00 14.01 ? 937  ASN A O   1 
ATOM   665  C CB  . ASN A 1 94  ? 36.149 4.423   2.380   1.00 7.40  ? 937  ASN A CB  1 
ATOM   666  C CG  . ASN A 1 94  ? 37.302 3.548   2.849   1.00 9.23  ? 937  ASN A CG  1 
ATOM   667  O OD1 . ASN A 1 94  ? 37.418 3.225   4.029   1.00 12.52 ? 937  ASN A OD1 1 
ATOM   668  N ND2 . ASN A 1 94  ? 38.155 3.156   1.912   1.00 9.78  ? 937  ASN A ND2 1 
ATOM   669  N N   . HIS A 1 95  ? 33.325 6.099   2.956   1.00 9.92  ? 938  HIS A N   1 
ATOM   670  C CA  . HIS A 1 95  ? 32.379 6.947   2.239   1.00 8.01  ? 938  HIS A CA  1 
ATOM   671  C C   . HIS A 1 95  ? 31.422 7.692   3.140   1.00 9.46  ? 938  HIS A C   1 
ATOM   672  O O   . HIS A 1 95  ? 30.520 8.368   2.658   1.00 8.49  ? 938  HIS A O   1 
ATOM   673  C CB  . HIS A 1 95  ? 31.618 6.094   1.230   1.00 6.89  ? 938  HIS A CB  1 
ATOM   674  C CG  . HIS A 1 95  ? 32.534 5.365   0.314   1.00 6.52  ? 938  HIS A CG  1 
ATOM   675  N ND1 . HIS A 1 95  ? 33.302 6.020   -0.626  1.00 8.73  ? 938  HIS A ND1 1 
ATOM   676  C CD2 . HIS A 1 95  ? 32.893 4.062   0.251   1.00 6.68  ? 938  HIS A CD2 1 
ATOM   677  C CE1 . HIS A 1 95  ? 34.053 5.144   -1.264  1.00 12.22 ? 938  HIS A CE1 1 
ATOM   678  N NE2 . HIS A 1 95  ? 33.829 3.946   -0.746  1.00 9.12  ? 938  HIS A NE2 1 
ATOM   679  N N   . VAL A 1 96  ? 31.656 7.605   4.442   1.00 8.88  ? 939  VAL A N   1 
ATOM   680  C CA  . VAL A 1 96  ? 30.790 8.265   5.416   1.00 9.01  ? 939  VAL A CA  1 
ATOM   681  C C   . VAL A 1 96  ? 30.742 9.785   5.213   1.00 12.61 ? 939  VAL A C   1 
ATOM   682  O O   . VAL A 1 96  ? 29.672 10.402  5.252   1.00 9.22  ? 939  VAL A O   1 
ATOM   683  C CB  . VAL A 1 96  ? 31.216 7.894   6.863   1.00 6.79  ? 939  VAL A CB  1 
ATOM   684  C CG1 . VAL A 1 96  ? 30.661 8.895   7.870   1.00 12.05 ? 939  VAL A CG1 1 
ATOM   685  C CG2 . VAL A 1 96  ? 30.768 6.481   7.184   1.00 9.71  ? 939  VAL A CG2 1 
ATOM   686  N N   . ARG A 1 97  ? 31.895 10.395  4.963   1.00 8.84  ? 940  ARG A N   1 
ATOM   687  C CA  . ARG A 1 97  ? 31.924 11.837  4.738   1.00 9.72  ? 940  ARG A CA  1 
ATOM   688  C C   . ARG A 1 97  ? 31.027 12.288  3.573   1.00 12.28 ? 940  ARG A C   1 
ATOM   689  O O   . ARG A 1 97  ? 30.418 13.360  3.625   1.00 10.44 ? 940  ARG A O   1 
ATOM   690  C CB  . ARG A 1 97  ? 33.365 12.298  4.537   1.00 17.73 ? 940  ARG A CB  1 
ATOM   691  C CG  . ARG A 1 97  ? 33.533 13.774  4.376   1.00 24.04 ? 940  ARG A CG  1 
ATOM   692  C CD  . ARG A 1 97  ? 35.008 14.118  4.288   1.00 20.02 ? 940  ARG A CD  1 
ATOM   693  N NE  . ARG A 1 97  ? 35.185 15.528  3.993   1.00 23.04 ? 940  ARG A NE  1 
ATOM   694  C CZ  . ARG A 1 97  ? 35.207 16.473  4.918   1.00 24.66 ? 940  ARG A CZ  1 
ATOM   695  N NH1 . ARG A 1 97  ? 35.070 16.143  6.200   1.00 16.99 ? 940  ARG A NH1 1 
ATOM   696  N NH2 . ARG A 1 97  ? 35.369 17.739  4.561   1.00 35.26 ? 940  ARG A NH2 1 
ATOM   697  N N   . ASN A 1 98  ? 30.931 11.469  2.525   1.00 10.61 ? 941  ASN A N   1 
ATOM   698  C CA  . ASN A 1 98  ? 30.041 11.789  1.412   1.00 11.25 ? 941  ASN A CA  1 
ATOM   699  C C   . ASN A 1 98  ? 28.566 11.532  1.712   1.00 15.12 ? 941  ASN A C   1 
ATOM   700  O O   . ASN A 1 98  ? 27.705 12.340  1.365   1.00 17.29 ? 941  ASN A O   1 
ATOM   701  C CB  . ASN A 1 98  ? 30.453 11.030  0.143   1.00 13.71 ? 941  ASN A CB  1 
ATOM   702  C CG  . ASN A 1 98  ? 31.589 11.711  -0.609  1.00 21.00 ? 941  ASN A CG  1 
ATOM   703  O OD1 . ASN A 1 98  ? 31.436 12.823  -1.125  1.00 23.69 ? 941  ASN A OD1 1 
ATOM   704  N ND2 . ASN A 1 98  ? 32.724 11.037  -0.690  1.00 26.85 ? 941  ASN A ND2 1 
ATOM   705  N N   . LEU A 1 99  ? 28.275 10.413  2.367   1.00 7.05  ? 942  LEU A N   1 
ATOM   706  C CA  . LEU A 1 99  ? 26.902 9.918   2.432   1.00 6.44  ? 942  LEU A CA  1 
ATOM   707  C C   . LEU A 1 99  ? 26.162 10.280  3.709   1.00 8.60  ? 942  LEU A C   1 
ATOM   708  O O   . LEU A 1 99  ? 24.953 10.464  3.685   1.00 6.87  ? 942  LEU A O   1 
ATOM   709  C CB  . LEU A 1 99  ? 26.867 8.402   2.264   1.00 8.36  ? 942  LEU A CB  1 
ATOM   710  C CG  . LEU A 1 99  ? 27.515 7.929   0.965   1.00 7.20  ? 942  LEU A CG  1 
ATOM   711  C CD1 . LEU A 1 99  ? 27.535 6.404   0.927   1.00 13.22 ? 942  LEU A CD1 1 
ATOM   712  C CD2 . LEU A 1 99  ? 26.780 8.504   -0.239  1.00 10.21 ? 942  LEU A CD2 1 
ATOM   713  N N   . PHE A 1 100 ? 26.883 10.358  4.821   1.00 6.51  ? 943  PHE A N   1 
ATOM   714  C CA  . PHE A 1 100 ? 26.249 10.629  6.111   1.00 8.06  ? 943  PHE A CA  1 
ATOM   715  C C   . PHE A 1 100 ? 25.469 11.960  6.150   1.00 9.23  ? 943  PHE A C   1 
ATOM   716  O O   . PHE A 1 100 ? 24.363 11.998  6.677   1.00 7.67  ? 943  PHE A O   1 
ATOM   717  C CB  . PHE A 1 100 ? 27.307 10.543  7.227   1.00 9.34  ? 943  PHE A CB  1 
ATOM   718  C CG  . PHE A 1 100 ? 26.767 10.676  8.629   1.00 9.07  ? 943  PHE A CG  1 
ATOM   719  C CD1 . PHE A 1 100 ? 25.680 9.928   9.060   1.00 10.99 ? 943  PHE A CD1 1 
ATOM   720  C CD2 . PHE A 1 100 ? 27.410 11.501  9.548   1.00 7.02  ? 943  PHE A CD2 1 
ATOM   721  C CE1 . PHE A 1 100 ? 25.219 10.024  10.367  1.00 8.44  ? 943  PHE A CE1 1 
ATOM   722  C CE2 . PHE A 1 100 ? 26.944 11.609  10.853  1.00 7.61  ? 943  PHE A CE2 1 
ATOM   723  C CZ  . PHE A 1 100 ? 25.849 10.864  11.261  1.00 9.88  ? 943  PHE A CZ  1 
ATOM   724  N N   . PRO A 1 101 ? 26.033 13.051  5.599   1.00 7.54  ? 944  PRO A N   1 
ATOM   725  C CA  . PRO A 1 101 ? 25.228 14.282  5.588   1.00 10.02 ? 944  PRO A CA  1 
ATOM   726  C C   . PRO A 1 101 ? 23.874 14.090  4.906   1.00 9.48  ? 944  PRO A C   1 
ATOM   727  O O   . PRO A 1 101 ? 22.868 14.659  5.361   1.00 8.28  ? 944  PRO A O   1 
ATOM   728  C CB  . PRO A 1 101 ? 26.096 15.255  4.797   1.00 8.47  ? 944  PRO A CB  1 
ATOM   729  C CG  . PRO A 1 101 ? 27.517 14.805  5.130   1.00 9.03  ? 944  PRO A CG  1 
ATOM   730  C CD  . PRO A 1 101 ? 27.415 13.290  5.139   1.00 9.01  ? 944  PRO A CD  1 
ATOM   731  N N   . GLY A 1 102 ? 23.847 13.281  3.847   1.00 6.88  ? 945  GLY A N   1 
ATOM   732  C CA  . GLY A 1 102 ? 22.605 13.012  3.137   1.00 6.92  ? 945  GLY A CA  1 
ATOM   733  C C   . GLY A 1 102 ? 21.644 12.162  3.955   1.00 5.41  ? 945  GLY A C   1 
ATOM   734  O O   . GLY A 1 102 ? 20.440 12.387  3.943   1.00 6.46  ? 945  GLY A O   1 
ATOM   735  N N   . PHE A 1 103 ? 22.174 11.166  4.661   1.00 6.26  ? 946  PHE A N   1 
ATOM   736  C CA  . PHE A 1 103 ? 21.364 10.376  5.579   1.00 5.38  ? 946  PHE A CA  1 
ATOM   737  C C   . PHE A 1 103 ? 20.751 11.273  6.647   1.00 7.82  ? 946  PHE A C   1 
ATOM   738  O O   . PHE A 1 103 ? 19.571 11.155  6.982   1.00 7.01  ? 946  PHE A O   1 
ATOM   739  C CB  . PHE A 1 103 ? 22.205 9.315   6.300   1.00 5.02  ? 946  PHE A CB  1 
ATOM   740  C CG  . PHE A 1 103 ? 22.858 8.310   5.402   1.00 6.00  ? 946  PHE A CG  1 
ATOM   741  C CD1 . PHE A 1 103 ? 22.434 8.105   4.098   1.00 8.79  ? 946  PHE A CD1 1 
ATOM   742  C CD2 . PHE A 1 103 ? 23.916 7.560   5.888   1.00 7.35  ? 946  PHE A CD2 1 
ATOM   743  C CE1 . PHE A 1 103 ? 23.060 7.164   3.295   1.00 9.18  ? 946  PHE A CE1 1 
ATOM   744  C CE2 . PHE A 1 103 ? 24.549 6.606   5.093   1.00 10.78 ? 946  PHE A CE2 1 
ATOM   745  C CZ  . PHE A 1 103 ? 24.119 6.414   3.787   1.00 6.38  ? 946  PHE A CZ  1 
ATOM   746  N N   . LEU A 1 104 ? 21.563 12.168  7.198   1.00 7.99  ? 947  LEU A N   1 
ATOM   747  C CA  . LEU A 1 104 ? 21.079 13.033  8.261   1.00 11.94 ? 947  LEU A CA  1 
ATOM   748  C C   . LEU A 1 104 ? 19.975 13.922  7.726   1.00 11.15 ? 947  LEU A C   1 
ATOM   749  O O   . LEU A 1 104 ? 18.982 14.184  8.403   1.00 11.00 ? 947  LEU A O   1 
ATOM   750  C CB  . LEU A 1 104 ? 22.214 13.891  8.822   1.00 7.06  ? 947  LEU A CB  1 
ATOM   751  C CG  . LEU A 1 104 ? 23.269 13.189  9.681   1.00 9.27  ? 947  LEU A CG  1 
ATOM   752  C CD1 . LEU A 1 104 ? 24.384 14.171  10.019  1.00 10.52 ? 947  LEU A CD1 1 
ATOM   753  C CD2 . LEU A 1 104 ? 22.635 12.587  10.941  1.00 14.43 ? 947  LEU A CD2 1 
ATOM   754  N N   . HIS A 1 105 ? 20.156 14.413  6.509   1.00 8.08  ? 948  HIS A N   1 
ATOM   755  C CA  . HIS A 1 105 ? 19.173 15.307  5.956   1.00 8.01  ? 948  HIS A CA  1 
ATOM   756  C C   . HIS A 1 105 ? 17.830 14.602  5.755   1.00 9.72  ? 948  HIS A C   1 
ATOM   757  O O   . HIS A 1 105 ? 16.773 15.200  5.961   1.00 13.32 ? 948  HIS A O   1 
ATOM   758  C CB  . HIS A 1 105 ? 19.665 15.918  4.653   1.00 9.28  ? 948  HIS A CB  1 
ATOM   759  C CG  . HIS A 1 105 ? 18.821 17.055  4.193   1.00 12.58 ? 948  HIS A CG  1 
ATOM   760  N ND1 . HIS A 1 105 ? 18.837 18.289  4.809   1.00 15.41 ? 948  HIS A ND1 1 
ATOM   761  C CD2 . HIS A 1 105 ? 17.901 17.133  3.206   1.00 13.69 ? 948  HIS A CD2 1 
ATOM   762  C CE1 . HIS A 1 105 ? 17.975 19.085  4.200   1.00 11.98 ? 948  HIS A CE1 1 
ATOM   763  N NE2 . HIS A 1 105 ? 17.392 18.407  3.229   1.00 16.42 ? 948  HIS A NE2 1 
ATOM   764  N N   . ALA A 1 106 ? 17.870 13.321  5.386   1.00 8.77  ? 949  ALA A N   1 
ATOM   765  C CA  . ALA A 1 106 ? 16.639 12.564  5.183   1.00 6.46  ? 949  ALA A CA  1 
ATOM   766  C C   . ALA A 1 106 ? 15.916 12.280  6.499   1.00 6.41  ? 949  ALA A C   1 
ATOM   767  O O   . ALA A 1 106 ? 14.739 11.922  6.493   1.00 8.21  ? 949  ALA A O   1 
ATOM   768  C CB  . ALA A 1 106 ? 16.934 11.242  4.446   1.00 8.26  ? 949  ALA A CB  1 
ATOM   769  N N   . LEU A 1 107 ? 16.624 12.401  7.623   1.00 7.33  ? 950  LEU A N   1 
ATOM   770  C CA  . LEU A 1 107 ? 15.980 12.256  8.937   1.00 9.77  ? 950  LEU A CA  1 
ATOM   771  C C   . LEU A 1 107 ? 14.933 13.326  9.177   1.00 12.77 ? 950  LEU A C   1 
ATOM   772  O O   . LEU A 1 107 ? 14.131 13.215  10.100  1.00 14.34 ? 950  LEU A O   1 
ATOM   773  C CB  . LEU A 1 107 ? 17.006 12.342  10.071  1.00 14.51 ? 950  LEU A CB  1 
ATOM   774  C CG  . LEU A 1 107 ? 17.938 11.163  10.289  1.00 12.44 ? 950  LEU A CG  1 
ATOM   775  C CD1 . LEU A 1 107 ? 18.875 11.491  11.457  1.00 8.01  ? 950  LEU A CD1 1 
ATOM   776  C CD2 . LEU A 1 107 ? 17.165 9.888   10.578  1.00 13.42 ? 950  LEU A CD2 1 
ATOM   777  N N   . GLY A 1 108 ? 14.968 14.382  8.375   1.00 9.37  ? 951  GLY A N   1 
ATOM   778  C CA  . GLY A 1 108 ? 14.014 15.472  8.508   1.00 10.25 ? 951  GLY A CA  1 
ATOM   779  C C   . GLY A 1 108 ? 12.775 15.302  7.651   1.00 12.34 ? 951  GLY A C   1 
ATOM   780  O O   . GLY A 1 108 ? 11.903 16.179  7.620   1.00 15.67 ? 951  GLY A O   1 
ATOM   781  N N   . ASP A 1 109 ? 12.692 14.180  6.951   1.00 8.74  ? 952  ASP A N   1 
ATOM   782  C CA  . ASP A 1 109 ? 11.617 13.956  5.991   1.00 8.39  ? 952  ASP A CA  1 
ATOM   783  C C   . ASP A 1 109 ? 10.260 13.948  6.696   1.00 14.55 ? 952  ASP A C   1 
ATOM   784  O O   . ASP A 1 109 ? 10.160 13.520  7.843   1.00 16.20 ? 952  ASP A O   1 
ATOM   785  C CB  . ASP A 1 109 ? 11.819 12.632  5.254   1.00 12.65 ? 952  ASP A CB  1 
ATOM   786  C CG  . ASP A 1 109 ? 10.978 12.532  3.990   1.00 16.80 ? 952  ASP A CG  1 
ATOM   787  O OD1 . ASP A 1 109 ? 9.772  12.213  4.090   1.00 19.32 ? 952  ASP A OD1 1 
ATOM   788  O OD2 . ASP A 1 109 ? 11.524 12.779  2.895   1.00 15.91 ? 952  ASP A OD2 1 
ATOM   789  N N   . ASN A 1 110 ? 9.230  14.436  6.000   1.00 19.54 ? 953  ASN A N   1 
ATOM   790  C CA  . ASN A 1 110 ? 7.851  14.431  6.487   1.00 22.82 ? 953  ASN A CA  1 
ATOM   791  C C   . ASN A 1 110 ? 7.254  13.043  6.667   1.00 20.28 ? 953  ASN A C   1 
ATOM   792  O O   . ASN A 1 110 ? 6.297  12.869  7.416   1.00 20.68 ? 953  ASN A O   1 
ATOM   793  C CB  . ASN A 1 110 ? 6.940  15.190  5.518   1.00 24.92 ? 953  ASN A CB  1 
ATOM   794  C CG  . ASN A 1 110 ? 7.209  16.667  5.497   1.00 36.32 ? 953  ASN A CG  1 
ATOM   795  O OD1 . ASN A 1 110 ? 7.657  17.246  6.488   1.00 42.87 ? 953  ASN A OD1 1 
ATOM   796  N ND2 . ASN A 1 110 ? 6.929  17.296  4.362   1.00 35.85 ? 953  ASN A ND2 1 
ATOM   797  N N   . LYS A 1 111 ? 7.800  12.066  5.952   1.00 18.18 ? 954  LYS A N   1 
ATOM   798  C CA  . LYS A 1 111 ? 7.246  10.717  5.950   1.00 16.25 ? 954  LYS A CA  1 
ATOM   799  C C   . LYS A 1 111 ? 8.110  9.772   6.795   1.00 19.85 ? 954  LYS A C   1 
ATOM   800  O O   . LYS A 1 111 ? 9.317  9.651   6.563   1.00 15.53 ? 954  LYS A O   1 
ATOM   801  C CB  . LYS A 1 111 ? 7.148  10.207  4.510   1.00 19.78 ? 954  LYS A CB  1 
ATOM   802  C CG  . LYS A 1 111 ? 6.202  11.039  3.640   1.00 23.09 ? 954  LYS A CG  1 
ATOM   803  C CD  . LYS A 1 111 ? 6.368  10.717  2.166   1.00 25.67 ? 954  LYS A CD  1 
ATOM   804  C CE  . LYS A 1 111 ? 7.732  11.154  1.666   1.00 33.65 ? 954  LYS A CE  1 
ATOM   805  N NZ  . LYS A 1 111 ? 8.035  12.560  2.072   1.00 36.15 ? 954  LYS A NZ  1 
ATOM   806  N N   . SER A 1 112 ? 7.483  9.101   7.761   1.00 14.73 ? 955  SER A N   1 
ATOM   807  C CA  . SER A 1 112 ? 8.190  8.263   8.730   1.00 16.68 ? 955  SER A CA  1 
ATOM   808  C C   . SER A 1 112 ? 8.985  7.123   8.097   1.00 19.25 ? 955  SER A C   1 
ATOM   809  O O   . SER A 1 112 ? 10.029 6.739   8.612   1.00 15.55 ? 955  SER A O   1 
ATOM   810  C CB  . SER A 1 112 ? 7.211  7.683   9.753   1.00 24.32 ? 955  SER A CB  1 
ATOM   811  O OG  . SER A 1 112 ? 6.354  6.735   9.142   1.00 18.56 ? 955  SER A OG  1 
ATOM   812  N N   . PHE A 1 113 ? 8.490  6.561   6.997   1.00 13.31 ? 956  PHE A N   1 
ATOM   813  C CA  . PHE A 1 113 ? 9.216  5.469   6.366   1.00 14.23 ? 956  PHE A CA  1 
ATOM   814  C C   . PHE A 1 113 ? 10.532 5.949   5.756   1.00 14.89 ? 956  PHE A C   1 
ATOM   815  O O   . PHE A 1 113 ? 11.487 5.182   5.673   1.00 18.14 ? 956  PHE A O   1 
ATOM   816  C CB  . PHE A 1 113 ? 8.342  4.716   5.339   1.00 13.18 ? 956  PHE A CB  1 
ATOM   817  C CG  . PHE A 1 113 ? 8.228  5.397   3.997   1.00 11.66 ? 956  PHE A CG  1 
ATOM   818  C CD1 . PHE A 1 113 ? 9.089  5.059   2.955   1.00 15.44 ? 956  PHE A CD1 1 
ATOM   819  C CD2 . PHE A 1 113 ? 7.244  6.339   3.763   1.00 12.17 ? 956  PHE A CD2 1 
ATOM   820  C CE1 . PHE A 1 113 ? 8.972  5.671   1.708   1.00 18.57 ? 956  PHE A CE1 1 
ATOM   821  C CE2 . PHE A 1 113 ? 7.120  6.949   2.531   1.00 14.33 ? 956  PHE A CE2 1 
ATOM   822  C CZ  . PHE A 1 113 ? 7.987  6.616   1.500   1.00 19.17 ? 956  PHE A CZ  1 
ATOM   823  N N   . VAL A 1 114 ? 10.589 7.213   5.337   1.00 12.89 ? 957  VAL A N   1 
ATOM   824  C CA  . VAL A 1 114 ? 11.828 7.765   4.801   1.00 10.27 ? 957  VAL A CA  1 
ATOM   825  C C   . VAL A 1 114 ? 12.790 8.008   5.954   1.00 11.22 ? 957  VAL A C   1 
ATOM   826  O O   . VAL A 1 114 ? 13.979 7.690   5.864   1.00 12.30 ? 957  VAL A O   1 
ATOM   827  C CB  . VAL A 1 114 ? 11.602 9.079   4.014   1.00 14.26 ? 957  VAL A CB  1 
ATOM   828  C CG1 . VAL A 1 114 ? 12.927 9.628   3.488   1.00 12.43 ? 957  VAL A CG1 1 
ATOM   829  C CG2 . VAL A 1 114 ? 10.628 8.832   2.852   1.00 11.76 ? 957  VAL A CG2 1 
ATOM   830  N N   . ARG A 1 115 ? 12.280 8.555   7.050   1.00 8.92  ? 958  ARG A N   1 
ATOM   831  C CA  . ARG A 1 115 ? 13.153 8.761   8.212   1.00 10.61 ? 958  ARG A CA  1 
ATOM   832  C C   . ARG A 1 115 ? 13.713 7.419   8.700   1.00 14.10 ? 958  ARG A C   1 
ATOM   833  O O   . ARG A 1 115 ? 14.858 7.340   9.133   1.00 14.10 ? 958  ARG A O   1 
ATOM   834  C CB  . ARG A 1 115 ? 12.425 9.486   9.344   1.00 10.00 ? 958  ARG A CB  1 
ATOM   835  C CG  . ARG A 1 115 ? 11.913 10.863  8.952   1.00 10.43 ? 958  ARG A CG  1 
ATOM   836  C CD  . ARG A 1 115 ? 11.500 11.689  10.172  1.00 13.41 ? 958  ARG A CD  1 
ATOM   837  N NE  . ARG A 1 115 ? 10.448 11.031  10.954  1.00 17.91 ? 958  ARG A NE  1 
ATOM   838  C CZ  . ARG A 1 115 ? 9.144  11.266  10.801  1.00 20.91 ? 958  ARG A CZ  1 
ATOM   839  N NH1 . ARG A 1 115 ? 8.733  12.142  9.899   1.00 18.41 ? 958  ARG A NH1 1 
ATOM   840  N NH2 . ARG A 1 115 ? 8.252  10.627  11.555  1.00 19.27 ? 958  ARG A NH2 1 
ATOM   841  N N   . ALA A 1 116 ? 12.915 6.359   8.579   1.00 14.46 ? 959  ALA A N   1 
ATOM   842  C CA  . ALA A 1 116 ? 13.325 5.031   9.034   1.00 13.42 ? 959  ALA A CA  1 
ATOM   843  C C   . ALA A 1 116 ? 14.400 4.443   8.134   1.00 11.78 ? 959  ALA A C   1 
ATOM   844  O O   . ALA A 1 116 ? 15.356 3.817   8.608   1.00 13.99 ? 959  ALA A O   1 
ATOM   845  C CB  . ALA A 1 116 ? 12.115 4.092   9.092   1.00 17.26 ? 959  ALA A CB  1 
ATOM   846  N N   . ALA A 1 117 ? 14.229 4.632   6.831   1.00 11.76 ? 960  ALA A N   1 
ATOM   847  C CA  . ALA A 1 117 ? 15.234 4.218   5.868   1.00 16.18 ? 960  ALA A CA  1 
ATOM   848  C C   . ALA A 1 117 ? 16.542 4.944   6.146   1.00 13.32 ? 960  ALA A C   1 
ATOM   849  O O   . ALA A 1 117 ? 17.620 4.350   6.070   1.00 13.42 ? 960  ALA A O   1 
ATOM   850  C CB  . ALA A 1 117 ? 14.754 4.489   4.441   1.00 14.63 ? 960  ALA A CB  1 
ATOM   851  N N   . ALA A 1 118 ? 16.448 6.230   6.480   1.00 9.88  ? 961  ALA A N   1 
ATOM   852  C CA  . ALA A 1 118 ? 17.634 7.024   6.757   1.00 9.09  ? 961  ALA A CA  1 
ATOM   853  C C   . ALA A 1 118 ? 18.331 6.506   8.020   1.00 8.45  ? 961  ALA A C   1 
ATOM   854  O O   . ALA A 1 118 ? 19.553 6.363   8.052   1.00 11.35 ? 961  ALA A O   1 
ATOM   855  C CB  . ALA A 1 118 ? 17.262 8.494   6.902   1.00 13.19 ? 961  ALA A CB  1 
ATOM   856  N N   . LEU A 1 119 ? 17.548 6.226   9.057   1.00 8.23  ? 962  LEU A N   1 
ATOM   857  C CA  . LEU A 1 119 ? 18.097 5.686   10.304  1.00 10.03 ? 962  LEU A CA  1 
ATOM   858  C C   . LEU A 1 119 ? 18.770 4.337   10.071  1.00 9.54  ? 962  LEU A C   1 
ATOM   859  O O   . LEU A 1 119 ? 19.810 4.046   10.649  1.00 13.75 ? 962  LEU A O   1 
ATOM   860  C CB  . LEU A 1 119 ? 16.996 5.540   11.355  1.00 13.89 ? 962  LEU A CB  1 
ATOM   861  C CG  . LEU A 1 119 ? 16.618 6.790   12.133  1.00 22.57 ? 962  LEU A CG  1 
ATOM   862  C CD1 . LEU A 1 119 ? 15.441 6.506   13.054  1.00 27.74 ? 962  LEU A CD1 1 
ATOM   863  C CD2 . LEU A 1 119 ? 17.823 7.302   12.935  1.00 25.39 ? 962  LEU A CD2 1 
ATOM   864  N N   . ASN A 1 120 ? 18.169 3.520   9.216   1.00 14.85 ? 963  ASN A N   1 
ATOM   865  C CA  . ASN A 1 120 ? 18.703 2.195   8.919   1.00 12.89 ? 963  ASN A CA  1 
ATOM   866  C C   . ASN A 1 120 ? 20.037 2.262   8.196   1.00 13.04 ? 963  ASN A C   1 
ATOM   867  O O   . ASN A 1 120 ? 20.934 1.466   8.459   1.00 17.70 ? 963  ASN A O   1 
ATOM   868  C CB  . ASN A 1 120 ? 17.706 1.403   8.079   1.00 15.13 ? 963  ASN A CB  1 
ATOM   869  C CG  . ASN A 1 120 ? 16.476 1.010   8.862   1.00 22.13 ? 963  ASN A CG  1 
ATOM   870  O OD1 . ASN A 1 120 ? 16.529 0.834   10.079  1.00 30.75 ? 963  ASN A OD1 1 
ATOM   871  N ND2 . ASN A 1 120 ? 15.356 0.862   8.165   1.00 29.75 ? 963  ASN A ND2 1 
ATOM   872  N N   . CYS A 1 121 ? 20.156 3.207   7.269   1.00 10.57 ? 964  CYS A N   1 
ATOM   873  C CA  . CYS A 1 121 ? 21.430 3.459   6.614   1.00 12.56 ? 964  CYS A CA  1 
ATOM   874  C C   . CYS A 1 121 ? 22.471 3.865   7.629   1.00 11.90 ? 964  CYS A C   1 
ATOM   875  O O   . CYS A 1 121 ? 23.589 3.361   7.621   1.00 13.73 ? 964  CYS A O   1 
ATOM   876  C CB  . CYS A 1 121 ? 21.315 4.586   5.597   1.00 15.90 ? 964  CYS A CB  1 
ATOM   877  S SG  . CYS A 1 121 ? 20.844 4.051   3.969   1.00 16.53 ? 964  CYS A SG  1 
ATOM   878  N N   . ILE A 1 122 ? 22.118 4.824   8.479   1.00 9.36  ? 965  ILE A N   1 
ATOM   879  C CA  . ILE A 1 122 ? 23.061 5.306   9.460   1.00 8.33  ? 965  ILE A CA  1 
ATOM   880  C C   . ILE A 1 122 ? 23.544 4.155   10.324  1.00 9.57  ? 965  ILE A C   1 
ATOM   881  O O   . ILE A 1 122 ? 24.740 3.956   10.486  1.00 12.10 ? 965  ILE A O   1 
ATOM   882  C CB  . ILE A 1 122 ? 22.456 6.413   10.349  1.00 9.76  ? 965  ILE A CB  1 
ATOM   883  C CG1 . ILE A 1 122 ? 22.228 7.680   9.513   1.00 9.97  ? 965  ILE A CG1 1 
ATOM   884  C CG2 . ILE A 1 122 ? 23.399 6.704   11.512  1.00 9.00  ? 965  ILE A CG2 1 
ATOM   885  C CD1 . ILE A 1 122 ? 21.375 8.762   10.196  1.00 7.64  ? 965  ILE A CD1 1 
ATOM   886  N N   . ASN A 1 123 ? 22.607 3.383   10.858  1.00 12.23 ? 966  ASN A N   1 
ATOM   887  C CA  . ASN A 1 123 ? 22.987 2.313   11.772  1.00 11.04 ? 966  ASN A CA  1 
ATOM   888  C C   . ASN A 1 123 ? 23.702 1.157   11.072  1.00 13.79 ? 966  ASN A C   1 
ATOM   889  O O   . ASN A 1 123 ? 24.549 0.501   11.672  1.00 16.55 ? 966  ASN A O   1 
ATOM   890  C CB  . ASN A 1 123 ? 21.782 1.846   12.592  1.00 13.19 ? 966  ASN A CB  1 
ATOM   891  C CG  . ASN A 1 123 ? 21.375 2.867   13.639  1.00 14.51 ? 966  ASN A CG  1 
ATOM   892  O OD1 . ASN A 1 123 ? 22.225 3.551   14.211  1.00 15.27 ? 966  ASN A OD1 1 
ATOM   893  N ND2 . ASN A 1 123 ? 20.076 2.993   13.878  1.00 15.61 ? 966  ASN A ND2 1 
ATOM   894  N N   . SER A 1 124 ? 23.375 0.925   9.804   1.00 15.89 ? 967  SER A N   1 
ATOM   895  C CA  . SER A 1 124 ? 24.112 -0.070  9.031   1.00 15.03 ? 967  SER A CA  1 
ATOM   896  C C   . SER A 1 124 ? 25.561 0.342   8.822   1.00 14.20 ? 967  SER A C   1 
ATOM   897  O O   . SER A 1 124 ? 26.481 -0.460  9.034   1.00 15.06 ? 967  SER A O   1 
ATOM   898  C CB  . SER A 1 124 ? 23.451 -0.346  7.685   1.00 14.35 ? 967  SER A CB  1 
ATOM   899  O OG  . SER A 1 124 ? 24.217 -1.318  6.984   1.00 17.98 ? 967  SER A OG  1 
ATOM   900  N N   . PHE A 1 125 ? 25.779 1.586   8.400   1.00 7.46  ? 968  PHE A N   1 
ATOM   901  C CA  . PHE A 1 125 ? 27.135 2.082   8.254   1.00 9.45  ? 968  PHE A CA  1 
ATOM   902  C C   . PHE A 1 125 ? 27.852 2.067   9.600   1.00 17.04 ? 968  PHE A C   1 
ATOM   903  O O   . PHE A 1 125 ? 29.032 1.733   9.676   1.00 13.93 ? 968  PHE A O   1 
ATOM   904  C CB  . PHE A 1 125 ? 27.147 3.492   7.651   1.00 11.16 ? 968  PHE A CB  1 
ATOM   905  C CG  . PHE A 1 125 ? 27.121 3.507   6.140   1.00 9.53  ? 968  PHE A CG  1 
ATOM   906  C CD1 . PHE A 1 125 ? 25.973 3.150   5.442   1.00 8.02  ? 968  PHE A CD1 1 
ATOM   907  C CD2 . PHE A 1 125 ? 28.256 3.864   5.423   1.00 9.23  ? 968  PHE A CD2 1 
ATOM   908  C CE1 . PHE A 1 125 ? 25.960 3.158   4.052   1.00 5.95  ? 968  PHE A CE1 1 
ATOM   909  C CE2 . PHE A 1 125 ? 28.248 3.877   4.035   1.00 10.79 ? 968  PHE A CE2 1 
ATOM   910  C CZ  . PHE A 1 125 ? 27.096 3.519   3.353   1.00 9.72  ? 968  PHE A CZ  1 
ATOM   911  N N   . GLY A 1 126 ? 27.136 2.419   10.663  1.00 14.42 ? 969  GLY A N   1 
ATOM   912  C CA  . GLY A 1 126 ? 27.748 2.467   11.984  1.00 16.31 ? 969  GLY A CA  1 
ATOM   913  C C   . GLY A 1 126 ? 28.247 1.106   12.434  1.00 18.18 ? 969  GLY A C   1 
ATOM   914  O O   . GLY A 1 126 ? 29.386 0.955   12.880  1.00 20.27 ? 969  GLY A O   1 
ATOM   915  N N   . GLU A 1 127 ? 27.388 0.107   12.308  1.00 12.47 ? 970  GLU A N   1 
ATOM   916  C CA  . GLU A 1 127 ? 27.735 -1.256  12.688  1.00 20.43 ? 970  GLU A CA  1 
ATOM   917  C C   . GLU A 1 127 ? 28.870 -1.839  11.852  1.00 21.57 ? 970  GLU A C   1 
ATOM   918  O O   . GLU A 1 127 ? 29.757 -2.509  12.376  1.00 18.91 ? 970  GLU A O   1 
ATOM   919  C CB  . GLU A 1 127 ? 26.512 -2.159  12.571  1.00 16.84 ? 970  GLU A CB  1 
ATOM   920  C CG  . GLU A 1 127 ? 25.357 -1.773  13.494  1.00 25.29 ? 970  GLU A CG  1 
ATOM   921  C CD  . GLU A 1 127 ? 25.738 -1.780  14.966  1.00 42.01 ? 970  GLU A CD  1 
ATOM   922  O OE1 . GLU A 1 127 ? 26.811 -2.321  15.312  1.00 53.88 ? 970  GLU A OE1 1 
ATOM   923  O OE2 . GLU A 1 127 ? 24.957 -1.243  15.782  1.00 45.37 ? 970  GLU A OE2 1 
ATOM   924  N N   . LYS A 1 128 ? 28.839 -1.582  10.550  1.00 19.77 ? 971  LYS A N   1 
ATOM   925  C CA  . LYS A 1 128 ? 29.785 -2.206  9.635   1.00 18.13 ? 971  LYS A CA  1 
ATOM   926  C C   . LYS A 1 128 ? 31.135 -1.505  9.597   1.00 21.98 ? 971  LYS A C   1 
ATOM   927  O O   . LYS A 1 128 ? 32.183 -2.155  9.591   1.00 26.15 ? 971  LYS A O   1 
ATOM   928  C CB  . LYS A 1 128 ? 29.177 -2.280  8.236   1.00 15.01 ? 971  LYS A CB  1 
ATOM   929  C CG  . LYS A 1 128 ? 27.976 -3.185  8.180   1.00 21.81 ? 971  LYS A CG  1 
ATOM   930  C CD  . LYS A 1 128 ? 27.270 -3.100  6.847   1.00 22.46 ? 971  LYS A CD  1 
ATOM   931  C CE  . LYS A 1 128 ? 26.130 -4.095  6.776   1.00 23.24 ? 971  LYS A CE  1 
ATOM   932  N NZ  . LYS A 1 128 ? 25.102 -3.841  7.819   1.00 25.97 ? 971  LYS A NZ  1 
ATOM   933  N N   . GLY A 1 129 ? 31.117 -0.177  9.575   1.00 17.34 ? 972  GLY A N   1 
ATOM   934  C CA  . GLY A 1 129 ? 32.342 0.583   9.424   1.00 21.14 ? 972  GLY A CA  1 
ATOM   935  C C   . GLY A 1 129 ? 32.814 1.248   10.698  1.00 18.91 ? 972  GLY A C   1 
ATOM   936  O O   . GLY A 1 129 ? 33.928 1.771   10.745  1.00 19.38 ? 972  GLY A O   1 
ATOM   937  N N   . GLY A 1 130 ? 31.963 1.232   11.720  1.00 20.02 ? 973  GLY A N   1 
ATOM   938  C CA  . GLY A 1 130 ? 32.239 1.908   12.975  1.00 20.34 ? 973  GLY A CA  1 
ATOM   939  C C   . GLY A 1 130 ? 31.514 3.240   13.071  1.00 21.40 ? 973  GLY A C   1 
ATOM   940  O O   . GLY A 1 130 ? 31.292 3.920   12.074  1.00 21.35 ? 973  GLY A O   1 
ATOM   941  N N   . TYR A 1 131 ? 31.136 3.620   14.283  1.00 11.94 ? 974  TYR A N   1 
ATOM   942  C CA  . TYR A 1 131 ? 30.409 4.861   14.476  1.00 8.70  ? 974  TYR A CA  1 
ATOM   943  C C   . TYR A 1 131 ? 31.362 6.051   14.536  1.00 14.50 ? 974  TYR A C   1 
ATOM   944  O O   . TYR A 1 131 ? 30.935 7.201   14.490  1.00 15.51 ? 974  TYR A O   1 
ATOM   945  C CB  . TYR A 1 131 ? 29.577 4.770   15.754  1.00 9.57  ? 974  TYR A CB  1 
ATOM   946  C CG  . TYR A 1 131 ? 28.306 3.968   15.602  1.00 16.05 ? 974  TYR A CG  1 
ATOM   947  C CD1 . TYR A 1 131 ? 28.304 2.585   15.753  1.00 14.36 ? 974  TYR A CD1 1 
ATOM   948  C CD2 . TYR A 1 131 ? 27.106 4.594   15.310  1.00 18.16 ? 974  TYR A CD2 1 
ATOM   949  C CE1 . TYR A 1 131 ? 27.124 1.856   15.616  1.00 15.20 ? 974  TYR A CE1 1 
ATOM   950  C CE2 . TYR A 1 131 ? 25.939 3.882   15.176  1.00 16.13 ? 974  TYR A CE2 1 
ATOM   951  C CZ  . TYR A 1 131 ? 25.950 2.515   15.326  1.00 14.68 ? 974  TYR A CZ  1 
ATOM   952  O OH  . TYR A 1 131 ? 24.771 1.812   15.179  1.00 19.72 ? 974  TYR A OH  1 
ATOM   953  N N   . LYS A 1 132 ? 32.656 5.768   14.610  1.00 17.31 ? 975  LYS A N   1 
ATOM   954  C CA  . LYS A 1 132 ? 33.664 6.799   14.817  1.00 15.97 ? 975  LYS A CA  1 
ATOM   955  C C   . LYS A 1 132 ? 33.620 7.865   13.734  1.00 15.64 ? 975  LYS A C   1 
ATOM   956  O O   . LYS A 1 132 ? 33.751 9.053   14.021  1.00 13.04 ? 975  LYS A O   1 
ATOM   957  C CB  . LYS A 1 132 ? 35.053 6.156   14.866  1.00 19.80 ? 975  LYS A CB  1 
ATOM   958  C CG  . LYS A 1 132 ? 36.195 7.123   15.101  1.00 18.04 ? 975  LYS A CG  1 
ATOM   959  C CD  . LYS A 1 132 ? 37.470 6.354   15.438  1.00 28.46 ? 975  LYS A CD  1 
ATOM   960  C CE  . LYS A 1 132 ? 38.692 7.263   15.473  1.00 36.03 ? 975  LYS A CE  1 
ATOM   961  N NZ  . LYS A 1 132 ? 39.105 7.690   14.108  1.00 41.10 ? 975  LYS A NZ  1 
ATOM   962  N N   . GLU A 1 133 ? 33.438 7.441   12.484  1.00 12.84 ? 976  GLU A N   1 
ATOM   963  C CA  . GLU A 1 133 ? 33.442 8.384   11.370  1.00 14.58 ? 976  GLU A CA  1 
ATOM   964  C C   . GLU A 1 133 ? 32.263 9.342   11.355  1.00 8.41  ? 976  GLU A C   1 
ATOM   965  O O   . GLU A 1 133 ? 32.314 10.350  10.639  1.00 12.00 ? 976  GLU A O   1 
ATOM   966  C CB  . GLU A 1 133 ? 33.535 7.663   10.020  1.00 18.72 ? 976  GLU A CB  1 
ATOM   967  C CG  . GLU A 1 133 ? 34.924 7.150   9.698   1.00 23.88 ? 976  GLU A CG  1 
ATOM   968  C CD  . GLU A 1 133 ? 35.278 5.948   10.536  1.00 28.28 ? 976  GLU A CD  1 
ATOM   969  O OE1 . GLU A 1 133 ? 34.349 5.277   11.038  1.00 25.96 ? 976  GLU A OE1 1 
ATOM   970  O OE2 . GLU A 1 133 ? 36.477 5.664   10.689  1.00 30.83 ? 976  GLU A OE2 1 
ATOM   971  N N   . PHE A 1 134 ? 31.211 9.056   12.125  1.00 13.77 ? 977  PHE A N   1 
ATOM   972  C CA  . PHE A 1 134 ? 30.050 9.962   12.190  1.00 9.88  ? 977  PHE A CA  1 
ATOM   973  C C   . PHE A 1 134 ? 30.355 11.203  13.023  1.00 8.99  ? 977  PHE A C   1 
ATOM   974  O O   . PHE A 1 134 ? 29.693 12.238  12.891  1.00 12.70 ? 977  PHE A O   1 
ATOM   975  C CB  . PHE A 1 134 ? 28.835 9.274   12.823  1.00 8.20  ? 977  PHE A CB  1 
ATOM   976  C CG  . PHE A 1 134 ? 28.268 8.139   12.011  1.00 11.18 ? 977  PHE A CG  1 
ATOM   977  C CD1 . PHE A 1 134 ? 28.294 8.166   10.630  1.00 15.49 ? 977  PHE A CD1 1 
ATOM   978  C CD2 . PHE A 1 134 ? 27.692 7.051   12.646  1.00 8.58  ? 977  PHE A CD2 1 
ATOM   979  C CE1 . PHE A 1 134 ? 27.762 7.113   9.897   1.00 14.73 ? 977  PHE A CE1 1 
ATOM   980  C CE2 . PHE A 1 134 ? 27.152 5.995   11.920  1.00 12.30 ? 977  PHE A CE2 1 
ATOM   981  C CZ  . PHE A 1 134 ? 27.193 6.027   10.548  1.00 10.22 ? 977  PHE A CZ  1 
ATOM   982  N N   . PHE A 1 135 ? 31.326 11.078  13.923  1.00 9.57  ? 978  PHE A N   1 
ATOM   983  C CA  . PHE A 1 135 ? 31.621 12.119  14.908  1.00 10.75 ? 978  PHE A CA  1 
ATOM   984  C C   . PHE A 1 135 ? 32.849 12.926  14.505  1.00 15.63 ? 978  PHE A C   1 
ATOM   985  O O   . PHE A 1 135 ? 33.828 13.028  15.244  1.00 14.43 ? 978  PHE A O   1 
ATOM   986  C CB  . PHE A 1 135 ? 31.754 11.488  16.300  1.00 10.26 ? 978  PHE A CB  1 
ATOM   987  C CG  . PHE A 1 135 ? 30.475 10.875  16.782  1.00 9.69  ? 978  PHE A CG  1 
ATOM   988  C CD1 . PHE A 1 135 ? 29.492 11.668  17.355  1.00 9.51  ? 978  PHE A CD1 1 
ATOM   989  C CD2 . PHE A 1 135 ? 30.227 9.522   16.620  1.00 10.68 ? 978  PHE A CD2 1 
ATOM   990  C CE1 . PHE A 1 135 ? 28.285 11.109  17.790  1.00 11.53 ? 978  PHE A CE1 1 
ATOM   991  C CE2 . PHE A 1 135 ? 29.021 8.962   17.032  1.00 10.48 ? 978  PHE A CE2 1 
ATOM   992  C CZ  . PHE A 1 135 ? 28.048 9.764   17.625  1.00 8.68  ? 978  PHE A CZ  1 
ATOM   993  N N   . GLU A 1 136 ? 32.755 13.503  13.312  1.00 12.12 ? 979  GLU A N   1 
ATOM   994  C CA  . GLU A 1 136 ? 33.821 14.271  12.701  1.00 9.95  ? 979  GLU A CA  1 
ATOM   995  C C   . GLU A 1 136 ? 33.225 15.399  11.877  1.00 10.58 ? 979  GLU A C   1 
ATOM   996  O O   . GLU A 1 136 ? 32.117 15.280  11.345  1.00 11.84 ? 979  GLU A O   1 
ATOM   997  C CB  . GLU A 1 136 ? 34.671 13.384  11.785  1.00 11.52 ? 979  GLU A CB  1 
ATOM   998  C CG  . GLU A 1 136 ? 35.353 12.232  12.516  1.00 16.98 ? 979  GLU A CG  1 
ATOM   999  C CD  . GLU A 1 136 ? 36.624 11.760  11.817  1.00 36.04 ? 979  GLU A CD  1 
ATOM   1000 O OE1 . GLU A 1 136 ? 37.024 12.395  10.827  1.00 36.83 ? 979  GLU A OE1 1 
ATOM   1001 O OE2 . GLU A 1 136 ? 37.222 10.761  12.264  1.00 49.92 ? 979  GLU A OE2 1 
ATOM   1002 N N   . SER A 1 137 ? 33.973 16.493  11.791  1.00 11.57 ? 980  SER A N   1 
ATOM   1003 C CA  . SER A 1 137 ? 33.696 17.580  10.861  1.00 12.69 ? 980  SER A CA  1 
ATOM   1004 C C   . SER A 1 137 ? 32.370 18.288  11.080  1.00 10.48 ? 980  SER A C   1 
ATOM   1005 O O   . SER A 1 137 ? 31.875 18.966  10.184  1.00 11.32 ? 980  SER A O   1 
ATOM   1006 C CB  . SER A 1 137 ? 33.803 17.070  9.423   1.00 13.59 ? 980  SER A CB  1 
ATOM   1007 O OG  . SER A 1 137 ? 35.099 16.549  9.190   1.00 20.86 ? 980  SER A OG  1 
ATOM   1008 N N   . GLU A 1 138 ? 31.822 18.132  12.284  1.00 10.55 ? 981  GLU A N   1 
ATOM   1009 C CA  . GLU A 1 138 ? 30.574 18.779  12.684  1.00 7.87  ? 981  GLU A CA  1 
ATOM   1010 C C   . GLU A 1 138 ? 29.393 18.431  11.791  1.00 8.86  ? 981  GLU A C   1 
ATOM   1011 O O   . GLU A 1 138 ? 28.491 19.236  11.616  1.00 9.09  ? 981  GLU A O   1 
ATOM   1012 C CB  . GLU A 1 138 ? 30.742 20.299  12.795  1.00 9.61  ? 981  GLU A CB  1 
ATOM   1013 C CG  . GLU A 1 138 ? 31.743 20.689  13.898  1.00 11.36 ? 981  GLU A CG  1 
ATOM   1014 C CD  . GLU A 1 138 ? 31.866 22.198  14.131  1.00 16.65 ? 981  GLU A CD  1 
ATOM   1015 O OE1 . GLU A 1 138 ? 31.047 22.979  13.603  1.00 17.43 ? 981  GLU A OE1 1 
ATOM   1016 O OE2 . GLU A 1 138 ? 32.798 22.610  14.857  1.00 18.45 ? 981  GLU A OE2 1 
ATOM   1017 N N   . MET A 1 139 ? 29.386 17.227  11.238  1.00 7.02  ? 982  MET A N   1 
ATOM   1018 C CA  . MET A 1 139 ? 28.239 16.805  10.427  1.00 9.33  ? 982  MET A CA  1 
ATOM   1019 C C   . MET A 1 139 ? 26.952 16.789  11.238  1.00 10.76 ? 982  MET A C   1 
ATOM   1020 O O   . MET A 1 139 ? 25.911 17.273  10.789  1.00 10.41 ? 982  MET A O   1 
ATOM   1021 C CB  . MET A 1 139 ? 28.495 15.442  9.789   1.00 8.00  ? 982  MET A CB  1 
ATOM   1022 C CG  . MET A 1 139 ? 29.567 15.503  8.715   1.00 7.07  ? 982  MET A CG  1 
ATOM   1023 S SD  . MET A 1 139 ? 29.951 13.907  7.958   1.00 11.12 ? 982  MET A SD  1 
ATOM   1024 C CE  . MET A 1 139 ? 30.713 13.036  9.316   1.00 10.60 ? 982  MET A CE  1 
ATOM   1025 N N   . ILE A 1 140 ? 27.031 16.239  12.440  1.00 8.01  ? 983  ILE A N   1 
ATOM   1026 C CA  . ILE A 1 140 ? 25.859 16.183  13.311  1.00 6.71  ? 983  ILE A CA  1 
ATOM   1027 C C   . ILE A 1 140 ? 25.431 17.592  13.769  1.00 8.87  ? 983  ILE A C   1 
ATOM   1028 O O   . ILE A 1 140 ? 24.255 17.961  13.671  1.00 8.86  ? 983  ILE A O   1 
ATOM   1029 C CB  . ILE A 1 140 ? 26.112 15.209  14.480  1.00 4.66  ? 983  ILE A CB  1 
ATOM   1030 C CG1 . ILE A 1 140 ? 26.107 13.765  13.955  1.00 8.42  ? 983  ILE A CG1 1 
ATOM   1031 C CG2 . ILE A 1 140 ? 25.078 15.378  15.582  1.00 9.12  ? 983  ILE A CG2 1 
ATOM   1032 C CD1 . ILE A 1 140 ? 26.704 12.756  14.935  1.00 10.37 ? 983  ILE A CD1 1 
ATOM   1033 N N   . ALA A 1 141 ? 26.384 18.388  14.244  1.00 8.07  ? 984  ALA A N   1 
ATOM   1034 C CA  . ALA A 1 141 ? 26.070 19.754  14.664  1.00 8.65  ? 984  ALA A CA  1 
ATOM   1035 C C   . ALA A 1 141 ? 25.471 20.591  13.531  1.00 11.14 ? 984  ALA A C   1 
ATOM   1036 O O   . ALA A 1 141 ? 24.556 21.377  13.753  1.00 13.56 ? 984  ALA A O   1 
ATOM   1037 C CB  . ALA A 1 141 ? 27.303 20.432  15.226  1.00 11.42 ? 984  ALA A CB  1 
ATOM   1038 N N   . ASP A 1 142 ? 25.984 20.420  12.319  1.00 8.87  ? 985  ASP A N   1 
ATOM   1039 C CA  . ASP A 1 142 ? 25.469 21.185  11.190  1.00 11.37 ? 985  ASP A CA  1 
ATOM   1040 C C   . ASP A 1 142 ? 24.026 20.787  10.886  1.00 12.87 ? 985  ASP A C   1 
ATOM   1041 O O   . ASP A 1 142 ? 23.211 21.633  10.494  1.00 15.73 ? 985  ASP A O   1 
ATOM   1042 C CB  . ASP A 1 142 ? 26.347 20.998  9.951   1.00 9.50  ? 985  ASP A CB  1 
ATOM   1043 C CG  . ASP A 1 142 ? 27.587 21.873  9.972   1.00 17.63 ? 985  ASP A CG  1 
ATOM   1044 O OD1 . ASP A 1 142 ? 27.625 22.847  10.750  1.00 22.33 ? 985  ASP A OD1 1 
ATOM   1045 O OD2 . ASP A 1 142 ? 28.517 21.593  9.184   1.00 21.38 ? 985  ASP A OD2 1 
ATOM   1046 N N   . ALA A 1 143 ? 23.703 19.506  11.055  1.00 8.81  ? 986  ALA A N   1 
ATOM   1047 C CA  . ALA A 1 143 ? 22.321 19.066  10.843  1.00 7.00  ? 986  ALA A CA  1 
ATOM   1048 C C   . ALA A 1 143 ? 21.404 19.610  11.937  1.00 9.72  ? 986  ALA A C   1 
ATOM   1049 O O   . ALA A 1 143 ? 20.272 19.996  11.678  1.00 11.42 ? 986  ALA A O   1 
ATOM   1050 C CB  . ALA A 1 143 ? 22.240 17.539  10.776  1.00 6.82  ? 986  ALA A CB  1 
ATOM   1051 N N   . LEU A 1 144 ? 21.897 19.642  13.172  1.00 10.38 ? 987  LEU A N   1 
ATOM   1052 C CA  . LEU A 1 144 ? 21.090 20.132  14.286  1.00 8.78  ? 987  LEU A CA  1 
ATOM   1053 C C   . LEU A 1 144 ? 20.827 21.630  14.136  1.00 15.44 ? 987  LEU A C   1 
ATOM   1054 O O   . LEU A 1 144 ? 19.721 22.114  14.399  1.00 15.74 ? 987  LEU A O   1 
ATOM   1055 C CB  . LEU A 1 144 ? 21.795 19.847  15.618  1.00 9.32  ? 987  LEU A CB  1 
ATOM   1056 C CG  . LEU A 1 144 ? 21.851 18.377  16.051  1.00 9.79  ? 987  LEU A CG  1 
ATOM   1057 C CD1 . LEU A 1 144 ? 22.865 18.214  17.201  1.00 10.79 ? 987  LEU A CD1 1 
ATOM   1058 C CD2 . LEU A 1 144 ? 20.469 17.853  16.468  1.00 10.93 ? 987  LEU A CD2 1 
ATOM   1059 N N   . LYS A 1 145 ? 21.860 22.346  13.708  1.00 14.12 ? 988  LYS A N   1 
ATOM   1060 C CA  . LYS A 1 145 ? 21.851 23.804  13.620  1.00 19.86 ? 988  LYS A CA  1 
ATOM   1061 C C   . LYS A 1 145 ? 20.631 24.346  12.879  1.00 28.23 ? 988  LYS A C   1 
ATOM   1062 O O   . LYS A 1 145 ? 19.786 25.025  13.468  1.00 33.97 ? 988  LYS A O   1 
ATOM   1063 C CB  . LYS A 1 145 ? 23.145 24.279  12.944  1.00 25.13 ? 988  LYS A CB  1 
ATOM   1064 C CG  . LYS A 1 145 ? 23.268 25.778  12.756  1.00 36.68 ? 988  LYS A CG  1 
ATOM   1065 C CD  . LYS A 1 145 ? 24.612 26.112  12.115  1.00 47.34 ? 988  LYS A CD  1 
ATOM   1066 C CE  . LYS A 1 145 ? 24.902 27.605  12.156  1.00 50.17 ? 988  LYS A CE  1 
ATOM   1067 N NZ  . LYS A 1 145 ? 23.885 28.409  11.421  1.00 48.40 ? 988  LYS A NZ  1 
ATOM   1068 N N   . GLY A 1 146 ? 20.529 24.058  11.589  1.00 23.64 ? 989  GLY A N   1 
ATOM   1069 C CA  . GLY A 1 146 ? 19.422 24.611  10.831  1.00 32.66 ? 989  GLY A CA  1 
ATOM   1070 C C   . GLY A 1 146 ? 18.245 23.661  10.768  1.00 27.19 ? 989  GLY A C   1 
ATOM   1071 O O   . GLY A 1 146 ? 17.351 23.814  9.936   1.00 21.91 ? 989  GLY A O   1 
ATOM   1072 N N   . GLY A 1 147 ? 18.229 22.685  11.666  1.00 19.30 ? 990  GLY A N   1 
ATOM   1073 C CA  . GLY A 1 147 ? 17.386 21.523  11.480  1.00 13.84 ? 990  GLY A CA  1 
ATOM   1074 C C   . GLY A 1 147 ? 15.896 21.716  11.651  1.00 15.62 ? 990  GLY A C   1 
ATOM   1075 O O   . GLY A 1 147 ? 15.448 22.492  12.496  1.00 15.04 ? 990  GLY A O   1 
ATOM   1076 N N   . SER A 1 148 ? 15.134 20.984  10.850  1.00 14.01 ? 991  SER A N   1 
ATOM   1077 C CA  . SER A 1 148 ? 13.692 20.907  11.000  1.00 15.01 ? 991  SER A CA  1 
ATOM   1078 C C   . SER A 1 148 ? 13.348 20.204  12.309  1.00 15.14 ? 991  SER A C   1 
ATOM   1079 O O   . SER A 1 148 ? 14.173 19.479  12.871  1.00 12.03 ? 991  SER A O   1 
ATOM   1080 C CB  . SER A 1 148 ? 13.083 20.140  9.828   1.00 18.40 ? 991  SER A CB  1 
ATOM   1081 O OG  . SER A 1 148 ? 13.373 18.759  9.930   1.00 16.29 ? 991  SER A OG  1 
ATOM   1082 N N   . PRO A 1 149 ? 12.132 20.424  12.815  1.00 16.73 ? 992  PRO A N   1 
ATOM   1083 C CA  . PRO A 1 149 ? 11.709 19.737  14.041  1.00 8.75  ? 992  PRO A CA  1 
ATOM   1084 C C   . PRO A 1 149 ? 11.807 18.213  13.930  1.00 10.35 ? 992  PRO A C   1 
ATOM   1085 O O   . PRO A 1 149 ? 12.234 17.566  14.886  1.00 10.51 ? 992  PRO A O   1 
ATOM   1086 C CB  . PRO A 1 149 ? 10.252 20.190  14.198  1.00 12.42 ? 992  PRO A CB  1 
ATOM   1087 C CG  . PRO A 1 149 ? 10.227 21.538  13.563  1.00 14.47 ? 992  PRO A CG  1 
ATOM   1088 C CD  . PRO A 1 149 ? 11.144 21.428  12.376  1.00 17.06 ? 992  PRO A CD  1 
ATOM   1089 N N   . ALA A 1 150 ? 11.417 17.645  12.790  1.00 10.88 ? 993  ALA A N   1 
ATOM   1090 C CA  . ALA A 1 150 ? 11.515 16.197  12.610  1.00 10.95 ? 993  ALA A CA  1 
ATOM   1091 C C   . ALA A 1 150 ? 12.965 15.734  12.714  1.00 11.83 ? 993  ALA A C   1 
ATOM   1092 O O   . ALA A 1 150 ? 13.265 14.746  13.383  1.00 13.17 ? 993  ALA A O   1 
ATOM   1093 C CB  . ALA A 1 150 ? 10.915 15.770  11.274  1.00 15.97 ? 993  ALA A CB  1 
ATOM   1094 N N   . LEU A 1 151 ? 13.868 16.453  12.055  1.00 10.90 ? 994  LEU A N   1 
ATOM   1095 C CA  . LEU A 1 151 ? 15.280 16.078  12.094  1.00 8.97  ? 994  LEU A CA  1 
ATOM   1096 C C   . LEU A 1 151 ? 15.822 16.159  13.516  1.00 8.87  ? 994  LEU A C   1 
ATOM   1097 O O   . LEU A 1 151 ? 16.482 15.224  13.993  1.00 9.70  ? 994  LEU A O   1 
ATOM   1098 C CB  . LEU A 1 151 ? 16.104 16.946  11.135  1.00 10.20 ? 994  LEU A CB  1 
ATOM   1099 C CG  . LEU A 1 151 ? 17.605 16.653  11.080  1.00 13.28 ? 994  LEU A CG  1 
ATOM   1100 C CD1 . LEU A 1 151 ? 18.203 17.091  9.729   1.00 12.77 ? 994  LEU A CD1 1 
ATOM   1101 C CD2 . LEU A 1 151 ? 18.323 17.346  12.249  1.00 15.71 ? 994  LEU A CD2 1 
ATOM   1102 N N   . LYS A 1 152 ? 15.533 17.252  14.211  1.00 10.58 ? 995  LYS A N   1 
ATOM   1103 C CA  . LYS A 1 152 ? 16.013 17.393  15.580  1.00 10.19 ? 995  LYS A CA  1 
ATOM   1104 C C   . LYS A 1 152 ? 15.462 16.277  16.469  1.00 11.44 ? 995  LYS A C   1 
ATOM   1105 O O   . LYS A 1 152 ? 16.184 15.724  17.294  1.00 10.48 ? 995  LYS A O   1 
ATOM   1106 C CB  . LYS A 1 152 ? 15.701 18.789  16.145  1.00 8.24  ? 995  LYS A CB  1 
ATOM   1107 C CG  . LYS A 1 152 ? 16.459 19.904  15.417  1.00 8.57  ? 995  LYS A CG  1 
ATOM   1108 C CD  . LYS A 1 152 ? 16.133 21.300  15.935  1.00 11.09 ? 995  LYS A CD  1 
ATOM   1109 C CE  . LYS A 1 152 ? 14.646 21.550  16.052  1.00 26.38 ? 995  LYS A CE  1 
ATOM   1110 N NZ  . LYS A 1 152 ? 14.395 22.947  16.525  1.00 27.84 ? 995  LYS A NZ  1 
ATOM   1111 N N   . THR A 1 153 ? 14.187 15.945  16.300  1.00 10.18 ? 996  THR A N   1 
ATOM   1112 C CA  . THR A 1 153 ? 13.588 14.852  17.060  1.00 10.09 ? 996  THR A CA  1 
ATOM   1113 C C   . THR A 1 153 ? 14.328 13.537  16.834  1.00 8.10  ? 996  THR A C   1 
ATOM   1114 O O   . THR A 1 153 ? 14.735 12.873  17.789  1.00 9.59  ? 996  THR A O   1 
ATOM   1115 C CB  . THR A 1 153 ? 12.105 14.681  16.710  1.00 11.59 ? 996  THR A CB  1 
ATOM   1116 O OG1 . THR A 1 153 ? 11.418 15.907  16.987  1.00 13.19 ? 996  THR A OG1 1 
