data_4QNR
# 
_entry.id   4QNR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4QNR         
RCSB  RCSB086286   
WWPDB D_1000086286 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2BJW 'CRYSTAL STRUCTURE OF PSPF'                     unspecified 
PDB 2BJV 'CRYSTAL STRUCTURE OF PSPF(1-275) R168A MUTANT' unspecified 
PDB 2C98 'AAA DOMAIN, RESIDUES 1-265 bound to ADP'       unspecified 
PDB 2C96 'AAA DOMAIN, RESIDUES 1-265 bound to ATP'       unspecified 
PDB 2C99 'AAA DOMAIN, RESIDUES 1-265 bound to AMPPNP'    unspecified 
PDB 2C9C 'AAA DOMAIN, RESIDUES 1-265 with Mg-ATP'        unspecified 
PDB 4QNM .                                               unspecified 
PDB 4QOS .                                               unspecified 
# 
_pdbx_database_status.entry_id                        4QNR 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-06-18 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Darbari, V.C.' 1 
'Lawton, E.'    2 
'Lu, D.'        3 
'Burrows, P.C.' 4 
'Wiesler, S.'   5 
'Joly, N.'      6 
'Zhang, N.'     7 
'Zhang, X.'     8 
'Buck, M.'      9 
# 
_citation.id                        primary 
_citation.title                     
'Molecular basis of nucleotide-dependent substrate engagement and remodeling by an AAA+ activator.' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            42 
_citation.page_first                9249 
_citation.page_last                 9261 
_citation.year                      2014 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25063294 
_citation.pdbx_database_id_DOI      10.1093/nar/gku588 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Darbari, V.C.' 1 
primary 'Lawton, E.'    2 
primary 'Lu, D.'        3 
primary 'Burrows, P.C.' 4 
primary 'Wiesler, S.'   5 
primary 'Joly, N.'      6 
primary 'Zhang, N.'     7 
primary 'Zhang, X.'     8 
primary 'Buck, M.'      9 
# 
_cell.length_a           113.555 
_cell.length_b           113.555 
_cell.length_c           39.510 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           4QNR 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.entry_id                         4QNR 
_symmetry.Int_Tables_number                170 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Psp operon transcriptional activator'                29986.307 1   ? E108Q 
'Phage Shock protein F AAA DOMAIN, RESIDUES 1-265' ? 
2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                           507.181   1   ? ?     ? ? 
3 non-polymer syn 'MAGNESIUM ION'                                       24.305    1   ? ?     ? ? 
4 non-polymer syn GLYCEROL                                              92.094    2   ? ?     ? ? 
5 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305   1   ? ?     ? ? 
6 water       nat water                                                 18.015    213 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Phage shock protein F' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAEYKDNLLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNENLLDSELFGH
EAGAFTGAQKRHPGRFERADGGTLFLDQLATAPMMVQEKLLRVIEYGELERVGGSQPLQVNVRLVCATNADLPAMVNEGT
FRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLFPGFTERARETLLNYRWPGNIRELKNVVERSVYRH
GTSDYPLDDIIIDPFKRRPPEDAIA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAEYKDNLLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNENLLDSELFGH
EAGAFTGAQKRHPGRFERADGGTLFLDQLATAPMMVQEKLLRVIEYGELERVGGSQPLQVNVRLVCATNADLPAMVNEGT
FRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLFPGFTERARETLLNYRWPGNIRELKNVVERSVYRH
GTSDYPLDDIIIDPFKRRPPEDAIA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   GLU n 
1 4   TYR n 
1 5   LYS n 
1 6   ASP n 
1 7   ASN n 
1 8   LEU n 
1 9   LEU n 
1 10  GLY n 
1 11  GLU n 
1 12  ALA n 
1 13  ASN n 
1 14  SER n 
1 15  PHE n 
1 16  LEU n 
1 17  GLU n 
1 18  VAL n 
1 19  LEU n 
1 20  GLU n 
1 21  GLN n 
1 22  VAL n 
1 23  SER n 
1 24  HIS n 
1 25  LEU n 
1 26  ALA n 
1 27  PRO n 
1 28  LEU n 
1 29  ASP n 
1 30  LYS n 
1 31  PRO n 
1 32  VAL n 
1 33  LEU n 
1 34  ILE n 
1 35  ILE n 
1 36  GLY n 
1 37  GLU n 
1 38  ARG n 
1 39  GLY n 
1 40  THR n 
1 41  GLY n 
1 42  LYS n 
1 43  GLU n 
1 44  LEU n 
1 45  ILE n 
1 46  ALA n 
1 47  SER n 
1 48  ARG n 
1 49  LEU n 
1 50  HIS n 
1 51  TYR n 
1 52  LEU n 
1 53  SER n 
1 54  SER n 
1 55  ARG n 
1 56  TRP n 
1 57  GLN n 
1 58  GLY n 
1 59  PRO n 
1 60  PHE n 
1 61  ILE n 
1 62  SER n 
1 63  LEU n 
1 64  ASN n 
1 65  CYS n 
1 66  ALA n 
1 67  ALA n 
1 68  LEU n 
1 69  ASN n 
1 70  GLU n 
1 71  ASN n 
1 72  LEU n 
1 73  LEU n 
1 74  ASP n 
1 75  SER n 
1 76  GLU n 
1 77  LEU n 
1 78  PHE n 
1 79  GLY n 
1 80  HIS n 
1 81  GLU n 
1 82  ALA n 
1 83  GLY n 
1 84  ALA n 
1 85  PHE n 
1 86  THR n 
1 87  GLY n 
1 88  ALA n 
1 89  GLN n 
1 90  LYS n 
1 91  ARG n 
1 92  HIS n 
1 93  PRO n 
1 94  GLY n 
1 95  ARG n 
1 96  PHE n 
1 97  GLU n 
1 98  ARG n 
1 99  ALA n 
1 100 ASP n 
1 101 GLY n 
1 102 GLY n 
1 103 THR n 
1 104 LEU n 
1 105 PHE n 
1 106 LEU n 
1 107 ASP n 
1 108 GLN n 
1 109 LEU n 
1 110 ALA n 
1 111 THR n 
1 112 ALA n 
1 113 PRO n 
1 114 MET n 
1 115 MET n 
1 116 VAL n 
1 117 GLN n 
1 118 GLU n 
1 119 LYS n 
1 120 LEU n 
1 121 LEU n 
1 122 ARG n 
1 123 VAL n 
1 124 ILE n 
1 125 GLU n 
1 126 TYR n 
1 127 GLY n 
1 128 GLU n 
1 129 LEU n 
1 130 GLU n 
1 131 ARG n 
1 132 VAL n 
1 133 GLY n 
1 134 GLY n 
1 135 SER n 
1 136 GLN n 
1 137 PRO n 
1 138 LEU n 
1 139 GLN n 
1 140 VAL n 
1 141 ASN n 
1 142 VAL n 
1 143 ARG n 
1 144 LEU n 
1 145 VAL n 
1 146 CYS n 
1 147 ALA n 
1 148 THR n 
1 149 ASN n 
1 150 ALA n 
1 151 ASP n 
1 152 LEU n 
1 153 PRO n 
1 154 ALA n 
1 155 MET n 
1 156 VAL n 
1 157 ASN n 
1 158 GLU n 
1 159 GLY n 
1 160 THR n 
1 161 PHE n 
1 162 ARG n 
1 163 ALA n 
1 164 ASP n 
1 165 LEU n 
1 166 LEU n 
1 167 ASP n 
1 168 ARG n 
1 169 LEU n 
1 170 ALA n 
1 171 PHE n 
1 172 ASP n 
1 173 VAL n 
1 174 VAL n 
1 175 GLN n 
1 176 LEU n 
1 177 PRO n 
1 178 PRO n 
1 179 LEU n 
1 180 ARG n 
1 181 GLU n 
1 182 ARG n 
1 183 GLU n 
1 184 SER n 
1 185 ASP n 
1 186 ILE n 
1 187 MET n 
1 188 LEU n 
1 189 MET n 
1 190 ALA n 
1 191 GLU n 
1 192 TYR n 
1 193 PHE n 
1 194 ALA n 
1 195 ILE n 
1 196 GLN n 
1 197 MET n 
1 198 CYS n 
1 199 ARG n 
1 200 GLU n 
1 201 ILE n 
1 202 LYS n 
1 203 LEU n 
1 204 PRO n 
1 205 LEU n 
1 206 PHE n 
1 207 PRO n 
1 208 GLY n 
1 209 PHE n 
1 210 THR n 
1 211 GLU n 
1 212 ARG n 
1 213 ALA n 
1 214 ARG n 
1 215 GLU n 
1 216 THR n 
1 217 LEU n 
1 218 LEU n 
1 219 ASN n 
1 220 TYR n 
1 221 ARG n 
1 222 TRP n 
1 223 PRO n 
1 224 GLY n 
1 225 ASN n 
1 226 ILE n 
1 227 ARG n 
1 228 GLU n 
1 229 LEU n 
1 230 LYS n 
1 231 ASN n 
1 232 VAL n 
1 233 VAL n 
1 234 GLU n 
1 235 ARG n 
1 236 SER n 
1 237 VAL n 
1 238 TYR n 
1 239 ARG n 
1 240 HIS n 
1 241 GLY n 
1 242 THR n 
1 243 SER n 
1 244 ASP n 
1 245 TYR n 
1 246 PRO n 
1 247 LEU n 
1 248 ASP n 
1 249 ASP n 
1 250 ILE n 
1 251 ILE n 
1 252 ILE n 
1 253 ASP n 
1 254 PRO n 
1 255 PHE n 
1 256 LYS n 
1 257 ARG n 
1 258 ARG n 
1 259 PRO n 
1 260 PRO n 
1 261 GLU n 
1 262 ASP n 
1 263 ALA n 
1 264 ILE n 
1 265 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'b1303, JW1296, pspF, ycjB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K-12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               B834 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PSPF_ECOLI 
_struct_ref.pdbx_db_accession          P37344 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAEYKDNLLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNENLLDSELFGH
EAGAFTGAQKRHPGRFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQVNVRLVCATNADLPAMVNEGT
FRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLFPGFTERARETLLNYRWPGNIRELKNVVERSVYRH
GTSDYPLDDIIIDPFKRRPPEDAIA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4QNR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 265 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P37344 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  265 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       265 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             4QNR 
_struct_ref_seq_dif.mon_id                       GLN 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      108 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P37344 
_struct_ref_seq_dif.db_mon_id                    GLU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          108 
_struct_ref_seq_dif.details                      'ENGINEERED MUTATION' 
_struct_ref_seq_dif.pdbx_auth_seq_num            108 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                               ?                               'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                              ?                               'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ?                               'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ?                               'C4 H7 N O4' 
133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE"                           ?                               
'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                                              ?                               'C3 H7 N O2 S' 
121.158 
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES                           'C8 H18 N2 O4 S' 
238.305 
GLN 'L-peptide linking' y GLUTAMINE                                             ?                               'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ?                               'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                               ?                               'C2 H5 N O2' 
75.067  
GOL non-polymer         . GLYCEROL                                              'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094  
HIS 'L-peptide linking' y HISTIDINE                                             ?                               'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                 ?                               'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ?                               'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                               ?                               'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                ?                               'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                            ?                               'C5 H11 N O2 S' 
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                       ?                               'Mg 2' 24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                         ?                               'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                               ?                               'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                ?                               'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                             ?                               'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ?                               'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                              ?                               'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                ?                               'C5 H11 N O2' 
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4QNR 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   49.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'100mM Bis-Tris pH 8.0, 12-16% MPD, 2M Ammonium formate , VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M-F' 
_diffrn_detector.pdbx_collection_date   2013-08-11 
_diffrn_detector.details                'KIRKPATRICK BAEZ BIMORPH MIRROR PAIR FOR HORIZONTAL AND VERTICAL FOCUSSING' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9794 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9794 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
# 
_reflns.entry_id                     4QNR 
_reflns.d_resolution_high            1.539 
_reflns.number_obs                   43434 
_reflns.pdbx_Rmerge_I_obs            0.047 
_reflns.pdbx_netI_over_sigmaI        23.88 
_reflns.pdbx_chi_squared             1.119 
_reflns.percent_possible_obs         99.800 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   4.46 
_reflns.d_resolution_low             28.4 
_reflns.number_all                   43512 
_reflns.pdbx_Rsym_value              0.05184 
_reflns.B_iso_Wilson_estimate        21.67 
_reflns.pdbx_redundancy              9.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.540 1.630 66357 ? 13488 0.645 2.510  ? ? ? ? 13488 98.800  1 1 
1.630 1.740 66434 ? 12819 0.402 4.260  ? ? ? ? 12819 100.000 2 1 
1.740 1.880 59014 ? 11977 0.219 7.230  ? ? ? ? 11977 100.000 3 1 
1.880 2.060 57722 ? 10980 0.114 13.270 ? ? ? ? 10980 100.000 4 1 
2.060 2.300 50589 ? 9963  0.066 21.070 ? ? ? ? 9963  99.900  5 1 
2.300 2.660 44798 ? 8780  0.048 28.680 ? ? ? ? 8780  100.000 6 1 
2.660 3.250 37257 ? 7407  0.040 35.590 ? ? ? ? 7407  99.900  7 1 
3.250 4.560 28381 ? 5733  0.033 41.660 ? ? ? ? 5733  99.900  8 1 
# 
_refine.entry_id                                 4QNR 
_refine.ls_d_res_high                            1.5390 
_refine.ls_d_res_low                             28.3890 
_refine.pdbx_ls_sigma_F                          1.390 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.8400 
_refine.ls_number_reflns_obs                     43434 
_refine.ls_number_reflns_all                     43512 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.1489 
_refine.ls_R_factor_obs                          0.1489 
_refine.ls_R_factor_R_work                       0.1473 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.1785 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0200 
_refine.ls_number_reflns_R_free                  2182 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               29.3200 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1500 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      2BJW 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.9101 
_refine.B_iso_max                                90.440 
_refine.B_iso_min                                12.080 
_refine.pdbx_overall_phase_error                 16.2000 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1898 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         59 
_refine_hist.number_atoms_solvent             213 
_refine_hist.number_atoms_total               2170 
_refine_hist.d_res_high                       1.5390 
_refine_hist.d_res_low                        28.3890 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           2032 0.004  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          2766 1.014  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     306  0.033  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      356  0.004  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 771  14.208 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.5387 1.5722  16 98.0000  2515 . 0.2011 0.2663 . 133 . 2648 2515 . 'X-RAY DIFFRACTION' 
1.5722 1.6088  16 100.0000 2539 . 0.1689 0.2547 . 140 . 2679 2539 . 'X-RAY DIFFRACTION' 
1.6088 1.6490  16 100.0000 2587 . 0.1418 0.2062 . 125 . 2712 2587 . 'X-RAY DIFFRACTION' 
1.6490 1.6936  16 100.0000 2558 . 0.1309 0.2027 . 126 . 2684 2558 . 'X-RAY DIFFRACTION' 
1.6936 1.7434  16 100.0000 2568 . 0.1274 0.1507 . 129 . 2697 2568 . 'X-RAY DIFFRACTION' 
1.7434 1.7997  16 100.0000 2562 . 0.1228 0.1765 . 147 . 2709 2562 . 'X-RAY DIFFRACTION' 
1.7997 1.8640  16 100.0000 2555 . 0.1271 0.1690 . 124 . 2679 2555 . 'X-RAY DIFFRACTION' 
1.8640 1.9386  16 100.0000 2572 . 0.1266 0.1697 . 141 . 2713 2572 . 'X-RAY DIFFRACTION' 
1.9386 2.0268  16 100.0000 2587 . 0.1272 0.1802 . 116 . 2703 2587 . 'X-RAY DIFFRACTION' 
2.0268 2.1336  16 100.0000 2587 . 0.1271 0.1795 . 137 . 2724 2587 . 'X-RAY DIFFRACTION' 
2.1336 2.2672  16 100.0000 2598 . 0.1247 0.1501 . 127 . 2725 2598 . 'X-RAY DIFFRACTION' 
2.2672 2.4422  16 100.0000 2551 . 0.1366 0.1795 . 158 . 2709 2551 . 'X-RAY DIFFRACTION' 
2.4422 2.6878  16 100.0000 2578 . 0.1414 0.1850 . 144 . 2722 2578 . 'X-RAY DIFFRACTION' 
2.6878 3.0763  16 100.0000 2594 . 0.1476 0.1809 . 159 . 2753 2594 . 'X-RAY DIFFRACTION' 
3.0763 3.8743  16 100.0000 2585 . 0.1470 0.1483 . 154 . 2739 2585 . 'X-RAY DIFFRACTION' 
3.8743 28.3936 16 100.0000 2716 . 0.1731 0.2022 . 122 . 2838 2716 . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4QNR 
_struct.title                     'CRYSTAL STRUCTURE OF PSPF(1-265) E108Q MUTANT bound to ATP' 
_struct.pdbx_descriptor           'Psp operon transcriptional activator' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4QNR 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;AAA domain, Transcriptional activator for the phage shock protein (psp) operon (pspABCDE) and pspG gene, BACTERIAL SIGMA54 ACTIVATOR, ATP Binding, DNA binding, TRANSCRIPTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 12  ? ALA A 26  ? ALA A 12  ALA A 26  1 ? 15 
HELX_P HELX_P2  2  GLY A 41  ? LEU A 52  ? GLY A 41  LEU A 52  1 ? 12 
HELX_P HELX_P3  3  ASN A 69  ? GLY A 79  ? ASN A 69  GLY A 79  1 ? 11 
HELX_P HELX_P4  4  GLY A 94  ? ALA A 99  ? GLY A 94  ALA A 99  1 ? 6  
HELX_P HELX_P5  5  GLN A 108 ? ALA A 112 ? GLN A 108 ALA A 112 5 ? 5  
HELX_P HELX_P6  6  PRO A 113 ? GLY A 127 ? PRO A 113 GLY A 127 1 ? 15 
HELX_P HELX_P7  7  ASP A 151 ? GLU A 158 ? ASP A 151 GLU A 158 1 ? 8  
HELX_P HELX_P8  8  ARG A 162 ? ALA A 170 ? ARG A 162 ALA A 170 1 ? 9  
HELX_P HELX_P9  9  PRO A 178 ? GLU A 181 ? PRO A 178 GLU A 181 5 ? 4  
HELX_P HELX_P10 10 ARG A 182 ? ILE A 201 ? ARG A 182 ILE A 201 1 ? 20 
HELX_P HELX_P11 11 THR A 210 ? TYR A 220 ? THR A 210 TYR A 220 1 ? 11 
HELX_P HELX_P12 12 GLY A 224 ? GLY A 241 ? GLY A 224 GLY A 241 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C MG  .   MG  ? ? ? 1_555 G HOH . O  ? ? A MG  302 A HOH 546 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc2 metalc ? ? B ATP .   O2G ? ? ? 1_555 C MG  . MG ? ? A ATP 301 A MG  302 1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc3 metalc ? ? B ATP .   O1B ? ? ? 1_555 C MG  . MG ? ? A ATP 301 A MG  302 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc4 metalc ? ? A ASP 107 OD2 ? ? ? 1_555 C MG  . MG ? ? A ASP 107 A MG  302 1_555 ? ? ? ? ? ? ? 2.745 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 60  ? ASN A 64  ? PHE A 60  ASN A 64  
A 2 THR A 103 ? ASP A 107 ? THR A 103 ASP A 107 
A 3 ARG A 143 ? THR A 148 ? ARG A 143 THR A 148 
A 4 VAL A 32  ? ILE A 35  ? VAL A 32  ILE A 35  
A 5 ASP A 172 ? GLN A 175 ? ASP A 172 GLN A 175 
B 1 GLU A 128 ? LEU A 129 ? GLU A 128 LEU A 129 
B 2 LEU A 138 ? GLN A 139 ? LEU A 138 GLN A 139 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 61  ? N ILE A 61  O PHE A 105 ? O PHE A 105 
A 2 3 N LEU A 106 ? N LEU A 106 O VAL A 145 ? O VAL A 145 
A 3 4 O CYS A 146 ? O CYS A 146 N ILE A 34  ? N ILE A 34  
A 4 5 N ILE A 35  ? N ILE A 35  O VAL A 174 ? O VAL A 174 
B 1 2 N LEU A 129 ? N LEU A 129 O LEU A 138 ? O LEU A 138 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE ATP A 301' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 302'  
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL A 303' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 304' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EPE A 305' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 ASN A 7   ? ASN A 7   . ? 1_555 ? 
2  AC1 22 LEU A 8   ? LEU A 8   . ? 1_555 ? 
3  AC1 22 LEU A 9   ? LEU A 9   . ? 1_555 ? 
4  AC1 22 PHE A 15  ? PHE A 15  . ? 1_555 ? 
5  AC1 22 GLU A 37  ? GLU A 37  . ? 1_555 ? 
6  AC1 22 ARG A 38  ? ARG A 38  . ? 1_555 ? 
7  AC1 22 GLY A 39  ? GLY A 39  . ? 1_555 ? 
8  AC1 22 THR A 40  ? THR A 40  . ? 1_555 ? 
9  AC1 22 GLY A 41  ? GLY A 41  . ? 1_555 ? 
10 AC1 22 LYS A 42  ? LYS A 42  . ? 1_555 ? 
11 AC1 22 GLU A 43  ? GLU A 43  . ? 1_555 ? 
12 AC1 22 LEU A 44  ? LEU A 44  . ? 1_555 ? 
13 AC1 22 ASP A 164 ? ASP A 164 . ? 6_554 ? 
14 AC1 22 ILE A 226 ? ILE A 226 . ? 1_555 ? 
15 AC1 22 ARG A 227 ? ARG A 227 . ? 1_555 ? 
16 AC1 22 MG  C .   ? MG  A 302 . ? 1_555 ? 
17 AC1 22 HOH G .   ? HOH A 426 . ? 1_555 ? 
18 AC1 22 HOH G .   ? HOH A 470 . ? 1_555 ? 
19 AC1 22 HOH G .   ? HOH A 511 . ? 1_555 ? 
20 AC1 22 HOH G .   ? HOH A 537 . ? 1_555 ? 
21 AC1 22 HOH G .   ? HOH A 546 . ? 1_555 ? 
22 AC1 22 HOH G .   ? HOH A 592 . ? 1_555 ? 
23 AC2 4  GLU A 43  ? GLU A 43  . ? 1_555 ? 
24 AC2 4  ASP A 107 ? ASP A 107 . ? 1_555 ? 
25 AC2 4  ATP B .   ? ATP A 301 . ? 1_555 ? 
26 AC2 4  HOH G .   ? HOH A 546 . ? 1_555 ? 
27 AC3 3  HIS A 24  ? HIS A 24  . ? 6_554 ? 
28 AC3 3  ARG A 239 ? ARG A 239 . ? 1_555 ? 
29 AC3 3  HOH G .   ? HOH A 407 . ? 6_554 ? 
30 AC4 9  PHE A 78  ? PHE A 78  . ? 1_555 ? 
31 AC4 9  GLY A 79  ? GLY A 79  . ? 1_555 ? 
32 AC4 9  HIS A 80  ? HIS A 80  . ? 1_555 ? 
33 AC4 9  GLU A 81  ? GLU A 81  . ? 1_555 ? 
34 AC4 9  GLU A 97  ? GLU A 97  . ? 1_555 ? 
35 AC4 9  GLU A 130 ? GLU A 130 . ? 1_555 ? 
36 AC4 9  LEU A 138 ? LEU A 138 . ? 1_555 ? 
37 AC4 9  HOH G .   ? HOH A 539 . ? 1_555 ? 
38 AC4 9  HOH G .   ? HOH A 540 . ? 1_555 ? 
39 AC5 7  GLU A 81  ? GLU A 81  . ? 6_555 ? 
40 AC5 7  GLN A 108 ? GLN A 108 . ? 1_555 ? 
41 AC5 7  ALA A 110 ? ALA A 110 . ? 1_555 ? 
42 AC5 7  THR A 111 ? THR A 111 . ? 1_555 ? 
43 AC5 7  SER A 135 ? SER A 135 . ? 6_555 ? 
44 AC5 7  THR A 148 ? THR A 148 . ? 1_555 ? 
45 AC5 7  ASN A 149 ? ASN A 149 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4QNR 
_atom_sites.fract_transf_matrix[1][1]   0.008806 
_atom_sites.fract_transf_matrix[1][2]   0.005084 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010169 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.025310 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N      . ASN A 1 7   ? 10.824  -41.767 -8.106  1.00 56.70 ? 7   ASN A N      1 
ATOM   2    C  CA     . ASN A 1 7   ? 11.628  -42.282 -7.005  1.00 56.93 ? 7   ASN A CA     1 
ATOM   3    C  C      . ASN A 1 7   ? 10.781  -42.560 -5.769  1.00 59.15 ? 7   ASN A C      1 
ATOM   4    O  O      . ASN A 1 7   ? 10.112  -41.663 -5.254  1.00 59.40 ? 7   ASN A O      1 
ATOM   5    C  CB     . ASN A 1 7   ? 12.749  -41.300 -6.659  1.00 55.70 ? 7   ASN A CB     1 
ATOM   6    N  N      . LEU A 1 8   ? 10.813  -43.803 -5.297  1.00 62.40 ? 8   LEU A N      1 
ATOM   7    C  CA     . LEU A 1 8   ? 10.026  -44.192 -4.133  1.00 63.04 ? 8   LEU A CA     1 
ATOM   8    C  C      . LEU A 1 8   ? 10.723  -45.282 -3.314  1.00 60.90 ? 8   LEU A C      1 
ATOM   9    O  O      . LEU A 1 8   ? 10.566  -46.474 -3.574  1.00 64.24 ? 8   LEU A O      1 
ATOM   10   C  CB     . LEU A 1 8   ? 8.638   -44.656 -4.573  1.00 63.68 ? 8   LEU A CB     1 
ATOM   11   C  CG     . LEU A 1 8   ? 7.541   -44.367 -3.549  1.00 63.24 ? 8   LEU A CG     1 
ATOM   12   C  CD1    . LEU A 1 8   ? 7.175   -42.888 -3.569  1.00 60.10 ? 8   LEU A CD1    1 
ATOM   13   C  CD2    . LEU A 1 8   ? 6.318   -45.232 -3.794  1.00 64.81 ? 8   LEU A CD2    1 
ATOM   14   H  H      . LEU A 1 8   ? 11.282  -44.441 -5.634  1.00 74.88 ? 8   LEU A H      1 
ATOM   15   H  HA     . LEU A 1 8   ? 9.913   -43.418 -3.560  1.00 75.65 ? 8   LEU A HA     1 
ATOM   16   H  HB2    . LEU A 1 8   ? 8.403   -44.201 -5.397  1.00 76.42 ? 8   LEU A HB2    1 
ATOM   17   H  HB3    . LEU A 1 8   ? 8.661   -45.614 -4.722  1.00 76.42 ? 8   LEU A HB3    1 
ATOM   18   H  HG     . LEU A 1 8   ? 7.878   -44.576 -2.663  1.00 75.88 ? 8   LEU A HG     1 
ATOM   19   H  HD11   . LEU A 1 8   ? 6.479   -42.727 -2.913  1.00 72.12 ? 8   LEU A HD11   1 
ATOM   20   H  HD12   . LEU A 1 8   ? 7.962   -42.365 -3.352  1.00 72.12 ? 8   LEU A HD12   1 
ATOM   21   H  HD13   . LEU A 1 8   ? 6.856   -42.655 -4.455  1.00 72.12 ? 8   LEU A HD13   1 
ATOM   22   H  HD21   . LEU A 1 8   ? 5.645   -45.023 -3.128  1.00 77.77 ? 8   LEU A HD21   1 
ATOM   23   H  HD22   . LEU A 1 8   ? 5.974   -45.047 -4.682  1.00 77.77 ? 8   LEU A HD22   1 
ATOM   24   H  HD23   . LEU A 1 8   ? 6.573   -46.166 -3.726  1.00 77.77 ? 8   LEU A HD23   1 
ATOM   25   N  N      . LEU A 1 9   ? 11.495  -44.846 -2.323  1.00 53.61 ? 9   LEU A N      1 
ATOM   26   C  CA     . LEU A 1 9   ? 12.214  -45.735 -1.419  1.00 47.87 ? 9   LEU A CA     1 
ATOM   27   C  C      . LEU A 1 9   ? 11.562  -45.793 -0.048  1.00 45.52 ? 9   LEU A C      1 
ATOM   28   O  O      . LEU A 1 9   ? 10.873  -44.861 0.367   1.00 40.77 ? 9   LEU A O      1 
ATOM   29   C  CB     . LEU A 1 9   ? 13.659  -45.273 -1.248  1.00 47.53 ? 9   LEU A CB     1 
ATOM   30   C  CG     . LEU A 1 9   ? 14.511  -45.183 -2.507  1.00 50.46 ? 9   LEU A CG     1 
ATOM   31   C  CD1    . LEU A 1 9   ? 15.773  -44.420 -2.187  1.00 50.40 ? 9   LEU A CD1    1 
ATOM   32   C  CD2    . LEU A 1 9   ? 14.831  -46.568 -3.037  1.00 50.62 ? 9   LEU A CD2    1 
ATOM   33   H  H      . LEU A 1 9   ? 11.621  -44.013 -2.150  1.00 64.33 ? 9   LEU A H      1 
ATOM   34   H  HA     . LEU A 1 9   ? 12.223  -46.631 -1.790  1.00 57.44 ? 9   LEU A HA     1 
ATOM   35   H  HB2    . LEU A 1 9   ? 13.647  -44.390 -0.847  1.00 57.04 ? 9   LEU A HB2    1 
ATOM   36   H  HB3    . LEU A 1 9   ? 14.103  -45.891 -0.647  1.00 57.04 ? 9   LEU A HB3    1 
ATOM   37   H  HG     . LEU A 1 9   ? 14.024  -44.697 -3.192  1.00 60.55 ? 9   LEU A HG     1 
ATOM   38   H  HD11   . LEU A 1 9   ? 16.318  -44.361 -2.988  1.00 60.48 ? 9   LEU A HD11   1 
ATOM   39   H  HD12   . LEU A 1 9   ? 15.536  -43.530 -1.882  1.00 60.48 ? 9   LEU A HD12   1 
ATOM   40   H  HD13   . LEU A 1 9   ? 16.258  -44.891 -1.491  1.00 60.48 ? 9   LEU A HD13   1 
ATOM   41   H  HD21   . LEU A 1 9   ? 15.373  -46.483 -3.837  1.00 60.74 ? 9   LEU A HD21   1 
ATOM   42   H  HD22   . LEU A 1 9   ? 15.319  -47.061 -2.358  1.00 60.74 ? 9   LEU A HD22   1 
ATOM   43   H  HD23   . LEU A 1 9   ? 14.002  -47.026 -3.246  1.00 60.74 ? 9   LEU A HD23   1 
ATOM   44   N  N      . GLY A 1 10  ? 11.808  -46.892 0.655   1.00 45.35 ? 10  GLY A N      1 
ATOM   45   C  CA     . GLY A 1 10  ? 11.369  -47.041 2.027   1.00 44.29 ? 10  GLY A CA     1 
ATOM   46   C  C      . GLY A 1 10  ? 10.640  -48.347 2.244   1.00 43.93 ? 10  GLY A C      1 
ATOM   47   O  O      . GLY A 1 10  ? 9.889   -48.807 1.382   1.00 44.89 ? 10  GLY A O      1 
ATOM   48   H  H      . GLY A 1 10  ? 12.235  -47.574 0.351   1.00 54.42 ? 10  GLY A H      1 
ATOM   49   H  HA2    . GLY A 1 10  ? 12.137  -47.014 2.619   1.00 53.15 ? 10  GLY A HA2    1 
ATOM   50   H  HA3    . GLY A 1 10  ? 10.773  -46.312 2.258   1.00 53.15 ? 10  GLY A HA3    1 
ATOM   51   N  N      . GLU A 1 11  ? 10.879  -48.950 3.400   1.00 42.02 ? 11  GLU A N      1 
ATOM   52   C  CA     . GLU A 1 11  ? 10.157  -50.144 3.811   1.00 44.51 ? 11  GLU A CA     1 
ATOM   53   C  C      . GLU A 1 11  ? 9.792   -50.050 5.288   1.00 41.27 ? 11  GLU A C      1 
ATOM   54   O  O      . GLU A 1 11  ? 9.372   -51.035 5.895   1.00 45.24 ? 11  GLU A O      1 
ATOM   55   C  CB     . GLU A 1 11  ? 10.988  -51.399 3.534   1.00 49.31 ? 11  GLU A CB     1 
ATOM   56   C  CG     . GLU A 1 11  ? 12.397  -51.357 4.092   1.00 53.61 ? 11  GLU A CG     1 
ATOM   57   C  CD     . GLU A 1 11  ? 13.265  -52.486 3.563   1.00 58.95 ? 11  GLU A CD     1 
ATOM   58   O  OE1    . GLU A 1 11  ? 13.292  -52.691 2.331   1.00 59.20 ? 11  GLU A OE1    1 
ATOM   59   O  OE2    . GLU A 1 11  ? 13.916  -53.173 4.378   1.00 60.22 ? 11  GLU A OE2    1 
ATOM   60   H  H      . GLU A 1 11  ? 11.462  -48.683 3.973   1.00 50.43 ? 11  GLU A H      1 
ATOM   61   H  HA     . GLU A 1 11  ? 9.335   -50.209 3.300   1.00 53.41 ? 11  GLU A HA     1 
ATOM   62   H  HB2    . GLU A 1 11  ? 10.538  -52.162 3.929   1.00 59.17 ? 11  GLU A HB2    1 
ATOM   63   H  HB3    . GLU A 1 11  ? 11.055  -51.521 2.574   1.00 59.17 ? 11  GLU A HB3    1 
ATOM   64   H  HG2    . GLU A 1 11  ? 12.812  -50.516 3.841   1.00 64.33 ? 11  GLU A HG2    1 
ATOM   65   H  HG3    . GLU A 1 11  ? 12.358  -51.434 5.058   1.00 64.33 ? 11  GLU A HG3    1 
ATOM   66   N  N      . ALA A 1 12  ? 9.956   -48.862 5.866   1.00 35.98 ? 12  ALA A N      1 
ATOM   67   C  CA     . ALA A 1 12  ? 9.482   -48.630 7.220   1.00 33.84 ? 12  ALA A CA     1 
ATOM   68   C  C      . ALA A 1 12  ? 7.988   -48.882 7.203   1.00 31.38 ? 12  ALA A C      1 
ATOM   69   O  O      . ALA A 1 12  ? 7.292   -48.442 6.286   1.00 29.65 ? 12  ALA A O      1 
ATOM   70   C  CB     . ALA A 1 12  ? 9.797   -47.223 7.693   1.00 35.28 ? 12  ALA A CB     1 
ATOM   71   H  H      . ALA A 1 12  ? 10.335  -48.183 5.498   1.00 43.17 ? 12  ALA A H      1 
ATOM   72   H  HA     . ALA A 1 12  ? 9.898   -49.263 7.826   1.00 40.61 ? 12  ALA A HA     1 
ATOM   73   H  HB1    . ALA A 1 12  ? 9.464   -47.112 8.597   1.00 42.34 ? 12  ALA A HB1    1 
ATOM   74   H  HB2    . ALA A 1 12  ? 10.758  -47.092 7.675   1.00 42.34 ? 12  ALA A HB2    1 
ATOM   75   H  HB3    . ALA A 1 12  ? 9.365   -46.587 7.101   1.00 42.34 ? 12  ALA A HB3    1 
ATOM   76   N  N      . ASN A 1 13  ? 7.503   -49.624 8.190   1.00 32.59 ? 13  ASN A N      1 
ATOM   77   C  CA     . ASN A 1 13  ? 6.099   -50.003 8.223   1.00 34.44 ? 13  ASN A CA     1 
ATOM   78   C  C      . ASN A 1 13  ? 5.182   -48.787 8.141   1.00 30.39 ? 13  ASN A C      1 
ATOM   79   O  O      . ASN A 1 13  ? 4.150   -48.835 7.482   1.00 29.99 ? 13  ASN A O      1 
ATOM   80   C  CB     . ASN A 1 13  ? 5.801   -50.811 9.484   1.00 40.69 ? 13  ASN A CB     1 
ATOM   81   C  CG     . ASN A 1 13  ? 6.422   -52.195 9.444   1.00 50.72 ? 13  ASN A CG     1 
ATOM   82   O  OD1    . ASN A 1 13  ? 6.982   -52.607 8.428   1.00 54.80 ? 13  ASN A OD1    1 
ATOM   83   N  ND2    . ASN A 1 13  ? 6.315   -52.926 10.545  1.00 55.33 ? 13  ASN A ND2    1 
ATOM   84   H  H      . ASN A 1 13  ? 7.965   -49.921 8.851   1.00 39.10 ? 13  ASN A H      1 
ATOM   85   H  HA     . ASN A 1 13  ? 5.910   -50.568 7.458   1.00 41.32 ? 13  ASN A HA     1 
ATOM   86   H  HB2    . ASN A 1 13  ? 6.161   -50.342 10.253  1.00 48.82 ? 13  ASN A HB2    1 
ATOM   87   H  HB3    . ASN A 1 13  ? 4.841   -50.914 9.576   1.00 48.82 ? 13  ASN A HB3    1 
ATOM   88   H  HD21   . ASN A 1 13  ? 5.910   -52.609 11.234  1.00 66.40 ? 13  ASN A HD21   1 
ATOM   89   H  HD22   . ASN A 1 13  ? 6.651   -53.717 10.570  1.00 66.40 ? 13  ASN A HD22   1 
ATOM   90   N  N      . SER A 1 14  ? 5.574   -47.690 8.782   1.00 29.23 ? 14  SER A N      1 
ATOM   91   C  CA     . SER A 1 14  ? 4.762   -46.475 8.761   1.00 29.22 ? 14  SER A CA     1 
ATOM   92   C  C      . SER A 1 14  ? 4.602   -45.951 7.335   1.00 26.24 ? 14  SER A C      1 
ATOM   93   O  O      . SER A 1 14  ? 3.537   -45.468 6.957   1.00 28.24 ? 14  SER A O      1 
ATOM   94   C  CB     . SER A 1 14  ? 5.378   -45.395 9.651   1.00 32.38 ? 14  SER A CB     1 
ATOM   95   O  OG     . SER A 1 14  ? 6.715   -45.126 9.273   1.00 31.02 ? 14  SER A OG     1 
ATOM   96   H  H      . SER A 1 14  ? 6.302   -47.621 9.235   1.00 35.08 ? 14  SER A H      1 
ATOM   97   H  HA     . SER A 1 14  ? 3.879   -46.679 9.106   1.00 35.07 ? 14  SER A HA     1 
ATOM   98   H  HB2    . SER A 1 14  ? 4.856   -44.581 9.566   1.00 38.86 ? 14  SER A HB2    1 
ATOM   99   H  HB3    . SER A 1 14  ? 5.366   -45.701 10.572  1.00 38.86 ? 14  SER A HB3    1 
ATOM   100  H  HG     . SER A 1 14  ? 7.040   -44.532 9.770   1.00 37.23 ? 14  SER A HG     1 
ATOM   101  N  N      . PHE A 1 15  ? 5.665   -46.058 6.544   1.00 22.81 ? 15  PHE A N      1 
ATOM   102  C  CA     . PHE A 1 15  ? 5.620   -45.638 5.150   1.00 24.07 ? 15  PHE A CA     1 
ATOM   103  C  C      . PHE A 1 15  ? 4.809   -46.616 4.295   1.00 23.72 ? 15  PHE A C      1 
ATOM   104  O  O      . PHE A 1 15  ? 4.037   -46.200 3.434   1.00 22.25 ? 15  PHE A O      1 
ATOM   105  C  CB     . PHE A 1 15  ? 7.039   -45.492 4.595   1.00 25.35 ? 15  PHE A CB     1 
ATOM   106  C  CG     . PHE A 1 15  ? 7.083   -45.085 3.157   1.00 32.07 ? 15  PHE A CG     1 
ATOM   107  C  CD1    . PHE A 1 15  ? 6.624   -43.839 2.764   1.00 34.64 ? 15  PHE A CD1    1 
ATOM   108  C  CD2    . PHE A 1 15  ? 7.592   -45.947 2.193   1.00 34.74 ? 15  PHE A CD2    1 
ATOM   109  C  CE1    . PHE A 1 15  ? 6.665   -43.457 1.430   1.00 40.42 ? 15  PHE A CE1    1 
ATOM   110  C  CE2    . PHE A 1 15  ? 7.638   -45.573 0.861   1.00 39.55 ? 15  PHE A CE2    1 
ATOM   111  C  CZ     . PHE A 1 15  ? 7.173   -44.325 0.480   1.00 40.71 ? 15  PHE A CZ     1 
ATOM   112  H  H      . PHE A 1 15  ? 6.426   -46.372 6.792   1.00 27.37 ? 15  PHE A H      1 
ATOM   113  H  HA     . PHE A 1 15  ? 5.190   -44.770 5.098   1.00 28.89 ? 15  PHE A HA     1 
ATOM   114  H  HB2    . PHE A 1 15  ? 7.508   -44.817 5.110   1.00 30.42 ? 15  PHE A HB2    1 
ATOM   115  H  HB3    . PHE A 1 15  ? 7.495   -46.344 4.676   1.00 30.42 ? 15  PHE A HB3    1 
ATOM   116  H  HD1    . PHE A 1 15  ? 6.282   -43.253 3.400   1.00 41.57 ? 15  PHE A HD1    1 
ATOM   117  H  HD2    . PHE A 1 15  ? 7.905   -46.785 2.446   1.00 41.68 ? 15  PHE A HD2    1 
ATOM   118  H  HE1    . PHE A 1 15  ? 6.353   -42.618 1.176   1.00 48.51 ? 15  PHE A HE1    1 
ATOM   119  H  HE2    . PHE A 1 15  ? 7.979   -46.158 0.224   1.00 47.47 ? 15  PHE A HE2    1 
ATOM   120  H  HZ     . PHE A 1 15  ? 7.202   -44.071 -0.414  1.00 48.85 ? 15  PHE A HZ     1 
ATOM   121  N  N      . LEU A 1 16  ? 4.975   -47.915 4.531   1.00 25.14 ? 16  LEU A N      1 
ATOM   122  C  CA     . LEU A 1 16  ? 4.209   -48.909 3.785   1.00 26.16 ? 16  LEU A CA     1 
ATOM   123  C  C      . LEU A 1 16  ? 2.714   -48.747 4.042   1.00 27.29 ? 16  LEU A C      1 
ATOM   124  O  O      . LEU A 1 16  ? 1.895   -48.957 3.147   1.00 27.81 ? 16  LEU A O      1 
ATOM   125  C  CB     . LEU A 1 16  ? 4.651   -50.322 4.153   1.00 30.62 ? 16  LEU A CB     1 
ATOM   126  C  CG     . LEU A 1 16  ? 6.110   -50.653 3.843   1.00 30.50 ? 16  LEU A CG     1 
ATOM   127  C  CD1    . LEU A 1 16  ? 6.424   -52.084 4.260   1.00 32.72 ? 16  LEU A CD1    1 
ATOM   128  C  CD2    . LEU A 1 16  ? 6.421   -50.446 2.366   1.00 29.45 ? 16  LEU A CD2    1 
ATOM   129  H  H      . LEU A 1 16  ? 5.519   -48.243 5.110   1.00 30.16 ? 16  LEU A H      1 
ATOM   130  H  HA     . LEU A 1 16  ? 4.366   -48.783 2.836   1.00 31.40 ? 16  LEU A HA     1 
ATOM   131  H  HB2    . LEU A 1 16  ? 4.521   -50.446 5.106   1.00 36.75 ? 16  LEU A HB2    1 
ATOM   132  H  HB3    . LEU A 1 16  ? 4.099   -50.953 3.666   1.00 36.75 ? 16  LEU A HB3    1 
ATOM   133  H  HG     . LEU A 1 16  ? 6.682   -50.061 4.354   1.00 36.59 ? 16  LEU A HG     1 
ATOM   134  H  HD11   . LEU A 1 16  ? 7.353   -52.275 4.056   1.00 39.26 ? 16  LEU A HD11   1 
ATOM   135  H  HD12   . LEU A 1 16  ? 6.270   -52.175 5.214   1.00 39.26 ? 16  LEU A HD12   1 
ATOM   136  H  HD13   . LEU A 1 16  ? 5.846   -52.690 3.771   1.00 39.26 ? 16  LEU A HD13   1 
ATOM   137  H  HD21   . LEU A 1 16  ? 7.352   -50.665 2.205   1.00 35.35 ? 16  LEU A HD21   1 
ATOM   138  H  HD22   . LEU A 1 16  ? 5.848   -51.025 1.838   1.00 35.35 ? 16  LEU A HD22   1 
ATOM   139  H  HD23   . LEU A 1 16  ? 6.254   -49.518 2.136   1.00 35.35 ? 16  LEU A HD23   1 
ATOM   140  N  N      . GLU A 1 17  ? 2.365   -48.368 5.265   1.00 24.82 ? 17  GLU A N      1 
ATOM   141  C  CA     . GLU A 1 17  ? 0.966   -48.137 5.613   1.00 26.54 ? 17  GLU A CA     1 
ATOM   142  C  C      . GLU A 1 17  ? 0.392   -46.955 4.831   1.00 23.68 ? 17  GLU A C      1 
ATOM   143  O  O      . GLU A 1 17  ? -0.767  -46.987 4.416   1.00 24.29 ? 17  GLU A O      1 
ATOM   144  C  CB     . GLU A 1 17  ? 0.821   -47.909 7.119   1.00 31.15 ? 17  GLU A CB     1 
ATOM   145  C  CG     . GLU A 1 17  ? 0.988   -49.181 7.943   1.00 41.95 ? 17  GLU A CG     1 
ATOM   146  C  CD     . GLU A 1 17  ? 0.902   -48.933 9.436   1.00 49.44 ? 17  GLU A CD     1 
ATOM   147  O  OE1    . GLU A 1 17  ? 0.261   -47.940 9.843   1.00 53.02 ? 17  GLU A OE1    1 
ATOM   148  O  OE2    . GLU A 1 17  ? 1.478   -49.731 10.205  1.00 54.96 ? 17  GLU A OE2    1 
ATOM   149  H  H      . GLU A 1 17  ? 2.916   -48.237 5.912   1.00 29.79 ? 17  GLU A H      1 
ATOM   150  H  HA     . GLU A 1 17  ? 0.451   -48.925 5.381   1.00 31.85 ? 17  GLU A HA     1 
ATOM   151  H  HB2    . GLU A 1 17  ? 1.498   -47.277 7.407   1.00 37.38 ? 17  GLU A HB2    1 
ATOM   152  H  HB3    . GLU A 1 17  ? -0.062  -47.551 7.298   1.00 37.38 ? 17  GLU A HB3    1 
ATOM   153  H  HG2    . GLU A 1 17  ? 0.286   -49.807 7.702   1.00 50.34 ? 17  GLU A HG2    1 
ATOM   154  H  HG3    . GLU A 1 17  ? 1.856   -49.569 7.753   1.00 50.34 ? 17  GLU A HG3    1 
ATOM   155  N  N      . VAL A 1 18  ? 1.204   -45.920 4.623   1.00 20.27 ? 18  VAL A N      1 
ATOM   156  C  CA     . VAL A 1 18  ? 0.797   -44.790 3.799   1.00 23.07 ? 18  VAL A CA     1 
ATOM   157  C  C      . VAL A 1 18  ? 0.489   -45.249 2.376   1.00 23.05 ? 18  VAL A C      1 
ATOM   158  O  O      . VAL A 1 18  ? -0.529  -44.869 1.805   1.00 21.11 ? 18  VAL A O      1 
ATOM   159  C  CB     . VAL A 1 18  ? 1.884   -43.690 3.767   1.00 24.72 ? 18  VAL A CB     1 
ATOM   160  C  CG1    . VAL A 1 18  ? 1.662   -42.716 2.606   1.00 24.68 ? 18  VAL A CG1    1 
ATOM   161  C  CG2    . VAL A 1 18  ? 1.912   -42.942 5.088   1.00 26.11 ? 18  VAL A CG2    1 
ATOM   162  H  H      . VAL A 1 18  ? 1.997   -45.851 4.950   1.00 24.32 ? 18  VAL A H      1 
ATOM   163  H  HA     . VAL A 1 18  ? -0.011  -44.402 4.172   1.00 27.69 ? 18  VAL A HA     1 
ATOM   164  H  HB     . VAL A 1 18  ? 2.750   -44.109 3.644   1.00 29.66 ? 18  VAL A HB     1 