ATOM   1117 C CG2 . THR A 1 153 ? 11.485 13.544  17.541  1.00 12.29 ? 996  THR A CG2 1 
ATOM   1118 N N   . GLU A 1 154 ? 14.524 13.166  15.570  1.00 10.95 ? 997  GLU A N   1 
ATOM   1119 C CA  . GLU A 1 154 ? 15.180 11.894  15.254  1.00 10.56 ? 997  GLU A CA  1 
ATOM   1120 C C   . GLU A 1 154 ? 16.631 11.895  15.699  1.00 9.95  ? 997  GLU A C   1 
ATOM   1121 O O   . GLU A 1 154 ? 17.125 10.898  16.219  1.00 9.82  ? 997  GLU A O   1 
ATOM   1122 C CB  . GLU A 1 154 ? 15.137 11.593  13.755  1.00 14.13 ? 997  GLU A CB  1 
ATOM   1123 C CG  . GLU A 1 154 ? 13.766 11.423  13.168  1.00 13.75 ? 997  GLU A CG  1 
ATOM   1124 C CD  . GLU A 1 154 ? 13.055 10.165  13.622  1.00 19.42 ? 997  GLU A CD  1 
ATOM   1125 O OE1 . GLU A 1 154 ? 13.715 9.219   14.097  1.00 19.96 ? 997  GLU A OE1 1 
ATOM   1126 O OE2 . GLU A 1 154 ? 11.817 10.129  13.497  1.00 19.71 ? 997  GLU A OE2 1 
ATOM   1127 N N   . LEU A 1 155 ? 17.312 13.016  15.486  1.00 8.31  ? 998  LEU A N   1 
ATOM   1128 C CA  . LEU A 1 155 ? 18.755 13.053  15.715  1.00 9.61  ? 998  LEU A CA  1 
ATOM   1129 C C   . LEU A 1 155 ? 19.107 13.052  17.201  1.00 9.67  ? 998  LEU A C   1 
ATOM   1130 O O   . LEU A 1 155 ? 20.028 12.351  17.626  1.00 8.00  ? 998  LEU A O   1 
ATOM   1131 C CB  . LEU A 1 155 ? 19.388 14.236  14.975  1.00 8.99  ? 998  LEU A CB  1 
ATOM   1132 C CG  . LEU A 1 155 ? 20.910 14.250  14.892  1.00 10.80 ? 998  LEU A CG  1 
ATOM   1133 C CD1 . LEU A 1 155 ? 21.481 12.861  14.562  1.00 8.00  ? 998  LEU A CD1 1 
ATOM   1134 C CD2 . LEU A 1 155 ? 21.355 15.288  13.871  1.00 7.02  ? 998  LEU A CD2 1 
ATOM   1135 N N   . TRP A 1 156 ? 18.370 13.808  18.011  1.00 9.98  ? 999  TRP A N   1 
ATOM   1136 C CA  . TRP A 1 156 ? 18.571 13.711  19.450  1.00 9.57  ? 999  TRP A CA  1 
ATOM   1137 C C   . TRP A 1 156 ? 18.234 12.314  19.996  1.00 9.45  ? 999  TRP A C   1 
ATOM   1138 O O   . TRP A 1 156 ? 18.883 11.836  20.922  1.00 10.16 ? 999  TRP A O   1 
ATOM   1139 C CB  . TRP A 1 156 ? 17.790 14.792  20.210  1.00 9.12  ? 999  TRP A CB  1 
ATOM   1140 C CG  . TRP A 1 156 ? 18.416 16.159  20.118  1.00 9.44  ? 999  TRP A CG  1 
ATOM   1141 C CD1 . TRP A 1 156 ? 17.833 17.294  19.625  1.00 12.63 ? 999  TRP A CD1 1 
ATOM   1142 C CD2 . TRP A 1 156 ? 19.744 16.536  20.524  1.00 7.93  ? 999  TRP A CD2 1 
ATOM   1143 N NE1 . TRP A 1 156 ? 18.707 18.347  19.708  1.00 9.92  ? 999  TRP A NE1 1 
ATOM   1144 C CE2 . TRP A 1 156 ? 19.889 17.911  20.246  1.00 10.46 ? 999  TRP A CE2 1 
ATOM   1145 C CE3 . TRP A 1 156 ? 20.821 15.844  21.091  1.00 8.03  ? 999  TRP A CE3 1 
ATOM   1146 C CZ2 . TRP A 1 156 ? 21.069 18.614  20.517  1.00 8.94  ? 999  TRP A CZ2 1 
ATOM   1147 C CZ3 . TRP A 1 156 ? 21.990 16.540  21.356  1.00 9.07  ? 999  TRP A CZ3 1 
ATOM   1148 C CH2 . TRP A 1 156 ? 22.106 17.914  21.070  1.00 8.64  ? 999  TRP A CH2 1 
ATOM   1149 N N   . ALA A 1 157 ? 17.226 11.654  19.432  1.00 9.07  ? 1000 ALA A N   1 
ATOM   1150 C CA  . ALA A 1 157 ? 16.883 10.309  19.893  1.00 9.53  ? 1000 ALA A CA  1 
ATOM   1151 C C   . ALA A 1 157 ? 18.039 9.376   19.589  1.00 10.35 ? 1000 ALA A C   1 
ATOM   1152 O O   . ALA A 1 157 ? 18.392 8.520   20.393  1.00 12.84 ? 1000 ALA A O   1 
ATOM   1153 C CB  . ALA A 1 157 ? 15.627 9.811   19.201  1.00 10.66 ? 1000 ALA A CB  1 
ATOM   1154 N N   . TRP A 1 158 ? 18.618 9.544   18.404  1.00 11.04 ? 1001 TRP A N   1 
ATOM   1155 C CA  . TRP A 1 158 ? 19.704 8.678   17.970  1.00 10.39 ? 1001 TRP A CA  1 
ATOM   1156 C C   . TRP A 1 158 ? 20.934 8.909   18.829  1.00 8.25  ? 1001 TRP A C   1 
ATOM   1157 O O   . TRP A 1 158 ? 21.573 7.960   19.266  1.00 10.20 ? 1001 TRP A O   1 
ATOM   1158 C CB  . TRP A 1 158 ? 20.010 8.915   16.493  1.00 9.46  ? 1001 TRP A CB  1 
ATOM   1159 C CG  . TRP A 1 158 ? 21.118 8.055   15.932  1.00 10.46 ? 1001 TRP A CG  1 
ATOM   1160 C CD1 . TRP A 1 158 ? 21.017 6.768   15.494  1.00 12.68 ? 1001 TRP A CD1 1 
ATOM   1161 C CD2 . TRP A 1 158 ? 22.475 8.454   15.709  1.00 8.27  ? 1001 TRP A CD2 1 
ATOM   1162 N NE1 . TRP A 1 158 ? 22.244 6.326   15.019  1.00 10.93 ? 1001 TRP A NE1 1 
ATOM   1163 C CE2 . TRP A 1 158 ? 23.155 7.343   15.150  1.00 9.17  ? 1001 TRP A CE2 1 
ATOM   1164 C CE3 . TRP A 1 158 ? 23.187 9.637   15.942  1.00 12.05 ? 1001 TRP A CE3 1 
ATOM   1165 C CZ2 . TRP A 1 158 ? 24.506 7.388   14.816  1.00 12.39 ? 1001 TRP A CZ2 1 
ATOM   1166 C CZ3 . TRP A 1 158 ? 24.533 9.676   15.615  1.00 12.46 ? 1001 TRP A CZ3 1 
ATOM   1167 C CH2 . TRP A 1 158 ? 25.177 8.557   15.056  1.00 13.90 ? 1001 TRP A CH2 1 
ATOM   1168 N N   . LEU A 1 159 ? 21.260 10.168  19.092  1.00 8.23  ? 1002 LEU A N   1 
ATOM   1169 C CA  . LEU A 1 159 ? 22.398 10.460  19.954  1.00 8.34  ? 1002 LEU A CA  1 
ATOM   1170 C C   . LEU A 1 159 ? 22.167 9.918   21.359  1.00 9.31  ? 1002 LEU A C   1 
ATOM   1171 O O   . LEU A 1 159 ? 23.079 9.370   21.970  1.00 11.27 ? 1002 LEU A O   1 
ATOM   1172 C CB  . LEU A 1 159 ? 22.679 11.967  20.003  1.00 7.53  ? 1002 LEU A CB  1 
ATOM   1173 C CG  . LEU A 1 159 ? 23.207 12.582  18.699  1.00 7.62  ? 1002 LEU A CG  1 
ATOM   1174 C CD1 . LEU A 1 159 ? 23.100 14.109  18.729  1.00 10.97 ? 1002 LEU A CD1 1 
ATOM   1175 C CD2 . LEU A 1 159 ? 24.643 12.155  18.448  1.00 8.46  ? 1002 LEU A CD2 1 
ATOM   1176 N N   . ALA A 1 160 ? 20.944 10.062  21.867  1.00 9.14  ? 1003 ALA A N   1 
ATOM   1177 C CA  . ALA A 1 160 ? 20.633 9.603   23.220  1.00 10.61 ? 1003 ALA A CA  1 
ATOM   1178 C C   . ALA A 1 160 ? 20.761 8.091   23.308  1.00 10.48 ? 1003 ALA A C   1 
ATOM   1179 O O   . ALA A 1 160 ? 21.183 7.540   24.327  1.00 15.70 ? 1003 ALA A O   1 
ATOM   1180 C CB  . ALA A 1 160 ? 19.215 10.048  23.630  1.00 11.86 ? 1003 ALA A CB  1 
ATOM   1181 N N   . ASP A 1 161 ? 20.415 7.426   22.214  1.00 14.15 ? 1004 ASP A N   1 
ATOM   1182 C CA  . ASP A 1 161 ? 20.438 5.976   22.129  1.00 14.09 ? 1004 ASP A CA  1 
ATOM   1183 C C   . ASP A 1 161 ? 21.866 5.447   21.980  1.00 17.65 ? 1004 ASP A C   1 
ATOM   1184 O O   . ASP A 1 161 ? 22.225 4.457   22.606  1.00 23.02 ? 1004 ASP A O   1 
ATOM   1185 C CB  . ASP A 1 161 ? 19.563 5.518   20.955  1.00 17.91 ? 1004 ASP A CB  1 
ATOM   1186 C CG  . ASP A 1 161 ? 19.489 4.006   20.829  1.00 30.77 ? 1004 ASP A CG  1 
ATOM   1187 O OD1 . ASP A 1 161 ? 19.325 3.328   21.864  1.00 34.64 ? 1004 ASP A OD1 1 
ATOM   1188 O OD2 . ASP A 1 161 ? 19.593 3.497   19.690  1.00 34.56 ? 1004 ASP A OD2 1 
ATOM   1189 N N   . LYS A 1 162 ? 22.681 6.119   21.170  1.00 12.61 ? 1005 LYS A N   1 
ATOM   1190 C CA  . LYS A 1 162 ? 23.973 5.564   20.771  1.00 11.29 ? 1005 LYS A CA  1 
ATOM   1191 C C   . LYS A 1 162 ? 25.162 6.014   21.620  1.00 12.82 ? 1005 LYS A C   1 
ATOM   1192 O O   . LYS A 1 162 ? 26.053 5.205   21.914  1.00 12.82 ? 1005 LYS A O   1 
ATOM   1193 C CB  . LYS A 1 162 ? 24.253 5.874   19.293  1.00 12.06 ? 1005 LYS A CB  1 
ATOM   1194 C CG  . LYS A 1 162 ? 23.265 5.248   18.325  1.00 15.24 ? 1005 LYS A CG  1 
ATOM   1195 C CD  . LYS A 1 162 ? 23.359 3.732   18.325  1.00 20.07 ? 1005 LYS A CD  1 
ATOM   1196 C CE  . LYS A 1 162 ? 22.384 3.121   17.331  1.00 25.48 ? 1005 LYS A CE  1 
ATOM   1197 N NZ  . LYS A 1 162 ? 22.417 1.630   17.375  1.00 25.94 ? 1005 LYS A NZ  1 
ATOM   1198 N N   . LEU A 1 163 ? 25.197 7.286   22.015  1.00 11.83 ? 1006 LEU A N   1 
ATOM   1199 C CA  . LEU A 1 163 ? 26.366 7.790   22.751  1.00 12.52 ? 1006 LEU A CA  1 
ATOM   1200 C C   . LEU A 1 163 ? 26.696 7.016   24.036  1.00 13.34 ? 1006 LEU A C   1 
ATOM   1201 O O   . LEU A 1 163 ? 27.868 6.784   24.325  1.00 12.35 ? 1006 LEU A O   1 
ATOM   1202 C CB  . LEU A 1 163 ? 26.231 9.278   23.072  1.00 11.74 ? 1006 LEU A CB  1 
ATOM   1203 C CG  . LEU A 1 163 ? 26.438 10.234  21.903  1.00 12.43 ? 1006 LEU A CG  1 
ATOM   1204 C CD1 . LEU A 1 163 ? 26.112 11.662  22.343  1.00 15.88 ? 1006 LEU A CD1 1 
ATOM   1205 C CD2 . LEU A 1 163 ? 27.867 10.134  21.391  1.00 14.59 ? 1006 LEU A CD2 1 
ATOM   1206 N N   . PRO A 1 164 ? 25.679 6.635   24.821  1.00 12.37 ? 1007 PRO A N   1 
ATOM   1207 C CA  . PRO A 1 164 ? 26.061 5.953   26.066  1.00 13.33 ? 1007 PRO A CA  1 
ATOM   1208 C C   . PRO A 1 164 ? 26.771 4.608   25.837  1.00 12.93 ? 1007 PRO A C   1 
ATOM   1209 O O   . PRO A 1 164 ? 27.506 4.151   26.719  1.00 18.59 ? 1007 PRO A O   1 
ATOM   1210 C CB  . PRO A 1 164 ? 24.716 5.755   26.783  1.00 13.47 ? 1007 PRO A CB  1 
ATOM   1211 C CG  . PRO A 1 164 ? 23.846 6.862   26.254  1.00 12.22 ? 1007 PRO A CG  1 
ATOM   1212 C CD  . PRO A 1 164 ? 24.246 6.981   24.795  1.00 13.28 ? 1007 PRO A CD  1 
ATOM   1213 N N   . GLY A 1 165 ? 26.581 3.997   24.668  1.00 13.68 ? 1008 GLY A N   1 
ATOM   1214 C CA  . GLY A 1 165 ? 27.162 2.691   24.402  1.00 11.71 ? 1008 GLY A CA  1 
ATOM   1215 C C   . GLY A 1 165 ? 28.435 2.708   23.576  1.00 14.98 ? 1008 GLY A C   1 
ATOM   1216 O O   . GLY A 1 165 ? 28.990 1.656   23.249  1.00 16.92 ? 1008 GLY A O   1 
ATOM   1217 N N   . LEU A 1 166 ? 28.895 3.905   23.232  1.00 12.76 ? 1009 LEU A N   1 
ATOM   1218 C CA  . LEU A 1 166 ? 30.116 4.067   22.451  1.00 11.05 ? 1009 LEU A CA  1 
ATOM   1219 C C   . LEU A 1 166 ? 31.284 4.351   23.382  1.00 14.68 ? 1009 LEU A C   1 
ATOM   1220 O O   . LEU A 1 166 ? 31.196 5.222   24.249  1.00 16.74 ? 1009 LEU A O   1 
ATOM   1221 C CB  . LEU A 1 166 ? 29.962 5.215   21.442  1.00 12.80 ? 1009 LEU A CB  1 
ATOM   1222 C CG  . LEU A 1 166 ? 29.015 4.972   20.262  1.00 10.71 ? 1009 LEU A CG  1 
ATOM   1223 C CD1 . LEU A 1 166 ? 28.875 6.210   19.390  1.00 13.32 ? 1009 LEU A CD1 1 
ATOM   1224 C CD2 . LEU A 1 166 ? 29.479 3.776   19.435  1.00 14.27 ? 1009 LEU A CD2 1 
ATOM   1225 N N   . PRO A 1 167 ? 32.385 3.607   23.215  1.00 18.66 ? 1010 PRO A N   1 
ATOM   1226 C CA  . PRO A 1 167 ? 33.580 3.853   24.024  1.00 24.98 ? 1010 PRO A CA  1 
ATOM   1227 C C   . PRO A 1 167 ? 34.186 5.195   23.641  1.00 22.95 ? 1010 PRO A C   1 
ATOM   1228 O O   . PRO A 1 167 ? 34.027 5.623   22.499  1.00 20.52 ? 1010 PRO A O   1 
ATOM   1229 C CB  . PRO A 1 167 ? 34.517 2.709   23.625  1.00 27.84 ? 1010 PRO A CB  1 
ATOM   1230 C CG  . PRO A 1 167 ? 34.098 2.347   22.247  1.00 28.56 ? 1010 PRO A CG  1 
ATOM   1231 C CD  . PRO A 1 167 ? 32.600 2.562   22.201  1.00 20.18 ? 1010 PRO A CD  1 
ATOM   1232 N N   . PRO A 1 168 ? 34.871 5.854   24.585  1.00 24.37 ? 1011 PRO A N   1 
ATOM   1233 C CA  . PRO A 1 168 ? 35.438 7.179   24.307  1.00 21.15 ? 1011 PRO A CA  1 
ATOM   1234 C C   . PRO A 1 168 ? 36.361 7.212   23.090  1.00 21.86 ? 1011 PRO A C   1 
ATOM   1235 O O   . PRO A 1 168 ? 36.401 8.230   22.414  1.00 17.39 ? 1011 PRO A O   1 
ATOM   1236 C CB  . PRO A 1 168 ? 36.205 7.520   25.593  1.00 30.15 ? 1011 PRO A CB  1 
ATOM   1237 C CG  . PRO A 1 168 ? 36.342 6.217   26.337  1.00 33.71 ? 1011 PRO A CG  1 
ATOM   1238 C CD  . PRO A 1 168 ? 35.132 5.418   25.967  1.00 26.59 ? 1011 PRO A CD  1 
ATOM   1239 N N   . LYS A 1 169 ? 37.077 6.127   22.803  1.00 21.02 ? 1012 LYS A N   1 
ATOM   1240 C CA  . LYS A 1 169 ? 38.000 6.115   21.666  1.00 22.45 ? 1012 LYS A CA  1 
ATOM   1241 C C   . LYS A 1 169 ? 37.280 6.245   20.325  1.00 23.49 ? 1012 LYS A C   1 
ATOM   1242 O O   . LYS A 1 169 ? 37.895 6.601   19.314  1.00 24.83 ? 1012 LYS A O   1 
ATOM   1243 C CB  . LYS A 1 169 ? 38.843 4.832   21.667  1.00 30.71 ? 1012 LYS A CB  1 
ATOM   1244 C CG  . LYS A 1 169 ? 38.314 3.735   20.739  1.00 41.10 ? 1012 LYS A CG  1 
ATOM   1245 C CD  . LYS A 1 169 ? 38.847 2.368   21.136  1.00 47.04 ? 1012 LYS A CD  1 
ATOM   1246 C CE  . LYS A 1 169 ? 38.126 1.853   22.371  1.00 48.02 ? 1012 LYS A CE  1 
ATOM   1247 N NZ  . LYS A 1 169 ? 38.890 0.792   23.076  1.00 49.33 ? 1012 LYS A NZ  1 
ATOM   1248 N N   . SER A 1 170 ? 35.982 5.946   20.317  1.00 21.01 ? 1013 SER A N   1 
ATOM   1249 C CA  . SER A 1 170 ? 35.192 5.946   19.086  1.00 19.77 ? 1013 SER A CA  1 
ATOM   1250 C C   . SER A 1 170 ? 34.491 7.272   18.852  1.00 22.98 ? 1013 SER A C   1 
ATOM   1251 O O   . SER A 1 170 ? 33.733 7.421   17.892  1.00 26.20 ? 1013 SER A O   1 
ATOM   1252 C CB  . SER A 1 170 ? 34.141 4.833   19.123  1.00 17.30 ? 1013 SER A CB  1 
ATOM   1253 O OG  . SER A 1 170 ? 34.740 3.560   19.305  1.00 26.05 ? 1013 SER A OG  1 
ATOM   1254 N N   . VAL A 1 171 ? 34.732 8.231   19.734  1.00 16.53 ? 1014 VAL A N   1 
ATOM   1255 C CA  . VAL A 1 171 ? 34.005 9.488   19.680  1.00 21.43 ? 1014 VAL A CA  1 
ATOM   1256 C C   . VAL A 1 171 ? 34.942 10.656  19.924  1.00 17.13 ? 1014 VAL A C   1 
ATOM   1257 O O   . VAL A 1 171 ? 35.567 10.763  20.977  1.00 15.88 ? 1014 VAL A O   1 
ATOM   1258 C CB  . VAL A 1 171 ? 32.876 9.533   20.722  1.00 21.08 ? 1014 VAL A CB  1 
ATOM   1259 C CG1 . VAL A 1 171 ? 32.090 10.835  20.596  1.00 23.98 ? 1014 VAL A CG1 1 
ATOM   1260 C CG2 . VAL A 1 171 ? 31.960 8.329   20.573  1.00 19.53 ? 1014 VAL A CG2 1 
ATOM   1261 N N   . SER A 1 172 ? 35.055 11.520  18.925  1.00 13.34 ? 1015 SER A N   1 
ATOM   1262 C CA  . SER A 1 172 ? 35.807 12.753  19.063  1.00 12.18 ? 1015 SER A CA  1 
ATOM   1263 C C   . SER A 1 172 ? 35.162 13.662  20.113  1.00 14.44 ? 1015 SER A C   1 
ATOM   1264 O O   . SER A 1 172 ? 34.016 14.084  19.958  1.00 12.75 ? 1015 SER A O   1 
ATOM   1265 C CB  . SER A 1 172 ? 35.876 13.472  17.708  1.00 11.80 ? 1015 SER A CB  1 
ATOM   1266 O OG  . SER A 1 172 ? 36.236 14.827  17.869  1.00 12.76 ? 1015 SER A OG  1 
ATOM   1267 N N   . LYS A 1 173 ? 35.900 13.986  21.172  1.00 13.15 ? 1016 LYS A N   1 
ATOM   1268 C CA  . LYS A 1 173 ? 35.366 14.887  22.190  1.00 9.82  ? 1016 LYS A CA  1 
ATOM   1269 C C   . LYS A 1 173 ? 35.046 16.242  21.603  1.00 10.33 ? 1016 LYS A C   1 
ATOM   1270 O O   . LYS A 1 173 ? 34.060 16.876  21.979  1.00 11.83 ? 1016 LYS A O   1 
ATOM   1271 C CB  . LYS A 1 173 ? 36.360 15.065  23.342  1.00 16.77 ? 1016 LYS A CB  1 
ATOM   1272 C CG  . LYS A 1 173 ? 36.525 13.831  24.193  1.00 20.85 ? 1016 LYS A CG  1 
ATOM   1273 C CD  . LYS A 1 173 ? 37.502 14.066  25.342  1.00 22.70 ? 1016 LYS A CD  1 
ATOM   1274 C CE  . LYS A 1 173 ? 37.088 15.255  26.199  1.00 24.17 ? 1016 LYS A CE  1 
ATOM   1275 N NZ  . LYS A 1 173 ? 38.037 15.451  27.326  1.00 26.87 ? 1016 LYS A NZ  1 
ATOM   1276 N N   . GLU A 1 174 ? 35.896 16.704  20.688  1.00 11.74 ? 1017 GLU A N   1 
ATOM   1277 C CA  . GLU A 1 174 ? 35.708 18.019  20.109  1.00 9.51  ? 1017 GLU A CA  1 
ATOM   1278 C C   . GLU A 1 174 ? 34.416 18.063  19.302  1.00 9.69  ? 1017 GLU A C   1 
ATOM   1279 O O   . GLU A 1 174 ? 33.721 19.080  19.294  1.00 11.82 ? 1017 GLU A O   1 
ATOM   1280 C CB  . GLU A 1 174 ? 36.891 18.385  19.210  1.00 18.13 ? 1017 GLU A CB  1 
ATOM   1281 C CG  . GLU A 1 174 ? 36.774 19.765  18.575  1.00 23.37 ? 1017 GLU A CG  1 
ATOM   1282 C CD  . GLU A 1 174 ? 36.562 20.889  19.579  1.00 25.63 ? 1017 GLU A CD  1 
ATOM   1283 O OE1 . GLU A 1 174 ? 36.956 20.760  20.760  1.00 19.99 ? 1017 GLU A OE1 1 
ATOM   1284 O OE2 . GLU A 1 174 ? 35.993 21.925  19.180  1.00 38.00 ? 1017 GLU A OE2 1 
ATOM   1285 N N   . ASP A 1 175 ? 34.112 16.978  18.593  1.00 7.29  ? 1018 ASP A N   1 
ATOM   1286 C CA  . ASP A 1 175 ? 32.869 16.948  17.832  1.00 7.21  ? 1018 ASP A CA  1 
ATOM   1287 C C   . ASP A 1 175 ? 31.654 16.949  18.758  1.00 8.15  ? 1018 ASP A C   1 
ATOM   1288 O O   . ASP A 1 175 ? 30.652 17.614  18.463  1.00 9.95  ? 1018 ASP A O   1 
ATOM   1289 C CB  . ASP A 1 175 ? 32.819 15.757  16.877  1.00 11.19 ? 1018 ASP A CB  1 
ATOM   1290 C CG  . ASP A 1 175 ? 31.873 15.998  15.715  1.00 10.13 ? 1018 ASP A CG  1 
ATOM   1291 O OD1 . ASP A 1 175 ? 32.193 16.878  14.887  1.00 11.09 ? 1018 ASP A OD1 1 
ATOM   1292 O OD2 . ASP A 1 175 ? 30.834 15.313  15.627  1.00 11.53 ? 1018 ASP A OD2 1 
ATOM   1293 N N   . ILE A 1 176 ? 31.724 16.210  19.865  1.00 8.94  ? 1019 ILE A N   1 
ATOM   1294 C CA  . ILE A 1 176 ? 30.652 16.303  20.872  1.00 8.14  ? 1019 ILE A CA  1 
ATOM   1295 C C   . ILE A 1 176 ? 30.520 17.740  21.412  1.00 11.57 ? 1019 ILE A C   1 
ATOM   1296 O O   . ILE A 1 176 ? 29.414 18.263  21.558  1.00 11.01 ? 1019 ILE A O   1 
ATOM   1297 C CB  . ILE A 1 176 ? 30.844 15.288  22.017  1.00 10.84 ? 1019 ILE A CB  1 
ATOM   1298 C CG1 . ILE A 1 176 ? 30.917 13.858  21.471  1.00 11.07 ? 1019 ILE A CG1 1 
ATOM   1299 C CG2 . ILE A 1 176 ? 29.725 15.417  23.050  1.00 16.97 ? 1019 ILE A CG2 1 
ATOM   1300 C CD1 . ILE A 1 176 ? 29.722 13.453  20.638  1.00 17.88 ? 1019 ILE A CD1 1 
ATOM   1301 N N   . HIS A 1 177 ? 31.644 18.399  21.690  1.00 12.39 ? 1020 HIS A N   1 
ATOM   1302 C CA  . HIS A 1 177 ? 31.593 19.803  22.095  1.00 11.34 ? 1020 HIS A CA  1 
ATOM   1303 C C   . HIS A 1 177 ? 30.776 20.661  21.118  1.00 10.83 ? 1020 HIS A C   1 
ATOM   1304 O O   . HIS A 1 177 ? 30.058 21.567  21.529  1.00 14.52 ? 1020 HIS A O   1 
ATOM   1305 C CB  . HIS A 1 177 ? 32.997 20.401  22.225  1.00 11.73 ? 1020 HIS A CB  1 
ATOM   1306 C CG  . HIS A 1 177 ? 33.613 20.239  23.581  1.00 17.39 ? 1020 HIS A CG  1 
ATOM   1307 N ND1 . HIS A 1 177 ? 33.285 21.046  24.650  1.00 14.20 ? 1020 HIS A ND1 1 
ATOM   1308 C CD2 . HIS A 1 177 ? 34.560 19.382  24.031  1.00 20.03 ? 1020 HIS A CD2 1 
ATOM   1309 C CE1 . HIS A 1 177 ? 33.996 20.684  25.703  1.00 18.02 ? 1020 HIS A CE1 1 
ATOM   1310 N NE2 . HIS A 1 177 ? 34.776 19.676  25.356  1.00 17.54 ? 1020 HIS A NE2 1 
ATOM   1311 N N   . SER A 1 178 ? 30.896 20.383  19.821  1.00 11.34 ? 1021 SER A N   1 
ATOM   1312 C CA  . SER A 1 178 ? 30.198 21.177  18.820  1.00 10.44 ? 1021 SER A CA  1 
ATOM   1313 C C   . SER A 1 178 ? 28.676 21.038  18.923  1.00 10.47 ? 1021 SER A C   1 
ATOM   1314 O O   . SER A 1 178 ? 27.944 21.886  18.417  1.00 13.71 ? 1021 SER A O   1 
ATOM   1315 C CB  . SER A 1 178 ? 30.674 20.828  17.404  1.00 9.34  ? 1021 SER A CB  1 
ATOM   1316 O OG  . SER A 1 178 ? 30.174 19.566  16.990  1.00 9.80  ? 1021 SER A OG  1 
ATOM   1317 N N   . MET A 1 179 ? 28.216 19.983  19.590  1.00 10.92 ? 1022 MET A N   1 
ATOM   1318 C CA  . MET A 1 179 ? 26.781 19.742  19.750  1.00 6.84  ? 1022 MET A CA  1 
ATOM   1319 C C   . MET A 1 179 ? 26.219 20.501  20.942  1.00 8.51  ? 1022 MET A C   1 
ATOM   1320 O O   . MET A 1 179 ? 25.012 20.693  21.059  1.00 10.32 ? 1022 MET A O   1 
ATOM   1321 C CB  . MET A 1 179 ? 26.507 18.257  19.936  1.00 8.57  ? 1022 MET A CB  1 
ATOM   1322 C CG  . MET A 1 179 ? 27.047 17.397  18.808  1.00 6.90  ? 1022 MET A CG  1 
ATOM   1323 S SD  . MET A 1 179 ? 26.824 15.661  19.203  1.00 10.55 ? 1022 MET A SD  1 
ATOM   1324 C CE  . MET A 1 179 ? 27.818 14.982  17.873  1.00 9.82  ? 1022 MET A CE  1 
ATOM   1325 N N   . VAL A 1 180 ? 27.095 20.921  21.842  1.00 9.83  ? 1023 VAL A N   1 
ATOM   1326 C CA  . VAL A 1 180 ? 26.628 21.466  23.118  1.00 9.24  ? 1023 VAL A CA  1 
ATOM   1327 C C   . VAL A 1 180 ? 25.746 22.732  23.003  1.00 7.75  ? 1023 VAL A C   1 
ATOM   1328 O O   . VAL A 1 180 ? 24.724 22.844  23.682  1.00 9.81  ? 1023 VAL A O   1 
ATOM   1329 C CB  . VAL A 1 180 ? 27.795 21.673  24.105  1.00 7.42  ? 1023 VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 180 ? 27.329 22.473  25.319  1.00 11.31 ? 1023 VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 180 ? 28.371 20.329  24.544  1.00 11.34 ? 1023 VAL A CG2 1 
ATOM   1332 N N   . PRO A 1 181 ? 26.117 23.686  22.137  1.00 9.58  ? 1024 PRO A N   1 
ATOM   1333 C CA  . PRO A 1 181 ? 25.214 24.840  22.006  1.00 10.59 ? 1024 PRO A CA  1 
ATOM   1334 C C   . PRO A 1 181 ? 23.822 24.434  21.544  1.00 13.92 ? 1024 PRO A C   1 
ATOM   1335 O O   . PRO A 1 181 ? 22.825 25.047  21.945  1.00 13.06 ? 1024 PRO A O   1 
ATOM   1336 C CB  . PRO A 1 181 ? 25.899 25.699  20.938  1.00 11.23 ? 1024 PRO A CB  1 
ATOM   1337 C CG  . PRO A 1 181 ? 27.346 25.341  21.045  1.00 14.73 ? 1024 PRO A CG  1 
ATOM   1338 C CD  . PRO A 1 181 ? 27.365 23.871  21.379  1.00 13.52 ? 1024 PRO A CD  1 
ATOM   1339 N N   . HIS A 1 182 ? 23.743 23.403  20.713  1.00 10.69 ? 1025 HIS A N   1 
ATOM   1340 C CA  . HIS A 1 182 ? 22.446 22.978  20.192  1.00 8.70  ? 1025 HIS A CA  1 
ATOM   1341 C C   . HIS A 1 182 ? 21.698 22.228  21.283  1.00 12.57 ? 1025 HIS A C   1 
ATOM   1342 O O   . HIS A 1 182 ? 20.494 22.375  21.426  1.00 11.89 ? 1025 HIS A O   1 
ATOM   1343 C CB  . HIS A 1 182 ? 22.627 22.128  18.943  1.00 7.53  ? 1025 HIS A CB  1 
ATOM   1344 C CG  . HIS A 1 182 ? 23.486 22.787  17.914  1.00 15.64 ? 1025 HIS A CG  1 
ATOM   1345 N ND1 . HIS A 1 182 ? 23.083 23.909  17.223  1.00 24.51 ? 1025 HIS A ND1 1 
ATOM   1346 C CD2 . HIS A 1 182 ? 24.738 22.507  17.484  1.00 16.90 ? 1025 HIS A CD2 1 
ATOM   1347 C CE1 . HIS A 1 182 ? 24.046 24.282  16.398  1.00 24.67 ? 1025 HIS A CE1 1 
ATOM   1348 N NE2 . HIS A 1 182 ? 25.061 23.449  16.537  1.00 23.13 ? 1025 HIS A NE2 1 
ATOM   1349 N N   . LEU A 1 183 ? 22.421 21.450  22.079  1.00 9.40  ? 1026 LEU A N   1 
ATOM   1350 C CA  . LEU A 1 183 ? 21.793 20.770  23.199  1.00 7.36  ? 1026 LEU A CA  1 
ATOM   1351 C C   . LEU A 1 183 ? 21.170 21.808  24.136  1.00 10.46 ? 1026 LEU A C   1 
ATOM   1352 O O   . LEU A 1 183 ? 20.029 21.659  24.577  1.00 10.72 ? 1026 LEU A O   1 
ATOM   1353 C CB  . LEU A 1 183 ? 22.835 19.961  23.960  1.00 7.15  ? 1026 LEU A CB  1 
ATOM   1354 C CG  . LEU A 1 183 ? 22.315 19.227  25.194  1.00 6.36  ? 1026 LEU A CG  1 
ATOM   1355 C CD1 . LEU A 1 183 ? 21.407 18.103  24.779  1.00 9.12  ? 1026 LEU A CD1 1 
ATOM   1356 C CD2 . LEU A 1 183 ? 23.505 18.685  25.964  1.00 8.45  ? 1026 LEU A CD2 1 
ATOM   1357 N N   . TYR A 1 184 ? 21.924 22.862  24.446  1.00 10.06 ? 1027 TYR A N   1 
ATOM   1358 C CA  . TYR A 1 184 ? 21.458 23.854  25.417  1.00 11.42 ? 1027 TYR A CA  1 
ATOM   1359 C C   . TYR A 1 184 ? 20.253 24.650  24.910  1.00 15.65 ? 1027 TYR A C   1 
ATOM   1360 O O   . TYR A 1 184 ? 19.398 25.075  25.691  1.00 16.00 ? 1027 TYR A O   1 
ATOM   1361 C CB  . TYR A 1 184 ? 22.599 24.785  25.838  1.00 9.56  ? 1027 TYR A CB  1 
ATOM   1362 C CG  . TYR A 1 184 ? 23.647 24.105  26.699  1.00 10.17 ? 1027 TYR A CG  1 
ATOM   1363 C CD1 . TYR A 1 184 ? 23.465 22.801  27.149  1.00 9.85  ? 1027 TYR A CD1 1 
ATOM   1364 C CD2 . TYR A 1 184 ? 24.805 24.777  27.084  1.00 10.53 ? 1027 TYR A CD2 1 
ATOM   1365 C CE1 . TYR A 1 184 ? 24.414 22.176  27.942  1.00 9.98  ? 1027 TYR A CE1 1 
ATOM   1366 C CE2 . TYR A 1 184 ? 25.764 24.157  27.883  1.00 9.50  ? 1027 TYR A CE2 1 
ATOM   1367 C CZ  . TYR A 1 184 ? 25.555 22.857  28.304  1.00 9.31  ? 1027 TYR A CZ  1 
ATOM   1368 O OH  . TYR A 1 184 ? 26.495 22.228  29.091  1.00 13.19 ? 1027 TYR A OH  1 
ATOM   1369 N N   . ALA A 1 185 ? 20.170 24.840  23.601  1.00 13.10 ? 1028 ALA A N   1 
ATOM   1370 C CA  . ALA A 1 185 ? 18.989 25.481  23.031  1.00 10.43 ? 1028 ALA A CA  1 
ATOM   1371 C C   . ALA A 1 185 ? 17.803 24.521  22.991  1.00 15.39 ? 1028 ALA A C   1 
ATOM   1372 O O   . ALA A 1 185 ? 16.680 24.894  23.337  1.00 16.33 ? 1028 ALA A O   1 
ATOM   1373 C CB  . ALA A 1 185 ? 19.285 25.991  21.648  1.00 9.54  ? 1028 ALA A CB  1 
ATOM   1374 N N   . HIS A 1 186 ? 18.054 23.287  22.565  1.00 12.09 ? 1029 HIS A N   1 
ATOM   1375 C CA  . HIS A 1 186 ? 16.965 22.348  22.294  1.00 10.67 ? 1029 HIS A CA  1 
ATOM   1376 C C   . HIS A 1 186 ? 16.338 21.732  23.542  1.00 16.32 ? 1029 HIS A C   1 
ATOM   1377 O O   . HIS A 1 186 ? 15.202 21.271  23.493  1.00 15.46 ? 1029 HIS A O   1 
ATOM   1378 C CB  . HIS A 1 186 ? 17.404 21.279  21.282  1.00 10.60 ? 1029 HIS A CB  1 
ATOM   1379 C CG  . HIS A 1 186 ? 17.812 21.847  19.961  1.00 10.04 ? 1029 HIS A CG  1 
ATOM   1380 N ND1 . HIS A 1 186 ? 18.470 21.111  18.996  1.00 10.45 ? 1029 HIS A ND1 1 
ATOM   1381 C CD2 . HIS A 1 186 ? 17.667 23.091  19.447  1.00 8.91  ? 1029 HIS A CD2 1 
ATOM   1382 C CE1 . HIS A 1 186 ? 18.712 21.877  17.951  1.00 10.59 ? 1029 HIS A CE1 1 
ATOM   1383 N NE2 . HIS A 1 186 ? 18.238 23.088  18.202  1.00 11.27 ? 1029 HIS A NE2 1 
ATOM   1384 N N   . ILE A 1 187 ? 17.075 21.729  24.651  1.00 12.65 ? 1030 ILE A N   1 
ATOM   1385 C CA  . ILE A 1 187 ? 16.511 21.386  25.944  1.00 17.60 ? 1030 ILE A CA  1 
ATOM   1386 C C   . ILE A 1 187 ? 15.309 22.273  26.221  1.00 16.89 ? 1030 ILE A C   1 
ATOM   1387 O O   . ILE A 1 187 ? 14.398 21.884  26.945  1.00 21.23 ? 1030 ILE A O   1 
ATOM   1388 C CB  . ILE A 1 187 ? 17.551 21.593  27.059  1.00 21.52 ? 1030 ILE A CB  1 
ATOM   1389 C CG1 . ILE A 1 187 ? 18.473 20.382  27.141  1.00 22.38 ? 1030 ILE A CG1 1 
ATOM   1390 C CG2 . ILE A 1 187 ? 16.874 21.835  28.400  1.00 32.44 ? 1030 ILE A CG2 1 
ATOM   1391 C CD1 . ILE A 1 187 ? 19.658 20.628  28.031  1.00 22.79 ? 1030 ILE A CD1 1 
ATOM   1392 N N   . CYS A 1 188 ? 15.311 23.459  25.617  1.00 14.83 ? 1031 CYS A N   1 
ATOM   1393 C CA  . CYS A 1 188 ? 14.247 24.440  25.808  1.00 19.69 ? 1031 CYS A CA  1 
ATOM   1394 C C   . CYS A 1 188 ? 13.440 24.694  24.538  1.00 22.79 ? 1031 CYS A C   1 
ATOM   1395 O O   . CYS A 1 188 ? 12.715 25.688  24.452  1.00 25.24 ? 1031 CYS A O   1 
ATOM   1396 C CB  . CYS A 1 188 ? 14.831 25.766  26.283  1.00 22.11 ? 1031 CYS A CB  1 
ATOM   1397 S SG  . CYS A 1 188 ? 15.641 25.659  27.883  1.00 30.97 ? 1031 CYS A SG  1 
ATOM   1398 N N   . ASP A 1 189 ? 13.572 23.808  23.555  1.00 19.54 ? 1032 ASP A N   1 
ATOM   1399 C CA  . ASP A 1 189 ? 12.926 23.998  22.259  1.00 15.34 ? 1032 ASP A CA  1 
ATOM   1400 C C   . ASP A 1 189 ? 11.425 24.194  22.423  1.00 13.31 ? 1032 ASP A C   1 
ATOM   1401 O O   . ASP A 1 189 ? 10.834 23.728  23.388  1.00 17.24 ? 1032 ASP A O   1 
ATOM   1402 C CB  . ASP A 1 189 ? 13.205 22.801  21.349  1.00 17.34 ? 1032 ASP A CB  1 
ATOM   1403 C CG  . ASP A 1 189 ? 12.976 23.111  19.887  1.00 24.72 ? 1032 ASP A CG  1 
ATOM   1404 O OD1 . ASP A 1 189 ? 11.863 22.850  19.383  1.00 20.00 ? 1032 ASP A OD1 1 
ATOM   1405 O OD2 . ASP A 1 189 ? 13.911 23.612  19.233  1.00 24.57 ? 1032 ASP A OD2 1 
ATOM   1406 N N   . ARG A 1 190 ? 10.824 24.897  21.472  1.00 16.64 ? 1033 ARG A N   1 
ATOM   1407 C CA  . ARG A 1 190 ? 9.382  25.136  21.497  1.00 24.54 ? 1033 ARG A CA  1 
ATOM   1408 C C   . ARG A 1 190 ? 8.619  23.845  21.216  1.00 19.46 ? 1033 ARG A C   1 
ATOM   1409 O O   . ARG A 1 190 ? 7.447  23.700  21.588  1.00 20.60 ? 1033 ARG A O   1 
ATOM   1410 C CB  . ARG A 1 190 ? 9.013  26.202  20.461  1.00 31.69 ? 1033 ARG A CB  1 
ATOM   1411 C CG  . ARG A 1 190 ? 9.483  25.864  19.051  1.00 39.17 ? 1033 ARG A CG  1 
ATOM   1412 C CD  . ARG A 1 190 ? 9.456  27.078  18.132  1.00 52.92 ? 1033 ARG A CD  1 
ATOM   1413 N NE  . ARG A 1 190 ? 9.953  26.755  16.796  1.00 63.60 ? 1033 ARG A NE  1 
ATOM   1414 C CZ  . ARG A 1 190 ? 11.241 26.624  16.487  1.00 71.73 ? 1033 ARG A CZ  1 
ATOM   1415 N NH1 . ARG A 1 190 ? 12.171 26.783  17.420  1.00 75.72 ? 1033 ARG A NH1 1 
ATOM   1416 N NH2 . ARG A 1 190 ? 11.601 26.330  15.246  1.00 72.12 ? 1033 ARG A NH2 1 
ATOM   1417 N N   . ASN A 1 191 ? 9.291  22.907  20.558  1.00 14.23 ? 1034 ASN A N   1 
ATOM   1418 C CA  . ASN A 1 191 ? 8.681  21.646  20.171  1.00 11.84 ? 1034 ASN A CA  1 
ATOM   1419 C C   . ASN A 1 191 ? 8.843  20.607  21.279  1.00 14.59 ? 1034 ASN A C   1 
ATOM   1420 O O   . ASN A 1 191 ? 9.958  20.330  21.719  1.00 13.08 ? 1034 ASN A O   1 
ATOM   1421 C CB  . ASN A 1 191 ? 9.310  21.143  18.871  1.00 10.53 ? 1034 ASN A CB  1 
ATOM   1422 C CG  . ASN A 1 191 ? 8.697  19.852  18.386  1.00 12.12 ? 1034 ASN A CG  1 
ATOM   1423 O OD1 . ASN A 1 191 ? 8.877  18.799  18.989  1.00 14.22 ? 1034 ASN A OD1 1 
ATOM   1424 N ND2 . ASN A 1 191 ? 7.973  19.926  17.271  1.00 13.15 ? 1034 ASN A ND2 1 
ATOM   1425 N N   . ALA A 1 192 ? 7.728  20.055  21.749  1.00 9.76  ? 1035 ALA A N   1 
ATOM   1426 C CA  . ALA A 1 192 ? 7.761  19.113  22.872  1.00 10.73 ? 1035 ALA A CA  1 
ATOM   1427 C C   . ALA A 1 192 ? 8.560  17.830  22.623  1.00 12.41 ? 1035 ALA A C   1 
ATOM   1428 O O   . ALA A 1 192 ? 9.123  17.258  23.561  1.00 12.81 ? 1035 ALA A O   1 
ATOM   1429 C CB  . ALA A 1 192 ? 6.333  18.769  23.332  1.00 12.55 ? 1035 ALA A CB  1 
ATOM   1430 N N   . ASP A 1 193 ? 8.575  17.359  21.379  1.00 11.81 ? 1036 ASP A N   1 
ATOM   1431 C CA  . ASP A 1 193 ? 9.302  16.144  21.025  1.00 11.74 ? 1036 ASP A CA  1 
ATOM   1432 C C   . ASP A 1 193 ? 10.806 16.413  21.049  1.00 10.43 ? 1036 ASP A C   1 
ATOM   1433 O O   . ASP A 1 193 ? 11.586 15.600  21.540  1.00 11.17 ? 1036 ASP A O   1 
ATOM   1434 C CB  . ASP A 1 193 ? 8.916  15.659  19.625  1.00 8.23  ? 1036 ASP A CB  1 
ATOM   1435 C CG  . ASP A 1 193 ? 7.462  15.216  19.523  1.00 20.95 ? 1036 ASP A CG  1 
ATOM   1436 O OD1 . ASP A 1 193 ? 6.839  14.958  20.573  1.00 17.85 ? 1036 ASP A OD1 1 
ATOM   1437 O OD2 . ASP A 1 193 ? 6.957  15.095  18.377  1.00 20.84 ? 1036 ASP A OD2 1 
ATOM   1438 N N   . VAL A 1 194 ? 11.194 17.548  20.480  1.00 9.54  ? 1037 VAL A N   1 
ATOM   1439 C CA  . VAL A 1 194 ? 12.586 18.000  20.510  1.00 8.56  ? 1037 VAL A CA  1 
ATOM   1440 C C   . VAL A 1 194 ? 13.096 18.151  21.946  1.00 12.13 ? 1037 VAL A C   1 
ATOM   1441 O O   . VAL A 1 194 ? 14.171 17.657  22.287  1.00 12.03 ? 1037 VAL A O   1 
ATOM   1442 C CB  . VAL A 1 194 ? 12.768 19.313  19.725  1.00 7.37  ? 1037 VAL A CB  1 
ATOM   1443 C CG1 . VAL A 1 194 ? 14.193 19.857  19.905  1.00 10.77 ? 1037 VAL A CG1 1 
ATOM   1444 C CG2 . VAL A 1 194 ? 12.476 19.076  18.253  1.00 12.00 ? 1037 VAL A CG2 1 
ATOM   1445 N N   . ARG A 1 195 ? 12.313 18.824  22.784  1.00 11.75 ? 1038 ARG A N   1 
ATOM   1446 C CA  . ARG A 1 195 ? 12.659 18.988  24.194  1.00 11.34 ? 1038 ARG A CA  1 
ATOM   1447 C C   . ARG A 1 195 ? 12.868 17.644  24.866  1.00 14.87 ? 1038 ARG A C   1 
ATOM   1448 O O   . ARG A 1 195 ? 13.871 17.433  25.547  1.00 11.52 ? 1038 ARG A O   1 
ATOM   1449 C CB  . ARG A 1 195 ? 11.565 19.753  24.950  1.00 14.83 ? 1038 ARG A CB  1 
ATOM   1450 C CG  . ARG A 1 195 ? 11.536 21.249  24.711  1.00 19.24 ? 1038 ARG A CG  1 
ATOM   1451 C CD  . ARG A 1 195 ? 10.792 21.998  25.838  1.00 19.66 ? 1038 ARG A CD  1 
ATOM   1452 N NE  . ARG A 1 195 ? 9.445  21.482  26.096  1.00 24.46 ? 1038 ARG A NE  1 
ATOM   1453 C CZ  . ARG A 1 195 ? 8.364  21.783  25.378  1.00 19.56 ? 1038 ARG A CZ  1 
ATOM   1454 N NH1 . ARG A 1 195 ? 8.455  22.588  24.330  1.00 20.21 ? 1038 ARG A NH1 1 
ATOM   1455 N NH2 . ARG A 1 195 ? 7.184  21.267  25.704  1.00 26.17 ? 1038 ARG A NH2 1 
ATOM   1456 N N   . LYS A 1 196 ? 11.914 16.737  24.689  1.00 11.32 ? 1039 LYS A N   1 
ATOM   1457 C CA  . LYS A 1 196 ? 11.997 15.430  25.329  1.00 11.55 ? 1039 LYS A CA  1 
ATOM   1458 C C   . LYS A 1 196 ? 13.270 14.701  24.916  1.00 15.54 ? 1039 LYS A C   1 
ATOM   1459 O O   . LYS A 1 196 ? 14.014 14.192  25.754  1.00 14.55 ? 1039 LYS A O   1 
ATOM   1460 C CB  . LYS A 1 196 ? 10.762 14.580  24.999  1.00 12.03 ? 1039 LYS A CB  1 
ATOM   1461 C CG  . LYS A 1 196 ? 10.853 13.148  25.493  1.00 15.64 ? 1039 LYS A CG  1 
ATOM   1462 C CD  . LYS A 1 196 ? 9.541  12.410  25.227  1.00 18.50 ? 1039 LYS A CD  1 
ATOM   1463 C CE  . LYS A 1 196 ? 9.582  10.988  25.764  1.00 25.02 ? 1039 LYS A CE  1 
ATOM   1464 N NZ  . LYS A 1 196 ? 10.546 10.146  25.007  1.00 25.21 ? 1039 LYS A NZ  1 
ATOM   1465 N N   . ASN A 1 197 ? 13.533 14.662  23.618  1.00 9.81  ? 1040 ASN A N   1 
ATOM   1466 C CA  . ASN A 1 197 ? 14.659 13.898  23.121  1.00 10.10 ? 1040 ASN A CA  1 
ATOM   1467 C C   . ASN A 1 197 ? 16.008 14.563  23.448  1.00 8.16  ? 1040 ASN A C   1 
ATOM   1468 O O   . ASN A 1 197 ? 16.983 13.879  23.751  1.00 13.18 ? 1040 ASN A O   1 
ATOM   1469 C CB  . ASN A 1 197 ? 14.497 13.625  21.624  1.00 10.95 ? 1040 ASN A CB  1 
ATOM   1470 C CG  . ASN A 1 197 ? 13.354 12.662  21.339  1.00 13.44 ? 1040 ASN A CG  1 
ATOM   1471 O OD1 . ASN A 1 197 ? 12.698 12.181  22.265  1.00 17.93 ? 1040 ASN A OD1 1 
ATOM   1472 N ND2 . ASN A 1 197 ? 13.114 12.370  20.066  1.00 12.79 ? 1040 ASN A ND2 1 
ATOM   1473 N N   . ALA A 1 198 ? 16.066 15.888  23.398  1.00 9.04  ? 1041 ALA A N   1 
ATOM   1474 C CA  . ALA A 1 198 ? 17.319 16.565  23.757  1.00 8.80  ? 1041 ALA A CA  1 
ATOM   1475 C C   . ALA A 1 198 ? 17.658 16.352  25.241  1.00 12.81 ? 1041 ALA A C   1 
ATOM   1476 O O   . ALA A 1 198 ? 18.818 16.092  25.610  1.00 11.33 ? 1041 ALA A O   1 
ATOM   1477 C CB  . ALA A 1 198 ? 17.261 18.043  23.393  1.00 10.10 ? 1041 ALA A CB  1 
ATOM   1478 N N   . ASN A 1 199 ? 16.651 16.423  26.102  1.00 12.18 ? 1042 ASN A N   1 
ATOM   1479 C CA  . ASN A 1 199 ? 16.886 16.129  27.510  1.00 8.83  ? 1042 ASN A CA  1 
ATOM   1480 C C   . ASN A 1 199 ? 17.407 14.714  27.720  1.00 13.62 ? 1042 ASN A C   1 
ATOM   1481 O O   . ASN A 1 199 ? 18.295 14.487  28.551  1.00 13.54 ? 1042 ASN A O   1 
ATOM   1482 C CB  . ASN A 1 199 ? 15.631 16.390  28.346  1.00 9.40  ? 1042 ASN A CB  1 
ATOM   1483 C CG  . ASN A 1 199 ? 15.477 17.851  28.713  1.00 16.10 ? 1042 ASN A CG  1 
ATOM   1484 O OD1 . ASN A 1 199 ? 16.118 18.340  29.644  1.00 14.80 ? 1042 ASN A OD1 1 
ATOM   1485 N ND2 . ASN A 1 199 ? 14.637 18.567  27.968  1.00 17.07 ? 1042 ASN A ND2 1 
ATOM   1486 N N   . GLU A 1 200 ? 16.870 13.767  26.960  1.00 13.55 ? 1043 GLU A N   1 
ATOM   1487 C CA  . GLU A 1 200 ? 17.305 12.378  27.064  1.00 12.26 ? 1043 GLU A CA  1 
ATOM   1488 C C   . GLU A 1 200 ? 18.745 12.195  26.604  1.00 13.11 ? 1043 GLU A C   1 
ATOM   1489 O O   . GLU A 1 200 ? 19.399 11.236  26.986  1.00 13.77 ? 1043 GLU A O   1 
ATOM   1490 C CB  . GLU A 1 200 ? 16.368 11.458  26.281  1.00 15.00 ? 1043 GLU A CB  1 
ATOM   1491 C CG  . GLU A 1 200 ? 14.973 11.408  26.879  1.00 19.71 ? 1043 GLU A CG  1 
ATOM   1492 C CD  . GLU A 1 200 ? 14.080 10.399  26.200  1.00 26.53 ? 1043 GLU A CD  1 
ATOM   1493 O OE1 . GLU A 1 200 ? 14.574 9.658   25.320  1.00 31.13 ? 1043 GLU A OE1 1 
ATOM   1494 O OE2 . GLU A 1 200 ? 12.885 10.344  26.561  1.00 27.13 ? 1043 GLU A OE2 1 
ATOM   1495 N N   . ALA A 1 201 ? 19.233 13.126  25.790  1.00 9.29  ? 1044 ALA A N   1 
ATOM   1496 C CA  . ALA A 1 201 ? 20.580 13.045  25.235  1.00 7.98  ? 1044 ALA A CA  1 
ATOM   1497 C C   . ALA A 1 201 ? 21.617 13.666  26.173  1.00 8.10  ? 1044 ALA A C   1 
ATOM   1498 O O   . ALA A 1 201 ? 22.815 13.520  25.963  1.00 9.95  ? 1044 ALA A O   1 
ATOM   1499 C CB  . ALA A 1 201 ? 20.624 13.732  23.871  1.00 10.78 ? 1044 ALA A CB  1 
ATOM   1500 N N   . VAL A 1 202 ? 21.162 14.368  27.207  1.00 8.11  ? 1045 VAL A N   1 
ATOM   1501 C CA  . VAL A 1 202 ? 22.100 15.024  28.118  1.00 7.64  ? 1045 VAL A CA  1 
ATOM   1502 C C   . VAL A 1 202 ? 23.091 14.028  28.718  1.00 9.51  ? 1045 VAL A C   1 
ATOM   1503 O O   . VAL A 1 202 ? 24.305 14.272  28.717  1.00 10.53 ? 1045 VAL A O   1 
ATOM   1504 C CB  . VAL A 1 202 ? 21.369 15.776  29.246  1.00 9.17  ? 1045 VAL A CB  1 
ATOM   1505 C CG1 . VAL A 1 202 ? 22.371 16.280  30.293  1.00 11.20 ? 1045 VAL A CG1 1 
ATOM   1506 C CG2 . VAL A 1 202 ? 20.589 16.959  28.671  1.00 11.31 ? 1045 VAL A CG2 1 
ATOM   1507 N N   . LEU A 1 203 ? 22.583 12.893  29.200  1.00 10.64 ? 1046 LEU A N   1 
ATOM   1508 C CA  . LEU A 1 203 ? 23.448 11.903  29.836  1.00 10.08 ? 1046 LEU A CA  1 
ATOM   1509 C C   . LEU A 1 203 ? 24.488 11.368  28.861  1.00 11.53 ? 1046 LEU A C   1 
ATOM   1510 O O   . LEU A 1 203 ? 25.671 11.264  29.192  1.00 10.19 ? 1046 LEU A O   1 
ATOM   1511 C CB  . LEU A 1 203 ? 22.629 10.751  30.429  1.00 12.05 ? 1046 LEU A CB  1 
ATOM   1512 C CG  . LEU A 1 203 ? 23.463 9.637   31.064  1.00 12.74 ? 1046 LEU A CG  1 
ATOM   1513 C CD1 . LEU A 1 203 ? 24.286 10.185  32.228  1.00 11.67 ? 1046 LEU A CD1 1 
ATOM   1514 C CD2 . LEU A 1 203 ? 22.556 8.495   31.521  1.00 17.53 ? 1046 LEU A CD2 1 
ATOM   1515 N N   . GLY A 1 204 ? 24.049 11.023  27.657  1.00 11.19 ? 1047 GLY A N   1 
ATOM   1516 C CA  . GLY A 1 204 ? 24.963 10.549  26.635  1.00 12.18 ? 1047 GLY A CA  1 
ATOM   1517 C C   . GLY A 1 204 ? 26.090 11.516  26.324  1.00 11.05 ? 1047 GLY A C   1 
ATOM   1518 O O   . GLY A 1 204 ? 27.234 11.105  26.193  1.00 12.30 ? 1047 GLY A O   1 
ATOM   1519 N N   . ILE A 1 205 ? 25.764 12.798  26.155  1.00 9.82  ? 1048 ILE A N   1 
ATOM   1520 C CA  . ILE A 1 205 ? 26.777 13.828  25.943  1.00 11.77 ? 1048 ILE A CA  1 
ATOM   1521 C C   . ILE A 1 205 ? 27.725 13.888  27.134  1.00 11.87 ? 1048 ILE A C   1 
ATOM   1522 O O   . ILE A 1 205 ? 28.947 13.913  26.976  1.00 10.84 ? 1048 ILE A O   1 
ATOM   1523 C CB  . ILE A 1 205 ? 26.128 15.226  25.734  1.00 10.69 ? 1048 ILE A CB  1 
ATOM   1524 C CG1 . ILE A 1 205 ? 25.183 15.210  24.518  1.00 20.67 ? 1048 ILE A CG1 1 
ATOM   1525 C CG2 . ILE A 1 205 ? 27.196 16.317  25.624  1.00 12.79 ? 1048 ILE A CG2 1 
ATOM   1526 C CD1 . ILE A 1 205 ? 25.877 15.279  23.183  1.00 20.20 ? 1048 ILE A CD1 1 
ATOM   1527 N N   . MET A 1 206 ? 27.167 13.892  28.339  1.00 7.74  ? 1049 MET A N   1 
ATOM   1528 C CA  . MET A 1 206 ? 28.001 13.993  29.535  1.00 8.91  ? 1049 MET A CA  1 
ATOM   1529 C C   . MET A 1 206 ? 28.920 12.791  29.737  1.00 13.24 ? 1049 MET A C   1 
ATOM   1530 O O   . MET A 1 206 ? 29.997 12.929  30.308  1.00 11.88 ? 1049 MET A O   1 
ATOM   1531 C CB  . MET A 1 206 ? 27.129 14.185  30.770  1.00 11.17 ? 1049 MET A CB  1 
ATOM   1532 C CG  . MET A 1 206 ? 27.913 14.657  31.985  1.00 9.93  ? 1049 MET A CG  1 
ATOM   1533 S SD  . MET A 1 206 ? 26.849 14.922  33.400  1.00 12.18 ? 1049 MET A SD  1 
ATOM   1534 C CE  . MET A 1 206 ? 26.022 16.428  32.898  1.00 9.24  ? 1049 MET A CE  1 
ATOM   1535 N N   . ILE A 1 207 ? 28.491 11.613  29.293  1.00 10.98 ? 1050 ILE A N   1 
ATOM   1536 C CA  . ILE A 1 207 ? 29.336 10.427  29.400  1.00 12.75 ? 1050 ILE A CA  1 
ATOM   1537 C C   . ILE A 1 207 ? 30.663 10.655  28.673  1.00 14.63 ? 1050 ILE A C   1 
ATOM   1538 O O   . ILE A 1 207 ? 31.710 10.154  29.098  1.00 17.33 ? 1050 ILE A O   1 
ATOM   1539 C CB  . ILE A 1 207 ? 28.616 9.172   28.867  1.00 12.33 ? 1050 ILE A CB  1 
ATOM   1540 C CG1 . ILE A 1 207 ? 27.640 8.654   29.920  1.00 12.23 ? 1050 ILE A CG1 1 
ATOM   1541 C CG2 . ILE A 1 207 ? 29.617 8.092   28.453  1.00 13.64 ? 1050 ILE A CG2 1 
ATOM   1542 C CD1 . ILE A 1 207 ? 26.685 7.605   29.397  1.00 16.70 ? 1050 ILE A CD1 1 
ATOM   1543 N N   . HIS A 1 208 ? 30.627 11.447  27.607  1.00 12.06 ? 1051 HIS A N   1 
ATOM   1544 C CA  . HIS A 1 208 ? 31.832 11.740  26.834  1.00 11.79 ? 1051 HIS A CA  1 
ATOM   1545 C C   . HIS A 1 208 ? 32.573 13.016  27.236  1.00 17.34 ? 1051 HIS A C   1 
ATOM   1546 O O   . HIS A 1 208 ? 33.795 13.077  27.133  1.00 18.60 ? 1051 HIS A O   1 
ATOM   1547 C CB  . HIS A 1 208 ? 31.507 11.740  25.334  1.00 12.87 ? 1051 HIS A CB  1 
ATOM   1548 C CG  . HIS A 1 208 ? 31.114 10.392  24.826  1.00 12.85 ? 1051 HIS A CG  1 
ATOM   1549 N ND1 . HIS A 1 208 ? 32.030 9.495   24.321  1.00 15.07 ? 1051 HIS A ND1 1 
ATOM   1550 C CD2 . HIS A 1 208 ? 29.916 9.760   24.803  1.00 13.47 ? 1051 HIS A CD2 1 
ATOM   1551 C CE1 . HIS A 1 208 ? 31.411 8.377   23.989  1.00 16.30 ? 1051 HIS A CE1 1 
ATOM   1552 N NE2 . HIS A 1 208 ? 30.125 8.515   24.263  1.00 14.22 ? 1051 HIS A NE2 1 
ATOM   1553 N N   . LEU A 1 209 ? 31.849 14.031  27.697  1.00 13.00 ? 1052 LEU A N   1 
ATOM   1554 C CA  . LEU A 1 209 ? 32.492 15.296  28.049  1.00 11.62 ? 1052 LEU A CA  1 
ATOM   1555 C C   . LEU A 1 209 ? 32.724 15.454  29.545  1.00 14.02 ? 1052 LEU A C   1 
ATOM   1556 O O   . LEU A 1 209 ? 33.675 16.124  29.964  1.00 15.82 ? 1052 LEU A O   1 
ATOM   1557 C CB  . LEU A 1 209 ? 31.673 16.483  27.542  1.00 12.28 ? 1052 LEU A CB  1 
ATOM   1558 C CG  . LEU A 1 209 ? 31.561 16.591  26.025  1.00 9.81  ? 1052 LEU A CG  1 
ATOM   1559 C CD1 . LEU A 1 209 ? 30.899 17.928  25.637  1.00 12.40 ? 1052 LEU A CD1 1 
ATOM   1560 C CD2 . LEU A 1 209 ? 32.930 16.438  25.368  1.00 14.05 ? 1052 LEU A CD2 1 
ATOM   1561 N N   . GLY A 1 210 ? 31.853 14.855  30.350  1.00 11.73 ? 1053 GLY A N   1 
ATOM   1562 C CA  . GLY A 1 210 ? 31.887 15.056  31.791  1.00 15.27 ? 1053 GLY A CA  1 
ATOM   1563 C C   . GLY A 1 210 ? 31.165 16.311  32.267  1.00 14.61 ? 1053 GLY A C   1 
ATOM   1564 O O   . GLY A 1 210 ? 30.990 17.268  31.512  1.00 14.53 ? 1053 GLY A O   1 
ATOM   1565 N N   . PHE A 1 211 ? 30.751 16.310  33.533  1.00 14.65 ? 1054 PHE A N   1 
ATOM   1566 C CA  . PHE A 1 211 ? 30.012 17.428  34.112  1.00 12.92 ? 1054 PHE A CA  1 
ATOM   1567 C C   . PHE A 1 211 ? 30.768 18.757  34.073  1.00 12.02 ? 1054 PHE A C   1 
ATOM   1568 O O   . PHE A 1 211 ? 30.219 19.776  33.659  1.00 15.54 ? 1054 PHE A O   1 
ATOM   1569 C CB  . PHE A 1 211 ? 29.619 17.117  35.559  1.00 14.64 ? 1054 PHE A CB  1 
ATOM   1570 C CG  . PHE A 1 211 ? 28.874 18.233  36.232  1.00 14.29 ? 1054 PHE A CG  1 
ATOM   1571 C CD1 . PHE A 1 211 ? 27.497 18.343  36.096  1.00 15.21 ? 1054 PHE A CD1 1 
ATOM   1572 C CD2 . PHE A 1 211 ? 29.543 19.178  36.990  1.00 14.60 ? 1054 PHE A CD2 1 
ATOM   1573 C CE1 . PHE A 1 211 ? 26.802 19.370  36.705  1.00 22.29 ? 1054 PHE A CE1 1 
ATOM   1574 C CE2 . PHE A 1 211 ? 28.853 20.215  37.605  1.00 15.90 ? 1054 PHE A CE2 1 
ATOM   1575 C CZ  . PHE A 1 211 ? 27.480 20.311  37.461  1.00 24.00 ? 1054 PHE A CZ  1 
ATOM   1576 N N   . ASP A 1 212 ? 32.024 18.751  34.521  1.00 14.50 ? 1055 ASP A N   1 
ATOM   1577 C CA  . ASP A 1 212 ? 32.801 19.980  34.602  1.00 14.80 ? 1055 ASP A CA  1 
ATOM   1578 C C   . ASP A 1 212 ? 32.909 20.711  33.258  1.00 12.64 ? 1055 ASP A C   1 
ATOM   1579 O O   . ASP A 1 212 ? 32.716 21.927  33.187  1.00 15.81 ? 1055 ASP A O   1 
ATOM   1580 C CB  . ASP A 1 212 ? 34.197 19.695  35.167  1.00 16.33 ? 1055 ASP A CB  1 
ATOM   1581 C CG  . ASP A 1 212 ? 34.171 19.329  36.646  1.00 26.09 ? 1055 ASP A CG  1 
ATOM   1582 O OD1 . ASP A 1 212 ? 33.135 19.556  37.313  1.00 24.26 ? 1055 ASP A OD1 1 
ATOM   1583 O OD2 . ASP A 1 212 ? 35.201 18.830  37.148  1.00 26.29 ? 1055 ASP A OD2 1 
ATOM   1584 N N   . ALA A 1 213 ? 33.195 19.965  32.196  1.00 17.62 ? 1056 ALA A N   1 
ATOM   1585 C CA  . ALA A 1 213 ? 33.326 20.553  30.866  1.00 15.85 ? 1056 ALA A CA  1 
ATOM   1586 C C   . ALA A 1 213 ? 31.996 21.142  30.391  1.00 14.10 ? 1056 ALA A C   1 
ATOM   1587 O O   . ALA A 1 213 ? 31.956 22.212  29.784  1.00 13.52 ? 1056 ALA A O   1 
ATOM   1588 C CB  . ALA A 1 213 ? 33.851 19.523  29.868  1.00 19.43 ? 1056 ALA A CB  1 
ATOM   1589 N N   . MET A 1 214 ? 30.898 20.458  30.692  1.00 16.39 ? 1057 MET A N   1 
ATOM   1590 C CA  . MET A 1 214 ? 29.597 20.948  30.244  1.00 12.52 ? 1057 MET A CA  1 
ATOM   1591 C C   . MET A 1 214 ? 29.194 22.179  31.030  1.00 14.64 ? 1057 MET A C   1 
ATOM   1592 O O   . MET A 1 214 ? 28.619 23.120  30.481  1.00 14.16 ? 1057 MET A O   1 
ATOM   1593 C CB  . MET A 1 214 ? 28.533 19.855  30.335  1.00 10.58 ? 1057 MET A CB  1 
ATOM   1594 C CG  . MET A 1 214 ? 28.827 18.700  29.401  1.00 14.28 ? 1057 MET A CG  1 
ATOM   1595 S SD  . MET A 1 214 ? 27.542 17.454  29.366  1.00 12.21 ? 1057 MET A SD  1 
ATOM   1596 C CE  . MET A 1 214 ? 26.231 18.313  28.486  1.00 9.77  ? 1057 MET A CE  1 
ATOM   1597 N N   . ASN A 1 215 ? 29.515 22.182  32.318  1.00 14.29 ? 1058 ASN A N   1 
ATOM   1598 C CA  . ASN A 1 215 ? 29.248 23.344  33.150  1.00 16.59 ? 1058 ASN A CA  1 
ATOM   1599 C C   . ASN A 1 215 ? 30.094 24.557  32.731  1.00 16.31 ? 1058 ASN A C   1 
ATOM   1600 O O   . ASN A 1 215 ? 29.615 25.690  32.752  1.00 18.67 ? 1058 ASN A O   1 
ATOM   1601 C CB  . ASN A 1 215 ? 29.468 22.996  34.616  1.00 17.95 ? 1058 ASN A CB  1 
ATOM   1602 C CG  . ASN A 1 215 ? 29.003 24.085  35.536  1.00 23.42 ? 1058 ASN A CG  1 
ATOM   1603 O OD1 . ASN A 1 215 ? 27.809 24.351  35.639  1.00 22.08 ? 1058 ASN A OD1 1 
ATOM   1604 N ND2 . ASN A 1 215 ? 29.946 24.735  36.210  1.00 28.43 ? 1058 ASN A ND2 1 
ATOM   1605 N N   . ARG A 1 216 ? 31.337 24.315  32.326  1.00 17.96 ? 1059 ARG A N   1 
ATOM   1606 C CA  . ARG A 1 216 ? 32.189 25.390  31.816  1.00 15.49 ? 1059 ARG A CA  1 
ATOM   1607 C C   . ARG A 1 216 ? 31.609 25.984  30.542  1.00 19.21 ? 1059 ARG A C   1 
ATOM   1608 O O   . ARG A 1 216 ? 31.618 27.204  30.343  1.00 19.33 ? 1059 ARG A O   1 
ATOM   1609 C CB  . ARG A 1 216 ? 33.611 24.889  31.539  1.00 21.85 ? 1059 ARG A CB  1 
ATOM   1610 C CG  . ARG A 1 216 ? 34.456 24.703  32.781  1.00 32.82 ? 1059 ARG A CG  1 
ATOM   1611 C CD  . ARG A 1 216 ? 35.936 24.595  32.439  1.00 34.27 ? 1059 ARG A CD  1 
ATOM   1612 N NE  . ARG A 1 216 ? 36.255 23.394  31.670  1.00 38.17 ? 1059 ARG A NE  1 
ATOM   1613 C CZ  . ARG A 1 216 ? 36.523 22.209  32.211  1.00 37.10 ? 1059 ARG A CZ  1 
ATOM   1614 N NH1 . ARG A 1 216 ? 36.502 22.059  33.529  1.00 43.31 ? 1059 ARG A NH1 1 
ATOM   1615 N NH2 . ARG A 1 216 ? 36.809 21.171  31.436  1.00 36.94 ? 1059 ARG A NH2 1 
ATOM   1616 N N   . ALA A 1 217 ? 31.110 25.108  29.677  1.00 18.58 ? 1060 ALA A N   1 
ATOM   1617 C CA  . ALA A 1 217 ? 30.483 25.533  28.433  1.00 17.45 ? 1060 ALA A CA  1 
ATOM   1618 C C   . ALA A 1 217 ? 29.248 26.379  28.724  1.00 17.05 ? 1060 ALA A C   1 
ATOM   1619 O O   . ALA A 1 217 ? 28.982 27.363  28.036  1.00 17.64 ? 1060 ALA A O   1 
ATOM   1620 C CB  . ALA A 1 217 ? 30.124 24.317  27.579  1.00 14.67 ? 1060 ALA A CB  1 
ATOM   1621 N N   . LEU A 1 218 ? 28.489 25.995  29.746  1.00 13.36 ? 1061 LEU A N   1 
ATOM   1622 C CA  . LEU A 1 218 ? 27.307 26.751  30.120  1.00 13.18 ? 1061 LEU A CA  1 
ATOM   1623 C C   . LEU A 1 218 ? 27.690 28.165  30.562  1.00 17.14 ? 1061 LEU A C   1 
ATOM   1624 O O   . LEU A 1 218 ? 27.060 29.144  30.169  1.00 19.18 ? 1061 LEU A O   1 
ATOM   1625 C CB  . LEU A 1 218 ? 26.551 26.034  31.238  1.00 13.31 ? 1061 LEU A CB  1 
ATOM   1626 C CG  . LEU A 1 218 ? 25.351 26.774  31.831  1.00 14.32 ? 1061 LEU A CG  1 
ATOM   1627 C CD1 . LEU A 1 218 ? 24.295 27.061  30.778  1.00 16.47 ? 1061 LEU A CD1 1 
ATOM   1628 C CD2 . LEU A 1 218 ? 24.756 25.953  32.974  1.00 17.55 ? 1061 LEU A CD2 1 
ATOM   1629 N N   . ASP A 1 219 ? 28.731 28.268  31.376  1.00 18.53 ? 1062 ASP A N   1 
ATOM   1630 C CA  . ASP A 1 219 ? 29.177 29.569  31.860  1.00 19.92 ? 1062 ASP A CA  1 
ATOM   1631 C C   . ASP A 1 219 ? 29.713 30.448  30.729  1.00 21.45 ? 1062 ASP A C   1 
ATOM   1632 O O   . ASP A 1 219 ? 29.437 31.644  30.686  1.00 26.30 ? 1062 ASP A O   1 
ATOM   1633 C CB  . ASP A 1 219 ? 30.252 29.398  32.934  1.00 24.02 ? 1062 ASP A CB  1 
ATOM   1634 C CG  . ASP A 1 219 ? 29.696 28.860  34.234  1.00 30.73 ? 1062 ASP A CG  1 
ATOM   1635 O OD1 . ASP A 1 219 ? 28.490 29.059  34.496  1.00 34.80 ? 1062 ASP A OD1 1 
ATOM   1636 O OD2 . ASP A 1 219 ? 30.468 28.241  34.997  1.00 37.79 ? 1062 ASP A OD2 1 
ATOM   1637 N N   . LYS A 1 220 ? 30.487 29.857  29.828  1.00 22.38 ? 1063 LYS A N   1 
ATOM   1638 C CA  . LYS A 1 220 ? 31.106 30.623  28.752  1.00 25.75 ? 1063 LYS A CA  1 
ATOM   1639 C C   . LYS A 1 220 ? 30.105 31.082  27.703  1.00 25.18 ? 1063 LYS A C   1 
ATOM   1640 O O   . LYS A 1 220 ? 30.157 32.233  27.250  1.00 29.38 ? 1063 LYS A O   1 
ATOM   1641 C CB  . LYS A 1 220 ? 32.232 29.837  28.083  1.00 31.36 ? 1063 LYS A CB  1 
ATOM   1642 C CG  . LYS A 1 220 ? 32.737 30.499  26.810  1.00 42.97 ? 1063 LYS A CG  1 
ATOM   1643 C CD  . LYS A 1 220 ? 34.223 30.267  26.578  1.00 52.23 ? 1063 LYS A CD  1 
ATOM   1644 C CE  . LYS A 1 220 ? 34.527 28.832  26.191  1.00 58.46 ? 1063 LYS A CE  1 
ATOM   1645 N NZ  . LYS A 1 220 ? 35.963 28.648  25.800  1.00 60.96 ? 1063 LYS A NZ  1 
ATOM   1646 N N   . GLN A 1 221 ? 29.189 30.192  27.326  1.00 20.06 ? 1064 GLN A N   1 
ATOM   1647 C CA  . GLN A 1 221 ? 28.271 30.468  26.233  1.00 21.81 ? 1064 GLN A CA  1 
ATOM   1648 C C   . GLN A 1 221 ? 27.083 31.328  26.674  1.00 20.04 ? 1064 GLN A C   1 
ATOM   1649 O O   . GLN A 1 221 ? 26.427 31.976  25.850  1.00 26.72 ? 1064 GLN A O   1 
ATOM   1650 C CB  . GLN A 1 221 ? 27.812 29.150  25.591  1.00 21.79 ? 1064 GLN A CB  1 
ATOM   1651 C CG  . GLN A 1 221 ? 28.985 28.367  24.979  1.00 23.65 ? 1064 GLN A CG  1 
ATOM   1652 C CD  . GLN A 1 221 ? 28.632 26.951  24.565  1.00 25.12 ? 1064 GLN A CD  1 
ATOM   1653 O OE1 . GLN A 1 221 ? 27.461 26.577  24.514  1.00 26.09 ? 1064 GLN A OE1 1 
ATOM   1654 N NE2 . GLN A 1 221 ? 29.653 26.154  24.264  1.00 24.59 ? 1064 GLN A NE2 1 
ATOM   1655 N N   . LYS A 1 222 ? 26.809 31.340  27.975  1.00 19.83 ? 1065 LYS A N   1 
ATOM   1656 C CA  . LYS A 1 222 ? 25.744 32.171  28.518  1.00 25.40 ? 1065 LYS A CA  1 
ATOM   1657 C C   . LYS A 1 222 ? 24.435 32.026  27.748  1.00 32.48 ? 1065 LYS A C   1 
ATOM   1658 O O   . LYS A 1 222 ? 23.823 33.028  27.364  1.00 26.62 ? 1065 LYS A O   1 
ATOM   1659 C CB  . LYS A 1 222 ? 26.165 33.641  28.515  1.00 30.63 ? 1065 LYS A CB  1 
ATOM   1660 C CG  . LYS A 1 222 ? 27.422 33.943  29.307  1.00 32.02 ? 1065 LYS A CG  1 
ATOM   1661 C CD  . LYS A 1 222 ? 27.717 35.438  29.279  1.00 33.03 ? 1065 LYS A CD  1 
ATOM   1662 C CE  . LYS A 1 222 ? 28.789 35.802  30.287  1.00 39.65 ? 1065 LYS A CE  1 
ATOM   1663 N NZ  . LYS A 1 222 ? 30.088 35.181  29.966  1.00 46.52 ? 1065 LYS A NZ  1 
ATOM   1664 N N   . PRO A 1 223 ? 23.986 30.781  27.516  1.00 22.64 ? 1066 PRO A N   1 
ATOM   1665 C CA  . PRO A 1 223 ? 22.709 30.661  26.813  1.00 16.97 ? 1066 PRO A CA  1 
ATOM   1666 C C   . PRO A 1 223 ? 21.574 31.119  27.723  1.00 18.68 ? 1066 PRO A C   1 
ATOM   1667 O O   . PRO A 1 223 ? 21.781 31.297  28.922  1.00 22.69 ? 1066 PRO A O   1 
ATOM   1668 C CB  . PRO A 1 223 ? 22.598 29.152  26.557  1.00 20.97 ? 1066 PRO A CB  1 
ATOM   1669 C CG  . PRO A 1 223 ? 23.331 28.548  27.702  1.00 18.62 ? 1066 PRO A CG  1 
ATOM   1670 C CD  . PRO A 1 223 ? 24.489 29.471  27.968  1.00 23.32 ? 1066 PRO A CD  1 
ATOM   1671 N N   . ALA A 1 224 ? 20.394 31.317  27.147  1.00 25.11 ? 1067 ALA A N   1 
ATOM   1672 C CA  . ALA A 1 224 ? 19.201 31.625  27.914  1.00 23.78 ? 1067 ALA A CA  1 
ATOM   1673 C C   . ALA A 1 224 ? 18.799 30.407  28.740  1.00 24.24 ? 1067 ALA A C   1 
ATOM   1674 O O   . ALA A 1 224 ? 19.184 29.276  28.417  1.00 20.85 ? 1067 ALA A O   1 
ATOM   1675 C CB  . ALA A 1 224 ? 18.068 32.021  26.972  1.00 22.77 ? 1067 ALA A CB  1 
ATOM   1676 N N   . SER A 1 225 ? 18.027 30.642  29.800  1.00 15.75 ? 1068 SER A N   1 
ATOM   1677 C CA  . SER A 1 225 ? 17.504 29.564  30.630  1.00 18.11 ? 1068 SER A CA  1 
ATOM   1678 C C   . SER A 1 225 ? 18.625 28.789  31.320  1.00 16.32 ? 1068 SER A C   1 
ATOM   1679 O O   . SER A 1 225 ? 18.570 27.561  31.424  1.00 17.03 ? 1068 SER A O   1 
ATOM   1680 C CB  . SER A 1 225 ? 16.651 28.610  29.788  1.00 27.67 ? 1068 SER A CB  1 
ATOM   1681 O OG  . SER A 1 225 ? 15.554 29.294  29.211  1.00 32.87 ? 1068 SER A OG  1 
ATOM   1682 N N   . LYS A 1 226 ? 19.633 29.516  31.790  1.00 16.63 ? 1069 LYS A N   1 
ATOM   1683 C CA  . LYS A 1 226 ? 20.768 28.901  32.475  1.00 16.94 ? 1069 LYS A CA  1 
ATOM   1684 C C   . LYS A 1 226 ? 20.328 27.994  33.623  1.00 21.60 ? 1069 LYS A C   1 
ATOM   1685 O O   . LYS A 1 226 ? 20.919 26.938  33.840  1.00 17.83 ? 1069 LYS A O   1 
ATOM   1686 C CB  . LYS A 1 226 ? 21.739 29.970  32.980  1.00 20.97 ? 1069 LYS A CB  1 
ATOM   1687 C CG  . LYS A 1 226 ? 22.933 29.417  33.754  1.00 31.65 ? 1069 LYS A CG  1 
ATOM   1688 C CD  . LYS A 1 226 ? 23.919 30.519  34.137  1.00 38.02 ? 1069 LYS A CD  1 
ATOM   1689 C CE  . LYS A 1 226 ? 24.474 31.238  32.902  1.00 43.64 ? 1069 LYS A CE  1 
ATOM   1690 N NZ  . LYS A 1 226 ? 25.436 30.423  32.086  1.00 31.30 ? 1069 LYS A NZ  1 
ATOM   1691 N N   . LYS A 1 227 ? 19.283 28.398  34.345  1.00 19.42 ? 1070 LYS A N   1 
ATOM   1692 C CA  . LYS A 1 227 ? 18.785 27.607  35.473  1.00 18.72 ? 1070 LYS A CA  1 
ATOM   1693 C C   . LYS A 1 227 ? 18.265 26.242  35.045  1.00 14.86 ? 1070 LYS A C   1 
ATOM   1694 O O   . LYS A 1 227 ? 18.508 25.237  35.718  1.00 17.59 ? 1070 LYS A O   1 
ATOM   1695 C CB  . LYS A 1 227 ? 17.690 28.365  36.232  1.00 18.77 ? 1070 LYS A CB  1 
ATOM   1696 C CG  . LYS A 1 227 ? 18.202 29.545  37.030  1.00 32.22 ? 1070 LYS A CG  1 
ATOM   1697 C CD  . LYS A 1 227 ? 17.091 30.139  37.888  1.00 41.46 ? 1070 LYS A CD  1 
ATOM   1698 C CE  . LYS A 1 227 ? 17.634 31.186  38.852  1.00 49.36 ? 1070 LYS A CE  1 
ATOM   1699 N NZ  . LYS A 1 227 ? 16.581 31.683  39.786  1.00 55.28 ? 1070 LYS A NZ  1 
ATOM   1700 N N   . ASP A 1 228 ? 17.548 26.204  33.927  1.00 14.40 ? 1071 ASP A N   1 
ATOM   1701 C CA  . ASP A 1 228 ? 17.038 24.946  33.402  1.00 14.42 ? 1071 ASP A CA  1 
ATOM   1702 C C   . ASP A 1 228 ? 18.132 24.066  32.804  1.00 14.89 ? 1071 ASP A C   1 
ATOM   1703 O O   . ASP A 1 228 ? 18.091 22.846  32.945  1.00 15.01 ? 1071 ASP A O   1 
ATOM   1704 C CB  . ASP A 1 228 ? 15.924 25.213  32.398  1.00 15.84 ? 1071 ASP A CB  1 
ATOM   1705 C CG  . ASP A 1 228 ? 14.767 25.967  33.026  1.00 26.45 ? 1071 ASP A CG  1 
ATOM   1706 O OD1 . ASP A 1 228 ? 14.108 25.391  33.916  1.00 25.30 ? 1071 ASP A OD1 1 
ATOM   1707 O OD2 . ASP A 1 228 ? 14.534 27.136  32.654  1.00 27.78 ? 1071 ASP A OD2 1 
ATOM   1708 N N   . ILE A 1 229 ? 19.113 24.680  32.149  1.00 12.57 ? 1072 ILE A N   1 
ATOM   1709 C CA  . ILE A 1 229 ? 20.232 23.915  31.604  1.00 13.16 ? 1072 ILE A CA  1 
ATOM   1710 C C   . ILE A 1 229 ? 21.039 23.297  32.745  1.00 15.06 ? 1072 ILE A C   1 
ATOM   1711 O O   . ILE A 1 229 ? 21.375 22.107  32.716  1.00 11.79 ? 1072 ILE A O   1 
ATOM   1712 C CB  . ILE A 1 229 ? 21.127 24.786  30.696  1.00 10.20 ? 1072 ILE A CB  1 
ATOM   1713 C CG1 . ILE A 1 229 ? 20.315 25.291  29.495  1.00 14.74 ? 1072 ILE A CG1 1 
ATOM   1714 C CG2 . ILE A 1 229 ? 22.345 23.999  30.223  1.00 11.61 ? 1072 ILE A CG2 1 
ATOM   1715 C CD1 . ILE A 1 229 ? 20.936 26.482  28.799  1.00 17.04 ? 1072 ILE A CD1 1 
ATOM   1716 N N   . LEU A 1 230 ? 21.322 24.094  33.769  1.00 14.04 ? 1073 LEU A N   1 
ATOM   1717 C CA  . LEU A 1 230 ? 22.066 23.587  34.915  1.00 10.68 ? 1073 LEU A CA  1 
ATOM   1718 C C   . LEU A 1 230 ? 21.278 22.471  35.602  1.00 12.00 ? 1073 LEU A C   1 
ATOM   1719 O O   . LEU A 1 230 ? 21.850 21.452  36.004  1.00 11.61 ? 1073 LEU A O   1 
ATOM   1720 C CB  . LEU A 1 230 ? 22.402 24.704  35.899  1.00 10.44 ? 1073 LEU A CB  1 
ATOM   1721 C CG  . LEU A 1 230 ? 23.168 24.235  37.138  1.00 10.16 ? 1073 LEU A CG  1 
ATOM   1722 C CD1 . LEU A 1 230 ? 24.477 23.557  36.745  1.00 13.36 ? 1073 LEU A CD1 1 
ATOM   1723 C CD2 . LEU A 1 230 ? 23.403 25.408  38.063  1.00 16.05 ? 1073 LEU A CD2 1 
ATOM   1724 N N   . ALA A 1 231 ? 19.968 22.647  35.711  1.00 11.33 ? 1074 ALA A N   1 
ATOM   1725 C CA  . ALA A 1 231 ? 19.128 21.610  36.306  1.00 14.48 ? 1074 ALA A CA  1 
ATOM   1726 C C   . ALA A 1 231 ? 19.274 20.293  35.556  1.00 11.47 ? 1074 ALA A C   1 
ATOM   1727 O O   . ALA A 1 231 ? 19.371 19.233  36.172  1.00 12.74 ? 1074 ALA A O   1 
ATOM   1728 C CB  . ALA A 1 231 ? 17.663 22.052  36.339  1.00 15.25 ? 1074 ALA A CB  1 
ATOM   1729 N N   . ALA A 1 232 ? 19.291 20.364  34.225  1.00 12.12 ? 1075 ALA A N   1 
ATOM   1730 C CA  . ALA A 1 232 ? 19.476 19.177  33.386  1.00 9.69  ? 1075 ALA A CA  1 
ATOM   1731 C C   . ALA A 1 232 ? 20.839 18.525  33.613  1.00 9.46  ? 1075 ALA A C   1 
ATOM   1732 O O   . ALA A 1 232 ? 20.949 17.303  33.694  1.00 11.33 ? 1075 ALA A O   1 
ATOM   1733 C CB  . ALA A 1 232 ? 19.298 19.535  31.918  1.00 11.11 ? 1075 ALA A CB  1 
ATOM   1734 N N   . LEU A 1 233 ? 21.884 19.336  33.720  1.00 11.69 ? 1076 LEU A N   1 
ATOM   1735 C CA  . LEU A 1 233 ? 23.213 18.793  33.973  1.00 10.45 ? 1076 LEU A CA  1 
ATOM   1736 C C   . LEU A 1 233 ? 23.226 18.108  35.332  1.00 12.97 ? 1076 LEU A C   1 
ATOM   1737 O O   . LEU A 1 233 ? 23.794 17.025  35.483  1.00 12.55 ? 1076 LEU A O   1 
ATOM   1738 C CB  . LEU A 1 233 ? 24.288 19.884  33.903  1.00 10.24 ? 1076 LEU A CB  1 
ATOM   1739 C CG  . LEU A 1 233 ? 24.425 20.679  32.602  1.00 8.71  ? 1076 LEU A CG  1 
ATOM   1740 C CD1 . LEU A 1 233 ? 25.565 21.689  32.738  1.00 12.42 ? 1076 LEU A CD1 1 
ATOM   1741 C CD2 . LEU A 1 233 ? 24.672 19.756  31.438  1.00 10.98 ? 1076 LEU A CD2 1 
ATOM   1742 N N   . GLU A 1 234 ? 22.584 18.727  36.320  1.00 9.16  ? 1077 GLU A N   1 
ATOM   1743 C CA  . GLU A 1 234 ? 22.601 18.163  37.671  1.00 12.36 ? 1077 GLU A CA  1 
ATOM   1744 C C   . GLU A 1 234 ? 21.765 16.889  37.754  1.00 12.77 ? 1077 GLU A C   1 
ATOM   1745 O O   . GLU A 1 234 ? 22.091 15.974  38.523  1.00 16.28 ? 1077 GLU A O   1 
ATOM   1746 C CB  . GLU A 1 234 ? 22.139 19.198  38.698  1.00 15.96 ? 1077 GLU A CB  1 
ATOM   1747 C CG  . GLU A 1 234 ? 23.161 20.294  38.919  1.00 12.05 ? 1077 GLU A CG  1 
ATOM   1748 C CD  . GLU A 1 234 ? 22.654 21.443  39.774  1.00 27.84 ? 1077 GLU A CD  1 
ATOM   1749 O OE1 . GLU A 1 234 ? 21.429 21.685  39.802  1.00 23.89 ? 1077 GLU A OE1 1 
ATOM   1750 O OE2 . GLU A 1 234 ? 23.493 22.116  40.410  1.00 34.36 ? 1077 GLU A OE2 1 
ATOM   1751 N N   . LYS A 1 235 ? 20.701 16.828  36.958  1.00 12.99 ? 1078 LYS A N   1 
ATOM   1752 C CA  . LYS A 1 235 ? 19.838 15.648  36.926  1.00 13.14 ? 1078 LYS A CA  1 
ATOM   1753 C C   . LYS A 1 235 ? 20.563 14.430  36.329  1.00 17.39 ? 1078 LYS A C   1 
ATOM   1754 O O   . LYS A 1 235 ? 20.349 13.300  36.767  1.00 15.59 ? 1078 LYS A O   1 
ATOM   1755 C CB  . LYS A 1 235 ? 18.540 15.943  36.171  1.00 19.61 ? 1078 LYS A CB  1 
ATOM   1756 C CG  . LYS A 1 235 ? 17.537 14.805  36.186  1.00 24.87 ? 1078 LYS A CG  1 
ATOM   1757 C CD  . LYS A 1 235 ? 16.286 15.178  35.412  1.00 26.79 ? 1078 LYS A CD  1 
ATOM   1758 C CE  . LYS A 1 235 ? 15.236 14.073  35.470  1.00 34.31 ? 1078 LYS A CE  1 
ATOM   1759 N NZ  . LYS A 1 235 ? 13.989 14.454  34.742  1.00 36.11 ? 1078 LYS A NZ  1 
ATOM   1760 N N   . ALA A 1 236 ? 21.436 14.673  35.352  1.00 13.43 ? 1079 ALA A N   1 
ATOM   1761 C CA  . ALA A 1 236 ? 22.130 13.595  34.636  1.00 12.92 ? 1079 ALA A CA  1 
ATOM   1762 C C   . ALA A 1 236 ? 23.345 13.071  35.391  1.00 18.91 ? 1079 ALA A C   1 
ATOM   1763 O O   . ALA A 1 236 ? 23.667 11.880  35.338  1.00 15.08 ? 1079 ALA A O   1 
ATOM   1764 C CB  . ALA A 1 236 ? 22.552 14.070  33.252  1.00 13.26 ? 1079 ALA A CB  1 
ATOM   1765 N N   . ARG A 1 237 ? 24.025 13.972  36.086  1.00 17.65 ? 1080 ARG A N   1 
ATOM   1766 C CA  . ARG A 1 237 ? 25.286 13.655  36.737  1.00 21.81 ? 1080 ARG A CA  1 
ATOM   1767 C C   . ARG A 1 237 ? 25.286 12.383  37.605  1.00 21.07 ? 1080 ARG A C   1 
ATOM   1768 O O   . ARG A 1 237 ? 26.201 11.564  37.505  1.00 17.75 ? 1080 ARG A O   1 
ATOM   1769 C CB  . ARG A 1 237 ? 25.731 14.851  37.567  1.00 26.10 ? 1080 ARG A CB  1 
ATOM   1770 C CG  . ARG A 1 237 ? 27.138 14.774  38.037  1.00 26.27 ? 1080 ARG A CG  1 
ATOM   1771 C CD  . ARG A 1 237 ? 27.359 15.865  39.048  1.00 28.88 ? 1080 ARG A CD  1 
ATOM   1772 N NE  . ARG A 1 237 ? 28.769 16.086  39.310  1.00 40.42 ? 1080 ARG A NE  1 
ATOM   1773 C CZ  . ARG A 1 237 ? 29.223 17.106  40.021  1.00 36.07 ? 1080 ARG A CZ  1 
ATOM   1774 N NH1 . ARG A 1 237 ? 28.366 17.983  40.523  1.00 37.49 ? 1080 ARG A NH1 1 
ATOM   1775 N NH2 . ARG A 1 237 ? 30.525 17.247  40.223  1.00 40.80 ? 1080 ARG A NH2 1 
ATOM   1776 N N   . PRO A 1 238 ? 24.277 12.221  38.473  1.00 20.65 ? 1081 PRO A N   1 
ATOM   1777 C CA  . PRO A 1 238 ? 24.303 11.042  39.348  1.00 16.98 ? 1081 PRO A CA  1 
ATOM   1778 C C   . PRO A 1 238 ? 24.114 9.729   38.579  1.00 24.43 ? 1081 PRO A C   1 
ATOM   1779 O O   . PRO A 1 238 ? 24.294 8.652   39.149  1.00 26.05 ? 1081 PRO A O   1 
ATOM   1780 C CB  . PRO A 1 238 ? 23.138 11.289  40.312  1.00 22.26 ? 1081 PRO A CB  1 
ATOM   1781 C CG  . PRO A 1 238 ? 22.254 12.272  39.620  1.00 24.81 ? 1081 PRO A CG  1 
ATOM   1782 C CD  . PRO A 1 238 ? 23.153 13.121  38.784  1.00 19.43 ? 1081 PRO A CD  1 
ATOM   1783 N N   . ASN A 1 239 ? 23.775 9.821   37.298  1.00 22.92 ? 1082 ASN A N   1 
ATOM   1784 C CA  . ASN A 1 239 ? 23.573 8.628   36.473  1.00 23.98 ? 1082 ASN A CA  1 
ATOM   1785 C C   . ASN A 1 239 ? 24.765 8.278   35.596  1.00 22.20 ? 1082 ASN A C   1 
ATOM   1786 O O   . ASN A 1 239 ? 24.719 7.327   34.808  1.00 24.62 ? 1082 ASN A O   1 
ATOM   1787 C CB  . ASN A 1 239 ? 22.307 8.773   35.636  1.00 22.84 ? 1082 ASN A CB  1 
ATOM   1788 C CG  . ASN A 1 239 ? 21.060 8.687   36.482  1.00 30.37 ? 1082 ASN A CG  1 
ATOM   1789 O OD1 . ASN A 1 239 ? 20.864 7.709   37.205  1.00 34.74 ? 1082 ASN A OD1 1 
ATOM   1790 N ND2 . ASN A 1 239 ? 20.233 9.724   36.435  1.00 28.96 ? 1082 ASN A ND2 1 
ATOM   1791 N N   . LEU A 1 240 ? 25.835 9.049   35.728  1.00 16.53 ? 1083 LEU A N   1 
ATOM   1792 C CA  . LEU A 1 240 ? 27.062 8.752   35.008  1.00 16.00 ? 1083 LEU A CA  1 
ATOM   1793 C C   . LEU A 1 240 ? 27.678 7.458   35.534  1.00 21.42 ? 1083 LEU A C   1 
ATOM   1794 O O   . LEU A 1 240 ? 27.520 7.122   36.707  1.00 24.91 ? 1083 LEU A O   1 
ATOM   1795 C CB  . LEU A 1 240 ? 28.068 9.888   35.175  1.00 17.22 ? 1083 LEU A CB  1 
ATOM   1796 C CG  . LEU A 1 240 ? 27.805 11.211  34.460  1.00 14.72 ? 1083 LEU A CG  1 
ATOM   1797 C CD1 . LEU A 1 240 ? 28.821 12.243  34.922  1.00 13.58 ? 1083 LEU A CD1 1 
ATOM   1798 C CD2 . LEU A 1 240 ? 27.879 11.026  32.960  1.00 16.05 ? 1083 LEU A CD2 1 
ATOM   1799 N N   . PRO A 1 241 ? 28.394 6.732   34.667  1.00 23.41 ? 1084 PRO A N   1 
ATOM   1800 C CA  . PRO A 1 241 ? 29.113 5.532   35.111  1.00 31.22 ? 1084 PRO A CA  1 
ATOM   1801 C C   . PRO A 1 241 ? 30.108 5.871   36.214  1.00 38.31 ? 1084 PRO A C   1 
ATOM   1802 O O   . PRO A 1 241 ? 30.728 6.932   36.135  1.00 39.28 ? 1084 PRO A O   1 
ATOM   1803 C CB  . PRO A 1 241 ? 29.863 5.092   33.853  1.00 31.87 ? 1084 PRO A CB  1 
ATOM   1804 C CG  . PRO A 1 241 ? 29.073 5.649   32.732  1.00 27.58 ? 1084 PRO A CG  1 
ATOM   1805 C CD  . PRO A 1 241 ? 28.532 6.957   33.220  1.00 26.16 ? 1084 PRO A CD  1 
HETATM 1806 S S   . SO4 B 2 .   ? 32.955 1.937   16.687  1.00 28.11 ? 1101 SO4 A S   1 
HETATM 1807 O O1  . SO4 B 2 .   ? 33.611 0.766   16.098  1.00 31.09 ? 1101 SO4 A O1  1 
HETATM 1808 O O2  . SO4 B 2 .   ? 31.519 1.870   16.450  1.00 23.80 ? 1101 SO4 A O2  1 
HETATM 1809 O O3  . SO4 B 2 .   ? 33.182 1.948   18.136  1.00 34.40 ? 1101 SO4 A O3  1 
HETATM 1810 O O4  . SO4 B 2 .   ? 33.520 3.148   16.089  1.00 27.17 ? 1101 SO4 A O4  1 
HETATM 1811 O O   . HOH C 3 .   ? 34.680 -1.974  -5.343  1.00 10.72 ? 1201 HOH A O   1 
HETATM 1812 O O   . HOH C 3 .   ? 37.325 -4.155  2.402   1.00 18.09 ? 1202 HOH A O   1 
HETATM 1813 O O   . HOH C 3 .   ? 29.402 14.987  13.363  1.00 8.13  ? 1203 HOH A O   1 
HETATM 1814 O O   . HOH C 3 .   ? 23.034 17.004  7.014   1.00 10.36 ? 1204 HOH A O   1 
HETATM 1815 O O   . HOH C 3 .   ? 35.141 -3.356  1.172   1.00 11.10 ? 1205 HOH A O   1 
HETATM 1816 O O   . HOH C 3 .   ? 28.923 17.525  15.411  1.00 7.70  ? 1206 HOH A O   1 
HETATM 1817 O O   . HOH C 3 .   ? 15.865 8.400   15.771  1.00 15.36 ? 1207 HOH A O   1 
HETATM 1818 O O   . HOH C 3 .   ? 29.013 -6.605  -10.853 1.00 15.34 ? 1208 HOH A O   1 
HETATM 1819 O O   . HOH C 3 .   ? 23.356 24.204  9.249   1.00 14.52 ? 1209 HOH A O   1 
HETATM 1820 O O   . HOH C 3 .   ? 28.246 23.098  13.160  1.00 23.43 ? 1210 HOH A O   1 
HETATM 1821 O O   . HOH C 3 .   ? 33.470 7.501   -4.473  1.00 16.96 ? 1211 HOH A O   1 
HETATM 1822 O O   . HOH C 3 .   ? 19.705 12.496  29.863  1.00 14.39 ? 1212 HOH A O   1 
HETATM 1823 O O   . HOH C 3 .   ? 31.561 5.877   -20.056 1.00 15.95 ? 1213 HOH A O   1 
HETATM 1824 O O   . HOH C 3 .   ? 33.002 -11.104 -4.139  1.00 21.25 ? 1214 HOH A O   1 
HETATM 1825 O O   . HOH C 3 .   ? 24.146 11.153  -9.294  1.00 15.85 ? 1215 HOH A O   1 
HETATM 1826 O O   . HOH C 3 .   ? 25.352 17.767  8.187   1.00 16.60 ? 1216 HOH A O   1 
HETATM 1827 O O   . HOH C 3 .   ? 33.932 6.632   -11.433 1.00 17.50 ? 1217 HOH A O   1 
HETATM 1828 O O   . HOH C 3 .   ? 36.894 -5.397  4.784   1.00 20.02 ? 1218 HOH A O   1 
HETATM 1829 O O   . HOH C 3 .   ? 33.849 5.925   -18.513 1.00 12.60 ? 1219 HOH A O   1 
HETATM 1830 O O   . HOH C 3 .   ? 38.123 3.886   -6.939  1.00 19.75 ? 1220 HOH A O   1 
HETATM 1831 O O   . HOH C 3 .   ? 29.210 14.791  -1.396  1.00 22.03 ? 1221 HOH A O   1 
HETATM 1832 O O   . HOH C 3 .   ? 12.939 4.802   -14.733 1.00 17.04 ? 1222 HOH A O   1 
HETATM 1833 O O   . HOH C 3 .   ? 22.840 -2.418  5.177   1.00 24.64 ? 1223 HOH A O   1 
HETATM 1834 O O   . HOH C 3 .   ? 25.962 11.133  -11.172 1.00 15.07 ? 1224 HOH A O   1 
HETATM 1835 O O   . HOH C 3 .   ? 38.822 -4.595  -0.036  1.00 18.97 ? 1225 HOH A O   1 
HETATM 1836 O O   . HOH C 3 .   ? 30.797 -7.184  3.300   1.00 15.92 ? 1226 HOH A O   1 
HETATM 1837 O O   . HOH C 3 .   ? 36.634 16.168  12.973  1.00 17.59 ? 1227 HOH A O   1 
HETATM 1838 O O   . HOH C 3 .   ? 16.567 7.542   22.201  1.00 20.79 ? 1228 HOH A O   1 
HETATM 1839 O O   . HOH C 3 .   ? 38.734 -2.006  3.597   1.00 26.91 ? 1229 HOH A O   1 
HETATM 1840 O O   . HOH C 3 .   ? 39.991 -7.077  -0.828  1.00 21.15 ? 1230 HOH A O   1 
HETATM 1841 O O   . HOH C 3 .   ? 39.130 -8.747  1.010   1.00 17.04 ? 1231 HOH A O   1 
HETATM 1842 O O   . HOH C 3 .   ? 35.974 5.298   -4.263  1.00 18.70 ? 1232 HOH A O   1 
HETATM 1843 O O   . HOH C 3 .   ? 38.796 -12.124 6.956   1.00 12.36 ? 1233 HOH A O   1 
HETATM 1844 O O   . HOH C 3 .   ? 34.367 -6.206  6.372   1.00 17.23 ? 1234 HOH A O   1 
HETATM 1845 O O   . HOH C 3 .   ? 33.863 8.692   -0.642  1.00 19.69 ? 1235 HOH A O   1 
HETATM 1846 O O   . HOH C 3 .   ? 28.704 -0.309  -15.884 1.00 16.74 ? 1236 HOH A O   1 
HETATM 1847 O O   . HOH C 3 .   ? 25.830 -7.976  -0.439  1.00 18.65 ? 1237 HOH A O   1 
HETATM 1848 O O   . HOH C 3 .   ? 23.720 -3.212  -14.418 1.00 18.38 ? 1238 HOH A O   1 
HETATM 1849 O O   . HOH C 3 .   ? 18.409 -3.678  -10.777 1.00 18.35 ? 1239 HOH A O   1 
HETATM 1850 O O   . HOH C 3 .   ? 9.453  18.792  10.757  1.00 18.25 ? 1240 HOH A O   1 
HETATM 1851 O O   . HOH C 3 .   ? 30.712 11.886  -8.961  1.00 23.02 ? 1241 HOH A O   1 
HETATM 1852 O O   . HOH C 3 .   ? 16.748 16.967  31.910  1.00 19.69 ? 1242 HOH A O   1 
HETATM 1853 O O   . HOH C 3 .   ? 30.580 4.912   26.742  1.00 24.96 ? 1243 HOH A O   1 
HETATM 1854 O O   . HOH C 3 .   ? 29.652 19.630  8.482   1.00 19.67 ? 1244 HOH A O   1 
HETATM 1855 O O   . HOH C 3 .   ? 34.036 11.362  8.669   1.00 15.78 ? 1245 HOH A O   1 
HETATM 1856 O O   . HOH C 3 .   ? 35.650 7.576   -19.682 1.00 17.56 ? 1246 HOH A O   1 
HETATM 1857 O O   . HOH C 3 .   ? 17.116 6.375   17.070  1.00 26.44 ? 1247 HOH A O   1 
HETATM 1858 O O   . HOH C 3 .   ? 18.761 27.770  25.977  1.00 17.91 ? 1248 HOH A O   1 
HETATM 1859 O O   . HOH C 3 .   ? 38.735 1.478   5.514   1.00 17.23 ? 1249 HOH A O   1 
HETATM 1860 O O   . HOH C 3 .   ? 28.724 -3.118  -15.793 1.00 22.90 ? 1250 HOH A O   1 
HETATM 1861 O O   . HOH C 3 .   ? 31.328 8.251   -21.500 1.00 22.85 ? 1251 HOH A O   1 
HETATM 1862 O O   . HOH C 3 .   ? 24.799 8.168   -20.116 1.00 18.82 ? 1252 HOH A O   1 
HETATM 1863 O O   . HOH C 3 .   ? 21.677 9.730   26.539  1.00 14.03 ? 1253 HOH A O   1 
HETATM 1864 O O   . HOH C 3 .   ? 14.323 3.280   0.708   1.00 20.13 ? 1254 HOH A O   1 
HETATM 1865 O O   . HOH C 3 .   ? 36.585 8.073   -0.045  1.00 24.24 ? 1255 HOH A O   1 
HETATM 1866 O O   . HOH C 3 .   ? 38.397 -15.696 1.027   1.00 23.78 ? 1256 HOH A O   1 
HETATM 1867 O O   . HOH C 3 .   ? 23.668 -5.748  6.333   1.00 31.05 ? 1257 HOH A O   1 
HETATM 1868 O O   . HOH C 3 .   ? 35.299 3.610   -18.081 1.00 19.47 ? 1258 HOH A O   1 
HETATM 1869 O O   . HOH C 3 .   ? 27.113 24.259  14.968  1.00 24.51 ? 1259 HOH A O   1 
HETATM 1870 O O   . HOH C 3 .   ? 12.553 15.260  -13.730 1.00 20.71 ? 1260 HOH A O   1 
HETATM 1871 O O   . HOH C 3 .   ? 18.188 1.287   12.703  1.00 33.11 ? 1261 HOH A O   1 
HETATM 1872 O O   . HOH C 3 .   ? 33.976 -4.911  -11.624 1.00 23.70 ? 1262 HOH A O   1 
HETATM 1873 O O   . HOH C 3 .   ? 8.729  15.570  16.215  1.00 20.52 ? 1263 HOH A O   1 
HETATM 1874 O O   . HOH C 3 .   ? 15.694 1.644   2.415   1.00 16.91 ? 1264 HOH A O   1 
HETATM 1875 O O   . HOH C 3 .   ? 30.512 15.457  1.938   1.00 24.86 ? 1265 HOH A O   1 
HETATM 1876 O O   . HOH C 3 .   ? 9.570  17.180  8.525   1.00 18.76 ? 1266 HOH A O   1 
HETATM 1877 O O   . HOH C 3 .   ? 24.103 -10.800 -4.300  1.00 23.12 ? 1267 HOH A O   1 
HETATM 1878 O O   . HOH C 3 .   ? 42.627 -8.277  2.391   1.00 35.46 ? 1268 HOH A O   1 
HETATM 1879 O O   . HOH C 3 .   ? 15.789 2.020   -9.572  1.00 24.00 ? 1269 HOH A O   1 
HETATM 1880 O O   . HOH C 3 .   ? 9.778  15.685  3.532   1.00 19.88 ? 1270 HOH A O   1 
HETATM 1881 O O   . HOH C 3 .   ? 6.968  9.632   -1.087  1.00 25.60 ? 1271 HOH A O   1 
HETATM 1882 O O   . HOH C 3 .   ? 34.251 20.829  16.302  1.00 19.33 ? 1272 HOH A O   1 
HETATM 1883 O O   . HOH C 3 .   ? 22.779 27.535  22.977  1.00 18.58 ? 1273 HOH A O   1 
HETATM 1884 O O   . HOH C 3 .   ? 24.196 -5.864  -0.825  1.00 13.96 ? 1274 HOH A O   1 
HETATM 1885 O O   . HOH C 3 .   ? 17.338 10.291  0.647   1.00 19.76 ? 1275 HOH A O   1 
HETATM 1886 O O   . HOH C 3 .   ? 20.183 -0.934  9.990   1.00 32.03 ? 1276 HOH A O   1 
HETATM 1887 O O   . HOH C 3 .   ? 28.253 2.217   -18.893 1.00 22.20 ? 1277 HOH A O   1 
HETATM 1888 O O   . HOH C 3 .   ? 20.260 15.686  -18.651 1.00 29.95 ? 1278 HOH A O   1 
HETATM 1889 O O   . HOH C 3 .   ? 9.101  14.309  -5.466  1.00 27.58 ? 1279 HOH A O   1 
HETATM 1890 O O   . HOH C 3 .   ? 18.279 -1.951  0.552   1.00 24.80 ? 1280 HOH A O   1 
HETATM 1891 O O   . HOH C 3 .   ? 14.891 20.475  30.857  1.00 31.00 ? 1281 HOH A O   1 
HETATM 1892 O O   . HOH C 3 .   ? 7.192  17.918  15.595  1.00 26.83 ? 1282 HOH A O   1 
HETATM 1893 O O   . HOH C 3 .   ? 26.151 0.360   -16.113 1.00 19.44 ? 1283 HOH A O   1 
HETATM 1894 O O   . HOH C 3 .   ? 28.528 15.089  -3.791  1.00 26.50 ? 1284 HOH A O   1 
HETATM 1895 O O   . HOH C 3 .   ? 40.837 -2.817  0.024   1.00 28.52 ? 1285 HOH A O   1 
HETATM 1896 O O   . HOH C 3 .   ? 27.127 9.312   -21.637 1.00 34.93 ? 1286 HOH A O   1 
HETATM 1897 O O   . HOH C 3 .   ? 34.556 9.233   4.246   1.00 28.34 ? 1287 HOH A O   1 
HETATM 1898 O O   . HOH C 3 .   ? 16.052 13.306  1.097   1.00 28.94 ? 1288 HOH A O   1 
HETATM 1899 O O   . HOH C 3 .   ? 11.304 9.669   -19.643 1.00 30.08 ? 1289 HOH A O   1 
HETATM 1900 O O   . HOH C 3 .   ? 21.945 5.527   29.407  1.00 27.75 ? 1290 HOH A O   1 
HETATM 1901 O O   . HOH C 3 .   ? 13.078 5.650   -7.984  1.00 22.80 ? 1291 HOH A O   1 
HETATM 1902 O O   . HOH C 3 .   ? 20.832 18.771  7.067   1.00 17.47 ? 1292 HOH A O   1 
HETATM 1903 O O   . HOH C 3 .   ? 29.896 11.433  -16.085 1.00 25.99 ? 1293 HOH A O   1 
HETATM 1904 O O   . HOH C 3 .   ? 40.770 -1.262  2.300   1.00 23.50 ? 1294 HOH A O   1 
HETATM 1905 O O   . HOH C 3 .   ? 25.758 2.164   -18.231 1.00 24.67 ? 1295 HOH A O   1 
HETATM 1906 O O   . HOH C 3 .   ? 24.232 4.338   -18.147 1.00 20.47 ? 1296 HOH A O   1 
HETATM 1907 O O   . HOH C 3 .   ? 38.078 -7.422  -8.763  1.00 23.54 ? 1297 HOH A O   1 
HETATM 1908 O O   . HOH C 3 .   ? 30.586 -8.739  -10.627 1.00 23.02 ? 1298 HOH A O   1 
HETATM 1909 O O   . HOH C 3 .   ? 27.534 -6.358  -13.250 1.00 30.48 ? 1299 HOH A O   1 
HETATM 1910 O O   . HOH C 3 .   ? 10.535 4.698   -8.691  1.00 34.38 ? 1300 HOH A O   1 
HETATM 1911 O O   . HOH C 3 .   ? 31.901 11.461  31.864  1.00 30.02 ? 1301 HOH A O   1 
HETATM 1912 O O   . HOH C 3 .   ? 25.887 25.014  9.551   1.00 28.17 ? 1302 HOH A O   1 
HETATM 1913 O O   . HOH C 3 .   ? 16.027 -1.059  1.866   1.00 29.76 ? 1303 HOH A O   1 
HETATM 1914 O O   . HOH C 3 .   ? 23.946 14.095  -16.330 1.00 33.16 ? 1304 HOH A O   1 
HETATM 1915 O O   . HOH C 3 .   ? 18.734 24.957  15.976  1.00 33.15 ? 1305 HOH A O   1 
HETATM 1916 O O   . HOH C 3 .   ? 22.646 9.487   -20.130 1.00 29.71 ? 1306 HOH A O   1 
HETATM 1917 O O   . HOH C 3 .   ? 24.518 4.933   30.629  1.00 24.78 ? 1307 HOH A O   1 
HETATM 1918 O O   . HOH C 3 .   ? 23.570 2.962   24.186  1.00 33.21 ? 1308 HOH A O   1 
HETATM 1919 O O   . HOH C 3 .   ? 31.992 24.238  17.288  1.00 37.24 ? 1309 HOH A O   1 
HETATM 1920 O O   . HOH C 3 .   ? 33.150 -7.452  -11.917 1.00 38.43 ? 1310 HOH A O   1 
HETATM 1921 O O   . HOH C 3 .   ? 19.052 9.663   29.841  1.00 26.22 ? 1311 HOH A O   1 
HETATM 1922 O O   . HOH C 3 .   ? 14.312 0.864   -14.163 1.00 23.73 ? 1312 HOH A O   1 
HETATM 1923 O O   . HOH C 3 .   ? 23.122 -6.301  -3.215  1.00 27.44 ? 1313 HOH A O   1 
HETATM 1924 O O   . HOH C 3 .   ? 31.441 21.417  7.266   1.00 33.73 ? 1314 HOH A O   1 
HETATM 1925 O O   . HOH C 3 .   ? 33.516 22.529  18.985  1.00 23.95 ? 1315 HOH A O   1 
HETATM 1926 O O   . HOH C 3 .   ? 34.510 18.341  15.165  1.00 12.48 ? 1316 HOH A O   1 
HETATM 1927 O O   . HOH C 3 .   ? 36.493 16.559  15.699  1.00 15.05 ? 1317 HOH A O   1 
HETATM 1928 O O   . HOH C 3 .   ? 17.977 18.851  38.523  1.00 16.35 ? 1318 HOH A O   1 
HETATM 1929 O O   . HOH C 3 .   ? 19.180 15.752  32.293  1.00 16.06 ? 1319 HOH A O   1 
HETATM 1930 O O   . HOH C 3 .   ? 16.708 19.872  8.516   1.00 17.01 ? 1320 HOH A O   1 
HETATM 1931 O O   . HOH C 3 .   ? 15.633 18.958  37.009  1.00 18.23 ? 1321 HOH A O   1 
HETATM 1932 O O   . HOH C 3 .   ? 34.445 17.335  32.234  1.00 15.59 ? 1322 HOH A O   1 
HETATM 1933 O O   . HOH C 3 .   ? 16.101 18.760  34.211  1.00 18.80 ? 1323 HOH A O   1 
HETATM 1934 O O   . HOH C 3 .   ? 19.528 20.247  8.978   1.00 12.88 ? 1324 HOH A O   1 
HETATM 1935 O O   . HOH C 3 .   ? 33.891 23.101  28.051  1.00 17.22 ? 1325 HOH A O   1 
HETATM 1936 O O   . HOH C 3 .   ? 15.922 17.747  6.878   1.00 15.08 ? 1326 HOH A O   1 
HETATM 1937 O O   . HOH C 3 .   ? 34.700 10.542  24.031  1.00 15.38 ? 1327 HOH A O   1 
HETATM 1938 O O   . HOH C 3 .   ? 37.614 3.971   -0.836  1.00 16.76 ? 1328 HOH A O   1 
HETATM 1939 O O   . HOH C 3 .   ? 8.533  17.325  26.187  1.00 20.54 ? 1329 HOH A O   1 
HETATM 1940 O O   . HOH C 3 .   ? 33.658 15.879  35.366  1.00 28.45 ? 1330 HOH A O   1 
HETATM 1941 O O   . HOH C 3 .   ? 13.265 13.788  28.315  1.00 20.86 ? 1331 HOH A O   1 
HETATM 1942 O O   . HOH C 3 .   ? 15.856 21.312  33.048  1.00 16.61 ? 1332 HOH A O   1 
HETATM 1943 O O   . HOH C 3 .   ? 14.176 13.844  2.902   1.00 28.20 ? 1333 HOH A O   1 
HETATM 1944 O O   . HOH C 3 .   ? 35.393 11.018  26.630  1.00 20.43 ? 1334 HOH A O   1 
HETATM 1945 O O   . HOH C 3 .   ? 21.547 16.818  -5.980  1.00 24.36 ? 1335 HOH A O   1 
HETATM 1946 O O   . HOH C 3 .   ? 35.338 13.949  8.148   1.00 22.62 ? 1336 HOH A O   1 
HETATM 1947 O O   . HOH C 3 .   ? 26.935 27.099  35.768  1.00 23.49 ? 1337 HOH A O   1 
HETATM 1948 O O   . HOH C 3 .   ? 18.864 12.621  38.874  1.00 24.14 ? 1338 HOH A O   1 
HETATM 1949 O O   . HOH C 3 .   ? 5.336  6.762   6.589   1.00 22.28 ? 1339 HOH A O   1 
HETATM 1950 O O   . HOH C 3 .   ? 10.467 6.589   11.364  1.00 22.36 ? 1340 HOH A O   1 
HETATM 1951 O O   . HOH C 3 .   ? 25.172 27.714  24.583  1.00 27.01 ? 1341 HOH A O   1 
HETATM 1952 O O   . HOH C 3 .   ? 14.011 16.268  -11.804 1.00 22.51 ? 1342 HOH A O   1 
HETATM 1953 O O   . HOH C 3 .   ? 18.973 13.046  32.419  1.00 18.71 ? 1343 HOH A O   1 
HETATM 1954 O O   . HOH C 3 .   ? 20.254 28.595  23.796  1.00 19.15 ? 1344 HOH A O   1 
HETATM 1955 O O   . HOH C 3 .   ? 19.018 8.781   32.456  1.00 23.39 ? 1345 HOH A O   1 
HETATM 1956 O O   . HOH C 3 .   ? 25.967 2.452   21.130  1.00 20.32 ? 1346 HOH A O   1 
HETATM 1957 O O   . HOH C 3 .   ? 30.622 3.690   -21.259 1.00 23.34 ? 1347 HOH A O   1 
HETATM 1958 O O   . HOH C 3 .   ? 32.664 12.125  34.332  1.00 31.43 ? 1348 HOH A O   1 
HETATM 1959 O O   . HOH C 3 .   ? 18.342 31.562  34.184  1.00 27.67 ? 1349 HOH A O   1 
HETATM 1960 O O   . HOH C 3 .   ? 13.152 14.751  -2.631  1.00 21.30 ? 1350 HOH A O   1 
HETATM 1961 O O   . HOH C 3 .   ? 39.718 3.197   -2.105  1.00 25.57 ? 1351 HOH A O   1 
HETATM 1962 O O   . HOH C 3 .   ? 14.335 15.585  4.474   1.00 22.01 ? 1352 HOH A O   1 
HETATM 1963 O O   . HOH C 3 .   ? 37.317 6.382   -1.992  1.00 28.84 ? 1353 HOH A O   1 
HETATM 1964 O O   . HOH C 3 .   ? 11.342 23.466  16.776  1.00 26.31 ? 1354 HOH A O   1 
HETATM 1965 O O   . HOH C 3 .   ? 35.645 19.385  12.895  1.00 23.88 ? 1355 HOH A O   1 
HETATM 1966 O O   . HOH C 3 .   ? 19.165 24.590  7.615   1.00 26.07 ? 1356 HOH A O   1 
HETATM 1967 O O   . HOH C 3 .   ? 21.889 -6.401  0.525   1.00 23.83 ? 1357 HOH A O   1 
HETATM 1968 O O   . HOH C 3 .   ? 29.493 10.097  -20.729 1.00 27.99 ? 1358 HOH A O   1 
HETATM 1969 O O   . HOH C 3 .   ? 35.874 4.384   -11.902 1.00 29.19 ? 1359 HOH A O   1 
HETATM 1970 O O   . HOH C 3 .   ? 31.784 14.308  35.232  1.00 24.50 ? 1360 HOH A O   1 
HETATM 1971 O O   . HOH C 3 .   ? 18.646 13.726  2.074   1.00 21.99 ? 1361 HOH A O   1 
HETATM 1972 O O   . HOH C 3 .   ? 38.634 14.253  12.234  1.00 26.65 ? 1362 HOH A O   1 
HETATM 1973 O O   . HOH C 3 .   ? 36.213 16.809  29.036  1.00 24.87 ? 1363 HOH A O   1 
HETATM 1974 O O   . HOH C 3 .   ? 40.575 1.356   1.897   1.00 26.10 ? 1364 HOH A O   1 
HETATM 1975 O O   . HOH C 3 .   ? 24.812 -1.861  -16.641 1.00 29.12 ? 1365 HOH A O   1 
HETATM 1976 O O   . HOH C 3 .   ? 12.964 21.307  29.130  1.00 29.00 ? 1366 HOH A O   1 
HETATM 1977 O O   . HOH C 3 .   ? 10.421 4.319   -1.462  1.00 29.52 ? 1367 HOH A O   1 
HETATM 1978 O O   . HOH C 3 .   ? 17.364 0.325   -7.720  1.00 24.21 ? 1368 HOH A O   1 
HETATM 1979 O O   . HOH C 3 .   ? 17.685 2.223   3.938   1.00 28.15 ? 1369 HOH A O   1 
HETATM 1980 O O   . HOH C 3 .   ? 32.199 26.456  25.204  1.00 28.89 ? 1370 HOH A O   1 
HETATM 1981 O O   . HOH C 3 .   ? 15.486 7.111   -19.278 1.00 30.91 ? 1371 HOH A O   1 
HETATM 1982 O O   . HOH C 3 .   ? 30.954 -11.272 -9.601  1.00 23.06 ? 1372 HOH A O   1 
HETATM 1983 O O   . HOH C 3 .   ? 14.888 2.684   11.358  1.00 33.38 ? 1373 HOH A O   1 
HETATM 1984 O O   . HOH C 3 .   ? 35.125 9.602   -3.431  1.00 27.12 ? 1374 HOH A O   1 
HETATM 1985 O O   . HOH C 3 .   ? 15.566 25.583  20.000  1.00 28.47 ? 1375 HOH A O   1 
HETATM 1986 O O   . HOH C 3 .   ? 14.023 22.731  34.313  1.00 26.60 ? 1376 HOH A O   1 
HETATM 1987 O O   . HOH C 3 .   ? 35.418 3.139   -15.595 1.00 30.75 ? 1377 HOH A O   1 
HETATM 1988 O O   . HOH C 3 .   ? 13.003 13.281  -0.580  1.00 27.24 ? 1378 HOH A O   1 
HETATM 1989 O O   . HOH C 3 .   ? 20.813 7.922   28.315  1.00 28.60 ? 1379 HOH A O   1 
HETATM 1990 O O   . HOH C 3 .   ? 34.799 -10.044 7.414   1.00 20.93 ? 1380 HOH A O   1 
HETATM 1991 O O   . HOH C 3 .   ? 20.060 10.805  33.727  1.00 34.57 ? 1381 HOH A O   1 
HETATM 1992 O O   . HOH C 3 .   ? 23.909 5.215   -20.602 1.00 28.02 ? 1382 HOH A O   1 
HETATM 1993 O O   . HOH C 3 .   ? 30.956 12.595  -11.455 1.00 39.02 ? 1383 HOH A O   1 
HETATM 1994 O O   . HOH C 3 .   ? 27.650 -8.671  4.076   1.00 25.45 ? 1384 HOH A O   1 
HETATM 1995 O O   . HOH C 3 .   ? 28.517 24.387  17.241  1.00 28.74 ? 1385 HOH A O   1 
HETATM 1996 O O   . HOH C 3 .   ? 20.268 31.265  24.448  1.00 23.87 ? 1386 HOH A O   1 
HETATM 1997 O O   . HOH C 3 .   ? 15.029 23.813  8.613   1.00 31.07 ? 1387 HOH A O   1 
HETATM 1998 O O   . HOH C 3 .   ? 6.925  18.914  12.819  1.00 25.66 ? 1388 HOH A O   1 
HETATM 1999 O O   . HOH C 3 .   ? 20.810 22.414  8.493   1.00 29.91 ? 1389 HOH A O   1 
HETATM 2000 O O   . HOH C 3 .   ? 8.610  14.094  14.090  1.00 33.06 ? 1390 HOH A O   1 
HETATM 2001 O O   . HOH C 3 .   ? 10.913 12.944  13.477  1.00 29.22 ? 1391 HOH A O   1 
HETATM 2002 O O   . HOH C 3 .   ? 22.101 -8.549  -10.721 1.00 30.20 ? 1392 HOH A O   1 
HETATM 2003 O O   . HOH C 3 .   ? 26.984 14.591  -9.587  1.00 32.22 ? 1393 HOH A O   1 
HETATM 2004 O O   . HOH C 3 .   ? 30.064 12.277  -18.960 1.00 31.73 ? 1394 HOH A O   1 
HETATM 2005 O O   . HOH C 3 .   ? 30.447 -12.060 -7.177  1.00 29.67 ? 1395 HOH A O   1 
HETATM 2006 O O   . HOH C 3 .   ? 30.732 23.513  23.352  1.00 28.73 ? 1396 HOH A O   1 
HETATM 2007 O O   . HOH C 3 .   ? 39.588 -9.754  -2.975  1.00 30.07 ? 1397 HOH A O   1 
HETATM 2008 O O   . HOH C 3 .   ? 33.778 25.771  27.004  1.00 34.78 ? 1398 HOH A O   1 
HETATM 2009 O O   . HOH C 3 .   ? 24.458 0.445   -20.035 1.00 36.43 ? 1399 HOH A O   1 
HETATM 2010 O O   . HOH C 3 .   ? 40.051 0.478   -8.852  1.00 30.44 ? 1400 HOH A O   1 
HETATM 2011 O O   . HOH C 3 .   ? 26.842 34.463  24.308  1.00 39.86 ? 1401 HOH A O   1 
HETATM 2012 O O   . HOH C 3 .   ? 26.813 -8.712  6.801   1.00 30.58 ? 1402 HOH A O   1 
HETATM 2013 O O   . HOH C 3 .   ? 17.888 4.783   -20.005 1.00 30.15 ? 1403 HOH A O   1 
HETATM 2014 O O   . HOH C 3 .   ? 12.400 18.762  7.208   1.00 26.46 ? 1404 HOH A O   1 
HETATM 2015 O O   . HOH C 3 .   ? 23.730 -9.209  -2.059  1.00 29.27 ? 1405 HOH A O   1 
HETATM 2016 O O   . HOH C 3 .   ? 20.530 7.838   -20.608 1.00 30.12 ? 1406 HOH A O   1 
HETATM 2017 O O   . HOH C 3 .   ? 17.960 -5.079  -12.954 1.00 34.48 ? 1407 HOH A O   1 
HETATM 2018 O O   . HOH C 3 .   ? 7.249  15.788  9.698   1.00 36.79 ? 1408 HOH A O   1 
HETATM 2019 O O   . HOH C 3 .   ? 32.070 34.593  27.932  1.00 33.50 ? 1409 HOH A O   1 
HETATM 2020 O O   . HOH C 3 .   ? 7.158  22.146  15.781  1.00 33.04 ? 1410 HOH A O   1 