ATOM   165  H  HG11   . VAL A 1 18  ? 2.362   -42.044 2.620   1.00 29.62 ? 18  VAL A HG11   1 
ATOM   166  H  HG12   . VAL A 1 18  ? 1.693   -43.209 1.771   1.00 29.62 ? 18  VAL A HG12   1 
ATOM   167  H  HG13   . VAL A 1 18  ? 0.795   -42.294 2.710   1.00 29.62 ? 18  VAL A HG13   1 
ATOM   168  H  HG21   . VAL A 1 18  ? 2.599   -42.258 5.049   1.00 31.33 ? 18  VAL A HG21   1 
ATOM   169  H  HG22   . VAL A 1 18  ? 1.045   -42.533 5.238   1.00 31.33 ? 18  VAL A HG22   1 
ATOM   170  H  HG23   . VAL A 1 18  ? 2.110   -43.569 5.802   1.00 31.33 ? 18  VAL A HG23   1 
ATOM   171  N  N      . LEU A 1 19  ? 1.363   -46.070 1.803   1.00 22.54 ? 19  LEU A N      1 
ATOM   172  C  CA     . LEU A 1 19  ? 1.172   -46.522 0.428   1.00 22.92 ? 19  LEU A CA     1 
ATOM   173  C  C      . LEU A 1 19  ? -0.104  -47.343 0.293   1.00 21.32 ? 19  LEU A C      1 
ATOM   174  O  O      . LEU A 1 19  ? -0.819  -47.231 -0.703  1.00 24.07 ? 19  LEU A O      1 
ATOM   175  C  CB     . LEU A 1 19  ? 2.374   -47.338 -0.045  1.00 25.28 ? 19  LEU A CB     1 
ATOM   176  C  CG     . LEU A 1 19  ? 3.706   -46.589 -0.147  1.00 29.62 ? 19  LEU A CG     1 
ATOM   177  C  CD1    . LEU A 1 19  ? 4.784   -47.525 -0.665  1.00 33.13 ? 19  LEU A CD1    1 
ATOM   178  C  CD2    . LEU A 1 19  ? 3.595   -45.360 -1.040  1.00 30.67 ? 19  LEU A CD2    1 
ATOM   179  H  H      . LEU A 1 19  ? 2.070   -46.378 2.185   1.00 27.05 ? 19  LEU A H      1 
ATOM   180  H  HA     . LEU A 1 19  ? 1.091   -45.747 -0.149  1.00 27.50 ? 19  LEU A HA     1 
ATOM   181  H  HB2    . LEU A 1 19  ? 2.504   -48.074 0.573   1.00 30.34 ? 19  LEU A HB2    1 
ATOM   182  H  HB3    . LEU A 1 19  ? 2.174   -47.690 -0.926  1.00 30.34 ? 19  LEU A HB3    1 
ATOM   183  H  HG     . LEU A 1 19  ? 3.968   -46.292 0.738   1.00 35.55 ? 19  LEU A HG     1 
ATOM   184  H  HD11   . LEU A 1 19  ? 5.622   -47.039 -0.725  1.00 39.76 ? 19  LEU A HD11   1 
ATOM   185  H  HD12   . LEU A 1 19  ? 4.877   -48.270 -0.051  1.00 39.76 ? 19  LEU A HD12   1 
ATOM   186  H  HD13   . LEU A 1 19  ? 4.526   -47.849 -1.542  1.00 39.76 ? 19  LEU A HD13   1 
ATOM   187  H  HD21   . LEU A 1 19  ? 4.457   -44.918 -1.076  1.00 36.81 ? 19  LEU A HD21   1 
ATOM   188  H  HD22   . LEU A 1 19  ? 3.329   -45.640 -1.930  1.00 36.81 ? 19  LEU A HD22   1 
ATOM   189  H  HD23   . LEU A 1 19  ? 2.930   -44.759 -0.669  1.00 36.81 ? 19  LEU A HD23   1 
ATOM   190  N  N      . GLU A 1 20  ? -0.385  -48.164 1.299   1.00 22.34 ? 20  GLU A N      1 
ATOM   191  C  CA     . GLU A 1 20  ? -1.613  -48.951 1.326   1.00 23.93 ? 20  GLU A CA     1 
ATOM   192  C  C      . GLU A 1 20  ? -2.821  -48.019 1.363   1.00 24.19 ? 20  GLU A C      1 
ATOM   193  O  O      . GLU A 1 20  ? -3.774  -48.194 0.610   1.00 23.84 ? 20  GLU A O      1 
ATOM   194  C  CB     . GLU A 1 20  ? -1.621  -49.897 2.535   1.00 29.51 ? 20  GLU A CB     1 
ATOM   195  C  CG     . GLU A 1 20  ? -2.887  -50.738 2.692   1.00 40.15 ? 20  GLU A CG     1 
ATOM   196  C  CD     . GLU A 1 20  ? -3.006  -51.845 1.655   1.00 50.47 ? 20  GLU A CD     1 
ATOM   197  O  OE1    . GLU A 1 20  ? -2.014  -52.119 0.947   1.00 56.04 ? 20  GLU A OE1    1 
ATOM   198  O  OE2    . GLU A 1 20  ? -4.096  -52.447 1.553   1.00 52.65 ? 20  GLU A OE2    1 
ATOM   199  H  H      . GLU A 1 20  ? 0.123   -48.284 1.983   1.00 26.81 ? 20  GLU A H      1 
ATOM   200  H  HA     . GLU A 1 20  ? -1.668  -49.487 0.520   1.00 28.72 ? 20  GLU A HA     1 
ATOM   201  H  HB2    . GLU A 1 20  ? -0.872  -50.508 2.452   1.00 35.41 ? 20  GLU A HB2    1 
ATOM   202  H  HB3    . GLU A 1 20  ? -1.520  -49.367 3.341   1.00 35.41 ? 20  GLU A HB3    1 
ATOM   203  H  HG2    . GLU A 1 20  ? -2.884  -51.150 3.570   1.00 48.18 ? 20  GLU A HG2    1 
ATOM   204  H  HG3    . GLU A 1 20  ? -3.661  -50.160 2.602   1.00 48.18 ? 20  GLU A HG3    1 
ATOM   205  N  N      . GLN A 1 21  ? -2.763  -47.021 2.239   1.00 20.52 ? 21  GLN A N      1 
ATOM   206  C  CA     . GLN A 1 21  ? -3.853  -46.061 2.374   1.00 19.19 ? 21  GLN A CA     1 
ATOM   207  C  C      . GLN A 1 21  ? -4.109  -45.342 1.054   1.00 19.29 ? 21  GLN A C      1 
ATOM   208  O  O      . GLN A 1 21  ? -5.260  -45.153 0.647   1.00 20.49 ? 21  GLN A O      1 
ATOM   209  C  CB     . GLN A 1 21  ? -3.538  -45.042 3.469   1.00 21.69 ? 21  GLN A CB     1 
ATOM   210  C  CG     . GLN A 1 21  ? -4.623  -43.997 3.666   1.00 23.48 ? 21  GLN A CG     1 
ATOM   211  C  CD     . GLN A 1 21  ? -4.239  -42.933 4.667   1.00 21.15 ? 21  GLN A CD     1 
ATOM   212  O  OE1    . GLN A 1 21  ? -3.061  -42.704 4.926   1.00 24.98 ? 21  GLN A OE1    1 
ATOM   213  N  NE2    . GLN A 1 21  ? -5.237  -42.272 5.238   1.00 24.47 ? 21  GLN A NE2    1 
ATOM   214  H  H      . GLN A 1 21  ? -2.101  -46.877 2.768   1.00 24.62 ? 21  GLN A H      1 
ATOM   215  H  HA     . GLN A 1 21  ? -4.663  -46.532 2.624   1.00 23.02 ? 21  GLN A HA     1 
ATOM   216  H  HB2    . GLN A 1 21  ? -3.424  -45.513 4.309   1.00 26.03 ? 21  GLN A HB2    1 
ATOM   217  H  HB3    . GLN A 1 21  ? -2.718  -44.579 3.238   1.00 26.03 ? 21  GLN A HB3    1 
ATOM   218  H  HG2    . GLN A 1 21  ? -4.798  -43.561 2.818   1.00 28.18 ? 21  GLN A HG2    1 
ATOM   219  H  HG3    . GLN A 1 21  ? -5.427  -44.434 3.987   1.00 28.18 ? 21  GLN A HG3    1 
ATOM   220  H  HE21   . GLN A 1 21  ? -6.050  -42.460 5.031   1.00 29.36 ? 21  GLN A HE21   1 
ATOM   221  H  HE22   . GLN A 1 21  ? -5.071  -41.657 5.815   1.00 29.36 ? 21  GLN A HE22   1 
ATOM   222  N  N      . VAL A 1 22  ? -3.027  -44.946 0.394   1.00 19.73 ? 22  VAL A N      1 
ATOM   223  C  CA     . VAL A 1 22  ? -3.114  -44.217 -0.864  1.00 22.48 ? 22  VAL A CA     1 
ATOM   224  C  C      . VAL A 1 22  ? -3.745  -45.091 -1.949  1.00 21.20 ? 22  VAL A C      1 
ATOM   225  O  O      . VAL A 1 22  ? -4.513  -44.606 -2.775  1.00 23.01 ? 22  VAL A O      1 
ATOM   226  C  CB     . VAL A 1 22  ? -1.714  -43.720 -1.294  1.00 22.44 ? 22  VAL A CB     1 
ATOM   227  C  CG1    . VAL A 1 22  ? -1.677  -43.308 -2.764  1.00 25.33 ? 22  VAL A CG1    1 
ATOM   228  C  CG2    . VAL A 1 22  ? -1.295  -42.561 -0.409  1.00 22.04 ? 22  VAL A CG2    1 
ATOM   229  H  H      . VAL A 1 22  ? -2.221  -45.089 0.658   1.00 23.67 ? 22  VAL A H      1 
ATOM   230  H  HA     . VAL A 1 22  ? -3.681  -43.440 -0.739  1.00 26.97 ? 22  VAL A HA     1 
ATOM   231  H  HB     . VAL A 1 22  ? -1.074  -44.437 -1.170  1.00 26.93 ? 22  VAL A HB     1 
ATOM   232  H  HG11   . VAL A 1 22  ? -0.783  -43.005 -2.984  1.00 30.40 ? 22  VAL A HG11   1 
ATOM   233  H  HG12   . VAL A 1 22  ? -1.912  -44.073 -3.312  1.00 30.40 ? 22  VAL A HG12   1 
ATOM   234  H  HG13   . VAL A 1 22  ? -2.315  -42.591 -2.907  1.00 30.40 ? 22  VAL A HG13   1 
ATOM   235  H  HG21   . VAL A 1 22  ? -0.417  -42.255 -0.685  1.00 26.45 ? 22  VAL A HG21   1 
ATOM   236  H  HG22   . VAL A 1 22  ? -1.940  -41.843 -0.502  1.00 26.45 ? 22  VAL A HG22   1 
ATOM   237  H  HG23   . VAL A 1 22  ? -1.266  -42.863 0.513   1.00 26.45 ? 22  VAL A HG23   1 
ATOM   238  N  N      . SER A 1 23  ? -3.439  -46.384 -1.936  1.00 21.61 ? 23  SER A N      1 
ATOM   239  C  CA     . SER A 1 23  ? -3.997  -47.293 -2.933  1.00 23.89 ? 23  SER A CA     1 
ATOM   240  C  C      . SER A 1 23  ? -5.522  -47.363 -2.818  1.00 23.45 ? 23  SER A C      1 
ATOM   241  O  O      . SER A 1 23  ? -6.223  -47.515 -3.819  1.00 25.38 ? 23  SER A O      1 
ATOM   242  C  CB     . SER A 1 23  ? -3.389  -48.691 -2.789  1.00 31.02 ? 23  SER A CB     1 
ATOM   243  O  OG     . SER A 1 23  ? -3.909  -49.367 -1.658  1.00 39.48 ? 23  SER A OG     1 
ATOM   244  H  H      . SER A 1 23  ? -2.914  -46.759 -1.367  1.00 25.94 ? 23  SER A H      1 
ATOM   245  H  HA     . SER A 1 23  ? -3.779  -46.962 -3.818  1.00 28.67 ? 23  SER A HA     1 
ATOM   246  H  HB2    . SER A 1 23  ? -3.595  -49.206 -3.585  1.00 37.22 ? 23  SER A HB2    1 
ATOM   247  H  HB3    . SER A 1 23  ? -2.428  -48.606 -2.690  1.00 37.22 ? 23  SER A HB3    1 
ATOM   248  H  HG     . SER A 1 23  ? -3.738  -48.933 -0.959  1.00 47.38 ? 23  SER A HG     1 
ATOM   249  N  N      . HIS A 1 24  ? -6.032  -47.236 -1.596  1.00 20.42 ? 24  HIS A N      1 
ATOM   250  C  CA     . HIS A 1 24  ? -7.471  -47.294 -1.359  1.00 19.72 ? 24  HIS A CA     1 
ATOM   251  C  C      . HIS A 1 24  ? -8.151  -45.948 -1.610  1.00 19.87 ? 24  HIS A C      1 
ATOM   252  O  O      . HIS A 1 24  ? -9.301  -45.910 -2.044  1.00 23.73 ? 24  HIS A O      1 
ATOM   253  C  CB     . HIS A 1 24  ? -7.758  -47.759 0.067   1.00 23.95 ? 24  HIS A CB     1 
ATOM   254  C  CG     . HIS A 1 24  ? -7.406  -49.193 0.315   1.00 28.49 ? 24  HIS A CG     1 
ATOM   255  N  ND1    . HIS A 1 24  ? -8.088  -50.234 -0.277  1.00 34.89 ? 24  HIS A ND1    1 
ATOM   256  C  CD2    . HIS A 1 24  ? -6.452  -49.755 1.087   1.00 31.61 ? 24  HIS A CD2    1 
ATOM   257  C  CE1    . HIS A 1 24  ? -7.562  -51.381 0.121   1.00 34.81 ? 24  HIS A CE1    1 
ATOM   258  N  NE2    . HIS A 1 24  ? -6.566  -51.117 0.951   1.00 35.94 ? 24  HIS A NE2    1 
ATOM   259  H  H      . HIS A 1 24  ? -5.564  -47.114 -0.885  1.00 24.50 ? 24  HIS A H      1 
ATOM   260  H  HA     . HIS A 1 24  ? -7.862  -47.941 -1.967  1.00 23.67 ? 24  HIS A HA     1 
ATOM   261  H  HB2    . HIS A 1 24  ? -7.242  -47.216 0.683   1.00 28.74 ? 24  HIS A HB2    1 
ATOM   262  H  HB3    . HIS A 1 24  ? -8.705  -47.651 0.247   1.00 28.74 ? 24  HIS A HB3    1 
ATOM   263  H  HD2    . HIS A 1 24  ? -5.831  -49.303 1.612   1.00 37.93 ? 24  HIS A HD2    1 
ATOM   264  H  HE1    . HIS A 1 24  ? -7.846  -52.229 -0.137  1.00 41.77 ? 24  HIS A HE1    1 
ATOM   265  N  N      . LEU A 1 25  ? -7.448  -44.851 -1.335  1.00 17.13 ? 25  LEU A N      1 
ATOM   266  C  CA     . LEU A 1 25  ? -8.015  -43.515 -1.520  1.00 17.08 ? 25  LEU A CA     1 
ATOM   267  C  C      . LEU A 1 25  ? -8.036  -43.074 -2.986  1.00 18.61 ? 25  LEU A C      1 
ATOM   268  O  O      . LEU A 1 25  ? -8.918  -42.316 -3.396  1.00 19.62 ? 25  LEU A O      1 
ATOM   269  C  CB     . LEU A 1 25  ? -7.236  -42.479 -0.705  1.00 17.13 ? 25  LEU A CB     1 
ATOM   270  C  CG     . LEU A 1 25  ? -7.425  -42.438 0.812   1.00 20.00 ? 25  LEU A CG     1 
ATOM   271  C  CD1    . LEU A 1 25  ? -6.361  -41.530 1.426   1.00 19.39 ? 25  LEU A CD1    1 
ATOM   272  C  CD2    . LEU A 1 25  ? -8.817  -41.951 1.188   1.00 21.01 ? 25  LEU A CD2    1 
ATOM   273  H  H      . LEU A 1 25  ? -6.641  -44.853 -1.040  1.00 20.56 ? 25  LEU A H      1 
ATOM   274  H  HA     . LEU A 1 25  ? -8.931  -43.517 -1.199  1.00 20.50 ? 25  LEU A HA     1 
ATOM   275  H  HB2    . LEU A 1 25  ? -6.291  -42.630 -0.864  1.00 20.55 ? 25  LEU A HB2    1 
ATOM   276  H  HB3    . LEU A 1 25  ? -7.474  -41.601 -1.039  1.00 20.55 ? 25  LEU A HB3    1 
ATOM   277  H  HG     . LEU A 1 25  ? -7.307  -43.331 1.173   1.00 23.99 ? 25  LEU A HG     1 
ATOM   278  H  HD11   . LEU A 1 25  ? -6.484  -41.506 2.388   1.00 23.27 ? 25  LEU A HD11   1 
ATOM   279  H  HD12   . LEU A 1 25  ? -5.483  -41.884 1.213   1.00 23.27 ? 25  LEU A HD12   1 
ATOM   280  H  HD13   . LEU A 1 25  ? -6.457  -40.638 1.058   1.00 23.27 ? 25  LEU A HD13   1 
ATOM   281  H  HD21   . LEU A 1 25  ? -8.896  -41.939 2.155   1.00 25.22 ? 25  LEU A HD21   1 
ATOM   282  H  HD22   . LEU A 1 25  ? -8.944  -41.057 0.834   1.00 25.22 ? 25  LEU A HD22   1 
ATOM   283  H  HD23   . LEU A 1 25  ? -9.475  -42.554 0.809   1.00 25.22 ? 25  LEU A HD23   1 
ATOM   284  N  N      . ALA A 1 26  ? -7.066  -43.539 -3.768  1.00 18.84 ? 26  ALA A N      1 
ATOM   285  C  CA     . ALA A 1 26  ? -6.872  -43.022 -5.123  1.00 19.22 ? 26  ALA A CA     1 
ATOM   286  C  C      . ALA A 1 26  ? -8.124  -43.133 -6.005  1.00 19.14 ? 26  ALA A C      1 
ATOM   287  O  O      . ALA A 1 26  ? -8.470  -42.176 -6.692  1.00 20.47 ? 26  ALA A O      1 
ATOM   288  C  CB     . ALA A 1 26  ? -5.687  -43.721 -5.788  1.00 21.04 ? 26  ALA A CB     1 
ATOM   289  H  H      . ALA A 1 26  ? -6.507  -44.151 -3.540  1.00 22.60 ? 26  ALA A H      1 
ATOM   290  H  HA     . ALA A 1 26  ? -6.650  -42.080 -5.058  1.00 23.06 ? 26  ALA A HA     1 
ATOM   291  H  HB1    . ALA A 1 26  ? -5.573  -43.367 -6.683  1.00 25.25 ? 26  ALA A HB1    1 
ATOM   292  H  HB2    . ALA A 1 26  ? -4.888  -43.556 -5.262  1.00 25.25 ? 26  ALA A HB2    1 
ATOM   293  H  HB3    . ALA A 1 26  ? -5.865  -44.674 -5.829  1.00 25.25 ? 26  ALA A HB3    1 
ATOM   294  N  N      . PRO A 1 27  ? -8.817  -44.287 -5.984  1.00 20.10 ? 27  PRO A N      1 
ATOM   295  C  CA     . PRO A 1 27  ? -9.994  -44.435 -6.852  1.00 22.96 ? 27  PRO A CA     1 
ATOM   296  C  C      . PRO A 1 27  ? -11.181 -43.527 -6.502  1.00 23.11 ? 27  PRO A C      1 
ATOM   297  O  O      . PRO A 1 27  ? -12.089 -43.387 -7.323  1.00 24.96 ? 27  PRO A O      1 
ATOM   298  C  CB     . PRO A 1 27  ? -10.379 -45.909 -6.662  1.00 23.27 ? 27  PRO A CB     1 
ATOM   299  C  CG     . PRO A 1 27  ? -9.144  -46.572 -6.169  1.00 26.86 ? 27  PRO A CG     1 
ATOM   300  C  CD     . PRO A 1 27  ? -8.484  -45.554 -5.309  1.00 22.51 ? 27  PRO A CD     1 
ATOM   301  H  HA     . PRO A 1 27  ? -9.745  -44.289 -7.778  1.00 27.56 ? 27  PRO A HA     1 
ATOM   302  H  HB2    . PRO A 1 27  ? -11.091 -45.979 -6.007  1.00 27.93 ? 27  PRO A HB2    1 
ATOM   303  H  HB3    . PRO A 1 27  ? -10.656 -46.287 -7.511  1.00 27.93 ? 27  PRO A HB3    1 
ATOM   304  H  HG2    . PRO A 1 27  ? -9.378  -47.359 -5.653  1.00 32.24 ? 27  PRO A HG2    1 
ATOM   305  H  HG3    . PRO A 1 27  ? -8.577  -46.808 -6.920  1.00 32.24 ? 27  PRO A HG3    1 
ATOM   306  H  HD2    . PRO A 1 27  ? -8.858  -45.571 -4.415  1.00 27.01 ? 27  PRO A HD2    1 
ATOM   307  H  HD3    . PRO A 1 27  ? -7.524  -45.690 -5.298  1.00 27.01 ? 27  PRO A HD3    1 
ATOM   308  N  N      . LEU A 1 28  ? -11.180 -42.928 -5.314  1.00 19.78 ? 28  LEU A N      1 
ATOM   309  C  CA     . LEU A 1 28  ? -12.266 -42.032 -4.907  1.00 19.56 ? 28  LEU A CA     1 
ATOM   310  C  C      . LEU A 1 28  ? -12.148 -40.674 -5.591  1.00 20.82 ? 28  LEU A C      1 
ATOM   311  O  O      . LEU A 1 28  ? -11.060 -40.266 -5.982  1.00 24.22 ? 28  LEU A O      1 
ATOM   312  C  CB     . LEU A 1 28  ? -12.265 -41.821 -3.391  1.00 21.01 ? 28  LEU A CB     1 
ATOM   313  C  CG     . LEU A 1 28  ? -12.289 -43.029 -2.455  1.00 24.23 ? 28  LEU A CG     1 
ATOM   314  C  CD1    . LEU A 1 28  ? -12.190 -42.535 -1.022  1.00 25.83 ? 28  LEU A CD1    1 
ATOM   315  C  CD2    . LEU A 1 28  ? -13.542 -43.860 -2.650  1.00 25.32 ? 28  LEU A CD2    1 
ATOM   316  H  H      . LEU A 1 28  ? -10.563 -43.023 -4.723  1.00 23.74 ? 28  LEU A H      1 
ATOM   317  H  HA     . LEU A 1 28  ? -13.116 -42.426 -5.158  1.00 23.47 ? 28  LEU A HA     1 
ATOM   318  H  HB2    . LEU A 1 28  ? -11.469 -41.316 -3.167  1.00 25.21 ? 28  LEU A HB2    1 
ATOM   319  H  HB3    . LEU A 1 28  ? -13.045 -41.287 -3.171  1.00 25.21 ? 28  LEU A HB3    1 
ATOM   320  H  HG     . LEU A 1 28  ? -11.520 -43.590 -2.637  1.00 29.07 ? 28  LEU A HG     1 
ATOM   321  H  HD11   . LEU A 1 28  ? -12.204 -43.298 -0.424  1.00 30.99 ? 28  LEU A HD11   1 
ATOM   322  H  HD12   . LEU A 1 28  ? -11.359 -42.045 -0.914  1.00 30.99 ? 28  LEU A HD12   1 
ATOM   323  H  HD13   . LEU A 1 28  ? -12.944 -41.953 -0.836  1.00 30.99 ? 28  LEU A HD13   1 
ATOM   324  H  HD21   . LEU A 1 28  ? -13.518 -44.614 -2.039  1.00 30.39 ? 28  LEU A HD21   1 
ATOM   325  H  HD22   . LEU A 1 28  ? -14.319 -43.309 -2.465  1.00 30.39 ? 28  LEU A HD22   1 
ATOM   326  H  HD23   . LEU A 1 28  ? -13.572 -44.177 -3.566  1.00 30.39 ? 28  LEU A HD23   1 
ATOM   327  N  N      . ASP A 1 29  ? -13.268 -39.969 -5.720  1.00 22.15 ? 29  ASP A N      1 
ATOM   328  C  CA     . ASP A 1 29  ? -13.244 -38.589 -6.213  1.00 23.34 ? 29  ASP A CA     1 
ATOM   329  C  C      . ASP A 1 29  ? -13.193 -37.591 -5.049  1.00 25.27 ? 29  ASP A C      1 
ATOM   330  O  O      . ASP A 1 29  ? -13.275 -36.375 -5.245  1.00 27.81 ? 29  ASP A O      1 
ATOM   331  C  CB     . ASP A 1 29  ? -14.461 -38.317 -7.104  1.00 25.89 ? 29  ASP A CB     1 
ATOM   332  C  CG     . ASP A 1 29  ? -14.203 -38.628 -8.577  1.00 37.89 ? 29  ASP A CG     1 
ATOM   333  O  OD1    . ASP A 1 29  ? -13.040 -38.874 -8.966  1.00 38.84 ? 29  ASP A OD1    1 
ATOM   334  O  OD2    . ASP A 1 29  ? -15.177 -38.608 -9.359  1.00 47.91 ? 29  ASP A OD2    1 
ATOM   335  H  H      . ASP A 1 29  ? -14.054 -40.262 -5.531  1.00 26.58 ? 29  ASP A H      1 
ATOM   336  H  HA     . ASP A 1 29  ? -12.446 -38.461 -6.750  1.00 28.00 ? 29  ASP A HA     1 
ATOM   337  H  HB2    . ASP A 1 29  ? -15.200 -38.870 -6.806  1.00 31.06 ? 29  ASP A HB2    1 
ATOM   338  H  HB3    . ASP A 1 29  ? -14.700 -37.379 -7.034  1.00 31.06 ? 29  ASP A HB3    1 
ATOM   339  N  N      . LYS A 1 30  ? -13.026 -38.115 -3.840  1.00 21.11 ? 30  LYS A N      1 
ATOM   340  C  CA     . LYS A 1 30  ? -13.026 -37.303 -2.629  1.00 18.79 ? 30  LYS A CA     1 
ATOM   341  C  C      . LYS A 1 30  ? -11.716 -36.558 -2.420  1.00 16.89 ? 30  LYS A C      1 
ATOM   342  O  O      . LYS A 1 30  ? -10.649 -37.070 -2.771  1.00 19.19 ? 30  LYS A O      1 
ATOM   343  C  CB     . LYS A 1 30  ? -13.281 -38.179 -1.404  1.00 19.63 ? 30  LYS A CB     1 
ATOM   344  C  CG     . LYS A 1 30  ? -14.579 -38.954 -1.447  1.00 20.59 ? 30  LYS A CG     1 
ATOM   345  C  CD     . LYS A 1 30  ? -15.787 -38.047 -1.305  1.00 21.82 ? 30  LYS A CD     1 
ATOM   346  C  CE     . LYS A 1 30  ? -17.059 -38.869 -1.399  1.00 25.34 ? 30  LYS A CE     1 
ATOM   347  N  NZ     . LYS A 1 30  ? -18.283 -38.051 -1.581  1.00 25.63 ? 30  LYS A NZ     1 
ATOM   348  H  H      . LYS A 1 30  ? -12.908 -38.954 -3.693  1.00 25.33 ? 30  LYS A H      1 
ATOM   349  H  HA     . LYS A 1 30  ? -13.739 -36.648 -2.687  1.00 22.55 ? 30  LYS A HA     1 
ATOM   350  H  HB2    . LYS A 1 30  ? -12.558 -38.821 -1.326  1.00 23.56 ? 30  LYS A HB2    1 
ATOM   351  H  HB3    . LYS A 1 30  ? -13.303 -37.613 -0.617  1.00 23.56 ? 30  LYS A HB3    1 
ATOM   352  H  HG2    . LYS A 1 30  ? -14.646 -39.416 -2.297  1.00 24.71 ? 30  LYS A HG2    1 
ATOM   353  H  HG3    . LYS A 1 30  ? -14.593 -39.593 -0.717  1.00 24.71 ? 30  LYS A HG3    1 
ATOM   354  H  HD2    . LYS A 1 30  ? -15.765 -37.608 -0.440  1.00 26.18 ? 30  LYS A HD2    1 
ATOM   355  H  HD3    . LYS A 1 30  ? -15.789 -37.392 -2.020  1.00 26.18 ? 30  LYS A HD3    1 
ATOM   356  H  HE2    . LYS A 1 30  ? -16.988 -39.470 -2.156  1.00 30.41 ? 30  LYS A HE2    1 
ATOM   357  H  HE3    . LYS A 1 30  ? -17.162 -39.380 -0.581  1.00 30.41 ? 30  LYS A HE3    1 
ATOM   358  H  HZ1    . LYS A 1 30  ? -18.997 -38.579 -1.630  1.00 30.75 ? 30  LYS A HZ1    1 
ATOM   359  H  HZ2    . LYS A 1 30  ? -18.382 -37.494 -0.894  1.00 30.75 ? 30  LYS A HZ2    1 
ATOM   360  H  HZ3    . LYS A 1 30  ? -18.222 -37.576 -2.332  1.00 30.75 ? 30  LYS A HZ3    1 
ATOM   361  N  N      . PRO A 1 31  ? -11.784 -35.366 -1.805  1.00 16.80 ? 31  PRO A N      1 
ATOM   362  C  CA     . PRO A 1 31  ? -10.543 -34.635 -1.521  1.00 18.33 ? 31  PRO A CA     1 
ATOM   363  C  C      . PRO A 1 31  ? -9.693  -35.328 -0.463  1.00 18.18 ? 31  PRO A C      1 
ATOM   364  O  O      . PRO A 1 31  ? -10.219 -35.949 0.461   1.00 19.80 ? 31  PRO A O      1 
ATOM   365  C  CB     . PRO A 1 31  ? -11.034 -33.268 -1.030  1.00 22.24 ? 31  PRO A CB     1 
ATOM   366  C  CG     . PRO A 1 31  ? -12.432 -33.482 -0.589  1.00 23.49 ? 31  PRO A CG     1 
ATOM   367  C  CD     . PRO A 1 31  ? -12.984 -34.612 -1.397  1.00 17.76 ? 31  PRO A CD     1 
ATOM   368  H  HA     . PRO A 1 31  ? -10.023 -34.521 -2.331  1.00 22.00 ? 31  PRO A HA     1 
ATOM   369  H  HB2    . PRO A 1 31  ? -10.484 -32.971 -0.288  1.00 26.68 ? 31  PRO A HB2    1 
ATOM   370  H  HB3    . PRO A 1 31  ? -10.999 -32.629 -1.758  1.00 26.68 ? 31  PRO A HB3    1 
ATOM   371  H  HG2    . PRO A 1 31  ? -12.440 -33.708 0.354   1.00 28.19 ? 31  PRO A HG2    1 
ATOM   372  H  HG3    . PRO A 1 31  ? -12.945 -32.674 -0.746  1.00 28.19 ? 31  PRO A HG3    1 
ATOM   373  H  HD2    . PRO A 1 31  ? -13.562 -35.167 -0.851  1.00 21.31 ? 31  PRO A HD2    1 
ATOM   374  H  HD3    . PRO A 1 31  ? -13.450 -34.272 -2.177  1.00 21.31 ? 31  PRO A HD3    1 
ATOM   375  N  N      . VAL A 1 32  ? -8.379  -35.220 -0.615  1.00 19.14 ? 32  VAL A N      1 
ATOM   376  C  CA     . VAL A 1 32  ? -7.432  -35.835 0.301   1.00 17.21 ? 32  VAL A CA     1 
ATOM   377  C  C      . VAL A 1 32  ? -6.463  -34.778 0.810   1.00 17.08 ? 32  VAL A C      1 
ATOM   378  O  O      . VAL A 1 32  ? -5.941  -33.972 0.040   1.00 18.41 ? 32  VAL A O      1 
ATOM   379  C  CB     . VAL A 1 32  ? -6.654  -36.982 -0.376  1.00 19.60 ? 32  VAL A CB     1 
ATOM   380  C  CG1    . VAL A 1 32  ? -5.591  -37.553 0.557   1.00 17.98 ? 32  VAL A CG1    1 
ATOM   381  C  CG2    . VAL A 1 32  ? -7.613  -38.079 -0.819  1.00 21.76 ? 32  VAL A CG2    1 
ATOM   382  H  H      . VAL A 1 32  ? -8.005  -34.785 -1.256  1.00 22.96 ? 32  VAL A H      1 
ATOM   383  H  HA     . VAL A 1 32  ? -7.912  -36.200 1.061   1.00 20.65 ? 32  VAL A HA     1 
ATOM   384  H  HB     . VAL A 1 32  ? -6.207  -36.638 -1.165  1.00 23.52 ? 32  VAL A HB     1 
ATOM   385  H  HG11   . VAL A 1 32  ? -5.123  -38.269 0.100   1.00 21.58 ? 32  VAL A HG11   1 
ATOM   386  H  HG12   . VAL A 1 32  ? -4.968  -36.848 0.794   1.00 21.58 ? 32  VAL A HG12   1 
ATOM   387  H  HG13   . VAL A 1 32  ? -6.024  -37.895 1.355   1.00 21.58 ? 32  VAL A HG13   1 
ATOM   388  H  HG21   . VAL A 1 32  ? -7.106  -38.790 -1.242  1.00 26.11 ? 32  VAL A HG21   1 
ATOM   389  H  HG22   . VAL A 1 32  ? -8.080  -38.423 -0.041  1.00 26.11 ? 32  VAL A HG22   1 
ATOM   390  H  HG23   . VAL A 1 32  ? -8.250  -37.707 -1.449  1.00 26.11 ? 32  VAL A HG23   1 
ATOM   391  N  N      . LEU A 1 33  ? -6.245  -34.786 2.119   1.00 18.02 ? 33  LEU A N      1 
ATOM   392  C  CA     . LEU A 1 33  ? -5.297  -33.890 2.763   1.00 16.30 ? 33  LEU A CA     1 
ATOM   393  C  C      . LEU A 1 33  ? -4.050  -34.682 3.145   1.00 15.55 ? 33  LEU A C      1 
ATOM   394  O  O      . LEU A 1 33  ? -4.149  -35.713 3.802   1.00 18.19 ? 33  LEU A O      1 
ATOM   395  C  CB     . LEU A 1 33  ? -5.927  -33.241 3.999   1.00 18.52 ? 33  LEU A CB     1 
ATOM   396  C  CG     . LEU A 1 33  ? -5.044  -32.311 4.829   1.00 21.24 ? 33  LEU A CG     1 
ATOM   397  C  CD1    . LEU A 1 33  ? -4.608  -31.104 4.014   1.00 23.97 ? 33  LEU A CD1    1 
ATOM   398  C  CD2    . LEU A 1 33  ? -5.784  -31.874 6.086   1.00 24.03 ? 33  LEU A CD2    1 
ATOM   399  H  H      . LEU A 1 33  ? -6.645  -35.314 2.668   1.00 21.62 ? 33  LEU A H      1 
ATOM   400  H  HA     . LEU A 1 33  ? -5.040  -33.189 2.144   1.00 19.56 ? 33  LEU A HA     1 
ATOM   401  H  HB2    . LEU A 1 33  ? -6.693  -32.721 3.709   1.00 22.22 ? 33  LEU A HB2    1 
ATOM   402  H  HB3    . LEU A 1 33  ? -6.229  -33.949 4.590   1.00 22.22 ? 33  LEU A HB3    1 
ATOM   403  H  HG     . LEU A 1 33  ? -4.247  -32.792 5.102   1.00 25.48 ? 33  LEU A HG     1 
ATOM   404  H  HD11   . LEU A 1 33  ? -4.050  -30.534 4.567   1.00 28.77 ? 33  LEU A HD11   1 
ATOM   405  H  HD12   . LEU A 1 33  ? -4.107  -31.409 3.241   1.00 28.77 ? 33  LEU A HD12   1 
ATOM   406  H  HD13   . LEU A 1 33  ? -5.396  -30.617 3.726   1.00 28.77 ? 33  LEU A HD13   1 
ATOM   407  H  HD21   . LEU A 1 33  ? -5.211  -31.285 6.602   1.00 28.83 ? 33  LEU A HD21   1 
ATOM   408  H  HD22   . LEU A 1 33  ? -6.594  -31.406 5.829   1.00 28.83 ? 33  LEU A HD22   1 
ATOM   409  H  HD23   . LEU A 1 33  ? -6.008  -32.660 6.610   1.00 28.83 ? 33  LEU A HD23   1 
ATOM   410  N  N      . ILE A 1 34  ? -2.888  -34.196 2.715   1.00 17.45 ? 34  ILE A N      1 
ATOM   411  C  CA     . ILE A 1 34  ? -1.607  -34.811 3.043   1.00 16.54 ? 34  ILE A CA     1 
ATOM   412  C  C      . ILE A 1 34  ? -0.883  -33.924 4.052   1.00 17.87 ? 34  ILE A C      1 
ATOM   413  O  O      . ILE A 1 34  ? -0.658  -32.741 3.796   1.00 20.21 ? 34  ILE A O      1 
ATOM   414  C  CB     . ILE A 1 34  ? -0.720  -35.001 1.795   1.00 16.69 ? 34  ILE A CB     1 
ATOM   415  C  CG1    . ILE A 1 34  ? -1.453  -35.812 0.724   1.00 18.47 ? 34  ILE A CG1    1 
ATOM   416  C  CG2    . ILE A 1 34  ? 0.592   -35.689 2.167   1.00 17.64 ? 34  ILE A CG2    1 
ATOM   417  C  CD1    . ILE A 1 34  ? -0.780  -35.781 -0.637  1.00 19.84 ? 34  ILE A CD1    1 
ATOM   418  H  H      . ILE A 1 34  ? -2.816  -33.495 2.222   1.00 20.94 ? 34  ILE A H      1 
ATOM   419  H  HA     . ILE A 1 34  ? -1.758  -35.679 3.449   1.00 19.85 ? 34  ILE A HA     1 
ATOM   420  H  HB     . ILE A 1 34  ? -0.514  -34.127 1.429   1.00 20.03 ? 34  ILE A HB     1 
ATOM   421  H  HG12   . ILE A 1 34  ? -1.500  -36.738 1.011   1.00 22.16 ? 34  ILE A HG12   1 
ATOM   422  H  HG13   . ILE A 1 34  ? -2.349  -35.455 0.621   1.00 22.16 ? 34  ILE A HG13   1 
ATOM   423  H  HG21   . ILE A 1 34  ? 1.130   -35.797 1.368   1.00 21.16 ? 34  ILE A HG21   1 
ATOM   424  H  HG22   . ILE A 1 34  ? 1.064   -35.140 2.813   1.00 21.16 ? 34  ILE A HG22   1 
ATOM   425  H  HG23   . ILE A 1 34  ? 0.395   -36.557 2.553   1.00 21.16 ? 34  ILE A HG23   1 
ATOM   426  H  HD11   . ILE A 1 34  ? -1.300  -36.314 -1.258  1.00 23.81 ? 34  ILE A HD11   1 
ATOM   427  H  HD12   . ILE A 1 34  ? -0.736  -34.862 -0.946  1.00 23.81 ? 34  ILE A HD12   1 
ATOM   428  H  HD13   . ILE A 1 34  ? 0.114   -36.146 -0.555  1.00 23.81 ? 34  ILE A HD13   1 
ATOM   429  N  N      . ILE A 1 35  ? -0.534  -34.496 5.198   1.00 19.35 ? 35  ILE A N      1 
ATOM   430  C  CA     . ILE A 1 35  ? 0.200   -33.780 6.232   1.00 17.25 ? 35  ILE A CA     1 
ATOM   431  C  C      . ILE A 1 35  ? 1.621   -34.322 6.293   1.00 15.82 ? 35  ILE A C      1 
ATOM   432  O  O      . ILE A 1 35  ? 1.830   -35.535 6.360   1.00 21.88 ? 35  ILE A O      1 
ATOM   433  C  CB     . ILE A 1 35  ? -0.464  -33.923 7.623   1.00 20.93 ? 35  ILE A CB     1 
ATOM   434  C  CG1    . ILE A 1 35  ? -1.941  -33.524 7.563   1.00 28.38 ? 35  ILE A CG1    1 
ATOM   435  C  CG2    . ILE A 1 35  ? 0.276   -33.085 8.661   1.00 22.34 ? 35  ILE A CG2    1 
ATOM   436  C  CD1    . ILE A 1 35  ? -2.189  -32.094 7.112   1.00 32.36 ? 35  ILE A CD1    1 
ATOM   437  H  H      . ILE A 1 35  ? -0.714  -35.312 5.404   1.00 23.22 ? 35  ILE A H      1 
ATOM   438  H  HA     . ILE A 1 35  ? 0.240   -32.837 6.006   1.00 20.71 ? 35  ILE A HA     1 
ATOM   439  H  HB     . ILE A 1 35  ? -0.411  -34.854 7.890   1.00 25.12 ? 35  ILE A HB     1 
ATOM   440  H  HG12   . ILE A 1 35  ? -2.396  -34.112 6.940   1.00 34.06 ? 35  ILE A HG12   1 
ATOM   441  H  HG13   . ILE A 1 35  ? -2.326  -33.625 8.447   1.00 34.06 ? 35  ILE A HG13   1 
ATOM   442  H  HG21   . ILE A 1 35  ? -0.160  -33.193 9.521   1.00 26.80 ? 35  ILE A HG21   1 
ATOM   443  H  HG22   . ILE A 1 35  ? 1.195   -33.389 8.714   1.00 26.80 ? 35  ILE A HG22   1 
ATOM   444  H  HG23   . ILE A 1 35  ? 0.250   -32.154 8.391   1.00 26.80 ? 35  ILE A HG23   1 
ATOM   445  H  HD11   . ILE A 1 35  ? -3.145  -31.927 7.103   1.00 38.83 ? 35  ILE A HD11   1 
ATOM   446  H  HD12   . ILE A 1 35  ? -1.753  -31.488 7.731   1.00 38.83 ? 35  ILE A HD12   1 
ATOM   447  H  HD13   . ILE A 1 35  ? -1.824  -31.977 6.221   1.00 38.83 ? 35  ILE A HD13   1 
ATOM   448  N  N      . GLY A 1 36  ? 2.601   -33.432 6.262   1.00 18.32 ? 36  GLY A N      1 
ATOM   449  C  CA     . GLY A 1 36  ? 3.983   -33.857 6.339   1.00 17.24 ? 36  GLY A CA     1 
ATOM   450  C  C      . GLY A 1 36  ? 4.965   -32.716 6.220   1.00 14.53 ? 36  GLY A C      1 
ATOM   451  O  O      . GLY A 1 36  ? 4.670   -31.681 5.623   1.00 17.16 ? 36  GLY A O      1 
ATOM   452  H  H      . GLY A 1 36  ? 2.491   -32.581 6.198   1.00 21.99 ? 36  GLY A H      1 
ATOM   453  H  HA2    . GLY A 1 36  ? 4.134   -34.303 7.187   1.00 20.69 ? 36  GLY A HA2    1 
ATOM   454  H  HA3    . GLY A 1 36  ? 4.164   -34.490 5.626   1.00 20.69 ? 36  GLY A HA3    1 
ATOM   455  N  N      . GLU A 1 37  ? 6.143   -32.927 6.794   1.00 17.85 ? 37  GLU A N      1 
ATOM   456  C  CA     . GLU A 1 37  ? 7.226   -31.951 6.760   1.00 18.48 ? 37  GLU A CA     1 
ATOM   457  C  C      . GLU A 1 37  ? 7.803   -31.800 5.359   1.00 17.03 ? 37  GLU A C      1 
ATOM   458  O  O      . GLU A 1 37  ? 7.536   -32.612 4.478   1.00 16.04 ? 37  GLU A O      1 
ATOM   459  C  CB     . GLU A 1 37  ? 8.323   -32.366 7.744   1.00 18.42 ? 37  GLU A CB     1 
ATOM   460  C  CG     . GLU A 1 37  ? 7.909   -32.223 9.200   1.00 20.69 ? 37  GLU A CG     1 
ATOM   461  C  CD     . GLU A 1 37  ? 8.937   -32.770 10.172  1.00 24.61 ? 37  GLU A CD     1 
ATOM   462  O  OE1    . GLU A 1 37  ? 10.125  -32.869 9.802   1.00 23.32 ? 37  GLU A OE1    1 
ATOM   463  O  OE2    . GLU A 1 37  ? 8.552   -33.104 11.312  1.00 26.93 ? 37  GLU A OE2    1 
ATOM   464  H  H      . GLU A 1 37  ? 6.345   -33.646 7.221   1.00 21.42 ? 37  GLU A H      1 
ATOM   465  H  HA     . GLU A 1 37  ? 6.883   -31.088 7.039   1.00 22.18 ? 37  GLU A HA     1 
ATOM   466  H  HB2    . GLU A 1 37  ? 8.550   -33.296 7.588   1.00 22.11 ? 37  GLU A HB2    1 
ATOM   467  H  HB3    . GLU A 1 37  ? 9.103   -31.807 7.599   1.00 22.11 ? 37  GLU A HB3    1 
ATOM   468  H  HG2    . GLU A 1 37  ? 7.781   -31.283 9.399   1.00 24.83 ? 37  GLU A HG2    1 
ATOM   469  H  HG3    . GLU A 1 37  ? 7.080   -32.706 9.339   1.00 24.83 ? 37  GLU A HG3    1 
ATOM   470  N  N      . ARG A 1 38  ? 8.598   -30.754 5.147   1.00 16.88 ? 38  ARG A N      1 
ATOM   471  C  CA     . ARG A 1 38  ? 9.260   -30.587 3.862   1.00 17.81 ? 38  ARG A CA     1 
ATOM   472  C  C      . ARG A 1 38  ? 10.156  -31.791 3.577   1.00 15.00 ? 38  ARG A C      1 
ATOM   473  O  O      . ARG A 1 38  ? 10.765  -32.362 4.487   1.00 15.78 ? 38  ARG A O      1 
ATOM   474  C  CB     . ARG A 1 38  ? 10.074  -29.288 3.824   1.00 18.76 ? 38  ARG A CB     1 
ATOM   475  C  CG     . ARG A 1 38  ? 11.355  -29.289 4.625   1.00 19.54 ? 38  ARG A CG     1 
ATOM   476  C  CD     . ARG A 1 38  ? 12.184  -28.041 4.327   1.00 21.99 ? 38  ARG A CD     1 
ATOM   477  N  NE     . ARG A 1 38  ? 13.458  -28.049 5.043   1.00 23.50 ? 38  ARG A NE     1 
ATOM   478  C  CZ     . ARG A 1 38  ? 13.616  -27.646 6.299   1.00 25.93 ? 38  ARG A CZ     1 
ATOM   479  N  NH1    . ARG A 1 38  ? 12.583  -27.185 6.993   1.00 28.26 ? 38  ARG A NH1    1 
ATOM   480  N  NH2    . ARG A 1 38  ? 14.813  -27.696 6.863   1.00 32.17 ? 38  ARG A NH2    1 
ATOM   481  H  H      . ARG A 1 38  ? 8.766   -30.137 5.722   1.00 20.25 ? 38  ARG A H      1 
ATOM   482  H  HA     . ARG A 1 38  ? 8.589   -30.541 3.164   1.00 21.38 ? 38  ARG A HA     1 
ATOM   483  H  HB2    . ARG A 1 38  ? 10.309  -29.102 2.901   1.00 22.51 ? 38  ARG A HB2    1 
ATOM   484  H  HB3    . ARG A 1 38  ? 9.519   -28.570 4.166   1.00 22.51 ? 38  ARG A HB3    1 
ATOM   485  H  HG2    . ARG A 1 38  ? 11.143  -29.297 5.571   1.00 23.45 ? 38  ARG A HG2    1 
ATOM   486  H  HG3    . ARG A 1 38  ? 11.881  -30.070 4.390   1.00 23.45 ? 38  ARG A HG3    1 
ATOM   487  H  HD2    . ARG A 1 38  ? 12.371  -28.002 3.376   1.00 26.38 ? 38  ARG A HD2    1 
ATOM   488  H  HD3    . ARG A 1 38  ? 11.687  -27.255 4.602   1.00 26.38 ? 38  ARG A HD3    1 
ATOM   489  H  HE     . ARG A 1 38  ? 14.152  -28.334 4.623   1.00 28.21 ? 38  ARG A HE     1 
ATOM   490  H  HH11   . ARG A 1 38  ? 11.803  -27.151 6.632   1.00 33.91 ? 38  ARG A HH11   1 
ATOM   491  H  HH12   . ARG A 1 38  ? 12.692  -26.924 7.805   1.00 33.91 ? 38  ARG A HH12   1 
ATOM   492  H  HH21   . ARG A 1 38  ? 15.487  -27.992 6.417   1.00 38.61 ? 38  ARG A HH21   1 
ATOM   493  H  HH22   . ARG A 1 38  ? 14.918  -27.432 7.674   1.00 38.61 ? 38  ARG A HH22   1 
ATOM   494  N  N      . GLY A 1 39  ? 10.209  -32.182 2.311   1.00 16.45 ? 39  GLY A N      1 
ATOM   495  C  CA     . GLY A 1 39  ? 11.080  -33.254 1.873   1.00 15.22 ? 39  GLY A CA     1 
ATOM   496  C  C      . GLY A 1 39  ? 10.600  -34.656 2.197   1.00 16.61 ? 39  GLY A C      1 
ATOM   497  O  O      . GLY A 1 39  ? 11.385  -35.592 2.110   1.00 17.26 ? 39  GLY A O      1 
ATOM   498  H  H      . GLY A 1 39  ? 9.741   -31.834 1.678   1.00 19.74 ? 39  GLY A H      1 
ATOM   499  H  HA2    . GLY A 1 39  ? 11.192  -33.193 0.911   1.00 18.27 ? 39  GLY A HA2    1 
ATOM   500  H  HA3    . GLY A 1 39  ? 11.951  -33.136 2.283   1.00 18.27 ? 39  GLY A HA3    1 
ATOM   501  N  N      . THR A 1 40  ? 9.328   -34.815 2.562   1.00 16.59 ? 40  THR A N      1 
ATOM   502  C  CA     . THR A 1 40  ? 8.804   -36.142 2.893   1.00 18.64 ? 40  THR A CA     1 
ATOM   503  C  C      . THR A 1 40  ? 8.088   -36.826 1.730   1.00 22.73 ? 40  THR A C      1 
ATOM   504  O  O      . THR A 1 40  ? 7.643   -37.965 1.871   1.00 29.43 ? 40  THR A O      1 
ATOM   505  C  CB     . THR A 1 40  ? 7.827   -36.096 4.084   1.00 19.90 ? 40  THR A CB     1 
ATOM   506  O  OG1    . THR A 1 40  ? 6.798   -35.129 3.834   1.00 18.22 ? 40  THR A OG1    1 
ATOM   507  C  CG2    . THR A 1 40  ? 8.564   -35.756 5.369   1.00 18.68 ? 40  THR A CG2    1 
ATOM   508  H  H      . THR A 1 40  ? 8.753   -34.179 2.627   1.00 19.91 ? 40  THR A H      1 
ATOM   509  H  HA     . THR A 1 40  ? 9.548   -36.709 3.149   1.00 22.37 ? 40  THR A HA     1 
ATOM   510  H  HB     . THR A 1 40  ? 7.420   -36.969 4.194   1.00 23.87 ? 40  THR A HB     1 
ATOM   511  H  HG1    . THR A 1 40  ? 6.264   -35.102 4.482   1.00 21.87 ? 40  THR A HG1    1 
ATOM   512  H  HG21   . THR A 1 40  ? 7.940   -35.729 6.112   1.00 22.42 ? 40  THR A HG21   1 
ATOM   513  H  HG22   . THR A 1 40  ? 9.241   -36.426 5.550   1.00 22.42 ? 40  THR A HG22   1 
ATOM   514  H  HG23   . THR A 1 40  ? 8.992   -34.889 5.286   1.00 22.42 ? 40  THR A HG23   1 
ATOM   515  N  N      . GLY A 1 41  ? 7.971   -36.148 0.592   1.00 21.93 ? 41  GLY A N      1 
ATOM   516  C  CA     . GLY A 1 41  ? 7.393   -36.768 -0.593  1.00 24.22 ? 41  GLY A CA     1 
ATOM   517  C  C      . GLY A 1 41  ? 5.933   -36.451 -0.888  1.00 22.97 ? 41  GLY A C      1 
ATOM   518  O  O      . GLY A 1 41  ? 5.253   -37.227 -1.562  1.00 24.79 ? 41  GLY A O      1 
ATOM   519  H  H      . GLY A 1 41  ? 8.216   -35.331 0.481   1.00 26.31 ? 41  GLY A H      1 
ATOM   520  H  HA2    . GLY A 1 41  ? 7.913   -36.498 -1.367  1.00 29.07 ? 41  GLY A HA2    1 
ATOM   521  H  HA3    . GLY A 1 41  ? 7.472   -37.731 -0.507  1.00 29.07 ? 41  GLY A HA3    1 
ATOM   522  N  N      . LYS A 1 42  ? 5.441   -35.315 -0.410  1.00 20.37 ? 42  LYS A N      1 
ATOM   523  C  CA     . LYS A 1 42  ? 4.007   -35.032 -0.497  1.00 18.13 ? 42  LYS A CA     1 
ATOM   524  C  C      . LYS A 1 42  ? 3.485   -34.908 -1.936  1.00 20.56 ? 42  LYS A C      1 
ATOM   525  O  O      . LYS A 1 42  ? 2.437   -35.471 -2.247  1.00 20.94 ? 42  LYS A O      1 
ATOM   526  C  CB     . LYS A 1 42  ? 3.677   -33.770 0.304   1.00 22.58 ? 42  LYS A CB     1 
ATOM   527  C  CG     . LYS A 1 42  ? 3.860   -33.978 1.804   1.00 22.11 ? 42  LYS A CG     1 
ATOM   528  C  CD     . LYS A 1 42  ? 3.261   -32.871 2.652   1.00 26.13 ? 42  LYS A CD     1 
ATOM   529  C  CE     . LYS A 1 42  ? 3.873   -31.516 2.353   1.00 24.67 ? 42  LYS A CE     1 
ATOM   530  N  NZ     . LYS A 1 42  ? 5.318   -31.479 2.704   1.00 24.87 ? 42  LYS A NZ     1 
ATOM   531  H  H      . LYS A 1 42  ? 5.906   -34.697 -0.034  1.00 24.44 ? 42  LYS A H      1 
ATOM   532  H  HA     . LYS A 1 42  ? 3.530   -35.767 -0.083  1.00 21.75 ? 42  LYS A HA     1 
ATOM   533  H  HB2    . LYS A 1 42  ? 4.266   -33.052 0.024   1.00 27.09 ? 42  LYS A HB2    1 
ATOM   534  H  HB3    . LYS A 1 42  ? 2.752   -33.525 0.144   1.00 27.09 ? 42  LYS A HB3    1 
ATOM   535  H  HG2    . LYS A 1 42  ? 3.434   -34.811 2.059   1.00 26.53 ? 42  LYS A HG2    1 
ATOM   536  H  HG3    . LYS A 1 42  ? 4.809   -34.021 2.000   1.00 26.53 ? 42  LYS A HG3    1 
ATOM   537  H  HD2    . LYS A 1 42  ? 2.309   -32.816 2.476   1.00 31.36 ? 42  LYS A HD2    1 
ATOM   538  H  HD3    . LYS A 1 42  ? 3.415   -33.070 3.589   1.00 31.36 ? 42  LYS A HD3    1 
ATOM   539  H  HE2    . LYS A 1 42  ? 3.785   -31.327 1.406   1.00 29.60 ? 42  LYS A HE2    1 
ATOM   540  H  HE3    . LYS A 1 42  ? 3.417   -30.837 2.874   1.00 29.60 ? 42  LYS A HE3    1 
ATOM   541  H  HZ1    . LYS A 1 42  ? 5.655   -30.676 2.520   1.00 29.84 ? 42  LYS A HZ1    1 
ATOM   542  H  HZ2    . LYS A 1 42  ? 5.425   -31.646 3.572   1.00 29.84 ? 42  LYS A HZ2    1 
ATOM   543  H  HZ3    . LYS A 1 42  ? 5.761   -32.093 2.235   1.00 29.84 ? 42  LYS A HZ3    1 
ATOM   544  N  N      . GLU A 1 43  ? 4.192   -34.203 -2.818  1.00 22.83 ? 43  GLU A N      1 
ATOM   545  C  CA     . GLU A 1 43  ? 3.710   -34.079 -4.196  1.00 23.38 ? 43  GLU A CA     1 
ATOM   546  C  C      . GLU A 1 43  ? 3.801   -35.422 -4.927  1.00 26.67 ? 43  GLU A C      1 
ATOM   547  O  O      . GLU A 1 43  ? 2.984   -35.716 -5.800  1.00 24.37 ? 43  GLU A O      1 
ATOM   548  C  CB     . GLU A 1 43  ? 4.479   -33.003 -4.970  1.00 25.25 ? 43  GLU A CB     1 
ATOM   549  C  CG     . GLU A 1 43  ? 3.994   -32.851 -6.413  1.00 31.38 ? 43  GLU A CG     1 
ATOM   550  C  CD     . GLU A 1 43  ? 4.297   -31.491 -7.020  1.00 37.04 ? 43  GLU A CD     1 
ATOM   551  O  OE1    . GLU A 1 43  ? 4.859   -30.624 -6.316  1.00 38.35 ? 43  GLU A OE1    1 
ATOM   552  O  OE2    . GLU A 1 43  ? 3.962   -31.287 -8.208  1.00 36.12 ? 43  GLU A OE2    1 
ATOM   553  H  H      . GLU A 1 43  ? 4.932   -33.797 -2.652  1.00 27.40 ? 43  GLU A H      1 
ATOM   554  H  HA     . GLU A 1 43  ? 2.776   -33.817 -4.176  1.00 28.05 ? 43  GLU A HA     1 
ATOM   555  N  N      . LEU A 1 44  ? 4.782   -36.242 -4.563  1.00 29.14 ? 44  LEU A N      1 
ATOM   556  C  CA     . LEU A 1 44  ? 4.898   -37.579 -5.141  1.00 28.15 ? 44  LEU A CA     1 
ATOM   557  C  C      . LEU A 1 44  ? 3.711   -38.460 -4.731  1.00 24.72 ? 44  LEU A C      1 