HETATM 2021 O O   . HOH C 3 .   ? 20.919 -7.644  -3.527  1.00 35.23 ? 1411 HOH A O   1 
HETATM 2022 O O   . HOH C 3 .   ? 8.849  24.010  15.889  1.00 32.85 ? 1412 HOH A O   1 
HETATM 2023 O O   . HOH C 3 .   ? 35.000 -4.820  -14.241 1.00 36.23 ? 1413 HOH A O   1 
HETATM 2024 O O   . HOH C 3 .   ? 18.952 -1.405  -3.826  1.00 30.05 ? 1414 HOH A O   1 
HETATM 2025 O O   . HOH C 3 .   ? 37.104 17.721  9.819   1.00 35.58 ? 1415 HOH A O   1 
HETATM 2026 O O   . HOH C 3 .   ? 39.601 4.331   -4.636  1.00 28.83 ? 1416 HOH A O   1 
HETATM 2027 O O   . HOH C 3 .   ? 33.370 29.069  31.536  1.00 35.89 ? 1417 HOH A O   1 
HETATM 2028 O O   . HOH C 3 .   ? 16.406 28.434  24.860  1.00 39.39 ? 1418 HOH A O   1 
HETATM 2029 O O   . HOH C 3 .   ? 22.097 11.938  -18.909 1.00 27.88 ? 1419 HOH A O   1 
HETATM 2030 O O   . HOH C 3 .   ? 37.686 -5.317  -11.356 1.00 33.20 ? 1420 HOH A O   1 
HETATM 2031 O O   . HOH C 3 .   ? 24.842 15.360  -9.762  1.00 40.61 ? 1421 HOH A O   1 
HETATM 2032 O O   . HOH C 3 .   ? 27.055 0.676   19.299  1.00 35.39 ? 1422 HOH A O   1 
HETATM 2033 O O   . HOH C 3 .   ? 39.544 2.978   -9.032  1.00 41.43 ? 1423 HOH A O   1 
HETATM 2034 O O   . HOH C 3 .   ? 40.760 -1.375  -5.001  1.00 26.45 ? 1424 HOH A O   1 
HETATM 2035 O O   . HOH C 3 .   ? 27.618 24.345  38.682  1.00 30.48 ? 1425 HOH A O   1 
HETATM 2036 O O   . HOH C 3 .   ? 37.350 18.703  36.018  1.00 37.85 ? 1426 HOH A O   1 
HETATM 2037 O O   . HOH C 3 .   ? 16.499 11.478  38.159  1.00 40.84 ? 1427 HOH A O   1 
HETATM 2038 O O   . HOH C 3 .   ? 18.646 32.211  32.262  1.00 30.29 ? 1428 HOH A O   1 
HETATM 2039 O O   . HOH C 3 .   ? 18.542 4.229   16.324  1.00 29.39 ? 1429 HOH A O   1 
HETATM 2040 O O   . HOH C 3 .   ? 9.769  8.637   13.068  1.00 30.27 ? 1430 HOH A O   1 
HETATM 2041 O O   . HOH C 3 .   ? 25.758 5.803   32.615  1.00 39.33 ? 1431 HOH A O   1 
HETATM 2042 O O   . HOH C 3 .   ? 41.202 -3.738  -7.267  1.00 34.37 ? 1432 HOH A O   1 
HETATM 2043 O O   . HOH C 3 .   ? 9.211  15.973  -7.412  1.00 33.66 ? 1433 HOH A O   1 
HETATM 2044 O O   . HOH C 3 .   ? 13.238 23.269  14.087  1.00 33.27 ? 1434 HOH A O   1 
HETATM 2045 O O   . HOH C 3 .   ? 11.849 25.052  13.077  1.00 39.50 ? 1435 HOH A O   1 
HETATM 2046 O O   . HOH C 3 .   ? 22.835 17.036  -8.899  1.00 32.96 ? 1436 HOH A O   1 
HETATM 2047 O O   . HOH C 3 .   ? 7.936  6.899   -3.354  1.00 34.99 ? 1437 HOH A O   1 
HETATM 2048 O O   . HOH C 3 .   ? 34.648 11.715  30.546  1.00 37.82 ? 1438 HOH A O   1 
HETATM 2049 O O   . HOH C 3 .   ? 26.766 26.870  17.721  1.00 31.78 ? 1439 HOH A O   1 
HETATM 2050 O O   . HOH C 3 .   ? 28.604 11.248  39.200  1.00 32.16 ? 1440 HOH A O   1 
HETATM 2051 O O   . HOH C 3 .   ? 20.862 25.845  17.934  1.00 42.54 ? 1441 HOH A O   1 
HETATM 2052 O O   . HOH C 3 .   ? 8.832  21.355  9.614   1.00 34.76 ? 1442 HOH A O   1 
HETATM 2053 O O   . HOH C 3 .   ? 26.568 -3.781  -17.250 1.00 34.42 ? 1443 HOH A O   1 
HETATM 2054 O O   . HOH C 3 .   ? 34.736 -0.462  -17.576 1.00 32.81 ? 1444 HOH A O   1 
HETATM 2055 O O   . HOH C 3 .   ? 21.667 21.369  6.256   1.00 37.01 ? 1445 HOH A O   1 
HETATM 2056 O O   . HOH C 3 .   ? 7.771  12.674  17.622  1.00 34.03 ? 1446 HOH A O   1 
HETATM 2057 O O   . HOH C 3 .   ? 34.609 12.670  -2.719  1.00 33.86 ? 1447 HOH A O   1 
HETATM 2058 O O   . HOH C 3 .   ? 21.324 -4.919  2.589   1.00 30.67 ? 1448 HOH A O   1 
HETATM 2059 O O   . HOH C 3 .   ? 36.513 22.740  16.266  1.00 36.00 ? 1449 HOH A O   1 
HETATM 2060 O O   . HOH C 3 .   ? 37.845 10.702  23.363  1.00 17.92 ? 1450 HOH A O   1 
HETATM 2061 O O   . HOH C 3 .   ? 35.119 10.453  16.014  1.00 17.33 ? 1451 HOH A O   1 
HETATM 2062 O O   . HOH C 3 .   ? 29.925 -13.459 -10.938 1.00 38.10 ? 1452 HOH A O   1 
HETATM 2063 O O   . HOH C 3 .   ? 36.852 22.404  23.346  1.00 31.12 ? 1453 HOH A O   1 
HETATM 2064 O O   . HOH C 3 .   ? 39.569 8.630   23.527  1.00 36.27 ? 1454 HOH A O   1 
HETATM 2065 O O   . HOH C 3 .   ? 38.109 10.985  26.408  1.00 30.75 ? 1455 HOH A O   1 
HETATM 2066 O O   . HOH C 3 .   ? 30.705 14.064  37.546  1.00 37.19 ? 1456 HOH A O   1 
HETATM 2067 O O   . HOH C 3 .   ? 7.052  12.433  21.710  1.00 33.57 ? 1457 HOH A O   1 
HETATM 2068 O O   . HOH C 3 .   ? 17.101 -0.264  -5.223  1.00 40.69 ? 1458 HOH A O   1 
HETATM 2069 O O   . HOH C 3 .   ? 38.965 8.626   27.635  1.00 37.22 ? 1459 HOH A O   1 
HETATM 2070 O O   . HOH C 3 .   ? 12.177 26.804  20.113  1.00 34.20 ? 1460 HOH A O   1 
HETATM 2071 O O   . HOH C 3 .   ? 37.376 9.859   17.425  1.00 29.09 ? 1461 HOH A O   1 
HETATM 2072 O O   . HOH C 3 .   ? 29.041 13.774  -8.185  1.00 34.62 ? 1462 HOH A O   1 
HETATM 2073 O O   . HOH C 3 .   ? 14.862 15.211  32.159  1.00 36.08 ? 1463 HOH A O   1 
HETATM 2074 O O   . HOH C 3 .   ? 36.582 9.745   -18.649 1.00 33.42 ? 1464 HOH A O   1 
HETATM 2075 O O   . HOH C 3 .   ? 33.371 20.397  8.271   1.00 37.30 ? 1465 HOH A O   1 
HETATM 2076 O O   . HOH C 3 .   ? 10.675 15.390  -9.976  1.00 32.13 ? 1466 HOH A O   1 
HETATM 2077 O O   . HOH C 3 .   ? 24.729 30.179  24.038  1.00 39.01 ? 1467 HOH A O   1 
HETATM 2078 O O   . HOH C 3 .   ? 28.178 12.546  -11.205 1.00 31.85 ? 1468 HOH A O   1 
HETATM 2079 O O   . HOH C 3 .   ? 35.252 19.170  6.804   1.00 31.29 ? 1469 HOH A O   1 
HETATM 2080 O O   . HOH C 3 .   ? 22.838 34.587  28.862  1.00 35.32 ? 1470 HOH A O   1 
HETATM 2081 O O   . HOH C 3 .   ? 9.815  24.404  11.332  1.00 42.07 ? 1471 HOH A O   1 
HETATM 2082 O O   . HOH C 3 .   ? 15.493 27.250  22.287  1.00 30.94 ? 1472 HOH A O   1 
HETATM 2083 O O   . HOH C 3 .   ? 39.143 12.733  28.243  1.00 34.79 ? 1473 HOH A O   1 
HETATM 2084 O O   . HOH C 3 .   ? 29.544 0.428   18.170  1.00 30.37 ? 1474 HOH A O   1 
HETATM 2085 O O   . HOH C 3 .   ? 29.259 8.814   38.786  1.00 39.09 ? 1475 HOH A O   1 
HETATM 2086 O O   . HOH C 3 .   ? 13.112 1.730   -5.954  1.00 31.72 ? 1476 HOH A O   1 
HETATM 2087 O O   . HOH C 3 .   ? 16.416 12.311  32.525  1.00 41.23 ? 1477 HOH A O   1 
HETATM 2088 O O   . HOH C 3 .   ? 20.077 32.393  36.192  1.00 41.11 ? 1478 HOH A O   1 
HETATM 2089 O O   . HOH C 3 .   ? 14.191 10.076  -20.411 1.00 43.51 ? 1479 HOH A O   1 
HETATM 2090 O O   . HOH C 3 .   ? 12.330 17.043  -9.376  1.00 32.96 ? 1480 HOH A O   1 
HETATM 2091 O O   . HOH C 3 .   ? 10.811 20.733  6.935   1.00 35.77 ? 1481 HOH A O   1 
HETATM 2092 O O   . HOH C 3 .   ? 19.508 -6.733  -9.017  1.00 39.11 ? 1482 HOH A O   1 
HETATM 2093 O O   . HOH C 3 .   ? 11.985 3.323   -3.448  1.00 34.07 ? 1483 HOH A O   1 
HETATM 2094 O O   . HOH C 3 .   ? 12.541 8.628   21.327  1.00 43.53 ? 1484 HOH A O   1 
HETATM 2095 O O   . HOH C 3 .   ? 29.196 -0.288  -18.460 1.00 35.05 ? 1485 HOH A O   1 
HETATM 2096 O O   . HOH C 3 .   ? 32.817 15.168  -2.303  1.00 34.03 ? 1486 HOH A O   1 
HETATM 2097 O O   . HOH C 3 .   ? 18.819 29.518  21.694  1.00 42.79 ? 1487 HOH A O   1 
HETATM 2098 O O   . HOH C 3 .   ? 23.233 -2.204  -18.886 1.00 33.23 ? 1488 HOH A O   1 
HETATM 2099 O O   . HOH C 3 .   ? 38.641 4.930   -10.679 1.00 44.66 ? 1489 HOH A O   1 
HETATM 2100 O O   . HOH C 3 .   ? 42.980 -2.895  7.353   1.00 40.62 ? 1490 HOH A O   1 
HETATM 2101 O O   . HOH C 3 .   ? 10.109 12.764  21.368  1.00 35.37 ? 1491 HOH A O   1 
HETATM 2102 O O   . HOH C 3 .   ? 6.694  12.276  -1.432  1.00 38.25 ? 1492 HOH A O   1 
HETATM 2103 O O   . HOH C 3 .   ? 20.851 -7.529  3.848   1.00 41.77 ? 1493 HOH A O   1 
HETATM 2104 O O   . HOH C 3 .   ? 32.338 -6.956  -14.865 1.00 42.23 ? 1494 HOH A O   1 
HETATM 2105 O O   . HOH C 3 .   ? 14.683 0.153   -4.083  1.00 36.13 ? 1495 HOH A O   1 
HETATM 2106 O O   . HOH C 3 .   ? 22.276 -3.176  9.411   1.00 38.68 ? 1496 HOH A O   1 
HETATM 2107 O O   . HOH C 3 .   ? 22.160 -9.382  1.481   1.00 40.86 ? 1497 HOH A O   1 
HETATM 2108 O O   . HOH C 3 .   ? 10.169 15.629  -3.008  1.00 35.40 ? 1498 HOH A O   1 
HETATM 2109 O O   . HOH C 3 .   ? 18.104 0.771   -16.465 1.00 28.06 ? 1499 HOH A O   1 
HETATM 2110 O O   . HOH C 3 .   ? 18.827 -1.964  -16.429 1.00 36.88 ? 1500 HOH A O   1 
HETATM 2111 O O   . HOH C 3 .   ? 12.409 23.808  9.668   1.00 34.92 ? 1501 HOH A O   1 
HETATM 2112 O O   . HOH C 3 .   ? 37.077 6.683   -17.724 1.00 32.74 ? 1502 HOH A O   1 
HETATM 2113 O O   . HOH C 3 .   ? 38.504 -10.262 -6.451  1.00 39.82 ? 1503 HOH A O   1 
HETATM 2114 O O   . HOH C 3 .   ? 41.982 3.325   -5.960  1.00 43.29 ? 1504 HOH A O   1 
HETATM 2115 O O   . HOH C 3 .   ? 37.778 10.666  14.880  1.00 42.15 ? 1505 HOH A O   1 
HETATM 2116 O O   . HOH C 3 .   ? 41.376 8.682   21.767  1.00 41.08 ? 1506 HOH A O   1 
HETATM 2117 O O   . HOH C 3 .   ? 27.922 32.955  33.074  1.00 42.42 ? 1507 HOH A O   1 
HETATM 2118 O O   . HOH C 3 .   ? 10.511 10.818  22.414  1.00 39.36 ? 1508 HOH A O   1 
HETATM 2119 O O   . HOH C 3 .   ? 20.170 6.394   33.298  1.00 37.28 ? 1509 HOH A O   1 
HETATM 2120 O O   . HOH C 3 .   ? 39.980 -3.260  -10.795 1.00 35.66 ? 1510 HOH A O   1 
HETATM 2121 O O   . HOH C 3 .   ? 12.898 -0.056  8.712   1.00 40.51 ? 1511 HOH A O   1 
HETATM 2122 O O   . HOH C 3 .   ? 32.067 10.097  36.497  1.00 40.56 ? 1512 HOH A O   1 
HETATM 2123 O O   . HOH C 3 .   ? 14.949 9.915   22.948  1.00 44.38 ? 1513 HOH A O   1 
HETATM 2124 O O   . HOH C 3 .   ? 40.623 1.174   -1.843  1.00 47.70 ? 1514 HOH A O   1 
HETATM 2125 O O   . HOH C 3 .   ? 19.939 -7.977  -11.104 1.00 42.61 ? 1515 HOH A O   1 
HETATM 2126 O O   . HOH C 3 .   ? 7.531  11.628  15.498  1.00 47.66 ? 1516 HOH A O   1 
HETATM 2127 O O   . HOH C 3 .   ? 29.067 -14.155 -8.033  1.00 16.80 ? 1517 HOH A O   1 
HETATM 2128 O O   . HOH C 3 .   ? 33.912 24.230  22.052  1.00 36.15 ? 1518 HOH A O   1 
HETATM 2129 O O   . HOH C 3 .   ? 36.296 -2.626  -17.360 1.00 33.68 ? 1519 HOH A O   1 
HETATM 2130 O O   . HOH C 3 .   ? 11.468 2.551   4.917   1.00 32.85 ? 1520 HOH A O   1 
HETATM 2131 O O   . HOH C 3 .   ? 15.394 0.153   5.681   1.00 35.55 ? 1521 HOH A O   1 
HETATM 2132 O O   . HOH C 3 .   ? 16.847 32.799  30.862  1.00 37.86 ? 1522 HOH A O   1 
HETATM 2133 O O   . HOH C 3 .   ? 35.149 2.728   15.036  1.00 39.70 ? 1523 HOH A O   1 
HETATM 2134 O O   . HOH C 3 .   ? 32.624 6.102   37.586  1.00 43.62 ? 1524 HOH A O   1 
HETATM 2135 O O   . HOH C 3 .   ? 33.035 15.922  0.900   1.00 42.47 ? 1525 HOH A O   1 
HETATM 2136 O O   . HOH C 3 .   ? 28.909 22.802  39.552  1.00 44.03 ? 1526 HOH A O   1 
HETATM 2137 O O   . HOH C 3 .   ? 14.187 1.087   4.556   1.00 38.61 ? 1527 HOH A O   1 
HETATM 2138 O O   . HOH C 3 .   ? 13.749 0.838   -8.268  1.00 42.72 ? 1528 HOH A O   1 
HETATM 2139 O O   . HOH C 3 .   ? 8.122  11.493  19.451  1.00 46.33 ? 1529 HOH A O   1 
HETATM 2140 O O   . HOH C 3 .   ? 9.114  14.529  -0.572  1.00 39.75 ? 1530 HOH A O   1 
HETATM 2141 O O   . HOH C 3 .   ? 16.080 8.234   33.141  1.00 42.22 ? 1531 HOH A O   1 
HETATM 2142 O O   . HOH C 3 .   ? 31.137 3.735   8.984   1.00 23.48 ? 1532 HOH A O   1 
HETATM 2143 O O   . HOH C 3 .   ? 13.816 4.560   16.159  1.00 38.86 ? 1533 HOH A O   1 
HETATM 2144 O O   . HOH C 3 .   ? 24.960 -5.616  -14.040 1.00 31.68 ? 1534 HOH A O   1 
HETATM 2145 O O   . HOH C 3 .   ? 35.041 -0.329  13.617  1.00 37.60 ? 1535 HOH A O   1 
HETATM 2146 O O   . HOH C 3 .   ? 36.645 18.533  26.942  1.00 27.89 ? 1536 HOH A O   1 
HETATM 2147 O O   . HOH C 3 .   ? 5.169  10.473  8.433   1.00 36.56 ? 1537 HOH A O   1 
HETATM 2148 O O   . HOH C 3 .   ? 13.472 17.594  4.620   1.00 44.76 ? 1538 HOH A O   1 
HETATM 2149 O O   . HOH C 3 .   ? 36.557 22.314  28.361  1.00 41.65 ? 1539 HOH A O   1 
HETATM 2150 O O   . HOH C 3 .   ? 13.890 -2.141  -14.691 1.00 35.17 ? 1540 HOH A O   1 
HETATM 2151 O O   . HOH C 3 .   ? 12.789 3.469   -7.912  1.00 36.02 ? 1541 HOH A O   1 
HETATM 2152 O O   . HOH C 3 .   ? 12.825 4.332   12.810  1.00 41.28 ? 1542 HOH A O   1 
HETATM 2153 O O   . HOH C 3 .   ? 11.259 2.957   16.341  1.00 44.05 ? 1543 HOH A O   1 
HETATM 2154 O O   . HOH C 3 .   ? 26.880 31.409  34.414  1.00 45.65 ? 1544 HOH A O   1 
HETATM 2155 O O   . HOH C 3 .   ? 40.423 11.086  28.826  1.00 44.38 ? 1545 HOH A O   1 
HETATM 2156 O O   . HOH C 3 .   ? 22.216 17.353  -15.189 1.00 45.90 ? 1546 HOH A O   1 
HETATM 2157 O O   . HOH C 3 .   ? 35.271 11.385  -6.506  1.00 42.67 ? 1547 HOH A O   1 
HETATM 2158 O O   . HOH C 3 .   ? 12.831 15.390  30.616  1.00 42.38 ? 1548 HOH A O   1 
HETATM 2159 O O   . HOH C 3 .   ? 8.280  14.879  -14.108 1.00 41.47 ? 1549 HOH A O   1 
HETATM 2160 O O   . HOH C 3 .   ? 45.987 -3.139  6.955   1.00 38.67 ? 1550 HOH A O   1 
HETATM 2161 O O   . HOH C 3 .   ? 13.778 24.796  29.398  1.00 29.79 ? 1551 HOH A O   1 
HETATM 2162 O O   . HOH C 3 .   ? 6.813  12.420  -14.343 1.00 36.90 ? 1552 HOH A O   1 
HETATM 2163 O O   . HOH C 3 .   ? 14.661 25.878  10.535  1.00 28.55 ? 1553 HOH A O   1 
HETATM 2164 O O   . HOH C 3 .   ? 31.427 5.289   10.407  1.00 37.38 ? 1554 HOH A O   1 
HETATM 2165 O O   . HOH C 3 .   ? 37.898 -0.463  6.832   1.00 42.50 ? 1555 HOH A O   1 
HETATM 2166 O O   . HOH C 3 .   ? 25.784 30.020  21.680  1.00 38.55 ? 1556 HOH A O   1 
HETATM 2167 O O   . HOH C 3 .   ? 3.523  10.021  6.843   1.00 32.18 ? 1557 HOH A O   1 
HETATM 2168 O O   . HOH C 3 .   ? 20.690 5.023   31.461  1.00 42.84 ? 1558 HOH A O   1 
HETATM 2169 O O   . HOH C 3 .   ? 16.705 7.551   25.458  1.00 42.13 ? 1559 HOH A O   1 
HETATM 2170 O O   . HOH C 3 .   ? 40.543 -6.670  -8.201  1.00 36.57 ? 1560 HOH A O   1 
HETATM 2171 O O   . HOH C 3 .   ? 35.580 17.662  1.108   1.00 41.48 ? 1561 HOH A O   1 
HETATM 2172 O O   . HOH C 3 .   ? 20.540 0.269   16.144  1.00 43.60 ? 1562 HOH A O   1 
HETATM 2173 O O   . HOH C 3 .   ? 30.434 -0.549  14.975  1.00 26.50 ? 1563 HOH A O   1 
HETATM 2174 O O   . HOH C 3 .   ? 35.447 3.364   12.311  1.00 36.72 ? 1564 HOH A O   1 
HETATM 2175 O O   . HOH C 3 .   ? 31.906 -2.391  13.709  1.00 37.05 ? 1565 HOH A O   1 
HETATM 2176 O O   . HOH C 3 .   ? 31.597 -14.533 -11.714 1.00 43.99 ? 1566 HOH A O   1 
HETATM 2177 O O   . HOH C 3 .   ? 34.140 10.121  1.967   1.00 35.54 ? 1567 HOH A O   1 
HETATM 2178 O O   . HOH C 3 .   ? 11.394 21.506  4.677   1.00 35.68 ? 1568 HOH A O   1 
HETATM 2179 O O   . HOH C 3 .   ? 32.401 23.767  24.348  1.00 46.45 ? 1569 HOH A O   1 
HETATM 2180 O O   . HOH C 3 .   ? 12.593 6.864   12.840  1.00 42.99 ? 1570 HOH A O   1 
HETATM 2181 O O   . HOH C 3 .   ? 35.166 11.794  1.102   1.00 40.63 ? 1571 HOH A O   1 
HETATM 2182 O O   . HOH C 3 .   ? 23.230 28.786  20.624  1.00 40.05 ? 1572 HOH A O   1 
HETATM 2183 O O   . HOH C 3 .   ? 21.462 5.035   -21.066 1.00 49.06 ? 1573 HOH A O   1 
HETATM 2184 O O   . HOH C 3 .   ? 37.898 -0.892  9.571   1.00 46.22 ? 1574 HOH A O   1 
HETATM 2185 O O   . HOH C 3 .   ? 10.644 17.912  4.245   1.00 41.23 ? 1575 HOH A O   1 
HETATM 2186 O O   . HOH C 3 .   ? 37.117 18.305  32.051  1.00 37.03 ? 1576 HOH A O   1 
HETATM 2187 O O   . HOH C 3 .   ? 40.258 -0.839  -2.346  1.00 42.50 ? 1577 HOH A O   1 
HETATM 2188 O O   . HOH C 3 .   ? 41.757 1.054   -6.449  1.00 46.65 ? 1578 HOH A O   1 
HETATM 2189 O O   . HOH C 3 .   ? 36.026 0.163   9.394   1.00 39.21 ? 1579 HOH A O   1 
HETATM 2190 O O   . HOH C 3 .   ? 41.154 0.813   5.644   1.00 40.51 ? 1580 HOH A O   1 
HETATM 2191 O O   . HOH C 3 .   ? 25.851 -4.463  15.207  1.00 46.30 ? 1581 HOH A O   1 
HETATM 2192 O O   . HOH C 3 .   ? 37.910 19.391  8.199   1.00 38.58 ? 1582 HOH A O   1 
HETATM 2193 O O   . HOH C 3 .   ? 31.342 8.542   32.309  1.00 43.74 ? 1583 HOH A O   1 
HETATM 2194 O O   . HOH C 3 .   ? 24.223 16.539  40.372  1.00 38.22 ? 1584 HOH A O   1 
HETATM 2195 O O   . HOH C 3 .   ? 33.370 8.416   27.552  1.00 42.28 ? 1585 HOH A O   1 
HETATM 2196 O O   . HOH C 3 .   ? 30.278 16.726  -5.536  1.00 46.98 ? 1586 HOH A O   1 
HETATM 2197 O O   . HOH C 3 .   ? 33.005 23.581  35.559  1.00 27.98 ? 1587 HOH A O   1 
HETATM 2198 O O   . HOH C 3 .   ? 37.437 24.644  26.110  1.00 44.90 ? 1588 HOH A O   1 
HETATM 2199 O O   . HOH C 3 .   ? 26.426 22.321  40.342  1.00 35.79 ? 1589 HOH A O   1 
HETATM 2200 O O   . HOH C 3 .   ? 5.063  8.061   -12.069 1.00 43.77 ? 1590 HOH A O   1 
HETATM 2201 O O   . HOH C 3 .   ? 8.290  10.912  -18.659 1.00 36.22 ? 1591 HOH A O   1 
HETATM 2202 O O   . HOH C 3 .   ? 32.869 16.580  38.562  1.00 36.63 ? 1592 HOH A O   1 
HETATM 2203 O O   . HOH C 3 .   ? 35.979 24.372  23.907  1.00 44.41 ? 1593 HOH A O   1 
HETATM 2204 O O   . HOH C 3 .   ? 21.220 35.924  28.575  1.00 43.15 ? 1594 HOH A O   1 
HETATM 2205 O O   . HOH C 3 .   ? 36.929 -10.239 -8.763  1.00 43.13 ? 1595 HOH A O   1 
HETATM 2206 O O   . HOH C 3 .   ? 27.229 26.214  7.245   1.00 43.36 ? 1596 HOH A O   1 
HETATM 2207 O O   . HOH C 3 .   ? 22.128 -10.772 -8.753  1.00 39.78 ? 1597 HOH A O   1 
HETATM 2208 O O   . HOH C 3 .   ? 23.659 -7.920  -13.815 1.00 43.33 ? 1598 HOH A O   1 
HETATM 2209 O O   . HOH C 3 .   ? 25.111 27.907  15.450  1.00 40.73 ? 1599 HOH A O   1 
HETATM 2210 O O   . HOH C 3 .   ? 14.157 31.778  31.913  1.00 49.19 ? 1600 HOH A O   1 
HETATM 2211 O O   . HOH C 3 .   ? 37.804 5.151   -15.083 1.00 44.41 ? 1601 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ALA A 6   ? 0.3250 0.3417 0.3327 0.0300  0.0068  -0.0041 849  ALA A N   
2    C CA  . ALA A 6   ? 0.3007 0.3084 0.3057 0.0293  0.0078  -0.0034 849  ALA A CA  
3    C C   . ALA A 6   ? 0.2849 0.2879 0.2892 0.0335  0.0081  -0.0014 849  ALA A C   
4    O O   . ALA A 6   ? 0.2972 0.3037 0.3032 0.0376  0.0080  -0.0013 849  ALA A O   
5    C CB  . ALA A 6   ? 0.3219 0.3284 0.3268 0.0278  0.0094  -0.0060 849  ALA A CB  
6    N N   . ASP A 7   ? 0.1735 0.1686 0.1756 0.0325  0.0084  0.0002  850  ASP A N   
7    C CA  . ASP A 7   ? 0.1400 0.1290 0.1416 0.0360  0.0094  0.0021  850  ASP A CA  
8    C C   . ASP A 7   ? 0.1040 0.0901 0.1062 0.0373  0.0109  -0.0002 850  ASP A C   
9    O O   . ASP A 7   ? 0.1689 0.1584 0.1718 0.0357  0.0111  -0.0030 850  ASP A O   
10   C CB  . ASP A 7   ? 0.1505 0.1319 0.1504 0.0341  0.0098  0.0042  850  ASP A CB  
11   C CG  . ASP A 7   ? 0.1761 0.1530 0.1755 0.0297  0.0101  0.0021  850  ASP A CG  
12   O OD1 . ASP A 7   ? 0.1382 0.1150 0.1378 0.0290  0.0106  -0.0007 850  ASP A OD1 
13   O OD2 . ASP A 7   ? 0.2239 0.1978 0.2228 0.0270  0.0098  0.0032  850  ASP A OD2 
14   N N   . LEU A 8   ? 0.1026 0.0821 0.1045 0.0403  0.0121  0.0011  851  LEU A N   
15   C CA  . LEU A 8   ? 0.1331 0.1095 0.1357 0.0423  0.0136  -0.0010 851  LEU A CA  
16   C C   . LEU A 8   ? 0.1525 0.1201 0.1540 0.0395  0.0148  -0.0025 851  LEU A C   
17   O O   . LEU A 8   ? 0.1645 0.1275 0.1664 0.0412  0.0162  -0.0041 851  LEU A O   
18   C CB  . LEU A 8   ? 0.1273 0.1025 0.1306 0.0482  0.0144  0.0010  851  LEU A CB  
19   C CG  . LEU A 8   ? 0.1954 0.1802 0.2003 0.0516  0.0130  0.0017  851  LEU A CG  
20   C CD1 . LEU A 8   ? 0.1916 0.1746 0.1969 0.0580  0.0136  0.0039  851  LEU A CD1 
21   C CD2 . LEU A 8   ? 0.2368 0.2292 0.2440 0.0504  0.0129  -0.0019 851  LEU A CD2 
22   N N   . LEU A 9   ? 0.1465 0.1122 0.1471 0.0353  0.0140  -0.0022 852  LEU A N   
23   C CA  . LEU A 9   ? 0.1198 0.0786 0.1198 0.0322  0.0145  -0.0043 852  LEU A CA  
24   C C   . LEU A 9   ? 0.1365 0.0974 0.1356 0.0305  0.0144  -0.0083 852  LEU A C   
25   O O   . LEU A 9   ? 0.1790 0.1468 0.1776 0.0298  0.0138  -0.0090 852  LEU A O   
26   C CB  . LEU A 9   ? 0.1383 0.0957 0.1380 0.0283  0.0135  -0.0032 852  LEU A CB  
27   C CG  . LEU A 9   ? 0.1490 0.1015 0.1494 0.0293  0.0144  0.0003  852  LEU A CG  
28   C CD1 . LEU A 9   ? 0.1669 0.1207 0.1672 0.0260  0.0133  0.0017  852  LEU A CD1 
29   C CD2 . LEU A 9   ? 0.1561 0.0994 0.1577 0.0294  0.0163  -0.0007 852  LEU A CD2 
30   N N   . PRO A 10  ? 0.1694 0.1243 0.1681 0.0298  0.0153  -0.0110 853  PRO A N   
31   C CA  . PRO A 10  ? 0.1956 0.1523 0.1923 0.0282  0.0152  -0.0147 853  PRO A CA  
32   C C   . PRO A 10  ? 0.2086 0.1672 0.2036 0.0240  0.0134  -0.0151 853  PRO A C   
33   O O   . PRO A 10  ? 0.2152 0.1699 0.2106 0.0216  0.0126  -0.0148 853  PRO A O   
34   C CB  . PRO A 10  ? 0.2715 0.2206 0.2682 0.0286  0.0164  -0.0175 853  PRO A CB  
35   C CG  . PRO A 10  ? 0.3069 0.2497 0.3057 0.0284  0.0167  -0.0154 853  PRO A CG  
36   C CD  . PRO A 10  ? 0.2741 0.2203 0.2739 0.0305  0.0166  -0.0109 853  PRO A CD  
37   N N   . ARG A 11  ? 0.1530 0.1178 0.1466 0.0231  0.0130  -0.0156 854  ARG A N   
38   C CA  . ARG A 11  ? 0.1294 0.0962 0.1211 0.0196  0.0115  -0.0155 854  ARG A CA  
39   C C   . ARG A 11  ? 0.1559 0.1242 0.1442 0.0185  0.0117  -0.0183 854  ARG A C   
40   O O   . ARG A 11  ? 0.1997 0.1713 0.1874 0.0200  0.0132  -0.0193 854  ARG A O   
41   C CB  . ARG A 11  ? 0.1454 0.1181 0.1384 0.0192  0.0109  -0.0126 854  ARG A CB  
42   C CG  . ARG A 11  ? 0.1692 0.1404 0.1645 0.0203  0.0105  -0.0096 854  ARG A CG  
43   C CD  . ARG A 11  ? 0.1189 0.0962 0.1151 0.0200  0.0097  -0.0073 854  ARG A CD  
44   N NE  . ARG A 11  ? 0.1038 0.0789 0.1012 0.0208  0.0094  -0.0045 854  ARG A NE  
45   C CZ  . ARG A 11  ? 0.1072 0.0791 0.1045 0.0184  0.0087  -0.0035 854  ARG A CZ  
46   N NH1 . ARG A 11  ? 0.1333 0.1043 0.1296 0.0152  0.0079  -0.0052 854  ARG A NH1 
47   N NH2 . ARG A 11  ? 0.1511 0.1210 0.1493 0.0194  0.0090  -0.0008 854  ARG A NH2 
48   N N   . VAL A 12  ? 0.1338 0.0997 0.1196 0.0159  0.0103  -0.0196 855  VAL A N   
49   C CA  . VAL A 12  ? 0.2203 0.1870 0.2017 0.0149  0.0103  -0.0221 855  VAL A CA  
50   C C   . VAL A 12  ? 0.1949 0.1667 0.1748 0.0135  0.0103  -0.0203 855  VAL A C   
51   O O   . VAL A 12  ? 0.1807 0.1535 0.1618 0.0118  0.0089  -0.0181 855  VAL A O   
52   C CB  . VAL A 12  ? 0.2095 0.1719 0.1889 0.0131  0.0084  -0.0244 855  VAL A CB  
53   C CG1 . VAL A 12  ? 0.2543 0.2178 0.2279 0.0125  0.0081  -0.0266 855  VAL A CG1 
54   C CG2 . VAL A 12  ? 0.2558 0.2127 0.2371 0.0141  0.0087  -0.0267 855  VAL A CG2 
55   N N   . ASP A 13  ? 0.1871 0.1615 0.1642 0.0140  0.0120  -0.0213 856  ASP A N   
56   C CA  . ASP A 13  ? 0.1734 0.1516 0.1486 0.0124  0.0124  -0.0199 856  ASP A CA  
57   C C   . ASP A 13  ? 0.2071 0.1826 0.1768 0.0109  0.0110  -0.0210 856  ASP A C   
58   O O   . ASP A 13  ? 0.2003 0.1742 0.1658 0.0117  0.0118  -0.0234 856  ASP A O   
59   C CB  . ASP A 13  ? 0.2266 0.2089 0.2016 0.0135  0.0153  -0.0204 856  ASP A CB  
60   C CG  . ASP A 13  ? 0.2234 0.2090 0.1969 0.0116  0.0164  -0.0189 856  ASP A CG  
61   O OD1 . ASP A 13  ? 0.2073 0.1923 0.1803 0.0097  0.0147  -0.0172 856  ASP A OD1 
62   O OD2 . ASP A 13  ? 0.2910 0.2797 0.2640 0.0120  0.0191  -0.0195 856  ASP A OD2 
63   N N   . ILE A 14  ? 0.1639 0.1391 0.1337 0.0090  0.0090  -0.0194 857  ILE A N   
64   C CA  . ILE A 14  ? 0.1808 0.1538 0.1456 0.0080  0.0073  -0.0204 857  ILE A CA  
65   C C   . ILE A 14  ? 0.1556 0.1306 0.1161 0.0073  0.0085  -0.0189 857  ILE A C   
66   O O   . ILE A 14  ? 0.1742 0.1477 0.1298 0.0069  0.0072  -0.0192 857  ILE A O   
67   C CB  . ILE A 14  ? 0.1921 0.1634 0.1590 0.0065  0.0042  -0.0198 857  ILE A CB  
68   C CG1 . ILE A 14  ? 0.1690 0.1428 0.1391 0.0053  0.0041  -0.0166 857  ILE A CG1 
69   C CG2 . ILE A 14  ? 0.1635 0.1318 0.1341 0.0070  0.0034  -0.0216 857  ILE A CG2 
70   C CD1 . ILE A 14  ? 0.1855 0.1581 0.1570 0.0038  0.0015  -0.0159 857  ILE A CD1 
71   N N   . ALA A 15  ? 0.1717 0.1502 0.1342 0.0072  0.0111  -0.0174 858  ALA A N   
72   C CA  . ALA A 15  ? 0.1904 0.1701 0.1493 0.0063  0.0129  -0.0159 858  ALA A CA  
73   C C   . ALA A 15  ? 0.1604 0.1379 0.1117 0.0072  0.0138  -0.0172 858  ALA A C   
74   O O   . ALA A 15  ? 0.2107 0.1870 0.1573 0.0066  0.0135  -0.0159 858  ALA A O   
75   C CB  . ALA A 15  ? 0.1890 0.1730 0.1518 0.0061  0.0160  -0.0150 858  ALA A CB  
76   N N   . PRO A 16  ? 0.2111 0.1879 0.1608 0.0089  0.0149  -0.0198 859  PRO A N   
77   C CA  . PRO A 16  ? 0.2153 0.1900 0.1569 0.0100  0.0157  -0.0213 859  PRO A CA  
78   C C   . PRO A 16  ? 0.2016 0.1734 0.1384 0.0100  0.0121  -0.0220 859  PRO A C   
79   O O   . PRO A 16  ? 0.2435 0.2139 0.1727 0.0108  0.0124  -0.0222 859  PRO A O   
80   C CB  . PRO A 16  ? 0.2753 0.2496 0.2174 0.0118  0.0169  -0.0245 859  PRO A CB  
81   C CG  . PRO A 16  ? 0.2319 0.2095 0.1817 0.0118  0.0185  -0.0236 859  PRO A CG  
82   C CD  . PRO A 16  ? 0.1798 0.1580 0.1344 0.0102  0.0160  -0.0213 859  PRO A CD  
83   N N   . GLN A 17  ? 0.1824 0.1534 0.1236 0.0092  0.0087  -0.0224 860  GLN A N   
84   C CA  . GLN A 17  ? 0.1846 0.1535 0.1226 0.0091  0.0049  -0.0236 860  GLN A CA  
85   C C   . GLN A 17  ? 0.1943 0.1638 0.1313 0.0080  0.0037  -0.0204 860  GLN A C   
86   O O   . GLN A 17  ? 0.1983 0.1667 0.1317 0.0083  0.0007  -0.0210 860  GLN A O   
87   C CB  . GLN A 17  ? 0.1854 0.1531 0.1291 0.0085  0.0021  -0.0257 860  GLN A CB  
88   C CG  . GLN A 17  ? 0.1714 0.1375 0.1157 0.0098  0.0029  -0.0293 860  GLN A CG  
89   C CD  . GLN A 17  ? 0.1466 0.1105 0.0959 0.0090  0.0002  -0.0316 860  GLN A CD  
90   O OE1 . GLN A 17  ? 0.2849 0.2479 0.2326 0.0086  -0.0029 -0.0338 860  GLN A OE1 
91   N NE2 . GLN A 17  ? 0.1656 0.1290 0.1211 0.0090  0.0015  -0.0311 860  GLN A NE2 
92   N N   . ILE A 18  ? 0.1708 0.1421 0.1111 0.0069  0.0059  -0.0174 861  ILE A N   
93   C CA  . ILE A 18  ? 0.1565 0.1279 0.0958 0.0060  0.0054  -0.0144 861  ILE A CA  
94   C C   . ILE A 18  ? 0.2264 0.1967 0.1580 0.0068  0.0080  -0.0130 861  ILE A C   
95   O O   . ILE A 18  ? 0.2155 0.1868 0.1478 0.0060  0.0115  -0.0108 861  ILE A O   
96   C CB  . ILE A 18  ? 0.2027 0.1763 0.1489 0.0042  0.0066  -0.0121 861  ILE A CB  
97   C CG1 . ILE A 18  ? 0.1927 0.1670 0.1457 0.0038  0.0049  -0.0133 861  ILE A CG1 
98   C CG2 . ILE A 18  ? 0.1833 0.1564 0.1289 0.0033  0.0055  -0.0095 861  ILE A CG2 
99   C CD1 . ILE A 18  ? 0.1816 0.1543 0.1353 0.0038  0.0011  -0.0146 861  ILE A CD1 
100  N N   . THR A 19  ? 0.1659 0.1343 0.0903 0.0085  0.0063  -0.0143 862  THR A N   
101  C CA  . THR A 19  ? 0.1744 0.1411 0.0900 0.0099  0.0089  -0.0131 862  THR A CA  
102  C C   . THR A 19  ? 0.2014 0.1667 0.1139 0.0097  0.0089  -0.0094 862  THR A C   
103  O O   . THR A 19  ? 0.2123 0.1779 0.1284 0.0090  0.0061  -0.0085 862  THR A O   
104  C CB  . THR A 19  ? 0.2444 0.2097 0.1526 0.0122  0.0067  -0.0161 862  THR A CB  
105  O OG1 . THR A 19  ? 0.2283 0.1932 0.1360 0.0126  0.0017  -0.0168 862  THR A OG1 
106  C CG2 . THR A 19  ? 0.2063 0.1723 0.1172 0.0125  0.0069  -0.0200 862  THR A CG2 
107  N N   . GLU A 20  ? 0.2301 0.1937 0.1357 0.0106  0.0125  -0.0073 863  GLU A N   
108  C CA  . GLU A 20  ? 0.2122 0.1733 0.1136 0.0109  0.0129  -0.0037 863  GLU A CA  
109  C C   . GLU A 20  ? 0.2618 0.2219 0.1588 0.0130  0.0077  -0.0043 863  GLU A C   
110  O O   . GLU A 20  ? 0.2462 0.2055 0.1440 0.0129  0.0059  -0.0021 863  GLU A O   
111  C CB  . GLU A 20  ? 0.2730 0.2316 0.1665 0.0119  0.0179  -0.0014 863  GLU A CB  
112  C CG  . GLU A 20  ? 0.3655 0.3255 0.2641 0.0096  0.0234  -0.0005 863  GLU A CG  
113  C CD  . GLU A 20  ? 0.5684 0.5284 0.4732 0.0072  0.0247  0.0023  863  GLU A CD  
114  O OE1 . GLU A 20  ? 0.5989 0.5567 0.5020 0.0076  0.0224  0.0043  863  GLU A OE1 
115  O OE2 . GLU A 20  ? 0.6734 0.6359 0.5850 0.0049  0.0280  0.0021  863  GLU A OE2 
116  N N   . ALA A 21  ? 0.2124 0.1728 0.1050 0.0148  0.0052  -0.0077 864  ALA A N   
117  C CA  . ALA A 21  ? 0.2866 0.2468 0.1750 0.0169  -0.0001 -0.0091 864  ALA A CA  
118  C C   . ALA A 21  ? 0.2374 0.1998 0.1350 0.0153  -0.0042 -0.0102 864  ALA A C   
119  O O   . ALA A 21  ? 0.2307 0.1932 0.1275 0.0162  -0.0075 -0.0092 864  ALA A O   
120  C CB  . ALA A 21  ? 0.2712 0.2317 0.1537 0.0190  -0.0019 -0.0132 864  ALA A CB  
121  N N   . LEU A 22  ? 0.2056 0.1698 0.1116 0.0131  -0.0039 -0.0122 865  LEU A N   
122  C CA  . LEU A 22  ? 0.1724 0.1385 0.0873 0.0114  -0.0071 -0.0131 865  LEU A CA  
123  C C   . LEU A 22  ? 0.1913 0.1572 0.1094 0.0103  -0.0062 -0.0092 865  LEU A C   
124  O O   . LEU A 22  ? 0.1734 0.1401 0.0939 0.0103  -0.0095 -0.0089 865  LEU A O   
125  C CB  . LEU A 22  ? 0.1848 0.1522 0.1074 0.0095  -0.0061 -0.0153 865  LEU A CB  
126  C CG  . LEU A 22  ? 0.1688 0.1376 0.1006 0.0076  -0.0084 -0.0155 865  LEU A CG  
127  C CD1 . LEU A 22  ? 0.2054 0.1749 0.1378 0.0082  -0.0132 -0.0183 865  LEU A CD1 
128  C CD2 . LEU A 22  ? 0.1817 0.1511 0.1199 0.0063  -0.0066 -0.0168 865  LEU A CD2 
129  N N   . LEU A 23  ? 0.1736 0.1388 0.0921 0.0092  -0.0018 -0.0065 866  LEU A N   
130  C CA  . LEU A 23  ? 0.1822 0.1470 0.1038 0.0080  -0.0007 -0.0031 866  LEU A CA  
131  C C   . LEU A 23  ? 0.1639 0.1264 0.0790 0.0100  -0.0020 -0.0007 866  LEU A C   
132  O O   . LEU A 23  ? 0.2224 0.1849 0.1406 0.0097  -0.0035 0.0008  866  LEU A O   
133  C CB  . LEU A 23  ? 0.2135 0.1781 0.1368 0.0064  0.0045  -0.0012 866  LEU A CB  
134  C CG  . LEU A 23  ? 0.1828 0.1502 0.1133 0.0047  0.0056  -0.0032 866  LEU A CG  
135  C CD1 . LEU A 23  ? 0.2322 0.2004 0.1647 0.0032  0.0104  -0.0017 866  LEU A CD1 
136  C CD2 . LEU A 23  ? 0.2332 0.2025 0.1716 0.0034  0.0027  -0.0038 866  LEU A CD2 
137  N N   . LYS A 24  ? 0.1956 0.1560 0.1013 0.0124  -0.0013 -0.0004 867  LYS A N   
138  C CA  . LYS A 24  ? 0.2082 0.1662 0.1065 0.0151  -0.0027 0.0019  867  LYS A CA  
139  C C   . LYS A 24  ? 0.2129 0.1731 0.1128 0.0165  -0.0088 -0.0001 867  LYS A C   
140  O O   . LYS A 24  ? 0.2801 0.2396 0.1797 0.0176  -0.0105 0.0020  867  LYS A O   
141  C CB  . LYS A 24  ? 0.2541 0.2095 0.1413 0.0177  -0.0007 0.0025  867  LYS A CB  
142  C CG  . LYS A 24  ? 0.3317 0.2842 0.2098 0.0212  -0.0019 0.0054  867  LYS A CG  
143  C CD  . LYS A 24  ? 0.3498 0.3006 0.2195 0.0232  0.0009  0.0063  867  LYS A CD  
144  C CE  . LYS A 24  ? 0.4441 0.3947 0.3084 0.0266  -0.0020 0.0078  867  LYS A CE  
145  N NZ  . LYS A 24  ? 0.5684 0.5181 0.4255 0.0284  0.0004  0.0082  867  LYS A NZ  
146  N N   . GLU A 25  ? 0.2056 0.1684 0.1076 0.0164  -0.0118 -0.0044 868  GLU A N   
147  C CA  . GLU A 25  ? 0.1963 0.1618 0.1014 0.0172  -0.0174 -0.0071 868  GLU A CA  
148  C C   . GLU A 25  ? 0.1973 0.1644 0.1123 0.0149  -0.0183 -0.0062 868  GLU A C   
149  O O   . GLU A 25  ? 0.2118 0.1801 0.1282 0.0160  -0.0215 -0.0057 868  GLU A O   
150  C CB  . GLU A 25  ? 0.2326 0.2003 0.1394 0.0168  -0.0199 -0.0123 868  GLU A CB  
151  C CG  . GLU A 25  ? 0.2509 0.2216 0.1601 0.0178  -0.0258 -0.0155 868  GLU A CG  
152  C CD  . GLU A 25  ? 0.3118 0.2841 0.2213 0.0178  -0.0282 -0.0209 868  GLU A CD  
153  O OE1 . GLU A 25  ? 0.3433 0.3150 0.2567 0.0157  -0.0258 -0.0225 868  GLU A OE1 
154  O OE2 . GLU A 25  ? 0.4165 0.3907 0.3224 0.0200  -0.0327 -0.0238 868  GLU A OE2 
155  N N   . MET A 26  ? 0.1570 0.1243 0.0787 0.0120  -0.0153 -0.0059 869  MET A N   
156  C CA  . MET A 26  ? 0.1277 0.0965 0.0584 0.0098  -0.0155 -0.0050 869  MET A CA  
157  C C   . MET A 26  ? 0.1663 0.1336 0.0960 0.0104  -0.0147 -0.0012 869  MET A C   
158  O O   . MET A 26  ? 0.1590 0.1277 0.0948 0.0096  -0.0161 -0.0008 869  MET A O   
159  C CB  . MET A 26  ? 0.1710 0.1403 0.1076 0.0071  -0.0122 -0.0051 869  MET A CB  
160  C CG  . MET A 26  ? 0.1573 0.1280 0.0975 0.0063  -0.0133 -0.0088 869  MET A CG  
161  S SD  . MET A 26  ? 0.2067 0.1778 0.1523 0.0041  -0.0094 -0.0084 869  MET A SD  
162  C CE  . MET A 26  ? 0.1727 0.1450 0.1254 0.0023  -0.0090 -0.0059 869  MET A CE  
163  N N   . SER A 27  ? 0.1833 0.1474 0.1055 0.0118  -0.0119 0.0016  870  SER A N   
164  C CA  . SER A 27  ? 0.2083 0.1700 0.1294 0.0124  -0.0104 0.0054  870  SER A CA  
165  C C   . SER A 27  ? 0.2207 0.1804 0.1336 0.0162  -0.0126 0.0070  870  SER A C   
166  O O   . SER A 27  ? 0.2783 0.2347 0.1880 0.0172  -0.0106 0.0106  870  SER A O   
167  C CB  . SER A 27  ? 0.2420 0.2011 0.1625 0.0106  -0.0048 0.0079  870  SER A CB  
168  O OG  . SER A 27  ? 0.2983 0.2553 0.2110 0.0118  -0.0023 0.0082  870  SER A OG  
169  N N   . ASP A 28  ? 0.2405 0.2023 0.1502 0.0183  -0.0168 0.0043  871  ASP A N   
170  C CA  . ASP A 28  ? 0.2304 0.1912 0.1320 0.0225  -0.0197 0.0054  871  ASP A CA  
171  C C   . ASP A 28  ? 0.2140 0.1751 0.1192 0.0235  -0.0217 0.0074  871  ASP A C   
172  O O   . ASP A 28  ? 0.2145 0.1779 0.1291 0.0211  -0.0223 0.0065  871  ASP A O   
173  C CB  . ASP A 28  ? 0.2289 0.1934 0.1288 0.0241  -0.0247 0.0009  871  ASP A CB  
174  C CG  . ASP A 28  ? 0.2771 0.2409 0.1669 0.0288  -0.0276 0.0017  871  ASP A CG  
175  O OD1 . ASP A 28  ? 0.3187 0.2807 0.2016 0.0300  -0.0249 0.0025  871  ASP A OD1 
176  O OD2 . ASP A 28  ? 0.2684 0.2349 0.1609 0.0306  -0.0315 0.0014  871  ASP A OD2 
177  N N   . LYS A 29  ? 0.2724 0.2309 0.1698 0.0274  -0.0225 0.0103  872  LYS A N   
178  C CA  . LYS A 29  ? 0.3037 0.2623 0.2039 0.0291  -0.0246 0.0123  872  LYS A CA  
179  C C   . LYS A 29  ? 0.2162 0.1810 0.1230 0.0297  -0.0307 0.0084  872  LYS A C   
180  O O   . LYS A 29  ? 0.2260 0.1924 0.1391 0.0298  -0.0321 0.0090  872  LYS A O   
181  C CB  . LYS A 29  ? 0.3700 0.3248 0.2617 0.0331  -0.0235 0.0161  872  LYS A CB  
182  C CG  . LYS A 29  ? 0.4973 0.4543 0.3829 0.0357  -0.0255 0.0144  872  LYS A CG  
183  C CD  . LYS A 29  ? 0.6252 0.5784 0.5038 0.0388  -0.0232 0.0184  872  LYS A CD  
184  C CE  . LYS A 29  ? 0.7105 0.6649 0.5818 0.0411  -0.0242 0.0170  872  LYS A CE  
185  N NZ  . LYS A 29  ? 0.8026 0.7524 0.6663 0.0438  -0.0210 0.0213  872  LYS A NZ  
186  N N   . ASP A 30  ? 0.2458 0.2142 0.1515 0.0301  -0.0340 0.0043  873  ASP A N   
187  C CA  . ASP A 30  ? 0.2294 0.2040 0.1417 0.0305  -0.0398 0.0000  873  ASP A CA  
188  C C   . ASP A 30  ? 0.2089 0.1864 0.1322 0.0257  -0.0392 -0.0033 873  ASP A C   
189  O O   . ASP A 30  ? 0.2262 0.2031 0.1493 0.0235  -0.0373 -0.0051 873  ASP A O   
190  C CB  . ASP A 30  ? 0.2774 0.2549 0.1849 0.0327  -0.0429 -0.0032 873  ASP A CB  
191  C CG  . ASP A 30  ? 0.4360 0.4204 0.3518 0.0321  -0.0481 -0.0084 873  ASP A CG  
192  O OD1 . ASP A 30  ? 0.3794 0.3667 0.3031 0.0316  -0.0503 -0.0088 873  ASP A OD1 
193  O OD2 . ASP A 30  ? 0.5540 0.5409 0.4687 0.0320  -0.0499 -0.0123 873  ASP A OD2 
194  N N   . TRP A 31  ? 0.1961 0.1766 0.1290 0.0243  -0.0407 -0.0039 874  TRP A N   
195  C CA  . TRP A 31  ? 0.1784 0.1611 0.1215 0.0200  -0.0395 -0.0063 874  TRP A CA  
196  C C   . TRP A 31  ? 0.1458 0.1315 0.0909 0.0188  -0.0420 -0.0114 874  TRP A C   
197  O O   . TRP A 31  ? 0.1798 0.1649 0.1291 0.0155  -0.0396 -0.0128 874  TRP A O   
198  C CB  . TRP A 31  ? 0.1919 0.1776 0.1446 0.0190  -0.0406 -0.0062 874  TRP A CB  
199  C CG  . TRP A 31  ? 0.2436 0.2350 0.2010 0.0203  -0.0459 -0.0099 874  TRP A CG  
200  C CD1 . TRP A 31  ? 0.2666 0.2602 0.2218 0.0242  -0.0497 -0.0095 874  TRP A CD1 
201  C CD2 . TRP A 31  ? 0.2425 0.2381 0.2083 0.0177  -0.0480 -0.0146 874  TRP A CD2 
202  N NE1 . TRP A 31  ? 0.2549 0.2547 0.2169 0.0241  -0.0544 -0.0141 874  TRP A NE1 
203  C CE2 . TRP A 31  ? 0.2639 0.2649 0.2327 0.0200  -0.0532 -0.0173 874  TRP A CE2 
204  C CE3 . TRP A 31  ? 0.2875 0.2830 0.2588 0.0138  -0.0459 -0.0168 874  TRP A CE3 
205  C CZ2 . TRP A 31  ? 0.2775 0.2837 0.2552 0.0180  -0.0561 -0.0224 874  TRP A CZ2 
206  C CZ3 . TRP A 31  ? 0.2991 0.2989 0.2785 0.0120  -0.0486 -0.0215 874  TRP A CZ3 
207  C CH2 . TRP A 31  ? 0.3206 0.3257 0.3034 0.0139  -0.0535 -0.0244 874  TRP A CH2 
208  N N   . LYS A 32  ? 0.1800 0.1688 0.1220 0.0215  -0.0468 -0.0144 875  LYS A N   
209  C CA  . LYS A 32  ? 0.1771 0.1685 0.1210 0.0203  -0.0492 -0.0198 875  LYS A CA  
210  C C   . LYS A 32  ? 0.1614 0.1490 0.0985 0.0197  -0.0460 -0.0198 875  LYS A C   
211  O O   . LYS A 32  ? 0.2044 0.1923 0.1454 0.0171  -0.0454 -0.0231 875  LYS A O   
212  C CB  . LYS A 32  ? 0.2576 0.2537 0.2000 0.0232  -0.0545 -0.0230 875  LYS A CB  
213  C CG  . LYS A 32  ? 0.2720 0.2732 0.2238 0.0232  -0.0574 -0.0240 875  LYS A CG  
214  C CD  . LYS A 32  ? 0.3553 0.3616 0.3077 0.0253  -0.0611 -0.0270 875  LYS A CD  
215  C CE  . LYS A 32  ? 0.4562 0.4679 0.4190 0.0250  -0.0636 -0.0283 875  LYS A CE  
216  N NZ  . LYS A 32  ? 0.4463 0.4631 0.4091 0.0276  -0.0674 -0.0309 875  LYS A NZ  
217  N N   . THR A 33  ? 0.1503 0.1339 0.0774 0.0220  -0.0435 -0.0159 876  THR A N   
218  C CA  . THR A 33  ? 0.1883 0.1684 0.1090 0.0216  -0.0400 -0.0156 876  THR A CA  
219  C C   . THR A 33  ? 0.1721 0.1500 0.0987 0.0178  -0.0350 -0.0139 876  THR A C   
220  O O   . THR A 33  ? 0.1734 0.1505 0.1006 0.0161  -0.0332 -0.0160 876  THR A O   
221  C CB  . THR A 33  ? 0.2457 0.2221 0.1541 0.0252  -0.0384 -0.0119 876  THR A CB  
222  O OG1 . THR A 33  ? 0.2766 0.2560 0.1815 0.0284  -0.0422 -0.0133 876  THR A OG1 
223  C CG2 . THR A 33  ? 0.2641 0.2373 0.1663 0.0246  -0.0344 -0.0118 876  THR A CG2 
224  N N   . ARG A 34  ? 0.2100 0.1869 0.1406 0.0167  -0.0329 -0.0103 877  ARG A N   
225  C CA  . ARG A 34  ? 0.1494 0.1252 0.0865 0.0132  -0.0289 -0.0092 877  ARG A CA  
226  C C   . ARG A 34  ? 0.1403 0.1187 0.0859 0.0107  -0.0302 -0.0131 877  ARG A C   
227  O O   . ARG A 34  ? 0.1473 0.1246 0.0953 0.0086  -0.0275 -0.0137 877  ARG A O   
228  C CB  . ARG A 34  ? 0.1413 0.1165 0.0824 0.0125  -0.0273 -0.0056 877  ARG A CB  
229  C CG  . ARG A 34  ? 0.1722 0.1442 0.1058 0.0151  -0.0259 -0.0017 877  ARG A CG  
230  C CD  . ARG A 34  ? 0.1567 0.1267 0.0937 0.0134  -0.0223 0.0018  877  ARG A CD  
231  N NE  . ARG A 34  ? 0.1660 0.1380 0.1093 0.0135  -0.0243 0.0021  877  ARG A NE  
232  C CZ  . ARG A 34  ? 0.1704 0.1424 0.1112 0.0164  -0.0268 0.0034  877  ARG A CZ  
233  N NH1 . ARG A 34  ? 0.1800 0.1501 0.1116 0.0198  -0.0278 0.0046  877  ARG A NH1 
234  N NH2 . ARG A 34  ? 0.1892 0.1633 0.1365 0.0163  -0.0283 0.0036  877  ARG A NH2 
235  N N   . ASN A 35  ? 0.1482 0.1301 0.0985 0.0109  -0.0343 -0.0159 878  ASN A N   
236  C CA  . ASN A 35  ? 0.1595 0.1434 0.1184 0.0083  -0.0353 -0.0195 878  ASN A CA  
237  C C   . ASN A 35  ? 0.1587 0.1417 0.1148 0.0081  -0.0354 -0.0231 878  ASN A C   
238  O O   . ASN A 35  ? 0.1609 0.1431 0.1221 0.0057  -0.0336 -0.0246 878  ASN A O   
239  C CB  . ASN A 35  ? 0.1682 0.1564 0.1331 0.0085  -0.0396 -0.0221 878  ASN A CB  
240  C CG  . ASN A 35  ? 0.2332 0.2231 0.2078 0.0054  -0.0399 -0.0256 878  ASN A CG  
241  O OD1 . ASN A 35  ? 0.2290 0.2176 0.2093 0.0030  -0.0368 -0.0239 878  ASN A OD1 
242  N ND2 . ASN A 35  ? 0.2272 0.2197 0.2036 0.0055  -0.0436 -0.0305 878  ASN A ND2 
243  N N   . GLU A 36  ? 0.1665 0.1494 0.1141 0.0108  -0.0374 -0.0244 879  GLU A N   
244  C CA  . GLU A 36  ? 0.1735 0.1554 0.1172 0.0110  -0.0374 -0.0279 879  GLU A CA  
245  C C   . GLU A 36  ? 0.1591 0.1375 0.1012 0.0098  -0.0323 -0.0258 879  GLU A C   
246  O O   . GLU A 36  ? 0.1899 0.1674 0.1340 0.0085  -0.0312 -0.0285 879  GLU A O   
247  C CB  . GLU A 36  ? 0.2226 0.2049 0.1559 0.0146  -0.0401 -0.0291 879  GLU A CB  
248  C CG  . GLU A 36  ? 0.2445 0.2313 0.1795 0.0161  -0.0459 -0.0324 879  GLU A CG  
249  C CD  . GLU A 36  ? 0.2633 0.2529 0.2072 0.0136  -0.0479 -0.0379 879  GLU A CD  
250  O OE1 . GLU A 36  ? 0.3055 0.2929 0.2498 0.0121  -0.0459 -0.0403 879  GLU A OE1 
251  O OE2 . GLU A 36  ? 0.3532 0.3471 0.3040 0.0132  -0.0509 -0.0397 879  GLU A OE2 
252  N N   . GLY A 37  ? 0.1624 0.1390 0.1012 0.0102  -0.0291 -0.0210 880  GLY A N   
253  C CA  . GLY A 37  ? 0.1478 0.1219 0.0861 0.0090  -0.0244 -0.0190 880  GLY A CA  
254  C C   . GLY A 37  ? 0.1251 0.0997 0.0729 0.0062  -0.0230 -0.0195 880  GLY A C   
255  O O   . GLY A 37  ? 0.1494 0.1228 0.0984 0.0053  -0.0207 -0.0206 880  GLY A O   
256  N N   . LEU A 38  ? 0.1319 0.1080 0.0862 0.0050  -0.0241 -0.0184 881  LEU A N   
257  C CA  . LEU A 38  ? 0.1321 0.1084 0.0949 0.0025  -0.0226 -0.0185 881  LEU A CA  
258  C C   . LEU A 38  ? 0.1179 0.0943 0.0845 0.0016  -0.0241 -0.0228 881  LEU A C   
259  O O   . LEU A 38  ? 0.1568 0.1319 0.1276 0.0002  -0.0219 -0.0231 881  LEU A O   
260  C CB  . LEU A 38  ? 0.1448 0.1228 0.1135 0.0016  -0.0235 -0.0167 881  LEU A CB  
261  C CG  . LEU A 38  ? 0.1583 0.1359 0.1244 0.0022  -0.0217 -0.0126 881  LEU A CG  
262  C CD1 . LEU A 38  ? 0.1570 0.1364 0.1290 0.0014  -0.0228 -0.0114 881  LEU A CD1 
263  C CD2 . LEU A 38  ? 0.1771 0.1531 0.1428 0.0012  -0.0176 -0.0105 881  LEU A CD2 
264  N N   . THR A 39  ? 0.1540 0.1318 0.1191 0.0025  -0.0278 -0.0263 882  THR A N   
265  C CA  . THR A 39  ? 0.1896 0.1673 0.1585 0.0015  -0.0292 -0.0311 882  THR A CA  
266  C C   . THR A 39  ? 0.1688 0.1436 0.1338 0.0019  -0.0267 -0.0322 882  THR A C   
267  O O   . THR A 39  ? 0.1777 0.1509 0.1477 0.0004  -0.0253 -0.0340 882  THR A O   