ATOM   558  O  O      . LEU A 1 44  ? 3.202   -39.247 -5.531  1.00 22.90 ? 44  LEU A O      1 
ATOM   559  C  CB     . LEU A 1 44  ? 6.215   -38.237 -4.724  1.00 30.99 ? 44  LEU A CB     1 
ATOM   560  C  CG     . LEU A 1 44  ? 7.513   -37.578 -5.207  1.00 39.67 ? 44  LEU A CG     1 
ATOM   561  C  CD1    . LEU A 1 44  ? 8.718   -38.378 -4.736  1.00 41.32 ? 44  LEU A CD1    1 
ATOM   562  C  CD2    . LEU A 1 44  ? 7.540   -37.422 -6.725  1.00 44.75 ? 44  LEU A CD2    1 
ATOM   563  H  H      . LEU A 1 44  ? 5.391   -36.050 -3.987  1.00 34.96 ? 44  LEU A H      1 
ATOM   564  H  HA     . LEU A 1 44  ? 4.894   -37.504 -6.108  1.00 33.78 ? 44  LEU A HA     1 
ATOM   565  H  HB2    . LEU A 1 44  ? 6.249   -38.255 -3.755  1.00 37.19 ? 44  LEU A HB2    1 
ATOM   566  H  HB3    . LEU A 1 44  ? 6.216   -39.147 -5.060  1.00 37.19 ? 44  LEU A HB3    1 
ATOM   567  H  HG     . LEU A 1 44  ? 7.576   -36.692 -4.817  1.00 47.61 ? 44  LEU A HG     1 
ATOM   568  H  HD11   . LEU A 1 44  ? 9.527   -37.945 -5.052  1.00 49.59 ? 44  LEU A HD11   1 
ATOM   569  H  HD12   . LEU A 1 44  ? 8.716   -38.410 -3.767  1.00 49.59 ? 44  LEU A HD12   1 
ATOM   570  H  HD13   . LEU A 1 44  ? 8.661   -39.276 -5.098  1.00 49.59 ? 44  LEU A HD13   1 
ATOM   571  H  HD21   . LEU A 1 44  ? 8.375   -37.002 -6.984  1.00 53.70 ? 44  LEU A HD21   1 
ATOM   572  H  HD22   . LEU A 1 44  ? 7.469   -38.298 -7.134  1.00 53.70 ? 44  LEU A HD22   1 
ATOM   573  H  HD23   . LEU A 1 44  ? 6.792   -36.867 -6.999  1.00 53.70 ? 44  LEU A HD23   1 
ATOM   574  N  N      . ILE A 1 45  ? 3.270   -38.324 -3.485  1.00 21.26 ? 45  ILE A N      1 
ATOM   575  C  CA     . ILE A 1 45  ? 2.084   -39.038 -3.021  1.00 19.64 ? 45  ILE A CA     1 
ATOM   576  C  C      . ILE A 1 45  ? 0.848   -38.518 -3.756  1.00 17.80 ? 45  ILE A C      1 
ATOM   577  O  O      . ILE A 1 45  ? -0.024  -39.293 -4.145  1.00 18.99 ? 45  ILE A O      1 
ATOM   578  C  CB     . ILE A 1 45  ? 1.903   -38.897 -1.490  1.00 20.47 ? 45  ILE A CB     1 
ATOM   579  C  CG1    . ILE A 1 45  ? 2.998   -39.670 -0.744  1.00 21.38 ? 45  ILE A CG1    1 
ATOM   580  C  CG2    . ILE A 1 45  ? 0.519   -39.371 -1.045  1.00 20.43 ? 45  ILE A CG2    1 
ATOM   581  C  CD1    . ILE A 1 45  ? 2.969   -41.184 -0.936  1.00 26.80 ? 45  ILE A CD1    1 
ATOM   582  H  H      . ILE A 1 45  ? 3.638   -37.826 -2.889  1.00 25.52 ? 45  ILE A H      1 
ATOM   583  H  HA     . ILE A 1 45  ? 2.182   -39.981 -3.226  1.00 23.57 ? 45  ILE A HA     1 
ATOM   584  H  HB     . ILE A 1 45  ? 1.988   -37.958 -1.262  1.00 24.56 ? 45  ILE A HB     1 
ATOM   585  H  HG12   . ILE A 1 45  ? 3.862   -39.353 -1.051  1.00 25.65 ? 45  ILE A HG12   1 
ATOM   586  H  HG13   . ILE A 1 45  ? 2.906   -39.494 0.206   1.00 25.65 ? 45  ILE A HG13   1 
ATOM   587  H  HG21   . ILE A 1 45  ? 0.445   -39.267 -0.083  1.00 24.51 ? 45  ILE A HG21   1 
ATOM   588  H  HG22   . ILE A 1 45  ? -0.156  -38.834 -1.489  1.00 24.51 ? 45  ILE A HG22   1 
ATOM   589  H  HG23   . ILE A 1 45  ? 0.412   -40.304 -1.286  1.00 24.51 ? 45  ILE A HG23   1 
ATOM   590  H  HD11   . ILE A 1 45  ? 3.694   -41.580 -0.428  1.00 32.16 ? 45  ILE A HD11   1 
ATOM   591  H  HD12   . ILE A 1 45  ? 2.118   -41.526 -0.619  1.00 32.16 ? 45  ILE A HD12   1 
ATOM   592  H  HD13   . ILE A 1 45  ? 3.076   -41.384 -1.879  1.00 32.16 ? 45  ILE A HD13   1 
ATOM   593  N  N      . ALA A 1 46  ? 0.769   -37.207 -3.958  1.00 19.40 ? 46  ALA A N      1 
ATOM   594  C  CA     . ALA A 1 46  ? -0.355  -36.640 -4.700  1.00 18.75 ? 46  ALA A CA     1 
ATOM   595  C  C      . ALA A 1 46  ? -0.375  -37.191 -6.124  1.00 19.29 ? 46  ALA A C      1 
ATOM   596  O  O      . ALA A 1 46  ? -1.436  -37.488 -6.673  1.00 21.00 ? 46  ALA A O      1 
ATOM   597  C  CB     . ALA A 1 46  ? -0.280  -35.124 -4.712  1.00 19.56 ? 46  ALA A CB     1 
ATOM   598  H  H      . ALA A 1 46  ? 1.343   -36.630 -3.680  1.00 23.29 ? 46  ALA A H      1 
ATOM   599  H  HA     . ALA A 1 46  ? -1.183  -36.897 -4.266  1.00 22.50 ? 46  ALA A HA     1 
ATOM   600  H  HB1    . ALA A 1 46  ? -1.036  -34.775 -5.210  1.00 23.47 ? 46  ALA A HB1    1 
ATOM   601  H  HB2    . ALA A 1 46  ? -0.308  -34.800 -3.798  1.00 23.47 ? 46  ALA A HB2    1 
ATOM   602  H  HB3    . ALA A 1 46  ? 0.549   -34.853 -5.135  1.00 23.47 ? 46  ALA A HB3    1 
ATOM   603  N  N      . SER A 1 47  ? 0.811   -37.332 -6.708  1.00 20.20 ? 47  SER A N      1 
ATOM   604  C  CA     . SER A 1 47  ? 0.954   -37.866 -8.057  1.00 22.42 ? 47  SER A CA     1 
ATOM   605  C  C      . SER A 1 47  ? 0.447   -39.305 -8.121  1.00 21.98 ? 47  SER A C      1 
ATOM   606  O  O      . SER A 1 47  ? -0.202  -39.718 -9.082  1.00 22.66 ? 47  SER A O      1 
ATOM   607  C  CB     . SER A 1 47  ? 2.419   -37.797 -8.498  1.00 26.43 ? 47  SER A CB     1 
ATOM   608  O  OG     . SER A 1 47  ? 2.585   -38.303 -9.809  1.00 37.27 ? 47  SER A OG     1 
ATOM   609  H  H      . SER A 1 47  ? 1.558   -37.124 -6.337  1.00 24.24 ? 47  SER A H      1 
ATOM   610  H  HA     . SER A 1 47  ? 0.426   -37.331 -8.670  1.00 26.91 ? 47  SER A HA     1 
ATOM   611  H  HB2    . SER A 1 47  ? 2.710   -36.872 -8.479  1.00 31.71 ? 47  SER A HB2    1 
ATOM   612  H  HB3    . SER A 1 47  ? 2.956   -38.325 -7.887  1.00 31.71 ? 47  SER A HB3    1 
ATOM   613  H  HG     . SER A 1 47  ? 3.393   -38.257 -10.035 1.00 44.73 ? 47  SER A HG     1 
ATOM   614  N  N      . ARG A 1 48  ? 0.747   -40.062 -7.075  1.00 22.64 ? 48  ARG A N      1 
ATOM   615  C  CA     . ARG A 1 48  ? 0.332   -41.453 -6.983  1.00 24.18 ? 48  ARG A CA     1 
ATOM   616  C  C      . ARG A 1 48  ? -1.187  -41.569 -6.877  1.00 20.91 ? 48  ARG A C      1 
ATOM   617  O  O      . ARG A 1 48  ? -1.799  -42.443 -7.492  1.00 23.18 ? 48  ARG A O      1 
ATOM   618  C  CB     . ARG A 1 48  ? 1.008   -42.106 -5.781  1.00 25.70 ? 48  ARG A CB     1 
ATOM   619  C  CG     . ARG A 1 48  ? 0.999   -43.614 -5.776  1.00 29.90 ? 48  ARG A CG     1 
ATOM   620  C  CD     . ARG A 1 48  ? 1.890   -44.118 -4.657  1.00 29.27 ? 48  ARG A CD     1 
ATOM   621  N  NE     . ARG A 1 48  ? 1.828   -45.567 -4.496  1.00 36.23 ? 48  ARG A NE     1 
ATOM   622  C  CZ     . ARG A 1 48  ? 2.682   -46.428 -5.041  1.00 40.89 ? 48  ARG A CZ     1 
ATOM   623  N  NH1    . ARG A 1 48  ? 3.685   -46.006 -5.799  1.00 43.87 ? 48  ARG A NH1    1 
ATOM   624  N  NH2    . ARG A 1 48  ? 2.529   -47.725 -4.824  1.00 44.26 ? 48  ARG A NH2    1 
ATOM   625  H  H      . ARG A 1 48  ? 1.198   -39.789 -6.396  1.00 27.17 ? 48  ARG A H      1 
ATOM   626  H  HA     . ARG A 1 48  ? 0.616   -41.924 -7.782  1.00 29.02 ? 48  ARG A HA     1 
ATOM   627  H  HB2    . ARG A 1 48  ? 1.934   -41.820 -5.756  1.00 30.84 ? 48  ARG A HB2    1 
ATOM   628  H  HB3    . ARG A 1 48  ? 0.556   -41.809 -4.975  1.00 30.84 ? 48  ARG A HB3    1 
ATOM   629  H  HG2    . ARG A 1 48  ? 0.096   -43.936 -5.624  1.00 35.89 ? 48  ARG A HG2    1 
ATOM   630  H  HG3    . ARG A 1 48  ? 1.343   -43.946 -6.621  1.00 35.89 ? 48  ARG A HG3    1 
ATOM   631  H  HD2    . ARG A 1 48  ? 2.809   -43.876 -4.851  1.00 35.13 ? 48  ARG A HD2    1 
ATOM   632  H  HD3    . ARG A 1 48  ? 1.609   -43.711 -3.822  1.00 35.13 ? 48  ARG A HD3    1 
ATOM   633  H  HE     . ARG A 1 48  ? 1.192   -45.887 -4.014  1.00 43.48 ? 48  ARG A HE     1 
ATOM   634  H  HH11   . ARG A 1 48  ? 3.791   -45.165 -5.943  1.00 52.64 ? 48  ARG A HH11   1 
ATOM   635  H  HH12   . ARG A 1 48  ? 4.230   -46.574 -6.146  1.00 52.64 ? 48  ARG A HH12   1 
ATOM   636  H  HH21   . ARG A 1 48  ? 1.880   -48.006 -4.334  1.00 53.12 ? 48  ARG A HH21   1 
ATOM   637  H  HH22   . ARG A 1 48  ? 3.077   -48.287 -5.174  1.00 53.12 ? 48  ARG A HH22   1 
ATOM   638  N  N      . LEU A 1 49  ? -1.795  -40.681 -6.096  1.00 22.57 ? 49  LEU A N      1 
ATOM   639  C  CA     . LEU A 1 49  ? -3.247  -40.630 -5.990  1.00 22.63 ? 49  LEU A CA     1 
ATOM   640  C  C      . LEU A 1 49  ? -3.867  -40.415 -7.366  1.00 21.79 ? 49  LEU A C      1 
ATOM   641  O  O      . LEU A 1 49  ? -4.870  -41.035 -7.697  1.00 27.08 ? 49  LEU A O      1 
ATOM   642  C  CB     . LEU A 1 49  ? -3.683  -39.522 -5.027  1.00 22.05 ? 49  LEU A CB     1 
ATOM   643  C  CG     . LEU A 1 49  ? -3.468  -39.821 -3.541  1.00 21.96 ? 49  LEU A CG     1 
ATOM   644  C  CD1    . LEU A 1 49  ? -3.558  -38.548 -2.714  1.00 21.86 ? 49  LEU A CD1    1 
ATOM   645  C  CD2    . LEU A 1 49  ? -4.476  -40.854 -3.044  1.00 20.14 ? 49  LEU A CD2    1 
ATOM   646  H  H      . LEU A 1 49  ? -1.386  -40.095 -5.617  1.00 27.09 ? 49  LEU A H      1 
ATOM   647  H  HA     . LEU A 1 49  ? -3.570  -41.476 -5.642  1.00 27.15 ? 49  LEU A HA     1 
ATOM   648  H  HB2    . LEU A 1 49  ? -3.182  -38.718 -5.237  1.00 26.46 ? 49  LEU A HB2    1 
ATOM   649  H  HB3    . LEU A 1 49  ? -4.630  -39.357 -5.157  1.00 26.46 ? 49  LEU A HB3    1 
ATOM   650  H  HG     . LEU A 1 49  ? -2.580  -40.191 -3.421  1.00 26.35 ? 49  LEU A HG     1 
ATOM   651  H  HD11   . LEU A 1 49  ? -3.419  -38.769 -1.779  1.00 26.24 ? 49  LEU A HD11   1 
ATOM   652  H  HD12   . LEU A 1 49  ? -2.875  -37.929 -3.013  1.00 26.24 ? 49  LEU A HD12   1 
ATOM   653  H  HD13   . LEU A 1 49  ? -4.437  -38.156 -2.834  1.00 26.24 ? 49  LEU A HD13   1 
ATOM   654  H  HD21   . LEU A 1 49  ? -4.316  -41.023 -2.103  1.00 24.17 ? 49  LEU A HD21   1 
ATOM   655  H  HD22   . LEU A 1 49  ? -5.372  -40.506 -3.171  1.00 24.17 ? 49  LEU A HD22   1 
ATOM   656  H  HD23   . LEU A 1 49  ? -4.364  -41.673 -3.551  1.00 24.17 ? 49  LEU A HD23   1 
ATOM   657  N  N      . HIS A 1 50  ? -3.261  -39.546 -8.169  1.00 18.80 ? 50  HIS A N      1 
ATOM   658  C  CA     . HIS A 1 50  ? -3.740  -39.304 -9.525  1.00 18.48 ? 50  HIS A CA     1 
ATOM   659  C  C      . HIS A 1 50  ? -3.590  -40.532 -10.427 1.00 21.41 ? 50  HIS A C      1 
ATOM   660  O  O      . HIS A 1 50  ? -4.545  -40.965 -11.068 1.00 22.60 ? 50  HIS A O      1 
ATOM   661  C  CB     . HIS A 1 50  ? -2.995  -38.123 -10.155 1.00 21.55 ? 50  HIS A CB     1 
ATOM   662  C  CG     . HIS A 1 50  ? -3.422  -37.829 -11.562 1.00 23.36 ? 50  HIS A CG     1 
ATOM   663  N  ND1    . HIS A 1 50  ? -4.647  -37.279 -11.864 1.00 21.75 ? 50  HIS A ND1    1 
ATOM   664  C  CD2    . HIS A 1 50  ? -2.792  -38.023 -12.745 1.00 25.26 ? 50  HIS A CD2    1 
ATOM   665  C  CE1    . HIS A 1 50  ? -4.753  -37.137 -13.177 1.00 22.96 ? 50  HIS A CE1    1 
ATOM   666  N  NE2    . HIS A 1 50  ? -3.639  -37.582 -13.731 1.00 25.39 ? 50  HIS A NE2    1 
ATOM   667  H  H      . HIS A 1 50  ? -2.569  -39.084 -7.952  1.00 22.56 ? 50  HIS A H      1 
ATOM   668  H  HA     . HIS A 1 50  ? -4.682  -39.076 -9.487  1.00 22.17 ? 50  HIS A HA     1 
ATOM   669  H  HB2    . HIS A 1 50  ? -3.158  -37.329 -9.623  1.00 25.86 ? 50  HIS A HB2    1 
ATOM   670  H  HB3    . HIS A 1 50  ? -2.046  -38.322 -10.168 1.00 25.86 ? 50  HIS A HB3    1 
ATOM   671  H  HD2    . HIS A 1 50  ? -1.943  -38.382 -12.866 1.00 30.31 ? 50  HIS A HD2    1 
ATOM   672  H  HE1    . HIS A 1 50  ? -5.485  -36.786 -13.630 1.00 27.56 ? 50  HIS A HE1    1 
ATOM   673  N  N      . TYR A 1 51  ? -2.392  -41.096 -10.485 1.00 20.18 ? 51  TYR A N      1 
ATOM   674  C  CA     . TYR A 1 51  ? -2.130  -42.125 -11.482 1.00 21.95 ? 51  TYR A CA     1 
ATOM   675  C  C      . TYR A 1 51  ? -2.696  -43.496 -11.105 1.00 22.52 ? 51  TYR A C      1 
ATOM   676  O  O      . TYR A 1 51  ? -2.820  -44.365 -11.966 1.00 24.37 ? 51  TYR A O      1 
ATOM   677  C  CB     . TYR A 1 51  ? -0.629  -42.191 -11.758 1.00 29.44 ? 51  TYR A CB     1 
ATOM   678  C  CG     . TYR A 1 51  ? -0.189  -41.015 -12.602 1.00 34.55 ? 51  TYR A CG     1 
ATOM   679  C  CD1    . TYR A 1 51  ? -0.537  -40.941 -13.945 1.00 36.68 ? 51  TYR A CD1    1 
ATOM   680  C  CD2    . TYR A 1 51  ? 0.538   -39.967 -12.057 1.00 33.68 ? 51  TYR A CD2    1 
ATOM   681  C  CE1    . TYR A 1 51  ? -0.161  -39.870 -14.723 1.00 36.04 ? 51  TYR A CE1    1 
ATOM   682  C  CE2    . TYR A 1 51  ? 0.922   -38.889 -12.830 1.00 37.47 ? 51  TYR A CE2    1 
ATOM   683  C  CZ     . TYR A 1 51  ? 0.570   -38.846 -14.163 1.00 37.86 ? 51  TYR A CZ     1 
ATOM   684  O  OH     . TYR A 1 51  ? 0.946   -37.776 -14.942 1.00 43.63 ? 51  TYR A OH     1 
ATOM   685  H  H      . TYR A 1 51  ? -1.727  -40.908 -9.973  1.00 24.21 ? 51  TYR A H      1 
ATOM   686  H  HA     . TYR A 1 51  ? -2.561  -41.858 -12.309 1.00 26.34 ? 51  TYR A HA     1 
ATOM   687  H  HB2    . TYR A 1 51  ? -0.145  -42.163 -10.918 1.00 35.32 ? 51  TYR A HB2    1 
ATOM   688  H  HB3    . TYR A 1 51  ? -0.425  -43.008 -12.240 1.00 35.32 ? 51  TYR A HB3    1 
ATOM   689  H  HD1    . TYR A 1 51  ? -1.031  -41.631 -14.327 1.00 44.02 ? 51  TYR A HD1    1 
ATOM   690  H  HD2    . TYR A 1 51  ? 0.777   -39.994 -11.158 1.00 40.42 ? 51  TYR A HD2    1 
ATOM   691  H  HE1    . TYR A 1 51  ? -0.397  -39.840 -15.622 1.00 43.24 ? 51  TYR A HE1    1 
ATOM   692  H  HE2    . TYR A 1 51  ? 1.415   -38.196 -12.454 1.00 44.96 ? 51  TYR A HE2    1 
ATOM   693  H  HH     . TYR A 1 51  ? 1.384   -37.226 -14.483 1.00 52.36 ? 51  TYR A HH     1 
ATOM   694  N  N      . LEU A 1 52  ? -3.083  -43.675 -9.845  1.00 21.48 ? 52  LEU A N      1 
ATOM   695  C  CA     . LEU A 1 52  ? -3.797  -44.885 -9.430  1.00 24.72 ? 52  LEU A CA     1 
ATOM   696  C  C      . LEU A 1 52  ? -5.314  -44.694 -9.444  1.00 22.63 ? 52  LEU A C      1 
ATOM   697  O  O      . LEU A 1 52  ? -6.066  -45.614 -9.115  1.00 28.41 ? 52  LEU A O      1 
ATOM   698  C  CB     . LEU A 1 52  ? -3.350  -45.325 -8.035  1.00 26.67 ? 52  LEU A CB     1 
ATOM   699  C  CG     . LEU A 1 52  ? -1.894  -45.780 -7.906  1.00 27.76 ? 52  LEU A CG     1 
ATOM   700  C  CD1    . LEU A 1 52  ? -1.590  -46.168 -6.470  1.00 29.54 ? 52  LEU A CD1    1 
ATOM   701  C  CD2    . LEU A 1 52  ? -1.594  -46.940 -8.849  1.00 30.99 ? 52  LEU A CD2    1 
ATOM   702  H  H      . LEU A 1 52  ? -2.945  -43.112 -9.209  1.00 25.77 ? 52  LEU A H      1 
ATOM   703  H  HA     . LEU A 1 52  ? -3.584  -45.601 -10.049 1.00 29.66 ? 52  LEU A HA     1 
ATOM   704  H  HB2    . LEU A 1 52  ? -3.475  -44.581 -7.426  1.00 32.01 ? 52  LEU A HB2    1 
ATOM   705  H  HB3    . LEU A 1 52  ? -3.910  -46.067 -7.755  1.00 32.01 ? 52  LEU A HB3    1 
ATOM   706  H  HG     . LEU A 1 52  ? -1.312  -45.042 -8.145  1.00 33.31 ? 52  LEU A HG     1 
ATOM   707  H  HD11   . LEU A 1 52  ? -0.664  -46.452 -6.410  1.00 35.44 ? 52  LEU A HD11   1 
ATOM   708  H  HD12   . LEU A 1 52  ? -1.738  -45.399 -5.897  1.00 35.44 ? 52  LEU A HD12   1 
ATOM   709  H  HD13   . LEU A 1 52  ? -2.177  -46.894 -6.208  1.00 35.44 ? 52  LEU A HD13   1 
ATOM   710  H  HD21   . LEU A 1 52  ? -0.666  -47.202 -8.742  1.00 37.19 ? 52  LEU A HD21   1 
ATOM   711  H  HD22   . LEU A 1 52  ? -2.176  -47.684 -8.628  1.00 37.19 ? 52  LEU A HD22   1 
ATOM   712  H  HD23   . LEU A 1 52  ? -1.754  -46.654 -9.762  1.00 37.19 ? 52  LEU A HD23   1 
ATOM   713  N  N      . SER A 1 53  ? -5.763  -43.504 -9.830  1.00 22.42 ? 53  SER A N      1 
ATOM   714  C  CA     . SER A 1 53  ? -7.193  -43.220 -9.899  1.00 23.12 ? 53  SER A CA     1 
ATOM   715  C  C      . SER A 1 53  ? -7.723  -43.468 -11.305 1.00 24.92 ? 53  SER A C      1 
ATOM   716  O  O      . SER A 1 53  ? -6.959  -43.757 -12.229 1.00 25.17 ? 53  SER A O      1 
ATOM   717  C  CB     . SER A 1 53  ? -7.487  -41.778 -9.489  1.00 21.98 ? 53  SER A CB     1 
ATOM   718  O  OG     . SER A 1 53  ? -7.209  -40.885 -10.553 1.00 23.63 ? 53  SER A OG     1 
ATOM   719  H  H      . SER A 1 53  ? -5.260  -42.845 -10.058 1.00 26.91 ? 53  SER A H      1 
ATOM   720  H  HA     . SER A 1 53  ? -7.664  -43.810 -9.290  1.00 27.74 ? 53  SER A HA     1 
ATOM   721  H  HB2    . SER A 1 53  ? -8.424  -41.702 -9.250  1.00 26.38 ? 53  SER A HB2    1 
ATOM   722  H  HB3    . SER A 1 53  ? -6.930  -41.546 -8.729  1.00 26.38 ? 53  SER A HB3    1 
ATOM   723  H  HG     . SER A 1 53  ? -6.400  -40.941 -10.771 1.00 28.36 ? 53  SER A HG     1 
ATOM   724  N  N      . SER A 1 54  ? -9.035  -43.352 -11.462 1.00 27.17 ? 54  SER A N      1 
ATOM   725  C  CA     . SER A 1 54  ? -9.654  -43.470 -12.774 1.00 29.88 ? 54  SER A CA     1 
ATOM   726  C  C      . SER A 1 54  ? -9.314  -42.260 -13.646 1.00 27.78 ? 54  SER A C      1 
ATOM   727  O  O      . SER A 1 54  ? -9.530  -42.283 -14.856 1.00 31.65 ? 54  SER A O      1 
ATOM   728  C  CB     . SER A 1 54  ? -11.170 -43.614 -12.638 1.00 32.19 ? 54  SER A CB     1 
ATOM   729  O  OG     . SER A 1 54  ? -11.761 -42.395 -12.230 1.00 35.07 ? 54  SER A OG     1 
ATOM   730  H  H      . SER A 1 54  ? -9.591  -43.203 -10.823 1.00 32.60 ? 54  SER A H      1 
ATOM   731  H  HA     . SER A 1 54  ? -9.314  -44.265 -13.215 1.00 35.85 ? 54  SER A HA     1 
ATOM   732  H  HB2    . SER A 1 54  ? -11.540 -43.872 -13.496 1.00 38.63 ? 54  SER A HB2    1 
ATOM   733  H  HB3    . SER A 1 54  ? -11.363 -44.295 -11.975 1.00 38.63 ? 54  SER A HB3    1 
ATOM   734  H  HG     . SER A 1 54  ? -12.592 -42.489 -12.159 1.00 42.08 ? 54  SER A HG     1 
ATOM   735  N  N      . ARG A 1 55  ? -8.777  -41.211 -13.025 1.00 28.19 ? 55  ARG A N      1 
ATOM   736  C  CA     . ARG A 1 55  ? -8.445  -39.970 -13.726 1.00 27.79 ? 55  ARG A CA     1 
ATOM   737  C  C      . ARG A 1 55  ? -7.045  -39.953 -14.314 1.00 27.08 ? 55  ARG A C      1 
ATOM   738  O  O      . ARG A 1 55  ? -6.597  -38.914 -14.797 1.00 28.78 ? 55  ARG A O      1 
ATOM   739  C  CB     . ARG A 1 55  ? -8.572  -38.780 -12.776 1.00 30.11 ? 55  ARG A CB     1 
ATOM   740  C  CG     . ARG A 1 55  ? -9.976  -38.482 -12.368 1.00 32.39 ? 55  ARG A CG     1 
ATOM   741  C  CD     . ARG A 1 55  ? -10.034 -37.484 -11.237 1.00 27.63 ? 55  ARG A CD     1 
ATOM   742  N  NE     . ARG A 1 55  ? -11.424 -37.278 -10.853 1.00 29.77 ? 55  ARG A NE     1 
ATOM   743  C  CZ     . ARG A 1 55  ? -12.180 -36.258 -11.245 1.00 28.46 ? 55  ARG A CZ     1 
ATOM   744  N  NH1    . ARG A 1 55  ? -11.685 -35.294 -12.017 1.00 24.86 ? 55  ARG A NH1    1 
ATOM   745  N  NH2    . ARG A 1 55  ? -13.441 -36.194 -10.845 1.00 32.01 ? 55  ARG A NH2    1 
ATOM   746  H  H      . ARG A 1 55  ? -8.593  -41.192 -12.185 1.00 33.82 ? 55  ARG A H      1 
ATOM   747  H  HA     . ARG A 1 55  ? -9.075  -39.842 -14.453 1.00 33.35 ? 55  ARG A HA     1 
ATOM   748  H  HB2    . ARG A 1 55  ? -8.063  -38.966 -11.972 1.00 36.13 ? 55  ARG A HB2    1 
ATOM   749  H  HB3    . ARG A 1 55  ? -8.217  -37.991 -13.214 1.00 36.13 ? 55  ARG A HB3    1 
ATOM   750  H  HG2    . ARG A 1 55  ? -10.456 -38.109 -13.124 1.00 38.86 ? 55  ARG A HG2    1 
ATOM   751  H  HG3    . ARG A 1 55  ? -10.403 -39.301 -12.071 1.00 38.86 ? 55  ARG A HG3    1 
ATOM   752  H  HD2    . ARG A 1 55  ? -9.547  -37.828 -10.471 1.00 33.15 ? 55  ARG A HD2    1 
ATOM   753  H  HD3    . ARG A 1 55  ? -9.662  -36.637 -11.528 1.00 33.15 ? 55  ARG A HD3    1 
ATOM   754  H  HE     . ARG A 1 55  ? -11.783 -37.862 -10.333 1.00 35.72 ? 55  ARG A HE     1 
ATOM   755  H  HH11   . ARG A 1 55  ? -10.868 -35.334 -12.283 1.00 29.84 ? 55  ARG A HH11   1 
ATOM   756  H  HH12   . ARG A 1 55  ? -12.184 -34.637 -12.258 1.00 29.84 ? 55  ARG A HH12   1 
ATOM   757  H  HH21   . ARG A 1 55  ? -13.763 -36.810 -10.339 1.00 38.41 ? 55  ARG A HH21   1 
ATOM   758  H  HH22   . ARG A 1 55  ? -13.934 -35.531 -11.082 1.00 38.41 ? 55  ARG A HH22   1 
ATOM   759  N  N      . TRP A 1 56  ? -6.356  -41.088 -14.281 1.00 27.72 ? 56  TRP A N      1 
ATOM   760  C  CA     . TRP A 1 56  ? -4.921  -41.108 -14.552 1.00 28.34 ? 56  TRP A CA     1 
ATOM   761  C  C      . TRP A 1 56  ? -4.546  -40.547 -15.929 1.00 28.32 ? 56  TRP A C      1 
ATOM   762  O  O      . TRP A 1 56  ? -3.434  -40.049 -16.104 1.00 27.92 ? 56  TRP A O      1 
ATOM   763  C  CB     . TRP A 1 56  ? -4.380  -42.532 -14.404 1.00 28.40 ? 56  TRP A CB     1 
ATOM   764  C  CG     . TRP A 1 56  ? -4.914  -43.501 -15.405 1.00 31.11 ? 56  TRP A CG     1 
ATOM   765  C  CD1    . TRP A 1 56  ? -6.111  -44.155 -15.359 1.00 33.88 ? 56  TRP A CD1    1 
ATOM   766  C  CD2    . TRP A 1 56  ? -4.262  -43.938 -16.601 1.00 37.29 ? 56  TRP A CD2    1 
ATOM   767  N  NE1    . TRP A 1 56  ? -6.245  -44.970 -16.457 1.00 35.19 ? 56  TRP A NE1    1 
ATOM   768  C  CE2    . TRP A 1 56  ? -5.122  -44.856 -17.234 1.00 37.53 ? 56  TRP A CE2    1 
ATOM   769  C  CE3    . TRP A 1 56  ? -3.034  -43.642 -17.198 1.00 41.14 ? 56  TRP A CE3    1 
ATOM   770  C  CZ2    . TRP A 1 56  ? -4.795  -45.476 -18.438 1.00 40.66 ? 56  TRP A CZ2    1 
ATOM   771  C  CZ3    . TRP A 1 56  ? -2.710  -44.259 -18.390 1.00 39.39 ? 56  TRP A CZ3    1 
ATOM   772  C  CH2    . TRP A 1 56  ? -3.587  -45.165 -18.997 1.00 41.19 ? 56  TRP A CH2    1 
ATOM   773  H  H      . TRP A 1 56  ? -6.694  -41.859 -14.104 1.00 33.26 ? 56  TRP A H      1 
ATOM   774  H  HA     . TRP A 1 56  ? -4.478  -40.559 -13.887 1.00 34.01 ? 56  TRP A HA     1 
ATOM   775  H  HB2    . TRP A 1 56  ? -3.415  -42.510 -14.502 1.00 34.09 ? 56  TRP A HB2    1 
ATOM   776  H  HB3    . TRP A 1 56  ? -4.612  -42.862 -13.522 1.00 34.09 ? 56  TRP A HB3    1 
ATOM   777  H  HD1    . TRP A 1 56  ? -6.744  -44.062 -14.684 1.00 40.66 ? 56  TRP A HD1    1 
ATOM   778  H  HE1    . TRP A 1 56  ? -6.923  -45.471 -16.628 1.00 42.23 ? 56  TRP A HE1    1 
ATOM   779  H  HE3    . TRP A 1 56  ? -2.446  -43.040 -16.800 1.00 49.36 ? 56  TRP A HE3    1 
ATOM   780  H  HZ2    . TRP A 1 56  ? -5.375  -46.079 -18.844 1.00 48.79 ? 56  TRP A HZ2    1 
ATOM   781  H  HZ3    . TRP A 1 56  ? -1.896  -44.069 -18.797 1.00 47.27 ? 56  TRP A HZ3    1 
ATOM   782  H  HH2    . TRP A 1 56  ? -3.342  -45.566 -19.800 1.00 49.43 ? 56  TRP A HH2    1 
ATOM   783  N  N      . GLN A 1 57  ? -5.461  -40.605 -16.895 1.00 26.38 ? 57  GLN A N      1 
ATOM   784  C  CA     . GLN A 1 57  ? -5.184  -40.050 -18.220 1.00 29.14 ? 57  GLN A CA     1 
ATOM   785  C  C      . GLN A 1 57  ? -5.542  -38.565 -18.302 1.00 27.97 ? 57  GLN A C      1 
ATOM   786  O  O      . GLN A 1 57  ? -5.251  -37.909 -19.303 1.00 30.44 ? 57  GLN A O      1 
ATOM   787  C  CB     . GLN A 1 57  ? -5.933  -40.830 -19.305 1.00 34.53 ? 57  GLN A CB     1 
ATOM   788  C  CG     . GLN A 1 57  ? -5.383  -42.227 -19.536 1.00 41.06 ? 57  GLN A CG     1 
ATOM   789  C  CD     . GLN A 1 57  ? -5.773  -42.804 -20.886 1.00 44.63 ? 57  GLN A CD     1 
ATOM   790  O  OE1    . GLN A 1 57  ? -4.918  -43.061 -21.734 1.00 50.12 ? 57  GLN A OE1    1 
ATOM   791  N  NE2    . GLN A 1 57  ? -7.065  -43.020 -21.087 1.00 44.28 ? 57  GLN A NE2    1 
ATOM   792  H  H      . GLN A 1 57  ? -6.242  -40.955 -16.811 1.00 31.66 ? 57  GLN A H      1 
ATOM   793  H  HA     . GLN A 1 57  ? -4.235  -40.134 -18.398 1.00 34.97 ? 57  GLN A HA     1 
ATOM   794  H  HB2    . GLN A 1 57  ? -6.864  -40.916 -19.044 1.00 41.44 ? 57  GLN A HB2    1 
ATOM   795  H  HB3    . GLN A 1 57  ? -5.869  -40.343 -20.142 1.00 41.44 ? 57  GLN A HB3    1 
ATOM   796  H  HG2    . GLN A 1 57  ? -4.415  -42.195 -19.493 1.00 49.28 ? 57  GLN A HG2    1 
ATOM   797  H  HG3    . GLN A 1 57  ? -5.726  -42.818 -18.848 1.00 49.28 ? 57  GLN A HG3    1 
ATOM   798  H  HE21   . GLN A 1 57  ? -7.634  -42.833 -20.469 1.00 53.13 ? 57  GLN A HE21   1 
ATOM   799  H  HE22   . GLN A 1 57  ? -7.336  -43.346 -21.836 1.00 53.13 ? 57  GLN A HE22   1 
ATOM   800  N  N      . GLY A 1 58  ? -6.169  -38.038 -17.253 1.00 29.13 ? 58  GLY A N      1 
ATOM   801  C  CA     . GLY A 1 58  ? -6.464  -36.618 -17.169 1.00 27.69 ? 58  GLY A CA     1 
ATOM   802  C  C      . GLY A 1 58  ? -5.257  -35.839 -16.677 1.00 29.74 ? 58  GLY A C      1 
ATOM   803  O  O      . GLY A 1 58  ? -4.226  -36.427 -16.350 1.00 28.38 ? 58  GLY A O      1 
ATOM   804  H  H      . GLY A 1 58  ? -6.434  -38.490 -16.571 1.00 34.95 ? 58  GLY A H      1 
ATOM   805  H  HA2    . GLY A 1 58  ? -6.716  -36.283 -18.044 1.00 33.23 ? 58  GLY A HA2    1 
ATOM   806  H  HA3    . GLY A 1 58  ? -7.201  -36.472 -16.555 1.00 33.23 ? 58  GLY A HA3    1 
ATOM   807  N  N      . PRO A 1 59  ? -5.371  -34.506 -16.617 1.00 26.38 ? 59  PRO A N      1 
ATOM   808  C  CA     . PRO A 1 59  ? -4.221  -33.689 -16.213 1.00 26.28 ? 59  PRO A CA     1 
ATOM   809  C  C      . PRO A 1 59  ? -3.908  -33.758 -14.723 1.00 25.34 ? 59  PRO A C      1 
ATOM   810  O  O      . PRO A 1 59  ? -4.816  -33.914 -13.910 1.00 24.74 ? 59  PRO A O      1 
ATOM   811  C  CB     . PRO A 1 59  ? -4.649  -32.272 -16.602 1.00 26.15 ? 59  PRO A CB     1 
ATOM   812  C  CG     . PRO A 1 59  ? -6.136  -32.301 -16.553 1.00 28.36 ? 59  PRO A CG     1 
ATOM   813  C  CD     . PRO A 1 59  ? -6.533  -33.681 -16.993 1.00 29.07 ? 59  PRO A CD     1 
ATOM   814  H  HA     . PRO A 1 59  ? -3.433  -33.938 -16.721 1.00 31.54 ? 59  PRO A HA     1 
ATOM   815  H  HB2    . PRO A 1 59  ? -4.296  -31.635 -15.962 1.00 31.38 ? 59  PRO A HB2    1 
ATOM   816  H  HB3    . PRO A 1 59  ? -4.338  -32.070 -17.498 1.00 31.38 ? 59  PRO A HB3    1 
ATOM   817  H  HG2    . PRO A 1 59  ? -6.435  -32.134 -15.645 1.00 34.03 ? 59  PRO A HG2    1 
ATOM   818  H  HG3    . PRO A 1 59  ? -6.495  -31.634 -17.159 1.00 34.03 ? 59  PRO A HG3    1 
ATOM   819  H  HD2    . PRO A 1 59  ? -7.324  -33.975 -16.515 1.00 34.89 ? 59  PRO A HD2    1 
ATOM   820  H  HD3    . PRO A 1 59  ? -6.668  -33.704 -17.953 1.00 34.89 ? 59  PRO A HD3    1 
ATOM   821  N  N      . PHE A 1 60  ? -2.627  -33.651 -14.383 1.00 23.09 ? 60  PHE A N      1 
ATOM   822  C  CA     . PHE A 1 60  ? -2.205  -33.464 -13.000 1.00 23.50 ? 60  PHE A CA     1 
ATOM   823  C  C      . PHE A 1 60  ? -1.578  -32.082 -12.875 1.00 25.10 ? 60  PHE A C      1 
ATOM   824  O  O      . PHE A 1 60  ? -0.490  -31.834 -13.402 1.00 26.45 ? 60  PHE A O      1 
ATOM   825  C  CB     . PHE A 1 60  ? -1.218  -34.550 -12.564 1.00 22.22 ? 60  PHE A CB     1 
ATOM   826  C  CG     . PHE A 1 60  ? -0.731  -34.393 -11.150 1.00 25.90 ? 60  PHE A CG     1 
ATOM   827  C  CD1    . PHE A 1 60  ? -1.528  -34.761 -10.088 1.00 23.94 ? 60  PHE A CD1    1 
ATOM   828  C  CD2    . PHE A 1 60  ? 0.529   -33.877 -10.886 1.00 26.72 ? 60  PHE A CD2    1 
ATOM   829  C  CE1    . PHE A 1 60  ? -1.083  -34.617 -8.784  1.00 24.71 ? 60  PHE A CE1    1 
ATOM   830  C  CE2    . PHE A 1 60  ? 0.977   -33.733 -9.590  1.00 28.87 ? 60  PHE A CE2    1 
ATOM   831  C  CZ     . PHE A 1 60  ? 0.167   -34.103 -8.537  1.00 27.24 ? 60  PHE A CZ     1 
ATOM   832  H  H      . PHE A 1 60  ? -1.975  -33.684 -14.943 1.00 27.71 ? 60  PHE A H      1 
ATOM   833  H  HA     . PHE A 1 60  ? -2.980  -33.502 -12.418 1.00 28.20 ? 60  PHE A HA     1 
ATOM   834  H  HB2    . PHE A 1 60  ? -1.653  -35.414 -12.634 1.00 26.67 ? 60  PHE A HB2    1 
ATOM   835  H  HB3    . PHE A 1 60  ? -0.444  -34.523 -13.149 1.00 26.67 ? 60  PHE A HB3    1 
ATOM   836  H  HD1    . PHE A 1 60  ? -2.375  -35.108 -10.249 1.00 28.72 ? 60  PHE A HD1    1 
ATOM   837  H  HD2    . PHE A 1 60  ? 1.078   -33.624 -11.593 1.00 32.06 ? 60  PHE A HD2    1 
ATOM   838  H  HE1    . PHE A 1 60  ? -1.631  -34.869 -8.076  1.00 29.65 ? 60  PHE A HE1    1 
ATOM   839  H  HE2    . PHE A 1 60  ? 1.823   -33.385 -9.427  1.00 34.64 ? 60  PHE A HE2    1 
ATOM   840  H  HZ     . PHE A 1 60  ? 0.468   -34.007 -7.662  1.00 32.68 ? 60  PHE A HZ     1 
ATOM   841  N  N      . ILE A 1 61  ? -2.286  -31.190 -12.188 1.00 23.54 ? 61  ILE A N      1 
ATOM   842  C  CA     . ILE A 1 61  ? -1.879  -29.796 -12.041 1.00 22.88 ? 61  ILE A CA     1 
ATOM   843  C  C      . ILE A 1 61  ? -1.471  -29.515 -10.602 1.00 22.12 ? 61  ILE A C      1 
ATOM   844  O  O      . ILE A 1 61  ? -2.109  -30.005 -9.674  1.00 23.12 ? 61  ILE A O      1 
ATOM   845  C  CB     . ILE A 1 61  ? -3.023  -28.837 -12.436 1.00 25.27 ? 61  ILE A CB     1 
ATOM   846  C  CG1    . ILE A 1 61  ? -3.553  -29.174 -13.833 1.00 25.35 ? 61  ILE A CG1    1 
ATOM   847  C  CG2    . ILE A 1 61  ? -2.566  -27.385 -12.360 1.00 25.98 ? 61  ILE A CG2    1 
ATOM   848  C  CD1    . ILE A 1 61  ? -2.521  -29.055 -14.943 1.00 27.35 ? 61  ILE A CD1    1 
ATOM   849  H  H      . ILE A 1 61  ? -3.025  -31.373 -11.788 1.00 28.25 ? 61  ILE A H      1 
ATOM   850  H  HA     . ILE A 1 61  ? -1.118  -29.619 -12.617 1.00 27.45 ? 61  ILE A HA     1 
ATOM   851  H  HB     . ILE A 1 61  ? -3.747  -28.957 -11.802 1.00 30.32 ? 61  ILE A HB     1 
ATOM   852  H  HG12   . ILE A 1 61  ? -3.877  -30.088 -13.830 1.00 30.42 ? 61  ILE A HG12   1 
ATOM   853  H  HG13   . ILE A 1 61  ? -4.282  -28.569 -14.043 1.00 30.42 ? 61  ILE A HG13   1 
ATOM   854  H  HG21   . ILE A 1 61  ? -3.304  -26.808 -12.613 1.00 31.17 ? 61  ILE A HG21   1 
ATOM   855  H  HG22   . ILE A 1 61  ? -2.288  -27.188 -11.452 1.00 31.17 ? 61  ILE A HG22   1 
ATOM   856  H  HG23   . ILE A 1 61  ? -1.822  -27.256 -12.969 1.00 31.17 ? 61  ILE A HG23   1 
ATOM   857  H  HD11   . ILE A 1 61  ? -2.939  -29.284 -15.787 1.00 32.83 ? 61  ILE A HD11   1 
ATOM   858  H  HD12   . ILE A 1 61  ? -2.194  -28.142 -14.972 1.00 32.83 ? 61  ILE A HD12   1 
ATOM   859  H  HD13   . ILE A 1 61  ? -1.789  -29.663 -14.759 1.00 32.83 ? 61  ILE A HD13   1 
ATOM   860  N  N      . SER A 1 62  ? -0.414  -28.723 -10.427 1.00 22.38 ? 62  SER A N      1 
ATOM   861  C  CA     A SER A 1 62  ? 0.061   -28.357 -9.096  0.65 24.29 ? 62  SER A CA     1 
ATOM   862  C  CA     B SER A 1 62  ? 0.060   -28.359 -9.095  0.35 25.86 ? 62  SER A CA     1 
ATOM   863  C  C      . SER A 1 62  ? 0.119   -26.845 -8.923  1.00 25.19 ? 62  SER A C      1 
ATOM   864  O  O      . SER A 1 62  ? 0.368   -26.110 -9.876  1.00 26.98 ? 62  SER A O      1 
ATOM   865  C  CB     A SER A 1 62  ? 1.447   -28.950 -8.834  0.65 29.92 ? 62  SER A CB     1 
ATOM   866  C  CB     B SER A 1 62  ? 1.440   -28.966 -8.830  0.35 30.90 ? 62  SER A CB     1 
ATOM   867  O  OG     A SER A 1 62  ? 1.443   -30.359 -8.983  0.65 33.44 ? 62  SER A OG     1 
ATOM   868  O  OG     B SER A 1 62  ? 2.420   -28.409 -9.686  0.35 35.02 ? 62  SER A OG     1 
ATOM   869  H  H      . SER A 1 62  ? 0.047   -28.383 -11.068 1.00 26.86 ? 62  SER A H      1 
ATOM   870  H  HA     . SER A 1 62  ? -0.553  -28.713 -8.433  0.65 31.04 ? 62  SER A HA     1 
ATOM   871  H  HB2    A SER A 1 62  ? 2.076   -28.569 -9.466  0.65 35.91 ? 62  SER A HB2    1 
ATOM   872  H  HB2    B SER A 1 62  ? 1.689   -28.789 -7.909  0.35 37.08 ? 62  SER A HB2    1 
ATOM   873  H  HB3    A SER A 1 62  ? 1.715   -28.732 -7.928  0.65 35.91 ? 62  SER A HB3    1 
ATOM   874  H  HB3    B SER A 1 62  ? 1.397   -29.923 -8.982  0.35 37.08 ? 62  SER A HB3    1 
ATOM   875  H  HG     A SER A 1 62  ? 2.211   -30.666 -8.835  0.65 40.13 ? 62  SER A HG     1 
ATOM   876  H  HG     B SER A 1 62  ? 3.170   -28.753 -9.526  0.35 42.02 ? 62  SER A HG     1 
ATOM   877  N  N      . LEU A 1 63  ? -0.108  -26.395 -7.694  1.00 23.92 ? 63  LEU A N      1 
ATOM   878  C  CA     . LEU A 1 63  ? -0.017  -24.985 -7.349  1.00 21.96 ? 63  LEU A CA     1 
ATOM   879  C  C      . LEU A 1 63  ? 0.484   -24.861 -5.920  1.00 22.33 ? 63  LEU A C      1 
ATOM   880  O  O      . LEU A 1 63  ? -0.065  -25.488 -5.018  1.00 23.67 ? 63  LEU A O      1 
ATOM   881  C  CB     . LEU A 1 63  ? -1.377  -24.297 -7.503  1.00 27.20 ? 63  LEU A CB     1 
ATOM   882  C  CG     . LEU A 1 63  ? -1.409  -22.794 -7.218  1.00 32.33 ? 63  LEU A CG     1 
ATOM   883  C  CD1    . LEU A 1 63  ? -0.617  -22.037 -8.271  1.00 36.11 ? 63  LEU A CD1    1 
ATOM   884  C  CD2    . LEU A 1 63  ? -2.842  -22.286 -7.146  1.00 35.91 ? 63  LEU A CD2    1 
ATOM   885  H  H      . LEU A 1 63  ? -0.320  -26.899 -7.030  1.00 28.70 ? 63  LEU A H      1 
ATOM   886  H  HA     . LEU A 1 63  ? 0.618   -24.547 -7.938  1.00 26.36 ? 63  LEU A HA     1 
ATOM   887  H  HB2    . LEU A 1 63  ? -1.681  -24.425 -8.415  1.00 32.63 ? 63  LEU A HB2    1 
ATOM   888  H  HB3    . LEU A 1 63  ? -2.002  -24.719 -6.893  1.00 32.63 ? 63  LEU A HB3    1 
ATOM   889  H  HG     . LEU A 1 63  ? -0.992  -22.629 -6.358  1.00 38.80 ? 63  LEU A HG     1 
ATOM   890  H  HD11   . LEU A 1 63  ? -0.651  -21.089 -8.070  1.00 43.33 ? 63  LEU A HD11   1 
ATOM   891  H  HD12   . LEU A 1 63  ? 0.303   -22.346 -8.256  1.00 43.33 ? 63  LEU A HD12   1 
ATOM   892  H  HD13   . LEU A 1 63  ? -1.009  -22.206 -9.142  1.00 43.33 ? 63  LEU A HD13   1 
ATOM   893  H  HD21   . LEU A 1 63  ? -2.830  -21.333 -6.965  1.00 43.09 ? 63  LEU A HD21   1 
ATOM   894  H  HD22   . LEU A 1 63  ? -3.280  -22.456 -7.995  1.00 43.09 ? 63  LEU A HD22   1 
ATOM   895  H  HD23   . LEU A 1 63  ? -3.306  -22.752 -6.434  1.00 43.09 ? 63  LEU A HD23   1 
ATOM   896  N  N      . ASN A 1 64  ? 1.542   -24.079 -5.718  1.00 22.63 ? 64  ASN A N      1 
ATOM   897  C  CA     . ASN A 1 64  ? 2.012   -23.776 -4.370  1.00 22.97 ? 64  ASN A CA     1 
ATOM   898  C  C      . ASN A 1 64  ? 1.389   -22.469 -3.885  1.00 23.37 ? 64  ASN A C      1 
ATOM   899  O  O      . ASN A 1 64  ? 1.645   -21.399 -4.437  1.00 27.21 ? 64  ASN A O      1 
ATOM   900  C  CB     . ASN A 1 64  ? 3.543   -23.700 -4.321  1.00 25.02 ? 64  ASN A CB     1 
ATOM   901  C  CG     . ASN A 1 64  ? 4.067   -23.560 -2.909  1.00 29.09 ? 64  ASN A CG     1 
ATOM   902  O  OD1    . ASN A 1 64  ? 3.682   -22.647 -2.180  1.00 34.97 ? 64  ASN A OD1    1 
ATOM   903  N  ND2    . ASN A 1 64  ? 4.940   -24.477 -2.505  1.00 27.81 ? 64  ASN A ND2    1 
ATOM   904  H  H      . ASN A 1 64  ? 2.004   -23.712 -6.344  1.00 27.16 ? 64  ASN A H      1 
ATOM   905  H  HA     . ASN A 1 64  ? 1.728   -24.484 -3.771  1.00 27.57 ? 64  ASN A HA     1 
ATOM   906  H  HB2    . ASN A 1 64  ? 3.913   -24.512 -4.701  1.00 30.02 ? 64  ASN A HB2    1 
ATOM   907  H  HB3    . ASN A 1 64  ? 3.838   -22.929 -4.829  1.00 30.02 ? 64  ASN A HB3    1 
ATOM   908  H  HD21   . ASN A 1 64  ? 5.266   -24.440 -1.711  1.00 33.37 ? 64  ASN A HD21   1 
ATOM   909  H  HD22   . ASN A 1 64  ? 5.178   -25.108 -3.039  1.00 33.37 ? 64  ASN A HD22   1 
ATOM   910  N  N      . CYS A 1 65  ? 0.568   -22.570 -2.846  1.00 22.26 ? 65  CYS A N      1 
ATOM   911  C  CA     . CYS A 1 65  ? -0.187  -21.428 -2.345  1.00 21.45 ? 65  CYS A CA     1 
ATOM   912  C  C      . CYS A 1 65  ? 0.683   -20.385 -1.649  1.00 24.33 ? 65  CYS A C      1 
ATOM   913  O  O      . CYS A 1 65  ? 0.320   -19.210 -1.593  1.00 27.53 ? 65  CYS A O      1 
ATOM   914  C  CB     . CYS A 1 65  ? -1.266  -21.904 -1.376  1.00 23.95 ? 65  CYS A CB     1 
ATOM   915  S  SG     . CYS A 1 65  ? -2.504  -22.983 -2.115  1.00 25.91 ? 65  CYS A SG     1 
ATOM   916  H  H      . CYS A 1 65  ? 0.430   -23.297 -2.408  1.00 26.71 ? 65  CYS A H      1 
ATOM   917  H  HA     . CYS A 1 65  ? -0.629  -20.994 -3.092  1.00 25.74 ? 65  CYS A HA     1 
ATOM   918  H  HB2    . CYS A 1 65  ? -0.842  -22.393 -0.655  1.00 28.74 ? 65  CYS A HB2    1 
ATOM   919  H  HB3    . CYS A 1 65  ? -1.727  -21.128 -1.019  1.00 28.74 ? 65  CYS A HB3    1 
ATOM   920  H  HG     . CYS A 1 65  ? -3.300  -23.297 -1.274  1.00 31.09 ? 65  CYS A HG     1 
ATOM   921  N  N      . ALA A 1 66  ? 1.820   -20.813 -1.112  1.00 24.25 ? 66  ALA A N      1 
ATOM   922  C  CA     . ALA A 1 66  ? 2.680   -19.917 -0.342  1.00 24.95 ? 66  ALA A CA     1 
ATOM   923  C  C      . ALA A 1 66  ? 3.449   -18.978 -1.250  1.00 26.95 ? 66  ALA A C      1 
ATOM   924  O  O      . ALA A 1 66  ? 3.859   -17.891 -0.837  1.00 29.60 ? 66  ALA A O      1 
ATOM   925  C  CB     . ALA A 1 66  ? 3.648   -20.716 0.509   1.00 24.15 ? 66  ALA A CB     1 
ATOM   926  H  H      . ALA A 1 66  ? 2.118   -21.617 -1.177  1.00 29.11 ? 66  ALA A H      1 
ATOM   927  H  HA     . ALA A 1 66  ? 2.130   -19.381 0.249   1.00 29.94 ? 66  ALA A HA     1 
ATOM   928  H  HB1    . ALA A 1 66  ? 4.208   -20.102 1.010   1.00 28.98 ? 66  ALA A HB1    1 
ATOM   929  H  HB2    . ALA A 1 66  ? 3.143   -21.276 1.119   1.00 28.98 ? 66  ALA A HB2    1 
ATOM   930  H  HB3    . ALA A 1 66  ? 4.197   -21.267 -0.070  1.00 28.98 ? 66  ALA A HB3    1 
ATOM   931  N  N      . ALA A 1 67  ? 3.645   -19.403 -2.491  1.00 25.42 ? 67  ALA A N      1 
ATOM   932  C  CA     . ALA A 1 67  ? 4.543   -18.705 -3.386  1.00 29.10 ? 67  ALA A CA     1 
ATOM   933  C  C      . ALA A 1 67  ? 3.951   -17.375 -3.843  1.00 34.84 ? 67  ALA A C      1 
ATOM   934  O  O      . ALA A 1 67  ? 4.685   -16.404 -4.017  1.00 41.62 ? 67  ALA A O      1 
ATOM   935  C  CB     . ALA A 1 67  ? 4.881   -19.592 -4.585  1.00 33.77 ? 67  ALA A CB     1 
ATOM   936  H  H      . ALA A 1 67  ? 3.267   -20.095 -2.836  1.00 30.51 ? 67  ALA A H      1 
ATOM   937  H  HA     . ALA A 1 67  ? 5.369   -18.515 -2.915  1.00 34.92 ? 67  ALA A HA     1 
ATOM   938  H  HB1    . ALA A 1 67  ? 5.483   -19.110 -5.174  1.00 40.53 ? 67  ALA A HB1    1 
ATOM   939  H  HB2    . ALA A 1 67  ? 5.309   -20.403 -4.266  1.00 40.53 ? 67  ALA A HB2    1 
ATOM   940  H  HB3    . ALA A 1 67  ? 4.062   -19.812 -5.056  1.00 40.53 ? 67  ALA A HB3    1 
ATOM   941  N  N      . LEU A 1 68  ? 2.628   -17.316 -3.981  1.00 31.71 ? 68  LEU A N      1 
ATOM   942  C  CA     . LEU A 1 68  ? 1.973   -16.183 -4.630  1.00 30.95 ? 68  LEU A CA     1 
ATOM   943  C  C      . LEU A 1 68  ? 1.292   -15.220 -3.656  1.00 32.64 ? 68  LEU A C      1 
ATOM   944  O  O      . LEU A 1 68  ? 0.746   -15.639 -2.635  1.00 31.08 ? 68  LEU A O      1 
ATOM   945  C  CB     . LEU A 1 68  ? 0.938   -16.692 -5.643  1.00 34.41 ? 68  LEU A CB     1 
ATOM   946  C  CG     . LEU A 1 68  ? 1.462   -17.628 -6.738  1.00 36.20 ? 68  LEU A CG     1 
ATOM   947  C  CD1    . LEU A 1 68  ? 0.316   -18.114 -7.611  1.00 37.22 ? 68  LEU A CD1    1 
ATOM   948  C  CD2    . LEU A 1 68  ? 2.524   -16.947 -7.588  1.00 38.14 ? 68  LEU A CD2    1 
ATOM   949  H  H      . LEU A 1 68  ? 2.085   -17.923 -3.706  1.00 38.05 ? 68  LEU A H      1 
ATOM   950  H  HA     . LEU A 1 68  ? 2.641   -15.679 -5.121  1.00 37.14 ? 68  LEU A HA     1 
ATOM   951  H  HB2    . LEU A 1 68  ? 0.250   -17.174 -5.157  1.00 41.29 ? 68  LEU A HB2    1 
ATOM   952  H  HB3    . LEU A 1 68  ? 0.542   -15.925 -6.084  1.00 41.29 ? 68  LEU A HB3    1 
ATOM   953  H  HG     . LEU A 1 68  ? 1.867   -18.404 -6.320  1.00 43.45 ? 68  LEU A HG     1 
ATOM   954  H  HD11   . LEU A 1 68  ? 0.670   -18.704 -8.296  1.00 44.67 ? 68  LEU A HD11   1 
ATOM   955  H  HD12   . LEU A 1 68  ? -0.321  -18.593 -7.058  1.00 44.67 ? 68  LEU A HD12   1 
ATOM   956  H  HD13   . LEU A 1 68  ? -0.113  -17.348 -8.023  1.00 44.67 ? 68  LEU A HD13   1 
ATOM   957  H  HD21   . LEU A 1 68  ? 2.830   -17.568 -8.267  1.00 45.77 ? 68  LEU A HD21   1 
ATOM   958  H  HD22   . LEU A 1 68  ? 2.137   -16.162 -8.006  1.00 45.77 ? 68  LEU A HD22   1 
ATOM   959  H  HD23   . LEU A 1 68  ? 3.265   -16.687 -7.018  1.00 45.77 ? 68  LEU A HD23   1 
ATOM   960  N  N      . ASN A 1 69  ? 1.321   -13.927 -3.981  1.00 32.82 ? 69  ASN A N      1 
ATOM   961  C  CA     . ASN A 1 69  ? 0.587   -12.940 -3.194  1.00 31.19 ? 69  ASN A CA     1 
ATOM   962  C  C      . ASN A 1 69  ? -0.913  -13.173 -3.373  1.00 33.12 ? 69  ASN A C      1 
ATOM   963  O  O      . ASN A 1 69  ? -1.330  -13.918 -4.260  1.00 33.02 ? 69  ASN A O      1 
ATOM   964  C  CB     . ASN A 1 69  ? 0.974   -11.504 -3.581  1.00 35.55 ? 69  ASN A CB     1 
ATOM   965  C  CG     . ASN A 1 69  ? 0.627   -11.162 -5.016  1.00 39.61 ? 69  ASN A CG     1 
ATOM   966  O  OD1    . ASN A 1 69  ? -0.545  -11.059 -5.377  1.00 40.29 ? 69  ASN A OD1    1 
ATOM   967  N  ND2    . ASN A 1 69  ? 1.651   -10.949 -5.837  1.00 44.47 ? 69  ASN A ND2    1 
ATOM   968  H  H      . ASN A 1 69  ? 1.755   -13.599 -4.647  1.00 39.38 ? 69  ASN A H      1 
ATOM   969  H  HA     . ASN A 1 69  ? 0.800   -13.064 -2.256  1.00 37.43 ? 69  ASN A HA     1 
ATOM   970  H  HB2    . ASN A 1 69  ? 0.502   -10.884 -3.004  1.00 42.66 ? 69  ASN A HB2    1 
ATOM   971  H  HB3    . ASN A 1 69  ? 1.932   -11.395 -3.471  1.00 42.66 ? 69  ASN A HB3    1 
ATOM   972  H  HD21   . ASN A 1 69  ? 1.507   -10.752 -6.661  1.00 53.36 ? 69  ASN A HD21   1 
ATOM   973  H  HD22   . ASN A 1 69  ? 2.457   -11.009 -5.543  1.00 53.36 ? 69  ASN A HD22   1 
ATOM   974  N  N      . GLU A 1 70  ? -1.719  -12.541 -2.528  1.00 34.55 ? 70  GLU A N      1 
ATOM   975  C  CA     . GLU A 1 70  ? -3.142  -12.864 -2.458  1.00 30.02 ? 70  GLU A CA     1 
ATOM   976  C  C      . GLU A 1 70  ? -3.881  -12.671 -3.786  1.00 31.64 ? 70  GLU A C      1 
ATOM   977  O  O      . GLU A 1 70  ? -4.638  -13.543 -4.214  1.00 28.27 ? 70  GLU A O      1 
ATOM   978  C  CB     . GLU A 1 70  ? -3.819  -12.027 -1.374  1.00 32.91 ? 70  GLU A CB     1 
ATOM   979  C  CG     . GLU A 1 70  ? -5.308  -12.323 -1.233  1.00 37.16 ? 70  GLU A CG     1 
ATOM   980  C  CD     . GLU A 1 70  ? -5.885  -11.881 0.099   1.00 46.46 ? 70  GLU A CD     1 
ATOM   981  O  OE1    . GLU A 1 70  ? -5.138  -11.320 0.929   1.00 51.60 ? 70  GLU A OE1    1 
ATOM   982  O  OE2    . GLU A 1 70  ? -7.093  -12.104 0.317   1.00 48.80 ? 70  GLU A OE2    1 
ATOM   983  H  H      . GLU A 1 70  ? -1.469  -11.923 -1.986  1.00 41.46 ? 70  GLU A H      1 
ATOM   984  H  HA     . GLU A 1 70  ? -3.233  -13.797 -2.206  1.00 36.02 ? 70  GLU A HA     1 
ATOM   985  H  HB2    . GLU A 1 70  ? -3.395  -12.212 -0.522  1.00 39.49 ? 70  GLU A HB2    1 
ATOM   986  H  HB3    . GLU A 1 70  ? -3.721  -11.087 -1.596  1.00 39.49 ? 70  GLU A HB3    1 
ATOM   987  H  HG2    . GLU A 1 70  ? -5.789  -11.858 -1.935  1.00 44.60 ? 70  GLU A HG2    1 
ATOM   988  H  HG3    . GLU A 1 70  ? -5.447  -13.279 -1.315  1.00 44.60 ? 70  GLU A HG3    1 
ATOM   989  N  N      . ASN A 1 71  ? -3.667  -11.534 -4.436  1.00 34.14 ? 71  ASN A N      1 
ATOM   990  C  CA     . ASN A 1 71  ? -4.359  -11.254 -5.687  1.00 35.53 ? 71  ASN A CA     1 
ATOM   991  C  C      . ASN A 1 71  ? -3.910  -12.189 -6.809  1.00 33.37 ? 71  ASN A C      1 
ATOM   992  O  O      . ASN A 1 71  ? -4.726  -12.634 -7.618  1.00 31.56 ? 71  ASN A O      1 
ATOM   993  C  CB     . ASN A 1 71  ? -4.147  -9.795  -6.093  1.00 44.02 ? 71  ASN A CB     1 
ATOM   994  C  CG     . ASN A 1 71  ? -4.970  -8.833  -5.256  1.00 53.30 ? 71  ASN A CG     1 
ATOM   995  O  OD1    . ASN A 1 71  ? -6.116  -9.120  -4.908  1.00 57.32 ? 71  ASN A OD1    1 
ATOM   996  N  ND2    . ASN A 1 71  ? -4.389  -7.685  -4.925  1.00 59.06 ? 71  ASN A ND2    1 
ATOM   997  H  H      . ASN A 1 71  ? -3.131  -10.913 -4.177  1.00 40.97 ? 71  ASN A H      1 
ATOM   998  H  HA     . ASN A 1 71  ? -5.310  -11.388 -5.553  1.00 42.63 ? 71  ASN A HA     1 
ATOM   999  H  HB2    . ASN A 1 71  ? -3.211  -9.568  -5.979  1.00 52.82 ? 71  ASN A HB2    1 
ATOM   1000 H  HB3    . ASN A 1 71  ? -4.406  -9.684  -7.021  1.00 52.82 ? 71  ASN A HB3    1 
ATOM   1001 H  HD21   . ASN A 1 71  ? -4.815  -7.108  -4.452  1.00 70.87 ? 71  ASN A HD21   1 
ATOM   1002 H  HD22   . ASN A 1 71  ? -3.586  -7.519  -5.185  1.00 70.87 ? 71  ASN A HD22   1 
ATOM   1003 N  N      . LEU A 1 72  ? -2.617  -12.496 -6.847  1.00 29.70 ? 72  LEU A N      1 
ATOM   1004 C  CA     . LEU A 1 72  ? -2.076  -13.393 -7.865  1.00 32.10 ? 72  LEU A CA     1 
ATOM   1005 C  C      . LEU A 1 72  ? -2.541  -14.835 -7.638  1.00 28.44 ? 72  LEU A C      1 
ATOM   1006 O  O      . LEU A 1 72  ? -2.842  -15.559 -8.587  1.00 29.99 ? 72  LEU A O      1 
ATOM   1007 C  CB     . LEU A 1 72  ? -0.548  -13.328 -7.877  1.00 31.65 ? 72  LEU A CB     1 
ATOM   1008 H  H      . LEU A 1 72  ? -2.030  -12.197 -6.294  1.00 35.64 ? 72  LEU A H      1 
ATOM   1009 H  HA     . LEU A 1 72  ? -2.394  -13.110 -8.737  1.00 38.52 ? 72  LEU A HA     1 
ATOM   1010 N  N      . LEU A 1 73  ? -2.605  -15.249 -6.377  1.00 25.46 ? 73  LEU A N      1 
ATOM   1011 C  CA     . LEU A 1 73  ? -3.058  -16.598 -6.054  1.00 24.78 ? 73  LEU A CA     1 
ATOM   1012 C  C      . LEU A 1 73  ? -4.508  -16.767 -6.490  1.00 23.64 ? 73  LEU A C      1 
ATOM   1013 O  O      . LEU A 1 73  ? -4.884  -17.790 -7.056  1.00 24.19 ? 73  LEU A O      1 
ATOM   1014 C  CB     . LEU A 1 73  ? -2.918  -16.880 -4.559  1.00 24.88 ? 73  LEU A CB     1 
ATOM   1015 C  CG     . LEU A 1 73  ? -3.407  -18.257 -4.104  1.00 22.29 ? 73  LEU A CG     1 
ATOM   1016 C  CD1    . LEU A 1 73  ? -2.667  -19.371 -4.831  1.00 23.61 ? 73  LEU A CD1    1 
ATOM   1017 C  CD2    . LEU A 1 73  ? -3.255  -18.406 -2.596  1.00 24.40 ? 73  LEU A CD2    1 
ATOM   1018 H  H      . LEU A 1 73  ? -2.393  -14.772 -5.693  1.00 30.55 ? 73  LEU A H      1 
ATOM   1019 H  HA     . LEU A 1 73  ? -2.517  -17.242 -6.537  1.00 29.73 ? 73  LEU A HA     1 
ATOM   1020 H  HB2    . LEU A 1 73  ? -1.980  -16.810 -4.319  1.00 29.86 ? 73  LEU A HB2    1 
ATOM   1021 H  HB3    . LEU A 1 73  ? -3.427  -16.214 -4.072  1.00 29.86 ? 73  LEU A HB3    1 
ATOM   1022 H  HG     . LEU A 1 73  ? -4.350  -18.339 -4.317  1.00 26.75 ? 73  LEU A HG     1 
ATOM   1023 H  HD11   . LEU A 1 73  ? -3.001  -20.226 -4.520  1.00 28.33 ? 73  LEU A HD11   1 
ATOM   1024 H  HD12   . LEU A 1 73  ? -2.821  -19.282 -5.784  1.00 28.33 ? 73  LEU A HD12   1 
ATOM   1025 H  HD13   . LEU A 1 73  ? -1.719  -19.296 -4.640  1.00 28.33 ? 73  LEU A HD13   1 
ATOM   1026 H  HD21   . LEU A 1 73  ? -3.571  -19.284 -2.333  1.00 29.28 ? 73  LEU A HD21   1 
ATOM   1027 H  HD22   . LEU A 1 73  ? -2.319  -18.306 -2.362  1.00 29.28 ? 73  LEU A HD22   1 
ATOM   1028 H  HD23   . LEU A 1 73  ? -3.781  -17.719 -2.157  1.00 29.28 ? 73  LEU A HD23   1 
ATOM   1029 N  N      . ASP A 1 74  ? -5.312  -15.746 -6.217  1.00 24.23 ? 74  ASP A N      1 
ATOM   1030 C  CA     . ASP A 1 74  ? -6.714  -15.726 -6.610  1.00 24.51 ? 74  ASP A CA     1 
ATOM   1031 C  C      . ASP A 1 74  ? -6.864  -15.939 -8.121  1.00 26.13 ? 74  ASP A C      1 
ATOM   1032 O  O      . ASP A 1 74  ? -7.644  -16.783 -8.566  1.00 25.07 ? 74  ASP A O      1 
ATOM   1033 C  CB     . ASP A 1 74  ? -7.345  -14.395 -6.181  1.00 29.50 ? 74  ASP A CB     1 
ATOM   1034 C  CG     . ASP A 1 74  ? -8.828  -14.313 -6.487  1.00 39.20 ? 74  ASP A CG     1 
ATOM   1035 O  OD1    . ASP A 1 74  ? -9.269  -13.263 -7.001  1.00 48.89 ? 74  ASP A OD1    1 
ATOM   1036 O  OD2    . ASP A 1 74  ? -9.557  -15.278 -6.189  1.00 37.31 ? 74  ASP A OD2    1 
ATOM   1037 H  H      . ASP A 1 74  ? -5.062  -15.039 -5.797  1.00 29.08 ? 74  ASP A H      1 
ATOM   1038 H  HA     . ASP A 1 74  ? -7.183  -16.444 -6.156  1.00 29.41 ? 74  ASP A HA     1 
ATOM   1039 H  HB2    . ASP A 1 74  ? -7.231  -14.287 -5.224  1.00 35.40 ? 74  ASP A HB2    1 
ATOM   1040 H  HB3    . ASP A 1 74  ? -6.902  -13.671 -6.651  1.00 35.40 ? 74  ASP A HB3    1 
ATOM   1041 N  N      A SER A 1 75  ? -6.099  -15.181 -8.902  0.49 27.70 ? 75  SER A N      1 
ATOM   1042 N  N      B SER A 1 75  ? -6.101  -15.177 -8.899  0.51 27.70 ? 75  SER A N      1 
ATOM   1043 C  CA     A SER A 1 75  ? -6.178  -15.261 -10.357 0.49 29.96 ? 75  SER A CA     1 
ATOM   1044 C  CA     B SER A 1 75  ? -6.167  -15.255 -10.355 0.51 29.97 ? 75  SER A CA     1 
ATOM   1045 C  C      A SER A 1 75  ? -5.596  -16.568 -10.895 0.49 28.68 ? 75  SER A C      1 
ATOM   1046 C  C      B SER A 1 75  ? -5.599  -16.569 -10.890 0.51 28.76 ? 75  SER A C      1 
ATOM   1047 O  O      A SER A 1 75  ? -6.090  -17.114 -11.881 0.49 29.96 ? 75  SER A O      1 
ATOM   1048 O  O      B SER A 1 75  ? -6.107  -17.120 -11.866 0.51 30.20 ? 75  SER A O      1 
ATOM   1049 C  CB     A SER A 1 75  ? -5.455  -14.072 -10.993 0.49 34.30 ? 75  SER A CB     1 
ATOM   1050 C  CB     B SER A 1 75  ? -5.422  -14.077 -10.984 0.51 34.64 ? 75  SER A CB     1 
ATOM   1051 O  OG     A SER A 1 75  ? -4.085  -14.054 -10.634 0.49 37.58 ? 75  SER A OG     1 
ATOM   1052 O  OG     B SER A 1 75  ? -6.100  -12.857 -10.743 0.51 38.79 ? 75  SER A OG     1 
ATOM   1053 H  H      A SER A 1 75  ? -5.525  -14.611 -8.612  0.49 33.24 ? 75  SER A H      1 
ATOM   1054 H  H      B SER A 1 75  ? -5.533  -14.601 -8.607  0.51 33.24 ? 75  SER A H      1 
ATOM   1055 H  HA     A SER A 1 75  ? -7.110  -15.219 -10.622 0.49 35.95 ? 75  SER A HA     1 
ATOM   1056 H  HA     B SER A 1 75  ? -7.096  -15.200 -10.630 0.51 35.97 ? 75  SER A HA     1 
ATOM   1057 H  HB2    A SER A 1 75  ? -5.527  -14.141 -11.958 0.49 41.16 ? 75  SER A HB2    1 
ATOM   1058 H  HB2    B SER A 1 75  ? -4.533  -14.025 -10.599 0.51 41.57 ? 75  SER A HB2    1 
ATOM   1059 H  HB3    A SER A 1 75  ? -5.871  -13.251 -10.688 0.49 41.16 ? 75  SER A HB3    1 
ATOM   1060 H  HB3    B SER A 1 75  ? -5.359  -14.219 -11.942 0.51 41.57 ? 75  SER A HB3    1 
ATOM   1061 H  HG     A SER A 1 75  ? -4.008  -13.995 -9.800  0.49 45.10 ? 75  SER A HG     1 
ATOM   1062 H  HG     B SER A 1 75  ? -6.872  -12.888 -11.073 0.51 46.55 ? 75  SER A HG     1 
ATOM   1063 N  N      . GLU A 1 76  ? -4.544  -17.069 -10.255 1.00 27.45 ? 76  GLU A N      1 
ATOM   1064 C  CA     . GLU A 1 76  ? -3.906  -18.298 -10.713 1.00 27.04 ? 76  GLU A CA     1 
ATOM   1065 C  C      . GLU A 1 76  ? -4.815  -19.501 -10.476 1.00 26.14 ? 76  GLU A C      1 
ATOM   1066 O  O      . GLU A 1 76  ? -4.876  -20.411 -11.298 1.00 27.18 ? 76  GLU A O      1 
ATOM   1067 C  CB     . GLU A 1 76  ? -2.559  -18.513 -10.018 1.00 29.28 ? 76  GLU A CB     1 
ATOM   1068 C  CG     . GLU A 1 76  ? -1.705  -19.602 -10.661 1.00 34.39 ? 76  GLU A CG     1 
ATOM   1069 C  CD     . GLU A 1 76  ? -1.442  -19.349 -12.139 1.00 37.93 ? 76  GLU A CD     1 
ATOM   1070 O  OE1    . GLU A 1 76  ? -1.242  -18.177 -12.517 1.00 41.48 ? 76  GLU A OE1    1 
ATOM   1071 O  OE2    . GLU A 1 76  ? -1.446  -20.323 -12.921 1.00 38.11 ? 76  GLU A OE2    1 
ATOM   1072 H  H      . GLU A 1 76  ? -4.183  -16.717 -9.559  1.00 32.94 ? 76  GLU A H      1 
ATOM   1073 H  HA     . GLU A 1 76  ? -3.743  -18.231 -11.667 1.00 32.45 ? 76  GLU A HA     1 
ATOM   1074 H  HB2    . GLU A 1 76  ? -2.056  -17.685 -10.047 1.00 35.14 ? 76  GLU A HB2    1 
ATOM   1075 H  HB3    . GLU A 1 76  ? -2.720  -18.768 -9.096  1.00 35.14 ? 76  GLU A HB3    1 
ATOM   1076 H  HG2    . GLU A 1 76  ? -0.849  -19.642 -10.207 1.00 41.27 ? 76  GLU A HG2    1 
ATOM   1077 H  HG3    . GLU A 1 76  ? -2.164  -20.453 -10.579 1.00 41.27 ? 76  GLU A HG3    1 
ATOM   1078 N  N      . LEU A 1 77  ? -5.533  -19.496 -9.359  1.00 25.69 ? 77  LEU A N      1 
ATOM   1079 C  CA     . LEU A 1 77  ? -6.366  -20.636 -8.991  1.00 21.91 ? 77  LEU A CA     1 
ATOM   1080 C  C      . LEU A 1 77  ? -7.719  -20.617 -9.704  1.00 24.73 ? 77  LEU A C      1 
ATOM   1081 O  O      . LEU A 1 77  ? -8.162  -21.637 -10.234 1.00 24.97 ? 77  LEU A O      1 
ATOM   1082 C  CB     . LEU A 1 77  ? -6.572  -20.665 -7.474  1.00 23.97 ? 77  LEU A CB     1 
ATOM   1083 C  CG     . LEU A 1 77  ? -7.270  -21.879 -6.855  1.00 28.38 ? 77  LEU A CG     1 
ATOM   1084 C  CD1    . LEU A 1 77  ? -6.641  -23.189 -7.306  1.00 32.46 ? 77  LEU A CD1    1 
ATOM   1085 C  CD2    . LEU A 1 77  ? -7.220  -21.767 -5.339  1.00 29.99 ? 77  LEU A CD2    1 
ATOM   1086 H  H      . LEU A 1 77  ? -5.556  -18.846 -8.796  1.00 30.83 ? 77  LEU A H      1 
ATOM   1087 H  HA     . LEU A 1 77  ? -5.908  -21.453 -9.244  1.00 26.29 ? 77  LEU A HA     1 
ATOM   1088 H  HB2    . LEU A 1 77  ? -5.699  -20.600 -7.056  1.00 28.77 ? 77  LEU A HB2    1 
ATOM   1089 H  HB3    . LEU A 1 77  ? -7.096  -19.886 -7.232  1.00 28.77 ? 77  LEU A HB3    1 
ATOM   1090 H  HG     . LEU A 1 77  ? -8.201  -21.882 -7.126  1.00 34.05 ? 77  LEU A HG     1 
ATOM   1091 H  HD11   . LEU A 1 77  ? -7.115  -23.926 -6.889  1.00 38.95 ? 77  LEU A HD11   1 
ATOM   1092 H  HD12   . LEU A 1 77  ? -6.709  -23.255 -8.271  1.00 38.95 ? 77  LEU A HD12   1 
ATOM   1093 H  HD13   . LEU A 1 77  ? -5.709  -23.200 -7.038  1.00 38.95 ? 77  LEU A HD13   1 
ATOM   1094 H  HD21   . LEU A 1 77  ? -7.663  -22.538 -4.951  1.00 35.99 ? 77  LEU A HD21   1 
ATOM   1095 H  HD22   . LEU A 1 77  ? -6.292  -21.741 -5.055  1.00 35.99 ? 77  LEU A HD22   1 
ATOM   1096 H  HD23   . LEU A 1 77  ? -7.672  -20.954 -5.067  1.00 35.99 ? 77  LEU A HD23   1 
ATOM   1097 N  N      . PHE A 1 78  ? -8.363  -19.453 -9.727  1.00 23.39 ? 78  PHE A N      1 
ATOM   1098 C  CA     . PHE A 1 78  ? -9.730  -19.342 -10.236 1.00 24.64 ? 78  PHE A CA     1 
ATOM   1099 C  C      . PHE A 1 78  ? -9.814  -18.696 -11.619 1.00 29.02 ? 78  PHE A C      1 
ATOM   1100 O  O      . PHE A 1 78  ? -10.877 -18.684 -12.239 1.00 30.11 ? 78  PHE A O      1 
ATOM   1101 C  CB     . PHE A 1 78  ? -10.578 -18.557 -9.236  1.00 24.04 ? 78  PHE A CB     1 
ATOM   1102 C  CG     . PHE A 1 78  ? -10.512 -19.108 -7.841  1.00 21.51 ? 78  PHE A CG     1 
ATOM   1103 C  CD1    . PHE A 1 78  ? -11.074 -20.336 -7.545  1.00 26.14 ? 78  PHE A CD1    1 
ATOM   1104 C  CD2    . PHE A 1 78  ? -9.877  -18.406 -6.831  1.00 23.95 ? 78  PHE A CD2    1 
ATOM   1105 C  CE1    . PHE A 1 78  ? -11.010 -20.856 -6.265  1.00 25.97 ? 78  PHE A CE1    1 
ATOM   1106 C  CE2    . PHE A 1 78  ? -9.809  -18.917 -5.549  1.00 25.40 ? 78  PHE A CE2    1 
ATOM   1107 C  CZ     . PHE A 1 78  ? -10.379 -20.144 -5.264  1.00 24.84 ? 78  PHE A CZ     1 
ATOM   1108 H  H      . PHE A 1 78  ? -8.030  -18.710 -9.453  1.00 28.07 ? 78  PHE A H      1 
ATOM   1109 H  HA     . PHE A 1 78  ? -10.108 -20.233 -10.306 1.00 29.57 ? 78  PHE A HA     1 
ATOM   1110 H  HB2    . PHE A 1 78  ? -10.263 -17.640 -9.210  1.00 28.84 ? 78  PHE A HB2    1 
ATOM   1111 H  HB3    . PHE A 1 78  ? -11.504 -18.581 -9.523  1.00 28.84 ? 78  PHE A HB3    1 
ATOM   1112 H  HD1    . PHE A 1 78  ? -11.501 -20.819 -8.216  1.00 31.36 ? 78  PHE A HD1    1 
ATOM   1113 H  HD2    . PHE A 1 78  ? -9.492  -17.580 -7.016  1.00 28.74 ? 78  PHE A HD2    1 
ATOM   1114 H  HE1    . PHE A 1 78  ? -11.395 -21.681 -6.078  1.00 31.17 ? 78  PHE A HE1    1 
ATOM   1115 H  HE2    . PHE A 1 78  ? -9.383  -18.435 -4.878  1.00 30.48 ? 78  PHE A HE2    1 
ATOM   1116 H  HZ     . PHE A 1 78  ? -10.335 -20.490 -4.402  1.00 29.81 ? 78  PHE A HZ     1 
ATOM   1117 N  N      . GLY A 1 79  ? -8.694  -18.167 -12.101 1.00 27.10 ? 79  GLY A N      1 
ATOM   1118 C  CA     . GLY A 1 79  ? -8.639  -17.580 -13.427 1.00 29.69 ? 79  GLY A CA     1 
ATOM   1119 C  C      . GLY A 1 79  ? -9.126  -16.145 -13.452 1.00 33.10 ? 79  GLY A C      1 
ATOM   1120 O  O      . GLY A 1 79  ? -9.619  -15.624 -12.450 1.00 34.09 ? 79  GLY A O      1 
ATOM   1121 H  H      . GLY A 1 79  ? -7.948  -18.137 -11.674 1.00 32.52 ? 79  GLY A H      1 
ATOM   1122 H  HA2    . GLY A 1 79  ? -7.725  -17.599 -13.750 1.00 35.62 ? 79  GLY A HA2    1 
ATOM   1123 H  HA3    . GLY A 1 79  ? -9.189  -18.101 -14.033 1.00 35.62 ? 79  GLY A HA3    1 
ATOM   1124 N  N      . HIS A 1 80  ? -8.984  -15.506 -14.608 1.00 38.15 ? 80  HIS A N      1 
ATOM   1125 C  CA     . HIS A 1 80  ? -9.509  -14.162 -14.822 1.00 43.50 ? 80  HIS A CA     1 
ATOM   1126 C  C      . HIS A 1 80  ? -9.621  -13.880 -16.315 1.00 51.49 ? 80  HIS A C      1 
ATOM   1127 O  O      . HIS A 1 80  ? -9.198  -14.687 -17.143 1.00 49.14 ? 80  HIS A O      1 
ATOM   1128 C  CB     . HIS A 1 80  ? -8.622  -13.109 -14.151 1.00 42.46 ? 80  HIS A CB     1 
ATOM   1129 C  CG     . HIS A 1 80  ? -7.307  -12.896 -14.835 1.00 41.22 ? 80  HIS A CG     1 
ATOM   1130 N  ND1    . HIS A 1 80  ? -6.117  -13.353 -14.315 1.00 47.77 ? 80  HIS A ND1    1 
ATOM   1131 C  CD2    . HIS A 1 80  ? -6.997  -12.266 -15.993 1.00 45.61 ? 80  HIS A CD2    1 
ATOM   1132 C  CE1    . HIS A 1 80  ? -5.127  -13.019 -15.127 1.00 46.97 ? 80  HIS A CE1    1 
ATOM   1133 N  NE2    . HIS A 1 80  ? -5.635  -12.361 -16.152 1.00 47.79 ? 80  HIS A NE2    1 
ATOM   1134 H  H      . HIS A 1 80  ? -8.581  -15.834 -15.294 1.00 45.78 ? 80  HIS A H      1 
ATOM   1135 H  HA     . HIS A 1 80  ? -10.396 -14.101 -14.434 1.00 52.21 ? 80  HIS A HA     1 
ATOM   1136 H  HB2    . HIS A 1 80  ? -9.094  -12.261 -14.146 1.00 50.95 ? 80  HIS A HB2    1 
ATOM   1137 H  HB3    . HIS A 1 80  ? -8.441  -13.388 -13.240 1.00 50.95 ? 80  HIS A HB3    1 
ATOM   1138 H  HD2    . HIS A 1 80  ? -7.593  -11.852 -16.573 1.00 54.73 ? 80  HIS A HD2    1 
ATOM   1139 H  HE1    . HIS A 1 80  ? -4.227  -13.216 -14.998 1.00 56.37 ? 80  HIS A HE1    1 
ATOM   1140 N  N      . GLU A 1 81  ? -10.187 -12.727 -16.652 1.00 61.58 ? 81  GLU A N      1 
ATOM   1141 C  CA     . GLU A 1 81  ? -10.364 -12.338 -18.046 1.00 69.73 ? 81  GLU A CA     1 
ATOM   1142 C  C      . GLU A 1 81  ? -10.068 -10.852 -18.242 1.00 75.56 ? 81  GLU A C      1 
ATOM   1143 O  O      . GLU A 1 81  ? -8.904  -10.460 -18.313 1.00 78.64 ? 81  GLU A O      1 
ATOM   1144 C  CB     . GLU A 1 81  ? -11.780 -12.689 -18.528 1.00 73.62 ? 81  GLU A CB     1 
ATOM   1145 C  CG     . GLU A 1 81  ? -12.891 -12.570 -17.470 1.00 75.37 ? 81  GLU A CG     1 
ATOM   1146 C  CD     . GLU A 1 81  ? -13.962 -13.648 -17.603 1.00 77.24 ? 81  GLU A CD     1 
ATOM   1147 O  OE1    . GLU A 1 81  ? -13.667 -14.737 -18.140 1.00 76.56 ? 81  GLU A OE1    1 
ATOM   1148 O  OE2    . GLU A 1 81  ? -15.105 -13.406 -17.162 1.00 79.43 ? 81  GLU A OE2    1 
ATOM   1149 H  H      . GLU A 1 81  ? -10.480 -12.148 -16.088 1.00 73.90 ? 81  GLU A H      1 
ATOM   1150 H  HA     . GLU A 1 81  ? -9.735  -12.837 -18.591 1.00 83.67 ? 81  GLU A HA     1 
ATOM   1151 H  HB2    . GLU A 1 81  ? -12.011 -12.095 -19.259 1.00 88.35 ? 81  GLU A HB2    1 
ATOM   1152 H  HB3    . GLU A 1 81  ? -11.777 -13.605 -18.844 1.00 88.35 ? 81  GLU A HB3    1 
ATOM   1153 H  HG2    . GLU A 1 81  ? -12.496 -12.649 -16.588 1.00 90.44 ? 81  GLU A HG2    1 
ATOM   1154 H  HG3    . GLU A 1 81  ? -13.323 -11.706 -17.563 1.00 90.44 ? 81  GLU A HG3    1 
ATOM   1155 N  N      . ALA A 1 82  ? -11.108 -10.029 -18.331 1.00 77.51 ? 82  ALA A N      1 
ATOM   1156 C  CA     . ALA A 1 82  ? -10.925 -8.603  -18.582 1.00 75.82 ? 82  ALA A CA     1 
ATOM   1157 C  C      . ALA A 1 82  ? -10.156 -7.931  -17.449 1.00 78.16 ? 82  ALA A C      1 
ATOM   1158 O  O      . ALA A 1 82  ? -8.969  -7.632  -17.586 1.00 78.85 ? 82  ALA A O      1 
ATOM   1159 C  CB     . ALA A 1 82  ? -12.269 -7.924  -18.783 1.00 72.55 ? 82  ALA A CB     1 
ATOM   1160 N  N      . ARG A 1 91  ? -8.011  -14.134 -22.003 1.00 51.38 ? 91  ARG A N      1 
ATOM   1161 C  CA     . ARG A 1 91  ? -8.456  -14.881 -20.833 1.00 50.42 ? 91  ARG A CA     1 
ATOM   1162 C  C      . ARG A 1 91  ? -7.304  -15.677 -20.230 1.00 48.79 ? 91  ARG A C      1 
ATOM   1163 O  O      . ARG A 1 91  ? -6.468  -16.218 -20.955 1.00 49.99 ? 91  ARG A O      1 
ATOM   1164 C  CB     . ARG A 1 91  ? -9.604  -15.823 -21.203 1.00 54.85 ? 91  ARG A CB     1 
ATOM   1165 H  H      . ARG A 1 91  ? -7.712  -14.627 -22.641 1.00 61.65 ? 91  ARG A H      1 
ATOM   1166 H  HA     . ARG A 1 91  ? -8.779  -14.260 -20.162 1.00 60.51 ? 91  ARG A HA     1 
ATOM   1167 N  N      . HIS A 1 92  ? -7.268  -15.741 -18.901 1.00 44.19 ? 92  HIS A N      1 
ATOM   1168 C  CA     . HIS A 1 92  ? -6.272  -16.533 -18.188 1.00 41.98 ? 92  HIS A CA     1 
ATOM   1169 C  C      . HIS A 1 92  ? -6.938  -17.689 -17.452 1.00 36.54 ? 92  HIS A C      1 
ATOM   1170 O  O      . HIS A 1 92  ? -7.506  -17.490 -16.379 1.00 38.01 ? 92  HIS A O      1 
ATOM   1171 C  CB     . HIS A 1 92  ? -5.499  -15.669 -17.191 1.00 46.56 ? 92  HIS A CB     1 
ATOM   1172 C  CG     . HIS A 1 92  ? -4.473  -16.431 -16.408 1.00 48.79 ? 92  HIS A CG     1 
ATOM   1173 N  ND1    . HIS A 1 92  ? -3.383  -17.030 -17.000 1.00 49.54 ? 92  HIS A ND1    1 
ATOM   1174 C  CD2    . HIS A 1 92  ? -4.379  -16.699 -15.085 1.00 51.55 ? 92  HIS A CD2    1 
ATOM   1175 C  CE1    . HIS A 1 92  ? -2.656  -17.630 -16.074 1.00 51.64 ? 92  HIS A CE1    1 
ATOM   1176 N  NE2    . HIS A 1 92  ? -3.239  -17.444 -14.902 1.00 52.78 ? 92  HIS A NE2    1 
ATOM   1177 H  H      . HIS A 1 92  ? -7.818  -15.329 -18.384 1.00 53.03 ? 92  HIS A H      1 
ATOM   1178 H  HA     . HIS A 1 92  ? -5.640  -16.901 -18.825 1.00 50.38 ? 92  HIS A HA     1 
ATOM   1179 H  HB2    . HIS A 1 92  ? -5.040  -14.965 -17.676 1.00 55.87 ? 92  HIS A HB2    1 
ATOM   1180 H  HB3    . HIS A 1 92  ? -6.126  -15.281 -16.561 1.00 55.87 ? 92  HIS A HB3    1 
ATOM   1181 H  HD2    . HIS A 1 92  ? -4.972  -16.427 -14.422 1.00 61.86 ? 92  HIS A HD2    1 
ATOM   1182 H  HE1    . HIS A 1 92  ? -1.869  -18.103 -16.221 1.00 61.97 ? 92  HIS A HE1    1 
ATOM   1183 N  N      . PRO A 1 93  ? -6.882  -18.901 -18.029 1.00 34.11 ? 93  PRO A N      1 
ATOM   1184 C  CA     . PRO A 1 93  ? -7.441  -20.063 -17.331 1.00 32.85 ? 93  PRO A CA     1 
ATOM   1185 C  C      . PRO A 1 93  ? -6.727  -20.329 -16.013 1.00 32.74 ? 93  PRO A C      1 
ATOM   1186 O  O      . PRO A 1 93  ? -5.495  -20.335 -15.977 1.00 32.71 ? 93  PRO A O      1 
ATOM   1187 C  CB     . PRO A 1 93  ? -7.215  -21.215 -18.316 1.00 32.76 ? 93  PRO A CB     1 
ATOM   1188 C  CG     . PRO A 1 93  ? -7.031  -20.570 -19.639 1.00 37.00 ? 93  PRO A CG     1 
ATOM   1189 C  CD     . PRO A 1 93  ? -6.395  -19.248 -19.375 1.00 34.37 ? 93  PRO A CD     1 
ATOM   1190 H  HA     . PRO A 1 93  ? -8.391  -19.947 -17.174 1.00 39.42 ? 93  PRO A HA     1 
ATOM   1191 H  HB2    . PRO A 1 93  ? -6.419  -21.710 -18.062 1.00 39.32 ? 93  PRO A HB2    1 
ATOM   1192 H  HB3    . PRO A 1 93  ? -7.992  -21.796 -18.322 1.00 39.32 ? 93  PRO A HB3    1 
ATOM   1193 H  HG2    . PRO A 1 93  ? -6.453  -21.121 -20.190 1.00 44.40 ? 93  PRO A HG2    1 
ATOM   1194 H  HG3    . PRO A 1 93  ? -7.895  -20.453 -20.064 1.00 44.40 ? 93  PRO A HG3    1 
ATOM   1195 H  HD2    . PRO A 1 93  ? -5.428  -19.331 -19.374 1.00 41.24 ? 93  PRO A HD2    1 
ATOM   1196 H  HD3    . PRO A 1 93  ? -6.695  -18.592 -20.023 1.00 41.24 ? 93  PRO A HD3    1 
ATOM   1197 N  N      . GLY A 1 94  ? -7.494  -20.534 -14.948 1.00 31.05 ? 94  GLY A N      1 
ATOM   1198 C  CA     . GLY A 1 94  ? -6.925  -20.847 -13.651 1.00 28.96 ? 94  GLY A CA     1 
ATOM   1199 C  C      . GLY A 1 94  ? -6.594  -22.323 -13.546 1.00 24.72 ? 94  GLY A C      1 
ATOM   1200 O  O      . GLY A 1 94  ? -6.857  -23.096 -14.467 1.00 25.16 ? 94  GLY A O      1 
ATOM   1201 H  H      . GLY A 1 94  ? -8.353  -20.496 -14.954 1.00 37.26 ? 94  GLY A H      1 
ATOM   1202 H  HA2    . GLY A 1 94  ? -6.113  -20.334 -13.517 1.00 34.75 ? 94  GLY A HA2    1 
ATOM   1203 H  HA3    . GLY A 1 94  ? -7.558  -20.618 -12.952 1.00 34.75 ? 94  GLY A HA3    1 
ATOM   1204 N  N      . ARG A 1 95  ? -6.021  -22.716 -12.415 1.00 22.69 ? 95  ARG A N      1 
ATOM   1205 C  CA     . ARG A 1 95  ? -5.540  -24.080 -12.235 1.00 21.85 ? 95  ARG A CA     1 
ATOM   1206 C  C      . ARG A 1 95  ? -6.687  -25.086 -12.141 1.00 23.16 ? 95  ARG A C      1 
ATOM   1207 O  O      . ARG A 1 95  ? -6.526  -26.242 -12.531 1.00 24.89 ? 95  ARG A O      1 
ATOM   1208 C  CB     . ARG A 1 95  ? -4.656  -24.162 -10.990 1.00 28.38 ? 95  ARG A CB     1 
ATOM   1209 C  CG     . ARG A 1 95  ? -3.439  -23.246 -11.047 1.00 33.70 ? 95  ARG A CG     1 
ATOM   1210 C  CD     . ARG A 1 95  ? -2.248  -23.901 -11.721 1.00 32.89 ? 95  ARG A CD     1 
ATOM   1211 N  NE     . ARG A 1 95  ? -1.225  -22.919 -12.085 1.00 34.51 ? 95  ARG A NE     1 
ATOM   1212 C  CZ     . ARG A 1 95  ? 0.061   -23.199 -12.282 1.00 38.68 ? 95  ARG A CZ     1 
ATOM   1213 N  NH1    . ARG A 1 95  ? 0.510   -24.441 -12.147 1.00 42.27 ? 95  ARG A NH1    1 
ATOM   1214 N  NH2    . ARG A 1 95  ? 0.905   -22.229 -12.614 1.00 42.67 ? 95  ARG A NH2    1 
ATOM   1215 H  H      . ARG A 1 95  ? -5.898  -22.208 -11.732 1.00 27.22 ? 95  ARG A H      1 
ATOM   1216 H  HA     . ARG A 1 95  ? -4.997  -24.323 -13.001 1.00 26.22 ? 95  ARG A HA     1 
ATOM   1217 H  HB2    . ARG A 1 95  ? -5.182  -23.910 -10.215 1.00 34.06 ? 95  ARG A HB2    1 
ATOM   1218 H  HB3    . ARG A 1 95  ? -4.339  -25.073 -10.890 1.00 34.06 ? 95  ARG A HB3    1 
ATOM   1219 H  HG2    . ARG A 1 95  ? -3.667  -22.448 -11.549 1.00 40.43 ? 95  ARG A HG2    1 
ATOM   1220 H  HG3    . ARG A 1 95  ? -3.180  -23.008 -10.144 1.00 40.43 ? 95  ARG A HG3    1 
ATOM   1221 H  HD2    . ARG A 1 95  ? -1.849  -24.543 -11.113 1.00 39.46 ? 95  ARG A HD2    1 
ATOM   1222 H  HD3    . ARG A 1 95  ? -2.543  -24.346 -12.531 1.00 39.46 ? 95  ARG A HD3    1 
ATOM   1223 H  HE     . ARG A 1 95  ? -1.473  -22.101 -12.178 1.00 41.41 ? 95  ARG A HE     1 
ATOM   1224 H  HH11   . ARG A 1 95  ? -0.032  -25.073 -11.933 1.00 50.72 ? 95  ARG A HH11   1 
ATOM   1225 H  HH12   . ARG A 1 95  ? 1.343   -24.613 -12.275 1.00 50.72 ? 95  ARG A HH12   1 
ATOM   1226 H  HH21   . ARG A 1 95  ? 0.620   -21.422 -12.702 1.00 51.20 ? 95  ARG A HH21   1 
ATOM   1227 H  HH22   . ARG A 1 95  ? 1.737   -22.407 -12.740 1.00 51.20 ? 95  ARG A HH22   1 
ATOM   1228 N  N      . PHE A 1 96  ? -7.841  -24.657 -11.631 1.00 24.91 ? 96  PHE A N      1 
ATOM   1229 C  CA     . PHE A 1 96  ? -9.014  -25.530 -11.601 1.00 25.56 ? 96  PHE A CA     1 
ATOM   1230 C  C      . PHE A 1 96  ? -9.458  -25.873 -13.021 1.00 25.40 ? 96  PHE A C      1 
ATOM   1231 O  O      . PHE A 1 96  ? -9.778  -27.020 -13.320 1.00 26.31 ? 96  PHE A O      1 
ATOM   1232 C  CB     . PHE A 1 96  ? -10.172 -24.882 -10.835 1.00 27.89 ? 96  PHE A CB     1 
ATOM   1233 C  CG     . PHE A 1 96  ? -10.246 -25.287 -9.389  1.00 23.98 ? 96  PHE A CG     1 
ATOM   1234 C  CD1    . PHE A 1 96  ? -10.582 -26.583 -9.039  1.00 25.56 ? 96  PHE A CD1    1 
ATOM   1235 C  CD2    . PHE A 1 96  ? -9.988  -24.373 -8.380  1.00 25.55 ? 96  PHE A CD2    1 
ATOM   1236 C  CE1    . PHE A 1 96  ? -10.653 -26.963 -7.712  1.00 24.75 ? 96  PHE A CE1    1 
ATOM   1237 C  CE2    . PHE A 1 96  ? -10.057 -24.749 -7.054  1.00 28.10 ? 96  PHE A CE2    1 
ATOM   1238 C  CZ     . PHE A 1 96  ? -10.389 -26.048 -6.721  1.00 24.90 ? 96  PHE A CZ     1 
ATOM   1239 H  H      . PHE A 1 96  ? -7.971  -23.874 -11.299 1.00 29.89 ? 96  PHE A H      1 
ATOM   1240 H  HA     . PHE A 1 96  ? -8.781  -26.357 -11.151 1.00 30.67 ? 96  PHE A HA     1 
ATOM   1241 H  HB2    . PHE A 1 96  ? -10.067 -23.918 -10.867 1.00 33.46 ? 96  PHE A HB2    1 
ATOM   1242 H  HB3    . PHE A 1 96  ? -11.007 -25.136 -11.257 1.00 33.46 ? 96  PHE A HB3    1 
ATOM   1243 H  HD1    . PHE A 1 96  ? -10.759 -27.207 -9.705  1.00 30.67 ? 96  PHE A HD1    1 
ATOM   1244 H  HD2    . PHE A 1 96  ? -9.761  -23.498 -8.599  1.00 30.66 ? 96  PHE A HD2    1 
ATOM   1245 H  HE1    . PHE A 1 96  ? -10.877 -27.838 -7.490  1.00 29.70 ? 96  PHE A HE1    1 
ATOM   1246 H  HE2    . PHE A 1 96  ? -9.880  -24.129 -6.385  1.00 33.72 ? 96  PHE A HE2    1 
ATOM   1247 H  HZ     . PHE A 1 96  ? -10.438 -26.302 -5.828  1.00 29.88 ? 96  PHE A HZ     1 
ATOM   1248 N  N      . GLU A 1 97  ? -9.474  -24.870 -13.893 1.00 26.81 ? 97  GLU A N      1 
ATOM   1249 C  CA     . GLU A 1 97  ? -9.847  -25.077 -15.291 1.00 28.10 ? 97  GLU A CA     1 
ATOM   1250 C  C      . GLU A 1 97  ? -8.883  -26.030 -15.976 1.00 30.47 ? 97  GLU A C      1 
ATOM   1251 O  O      . GLU A 1 97  ? -9.296  -26.936 -16.695 1.00 31.13 ? 97  GLU A O      1 
ATOM   1252 C  CB     . GLU A 1 97  ? -9.876  -23.747 -16.041 1.00 34.42 ? 97  GLU A CB     1 
ATOM   1253 C  CG     . GLU A 1 97  ? -10.930 -22.786 -15.534 1.00 40.55 ? 97  GLU A CG     1 
ATOM   1254 C  CD     . GLU A 1 97  ? -10.653 -21.354 -15.930 1.00 45.52 ? 97  GLU A CD     1 
ATOM   1255 O  OE1    . GLU A 1 97  ? -10.887 -21.009 -17.105 1.00 44.33 ? 97  GLU A OE1    1 
ATOM   1256 O  OE2    . GLU A 1 97  ? -10.201 -20.575 -15.064 1.00 44.98 ? 97  GLU A OE2    1 
ATOM   1257 H  H      . GLU A 1 97  ? -9.273  -24.057 -13.701 1.00 32.17 ? 97  GLU A H      1 
ATOM   1258 H  HA     . GLU A 1 97  ? -10.735 -25.466 -15.329 1.00 33.72 ? 97  GLU A HA     1 
ATOM   1259 H  HB2    . GLU A 1 97  ? -9.012  -23.316 -15.947 1.00 41.30 ? 97  GLU A HB2    1 
ATOM   1260 H  HB3    . GLU A 1 97  ? -10.058 -23.919 -16.978 1.00 41.30 ? 97  GLU A HB3    1 
ATOM   1261 H  HG2    . GLU A 1 97  ? -11.791 -23.038 -15.902 1.00 48.66 ? 97  GLU A HG2    1 
ATOM   1262 H  HG3    . GLU A 1 97  ? -10.957 -22.829 -14.565 1.00 48.66 ? 97  GLU A HG3    1 
ATOM   1263 N  N      . ARG A 1 98  ? -7.593  -25.814 -15.749 1.00 28.60 ? 98  ARG A N      1 
ATOM   1264 C  CA     . ARG A 1 98  ? -6.561  -26.631 -16.370 1.00 28.82 ? 98  ARG A CA     1 
ATOM   1265 C  C      . ARG A 1 98  ? -6.608  -28.073 -15.873 1.00 27.61 ? 98  ARG A C      1 
ATOM   1266 O  O      . ARG A 1 98  ? -6.166  -28.988 -16.570 1.00 31.49 ? 98  ARG A O      1 
ATOM   1267 C  CB     . ARG A 1 98  ? -5.186  -26.018 -16.104 1.00 29.52 ? 98  ARG A CB     1 
ATOM   1268 C  CG     . ARG A 1 98  ? -4.967  -24.707 -16.848 1.00 32.24 ? 98  ARG A CG     1 
ATOM   1269 C  CD     . ARG A 1 98  ? -3.651  -24.055 -16.475 1.00 35.19 ? 98  ARG A CD     1 
ATOM   1270 N  NE     . ARG A 1 98  ? -2.511  -24.941 -16.692 1.00 42.46 ? 98  ARG A NE     1 
ATOM   1271 C  CZ     . ARG A 1 98  ? -1.292  -24.723 -16.207 1.00 53.00 ? 98  ARG A CZ     1 
ATOM   1272 N  NH1    . ARG A 1 98  ? -0.315  -25.585 -16.457 1.00 57.17 ? 98  ARG A NH1    1 
ATOM   1273 N  NH2    . ARG A 1 98  ? -1.047  -23.648 -15.467 1.00 54.55 ? 98  ARG A NH2    1 
ATOM   1274 H  H      . ARG A 1 98  ? -7.288  -25.197 -15.235 1.00 34.32 ? 98  ARG A H      1 
ATOM   1275 H  HA     . ARG A 1 98  ? -6.702  -26.641 -17.330 1.00 34.58 ? 98  ARG A HA     1 
ATOM   1276 H  HB2    . ARG A 1 98  ? -5.098  -25.842 -15.154 1.00 35.42 ? 98  ARG A HB2    1 
ATOM   1277 H  HB3    . ARG A 1 98  ? -4.501  -26.643 -16.390 1.00 35.42 ? 98  ARG A HB3    1 
ATOM   1278 H  HG2    . ARG A 1 98  ? -4.959  -24.881 -17.803 1.00 38.68 ? 98  ARG A HG2    1 
ATOM   1279 H  HG3    . ARG A 1 98  ? -5.684  -24.092 -16.626 1.00 38.68 ? 98  ARG A HG3    1 
ATOM   1280 H  HD2    . ARG A 1 98  ? -3.524  -23.262 -17.020 1.00 42.23 ? 98  ARG A HD2    1 
ATOM   1281 H  HD3    . ARG A 1 98  ? -3.671  -23.814 -15.536 1.00 42.23 ? 98  ARG A HD3    1 
ATOM   1282 H  HE     . ARG A 1 98  ? -2.636  -25.649 -17.163 1.00 50.96 ? 98  ARG A HE     1 
ATOM   1283 H  HH11   . ARG A 1 98  ? -0.469  -26.283 -16.935 1.00 68.61 ? 98  ARG A HH11   1 
ATOM   1284 H  HH12   . ARG A 1 98  ? 0.473   -25.445 -16.142 1.00 68.61 ? 98  ARG A HH12   1 
ATOM   1285 H  HH21   . ARG A 1 98  ? -1.678  -23.087 -15.303 1.00 65.47 ? 98  ARG A HH21   1 
ATOM   1286 H  HH22   . ARG A 1 98  ? -0.258  -23.512 -15.155 1.00 65.47 ? 98  ARG A HH22   1 
ATOM   1287 N  N      . ALA A 1 99  ? -7.160  -28.270 -14.679 1.00 26.35 ? 99  ALA A N      1 
ATOM   1288 C  CA     . ALA A 1 99  ? -7.210  -29.592 -14.056 1.00 25.53 ? 99  ALA A CA     1 
ATOM   1289 C  C      . ALA A 1 99  ? -8.518  -30.335 -14.315 1.00 25.69 ? 99  ALA A C      1 
ATOM   1290 O  O      . ALA A 1 99  ? -8.713  -31.440 -13.801 1.00 25.72 ? 99  ALA A O      1 
ATOM   1291 C  CB     . ALA A 1 99  ? -6.985  -29.464 -12.559 1.00 25.28 ? 99  ALA A CB     1 
ATOM   1292 H  H      . ALA A 1 99  ? -7.517  -27.648 -14.204 1.00 31.62 ? 99  ALA A H      1 
ATOM   1293 H  HA     . ALA A 1 99  ? -6.489  -30.132 -14.417 1.00 30.64 ? 99  ALA A HA     1 
ATOM   1294 H  HB1    . ALA A 1 99  ? -7.020  -30.346 -12.158 1.00 30.34 ? 99  ALA A HB1    1 
ATOM   1295 H  HB2    . ALA A 1 99  ? -6.115  -29.064 -12.404 1.00 30.34 ? 99  ALA A HB2    1 
ATOM   1296 H  HB3    . ALA A 1 99  ? -7.680  -28.901 -12.183 1.00 30.34 ? 99  ALA A HB3    1 
ATOM   1297 N  N      . ASP A 1 100 ? -9.410  -29.735 -15.100 1.00 27.57 ? 100 ASP A N      1 
ATOM   1298 C  CA     . ASP A 1 100 ? -10.710 -30.338 -15.387 1.00 26.78 ? 100 ASP A CA     1 
ATOM   1299 C  C      . ASP A 1 100 ? -10.538 -31.742 -15.963 1.00 27.44 ? 100 ASP A C      1 
ATOM   1300 O  O      . ASP A 1 100 ? -9.788  -31.943 -16.915 1.00 28.28 ? 100 ASP A O      1 
ATOM   1301 C  CB     . ASP A 1 100 ? -11.509 -29.463 -16.358 1.00 29.54 ? 100 ASP A CB     1 
ATOM   1302 C  CG     . ASP A 1 100 ? -12.951 -29.932 -16.523 1.00 34.83 ? 100 ASP A CG     1 
ATOM   1303 O  OD1    . ASP A 1 100 ? -13.568 -30.349 -15.520 1.00 36.41 ? 100 ASP A OD1    1 
ATOM   1304 O  OD2    . ASP A 1 100 ? -13.470 -29.880 -17.658 1.00 45.47 ? 100 ASP A OD2    1 
ATOM   1305 H  H      . ASP A 1 100 ? -9.286  -28.973 -15.481 1.00 33.08 ? 100 ASP A H      1 
ATOM   1306 H  HA     . ASP A 1 100 ? -11.215 -30.410 -14.562 1.00 32.14 ? 100 ASP A HA     1 
ATOM   1307 H  HB2    . ASP A 1 100 ? -11.526 -28.553 -16.023 1.00 35.45 ? 100 ASP A HB2    1 
ATOM   1308 H  HB3    . ASP A 1 100 ? -11.084 -29.488 -17.229 1.00 35.45 ? 100 ASP A HB3    1 
ATOM   1309 N  N      . GLY A 1 101 ? -11.236 -32.706 -15.369 1.00 28.05 ? 101 GLY A N      1 
ATOM   1310 C  CA     . GLY A 1 101 ? -11.115 -34.100 -15.757 1.00 30.70 ? 101 GLY A CA     1 
ATOM   1311 C  C      . GLY A 1 101 ? -9.924  -34.786 -15.112 1.00 25.14 ? 101 GLY A C      1 
ATOM   1312 O  O      . GLY A 1 101 ? -9.662  -35.960 -15.378 1.00 28.77 ? 101 GLY A O      1 
ATOM   1313 H  H      . GLY A 1 101 ? -11.793 -32.572 -14.728 1.00 33.65 ? 101 GLY A H      1 
ATOM   1314 H  HA2    . GLY A 1 101 ? -11.920 -34.576 -15.500 1.00 36.84 ? 101 GLY A HA2    1 
ATOM   1315 H  HA3    . GLY A 1 101 ? -11.018 -34.159 -16.720 1.00 36.84 ? 101 GLY A HA3    1 
ATOM   1316 N  N      . GLY A 1 102 ? -9.202  -34.058 -14.262 1.00 25.68 ? 102 GLY A N      1 
ATOM   1317 C  CA     . GLY A 1 102 ? -8.012  -34.591 -13.618 1.00 22.29 ? 102 GLY A CA     1 
ATOM   1318 C  C      . GLY A 1 102 ? -7.911  -34.261 -12.143 1.00 22.38 ? 102 GLY A C      1 
ATOM   1319 O  O      . GLY A 1 102 ? -8.915  -34.229 -11.436 1.00 20.70 ? 102 GLY A O      1 
ATOM   1320 H  H      . GLY A 1 102 ? -9.385  -33.247 -14.042 1.00 30.82 ? 102 GLY A H      1 
ATOM   1321 H  HA2    . GLY A 1 102 ? -8.005  -35.556 -13.713 1.00 26.75 ? 102 GLY A HA2    1 
ATOM   1322 H  HA3    . GLY A 1 102 ? -7.226  -34.237 -14.062 1.00 26.75 ? 102 GLY A HA3    1 
ATOM   1323 N  N      . THR A 1 103 ? -6.684  -34.016 -11.691 1.00 22.38 ? 103 THR A N      1 
ATOM   1324 C  CA     . THR A 1 103 ? -6.389  -33.786 -10.283 1.00 22.36 ? 103 THR A CA     1 
ATOM   1325 C  C      . THR A 1 103 ? -5.630  -32.477 -10.101 1.00 19.63 ? 103 THR A C      1 
ATOM   1326 O  O      . THR A 1 103 ? -4.720  -32.168 -10.874 1.00 22.17 ? 103 THR A O      1 
ATOM   1327 C  CB     . THR A 1 103 ? -5.549  -34.947 -9.687  1.00 21.77 ? 103 THR A CB     1 
ATOM   1328 O  OG1    . THR A 1 103 ? -6.241  -36.189 -9.867  1.00 22.16 ? 103 THR A OG1    1 
ATOM   1329 C  CG2    . THR A 1 103 ? -5.278  -34.732 -8.200  1.00 27.43 ? 103 THR A CG2    1 
ATOM   1330 H  H      . THR A 1 103 ? -5.989  -33.977 -12.196 1.00 26.85 ? 103 THR A H      1 
ATOM   1331 H  HA     . THR A 1 103 ? -7.221  -33.726 -9.788  1.00 26.83 ? 103 THR A HA     1 
ATOM   1332 H  HB     . THR A 1 103 ? -4.696  -34.990 -10.146 1.00 26.12 ? 103 THR A HB     1 
ATOM   1333 H  HG1    . THR A 1 103 ? -6.365  -36.333 -10.685 1.00 26.59 ? 103 THR A HG1    1 
ATOM   1334 H  HG21   . THR A 1 103 ? -4.753  -35.469 -7.849  1.00 32.92 ? 103 THR A HG21   1 
ATOM   1335 H  HG22   . THR A 1 103 ? -4.788  -33.906 -8.069  1.00 32.92 ? 103 THR A HG22   1 
ATOM   1336 H  HG23   . THR A 1 103 ? -6.116  -34.683 -7.714  1.00 32.92 ? 103 THR A HG23   1 
ATOM   1337 N  N      . LEU A 1 104 ? -6.017  -31.713 -9.083  1.00 19.98 ? 104 LEU A N      1 
ATOM   1338 C  CA     . LEU A 1 104 ? -5.310  -30.493 -8.706  1.00 19.42 ? 104 LEU A CA     1 
ATOM   1339 C  C      . LEU A 1 104 ? -4.673  -30.678 -7.334  1.00 18.35 ? 104 LEU A C      1 
ATOM   1340 O  O      . LEU A 1 104 ? -5.356  -31.024 -6.365  1.00 18.09 ? 104 LEU A O      1 
ATOM   1341 C  CB     . LEU A 1 104 ? -6.260  -29.293 -8.700  1.00 19.80 ? 104 LEU A CB     1 
ATOM   1342 C  CG     . LEU A 1 104 ? -5.711  -27.966 -8.159  1.00 20.05 ? 104 LEU A CG     1 
ATOM   1343 C  CD1    . LEU A 1 104 ? -4.505  -27.496 -8.957  1.00 22.06 ? 104 LEU A CD1    1 