268  C CB  . THR A 39  ? 0.1904 0.1708 0.1580 0.0026  -0.0340 -0.0352 882  THR A CB  
269  O OG1 . THR A 39  ? 0.2242 0.2077 0.1979 0.0018  -0.0362 -0.0347 882  THR A OG1 
270  C CG2 . THR A 39  ? 0.2271 0.2070 0.1980 0.0014  -0.0351 -0.0407 882  THR A CG2 
271  N N   . LYS A 40  ? 0.1292 0.1033 0.0855 0.0040  -0.0258 -0.0310 883  LYS A N   
272  C CA  . LYS A 40  ? 0.1314 0.1032 0.0837 0.0046  -0.0231 -0.0320 883  LYS A CA  
273  C C   . LYS A 40  ? 0.1697 0.1401 0.1263 0.0034  -0.0191 -0.0291 883  LYS A C   
274  O O   . LYS A 40  ? 0.1885 0.1571 0.1470 0.0030  -0.0173 -0.0308 883  LYS A O   
275  C CB  . LYS A 40  ? 0.1389 0.1103 0.0808 0.0071  -0.0224 -0.0308 883  LYS A CB  
276  C CG  . LYS A 40  ? 0.1640 0.1366 0.0997 0.0092  -0.0264 -0.0340 883  LYS A CG  
277  C CD  . LYS A 40  ? 0.2403 0.2118 0.1650 0.0118  -0.0249 -0.0320 883  LYS A CD  
278  C CE  . LYS A 40  ? 0.2790 0.2516 0.1961 0.0144  -0.0288 -0.0352 883  LYS A CE  
279  N NZ  . LYS A 40  ? 0.2485 0.2237 0.1662 0.0154  -0.0328 -0.0345 883  LYS A NZ  
280  N N   . LEU A 41  ? 0.1598 0.1311 0.1179 0.0028  -0.0178 -0.0250 884  LEU A N   
281  C CA  . LEU A 41  ? 0.1426 0.1134 0.1046 0.0019  -0.0144 -0.0222 884  LEU A CA  
282  C C   . LEU A 41  ? 0.1156 0.0856 0.0854 0.0003  -0.0142 -0.0234 884  LEU A C   
283  O O   . LEU A 41  ? 0.1311 0.0998 0.1028 0.0003  -0.0118 -0.0231 884  LEU A O   
284  C CB  . LEU A 41  ? 0.0996 0.0717 0.0621 0.0015  -0.0136 -0.0182 884  LEU A CB  
285  C CG  . LEU A 41  ? 0.1190 0.0913 0.0856 0.0005  -0.0105 -0.0157 884  LEU A CG  
286  C CD1 . LEU A 41  ? 0.1886 0.1604 0.1522 0.0014  -0.0076 -0.0157 884  LEU A CD1 
287  C CD2 . LEU A 41  ? 0.1191 0.0927 0.0866 0.0000  -0.0100 -0.0124 884  LEU A CD2 
288  N N   . GLN A 42  ? 0.1415 0.1123 0.1159 -0.0008 -0.0168 -0.0247 885  GLN A N   
289  C CA  . GLN A 42  ? 0.1384 0.1080 0.1203 -0.0025 -0.0163 -0.0256 885  GLN A CA  
290  C C   . GLN A 42  ? 0.1565 0.1234 0.1387 -0.0023 -0.0156 -0.0290 885  GLN A C   
291  O O   . GLN A 42  ? 0.1766 0.1413 0.1628 -0.0028 -0.0134 -0.0285 885  GLN A O   
292  C CB  . GLN A 42  ? 0.1819 0.1533 0.1686 -0.0038 -0.0192 -0.0270 885  GLN A CB  
293  C CG  . GLN A 42  ? 0.3543 0.3246 0.3493 -0.0058 -0.0180 -0.0269 885  GLN A CG  
294  C CD  . GLN A 42  ? 0.4367 0.4042 0.4350 -0.0066 -0.0177 -0.0307 885  GLN A CD  
295  O OE1 . GLN A 42  ? 0.3874 0.3524 0.3910 -0.0078 -0.0154 -0.0300 885  GLN A OE1 
296  N NE2 . GLN A 42  ? 0.3272 0.2947 0.3222 -0.0060 -0.0199 -0.0348 885  GLN A NE2 
297  N N   . ALA A 43  ? 0.1542 0.1211 0.1316 -0.0013 -0.0176 -0.0325 886  ALA A N   
298  C CA  . ALA A 43  ? 0.1842 0.1484 0.1615 -0.0011 -0.0171 -0.0365 886  ALA A CA  
299  C C   . ALA A 43  ? 0.2005 0.1630 0.1749 0.0003  -0.0136 -0.0349 886  ALA A C   
300  O O   . ALA A 43  ? 0.1911 0.1506 0.1682 0.0004  -0.0119 -0.0365 886  ALA A O   
301  C CB  . ALA A 43  ? 0.1783 0.1435 0.1508 -0.0002 -0.0204 -0.0409 886  ALA A CB  
302  N N   . ILE A 44  ? 0.1797 0.1439 0.1489 0.0016  -0.0124 -0.0319 887  ILE A N   
303  C CA  . ILE A 44  ? 0.1651 0.1286 0.1320 0.0029  -0.0091 -0.0304 887  ILE A CA  
304  C C   . ILE A 44  ? 0.1576 0.1203 0.1308 0.0023  -0.0069 -0.0279 887  ILE A C   
305  O O   . ILE A 44  ? 0.1667 0.1275 0.1411 0.0033  -0.0048 -0.0286 887  ILE A O   
306  C CB  . ILE A 44  ? 0.1201 0.0859 0.0814 0.0038  -0.0079 -0.0274 887  ILE A CB  
307  C CG1 . ILE A 44  ? 0.1969 0.1627 0.1503 0.0052  -0.0091 -0.0295 887  ILE A CG1 
308  C CG2 . ILE A 44  ? 0.1500 0.1161 0.1117 0.0046  -0.0043 -0.0255 887  ILE A CG2 
309  C CD1 . ILE A 44  ? 0.1997 0.1671 0.1477 0.0058  -0.0082 -0.0263 887  ILE A CD1 
310  N N   . ILE A 45  ? 0.1451 0.1092 0.1219 0.0011  -0.0073 -0.0251 888  ILE A N   
311  C CA  . ILE A 45  ? 0.1180 0.0815 0.1001 0.0008  -0.0054 -0.0226 888  ILE A CA  
312  C C   . ILE A 45  ? 0.1637 0.1236 0.1507 0.0002  -0.0052 -0.0246 888  ILE A C   
313  O O   . ILE A 45  ? 0.1615 0.1194 0.1504 0.0013  -0.0029 -0.0238 888  ILE A O   
314  C CB  . ILE A 45  ? 0.1144 0.0802 0.0989 -0.0004 -0.0059 -0.0193 888  ILE A CB  
315  C CG1 . ILE A 45  ? 0.1393 0.1080 0.1194 0.0001  -0.0056 -0.0173 888  ILE A CG1 
316  C CG2 . ILE A 45  ? 0.1262 0.0913 0.1153 -0.0003 -0.0039 -0.0168 888  ILE A CG2 
317  C CD1 . ILE A 45  ? 0.1589 0.1295 0.1404 -0.0011 -0.0066 -0.0150 888  ILE A CD1 
318  N N   . SER A 46  ? 0.1628 0.1218 0.1519 -0.0013 -0.0074 -0.0273 889  SER A N   
319  C CA  . SER A 46  ? 0.1884 0.1435 0.1828 -0.0023 -0.0069 -0.0296 889  SER A CA  
320  C C   . SER A 46  ? 0.1761 0.1278 0.1689 -0.0009 -0.0055 -0.0323 889  SER A C   
321  O O   . SER A 46  ? 0.2185 0.1664 0.2151 -0.0007 -0.0033 -0.0321 889  SER A O   
322  C CB  . SER A 46  ? 0.2222 0.1780 0.2192 -0.0043 -0.0099 -0.0330 889  SER A CB  
323  O OG  . SER A 46  ? 0.4073 0.3653 0.4081 -0.0058 -0.0106 -0.0306 889  SER A OG  
324  N N   . GLU A 47  ? 0.1507 0.1036 0.1379 0.0002  -0.0065 -0.0347 890  GLU A N   
325  C CA  . GLU A 47  ? 0.1722 0.1221 0.1575 0.0017  -0.0052 -0.0379 890  GLU A CA  
326  C C   . GLU A 47  ? 0.2020 0.1511 0.1871 0.0038  -0.0019 -0.0349 890  GLU A C   
327  O O   . GLU A 47  ? 0.2207 0.1660 0.2076 0.0048  0.0000  -0.0363 890  GLU A O   
328  C CB  . GLU A 47  ? 0.2155 0.1672 0.1937 0.0026  -0.0069 -0.0410 890  GLU A CB  
329  C CG  . GLU A 47  ? 0.3339 0.2828 0.3093 0.0044  -0.0053 -0.0444 890  GLU A CG  
330  C CD  . GLU A 47  ? 0.6268 0.5711 0.6066 0.0034  -0.0056 -0.0488 890  GLU A CD  
331  O OE1 . GLU A 47  ? 0.6857 0.6293 0.6711 0.0011  -0.0071 -0.0495 890  GLU A OE1 
332  O OE2 . GLU A 47  ? 0.7573 0.6987 0.7355 0.0049  -0.0042 -0.0518 890  GLU A OE2 
333  N N   . ALA A 48  ? 0.1964 0.1492 0.1796 0.0044  -0.0012 -0.0311 891  ALA A N   
334  C CA  . ALA A 48  ? 0.1623 0.1156 0.1460 0.0064  0.0016  -0.0284 891  ALA A CA  
335  C C   . ALA A 48  ? 0.1560 0.1071 0.1452 0.0065  0.0029  -0.0257 891  ALA A C   
336  O O   . ALA A 48  ? 0.1698 0.1189 0.1603 0.0086  0.0050  -0.0250 891  ALA A O   
337  C CB  . ALA A 48  ? 0.1516 0.1099 0.1321 0.0068  0.0019  -0.0256 891  ALA A CB  
338  N N   . ARG A 49  ? 0.1604 0.1117 0.1526 0.0045  0.0017  -0.0242 892  ARG A N   
339  C CA  . ARG A 49  ? 0.1397 0.0890 0.1365 0.0043  0.0030  -0.0212 892  ARG A CA  
340  C C   . ARG A 49  ? 0.1448 0.0975 0.1412 0.0060  0.0042  -0.0171 892  ARG A C   
341  O O   . ARG A 49  ? 0.1361 0.0908 0.1338 0.0050  0.0038  -0.0144 892  ARG A O   
342  C CB  . ARG A 49  ? 0.1446 0.0879 0.1447 0.0049  0.0047  -0.0225 892  ARG A CB  
343  C CG  . ARG A 49  ? 0.1790 0.1199 0.1834 0.0046  0.0062  -0.0191 892  ARG A CG  
344  C CD  . ARG A 49  ? 0.1991 0.1330 0.2069 0.0050  0.0084  -0.0201 892  ARG A CD  
345  N NE  . ARG A 49  ? 0.2446 0.1759 0.2556 0.0051  0.0104  -0.0162 892  ARG A NE  
346  C CZ  . ARG A 49  ? 0.3041 0.2289 0.3179 0.0061  0.0131  -0.0154 892  ARG A CZ  
347  N NH1 . ARG A 49  ? 0.2507 0.1709 0.2648 0.0069  0.0141  -0.0186 892  ARG A NH1 
348  N NH2 . ARG A 49  ? 0.3045 0.2270 0.3203 0.0063  0.0152  -0.0113 892  ARG A NH2 
349  N N   . LEU A 50  ? 0.1264 0.0797 0.1213 0.0086  0.0057  -0.0168 893  LEU A N   
350  C CA  . LEU A 50  ? 0.0971 0.0544 0.0918 0.0104  0.0066  -0.0135 893  LEU A CA  
351  C C   . LEU A 50  ? 0.1199 0.0818 0.1113 0.0110  0.0066  -0.0145 893  LEU A C   
352  O O   . LEU A 50  ? 0.1454 0.1062 0.1350 0.0120  0.0073  -0.0171 893  LEU A O   
353  C CB  . LEU A 50  ? 0.1302 0.0850 0.1268 0.0133  0.0086  -0.0119 893  LEU A CB  
354  C CG  . LEU A 50  ? 0.1377 0.0871 0.1375 0.0131  0.0095  -0.0103 893  LEU A CG  
355  C CD1 . LEU A 50  ? 0.1548 0.1021 0.1554 0.0168  0.0115  -0.0081 893  LEU A CD1 
356  C CD2 . LEU A 50  ? 0.1516 0.1027 0.1526 0.0110  0.0086  -0.0078 893  LEU A CD2 
357  N N   . ILE A 51  ? 0.1141 0.0808 0.1048 0.0103  0.0062  -0.0126 894  ILE A N   
358  C CA  . ILE A 51  ? 0.0897 0.0604 0.0775 0.0102  0.0065  -0.0135 894  ILE A CA  
359  C C   . ILE A 51  ? 0.1486 0.1247 0.1378 0.0113  0.0075  -0.0115 894  ILE A C   
360  O O   . ILE A 51  ? 0.1512 0.1284 0.1428 0.0118  0.0072  -0.0092 894  ILE A O   
361  C CB  . ILE A 51  ? 0.0884 0.0598 0.0735 0.0077  0.0050  -0.0139 894  ILE A CB  
362  C CG1 . ILE A 51  ? 0.1319 0.1053 0.1188 0.0062  0.0040  -0.0113 894  ILE A CG1 
363  C CG2 . ILE A 51  ? 0.1188 0.0860 0.1027 0.0067  0.0035  -0.0165 894  ILE A CG2 
364  C CD1 . ILE A 51  ? 0.1463 0.1201 0.1308 0.0041  0.0025  -0.0115 894  ILE A CD1 
365  N N   . LYS A 52  ? 0.1675 0.1468 0.1550 0.0118  0.0086  -0.0125 895  LYS A N   
366  C CA  . LYS A 52  ? 0.1406 0.1258 0.1299 0.0123  0.0095  -0.0114 895  LYS A CA  
367  C C   . LYS A 52  ? 0.1180 0.1053 0.1066 0.0096  0.0087  -0.0101 895  LYS A C   
368  O O   . LYS A 52  ? 0.1159 0.1004 0.1022 0.0078  0.0076  -0.0102 895  LYS A O   
369  C CB  . LYS A 52  ? 0.1621 0.1500 0.1505 0.0133  0.0115  -0.0132 895  LYS A CB  
370  C CG  . LYS A 52  ? 0.2248 0.2104 0.2136 0.0160  0.0125  -0.0148 895  LYS A CG  
371  C CD  . LYS A 52  ? 0.2528 0.2427 0.2420 0.0174  0.0148  -0.0163 895  LYS A CD  
372  C CE  . LYS A 52  ? 0.4084 0.3957 0.3976 0.0202  0.0160  -0.0182 895  LYS A CE  
373  N NZ  . LYS A 52  ? 0.4581 0.4438 0.4506 0.0229  0.0154  -0.0170 895  LYS A NZ  
374  N N   . PRO A 53  ? 0.1198 0.1122 0.1108 0.0095  0.0091  -0.0091 896  PRO A N   
375  C CA  . PRO A 53  ? 0.1674 0.1615 0.1581 0.0070  0.0086  -0.0080 896  PRO A CA  
376  C C   . PRO A 53  ? 0.1009 0.0952 0.0887 0.0053  0.0098  -0.0088 896  PRO A C   
377  O O   . PRO A 53  ? 0.1880 0.1824 0.1749 0.0033  0.0095  -0.0079 896  PRO A O   
378  C CB  . PRO A 53  ? 0.1973 0.1971 0.1917 0.0077  0.0088  -0.0074 896  PRO A CB  
379  C CG  . PRO A 53  ? 0.2188 0.2192 0.2152 0.0109  0.0088  -0.0074 896  PRO A CG  
380  C CD  . PRO A 53  ? 0.1725 0.1693 0.1669 0.0119  0.0097  -0.0088 896  PRO A CD  
381  N N   . SER A 54  ? 0.1488 0.1430 0.1349 0.0063  0.0115  -0.0104 897  SER A N   
382  C CA  . SER A 54  ? 0.1636 0.1579 0.1463 0.0050  0.0132  -0.0110 897  SER A CA  
383  C C   . SER A 54  ? 0.1597 0.1488 0.1372 0.0043  0.0120  -0.0111 897  SER A C   
384  O O   . SER A 54  ? 0.1734 0.1596 0.1488 0.0055  0.0114  -0.0126 897  SER A O   
385  C CB  . SER A 54  ? 0.1882 0.1845 0.1710 0.0065  0.0158  -0.0127 897  SER A CB  
386  O OG  . SER A 54  ? 0.1972 0.1908 0.1795 0.0087  0.0152  -0.0140 897  SER A OG  
387  N N   . ILE A 55  ? 0.1095 0.0978 0.0852 0.0025  0.0114  -0.0097 898  ILE A N   
388  C CA  . ILE A 55  ? 0.1343 0.1185 0.1053 0.0022  0.0097  -0.0098 898  ILE A CA  
389  C C   . ILE A 55  ? 0.1658 0.1492 0.1320 0.0013  0.0112  -0.0090 898  ILE A C   
390  O O   . ILE A 55  ? 0.1612 0.1421 0.1242 0.0008  0.0096  -0.0082 898  ILE A O   
391  C CB  . ILE A 55  ? 0.1495 0.1324 0.1227 0.0014  0.0069  -0.0088 898  ILE A CB  
392  C CG1 . ILE A 55  ? 0.1621 0.1475 0.1384 0.0000  0.0072  -0.0069 898  ILE A CG1 
393  C CG2 . ILE A 55  ? 0.1516 0.1335 0.1280 0.0025  0.0057  -0.0097 898  ILE A CG2 
394  C CD1 . ILE A 55  ? 0.1755 0.1598 0.1538 -0.0007 0.0048  -0.0059 898  ILE A CD1 
395  N N   . GLY A 56  ? 0.2030 0.1885 0.1688 0.0013  0.0144  -0.0091 899  GLY A N   
396  C CA  . GLY A 56  ? 0.2059 0.1901 0.1670 0.0005  0.0166  -0.0081 899  GLY A CA  
397  C C   . GLY A 56  ? 0.1526 0.1363 0.1147 -0.0012 0.0162  -0.0059 899  GLY A C   
398  O O   . GLY A 56  ? 0.1924 0.1790 0.1600 -0.0024 0.0163  -0.0055 899  GLY A O   
399  N N   . ASP A 57  ? 0.2071 0.1872 0.1636 -0.0012 0.0156  -0.0046 900  ASP A N   
400  C CA  . ASP A 57  ? 0.2176 0.1966 0.1746 -0.0025 0.0152  -0.0025 900  ASP A CA  
401  C C   . ASP A 57  ? 0.2170 0.1946 0.1745 -0.0021 0.0111  -0.0023 900  ASP A C   
402  O O   . ASP A 57  ? 0.1971 0.1729 0.1532 -0.0024 0.0103  -0.0007 900  ASP A O   
403  C CB  . ASP A 57  ? 0.2968 0.2725 0.2473 -0.0024 0.0177  -0.0007 900  ASP A CB  
404  C CG  . ASP A 57  ? 0.3807 0.3577 0.3313 -0.0032 0.0225  -0.0007 900  ASP A CG  
405  O OD1 . ASP A 57  ? 0.3060 0.2869 0.2632 -0.0047 0.0239  -0.0015 900  ASP A OD1 
406  O OD2 . ASP A 57  ? 0.4870 0.4613 0.4311 -0.0024 0.0248  0.0001  900  ASP A OD2 
407  N N   . LEU A 58  ? 0.1957 0.1742 0.1557 -0.0014 0.0088  -0.0040 901  LEU A N   
408  C CA  . LEU A 58  ? 0.1505 0.1278 0.1114 -0.0011 0.0052  -0.0042 901  LEU A CA  
409  C C   . LEU A 58  ? 0.1617 0.1402 0.1273 -0.0024 0.0044  -0.0027 901  LEU A C   
410  O O   . LEU A 58  ? 0.1625 0.1396 0.1276 -0.0024 0.0022  -0.0020 901  LEU A O   
411  C CB  . LEU A 58  ? 0.2034 0.1809 0.1666 -0.0003 0.0035  -0.0063 901  LEU A CB  
412  C CG  . LEU A 58  ? 0.1015 0.0780 0.0667 -0.0004 0.0002  -0.0068 901  LEU A CG  
413  C CD1 . LEU A 58  ? 0.1043 0.0788 0.0643 0.0003  -0.0019 -0.0072 901  LEU A CD1 
414  C CD2 . LEU A 58  ? 0.1134 0.0896 0.0815 0.0001  -0.0006 -0.0089 901  LEU A CD2 
415  N N   . ALA A 59  ? 0.1521 0.1333 0.1221 -0.0034 0.0060  -0.0024 902  ALA A N   
416  C CA  . ALA A 59  ? 0.1598 0.1423 0.1341 -0.0044 0.0052  -0.0014 902  ALA A CA  
417  C C   . ALA A 59  ? 0.1541 0.1348 0.1267 -0.0052 0.0055  0.0002  902  ALA A C   
418  O O   . ALA A 59  ? 0.1449 0.1249 0.1187 -0.0053 0.0035  0.0008  902  ALA A O   
419  C CB  . ALA A 59  ? 0.1920 0.1783 0.1710 -0.0050 0.0066  -0.0018 902  ALA A CB  
420  N N   . PRO A 60  ? 0.1586 0.1385 0.1286 -0.0058 0.0082  0.0009  903  PRO A N   
421  C CA  . PRO A 60  ? 0.2074 0.1848 0.1756 -0.0063 0.0086  0.0027  903  PRO A CA  
422  C C   . PRO A 60  ? 0.1798 0.1540 0.1432 -0.0047 0.0062  0.0034  903  PRO A C   
423  O O   . PRO A 60  ? 0.1847 0.1575 0.1483 -0.0046 0.0049  0.0046  903  PRO A O   
424  C CB  . PRO A 60  ? 0.2242 0.2007 0.1901 -0.0071 0.0125  0.0033  903  PRO A CB  
425  C CG  . PRO A 60  ? 0.2930 0.2733 0.2621 -0.0076 0.0140  0.0016  903  PRO A CG  
426  C CD  . PRO A 60  ? 0.2169 0.1982 0.1864 -0.0061 0.0112  0.0002  903  PRO A CD  
427  N N   . ALA A 61  ? 0.1657 0.1392 0.1254 -0.0033 0.0053  0.0024  904  ALA A N   
428  C CA  . ALA A 61  ? 0.1568 0.1283 0.1122 -0.0015 0.0024  0.0023  904  ALA A CA  
429  C C   . ALA A 61  ? 0.1641 0.1368 0.1240 -0.0016 -0.0010 0.0016  904  ALA A C   
430  O O   . ALA A 61  ? 0.1511 0.1227 0.1099 -0.0008 -0.0030 0.0024  904  ALA A O   
431  C CB  . ALA A 61  ? 0.1498 0.1208 0.1008 -0.0002 0.0020  0.0006  904  ALA A CB  
432  N N   . LEU A 62  ? 0.1219 0.0969 0.0868 -0.0024 -0.0014 0.0002  905  LEU A N   
433  C CA  . LEU A 62  ? 0.0860 0.0621 0.0557 -0.0028 -0.0039 -0.0003 905  LEU A CA  
434  C C   . LEU A 62  ? 0.1119 0.0884 0.0846 -0.0036 -0.0036 0.0013  905  LEU A C   
435  O O   . LEU A 62  ? 0.1267 0.1035 0.1016 -0.0035 -0.0056 0.0014  905  LEU A O   
436  C CB  . LEU A 62  ? 0.0951 0.0728 0.0691 -0.0033 -0.0038 -0.0017 905  LEU A CB  
437  C CG  . LEU A 62  ? 0.1239 0.1008 0.0962 -0.0024 -0.0047 -0.0038 905  LEU A CG  
438  C CD1 . LEU A 62  ? 0.1718 0.1497 0.1484 -0.0027 -0.0039 -0.0046 905  LEU A CD1 
439  C CD2 . LEU A 62  ? 0.1544 0.1305 0.1264 -0.0019 -0.0078 -0.0051 905  LEU A CD2 
440  N N   . ALA A 63  ? 0.1711 0.1480 0.1443 -0.0046 -0.0009 0.0024  906  ALA A N   
441  C CA  . ALA A 63  ? 0.1784 0.1555 0.1543 -0.0055 -0.0003 0.0035  906  ALA A CA  
442  C C   . ALA A 63  ? 0.1357 0.1103 0.1089 -0.0045 -0.0015 0.0048  906  ALA A C   
443  O O   . ALA A 63  ? 0.1605 0.1355 0.1365 -0.0045 -0.0028 0.0052  906  ALA A O   
444  C CB  . ALA A 63  ? 0.1463 0.1243 0.1230 -0.0068 0.0028  0.0039  906  ALA A CB  
445  N N   . HIS A 64  ? 0.1692 0.1413 0.1367 -0.0034 -0.0009 0.0056  907  HIS A N   
446  C CA  . HIS A 64  ? 0.2112 0.1808 0.1752 -0.0018 -0.0022 0.0070  907  HIS A CA  
447  C C   . HIS A 64  ? 0.1753 0.1463 0.1409 -0.0006 -0.0062 0.0059  907  HIS A C   
448  O O   . HIS A 64  ? 0.1958 0.1665 0.1623 0.0004  -0.0078 0.0067  907  HIS A O   
449  C CB  . HIS A 64  ? 0.1860 0.1526 0.1427 -0.0004 -0.0009 0.0081  907  HIS A CB  
450  C CG  . HIS A 64  ? 0.3687 0.3329 0.3238 -0.0015 0.0032  0.0098  907  HIS A CG  
451  N ND1 . HIS A 64  ? 0.4759 0.4406 0.4305 -0.0028 0.0062  0.0093  907  HIS A ND1 
452  C CD2 . HIS A 64  ? 0.4274 0.3884 0.3816 -0.0016 0.0051  0.0120  907  HIS A CD2 
453  C CE1 . HIS A 64  ? 0.5462 0.5087 0.5002 -0.0038 0.0098  0.0108  907  HIS A CE1 
454  N NE2 . HIS A 64  ? 0.4928 0.4526 0.4464 -0.0032 0.0093  0.0125  907  HIS A NE2 
455  N N   . ARG A 65  ? 0.1397 0.1125 0.1061 -0.0006 -0.0077 0.0038  908  ARG A N   
456  C CA  . ARG A 65  ? 0.1240 0.0983 0.0926 0.0002  -0.0114 0.0022  908  ARG A CA  
457  C C   . ARG A 65  ? 0.1180 0.0945 0.0939 -0.0011 -0.0119 0.0019  908  ARG A C   
458  O O   . ARG A 65  ? 0.1208 0.0987 0.0994 -0.0005 -0.0144 0.0012  908  ARG A O   
459  C CB  . ARG A 65  ? 0.0902 0.0652 0.0575 0.0005  -0.0126 -0.0003 908  ARG A CB  
460  C CG  . ARG A 65  ? 0.1145 0.0875 0.0741 0.0020  -0.0120 -0.0002 908  ARG A CG  
461  C CD  . ARG A 65  ? 0.1540 0.1261 0.1082 0.0045  -0.0147 0.0000  908  ARG A CD  
462  N NE  . ARG A 65  ? 0.1423 0.1131 0.0955 0.0055  -0.0145 0.0027  908  ARG A NE  
463  C CZ  . ARG A 65  ? 0.2483 0.2159 0.1965 0.0061  -0.0117 0.0054  908  ARG A CZ  
464  N NH1 . ARG A 65  ? 0.2358 0.2017 0.1799 0.0057  -0.0087 0.0058  908  ARG A NH1 
465  N NH2 . ARG A 65  ? 0.2777 0.2437 0.2255 0.0071  -0.0117 0.0077  908  ARG A NH2 
466  N N   . LEU A 66  ? 0.1280 0.1052 0.1070 -0.0027 -0.0095 0.0024  909  LEU A N   
467  C CA  . LEU A 66  ? 0.1336 0.1125 0.1185 -0.0037 -0.0095 0.0024  909  LEU A CA  
468  C C   . LEU A 66  ? 0.1074 0.0860 0.0931 -0.0031 -0.0099 0.0037  909  LEU A C   
469  O O   . LEU A 66  ? 0.1664 0.1465 0.1567 -0.0034 -0.0108 0.0034  909  LEU A O   
470  C CB  . LEU A 66  ? 0.1709 0.1507 0.1577 -0.0050 -0.0069 0.0027  909  LEU A CB  
471  C CG  . LEU A 66  ? 0.0927 0.0733 0.0806 -0.0054 -0.0066 0.0015  909  LEU A CG  
472  C CD1 . LEU A 66  ? 0.0974 0.0792 0.0863 -0.0061 -0.0042 0.0020  909  LEU A CD1 
473  C CD2 . LEU A 66  ? 0.1326 0.1141 0.1249 -0.0057 -0.0080 0.0006  909  LEU A CD2 
474  N N   . VAL A 67  ? 0.1481 0.1243 0.1294 -0.0024 -0.0088 0.0052  910  VAL A N   
475  C CA  . VAL A 67  ? 0.1610 0.1359 0.1423 -0.0014 -0.0089 0.0066  910  VAL A CA  
476  C C   . VAL A 67  ? 0.1533 0.1265 0.1299 0.0010  -0.0110 0.0073  910  VAL A C   
477  O O   . VAL A 67  ? 0.1709 0.1414 0.1445 0.0023  -0.0103 0.0092  910  VAL A O   
478  C CB  . VAL A 67  ? 0.1968 0.1697 0.1772 -0.0024 -0.0056 0.0080  910  VAL A CB  
479  C CG1 . VAL A 67  ? 0.2437 0.2189 0.2286 -0.0045 -0.0041 0.0071  910  VAL A CG1 
480  C CG2 . VAL A 67  ? 0.2068 0.1770 0.1816 -0.0023 -0.0037 0.0089  910  VAL A CG2 
481  N N   . ASP A 68  ? 0.1732 0.1480 0.1490 0.0019  -0.0137 0.0057  911  ASP A N   
482  C CA  . ASP A 68  ? 0.1294 0.1034 0.1004 0.0046  -0.0163 0.0058  911  ASP A CA  
483  C C   . ASP A 68  ? 0.1519 0.1268 0.1256 0.0062  -0.0183 0.0065  911  ASP A C   
484  O O   . ASP A 68  ? 0.1780 0.1554 0.1584 0.0051  -0.0186 0.0057  911  ASP A O   
485  C CB  . ASP A 68  ? 0.1542 0.1305 0.1253 0.0048  -0.0191 0.0030  911  ASP A CB  
486  C CG  . ASP A 68  ? 0.1606 0.1358 0.1245 0.0076  -0.0214 0.0029  911  ASP A CG  
487  O OD1 . ASP A 68  ? 0.1652 0.1420 0.1291 0.0098  -0.0246 0.0026  911  ASP A OD1 
488  O OD2 . ASP A 68  ? 0.1550 0.1283 0.1132 0.0078  -0.0199 0.0031  911  ASP A OD2 
489  N N   . SER A 69  ? 0.2209 0.1939 0.1892 0.0091  -0.0197 0.0079  912  SER A N   
490  C CA  . SER A 69  ? 0.2010 0.1751 0.1716 0.0113  -0.0219 0.0086  912  SER A CA  
491  C C   . SER A 69  ? 0.2091 0.1883 0.1841 0.0121  -0.0263 0.0056  912  SER A C   
492  O O   . SER A 69  ? 0.2257 0.2074 0.2054 0.0133  -0.0282 0.0053  912  SER A O   
493  C CB  . SER A 69  ? 0.2595 0.2294 0.2225 0.0147  -0.0217 0.0114  912  SER A CB  
494  O OG  . SER A 69  ? 0.2699 0.2394 0.2259 0.0166  -0.0234 0.0111  912  SER A OG  
495  N N   . ASN A 70  ? 0.1695 0.1502 0.1435 0.0114  -0.0277 0.0032  913  ASN A N   
496  C CA  . ASN A 70  ? 0.1842 0.1699 0.1635 0.0113  -0.0315 -0.0002 913  ASN A CA  
497  C C   . ASN A 70  ? 0.1992 0.1868 0.1863 0.0077  -0.0300 -0.0020 913  ASN A C   
498  O O   . ASN A 70  ? 0.1800 0.1659 0.1661 0.0057  -0.0275 -0.0021 913  ASN A O   
499  C CB  . ASN A 70  ? 0.1941 0.1801 0.1676 0.0128  -0.0341 -0.0022 913  ASN A CB  
500  C CG  . ASN A 70  ? 0.1767 0.1679 0.1559 0.0126  -0.0382 -0.0064 913  ASN A CG  
501  O OD1 . ASN A 70  ? 0.2310 0.2239 0.2161 0.0097  -0.0376 -0.0088 913  ASN A OD1 
502  N ND2 . ASN A 70  ? 0.1958 0.1898 0.1734 0.0159  -0.0424 -0.0074 913  ASN A ND2 
503  N N   . ALA A 71  ? 0.1731 0.1644 0.1682 0.0071  -0.0312 -0.0033 914  ALA A N   
504  C CA  . ALA A 71  ? 0.1475 0.1402 0.1500 0.0039  -0.0292 -0.0044 914  ALA A CA  
505  C C   . ALA A 71  ? 0.1498 0.1432 0.1536 0.0021  -0.0297 -0.0072 914  ALA A C   
506  O O   . ALA A 71  ? 0.2188 0.2108 0.2245 -0.0002 -0.0269 -0.0070 914  ALA A O   
507  C CB  . ALA A 71  ? 0.2524 0.2491 0.2631 0.0039  -0.0303 -0.0053 914  ALA A CB  
508  N N   . LYS A 72  ? 0.1647 0.1600 0.1673 0.0033  -0.0333 -0.0099 915  LYS A N   
509  C CA  . LYS A 72  ? 0.1447 0.1404 0.1485 0.0017  -0.0339 -0.0130 915  LYS A CA  
510  C C   . LYS A 72  ? 0.1165 0.1080 0.1140 0.0011  -0.0311 -0.0117 915  LYS A C   
511  O O   . LYS A 72  ? 0.1622 0.1526 0.1623 -0.0010 -0.0292 -0.0127 915  LYS A O   
512  C CB  . LYS A 72  ? 0.1719 0.1705 0.1745 0.0035  -0.0386 -0.0164 915  LYS A CB  
513  C CG  . LYS A 72  ? 0.2777 0.2816 0.2878 0.0041  -0.0417 -0.0184 915  LYS A CG  
514  C CD  . LYS A 72  ? 0.4308 0.4382 0.4386 0.0065  -0.0469 -0.0218 915  LYS A CD  
515  C CE  . LYS A 72  ? 0.4561 0.4695 0.4718 0.0073  -0.0503 -0.0240 915  LYS A CE  
516  N NZ  . LYS A 72  ? 0.5132 0.5303 0.5253 0.0105  -0.0557 -0.0270 915  LYS A NZ  
517  N N   . ILE A 73  ? 0.1172 0.1062 0.1066 0.0032  -0.0307 -0.0095 916  ILE A N   
518  C CA  . ILE A 73  ? 0.1276 0.1131 0.1114 0.0027  -0.0278 -0.0083 916  ILE A CA  
519  C C   . ILE A 73  ? 0.1417 0.1260 0.1288 0.0005  -0.0239 -0.0063 916  ILE A C   
520  O O   . ILE A 73  ? 0.1332 0.1163 0.1205 -0.0008 -0.0220 -0.0068 916  ILE A O   
521  C CB  . ILE A 73  ? 0.1305 0.1135 0.1053 0.0052  -0.0274 -0.0058 916  ILE A CB  
522  C CG1 . ILE A 73  ? 0.1676 0.1516 0.1373 0.0079  -0.0312 -0.0077 916  ILE A CG1 
523  C CG2 . ILE A 73  ? 0.1560 0.1359 0.1264 0.0043  -0.0238 -0.0045 916  ILE A CG2 
524  C CD1 . ILE A 73  ? 0.1516 0.1359 0.1197 0.0073  -0.0322 -0.0111 916  ILE A CD1 
525  N N   . ALA A 74  ? 0.1350 0.1196 0.1247 0.0005  -0.0229 -0.0042 917  ALA A N   
526  C CA  . ALA A 74  ? 0.1515 0.1353 0.1440 -0.0013 -0.0196 -0.0025 917  ALA A CA  
527  C C   . ALA A 74  ? 0.1628 0.1479 0.1614 -0.0033 -0.0190 -0.0040 917  ALA A C   
528  O O   . ALA A 74  ? 0.1382 0.1223 0.1371 -0.0044 -0.0164 -0.0034 917  ALA A O   
529  C CB  . ALA A 74  ? 0.1790 0.1632 0.1735 -0.0009 -0.0189 -0.0006 917  ALA A CB  
530  N N   . GLN A 75  ? 0.1284 0.1158 0.1321 -0.0036 -0.0211 -0.0061 918  GLN A N   
531  C CA  . GLN A 75  ? 0.1822 0.1703 0.1921 -0.0056 -0.0202 -0.0075 918  GLN A CA  
532  C C   . GLN A 75  ? 0.1486 0.1349 0.1565 -0.0061 -0.0200 -0.0093 918  GLN A C   
533  O O   . GLN A 75  ? 0.1726 0.1575 0.1823 -0.0073 -0.0176 -0.0088 918  GLN A O   
534  C CB  . GLN A 75  ? 0.1775 0.1688 0.1940 -0.0060 -0.0224 -0.0096 918  GLN A CB  
535  C CG  . GLN A 75  ? 0.1905 0.1836 0.2101 -0.0056 -0.0220 -0.0079 918  GLN A CG  
536  C CD  . GLN A 75  ? 0.2045 0.2015 0.2293 -0.0050 -0.0250 -0.0100 918  GLN A CD  
537  O OE1 . GLN A 75  ? 0.2408 0.2396 0.2685 -0.0055 -0.0273 -0.0131 918  GLN A OE1 
538  N NE2 . GLN A 75  ? 0.2103 0.2089 0.2367 -0.0039 -0.0252 -0.0085 918  GLN A NE2 
539  N N   . THR A 76  ? 0.1150 0.1013 0.1188 -0.0049 -0.0225 -0.0112 919  THR A N   
540  C CA  . THR A 76  ? 0.1470 0.1315 0.1485 -0.0051 -0.0224 -0.0131 919  THR A CA  
541  C C   . THR A 76  ? 0.1283 0.1103 0.1257 -0.0050 -0.0192 -0.0109 919  THR A C   
542  O O   . THR A 76  ? 0.1484 0.1289 0.1468 -0.0058 -0.0176 -0.0116 919  THR A O   
543  C CB  . THR A 76  ? 0.1567 0.1418 0.1530 -0.0034 -0.0255 -0.0154 919  THR A CB  
544  O OG1 . THR A 76  ? 0.1907 0.1790 0.1917 -0.0034 -0.0289 -0.0182 919  THR A OG1 
545  C CG2 . THR A 76  ? 0.1618 0.1448 0.1551 -0.0035 -0.0251 -0.0177 919  THR A CG2 
546  N N   . THR A 77  ? 0.1014 0.0831 0.0947 -0.0041 -0.0182 -0.0083 920  THR A N   
547  C CA  . THR A 77  ? 0.1118 0.0920 0.1018 -0.0041 -0.0153 -0.0065 920  THR A CA  
548  C C   . THR A 77  ? 0.1305 0.1108 0.1251 -0.0054 -0.0129 -0.0054 920  THR A C   
549  O O   . THR A 77  ? 0.1132 0.0926 0.1069 -0.0054 -0.0111 -0.0052 920  THR A O   
550  C CB  . THR A 77  ? 0.1044 0.0841 0.0897 -0.0031 -0.0145 -0.0042 920  THR A CB  
551  O OG1 . THR A 77  ? 0.1139 0.0931 0.0941 -0.0015 -0.0166 -0.0049 920  THR A OG1 
552  C CG2 . THR A 77  ? 0.1341 0.1128 0.1168 -0.0034 -0.0115 -0.0029 920  THR A CG2 
553  N N   . LEU A 78  ? 0.1193 0.1008 0.1187 -0.0061 -0.0129 -0.0046 921  LEU A N   
554  C CA  . LEU A 78  ? 0.1026 0.0841 0.1057 -0.0070 -0.0107 -0.0035 921  LEU A CA  
555  C C   . LEU A 78  ? 0.1206 0.1007 0.1258 -0.0075 -0.0102 -0.0050 921  LEU A C   
556  O O   . LEU A 78  ? 0.1239 0.1029 0.1287 -0.0073 -0.0082 -0.0040 921  LEU A O   
557  C CB  . LEU A 78  ? 0.1235 0.1065 0.1313 -0.0077 -0.0106 -0.0027 921  LEU A CB  
558  C CG  . LEU A 78  ? 0.1767 0.1608 0.1830 -0.0072 -0.0103 -0.0009 921  LEU A CG  
559  C CD1 . LEU A 78  ? 0.1698 0.1555 0.1808 -0.0076 -0.0109 -0.0009 921  LEU A CD1 
560  C CD2 . LEU A 78  ? 0.1424 0.1264 0.1471 -0.0073 -0.0078 0.0008  921  LEU A CD2 
561  N N   . ALA A 79  ? 0.1373 0.1172 0.1448 -0.0080 -0.0122 -0.0074 922  ALA A N   
562  C CA  . ALA A 79  ? 0.1465 0.1244 0.1564 -0.0086 -0.0117 -0.0093 922  ALA A CA  
563  C C   . ALA A 79  ? 0.1409 0.1170 0.1460 -0.0075 -0.0109 -0.0097 922  ALA A C   
564  O O   . ALA A 79  ? 0.1450 0.1190 0.1510 -0.0075 -0.0090 -0.0095 922  ALA A O   
565  C CB  . ALA A 79  ? 0.1667 0.1454 0.1797 -0.0094 -0.0144 -0.0127 922  ALA A CB  
566  N N   . ILE A 80  ? 0.1249 0.1016 0.1246 -0.0065 -0.0122 -0.0102 923  ILE A N   
567  C CA  . ILE A 80  ? 0.1194 0.0947 0.1145 -0.0054 -0.0111 -0.0106 923  ILE A CA  
568  C C   . ILE A 80  ? 0.1599 0.1353 0.1545 -0.0050 -0.0084 -0.0080 923  ILE A C   
569  O O   . ILE A 80  ? 0.1460 0.1202 0.1399 -0.0043 -0.0070 -0.0084 923  ILE A O   
570  C CB  . ILE A 80  ? 0.1733 0.1492 0.1624 -0.0043 -0.0125 -0.0112 923  ILE A CB  
571  C CG1 . ILE A 80  ? 0.2912 0.2669 0.2798 -0.0042 -0.0154 -0.0145 923  ILE A CG1 
572  C CG2 . ILE A 80  ? 0.1490 0.1240 0.1336 -0.0033 -0.0106 -0.0109 923  ILE A CG2 
573  C CD1 . ILE A 80  ? 0.3156 0.2921 0.2980 -0.0027 -0.0172 -0.0148 923  ILE A CD1 
574  N N   . CYS A 81  ? 0.1239 0.1010 0.1189 -0.0053 -0.0078 -0.0058 924  CYS A N   
575  C CA  . CYS A 81  ? 0.1096 0.0876 0.1044 -0.0048 -0.0056 -0.0038 924  CYS A CA  
576  C C   . CYS A 81  ? 0.1524 0.1295 0.1508 -0.0048 -0.0043 -0.0032 924  CYS A C   
577  O O   . CYS A 81  ? 0.1397 0.1169 0.1374 -0.0037 -0.0028 -0.0025 924  CYS A O   
578  C CB  . CYS A 81  ? 0.1298 0.1097 0.1245 -0.0052 -0.0053 -0.0020 924  CYS A CB  
579  S SG  . CYS A 81  ? 0.1426 0.1229 0.1324 -0.0050 -0.0056 -0.0019 924  CYS A SG  
580  N N   . GLU A 82  ? 0.1005 0.0765 0.1027 -0.0057 -0.0047 -0.0035 925  GLU A N   
581  C CA  . GLU A 82  ? 0.1799 0.1541 0.1851 -0.0055 -0.0030 -0.0026 925  GLU A CA  
582  C C   . GLU A 82  ? 0.2017 0.1732 0.2063 -0.0048 -0.0025 -0.0041 925  GLU A C   
583  O O   . GLU A 82  ? 0.1635 0.1337 0.1679 -0.0035 -0.0008 -0.0029 925  GLU A O   
584  C CB  . GLU A 82  ? 0.2770 0.2506 0.2870 -0.0070 -0.0030 -0.0026 925  GLU A CB  
585  C CG  . GLU A 82  ? 0.4509 0.4228 0.4633 -0.0067 -0.0005 -0.0004 925  GLU A CG  
586  C CD  . GLU A 82  ? 0.5193 0.4909 0.5366 -0.0082 0.0001  -0.0001 925  GLU A CD  
587  O OE1 . GLU A 82  ? 0.5162 0.4903 0.5348 -0.0092 -0.0014 -0.0007 925  GLU A OE1 
588  O OE2 . GLU A 82  ? 0.5209 0.4896 0.5409 -0.0084 0.0022  0.0008  925  GLU A OE2 
589  N N   . GLN A 83  ? 0.1302 0.1009 0.1341 -0.0053 -0.0042 -0.0069 926  GLN A N   
590  C CA  . GLN A 83  ? 0.1340 0.1020 0.1369 -0.0046 -0.0039 -0.0090 926  GLN A CA  
591  C C   . GLN A 83  ? 0.1614 0.1303 0.1604 -0.0027 -0.0027 -0.0082 926  GLN A C   
592  O O   . GLN A 83  ? 0.1357 0.1026 0.1349 -0.0015 -0.0013 -0.0083 926  GLN A O   
593  C CB  . GLN A 83  ? 0.1727 0.1406 0.1746 -0.0053 -0.0063 -0.0124 926  GLN A CB  
594  C CG  . GLN A 83  ? 0.2634 0.2288 0.2635 -0.0046 -0.0063 -0.0152 926  GLN A CG  
595  C CD  . GLN A 83  ? 0.3028 0.2689 0.3004 -0.0049 -0.0090 -0.0186 926  GLN A CD  
596  O OE1 . GLN A 83  ? 0.3034 0.2720 0.3000 -0.0053 -0.0110 -0.0184 926  GLN A OE1 
597  N NE2 . GLN A 83  ? 0.2159 0.1797 0.2125 -0.0045 -0.0092 -0.0218 926  GLN A NE2 
598  N N   . LEU A 84  ? 0.1473 0.1191 0.1432 -0.0026 -0.0031 -0.0073 927  LEU A N   
599  C CA  . LEU A 84  ? 0.1260 0.0993 0.1190 -0.0012 -0.0019 -0.0068 927  LEU A CA  
600  C C   . LEU A 84  ? 0.1353 0.1095 0.1302 0.0000  -0.0002 -0.0047 927  LEU A C   
601  O O   . LEU A 84  ? 0.1504 0.1248 0.1447 0.0016  0.0010  -0.0048 927  LEU A O   
602  C CB  . LEU A 84  ? 0.1543 0.1303 0.1442 -0.0016 -0.0023 -0.0063 927  LEU A CB  
603  C CG  . LEU A 84  ? 0.1961 0.1738 0.1830 -0.0007 -0.0009 -0.0063 927  LEU A CG  
604  C CD1 . LEU A 84  ? 0.1712 0.1472 0.1547 0.0000  -0.0010 -0.0087 927  LEU A CD1 
605  C CD2 . LEU A 84  ? 0.2533 0.2332 0.2385 -0.0015 -0.0007 -0.0051 927  LEU A CD2 
606  N N   . ALA A 85  ? 0.1250 0.1001 0.1221 -0.0006 -0.0001 -0.0028 928  ALA A N   
607  C CA  . ALA A 85  ? 0.1684 0.1445 0.1665 0.0008  0.0013  -0.0007 928  ALA A CA  
608  C C   . ALA A 85  ? 0.1362 0.1089 0.1356 0.0023  0.0024  -0.0006 928  ALA A C   
609  O O   . ALA A 85  ? 0.1199 0.0934 0.1188 0.0044  0.0035  0.0002  928  ALA A O   
610  C CB  . ALA A 85  ? 0.1459 0.1229 0.1458 -0.0001 0.0013  0.0012  928  ALA A CB  
611  N N   . THR A 86  ? 0.1371 0.1060 0.1386 0.0011  0.0023  -0.0015 929  THR A N   
612  C CA  . THR A 86  ? 0.1153 0.0798 0.1184 0.0022  0.0038  -0.0015 929  THR A CA  
613  C C   . THR A 86  ? 0.1274 0.0911 0.1286 0.0039  0.0041  -0.0032 929  THR A C   
614  O O   . THR A 86  ? 0.1701 0.1321 0.1714 0.0062  0.0056  -0.0022 929  THR A O   
615  C CB  . THR A 86  ? 0.1451 0.1058 0.1515 0.0001  0.0036  -0.0029 929  THR A CB  
616  O OG1 . THR A 86  ? 0.1916 0.1532 0.2002 -0.0012 0.0039  -0.0010 929  THR A OG1 
617  C CG2 . THR A 86  ? 0.1637 0.1190 0.1719 0.0010  0.0055  -0.0032 929  THR A CG2 
618  N N   . ALA A 87  ? 0.1532 0.1181 0.1524 0.0030  0.0028  -0.0058 930  ALA A N   
619  C CA  . ALA A 87  ? 0.1316 0.0959 0.1287 0.0045  0.0032  -0.0078 930  ALA A CA  
620  C C   . ALA A 87  ? 0.1098 0.0778 0.1054 0.0067  0.0042  -0.0064 930  ALA A C   
621  O O   . ALA A 87  ? 0.1093 0.0767 0.1045 0.0088  0.0053  -0.0072 930  ALA A O   
622  C CB  . ALA A 87  ? 0.1143 0.0792 0.1086 0.0031  0.0016  -0.0106 930  ALA A CB  
623  N N   . MET A 88  ? 0.1147 0.0869 0.1101 0.0062  0.0038  -0.0047 931  MET A N   
624  C CA  . MET A 88  ? 0.1077 0.0846 0.1023 0.0077  0.0045  -0.0041 931  MET A CA  
625  C C   . MET A 88  ? 0.1269 0.1053 0.1231 0.0099  0.0052  -0.0018 931  MET A C   
626  O O   . MET A 88  ? 0.1470 0.1290 0.1433 0.0119  0.0057  -0.0018 931  MET A O   
627  C CB  . MET A 88  ? 0.1683 0.1490 0.1617 0.0058  0.0038  -0.0040 931  MET A CB  
628  C CG  . MET A 88  ? 0.2587 0.2432 0.2509 0.0063  0.0046  -0.0049 931  MET A CG  
629  S SD  . MET A 88  ? 0.2238 0.2109 0.2145 0.0037  0.0043  -0.0047 931  MET A SD  
630  C CE  . MET A 88  ? 0.2134 0.1971 0.2003 0.0027  0.0038  -0.0065 931  MET A CE  
631  N N   . GLY A 89  ? 0.1148 0.0907 0.1122 0.0098  0.0052  0.0000  932  GLY A N   
632  C CA  . GLY A 89  ? 0.1205 0.0976 0.1185 0.0122  0.0058  0.0025  932  GLY A CA  
633  C C   . GLY A 89  ? 0.1994 0.1831 0.1970 0.0125  0.0052  0.0029  932  GLY A C   
634  O O   . GLY A 89  ? 0.1740 0.1598 0.1714 0.0100  0.0044  0.0024  932  GLY A O   
635  N N   . ALA A 90  ? 0.1483 0.1353 0.1461 0.0155  0.0054  0.0036  933  ALA A N   
636  C CA  . ALA A 90  ? 0.1964 0.1903 0.1946 0.0159  0.0046  0.0036  933  ALA A CA  
637  C C   . ALA A 90  ? 0.1699 0.1674 0.1684 0.0134  0.0044  0.0012  933  ALA A C   
638  O O   . ALA A 90  ? 0.1600 0.1620 0.1591 0.0122  0.0038  0.0009  933  ALA A O   
639  C CB  . ALA A 90  ? 0.2082 0.2056 0.2069 0.0199  0.0046  0.0042  933  ALA A CB  
640  N N   . GLY A 91  ? 0.1388 0.1340 0.1368 0.0126  0.0050  -0.0004 934  GLY A N   
641  C CA  . GLY A 91  ? 0.1620 0.1599 0.1597 0.0105  0.0053  -0.0023 934  GLY A CA  
642  C C   . GLY A 91  ? 0.1197 0.1167 0.1165 0.0074  0.0047  -0.0020 934  GLY A C   
643  O O   . GLY A 91  ? 0.1473 0.1466 0.1438 0.0056  0.0051  -0.0030 934  GLY A O   
644  N N   . CYS A 92  ? 0.1265 0.1202 0.1230 0.0067  0.0039  -0.0006 935  CYS A N   
645  C CA  . CYS A 92  ? 0.1187 0.1116 0.1146 0.0041  0.0033  -0.0005 935  CYS A CA  
646  C C   . CYS A 92  ? 0.1218 0.1192 0.1185 0.0032  0.0033  -0.0003 935  CYS A C   
647  O O   . CYS A 92  ? 0.1385 0.1358 0.1346 0.0010  0.0031  -0.0006 935  CYS A O   
648  C CB  . CYS A 92  ? 0.1706 0.1594 0.1667 0.0035  0.0027  0.0007  935  CYS A CB  
649  S SG  . CYS A 92  ? 0.1874 0.1772 0.1848 0.0049  0.0028  0.0030  935  CYS A SG  
650  N N   . ARG A 93  ? 0.1227 0.1243 0.1209 0.0049  0.0033  -0.0001 936  ARG A N   
651  C CA  . ARG A 93  ? 0.1374 0.1437 0.1368 0.0039  0.0031  -0.0006 936  ARG A CA  
652  C C   . ARG A 93  ? 0.1486 0.1569 0.1485 0.0019  0.0041  -0.0024 936  ARG A C   
653  O O   . ARG A 93  ? 0.1589 0.1693 0.1596 0.0000  0.0043  -0.0029 936  ARG A O   
654  C CB  . ARG A 93  ? 0.1693 0.1806 0.1702 0.0065  0.0027  -0.0007 936  ARG A CB  
655  C CG  . ARG A 93  ? 0.1704 0.1851 0.1727 0.0082  0.0032  -0.0020 936  ARG A CG  
656  C CD  . ARG A 93  ? 0.3289 0.3501 0.3331 0.0106  0.0023  -0.0025 936  ARG A CD  
657  N NE  . ARG A 93  ? 0.4663 0.4916 0.4728 0.0123  0.0028  -0.0041 936  ARG A NE  
658  C CZ  . ARG A 93  ? 0.4704 0.5030 0.4797 0.0140  0.0020  -0.0056 936  ARG A CZ  
659  N NH1 . ARG A 93  ? 0.5164 0.5530 0.5261 0.0142  0.0006  -0.0058 936  ARG A NH1 
660  N NH2 . ARG A 93  ? 0.4121 0.4486 0.4239 0.0156  0.0026  -0.0071 936  ARG A NH2 
661  N N   . ASN A 94  ? 0.1193 0.1266 0.1185 0.0023  0.0050  -0.0032 937  ASN A N   
662  C CA  . ASN A 94  ? 0.1097 0.1184 0.1089 0.0006  0.0065  -0.0045 937  ASN A CA  
663  C C   . ASN A 94  ? 0.1466 0.1519 0.1437 -0.0019 0.0068  -0.0040 937  ASN A C   
664  O O   . ASN A 94  ? 0.1762 0.1825 0.1734 -0.0036 0.0084  -0.0047 937  ASN A O   
665  C CB  . ASN A 94  ? 0.0918 0.0994 0.0899 0.0017  0.0077  -0.0054 937  ASN A CB  
666  C CG  . ASN A 94  ? 0.1127 0.1245 0.1135 0.0043  0.0078  -0.0062 937  ASN A CG  
667  O OD1 . ASN A 94  ? 0.1530 0.1673 0.1555 0.0059  0.0066  -0.0056 937  ASN A OD1 
668  N ND2 . ASN A 94  ? 0.1193 0.1320 0.1202 0.0050  0.0094  -0.0075 937  ASN A ND2 
669  N N   . HIS A 95  ? 0.1268 0.1281 0.1222 -0.0021 0.0055  -0.0028 938  HIS A N   
670  C CA  . HIS A 95  ? 0.1046 0.1023 0.0976 -0.0038 0.0054  -0.0022 938  HIS A CA  
671  C C   . HIS A 95  ? 0.1228 0.1201 0.1167 -0.0047 0.0045  -0.0013 938  HIS A C   
672  O O   . HIS A 95  ? 0.1119 0.1064 0.1042 -0.0058 0.0041  -0.0007 938  HIS A O   
673  C CB  . HIS A 95  ? 0.0927 0.0862 0.0830 -0.0031 0.0046  -0.0022 938  HIS A CB  
674  C CG  . HIS A 95  ? 0.0884 0.0820 0.0774 -0.0020 0.0057  -0.0033 938  HIS A CG  
675  N ND1 . HIS A 95  ? 0.1168 0.1110 0.1041 -0.0027 0.0075  -0.0039 938  HIS A ND1 
676  C CD2 . HIS A 95  ? 0.0903 0.0836 0.0798 -0.0003 0.0056  -0.0040 938  HIS A CD2 
677  C CE1 . HIS A 95  ? 0.1611 0.1556 0.1477 -0.0014 0.0084  -0.0051 938  HIS A CE1 
678  N NE2 . HIS A 95  ? 0.1216 0.1155 0.1096 0.0002  0.0072  -0.0052 938  HIS A NE2 
679  N N   . VAL A 96  ? 0.1135 0.1140 0.1099 -0.0042 0.0040  -0.0012 939  VAL A N   
680  C CA  . VAL A 96  ? 0.1150 0.1153 0.1121 -0.0049 0.0033  -0.0005 939  VAL A CA  
681  C C   . VAL A 96  ? 0.1606 0.1609 0.1578 -0.0069 0.0042  -0.0009 939  VAL A C   
682  O O   . VAL A 96  ? 0.1187 0.1165 0.1153 -0.0077 0.0037  -0.0001 939  VAL A O   
683  C CB  . VAL A 96  ? 0.0850 0.0891 0.0840 -0.0035 0.0029  -0.0005 939  VAL A CB  
684  C CG1 . VAL A 96  ? 0.1510 0.1562 0.1508 -0.0045 0.0026  -0.0005 939  VAL A CG1 
685  C CG2 . VAL A 96  ? 0.1228 0.1250 0.1212 -0.0015 0.0022  0.0008  939  VAL A CG2 
686  N N   . ARG A 97  ? 0.1116 0.1144 0.1098 -0.0078 0.0056  -0.0022 940  ARG A N   
687  C CA  . ARG A 97  ? 0.1229 0.1250 0.1214 -0.0099 0.0070  -0.0026 940  ARG A CA  
688  C C   . ARG A 97  ? 0.1583 0.1550 0.1533 -0.0104 0.0073  -0.0012 940  ARG A C   
689  O O   . ARG A 97  ? 0.1357 0.1303 0.1305 -0.0114 0.0076  -0.0007 940  ARG A O   
690  C CB  . ARG A 97  ? 0.2225 0.2281 0.2231 -0.0110 0.0089  -0.0043 940  ARG A CB  
691  C CG  . ARG A 97  ? 0.3024 0.3070 0.3039 -0.0134 0.0109  -0.0049 940  ARG A CG  
692  C CD  . ARG A 97  ? 0.2489 0.2579 0.2538 -0.0146 0.0130  -0.0070 940  ARG A CD  
693  N NE  . ARG A 97  ? 0.2875 0.2945 0.2933 -0.0172 0.0155  -0.0075 940  ARG A NE  
694  C CZ  . ARG A 97  ? 0.3065 0.3152 0.3154 -0.0188 0.0157  -0.0090 940  ARG A CZ  
695  N NH1 . ARG A 97  ? 0.2074 0.2200 0.2181 -0.0178 0.0133  -0.0101 940  ARG A NH1 
696  N NH2 . ARG A 97  ? 0.4413 0.4473 0.4512 -0.0212 0.0184  -0.0093 940  ARG A NH2 
697  N N   . ASN A 98  ? 0.1387 0.1334 0.1312 -0.0094 0.0070  -0.0007 941  ASN A N   
698  C CA  . ASN A 98  ? 0.1495 0.1396 0.1382 -0.0093 0.0067  0.0004  941  ASN A CA  
699  C C   . ASN A 98  ? 0.1992 0.1874 0.1878 -0.0087 0.0044  0.0013  941  ASN A C   
700  O O   . ASN A 98  ? 0.2281 0.2136 0.2152 -0.0089 0.0040  0.0022  941  ASN A O   
701  C CB  . ASN A 98  ? 0.1822 0.1710 0.1678 -0.0084 0.0071  0.0002  941  ASN A CB  
702  C CG  . ASN A 98  ? 0.2749 0.2639 0.2593 -0.0093 0.0100  -0.0001 941  ASN A CG  
703  O OD1 . ASN A 98  ? 0.3105 0.2968 0.2928 -0.0102 0.0114  0.0009  941  ASN A OD1 
704  N ND2 . ASN A 98  ? 0.3475 0.3395 0.3333 -0.0090 0.0111  -0.0013 941  ASN A ND2 
705  N N   . LEU A 99  ? 0.0961 0.0855 0.0864 -0.0077 0.0030  0.0011  942  LEU A N   
706  C CA  . LEU A 99  ? 0.0889 0.0764 0.0795 -0.0072 0.0011  0.0017  942  LEU A CA  
707  C C   . LEU A 99  ? 0.1149 0.1035 0.1082 -0.0075 0.0007  0.0022  942  LEU A C   
708  O O   . LEU A 99  ? 0.0934 0.0804 0.0871 -0.0075 -0.0004 0.0027  942  LEU A O   
709  C CB  . LEU A 99  ? 0.1132 0.1004 0.1041 -0.0061 0.0003  0.0011  942  LEU A CB  
710  C CG  . LEU A 99  ? 0.0999 0.0860 0.0878 -0.0056 0.0007  0.0003  942  LEU A CG  
711  C CD1 . LEU A 99  ? 0.1761 0.1616 0.1647 -0.0045 0.0001  -0.0005 942  LEU A CD1 
712  C CD2 . LEU A 99  ? 0.1400 0.1234 0.1245 -0.0057 -0.0002 0.0004  942  LEU A CD2 
713  N N   . PHE A 100 ? 0.0869 0.0784 0.0820 -0.0076 0.0015  0.0019  943  PHE A N   
714  C CA  . PHE A 100 ? 0.1055 0.0981 0.1026 -0.0077 0.0013  0.0023  943  PHE A CA  
715  C C   . PHE A 100 ? 0.1207 0.1119 0.1180 -0.0086 0.0014  0.0026  943  PHE A C   
716  O O   . PHE A 100 ? 0.1007 0.0914 0.0993 -0.0085 0.0008  0.0031  943  PHE A O   
717  C CB  . PHE A 100 ? 0.1201 0.1165 0.1184 -0.0073 0.0019  0.0016  943  PHE A CB  
718  C CG  . PHE A 100 ? 0.1157 0.1136 0.1153 -0.0070 0.0018  0.0020  943  PHE A CG  
719  C CD1 . PHE A 100 ? 0.1404 0.1367 0.1404 -0.0062 0.0013  0.0032  943  PHE A CD1 
720  C CD2 . PHE A 100 ? 0.0884 0.0895 0.0888 -0.0073 0.0023  0.0008  943  PHE A CD2 
721  C CE1 . PHE A 100 ? 0.1074 0.1052 0.1082 -0.0057 0.0016  0.0037  943  PHE A CE1 
722  C CE2 . PHE A 100 ? 0.0952 0.0978 0.0960 -0.0067 0.0022  0.0010  943  PHE A CE2 
723  C CZ  . PHE A 100 ? 0.1246 0.1255 0.1254 -0.0059 0.0020  0.0026  943  PHE A CZ  
724  N N   . PRO A 101 ? 0.0999 0.0905 0.0962 -0.0096 0.0025  0.0022  944  PRO A N   
725  C CA  . PRO A 101 ? 0.1320 0.1204 0.1282 -0.0101 0.0027  0.0026  944  PRO A CA  
726  C C   . PRO A 101 ? 0.1262 0.1121 0.1217 -0.0093 0.0011  0.0037  944  PRO A C   
727  O O   . PRO A 101 ? 0.1109 0.0961 0.1078 -0.0091 0.0007  0.0041  944  PRO A O   
728  C CB  . PRO A 101 ? 0.1133 0.1004 0.1080 -0.0111 0.0044  0.0024  944  PRO A CB  
729  C CG  . PRO A 101 ? 0.1188 0.1094 0.1147 -0.0116 0.0054  0.0011  944  PRO A CG  
730  C CD  . PRO A 101 ? 0.1184 0.1101 0.1140 -0.0102 0.0039  0.0013  944  PRO A CD  
731  N N   . GLY A 102 ? 0.0944 0.0791 0.0879 -0.0086 0.0002  0.0038  945  GLY A N   
732  C CA  . GLY A 102 ? 0.0956 0.0787 0.0887 -0.0077 -0.0017 0.0043  945  GLY A CA  
733  C C   . GLY A 102 ? 0.0748 0.0593 0.0714 -0.0076 -0.0028 0.0041  945  GLY A C   
734  O O   . GLY A 102 ? 0.0878 0.0719 0.0859 -0.0072 -0.0039 0.0043  945  GLY A O   
735  N N   . PHE A 103 ? 0.0846 0.0706 0.0825 -0.0077 -0.0022 0.0038  946  PHE A N   
736  C CA  . PHE A 103 ? 0.0722 0.0591 0.0732 -0.0076 -0.0025 0.0040  946  PHE A CA  
737  C C   . PHE A 103 ? 0.1021 0.0899 0.1050 -0.0078 -0.0018 0.0044  946  PHE A C   
738  O O   . PHE A 103 ? 0.0909 0.0789 0.0965 -0.0078 -0.0022 0.0046  946  PHE A O   
739  C CB  . PHE A 103 ? 0.0672 0.0552 0.0685 -0.0072 -0.0015 0.0040  946  PHE A CB  
740  C CG  . PHE A 103 ? 0.0803 0.0674 0.0801 -0.0068 -0.0019 0.0034  946  PHE A CG  
741  C CD1 . PHE A 103 ? 0.1166 0.1019 0.1152 -0.0068 -0.0032 0.0027  946  PHE A CD1 
742  C CD2 . PHE A 103 ? 0.0973 0.0854 0.0967 -0.0061 -0.0010 0.0035  946  PHE A CD2 
743  C CE1 . PHE A 103 ? 0.1225 0.1068 0.1195 -0.0063 -0.0033 0.0019  946  PHE A CE1 
744  C CE2 . PHE A 103 ? 0.1414 0.1285 0.1396 -0.0055 -0.0011 0.0029  946  PHE A CE2 
745  C CZ  . PHE A 103 ? 0.0867 0.0719 0.0837 -0.0057 -0.0022 0.0019  946  PHE A CZ  
746  N N   . LEU A 104 ? 0.1043 0.0931 0.1062 -0.0082 -0.0006 0.0043  947  LEU A N   
747  C CA  . LEU A 104 ? 0.1536 0.1433 0.1570 -0.0083 0.0001  0.0043  947  LEU A CA  
748  C C   . LEU A 104 ? 0.1438 0.1318 0.1480 -0.0082 -0.0006 0.0046  947  LEU A C   
749  O O   . LEU A 104 ? 0.1410 0.1295 0.1476 -0.0080 -0.0004 0.0047  947  LEU A O   
750  C CB  . LEU A 104 ? 0.0916 0.0827 0.0940 -0.0089 0.0013  0.0035  947  LEU A CB  
751  C CG  . LEU A 104 ? 0.1187 0.1127 0.1209 -0.0086 0.0018  0.0030  947  LEU A CG  
752  C CD1 . LEU A 104 ? 0.1340 0.1298 0.1359 -0.0094 0.0027  0.0015  947  LEU A CD1 
753  C CD2 . LEU A 104 ? 0.1832 0.1785 0.1865 -0.0077 0.0021  0.0036  947  LEU A CD2 
754  N N   . HIS A 105 ? 0.1063 0.0923 0.1083 -0.0081 -0.0011 0.0047  948  HIS A N   
755  C CA  . HIS A 105 ? 0.1059 0.0902 0.1081 -0.0075 -0.0019 0.0052  948  HIS A CA  
756  C C   . HIS A 105 ? 0.1264 0.1115 0.1313 -0.0068 -0.0037 0.0052  948  HIS A C   
757  O O   . HIS A 105 ? 0.1713 0.1565 0.1784 -0.0062 -0.0041 0.0054  948  HIS A O   
758  C CB  . HIS A 105 ? 0.1242 0.1058 0.1226 -0.0071 -0.0020 0.0057  948  HIS A CB  
759  C CG  . HIS A 105 ? 0.1669 0.1463 0.1648 -0.0061 -0.0024 0.0065  948  HIS A CG  
760  N ND1 . HIS A 105 ? 0.2029 0.1810 0.2015 -0.0064 -0.0008 0.0067  948  HIS A ND1 
761  C CD2 . HIS A 105 ? 0.1816 0.1599 0.1785 -0.0045 -0.0044 0.0071  948  HIS A CD2 
762  C CE1 . HIS A 105 ? 0.1605 0.1363 0.1584 -0.0048 -0.0016 0.0077  948  HIS A CE1 
763  N NE2 . HIS A 105 ? 0.2170 0.1931 0.2137 -0.0036 -0.0039 0.0080  948  HIS A NE2 
764  N N   . ALA A 106 ? 0.1142 0.0998 0.1193 -0.0069 -0.0046 0.0048  949  ALA A N   
765  C CA  . ALA A 106 ? 0.0835 0.0701 0.0919 -0.0066 -0.0062 0.0043  949  ALA A CA  
766  C C   . ALA A 106 ? 0.0808 0.0692 0.0936 -0.0071 -0.0050 0.0044  949  ALA A C   
767  O O   . ALA A 106 ? 0.1019 0.0915 0.1187 -0.0071 -0.0058 0.0039  949  ALA A O   
768  C CB  . ALA A 106 ? 0.1065 0.0929 0.1143 -0.0068 -0.0072 0.0035  949  ALA A CB  
769  N N   . LEU A 107 ? 0.0924 0.0813 0.1046 -0.0075 -0.0030 0.0049  950  LEU A N   
770  C CA  . LEU A 107 ? 0.1218 0.1122 0.1371 -0.0077 -0.0015 0.0052  950  LEU A CA  
771  C C   . LEU A 107 ? 0.1589 0.1499 0.1765 -0.0073 -0.0015 0.0051  950  LEU A C   
772  O O   . LEU A 107 ? 0.1772 0.1695 0.1980 -0.0073 -0.0003 0.0052  950  LEU A O   
773  C CB  . LEU A 107 ? 0.1824 0.1735 0.1955 -0.0078 0.0003  0.0055  950  LEU A CB  
774  C CG  . LEU A 107 ? 0.1567 0.1478 0.1682 -0.0077 0.0008  0.0059  950  LEU A CG  
775  C CD1 . LEU A 107 ? 0.1007 0.0934 0.1101 -0.0073 0.0022  0.0060  950  LEU A CD1 
776  C CD2 . LEU A 107 ? 0.1682 0.1591 0.1825 -0.0078 0.0014  0.0065  950  LEU A CD2 
777  N N   . GLY A 108 ? 0.1168 0.1065 0.1327 -0.0067 -0.0026 0.0050  951  GLY A N   
778  C CA  . GLY A 108 ? 0.1273 0.1171 0.1452 -0.0059 -0.0026 0.0050  951  GLY A CA  
779  C C   . GLY A 108 ? 0.1523 0.1431 0.1734 -0.0050 -0.0048 0.0047  951  GLY A C   
780  O O   . GLY A 108 ? 0.1937 0.1848 0.2168 -0.0038 -0.0053 0.0047  951  GLY A O   
781  N N   . ASP A 109 ? 0.1064 0.0977 0.1280 -0.0054 -0.0063 0.0041  952  ASP A N   
782  C CA  . ASP A 109 ? 0.1006 0.0933 0.1250 -0.0045 -0.0089 0.0033  952  ASP A CA  
783  C C   . ASP A 109 ? 0.1754 0.1711 0.2064 -0.0045 -0.0086 0.0027  952  ASP A C   
784  O O   . ASP A 109 ? 0.1951 0.1917 0.2287 -0.0056 -0.0062 0.0029  952  ASP A O   
785  C CB  . ASP A 109 ? 0.1544 0.1473 0.1787 -0.0053 -0.0103 0.0022  952  ASP A CB  
786  C CG  . ASP A 109 ? 0.2063 0.2005 0.2317 -0.0042 -0.0137 0.0009  952  ASP A CG  
787  O OD1 . ASP A 109 ? 0.2352 0.2324 0.2666 -0.0043 -0.0147 -0.0004 952  ASP A OD1 
788  O OD2 . ASP A 109 ? 0.1973 0.1898 0.2176 -0.0031 -0.0153 0.0010  952  ASP A OD2 
789  N N   . ASN A 110 ? 0.2372 0.2345 0.2707 -0.0030 -0.0109 0.0020  953  ASN A N   
790  C CA  . ASN A 110 ? 0.2752 0.2761 0.3159 -0.0028 -0.0109 0.0011  953  ASN A CA  
791  C C   . ASN A 110 ? 0.2402 0.2437 0.2866 -0.0046 -0.0108 -0.0004 953  ASN A C   
792  O O   . ASN A 110 ? 0.2423 0.2486 0.2950 -0.0052 -0.0094 -0.0009 953  ASN A O   
793  C CB  . ASN A 110 ? 0.3007 0.3033 0.3427 -0.0004 -0.0141 0.0005  953  ASN A CB  
794  C CG  . ASN A 110 ? 0.4473 0.4472 0.4854 0.0016  -0.0136 0.0020  953  ASN A CG  
795  O OD1 . ASN A 110 ? 0.5313 0.5294 0.5682 0.0011  -0.0108 0.0029  953  ASN A OD1 
796  N ND2 . ASN A 110 ? 0.4423 0.4417 0.4780 0.0041  -0.0165 0.0023  953  ASN A ND2 
797  N N   . LYS A 111 ? 0.2146 0.2171 0.2590 -0.0056 -0.0120 -0.0011 954  LYS A N   
798  C CA  . LYS A 111 ? 0.1878 0.1921 0.2377 -0.0074 -0.0119 -0.0027 954  LYS A CA  
799  C C   . LYS A 111 ? 0.2347 0.2364 0.2830 -0.0091 -0.0088 -0.0016 954  LYS A C   
800  O O   . LYS A 111 ? 0.1831 0.1818 0.2253 -0.0090 -0.0086 -0.0007 954  LYS A O   
801  C CB  . LYS A 111 ? 0.2325 0.2375 0.2817 -0.0070 -0.0157 -0.0048 954  LYS A CB  
802  C CG  . LYS A 111 ? 0.2728 0.2810 0.3238 -0.0048 -0.0193 -0.0060 954  LYS A CG  
803  C CD  . LYS A 111 ? 0.3065 0.3148 0.3541 -0.0037 -0.0231 -0.0077 954  LYS A CD  
804  C CE  . LYS A 111 ? 0.4123 0.4160 0.4502 -0.0027 -0.0228 -0.0057 954  LYS A CE  
805  N NZ  . LYS A 111 ? 0.4458 0.4475 0.4800 -0.0011 -0.0215 -0.0031 954  LYS A NZ  
806  N N   . SER A 112 ? 0.1677 0.1705 0.2215 -0.0106 -0.0061 -0.0016 955  SER A N   
807  C CA  . SER A 112 ? 0.1938 0.1940 0.2460 -0.0118 -0.0027 0.0000  955  SER A CA  
808  C C   . SER A 112 ? 0.2280 0.2255 0.2777 -0.0126 -0.0033 -0.0005 955  SER A C   
809  O O   . SER A 112 ? 0.1836 0.1784 0.2288 -0.0125 -0.0014 0.0011  955  SER A O   
810  C CB  . SER A 112 ? 0.2878 0.2894 0.3466 -0.0132 0.0005  0.0001  955  SER A CB  
811  O OG  . SER A 112 ? 0.2122 0.2153 0.2777 -0.0147 -0.0004 -0.0021 955  SER A OG  
812  N N   . PHE A 113 ? 0.1514 0.1500 0.2042 -0.0132 -0.0059 -0.0030 956  PHE A N   
813  C CA  . PHE A 113 ? 0.1647 0.1606 0.2152 -0.0138 -0.0064 -0.0038 956  PHE A CA  
814  C C   . PHE A 113 ? 0.1765 0.1704 0.2188 -0.0124 -0.0078 -0.0029 956  PHE A C   
815  O O   . PHE A 113 ? 0.2197 0.2107 0.2587 -0.0125 -0.0069 -0.0025 956  PHE A O   
816  C CB  . PHE A 113 ? 0.1490 0.1468 0.2050 -0.0150 -0.0089 -0.0072 956  PHE A CB  
817  C CG  . PHE A 113 ? 0.1299 0.1297 0.1833 -0.0134 -0.0134 -0.0091 956  PHE A CG  
818  C CD1 . PHE A 113 ? 0.1803 0.1781 0.2282 -0.0128 -0.0153 -0.0100 956  PHE A CD1 
819  C CD2 . PHE A 113 ? 0.1341 0.1378 0.1906 -0.0123 -0.0155 -0.0098 956  PHE A CD2 
820  C CE1 . PHE A 113 ? 0.2205 0.2198 0.2652 -0.0110 -0.0192 -0.0115 956  PHE A CE1 
821  C CE2 . PHE A 113 ? 0.1618 0.1671 0.2153 -0.0104 -0.0196 -0.0112 956  PHE A CE2 
822  C CZ  . PHE A 113 ? 0.2260 0.2290 0.2733 -0.0097 -0.0214 -0.0120 956  PHE A CZ  
823  N N   . VAL A 114 ? 0.1519 0.1469 0.1910 -0.0108 -0.0096 -0.0026 957  VAL A N   
824  C CA  . VAL A 114 ? 0.1220 0.1148 0.1536 -0.0096 -0.0103 -0.0016 957  VAL A CA  
825  C C   . VAL A 114 ? 0.1355 0.1269 0.1641 -0.0096 -0.0073 0.0007  957  VAL A C   
826  O O   . VAL A 114 ? 0.1512 0.1407 0.1755 -0.0094 -0.0067 0.0013  957  VAL A O   
827  C CB  . VAL A 114 ? 0.1731 0.1668 0.2020 -0.0079 -0.0126 -0.0016 957  VAL A CB  
828  C CG1 . VAL A 114 ? 0.1532 0.1445 0.1748 -0.0070 -0.0126 -0.0005 957  VAL A CG1 
829  C CG2 . VAL A 114 ? 0.1398 0.1358 0.1714 -0.0074 -0.0161 -0.0040 957  VAL A CG2 
830  N N   . ARG A 115 ? 0.1051 0.0977 0.1362 -0.0097 -0.0055 0.0017  958  ARG A N   
831  C CA  . ARG A 115 ? 0.1278 0.1194 0.1558 -0.0095 -0.0029 0.0035  958  ARG A CA  
832  C C   . ARG A 115 ? 0.1726 0.1626 0.2004 -0.0101 -0.0011 0.0041  958  ARG A C   
833  O O   . ARG A 115 ? 0.1743 0.1633 0.1980 -0.0095 -0.0001 0.0052  958  ARG A O   
834  C CB  . ARG A 115 ? 0.1187 0.1119 0.1493 -0.0094 -0.0011 0.0043  958  ARG A CB  
835  C CG  . ARG A 115 ? 0.1237 0.1180 0.1544 -0.0085 -0.0026 0.0038  958  ARG A CG  
836  C CD  . ARG A 115 ? 0.1607 0.1562 0.1927 -0.0081 -0.0005 0.0045  958  ARG A CD  
837  N NE  . ARG A 115 ? 0.2153 0.2124 0.2527 -0.0088 0.0013  0.0045  958  ARG A NE  
838  C CZ  . ARG A 115 ? 0.2506 0.2500 0.2937 -0.0088 0.0008  0.0036  958  ARG A CZ  
839  N NH1 . ARG A 115 ? 0.2185 0.2188 0.2621 -0.0077 -0.0018 0.0027  958  ARG A NH1 
840  N NH2 . ARG A 115 ? 0.2276 0.2286 0.2760 -0.0097 0.0030  0.0036  958  ARG A NH2 
841  N N   . ALA A 116 ? 0.1757 0.1655 0.2082 -0.0111 -0.0008 0.0034  959  ALA A N   
842  C CA  . ALA A 116 ? 0.1633 0.1507 0.1960 -0.0116 0.0013  0.0041  959  ALA A CA  
843  C C   . ALA A 116 ? 0.1445 0.1299 0.1734 -0.0112 0.0000  0.0035  959  ALA A C   
844  O O   . ALA A 116 ? 0.1740 0.1575 0.2000 -0.0105 0.0015  0.0048  959  ALA A O   
845  C CB  . ALA A 116 ? 0.2096 0.1970 0.2491 -0.0132 0.0023  0.0032  959  ALA A CB  
846  N N   . ALA A 117 ? 0.1441 0.1301 0.1728 -0.0113 -0.0029 0.0014  960  ALA A N   
847  C CA  . ALA A 117 ? 0.2020 0.1863 0.2267 -0.0107 -0.0041 0.0006  960  ALA A CA  
848  C C   . ALA A 117 ? 0.1676 0.1519 0.1867 -0.0095 -0.0035 0.0021  960  ALA A C   
849  O O   . ALA A 117 ? 0.1703 0.1532 0.1865 -0.0089 -0.0029 0.0024  960  ALA A O   
850  C CB  . ALA A 117 ? 0.1820 0.1673 0.2067 -0.0107 -0.0073 -0.0018 960  ALA A CB  
851  N N   . ALA A 118 ? 0.1238 0.1098 0.1418 -0.0092 -0.0037 0.0028  961  ALA A N   
852  C CA  . ALA A 118 ? 0.1151 0.1014 0.1288 -0.0084 -0.0031 0.0038  961  ALA A CA  
853  C C   . ALA A 118 ? 0.1073 0.0935 0.1202 -0.0080 -0.0008 0.0052  961  ALA A C   
854  O O   . ALA A 118 ? 0.1450 0.1313 0.1549 -0.0072 -0.0005 0.0055  961  ALA A O   
855  C CB  . ALA A 118 ? 0.1667 0.1543 0.1800 -0.0083 -0.0035 0.0041  961  ALA A CB  
856  N N   . LEU A 119 ? 0.1034 0.0899 0.1192 -0.0082 0.0007  0.0062  962  LEU A N   
857  C CA  . LEU A 119 ? 0.1267 0.1131 0.1413 -0.0073 0.0029  0.0078  962  LEU A CA  
858  C C   . LEU A 119 ? 0.1215 0.1056 0.1353 -0.0067 0.0034  0.0081  962  LEU A C   
859  O O   . LEU A 119 ? 0.1758 0.1601 0.1867 -0.0054 0.0042  0.0092  962  LEU A O   
860  C CB  . LEU A 119 ? 0.1745 0.1610 0.1922 -0.0077 0.0048  0.0089  962  LEU A CB  
861  C CG  . LEU A 119 ? 0.2838 0.2725 0.3013 -0.0075 0.0053  0.0091  962  LEU A CG  
862  C CD1 . LEU A 119 ? 0.3480 0.3368 0.3691 -0.0079 0.0075  0.0101  962  LEU A CD1 
863  C CD2 . LEU A 119 ? 0.3206 0.3106 0.3336 -0.0063 0.0057  0.0097  962  LEU A CD2 
864  N N   . ASN A 120 ? 0.1886 0.1708 0.2051 -0.0077 0.0028  0.0070  963  ASN A N   
865  C CA  . ASN A 120 ? 0.1648 0.1442 0.1809 -0.0072 0.0034  0.0070  963  ASN A CA  
866  C C   . ASN A 120 ? 0.1679 0.1475 0.1801 -0.0062 0.0022  0.0063  963  ASN A C   
867  O O   . ASN A 120 ? 0.2280 0.2063 0.2384 -0.0048 0.0032  0.0071  963  ASN A O   
868  C CB  . ASN A 120 ? 0.1923 0.1698 0.2127 -0.0088 0.0028  0.0052  963  ASN A CB  
869  C CG  . ASN A 120 ? 0.2796 0.2565 0.3049 -0.0100 0.0048  0.0060  963  ASN A CG  
870  O OD1 . ASN A 120 ? 0.3892 0.3654 0.4139 -0.0092 0.0073  0.0083  963  ASN A OD1 
871  N ND2 . ASN A 120 ? 0.3743 0.3516 0.4044 -0.0117 0.0036  0.0038  963  ASN A ND2 
872  N N   . CYS A 121 ? 0.1365 0.1177 0.1473 -0.0066 0.0003  0.0049  964  CYS A N   
873  C CA  . CYS A 121 ? 0.1628 0.1447 0.1699 -0.0058 -0.0004 0.0043  964  CYS A CA  
874  C C   . CYS A 121 ? 0.1544 0.1384 0.1594 -0.0046 0.0007  0.0056  964  CYS A C   
875  O O   . CYS A 121 ? 0.1780 0.1622 0.1813 -0.0034 0.0011  0.0057  964  CYS A O   
876  C CB  . CYS A 121 ? 0.2053 0.1882 0.2109 -0.0064 -0.0020 0.0031  964  CYS A CB  
877  S SG  . CYS A 121 ? 0.2138 0.1949 0.2192 -0.0068 -0.0040 0.0009  964  CYS A SG  
878  N N   . ILE A 122 ? 0.1215 0.1073 0.1268 -0.0049 0.0011  0.0063  965  ILE A N   
879  C CA  . ILE A 122 ? 0.1082 0.0966 0.1117 -0.0038 0.0018  0.0070  965  ILE A CA  
880  C C   . ILE A 122 ? 0.1242 0.1121 0.1272 -0.0021 0.0030  0.0084  965  ILE A C   
881  O O   . ILE A 122 ? 0.1564 0.1459 0.1575 -0.0006 0.0030  0.0084  965  ILE A O   
882  C CB  . ILE A 122 ? 0.1256 0.1158 0.1296 -0.0044 0.0021  0.0074  965  ILE A CB  
883  C CG1 . ILE A 122 ? 0.1281 0.1187 0.1322 -0.0057 0.0010  0.0061  965  ILE A CG1 
884  C CG2 . ILE A 122 ? 0.1156 0.1087 0.1178 -0.0031 0.0028  0.0077  965  ILE A CG2 
885  C CD1 . ILE A 122 ? 0.0978 0.0893 0.1031 -0.0062 0.0014  0.0063  965  ILE A CD1 
886  N N   . ASN A 123 ? 0.1582 0.1437 0.1628 -0.0021 0.0042  0.0097  966  ASN A N   
887  C CA  . ASN A 123 ? 0.1438 0.1281 0.1474 -0.0001 0.0058  0.0117  966  ASN A CA  
888  C C   . ASN A 123 ? 0.1797 0.1616 0.1828 0.0010  0.0058  0.0114  966  ASN A C   
889  O O   . ASN A 123 ? 0.2152 0.1971 0.2164 0.0034  0.0065  0.0127  966  ASN A O   
890  C CB  . ASN A 123 ? 0.1712 0.1532 0.1766 -0.0004 0.0077  0.0134  966  ASN A CB  
891  C CG  . ASN A 123 ? 0.1873 0.1720 0.1920 -0.0004 0.0082  0.0140  966  ASN A CG  
892  O OD1 . ASN A 123 ? 0.1968 0.1847 0.1986 0.0008  0.0076  0.0138  966  ASN A OD1 
893  N ND2 . ASN A 123 ? 0.2006 0.1843 0.2082 -0.0019 0.0093  0.0143  966  ASN A ND2 
894  N N   . SER A 124 ? 0.2064 0.1864 0.2111 -0.0005 0.0049  0.0097  967  SER A N   
895  C CA  . SER A 124 ? 0.1963 0.1742 0.2005 0.0005  0.0048  0.0089  967  SER A CA  
896  C C   . SER A 124 ? 0.1856 0.1668 0.1872 0.0019  0.0040  0.0083  967  SER A C   
897  O O   . SER A 124 ? 0.1970 0.1778 0.1975 0.0041  0.0046  0.0089  967  SER A O   
898  C CB  . SER A 124 ? 0.1878 0.1635 0.1939 -0.0014 0.0038  0.0067  967  SER A CB  
899  O OG  . SER A 124 ? 0.2348 0.2083 0.2400 -0.0003 0.0039  0.0058  967  SER A OG  
900  N N   . PHE A 125 ? 0.0995 0.0838 0.1004 0.0007  0.0028  0.0070  968  PHE A N   
901  C CA  . PHE A 125 ? 0.1240 0.1119 0.1233 0.0017  0.0024  0.0062  968  PHE A CA  
902  C C   . PHE A 125 ? 0.2194 0.2102 0.2178 0.0038  0.0029  0.0075  968  PHE A C   
903  O O   . PHE A 125 ? 0.1794 0.1725 0.1772 0.0056  0.0029  0.0072  968  PHE A O   
904  C CB  . PHE A 125 ? 0.1450 0.1350 0.1439 -0.0002 0.0016  0.0048  968  PHE A CB  
905  C CG  . PHE A 125 ? 0.1252 0.1135 0.1234 -0.0012 0.0010  0.0033  968  PHE A CG  
906  C CD1 . PHE A 125 ? 0.1070 0.0920 0.1059 -0.0022 0.0004  0.0029  968  PHE A CD1 
907  C CD2 . PHE A 125 ? 0.1213 0.1114 0.1181 -0.0011 0.0012  0.0022  968  PHE A CD2 
908  C CE1 . PHE A 125 ? 0.0817 0.0653 0.0791 -0.0028 -0.0004 0.0014  968  PHE A CE1 
909  C CE2 . PHE A 125 ? 0.1420 0.1304 0.1374 -0.0017 0.0009  0.0010  968  PHE A CE2 
910  C CZ  . PHE A 125 ? 0.1296 0.1147 0.1249 -0.0024 0.0000  0.0006  968  PHE A CZ  
911  N N   . GLY A 126 ? 0.1860 0.1772 0.1845 0.0036  0.0033  0.0088  969  GLY A N   
912  C CA  . GLY A 126 ? 0.2094 0.2038 0.2064 0.0059  0.0035  0.0099  969  GLY A CA  
913  C C   . GLY A 126 ? 0.2341 0.2267 0.2300 0.0089  0.0044  0.0117  969  GLY A C   
914  O O   . GLY A 126 ? 0.2598 0.2558 0.2544 0.0114  0.0039  0.0116  969  GLY A O   
915  N N   . GLU A 127 ? 0.1633 0.1506 0.1599 0.0088  0.0057  0.0131  970  GLU A N   
916  C CA  . GLU A 127 ? 0.2655 0.2497 0.2610 0.0116  0.0069  0.0151  970  GLU A CA  
917  C C   . GLU A 127 ? 0.2798 0.2644 0.2754 0.0131  0.0063  0.0138  970  GLU A C   
918  O O   . GLU A 127 ? 0.2464 0.2317 0.2405 0.0165  0.0066  0.0151  970  GLU A O   
919  C CB  . GLU A 127 ? 0.2215 0.1995 0.2188 0.0105  0.0088  0.0164  970  GLU A CB  
920  C CG  . GLU A 127 ? 0.3286 0.3059 0.3262 0.0093  0.0100  0.0180  970  GLU A CG  
921  C CD  . GLU A 127 ? 0.5410 0.5201 0.5351 0.0124  0.0109  0.0206  970  GLU A CD  
922  O OE1 . GLU A 127 ? 0.6919 0.6718 0.6834 0.0157  0.0107  0.0215  970  GLU A OE1 
923  O OE2 . GLU A 127 ? 0.5835 0.5632 0.5771 0.0117  0.0118  0.0215  970  GLU A OE2 
924  N N   . LYS A 128 ? 0.2566 0.2407 0.2537 0.0108  0.0056  0.0114  971  LYS A N   
925  C CA  . LYS A 128 ? 0.2359 0.2197 0.2331 0.0120  0.0054  0.0101  971  LYS A CA  
926  C C   . LYS A 128 ? 0.2828 0.2728 0.2796 0.0131  0.0043  0.0087  971  LYS A C   
927  O O   . LYS A 128 ? 0.3352 0.3265 0.3318 0.0158  0.0045  0.0086  971  LYS A O   
928  C CB  . LYS A 128 ? 0.1971 0.1778 0.1956 0.0094  0.0052  0.0080  971  LYS A CB  
929  C CG  . LYS A 128 ? 0.2846 0.2594 0.2846 0.0084  0.0062  0.0087  971  LYS A CG  
930  C CD  . LYS A 128 ? 0.2931 0.2660 0.2944 0.0057  0.0054  0.0062  971  LYS A CD  
931  C CE  . LYS A 128 ? 0.3039 0.2713 0.3077 0.0046  0.0064  0.0063  971  LYS A CE  
932  N NZ  . LYS A 128 ? 0.3382 0.3052 0.3434 0.0036  0.0073  0.0083  971  LYS A NZ  
933  N N   . GLY A 129 ? 0.2227 0.2166 0.2197 0.0110  0.0034  0.0074  972  GLY A N   
934  C CA  . GLY A 129 ? 0.2687 0.2685 0.2662 0.0112  0.0027  0.0056  972  GLY A CA  
935  C C   . GLY A 129 ? 0.2387 0.2438 0.2360 0.0124  0.0020  0.0059  972  GLY A C   
936  O O   . GLY A 129 ? 0.2425 0.2532 0.2408 0.0129  0.0014  0.0042  972  GLY A O   
937  N N   . GLY A 130 ? 0.2537 0.2573 0.2497 0.0128  0.0021  0.0078  973  GLY A N   
938  C CA  . GLY A 130 ? 0.2565 0.2649 0.2516 0.0138  0.0014  0.0079  973  GLY A CA  
939  C C   . GLY A 130 ? 0.2694 0.2786 0.2650 0.0107  0.0012  0.0068  973  GLY A C   
940  O O   . GLY A 130 ? 0.2686 0.2769 0.2656 0.0078  0.0012  0.0053  973  GLY A O   
941  N N   . TYR A 131 ? 0.1496 0.1604 0.1438 0.0114  0.0010  0.0076  974  TYR A N   
942  C CA  . TYR A 131 ? 0.1081 0.1195 0.1028 0.0087  0.0010  0.0066  974  TYR A CA  
943  C C   . TYR A 131 ? 0.1792 0.1964 0.1753 0.0076  0.0000  0.0036  974  TYR A C   
944  O O   . TYR A 131 ? 0.1916 0.2091 0.1886 0.0051  0.0001  0.0022  974  TYR A O   
945  C CB  . TYR A 131 ? 0.1202 0.1307 0.1127 0.0099  0.0016  0.0085  974  TYR A CB  
946  C CG  . TYR A 131 ? 0.2044 0.2087 0.1967 0.0095  0.0032  0.0110  974  TYR A CG  
947  C CD1 . TYR A 131 ? 0.1845 0.1855 0.1757 0.0119  0.0042  0.0134  974  TYR A CD1 
948  C CD2 . TYR A 131 ? 0.2314 0.2333 0.2252 0.0067  0.0038  0.0108  974  TYR A CD2 
949  C CE1 . TYR A 131 ? 0.1968 0.1921 0.1887 0.0110  0.0059  0.0154  974  TYR A CE1 
950  C CE2 . TYR A 131 ? 0.2071 0.2041 0.2018 0.0061  0.0052  0.0127  974  TYR A CE2 
951  C CZ  . TYR A 131 ? 0.1900 0.1837 0.1839 0.0081  0.0063  0.0148  974  TYR A CZ  
952  O OH  . TYR A 131 ? 0.2550 0.2438 0.2506 0.0070  0.0080  0.0163  974  TYR A OH  
953  N N   . LYS A 132 ? 0.2130 0.2348 0.2098 0.0095  -0.0009 0.0024  975  LYS A N   
954  C CA  . LYS A 132 ? 0.1933 0.2215 0.1922 0.0086  -0.0018 -0.0008 975  LYS A CA  
955  C C   . LYS A 132 ? 0.1885 0.2157 0.1900 0.0047  -0.0010 -0.0027 975  LYS A C   
956  O O   . LYS A 132 ? 0.1543 0.1841 0.1571 0.0027  -0.0011 -0.0049 975  LYS A O   
957  C CB  . LYS A 132 ? 0.2396 0.2730 0.2397 0.0113  -0.0028 -0.0018 975  LYS A CB  
958  C CG  . LYS A 132 ? 0.2138 0.2547 0.2171 0.0104  -0.0038 -0.0056 975  LYS A CG  
959  C CD  . LYS A 132 ? 0.3434 0.3903 0.3477 0.0140  -0.0051 -0.0064 975  LYS A CD  
960  C CE  . LYS A 132 ? 0.4349 0.4900 0.4439 0.0127  -0.0060 -0.0107 975  LYS A CE  
961  N NZ  . LYS A 132 ? 0.4982 0.5523 0.5109 0.0095  -0.0042 -0.0122 975  LYS A NZ  
962  N N   . GLU A 133 ? 0.1544 0.1775 0.1561 0.0037  -0.0001 -0.0019 976  GLU A N   
963  C CA  . GLU A 133 ? 0.1764 0.1980 0.1796 0.0005  0.0009  -0.0033 976  GLU A CA  
964  C C   . GLU A 133 ? 0.0997 0.1177 0.1022 -0.0018 0.0013  -0.0028 976  GLU A C   
965  O O   . GLU A 133 ? 0.1450 0.1622 0.1486 -0.0042 0.0021  -0.0040 976  GLU A O   
966  C CB  . GLU A 133 ? 0.2302 0.2483 0.2330 0.0005  0.0016  -0.0026 976  GLU A CB  
967  C CG  . GLU A 133 ? 0.2935 0.3157 0.2980 0.0019  0.0017  -0.0039 976  GLU A CG  
968  C CD  . GLU A 133 ? 0.3489 0.3730 0.3527 0.0056  0.0007  -0.0028 976  GLU A CD  
969  O OE1 . GLU A 133 ? 0.3215 0.3418 0.3231 0.0068  0.0005  -0.0005 976  GLU A OE1 
970  O OE2 . GLU A 133 ? 0.3789 0.4081 0.3846 0.0073  0.0004  -0.0042 976  GLU A OE2 
971  N N   . PHE A 134 ? 0.1688 0.1847 0.1697 -0.0009 0.0010  -0.0011 977  PHE A N   
972  C CA  . PHE A 134 ? 0.1206 0.1335 0.1213 -0.0028 0.0013  -0.0008 977  PHE A CA  
973  C C   . PHE A 134 ? 0.1078 0.1243 0.1096 -0.0038 0.0013  -0.0029 977  PHE A C   
974  O O   . PHE A 134 ? 0.1552 0.1697 0.1575 -0.0057 0.0019  -0.0034 977  PHE A O   
975  C CB  . PHE A 134 ? 0.1007 0.1108 0.1001 -0.0016 0.0014  0.0015  977  PHE A CB  
976  C CG  . PHE A 134 ? 0.1400 0.1458 0.1390 -0.0011 0.0015  0.0033  977  PHE A CG  
977  C CD1 . PHE A 134 ? 0.1952 0.1987 0.1946 -0.0024 0.0016  0.0028  977  PHE A CD1 
978  C CD2 . PHE A 134 ? 0.1080 0.1119 0.1060 0.0006  0.0019  0.0053  977  PHE A CD2 
979  C CE1 . PHE A 134 ? 0.1869 0.1867 0.1859 -0.0020 0.0015  0.0039  977  PHE A CE1 
980  C CE2 . PHE A 134 ? 0.1564 0.1563 0.1547 0.0008  0.0022  0.0065  977  PHE A CE2 
981  C CZ  . PHE A 134 ? 0.1304 0.1285 0.1294 -0.0005 0.0018  0.0056  977  PHE A CZ  
982  N N   . PHE A 135 ? 0.1132 0.1351 0.1153 -0.0024 0.0005  -0.0044 978  PHE A N   
983  C CA  . PHE A 135 ? 0.1265 0.1525 0.1296 -0.0030 0.0002  -0.0069 978  PHE A CA  
984  C C   . PHE A 135 ? 0.1858 0.2157 0.1922 -0.0049 0.0004  -0.0101 978  PHE A C   
985  O O   . PHE A 135 ? 0.1682 0.2042 0.1760 -0.0040 -0.0007 -0.0126 978  PHE A O   
986  C CB  . PHE A 135 ? 0.1198 0.1494 0.1206 0.0001  -0.0010 -0.0066 978  PHE A CB  
987  C CG  . PHE A 135 ? 0.1150 0.1404 0.1129 0.0014  -0.0005 -0.0035 978  PHE A CG  
988  C CD1 . PHE A 135 ? 0.1135 0.1372 0.1107 0.0004  0.0001  -0.0036 978  PHE A CD1 
989  C CD2 . PHE A 135 ? 0.1289 0.1516 0.1251 0.0035  -0.0003 -0.0005 978  PHE A CD2 
990  C CE1 . PHE A 135 ? 0.1409 0.1610 0.1361 0.0014  0.0009  -0.0009 978  PHE A CE1 
991  C CE2 . PHE A 135 ? 0.1285 0.1470 0.1227 0.0043  0.0006  0.0022  978  PHE A CE2 
992  C CZ  . PHE A 135 ? 0.1061 0.1237 0.1000 0.0032  0.0013  0.0020  978  PHE A CZ  
993  N N   . GLU A 136 ? 0.1422 0.1685 0.1499 -0.0074 0.0018  -0.0101 979  GLU A N   
994  C CA  . GLU A 136 ? 0.1128 0.1415 0.1238 -0.0096 0.0029  -0.0127 979  GLU A CA  
995  C C   . GLU A 136 ? 0.1224 0.1459 0.1337 -0.0124 0.0047  -0.0124 979  GLU A C   
996  O O   . GLU A 136 ? 0.1410 0.1590 0.1498 -0.0123 0.0050  -0.0099 979  GLU A O   
997  C CB  . GLU A 136 ? 0.1321 0.1619 0.1437 -0.0087 0.0031  -0.0121 979  GLU A CB  
998  C CG  . GLU A 136 ? 0.1996 0.2344 0.2110 -0.0055 0.0014  -0.0122 979  GLU A CG  
999  C CD  . GLU A 136 ? 0.4391 0.4774 0.4530 -0.0051 0.0018  -0.0134 979  GLU A CD  
1000 O OE1 . GLU A 136 ? 0.4487 0.4860 0.4646 -0.0076 0.0037  -0.0144 979  GLU A OE1 
1001 O OE2 . GLU A 136 ? 0.6136 0.6557 0.6275 -0.0021 0.0005  -0.0132 979  GLU A OE2 
1002 N N   . SER A 137 ? 0.1333 0.1587 0.1478 -0.0149 0.0061  -0.0152 980  SER A N   
1003 C CA  . SER A 137 ? 0.1490 0.1692 0.1640 -0.0175 0.0084  -0.0149 980  SER A CA  
1004 C C   . SER A 137 ? 0.1234 0.1385 0.1365 -0.0179 0.0086  -0.0136 980  SER A C   
1005 O O   . SER A 137 ? 0.1361 0.1457 0.1482 -0.0191 0.0102  -0.0123 980  SER A O   
1006 C CB  . SER A 137 ? 0.1621 0.1788 0.1754 -0.0175 0.0095  -0.0127 980  SER A CB  
1007 O OG  . SER A 137 ? 0.2518 0.2734 0.2674 -0.0173 0.0099  -0.0142 980  SER A OG  
1008 N N   . GLU A 138 ? 0.1238 0.1409 0.1362 -0.0165 0.0070  -0.0141 981  GLU A N   
1009 C CA  . GLU A 138 ? 0.0916 0.1048 0.1027 -0.0166 0.0071  -0.0132 981  GLU A CA  
1010 C C   . GLU A 138 ? 0.1069 0.1143 0.1153 -0.0158 0.0072  -0.0097 981  GLU A C   
1011 O O   . GLU A 138 ? 0.1114 0.1146 0.1194 -0.0163 0.0079  -0.0089 981  GLU A O   
1012 C CB  . GLU A 138 ? 0.1132 0.1250 0.1268 -0.0192 0.0089  -0.0157 981  GLU A CB  
1013 C CG  . GLU A 138 ? 0.1323 0.1505 0.1489 -0.0200 0.0084  -0.0200 981  GLU A CG  
1014 C CD  . GLU A 138 ? 0.1988 0.2155 0.2183 -0.0228 0.0103  -0.0231 981  GLU A CD  
1015 O OE1 . GLU A 138 ? 0.2111 0.2214 0.2299 -0.0236 0.0119  -0.0215 981  GLU A OE1 
1016 O OE2 . GLU A 138 ? 0.2187 0.2408 0.2416 -0.0240 0.0100  -0.0272 981  GLU A OE2 
1017 N N   . MET A 139 ? 0.0843 0.0915 0.0910 -0.0143 0.0063  -0.0077 982  MET A N   
1018 C CA  . MET A 139 ? 0.1158 0.1183 0.1204 -0.0134 0.0059  -0.0049 982  MET A CA  
1019 C C   . MET A 139 ? 0.1344 0.1359 0.1386 -0.0125 0.0052  -0.0039 982  MET A C   
1020 O O   . MET A 139 ? 0.1314 0.1290 0.1352 -0.0126 0.0054  -0.0027 982  MET A O   
1021 C CB  . MET A 139 ? 0.0992 0.1021 0.1025 -0.0121 0.0051  -0.0035 982  MET A CB  
1022 C CG  . MET A 139 ? 0.0874 0.0904 0.0908 -0.0130 0.0062  -0.0040 982  MET A CG  
1023 S SD  . MET A 139 ? 0.1391 0.1424 0.1410 -0.0113 0.0053  -0.0029 982  MET A SD  
1024 C CE  . MET A 139 ? 0.1301 0.1392 0.1335 -0.0096 0.0042  -0.0040 982  MET A CE  
1025 N N   . ILE A 140 ? 0.0984 0.1034 0.1026 -0.0113 0.0045  -0.0045 983  ILE A N   
1026 C CA  . ILE A 140 ? 0.0822 0.0866 0.0860 -0.0103 0.0042  -0.0036 983  ILE A CA  
1027 C C   . ILE A 140 ? 0.1097 0.1130 0.1145 -0.0114 0.0052  -0.0052 983  ILE A C   
1028 O O   . ILE A 140 ? 0.1104 0.1107 0.1154 -0.0113 0.0054  -0.0041 983  ILE A O   
1029 C CB  . ILE A 140 ? 0.0555 0.0635 0.0581 -0.0084 0.0035  -0.0035 983  ILE A CB  
1030 C CG1 . ILE A 140 ? 0.1037 0.1108 0.1054 -0.0071 0.0030  -0.0013 983  ILE A CG1 
1031 C CG2 . ILE A 140 ? 0.1122 0.1201 0.1142 -0.0076 0.0039  -0.0031 983  ILE A CG2 
1032 C CD1 . ILE A 140 ? 0.1278 0.1383 0.1280 -0.0049 0.0024  -0.0010 983  ILE A CD1 
1033 N N   . ALA A 141 ? 0.0982 0.1041 0.1041 -0.0126 0.0056  -0.0079 984  ALA A N   
1034 C CA  . ALA A 141 ? 0.1056 0.1102 0.1128 -0.0138 0.0067  -0.0098 984  ALA A CA  
1035 C C   . ALA A 141 ? 0.1389 0.1378 0.1465 -0.0149 0.0079  -0.0085 984  ALA A C   
1036 O O   . ALA A 141 ? 0.1703 0.1665 0.1784 -0.0148 0.0085  -0.0085 984  ALA A O   
1037 C CB  . ALA A 141 ? 0.1389 0.1472 0.1478 -0.0152 0.0071  -0.0135 984  ALA A CB  
1038 N N   . ASP A 142 ? 0.1109 0.1080 0.1181 -0.0155 0.0082  -0.0075 985  ASP A N   
1039 C CA  . ASP A 142 ? 0.1445 0.1361 0.1513 -0.0160 0.0092  -0.0059 985  ASP A CA  
1040 C C   . ASP A 142 ? 0.1648 0.1539 0.1704 -0.0143 0.0081  -0.0034 985  ASP A C   
1041 O O   . ASP A 142 ? 0.2023 0.1875 0.2079 -0.0140 0.0087  -0.0025 985  ASP A O   
1042 C CB  . ASP A 142 ? 0.1216 0.1120 0.1274 -0.0168 0.0099  -0.0052 985  ASP A CB  
1043 C CG  . ASP A 142 ? 0.2235 0.2147 0.2315 -0.0191 0.0119  -0.0076 985  ASP A CG  
1044 O OD1 . ASP A 142 ? 0.2823 0.2736 0.2923 -0.0203 0.0129  -0.0098 985  ASP A OD1 
1045 O OD2 . ASP A 142 ? 0.2709 0.2627 0.2787 -0.0199 0.0127  -0.0075 985  ASP A OD2 
1046 N N   . ALA A 143 ? 0.1128 0.1040 0.1178 -0.0130 0.0066  -0.0023 986  ALA A N   
1047 C CA  . ALA A 143 ? 0.0905 0.0802 0.0955 -0.0116 0.0056  -0.0004 986  ALA A CA  
1048 C C   . ALA A 143 ? 0.1243 0.1143 0.1307 -0.0111 0.0060  -0.0010 986  ALA A C   
1049 O O   . ALA A 143 ? 0.1462 0.1341 0.1535 -0.0104 0.0059  0.0000  986  ALA A O   
1050 C CB  . ALA A 143 ? 0.0877 0.0792 0.0922 -0.0106 0.0043  0.0007  986  ALA A CB  
1051 N N   . LEU A 144 ? 0.1315 0.1248 0.1382 -0.0113 0.0065  -0.0027 987  LEU A N   
1052 C CA  . LEU A 144 ? 0.1107 0.1046 0.1183 -0.0108 0.0072  -0.0035 987  LEU A CA  
1053 C C   . LEU A 144 ? 0.1957 0.1865 0.2044 -0.0115 0.0084  -0.0047 987  LEU A C   
1054 O O   . LEU A 144 ? 0.1997 0.1889 0.2095 -0.0106 0.0088  -0.0043 987  LEU A O   
1055 C CB  . LEU A 144 ? 0.1163 0.1146 0.1231 -0.0106 0.0073  -0.0054 987  LEU A CB  
1056 C CG  . LEU A 144 ? 0.1219 0.1227 0.1273 -0.0092 0.0065  -0.0039 987  LEU A CG  
1057 C CD1 . LEU A 144 ? 0.1336 0.1389 0.1375 -0.0088 0.0063  -0.0058 987  LEU A CD1 
1058 C CD2 . LEU A 144 ? 0.1365 0.1366 0.1424 -0.0080 0.0069  -0.0021 987  LEU A CD2 
1059 N N   . LYS A 145 ? 0.1793 0.1690 0.1880 -0.0130 0.0091  -0.0060 988  LYS A N   
1060 C CA  . LYS A 145 ? 0.2529 0.2391 0.2626 -0.0140 0.0108  -0.0074 988  LYS A CA  
1061 C C   . LYS A 145 ? 0.3604 0.3419 0.3703 -0.0128 0.0109  -0.0052 988  LYS A C   
1062 O O   . LYS A 145 ? 0.4330 0.4134 0.4442 -0.0120 0.0116  -0.0058 988  LYS A O   
1063 C CB  . LYS A 145 ? 0.3199 0.3050 0.3298 -0.0160 0.0118  -0.0084 988  LYS A CB  
1064 C CG  . LYS A 145 ? 0.4673 0.4479 0.4784 -0.0173 0.0141  -0.0097 988  LYS A CG  
1065 C CD  . LYS A 145 ? 0.6023 0.5823 0.6141 -0.0196 0.0155  -0.0107 988  LYS A CD  
1066 C CE  . LYS A 145 ? 0.6389 0.6147 0.6526 -0.0215 0.0183  -0.0127 988  LYS A CE  
1067 N NZ  . LYS A 145 ? 0.6193 0.5881 0.6318 -0.0202 0.0194  -0.0101 988  LYS A NZ  
1068 N N   . GLY A 146 ? 0.3036 0.2826 0.3122 -0.0123 0.0103  -0.0028 989  GLY A N   
1069 C CA  . GLY A 146 ? 0.4191 0.3941 0.4276 -0.0107 0.0101  -0.0008 989  GLY A CA  
1070 C C   . GLY A 146 ? 0.3490 0.3260 0.3582 -0.0089 0.0081  0.0007  989  GLY A C   
1071 O O   . GLY A 146 ? 0.2828 0.2576 0.2919 -0.0073 0.0072  0.0025  989  GLY A O   
1072 N N   . GLY A 147 ? 0.2473 0.2286 0.2573 -0.0090 0.0076  0.0000  990  GLY A N   
1073 C CA  . GLY A 147 ? 0.1773 0.1606 0.1881 -0.0080 0.0059  0.0014  990  GLY A CA  
1074 C C   . GLY A 147 ? 0.1989 0.1823 0.2124 -0.0064 0.0056  0.0020  990  GLY A C   
1075 O O   . GLY A 147 ? 0.1911 0.1743 0.2061 -0.0061 0.0069  0.0010  990  GLY A O   
1076 N N   . SER A 148 ? 0.1780 0.1619 0.1925 -0.0055 0.0038  0.0033  991  SER A N   
1077 C CA  . SER A 148 ? 0.1890 0.1742 0.2071 -0.0042 0.0032  0.0037  991  SER A CA  
1078 C C   . SER A 148 ? 0.1889 0.1774 0.2091 -0.0046 0.0044  0.0030  991  SER A C   
1079 O O   . SER A 148 ? 0.1496 0.1395 0.1681 -0.0056 0.0050  0.0028  991  SER A O   
1080 C CB  . SER A 148 ? 0.2316 0.2173 0.2504 -0.0034 0.0008  0.0047  991  SER A CB  
1081 O OG  . SER A 148 ? 0.2040 0.1918 0.2229 -0.0044 0.0004  0.0047  991  SER A OG  
1082 N N   . PRO A 149 ? 0.2073 0.1972 0.2312 -0.0036 0.0050  0.0028  992  PRO A N   
1083 C CA  . PRO A 149 ? 0.1046 0.0975 0.1304 -0.0039 0.0066  0.0025  992  PRO A CA  
1084 C C   . PRO A 149 ? 0.1242 0.1187 0.1503 -0.0047 0.0060  0.0034  992  PRO A C   
1085 O O   . PRO A 149 ? 0.1262 0.1220 0.1510 -0.0052 0.0075  0.0035  992  PRO A O   
1086 C CB  . PRO A 149 ? 0.1491 0.1432 0.1797 -0.0026 0.0069  0.0024  992  PRO A CB  
1087 C CG  . PRO A 149 ? 0.1763 0.1674 0.2061 -0.0015 0.0063  0.0021  992  PRO A CG  
1088 C CD  . PRO A 149 ? 0.2111 0.1997 0.2373 -0.0020 0.0045  0.0029  992  PRO A CD  
1089 N N   . ALA A 150 ? 0.1305 0.1249 0.1582 -0.0047 0.0040  0.0040  993  ALA A N   
1090 C CA  . ALA A 150 ? 0.1307 0.1262 0.1590 -0.0055 0.0035  0.0045  993  ALA A CA  
1091 C C   . ALA A 150 ? 0.1438 0.1382 0.1674 -0.0062 0.0037  0.0048  993  ALA A C   
1092 O O   . ALA A 150 ? 0.1607 0.1559 0.1838 -0.0067 0.0049  0.0053  993  ALA A O   
1093 C CB  . ALA A 150 ? 0.1936 0.1892 0.2241 -0.0053 0.0009  0.0044  993  ALA A CB  
1094 N N   . LEU A 151 ? 0.1338 0.1264 0.1541 -0.0063 0.0029  0.0045  994  LEU A N   
1095 C CA  . LEU A 151 ? 0.1107 0.1029 0.1272 -0.0069 0.0030  0.0045  994  LEU A CA  
1096 C C   . LEU A 151 ? 0.1093 0.1031 0.1245 -0.0070 0.0049  0.0040  994  LEU A C   
1097 O O   . LEU A 151 ? 0.1200 0.1149 0.1336 -0.0070 0.0053  0.0044  994  LEU A O   
1098 C CB  . LEU A 151 ? 0.1279 0.1179 0.1416 -0.0071 0.0023  0.0042  994  LEU A CB  
1099 C CG  . LEU A 151 ? 0.1680 0.1581 0.1786 -0.0078 0.0025  0.0038  994  LEU A CG  
1100 C CD1 . LEU A 151 ? 0.1630 0.1507 0.1714 -0.0080 0.0017  0.0040  994  LEU A CD1 
1101 C CD2 . LEU A 151 ? 0.1986 0.1899 0.2083 -0.0083 0.0040  0.0026  994  LEU A CD2 
1102 N N   . LYS A 152 ? 0.1309 0.1247 0.1464 -0.0067 0.0060  0.0031  995  LYS A N   
1103 C CA  . LYS A 152 ? 0.1258 0.1215 0.1397 -0.0066 0.0075  0.0022  995  LYS A CA  
1104 C C   . LYS A 152 ? 0.1409 0.1383 0.1554 -0.0060 0.0087  0.0034  995  LYS A C   
1105 O O   . LYS A 152 ? 0.1292 0.1280 0.1409 -0.0056 0.0094  0.0035  995  LYS A O   
1106 C CB  . LYS A 152 ? 0.1012 0.0964 0.1156 -0.0064 0.0086  0.0007  995  LYS A CB  
1107 C CG  . LYS A 152 ? 0.1064 0.0993 0.1198 -0.0071 0.0081  -0.0004 995  LYS A CG  
1108 C CD  . LYS A 152 ? 0.1385 0.1302 0.1528 -0.0070 0.0094  -0.0021 995  LYS A CD  
1109 C CE  . LYS A 152 ? 0.3313 0.3226 0.3486 -0.0058 0.0099  -0.0014 995  LYS A CE  
1110 N NZ  . LYS A 152 ? 0.3500 0.3396 0.3680 -0.0055 0.0112  -0.0032 995  LYS A NZ  
1111 N N   . THR A 153 ? 0.1238 0.1211 0.1420 -0.0059 0.0091  0.0042  996  THR A N   
1112 C CA  . THR A 153 ? 0.1218 0.1202 0.1412 -0.0056 0.0107  0.0055  996  THR A CA  
1113 C C   . THR A 153 ? 0.0974 0.0953 0.1149 -0.0058 0.0103  0.0068  996  THR A C   
1114 O O   . THR A 153 ? 0.1170 0.1154 0.1319 -0.0051 0.0118  0.0077  996  THR A O   
1115 C CB  . THR A 153 ? 0.1389 0.1376 0.1638 -0.0058 0.0111  0.0059  996  THR A CB  
1116 O OG1 . THR A 153 ? 0.1585 0.1577 0.1851 -0.0052 0.0116  0.0048  996  THR A OG1 
1117 C CG2 . THR A 153 ? 0.1470 0.1465 0.1735 -0.0058 0.0135  0.0072  996  THR A CG2 
1118 N N   . GLU A 154 ? 0.1337 0.1303 0.1521 -0.0064 0.0083  0.0068  997  GLU A N   
1119 C CA  . GLU A 154 ? 0.1295 0.1253 0.1465 -0.0065 0.0080  0.0077  997  GLU A CA  
1120 C C   . GLU A 154 ? 0.1231 0.1195 0.1354 -0.0058 0.0079  0.0076  997  GLU A C   
1121 O O   . GLU A 154 ? 0.1221 0.1185 0.1326 -0.0051 0.0087  0.0088  997  GLU A O   
1122 C CB  . GLU A 154 ? 0.1746 0.1691 0.1931 -0.0072 0.0058  0.0073  997  GLU A CB  
1123 C CG  . GLU A 154 ? 0.1681 0.1626 0.1916 -0.0077 0.0052  0.0070  997  GLU A CG  
1124 C CD  . GLU A 154 ? 0.2389 0.2333 0.2656 -0.0082 0.0069  0.0079  997  GLU A CD  
1125 O OE1 . GLU A 154 ? 0.2468 0.2402 0.2713 -0.0080 0.0081  0.0090  997  GLU A OE1 
1126 O OE2 . GLU A 154 ? 0.2406 0.2360 0.2723 -0.0088 0.0071  0.0075  997  GLU A OE2 
1127 N N   . LEU A 155 ? 0.1027 0.0996 0.1135 -0.0061 0.0069  0.0061  998  LEU A N   
1128 C CA  . LEU A 155 ? 0.1199 0.1180 0.1272 -0.0057 0.0065  0.0055  998  LEU A CA  
1129 C C   . LEU A 155 ? 0.1206 0.1211 0.1255 -0.0045 0.0077  0.0054  998  LEU A C   
1130 O O   . LEU A 155 ? 0.0999 0.1017 0.1022 -0.0035 0.0076  0.0058  998  LEU A O   
1131 C CB  . LEU A 155 ? 0.1122 0.1101 0.1192 -0.0067 0.0055  0.0038  998  LEU A CB  
1132 C CG  . LEU A 155 ? 0.1354 0.1347 0.1401 -0.0067 0.0049  0.0028  998  LEU A CG  
1133 C CD1 . LEU A 155 ? 0.1003 0.0998 0.1041 -0.0060 0.0044  0.0040  998  LEU A CD1 
1134 C CD2 . LEU A 155 ? 0.0879 0.0859 0.0930 -0.0080 0.0044  0.0016  998  LEU A CD2 
1135 N N   . TRP A 156 ? 0.1242 0.1253 0.1296 -0.0044 0.0089  0.0048  999  TRP A N   
1136 C CA  . TRP A 156 ? 0.1193 0.1226 0.1218 -0.0029 0.0102  0.0048  999  TRP A CA  
1137 C C   . TRP A 156 ? 0.1183 0.1210 0.1196 -0.0017 0.0117  0.0074  999  TRP A C   
1138 O O   . TRP A 156 ? 0.1281 0.1323 0.1256 0.0001  0.0121  0.0080  999  TRP A O   
1139 C CB  . TRP A 156 ? 0.1131 0.1170 0.1162 -0.0029 0.0115  0.0035  999  TRP A CB  
1140 C CG  . TRP A 156 ? 0.1170 0.1217 0.1199 -0.0038 0.0106  0.0006  999  TRP A CG  
1141 C CD1 . TRP A 156 ? 0.1572 0.1601 0.1627 -0.0048 0.0107  -0.0007 999  TRP A CD1 
1142 C CD2 . TRP A 156 ? 0.0980 0.1052 0.0982 -0.0037 0.0096  -0.0016 999  TRP A CD2 
1143 N NE1 . TRP A 156 ? 0.1228 0.1265 0.1275 -0.0055 0.0102  -0.0033 999  TRP A NE1 
1144 C CE2 . TRP A 156 ? 0.1297 0.1362 0.1315 -0.0050 0.0094  -0.0041 999  TRP A CE2 
1145 C CE3 . TRP A 156 ? 0.0993 0.1093 0.0963 -0.0024 0.0089  -0.0016 999  TRP A CE3 
1146 C CZ2 . TRP A 156 ? 0.1100 0.1188 0.1108 -0.0057 0.0087  -0.0071 999  TRP A CZ2 
1147 C CZ3 . TRP A 156 ? 0.1119 0.1248 0.1080 -0.0028 0.0077  -0.0046 999  TRP A CZ3 
1148 C CH2 . TRP A 156 ? 0.1059 0.1183 0.1041 -0.0046 0.0077  -0.0075 999  TRP A CH2 
1149 N N   . ALA A 157 ? 0.1132 0.1136 0.1179 -0.0024 0.0124  0.0090  1000 ALA A N   
1150 C CA  . ALA A 157 ? 0.1195 0.1186 0.1238 -0.0015 0.0143  0.0115  1000 ALA A CA  
1151 C C   . ALA A 157 ? 0.1310 0.1295 0.1327 -0.0006 0.0132  0.0124  1000 ALA A C   
1152 O O   . ALA A 157 ? 0.1638 0.1620 0.1623 0.0012  0.0144  0.0142  1000 ALA A O   
1153 C CB  . ALA A 157 ? 0.1329 0.1298 0.1424 -0.0030 0.0150  0.0123  1000 ALA A CB  
1154 N N   . TRP A 158 ? 0.1395 0.1377 0.1424 -0.0017 0.0109  0.0111  1001 TRP A N   
1155 C CA  . TRP A 158 ? 0.1320 0.1298 0.1331 -0.0009 0.0099  0.0116  1001 TRP A CA  
1156 C C   . TRP A 158 ? 0.1052 0.1061 0.1021 0.0010  0.0093  0.0110  1001 TRP A C   
1157 O O   . TRP A 158 ? 0.1307 0.1317 0.1250 0.0029  0.0096  0.0125  1001 TRP A O   
1158 C CB  . TRP A 158 ? 0.1198 0.1168 0.1229 -0.0024 0.0079  0.0102  1001 TRP A CB  
1159 C CG  . TRP A 158 ? 0.1331 0.1297 0.1348 -0.0017 0.0069  0.0105  1001 TRP A CG  
1160 C CD1 . TRP A 158 ? 0.1618 0.1558 0.1642 -0.0013 0.0074  0.0118  1001 TRP A CD1 
1161 C CD2 . TRP A 158 ? 0.1051 0.1042 0.1049 -0.0012 0.0055  0.0090  1001 TRP A CD2 
1162 N NE1 . TRP A 158 ? 0.1400 0.1345 0.1407 -0.0004 0.0063  0.0114  1001 TRP A NE1 
1163 C CE2 . TRP A 158 ? 0.1170 0.1149 0.1163 -0.0004 0.0052  0.0097  1001 TRP A CE2 
1164 C CE3 . TRP A 158 ? 0.1523 0.1544 0.1512 -0.0016 0.0048  0.0070  1001 TRP A CE3 
1165 C CZ2 . TRP A 158 ? 0.1576 0.1578 0.1556 0.0003  0.0041  0.0086  1001 TRP A CZ2 
1166 C CZ3 . TRP A 158 ? 0.1570 0.1614 0.1551 -0.0013 0.0037  0.0057  1001 TRP A CZ3 
1167 C CH2 . TRP A 158 ? 0.1755 0.1792 0.1732 -0.0003 0.0033  0.0066  1001 TRP A CH2 
1168 N N   . LEU A 159 ? 0.1043 0.1079 0.1007 0.0004  0.0085  0.0087  1002 LEU A N   
1169 C CA  . LEU A 159 ? 0.1056 0.1130 0.0985 0.0021  0.0077  0.0075  1002 LEU A CA  
1170 C C   . LEU A 159 ? 0.1188 0.1271 0.1080 0.0046  0.0092  0.0092  1002 LEU A C   
1171 O O   . LEU A 159 ? 0.1440 0.1544 0.1297 0.0069  0.0086  0.0097  1002 LEU A O   
1172 C CB  . LEU A 159 ? 0.0942 0.1040 0.0879 0.0006  0.0068  0.0042  1002 LEU A CB  
1173 C CG  . LEU A 159 ? 0.0947 0.1039 0.0911 -0.0015 0.0055  0.0026  1002 LEU A CG  
1174 C CD1 . LEU A 159 ? 0.1364 0.1462 0.1342 -0.0031 0.0055  -0.0001 1002 LEU A CD1 
1175 C CD2 . LEU A 159 ? 0.1047 0.1166 0.1002 -0.0008 0.0042  0.0018  1002 LEU A CD2 
1176 N N   . ALA A 160 ? 0.1170 0.1236 0.1068 0.0043  0.0113  0.0102  1003 ALA A N   
1177 C CA  . ALA A 160 ? 0.1369 0.1439 0.1225 0.0067  0.0133  0.0121  1003 ALA A CA  
1178 C C   . ALA A 160 ? 0.1367 0.1411 0.1206 0.0085  0.0145  0.0155  1003 ALA A C   
1179 O O   . ALA A 160 ? 0.2041 0.2094 0.1830 0.0115  0.0153  0.0172  1003 ALA A O   
1180 C CB  . ALA A 160 ? 0.1525 0.1581 0.1401 0.0057  0.0158  0.0125  1003 ALA A CB  
1181 N N   . ASP A 161 ? 0.1829 0.1840 0.1707 0.0069  0.0146  0.0165  1004 ASP A N   
1182 C CA  . ASP A 161 ? 0.1835 0.1810 0.1707 0.0081  0.0160  0.0195  1004 ASP A CA  
1183 C C   . ASP A 161 ? 0.2292 0.2281 0.2135 0.0102  0.0140  0.0195  1004 ASP A C   
1184 O O   . ASP A 161 ? 0.2987 0.2964 0.2794 0.0131  0.0151  0.0222  1004 ASP A O   
1185 C CB  . ASP A 161 ? 0.2312 0.2251 0.2241 0.0054  0.0165  0.0198  1004 ASP A CB  
1186 C CG  . ASP A 161 ? 0.3955 0.3851 0.3885 0.0063  0.0183  0.0225  1004 ASP A CG  
1187 O OD1 . ASP A 161 ? 0.4462 0.4341 0.4360 0.0084  0.0209  0.0254  1004 ASP A OD1 
1188 O OD2 . ASP A 161 ? 0.4431 0.4307 0.4392 0.0049  0.0172  0.0219  1004 ASP A OD2 
1189 N N   . LYS A 162 ? 0.1639 0.1655 0.1498 0.0091  0.0112  0.0167  1005 LYS A N   
1190 C CA  . LYS A 162 ? 0.1470 0.1500 0.1318 0.0106  0.0095  0.0165  1005 LYS A CA  
1191 C C   . LYS A 162 ? 0.1658 0.1743 0.1469 0.0131  0.0077  0.0150  1005 LYS A C   
1192 O O   . LYS A 162 ? 0.1664 0.1759 0.1449 0.0160  0.0071  0.0161  1005 LYS A O   