ATOM   1344 C  CD2    . LEU A 1 104 ? -6.804  -26.910 -8.167  1.00 20.90 ? 104 LEU A CD2    1 
ATOM   1345 H  H      . LEU A 1 104 ? -6.699  -31.883 -8.588  1.00 23.98 ? 104 LEU A H      1 
ATOM   1346 H  HA     . LEU A 1 104 ? -4.604  -30.320 -9.348  1.00 23.30 ? 104 LEU A HA     1 
ATOM   1347 H  HB2    . LEU A 1 104 ? -6.546  -29.132 -9.613  1.00 23.76 ? 104 LEU A HB2    1 
ATOM   1348 H  HB3    . LEU A 1 104 ? -7.032  -29.523 -8.160  1.00 23.76 ? 104 LEU A HB3    1 
ATOM   1349 H  HG     . LEU A 1 104 ? -5.428  -28.095 -7.240  1.00 24.06 ? 104 LEU A HG     1 
ATOM   1350 H  HD11   . LEU A 1 104 ? -4.188  -26.657 -8.586  1.00 26.48 ? 104 LEU A HD11   1 
ATOM   1351 H  HD12   . LEU A 1 104 ? -3.808  -28.168 -8.900  1.00 26.48 ? 104 LEU A HD12   1 
ATOM   1352 H  HD13   . LEU A 1 104 ? -4.768  -27.370 -9.882  1.00 26.48 ? 104 LEU A HD13   1 
ATOM   1353 H  HD21   . LEU A 1 104 ? -6.442  -26.078 -7.822  1.00 25.08 ? 104 LEU A HD21   1 
ATOM   1354 H  HD22   . LEU A 1 104 ? -7.114  -26.784 -9.077  1.00 25.08 ? 104 LEU A HD22   1 
ATOM   1355 H  HD23   . LEU A 1 104 ? -7.536  -27.209 -7.606  1.00 25.08 ? 104 LEU A HD23   1 
ATOM   1356 N  N      . PHE A 1 105 ? -3.362  -30.456 -7.274  1.00 17.71 ? 105 PHE A N      1 
ATOM   1357 C  CA     . PHE A 1 105 ? -2.599  -30.525 -6.035  1.00 16.88 ? 105 PHE A CA     1 
ATOM   1358 C  C      . PHE A 1 105 ? -2.280  -29.120 -5.524  1.00 17.05 ? 105 PHE A C      1 
ATOM   1359 O  O      . PHE A 1 105 ? -1.593  -28.355 -6.203  1.00 19.53 ? 105 PHE A O      1 
ATOM   1360 C  CB     . PHE A 1 105 ? -1.308  -31.321 -6.247  1.00 19.90 ? 105 PHE A CB     1 
ATOM   1361 C  CG     . PHE A 1 105 ? -0.387  -31.317 -5.059  1.00 19.19 ? 105 PHE A CG     1 
ATOM   1362 C  CD1    . PHE A 1 105 ? -0.798  -31.829 -3.845  1.00 22.23 ? 105 PHE A CD1    1 
ATOM   1363 C  CD2    . PHE A 1 105 ? 0.896   -30.810 -5.162  1.00 21.72 ? 105 PHE A CD2    1 
ATOM   1364 C  CE1    . PHE A 1 105 ? 0.053   -31.829 -2.755  1.00 21.50 ? 105 PHE A CE1    1 
ATOM   1365 C  CE2    . PHE A 1 105 ? 1.746   -30.811 -4.079  1.00 22.56 ? 105 PHE A CE2    1 
ATOM   1366 C  CZ     . PHE A 1 105 ? 1.325   -31.317 -2.875  1.00 19.44 ? 105 PHE A CZ     1 
ATOM   1367 H  H      . PHE A 1 105 ? -2.880  -30.259 -7.959  1.00 21.25 ? 105 PHE A H      1 
ATOM   1368 H  HA     . PHE A 1 105 ? -3.128  -30.979 -5.360  1.00 20.25 ? 105 PHE A HA     1 
ATOM   1369 H  HB2    . PHE A 1 105 ? -1.538  -32.243 -6.441  1.00 23.88 ? 105 PHE A HB2    1 
ATOM   1370 H  HB3    . PHE A 1 105 ? -0.826  -30.939 -6.997  1.00 23.88 ? 105 PHE A HB3    1 
ATOM   1371 H  HD1    . PHE A 1 105 ? -1.657  -32.175 -3.758  1.00 26.68 ? 105 PHE A HD1    1 
ATOM   1372 H  HD2    . PHE A 1 105 ? 1.188   -30.464 -5.975  1.00 26.06 ? 105 PHE A HD2    1 
ATOM   1373 H  HE1    . PHE A 1 105 ? -0.235  -32.174 -1.941  1.00 25.79 ? 105 PHE A HE1    1 
ATOM   1374 H  HE2    . PHE A 1 105 ? 2.605   -30.464 -4.162  1.00 27.07 ? 105 PHE A HE2    1 
ATOM   1375 H  HZ     . PHE A 1 105 ? 1.898   -31.317 -2.143  1.00 23.33 ? 105 PHE A HZ     1 
ATOM   1376 N  N      . LEU A 1 106 ? -2.790  -28.783 -4.339  1.00 18.79 ? 106 LEU A N      1 
ATOM   1377 C  CA     . LEU A 1 106 ? -2.501  -27.498 -3.694  1.00 18.30 ? 106 LEU A CA     1 
ATOM   1378 C  C      . LEU A 1 106 ? -1.532  -27.669 -2.530  1.00 17.15 ? 106 LEU A C      1 
ATOM   1379 O  O      . LEU A 1 106 ? -1.897  -28.207 -1.491  1.00 18.82 ? 106 LEU A O      1 
ATOM   1380 C  CB     . LEU A 1 106 ? -3.787  -26.835 -3.186  1.00 18.81 ? 106 LEU A CB     1 
ATOM   1381 C  CG     . LEU A 1 106 ? -4.872  -26.553 -4.228  1.00 20.40 ? 106 LEU A CG     1 
ATOM   1382 C  CD1    . LEU A 1 106 ? -6.072  -25.875 -3.575  1.00 22.34 ? 106 LEU A CD1    1 
ATOM   1383 C  CD2    . LEU A 1 106 ? -4.328  -25.704 -5.361  1.00 24.65 ? 106 LEU A CD2    1 
ATOM   1384 H  H      . LEU A 1 106 ? -3.314  -29.288 -3.881  1.00 22.55 ? 106 LEU A H      1 
ATOM   1385 H  HA     . LEU A 1 106 ? -2.091  -26.903 -4.342  1.00 21.96 ? 106 LEU A HA     1 
ATOM   1386 H  HB2    . LEU A 1 106 ? -4.180  -27.412 -2.513  1.00 22.58 ? 106 LEU A HB2    1 
ATOM   1387 H  HB3    . LEU A 1 106 ? -3.551  -25.985 -2.781  1.00 22.58 ? 106 LEU A HB3    1 
ATOM   1388 H  HG     . LEU A 1 106 ? -5.173  -27.395 -4.604  1.00 24.48 ? 106 LEU A HG     1 
ATOM   1389 H  HD11   . LEU A 1 106 ? -6.745  -25.707 -4.252  1.00 26.81 ? 106 LEU A HD11   1 
ATOM   1390 H  HD12   . LEU A 1 106 ? -6.430  -26.461 -2.890  1.00 26.81 ? 106 LEU A HD12   1 
ATOM   1391 H  HD13   . LEU A 1 106 ? -5.784  -25.039 -3.178  1.00 26.81 ? 106 LEU A HD13   1 
ATOM   1392 H  HD21   . LEU A 1 106 ? -5.037  -25.543 -6.002  1.00 29.58 ? 106 LEU A HD21   1 
ATOM   1393 H  HD22   . LEU A 1 106 ? -4.011  -24.861 -4.999  1.00 29.58 ? 106 LEU A HD22   1 
ATOM   1394 H  HD23   . LEU A 1 106 ? -3.597  -26.178 -5.787  1.00 29.58 ? 106 LEU A HD23   1 
ATOM   1395 N  N      . ASP A 1 107 ? -0.303  -27.192 -2.707  1.00 19.11 ? 107 ASP A N      1 
ATOM   1396 C  CA     . ASP A 1 107 ? 0.732   -27.298 -1.683  1.00 18.87 ? 107 ASP A CA     1 
ATOM   1397 C  C      . ASP A 1 107 ? 0.722   -26.073 -0.766  1.00 16.44 ? 107 ASP A C      1 
ATOM   1398 O  O      . ASP A 1 107 ? 0.291   -24.989 -1.166  1.00 20.14 ? 107 ASP A O      1 
ATOM   1399 C  CB     . ASP A 1 107 ? 2.103   -27.458 -2.345  1.00 24.46 ? 107 ASP A CB     1 
ATOM   1400 C  CG     . ASP A 1 107 ? 3.129   -28.136 -1.444  1.00 29.66 ? 107 ASP A CG     1 
ATOM   1401 O  OD1    . ASP A 1 107 ? 2.788   -28.583 -0.330  1.00 28.18 ? 107 ASP A OD1    1 
ATOM   1402 O  OD2    . ASP A 1 107 ? 4.294   -28.232 -1.873  1.00 34.39 ? 107 ASP A OD2    1 
ATOM   1403 H  H      . ASP A 1 107 ? -0.041  -26.796 -3.424  1.00 22.93 ? 107 ASP A H      1 
ATOM   1404 H  HA     . ASP A 1 107 ? 0.564   -28.084 -1.140  1.00 22.64 ? 107 ASP A HA     1 
ATOM   1405 H  HB2    . ASP A 1 107 ? 2.005   -27.999 -3.145  1.00 29.35 ? 107 ASP A HB2    1 
ATOM   1406 H  HB3    . ASP A 1 107 ? 2.444   -26.581 -2.579  1.00 29.35 ? 107 ASP A HB3    1 
ATOM   1407 N  N      . GLN A 1 108 ? 1.190   -26.270 0.465   1.00 19.72 ? 108 GLN A N      1 
ATOM   1408 C  CA     . GLN A 1 108 ? 1.255   -25.220 1.488   1.00 18.67 ? 108 GLN A CA     1 
ATOM   1409 C  C      . GLN A 1 108 ? -0.096  -24.537 1.643   1.00 17.41 ? 108 GLN A C      1 
ATOM   1410 O  O      . GLN A 1 108 ? -0.209  -23.315 1.641   1.00 19.94 ? 108 GLN A O      1 
ATOM   1411 C  CB     . GLN A 1 108 ? 2.358   -24.213 1.150   1.00 20.99 ? 108 GLN A CB     1 
ATOM   1412 C  CG     . GLN A 1 108 ? 3.740   -24.852 1.155   1.00 20.64 ? 108 GLN A CG     1 
ATOM   1413 C  CD     . GLN A 1 108 ? 4.877   -23.846 1.144   1.00 24.84 ? 108 GLN A CD     1 
ATOM   1414 O  OE1    . GLN A 1 108 ? 5.592   -23.709 0.150   1.00 28.12 ? 108 GLN A OE1    1 
ATOM   1415 N  NE2    . GLN A 1 108 ? 5.066   -23.155 2.262   1.00 28.30 ? 108 GLN A NE2    1 
ATOM   1416 H  H      . GLN A 1 108 ? 1.486   -27.028 0.742   1.00 23.66 ? 108 GLN A H      1 
ATOM   1417 H  HA     . GLN A 1 108 ? 1.478   -25.628 2.339   1.00 22.41 ? 108 GLN A HA     1 
ATOM   1418 H  HB2    . GLN A 1 108 ? 2.196   -23.848 0.266   1.00 25.19 ? 108 GLN A HB2    1 
ATOM   1419 H  HB3    . GLN A 1 108 ? 2.352   -23.502 1.810   1.00 25.19 ? 108 GLN A HB3    1 
ATOM   1420 H  HG2    . GLN A 1 108 ? 3.831   -25.395 1.954   1.00 24.77 ? 108 GLN A HG2    1 
ATOM   1421 H  HG3    . GLN A 1 108 ? 3.829   -25.410 0.366   1.00 24.77 ? 108 GLN A HG3    1 
ATOM   1422 H  HE21   . GLN A 1 108 ? 4.557   -23.290 2.942   1.00 33.96 ? 108 GLN A HE21   1 
ATOM   1423 H  HE22   . GLN A 1 108 ? 5.698   -22.573 2.306   1.00 33.96 ? 108 GLN A HE22   1 
ATOM   1424 N  N      . LEU A 1 109 ? -1.117  -25.370 1.802   1.00 19.72 ? 109 LEU A N      1 
ATOM   1425 C  CA     . LEU A 1 109 ? -2.505  -24.933 1.860   1.00 18.86 ? 109 LEU A CA     1 
ATOM   1426 C  C      . LEU A 1 109 ? -2.770  -23.928 2.971   1.00 19.71 ? 109 LEU A C      1 
ATOM   1427 O  O      . LEU A 1 109 ? -3.595  -23.030 2.817   1.00 20.76 ? 109 LEU A O      1 
ATOM   1428 C  CB     . LEU A 1 109 ? -3.407  -26.149 2.052   1.00 20.32 ? 109 LEU A CB     1 
ATOM   1429 C  CG     . LEU A 1 109 ? -4.904  -25.880 2.187   1.00 25.68 ? 109 LEU A CG     1 
ATOM   1430 C  CD1    . LEU A 1 109 ? -5.477  -25.404 0.865   1.00 31.17 ? 109 LEU A CD1    1 
ATOM   1431 C  CD2    . LEU A 1 109 ? -5.612  -27.136 2.676   1.00 26.08 ? 109 LEU A CD2    1 
ATOM   1432 H  H      . LEU A 1 109 ? -1.026  -26.222 1.882   1.00 23.66 ? 109 LEU A H      1 
ATOM   1433 H  HA     . LEU A 1 109 ? -2.739  -24.516 1.016   1.00 22.64 ? 109 LEU A HA     1 
ATOM   1434 H  HB2    . LEU A 1 109 ? -3.289  -26.737 1.290   1.00 24.39 ? 109 LEU A HB2    1 
ATOM   1435 H  HB3    . LEU A 1 109 ? -3.125  -26.610 2.858   1.00 24.39 ? 109 LEU A HB3    1 
ATOM   1436 H  HG     . LEU A 1 109 ? -5.043  -25.180 2.844   1.00 30.81 ? 109 LEU A HG     1 
ATOM   1437 H  HD11   . LEU A 1 109 ? -6.427  -25.240 0.974   1.00 37.40 ? 109 LEU A HD11   1 
ATOM   1438 H  HD12   . LEU A 1 109 ? -5.027  -24.586 0.603   1.00 37.40 ? 109 LEU A HD12   1 
ATOM   1439 H  HD13   . LEU A 1 109 ? -5.334  -26.090 0.194   1.00 37.40 ? 109 LEU A HD13   1 
ATOM   1440 H  HD21   . LEU A 1 109 ? -6.561  -26.951 2.757   1.00 31.29 ? 109 LEU A HD21   1 
ATOM   1441 H  HD22   . LEU A 1 109 ? -5.467  -27.850 2.036   1.00 31.29 ? 109 LEU A HD22   1 
ATOM   1442 H  HD23   . LEU A 1 109 ? -5.249  -27.386 3.540   1.00 31.29 ? 109 LEU A HD23   1 
ATOM   1443 N  N      . ALA A 1 110 ? -2.089  -24.097 4.096   1.00 19.14 ? 110 ALA A N      1 
ATOM   1444 C  CA     . ALA A 1 110 ? -2.368  -23.290 5.276   1.00 19.69 ? 110 ALA A CA     1 
ATOM   1445 C  C      . ALA A 1 110 ? -1.925  -21.838 5.100   1.00 21.32 ? 110 ALA A C      1 
ATOM   1446 O  O      . ALA A 1 110 ? -2.266  -20.985 5.922   1.00 25.16 ? 110 ALA A O      1 
ATOM   1447 C  CB     . ALA A 1 110 ? -1.701  -23.907 6.492   1.00 24.07 ? 110 ALA A CB     1 
ATOM   1448 H  H      . ALA A 1 110 ? -1.459  -24.672 4.203   1.00 22.97 ? 110 ALA A H      1 
ATOM   1449 H  HA     . ALA A 1 110 ? -3.325  -23.290 5.433   1.00 23.63 ? 110 ALA A HA     1 
ATOM   1450 H  HB1    . ALA A 1 110 ? -1.894  -23.361 7.270   1.00 28.88 ? 110 ALA A HB1    1 
ATOM   1451 H  HB2    . ALA A 1 110 ? -2.049  -24.803 6.622   1.00 28.88 ? 110 ALA A HB2    1 
ATOM   1452 H  HB3    . ALA A 1 110 ? -0.743  -23.943 6.343   1.00 28.88 ? 110 ALA A HB3    1 
ATOM   1453 N  N      . THR A 1 111 ? -1.181  -21.554 4.031   1.00 19.93 ? 111 THR A N      1 
ATOM   1454 C  CA     . THR A 1 111 ? -0.779  -20.177 3.734   1.00 17.74 ? 111 THR A CA     1 
ATOM   1455 C  C      . THR A 1 111 ? -1.812  -19.445 2.882   1.00 18.25 ? 111 THR A C      1 
ATOM   1456 O  O      . THR A 1 111 ? -1.680  -18.244 2.654   1.00 22.31 ? 111 THR A O      1 
ATOM   1457 C  CB     . THR A 1 111 ? 0.577   -20.095 2.992   1.00 20.55 ? 111 THR A CB     1 
ATOM   1458 O  OG1    . THR A 1 111 ? 0.450   -20.624 1.667   1.00 21.07 ? 111 THR A OG1    1 
ATOM   1459 C  CG2    . THR A 1 111 ? 1.647   -20.844 3.745   1.00 21.14 ? 111 THR A CG2    1 
ATOM   1460 H  H      . THR A 1 111 ? -0.897  -22.135 3.465   1.00 23.92 ? 111 THR A H      1 
ATOM   1461 H  HA     . THR A 1 111 ? -0.689  -19.692 4.570   1.00 21.29 ? 111 THR A HA     1 
ATOM   1462 H  HB     . THR A 1 111 ? 0.848   -19.165 2.935   1.00 24.66 ? 111 THR A HB     1 
ATOM   1463 H  HG1    . THR A 1 111 ? 0.208   -21.427 1.701   1.00 25.28 ? 111 THR A HG1    1 
ATOM   1464 H  HG21   . THR A 1 111 ? 2.490   -20.784 3.269   1.00 25.37 ? 111 THR A HG21   1 
ATOM   1465 H  HG22   . THR A 1 111 ? 1.757   -20.464 4.630   1.00 25.37 ? 111 THR A HG22   1 
ATOM   1466 H  HG23   . THR A 1 111 ? 1.399   -21.778 3.831   1.00 25.37 ? 111 THR A HG23   1 
ATOM   1467 N  N      . ALA A 1 112 ? -2.829  -20.157 2.404   1.00 18.96 ? 112 ALA A N      1 
ATOM   1468 C  CA     . ALA A 1 112 ? -3.874  -19.529 1.596   1.00 18.41 ? 112 ALA A CA     1 
ATOM   1469 C  C      . ALA A 1 112 ? -4.598  -18.468 2.417   1.00 20.50 ? 112 ALA A C      1 
ATOM   1470 O  O      . ALA A 1 112 ? -5.013  -18.747 3.540   1.00 19.99 ? 112 ALA A O      1 
ATOM   1471 C  CB     . ALA A 1 112 ? -4.863  -20.570 1.093   1.00 20.19 ? 112 ALA A CB     1 
ATOM   1472 H  H      . ALA A 1 112 ? -2.938  -21.000 2.531   1.00 22.76 ? 112 ALA A H      1 
ATOM   1473 H  HA     . ALA A 1 112 ? -3.469  -19.097 0.828   1.00 22.09 ? 112 ALA A HA     1 
ATOM   1474 H  HB1    . ALA A 1 112 ? -5.543  -20.127 0.562   1.00 24.23 ? 112 ALA A HB1    1 
ATOM   1475 H  HB2    . ALA A 1 112 ? -4.389  -21.219 0.550   1.00 24.23 ? 112 ALA A HB2    1 
ATOM   1476 H  HB3    . ALA A 1 112 ? -5.272  -21.011 1.854   1.00 24.23 ? 112 ALA A HB3    1 
ATOM   1477 N  N      . PRO A 1 113 ? -4.744  -17.245 1.870   1.00 19.75 ? 113 PRO A N      1 
ATOM   1478 C  CA     . PRO A 1 113 ? -5.516  -16.230 2.592   1.00 21.27 ? 113 PRO A CA     1 
ATOM   1479 C  C      . PRO A 1 113 ? -6.967  -16.656 2.793   1.00 19.80 ? 113 PRO A C      1 
ATOM   1480 O  O      . PRO A 1 113 ? -7.482  -17.484 2.042   1.00 20.42 ? 113 PRO A O      1 
ATOM   1481 C  CB     . PRO A 1 113 ? -5.432  -14.998 1.684   1.00 26.50 ? 113 PRO A CB     1 
ATOM   1482 C  CG     . PRO A 1 113 ? -4.272  -15.239 0.793   1.00 28.93 ? 113 PRO A CG     1 
ATOM   1483 C  CD     . PRO A 1 113 ? -4.184  -16.718 0.614   1.00 21.19 ? 113 PRO A CD     1 
ATOM   1484 H  HA     . PRO A 1 113 ? -5.109  -16.033 3.450   1.00 25.53 ? 113 PRO A HA     1 
ATOM   1485 H  HB2    . PRO A 1 113 ? -6.248  -14.917 1.167   1.00 31.80 ? 113 PRO A HB2    1 
ATOM   1486 H  HB3    . PRO A 1 113 ? -5.289  -14.204 2.223   1.00 31.80 ? 113 PRO A HB3    1 
ATOM   1487 H  HG2    . PRO A 1 113 ? -4.421  -14.801 -0.059  1.00 34.72 ? 113 PRO A HG2    1 
ATOM   1488 H  HG3    . PRO A 1 113 ? -3.465  -14.900 1.212   1.00 34.72 ? 113 PRO A HG3    1 
ATOM   1489 H  HD2    . PRO A 1 113 ? -4.724  -16.999 -0.142  1.00 25.43 ? 113 PRO A HD2    1 
ATOM   1490 H  HD3    . PRO A 1 113 ? -3.260  -16.993 0.513   1.00 25.43 ? 113 PRO A HD3    1 
ATOM   1491 N  N      . MET A 1 114 ? -7.618  -16.089 3.800   1.00 23.17 ? 114 MET A N      1 
ATOM   1492 C  CA     . MET A 1 114 ? -8.979  -16.488 4.136   1.00 25.47 ? 114 MET A CA     1 
ATOM   1493 C  C      . MET A 1 114 ? -9.975  -16.293 2.978   1.00 23.19 ? 114 MET A C      1 
ATOM   1494 O  O      . MET A 1 114 ? -10.942 -17.044 2.886   1.00 29.23 ? 114 MET A O      1 
ATOM   1495 C  CB     . MET A 1 114 ? -9.442  -15.738 5.387   1.00 27.01 ? 114 MET A CB     1 
ATOM   1496 C  CG     . MET A 1 114 ? -8.664  -16.140 6.642   1.00 29.82 ? 114 MET A CG     1 
ATOM   1497 S  SD     . MET A 1 114 ? -9.046  -17.801 7.243   1.00 35.05 ? 114 MET A SD     1 
ATOM   1498 C  CE     . MET A 1 114 ? -10.585 -17.504 8.116   1.00 34.29 ? 114 MET A CE     1 
ATOM   1499 H  H      . MET A 1 114 ? -7.296  -15.471 4.304   1.00 27.80 ? 114 MET A H      1 
ATOM   1500 H  HA     . MET A 1 114 ? -8.965  -17.432 4.361   1.00 30.56 ? 114 MET A HA     1 
ATOM   1501 H  HB2    . MET A 1 114 ? -9.317  -14.786 5.248   1.00 32.42 ? 114 MET A HB2    1 
ATOM   1502 H  HB3    . MET A 1 114 ? -10.380 -15.931 5.541   1.00 32.42 ? 114 MET A HB3    1 
ATOM   1503 H  HG2    . MET A 1 114 ? -7.715  -16.108 6.444   1.00 35.79 ? 114 MET A HG2    1 
ATOM   1504 H  HG3    . MET A 1 114 ? -8.872  -15.513 7.352   1.00 35.79 ? 114 MET A HG3    1 
ATOM   1505 H  HE1    . MET A 1 114 ? -10.900 -18.341 8.493   1.00 41.15 ? 114 MET A HE1    1 
ATOM   1506 H  HE2    . MET A 1 114 ? -10.427 -16.860 8.823   1.00 41.15 ? 114 MET A HE2    1 
ATOM   1507 H  HE3    . MET A 1 114 ? -11.240 -17.156 7.490   1.00 41.15 ? 114 MET A HE3    1 
ATOM   1508 N  N      A MET A 1 115 ? -9.717  -15.319 2.107   0.68 23.88 ? 115 MET A N      1 
ATOM   1509 N  N      B MET A 1 115 ? -9.765  -15.300 2.111   0.32 28.18 ? 115 MET A N      1 
ATOM   1510 C  CA     A MET A 1 115 ? -10.559 -15.096 0.932   0.68 23.89 ? 115 MET A CA     1 
ATOM   1511 C  CA     B MET A 1 115 ? -10.580 -15.202 0.892   0.32 30.83 ? 115 MET A CA     1 
ATOM   1512 C  C      A MET A 1 115 ? -10.521 -16.291 -0.015  0.68 23.81 ? 115 MET A C      1 
ATOM   1513 C  C      B MET A 1 115 ? -10.538 -16.496 0.167   0.32 31.22 ? 115 MET A C      1 
ATOM   1514 O  O      A MET A 1 115 ? -11.548 -16.694 -0.551  0.68 22.61 ? 115 MET A O      1 
ATOM   1515 O  O      B MET A 1 115 ? -11.547 -17.178 -0.011  0.32 34.65 ? 115 MET A O      1 
ATOM   1516 C  CB     A MET A 1 115 ? -10.120 -13.831 0.178   0.68 26.02 ? 115 MET A CB     1 
ATOM   1517 C  CB     B MET A 1 115 ? -10.074 -14.165 -0.098  0.32 36.76 ? 115 MET A CB     1 
ATOM   1518 C  CG     A MET A 1 115 ? -10.877 -13.590 -1.131  0.68 30.62 ? 115 MET A CG     1 
ATOM   1519 C  CG     B MET A 1 115 ? -10.548 -12.793 0.127   0.32 42.42 ? 115 MET A CG     1 
ATOM   1520 S  SD     A MET A 1 115 ? -10.310 -12.162 -2.079  0.68 42.09 ? 115 MET A SD     1 
ATOM   1521 S  SD     B MET A 1 115 ? -10.109 -11.727 -1.240  0.32 52.29 ? 115 MET A SD     1 
ATOM   1522 C  CE     A MET A 1 115 ? -8.740  -12.745 -2.721  0.68 44.97 ? 115 MET A CE     1 
ATOM   1523 C  CE     B MET A 1 115 ? -9.949  -10.223 -0.317  0.32 49.63 ? 115 MET A CE     1 
ATOM   1524 H  H      A MET A 1 115 ? -9.057  -14.771 2.173   0.68 28.65 ? 115 MET A H      1 
ATOM   1525 H  H      B MET A 1 115 ? -9.172  -14.684 2.199   0.32 33.82 ? 115 MET A H      1 
ATOM   1526 H  HA     A MET A 1 115 ? -11.474 -14.962 1.227   0.68 28.67 ? 115 MET A HA     1 
ATOM   1527 H  HA     B MET A 1 115 ? -11.496 -14.987 1.127   0.32 37.00 ? 115 MET A HA     1 
ATOM   1528 H  HB2    A MET A 1 115 ? -10.266 -13.061 0.750   0.68 31.22 ? 115 MET A HB2    1 
ATOM   1529 H  HB2    B MET A 1 115 ? -9.105  -14.148 -0.057  0.32 44.12 ? 115 MET A HB2    1 
ATOM   1530 H  HB3    A MET A 1 115 ? -9.177  -13.907 -0.035  0.68 31.22 ? 115 MET A HB3    1 
ATOM   1531 H  HB3    B MET A 1 115 ? -10.355 -14.428 -0.989  0.32 44.12 ? 115 MET A HB3    1 
ATOM   1532 H  HG2    A MET A 1 115 ? -10.778 -14.374 -1.694  0.68 36.74 ? 115 MET A HG2    1 
ATOM   1533 H  HG2    B MET A 1 115 ? -11.515 -12.797 0.212   0.32 50.91 ? 115 MET A HG2    1 
ATOM   1534 H  HG3    A MET A 1 115 ? -11.815 -13.453 -0.925  0.68 36.74 ? 115 MET A HG3    1 
ATOM   1535 H  HG3    B MET A 1 115 ? -10.140 -12.440 0.933   0.32 50.91 ? 115 MET A HG3    1 
ATOM   1536 H  HE1    A MET A 1 115 ? -8.895  -13.531 -3.267  0.68 53.96 ? 115 MET A HE1    1 
ATOM   1537 H  HE1    B MET A 1 115 ? -9.260  -10.337 0.356   0.32 59.56 ? 115 MET A HE1    1 
ATOM   1538 H  HE2    A MET A 1 115 ? -8.339  -12.043 -3.257  0.68 53.96 ? 115 MET A HE2    1 
ATOM   1539 H  HE2    B MET A 1 115 ? -9.704  -9.506  -0.923  0.32 59.56 ? 115 MET A HE2    1 
ATOM   1540 H  HE3    A MET A 1 115 ? -8.159  -12.967 -1.978  0.68 53.96 ? 115 MET A HE3    1 
ATOM   1541 H  HE3    B MET A 1 115 ? -10.797 -10.022 0.107   0.32 59.56 ? 115 MET A HE3    1 
ATOM   1542 N  N      . VAL A 1 116 ? -9.320  -16.815 -0.246  1.00 22.22 ? 116 VAL A N      1 
ATOM   1543 C  CA     . VAL A 1 116 ? -9.094  -17.905 -1.161  1.00 20.96 ? 116 VAL A CA     1 
ATOM   1544 C  C      . VAL A 1 116 ? -9.698  -19.159 -0.566  1.00 21.84 ? 116 VAL A C      1 
ATOM   1545 O  O      . VAL A 1 116 ? -10.288 -19.961 -1.278  1.00 21.08 ? 116 VAL A O      1 
ATOM   1546 C  CB     . VAL A 1 116 ? -7.588  -18.061 -1.441  1.00 21.88 ? 116 VAL A CB     1 
ATOM   1547 C  CG1    . VAL A 1 116 ? -7.292  -19.343 -2.199  1.00 21.62 ? 116 VAL A CG1    1 
ATOM   1548 C  CG2    . VAL A 1 116 ? -7.083  -16.842 -2.211  1.00 23.19 ? 116 VAL A CG2    1 
ATOM   1549 H  H      . VAL A 1 116 ? -8.595  -16.474 0.064   1.00 26.66 ? 116 VAL A H      1 
ATOM   1550 H  HA     . VAL A 1 116 ? -9.542  -17.719 -2.001  1.00 25.15 ? 116 VAL A HA     1 
ATOM   1551 H  HB     . VAL A 1 116 ? -7.114  -18.098 -0.596  1.00 26.26 ? 116 VAL A HB     1 
ATOM   1552 H  HG11   . VAL A 1 116 ? -6.336  -19.403 -2.355  1.00 25.95 ? 116 VAL A HG11   1 
ATOM   1553 H  HG12   . VAL A 1 116 ? -7.589  -20.099 -1.669  1.00 25.95 ? 116 VAL A HG12   1 
ATOM   1554 H  HG13   . VAL A 1 116 ? -7.765  -19.325 -3.046  1.00 25.95 ? 116 VAL A HG13   1 
ATOM   1555 H  HG21   . VAL A 1 116 ? -6.134  -16.949 -2.382  1.00 27.83 ? 116 VAL A HG21   1 
ATOM   1556 H  HG22   . VAL A 1 116 ? -7.566  -16.777 -3.049  1.00 27.83 ? 116 VAL A HG22   1 
ATOM   1557 H  HG23   . VAL A 1 116 ? -7.236  -16.047 -1.677  1.00 27.83 ? 116 VAL A HG23   1 
ATOM   1558 N  N      . GLN A 1 117 ? -9.595  -19.288 0.754   1.00 19.34 ? 117 GLN A N      1 
ATOM   1559 C  CA     . GLN A 1 117 ? -10.185 -20.418 1.461   1.00 17.83 ? 117 GLN A CA     1 
ATOM   1560 C  C      . GLN A 1 117 ? -11.696 -20.476 1.248   1.00 20.29 ? 117 GLN A C      1 
ATOM   1561 O  O      . GLN A 1 117 ? -12.253 -21.539 0.974   1.00 22.51 ? 117 GLN A O      1 
ATOM   1562 C  CB     . GLN A 1 117 ? -9.871  -20.338 2.954   1.00 19.28 ? 117 GLN A CB     1 
ATOM   1563 C  CG     . GLN A 1 117 ? -8.416  -20.603 3.305   1.00 19.11 ? 117 GLN A CG     1 
ATOM   1564 C  CD     . GLN A 1 117 ? -8.179  -20.568 4.796   1.00 20.33 ? 117 GLN A CD     1 
ATOM   1565 O  OE1    . GLN A 1 117 ? -8.973  -21.096 5.567   1.00 21.38 ? 117 GLN A OE1    1 
ATOM   1566 N  NE2    . GLN A 1 117 ? -7.088  -19.933 5.212   1.00 20.42 ? 117 GLN A NE2    1 
ATOM   1567 H  H      . GLN A 1 117 ? -9.185  -18.731 1.265   1.00 23.21 ? 117 GLN A H      1 
ATOM   1568 H  HA     . GLN A 1 117 ? -9.802  -21.241 1.117   1.00 21.39 ? 117 GLN A HA     1 
ATOM   1569 H  HB2    . GLN A 1 117 ? -10.093 -19.449 3.271   1.00 23.13 ? 117 GLN A HB2    1 
ATOM   1570 H  HB3    . GLN A 1 117 ? -10.410 -20.996 3.421   1.00 23.13 ? 117 GLN A HB3    1 
ATOM   1571 H  HG2    . GLN A 1 117 ? -8.164  -21.481 2.979   1.00 22.93 ? 117 GLN A HG2    1 
ATOM   1572 H  HG3    . GLN A 1 117 ? -7.860  -19.922 2.894   1.00 22.93 ? 117 GLN A HG3    1 
ATOM   1573 H  HE21   . GLN A 1 117 ? -6.559  -19.568 4.641   1.00 24.51 ? 117 GLN A HE21   1 
ATOM   1574 H  HE22   . GLN A 1 117 ? -6.912  -19.888 6.053   1.00 24.51 ? 117 GLN A HE22   1 
ATOM   1575 N  N      . GLU A 1 118 ? -12.359 -19.332 1.373   1.00 20.59 ? 118 GLU A N      1 
ATOM   1576 C  CA     . GLU A 1 118 ? -13.802 -19.293 1.204   1.00 23.37 ? 118 GLU A CA     1 
ATOM   1577 C  C      . GLU A 1 118 ? -14.170 -19.617 -0.239  1.00 23.53 ? 118 GLU A C      1 
ATOM   1578 O  O      . GLU A 1 118 ? -15.089 -20.404 -0.492  1.00 24.14 ? 118 GLU A O      1 
ATOM   1579 C  CB     . GLU A 1 118 ? -14.354 -17.925 1.615   1.00 25.33 ? 118 GLU A CB     1 
ATOM   1580 C  CG     . GLU A 1 118 ? -15.881 -17.863 1.679   1.00 28.76 ? 118 GLU A CG     1 
ATOM   1581 C  CD     . GLU A 1 118 ? -16.534 -17.526 0.348   1.00 35.74 ? 118 GLU A CD     1 
ATOM   1582 O  OE1    . GLU A 1 118 ? -15.835 -17.058 -0.579  1.00 35.86 ? 118 GLU A OE1    1 
ATOM   1583 O  OE2    . GLU A 1 118 ? -17.760 -17.729 0.231   1.00 38.40 ? 118 GLU A OE2    1 
ATOM   1584 H  H      . GLU A 1 118 ? -11.999 -18.573 1.554   1.00 24.70 ? 118 GLU A H      1 
ATOM   1585 H  HA     . GLU A 1 118 ? -14.207 -19.964 1.776   1.00 28.04 ? 118 GLU A HA     1 
ATOM   1586 H  HB2    . GLU A 1 118 ? -14.012 -17.703 2.495   1.00 30.39 ? 118 GLU A HB2    1 
ATOM   1587 H  HB3    . GLU A 1 118 ? -14.057 -17.263 0.971   1.00 30.39 ? 118 GLU A HB3    1 
ATOM   1588 H  HG2    . GLU A 1 118 ? -16.218 -18.726 1.965   1.00 34.51 ? 118 GLU A HG2    1 
ATOM   1589 H  HG3    . GLU A 1 118 ? -16.140 -17.181 2.318   1.00 34.51 ? 118 GLU A HG3    1 
ATOM   1590 N  N      . LYS A 1 119 ? -13.443 -19.029 -1.185  1.00 23.97 ? 119 LYS A N      1 
ATOM   1591 C  CA     . LYS A 1 119 ? -13.711 -19.266 -2.600  1.00 24.11 ? 119 LYS A CA     1 
ATOM   1592 C  C      . LYS A 1 119 ? -13.457 -20.726 -2.953  1.00 21.81 ? 119 LYS A C      1 
ATOM   1593 O  O      . LYS A 1 119 ? -14.175 -21.316 -3.758  1.00 23.79 ? 119 LYS A O      1 
ATOM   1594 C  CB     . LYS A 1 119 ? -12.854 -18.350 -3.474  1.00 27.37 ? 119 LYS A CB     1 
ATOM   1595 C  CG     . LYS A 1 119 ? -13.238 -16.881 -3.376  1.00 32.88 ? 119 LYS A CG     1 
ATOM   1596 C  CD     . LYS A 1 119 ? -12.377 -15.998 -4.266  1.00 35.94 ? 119 LYS A CD     1 
ATOM   1597 C  CE     . LYS A 1 119 ? -12.660 -16.243 -5.739  1.00 41.83 ? 119 LYS A CE     1 
ATOM   1598 N  NZ     . LYS A 1 119 ? -12.243 -15.089 -6.584  1.00 47.36 ? 119 LYS A NZ     1 
ATOM   1599 H  H      . LYS A 1 119 ? -12.790 -18.490 -1.034  1.00 28.76 ? 119 LYS A H      1 
ATOM   1600 H  HA     . LYS A 1 119 ? -14.643 -19.070 -2.783  1.00 28.93 ? 119 LYS A HA     1 
ATOM   1601 H  HB2    . LYS A 1 119 ? -11.927 -18.434 -3.201  1.00 32.84 ? 119 LYS A HB2    1 
ATOM   1602 H  HB3    . LYS A 1 119 ? -12.950 -18.621 -4.401  1.00 32.84 ? 119 LYS A HB3    1 
ATOM   1603 H  HG2    . LYS A 1 119 ? -14.162 -16.775 -3.650  1.00 39.46 ? 119 LYS A HG2    1 
ATOM   1604 H  HG3    . LYS A 1 119 ? -13.126 -16.584 -2.459  1.00 39.46 ? 119 LYS A HG3    1 
ATOM   1605 H  HD2    . LYS A 1 119 ? -12.566 -15.067 -4.072  1.00 43.13 ? 119 LYS A HD2    1 
ATOM   1606 H  HD3    . LYS A 1 119 ? -11.441 -16.193 -4.100  1.00 43.13 ? 119 LYS A HD3    1 
ATOM   1607 H  HE2    . LYS A 1 119 ? -12.168 -17.026 -6.032  1.00 50.20 ? 119 LYS A HE2    1 
ATOM   1608 H  HE3    . LYS A 1 119 ? -13.612 -16.380 -5.862  1.00 50.20 ? 119 LYS A HE3    1 
ATOM   1609 H  HZ1    . LYS A 1 119 ? -12.684 -14.356 -6.338  1.00 56.83 ? 119 LYS A HZ1    1 
ATOM   1610 H  HZ2    . LYS A 1 119 ? -11.369 -14.944 -6.492  1.00 56.83 ? 119 LYS A HZ2    1 
ATOM   1611 H  HZ3    . LYS A 1 119 ? -12.419 -15.259 -7.440  1.00 56.83 ? 119 LYS A HZ3    1 
ATOM   1612 N  N      . LEU A 1 120 ? -12.433 -21.308 -2.341  1.00 22.30 ? 120 LEU A N      1 
ATOM   1613 C  CA     . LEU A 1 120 ? -12.114 -22.711 -2.565  1.00 20.98 ? 120 LEU A CA     1 
ATOM   1614 C  C      . LEU A 1 120 ? -13.262 -23.608 -2.096  1.00 24.47 ? 120 LEU A C      1 
ATOM   1615 O  O      . LEU A 1 120 ? -13.646 -24.548 -2.793  1.00 23.30 ? 120 LEU A O      1 
ATOM   1616 C  CB     . LEU A 1 120 ? -10.809 -23.078 -1.850  1.00 22.95 ? 120 LEU A CB     1 
ATOM   1617 C  CG     . LEU A 1 120 ? -10.403 -24.550 -1.885  1.00 25.35 ? 120 LEU A CG     1 
ATOM   1618 C  CD1    . LEU A 1 120 ? -10.241 -25.032 -3.317  1.00 27.40 ? 120 LEU A CD1    1 
ATOM   1619 C  CD2    . LEU A 1 120 ? -9.116  -24.751 -1.098  1.00 25.32 ? 120 LEU A CD2    1 
ATOM   1620 H  H      . LEU A 1 120 ? -11.906 -20.911 -1.789  1.00 26.76 ? 120 LEU A H      1 
ATOM   1621 H  HA     . LEU A 1 120 ? -11.988 -22.858 -3.515  1.00 25.18 ? 120 LEU A HA     1 
ATOM   1622 H  HB2    . LEU A 1 120 ? -10.089 -22.571 -2.256  1.00 27.54 ? 120 LEU A HB2    1 
ATOM   1623 H  HB3    . LEU A 1 120 ? -10.893 -22.826 -0.917  1.00 27.54 ? 120 LEU A HB3    1 
ATOM   1624 H  HG     . LEU A 1 120 ? -11.098 -25.081 -1.466  1.00 30.42 ? 120 LEU A HG     1 
ATOM   1625 H  HD11   . LEU A 1 120 ? -9.984  -25.967 -3.309  1.00 32.88 ? 120 LEU A HD11   1 
ATOM   1626 H  HD12   . LEU A 1 120 ? -11.085 -24.925 -3.783  1.00 32.88 ? 120 LEU A HD12   1 
ATOM   1627 H  HD13   . LEU A 1 120 ? -9.554  -24.503 -3.752  1.00 32.88 ? 120 LEU A HD13   1 
ATOM   1628 H  HD21   . LEU A 1 120 ? -8.871  -25.688 -1.129  1.00 30.39 ? 120 LEU A HD21   1 
ATOM   1629 H  HD22   . LEU A 1 120 ? -8.416  -24.211 -1.496  1.00 30.39 ? 120 LEU A HD22   1 
ATOM   1630 H  HD23   . LEU A 1 120 ? -9.263  -24.477 -0.179  1.00 30.39 ? 120 LEU A HD23   1 
ATOM   1631 N  N      . LEU A 1 121 ? -13.818 -23.309 -0.925  1.00 23.02 ? 121 LEU A N      1 
ATOM   1632 C  CA     . LEU A 1 121 ? -14.938 -24.087 -0.411  1.00 23.55 ? 121 LEU A CA     1 
ATOM   1633 C  C      . LEU A 1 121 ? -16.120 -24.005 -1.368  1.00 25.02 ? 121 LEU A C      1 
ATOM   1634 O  O      . LEU A 1 121 ? -16.798 -24.999 -1.604  1.00 24.56 ? 121 LEU A O      1 
ATOM   1635 C  CB     . LEU A 1 121 ? -15.357 -23.604 0.980   1.00 22.03 ? 121 LEU A CB     1 
ATOM   1636 C  CG     . LEU A 1 121 ? -16.557 -24.338 1.596   1.00 25.65 ? 121 LEU A CG     1 
ATOM   1637 C  CD1    . LEU A 1 121 ? -16.308 -25.839 1.681   1.00 27.90 ? 121 LEU A CD1    1 
ATOM   1638 C  CD2    . LEU A 1 121 ? -16.881 -23.776 2.970   1.00 27.16 ? 121 LEU A CD2    1 
ATOM   1639 H  H      . LEU A 1 121 ? -13.567 -22.666 -0.413  1.00 27.63 ? 121 LEU A H      1 
ATOM   1640 H  HA     . LEU A 1 121 ? -14.672 -25.017 -0.339  1.00 28.26 ? 121 LEU A HA     1 
ATOM   1641 H  HB2    . LEU A 1 121 ? -14.606 -23.716 1.583   1.00 26.44 ? 121 LEU A HB2    1 
ATOM   1642 H  HB3    . LEU A 1 121 ? -15.589 -22.664 0.922   1.00 26.44 ? 121 LEU A HB3    1 
ATOM   1643 H  HG     . LEU A 1 121 ? -17.331 -24.198 1.030   1.00 30.79 ? 121 LEU A HG     1 
ATOM   1644 H  HD11   . LEU A 1 121 ? -17.085 -26.266 2.074   1.00 33.48 ? 121 LEU A HD11   1 
ATOM   1645 H  HD12   . LEU A 1 121 ? -16.157 -26.185 0.787   1.00 33.48 ? 121 LEU A HD12   1 
ATOM   1646 H  HD13   . LEU A 1 121 ? -15.527 -25.999 2.234   1.00 33.48 ? 121 LEU A HD13   1 
ATOM   1647 H  HD21   . LEU A 1 121 ? -17.641 -24.256 3.335   1.00 32.59 ? 121 LEU A HD21   1 
ATOM   1648 H  HD22   . LEU A 1 121 ? -16.110 -23.888 3.547   1.00 32.59 ? 121 LEU A HD22   1 
ATOM   1649 H  HD23   . LEU A 1 121 ? -17.095 -22.834 2.883   1.00 32.59 ? 121 LEU A HD23   1 
ATOM   1650 N  N      . ARG A 1 122 ? -16.355 -22.817 -1.922  1.00 25.70 ? 122 ARG A N      1 
ATOM   1651 C  CA     . ARG A 1 122 ? -17.453 -22.615 -2.868  1.00 28.06 ? 122 ARG A CA     1 
ATOM   1652 C  C      . ARG A 1 122 ? -17.305 -23.531 -4.083  1.00 27.22 ? 122 ARG A C      1 
ATOM   1653 O  O      . ARG A 1 122 ? -18.274 -24.144 -4.522  1.00 30.73 ? 122 ARG A O      1 
ATOM   1654 C  CB     . ARG A 1 122 ? -17.514 -21.154 -3.319  1.00 32.09 ? 122 ARG A CB     1 
ATOM   1655 C  CG     . ARG A 1 122 ? -17.686 -20.156 -2.186  1.00 41.10 ? 122 ARG A CG     1 
ATOM   1656 C  CD     . ARG A 1 122 ? -19.072 -20.234 -1.563  1.00 46.39 ? 122 ARG A CD     1 
ATOM   1657 N  NE     . ARG A 1 122 ? -20.119 -19.807 -2.488  1.00 50.93 ? 122 ARG A NE     1 
ATOM   1658 C  CZ     . ARG A 1 122 ? -21.403 -19.695 -2.163  1.00 51.22 ? 122 ARG A CZ     1 
ATOM   1659 N  NH1    . ARG A 1 122 ? -21.803 -19.981 -0.932  1.00 49.25 ? 122 ARG A NH1    1 
ATOM   1660 N  NH2    . ARG A 1 122 ? -22.287 -19.301 -3.069  1.00 49.37 ? 122 ARG A NH2    1 
ATOM   1661 H  H      . ARG A 1 122 ? -15.891 -22.110 -1.767  1.00 30.83 ? 122 ARG A H      1 
ATOM   1662 H  HA     . ARG A 1 122 ? -18.291 -22.830 -2.430  1.00 33.67 ? 122 ARG A HA     1 
ATOM   1663 N  N      . VAL A 1 123 ? -16.092 -23.627 -4.620  1.00 28.32 ? 123 VAL A N      1 
ATOM   1664 C  CA     . VAL A 1 123 ? -15.852 -24.472 -5.788  1.00 27.34 ? 123 VAL A CA     1 
ATOM   1665 C  C      . VAL A 1 123 ? -16.083 -25.942 -5.441  0.93 29.44 ? 123 VAL A C      1 
ATOM   1666 O  O      . VAL A 1 123 ? -16.682 -26.687 -6.218  0.99 33.33 ? 123 VAL A O      1 
ATOM   1667 C  CB     . VAL A 1 123 ? -14.423 -24.294 -6.339  0.90 29.52 ? 123 VAL A CB     1 
ATOM   1668 C  CG1    . VAL A 1 123 ? -14.157 -25.268 -7.485  1.00 28.85 ? 123 VAL A CG1    1 
ATOM   1669 C  CG2    . VAL A 1 123 ? -14.209 -22.865 -6.810  0.89 30.94 ? 123 VAL A CG2    1 
ATOM   1670 H  H      . VAL A 1 123 ? -15.395 -23.216 -4.331  1.00 33.98 ? 123 VAL A H      1 
ATOM   1671 H  HA     . VAL A 1 123 ? -16.477 -24.228 -6.489  1.00 32.81 ? 123 VAL A HA     1 
ATOM   1672 H  HB     . VAL A 1 123 ? -13.784 -24.478 -5.633  0.90 35.43 ? 123 VAL A HB     1 
ATOM   1673 H  HG11   . VAL A 1 123 ? -13.254 -25.134 -7.811  1.00 34.62 ? 123 VAL A HG11   1 
ATOM   1674 H  HG12   . VAL A 1 123 ? -14.260 -26.176 -7.158  1.00 34.62 ? 123 VAL A HG12   1 
ATOM   1675 H  HG13   . VAL A 1 123 ? -14.794 -25.099 -8.197  1.00 34.62 ? 123 VAL A HG13   1 
ATOM   1676 H  HG21   . VAL A 1 123 ? -13.305 -22.777 -7.151  0.89 37.13 ? 123 VAL A HG21   1 
ATOM   1677 H  HG22   . VAL A 1 123 ? -14.849 -22.665 -7.511  0.89 37.13 ? 123 VAL A HG22   1 
ATOM   1678 H  HG23   . VAL A 1 123 ? -14.340 -22.264 -6.060  0.89 37.13 ? 123 VAL A HG23   1 
ATOM   1679 N  N      . ILE A 1 124 ? -15.604 -26.353 -4.273  1.00 28.12 ? 124 ILE A N      1 
ATOM   1680 C  CA     . ILE A 1 124 ? -15.760 -27.734 -3.829  1.00 28.98 ? 124 ILE A CA     1 
ATOM   1681 C  C      . ILE A 1 124 ? -17.235 -28.097 -3.683  0.83 30.57 ? 124 ILE A C      1 
ATOM   1682 O  O      . ILE A 1 124 ? -17.661 -29.175 -4.096  0.90 33.47 ? 124 ILE A O      1 
ATOM   1683 C  CB     . ILE A 1 124 ? -15.031 -27.981 -2.487  1.00 27.97 ? 124 ILE A CB     1 
ATOM   1684 C  CG1    . ILE A 1 124 ? -13.516 -27.915 -2.690  1.00 28.89 ? 124 ILE A CG1    1 
ATOM   1685 C  CG2    . ILE A 1 124 ? -15.402 -29.346 -1.902  0.85 30.45 ? 124 ILE A CG2    1 
ATOM   1686 C  CD1    . ILE A 1 124 ? -12.723 -27.807 -1.404  0.86 28.76 ? 124 ILE A CD1    1 
ATOM   1687 H  H      . ILE A 1 124 ? -15.182 -25.851 -3.716  0.93 33.75 ? 124 ILE A H      1 
ATOM   1688 H  HA     . ILE A 1 124 ? -15.371 -28.324 -4.494  1.00 34.77 ? 124 ILE A HA     1 
ATOM   1689 H  HB     . ILE A 1 124 ? -15.292 -27.290 -1.858  1.00 33.56 ? 124 ILE A HB     1 
ATOM   1690 H  HG12   . ILE A 1 124 ? -13.228 -28.720 -3.148  1.00 34.67 ? 124 ILE A HG12   1 
ATOM   1691 H  HG13   . ILE A 1 124 ? -13.309 -27.138 -3.232  1.00 34.67 ? 124 ILE A HG13   1 
ATOM   1692 H  HG21   . ILE A 1 124 ? -14.930 -29.468 -1.063  0.85 36.54 ? 124 ILE A HG21   1 
ATOM   1693 H  HG22   . ILE A 1 124 ? -16.360 -29.373 -1.750  0.85 36.54 ? 124 ILE A HG22   1 
ATOM   1694 H  HG23   . ILE A 1 124 ? -15.146 -30.038 -2.530  0.85 36.54 ? 124 ILE A HG23   1 
ATOM   1695 H  HD11   . ILE A 1 124 ? -11.778 -27.770 -1.619  0.86 34.52 ? 124 ILE A HD11   1 
ATOM   1696 H  HD12   . ILE A 1 124 ? -12.988 -26.999 -0.937  0.86 34.52 ? 124 ILE A HD12   1 
ATOM   1697 H  HD13   . ILE A 1 124 ? -12.908 -28.583 -0.853  0.86 34.52 ? 124 ILE A HD13   1 
ATOM   1698 N  N      . GLU A 1 125 ? -18.015 -27.191 -3.104  0.83 30.02 ? 125 GLU A N      1 
ATOM   1699 C  CA     . GLU A 1 125 ? -19.403 -27.497 -2.772  1.00 33.46 ? 125 GLU A CA     1 
ATOM   1700 C  C      . GLU A 1 125 ? -20.378 -27.251 -3.928  0.97 36.28 ? 125 GLU A C      1 
ATOM   1701 O  O      . GLU A 1 125 ? -21.416 -27.906 -3.992  0.73 38.17 ? 125 GLU A O      1 
ATOM   1702 C  CB     . GLU A 1 125 ? -19.832 -26.694 -1.540  0.98 34.68 ? 125 GLU A CB     1 
ATOM   1703 C  CG     . GLU A 1 125 ? -19.052 -27.075 -0.282  0.90 31.62 ? 125 GLU A CG     1 
ATOM   1704 C  CD     . GLU A 1 125 ? -19.798 -26.777 1.009   0.38 30.33 ? 125 GLU A CD     1 
ATOM   1705 O  OE1    . GLU A 1 125 ? -20.328 -25.655 1.155   0.90 29.09 ? 125 GLU A OE1    1 
ATOM   1706 O  OE2    . GLU A 1 125 ? -19.850 -27.668 1.885   1.00 31.10 ? 125 GLU A OE2    1 
ATOM   1707 H  H      . GLU A 1 125 ? -17.766 -26.396 -2.892  0.83 36.03 ? 125 GLU A H      1 
ATOM   1708 H  HA     . GLU A 1 125 ? -19.461 -28.437 -2.541  1.00 40.15 ? 125 GLU A HA     1 
ATOM   1709 H  HB2    . GLU A 1 125 ? -19.683 -25.750 -1.710  0.98 41.62 ? 125 GLU A HB2    1 
ATOM   1710 H  HB3    . GLU A 1 125 ? -20.773 -26.855 -1.370  0.98 41.62 ? 125 GLU A HB3    1 
ATOM   1711 H  HG2    . GLU A 1 125 ? -18.867 -28.027 -0.305  0.90 37.94 ? 125 GLU A HG2    1 
ATOM   1712 H  HG3    . GLU A 1 125 ? -18.220 -26.577 -0.266  0.90 37.94 ? 125 GLU A HG3    1 
ATOM   1713 N  N      . TYR A 1 126 ? -20.052 -26.332 -4.839  0.94 38.12 ? 126 TYR A N      1 
ATOM   1714 C  CA     . TYR A 1 126 ? -20.953 -26.014 -5.957  1.00 37.18 ? 126 TYR A CA     1 
ATOM   1715 C  C      . TYR A 1 126 ? -20.442 -26.496 -7.316  0.77 37.14 ? 126 TYR A C      1 
ATOM   1716 O  O      . TYR A 1 126 ? -21.213 -26.589 -8.273  0.77 37.64 ? 126 TYR A O      1 
ATOM   1717 C  CB     . TYR A 1 126 ? -21.212 -24.508 -6.011  0.74 39.15 ? 126 TYR A CB     1 
ATOM   1718 C  CG     . TYR A 1 126 ? -22.078 -24.022 -4.874  0.68 42.69 ? 126 TYR A CG     1 
ATOM   1719 C  CD1    . TYR A 1 126 ? -21.514 -23.503 -3.716  0.75 46.21 ? 126 TYR A CD1    1 
ATOM   1720 C  CD2    . TYR A 1 126 ? -23.462 -24.100 -4.950  0.57 46.34 ? 126 TYR A CD2    1 
ATOM   1721 C  CE1    . TYR A 1 126 ? -22.303 -23.066 -2.672  0.43 48.39 ? 126 TYR A CE1    1 
ATOM   1722 C  CE2    . TYR A 1 126 ? -24.261 -23.664 -3.911  0.91 49.63 ? 126 TYR A CE2    1 
ATOM   1723 C  CZ     . TYR A 1 126 ? -23.676 -23.149 -2.774  0.68 50.73 ? 126 TYR A CZ     1 
ATOM   1724 O  OH     . TYR A 1 126 ? -24.467 -22.715 -1.735  0.76 52.84 ? 126 TYR A OH     1 
ATOM   1725 H  H      . TYR A 1 126 ? -19.321 -25.880 -4.835  0.94 45.75 ? 126 TYR A H      1 
ATOM   1726 H  HA     . TYR A 1 126 ? -21.805 -26.450 -5.796  1.00 44.62 ? 126 TYR A HA     1 
ATOM   1727 H  HB2    . TYR A 1 126 ? -20.363 -24.040 -5.963  0.74 46.99 ? 126 TYR A HB2    1 
ATOM   1728 H  HB3    . TYR A 1 126 ? -21.662 -24.295 -6.843  0.74 46.99 ? 126 TYR A HB3    1 
ATOM   1729 H  HD1    . TYR A 1 126 ? -20.588 -23.446 -3.644  0.75 55.45 ? 126 TYR A HD1    1 
ATOM   1730 H  HD2    . TYR A 1 126 ? -23.859 -24.447 -5.717  0.57 55.61 ? 126 TYR A HD2    1 
ATOM   1731 H  HE1    . TYR A 1 126 ? -21.911 -22.718 -1.903  0.43 58.06 ? 126 TYR A HE1    1 
ATOM   1732 H  HE2    . TYR A 1 126 ? -25.187 -23.720 -3.977  0.91 59.56 ? 126 TYR A HE2    1 
ATOM   1733 H  HH     . TYR A 1 126 ? -25.277 -22.822 -1.928  0.76 63.40 ? 126 TYR A HH     1 
ATOM   1734 N  N      . GLY A 1 127 ? -19.151 -26.792 -7.408  0.99 36.46 ? 127 GLY A N      1 
ATOM   1735 C  CA     . GLY A 1 127 ? -18.602 -27.395 -8.609  1.00 36.15 ? 127 GLY A CA     1 
ATOM   1736 C  C      . GLY A 1 127 ? -18.519 -26.459 -9.801  0.64 35.35 ? 127 GLY A C      1 