1193 C CB  . LYS A 162 ? 0.1556 0.1582 0.1444 0.0080  0.0078  0.0143  1005 LYS A CB  
1194 C CG  . LYS A 162 ? 0.1963 0.1940 0.1886 0.0060  0.0089  0.0154  1005 LYS A CG  
1195 C CD  . LYS A 162 ? 0.2590 0.2530 0.2505 0.0078  0.0102  0.0180  1005 LYS A CD  
1196 C CE  . LYS A 162 ? 0.3276 0.3172 0.3232 0.0055  0.0111  0.0183  1005 LYS A CE  
1197 N NZ  . LYS A 162 ? 0.3351 0.3203 0.3303 0.0070  0.0128  0.0207  1005 LYS A NZ  
1198 N N   . LEU A 163 ? 0.1520 0.1642 0.1331 0.0120  0.0068  0.0122  1006 LEU A N   
1199 C CA  . LEU A 163 ? 0.1597 0.1778 0.1382 0.0139  0.0048  0.0099  1006 LEU A CA  
1200 C C   . LEU A 163 ? 0.1715 0.1912 0.1442 0.0183  0.0051  0.0121  1006 LEU A C   
1201 O O   . LEU A 163 ? 0.1581 0.1820 0.1289 0.0209  0.0031  0.0112  1006 LEU A O   
1202 C CB  . LEU A 163 ? 0.1484 0.1697 0.1279 0.0119  0.0041  0.0064  1006 LEU A CB  
1203 C CG  . LEU A 163 ? 0.1555 0.1768 0.1399 0.0083  0.0032  0.0035  1006 LEU A CG  
1204 C CD1 . LEU A 163 ? 0.1983 0.2214 0.1835 0.0066  0.0032  0.0005  1006 LEU A CD1 
1205 C CD2 . LEU A 163 ? 0.1812 0.2062 0.1668 0.0086  0.0012  0.0017  1006 LEU A CD2 
1206 N N   . PRO A 164 ? 0.1613 0.1777 0.1310 0.0194  0.0077  0.0150  1007 PRO A N   
1207 C CA  . PRO A 164 ? 0.1752 0.1930 0.1384 0.0240  0.0080  0.0173  1007 PRO A CA  
1208 C C   . PRO A 164 ? 0.1712 0.1872 0.1329 0.0270  0.0079  0.0202  1007 PRO A C   
1209 O O   . PRO A 164 ? 0.2437 0.2624 0.2001 0.0314  0.0070  0.0213  1007 PRO A O   
1210 C CB  . PRO A 164 ? 0.1790 0.1927 0.1400 0.0242  0.0117  0.0202  1007 PRO A CB  
1211 C CG  . PRO A 164 ? 0.1617 0.1749 0.1276 0.0199  0.0121  0.0176  1007 PRO A CG  
1212 C CD  . PRO A 164 ? 0.1734 0.1861 0.1451 0.0170  0.0102  0.0158  1007 PRO A CD  
1213 N N   . GLY A 165 ? 0.1806 0.1923 0.1467 0.0250  0.0085  0.0211  1008 GLY A N   
1214 C CA  . GLY A 165 ? 0.1570 0.1660 0.1220 0.0277  0.0088  0.0238  1008 GLY A CA  
1215 C C   . GLY A 165 ? 0.1963 0.2090 0.1639 0.0278  0.0058  0.0213  1008 GLY A C   
1216 O O   . GLY A 165 ? 0.2216 0.2323 0.1889 0.0301  0.0059  0.0231  1008 GLY A O   
1217 N N   . LEU A 166 ? 0.1654 0.1834 0.1359 0.0254  0.0036  0.0171  1009 LEU A N   
1218 C CA  . LEU A 166 ? 0.1414 0.1635 0.1149 0.0251  0.0011  0.0143  1009 LEU A CA  
1219 C C   . LEU A 166 ? 0.1857 0.2155 0.1566 0.0285  -0.0015 0.0123  1009 LEU A C   
1220 O O   . LEU A 166 ? 0.2112 0.2448 0.1801 0.0285  -0.0022 0.0104  1009 LEU A O   
1221 C CB  . LEU A 166 ? 0.1616 0.1845 0.1403 0.0203  0.0005  0.0108  1009 LEU A CB  
1222 C CG  . LEU A 166 ? 0.1361 0.1527 0.1182 0.0170  0.0022  0.0119  1009 LEU A CG  
1223 C CD1 . LEU A 166 ? 0.1676 0.1851 0.1535 0.0129  0.0016  0.0088  1009 LEU A CD1 
1224 C CD2 . LEU A 166 ? 0.1819 0.1955 0.1648 0.0182  0.0024  0.0134  1009 LEU A CD2 
1225 N N   . PRO A 167 ? 0.2353 0.2676 0.2062 0.0315  -0.0029 0.0126  1010 PRO A N   
1226 C CA  . PRO A 167 ? 0.3131 0.3538 0.2823 0.0349  -0.0058 0.0103  1010 PRO A CA  
1227 C C   . PRO A 167 ? 0.2836 0.3306 0.2576 0.0314  -0.0078 0.0048  1010 PRO A C   
1228 O O   . PRO A 167 ? 0.2520 0.2968 0.2309 0.0272  -0.0070 0.0034  1010 PRO A O   
1229 C CB  . PRO A 167 ? 0.3491 0.3901 0.3187 0.0384  -0.0065 0.0118  1010 PRO A CB  
1230 C CG  . PRO A 167 ? 0.3589 0.3936 0.3326 0.0350  -0.0047 0.0126  1010 PRO A CG  
1231 C CD  . PRO A 167 ? 0.2553 0.2832 0.2284 0.0318  -0.0020 0.0144  1010 PRO A CD  
1232 N N   . PRO A 168 ? 0.2994 0.3542 0.2722 0.0330  -0.0102 0.0017  1011 PRO A N   
1233 C CA  . PRO A 168 ? 0.2549 0.3157 0.2328 0.0294  -0.0118 -0.0039 1011 PRO A CA  
1234 C C   . PRO A 168 ? 0.2612 0.3240 0.2454 0.0272  -0.0123 -0.0060 1011 PRO A C   
1235 O O   . PRO A 168 ? 0.2027 0.2662 0.1917 0.0227  -0.0119 -0.0092 1011 PRO A O   
1236 C CB  . PRO A 168 ? 0.3670 0.4365 0.3421 0.0328  -0.0147 -0.0067 1011 PRO A CB  
1237 C CG  . PRO A 168 ? 0.4145 0.4832 0.3832 0.0390  -0.0151 -0.0024 1011 PRO A CG  
1238 C CD  . PRO A 168 ? 0.3286 0.3869 0.2948 0.0385  -0.0116 0.0030  1011 PRO A CD  
1239 N N   . LYS A 169 ? 0.2503 0.3138 0.2345 0.0305  -0.0129 -0.0043 1012 LYS A N   
1240 C CA  . LYS A 169 ? 0.2656 0.3315 0.2558 0.0288  -0.0131 -0.0064 1012 LYS A CA  
1241 C C   . LYS A 169 ? 0.2804 0.3389 0.2733 0.0243  -0.0105 -0.0053 1012 LYS A C   
1242 O O   . LYS A 169 ? 0.2952 0.3552 0.2930 0.0217  -0.0102 -0.0076 1012 LYS A O   
1243 C CB  . LYS A 169 ? 0.3700 0.4377 0.3593 0.0338  -0.0141 -0.0044 1012 LYS A CB  
1244 C CG  . LYS A 169 ? 0.5047 0.5636 0.4933 0.0340  -0.0116 -0.0004 1012 LYS A CG  
1245 C CD  . LYS A 169 ? 0.5809 0.6398 0.5665 0.0399  -0.0123 0.0027  1012 LYS A CD  
1246 C CE  . LYS A 169 ? 0.5968 0.6525 0.5752 0.0437  -0.0119 0.0065  1012 LYS A CE  
1247 N NZ  . LYS A 169 ? 0.6137 0.6719 0.5886 0.0504  -0.0133 0.0088  1012 LYS A NZ  
1248 N N   . SER A 170 ? 0.2526 0.3032 0.2423 0.0236  -0.0085 -0.0019 1013 SER A N   
1249 C CA  . SER A 170 ? 0.2386 0.2821 0.2302 0.0200  -0.0064 -0.0006 1013 SER A CA  
1250 C C   . SER A 170 ? 0.2792 0.3214 0.2725 0.0155  -0.0056 -0.0026 1013 SER A C   
1251 O O   . SER A 170 ? 0.3214 0.3580 0.3160 0.0126  -0.0041 -0.0017 1013 SER A O   
1252 C CB  . SER A 170 ? 0.2112 0.2469 0.1992 0.0215  -0.0046 0.0040  1013 SER A CB  
1253 O OG  . SER A 170 ? 0.3227 0.3583 0.3089 0.0258  -0.0049 0.0062  1013 SER A OG  
1254 N N   . VAL A 171 ? 0.1958 0.2432 0.1891 0.0151  -0.0068 -0.0054 1014 VAL A N   
1255 C CA  . VAL A 171 ? 0.2579 0.3037 0.2525 0.0114  -0.0059 -0.0072 1014 VAL A CA  
1256 C C   . VAL A 171 ? 0.2000 0.2527 0.1982 0.0096  -0.0072 -0.0121 1014 VAL A C   
1257 O O   . VAL A 171 ? 0.1824 0.2414 0.1795 0.0118  -0.0091 -0.0142 1014 VAL A O   
1258 C CB  . VAL A 171 ? 0.2558 0.2990 0.2461 0.0124  -0.0053 -0.0053 1014 VAL A CB  
1259 C CG1 . VAL A 171 ? 0.2926 0.3338 0.2846 0.0087  -0.0043 -0.0071 1014 VAL A CG1 
1260 C CG2 . VAL A 171 ? 0.2393 0.2759 0.2267 0.0141  -0.0037 -0.0006 1014 VAL A CG2 
1261 N N   . SER A 172 ? 0.1511 0.2024 0.1534 0.0056  -0.0061 -0.0140 1015 SER A N   
1262 C CA  . SER A 172 ? 0.1333 0.1899 0.1397 0.0030  -0.0065 -0.0188 1015 SER A CA  
1263 C C   . SER A 172 ? 0.1623 0.2194 0.1670 0.0024  -0.0068 -0.0205 1015 SER A C   
1264 O O   . SER A 172 ? 0.1433 0.1944 0.1466 0.0008  -0.0052 -0.0189 1015 SER A O   
1265 C CB  . SER A 172 ? 0.1282 0.1814 0.1387 -0.0011 -0.0045 -0.0196 1015 SER A CB  
1266 O OG  . SER A 172 ? 0.1383 0.1941 0.1525 -0.0043 -0.0041 -0.0237 1015 SER A OG  
1267 N N   . LYS A 173 ? 0.1434 0.2079 0.1484 0.0038  -0.0088 -0.0241 1016 LYS A N   
1268 C CA  . LYS A 173 ? 0.1015 0.1668 0.1047 0.0032  -0.0091 -0.0263 1016 LYS A CA  
1269 C C   . LYS A 173 ? 0.1077 0.1698 0.1150 -0.0016 -0.0072 -0.0288 1016 LYS A C   
1270 O O   . LYS A 173 ? 0.1286 0.1868 0.1340 -0.0025 -0.0061 -0.0286 1016 LYS A O   
1271 C CB  . LYS A 173 ? 0.1863 0.2611 0.1896 0.0053  -0.0119 -0.0306 1016 LYS A CB  
1272 C CG  . LYS A 173 ? 0.2389 0.3166 0.2367 0.0109  -0.0139 -0.0280 1016 LYS A CG  
1273 C CD  . LYS A 173 ? 0.2590 0.3468 0.2566 0.0133  -0.0172 -0.0326 1016 LYS A CD  
1274 C CE  . LYS A 173 ? 0.2775 0.3667 0.2743 0.0116  -0.0173 -0.0365 1016 LYS A CE  
1275 N NZ  . LYS A 173 ? 0.3088 0.4067 0.3056 0.0141  -0.0202 -0.0407 1016 LYS A NZ  
1276 N N   . GLU A 174 ? 0.1233 0.1867 0.1360 -0.0045 -0.0065 -0.0310 1017 GLU A N   
1277 C CA  . GLU A 174 ? 0.0949 0.1550 0.1115 -0.0089 -0.0043 -0.0333 1017 GLU A CA  
1278 C C   . GLU A 174 ? 0.1011 0.1518 0.1154 -0.0100 -0.0021 -0.0290 1017 GLU A C   
1279 O O   . GLU A 174 ? 0.1292 0.1759 0.1441 -0.0122 -0.0006 -0.0298 1017 GLU A O   
1280 C CB  . GLU A 174 ? 0.2010 0.2640 0.2238 -0.0117 -0.0035 -0.0359 1017 GLU A CB  
1281 C CG  . GLU A 174 ? 0.2675 0.3263 0.2942 -0.0163 -0.0007 -0.0380 1017 GLU A CG  
1282 C CD  . GLU A 174 ? 0.2952 0.3555 0.3229 -0.0177 -0.0010 -0.0422 1017 GLU A CD  
1283 O OE1 . GLU A 174 ? 0.2217 0.2889 0.2487 -0.0158 -0.0035 -0.0452 1017 GLU A OE1 
1284 O OE2 . GLU A 174 ? 0.4535 0.5079 0.4825 -0.0207 0.0015  -0.0425 1017 GLU A OE2 
1285 N N   . ASP A 175 ? 0.0725 0.1199 0.0846 -0.0083 -0.0019 -0.0247 1018 ASP A N   
1286 C CA  . ASP A 175 ? 0.0748 0.1141 0.0850 -0.0091 -0.0002 -0.0210 1018 ASP A CA  
1287 C C   . ASP A 175 ? 0.0887 0.1256 0.0952 -0.0076 -0.0003 -0.0195 1018 ASP A C   
1288 O O   . ASP A 175 ? 0.1133 0.1451 0.1198 -0.0091 0.0011  -0.0186 1018 ASP A O   
1289 C CB  . ASP A 175 ? 0.1266 0.1632 0.1355 -0.0078 -0.0001 -0.0173 1018 ASP A CB  
1290 C CG  . ASP A 175 ? 0.1157 0.1449 0.1243 -0.0095 0.0017  -0.0148 1018 ASP A CG  
1291 O OD1 . ASP A 175 ? 0.1275 0.1550 0.1386 -0.0122 0.0031  -0.0160 1018 ASP A OD1 
1292 O OD2 . ASP A 175 ? 0.1356 0.1608 0.1415 -0.0082 0.0016  -0.0116 1018 ASP A OD2 
1293 N N   . ILE A 176 ? 0.0985 0.1393 0.1019 -0.0044 -0.0018 -0.0192 1019 ILE A N   
1294 C CA  . ILE A 176 ? 0.0901 0.1292 0.0899 -0.0031 -0.0015 -0.0182 1019 ILE A CA  
1295 C C   . ILE A 176 ? 0.1328 0.1728 0.1342 -0.0052 -0.0011 -0.0221 1019 ILE A C   
1296 O O   . ILE A 176 ? 0.1273 0.1631 0.1278 -0.0059 0.0003  -0.0213 1019 ILE A O   
1297 C CB  . ILE A 176 ? 0.1245 0.1675 0.1199 0.0010  -0.0030 -0.0170 1019 ILE A CB  
1298 C CG1 . ILE A 176 ? 0.1285 0.1697 0.1225 0.0031  -0.0031 -0.0130 1019 ILE A CG1 
1299 C CG2 . ILE A 176 ? 0.2040 0.2452 0.1955 0.0023  -0.0022 -0.0160 1019 ILE A CG2 
1300 C CD1 . ILE A 176 ? 0.2172 0.2510 0.2110 0.0021  -0.0013 -0.0092 1019 ILE A CD1 
1301 N N   . HIS A 177 ? 0.1403 0.1858 0.1446 -0.0064 -0.0021 -0.0267 1020 HIS A N   
1302 C CA  . HIS A 177 ? 0.1262 0.1720 0.1327 -0.0089 -0.0014 -0.0309 1020 HIS A CA  
1303 C C   . HIS A 177 ? 0.1215 0.1598 0.1303 -0.0118 0.0011  -0.0297 1020 HIS A C   
1304 O O   . HIS A 177 ? 0.1691 0.2048 0.1778 -0.0128 0.0022  -0.0311 1020 HIS A O   
1305 C CB  . HIS A 177 ? 0.1274 0.1798 0.1385 -0.0106 -0.0025 -0.0362 1020 HIS A CB  
1306 C CG  . HIS A 177 ? 0.1971 0.2574 0.2062 -0.0081 -0.0051 -0.0397 1020 HIS A CG  
1307 N ND1 . HIS A 177 ? 0.1566 0.2186 0.1644 -0.0082 -0.0054 -0.0431 1020 HIS A ND1 
1308 C CD2 . HIS A 177 ? 0.2285 0.2959 0.2368 -0.0053 -0.0077 -0.0403 1020 HIS A CD2 
1309 C CE1 . HIS A 177 ? 0.2031 0.2729 0.2088 -0.0054 -0.0082 -0.0458 1020 HIS A CE1 
1310 N NE2 . HIS A 177 ? 0.1958 0.2691 0.2017 -0.0035 -0.0097 -0.0441 1020 HIS A NE2 
1311 N N   . SER A 178 ? 0.1285 0.1633 0.1390 -0.0130 0.0021  -0.0272 1021 SER A N   
1312 C CA  . SER A 178 ? 0.1189 0.1468 0.1310 -0.0154 0.0043  -0.0259 1021 SER A CA  
1313 C C   . SER A 178 ? 0.1220 0.1448 0.1311 -0.0140 0.0049  -0.0226 1021 SER A C   
1314 O O   . SER A 178 ? 0.1644 0.1819 0.1745 -0.0155 0.0065  -0.0221 1021 SER A O   
1315 C CB  . SER A 178 ? 0.1052 0.1307 0.1188 -0.0165 0.0050  -0.0238 1021 SER A CB  
1316 O OG  . SER A 178 ? 0.1126 0.1365 0.1233 -0.0143 0.0043  -0.0197 1021 SER A OG  
1317 N N   . MET A 179 ? 0.1282 0.1526 0.1339 -0.0112 0.0038  -0.0204 1022 MET A N   
1318 C CA  . MET A 179 ? 0.0786 0.0989 0.0822 -0.0100 0.0046  -0.0174 1022 MET A CA  
1319 C C   . MET A 179 ? 0.0998 0.1210 0.1024 -0.0095 0.0051  -0.0196 1022 MET A C   
1320 O O   . MET A 179 ? 0.1242 0.1419 0.1261 -0.0091 0.0063  -0.0180 1022 MET A O   
1321 C CB  . MET A 179 ? 0.1013 0.1224 0.1020 -0.0074 0.0038  -0.0140 1022 MET A CB  
1322 C CG  . MET A 179 ? 0.0801 0.1003 0.0816 -0.0075 0.0033  -0.0119 1022 MET A CG  
1323 S SD  . MET A 179 ? 0.1273 0.1482 0.1255 -0.0043 0.0026  -0.0084 1022 MET A SD  
1324 C CE  . MET A 179 ? 0.1175 0.1382 0.1173 -0.0049 0.0020  -0.0077 1022 MET A CE  
1325 N N   . VAL A 180 ? 0.1149 0.1412 0.1174 -0.0096 0.0042  -0.0236 1023 VAL A N   
1326 C CA  . VAL A 180 ? 0.1076 0.1355 0.1080 -0.0086 0.0045  -0.0259 1023 VAL A CA  
1327 C C   . VAL A 180 ? 0.0896 0.1128 0.0920 -0.0103 0.0064  -0.0272 1023 VAL A C   
1328 O O   . VAL A 180 ? 0.1168 0.1386 0.1172 -0.0090 0.0074  -0.0265 1023 VAL A O   
1329 C CB  . VAL A 180 ? 0.0823 0.1173 0.0822 -0.0081 0.0027  -0.0305 1023 VAL A CB  
1330 C CG1 . VAL A 180 ? 0.1319 0.1681 0.1298 -0.0076 0.0031  -0.0338 1023 VAL A CG1 
1331 C CG2 . VAL A 180 ? 0.1316 0.1712 0.1280 -0.0050 0.0008  -0.0286 1023 VAL A CG2 
1332 N N   . PRO A 181 ? 0.1124 0.1328 0.1188 -0.0132 0.0073  -0.0288 1024 PRO A N   
1333 C CA  . PRO A 181 ? 0.1265 0.1416 0.1345 -0.0143 0.0093  -0.0295 1024 PRO A CA  
1334 C C   . PRO A 181 ? 0.1704 0.1810 0.1774 -0.0129 0.0101  -0.0250 1024 PRO A C   
1335 O O   . PRO A 181 ? 0.1604 0.1684 0.1674 -0.0123 0.0114  -0.0252 1024 PRO A O   
1336 C CB  . PRO A 181 ? 0.1342 0.1462 0.1462 -0.0173 0.0103  -0.0308 1024 PRO A CB  
1337 C CG  . PRO A 181 ? 0.1762 0.1940 0.1893 -0.0182 0.0089  -0.0333 1024 PRO A CG  
1338 C CD  . PRO A 181 ? 0.1608 0.1826 0.1703 -0.0153 0.0069  -0.0305 1024 PRO A CD  
1339 N N   . HIS A 182 ? 0.1300 0.1398 0.1365 -0.0122 0.0094  -0.0211 1025 HIS A N   
1340 C CA  . HIS A 182 ? 0.1062 0.1122 0.1124 -0.0111 0.0100  -0.0173 1025 HIS A CA  
1341 C C   . HIS A 182 ? 0.1552 0.1635 0.1589 -0.0088 0.0101  -0.0161 1025 HIS A C   
1342 O O   . HIS A 182 ? 0.1472 0.1533 0.1514 -0.0080 0.0112  -0.0148 1025 HIS A O   
1343 C CB  . HIS A 182 ? 0.0917 0.0962 0.0983 -0.0113 0.0092  -0.0141 1025 HIS A CB  
1344 C CG  . HIS A 182 ? 0.1945 0.1970 0.2029 -0.0134 0.0094  -0.0151 1025 HIS A CG  
1345 N ND1 . HIS A 182 ? 0.3079 0.3054 0.3180 -0.0145 0.0108  -0.0152 1025 HIS A ND1 
1346 C CD2 . HIS A 182 ? 0.2095 0.2142 0.2183 -0.0144 0.0088  -0.0159 1025 HIS A CD2 
1347 C CE1 . HIS A 182 ? 0.3099 0.3063 0.3211 -0.0163 0.0112  -0.0159 1025 HIS A CE1 
1348 N NE2 . HIS A 182 ? 0.2891 0.2900 0.2998 -0.0164 0.0101  -0.0165 1025 HIS A NE2 
1349 N N   . LEU A 183 ? 0.1144 0.1273 0.1153 -0.0076 0.0090  -0.0167 1026 LEU A N   
1350 C CA  . LEU A 183 ? 0.0890 0.1038 0.0867 -0.0053 0.0095  -0.0155 1026 LEU A CA  
1351 C C   . LEU A 183 ? 0.1285 0.1432 0.1258 -0.0051 0.0109  -0.0181 1026 LEU A C   
1352 O O   . LEU A 183 ? 0.1324 0.1459 0.1291 -0.0038 0.0125  -0.0165 1026 LEU A O   
1353 C CB  . LEU A 183 ? 0.0858 0.1057 0.0801 -0.0037 0.0081  -0.0161 1026 LEU A CB  
1354 C CG  . LEU A 183 ? 0.0767 0.0985 0.0664 -0.0008 0.0088  -0.0146 1026 LEU A CG  
1355 C CD1 . LEU A 183 ? 0.1126 0.1314 0.1024 0.0000  0.0099  -0.0098 1026 LEU A CD1 
1356 C CD2 . LEU A 183 ? 0.1026 0.1297 0.0886 0.0010  0.0070  -0.0159 1026 LEU A CD2 
1357 N N   . TYR A 184 ? 0.1227 0.1389 0.1208 -0.0064 0.0106  -0.0225 1027 TYR A N   
1358 C CA  . TYR A 184 ? 0.1401 0.1565 0.1376 -0.0061 0.0118  -0.0257 1027 TYR A CA  
1359 C C   . TYR A 184 ? 0.1943 0.2054 0.1949 -0.0067 0.0138  -0.0248 1027 TYR A C   
1360 O O   . TYR A 184 ? 0.1991 0.2098 0.1989 -0.0056 0.0153  -0.0257 1027 TYR A O   
1361 C CB  . TYR A 184 ? 0.1152 0.1344 0.1134 -0.0076 0.0109  -0.0312 1027 TYR A CB  
1362 C CG  . TYR A 184 ? 0.1219 0.1477 0.1166 -0.0062 0.0089  -0.0329 1027 TYR A CG  
1363 C CD1 . TYR A 184 ? 0.1186 0.1466 0.1090 -0.0034 0.0083  -0.0293 1027 TYR A CD1 
1364 C CD2 . TYR A 184 ? 0.1249 0.1547 0.1207 -0.0075 0.0075  -0.0381 1027 TYR A CD2 
1365 C CE1 . TYR A 184 ? 0.1195 0.1534 0.1062 -0.0014 0.0063  -0.0306 1027 TYR A CE1 
1366 C CE2 . TYR A 184 ? 0.1106 0.1472 0.1033 -0.0057 0.0052  -0.0399 1027 TYR A CE2 
1367 C CZ  . TYR A 184 ? 0.1091 0.1476 0.0969 -0.0025 0.0046  -0.0359 1027 TYR A CZ  
1368 O OH  . TYR A 184 ? 0.1573 0.2023 0.1415 -0.0002 0.0022  -0.0373 1027 TYR A OH  
1369 N N   . ALA A 185 ? 0.1622 0.1693 0.1660 -0.0082 0.0137  -0.0230 1028 ALA A N   
1370 C CA  . ALA A 185 ? 0.1291 0.1314 0.1357 -0.0082 0.0152  -0.0216 1028 ALA A CA  
1371 C C   . ALA A 185 ? 0.1920 0.1943 0.1985 -0.0064 0.0156  -0.0177 1028 ALA A C   
1372 O O   . ALA A 185 ? 0.2039 0.2049 0.2115 -0.0054 0.0171  -0.0174 1028 ALA A O   
1373 C CB  . ALA A 185 ? 0.1183 0.1165 0.1277 -0.0099 0.0149  -0.0207 1028 ALA A CB  
1374 N N   . HIS A 186 ? 0.1501 0.1537 0.1556 -0.0061 0.0144  -0.0148 1029 HIS A N   
1375 C CA  . HIS A 186 ? 0.1320 0.1350 0.1384 -0.0050 0.0148  -0.0112 1029 HIS A CA  
1376 C C   . HIS A 186 ? 0.2035 0.2090 0.2077 -0.0032 0.0164  -0.0105 1029 HIS A C   
1377 O O   . HIS A 186 ? 0.1922 0.1970 0.1983 -0.0025 0.0175  -0.0083 1029 HIS A O   
1378 C CB  . HIS A 186 ? 0.1312 0.1339 0.1377 -0.0054 0.0133  -0.0085 1029 HIS A CB  
1379 C CG  . HIS A 186 ? 0.1245 0.1242 0.1329 -0.0069 0.0122  -0.0086 1029 HIS A CG  
1380 N ND1 . HIS A 186 ? 0.1298 0.1292 0.1380 -0.0075 0.0108  -0.0070 1029 HIS A ND1 
1381 C CD2 . HIS A 186 ? 0.1105 0.1071 0.1209 -0.0077 0.0127  -0.0099 1029 HIS A CD2 
1382 C CE1 . HIS A 186 ? 0.1322 0.1286 0.1417 -0.0086 0.0105  -0.0073 1029 HIS A CE1 
1383 N NE2 . HIS A 186 ? 0.1410 0.1354 0.1518 -0.0087 0.0117  -0.0089 1029 HIS A NE2 
1384 N N   . ILE A 187 ? 0.1573 0.1659 0.1574 -0.0025 0.0164  -0.0126 1030 ILE A N   
1385 C CA  . ILE A 187 ? 0.2203 0.2310 0.2173 -0.0005 0.0182  -0.0124 1030 ILE A CA  
1386 C C   . ILE A 187 ? 0.2110 0.2201 0.2106 -0.0003 0.0203  -0.0133 1030 ILE A C   
1387 O O   . ILE A 187 ? 0.2660 0.2758 0.2648 0.0011  0.0225  -0.0120 1030 ILE A O   
1388 C CB  . ILE A 187 ? 0.2703 0.2848 0.2625 0.0003  0.0175  -0.0155 1030 ILE A CB  
1389 C CG1 . ILE A 187 ? 0.2815 0.2984 0.2703 0.0013  0.0159  -0.0136 1030 ILE A CG1 
1390 C CG2 . ILE A 187 ? 0.4092 0.4252 0.3982 0.0022  0.0197  -0.0166 1030 ILE A CG2 
1391 C CD1 . ILE A 187 ? 0.2866 0.3079 0.2713 0.0022  0.0144  -0.0170 1030 ILE A CD1 
1392 N N   . CYS A 188 ? 0.1847 0.1913 0.1874 -0.0016 0.0200  -0.0155 1031 CYS A N   
1393 C CA  . CYS A 188 ? 0.2460 0.2507 0.2515 -0.0011 0.0219  -0.0168 1031 CYS A CA  
1394 C C   . CYS A 188 ? 0.2847 0.2859 0.2953 -0.0016 0.0216  -0.0147 1031 CYS A C   
1395 O O   . CYS A 188 ? 0.3154 0.3145 0.3289 -0.0013 0.0227  -0.0159 1031 CYS A O   
1396 C CB  . CYS A 188 ? 0.2771 0.2812 0.2819 -0.0017 0.0221  -0.0214 1031 CYS A CB  
1397 S SG  . CYS A 188 ? 0.3897 0.3986 0.3883 -0.0007 0.0222  -0.0247 1031 CYS A SG  
1398 N N   . ASP A 189 ? 0.2434 0.2442 0.2551 -0.0022 0.0200  -0.0118 1032 ASP A N   
1399 C CA  . ASP A 189 ? 0.1897 0.1877 0.2057 -0.0025 0.0192  -0.0100 1032 ASP A CA  
1400 C C   . ASP A 189 ? 0.1627 0.1606 0.1825 -0.0012 0.0208  -0.0093 1032 ASP A C   
1401 O O   . ASP A 189 ? 0.2118 0.2121 0.2311 -0.0003 0.0227  -0.0091 1032 ASP A O   
1402 C CB  . ASP A 189 ? 0.2149 0.2132 0.2309 -0.0031 0.0174  -0.0072 1032 ASP A CB  
1403 C CG  . ASP A 189 ? 0.3084 0.3037 0.3272 -0.0035 0.0158  -0.0060 1032 ASP A CG  
1404 O OD1 . ASP A 189 ? 0.2474 0.2426 0.2698 -0.0028 0.0157  -0.0044 1032 ASP A OD1 
1405 O OD2 . ASP A 189 ? 0.3076 0.3009 0.3252 -0.0046 0.0148  -0.0067 1032 ASP A OD2 
1406 N N   . ARG A 190 ? 0.2045 0.1998 0.2279 -0.0009 0.0202  -0.0089 1033 ARG A N   
1407 C CA  . ARG A 190 ? 0.3030 0.2987 0.3309 0.0006  0.0214  -0.0084 1033 ARG A CA  
1408 C C   . ARG A 190 ? 0.2367 0.2351 0.2674 0.0007  0.0211  -0.0058 1033 ARG A C   
1409 O O   . ARG A 190 ? 0.2493 0.2497 0.2839 0.0017  0.0227  -0.0055 1033 ARG A O   
1410 C CB  . ARG A 190 ? 0.3937 0.3858 0.4245 0.0014  0.0204  -0.0084 1033 ARG A CB  
1411 C CG  . ARG A 190 ? 0.4892 0.4794 0.5197 0.0007  0.0177  -0.0064 1033 ARG A CG  
1412 C CD  . ARG A 190 ? 0.6646 0.6502 0.6958 0.0015  0.0171  -0.0065 1033 ARG A CD  
1413 N NE  . ARG A 190 ? 0.8010 0.7847 0.8309 0.0009  0.0147  -0.0045 1033 ARG A NE  
1414 C CZ  . ARG A 190 ? 0.9055 0.8879 0.9319 -0.0008 0.0142  -0.0046 1033 ARG A CZ  
1415 N NH1 . ARG A 190 ? 0.9567 0.9396 0.9806 -0.0023 0.0155  -0.0068 1033 ARG A NH1 
1416 N NH2 . ARG A 190 ? 0.9115 0.8922 0.9367 -0.0011 0.0123  -0.0028 1033 ARG A NH2 
1417 N N   . ASN A 191 ? 0.1711 0.1695 0.2002 -0.0004 0.0192  -0.0042 1034 ASN A N   
1418 C CA  . ASN A 191 ? 0.1392 0.1396 0.1711 -0.0007 0.0188  -0.0020 1034 ASN A CA  
1419 C C   . ASN A 191 ? 0.1741 0.1767 0.2036 -0.0009 0.0208  -0.0013 1034 ASN A C   
1420 O O   . ASN A 191 ? 0.1567 0.1592 0.1811 -0.0013 0.0206  -0.0015 1034 ASN A O   
1421 C CB  . ASN A 191 ? 0.1233 0.1222 0.1545 -0.0016 0.0159  -0.0008 1034 ASN A CB  
1422 C CG  . ASN A 191 ? 0.1419 0.1425 0.1762 -0.0020 0.0152  0.0009  1034 ASN A CG  
1423 O OD1 . ASN A 191 ? 0.1684 0.1703 0.2016 -0.0026 0.0164  0.0018  1034 ASN A OD1 
1424 N ND2 . ASN A 191 ? 0.1536 0.1542 0.1920 -0.0017 0.0133  0.0013  1034 ASN A ND2 
1425 N N   . ALA A 192 ? 0.1110 0.1156 0.1441 -0.0005 0.0229  -0.0004 1035 ALA A N   
1426 C CA  . ALA A 192 ? 0.1236 0.1298 0.1542 -0.0005 0.0256  0.0007  1035 ALA A CA  
1427 C C   . ALA A 192 ? 0.1460 0.1517 0.1738 -0.0013 0.0246  0.0026  1035 ALA A C   
1428 O O   . ALA A 192 ? 0.1526 0.1587 0.1756 -0.0009 0.0262  0.0034  1035 ALA A O   
1429 C CB  . ALA A 192 ? 0.1442 0.1525 0.1802 -0.0001 0.0285  0.0013  1035 ALA A CB  
1430 N N   . ASP A 193 ? 0.1378 0.1426 0.1684 -0.0023 0.0222  0.0034  1036 ASP A N   
1431 C CA  . ASP A 193 ? 0.1379 0.1418 0.1663 -0.0031 0.0212  0.0050  1036 ASP A CA  
1432 C C   . ASP A 193 ? 0.1236 0.1266 0.1460 -0.0030 0.0195  0.0043  1036 ASP A C   
1433 O O   . ASP A 193 ? 0.1343 0.1374 0.1526 -0.0027 0.0199  0.0054  1036 ASP A O   
1434 C CB  . ASP A 193 ? 0.0921 0.0955 0.1251 -0.0041 0.0188  0.0054  1036 ASP A CB  
1435 C CG  . ASP A 193 ? 0.2503 0.2554 0.2904 -0.0045 0.0202  0.0058  1036 ASP A CG  
1436 O OD1 . ASP A 193 ? 0.2102 0.2166 0.2515 -0.0043 0.0235  0.0063  1036 ASP A OD1 
1437 O OD2 . ASP A 193 ? 0.2472 0.2527 0.2918 -0.0051 0.0179  0.0053  1036 ASP A OD2 
1438 N N   . VAL A 194 ? 0.1127 0.1148 0.1348 -0.0031 0.0177  0.0026  1037 VAL A N   
1439 C CA  . VAL A 194 ? 0.1020 0.1036 0.1194 -0.0033 0.0164  0.0014  1037 VAL A CA  
1440 C C   . VAL A 194 ? 0.1482 0.1515 0.1611 -0.0024 0.0180  0.0004  1037 VAL A C   
1441 O O   . VAL A 194 ? 0.1481 0.1523 0.1569 -0.0022 0.0174  0.0005  1037 VAL A O   
1442 C CB  . VAL A 194 ? 0.0873 0.0870 0.1057 -0.0037 0.0149  -0.0003 1037 VAL A CB  
1443 C CG1 . VAL A 194 ? 0.1318 0.1314 0.1461 -0.0042 0.0141  -0.0021 1037 VAL A CG1 
1444 C CG2 . VAL A 194 ? 0.1455 0.1437 0.1667 -0.0042 0.0129  0.0009  1037 VAL A CG2 
1445 N N   . ARG A 195 ? 0.1429 0.1470 0.1566 -0.0016 0.0201  -0.0007 1038 ARG A N   
1446 C CA  . ARG A 195 ? 0.1386 0.1446 0.1477 -0.0004 0.0218  -0.0018 1038 ARG A CA  
1447 C C   . ARG A 195 ? 0.1841 0.1911 0.1898 0.0005  0.0230  0.0006  1038 ARG A C   
1448 O O   . ARG A 195 ? 0.1429 0.1513 0.1433 0.0014  0.0225  0.0001  1038 ARG A O   
1449 C CB  . ARG A 195 ? 0.1821 0.1885 0.1930 0.0004  0.0243  -0.0030 1038 ARG A CB  
1450 C CG  . ARG A 195 ? 0.2377 0.2429 0.2503 0.0002  0.0237  -0.0059 1038 ARG A CG  
1451 C CD  . ARG A 195 ? 0.2429 0.2490 0.2552 0.0014  0.0265  -0.0078 1038 ARG A CD  
1452 N NE  . ARG A 195 ? 0.3022 0.3093 0.3180 0.0022  0.0290  -0.0059 1038 ARG A NE  
1453 C CZ  . ARG A 195 ? 0.2382 0.2447 0.2604 0.0021  0.0292  -0.0054 1038 ARG A CZ  
1454 N NH1 . ARG A 195 ? 0.2463 0.2506 0.2711 0.0016  0.0269  -0.0063 1038 ARG A NH1 
1455 N NH2 . ARG A 195 ? 0.3201 0.3282 0.3459 0.0026  0.0317  -0.0040 1038 ARG A NH2 
1456 N N   . LYS A 196 ? 0.1383 0.1447 0.1472 0.0003  0.0245  0.0031  1039 LYS A N   
1457 C CA  . LYS A 196 ? 0.1421 0.1486 0.1480 0.0012  0.0263  0.0059  1039 LYS A CA  
1458 C C   . LYS A 196 ? 0.1940 0.2000 0.1966 0.0013  0.0240  0.0067  1039 LYS A C   
1459 O O   . LYS A 196 ? 0.1830 0.1900 0.1800 0.0029  0.0244  0.0075  1039 LYS A O   
1460 C CB  . LYS A 196 ? 0.1467 0.1522 0.1581 0.0004  0.0284  0.0081  1039 LYS A CB  
1461 C CG  . LYS A 196 ? 0.1935 0.1980 0.2025 0.0010  0.0306  0.0113  1039 LYS A CG  
1462 C CD  . LYS A 196 ? 0.2279 0.2315 0.2434 -0.0002 0.0331  0.0130  1039 LYS A CD  
1463 C CE  . LYS A 196 ? 0.3119 0.3136 0.3252 0.0003  0.0360  0.0163  1039 LYS A CE  
1464 N NZ  . LYS A 196 ? 0.3154 0.3152 0.3272 0.0001  0.0335  0.0173  1039 LYS A NZ  
1465 N N   . ASN A 197 ? 0.1207 0.1255 0.1265 -0.0002 0.0215  0.0065  1040 ASN A N   
1466 C CA  . ASN A 197 ? 0.1254 0.1298 0.1288 -0.0002 0.0195  0.0073  1040 ASN A CA  
1467 C C   . ASN A 197 ? 0.1015 0.1078 0.1005 0.0004  0.0176  0.0051  1040 ASN A C   
1468 O O   . ASN A 197 ? 0.1660 0.1733 0.1612 0.0016  0.0169  0.0058  1040 ASN A O   
1469 C CB  . ASN A 197 ? 0.1352 0.1377 0.1430 -0.0019 0.0176  0.0076  1040 ASN A CB  
1470 C CG  . ASN A 197 ? 0.1657 0.1669 0.1779 -0.0025 0.0192  0.0096  1040 ASN A CG  
1471 O OD1 . ASN A 197 ? 0.2227 0.2240 0.2347 -0.0018 0.0221  0.0111  1040 ASN A OD1 
1472 N ND2 . ASN A 197 ? 0.1567 0.1566 0.1728 -0.0038 0.0174  0.0096  1040 ASN A ND2 
1473 N N   . ALA A 198 ? 0.1122 0.1192 0.1122 -0.0003 0.0169  0.0022  1041 ALA A N   
1474 C CA  . ALA A 198 ? 0.1095 0.1186 0.1061 -0.0001 0.0153  -0.0005 1041 ALA A CA  
1475 C C   . ALA A 198 ? 0.1612 0.1732 0.1524 0.0021  0.0164  -0.0008 1041 ALA A C   
1476 O O   . ALA A 198 ? 0.1428 0.1573 0.1304 0.0031  0.0149  -0.0017 1041 ALA A O   
1477 C CB  . ALA A 198 ? 0.1253 0.1338 0.1245 -0.0015 0.0148  -0.0035 1041 ALA A CB  
1478 N N   . ASN A 199 ? 0.1535 0.1653 0.1440 0.0031  0.0189  -0.0002 1042 ASN A N   
1479 C CA  . ASN A 199 ? 0.1123 0.1265 0.0968 0.0056  0.0202  -0.0001 1042 ASN A CA  
1480 C C   . ASN A 199 ? 0.1742 0.1884 0.1550 0.0073  0.0202  0.0032  1042 ASN A C   
1481 O O   . ASN A 199 ? 0.1741 0.1911 0.1493 0.0095  0.0194  0.0027  1042 ASN A O   
1482 C CB  . ASN A 199 ? 0.1196 0.1334 0.1040 0.0063  0.0235  0.0003  1042 ASN A CB  
1483 C CG  . ASN A 199 ? 0.2039 0.2188 0.1890 0.0059  0.0236  -0.0037 1042 ASN A CG  
1484 O OD1 . ASN A 199 ? 0.1882 0.2058 0.1685 0.0071  0.0231  -0.0064 1042 ASN A OD1 
1485 N ND2 . ASN A 199 ? 0.2149 0.2278 0.2058 0.0042  0.0240  -0.0044 1042 ASN A ND2 
1486 N N   . GLU A 200 ? 0.1732 0.1845 0.1572 0.0065  0.0211  0.0063  1043 GLU A N   
1487 C CA  . GLU A 200 ? 0.1581 0.1684 0.1392 0.0081  0.0214  0.0096  1043 GLU A CA  
1488 C C   . GLU A 200 ? 0.1689 0.1809 0.1485 0.0085  0.0181  0.0086  1043 GLU A C   
1489 O O   . GLU A 200 ? 0.1785 0.1908 0.1540 0.0107  0.0179  0.0106  1043 GLU A O   
1490 C CB  . GLU A 200 ? 0.1925 0.1990 0.1785 0.0067  0.0231  0.0126  1043 GLU A CB  
1491 C CG  . GLU A 200 ? 0.2520 0.2573 0.2397 0.0066  0.0269  0.0140  1043 GLU A CG  
1492 C CD  . GLU A 200 ? 0.3376 0.3398 0.3306 0.0051  0.0287  0.0166  1043 GLU A CD  
1493 O OE1 . GLU A 200 ? 0.3960 0.3965 0.3904 0.0044  0.0270  0.0175  1043 GLU A OE1 
1494 O OE2 . GLU A 200 ? 0.3445 0.3459 0.3403 0.0046  0.0319  0.0175  1043 GLU A OE2 
1495 N N   . ALA A 201 ? 0.1190 0.1321 0.1018 0.0065  0.0157  0.0055  1044 ALA A N   
1496 C CA  . ALA A 201 ? 0.1019 0.1168 0.0843 0.0064  0.0128  0.0042  1044 ALA A CA  
1497 C C   . ALA A 201 ? 0.1032 0.1230 0.0816 0.0079  0.0113  0.0011  1044 ALA A C   
1498 O O   . ALA A 201 ? 0.1260 0.1485 0.1037 0.0084  0.0090  -0.0001 1044 ALA A O   
1499 C CB  . ALA A 201 ? 0.1361 0.1495 0.1238 0.0034  0.0114  0.0025  1044 ALA A CB  
1500 N N   . VAL A 202 ? 0.1037 0.1249 0.0796 0.0087  0.0124  -0.0005 1045 VAL A N   
1501 C CA  . VAL A 202 ? 0.0973 0.1234 0.0696 0.0100  0.0107  -0.0041 1045 VAL A CA  
1502 C C   . VAL A 202 ? 0.1216 0.1509 0.0887 0.0133  0.0093  -0.0028 1045 VAL A C   
1503 O O   . VAL A 202 ? 0.1331 0.1668 0.1000 0.0136  0.0065  -0.0056 1045 VAL A O   
1504 C CB  . VAL A 202 ? 0.1173 0.1444 0.0868 0.0109  0.0125  -0.0058 1045 VAL A CB  
1505 C CG1 . VAL A 202 ? 0.1427 0.1754 0.1075 0.0127  0.0105  -0.0097 1045 VAL A CG1 
1506 C CG2 . VAL A 202 ? 0.1434 0.1680 0.1182 0.0079  0.0134  -0.0080 1045 VAL A CG2 
1507 N N   . LEU A 203 ? 0.1380 0.1650 0.1014 0.0158  0.0113  0.0016  1046 LEU A N   
1508 C CA  . LEU A 203 ? 0.1320 0.1614 0.0898 0.0196  0.0103  0.0035  1046 LEU A CA  
1509 C C   . LEU A 203 ? 0.1491 0.1792 0.1097 0.0192  0.0078  0.0036  1046 LEU A C   
1510 O O   . LEU A 203 ? 0.1313 0.1662 0.0896 0.0213  0.0052  0.0019  1046 LEU A O   
1511 C CB  . LEU A 203 ? 0.1596 0.1850 0.1132 0.0221  0.0136  0.0088  1046 LEU A CB  
1512 C CG  . LEU A 203 ? 0.1701 0.1968 0.1173 0.0266  0.0129  0.0116  1046 LEU A CG  
1513 C CD1 . LEU A 203 ? 0.1564 0.1896 0.0974 0.0298  0.0106  0.0085  1046 LEU A CD1 
1514 C CD2 . LEU A 203 ? 0.2336 0.2549 0.1774 0.0286  0.0170  0.0172  1046 LEU A CD2 
1515 N N   . GLY A 204 ? 0.1446 0.1703 0.1104 0.0166  0.0086  0.0053  1047 GLY A N   
1516 C CA  . GLY A 204 ? 0.1561 0.1820 0.1248 0.0160  0.0066  0.0053  1047 GLY A CA  
1517 C C   . GLY A 204 ? 0.1392 0.1702 0.1104 0.0146  0.0037  0.0006  1047 GLY A C   
1518 O O   . GLY A 204 ? 0.1540 0.1884 0.1249 0.0160  0.0016  -0.0001 1047 GLY A O   
1519 N N   . ILE A 205 ? 0.1225 0.1538 0.0967 0.0117  0.0038  -0.0027 1048 ILE A N   
1520 C CA  . ILE A 205 ? 0.1448 0.1806 0.1218 0.0100  0.0016  -0.0075 1048 ILE A CA  
1521 C C   . ILE A 205 ? 0.1453 0.1877 0.1181 0.0129  -0.0005 -0.0101 1048 ILE A C   
1522 O O   . ILE A 205 ? 0.1301 0.1774 0.1044 0.0132  -0.0029 -0.0126 1048 ILE A O   
1523 C CB  . ILE A 205 ? 0.1306 0.1647 0.1109 0.0067  0.0025  -0.0104 1048 ILE A CB  
1524 C CG1 . ILE A 205 ? 0.2577 0.2858 0.2420 0.0042  0.0041  -0.0080 1048 ILE A CG1 
1525 C CG2 . ILE A 205 ? 0.1548 0.1932 0.1381 0.0048  0.0007  -0.0156 1048 ILE A CG2 
1526 C CD1 . ILE A 205 ? 0.2507 0.2779 0.2391 0.0020  0.0031  -0.0086 1048 ILE A CD1 
1527 N N   . MET A 206 ? 0.0945 0.1376 0.0621 0.0153  0.0004  -0.0096 1049 MET A N   
1528 C CA  . MET A 206 ? 0.1087 0.1584 0.0716 0.0184  -0.0017 -0.0122 1049 MET A CA  
1529 C C   . MET A 206 ? 0.1636 0.2163 0.1232 0.0224  -0.0035 -0.0100 1049 MET A C   
1530 O O   . MET A 206 ? 0.1446 0.2042 0.1027 0.0244  -0.0064 -0.0131 1049 MET A O   
1531 C CB  . MET A 206 ? 0.1394 0.1887 0.0965 0.0205  0.0000  -0.0117 1049 MET A CB  
1532 C CG  . MET A 206 ? 0.1228 0.1794 0.0753 0.0231  -0.0025 -0.0160 1049 MET A CG  
1533 S SD  . MET A 206 ? 0.1540 0.2098 0.0990 0.0256  0.0000  -0.0155 1049 MET A SD  
1534 C CE  . MET A 206 ? 0.1156 0.1683 0.0671 0.0204  0.0017  -0.0193 1049 MET A CE  
1535 N N   . ILE A 207 ? 0.1370 0.1846 0.0957 0.0235  -0.0018 -0.0047 1050 ILE A N   
1536 C CA  . ILE A 207 ? 0.1598 0.2091 0.1156 0.0274  -0.0032 -0.0021 1050 ILE A CA  
1537 C C   . ILE A 207 ? 0.1803 0.2347 0.1411 0.0263  -0.0062 -0.0057 1050 ILE A C   
1538 O O   . ILE A 207 ? 0.2134 0.2732 0.1720 0.0298  -0.0087 -0.0062 1050 ILE A O   
1539 C CB  . ILE A 207 ? 0.1570 0.1990 0.1124 0.0280  -0.0004 0.0038  1050 ILE A CB  
1540 C CG1 . ILE A 207 ? 0.1591 0.1976 0.1079 0.0308  0.0024  0.0076  1050 ILE A CG1 
1541 C CG2 . ILE A 207 ? 0.1733 0.2162 0.1286 0.0307  -0.0020 0.0056  1050 ILE A CG2 
1542 C CD1 . ILE A 207 ? 0.2180 0.2487 0.1677 0.0303  0.0058  0.0129  1050 ILE A CD1 
1543 N N   . HIS A 208 ? 0.1458 0.1989 0.1134 0.0216  -0.0060 -0.0081 1051 HIS A N   
1544 C CA  . HIS A 208 ? 0.1391 0.1966 0.1121 0.0199  -0.0082 -0.0115 1051 HIS A CA  
1545 C C   . HIS A 208 ? 0.2063 0.2706 0.1819 0.0182  -0.0102 -0.0178 1051 HIS A C   
1546 O O   . HIS A 208 ? 0.2192 0.2899 0.1977 0.0186  -0.0126 -0.0209 1051 HIS A O   
1547 C CB  . HIS A 208 ? 0.1530 0.2049 0.1313 0.0161  -0.0065 -0.0102 1051 HIS A CB  
1548 C CG  . HIS A 208 ? 0.1550 0.2016 0.1318 0.0178  -0.0052 -0.0050 1051 HIS A CG  
1549 N ND1 . HIS A 208 ? 0.1823 0.2303 0.1601 0.0196  -0.0063 -0.0040 1051 HIS A ND1 
1550 C CD2 . HIS A 208 ? 0.1658 0.2057 0.1404 0.0181  -0.0027 -0.0008 1051 HIS A CD2 
1551 C CE1 . HIS A 208 ? 0.2004 0.2424 0.1764 0.0209  -0.0045 0.0006  1051 HIS A CE1 
1552 N NE2 . HIS A 208 ? 0.1762 0.2134 0.1506 0.0198  -0.0023 0.0025  1051 HIS A NE2 
1553 N N   . LEU A 209 ? 0.1519 0.2150 0.1270 0.0162  -0.0092 -0.0199 1052 LEU A N   
1554 C CA  . LEU A 209 ? 0.1315 0.2004 0.1097 0.0141  -0.0108 -0.0263 1052 LEU A CA  
1555 C C   . LEU A 209 ? 0.1616 0.2366 0.1344 0.0176  -0.0127 -0.0289 1052 LEU A C   
1556 O O   . LEU A 209 ? 0.1813 0.2637 0.1562 0.0172  -0.0152 -0.0345 1052 LEU A O   
1557 C CB  . LEU A 209 ? 0.1402 0.2041 0.1222 0.0095  -0.0085 -0.0279 1052 LEU A CB  
1558 C CG  . LEU A 209 ? 0.1088 0.1675 0.0965 0.0059  -0.0069 -0.0264 1052 LEU A CG  
1559 C CD1 . LEU A 209 ? 0.1417 0.1964 0.1329 0.0018  -0.0050 -0.0287 1052 LEU A CD1 
1560 C CD2 . LEU A 209 ? 0.1594 0.2229 0.1516 0.0052  -0.0086 -0.0285 1052 LEU A CD2 
1561 N N   . GLY A 210 ? 0.1360 0.2080 0.1017 0.0209  -0.0114 -0.0251 1053 GLY A N   
1562 C CA  . GLY A 210 ? 0.1814 0.2581 0.1408 0.0242  -0.0127 -0.0271 1053 GLY A CA  
1563 C C   . GLY A 210 ? 0.1733 0.2489 0.1329 0.0217  -0.0114 -0.0308 1053 GLY A C   
1564 O O   . GLY A 210 ? 0.1709 0.2443 0.1367 0.0170  -0.0104 -0.0335 1053 GLY A O   
1565 N N   . PHE A 211 ? 0.1755 0.2513 0.1297 0.0245  -0.0110 -0.0301 1054 PHE A N   
1566 C CA  . PHE A 211 ? 0.1542 0.2287 0.1079 0.0227  -0.0095 -0.0333 1054 PHE A CA  
1567 C C   . PHE A 211 ? 0.1392 0.2179 0.0996 0.0192  -0.0113 -0.0403 1054 PHE A C   
1568 O O   . PHE A 211 ? 0.1837 0.2594 0.1474 0.0154  -0.0097 -0.0430 1054 PHE A O   
1569 C CB  . PHE A 211 ? 0.1783 0.2532 0.1247 0.0268  -0.0091 -0.0315 1054 PHE A CB  
1570 C CG  . PHE A 211 ? 0.1746 0.2484 0.1201 0.0253  -0.0076 -0.0348 1054 PHE A CG  
1571 C CD1 . PHE A 211 ? 0.1889 0.2567 0.1323 0.0244  -0.0038 -0.0324 1054 PHE A CD1 
1572 C CD2 . PHE A 211 ? 0.1762 0.2550 0.1234 0.0248  -0.0099 -0.0405 1054 PHE A CD2 
1573 C CE1 . PHE A 211 ? 0.2792 0.3458 0.2219 0.0232  -0.0023 -0.0355 1054 PHE A CE1 
1574 C CE2 . PHE A 211 ? 0.1935 0.2708 0.1399 0.0235  -0.0084 -0.0436 1054 PHE A CE2 
1575 C CZ  . PHE A 211 ? 0.2989 0.3700 0.2429 0.0228  -0.0046 -0.0411 1054 PHE A CZ  
1576 N N   . ASP A 212 ? 0.1677 0.2530 0.1301 0.0205  -0.0144 -0.0431 1055 ASP A N   
1577 C CA  . ASP A 212 ? 0.1679 0.2575 0.1370 0.0174  -0.0158 -0.0496 1055 ASP A CA  
1578 C C   . ASP A 212 ? 0.1388 0.2258 0.1157 0.0120  -0.0147 -0.0519 1055 ASP A C   
1579 O O   . ASP A 212 ? 0.1780 0.2635 0.1591 0.0084  -0.0136 -0.0559 1055 ASP A O   
1580 C CB  . ASP A 212 ? 0.1841 0.2817 0.1548 0.0199  -0.0192 -0.0519 1055 ASP A CB  
1581 C CG  . ASP A 212 ? 0.3091 0.4096 0.2725 0.0247  -0.0204 -0.0513 1055 ASP A CG  
1582 O OD1 . ASP A 212 ? 0.2890 0.3858 0.2470 0.0255  -0.0187 -0.0502 1055 ASP A OD1 
1583 O OD2 . ASP A 212 ? 0.3097 0.4164 0.2730 0.0279  -0.0231 -0.0520 1055 ASP A OD2 
1584 N N   . ALA A 213 ? 0.2015 0.2876 0.1804 0.0115  -0.0147 -0.0491 1056 ALA A N   
1585 C CA  . ALA A 213 ? 0.1777 0.2610 0.1637 0.0066  -0.0134 -0.0507 1056 ALA A CA  
1586 C C   . ALA A 213 ? 0.1582 0.2340 0.1434 0.0040  -0.0103 -0.0499 1056 ALA A C   
1587 O O   . ALA A 213 ? 0.1499 0.2230 0.1408 -0.0003 -0.0089 -0.0530 1056 ALA A O   
1588 C CB  . ALA A 213 ? 0.2224 0.3061 0.2097 0.0072  -0.0141 -0.0475 1056 ALA A CB  
1589 N N   . MET A 214 ? 0.1908 0.2620 0.1700 0.0066  -0.0087 -0.0448 1057 MET A N   
1590 C CA  . MET A 214 ? 0.1441 0.2072 0.1244 0.0044  -0.0053 -0.0424 1057 MET A CA  
1591 C C   . MET A 214 ? 0.1710 0.2344 0.1509 0.0032  -0.0046 -0.0473 1057 MET A C   
1592 O O   . MET A 214 ? 0.1653 0.2235 0.1494 0.0000  -0.0024 -0.0483 1057 MET A O   
1593 C CB  . MET A 214 ? 0.1229 0.1813 0.0980 0.0073  -0.0035 -0.0357 1057 MET A CB  
1594 C CG  . MET A 214 ? 0.1698 0.2266 0.1460 0.0078  -0.0038 -0.0309 1057 MET A CG  
1595 S SD  . MET A 214 ? 0.1472 0.1978 0.1191 0.0103  -0.0012 -0.0234 1057 MET A SD  
1596 C CE  . MET A 214 ? 0.1172 0.1602 0.0939 0.0064  0.0018  -0.0226 1057 MET A CE  
1597 N N   . ASN A 215 ? 0.1663 0.2354 0.1414 0.0061  -0.0063 -0.0501 1058 ASN A N   
1598 C CA  . ASN A 215 ? 0.1952 0.2643 0.1709 0.0052  -0.0058 -0.0543 1058 ASN A CA  
1599 C C   . ASN A 215 ? 0.1884 0.2587 0.1725 0.0009  -0.0064 -0.0597 1058 ASN A C   
1600 O O   . ASN A 215 ? 0.2186 0.2853 0.2054 -0.0016 -0.0045 -0.0625 1058 ASN A O   
1601 C CB  . ASN A 215 ? 0.2129 0.2866 0.1825 0.0094  -0.0075 -0.0544 1058 ASN A CB  
1602 C CG  . ASN A 215 ? 0.2827 0.3558 0.2515 0.0088  -0.0067 -0.0582 1058 ASN A CG  
1603 O OD1 . ASN A 215 ? 0.2682 0.3363 0.2345 0.0088  -0.0038 -0.0569 1058 ASN A OD1 
1604 N ND2 . ASN A 215 ? 0.3434 0.4219 0.3148 0.0085  -0.0090 -0.0630 1058 ASN A ND2 
1605 N N   . ARG A 216 ? 0.2064 0.2813 0.1948 0.0002  -0.0085 -0.0608 1059 ARG A N   
1606 C CA  . ARG A 216 ? 0.1720 0.2478 0.1689 -0.0039 -0.0083 -0.0652 1059 ARG A CA  
1607 C C   . ARG A 216 ? 0.2201 0.2883 0.2213 -0.0080 -0.0054 -0.0645 1059 ARG A C   
1608 O O   . ARG A 216 ? 0.2209 0.2863 0.2272 -0.0113 -0.0037 -0.0676 1059 ARG A O   
1609 C CB  . ARG A 216 ? 0.2490 0.3313 0.2498 -0.0036 -0.0107 -0.0661 1059 ARG A CB  
1610 C CG  . ARG A 216 ? 0.3859 0.4762 0.3850 -0.0004 -0.0136 -0.0686 1059 ARG A CG  
1611 C CD  . ARG A 216 ? 0.4001 0.4967 0.4054 -0.0011 -0.0153 -0.0709 1059 ARG A CD  
1612 N NE  . ARG A 216 ? 0.4495 0.5467 0.4540 0.0005  -0.0160 -0.0668 1059 ARG A NE  
1613 C CZ  . ARG A 216 ? 0.4364 0.5375 0.4357 0.0053  -0.0183 -0.0640 1059 ARG A CZ  
1614 N NH1 . ARG A 216 ? 0.5155 0.6203 0.5096 0.0090  -0.0200 -0.0647 1059 ARG A NH1 
1615 N NH2 . ARG A 216 ? 0.4345 0.5354 0.4335 0.0064  -0.0187 -0.0604 1059 ARG A NH2 
1616 N N   . ALA A 217 ? 0.2140 0.2789 0.2131 -0.0076 -0.0046 -0.0601 1060 ALA A N   
1617 C CA  . ALA A 217 ? 0.2011 0.2582 0.2038 -0.0109 -0.0018 -0.0581 1060 ALA A CA  
1618 C C   . ALA A 217 ? 0.1985 0.2494 0.2000 -0.0114 0.0008  -0.0582 1060 ALA A C   
1619 O O   . ALA A 217 ? 0.2062 0.2516 0.2124 -0.0146 0.0030  -0.0592 1060 ALA A O   
1620 C CB  . ALA A 217 ? 0.1675 0.2213 0.1685 -0.0093 -0.0014 -0.0510 1060 ALA A CB  
1621 N N   . LEU A 218 ? 0.1535 0.2054 0.1488 -0.0080 0.0007  -0.0571 1061 LEU A N   
1622 C CA  . LEU A 218 ? 0.1532 0.2001 0.1474 -0.0081 0.0032  -0.0574 1061 LEU A CA  
1623 C C   . LEU A 218 ? 0.2019 0.2494 0.1998 -0.0106 0.0035  -0.0640 1061 LEU A C   
1624 O O   . LEU A 218 ? 0.2288 0.2702 0.2299 -0.0128 0.0060  -0.0649 1061 LEU A O   
1625 C CB  . LEU A 218 ? 0.1568 0.2055 0.1434 -0.0039 0.0031  -0.0552 1061 LEU A CB  
1626 C CG  . LEU A 218 ? 0.1714 0.2162 0.1564 -0.0035 0.0057  -0.0560 1061 LEU A CG  
1627 C CD1 . LEU A 218 ? 0.2001 0.2367 0.1889 -0.0051 0.0086  -0.0520 1061 LEU A CD1 
1628 C CD2 . LEU A 218 ? 0.2142 0.2615 0.1912 0.0008  0.0059  -0.0538 1061 LEU A CD2 
1629 N N   . ASP A 219 ? 0.2172 0.2714 0.2156 -0.0100 0.0009  -0.0670 1062 ASP A N   
1630 C CA  . ASP A 219 ? 0.2330 0.2879 0.2358 -0.0121 0.0012  -0.0720 1062 ASP A CA  
1631 C C   . ASP A 219 ? 0.2510 0.3021 0.2619 -0.0165 0.0029  -0.0732 1062 ASP A C   
1632 O O   . ASP A 219 ? 0.3127 0.3594 0.3271 -0.0187 0.0050  -0.0755 1062 ASP A O   
1633 C CB  . ASP A 219 ? 0.2824 0.3460 0.2844 -0.0102 -0.0020 -0.0751 1062 ASP A CB  
1634 C CG  . ASP A 219 ? 0.3692 0.4355 0.3629 -0.0059 -0.0032 -0.0743 1062 ASP A CG  
1635 O OD1 . ASP A 219 ? 0.4235 0.4850 0.4136 -0.0051 -0.0010 -0.0731 1062 ASP A OD1 
1636 O OD2 . ASP A 219 ? 0.4571 0.5304 0.4482 -0.0032 -0.0061 -0.0749 1062 ASP A OD2 
1637 N N   . LYS A 220 ? 0.2613 0.3140 0.2750 -0.0175 0.0021  -0.0715 1063 LYS A N   
1638 C CA  . LYS A 220 ? 0.3026 0.3520 0.3236 -0.0214 0.0040  -0.0722 1063 LYS A CA  
1639 C C   . LYS A 220 ? 0.2983 0.3380 0.3203 -0.0233 0.0073  -0.0693 1063 LYS A C   
1640 O O   . LYS A 220 ? 0.3516 0.3865 0.3783 -0.0259 0.0098  -0.0705 1063 LYS A O   
1641 C CB  . LYS A 220 ? 0.3714 0.4253 0.3948 -0.0218 0.0025  -0.0711 1063 LYS A CB  
1642 C CG  . LYS A 220 ? 0.5178 0.5672 0.5477 -0.0255 0.0052  -0.0706 1063 LYS A CG  
1643 C CD  . LYS A 220 ? 0.6314 0.6872 0.6658 -0.0263 0.0040  -0.0724 1063 LYS A CD  
1644 C CE  . LYS A 220 ? 0.7101 0.7695 0.7418 -0.0242 0.0019  -0.0692 1063 LYS A CE  
1645 N NZ  . LYS A 220 ? 0.7382 0.8031 0.7749 -0.0251 0.0013  -0.0707 1063 LYS A NZ  
1646 N N   . GLN A 221 ? 0.2359 0.2727 0.2535 -0.0216 0.0074  -0.0653 1064 GLN A N   
1647 C CA  . GLN A 221 ? 0.2608 0.2886 0.2793 -0.0229 0.0102  -0.0622 1064 GLN A CA  
1648 C C   . GLN A 221 ? 0.2405 0.2629 0.2580 -0.0224 0.0124  -0.0628 1064 GLN A C   
1649 O O   . GLN A 221 ? 0.3270 0.3416 0.3467 -0.0237 0.0149  -0.0609 1064 GLN A O   
1650 C CB  . GLN A 221 ? 0.2619 0.2889 0.2771 -0.0206 0.0095  -0.0555 1064 GLN A CB  
1651 C CG  . GLN A 221 ? 0.2834 0.3148 0.3003 -0.0213 0.0077  -0.0547 1064 GLN A CG  
1652 C CD  . GLN A 221 ? 0.3032 0.3349 0.3164 -0.0185 0.0066  -0.0485 1064 GLN A CD  
1653 O OE1 . GLN A 221 ? 0.3178 0.3455 0.3279 -0.0166 0.0075  -0.0444 1064 GLN A OE1 
1654 N NE2 . GLN A 221 ? 0.2947 0.3311 0.3085 -0.0183 0.0049  -0.0482 1064 GLN A NE2 
1655 N N   . LYS A 222 ? 0.2377 0.2641 0.2516 -0.0202 0.0113  -0.0653 1065 LYS A N   
1656 C CA  . LYS A 222 ? 0.3100 0.3321 0.3230 -0.0195 0.0134  -0.0663 1065 LYS A CA  
1657 C C   . LYS A 222 ? 0.4025 0.4172 0.4146 -0.0185 0.0157  -0.0614 1065 LYS A C   
1658 O O   . LYS A 222 ? 0.3295 0.3375 0.3444 -0.0196 0.0182  -0.0617 1065 LYS A O   
1659 C CB  . LYS A 222 ? 0.3754 0.3947 0.3938 -0.0222 0.0148  -0.0695 1065 LYS A CB  
1660 C CG  . LYS A 222 ? 0.3899 0.4164 0.4102 -0.0230 0.0128  -0.0740 1065 LYS A CG  
1661 C CD  . LYS A 222 ? 0.4020 0.4252 0.4278 -0.0257 0.0149  -0.0772 1065 LYS A CD  
1662 C CE  . LYS A 222 ? 0.4828 0.5135 0.5103 -0.0261 0.0129  -0.0824 1065 LYS A CE  
1663 N NZ  . LYS A 222 ? 0.5668 0.6038 0.5968 -0.0270 0.0109  -0.0827 1065 LYS A NZ  
1664 N N   . PRO A 223 ? 0.2785 0.2945 0.2873 -0.0161 0.0147  -0.0557 1066 PRO A N   
1665 C CA  . PRO A 223 ? 0.2087 0.2185 0.2176 -0.0149 0.0164  -0.0503 1066 PRO A CA  
1666 C C   . PRO A 223 ? 0.2314 0.2400 0.2384 -0.0130 0.0181  -0.0514 1066 PRO A C   
1667 O O   . PRO A 223 ? 0.2817 0.2945 0.2860 -0.0121 0.0177  -0.0556 1066 PRO A O   
1668 C CB  . PRO A 223 ? 0.2594 0.2721 0.2653 -0.0129 0.0148  -0.0450 1066 PRO A CB  
1669 C CG  . PRO A 223 ? 0.2285 0.2486 0.2304 -0.0114 0.0128  -0.0476 1066 PRO A CG  
1670 C CD  . PRO A 223 ? 0.2862 0.3089 0.2909 -0.0140 0.0121  -0.0540 1066 PRO A CD  
1671 N N   . ALA A 224 ? 0.3142 0.3172 0.3226 -0.0121 0.0199  -0.0478 1067 ALA A N   
1672 C CA  . ALA A 224 ? 0.2982 0.3001 0.3052 -0.0099 0.0217  -0.0481 1067 ALA A CA  
1673 C C   . ALA A 224 ? 0.3040 0.3110 0.3061 -0.0072 0.0210  -0.0457 1067 ALA A C   
1674 O O   . ALA A 224 ? 0.2607 0.2703 0.2611 -0.0068 0.0194  -0.0424 1067 ALA A O   
1675 C CB  . ALA A 224 ? 0.2864 0.2819 0.2967 -0.0095 0.0235  -0.0444 1067 ALA A CB  
1676 N N   . SER A 225 ? 0.1969 0.2049 0.1966 -0.0052 0.0226  -0.0473 1068 SER A N   
1677 C CA  . SER A 225 ? 0.2272 0.2391 0.2220 -0.0025 0.0228  -0.0447 1068 SER A CA  
1678 C C   . SER A 225 ? 0.2041 0.2222 0.1940 -0.0018 0.0204  -0.0460 1068 SER A C   
1679 O O   . SER A 225 ? 0.2133 0.2337 0.1999 -0.0002 0.0198  -0.0420 1068 SER A O   
1680 C CB  . SER A 225 ? 0.3484 0.3583 0.3448 -0.0017 0.0233  -0.0383 1068 SER A CB  
1681 O OG  . SER A 225 ? 0.4143 0.4194 0.4151 -0.0017 0.0252  -0.0372 1068 SER A OG  
1682 N N   . LYS A 226 ? 0.2073 0.2278 0.1969 -0.0031 0.0191  -0.0518 1069 LYS A N   
1683 C CA  . LYS A 226 ? 0.2104 0.2376 0.1957 -0.0023 0.0164  -0.0538 1069 LYS A CA  
1684 C C   . LYS A 226 ? 0.2705 0.3016 0.2485 0.0015  0.0167  -0.0519 1069 LYS A C   
1685 O O   . LYS A 226 ? 0.2228 0.2579 0.1970 0.0031  0.0149  -0.0498 1069 LYS A O   
1686 C CB  . LYS A 226 ? 0.2601 0.2899 0.2467 -0.0041 0.0152  -0.0613 1069 LYS A CB  
1687 C CG  . LYS A 226 ? 0.3942 0.4317 0.3768 -0.0029 0.0119  -0.0637 1069 LYS A CG  
1688 C CD  . LYS A 226 ? 0.4729 0.5123 0.4593 -0.0051 0.0101  -0.0690 1069 LYS A CD  
1689 C CE  . LYS A 226 ? 0.5427 0.5784 0.5370 -0.0093 0.0105  -0.0701 1069 LYS A CE  
1690 N NZ  . LYS A 226 ? 0.3849 0.4235 0.3809 -0.0102 0.0085  -0.0684 1069 LYS A NZ  
1691 N N   . LYS A 227 ? 0.2442 0.2737 0.2202 0.0030  0.0194  -0.0526 1070 LYS A N   
1692 C CA  . LYS A 227 ? 0.2367 0.2693 0.2054 0.0066  0.0205  -0.0507 1070 LYS A CA  
1693 C C   . LYS A 227 ? 0.1885 0.2201 0.1562 0.0080  0.0213  -0.0434 1070 LYS A C   
1694 O O   . LYS A 227 ? 0.2240 0.2589 0.1855 0.0107  0.0208  -0.0411 1070 LYS A O   
1695 C CB  . LYS A 227 ? 0.2382 0.2690 0.2058 0.0078  0.0237  -0.0527 1070 LYS A CB  
1696 C CG  . LYS A 227 ? 0.4084 0.4405 0.3751 0.0073  0.0228  -0.0595 1070 LYS A CG  
1697 C CD  . LYS A 227 ? 0.5268 0.5568 0.4916 0.0090  0.0259  -0.0604 1070 LYS A CD  
1698 C CE  . LYS A 227 ? 0.6270 0.6581 0.5904 0.0087  0.0244  -0.0658 1070 LYS A CE  
1699 N NZ  . LYS A 227 ? 0.7036 0.7329 0.6640 0.0108  0.0274  -0.0666 1070 LYS A NZ  
1700 N N   . ASP A 228 ? 0.1822 0.2090 0.1559 0.0064  0.0225  -0.0398 1071 ASP A N   
1701 C CA  . ASP A 228 ? 0.1829 0.2083 0.1567 0.0071  0.0232  -0.0334 1071 ASP A CA  
1702 C C   . ASP A 228 ? 0.1883 0.2156 0.1617 0.0067  0.0202  -0.0314 1071 ASP A C   
1703 O O   . ASP A 228 ? 0.1906 0.2188 0.1608 0.0084  0.0204  -0.0272 1071 ASP A O   
1704 C CB  . ASP A 228 ? 0.2004 0.2208 0.1808 0.0057  0.0250  -0.0307 1071 ASP A CB  
1705 C CG  . ASP A 228 ? 0.3349 0.3540 0.3160 0.0067  0.0282  -0.0322 1071 ASP A CG  
1706 O OD1 . ASP A 228 ? 0.3212 0.3418 0.2983 0.0089  0.0305  -0.0305 1071 ASP A OD1 
1707 O OD2 . ASP A 228 ? 0.3513 0.3676 0.3367 0.0053  0.0286  -0.0352 1071 ASP A OD2 
1708 N N   . ILE A 229 ? 0.1578 0.1853 0.1346 0.0043  0.0178  -0.0345 1072 ILE A N   
1709 C CA  . ILE A 229 ? 0.1646 0.1943 0.1413 0.0039  0.0151  -0.0332 1072 ILE A CA  
1710 C C   . ILE A 229 ? 0.1889 0.2245 0.1587 0.0067  0.0134  -0.0344 1072 ILE A C   
1711 O O   . ILE A 229 ? 0.1479 0.1850 0.1149 0.0084  0.0125  -0.0307 1072 ILE A O   
1712 C CB  . ILE A 229 ? 0.1254 0.1544 0.1076 0.0006  0.0133  -0.0366 1072 ILE A CB  
1713 C CG1 . ILE A 229 ? 0.1830 0.2058 0.1711 -0.0015 0.0149  -0.0345 1072 ILE A CG1 
1714 C CG2 . ILE A 229 ? 0.1423 0.1744 0.1244 0.0004  0.0106  -0.0358 1072 ILE A CG2 
1715 C CD1 . ILE A 229 ? 0.2113 0.2320 0.2043 -0.0046 0.0145  -0.0383 1072 ILE A CD1 
1716 N N   . LEU A 230 ? 0.1758 0.2148 0.1428 0.0074  0.0130  -0.0397 1073 LEU A N   
1717 C CA  . LEU A 230 ? 0.1336 0.1787 0.0934 0.0105  0.0111  -0.0412 1073 LEU A CA  
1718 C C   . LEU A 230 ? 0.1527 0.1972 0.1059 0.0142  0.0133  -0.0359 1073 LEU A C   
1719 O O   . LEU A 230 ? 0.1485 0.1960 0.0965 0.0170  0.0119  -0.0335 1073 LEU A O   
1720 C CB  . LEU A 230 ? 0.1301 0.1787 0.0878 0.0106  0.0104  -0.0483 1073 LEU A CB  
1721 C CG  . LEU A 230 ? 0.1269 0.1808 0.0782 0.0139  0.0078  -0.0487 1073 LEU A CG  
1722 C CD1 . LEU A 230 ? 0.1657 0.2237 0.1180 0.0140  0.0041  -0.0483 1073 LEU A CD1 
1723 C CD2 . LEU A 230 ? 0.2010 0.2564 0.1525 0.0133  0.0069  -0.0543 1073 LEU A CD2 
1724 N N   . ALA A 231 ? 0.1455 0.1859 0.0993 0.0142  0.0169  -0.0338 1074 ALA A N   
1725 C CA  . ALA A 231 ? 0.1875 0.2268 0.1361 0.0172  0.0197  -0.0286 1074 ALA A CA  
1726 C C   . ALA A 231 ? 0.1496 0.1872 0.0991 0.0174  0.0194  -0.0228 1074 ALA A C   
1727 O O   . ALA A 231 ? 0.1674 0.2061 0.1107 0.0205  0.0199  -0.0193 1074 ALA A O   
1728 C CB  . ALA A 231 ? 0.1976 0.2328 0.1488 0.0165  0.0238  -0.0275 1074 ALA A CB  
1729 N N   . ALA A 232 ? 0.1563 0.1909 0.1132 0.0143  0.0185  -0.0218 1075 ALA A N   
1730 C CA  . ALA A 232 ? 0.1257 0.1584 0.0842 0.0142  0.0180  -0.0169 1075 ALA A CA  
1731 C C   . ALA A 232 ? 0.1227 0.1596 0.0771 0.0160  0.0148  -0.0172 1075 ALA A C   
1732 O O   . ALA A 232 ? 0.1476 0.1841 0.0988 0.0182  0.0151  -0.0128 1075 ALA A O   
1733 C CB  . ALA A 232 ? 0.1421 0.1713 0.1088 0.0105  0.0174  -0.0166 1075 ALA A CB  
1734 N N   . LEU A 233 ? 0.1494 0.1905 0.1044 0.0152  0.0118  -0.0225 1076 LEU A N   
1735 C CA  . LEU A 233 ? 0.1330 0.1792 0.0848 0.0172  0.0084  -0.0234 1076 LEU A CA  
1736 C C   . LEU A 233 ? 0.1670 0.2162 0.1095 0.0219  0.0088  -0.0219 1076 LEU A C   
1737 O O   . LEU A 233 ? 0.1625 0.2132 0.1010 0.0248  0.0077  -0.0187 1076 LEU A O   
1738 C CB  . LEU A 233 ? 0.1278 0.1785 0.0828 0.0151  0.0054  -0.0301 1076 LEU A CB  
1739 C CG  . LEU A 233 ? 0.1065 0.1542 0.0702 0.0105  0.0051  -0.0319 1076 LEU A CG  
1740 C CD1 . LEU A 233 ? 0.1510 0.2037 0.1174 0.0088  0.0025  -0.0387 1076 LEU A CD1 
1741 C CD2 . LEU A 233 ? 0.1350 0.1804 0.1019 0.0097  0.0047  -0.0276 1076 LEU A CD2 
1742 N N   . GLU A 234 ? 0.1200 0.1697 0.0585 0.0230  0.0106  -0.0240 1077 GLU A N   
1743 C CA  . GLU A 234 ? 0.1626 0.2139 0.0931 0.0271  0.0109  -0.0221 1077 GLU A CA  
1744 C C   . GLU A 234 ? 0.1705 0.2173 0.0975 0.0293  0.0144  -0.0149 1077 GLU A C   
1745 O O   . GLU A 234 ? 0.2167 0.2637 0.1383 0.0326  0.0139  -0.0117 1077 GLU A O   
1746 C CB  . GLU A 234 ? 0.2087 0.2605 0.1372 0.0271  0.0118  -0.0260 1077 GLU A CB  
1747 C CG  . GLU A 234 ? 0.1567 0.2131 0.0878 0.0256  0.0080  -0.0329 1077 GLU A CG  
1748 C CD  . GLU A 234 ? 0.3571 0.4134 0.2873 0.0250  0.0091  -0.0372 1077 GLU A CD  
1749 O OE1 . GLU A 234 ? 0.3085 0.3608 0.2384 0.0246  0.0130  -0.0359 1077 GLU A OE1 
1750 O OE2 . GLU A 234 ? 0.4383 0.4988 0.3684 0.0251  0.0061  -0.0420 1077 GLU A OE2 
1751 N N   . LYS A 235 ? 0.1734 0.2157 0.1045 0.0272  0.0178  -0.0124 1078 LYS A N   
1752 C CA  . LYS A 235 ? 0.1774 0.2150 0.1070 0.0285  0.0215  -0.0057 1078 LYS A CA  
1753 C C   . LYS A 235 ? 0.2315 0.2682 0.1611 0.0295  0.0199  -0.0018 1078 LYS A C   
1754 O O   . LYS A 235 ? 0.2110 0.2451 0.1364 0.0320  0.0218  0.0032  1078 LYS A O   
1755 C CB  . LYS A 235 ? 0.2585 0.2910 0.1956 0.0250  0.0248  -0.0044 1078 LYS A CB  
1756 C CG  . LYS A 235 ? 0.3267 0.3547 0.2634 0.0258  0.0290  0.0018  1078 LYS A CG  
1757 C CD  . LYS A 235 ? 0.3495 0.3738 0.2946 0.0223  0.0316  0.0023  1078 LYS A CD  
1758 C CE  . LYS A 235 ? 0.4459 0.4661 0.3915 0.0227  0.0362  0.0079  1078 LYS A CE  
1759 N NZ  . LYS A 235 ? 0.4666 0.4843 0.4210 0.0195  0.0384  0.0079  1078 LYS A NZ  
1760 N N   . ALA A 236 ? 0.1790 0.2171 0.1141 0.0271  0.0163  -0.0041 1079 ALA A N   
1761 C CA  . ALA A 236 ? 0.1725 0.2097 0.1088 0.0277  0.0148  -0.0009 1079 ALA A CA  
1762 C C   . ALA A 236 ? 0.2490 0.2913 0.1783 0.0320  0.0119  -0.0012 1079 ALA A C   
1763 O O   . ALA A 236 ? 0.2018 0.2423 0.1289 0.0343  0.0119  0.0031  1079 ALA A O   
1764 C CB  . ALA A 236 ? 0.1741 0.2108 0.1190 0.0236  0.0125  -0.0032 1079 ALA A CB  
1765 N N   . ARG A 237 ? 0.2316 0.2792 0.1596 0.0324  0.0090  -0.0064 1080 ARG A N   
1766 C CA  . ARG A 237 ? 0.2836 0.3360 0.2090 0.0353  0.0051  -0.0077 1080 ARG A CA  
1767 C C   . ARG A 237 ? 0.2769 0.3273 0.1963 0.0398  0.0061  -0.0023 1080 ARG A C   
1768 O O   . ARG A 237 ? 0.2345 0.2864 0.1534 0.0421  0.0039  -0.0007 1080 ARG A O   
1769 C CB  . ARG A 237 ? 0.3363 0.3939 0.2615 0.0350  0.0027  -0.0139 1080 ARG A CB  
1770 C CG  . ARG A 237 ? 0.3364 0.4004 0.2613 0.0371  -0.0017 -0.0166 1080 ARG A CG  
1771 C CD  . ARG A 237 ? 0.3684 0.4367 0.2923 0.0371  -0.0033 -0.0220 1080 ARG A CD  
1772 N NE  . ARG A 237 ? 0.5114 0.5868 0.4375 0.0381  -0.0077 -0.0262 1080 ARG A NE  
1773 C CZ  . ARG A 237 ? 0.4544 0.5347 0.3815 0.0375  -0.0098 -0.0319 1080 ARG A CZ  
1774 N NH1 . ARG A 237 ? 0.4735 0.5517 0.3991 0.0361  -0.0078 -0.0340 1080 ARG A NH1 
1775 N NH2 . ARG A 237 ? 0.5111 0.5982 0.4410 0.0384  -0.0136 -0.0356 1080 ARG A NH2 
1776 N N   . PRO A 238 ? 0.2742 0.3211 0.1892 0.0411  0.0096  0.0003  1081 PRO A N   
1777 C CA  . PRO A 238 ? 0.2304 0.2751 0.1396 0.0453  0.0108  0.0052  1081 PRO A CA  
1778 C C   . PRO A 238 ? 0.3262 0.3654 0.2367 0.0457  0.0128  0.0110  1081 PRO A C   
1779 O O   . PRO A 238 ? 0.3487 0.3859 0.2553 0.0492  0.0136  0.0150  1081 PRO A O   
1780 C CB  . PRO A 238 ? 0.2996 0.3414 0.2047 0.0457  0.0146  0.0064  1081 PRO A CB  
1781 C CG  . PRO A 238 ? 0.3308 0.3712 0.2407 0.0414  0.0166  0.0039  1081 PRO A CG  
1782 C CD  . PRO A 238 ? 0.2593 0.3044 0.1743 0.0390  0.0126  -0.0014 1081 PRO A CD  
1783 N N   . ASN A 239 ? 0.3060 0.3429 0.2222 0.0422  0.0137  0.0112  1082 ASN A N   
1784 C CA  . ASN A 239 ? 0.3203 0.3519 0.2387 0.0420  0.0157  0.0163  1082 ASN A CA  
1785 C C   . ASN A 239 ? 0.2961 0.3302 0.2173 0.0423  0.0121  0.0154  1082 ASN A C   
1786 O O   . ASN A 239 ? 0.3273 0.3572 0.2507 0.0421  0.0132  0.0191  1082 ASN A O   
1787 C CB  . ASN A 239 ? 0.3060 0.3326 0.2290 0.0382  0.0195  0.0179  1082 ASN A CB  
1788 C CG  . ASN A 239 ? 0.4035 0.4263 0.3243 0.0384  0.0240  0.0202  1082 ASN A CG  
1789 O OD1 . ASN A 239 ? 0.4610 0.4806 0.3782 0.0410  0.0260  0.0242  1082 ASN A OD1 
1790 N ND2 . ASN A 239 ? 0.3846 0.4080 0.3077 0.0358  0.0256  0.0176  1082 ASN A ND2 
1791 N N   . LEU A 240 ? 0.2217 0.2628 0.1434 0.0426  0.0077  0.0104  1083 LEU A N   
1792 C CA  . LEU A 240 ? 0.2129 0.2574 0.1375 0.0431  0.0042  0.0091  1083 LEU A CA  
1793 C C   . LEU A 240 ? 0.2831 0.3266 0.2042 0.0477  0.0038  0.0129  1083 LEU A C   
1794 O O   . LEU A 240 ? 0.3292 0.3722 0.2451 0.0509  0.0048  0.0146  1083 LEU A O   
1795 C CB  . LEU A 240 ? 0.2250 0.2776 0.1518 0.0423  -0.0001 0.0024  1083 LEU A CB  
1796 C CG  . LEU A 240 ? 0.1911 0.2455 0.1227 0.0375  -0.0005 -0.0024 1083 LEU A CG  
1797 C CD1 . LEU A 240 ? 0.1734 0.2354 0.1071 0.0370  -0.0044 -0.0090 1083 LEU A CD1 
1798 C CD2 . LEU A 240 ? 0.2067 0.2588 0.1444 0.0344  -0.0004 -0.0017 1083 LEU A CD2 
1799 N N   . PRO A 241 ? 0.3074 0.3506 0.2314 0.0481  0.0025  0.0142  1084 PRO A N   
1800 C CA  . PRO A 241 ? 0.4075 0.4502 0.3287 0.0527  0.0020  0.0173  1084 PRO A CA  
1801 C C   . PRO A 241 ? 0.4958 0.5458 0.4140 0.0562  -0.0014 0.0140  1084 PRO A C   
1802 O O   . PRO A 241 ? 0.5049 0.5616 0.4260 0.0545  -0.0046 0.0085  1084 PRO A O   
1803 C CB  . PRO A 241 ? 0.4139 0.4570 0.3400 0.0517  0.0003  0.0172  1084 PRO A CB  
1804 C CG  . PRO A 241 ? 0.3592 0.3993 0.2895 0.0468  0.0018  0.0167  1084 PRO A CG  
1805 C CD  . PRO A 241 ? 0.3404 0.3834 0.2702 0.0445  0.0018  0.0130  1084 PRO A CD  
1806 S S   . SO4 B .   ? 0.3538 0.3714 0.3427 0.0214  -0.0003 0.0105  1101 SO4 A S   
1807 O O1  . SO4 B .   ? 0.3921 0.4079 0.3815 0.0238  0.0000  0.0114  1101 SO4 A O1  
1808 O O2  . SO4 B .   ? 0.3015 0.3127 0.2902 0.0189  0.0014  0.0122  1101 SO4 A O2  
1809 O O3  . SO4 B .   ? 0.4334 0.4546 0.4189 0.0247  -0.0011 0.0115  1101 SO4 A O3  
1810 O O4  . SO4 B .   ? 0.3393 0.3616 0.3313 0.0185  -0.0014 0.0068  1101 SO4 A O4  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   844  ?    ?   ?   A . n 
A 1 2   SER 2   845  ?    ?   ?   A . n 
A 1 3   HIS 3   846  ?    ?   ?   A . n 
A 1 4   MET 4   847  ?    ?   ?   A . n 
A 1 5   MET 5   848  ?    ?   ?   A . n 
A 1 6   ALA 6   849  849  ALA ALA A . n 
A 1 7   ASP 7   850  850  ASP ASP A . n 
A 1 8   LEU 8   851  851  LEU LEU A . n 
A 1 9   LEU 9   852  852  LEU LEU A . n 
A 1 10  PRO 10  853  853  PRO PRO A . n 
A 1 11  ARG 11  854  854  ARG ARG A . n 
A 1 12  VAL 12  855  855  VAL VAL A . n 
A 1 13  ASP 13  856  856  ASP ASP A . n 
A 1 14  ILE 14  857  857  ILE ILE A . n 
A 1 15  ALA 15  858  858  ALA ALA A . n 
A 1 16  PRO 16  859  859  PRO PRO A . n 
A 1 17  GLN 17  860  860  GLN GLN A . n 
A 1 18  ILE 18  861  861  ILE ILE A . n 
A 1 19  THR 19  862  862  THR THR A . n 
A 1 20  GLU 20  863  863  GLU GLU A . n 
A 1 21  ALA 21  864  864  ALA ALA A . n 
A 1 22  LEU 22  865  865  LEU LEU A . n 
A 1 23  LEU 23  866  866  LEU LEU A . n 
A 1 24  LYS 24  867  867  LYS LYS A . n 
A 1 25  GLU 25  868  868  GLU GLU A . n 
A 1 26  MET 26  869  869  MET MET A . n 
A 1 27  SER 27  870  870  SER SER A . n 
A 1 28  ASP 28  871  871  ASP ASP A . n 
A 1 29  LYS 29  872  872  LYS LYS A . n 
A 1 30  ASP 30  873  873  ASP ASP A . n 
A 1 31  TRP 31  874  874  TRP TRP A . n 
A 1 32  LYS 32  875  875  LYS LYS A . n 
A 1 33  THR 33  876  876  THR THR A . n 
A 1 34  ARG 34  877  877  ARG ARG A . n 
A 1 35  ASN 35  878  878  ASN ASN A . n 
A 1 36  GLU 36  879  879  GLU GLU A . n 
A 1 37  GLY 37  880  880  GLY GLY A . n 
A 1 38  LEU 38  881  881  LEU LEU A . n 
A 1 39  THR 39  882  882  THR THR A . n 
A 1 40  LYS 40  883  883  LYS LYS A . n 
A 1 41  LEU 41  884  884  LEU LEU A . n 
A 1 42  GLN 42  885  885  GLN GLN A . n 
A 1 43  ALA 43  886  886  ALA ALA A . n 
A 1 44  ILE 44  887  887  ILE ILE A . n 
A 1 45  ILE 45  888  888  ILE ILE A . n 
A 1 46  SER 46  889  889  SER SER A . n 
A 1 47  GLU 47  890  890  GLU GLU A . n 
A 1 48  ALA 48  891  891  ALA ALA A . n 
A 1 49  ARG 49  892  892  ARG ARG A . n 
A 1 50  LEU 50  893  893  LEU LEU A . n 
A 1 51  ILE 51  894  894  ILE ILE A . n 
A 1 52  LYS 52  895  895  LYS LYS A . n 
A 1 53  PRO 53  896  896  PRO PRO A . n 
A 1 54  SER 54  897  897  SER SER A . n 
A 1 55  ILE 55  898  898  ILE ILE A . n 
A 1 56  GLY 56  899  899  GLY GLY A . n 
A 1 57  ASP 57  900  900  ASP ASP A . n 
A 1 58  LEU 58  901  901  LEU LEU A . n 
A 1 59  ALA 59  902  902  ALA ALA A . n 
A 1 60  PRO 60  903  903  PRO PRO A . n 
A 1 61  ALA 61  904  904  ALA ALA A . n 
A 1 62  LEU 62  905  905  LEU LEU A . n 
A 1 63  ALA 63  906  906  ALA ALA A . n 
A 1 64  HIS 64  907  907  HIS HIS A . n 
A 1 65  ARG 65  908  908  ARG ARG A . n 
A 1 66  LEU 66  909  909  LEU LEU A . n 
A 1 67  VAL 67  910  910  VAL VAL A . n 
A 1 68  ASP 68  911  911  ASP ASP A . n 
A 1 69  SER 69  912  912  SER SER A . n 
A 1 70  ASN 70  913  913  ASN ASN A . n 
A 1 71  ALA 71  914  914  ALA ALA A . n 
A 1 72  LYS 72  915  915  LYS LYS A . n 
A 1 73  ILE 73  916  916  ILE ILE A . n 
A 1 74  ALA 74  917  917  ALA ALA A . n 
A 1 75  GLN 75  918  918  GLN GLN A . n 
A 1 76  THR 76  919  919  THR THR A . n 
A 1 77  THR 77  920  920  THR THR A . n 
A 1 78  LEU 78  921  921  LEU LEU A . n 
A 1 79  ALA 79  922  922  ALA ALA A . n 
A 1 80  ILE 80  923  923  ILE ILE A . n 
A 1 81  CYS 81  924  924  CYS CYS A . n 
A 1 82  GLU 82  925  925  GLU GLU A . n 
A 1 83  GLN 83  926  926  GLN GLN A . n 
A 1 84  LEU 84  927  927  LEU LEU A . n 
A 1 85  ALA 85  928  928  ALA ALA A . n 
A 1 86  THR 86  929  929  THR THR A . n 
A 1 87  ALA 87  930  930  ALA ALA A . n 
A 1 88  MET 88  931  931  MET MET A . n 
A 1 89  GLY 89  932  932  GLY GLY A . n 
A 1 90  ALA 90  933  933  ALA ALA A . n 
A 1 91  GLY 91  934  934  GLY GLY A . n 
A 1 92  CYS 92  935  935  CYS CYS A . n 
A 1 93  ARG 93  936  936  ARG ARG A . n 
A 1 94  ASN 94  937  937  ASN ASN A . n 
A 1 95  HIS 95  938  938  HIS HIS A . n 
A 1 96  VAL 96  939  939  VAL VAL A . n 
A 1 97  ARG 97  940  940  ARG ARG A . n 
A 1 98  ASN 98  941  941  ASN ASN A . n 
A 1 99  LEU 99  942  942  LEU LEU A . n 
A 1 100 PHE 100 943  943  PHE PHE A . n 
A 1 101 PRO 101 944  944  PRO PRO A . n 
A 1 102 GLY 102 945  945  GLY GLY A . n 
A 1 103 PHE 103 946  946  PHE PHE A . n 
A 1 104 LEU 104 947  947  LEU LEU A . n 
A 1 105 HIS 105 948  948  HIS HIS A . n 
A 1 106 ALA 106 949  949  ALA ALA A . n 
A 1 107 LEU 107 950  950  LEU LEU A . n 
A 1 108 GLY 108 951  951  GLY GLY A . n 
A 1 109 ASP 109 952  952  ASP ASP A . n 
A 1 110 ASN 110 953  953  ASN ASN A . n 
A 1 111 LYS 111 954  954  LYS LYS A . n 
A 1 112 SER 112 955  955  SER SER A . n 
A 1 113 PHE 113 956  956  PHE PHE A . n 
A 1 114 VAL 114 957  957  VAL VAL A . n 
A 1 115 ARG 115 958  958  ARG ARG A . n 
A 1 116 ALA 116 959  959  ALA ALA A . n 
A 1 117 ALA 117 960  960  ALA ALA A . n 
A 1 118 ALA 118 961  961  ALA ALA A . n 
A 1 119 LEU 119 962  962  LEU LEU A . n 
A 1 120 ASN 120 963  963  ASN ASN A . n 
A 1 121 CYS 121 964  964  CYS CYS A . n 
A 1 122 ILE 122 965  965  ILE ILE A . n 
A 1 123 ASN 123 966  966  ASN ASN A . n 
A 1 124 SER 124 967  967  SER SER A . n 
A 1 125 PHE 125 968  968  PHE PHE A . n 
A 1 126 GLY 126 969  969  GLY GLY A . n 
A 1 127 GLU 127 970  970  GLU GLU A . n 
A 1 128 LYS 128 971  971  LYS LYS A . n 
A 1 129 GLY 129 972  972  GLY GLY A . n 
A 1 130 GLY 130 973  973  GLY GLY A . n 
A 1 131 TYR 131 974  974  TYR TYR A . n 
A 1 132 LYS 132 975  975  LYS LYS A . n 
A 1 133 GLU 133 976  976  GLU GLU A . n 
A 1 134 PHE 134 977  977  PHE PHE A . n 
A 1 135 PHE 135 978  978  PHE PHE A . n 
A 1 136 GLU 136 979  979  GLU GLU A . n 
A 1 137 SER 137 980  980  SER SER A . n 
A 1 138 GLU 138 981  981  GLU GLU A . n 
A 1 139 MET 139 982  982  MET MET A . n 
A 1 140 ILE 140 983  983  ILE ILE A . n 
A 1 141 ALA 141 984  984  ALA ALA A . n 
A 1 142 ASP 142 985  985  ASP ASP A . n 
A 1 143 ALA 143 986  986  ALA ALA A . n 
A 1 144 LEU 144 987  987  LEU LEU A . n 
A 1 145 LYS 145 988  988  LYS LYS A . n 
A 1 146 GLY 146 989  989  GLY GLY A . n 
A 1 147 GLY 147 990  990  GLY GLY A . n 
A 1 148 SER 148 991  991  SER SER A . n 
A 1 149 PRO 149 992  992  PRO PRO A . n 
A 1 150 ALA 150 993  993  ALA ALA A . n 
A 1 151 LEU 151 994  994  LEU LEU A . n 
A 1 152 LYS 152 995  995  LYS LYS A . n 
A 1 153 THR 153 996  996  THR THR A . n 
A 1 154 GLU 154 997  997  GLU GLU A . n 
A 1 155 LEU 155 998  998  LEU LEU A . n 
A 1 156 TRP 156 999  999  TRP TRP A . n 
A 1 157 ALA 157 1000 1000 ALA ALA A . n 
A 1 158 TRP 158 1001 1001 TRP TRP A . n 
A 1 159 LEU 159 1002 1002 LEU LEU A . n 
A 1 160 ALA 160 1003 1003 ALA ALA A . n 
A 1 161 ASP 161 1004 1004 ASP ASP A . n 
A 1 162 LYS 162 1005 1005 LYS LYS A . n 
A 1 163 LEU 163 1006 1006 LEU LEU A . n 
A 1 164 PRO 164 1007 1007 PRO PRO A . n 
A 1 165 GLY 165 1008 1008 GLY GLY A . n 
A 1 166 LEU 166 1009 1009 LEU LEU A . n 
A 1 167 PRO 167 1010 1010 PRO PRO A . n 
A 1 168 PRO 168 1011 1011 PRO PRO A . n 
A 1 169 LYS 169 1012 1012 LYS LYS A . n 
A 1 170 SER 170 1013 1013 SER SER A . n 
A 1 171 VAL 171 1014 1014 VAL VAL A . n 
A 1 172 SER 172 1015 1015 SER SER A . n 
A 1 173 LYS 173 1016 1016 LYS LYS A . n 
A 1 174 GLU 174 1017 1017 GLU GLU A . n 
A 1 175 ASP 175 1018 1018 ASP ASP A . n 
A 1 176 ILE 176 1019 1019 ILE ILE A . n 
A 1 177 HIS 177 1020 1020 HIS HIS A . n 
A 1 178 SER 178 1021 1021 SER SER A . n 
A 1 179 MET 179 1022 1022 MET MET A . n 
A 1 180 VAL 180 1023 1023 VAL VAL A . n 
A 1 181 PRO 181 1024 1024 PRO PRO A . n 
A 1 182 HIS 182 1025 1025 HIS HIS A . n 
A 1 183 LEU 183 1026 1026 LEU LEU A . n 
A 1 184 TYR 184 1027 1027 TYR TYR A . n 
A 1 185 ALA 185 1028 1028 ALA ALA A . n 
A 1 186 HIS 186 1029 1029 HIS HIS A . n 
A 1 187 ILE 187 1030 1030 ILE ILE A . n 
A 1 188 CYS 188 1031 1031 CYS CYS A . n 
A 1 189 ASP 189 1032 1032 ASP ASP A . n 
A 1 190 ARG 190 1033 1033 ARG ARG A . n 
A 1 191 ASN 191 1034 1034 ASN ASN A . n 
A 1 192 ALA 192 1035 1035 ALA ALA A . n 
A 1 193 ASP 193 1036 1036 ASP ASP A . n 
A 1 194 VAL 194 1037 1037 VAL VAL A . n 
A 1 195 ARG 195 1038 1038 ARG ARG A . n 
A 1 196 LYS 196 1039 1039 LYS LYS A . n 
A 1 197 ASN 197 1040 1040 ASN ASN A . n 
A 1 198 ALA 198 1041 1041 ALA ALA A . n 
A 1 199 ASN 199 1042 1042 ASN ASN A . n 
A 1 200 GLU 200 1043 1043 GLU GLU A . n 
A 1 201 ALA 201 1044 1044 ALA ALA A . n 
A 1 202 VAL 202 1045 1045 VAL VAL A . n 
A 1 203 LEU 203 1046 1046 LEU LEU A . n 
A 1 204 GLY 204 1047 1047 GLY GLY A . n 
A 1 205 ILE 205 1048 1048 ILE ILE A . n 
A 1 206 MET 206 1049 1049 MET MET A . n 
A 1 207 ILE 207 1050 1050 ILE ILE A . n 
A 1 208 HIS 208 1051 1051 HIS HIS A . n 
A 1 209 LEU 209 1052 1052 LEU LEU A . n 
A 1 210 GLY 210 1053 1053 GLY GLY A . n 
A 1 211 PHE 211 1054 1054 PHE PHE A . n 
A 1 212 ASP 212 1055 1055 ASP ASP A . n 
A 1 213 ALA 213 1056 1056 ALA ALA A . n 
A 1 214 MET 214 1057 1057 MET MET A . n 
A 1 215 ASN 215 1058 1058 ASN ASN A . n 
A 1 216 ARG 216 1059 1059 ARG ARG A . n 
A 1 217 ALA 217 1060 1060 ALA ALA A . n 
A 1 218 LEU 218 1061 1061 LEU LEU A . n 
A 1 219 ASP 219 1062 1062 ASP ASP A . n 
A 1 220 LYS 220 1063 1063 LYS LYS A . n 
A 1 221 GLN 221 1064 1064 GLN GLN A . n 
A 1 222 LYS 222 1065 1065 LYS LYS A . n 
A 1 223 PRO 223 1066 1066 PRO PRO A . n 
A 1 224 ALA 224 1067 1067 ALA ALA A . n 
A 1 225 SER 225 1068 1068 SER SER A . n 
A 1 226 LYS 226 1069 1069 LYS LYS A . n 
A 1 227 LYS 227 1070 1070 LYS LYS A . n 
A 1 228 ASP 228 1071 1071 ASP ASP A . n 
A 1 229 ILE 229 1072 1072 ILE ILE A . n 
A 1 230 LEU 230 1073 1073 LEU LEU A . n 
A 1 231 ALA 231 1074 1074 ALA ALA A . n 
A 1 232 ALA 232 1075 1075 ALA ALA A . n 
A 1 233 LEU 233 1076 1076 LEU LEU A . n 
A 1 234 GLU 234 1077 1077 GLU GLU A . n 
A 1 235 LYS 235 1078 1078 LYS LYS A . n 
A 1 236 ALA 236 1079 1079 ALA ALA A . n 
A 1 237 ARG 237 1080 1080 ARG ARG A . n 
A 1 238 PRO 238 1081 1081 PRO PRO A . n 
A 1 239 ASN 239 1082 1082 ASN ASN A . n 
A 1 240 LEU 240 1083 1083 LEU LEU A . n 
A 1 241 PRO 241 1084 1084 PRO PRO A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   1101 376 SO4 SO4 A . 
C 3 HOH 1   1201 1   HOH HOH A . 
C 3 HOH 2   1202 2   HOH HOH A . 
C 3 HOH 3   1203 3   HOH HOH A . 
C 3 HOH 4   1204 4   HOH HOH A . 
C 3 HOH 5   1205 5   HOH HOH A . 
C 3 HOH 6   1206 6   HOH HOH A . 
C 3 HOH 7   1207 7   HOH HOH A . 
C 3 HOH 8   1208 8   HOH HOH A . 
C 3 HOH 9   1209 9   HOH HOH A . 
C 3 HOH 10  1210 10  HOH HOH A . 
C 3 HOH 11  1211 11  HOH HOH A . 
C 3 HOH 12  1212 12  HOH HOH A . 
C 3 HOH 13  1213 13  HOH HOH A . 
C 3 HOH 14  1214 14  HOH HOH A . 
C 3 HOH 15  1215 15  HOH HOH A . 
C 3 HOH 16  1216 16  HOH HOH A . 
C 3 HOH 17  1217 17  HOH HOH A . 
C 3 HOH 18  1218 18  HOH HOH A . 
C 3 HOH 19  1219 19  HOH HOH A . 
C 3 HOH 20  1220 20  HOH HOH A . 
C 3 HOH 21  1221 21  HOH HOH A . 
C 3 HOH 22  1222 22  HOH HOH A . 
C 3 HOH 23  1223 23  HOH HOH A . 
C 3 HOH 24  1224 24  HOH HOH A . 
C 3 HOH 25  1225 25  HOH HOH A . 
C 3 HOH 26  1226 26  HOH HOH A . 
C 3 HOH 27  1227 27  HOH HOH A . 
C 3 HOH 28  1228 28  HOH HOH A . 
C 3 HOH 29  1229 29  HOH HOH A . 
C 3 HOH 30  1230 30  HOH HOH A . 
C 3 HOH 31  1231 31  HOH HOH A . 
C 3 HOH 32  1232 32  HOH HOH A . 
C 3 HOH 33  1233 33  HOH HOH A . 
C 3 HOH 34  1234 34  HOH HOH A . 
C 3 HOH 35  1235 35  HOH HOH A . 
C 3 HOH 36  1236 36  HOH HOH A . 
C 3 HOH 37  1237 37  HOH HOH A . 
C 3 HOH 38  1238 38  HOH HOH A . 
C 3 HOH 39  1239 39  HOH HOH A . 
C 3 HOH 40  1240 40  HOH HOH A . 
C 3 HOH 41  1241 41  HOH HOH A . 
C 3 HOH 42  1242 42  HOH HOH A . 
C 3 HOH 43  1243 43  HOH HOH A . 
C 3 HOH 44  1244 44  HOH HOH A . 
C 3 HOH 45  1245 45  HOH HOH A . 
C 3 HOH 46  1246 46  HOH HOH A . 
C 3 HOH 47  1247 47  HOH HOH A . 
C 3 HOH 48  1248 48  HOH HOH A . 
C 3 HOH 49  1249 49  HOH HOH A . 
C 3 HOH 50  1250 50  HOH HOH A . 
C 3 HOH 51  1251 51  HOH HOH A . 
C 3 HOH 52  1252 52  HOH HOH A . 
C 3 HOH 53  1253 53  HOH HOH A . 
C 3 HOH 54  1254 54  HOH HOH A . 
C 3 HOH 55  1255 55  HOH HOH A . 
C 3 HOH 56  1256 56  HOH HOH A . 
C 3 HOH 57  1257 57  HOH HOH A . 
C 3 HOH 58  1258 58  HOH HOH A . 
C 3 HOH 59  1259 59  HOH HOH A . 
C 3 HOH 60  1260 60  HOH HOH A . 
C 3 HOH 61  1261 61  HOH HOH A . 
C 3 HOH 62  1262 62  HOH HOH A . 
C 3 HOH 63  1263 63  HOH HOH A . 
C 3 HOH 64  1264 64  HOH HOH A . 
C 3 HOH 65  1265 65  HOH HOH A . 
C 3 HOH 66  1266 66  HOH HOH A . 
C 3 HOH 67  1267 67  HOH HOH A . 
C 3 HOH 68  1268 68  HOH HOH A . 
C 3 HOH 69  1269 69  HOH HOH A . 
C 3 HOH 70  1270 70  HOH HOH A . 
C 3 HOH 71  1271 71  HOH HOH A . 
C 3 HOH 72  1272 72  HOH HOH A . 
C 3 HOH 73  1273 73  HOH HOH A . 
C 3 HOH 74  1274 74  HOH HOH A . 
C 3 HOH 75  1275 75  HOH HOH A . 
C 3 HOH 76  1276 76  HOH HOH A . 
C 3 HOH 77  1277 77  HOH HOH A . 
C 3 HOH 78  1278 78  HOH HOH A . 
C 3 HOH 79  1279 79  HOH HOH A . 
C 3 HOH 80  1280 80  HOH HOH A . 
C 3 HOH 81  1281 81  HOH HOH A . 
C 3 HOH 82  1282 82  HOH HOH A . 
C 3 HOH 83  1283 83  HOH HOH A . 
C 3 HOH 84  1284 84  HOH HOH A . 
C 3 HOH 85  1285 85  HOH HOH A . 
C 3 HOH 86  1286 86  HOH HOH A . 
C 3 HOH 87  1287 87  HOH HOH A . 
C 3 HOH 88  1288 88  HOH HOH A . 
C 3 HOH 89  1289 89  HOH HOH A . 
C 3 HOH 90  1290 90  HOH HOH A . 
C 3 HOH 91  1291 91  HOH HOH A . 
C 3 HOH 92  1292 92  HOH HOH A . 
C 3 HOH 93  1293 93  HOH HOH A . 
C 3 HOH 94  1294 94  HOH HOH A . 
C 3 HOH 95  1295 95  HOH HOH A . 
C 3 HOH 96  1296 96  HOH HOH A . 
C 3 HOH 97  1297 97  HOH HOH A . 
C 3 HOH 98  1298 98  HOH HOH A . 
C 3 HOH 99  1299 99  HOH HOH A . 
C 3 HOH 100 1300 100 HOH HOH A . 
C 3 HOH 101 1301 101 HOH HOH A . 
C 3 HOH 102 1302 102 HOH HOH A . 
C 3 HOH 103 1303 103 HOH HOH A . 
C 3 HOH 104 1304 104 HOH HOH A . 
C 3 HOH 105 1305 105 HOH HOH A . 
C 3 HOH 106 1306 106 HOH HOH A . 
C 3 HOH 107 1307 107 HOH HOH A . 
C 3 HOH 108 1308 108 HOH HOH A . 
C 3 HOH 109 1309 109 HOH HOH A . 
C 3 HOH 110 1310 110 HOH HOH A . 
C 3 HOH 111 1311 111 HOH HOH A . 
C 3 HOH 112 1312 112 HOH HOH A . 
C 3 HOH 113 1313 113 HOH HOH A . 
C 3 HOH 114 1314 114 HOH HOH A . 
C 3 HOH 115 1315 115 HOH HOH A . 
C 3 HOH 116 1316 116 HOH HOH A . 
C 3 HOH 117 1317 117 HOH HOH A . 
C 3 HOH 118 1318 118 HOH HOH A . 
C 3 HOH 119 1319 119 HOH HOH A . 
C 3 HOH 120 1320 120 HOH HOH A . 
C 3 HOH 121 1321 121 HOH HOH A . 
C 3 HOH 122 1322 122 HOH HOH A . 
C 3 HOH 123 1323 123 HOH HOH A . 
C 3 HOH 124 1324 124 HOH HOH A . 
C 3 HOH 125 1325 125 HOH HOH A . 
C 3 HOH 126 1326 126 HOH HOH A . 
C 3 HOH 127 1327 127 HOH HOH A . 
C 3 HOH 128 1328 128 HOH HOH A . 
C 3 HOH 129 1329 129 HOH HOH A . 
C 3 HOH 130 1330 130 HOH HOH A . 
C 3 HOH 131 1331 131 HOH HOH A . 
C 3 HOH 132 1332 132 HOH HOH A . 
C 3 HOH 133 1333 133 HOH HOH A . 
C 3 HOH 134 1334 134 HOH HOH A . 
C 3 HOH 135 1335 135 HOH HOH A . 
C 3 HOH 136 1336 136 HOH HOH A . 
C 3 HOH 137 1337 137 HOH HOH A . 
C 3 HOH 138 1338 138 HOH HOH A . 
C 3 HOH 139 1339 139 HOH HOH A . 
C 3 HOH 140 1340 140 HOH HOH A . 
C 3 HOH 141 1341 141 HOH HOH A . 
C 3 HOH 142 1342 142 HOH HOH A . 
C 3 HOH 143 1343 143 HOH HOH A . 
C 3 HOH 144 1344 144 HOH HOH A . 
C 3 HOH 145 1345 145 HOH HOH A . 
C 3 HOH 146 1346 146 HOH HOH A . 
C 3 HOH 147 1347 147 HOH HOH A . 
C 3 HOH 148 1348 148 HOH HOH A . 
C 3 HOH 149 1349 149 HOH HOH A . 
C 3 HOH 150 1350 150 HOH HOH A . 
C 3 HOH 151 1351 151 HOH HOH A . 
C 3 HOH 152 1352 152 HOH HOH A . 
C 3 HOH 153 1353 153 HOH HOH A . 
C 3 HOH 154 1354 154 HOH HOH A . 
C 3 HOH 155 1355 155 HOH HOH A . 
C 3 HOH 156 1356 156 HOH HOH A . 
C 3 HOH 157 1357 157 HOH HOH A . 
C 3 HOH 158 1358 158 HOH HOH A . 
C 3 HOH 159 1359 159 HOH HOH A . 
C 3 HOH 160 1360 160 HOH HOH A . 
C 3 HOH 161 1361 161 HOH HOH A . 
C 3 HOH 162 1362 162 HOH HOH A . 
C 3 HOH 163 1363 163 HOH HOH A . 
C 3 HOH 164 1364 164 HOH HOH A . 
C 3 HOH 165 1365 165 HOH HOH A . 
C 3 HOH 166 1366 166 HOH HOH A . 
C 3 HOH 167 1367 167 HOH HOH A . 
C 3 HOH 168 1368 168 HOH HOH A . 
C 3 HOH 169 1369 169 HOH HOH A . 
C 3 HOH 170 1370 170 HOH HOH A . 
C 3 HOH 171 1371 171 HOH HOH A . 
C 3 HOH 172 1372 172 HOH HOH A . 
C 3 HOH 173 1373 173 HOH HOH A . 
C 3 HOH 174 1374 174 HOH HOH A . 
C 3 HOH 175 1375 175 HOH HOH A . 
C 3 HOH 176 1376 176 HOH HOH A . 
C 3 HOH 177 1377 177 HOH HOH A . 
C 3 HOH 178 1378 178 HOH HOH A . 
C 3 HOH 179 1379 179 HOH HOH A . 
C 3 HOH 180 1380 180 HOH HOH A . 
C 3 HOH 181 1381 181 HOH HOH A . 
C 3 HOH 182 1382 182 HOH HOH A . 
C 3 HOH 183 1383 183 HOH HOH A . 
C 3 HOH 184 1384 184 HOH HOH A . 
C 3 HOH 185 1385 185 HOH HOH A . 
C 3 HOH 186 1386 186 HOH HOH A . 
C 3 HOH 187 1387 187 HOH HOH A . 
C 3 HOH 188 1388 188 HOH HOH A . 
C 3 HOH 189 1389 189 HOH HOH A . 
C 3 HOH 190 1390 190 HOH HOH A . 
C 3 HOH 191 1391 191 HOH HOH A . 
C 3 HOH 192 1392 192 HOH HOH A . 
C 3 HOH 193 1393 193 HOH HOH A . 
C 3 HOH 194 1394 194 HOH HOH A . 
C 3 HOH 195 1395 195 HOH HOH A . 
C 3 HOH 196 1396 196 HOH HOH A . 
C 3 HOH 197 1397 197 HOH HOH A . 
C 3 HOH 198 1398 198 HOH HOH A . 
C 3 HOH 199 1399 199 HOH HOH A . 
C 3 HOH 200 1400 200 HOH HOH A . 
C 3 HOH 201 1401 201 HOH HOH A . 
C 3 HOH 202 1402 202 HOH HOH A . 
C 3 HOH 203 1403 203 HOH HOH A . 
C 3 HOH 204 1404 204 HOH HOH A . 
C 3 HOH 205 1405 205 HOH HOH A . 
C 3 HOH 206 1406 206 HOH HOH A . 
C 3 HOH 207 1407 207 HOH HOH A . 
C 3 HOH 208 1408 208 HOH HOH A . 
C 3 HOH 209 1409 209 HOH HOH A . 
C 3 HOH 210 1410 210 HOH HOH A . 
C 3 HOH 211 1411 211 HOH HOH A . 
C 3 HOH 212 1412 212 HOH HOH A . 
C 3 HOH 213 1413 213 HOH HOH A . 
C 3 HOH 214 1414 214 HOH HOH A . 
C 3 HOH 215 1415 215 HOH HOH A . 
C 3 HOH 216 1416 216 HOH HOH A . 
C 3 HOH 217 1417 217 HOH HOH A . 
C 3 HOH 218 1418 218 HOH HOH A . 
C 3 HOH 219 1419 219 HOH HOH A . 
C 3 HOH 220 1420 220 HOH HOH A . 
C 3 HOH 221 1421 221 HOH HOH A . 
C 3 HOH 222 1422 222 HOH HOH A . 
C 3 HOH 223 1423 223 HOH HOH A . 
C 3 HOH 224 1424 224 HOH HOH A . 
C 3 HOH 225 1425 225 HOH HOH A . 
C 3 HOH 226 1426 226 HOH HOH A . 
C 3 HOH 227 1427 227 HOH HOH A . 
C 3 HOH 228 1428 228 HOH HOH A . 
C 3 HOH 229 1429 229 HOH HOH A . 
C 3 HOH 230 1430 230 HOH HOH A . 
C 3 HOH 231 1431 231 HOH HOH A . 
C 3 HOH 232 1432 232 HOH HOH A . 
C 3 HOH 233 1433 233 HOH HOH A . 
C 3 HOH 234 1434 234 HOH HOH A . 
C 3 HOH 235 1435 235 HOH HOH A . 
C 3 HOH 236 1436 236 HOH HOH A . 
C 3 HOH 237 1437 237 HOH HOH A . 
C 3 HOH 238 1438 238 HOH HOH A . 
C 3 HOH 239 1439 239 HOH HOH A . 
C 3 HOH 240 1440 240 HOH HOH A . 
C 3 HOH 241 1441 241 HOH HOH A . 
C 3 HOH 242 1442 242 HOH HOH A . 
C 3 HOH 243 1443 243 HOH HOH A . 
C 3 HOH 244 1444 244 HOH HOH A . 
C 3 HOH 245 1445 245 HOH HOH A . 
C 3 HOH 246 1446 246 HOH HOH A . 
C 3 HOH 247 1447 247 HOH HOH A . 
C 3 HOH 248 1448 248 HOH HOH A . 
C 3 HOH 249 1449 249 HOH HOH A . 
C 3 HOH 250 1450 250 HOH HOH A . 
C 3 HOH 251 1451 251 HOH HOH A . 
C 3 HOH 252 1452 252 HOH HOH A . 
C 3 HOH 253 1453 253 HOH HOH A . 
C 3 HOH 254 1454 254 HOH HOH A . 
C 3 HOH 255 1455 255 HOH HOH A . 
C 3 HOH 256 1456 256 HOH HOH A . 
C 3 HOH 257 1457 257 HOH HOH A . 
C 3 HOH 258 1458 258 HOH HOH A . 
C 3 HOH 259 1459 259 HOH HOH A . 
C 3 HOH 260 1460 260 HOH HOH A . 
C 3 HOH 261 1461 261 HOH HOH A . 
C 3 HOH 262 1462 262 HOH HOH A . 
C 3 HOH 263 1463 263 HOH HOH A . 
C 3 HOH 264 1464 264 HOH HOH A . 
C 3 HOH 265 1465 265 HOH HOH A . 
C 3 HOH 266 1466 266 HOH HOH A . 
C 3 HOH 267 1467 267 HOH HOH A . 
C 3 HOH 268 1468 268 HOH HOH A . 
C 3 HOH 269 1469 269 HOH HOH A . 
C 3 HOH 270 1470 270 HOH HOH A . 
C 3 HOH 271 1471 271 HOH HOH A . 
C 3 HOH 272 1472 272 HOH HOH A . 
C 3 HOH 273 1473 273 HOH HOH A . 
C 3 HOH 274 1474 274 HOH HOH A . 
C 3 HOH 275 1475 275 HOH HOH A . 
C 3 HOH 276 1476 276 HOH HOH A . 
C 3 HOH 277 1477 277 HOH HOH A . 
C 3 HOH 278 1478 278 HOH HOH A . 
C 3 HOH 279 1479 279 HOH HOH A . 
C 3 HOH 280 1480 280 HOH HOH A . 
C 3 HOH 281 1481 281 HOH HOH A . 
C 3 HOH 282 1482 282 HOH HOH A . 
C 3 HOH 283 1483 283 HOH HOH A . 
C 3 HOH 284 1484 284 HOH HOH A . 
C 3 HOH 285 1485 285 HOH HOH A . 
C 3 HOH 286 1486 286 HOH HOH A . 
C 3 HOH 287 1487 287 HOH HOH A . 
C 3 HOH 288 1488 288 HOH HOH A . 
C 3 HOH 289 1489 289 HOH HOH A . 
C 3 HOH 290 1490 290 HOH HOH A . 
C 3 HOH 291 1491 291 HOH HOH A . 
C 3 HOH 292 1492 292 HOH HOH A . 
C 3 HOH 293 1493 293 HOH HOH A . 
C 3 HOH 294 1494 294 HOH HOH A . 
C 3 HOH 295 1495 295 HOH HOH A . 
C 3 HOH 296 1496 296 HOH HOH A . 
C 3 HOH 297 1497 297 HOH HOH A . 
C 3 HOH 298 1498 298 HOH HOH A . 
C 3 HOH 299 1499 299 HOH HOH A . 
C 3 HOH 300 1500 300 HOH HOH A . 
C 3 HOH 301 1501 301 HOH HOH A . 
C 3 HOH 302 1502 302 HOH HOH A . 
C 3 HOH 303 1503 303 HOH HOH A . 
C 3 HOH 304 1504 304 HOH HOH A . 
C 3 HOH 305 1505 305 HOH HOH A . 
C 3 HOH 306 1506 306 HOH HOH A . 
C 3 HOH 307 1507 307 HOH HOH A . 
C 3 HOH 308 1508 308 HOH HOH A . 
C 3 HOH 309 1509 309 HOH HOH A . 
C 3 HOH 310 1510 310 HOH HOH A . 
C 3 HOH 311 1511 311 HOH HOH A . 
C 3 HOH 312 1512 312 HOH HOH A . 
C 3 HOH 313 1513 313 HOH HOH A . 
C 3 HOH 314 1514 314 HOH HOH A . 
C 3 HOH 315 1515 315 HOH HOH A . 
C 3 HOH 316 1516 316 HOH HOH A . 
C 3 HOH 317 1517 317 HOH HOH A . 
C 3 HOH 318 1518 318 HOH HOH A . 
C 3 HOH 319 1519 319 HOH HOH A . 
C 3 HOH 320 1520 320 HOH HOH A . 
C 3 HOH 321 1521 321 HOH HOH A . 
C 3 HOH 322 1522 322 HOH HOH A . 
C 3 HOH 323 1523 323 HOH HOH A . 
C 3 HOH 324 1524 324 HOH HOH A . 
C 3 HOH 325 1525 325 HOH HOH A . 
C 3 HOH 326 1526 326 HOH HOH A . 
C 3 HOH 327 1527 327 HOH HOH A . 
C 3 HOH 328 1528 328 HOH HOH A . 
C 3 HOH 329 1529 329 HOH HOH A . 
C 3 HOH 330 1530 330 HOH HOH A . 
C 3 HOH 331 1531 331 HOH HOH A . 
C 3 HOH 332 1532 332 HOH HOH A . 
C 3 HOH 333 1533 333 HOH HOH A . 
C 3 HOH 334 1534 334 HOH HOH A . 
C 3 HOH 335 1535 335 HOH HOH A . 
C 3 HOH 336 1536 336 HOH HOH A . 
C 3 HOH 337 1537 337 HOH HOH A . 
C 3 HOH 338 1538 338 HOH HOH A . 
C 3 HOH 339 1539 339 HOH HOH A . 
C 3 HOH 340 1540 340 HOH HOH A . 
C 3 HOH 341 1541 341 HOH HOH A . 
C 3 HOH 342 1542 342 HOH HOH A . 
C 3 HOH 343 1543 343 HOH HOH A . 
C 3 HOH 344 1544 344 HOH HOH A . 
C 3 HOH 345 1545 345 HOH HOH A . 
C 3 HOH 346 1546 346 HOH HOH A . 
C 3 HOH 347 1547 347 HOH HOH A . 
C 3 HOH 348 1548 348 HOH HOH A . 
C 3 HOH 349 1549 349 HOH HOH A . 
C 3 HOH 350 1550 350 HOH HOH A . 
C 3 HOH 351 1551 351 HOH HOH A . 
C 3 HOH 352 1552 352 HOH HOH A . 
C 3 HOH 353 1553 353 HOH HOH A . 
C 3 HOH 354 1554 354 HOH HOH A . 
C 3 HOH 355 1555 355 HOH HOH A . 
C 3 HOH 356 1556 356 HOH HOH A . 
C 3 HOH 357 1557 357 HOH HOH A . 
C 3 HOH 358 1558 358 HOH HOH A . 
C 3 HOH 359 1559 359 HOH HOH A . 
C 3 HOH 360 1560 360 HOH HOH A . 
C 3 HOH 361 1561 361 HOH HOH A . 
C 3 HOH 362 1562 362 HOH HOH A . 
C 3 HOH 363 1563 363 HOH HOH A . 
C 3 HOH 364 1564 364 HOH HOH A . 
C 3 HOH 365 1565 365 HOH HOH A . 
C 3 HOH 366 1566 366 HOH HOH A . 
C 3 HOH 367 1567 367 HOH HOH A . 
C 3 HOH 368 1568 368 HOH HOH A . 
C 3 HOH 369 1569 369 HOH HOH A . 
C 3 HOH 370 1570 370 HOH HOH A . 
C 3 HOH 371 1571 371 HOH HOH A . 
C 3 HOH 372 1572 372 HOH HOH A . 
C 3 HOH 373 1573 373 HOH HOH A . 
C 3 HOH 374 1574 374 HOH HOH A . 
C 3 HOH 375 1575 375 HOH HOH A . 
C 3 HOH 376 1576 376 HOH HOH A . 
C 3 HOH 377 1577 377 HOH HOH A . 
C 3 HOH 378 1578 378 HOH HOH A . 
C 3 HOH 379 1579 379 HOH HOH A . 
C 3 HOH 380 1580 380 HOH HOH A . 
C 3 HOH 381 1581 381 HOH HOH A . 
C 3 HOH 382 1582 382 HOH HOH A . 
C 3 HOH 383 1583 383 HOH HOH A . 
C 3 HOH 384 1584 384 HOH HOH A . 
C 3 HOH 385 1585 385 HOH HOH A . 
C 3 HOH 386 1586 386 HOH HOH A . 
C 3 HOH 387 1587 387 HOH HOH A . 
C 3 HOH 388 1588 388 HOH HOH A . 
C 3 HOH 389 1589 389 HOH HOH A . 
C 3 HOH 390 1590 390 HOH HOH A . 
C 3 HOH 391 1591 391 HOH HOH A . 
C 3 HOH 392 1592 392 HOH HOH A . 
C 3 HOH 393 1593 393 HOH HOH A . 
C 3 HOH 394 1594 394 HOH HOH A . 
C 3 HOH 395 1595 395 HOH HOH A . 
C 3 HOH 396 1596 396 HOH HOH A . 
C 3 HOH 397 1597 397 HOH HOH A . 
C 3 HOH 398 1598 398 HOH HOH A . 
C 3 HOH 399 1599 399 HOH HOH A . 
C 3 HOH 400 1600 400 HOH HOH A . 
C 3 HOH 401 1601 401 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-07-09 
2 'Structure model' 1 1 2014-09-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         24.1554 
_pdbx_refine_tls.origin_y         10.4333 
_pdbx_refine_tls.origin_z         10.0088 
_pdbx_refine_tls.T[1][1]          0.0450 
_pdbx_refine_tls.T[2][2]          0.0405 
_pdbx_refine_tls.T[3][3]          0.0464 
_pdbx_refine_tls.T[1][2]          -0.0065 
_pdbx_refine_tls.T[1][3]          0.0014 
_pdbx_refine_tls.T[2][3]          0.0040 
_pdbx_refine_tls.L[1][1]          0.4646 
_pdbx_refine_tls.L[2][2]          0.4397 
_pdbx_refine_tls.L[3][3]          0.3843 
_pdbx_refine_tls.L[1][2]          -0.1672 
_pdbx_refine_tls.L[1][3]          -0.1680 
_pdbx_refine_tls.L[2][3]          0.1493 
_pdbx_refine_tls.S[1][1]          -0.0065 
_pdbx_refine_tls.S[1][2]          -0.0356 
_pdbx_refine_tls.S[1][3]          -0.0096 
_pdbx_refine_tls.S[2][1]          -0.0081 
_pdbx_refine_tls.S[2][2]          0.0205 
_pdbx_refine_tls.S[2][3]          0.0239 
_pdbx_refine_tls.S[3][1]          0.0112 
_pdbx_refine_tls.S[3][2]          0.0435 
_pdbx_refine_tls.S[3][3]          -0.0028 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   all 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum                    ? 1 
PHENIX   'model building'  .                          ? 2 
PHENIX   refinement        '(phenix.refine: 1.7_650)' ? 3 
HKL-2000 'data reduction'  .                          ? 4 
HKL-2000 'data scaling'    .                          ? 5 
PHENIX   phasing           .                          ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O  A HOH 1521 ? ? O A HOH 1527 ? ? 1.90 
2  1 O  A HOH 1396 ? ? O A HOH 1569 ? ? 1.96 
3  1 O4 A SO4 1101 ? ? O A HOH 1523 ? ? 1.98 
4  1 O  A HOH 1349 ? ? O A HOH 1428 ? ? 2.05 
5  1 O  A HOH 1514 ? ? O A HOH 1577 ? ? 2.11 
6  1 O  A HOH 1470 ? ? O A HOH 1594 ? ? 2.12 
7  1 O  A HOH 1532 ? ? O A HOH 1554 ? ? 2.13 
8  1 O  A HOH 1452 ? ? O A HOH 1566 ? ? 2.13 
9  1 O  A HOH 1567 ? ? O A HOH 1571 ? ? 2.14 
10 1 O  A HOH 1574 ? ? O A HOH 1579 ? ? 2.16 
11 1 O  A GLY 973  ? ? O A HOH 1554 ? ? 2.16 
12 1 O  A HOH 1473 ? ? O A HOH 1545 ? ? 2.17 
13 1 O  A HOH 1352 ? ? O A HOH 1538 ? ? 2.19 
14 1 O  A HOH 1425 ? ? O A HOH 1526 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     1505 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     1516 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_655 
_pdbx_validate_symm_contact.dist              1.92 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 850 ? ? -69.88  -177.55 
2 1 ARG A 892 ? ? 69.47   -62.75  
3 1 PHE A 978 ? ? -102.18 57.40   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 844 ? A GLY 1 
2 1 Y 1 A SER 845 ? A SER 2 
3 1 Y 1 A HIS 846 ? A HIS 3 
4 1 Y 1 A MET 847 ? A MET 4 
5 1 Y 1 A MET 848 ? A MET 5 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#