ATOM   1737 O  O      . GLY A 1 127 ? -18.497 -26.912 -10.947 1.00 35.10 ? 127 GLY A O      1 
ATOM   1738 H  H      . GLY A 1 127 ? -18.574 -26.652 -6.786  0.77 43.75 ? 127 GLY A H      1 
ATOM   1739 H  HA2    . GLY A 1 127 ? -17.707 -27.719 -8.419  1.00 43.38 ? 127 GLY A HA2    1 
ATOM   1740 H  HA3    . GLY A 1 127 ? -19.150 -28.154 -8.861  1.00 43.38 ? 127 GLY A HA3    1 
ATOM   1741 N  N      . GLU A 1 128 ? -18.474 -25.155 -9.545  0.81 36.60 ? 128 GLU A N      1 
ATOM   1742 C  CA     . GLU A 1 128 ? -18.308 -24.186 -10.622 1.00 37.67 ? 128 GLU A CA     1 
ATOM   1743 C  C      . GLU A 1 128 ? -17.467 -22.995 -10.197 1.00 34.51 ? 128 GLU A C      1 
ATOM   1744 O  O      . GLU A 1 128 ? -17.404 -22.652 -9.016  1.00 34.11 ? 128 GLU A O      1 
ATOM   1745 C  CB     . GLU A 1 128 ? -19.668 -23.696 -11.124 1.00 43.29 ? 128 GLU A CB     1 
ATOM   1746 C  CG     . GLU A 1 128 ? -20.529 -23.024 -10.068 0.97 47.79 ? 128 GLU A CG     1 
ATOM   1747 C  CD     . GLU A 1 128 ? -21.872 -22.574 -10.614 0.76 51.86 ? 128 GLU A CD     1 
ATOM   1748 O  OE1    . GLU A 1 128 ? -22.550 -23.388 -11.276 0.92 54.61 ? 128 GLU A OE1    1 
ATOM   1749 O  OE2    . GLU A 1 128 ? -22.246 -21.404 -10.390 0.88 53.24 ? 128 GLU A OE2    1 
ATOM   1750 H  H      . GLU A 1 128 ? -18.537 -24.808 -8.760  0.64 43.92 ? 128 GLU A H      1 
ATOM   1751 H  HA     . GLU A 1 128 ? -17.856 -24.619 -11.363 1.00 45.20 ? 128 GLU A HA     1 
ATOM   1752 H  HB2    . GLU A 1 128 ? -19.522 -23.055 -11.837 1.00 51.94 ? 128 GLU A HB2    1 
ATOM   1753 H  HB3    . GLU A 1 128 ? -20.163 -24.457 -11.467 1.00 51.94 ? 128 GLU A HB3    1 
ATOM   1754 H  HG2    . GLU A 1 128 ? -20.693 -23.650 -9.346  0.97 57.35 ? 128 GLU A HG2    1 
ATOM   1755 H  HG3    . GLU A 1 128 ? -20.064 -22.242 -9.731  0.97 57.35 ? 128 GLU A HG3    1 
ATOM   1756 N  N      . LEU A 1 129 ? -16.822 -22.374 -11.180 0.89 37.37 ? 129 LEU A N      1 
ATOM   1757 C  CA     . LEU A 1 129 ? -16.035 -21.171 -10.961 0.73 38.31 ? 129 LEU A CA     1 
ATOM   1758 C  C      . LEU A 1 129 ? -16.897 -19.944 -11.228 1.00 40.71 ? 129 LEU A C      1 
ATOM   1759 O  O      . LEU A 1 129 ? -17.505 -19.830 -12.292 0.85 43.09 ? 129 LEU A O      1 
ATOM   1760 C  CB     . LEU A 1 129 ? -14.801 -21.166 -11.868 0.92 38.86 ? 129 LEU A CB     1 
ATOM   1761 C  CG     . LEU A 1 129 ? -13.831 -22.327 -11.644 1.00 36.06 ? 129 LEU A CG     1 
ATOM   1762 C  CD1    . LEU A 1 129 ? -12.784 -22.363 -12.743 0.57 36.44 ? 129 LEU A CD1    1 
ATOM   1763 C  CD2    . LEU A 1 129 ? -13.169 -22.222 -10.279 1.00 38.08 ? 129 LEU A CD2    1 
ATOM   1764 H  H      . LEU A 1 129 ? -16.827 -22.638 -11.999 0.73 44.84 ? 129 LEU A H      1 
ATOM   1765 H  HA     . LEU A 1 129 ? -15.737 -21.142 -10.039 0.73 45.97 ? 129 LEU A HA     1 
ATOM   1766 H  HB2    . LEU A 1 129 ? -15.097 -21.206 -12.791 0.92 46.64 ? 129 LEU A HB2    1 
ATOM   1767 H  HB3    . LEU A 1 129 ? -14.312 -20.342 -11.719 0.92 46.64 ? 129 LEU A HB3    1 
ATOM   1768 H  HG     . LEU A 1 129 ? -14.325 -23.161 -11.674 1.00 43.27 ? 129 LEU A HG     1 
ATOM   1769 H  HD11   . LEU A 1 129 ? -12.181 -23.105 -12.580 0.57 43.73 ? 129 LEU A HD11   1 
ATOM   1770 H  HD12   . LEU A 1 129 ? -13.227 -22.478 -13.598 0.57 43.73 ? 129 LEU A HD12   1 
ATOM   1771 H  HD13   . LEU A 1 129 ? -12.290 -21.528 -12.736 0.57 43.73 ? 129 LEU A HD13   1 
ATOM   1772 H  HD21   . LEU A 1 129 ? -12.561 -22.969 -10.166 1.00 45.70 ? 129 LEU A HD21   1 
ATOM   1773 H  HD22   . LEU A 1 129 ? -12.679 -21.386 -10.230 1.00 45.70 ? 129 LEU A HD22   1 
ATOM   1774 H  HD23   . LEU A 1 129 ? -13.854 -22.245 -9.593  1.00 45.70 ? 129 LEU A HD23   1 
ATOM   1775 N  N      . GLU A 1 130 ? -16.960 -19.039 -10.255 1.00 42.89 ? 130 GLU A N      1 
ATOM   1776 C  CA     . GLU A 1 130 ? -17.743 -17.815 -10.392 0.83 47.39 ? 130 GLU A CA     1 
ATOM   1777 C  C      . GLU A 1 130 ? -17.220 -16.974 -11.547 0.87 46.76 ? 130 GLU A C      1 
ATOM   1778 O  O      . GLU A 1 130 ? -16.014 -16.889 -11.763 0.64 46.64 ? 130 GLU A O      1 
ATOM   1779 C  CB     . GLU A 1 130 ? -17.709 -16.999 -9.098  1.00 49.92 ? 130 GLU A CB     1 
ATOM   1780 C  CG     . GLU A 1 130 ? -18.398 -15.643 -9.192  0.95 52.98 ? 130 GLU A CG     1 
ATOM   1781 C  CD     . GLU A 1 130 ? -19.907 -15.746 -9.099  0.54 56.57 ? 130 GLU A CD     1 
ATOM   1782 O  OE1    . GLU A 1 130 ? -20.493 -16.601 -9.795  0.50 57.82 ? 130 GLU A OE1    1 
ATOM   1783 O  OE2    . GLU A 1 130 ? -20.507 -14.975 -8.321  0.89 59.49 ? 130 GLU A OE2    1 
ATOM   1784 N  N      . ARG A 1 131 ? -18.135 -16.354 -12.284 0.67 47.00 ? 131 ARG A N      1 
ATOM   1785 C  CA     . ARG A 1 131 ? -17.763 -15.512 -13.415 0.95 47.99 ? 131 ARG A CA     1 
ATOM   1786 C  C      . ARG A 1 131 ? -18.874 -14.526 -13.762 0.54 50.23 ? 131 ARG A C      1 
ATOM   1787 O  O      . ARG A 1 131 ? -20.033 -14.906 -13.928 1.00 54.17 ? 131 ARG A O      1 
ATOM   1788 C  CB     . ARG A 1 131 ? -17.421 -16.372 -14.635 1.00 48.75 ? 131 ARG A CB     1 
ATOM   1789 N  N      . VAL A 1 132 ? -18.507 -13.253 -13.857 1.00 50.05 ? 132 VAL A N      1 
ATOM   1790 C  CA     . VAL A 1 132 ? -19.436 -12.209 -14.262 0.47 51.82 ? 132 VAL A CA     1 
ATOM   1791 C  C      . VAL A 1 132 ? -18.817 -11.455 -15.439 0.53 50.16 ? 132 VAL A C      1 
ATOM   1792 O  O      . VAL A 1 132 ? -17.925 -11.978 -16.105 0.72 50.06 ? 132 VAL A O      1 
ATOM   1793 C  CB     . VAL A 1 132 ? -19.760 -11.252 -13.093 0.65 54.10 ? 132 VAL A CB     1 
ATOM   1794 C  CG1    . VAL A 1 132 ? -18.561 -10.371 -12.770 0.72 53.28 ? 132 VAL A CG1    1 
ATOM   1795 C  CG2    . VAL A 1 132 ? -20.995 -10.415 -13.403 0.91 54.90 ? 132 VAL A CG2    1 
ATOM   1796 N  N      . GLY A 1 133 ? -19.284 -10.240 -15.704 0.58 49.71 ? 133 GLY A N      1 
ATOM   1797 C  CA     . GLY A 1 133 ? -18.770 -9.467  -16.819 0.71 45.61 ? 133 GLY A CA     1 
ATOM   1798 C  C      . GLY A 1 133 ? -19.364 -9.905  -18.143 0.59 46.72 ? 133 GLY A C      1 
ATOM   1799 O  O      . GLY A 1 133 ? -19.055 -9.333  -19.189 0.71 45.99 ? 133 GLY A O      1 
ATOM   1800 N  N      . GLY A 1 134 ? -20.216 -10.926 -18.095 1.00 46.88 ? 134 GLY A N      1 
ATOM   1801 C  CA     . GLY A 1 134 ? -20.915 -11.408 -19.273 0.94 43.72 ? 134 GLY A CA     1 
ATOM   1802 C  C      . GLY A 1 134 ? -20.784 -12.903 -19.468 0.81 41.18 ? 134 GLY A C      1 
ATOM   1803 O  O      . GLY A 1 134 ? -21.650 -13.528 -20.081 1.00 37.66 ? 134 GLY A O      1 
ATOM   1804 H  H      . GLY A 1 134 ? -20.406 -11.361 -17.378 0.59 56.26 ? 134 GLY A H      1 
ATOM   1805 H  HA2    . GLY A 1 134 ? -21.857 -11.191 -19.198 0.94 52.46 ? 134 GLY A HA2    1 
ATOM   1806 H  HA3    . GLY A 1 134 ? -20.560 -10.965 -20.060 0.94 52.46 ? 134 GLY A HA3    1 
ATOM   1807 N  N      . SER A 1 135 ? -19.704 -13.477 -18.947 0.90 40.23 ? 135 SER A N      1 
ATOM   1808 C  CA     . SER A 1 135 ? -19.429 -14.899 -19.120 0.78 40.19 ? 135 SER A CA     1 
ATOM   1809 C  C      . SER A 1 135 ? -20.236 -15.764 -18.156 0.71 40.86 ? 135 SER A C      1 
ATOM   1810 O  O      . SER A 1 135 ? -20.405 -15.419 -16.986 0.71 40.13 ? 135 SER A O      1 
ATOM   1811 C  CB     . SER A 1 135 ? -17.937 -15.178 -18.932 0.81 41.83 ? 135 SER A CB     1 
ATOM   1812 O  OG     . SER A 1 135 ? -17.149 -14.308 -19.724 0.37 41.75 ? 135 SER A OG     1 
ATOM   1813 N  N      . GLN A 1 136 ? -20.731 -16.890 -18.656 0.91 40.63 ? 136 GLN A N      1 
ATOM   1814 C  CA     . GLN A 1 136 ? -21.442 -17.846 -17.821 0.76 43.18 ? 136 GLN A CA     1 
ATOM   1815 C  C      . GLN A 1 136 ? -20.451 -18.540 -16.897 0.52 39.37 ? 136 GLN A C      1 
ATOM   1816 O  O      . GLN A 1 136 ? -19.274 -18.655 -17.238 1.00 38.73 ? 136 GLN A O      1 
ATOM   1817 C  CB     . GLN A 1 136 ? -22.178 -18.874 -18.680 0.86 46.93 ? 136 GLN A CB     1 
ATOM   1818 C  CG     . GLN A 1 136 ? -23.023 -18.265 -19.790 0.76 50.88 ? 136 GLN A CG     1 
ATOM   1819 C  CD     . GLN A 1 136 ? -24.147 -17.397 -19.263 0.79 53.70 ? 136 GLN A CD     1 
ATOM   1820 O  OE1    . GLN A 1 136 ? -24.497 -17.463 -18.085 0.79 53.89 ? 136 GLN A OE1    1 
ATOM   1821 N  NE2    . GLN A 1 136 ? -24.718 -16.574 -20.136 0.89 52.94 ? 136 GLN A NE2    1 
ATOM   1822 H  H      . GLN A 1 136 ? -20.667 -17.125 -19.481 0.71 48.76 ? 136 GLN A H      1 
ATOM   1823 H  HA     . GLN A 1 136 ? -22.094 -17.377 -17.276 0.76 51.81 ? 136 GLN A HA     1 
ATOM   1824 H  HB2    . GLN A 1 136 ? -21.525 -19.459 -19.093 0.86 56.32 ? 136 GLN A HB2    1 
ATOM   1825 H  HB3    . GLN A 1 136 ? -22.768 -19.391 -18.110 0.86 56.32 ? 136 GLN A HB3    1 
ATOM   1826 H  HG2    . GLN A 1 136 ? -22.457 -17.713 -20.352 0.76 61.05 ? 136 GLN A HG2    1 
ATOM   1827 H  HG3    . GLN A 1 136 ? -23.417 -18.979 -20.315 0.76 61.05 ? 136 GLN A HG3    1 
ATOM   1828 H  HE21   . GLN A 1 136 ? -24.444 -16.554 -20.951 0.79 63.53 ? 136 GLN A HE21   1 
ATOM   1829 H  HE22   . GLN A 1 136 ? -25.361 -16.060 -19.886 0.79 63.53 ? 136 GLN A HE22   1 
ATOM   1830 N  N      . PRO A 1 137 ? -20.917 -19.000 -15.720 1.00 39.85 ? 137 PRO A N      1 
ATOM   1831 C  CA     . PRO A 1 137 ? -20.003 -19.703 -14.812 1.00 39.10 ? 137 PRO A CA     1 
ATOM   1832 C  C      . PRO A 1 137 ? -19.417 -20.955 -15.450 1.00 39.86 ? 137 PRO A C      1 
ATOM   1833 O  O      . PRO A 1 137 ? -20.051 -21.543 -16.328 1.00 40.66 ? 137 PRO A O      1 
ATOM   1834 C  CB     . PRO A 1 137 ? -20.891 -20.071 -13.616 1.00 38.28 ? 137 PRO A CB     1 
ATOM   1835 C  CG     . PRO A 1 137 ? -22.068 -19.170 -13.702 1.00 41.26 ? 137 PRO A CG     1 
ATOM   1836 C  CD     . PRO A 1 137 ? -22.272 -18.876 -15.154 1.00 43.38 ? 137 PRO A CD     1 
ATOM   1837 H  HA     . PRO A 1 137 ? -19.288 -19.116 -14.521 1.00 46.92 ? 137 PRO A HA     1 
ATOM   1838 H  HB2    . PRO A 1 137 ? -21.165 -20.999 -13.687 1.00 45.93 ? 137 PRO A HB2    1 
ATOM   1839 H  HB3    . PRO A 1 137 ? -20.405 -19.920 -12.790 1.00 45.93 ? 137 PRO A HB3    1 
ATOM   1840 H  HG2    . PRO A 1 137 ? -22.846 -19.619 -13.335 1.00 49.51 ? 137 PRO A HG2    1 
ATOM   1841 H  HG3    . PRO A 1 137 ? -21.886 -18.353 -13.213 1.00 49.51 ? 137 PRO A HG3    1 
ATOM   1842 H  HD2    . PRO A 1 137 ? -22.866 -19.531 -15.552 1.00 52.05 ? 137 PRO A HD2    1 
ATOM   1843 H  HD3    . PRO A 1 137 ? -22.607 -17.973 -15.273 1.00 52.05 ? 137 PRO A HD3    1 
ATOM   1844 N  N      . LEU A 1 138 ? -18.225 -21.345 -15.007 1.00 39.73 ? 138 LEU A N      1 
ATOM   1845 C  CA     . LEU A 1 138 ? -17.539 -22.516 -15.535 1.00 40.87 ? 138 LEU A CA     1 
ATOM   1846 C  C      . LEU A 1 138 ? -17.717 -23.707 -14.605 1.00 38.99 ? 138 LEU A C      1 
ATOM   1847 O  O      . LEU A 1 138 ? -17.266 -23.677 -13.461 1.00 39.06 ? 138 LEU A O      1 
ATOM   1848 C  CB     . LEU A 1 138 ? -16.048 -22.231 -15.711 1.00 46.09 ? 138 LEU A CB     1 
ATOM   1849 C  CG     . LEU A 1 138 ? -15.669 -20.901 -16.359 1.00 53.55 ? 138 LEU A CG     1 
ATOM   1850 C  CD1    . LEU A 1 138 ? -14.218 -20.604 -16.071 1.00 56.66 ? 138 LEU A CD1    1 
ATOM   1851 C  CD2    . LEU A 1 138 ? -15.919 -20.920 -17.856 1.00 57.89 ? 138 LEU A CD2    1 
ATOM   1852 H  H      . LEU A 1 138 ? -17.786 -20.939 -14.389 1.00 47.68 ? 138 LEU A H      1 
ATOM   1853 H  HA     . LEU A 1 138 ? -17.912 -22.745 -16.401 1.00 49.05 ? 138 LEU A HA     1 
ATOM   1854 H  HB2    . LEU A 1 138 ? -15.631 -22.251 -14.835 1.00 55.30 ? 138 LEU A HB2    1 
ATOM   1855 H  HB3    . LEU A 1 138 ? -15.669 -22.935 -16.261 1.00 55.30 ? 138 LEU A HB3    1 
ATOM   1856 H  HG     . LEU A 1 138 ? -16.206 -20.192 -15.971 1.00 64.25 ? 138 LEU A HG     1 
ATOM   1857 H  HD11   . LEU A 1 138 ? -13.981 -19.759 -16.485 1.00 68.00 ? 138 LEU A HD11   1 
ATOM   1858 H  HD12   . LEU A 1 138 ? -14.091 -20.551 -15.111 1.00 68.00 ? 138 LEU A HD12   1 
ATOM   1859 H  HD13   . LEU A 1 138 ? -13.672 -21.317 -16.438 1.00 68.00 ? 138 LEU A HD13   1 
ATOM   1860 H  HD21   . LEU A 1 138 ? -15.666 -20.061 -18.229 1.00 69.47 ? 138 LEU A HD21   1 
ATOM   1861 H  HD22   . LEU A 1 138 ? -15.385 -21.624 -18.256 1.00 69.47 ? 138 LEU A HD22   1 
ATOM   1862 H  HD23   . LEU A 1 138 ? -16.861 -21.087 -18.017 1.00 69.47 ? 138 LEU A HD23   1 
ATOM   1863 N  N      . GLN A 1 139 ? -18.375 -24.752 -15.091 1.00 37.52 ? 139 GLN A N      1 
ATOM   1864 C  CA     . GLN A 1 139 ? -18.476 -25.991 -14.335 1.00 36.06 ? 139 GLN A CA     1 
ATOM   1865 C  C      . GLN A 1 139 ? -17.154 -26.745 -14.439 1.00 35.76 ? 139 GLN A C      1 
ATOM   1866 O  O      . GLN A 1 139 ? -16.600 -26.878 -15.533 1.00 38.82 ? 139 GLN A O      1 
ATOM   1867 C  CB     . GLN A 1 139 ? -19.633 -26.845 -14.853 1.00 37.57 ? 139 GLN A CB     1 
ATOM   1868 H  H      . GLN A 1 139 ? -18.771 -24.769 -15.854 1.00 45.03 ? 139 GLN A H      1 
ATOM   1869 H  HA     . GLN A 1 139 ? -18.639 -25.787 -13.401 1.00 43.28 ? 139 GLN A HA     1 
ATOM   1870 N  N      . VAL A 1 140 ? -16.639 -27.214 -13.303 1.00 29.49 ? 140 VAL A N      1 
ATOM   1871 C  CA     . VAL A 1 140 ? -15.389 -27.966 -13.290 1.00 30.28 ? 140 VAL A CA     1 
ATOM   1872 C  C      . VAL A 1 140 ? -15.525 -29.280 -12.534 1.00 26.26 ? 140 VAL A C      1 
ATOM   1873 O  O      . VAL A 1 140 ? -16.280 -29.392 -11.568 1.00 27.78 ? 140 VAL A O      1 
ATOM   1874 C  CB     . VAL A 1 140 ? -14.232 -27.158 -12.665 1.00 34.93 ? 140 VAL A CB     1 
ATOM   1875 C  CG1    . VAL A 1 140 ? -13.873 -25.973 -13.549 1.00 38.61 ? 140 VAL A CG1    1 
ATOM   1876 C  CG2    . VAL A 1 140 ? -14.577 -26.704 -11.251 1.00 33.39 ? 140 VAL A CG2    1 
ATOM   1877 H  H      . VAL A 1 140 ? -16.995 -27.109 -12.528 1.00 35.38 ? 140 VAL A H      1 
ATOM   1878 H  HA     . VAL A 1 140 ? -15.143 -28.175 -14.205 1.00 36.34 ? 140 VAL A HA     1 
ATOM   1879 H  HB     . VAL A 1 140 ? -13.450 -27.729 -12.608 1.00 41.91 ? 140 VAL A HB     1 
ATOM   1880 H  HG11   . VAL A 1 140 ? -13.145 -25.481 -13.137 1.00 46.34 ? 140 VAL A HG11   1 
ATOM   1881 H  HG12   . VAL A 1 140 ? -13.600 -26.300 -14.420 1.00 46.34 ? 140 VAL A HG12   1 
ATOM   1882 H  HG13   . VAL A 1 140 ? -14.650 -25.400 -13.639 1.00 46.34 ? 140 VAL A HG13   1 
ATOM   1883 H  HG21   . VAL A 1 140 ? -13.830 -26.201 -10.891 1.00 40.07 ? 140 VAL A HG21   1 
ATOM   1884 H  HG22   . VAL A 1 140 ? -15.368 -26.145 -11.284 1.00 40.07 ? 140 VAL A HG22   1 
ATOM   1885 H  HG23   . VAL A 1 140 ? -14.746 -27.486 -10.702 1.00 40.07 ? 140 VAL A HG23   1 
ATOM   1886 N  N      . ASN A 1 141 ? -14.768 -30.266 -12.999 1.00 28.95 ? 141 ASN A N      1 
ATOM   1887 C  CA     . ASN A 1 141 ? -14.759 -31.602 -12.430 1.00 28.84 ? 141 ASN A CA     1 
ATOM   1888 C  C      . ASN A 1 141 ? -13.327 -31.970 -12.070 1.00 24.81 ? 141 ASN A C      1 
ATOM   1889 O  O      . ASN A 1 141 ? -12.577 -32.483 -12.902 1.00 26.55 ? 141 ASN A O      1 
ATOM   1890 C  CB     . ASN A 1 141 ? -15.360 -32.600 -13.422 1.00 35.64 ? 141 ASN A CB     1 
ATOM   1891 C  CG     . ASN A 1 141 ? -15.243 -34.037 -12.960 1.00 41.22 ? 141 ASN A CG     1 
ATOM   1892 O  OD1    . ASN A 1 141 ? -15.077 -34.312 -11.772 1.00 40.86 ? 141 ASN A OD1    1 
ATOM   1893 N  ND2    . ASN A 1 141 ? -15.338 -34.966 -13.904 1.00 49.53 ? 141 ASN A ND2    1 
ATOM   1894 H  H      . ASN A 1 141 ? -14.233 -30.179 -13.666 1.00 34.74 ? 141 ASN A H      1 
ATOM   1895 H  HA     . ASN A 1 141 ? -15.293 -31.614 -11.620 1.00 34.60 ? 141 ASN A HA     1 
ATOM   1896 H  HB2    . ASN A 1 141 ? -16.302 -32.399 -13.540 1.00 42.77 ? 141 ASN A HB2    1 
ATOM   1897 H  HB3    . ASN A 1 141 ? -14.896 -32.520 -14.270 1.00 42.77 ? 141 ASN A HB3    1 
ATOM   1898 H  HD21   . ASN A 1 141 ? -15.278 -35.798 -13.696 1.00 59.44 ? 141 ASN A HD21   1 
ATOM   1899 H  HD22   . ASN A 1 141 ? -15.459 -34.736 -14.724 1.00 59.44 ? 141 ASN A HD22   1 
ATOM   1900 N  N      . VAL A 1 142 ? -12.963 -31.698 -10.821 1.00 24.85 ? 142 VAL A N      1 
ATOM   1901 C  CA     . VAL A 1 142 ? -11.578 -31.783 -10.373 1.00 20.41 ? 142 VAL A CA     1 
ATOM   1902 C  C      . VAL A 1 142 ? -11.472 -32.549 -9.065  1.00 19.67 ? 142 VAL A C      1 
ATOM   1903 O  O      . VAL A 1 142 ? -12.217 -32.286 -8.128  1.00 21.54 ? 142 VAL A O      1 
ATOM   1904 C  CB     . VAL A 1 142 ? -10.972 -30.371 -10.185 1.00 22.86 ? 142 VAL A CB     1 
ATOM   1905 C  CG1    . VAL A 1 142 ? -9.579  -30.440 -9.558  1.00 23.71 ? 142 VAL A CG1    1 
ATOM   1906 C  CG2    . VAL A 1 142 ? -10.926 -29.636 -11.517 1.00 24.53 ? 142 VAL A CG2    1 
ATOM   1907 H  H      . VAL A 1 142 ? -13.511 -31.457 -10.203 1.00 29.82 ? 142 VAL A H      1 
ATOM   1908 H  HA     . VAL A 1 142 ? -11.054 -32.251 -11.042 1.00 24.49 ? 142 VAL A HA     1 
ATOM   1909 H  HB     . VAL A 1 142 ? -11.542 -29.863 -9.586  1.00 27.44 ? 142 VAL A HB     1 
ATOM   1910 H  HG11   . VAL A 1 142 ? -9.234  -29.539 -9.457  1.00 28.45 ? 142 VAL A HG11   1 
ATOM   1911 H  HG12   . VAL A 1 142 ? -9.644  -30.869 -8.691  1.00 28.45 ? 142 VAL A HG12   1 
ATOM   1912 H  HG13   . VAL A 1 142 ? -8.997  -30.954 -10.139 1.00 28.45 ? 142 VAL A HG13   1 
ATOM   1913 H  HG21   . VAL A 1 142 ? -10.544 -28.755 -11.378 1.00 29.43 ? 142 VAL A HG21   1 
ATOM   1914 H  HG22   . VAL A 1 142 ? -10.377 -30.141 -12.137 1.00 29.43 ? 142 VAL A HG22   1 
ATOM   1915 H  HG23   . VAL A 1 142 ? -11.828 -29.554 -11.863 1.00 29.43 ? 142 VAL A HG23   1 
ATOM   1916 N  N      . ARG A 1 143 ? -10.541 -33.498 -9.016  1.00 20.37 ? 143 ARG A N      1 
ATOM   1917 C  CA     . ARG A 1 143 ? -10.212 -34.196 -7.781  1.00 19.09 ? 143 ARG A CA     1 
ATOM   1918 C  C      . ARG A 1 143 ? -9.133  -33.408 -7.056  1.00 20.14 ? 143 ARG A C      1 
ATOM   1919 O  O      . ARG A 1 143 ? -8.073  -33.149 -7.608  1.00 19.78 ? 143 ARG A O      1 
ATOM   1920 C  CB     . ARG A 1 143 ? -9.741  -35.622 -8.068  1.00 21.16 ? 143 ARG A CB     1 
ATOM   1921 C  CG     . ARG A 1 143 ? -9.809  -36.558 -6.865  1.00 20.70 ? 143 ARG A CG     1 
ATOM   1922 C  CD     . ARG A 1 143 ? -8.567  -36.521 -5.968  1.00 21.58 ? 143 ARG A CD     1 
ATOM   1923 N  NE     . ARG A 1 143 ? -8.796  -37.410 -4.832  1.00 21.15 ? 143 ARG A NE     1 
ATOM   1924 C  CZ     . ARG A 1 143 ? -8.605  -38.725 -4.854  1.00 21.38 ? 143 ARG A CZ     1 
ATOM   1925 N  NH1    . ARG A 1 143 ? -8.118  -39.317 -5.936  1.00 21.14 ? 143 ARG A NH1    1 
ATOM   1926 N  NH2    . ARG A 1 143 ? -8.883  -39.449 -3.781  1.00 20.89 ? 143 ARG A NH2    1 
ATOM   1927 H  H      . ARG A 1 143 ? -10.080 -33.757 -9.695  1.00 24.45 ? 143 ARG A H      1 
ATOM   1928 H  HA     . ARG A 1 143 ? -10.997 -34.239 -7.214  1.00 22.91 ? 143 ARG A HA     1 
ATOM   1929 H  HB2    . ARG A 1 143 ? -10.298 -35.999 -8.767  1.00 25.39 ? 143 ARG A HB2    1 
ATOM   1930 H  HB3    . ARG A 1 143 ? -8.818  -35.590 -8.366  1.00 25.39 ? 143 ARG A HB3    1 
ATOM   1931 H  HG2    . ARG A 1 143 ? -10.573 -36.310 -6.321  1.00 24.83 ? 143 ARG A HG2    1 
ATOM   1932 H  HG3    . ARG A 1 143 ? -9.915  -37.467 -7.184  1.00 24.83 ? 143 ARG A HG3    1 
ATOM   1933 H  HD2    . ARG A 1 143 ? -7.794  -36.836 -6.461  1.00 25.89 ? 143 ARG A HD2    1 
ATOM   1934 H  HD3    . ARG A 1 143 ? -8.425  -35.620 -5.638  1.00 25.89 ? 143 ARG A HD3    1 
ATOM   1935 H  HE     . ARG A 1 143 ? -9.073  -37.058 -4.097  1.00 25.38 ? 143 ARG A HE     1 
ATOM   1936 H  HH11   . ARG A 1 143 ? -7.945  -38.853 -6.640  1.00 25.36 ? 143 ARG A HH11   1 
ATOM   1937 H  HH12   . ARG A 1 143 ? -7.989  -40.167 -5.940  1.00 25.36 ? 143 ARG A HH12   1 
ATOM   1938 H  HH21   . ARG A 1 143 ? -9.186  -39.068 -3.072  1.00 25.07 ? 143 ARG A HH21   1 
ATOM   1939 H  HH22   . ARG A 1 143 ? -8.738  -40.297 -3.786  1.00 25.07 ? 143 ARG A HH22   1 
ATOM   1940 N  N      . LEU A 1 144 ? -9.411  -33.034 -5.814  1.00 20.49 ? 144 LEU A N      1 
ATOM   1941 C  CA     . LEU A 1 144 ? -8.522  -32.164 -5.056  1.00 18.21 ? 144 LEU A CA     1 
ATOM   1942 C  C      . LEU A 1 144 ? -7.612  -32.940 -4.104  1.00 18.09 ? 144 LEU A C      1 
ATOM   1943 O  O      . LEU A 1 144 ? -8.056  -33.834 -3.384  1.00 18.43 ? 144 LEU A O      1 
ATOM   1944 C  CB     . LEU A 1 144 ? -9.350  -31.148 -4.269  1.00 19.69 ? 144 LEU A CB     1 
ATOM   1945 C  CG     . LEU A 1 144 ? -8.627  -29.994 -3.583  1.00 25.65 ? 144 LEU A CG     1 
ATOM   1946 C  CD1    . LEU A 1 144 ? -7.873  -29.131 -4.583  1.00 25.33 ? 144 LEU A CD1    1 
ATOM   1947 C  CD2    . LEU A 1 144 ? -9.651  -29.169 -2.830  1.00 27.20 ? 144 LEU A CD2    1 
ATOM   1948 H  H      . LEU A 1 144 ? -10.116 -33.274 -5.383  1.00 24.59 ? 144 LEU A H      1 
ATOM   1949 H  HA     . LEU A 1 144 ? -7.958  -31.675 -5.675  1.00 21.86 ? 144 LEU A HA     1 
ATOM   1950 H  HB2    . LEU A 1 144 ? -9.991  -30.753 -4.880  1.00 23.63 ? 144 LEU A HB2    1 
ATOM   1951 H  HB3    . LEU A 1 144 ? -9.829  -31.629 -3.577  1.00 23.63 ? 144 LEU A HB3    1 
ATOM   1952 H  HG     . LEU A 1 144 ? -7.990  -30.348 -2.943  1.00 30.78 ? 144 LEU A HG     1 
ATOM   1953 H  HD11   . LEU A 1 144 ? -7.429  -28.412 -4.107  1.00 30.39 ? 144 LEU A HD11   1 
ATOM   1954 H  HD12   . LEU A 1 144 ? -7.217  -29.680 -5.041  1.00 30.39 ? 144 LEU A HD12   1 
ATOM   1955 H  HD13   . LEU A 1 144 ? -8.504  -28.766 -5.222  1.00 30.39 ? 144 LEU A HD13   1 
ATOM   1956 H  HD21   . LEU A 1 144 ? -9.200  -28.431 -2.389  1.00 32.64 ? 144 LEU A HD21   1 
ATOM   1957 H  HD22   . LEU A 1 144 ? -10.306 -28.828 -3.459  1.00 32.64 ? 144 LEU A HD22   1 
ATOM   1958 H  HD23   . LEU A 1 144 ? -10.087 -29.732 -2.171  1.00 32.64 ? 144 LEU A HD23   1 
ATOM   1959 N  N      . VAL A 1 145 ? -6.330  -32.594 -4.124  1.00 17.96 ? 145 VAL A N      1 
ATOM   1960 C  CA     . VAL A 1 145 ? -5.382  -33.069 -3.123  1.00 17.87 ? 145 VAL A CA     1 
ATOM   1961 C  C      . VAL A 1 145 ? -4.651  -31.854 -2.573  1.00 15.59 ? 145 VAL A C      1 
ATOM   1962 O  O      . VAL A 1 145 ? -4.197  -31.012 -3.334  1.00 19.88 ? 145 VAL A O      1 
ATOM   1963 C  CB     . VAL A 1 145 ? -4.374  -34.079 -3.702  1.00 19.92 ? 145 VAL A CB     1 
ATOM   1964 C  CG1    . VAL A 1 145 ? -3.466  -34.620 -2.601  1.00 20.93 ? 145 VAL A CG1    1 
ATOM   1965 C  CG2    . VAL A 1 145 ? -5.099  -35.219 -4.400  1.00 20.35 ? 145 VAL A CG2    1 
ATOM   1966 H  H      . VAL A 1 145 ? -5.980  -32.077 -4.715  1.00 21.55 ? 145 VAL A H      1 
ATOM   1967 H  HA     . VAL A 1 145 ? -5.863  -33.496 -2.397  1.00 21.45 ? 145 VAL A HA     1 
ATOM   1968 H  HB     . VAL A 1 145 ? -3.817  -33.631 -4.358  1.00 23.90 ? 145 VAL A HB     1 
ATOM   1969 H  HG11   . VAL A 1 145 ? -2.842  -35.253 -2.990  1.00 25.11 ? 145 VAL A HG11   1 
ATOM   1970 H  HG12   . VAL A 1 145 ? -2.983  -33.881 -2.200  1.00 25.11 ? 145 VAL A HG12   1 
ATOM   1971 H  HG13   . VAL A 1 145 ? -4.012  -35.062 -1.932  1.00 25.11 ? 145 VAL A HG13   1 
ATOM   1972 H  HG21   . VAL A 1 145 ? -4.443  -35.840 -4.755  1.00 24.41 ? 145 VAL A HG21   1 
ATOM   1973 H  HG22   . VAL A 1 145 ? -5.669  -35.671 -3.757  1.00 24.41 ? 145 VAL A HG22   1 
ATOM   1974 H  HG23   . VAL A 1 145 ? -5.637  -34.857 -5.121  1.00 24.41 ? 145 VAL A HG23   1 
ATOM   1975 N  N      . CYS A 1 146 ? -4.570  -31.743 -1.252  1.00 18.00 ? 146 CYS A N      1 
ATOM   1976 C  CA     . CYS A 1 146 ? -3.881  -30.614 -0.631  1.00 15.97 ? 146 CYS A CA     1 
ATOM   1977 C  C      . CYS A 1 146 ? -2.819  -31.111 0.329   1.00 16.10 ? 146 CYS A C      1 
ATOM   1978 O  O      . CYS A 1 146 ? -2.907  -32.228 0.835   1.00 20.51 ? 146 CYS A O      1 
ATOM   1979 C  CB     . CYS A 1 146 ? -4.856  -29.707 0.118   1.00 19.26 ? 146 CYS A CB     1 
ATOM   1980 S  SG     . CYS A 1 146 ? -6.202  -29.041 -0.885  1.00 21.16 ? 146 CYS A SG     1 
ATOM   1981 H  H      . CYS A 1 146 ? -4.904  -32.305 -0.693  1.00 21.60 ? 146 CYS A H      1 
ATOM   1982 H  HA     . CYS A 1 146 ? -3.445  -30.088 -1.319  1.00 19.17 ? 146 CYS A HA     1 
ATOM   1983 H  HB2    . CYS A 1 146 ? -5.255  -30.214 0.842   1.00 23.12 ? 146 CYS A HB2    1 
ATOM   1984 H  HB3    . CYS A 1 146 ? -4.362  -28.955 0.480   1.00 23.12 ? 146 CYS A HB3    1 
ATOM   1985 H  HG     . CYS A 1 146 ? -6.898  -28.349 -0.194  1.00 25.39 ? 146 CYS A HG     1 
ATOM   1986 N  N      . ALA A 1 147 ? -1.822  -30.266 0.576   1.00 16.60 ? 147 ALA A N      1 
ATOM   1987 C  CA     . ALA A 1 147 ? -0.744  -30.595 1.503   1.00 16.75 ? 147 ALA A CA     1 
ATOM   1988 C  C      . ALA A 1 147 ? -0.371  -29.421 2.402   1.00 19.95 ? 147 ALA A C      1 
ATOM   1989 O  O      . ALA A 1 147 ? -0.501  -28.257 2.019   1.00 20.54 ? 147 ALA A O      1 
ATOM   1990 C  CB     . ALA A 1 147 ? 0.479   -31.077 0.737   1.00 20.88 ? 147 ALA A CB     1 
ATOM   1991 H  H      . ALA A 1 147 ? -1.747  -29.488 0.216   1.00 19.92 ? 147 ALA A H      1 
ATOM   1992 H  HA     . ALA A 1 147 ? -1.039  -31.321 2.074   1.00 20.10 ? 147 ALA A HA     1 
ATOM   1993 H  HB1    . ALA A 1 147 ? 1.183   -31.290 1.369   1.00 25.06 ? 147 ALA A HB1    1 
ATOM   1994 H  HB2    . ALA A 1 147 ? 0.241   -31.867 0.227   1.00 25.06 ? 147 ALA A HB2    1 
ATOM   1995 H  HB3    . ALA A 1 147 ? 0.773   -30.373 0.138   1.00 25.06 ? 147 ALA A HB3    1 
ATOM   1996 N  N      . THR A 1 148 ? 0.101   -29.750 3.601   1.00 19.13 ? 148 THR A N      1 
ATOM   1997 C  CA     . THR A 1 148 ? 0.553   -28.762 4.582   1.00 20.59 ? 148 THR A CA     1 
ATOM   1998 C  C      . THR A 1 148 ? 1.327   -29.472 5.692   1.00 19.45 ? 148 THR A C      1 
ATOM   1999 O  O      . THR A 1 148 ? 1.244   -30.692 5.798   1.00 20.05 ? 148 THR A O      1 
ATOM   2000 C  CB     . THR A 1 148 ? -0.631  -27.999 5.200   1.00 24.37 ? 148 THR A CB     1 
ATOM   2001 O  OG1    . THR A 1 148 ? -0.148  -26.944 6.039   1.00 25.04 ? 148 THR A OG1    1 
ATOM   2002 C  CG2    . THR A 1 148 ? -1.504  -28.944 6.023   1.00 24.38 ? 148 THR A CG2    1 
ATOM   2003 H  H      . THR A 1 148 ? 0.173   -30.561 3.878   1.00 22.96 ? 148 THR A H      1 
ATOM   2004 H  HA     . THR A 1 148 ? 1.144   -28.123 4.153   1.00 24.70 ? 148 THR A HA     1 
ATOM   2005 H  HB     . THR A 1 148 ? -1.174  -27.621 4.491   1.00 29.24 ? 148 THR A HB     1 
ATOM   2006 H  HG1    . THR A 1 148 ? -0.794  -26.527 6.377   1.00 30.05 ? 148 THR A HG1    1 
ATOM   2007 H  HG21   . THR A 1 148 ? -2.248  -28.455 6.409   1.00 29.26 ? 148 THR A HG21   1 
ATOM   2008 H  HG22   . THR A 1 148 ? -1.851  -29.651 5.457   1.00 29.26 ? 148 THR A HG22   1 
ATOM   2009 H  HG23   . THR A 1 148 ? -0.982  -29.339 6.738   1.00 29.26 ? 148 THR A HG23   1 
ATOM   2010 N  N      . ASN A 1 149 ? 2.085   -28.736 6.505   1.00 23.59 ? 149 ASN A N      1 
ATOM   2011 C  CA     . ASN A 1 149 ? 2.574   -29.303 7.769   1.00 27.16 ? 149 ASN A CA     1 
ATOM   2012 C  C      . ASN A 1 149 ? 2.022   -28.557 8.971   1.00 25.37 ? 149 ASN A C      1 
ATOM   2013 O  O      . ASN A 1 149 ? 2.462   -28.767 10.102  1.00 28.74 ? 149 ASN A O      1 
ATOM   2014 C  CB     . ASN A 1 149 ? 4.098   -29.307 7.854   1.00 31.95 ? 149 ASN A CB     1 
ATOM   2015 C  CG     . ASN A 1 149 ? 4.605   -30.259 8.932   1.00 36.09 ? 149 ASN A CG     1 
ATOM   2016 O  OD1    . ASN A 1 149 ? 4.140   -31.397 9.033   1.00 34.29 ? 149 ASN A OD1    1 
ATOM   2017 N  ND2    . ASN A 1 149 ? 5.517   -29.785 9.770   1.00 40.85 ? 149 ASN A ND2    1 
ATOM   2018 H  H      . ASN A 1 149 ? 2.327   -27.924 6.357   1.00 28.31 ? 149 ASN A H      1 
ATOM   2019 H  HA     . ASN A 1 149 ? 2.273   -30.223 7.831   1.00 32.60 ? 149 ASN A HA     1 
ATOM   2020 H  HB2    . ASN A 1 149 ? 4.464   -29.593 7.002   1.00 38.34 ? 149 ASN A HB2    1 
ATOM   2021 H  HB3    . ASN A 1 149 ? 4.408   -28.414 8.069   1.00 38.34 ? 149 ASN A HB3    1 
ATOM   2022 H  HD21   . ASN A 1 149 ? 5.831   -30.287 10.393  1.00 49.02 ? 149 ASN A HD21   1 
ATOM   2023 H  HD22   . ASN A 1 149 ? 5.795   -28.975 9.689   1.00 49.02 ? 149 ASN A HD22   1 
ATOM   2024 N  N      . ALA A 1 150 ? 1.058   -27.682 8.724   1.00 21.87 ? 150 ALA A N      1 
ATOM   2025 C  CA     . ALA A 1 150 ? 0.401   -26.958 9.794   1.00 23.00 ? 150 ALA A CA     1 
ATOM   2026 C  C      . ALA A 1 150 ? -0.549  -27.854 10.572  1.00 21.25 ? 150 ALA A C      1 
ATOM   2027 O  O      . ALA A 1 150 ? -1.017  -28.876 10.068  1.00 23.87 ? 150 ALA A O      1 
ATOM   2028 C  CB     . ALA A 1 150 ? -0.356  -25.774 9.237   1.00 25.64 ? 150 ALA A CB     1 
ATOM   2029 H  H      . ALA A 1 150 ? 0.766   -27.490 7.938   1.00 26.24 ? 150 ALA A H      1 
ATOM   2030 H  HA     . ALA A 1 150 ? 1.072   -26.624 10.410  1.00 27.60 ? 150 ALA A HA     1 
ATOM   2031 H  HB1    . ALA A 1 150 ? -0.787  -25.303 9.968   1.00 30.76 ? 150 ALA A HB1    1 
ATOM   2032 H  HB2    . ALA A 1 150 ? 0.269   -25.184 8.786   1.00 30.76 ? 150 ALA A HB2    1 
ATOM   2033 H  HB3    . ALA A 1 150 ? -1.023  -26.093 8.609   1.00 30.76 ? 150 ALA A HB3    1 
ATOM   2034 N  N      . ASP A 1 151 ? -0.807  -27.454 11.811  1.00 22.75 ? 151 ASP A N      1 
ATOM   2035 C  CA     . ASP A 1 151 ? -1.887  -28.002 12.618  1.00 25.68 ? 151 ASP A CA     1 
ATOM   2036 C  C      . ASP A 1 151 ? -3.162  -27.249 12.249  1.00 23.94 ? 151 ASP A C      1 
ATOM   2037 O  O      . ASP A 1 151 ? -3.442  -26.182 12.802  1.00 23.50 ? 151 ASP A O      1 
ATOM   2038 C  CB     . ASP A 1 151 ? -1.561  -27.858 14.110  1.00 29.83 ? 151 ASP A CB     1 
ATOM   2039 C  CG     . ASP A 1 151 ? -2.593  -28.507 15.015  1.00 36.02 ? 151 ASP A CG     1 
ATOM   2040 O  OD1    . ASP A 1 151 ? -3.732  -28.755 14.573  1.00 34.96 ? 151 ASP A OD1    1 
ATOM   2041 O  OD2    . ASP A 1 151 ? -2.257  -28.761 16.190  1.00 39.95 ? 151 ASP A OD2    1 
ATOM   2042 H  H      . ASP A 1 151 ? -0.354  -26.846 12.218  1.00 27.30 ? 151 ASP A H      1 
ATOM   2043 H  HA     . ASP A 1 151 ? -2.007  -28.943 12.413  1.00 30.82 ? 151 ASP A HA     1 
ATOM   2044 H  HB2    . ASP A 1 151 ? -0.704  -28.276 14.287  1.00 35.80 ? 151 ASP A HB2    1 
ATOM   2045 H  HB3    . ASP A 1 151 ? -1.520  -26.914 14.333  1.00 35.80 ? 151 ASP A HB3    1 
ATOM   2046 N  N      . LEU A 1 152 ? -3.928  -27.787 11.306  1.00 23.43 ? 152 LEU A N      1 
ATOM   2047 C  CA     . LEU A 1 152 ? -5.085  -27.064 10.796  1.00 18.79 ? 152 LEU A CA     1 
ATOM   2048 C  C      . LEU A 1 152 ? -6.177  -26.909 11.853  1.00 21.17 ? 152 LEU A C      1 
ATOM   2049 O  O      . LEU A 1 152 ? -6.777  -25.842 11.950  1.00 22.53 ? 152 LEU A O      1 
ATOM   2050 C  CB     . LEU A 1 152 ? -5.639  -27.745 9.540   1.00 23.51 ? 152 LEU A CB     1 
ATOM   2051 C  CG     . LEU A 1 152 ? -4.732  -27.644 8.302   1.00 21.18 ? 152 LEU A CG     1 
ATOM   2052 C  CD1    . LEU A 1 152 ? -5.378  -28.311 7.100   1.00 26.83 ? 152 LEU A CD1    1 
ATOM   2053 C  CD2    . LEU A 1 152 ? -4.380  -26.198 7.966   1.00 26.09 ? 152 LEU A CD2    1 
ATOM   2054 H  H      . LEU A 1 152 ? -3.801  -28.559 10.949  1.00 28.12 ? 152 LEU A H      1 
ATOM   2055 H  HA     . LEU A 1 152 ? -4.801  -26.172 10.541  1.00 22.55 ? 152 LEU A HA     1 
ATOM   2056 H  HB2    . LEU A 1 152 ? -5.771  -28.687 9.731   1.00 28.21 ? 152 LEU A HB2    1 
ATOM   2057 H  HB3    . LEU A 1 152 ? -6.489  -27.336 9.315   1.00 28.21 ? 152 LEU A HB3    1 
ATOM   2058 H  HG     . LEU A 1 152 ? -3.903  -28.112 8.487   1.00 25.41 ? 152 LEU A HG     1 
ATOM   2059 H  HD11   . LEU A 1 152 ? -4.784  -28.231 6.338   1.00 32.19 ? 152 LEU A HD11   1 
ATOM   2060 H  HD12   . LEU A 1 152 ? -5.532  -29.247 7.304   1.00 32.19 ? 152 LEU A HD12   1 
ATOM   2061 H  HD13   . LEU A 1 152 ? -6.222  -27.871 6.911   1.00 32.19 ? 152 LEU A HD13   1 
ATOM   2062 H  HD21   . LEU A 1 152 ? -3.809  -26.187 7.182   1.00 31.31 ? 152 LEU A HD21   1 
ATOM   2063 H  HD22   . LEU A 1 152 ? -5.198  -25.708 7.787   1.00 31.31 ? 152 LEU A HD22   1 
ATOM   2064 H  HD23   . LEU A 1 152 ? -3.915  -25.803 8.720   1.00 31.31 ? 152 LEU A HD23   1 
ATOM   2065 N  N      . PRO A 1 153 ? -6.436  -27.957 12.652  1.00 23.05 ? 153 PRO A N      1 
ATOM   2066 C  CA     . PRO A 1 153 ? -7.400  -27.732 13.736  1.00 24.60 ? 153 PRO A CA     1 
ATOM   2067 C  C      . PRO A 1 153 ? -7.005  -26.582 14.664  1.00 22.38 ? 153 PRO A C      1 
ATOM   2068 O  O      . PRO A 1 153 ? -7.877  -25.831 15.103  1.00 25.81 ? 153 PRO A O      1 
ATOM   2069 C  CB     . PRO A 1 153 ? -7.398  -29.067 14.480  1.00 28.86 ? 153 PRO A CB     1 
ATOM   2070 C  CG     . PRO A 1 153 ? -7.098  -30.062 13.421  1.00 30.97 ? 153 PRO A CG     1 
ATOM   2071 C  CD     . PRO A 1 153 ? -6.096  -29.387 12.517  1.00 26.77 ? 153 PRO A CD     1 
ATOM   2072 H  HA     . PRO A 1 153 ? -8.285  -27.565 13.374  1.00 29.52 ? 153 PRO A HA     1 
ATOM   2073 H  HB2    . PRO A 1 153 ? -6.707  -29.065 15.160  1.00 34.64 ? 153 PRO A HB2    1 
ATOM   2074 H  HB3    . PRO A 1 153 ? -8.271  -29.229 14.871  1.00 34.64 ? 153 PRO A HB3    1 
ATOM   2075 H  HG2    . PRO A 1 153 ? -6.717  -30.859 13.821  1.00 37.16 ? 153 PRO A HG2    1 
ATOM   2076 H  HG3    . PRO A 1 153 ? -7.909  -30.276 12.934  1.00 37.16 ? 153 PRO A HG3    1 
ATOM   2077 H  HD2    . PRO A 1 153 ? -5.192  -29.551 12.830  1.00 32.12 ? 153 PRO A HD2    1 
ATOM   2078 H  HD3    . PRO A 1 153 ? -6.215  -29.679 11.600  1.00 32.12 ? 153 PRO A HD3    1 
ATOM   2079 N  N      . ALA A 1 154 ? -5.713  -26.438 14.943  1.00 25.60 ? 154 ALA A N      1 
ATOM   2080 C  CA     . ALA A 1 154 ? -5.239  -25.352 15.790  1.00 23.39 ? 154 ALA A CA     1 
ATOM   2081 C  C      . ALA A 1 154 ? -5.443  -23.996 15.116  1.00 27.33 ? 154 ALA A C      1 
ATOM   2082 O  O      . ALA A 1 154 ? -5.778  -23.014 15.779  1.00 27.30 ? 154 ALA A O      1 
ATOM   2083 C  CB     . ALA A 1 154 ? -3.773  -25.554 16.143  1.00 26.32 ? 154 ALA A CB     1 
ATOM   2084 H  H      . ALA A 1 154 ? -5.091  -26.956 14.653  1.00 30.72 ? 154 ALA A H      1 
ATOM   2085 H  HA     . ALA A 1 154 ? -5.747  -25.353 16.617  1.00 28.07 ? 154 ALA A HA     1 
ATOM   2086 H  HB1    . ALA A 1 154 ? -3.480  -24.821 16.706  1.00 31.58 ? 154 ALA A HB1    1 
ATOM   2087 H  HB2    . ALA A 1 154 ? -3.675  -26.395 16.616  1.00 31.58 ? 154 ALA A HB2    1 
ATOM   2088 H  HB3    . ALA A 1 154 ? -3.251  -25.572 15.325  1.00 31.58 ? 154 ALA A HB3    1 
ATOM   2089 N  N      . MET A 1 155 ? -5.247  -23.941 13.801  1.00 25.30 ? 155 MET A N      1 
ATOM   2090 C  CA     . MET A 1 155 ? -5.459  -22.702 13.059  1.00 22.28 ? 155 MET A CA     1 
ATOM   2091 C  C      . MET A 1 155 ? -6.943  -22.344 13.007  1.00 22.55 ? 155 MET A C      1 
ATOM   2092 O  O      . MET A 1 155 ? -7.302  -21.167 12.982  1.00 23.56 ? 155 MET A O      1 
ATOM   2093 C  CB     . MET A 1 155 ? -4.903  -22.812 11.640  1.00 21.31 ? 155 MET A CB     1 
ATOM   2094 C  CG     . MET A 1 155 ? -3.396  -22.827 11.567  1.00 22.96 ? 155 MET A CG     1 
ATOM   2095 S  SD     . MET A 1 155 ? -2.795  -22.913 9.872   1.00 23.41 ? 155 MET A SD     1 
ATOM   2096 C  CE     . MET A 1 155 ? -3.112  -21.243 9.311   1.00 25.43 ? 155 MET A CE     1 
ATOM   2097 H  H      . MET A 1 155 ? -4.992  -24.605 13.317  1.00 30.36 ? 155 MET A H      1 
ATOM   2098 H  HA     . MET A 1 155 ? -4.982  -21.986 13.508  1.00 26.73 ? 155 MET A HA     1 
ATOM   2099 H  HB2    . MET A 1 155 ? -5.227  -23.635 11.242  1.00 25.57 ? 155 MET A HB2    1 
ATOM   2100 H  HB3    . MET A 1 155 ? -5.217  -22.053 11.124  1.00 25.57 ? 155 MET A HB3    1 
ATOM   2101 H  HG2    . MET A 1 155 ? -3.050  -22.015 11.969  1.00 27.55 ? 155 MET A HG2    1 
ATOM   2102 H  HG3    . MET A 1 155 ? -3.062  -23.603 12.045  1.00 27.55 ? 155 MET A HG3    1 
ATOM   2103 H  HE1    . MET A 1 155 ? -2.825  -21.161 8.388   1.00 30.51 ? 155 MET A HE1    1 
ATOM   2104 H  HE2    . MET A 1 155 ? -4.063  -21.063 9.379   1.00 30.51 ? 155 MET A HE2    1 
ATOM   2105 H  HE3    . MET A 1 155 ? -2.617  -20.624 9.869   1.00 30.51 ? 155 MET A HE3    1 
ATOM   2106 N  N      . VAL A 1 156 ? -7.805  -23.353 12.977  1.00 23.18 ? 156 VAL A N      1 
ATOM   2107 C  CA     . VAL A 1 156 ? -9.243  -23.104 13.030  1.00 23.81 ? 156 VAL A CA     1 
ATOM   2108 C  C      . VAL A 1 156 ? -9.598  -22.408 14.344  1.00 27.14 ? 156 VAL A C      1 
ATOM   2109 O  O      . VAL A 1 156 ? -10.370 -21.450 14.360  1.00 29.54 ? 156 VAL A O      1 
ATOM   2110 C  CB     . VAL A 1 156 ? -10.055 -24.410 12.878  1.00 20.62 ? 156 VAL A CB     1 
ATOM   2111 C  CG1    . VAL A 1 156 ? -11.520 -24.198 13.265  1.00 26.03 ? 156 VAL A CG1    1 
ATOM   2112 C  CG2    . VAL A 1 156 ? -9.961  -24.927 11.455  1.00 21.73 ? 156 VAL A CG2    1 
ATOM   2113 H  H      . VAL A 1 156 ? -7.588  -24.184 12.927  1.00 27.81 ? 156 VAL A H      1 
ATOM   2114 H  HA     . VAL A 1 156 ? -9.487  -22.512 12.301  1.00 28.57 ? 156 VAL A HA     1 
ATOM   2115 H  HB     . VAL A 1 156 ? -9.684  -25.085 13.468  1.00 24.74 ? 156 VAL A HB     1 
ATOM   2116 H  HG11   . VAL A 1 156 ? -11.999 -25.035 13.159  1.00 31.24 ? 156 VAL A HG11   1 
ATOM   2117 H  HG12   . VAL A 1 156 ? -11.563 -23.907 14.190  1.00 31.24 ? 156 VAL A HG12   1 
ATOM   2118 H  HG13   . VAL A 1 156 ? -11.904 -23.520 12.687  1.00 31.24 ? 156 VAL A HG13   1 
ATOM   2119 H  HG21   . VAL A 1 156 ? -10.476 -25.745 11.382  1.00 26.08 ? 156 VAL A HG21   1 
ATOM   2120 H  HG22   . VAL A 1 156 ? -10.317 -24.256 10.852  1.00 26.08 ? 156 VAL A HG22   1 
ATOM   2121 H  HG23   . VAL A 1 156 ? -9.030  -25.102 11.245  1.00 26.08 ? 156 VAL A HG23   1 
ATOM   2122 N  N      . ASN A 1 157 ? -9.022  -22.884 15.442  1.00 27.88 ? 157 ASN A N      1 
ATOM   2123 C  CA     . ASN A 1 157 ? -9.259  -22.270 16.743  1.00 30.25 ? 157 ASN A CA     1 
ATOM   2124 C  C      . ASN A 1 157 ? -8.720  -20.842 16.787  1.00 33.40 ? 157 ASN A C      1 
ATOM   2125 O  O      . ASN A 1 157 ? -9.281  -19.984 17.469  1.00 36.20 ? 157 ASN A O      1 
ATOM   2126 C  CB     . ASN A 1 157 ? -8.625  -23.105 17.859  1.00 33.79 ? 157 ASN A CB     1 
ATOM   2127 C  CG     . ASN A 1 157 ? -9.333  -24.432 18.069  1.00 38.92 ? 157 ASN A CG     1 
ATOM   2128 O  OD1    . ASN A 1 157 ? -10.451 -24.632 17.596  1.00 43.19 ? 157 ASN A OD1    1 
ATOM   2129 N  ND2    . ASN A 1 157 ? -8.687  -25.342 18.791  1.00 39.67 ? 157 ASN A ND2    1 
ATOM   2130 H  H      . ASN A 1 157 ? -8.492  -23.561 15.462  1.00 33.45 ? 157 ASN A H      1 
ATOM   2131 H  HA     . ASN A 1 157 ? -10.215 -22.233 16.904  1.00 36.30 ? 157 ASN A HA     1 
ATOM   2132 H  HB2    . ASN A 1 157 ? -7.701  -23.291 17.629  1.00 40.55 ? 157 ASN A HB2    1 
ATOM   2133 H  HB3    . ASN A 1 157 ? -8.668  -22.607 18.690  1.00 40.55 ? 157 ASN A HB3    1 
ATOM   2134 H  HD21   . ASN A 1 157 ? -9.048  -26.109 18.938  1.00 47.60 ? 157 ASN A HD21   1 
ATOM   2135 H  HD22   . ASN A 1 157 ? -7.910  -25.164 19.112  1.00 47.60 ? 157 ASN A HD22   1 
ATOM   2136 N  N      . GLU A 1 158 ? -7.642  -20.592 16.049  1.00 30.53 ? 158 GLU A N      1 
ATOM   2137 C  CA     . GLU A 1 158 ? -7.013  -19.271 16.018  1.00 31.09 ? 158 GLU A CA     1 
ATOM   2138 C  C      . GLU A 1 158 ? -7.707  -18.318 15.045  1.00 32.90 ? 158 GLU A C      1 
ATOM   2139 O  O      . GLU A 1 158 ? -7.444  -17.117 15.051  1.00 35.49 ? 158 GLU A O      1 
ATOM   2140 C  CB     . GLU A 1 158 ? -5.534  -19.397 15.646  1.00 35.19 ? 158 GLU A CB     1 
ATOM   2141 H  H      . GLU A 1 158 ? -7.251  -21.175 15.551  1.00 36.64 ? 158 GLU A H      1 
ATOM   2142 H  HA     . GLU A 1 158 ? -7.065  -18.879 16.904  1.00 37.30 ? 158 GLU A HA     1 
ATOM   2143 N  N      . GLY A 1 159 ? -8.590  -18.856 14.208  1.00 29.12 ? 159 GLY A N      1 
ATOM   2144 C  CA     . GLY A 1 159 ? -9.327  -18.044 13.256  1.00 30.69 ? 159 GLY A CA     1 
ATOM   2145 C  C      . GLY A 1 159 ? -8.550  -17.739 11.987  1.00 26.77 ? 159 GLY A C      1 
ATOM   2146 O  O      . GLY A 1 159 ? -8.894  -16.810 11.247  1.00 28.65 ? 159 GLY A O      1 
ATOM   2147 H  H      . GLY A 1 159 ? -8.778  -19.694 14.175  1.00 34.95 ? 159 GLY A H      1 
ATOM   2148 H  HA2    . GLY A 1 159 ? -10.144 -18.506 13.008  1.00 36.83 ? 159 GLY A HA2    1 
ATOM   2149 H  HA3    . GLY A 1 159 ? -9.569  -17.203 13.673  1.00 36.83 ? 159 GLY A HA3    1 
ATOM   2150 N  N      . THR A 1 160 ? -7.508  -18.524 11.728  1.00 25.31 ? 160 THR A N      1 
ATOM   2151 C  CA     . THR A 1 160 ? -6.655  -18.312 10.559  1.00 24.19 ? 160 THR A CA     1 
ATOM   2152 C  C      . THR A 1 160 ? -6.845  -19.394 9.495   1.00 24.22 ? 160 THR A C      1 
ATOM   2153 O  O      . THR A 1 160 ? -6.209  -19.351 8.438   1.00 24.13 ? 160 THR A O      1 
ATOM   2154 C  CB     . THR A 1 160 ? -5.176  -18.253 10.959  1.00 25.36 ? 160 THR A CB     1 
ATOM   2155 O  OG1    . THR A 1 160 ? -4.822  -19.441 11.675  1.00 26.06 ? 160 THR A OG1    1 
ATOM   2156 C  CG2    . THR A 1 160 ? -4.919  -17.037 11.836  1.00 27.38 ? 160 THR A CG2    1 
ATOM   2157 H  H      . THR A 1 160 ? -7.270  -19.190 12.216  1.00 30.38 ? 160 THR A H      1 
ATOM   2158 H  HA     . THR A 1 160 ? -6.886  -17.460 10.157  1.00 29.03 ? 160 THR A HA     1 
ATOM   2159 H  HB     . THR A 1 160 ? -4.628  -18.180 10.162  1.00 30.43 ? 160 THR A HB     1 
ATOM   2160 H  HG1    . THR A 1 160 ? -4.013  -19.412 11.896  1.00 31.28 ? 160 THR A HG1    1 
ATOM   2161 H  HG21   . THR A 1 160 ? -3.983  -17.002 12.088  1.00 32.86 ? 160 THR A HG21   1 
ATOM   2162 H  HG22   . THR A 1 160 ? -5.146  -16.226 11.353  1.00 32.86 ? 160 THR A HG22   1 
ATOM   2163 H  HG23   . THR A 1 160 ? -5.460  -17.087 12.639  1.00 32.86 ? 160 THR A HG23   1 
ATOM   2164 N  N      . PHE A 1 161 ? -7.707  -20.366 9.781   1.00 21.18 ? 161 PHE A N      1 
ATOM   2165 C  CA     . PHE A 1 161 ? -8.168  -21.306 8.765   1.00 20.30 ? 161 PHE A CA     1 
ATOM   2166 C  C      . PHE A 1 161 ? -9.658  -21.516 8.959   1.00 18.30 ? 161 PHE A C      1 
ATOM   2167 O  O      . PHE A 1 161 ? -10.130 -21.593 10.090  1.00 20.27 ? 161 PHE A O      1 
ATOM   2168 C  CB     . PHE A 1 161 ? -7.424  -22.640 8.840   1.00 20.39 ? 161 PHE A CB     1 
ATOM   2169 C  CG     . PHE A 1 161 ? -7.492  -23.440 7.569   1.00 21.52 ? 161 PHE A CG     1 
ATOM   2170 C  CD1    . PHE A 1 161 ? -8.473  -24.404 7.389   1.00 20.51 ? 161 PHE A CD1    1 
ATOM   2171 C  CD2    . PHE A 1 161 ? -6.577  -23.221 6.548   1.00 23.30 ? 161 PHE A CD2    1 
ATOM   2172 C  CE1    . PHE A 1 161 ? -8.539  -25.139 6.216   1.00 23.37 ? 161 PHE A CE1    1 
ATOM   2173 C  CE2    . PHE A 1 161 ? -6.637  -23.954 5.370   1.00 21.53 ? 161 PHE A CE2    1 
ATOM   2174 C  CZ     . PHE A 1 161 ? -7.621  -24.915 5.207   1.00 20.86 ? 161 PHE A CZ     1 
ATOM   2175 H  H      . PHE A 1 161 ? -8.041  -20.503 10.562  1.00 25.41 ? 161 PHE A H      1 
ATOM   2176 H  HA     . PHE A 1 161 ? -8.025  -20.925 7.885   1.00 24.35 ? 161 PHE A HA     1 
ATOM   2177 H  HB2    . PHE A 1 161 ? -6.489  -22.466 9.032   1.00 24.47 ? 161 PHE A HB2    1 
ATOM   2178 H  HB3    . PHE A 1 161 ? -7.812  -23.176 9.550   1.00 24.47 ? 161 PHE A HB3    1 
ATOM   2179 H  HD1    . PHE A 1 161 ? -9.093  -24.559 8.064   1.00 24.61 ? 161 PHE A HD1    1 
ATOM   2180 H  HD2    . PHE A 1 161 ? -5.915  -22.577 6.655   1.00 27.96 ? 161 PHE A HD2    1 
ATOM   2181 H  HE1    . PHE A 1 161 ? -9.200  -25.784 6.108   1.00 28.04 ? 161 PHE A HE1    1 
ATOM   2182 H  HE2    . PHE A 1 161 ? -6.018  -23.800 4.694   1.00 25.83 ? 161 PHE A HE2    1 
ATOM   2183 H  HZ     . PHE A 1 161 ? -7.665  -25.408 4.419   1.00 25.03 ? 161 PHE A HZ     1 
ATOM   2184 N  N      . ARG A 1 162 ? -10.393 -21.606 7.855   1.00 18.17 ? 162 ARG A N      1 
ATOM   2185 C  CA     . ARG A 1 162 ? -11.846 -21.727 7.906   1.00 20.99 ? 162 ARG A CA     1 
ATOM   2186 C  C      . ARG A 1 162 ? -12.295 -23.113 8.363   1.00 19.66 ? 162 ARG A C      1 
ATOM   2187 O  O      . ARG A 1 162 ? -11.906 -24.129 7.786   1.00 20.58 ? 162 ARG A O      1 
ATOM   2188 C  CB     . ARG A 1 162 ? -12.450 -21.422 6.537   1.00 21.21 ? 162 ARG A CB     1 
ATOM   2189 C  CG     . ARG A 1 162 ? -12.357 -19.972 6.116   1.00 20.81 ? 162 ARG A CG     1 
ATOM   2190 C  CD     . ARG A 1 162 ? -13.225 -19.699 4.895   1.00 23.00 ? 162 ARG A CD     1 
ATOM   2191 N  NE     . ARG A 1 162 ? -14.650 -19.887 5.173   1.00 23.97 ? 162 ARG A NE     1 
ATOM   2192 C  CZ     . ARG A 1 162 ? -15.496 -18.916 5.510   1.00 23.42 ? 162 ARG A CZ     1 
ATOM   2193 N  NH1    . ARG A 1 162 ? -15.084 -17.657 5.617   1.00 25.54 ? 162 ARG A NH1    1 
ATOM   2194 N  NH2    . ARG A 1 162 ? -16.770 -19.205 5.739   1.00 25.91 ? 162 ARG A NH2    1 
ATOM   2195 H  H      . ARG A 1 162 ? -10.071 -21.598 7.058   1.00 21.81 ? 162 ARG A H      1 
ATOM   2196 H  HA     . ARG A 1 162 ? -12.194 -21.078 8.537   1.00 25.19 ? 162 ARG A HA     1 
ATOM   2197 H  HB2    . ARG A 1 162 ? -11.986 -21.952 5.869   1.00 25.45 ? 162 ARG A HB2    1 
ATOM   2198 H  HB3    . ARG A 1 162 ? -13.389 -21.665 6.551   1.00 25.45 ? 162 ARG A HB3    1 
ATOM   2199 H  HG2    . ARG A 1 162 ? -12.666 -19.406 6.842   1.00 24.97 ? 162 ARG A HG2    1 
ATOM   2200 H  HG3    . ARG A 1 162 ? -11.438 -19.760 5.891   1.00 24.97 ? 162 ARG A HG3    1 
ATOM   2201 H  HD2    . ARG A 1 162 ? -13.091 -18.782 4.609   1.00 27.60 ? 162 ARG A HD2    1 
ATOM   2202 H  HD3    . ARG A 1 162 ? -12.973 -20.310 4.184   1.00 27.60 ? 162 ARG A HD3    1 
ATOM   2203 H  HE     . ARG A 1 162 ? -14.965 -20.685 5.113   1.00 28.77 ? 162 ARG A HE     1 
ATOM   2204 H  HH11   . ARG A 1 162 ? -14.260 -17.460 5.470   1.00 30.65 ? 162 ARG A HH11   1 
ATOM   2205 H  HH12   . ARG A 1 162 ? -15.641 -17.039 5.834   1.00 30.65 ? 162 ARG A HH12   1 
ATOM   2206 H  HH21   . ARG A 1 162 ? -17.046 -20.016 5.671   1.00 31.10 ? 162 ARG A HH21   1 
ATOM   2207 H  HH22   . ARG A 1 162 ? -17.320 -18.580 5.956   1.00 31.10 ? 162 ARG A HH22   1 
ATOM   2208 N  N      . ALA A 1 163 ? -13.124 -23.139 9.400   1.00 22.39 ? 163 ALA A N      1 
ATOM   2209 C  CA     . ALA A 1 163 ? -13.657 -24.386 9.926   1.00 21.63 ? 163 ALA A CA     1 
ATOM   2210 C  C      . ALA A 1 163 ? -14.499 -25.113 8.881   1.00 23.92 ? 163 ALA A C      1 
ATOM   2211 O  O      . ALA A 1 163 ? -14.408 -26.335 8.753   1.00 23.37 ? 163 ALA A O      1 
ATOM   2212 C  CB     . ALA A 1 163 ? -14.481 -24.123 11.177  1.00 22.58 ? 163 ALA A CB     1 
ATOM   2213 H  H      . ALA A 1 163 ? -13.396 -22.439 9.820   1.00 26.87 ? 163 ALA A H      1 
ATOM   2214 H  HA     . ALA A 1 163 ? -12.918 -24.966 10.170  1.00 25.95 ? 163 ALA A HA     1 
ATOM   2215 H  HB1    . ALA A 1 163 ? -14.826 -24.966 11.510  1.00 27.10 ? 163 ALA A HB1    1 
ATOM   2216 H  HB2    . ALA A 1 163 ? -13.914 -23.709 11.846  1.00 27.10 ? 163 ALA A HB2    1 
ATOM   2217 H  HB3    . ALA A 1 163 ? -15.215 -23.530 10.952  1.00 27.10 ? 163 ALA A HB3    1 
ATOM   2218 N  N      . ASP A 1 164 ? -15.316 -24.373 8.132   1.00 22.36 ? 164 ASP A N      1 
ATOM   2219 C  CA     . ASP A 1 164 ? -16.185 -25.019 7.156   1.00 21.03 ? 164 ASP A CA     1 
ATOM   2220 C  C      . ASP A 1 164 ? -15.363 -25.609 6.009   1.00 20.79 ? 164 ASP A C      1 
ATOM   2221 O  O      . ASP A 1 164 ? -15.680 -26.687 5.518   1.00 22.94 ? 164 ASP A O      1 
ATOM   2222 C  CB     . ASP A 1 164 ? -17.278 -24.062 6.629   1.00 23.29 ? 164 ASP A CB     1 
ATOM   2223 C  CG     . ASP A 1 164 ? -16.747 -22.722 6.127   1.00 23.38 ? 164 ASP A CG     1 
ATOM   2224 O  OD1    . ASP A 1 164 ? -15.521 -22.501 6.084   1.00 25.12 ? 164 ASP A OD1    1 
ATOM   2225 O  OD2    . ASP A 1 164 ? -17.598 -21.879 5.756   1.00 24.26 ? 164 ASP A OD2    1 
ATOM   2226 H  H      . ASP A 1 164 ? -15.385 -23.517 8.169   1.00 26.84 ? 164 ASP A H      1 
ATOM   2227 H  HA     . ASP A 1 164 ? -16.637 -25.757 7.594   1.00 25.24 ? 164 ASP A HA     1 
ATOM   2228 H  HB2    . ASP A 1 164 ? -17.739 -24.491 5.892   1.00 27.95 ? 164 ASP A HB2    1 
ATOM   2229 H  HB3    . ASP A 1 164 ? -17.905 -23.880 7.346   1.00 27.95 ? 164 ASP A HB3    1 
ATOM   2230 N  N      . LEU A 1 165 ? -14.288 -24.938 5.606   1.00 20.41 ? 165 LEU A N      1 
ATOM   2231 C  CA     . LEU A 1 165 ? -13.426 -25.495 4.569   1.00 20.12 ? 165 LEU A CA     1 
ATOM   2232 C  C      . LEU A 1 165 ? -12.816 -26.807 5.047   1.00 22.82 ? 165 LEU A C      1 
ATOM   2233 O  O      . LEU A 1 165 ? -12.770 -27.785 4.304   1.00 24.40 ? 165 LEU A O      1 
ATOM   2234 C  CB     . LEU A 1 165 ? -12.317 -24.518 4.173   1.00 18.62 ? 165 LEU A CB     1 
ATOM   2235 C  CG     . LEU A 1 165 ? -11.286 -25.064 3.175   1.00 22.14 ? 165 LEU A CG     1 
ATOM   2236 C  CD1    . LEU A 1 165 ? -11.939 -25.555 1.892   1.00 21.35 ? 165 LEU A CD1    1 
ATOM   2237 C  CD2    . LEU A 1 165 ? -10.236 -24.007 2.853   1.00 21.03 ? 165 LEU A CD2    1 
ATOM   2238 H  H      . LEU A 1 165 ? -14.040 -24.173 5.909   1.00 24.49 ? 165 LEU A H      1 
ATOM   2239 H  HA     . LEU A 1 165 ? -13.959 -25.681 3.780   1.00 24.14 ? 165 LEU A HA     1 
ATOM   2240 H  HB2    . LEU A 1 165 ? -12.725 -23.736 3.772   1.00 22.35 ? 165 LEU A HB2    1 
ATOM   2241 H  HB3    . LEU A 1 165 ? -11.836 -24.258 4.975   1.00 22.35 ? 165 LEU A HB3    1 
ATOM   2242 H  HG     . LEU A 1 165 ? -10.830 -25.818 3.581   1.00 26.57 ? 165 LEU A HG     1 
ATOM   2243 H  HD11   . LEU A 1 165 ? -11.250 -25.889 1.296   1.00 25.61 ? 165 LEU A HD11   1 
ATOM   2244 H  HD12   . LEU A 1 165 ? -12.563 -26.266 2.109   1.00 25.61 ? 165 LEU A HD12   1 
ATOM   2245 H  HD13   . LEU A 1 165 ? -12.409 -24.817 1.475   1.00 25.61 ? 165 LEU A HD13   1 
ATOM   2246 H  HD21   . LEU A 1 165 ? -9.599  -24.378 2.222   1.00 25.24 ? 165 LEU A HD21   1 
ATOM   2247 H  HD22   . LEU A 1 165 ? -10.675 -23.234 2.465   1.00 25.24 ? 165 LEU A HD22   1 
ATOM   2248 H  HD23   . LEU A 1 165 ? -9.782  -23.754 3.672   1.00 25.24 ? 165 LEU A HD23   1 
ATOM   2249 N  N      . LEU A 1 166 ? -12.359 -26.830 6.295   1.00 22.36 ? 166 LEU A N      1 
ATOM   2250 C  CA     . LEU A 1 166 ? -11.717 -28.023 6.837   1.00 22.27 ? 166 LEU A CA     1 
ATOM   2251 C  C      . LEU A 1 166 ? -12.722 -29.152 7.046   1.00 23.69 ? 166 LEU A C      1 
ATOM   2252 O  O      . LEU A 1 166 ? -12.371 -30.318 6.904   1.00 25.72 ? 166 LEU A O      1 
ATOM   2253 C  CB     . LEU A 1 166 ? -11.004 -27.712 8.155   1.00 23.60 ? 166 LEU A CB     1 
ATOM   2254 C  CG     . LEU A 1 166 ? -10.098 -28.829 8.683   1.00 26.22 ? 166 LEU A CG     1 
ATOM   2255 C  CD1    . LEU A 1 166 ? -8.960  -29.119 7.710   1.00 27.28 ? 166 LEU A CD1    1 
ATOM   2256 C  CD2    . LEU A 1 166 ? -9.541  -28.485 10.056  1.00 27.11 ? 166 LEU A CD2    1 
ATOM   2257 H  H      . LEU A 1 166 ? -12.407 -26.172 6.846   1.00 26.83 ? 166 LEU A H      1 
ATOM   2258 H  HA     . LEU A 1 166 ? -11.049 -28.334 6.205   1.00 26.73 ? 166 LEU A HA     1 
ATOM   2259 H  HB2    . LEU A 1 166 ? -10.453 -26.923 8.028   1.00 28.32 ? 166 LEU A HB2    1 
ATOM   2260 H  HB3    . LEU A 1 166 ? -11.675 -27.534 8.833   1.00 28.32 ? 166 LEU A HB3    1 
ATOM   2261 H  HG     . LEU A 1 166 ? -10.624 -29.640 8.772   1.00 31.46 ? 166 LEU A HG     1 
ATOM   2262 H  HD11   . LEU A 1 166 ? -8.407  -29.828 8.074   1.00 32.74 ? 166 LEU A HD11   1 
ATOM   2263 H  HD12   . LEU A 1 166 ? -9.334  -29.394 6.859   1.00 32.74 ? 166 LEU A HD12   1 
ATOM   2264 H  HD13   . LEU A 1 166 ? -8.431  -28.314 7.595   1.00 32.74 ? 166 LEU A HD13   1 
ATOM   2265 H  HD21   . LEU A 1 166 ? -8.974  -29.213 10.358  1.00 32.53 ? 166 LEU A HD21   1 
ATOM   2266 H  HD22   . LEU A 1 166 ? -9.024  -27.667 9.991   1.00 32.53 ? 166 LEU A HD22   1 
ATOM   2267 H  HD23   . LEU A 1 166 ? -10.279 -28.362 10.674  1.00 32.53 ? 166 LEU A HD23   1 
ATOM   2268 N  N      . ASP A 1 167 ? -13.963 -28.804 7.383   1.00 25.65 ? 167 ASP A N      1 
ATOM   2269 C  CA     . ASP A 1 167 ? -15.027 -29.799 7.564   1.00 25.28 ? 167 ASP A CA     1 
ATOM   2270 C  C      . ASP A 1 167 ? -15.299 -30.572 6.282   1.00 29.11 ? 167 ASP A C      1 
ATOM   2271 O  O      . ASP A 1 167 ? -15.774 -31.707 6.318   1.00 35.50 ? 167 ASP A O      1 
ATOM   2272 C  CB     . ASP A 1 167 ? -16.333 -29.135 8.018   1.00 26.52 ? 167 ASP A CB     1 
ATOM   2273 C  CG     . ASP A 1 167 ? -16.347 -28.796 9.498   1.00 30.81 ? 167 ASP A CG     1 
ATOM   2274 O  OD1    . ASP A 1 167 ? -15.541 -29.364 10.267  1.00 33.65 ? 167 ASP A OD1    1 
ATOM   2275 O  OD2    . ASP A 1 167 ? -17.192 -27.964 9.895   1.00 28.78 ? 167 ASP A OD2    1 
ATOM   2276 H  H      . ASP A 1 167 ? -14.219 -27.994 7.514   1.00 30.78 ? 167 ASP A H      1 
ATOM   2277 H  HA     . ASP A 1 167 ? -14.756 -30.432 8.247   1.00 30.34 ? 167 ASP A HA     1 
ATOM   2278 H  HB2    . ASP A 1 167 ? -16.456 -28.311 7.522   1.00 31.82 ? 167 ASP A HB2    1 
ATOM   2279 H  HB3    . ASP A 1 167 ? -17.070 -29.740 7.843   1.00 31.82 ? 167 ASP A HB3    1 
ATOM   2280 N  N      . ARG A 1 168 ? -15.004 -29.939 5.153   1.00 30.83 ? 168 ARG A N      1 
ATOM   2281 C  CA     . ARG A 1 168 ? -15.347 -30.474 3.843   1.00 33.14 ? 168 ARG A CA     1 
ATOM   2282 C  C      . ARG A 1 168 ? -14.118 -31.064 3.164   1.00 33.90 ? 168 ARG A C      1 
ATOM   2283 O  O      . ARG A 1 168 ? -14.178 -32.111 2.518   1.00 39.21 ? 168 ARG A O      1 
ATOM   2284 C  CB     . ARG A 1 168 ? -15.955 -29.365 2.977   1.00 36.68 ? 168 ARG A CB     1 
ATOM   2285 C  CG     . ARG A 1 168 ? -16.409 -29.805 1.597   1.00 36.37 ? 168 ARG A CG     1 
ATOM   2286 C  CD     . ARG A 1 168 ? -17.545 -30.812 1.674   1.00 38.75 ? 168 ARG A CD     1 
ATOM   2287 N  NE     . ARG A 1 168 ? -17.824 -31.421 0.375   1.00 43.43 ? 168 ARG A NE     1 
ATOM   2288 C  CZ     . ARG A 1 168 ? -18.944 -31.258 -0.325  1.00 49.75 ? 168 ARG A CZ     1 
ATOM   2289 N  NH1    . ARG A 1 168 ? -19.938 -30.500 0.129   1.00 50.39 ? 168 ARG A NH1    1 
ATOM   2290 N  NH2    . ARG A 1 168 ? -19.076 -31.867 -1.496  1.00 50.64 ? 168 ARG A NH2    1 
ATOM   2291 H  H      . ARG A 1 168 ? -14.597 -29.182 5.120   1.00 36.99 ? 168 ARG A H      1 
ATOM   2292 H  HA     . ARG A 1 168 ? -16.007 -31.178 3.946   1.00 39.77 ? 168 ARG A HA     1 
ATOM   2293 H  HB2    . ARG A 1 168 ? -16.728 -29.003 3.437   1.00 44.01 ? 168 ARG A HB2    1 
ATOM   2294 H  HB3    . ARG A 1 168 ? -15.291 -28.668 2.857   1.00 44.01 ? 168 ARG A HB3    1 
ATOM   2295 H  HG2    . ARG A 1 168 ? -16.722 -29.032 1.101   1.00 43.64 ? 168 ARG A HG2    1 
ATOM   2296 H  HG3    . ARG A 1 168 ? -15.666 -30.222 1.134   1.00 43.64 ? 168 ARG A HG3    1 
ATOM   2297 H  HD2    . ARG A 1 168 ? -17.304 -31.518 2.294   1.00 46.51 ? 168 ARG A HD2    1 
ATOM   2298 H  HD3    . ARG A 1 168 ? -18.350 -30.362 1.977   1.00 46.51 ? 168 ARG A HD3    1 
ATOM   2299 H  HE     . ARG A 1 168 ? -17.214 -31.924 0.035   1.00 52.12 ? 168 ARG A HE     1 
ATOM   2300 H  HH11   . ARG A 1 168 ? -19.863 -30.102 0.888   1.00 60.47 ? 168 ARG A HH11   1 
ATOM   2301 H  HH12   . ARG A 1 168 ? -20.655 -30.407 -0.336  1.00 60.47 ? 168 ARG A HH12   1 
ATOM   2302 H  HH21   . ARG A 1 168 ? -18.439 -32.360 -1.798  1.00 60.77 ? 168 ARG A HH21   1 
ATOM   2303 H  HH22   . ARG A 1 168 ? -19.797 -31.767 -1.954  1.00 60.77 ? 168 ARG A HH22   1 
ATOM   2304 N  N      . LEU A 1 169 ? -12.996 -30.378 3.338   1.00 30.89 ? 169 LEU A N      1 
ATOM   2305 C  CA     . LEU A 1 169 ? -11.769 -30.684 2.619   1.00 31.40 ? 169 LEU A CA     1 
ATOM   2306 C  C      . LEU A 1 169 ? -11.079 -31.948 3.122   1.00 28.18 ? 169 LEU A C      1 
ATOM   2307 O  O      . LEU A 1 169 ? -10.513 -32.710 2.341   1.00 33.28 ? 169 LEU A O      1 
ATOM   2308 C  CB     . LEU A 1 169 ? -10.818 -29.494 2.733   1.00 34.90 ? 169 LEU A CB     1 
ATOM   2309 C  CG     . LEU A 1 169 ? -9.557  -29.468 1.881   1.00 37.41 ? 169 LEU A CG     1 
ATOM   2310 C  CD1    . LEU A 1 169 ? -9.887  -29.639 0.412   1.00 39.58 ? 169 LEU A CD1    1 
ATOM   2311 C  CD2    . LEU A 1 169 ? -8.858  -28.148 2.127   1.00 36.58 ? 169 LEU A CD2    1 
ATOM   2312 H  H      . LEU A 1 169 ? -12.920 -29.714 3.880   1.00 37.07 ? 169 LEU A H      1 
ATOM   2313 H  HA     . LEU A 1 169 ? -11.977 -30.811 1.680   1.00 37.68 ? 169 LEU A HA     1 
ATOM   2314 H  HB2    . LEU A 1 169 ? -11.321 -28.694 2.510   1.00 41.88 ? 169 LEU A HB2    1 
ATOM   2315 H  HB3    . LEU A 1 169 ? -10.531 -29.435 3.657   1.00 41.88 ? 169 LEU A HB3    1 
ATOM   2316 H  HG     . LEU A 1 169 ? -8.965  -30.187 2.152   1.00 44.89 ? 169 LEU A HG     1 
ATOM   2317 H  HD11   . LEU A 1 169 ? -9.063  -29.617 -0.100  1.00 47.50 ? 169 LEU A HD11   1 
ATOM   2318 H  HD12   . LEU A 1 169 ? -10.333 -30.490 0.286   1.00 47.50 ? 169 LEU A HD12   1 
ATOM   2319 H  HD13   . LEU A 1 169 ? -10.469 -28.915 0.134   1.00 47.50 ? 169 LEU A HD13   1 
ATOM   2320 H  HD21   . LEU A 1 169 ? -8.050  -28.115 1.591   1.00 43.89 ? 169 LEU A HD21   1 
ATOM   2321 H  HD22   . LEU A 1 169 ? -9.453  -27.425 1.876   1.00 43.89 ? 169 LEU A HD22   1 
ATOM   2322 H  HD23   . LEU A 1 169 ? -8.634  -28.081 3.068   1.00 43.89 ? 169 LEU A HD23   1 
ATOM   2323 N  N      . ALA A 1 170 ? -11.131 -32.163 4.432   1.00 28.74 ? 170 ALA A N      1 
ATOM   2324 C  CA     . ALA A 1 170 ? -10.451 -33.292 5.047   1.00 27.88 ? 170 ALA A CA     1 
ATOM   2325 C  C      . ALA A 1 170 ? -11.321 -34.544 5.040   1.00 25.83 ? 170 ALA A C      1 
ATOM   2326 O  O      . ALA A 1 170 ? -11.652 -35.067 6.104   1.00 24.97 ? 170 ALA A O      1 
ATOM   2327 C  CB     . ALA A 1 170 ? -10.046 -32.946 6.474   1.00 30.03 ? 170 ALA A CB     1 
ATOM   2328 H  H      . ALA A 1 170 ? -11.557 -31.665 4.989   1.00 34.49 ? 170 ALA A H      1 
ATOM   2329 H  HA     . ALA A 1 170 ? -9.644  -33.486 4.545   1.00 33.46 ? 170 ALA A HA     1 
ATOM   2330 H  HB1    . ALA A 1 170 ? -9.595  -33.710 6.867   1.00 36.03 ? 170 ALA A HB1    1 
ATOM   2331 H  HB2    . ALA A 1 170 ? -9.449  -32.182 6.456   1.00 36.03 ? 170 ALA A HB2    1 
ATOM   2332 H  HB3    . ALA A 1 170 ? -10.843 -32.732 6.985   1.00 36.03 ? 170 ALA A HB3    1 
ATOM   2333 N  N      . PHE A 1 171 ? -11.695 -35.026 3.858   1.00 19.71 ? 171 PHE A N      1 
ATOM   2334 C  CA     . PHE A 1 171 ? -12.446 -36.282 3.787   1.00 22.36 ? 171 PHE A CA     1 
ATOM   2335 C  C      . PHE A 1 171 ? -11.620 -37.394 4.411   1.00 17.24 ? 171 PHE A C      1 
ATOM   2336 O  O      . PHE A 1 171 ? -12.125 -38.184 5.194   1.00 18.23 ? 171 PHE A O      1 
ATOM   2337 C  CB     . PHE A 1 171 ? -12.824 -36.658 2.357   1.00 21.89 ? 171 PHE A CB     1 
ATOM   2338 C  CG     . PHE A 1 171 ? -13.227 -38.101 2.208   1.00 19.03 ? 171 PHE A CG     1 
ATOM   2339 C  CD1    . PHE A 1 171 ? -14.527 -38.509 2.489   1.00 18.70 ? 171 PHE A CD1    1 
ATOM   2340 C  CD2    . PHE A 1 171 ? -12.306 -39.051 1.807   1.00 17.93 ? 171 PHE A CD2    1 
ATOM   2341 C  CE1    . PHE A 1 171 ? -14.894 -39.830 2.363   1.00 18.51 ? 171 PHE A CE1    1 
ATOM   2342 C  CE2    . PHE A 1 171 ? -12.671 -40.379 1.683   1.00 19.03 ? 171 PHE A CE2    1 
ATOM   2343 C  CZ     . PHE A 1 171 ? -13.964 -40.767 1.958   1.00 18.95 ? 171 PHE A CZ     1 
ATOM   2344 H  H      . PHE A 1 171 ? -11.533 -34.658 3.098   1.00 23.65 ? 171 PHE A H      1 
ATOM   2345 H  HA     . PHE A 1 171 ? -13.265 -36.191 4.300   1.00 26.83 ? 171 PHE A HA     1 
ATOM   2346 H  HB2    . PHE A 1 171 ? -13.571 -36.108 2.075   1.00 26.27 ? 171 PHE A HB2    1 
ATOM   2347 H  HB3    . PHE A 1 171 ? -12.061 -36.500 1.779   1.00 26.27 ? 171 PHE A HB3    1 
ATOM   2348 H  HD1    . PHE A 1 171 ? -15.157 -37.881 2.762   1.00 22.44 ? 171 PHE A HD1    1 
ATOM   2349 H  HD2    . PHE A 1 171 ? -11.431 -38.795 1.620   1.00 21.51 ? 171 PHE A HD2    1 
ATOM   2350 H  HE1    . PHE A 1 171 ? -15.767 -40.091 2.550   1.00 22.21 ? 171 PHE A HE1    1 
ATOM   2351 H  HE2    . PHE A 1 171 ? -12.044 -41.010 1.408   1.00 22.84 ? 171 PHE A HE2    1 
ATOM   2352 H  HZ     . PHE A 1 171 ? -14.210 -41.660 1.871   1.00 22.74 ? 171 PHE A HZ     1 
ATOM   2353 N  N      . ASP A 1 172 ? -10.344 -37.465 4.056   1.00 17.91 ? 172 ASP A N      1 
ATOM   2354 C  CA     . ASP A 1 172 ? -9.421  -38.274 4.833   1.00 18.76 ? 172 ASP A CA     1 
ATOM   2355 C  C      . ASP A 1 172 ? -8.045  -37.628 4.796   1.00 16.63 ? 172 ASP A C      1 
ATOM   2356 O  O      . ASP A 1 172 ? -7.801  -36.701 4.015   1.00 17.42 ? 172 ASP A O      1 
ATOM   2357 C  CB     . ASP A 1 172 ? -9.373  -39.720 4.327   1.00 18.96 ? 172 ASP A CB     1 
ATOM   2358 C  CG     . ASP A 1 172 ? -9.171  -40.726 5.460   1.00 22.87 ? 172 ASP A CG     1 
ATOM   2359 O  OD1    . ASP A 1 172 ? -8.612  -40.340 6.509   1.00 21.30 ? 172 ASP A OD1    1 
ATOM   2360 O  OD2    . ASP A 1 172 ? -9.575  -41.902 5.313   1.00 23.79 ? 172 ASP A OD2    1 
ATOM   2361 H  H      . ASP A 1 172 ? -9.994  -37.063 3.381   1.00 21.49 ? 172 ASP A H      1 
ATOM   2362 H  HA     . ASP A 1 172 ? -9.719  -38.291 5.757   1.00 22.52 ? 172 ASP A HA     1 
ATOM   2363 H  HB2    . ASP A 1 172 ? -10.211 -39.929 3.884   1.00 22.75 ? 172 ASP A HB2    1 
ATOM   2364 H  HB3    . ASP A 1 172 ? -8.635  -39.814 3.705   1.00 22.75 ? 172 ASP A HB3    1 
ATOM   2365 N  N      . VAL A 1 173 ? -7.172  -38.113 5.671   1.00 16.75 ? 173 VAL A N      1 
ATOM   2366 C  CA     . VAL A 1 173 ? -5.871  -37.507 5.896   1.00 16.10 ? 173 VAL A CA     1 
ATOM   2367 C  C      . VAL A 1 173 ? -4.768  -38.550 5.772   1.00 17.06 ? 173 VAL A C      1 
ATOM   2368 O  O      . VAL A 1 173 ? -4.828  -39.619 6.392   1.00 19.50 ? 173 VAL A O      1 
ATOM   2369 C  CB     . VAL A 1 173 ? -5.800  -36.839 7.286   1.00 19.25 ? 173 VAL A CB     1 
ATOM   2370 C  CG1    . VAL A 1 173 ? -4.412  -36.258 7.545   1.00 22.97 ? 173 VAL A CG1    1 
ATOM   2371 C  CG2    . VAL A 1 173 ? -6.855  -35.750 7.402   1.00 18.76 ? 173 VAL A CG2    1 
ATOM   2372 H  H      . VAL A 1 173 ? -7.316  -38.809 6.156   1.00 20.10 ? 173 VAL A H      1 
ATOM   2373 H  HA     . VAL A 1 173 ? -5.718  -36.824 5.225   1.00 19.32 ? 173 VAL A HA     1 
ATOM   2374 H  HB     . VAL A 1 173 ? -5.980  -37.505 7.967   1.00 23.10 ? 173 VAL A HB     1 
ATOM   2375 H  HG11   . VAL A 1 173 ? -4.401  -35.847 8.423   1.00 27.56 ? 173 VAL A HG11   1 
ATOM   2376 H  HG12   . VAL A 1 173 ? -3.759  -36.974 7.506   1.00 27.56 ? 173 VAL A HG12   1 
ATOM   2377 H  HG13   . VAL A 1 173 ? -4.216  -35.594 6.866   1.00 27.56 ? 173 VAL A HG13   1 
ATOM   2378 H  HG21   . VAL A 1 173 ? -6.794  -35.344 8.280   1.00 22.51 ? 173 VAL A HG21   1 
ATOM   2379 H  HG22   . VAL A 1 173 ? -6.696  -35.083 6.716   1.00 22.51 ? 173 VAL A HG22   1 
ATOM   2380 H  HG23   . VAL A 1 173 ? -7.732  -36.147 7.280   1.00 22.51 ? 173 VAL A HG23   1 
ATOM   2381 N  N      . VAL A 1 174 ? -3.770  -38.226 4.956   1.00 18.59 ? 174 VAL A N      1 
ATOM   2382 C  CA     . VAL A 1 174 ? -2.572  -39.040 4.816   1.00 18.98 ? 174 VAL A CA     1 
ATOM   2383 C  C      . VAL A 1 174 ? -1.449  -38.347 5.572   1.00 18.10 ? 174 VAL A C      1 
ATOM   2384 O  O      . VAL A 1 174 ? -1.086  -37.216 5.257   1.00 19.10 ? 174 VAL A O      1 
ATOM   2385 C  CB     . VAL A 1 174 ? -2.174  -39.232 3.339   1.00 18.90 ? 174 VAL A CB     1 
ATOM   2386 C  CG1    . VAL A 1 174 ? -0.903  -40.071 3.222   1.00 21.55 ? 174 VAL A CG1    1 
ATOM   2387 C  CG2    . VAL A 1 174 ? -3.310  -39.880 2.562   1.00 23.73 ? 174 VAL A CG2    1 
ATOM   2388 H  H      . VAL A 1 174 ? -3.766  -37.522 4.462   1.00 22.30 ? 174 VAL A H      1 
ATOM   2389 H  HA     . VAL A 1 174 ? -2.722  -39.912 5.213   1.00 22.77 ? 174 VAL A HA     1 
ATOM   2390 H  HB     . VAL A 1 174 ? -1.997  -38.364 2.944   1.00 22.67 ? 174 VAL A HB     1 
ATOM   2391 H  HG11   . VAL A 1 174 ? -0.678  -40.174 2.284   1.00 25.86 ? 174 VAL A HG11   1 
ATOM   2392 H  HG12   . VAL A 1 174 ? -0.182  -39.618 3.688   1.00 25.86 ? 174 VAL A HG12   1 
ATOM   2393 H  HG13   . VAL A 1 174 ? -1.061  -40.940 3.622   1.00 25.86 ? 174 VAL A HG13   1 
ATOM   2394 H  HG21   . VAL A 1 174 ? -3.037  -39.991 1.638   1.00 28.47 ? 174 VAL A HG21   1 
ATOM   2395 H  HG22   . VAL A 1 174 ? -3.508  -40.745 2.955   1.00 28.47 ? 174 VAL A HG22   1 
ATOM   2396 H  HG23   . VAL A 1 174 ? -4.092  -39.308 2.610   1.00 28.47 ? 174 VAL A HG23   1 
ATOM   2397 N  N      . GLN A 1 175 ? -0.907  -39.023 6.577   1.00 19.14 ? 175 GLN A N      1 
ATOM   2398 C  CA     . GLN A 1 175 ? 0.149   -38.444 7.395   1.00 21.22 ? 175 GLN A CA     1 
ATOM   2399 C  C      . GLN A 1 175 ? 1.484   -39.092 7.056   1.00 17.94 ? 175 GLN A C      1 
ATOM   2400 O  O      . GLN A 1 175 ? 1.695   -40.272 7.325   1.00 19.79 ? 175 GLN A O      1 
ATOM   2401 C  CB     . GLN A 1 175 ? -0.192  -38.605 8.877   1.00 25.65 ? 175 GLN A CB     1 
ATOM   2402 C  CG     . GLN A 1 175 ? -1.559  -38.013 9.222   1.00 32.88 ? 175 GLN A CG     1 
ATOM   2403 C  CD     . GLN A 1 175 ? -1.879  -38.058 10.699  1.00 40.51 ? 175 GLN A CD     1 
ATOM   2404 O  OE1    . GLN A 1 175 ? -1.043  -37.729 11.540  1.00 45.87 ? 175 GLN A OE1    1 
ATOM   2405 N  NE2    . GLN A 1 175 ? -3.103  -38.465 11.024  1.00 36.67 ? 175 GLN A NE2    1 
ATOM   2406 H  H      . GLN A 1 175 ? -1.134  -39.821 6.807   1.00 22.97 ? 175 GLN A H      1 
ATOM   2407 H  HA     . GLN A 1 175 ? 0.217   -37.495 7.203   1.00 25.47 ? 175 GLN A HA     1 
ATOM   2408 H  HB2    . GLN A 1 175 ? -0.207  -39.549 9.099   1.00 30.78 ? 175 GLN A HB2    1 
ATOM   2409 H  HB3    . GLN A 1 175 ? 0.478   -38.147 9.409   1.00 30.78 ? 175 GLN A HB3    1 
ATOM   2410 H  HG2    . GLN A 1 175 ? -1.579  -37.085 8.941   1.00 39.45 ? 175 GLN A HG2    1 
ATOM   2411 H  HG3    . GLN A 1 175 ? -2.244  -38.514 8.754   1.00 39.45 ? 175 GLN A HG3    1 
ATOM   2412 H  HE21   . GLN A 1 175 ? -3.661  -38.685 10.407  1.00 44.01 ? 175 GLN A HE21   1 
ATOM   2413 H  HE22   . GLN A 1 175 ? -3.337  -38.509 11.851  1.00 44.01 ? 175 GLN A HE22   1 
ATOM   2414 N  N      . LEU A 1 176 ? 2.374   -38.318 6.438   1.00 17.63 ? 176 LEU A N      1 
ATOM   2415 C  CA     . LEU A 1 176 ? 3.683   -38.834 6.057   1.00 19.21 ? 176 LEU A CA     1 
ATOM   2416 C  C      . LEU A 1 176 ? 4.645   -38.751 7.234   1.00 18.46 ? 176 LEU A C      1 
ATOM   2417 O  O      . LEU A 1 176 ? 4.850   -37.674 7.799   1.00 22.03 ? 176 LEU A O      1 
ATOM   2418 C  CB     . LEU A 1 176 ? 4.265   -38.069 4.870   1.00 22.39 ? 176 LEU A CB     1 
ATOM   2419 C  CG     . LEU A 1 176 ? 3.444   -37.986 3.585   1.00 23.66 ? 176 LEU A CG     1 
ATOM   2420 C  CD1    . LEU A 1 176 ? 4.298   -37.353 2.499   1.00 23.20 ? 176 LEU A CD1    1 
ATOM   2421 C  CD2    . LEU A 1 176 ? 2.938   -39.350 3.151   1.00 26.12 ? 176 LEU A CD2    1 
ATOM   2422 H  H      . LEU A 1 176 ? 2.244   -37.494 6.228   1.00 21.16 ? 176 LEU A H      1 
ATOM   2423 H  HA     . LEU A 1 176 ? 3.596   -39.766 5.803   1.00 23.06 ? 176 LEU A HA     1 
ATOM   2424 H  HB2    . LEU A 1 176 ? 4.430   -37.158 5.157   1.00 26.86 ? 176 LEU A HB2    1 
ATOM   2425 H  HB3    . LEU A 1 176 ? 5.110   -38.484 4.636   1.00 26.86 ? 176 LEU A HB3    1 
ATOM   2426 H  HG     . LEU A 1 176 ? 2.675   -37.413 3.737   1.00 28.39 ? 176 LEU A HG     1 
ATOM   2427 H  HD11   . LEU A 1 176 ? 3.778   -37.298 1.682   1.00 27.84 ? 176 LEU A HD11   1 
ATOM   2428 H  HD12   . LEU A 1 176 ? 4.562   -36.464 2.784   1.00 27.84 ? 176 LEU A HD12   1 
ATOM   2429 H  HD13   . LEU A 1 176 ? 5.084   -37.903 2.356   1.00 27.84 ? 176 LEU A HD13   1 
ATOM   2430 H  HD21   . LEU A 1 176 ? 2.423   -39.251 2.335   1.00 31.34 ? 176 LEU A HD21   1 
ATOM   2431 H  HD22   . LEU A 1 176 ? 3.697   -39.933 2.995   1.00 31.34 ? 176 LEU A HD22   1 
ATOM   2432 H  HD23   . LEU A 1 176 ? 2.378   -39.717 3.853   1.00 31.34 ? 176 LEU A HD23   1 
ATOM   2433 N  N      . PRO A 1 177 ? 5.251   -39.887 7.608   1.00 20.30 ? 177 PRO A N      1 
ATOM   2434 C  CA     . PRO A 1 177 ? 6.212   -39.858 8.713   1.00 21.33 ? 177 PRO A CA     1 
ATOM   2435 C  C      . PRO A 1 177 ? 7.499   -39.120 8.354   1.00 19.24 ? 177 PRO A C      1 
ATOM   2436 O  O      . PRO A 1 177 ? 8.003   -39.289 7.243   1.00 21.76 ? 177 PRO A O      1 
ATOM   2437 C  CB     . PRO A 1 177 ? 6.493   -41.339 8.973   1.00 25.43 ? 177 PRO A CB     1 
ATOM   2438 C  CG     . PRO A 1 177 ? 6.195   -42.012 7.684   1.00 28.40 ? 177 PRO A CG     1 
ATOM   2439 C  CD     . PRO A 1 177 ? 5.078   -41.245 7.061   1.00 24.79 ? 177 PRO A CD     1 
ATOM   2440 H  HA     . PRO A 1 177 ? 5.815   -39.458 9.503   1.00 25.60 ? 177 PRO A HA     1 
ATOM   2441 H  HB2    . PRO A 1 177 ? 7.425   -41.459 9.216   1.00 30.52 ? 177 PRO A HB2    1 
ATOM   2442 H  HB3    . PRO A 1 177 ? 5.909   -41.666 9.675   1.00 30.52 ? 177 PRO A HB3    1 
ATOM   2443 H  HG2    . PRO A 1 177 ? 6.982   -41.987 7.116   1.00 34.09 ? 177 PRO A HG2    1 
ATOM   2444 H  HG3    . PRO A 1 177 ? 5.926   -42.928 7.852   1.00 34.09 ? 177 PRO A HG3    1 
ATOM   2445 H  HD2    . PRO A 1 177 ? 5.171   -41.236 6.096   1.00 29.75 ? 177 PRO A HD2    1 
ATOM   2446 H  HD3    . PRO A 1 177 ? 4.223   -41.613 7.333   1.00 29.75 ? 177 PRO A HD3    1 
ATOM   2447 N  N      . PRO A 1 178 ? 8.027   -38.308 9.280   1.00 20.62 ? 178 PRO A N      1 
ATOM   2448 C  CA     . PRO A 1 178 ? 9.330   -37.714 8.994   1.00 20.26 ? 178 PRO A CA     1 
ATOM   2449 C  C      . PRO A 1 178 ? 10.410  -38.780 9.048   1.00 18.51 ? 178 PRO A C      1 
ATOM   2450 O  O      . PRO A 1 178 ? 10.211  -39.843 9.640   1.00 19.67 ? 178 PRO A O      1 
ATOM   2451 C  CB     . PRO A 1 178 ? 9.505   -36.685 10.107  1.00 22.77 ? 178 PRO A CB     1 
ATOM   2452 C  CG     . PRO A 1 178 ? 8.720   -37.244 11.238  1.00 25.78 ? 178 PRO A CG     1 
ATOM   2453 C  CD     . PRO A 1 178 ? 7.522   -37.897 10.601  1.00 22.62 ? 178 PRO A CD     1 
ATOM   2454 H  HA     . PRO A 1 178 ? 9.333   -37.275 8.129   1.00 24.32 ? 178 PRO A HA     1 
ATOM   2455 H  HB2    . PRO A 1 178 ? 10.443  -36.608 10.342  1.00 27.32 ? 178 PRO A HB2    1 
ATOM   2456 H  HB3    . PRO A 1 178 ? 9.146   -35.829 9.826   1.00 27.32 ? 178 PRO A HB3    1 
ATOM   2457 H  HG2    . PRO A 1 178 ? 9.254   -37.899 11.715  1.00 30.94 ? 178 PRO A HG2    1 
ATOM   2458 H  HG3    . PRO A 1 178 ? 8.445   -36.528 11.831  1.00 30.94 ? 178 PRO A HG3    1 
ATOM   2459 H  HD2    . PRO A 1 178 ? 7.246   -38.673 11.114  1.00 27.15 ? 178 PRO A HD2    1 
ATOM   2460 H  HD3    . PRO A 1 178 ? 6.799   -37.258 10.504  1.00 27.15 ? 178 PRO A HD3    1 
ATOM   2461 N  N      . LEU A 1 179 ? 11.545  -38.489 8.434   1.00 19.59 ? 179 LEU A N      1 
ATOM   2462 C  CA     . LEU A 1 179 ? 12.629  -39.445 8.336   1.00 20.18 ? 179 LEU A CA     1 
ATOM   2463 C  C      . LEU A 1 179 ? 13.100  -39.912 9.717   1.00 19.96 ? 179 LEU A C      1 
ATOM   2464 O  O      . LEU A 1 179 ? 13.449  -41.077 9.902   1.00 24.27 ? 179 LEU A O      1 
ATOM   2465 C  CB     . LEU A 1 179 ? 13.772  -38.809 7.551   1.00 21.47 ? 179 LEU A CB     1 
ATOM   2466 C  CG     . LEU A 1 179 ? 14.962  -39.657 7.137   1.00 23.45 ? 179 LEU A CG     1 
ATOM   2467 C  CD1    . LEU A 1 179 ? 14.528  -40.957 6.467   1.00 24.42 ? 179 LEU A CD1    1 
ATOM   2468 C  CD2    . LEU A 1 179 ? 15.821  -38.820 6.208   1.00 25.32 ? 179 LEU A CD2    1 
ATOM   2469 H  H      . LEU A 1 179 ? 11.713  -37.732 8.061   1.00 23.51 ? 179 LEU A H      1 
ATOM   2470 H  HA     . LEU A 1 179 ? 12.322  -40.223 7.844   1.00 24.21 ? 179 LEU A HA     1 
ATOM   2471 H  HB2    . LEU A 1 179 ? 13.397  -38.443 6.735   1.00 25.76 ? 179 LEU A HB2    1 
ATOM   2472 H  HB3    . LEU A 1 179 ? 14.124  -38.082 8.087   1.00 25.76 ? 179 LEU A HB3    1 
ATOM   2473 H  HG     . LEU A 1 179 ? 15.487  -39.879 7.922   1.00 28.14 ? 179 LEU A HG     1 
ATOM   2474 H  HD11   . LEU A 1 179 ? 15.318  -41.463 6.221   1.00 29.31 ? 179 LEU A HD11   1 
ATOM   2475 H  HD12   . LEU A 1 179 ? 13.988  -41.467 7.090   1.00 29.31 ? 179 LEU A HD12   1 
ATOM   2476 H  HD13   . LEU A 1 179 ? 14.010  -40.745 5.675   1.00 29.31 ? 179 LEU A HD13   1 
ATOM   2477 H  HD21   . LEU A 1 179 ? 16.588  -39.344 5.931   1.00 30.39 ? 179 LEU A HD21   1 
ATOM   2478 H  HD22   . LEU A 1 179 ? 15.294  -38.569 5.433   1.00 30.39 ? 179 LEU A HD22   1 
ATOM   2479 H  HD23   . LEU A 1 179 ? 16.115  -38.026 6.681   1.00 30.39 ? 179 LEU A HD23   1 
ATOM   2480 N  N      . ARG A 1 180 ? 13.077  -39.008 10.691  1.00 21.51 ? 180 ARG A N      1 
ATOM   2481 C  CA     . ARG A 1 180 ? 13.571  -39.322 12.029  1.00 24.17 ? 180 ARG A CA     1 
ATOM   2482 C  C      . ARG A 1 180 ? 12.676  -40.334 12.749  1.00 25.97 ? 180 ARG A C      1 
ATOM   2483 O  O      . ARG A 1 180 ? 13.092  -40.944 13.738  1.00 29.17 ? 180 ARG A O      1 
ATOM   2484 C  CB     . ARG A 1 180 ? 13.700  -38.041 12.858  1.00 23.16 ? 180 ARG A CB     1 
ATOM   2485 C  CG     . ARG A 1 180 ? 12.380  -37.370 13.203  1.00 25.19 ? 180 ARG A CG     1 
ATOM   2486 C  CD     . ARG A 1 180 ? 12.614  -36.033 13.893  1.00 29.02 ? 180 ARG A CD     1 
ATOM   2487 N  NE     . ARG A 1 180 ? 11.369  -35.295 14.087  1.00 35.78 ? 180 ARG A NE     1 
ATOM   2488 C  CZ     . ARG A 1 180 ? 10.826  -34.482 13.185  1.00 35.54 ? 180 ARG A CZ     1 
ATOM   2489 N  NH1    . ARG A 1 180 ? 9.689   -33.859 13.459  1.00 41.68 ? 180 ARG A NH1    1 
ATOM   2490 N  NH2    . ARG A 1 180 ? 11.414  -34.286 12.011  1.00 37.41 ? 180 ARG A NH2    1 
ATOM   2491 H  H      . ARG A 1 180 ? 12.781  -38.205 10.604  1.00 25.81 ? 180 ARG A H      1 
ATOM   2492 H  HA     . ARG A 1 180 ? 14.455  -39.713 11.950  1.00 29.01 ? 180 ARG A HA     1 
ATOM   2493 H  HB2    . ARG A 1 180 ? 14.146  -38.256 13.691  1.00 27.79 ? 180 ARG A HB2    1 
ATOM   2494 H  HB3    . ARG A 1 180 ? 14.232  -37.402 12.359  1.00 27.79 ? 180 ARG A HB3    1 
ATOM   2495 H  HG2    . ARG A 1 180 ? 11.878  -37.211 12.389  1.00 30.22 ? 180 ARG A HG2    1 
ATOM   2496 H  HG3    . ARG A 1 180 ? 11.877  -37.941 13.804  1.00 30.22 ? 180 ARG A HG3    1 
ATOM   2497 H  HD2    . ARG A 1 180 ? 13.013  -36.189 14.763  1.00 34.82 ? 180 ARG A HD2    1 
ATOM   2498 H  HD3    . ARG A 1 180 ? 13.205  -35.491 13.346  1.00 34.82 ? 180 ARG A HD3    1 
ATOM   2499 H  HE     . ARG A 1 180 ? 10.958  -35.393 14.836  1.00 42.93 ? 180 ARG A HE     1 
ATOM   2500 H  HH11   . ARG A 1 180 ? 9.304   -33.981 14.218  1.00 50.02 ? 180 ARG A HH11   1 
ATOM   2501 H  HH12   . ARG A 1 180 ? 9.337   -33.332 12.878  1.00 50.02 ? 180 ARG A HH12   1 
ATOM   2502 H  HH21   . ARG A 1 180 ? 12.152  -34.688 11.827  1.00 44.89 ? 180 ARG A HH21   1 
ATOM   2503 H  HH22   . ARG A 1 180 ? 11.057  -33.758 11.434  1.00 44.89 ? 180 ARG A HH22   1 
ATOM   2504 N  N      . GLU A 1 181 ? 11.458  -40.510 12.243  1.00 23.55 ? 181 GLU A N      1 
ATOM   2505 C  CA     . GLU A 1 181 ? 10.534  -41.514 12.761  1.00 25.91 ? 181 GLU A CA     1 
ATOM   2506 C  C      . GLU A 1 181 ? 10.508  -42.743 11.850  1.00 29.44 ? 181 GLU A C      1 
ATOM   2507 O  O      . GLU A 1 181 ? 9.715   -43.665 12.066  1.00 33.21 ? 181 GLU A O      1 
ATOM   2508 C  CB     . GLU A 1 181 ? 9.129   -40.921 12.908  1.00 30.74 ? 181 GLU A CB     1 
ATOM   2509 C  CG     . GLU A 1 181 ? 9.035   -39.813 13.951  1.00 34.47 ? 181 GLU A CG     1 
ATOM   2510 C  CD     . GLU A 1 181 ? 7.648   -39.203 14.044  1.00 41.56 ? 181 GLU A CD     1 
ATOM   2511 O  OE1    . GLU A 1 181 ? 6.695   -39.781 13.479  1.00 41.60 ? 181 GLU A OE1    1 
ATOM   2512 O  OE2    . GLU A 1 181 ? 7.513   -38.139 14.683  1.00 46.12 ? 181 GLU A OE2    1 
ATOM   2513 H  H      . GLU A 1 181 ? 11.139  -40.052 11.589  1.00 28.27 ? 181 GLU A H      1 
ATOM   2514 H  HA     . GLU A 1 181 ? 10.834  -41.798 13.639  1.00 31.09 ? 181 GLU A HA     1 
ATOM   2515 H  HB2    . GLU A 1 181 ? 8.857   -40.548 12.054  1.00 36.89 ? 181 GLU A HB2    1 
ATOM   2516 H  HB3    . GLU A 1 181 ? 8.517   -41.627 13.169  1.00 36.89 ? 181 GLU A HB3    1 
ATOM   2517 H  HG2    . GLU A 1 181 ? 9.260   -40.179 14.821  1.00 41.36 ? 181 GLU A HG2    1 
ATOM   2518 H  HG3    . GLU A 1 181 ? 9.658   -39.107 13.718  1.00 41.36 ? 181 GLU A HG3    1 
ATOM   2519 N  N      . ARG A 1 182 ? 11.372  -42.735 10.833  1.00 31.60 ? 182 ARG A N      1 
ATOM   2520 C  CA     . ARG A 1 182 ? 11.591  -43.879 9.950   1.00 32.50 ? 182 ARG A CA     1 
ATOM   2521 C  C      . ARG A 1 182 ? 13.055  -44.308 10.049  1.00 29.22 ? 182 ARG A C      1 
ATOM   2522 O  O      . ARG A 1 182 ? 13.728  -44.447 9.023   1.00 25.96 ? 182 ARG A O      1 
ATOM   2523 C  CB     . ARG A 1 182 ? 11.276  -43.542 8.484   1.00 32.05 ? 182 ARG A CB     1 
ATOM   2524 C  CG     . ARG A 1 182 ? 9.901   -42.980 8.181   1.00 34.33 ? 182 ARG A CG     1 
ATOM   2525 C  CD     . ARG A 1 182 ? 9.878   -42.379 6.764   1.00 29.65 ? 182 ARG A CD     1 
ATOM   2526 N  NE     . ARG A 1 182 ? 10.192  -43.364 5.732   1.00 35.95 ? 182 ARG A NE     1 
ATOM   2527 C  CZ     . ARG A 1 182 ? 10.009  -43.175 4.428   1.00 36.72 ? 182 ARG A CZ     1 
ATOM   2528 N  NH1    . ARG A 1 182 ? 9.496   -42.039 3.975   1.00 42.45 ? 182 ARG A NH1    1 
ATOM   2529 N  NH2    . ARG A 1 182 ? 10.328  -44.131 3.567   1.00 39.21 ? 182 ARG A NH2    1 
ATOM   2530 H  H      . ARG A 1 182 ? 11.857  -42.055 10.630  1.00 37.92 ? 182 ARG A H      1 
ATOM   2531 H  HA     . ARG A 1 182 ? 11.029  -44.620 10.228  1.00 38.99 ? 182 ARG A HA     1 
ATOM   2532 H  HB2    . ARG A 1 182 ? 11.924  -42.888 8.180   1.00 38.46 ? 182 ARG A HB2    1 
ATOM   2533 H  HB3    . ARG A 1 182 ? 11.373  -44.353 7.962   1.00 38.46 ? 182 ARG A HB3    1 
ATOM   2534 H  HG2    . ARG A 1 182 ? 9.242   -43.690 8.226   1.00 41.20 ? 182 ARG A HG2    1 
ATOM   2535 H  HG3    . ARG A 1 182 ? 9.690   -42.278 8.817   1.00 41.20 ? 182 ARG A HG3    1 
ATOM   2536 H  HD2    . ARG A 1 182 ? 8.992   -42.027 6.583   1.00 35.58 ? 182 ARG A HD2    1 
ATOM   2537 H  HD3    . ARG A 1 182 ? 10.536  -41.668 6.710   1.00 35.58 ? 182 ARG A HD3    1 
ATOM   2538 H  HE     . ARG A 1 182 ? 10.518  -44.119 5.985   1.00 43.14 ? 182 ARG A HE     1 
ATOM   2539 H  HH11   . ARG A 1 182 ? 9.286   -41.412 4.525   1.00 50.94 ? 182 ARG A HH11   1 
ATOM   2540 H  HH12   . ARG A 1 182 ? 9.379   -41.926 3.130   1.00 50.94 ? 182 ARG A HH12   1 
ATOM   2541 H  HH21   . ARG A 1 182 ? 10.659  -44.873 3.850   1.00 47.05 ? 182 ARG A HH21   1 
ATOM   2542 H  HH22   . ARG A 1 182 ? 10.206  -44.009 2.724   1.00 47.05 ? 182 ARG A HH22   1 
ATOM   2543 N  N      . GLU A 1 183 ? 13.551  -44.496 11.269  1.00 33.07 ? 183 GLU A N      1 
ATOM   2544 C  CA     . GLU A 1 183 ? 14.985  -44.690 11.496  1.00 37.64 ? 183 GLU A CA     1 
ATOM   2545 C  C      . GLU A 1 183 ? 15.595  -45.784 10.616  1.00 33.03 ? 183 GLU A C      1 
ATOM   2546 O  O      . GLU A 1 183 ? 16.719  -45.638 10.140  1.00 34.65 ? 183 GLU A O      1 
ATOM   2547 C  CB     . GLU A 1 183 ? 15.259  -45.022 12.966  1.00 42.31 ? 183 GLU A CB     1 
ATOM   2548 C  CG     . GLU A 1 183 ? 15.047  -43.867 13.928  1.00 46.70 ? 183 GLU A CG     1 
ATOM   2549 C  CD     . GLU A 1 183 ? 13.656  -43.852 14.534  1.00 51.54 ? 183 GLU A CD     1 
ATOM   2550 O  OE1    . GLU A 1 183 ? 12.688  -44.243 13.845  1.00 49.77 ? 183 GLU A OE1    1 
ATOM   2551 O  OE2    . GLU A 1 183 ? 13.536  -43.454 15.711  1.00 54.73 ? 183 GLU A OE2    1 
ATOM   2552 H  H      . GLU A 1 183 ? 13.077  -44.516 11.987  1.00 39.69 ? 183 GLU A H      1 
ATOM   2553 H  HA     . GLU A 1 183 ? 15.444  -43.861 11.292  1.00 45.17 ? 183 GLU A HA     1 
ATOM   2554 N  N      . SER A 1 184 ? 14.858  -46.870 10.394  1.00 32.25 ? 184 SER A N      1 
ATOM   2555 C  CA     . SER A 1 184 ? 15.368  -47.981 9.592   1.00 36.83 ? 184 SER A CA     1 
ATOM   2556 C  C      . SER A 1 184 ? 15.595  -47.586 8.132   1.00 34.01 ? 184 SER A C      1 
ATOM   2557 O  O      . SER A 1 184 ? 16.421  -48.187 7.444   1.00 40.05 ? 184 SER A O      1 
ATOM   2558 C  CB     . SER A 1 184 ? 14.413  -49.175 9.659   1.00 38.39 ? 184 SER A CB     1 
ATOM   2559 O  OG     . SER A 1 184 ? 13.169  -48.868 9.051   1.00 43.48 ? 184 SER A OG     1 
ATOM   2560 H  H      . SER A 1 184 ? 14.061  -46.988 10.696  1.00 38.70 ? 184 SER A H      1 
ATOM   2561 H  HA     . SER A 1 184 ? 16.221  -48.263 9.958   1.00 44.20 ? 184 SER A HA     1 
ATOM   2562 H  HB2    . SER A 1 184 ? 14.814  -49.926 9.195   1.00 46.06 ? 184 SER A HB2    1 
ATOM   2563 H  HB3    . SER A 1 184 ? 14.260  -49.404 10.589  1.00 46.06 ? 184 SER A HB3    1 
ATOM   2564 H  HG     . SER A 1 184 ? 12.656  -49.532 9.095   1.00 52.18 ? 184 SER A HG     1 
ATOM   2565 N  N      . ASP A 1 185 ? 14.867  -46.577 7.663   1.00 27.90 ? 185 ASP A N      1 
ATOM   2566 C  CA     . ASP A 1 185 ? 14.983  -46.132 6.276   1.00 27.11 ? 185 ASP A CA     1 
ATOM   2567 C  C      . ASP A 1 185 ? 16.178  -45.207 6.049   1.00 23.81 ? 185 ASP A C      1 
ATOM   2568 O  O      . ASP A 1 185 ? 16.605  -45.018 4.911   1.00 24.60 ? 185 ASP A O      1 
ATOM   2569 C  CB     . ASP A 1 185 ? 13.707  -45.410 5.830   1.00 26.82 ? 185 ASP A CB     1 
ATOM   2570 C  CG     . ASP A 1 185 ? 12.609  -46.364 5.387   1.00 33.11 ? 185 ASP A CG     1 
ATOM   2571 O  OD1    . ASP A 1 185 ? 12.920  -47.506 4.989   1.00 36.73 ? 185 ASP A OD1    1 
ATOM   2572 O  OD2    . ASP A 1 185 ? 11.427  -45.960 5.418   1.00 35.00 ? 185 ASP A OD2    1 
ATOM   2573 H  H      . ASP A 1 185 ? 14.296  -46.132 8.127   1.00 33.48 ? 185 ASP A H      1 
ATOM   2574 H  HA     . ASP A 1 185 ? 15.098  -46.910 5.708   1.00 32.54 ? 185 ASP A HA     1 
ATOM   2575 H  HB2    . ASP A 1 185 ? 13.366  -44.885 6.571   1.00 32.18 ? 185 ASP A HB2    1 
ATOM   2576 H  HB3    . ASP A 1 185 ? 13.918  -44.829 5.082   1.00 32.18 ? 185 ASP A HB3    1 
ATOM   2577 N  N      . ILE A 1 186 ? 16.709  -44.619 7.118   1.00 23.08 ? 186 ILE A N      1 
ATOM   2578 C  CA     . ILE A 1 186 ? 17.797  -43.659 6.970   1.00 21.50 ? 186 ILE A CA     1 
ATOM   2579 C  C      . ILE A 1 186 ? 19.017  -44.317 6.323   1.00 16.40 ? 186 ILE A C      1 
ATOM   2580 O  O      . ILE A 1 186 ? 19.529  -43.819 5.324   1.00 16.53 ? 186 ILE A O      1 
ATOM   2581 C  CB     . ILE A 1 186 ? 18.182  -43.027 8.325   1.00 19.82 ? 186 ILE A CB     1 
ATOM   2582 C  CG1    . ILE A 1 186 ? 17.060  -42.091 8.786   1.00 22.20 ? 186 ILE A CG1    1 
ATOM   2583 C  CG2    . ILE A 1 186 ? 19.489  -42.239 8.210   1.00 19.21 ? 186 ILE A CG2    1 
ATOM   2584 C  CD1    . ILE A 1 186 ? 17.217  -41.551 10.196  1.00 21.98 ? 186 ILE A CD1    1 
ATOM   2585 H  H      . ILE A 1 186 ? 16.461  -44.757 7.930   1.00 27.69 ? 186 ILE A H      1 
ATOM   2586 H  HA     . ILE A 1 186 ? 17.503  -42.944 6.385   1.00 25.81 ? 186 ILE A HA     1 
ATOM   2587 H  HB     . ILE A 1 186 ? 18.295  -43.732 8.982   1.00 23.78 ? 186 ILE A HB     1 
ATOM   2588 H  HG12   . ILE A 1 186 ? 17.025  -41.331 8.184   1.00 26.64 ? 186 ILE A HG12   1 
ATOM   2589 H  HG13   . ILE A 1 186 ? 16.220  -42.574 8.749   1.00 26.64 ? 186 ILE A HG13   1 
ATOM   2590 H  HG21   . ILE A 1 186 ? 19.703  -41.855 9.075   1.00 23.05 ? 186 ILE A HG21   1 
ATOM   2591 H  HG22   . ILE A 1 186 ? 20.197  -42.840 7.930   1.00 23.05 ? 186 ILE A HG22   1 
ATOM   2592 H  HG23   . ILE A 1 186 ? 19.375  -41.533 7.554   1.00 23.05 ? 186 ILE A HG23   1 
ATOM   2593 H  HD11   . ILE A 1 186 ? 16.465  -40.972 10.397  1.00 26.37 ? 186 ILE A HD11   1 
ATOM   2594 H  HD12   . ILE A 1 186 ? 17.238  -42.294 10.818  1.00 26.37 ? 186 ILE A HD12   1 
ATOM   2595 H  HD13   . ILE A 1 186 ? 18.045  -41.049 10.251  1.00 26.37 ? 186 ILE A HD13   1 
ATOM   2596 N  N      . MET A 1 187 ? 19.480  -45.441 6.858   1.00 19.08 ? 187 MET A N      1 
ATOM   2597 C  CA     . MET A 1 187 ? 20.678  -46.051 6.285   1.00 17.30 ? 187 MET A CA     1 
ATOM   2598 C  C      . MET A 1 187 ? 20.365  -46.687 4.922   1.00 18.53 ? 187 MET A C      1 
ATOM   2599 O  O      . MET A 1 187 ? 21.211  -46.690 4.025   1.00 19.20 ? 187 MET A O      1 
ATOM   2600 C  CB     . MET A 1 187 ? 21.285  -47.085 7.242   1.00 24.21 ? 187 MET A CB     1 
ATOM   2601 C  CG     . MET A 1 187 ? 21.961  -46.485 8.492   1.00 24.61 ? 187 MET A CG     1 
ATOM   2602 S  SD     . MET A 1 187 ? 23.072  -45.070 8.207   1.00 23.53 ? 187 MET A SD     1 
ATOM   2603 C  CE     . MET A 1 187 ? 24.175  -45.757 6.972   1.00 25.08 ? 187 MET A CE     1 
ATOM   2604 H  H      . MET A 1 187 ? 19.137  -45.858 7.527   1.00 22.90 ? 187 MET A H      1 
ATOM   2605 H  HA     . MET A 1 187 ? 21.341  -45.356 6.152   1.00 20.76 ? 187 MET A HA     1 
ATOM   2606 H  HB2    . MET A 1 187 ? 20.580  -47.677 7.546   1.00 29.05 ? 187 MET A HB2    1 
ATOM   2607 H  HB3    . MET A 1 187 ? 21.956  -47.595 6.762   1.00 29.05 ? 187 MET A HB3    1 
ATOM   2608 H  HG2    . MET A 1 187 ? 21.266  -46.188 9.100   1.00 29.53 ? 187 MET A HG2    1 
ATOM   2609 H  HG3    . MET A 1 187 ? 22.485  -47.181 8.918   1.00 29.53 ? 187 MET A HG3    1 
ATOM   2610 H  HE1    . MET A 1 187 ? 24.832  -45.086 6.728   1.00 30.10 ? 187 MET A HE1    1 
ATOM   2611 H  HE2    . MET A 1 187 ? 24.619  -46.535 7.343   1.00 30.10 ? 187 MET A HE2    1 
ATOM   2612 H  HE3    . MET A 1 187 ? 23.657  -46.011 6.192   1.00 30.10 ? 187 MET A HE3    1 
ATOM   2613 N  N      . LEU A 1 188 ? 19.152  -47.211 4.762   1.00 21.65 ? 188 LEU A N      1 
ATOM   2614 C  CA     . LEU A 1 188 ? 18.736  -47.782 3.486   1.00 21.04 ? 188 LEU A CA     1 
ATOM   2615 C  C      . LEU A 1 188 ? 18.801  -46.723 2.382   1.00 19.01 ? 188 LEU A C      1 
ATOM   2616 O  O      . LEU A 1 188 ? 19.402  -46.942 1.325   1.00 19.20 ? 188 LEU A O      1 
ATOM   2617 C  CB     . LEU A 1 188 ? 17.319  -48.365 3.592   1.00 26.96 ? 188 LEU A CB     1 
ATOM   2618 C  CG     . LEU A 1 188 ? 16.713  -48.977 2.324   1.00 36.73 ? 188 LEU A CG     1 
ATOM   2619 C  CD1    . LEU A 1 188 ? 17.548  -50.148 1.833   1.00 43.18 ? 188 LEU A CD1    1 
ATOM   2620 C  CD2    . LEU A 1 188 ? 15.274  -49.422 2.561   1.00 42.21 ? 188 LEU A CD2    1 
ATOM   2621 H  H      . LEU A 1 188 ? 18.553  -47.249 5.378   1.00 25.98 ? 188 LEU A H      1 
ATOM   2622 H  HA     . LEU A 1 188 ? 19.341  -48.502 3.248   1.00 25.25 ? 188 LEU A HA     1 
ATOM   2623 H  HB2    . LEU A 1 188 ? 17.330  -49.062 4.266   1.00 32.35 ? 188 LEU A HB2    1 
ATOM   2624 H  HB3    . LEU A 1 188 ? 16.722  -47.656 3.878   1.00 32.35 ? 188 LEU A HB3    1 
ATOM   2625 H  HG     . LEU A 1 188 ? 16.705  -48.305 1.624   1.00 44.08 ? 188 LEU A HG     1 
ATOM   2626 H  HD11   . LEU A 1 188 ? 17.141  -50.513 1.032   1.00 51.82 ? 188 LEU A HD11   1 
ATOM   2627 H  HD12   . LEU A 1 188 ? 18.445  -49.835 1.636   1.00 51.82 ? 188 LEU A HD12   1 
ATOM   2628 H  HD13   . LEU A 1 188 ? 17.579  -50.826 2.527   1.00 51.82 ? 188 LEU A HD13   1 
ATOM   2629 H  HD21   . LEU A 1 188 ? 14.922  -49.803 1.741   1.00 50.65 ? 188 LEU A HD21   1 
ATOM   2630 H  HD22   . LEU A 1 188 ? 15.262  -50.087 3.267   1.00 50.65 ? 188 LEU A HD22   1 
ATOM   2631 H  HD23   . LEU A 1 188 ? 14.744  -48.652 2.822   1.00 50.65 ? 188 LEU A HD23   1 
ATOM   2632 N  N      . MET A 1 189 ? 18.201  -45.567 2.642   1.00 17.70 ? 189 MET A N      1 
ATOM   2633 C  CA     . MET A 1 189 ? 18.181  -44.488 1.665   1.00 16.19 ? 189 MET A CA     1 
ATOM   2634 C  C      . MET A 1 189 ? 19.569  -43.872 1.488   1.00 16.57 ? 189 MET A C      1 
ATOM   2635 O  O      . MET A 1 189 ? 19.952  -43.518 0.376   1.00 16.21 ? 189 MET A O      1 
ATOM   2636 C  CB     . MET A 1 189 ? 17.192  -43.401 2.079   1.00 19.99 ? 189 MET A CB     1 
ATOM   2637 C  CG     . MET A 1 189 ? 15.730  -43.778 1.939   1.00 29.35 ? 189 MET A CG     1 
ATOM   2638 S  SD     . MET A 1 189 ? 14.693  -42.399 2.473   1.00 39.05 ? 189 MET A SD     1 
ATOM   2639 C  CE     . MET A 1 189 ? 13.041  -43.063 2.267   1.00 43.10 ? 189 MET A CE     1 
ATOM   2640 H  H      . MET A 1 189 ? 17.797  -45.382 3.378   1.00 21.24 ? 189 MET A H      1 
ATOM   2641 H  HA     . MET A 1 189 ? 17.887  -44.846 0.813   1.00 19.43 ? 189 MET A HA     1 
ATOM   2642 H  HB2    . MET A 1 189 ? 17.349  -43.179 3.010   1.00 23.99 ? 189 MET A HB2    1 
ATOM   2643 H  HB3    . MET A 1 189 ? 17.346  -42.618 1.528   1.00 23.99 ? 189 MET A HB3    1 
ATOM   2644 H  HG2    . MET A 1 189 ? 15.531  -43.974 1.010   1.00 35.21 ? 189 MET A HG2    1 
ATOM   2645 H  HG3    . MET A 1 189 ? 15.536  -44.546 2.499   1.00 35.21 ? 189 MET A HG3    1 
ATOM   2646 H  HE1    . MET A 1 189 ? 12.396  -42.389 2.531   1.00 51.71 ? 189 MET A HE1    1 
ATOM   2647 H  HE2    . MET A 1 189 ? 12.911  -43.299 1.335   1.00 51.71 ? 189 MET A HE2    1 
ATOM   2648 H  HE3    . MET A 1 189 ? 12.946  -43.850 2.825   1.00 51.71 ? 189 MET A HE3    1 
ATOM   2649 N  N      . ALA A 1 190 ? 20.310  -43.725 2.584   1.00 14.10 ? 190 ALA A N      1 
ATOM   2650 C  CA     . ALA A 1 190 ? 21.651  -43.150 2.511   1.00 14.48 ? 190 ALA A CA     1 
ATOM   2651 C  C      . ALA A 1 190 ? 22.542  -43.980 1.594   1.00 12.36 ? 190 ALA A C      1 
ATOM   2652 O  O      . ALA A 1 190 ? 23.298  -43.437 0.790   1.00 13.61 ? 190 ALA A O      1 
ATOM   2653 C  CB     . ALA A 1 190 ? 22.269  -43.046 3.895   1.00 13.99 ? 190 ALA A CB     1 
ATOM   2654 H  H      . ALA A 1 190 ? 20.062  -43.948 3.377   1.00 16.92 ? 190 ALA A H      1 
ATOM   2655 H  HA     . ALA A 1 190 ? 21.591  -42.255 2.141   1.00 17.38 ? 190 ALA A HA     1 
ATOM   2656 H  HB1    . ALA A 1 190 ? 23.156  -42.662 3.816   1.00 16.79 ? 190 ALA A HB1    1 
ATOM   2657 H  HB2    . ALA A 1 190 ? 21.710  -42.478 4.448   1.00 16.79 ? 190 ALA A HB2    1 
ATOM   2658 H  HB3    . ALA A 1 190 ? 22.325  -43.933 4.282   1.00 16.79 ? 190 ALA A HB3    1 
ATOM   2659 N  N      . GLU A 1 191 ? 22.454  -45.301 1.724   1.00 13.33 ? 191 GLU A N      1 
ATOM   2660 C  CA     . GLU A 1 191 ? 23.229  -46.204 0.885   1.00 14.06 ? 191 GLU A CA     1 
ATOM   2661 C  C      . GLU A 1 191 ? 22.821  -46.051 -0.581  1.00 15.25 ? 191 GLU A C      1 
ATOM   2662 O  O      . GLU A 1 191 ? 23.667  -45.972 -1.464  1.00 16.30 ? 191 GLU A O      1 
ATOM   2663 C  CB     . GLU A 1 191 ? 23.045  -47.654 1.352   1.00 20.29 ? 191 GLU A CB     1 
ATOM   2664 H  H      . GLU A 1 191 ? 21.948  -45.700 2.293   1.00 15.99 ? 191 GLU A H      1 
ATOM   2665 H  HA     . GLU A 1 191 ? 24.170  -45.979 0.961   1.00 16.87 ? 191 GLU A HA     1 
ATOM   2666 N  N      . TYR A 1 192 ? 21.519  -45.988 -0.836  1.00 15.50 ? 192 TYR A N      1 
ATOM   2667 C  CA     . TYR A 1 192 ? 21.031  -45.824 -2.199  1.00 15.20 ? 192 TYR A CA     1 
ATOM   2668 C  C      . TYR A 1 192 ? 21.544  -44.517 -2.818  1.00 15.06 ? 192 TYR A C      1 
ATOM   2669 O  O      . TYR A 1 192 ? 22.044  -44.511 -3.938  1.00 15.62 ? 192 TYR A O      1 
ATOM   2670 C  CB     . TYR A 1 192 ? 19.502  -45.863 -2.226  1.00 16.00 ? 192 TYR A CB     1 
ATOM   2671 C  CG     . TYR A 1 192 ? 18.910  -45.648 -3.599  1.00 22.08 ? 192 TYR A CG     1 
ATOM   2672 C  CD1    . TYR A 1 192 ? 18.621  -46.722 -4.425  1.00 30.77 ? 192 TYR A CD1    1 
ATOM   2673 C  CD2    . TYR A 1 192 ? 18.651  -44.370 -4.072  1.00 23.91 ? 192 TYR A CD2    1 
ATOM   2674 C  CE1    . TYR A 1 192 ? 18.079  -46.530 -5.682  1.00 32.08 ? 192 TYR A CE1    1 
ATOM   2675 C  CE2    . TYR A 1 192 ? 18.107  -44.169 -5.324  1.00 29.87 ? 192 TYR A CE2    1 
ATOM   2676 C  CZ     . TYR A 1 192 ? 17.829  -45.252 -6.127  1.00 35.22 ? 192 TYR A CZ     1 
ATOM   2677 O  OH     . TYR A 1 192 ? 17.292  -45.055 -7.378  1.00 42.64 ? 192 TYR A OH     1 
ATOM   2678 H  H      . TYR A 1 192 ? 20.900  -46.036 -0.241  1.00 18.60 ? 192 TYR A H      1 
ATOM   2679 H  HA     . TYR A 1 192 ? 21.358  -46.560 -2.741  1.00 18.23 ? 192 TYR A HA     1 
ATOM   2680 H  HB2    . TYR A 1 192 ? 19.205  -46.730 -1.907  1.00 19.20 ? 192 TYR A HB2    1 
ATOM   2681 H  HB3    . TYR A 1 192 ? 19.162  -45.165 -1.644  1.00 19.20 ? 192 TYR A HB3    1 
ATOM   2682 H  HD1    . TYR A 1 192 ? 18.790  -47.586 -4.127  1.00 36.92 ? 192 TYR A HD1    1 
ATOM   2683 H  HD2    . TYR A 1 192 ? 18.837  -43.636 -3.531  1.00 28.70 ? 192 TYR A HD2    1 
ATOM   2684 H  HE1    . TYR A 1 192 ? 17.889  -47.260 -6.226  1.00 38.49 ? 192 TYR A HE1    1 
ATOM   2685 H  HE2    . TYR A 1 192 ? 17.938  -43.306 -5.627  1.00 35.84 ? 192 TYR A HE2    1 
ATOM   2686 H  HH     . TYR A 1 192 ? 17.191  -44.233 -7.522  1.00 51.17 ? 192 TYR A HH     1 
ATOM   2687 N  N      . PHE A 1 193 ? 21.424  -43.412 -2.089  1.00 12.61 ? 193 PHE A N      1 
ATOM   2688 C  CA     . PHE A 1 193 ? 21.871  -42.121 -2.604  1.00 14.03 ? 193 PHE A CA     1 
ATOM   2689 C  C      . PHE A 1 193 ? 23.391  -42.091 -2.793  1.00 14.40 ? 193 PHE A C      1 
ATOM   2690 O  O      . PHE A 1 193 ? 23.899  -41.466 -3.723  1.00 15.28 ? 193 PHE A O      1 
ATOM   2691 C  CB     . PHE A 1 193 ? 21.435  -40.990 -1.663  1.00 15.23 ? 193 PHE A CB     1 
ATOM   2692 C  CG     . PHE A 1 193 ? 19.942  -40.773 -1.602  1.00 17.78 ? 193 PHE A CG     1 
ATOM   2693 C  CD1    . PHE A 1 193 ? 19.150  -40.886 -2.734  1.00 19.93 ? 193 PHE A CD1    1 
ATOM   2694 C  CD2    . PHE A 1 193 ? 19.335  -40.447 -0.405  1.00 16.73 ? 193 PHE A CD2    1 
ATOM   2695 C  CE1    . PHE A 1 193 ? 17.782  -40.680 -2.670  1.00 22.78 ? 193 PHE A CE1    1 
ATOM   2696 C  CE2    . PHE A 1 193 ? 17.964  -40.239 -0.336  1.00 17.31 ? 193 PHE A CE2    1 
ATOM   2697 C  CZ     . PHE A 1 193 ? 17.192  -40.357 -1.470  1.00 19.76 ? 193 PHE A CZ     1 
ATOM   2698 H  H      . PHE A 1 193 ? 21.089  -43.382 -1.298  1.00 15.13 ? 193 PHE A H      1 
ATOM   2699 H  HA     . PHE A 1 193 ? 21.459  -41.967 -3.468  1.00 16.84 ? 193 PHE A HA     1 
ATOM   2700 H  HB2    . PHE A 1 193 ? 21.740  -41.197 -0.766  1.00 18.27 ? 193 PHE A HB2    1 
ATOM   2701 H  HB3    . PHE A 1 193 ? 21.841  -40.162 -1.964  1.00 18.27 ? 193 PHE A HB3    1 
ATOM   2702 H  HD1    . PHE A 1 193 ? 19.543  -41.104 -3.549  1.00 23.92 ? 193 PHE A HD1    1 
ATOM   2703 H  HD2    . PHE A 1 193 ? 19.851  -40.365 0.364   1.00 20.07 ? 193 PHE A HD2    1 
ATOM   2704 H  HE1    . PHE A 1 193 ? 17.263  -40.761 -3.437  1.00 27.33 ? 193 PHE A HE1    1 
ATOM   2705 H  HE2    . PHE A 1 193 ? 17.567  -40.021 0.476   1.00 20.78 ? 193 PHE A HE2    1 
ATOM   2706 H  HZ     . PHE A 1 193 ? 16.274  -40.219 -1.425  1.00 23.71 ? 193 PHE A HZ     1 
ATOM   2707 N  N      . ALA A 1 194 ? 24.117  -42.765 -1.908  1.00 12.82 ? 194 ALA A N      1 
ATOM   2708 C  CA     . ALA A 1 194 ? 25.575  -42.799 -1.998  1.00 13.62 ? 194 ALA A CA     1 
ATOM   2709 C  C      . ALA A 1 194 ? 26.020  -43.546 -3.251  1.00 13.25 ? 194 ALA A C      1 
ATOM   2710 O  O      . ALA A 1 194 ? 26.923  -43.109 -3.960  1.00 14.05 ? 194 ALA A O      1 
ATOM   2711 C  CB     . ALA A 1 194 ? 26.168  -43.441 -0.763  1.00 13.13 ? 194 ALA A CB     1 
ATOM   2712 H  H      . ALA A 1 194 ? 23.793  -43.209 -1.247  1.00 15.38 ? 194 ALA A H      1 
ATOM   2713 H  HA     . ALA A 1 194 ? 25.910  -41.890 -2.055  1.00 16.34 ? 194 ALA A HA     1 
ATOM   2714 H  HB1    . ALA A 1 194 ? 27.135  -43.452 -0.846  1.00 15.75 ? 194 ALA A HB1    1 
ATOM   2715 H  HB2    . ALA A 1 194 ? 25.909  -42.925 0.017   1.00 15.75 ? 194 ALA A HB2    1 
ATOM   2716 H  HB3    . ALA A 1 194 ? 25.832  -44.347 -0.686  1.00 15.75 ? 194 ALA A HB3    1 
ATOM   2717 N  N      . ILE A 1 195 ? 25.372  -44.675 -3.518  1.00 14.12 ? 195 ILE A N      1 
ATOM   2718 C  CA     . ILE A 1 195 ? 25.688  -45.475 -4.691  1.00 15.26 ? 195 ILE A CA     1 
ATOM   2719 C  C      . ILE A 1 195 ? 25.423  -44.677 -5.969  1.00 14.34 ? 195 ILE A C      1 
ATOM   2720 O  O      . ILE A 1 195 ? 26.244  -44.687 -6.886  1.00 17.12 ? 195 ILE A O      1 
ATOM   2721 C  CB     . ILE A 1 195 ? 24.883  -46.788 -4.689  1.00 16.30 ? 195 ILE A CB     1 
ATOM   2722 C  CG1    . ILE A 1 195 ? 25.421  -47.708 -3.592  1.00 15.86 ? 195 ILE A CG1    1 
ATOM   2723 C  CG2    . ILE A 1 195 ? 24.955  -47.492 -6.040  1.00 16.86 ? 195 ILE A CG2    1 
ATOM   2724 C  CD1    . ILE A 1 195 ? 24.521  -48.879 -3.257  1.00 18.25 ? 195 ILE A CD1    1 
ATOM   2725 H  H      . ILE A 1 195 ? 24.742  -44.999 -3.032  1.00 16.94 ? 195 ILE A H      1 
ATOM   2726 H  HA     . ILE A 1 195 ? 26.630  -45.703 -4.672  1.00 18.31 ? 195 ILE A HA     1 
ATOM   2727 H  HB     . ILE A 1 195 ? 23.955  -46.583 -4.494  1.00 19.56 ? 195 ILE A HB     1 
ATOM   2728 H  HG12   . ILE A 1 195 ? 26.275  -48.066 -3.880  1.00 19.03 ? 195 ILE A HG12   1 
ATOM   2729 H  HG13   . ILE A 1 195 ? 25.541  -47.188 -2.782  1.00 19.03 ? 195 ILE A HG13   1 
ATOM   2730 H  HG21   . ILE A 1 195 ? 24.437  -48.311 -5.997  1.00 20.24 ? 195 ILE A HG21   1 
ATOM   2731 H  HG22   . ILE A 1 195 ? 24.590  -46.906 -6.721  1.00 20.24 ? 195 ILE A HG22   1 
ATOM   2732 H  HG23   . ILE A 1 195 ? 25.882  -47.697 -6.240  1.00 20.24 ? 195 ILE A HG23   1 
ATOM   2733 H  HD11   . ILE A 1 195 ? 24.937  -49.406 -2.557  1.00 21.90 ? 195 ILE A HD11   1 
ATOM   2734 H  HD12   . ILE A 1 195 ? 23.665  -48.541 -2.953  1.00 21.90 ? 195 ILE A HD12   1 
ATOM   2735 H  HD13   . ILE A 1 195 ? 24.400  -49.421 -4.052  1.00 21.90 ? 195 ILE A HD13   1 
ATOM   2736 N  N      . GLN A 1 196 ? 24.288  -43.983 -6.027  1.00 15.34 ? 196 GLN A N      1 
ATOM   2737 C  CA     . GLN A 1 196 ? 23.973  -43.161 -7.193  1.00 16.78 ? 196 GLN A CA     1 
ATOM   2738 C  C      . GLN A 1 196 ? 25.050  -42.099 -7.404  1.00 16.96 ? 196 GLN A C      1 
ATOM   2739 O  O      . GLN A 1 196 ? 25.460  -41.834 -8.533  1.00 17.18 ? 196 GLN A O      1 
ATOM   2740 C  CB     . GLN A 1 196 ? 22.605  -42.496 -7.044  1.00 20.00 ? 196 GLN A CB     1 
ATOM   2741 H  H      . GLN A 1 196 ? 23.689  -43.970 -5.410  1.00 18.40 ? 196 GLN A H      1 
ATOM   2742 H  HA     . GLN A 1 196 ? 23.949  -43.726 -7.981  1.00 20.13 ? 196 GLN A HA     1 
ATOM   2743 N  N      . MET A 1 197 ? 25.517  -41.497 -6.316  1.00 14.49 ? 197 MET A N      1 
ATOM   2744 C  CA     . MET A 1 197 ? 26.534  -40.462 -6.437  1.00 16.06 ? 197 MET A CA     1 
ATOM   2745 C  C      . MET A 1 197 ? 27.858  -41.061 -6.904  1.00 15.62 ? 197 MET A C      1 
ATOM   2746 O  O      . MET A 1 197 ? 28.577  -40.441 -7.678  1.00 17.65 ? 197 MET A O      1 
ATOM   2747 C  CB     . MET A 1 197 ? 26.729  -39.722 -5.117  1.00 14.71 ? 197 MET A CB     1 
ATOM   2748 C  CG     . MET A 1 197 ? 27.615  -38.489 -5.246  1.00 15.69 ? 197 MET A CG     1 
ATOM   2749 S  SD     . MET A 1 197 ? 26.953  -37.254 -6.400  1.00 17.49 ? 197 MET A SD     1 
ATOM   2750 C  CE     . MET A 1 197 ? 28.191  -35.967 -6.233  1.00 19.91 ? 197 MET A CE     1 
ATOM   2751 H  H      . MET A 1 197 ? 25.268  -41.666 -5.511  1.00 17.39 ? 197 MET A H      1 
ATOM   2752 H  HA     . MET A 1 197 ? 26.238  -39.813 -7.095  1.00 19.27 ? 197 MET A HA     1 
ATOM   2753 H  HB2    . MET A 1 197 ? 25.863  -39.435 -4.787  1.00 17.65 ? 197 MET A HB2    1 
ATOM   2754 H  HB3    . MET A 1 197 ? 27.144  -40.323 -4.479  1.00 17.65 ? 197 MET A HB3    1 
ATOM   2755 H  HG2    . MET A 1 197 ? 27.698  -38.069 -4.375  1.00 18.83 ? 197 MET A HG2    1 
ATOM   2756 H  HG3    . MET A 1 197 ? 28.488  -38.761 -5.567  1.00 18.83 ? 197 MET A HG3    1 
ATOM   2757 H  HE1    . MET A 1 197 ? 27.954  -35.225 -6.812  1.00 23.89 ? 197 MET A HE1    1 
ATOM   2758 H  HE2    . MET A 1 197 ? 28.216  -35.671 -5.310  1.00 23.89 ? 197 MET A HE2    1 
ATOM   2759 H  HE3    . MET A 1 197 ? 29.055  -36.325 -6.490  1.00 23.89 ? 197 MET A HE3    1 
ATOM   2760 N  N      . CYS A 1 198 ? 28.175  -42.268 -6.444  1.00 14.51 ? 198 CYS A N      1 
ATOM   2761 C  CA     . CYS A 1 198 ? 29.386  -42.940 -6.909  1.00 15.06 ? 198 CYS A CA     1 
ATOM   2762 C  C      . CYS A 1 198 ? 29.349  -43.140 -8.422  1.00 16.70 ? 198 CYS A C      1 
ATOM   2763 O  O      . CYS A 1 198 ? 30.367  -42.979 -9.093  1.00 18.43 ? 198 CYS A O      1 
ATOM   2764 C  CB     . CYS A 1 198 ? 29.575  -44.285 -6.209  1.00 15.62 ? 198 CYS A CB     1 
ATOM   2765 S  SG     . CYS A 1 198 ? 30.086  -44.164 -4.482  1.00 18.62 ? 198 CYS A SG     1 
ATOM   2766 H  H      . CYS A 1 198 ? 27.715  -42.714 -5.871  1.00 17.41 ? 198 CYS A H      1 
ATOM   2767 H  HA     . CYS A 1 198 ? 30.153  -42.384 -6.700  1.00 18.07 ? 198 CYS A HA     1 
ATOM   2768 H  HB2    . CYS A 1 198 ? 28.735  -44.769 -6.234  1.00 18.74 ? 198 CYS A HB2    1 
ATOM   2769 H  HB3    . CYS A 1 198 ? 30.256  -44.788 -6.682  1.00 18.74 ? 198 CYS A HB3    1 
ATOM   2770 H  HG     . CYS A 1 198 ? 29.250  -43.560 -3.869  1.00 22.34 ? 198 CYS A HG     1 
ATOM   2771 N  N      . ARG A 1 199 ? 28.182  -43.484 -8.962  1.00 17.10 ? 199 ARG A N      1 
ATOM   2772 C  CA     . ARG A 1 199 ? 28.043  -43.615 -10.410 1.00 17.49 ? 199 ARG A CA     1 
ATOM   2773 C  C      . ARG A 1 199 ? 28.266  -42.270 -11.105 1.00 19.72 ? 199 ARG A C      1 
ATOM   2774 O  O      . ARG A 1 199 ? 28.912  -42.197 -12.152 1.00 22.28 ? 199 ARG A O      1 
ATOM   2775 C  CB     . ARG A 1 199 ? 26.664  -44.169 -10.780 1.00 18.17 ? 199 ARG A CB     1 
ATOM   2776 C  CG     . ARG A 1 199 ? 26.402  -45.606 -10.332 1.00 19.85 ? 199 ARG A CG     1 
ATOM   2777 C  CD     . ARG A 1 199 ? 27.420  -46.595 -10.893 1.00 22.50 ? 199 ARG A CD     1 
ATOM   2778 N  NE     . ARG A 1 199 ? 28.580  -46.742 -10.019 1.00 19.06 ? 199 ARG A NE     1 
ATOM   2779 C  CZ     . ARG A 1 199 ? 28.588  -47.458 -8.898  1.00 18.87 ? 199 ARG A CZ     1 
ATOM   2780 N  NH1    . ARG A 1 199 ? 27.494  -48.100 -8.502  1.00 19.11 ? 199 ARG A NH1    1 
ATOM   2781 N  NH2    . ARG A 1 199 ? 29.692  -47.532 -8.166  1.00 18.98 ? 199 ARG A NH2    1 
ATOM   2782 H  H      . ARG A 1 199 ? 27.463  -43.644 -8.518  1.00 20.52 ? 199 ARG A H      1 
ATOM   2783 H  HA     . ARG A 1 199 ? 28.713  -44.236 -10.736 1.00 20.99 ? 199 ARG A HA     1 
ATOM   2784 H  HB2    . ARG A 1 199 ? 25.986  -43.608 -10.373 1.00 21.80 ? 199 ARG A HB2    1 
ATOM   2785 H  HB3    . ARG A 1 199 ? 26.571  -44.143 -11.745 1.00 21.80 ? 199 ARG A HB3    1 
ATOM   2786 H  HG2    . ARG A 1 199 ? 26.446  -45.647 -9.363  1.00 23.82 ? 199 ARG A HG2    1 
ATOM   2787 H  HG3    . ARG A 1 199 ? 25.522  -45.876 -10.636 1.00 23.82 ? 199 ARG A HG3    1 
ATOM   2788 H  HD2    . ARG A 1 199 ? 27.000  -47.464 -10.987 1.00 27.00 ? 199 ARG A HD2    1 
ATOM   2789 H  HD3    . ARG A 1 199 ? 27.730  -46.277 -11.755 1.00 27.00 ? 199 ARG A HD3    1 
ATOM   2790 H  HE     . ARG A 1 199 ? 29.306  -46.339 -10.244 1.00 22.87 ? 199 ARG A HE     1 
ATOM   2791 H  HH11   . ARG A 1 199 ? 26.776  -48.055 -8.972  1.00 22.94 ? 199 ARG A HH11   1 
ATOM   2792 H  HH12   . ARG A 1 199 ? 27.505  -48.561 -7.776  1.00 22.94 ? 199 ARG A HH12   1 
ATOM   2793 H  HH21   . ARG A 1 199 ? 30.403  -47.119 -8.417  1.00 22.78 ? 199 ARG A HH21   1 
ATOM   2794 H  HH22   . ARG A 1 199 ? 29.697  -47.995 -7.441  1.00 22.78 ? 199 ARG A HH22   1 
ATOM   2795 N  N      . GLU A 1 200 ? 27.733  -41.204 -10.520 1.00 20.18 ? 200 GLU A N      1 
ATOM   2796 C  CA     . GLU A 1 200 ? 27.822  -39.888 -11.140 1.00 20.43 ? 200 GLU A CA     1 
ATOM   2797 C  C      . GLU A 1 200 ? 29.262  -39.375 -11.204 1.00 21.48 ? 200 GLU A C      1 
ATOM   2798 O  O      . GLU A 1 200 ? 29.640  -38.719 -12.178 1.00 25.06 ? 200 GLU A O      1 
ATOM   2799 C  CB     . GLU A 1 200 ? 26.940  -38.886 -10.393 1.00 22.23 ? 200 GLU A CB     1 
ATOM   2800 C  CG     . GLU A 1 200 ? 26.892  -37.519 -11.053 1.00 28.08 ? 200 GLU A CG     1 
ATOM   2801 C  CD     . GLU A 1 200 ? 25.731  -36.659 -10.585 1.00 32.41 ? 200 GLU A CD     1 
ATOM   2802 O  OE1    . GLU A 1 200 ? 24.905  -37.128 -9.768  1.00 27.79 ? 200 GLU A OE1    1 
ATOM   2803 O  OE2    . GLU A 1 200 ? 25.644  -35.507 -11.053 1.00 34.26 ? 200 GLU A OE2    1 
ATOM   2804 H  H      . GLU A 1 200 ? 27.317  -41.215 -9.767  1.00 24.22 ? 200 GLU A H      1 
ATOM   2805 H  HA     . GLU A 1 200 ? 27.491  -39.951 -12.049 1.00 24.52 ? 200 GLU A HA     1 
ATOM   2806 H  HB2    . GLU A 1 200 ? 26.034  -39.231 -10.356 1.00 26.67 ? 200 GLU A HB2    1 
ATOM   2807 H  HB3    . GLU A 1 200 ? 27.287  -38.771 -9.494  1.00 26.67 ? 200 GLU A HB3    1 
ATOM   2808 H  HG2    . GLU A 1 200 ? 27.713  -37.044 -10.852 1.00 33.70 ? 200 GLU A HG2    1 
ATOM   2809 H  HG3    . GLU A 1 200 ? 26.807  -37.637 -12.012 1.00 33.70 ? 200 GLU A HG3    1 
ATOM   2810 N  N      . ILE A 1 201 ? 30.065  -39.683 -10.187 1.00 20.18 ? 201 ILE A N      1 
ATOM   2811 C  CA     . ILE A 1 201 ? 31.460  -39.238 -10.164 1.00 19.18 ? 201 ILE A CA     1 
ATOM   2812 C  C      . ILE A 1 201 ? 32.437  -40.383 -10.482 1.00 20.62 ? 201 ILE A C      1 
ATOM   2813 O  O      . ILE A 1 201 ? 33.651  -40.248 -10.300 1.00 23.63 ? 201 ILE A O      1 
ATOM   2814 C  CB     . ILE A 1 201 ? 31.819  -38.581 -8.807  1.00 22.51 ? 201 ILE A CB     1 
ATOM   2815 C  CG1    . ILE A 1 201 ? 31.816  -39.594 -7.659  1.00 21.37 ? 201 ILE A CG1    1 
ATOM   2816 C  CG2    . ILE A 1 201 ? 30.849  -37.426 -8.517  1.00 22.49 ? 201 ILE A CG2    1 
ATOM   2817 C  CD1    . ILE A 1 201 ? 32.329  -39.019 -6.340  1.00 24.42 ? 201 ILE A CD1    1 
ATOM   2818 H  H      . ILE A 1 201 ? 29.830  -40.146 -9.501  1.00 24.22 ? 201 ILE A H      1 
ATOM   2819 H  HA     . ILE A 1 201 ? 31.575  -38.562 -10.851 1.00 23.01 ? 201 ILE A HA     1 
ATOM   2820 H  HB     . ILE A 1 201 ? 32.713  -38.212 -8.879  1.00 27.01 ? 201 ILE A HB     1 
ATOM   2821 H  HG12   . ILE A 1 201 ? 30.908  -39.903 -7.515  1.00 25.65 ? 201 ILE A HG12   1 
ATOM   2822 H  HG13   . ILE A 1 201 ? 32.385  -40.342 -7.899  1.00 25.65 ? 201 ILE A HG13   1 
ATOM   2823 H  HG21   . ILE A 1 201 ? 31.083  -37.024 -7.666  1.00 26.99 ? 201 ILE A HG21   1 
ATOM   2824 H  HG22   . ILE A 1 201 ? 30.922  -36.768 -9.226  1.00 26.99 ? 201 ILE A HG22   1 
ATOM   2825 H  HG23   . ILE A 1 201 ? 29.945  -37.776 -8.481  1.00 26.99 ? 201 ILE A HG23   1 
ATOM   2826 H  HD11   . ILE A 1 201 ? 32.299  -39.712 -5.661  1.00 29.31 ? 201 ILE A HD11   1 
ATOM   2827 H  HD12   . ILE A 1 201 ? 33.242  -38.715 -6.463  1.00 29.31 ? 201 ILE A HD12   1 
ATOM   2828 H  HD13   . ILE A 1 201 ? 31.764  -38.275 -6.079  1.00 29.31 ? 201 ILE A HD13   1 
ATOM   2829 N  N      . LYS A 1 202 ? 31.891  -41.496 -10.966 1.00 20.28 ? 202 LYS A N      1 
ATOM   2830 C  CA     . LYS A 1 202 ? 32.667  -42.594 -11.561 1.00 22.31 ? 202 LYS A CA     1 
ATOM   2831 C  C      . LYS A 1 202 ? 33.624  -43.292 -10.593 1.00 20.80 ? 202 LYS A C      1 
ATOM   2832 O  O      . LYS A 1 202 ? 34.731  -43.695 -10.971 1.00 26.26 ? 202 LYS A O      1 
ATOM   2833 C  CB     . LYS A 1 202 ? 33.437  -42.078 -12.780 1.00 27.10 ? 202 LYS A CB     1 
ATOM   2834 C  CG     . LYS A 1 202 ? 32.514  -41.486 -13.831 1.00 30.88 ? 202 LYS A CG     1 
ATOM   2835 C  CD     . LYS A 1 202 ? 33.113  -41.485 -15.223 1.00 40.21 ? 202 LYS A CD     1 
ATOM   2836 C  CE     . LYS A 1 202 ? 32.180  -40.794 -16.207 1.00 47.79 ? 202 LYS A CE     1 
ATOM   2837 N  NZ     . LYS A 1 202 ? 30.781  -41.308 -16.114 1.00 50.68 ? 202 LYS A NZ     1 
ATOM   2838 H  H      . LYS A 1 202 ? 31.044  -41.647 -10.963 1.00 24.34 ? 202 LYS A H      1 
ATOM   2839 H  HA     . LYS A 1 202 ? 32.043  -43.265 -11.879 1.00 26.77 ? 202 LYS A HA     1 
ATOM   2840 H  HB2    . LYS A 1 202 ? 34.056  -41.387 -12.497 1.00 32.51 ? 202 LYS A HB2    1 
ATOM   2841 H  HB3    . LYS A 1 202 ? 33.922  -42.815 -13.185 1.00 32.51 ? 202 LYS A HB3    1 
ATOM   2842 H  HG2    . LYS A 1 202 ? 31.695  -42.006 -13.859 1.00 37.05 ? 202 LYS A HG2    1 
ATOM   2843 H  HG3    . LYS A 1 202 ? 32.313  -40.568 -13.591 1.00 37.05 ? 202 LYS A HG3    1 
ATOM   2844 H  HD2    . LYS A 1 202 ? 33.956  -41.005 -15.210 1.00 48.25 ? 202 LYS A HD2    1 
ATOM   2845 H  HD3    . LYS A 1 202 ? 33.248  -42.399 -15.517 1.00 48.25 ? 202 LYS A HD3    1 
ATOM   2846 H  HE2    . LYS A 1 202 ? 32.166  -39.843 -16.018 1.00 57.34 ? 202 LYS A HE2    1 
ATOM   2847 H  HE3    . LYS A 1 202 ? 32.499  -40.950 -17.110 1.00 57.34 ? 202 LYS A HE3    1 
ATOM   2848 H  HZ1    . LYS A 1 202 ? 30.262  -40.885 -16.700 1.00 60.82 ? 202 LYS A HZ1    1 
ATOM   2849 H  HZ2    . LYS A 1 202 ? 30.766  -42.180 -16.289 1.00 60.82 ? 202 LYS A HZ2    1 
ATOM   2850 H  HZ3    . LYS A 1 202 ? 30.462  -41.172 -15.294 1.00 60.82 ? 202 LYS A HZ3    1 
ATOM   2851 N  N      . LEU A 1 203 ? 33.182  -43.448 -9.351  1.00 19.26 ? 203 LEU A N      1 
ATOM   2852 C  CA     . LEU A 1 203 ? 33.861  -44.312 -8.391  1.00 19.08 ? 203 LEU A CA     1 
ATOM   2853 C  C      . LEU A 1 203 ? 33.453  -45.762 -8.650  1.00 20.47 ? 203 LEU A C      1 
ATOM   2854 O  O      . LEU A 1 203 ? 32.288  -46.036 -8.930  1.00 20.48 ? 203 LEU A O      1 
ATOM   2855 C  CB     . LEU A 1 203 ? 33.517  -43.907 -6.954  1.00 21.01 ? 203 LEU A CB     1 
ATOM   2856 C  CG     . LEU A 1 203 ? 34.157  -42.621 -6.426  1.00 23.10 ? 203 LEU A CG     1 
ATOM   2857 C  CD1    . LEU A 1 203 ? 33.627  -42.297 -5.041  1.00 24.88 ? 203 LEU A CD1    1 
ATOM   2858 C  CD2    . LEU A 1 203 ? 35.674  -42.737 -6.400  1.00 25.05 ? 203 LEU A CD2    1 
ATOM   2859 H  H      . LEU A 1 203 ? 32.482  -43.060 -9.035  1.00 23.11 ? 203 LEU A H      1 
ATOM   2860 H  HA     . LEU A 1 203 ? 34.820  -44.237 -8.510  1.00 22.90 ? 203 LEU A HA     1 
ATOM   2861 H  HB2    . LEU A 1 203 ? 32.556  -43.794 -6.894  1.00 25.22 ? 203 LEU A HB2    1 
ATOM   2862 H  HB3    . LEU A 1 203 ? 33.791  -44.626 -6.364  1.00 25.22 ? 203 LEU A HB3    1 
ATOM   2863 H  HG     . LEU A 1 203 ? 33.923  -41.887 -7.015  1.00 27.72 ? 203 LEU A HG     1 
ATOM   2864 H  HD11   . LEU A 1 203 ? 34.045  -41.480 -4.726  1.00 29.86 ? 203 LEU A HD11   1 
ATOM   2865 H  HD12   . LEU A 1 203 ? 32.666  -42.178 -5.090  1.00 29.86 ? 203 LEU A HD12   1 
ATOM   2866 H  HD13   . LEU A 1 203 ? 33.840  -43.029 -4.442  1.00 29.86 ? 203 LEU A HD13   1 
ATOM   2867 H  HD21   . LEU A 1 203 ? 36.048  -41.908 -6.062  1.00 30.06 ? 203 LEU A HD21   1 
ATOM   2868 H  HD22   . LEU A 1 203 ? 35.924  -43.474 -5.821  1.00 30.06 ? 203 LEU A HD22   1 
ATOM   2869 H  HD23   . LEU A 1 203 ? 35.993  -42.900 -7.302  1.00 30.06 ? 203 LEU A HD23   1 
ATOM   2870 N  N      . PRO A 1 204 ? 34.407  -46.700 -8.560  1.00 18.33 ? 204 PRO A N      1 
ATOM   2871 C  CA     . PRO A 1 204 ? 34.073  -48.088 -8.906  1.00 20.03 ? 204 PRO A CA     1 
ATOM   2872 C  C      . PRO A 1 204 ? 33.117  -48.768 -7.933  1.00 17.91 ? 204 PRO A C      1 
ATOM   2873 O  O      . PRO A 1 204 ? 32.391  -49.669 -8.345  1.00 17.98 ? 204 PRO A O      1 
ATOM   2874 C  CB     . PRO A 1 204 ? 35.435  -48.790 -8.887  1.00 21.39 ? 204 PRO A CB     1 
ATOM   2875 C  CG     . PRO A 1 204 ? 36.291  -47.945 -8.011  1.00 23.72 ? 204 PRO A CG     1 
ATOM   2876 C  CD     . PRO A 1 204 ? 35.838  -46.540 -8.251  1.00 20.49 ? 204 PRO A CD     1 
ATOM   2877 H  HA     . PRO A 1 204 ? 33.704  -48.131 -9.802  1.00 24.04 ? 204 PRO A HA     1 
ATOM   2878 H  HB2    . PRO A 1 204 ? 35.338  -49.681 -8.516  1.00 25.67 ? 204 PRO A HB2    1 
ATOM   2879 H  HB3    . PRO A 1 204 ? 35.796  -48.828 -9.786  1.00 25.67 ? 204 PRO A HB3    1 
ATOM   2880 H  HG2    . PRO A 1 204 ? 36.156  -48.194 -7.084  1.00 28.47 ? 204 PRO A HG2    1 
ATOM   2881 H  HG3    . PRO A 1 204 ? 37.222  -48.052 -8.263  1.00 28.47 ? 204 PRO A HG3    1 
ATOM   2882 H  HD2    . PRO A 1 204 ? 35.955  -46.005 -7.450  1.00 24.59 ? 204 PRO A HD2    1 
ATOM   2883 H  HD3    . PRO A 1 204 ? 36.308  -46.157 -9.008  1.00 24.59 ? 204 PRO A HD3    1 
ATOM   2884 N  N      . LEU A 1 205 ? 33.127  -48.347 -6.673  1.00 18.72 ? 205 LEU A N      1 
ATOM   2885 C  CA     . LEU A 1 205 ? 32.326  -48.987 -5.633  1.00 17.93 ? 205 LEU A CA     1 
ATOM   2886 C  C      . LEU A 1 205 ? 32.090  -48.008 -4.493  1.00 17.35 ? 205 LEU A C      1 
ATOM   2887 O  O      . LEU A 1 205 ? 32.972  -47.217 -4.165  1.00 21.52 ? 205 LEU A O      1 
ATOM   2888 C  CB     . LEU A 1 205 ? 33.036  -50.242 -5.108  1.00 19.19 ? 205 LEU A CB     1 
ATOM   2889 C  CG     . LEU A 1 205 ? 32.208  -51.254 -4.310  1.00 22.26 ? 205 LEU A CG     1 
ATOM   2890 C  CD1    . LEU A 1 205 ? 31.260  -52.016 -5.227  1.00 23.26 ? 205 LEU A CD1    1 
ATOM   2891 C  CD2    . LEU A 1 205 ? 33.112  -52.220 -3.558  1.00 30.48 ? 205 LEU A CD2    1 
ATOM   2892 H  H      . LEU A 1 205 ? 33.595  -47.683 -6.390  1.00 22.47 ? 205 LEU A H      1 
ATOM   2893 H  HA     . LEU A 1 205 ? 31.467  -49.248 -5.999  1.00 21.52 ? 205 LEU A HA     1 
ATOM   2894 H  HB2    . LEU A 1 205 ? 33.404  -50.716 -5.869  1.00 23.03 ? 205 LEU A HB2    1 
ATOM   2895 H  HB3    . LEU A 1 205 ? 33.761  -49.955 -4.532  1.00 23.03 ? 205 LEU A HB3    1 
ATOM   2896 H  HG     . LEU A 1 205 ? 31.672  -50.777 -3.657  1.00 26.71 ? 205 LEU A HG     1 
ATOM   2897 H  HD11   . LEU A 1 205 ? 30.750  -52.649 -4.698  1.00 27.91 ? 205 LEU A HD11   1 
ATOM   2898 H  HD12   . LEU A 1 205 ? 30.662  -51.385 -5.657  1.00 27.91 ? 205 LEU A HD12   1 
ATOM   2899 H  HD13   . LEU A 1 205 ? 31.780  -52.487 -5.897  1.00 27.91 ? 205 LEU A HD13   1 
ATOM   2900 H  HD21   . LEU A 1 205 ? 32.562  -52.847 -3.063  1.00 36.58 ? 205 LEU A HD21   1 
ATOM   2901 H  HD22   . LEU A 1 205 ? 33.666  -52.696 -4.196  1.00 36.58 ? 205 LEU A HD22   1 
ATOM   2902 H  HD23   . LEU A 1 205 ? 33.671  -51.716 -2.945  1.00 36.58 ? 205 LEU A HD23   1 
ATOM   2903 N  N      . PHE A 1 206 ? 30.908  -48.046 -3.889  1.00 17.54 ? 206 PHE A N      1 
ATOM   2904 C  CA     . PHE A 1 206 ? 30.697  -47.296 -2.659  1.00 17.41 ? 206 PHE A CA     1 
ATOM   2905 C  C      . PHE A 1 206 ? 31.395  -48.049 -1.526  1.00 14.62 ? 206 PHE A C      1 
ATOM   2906 O  O      . PHE A 1 206 ? 31.083  -49.215 -1.278  1.00 17.98 ? 206 PHE A O      1 
ATOM   2907 C  CB     . PHE A 1 206 ? 29.214  -47.107 -2.338  1.00 17.23 ? 206 PHE A CB     1 
ATOM   2908 C  CG     . PHE A 1 206 ? 28.983  -46.443 -1.014  1.00 18.25 ? 206 PHE A CG     1 
ATOM   2909 C  CD1    . PHE A 1 206 ? 29.496  -45.186 -0.767  1.00 18.35 ? 206 PHE A CD1    1 
ATOM   2910 C  CD2    . PHE A 1 206 ? 28.285  -47.080 -0.009  1.00 19.82 ? 206 PHE A CD2    1 
ATOM   2911 C  CE1    . PHE A 1 206 ? 29.314  -44.573 0.453   1.00 19.88 ? 206 PHE A CE1    1 
ATOM   2912 C  CE2    . PHE A 1 206 ? 28.093  -46.468 1.212   1.00 19.13 ? 206 PHE A CE2    1 
ATOM   2913 C  CZ     . PHE A 1 206 ? 28.611  -45.215 1.442   1.00 19.48 ? 206 PHE A CZ     1 
ATOM   2914 H  H      . PHE A 1 206 ? 30.224  -48.489 -4.165  1.00 21.05 ? 206 PHE A H      1 
ATOM   2915 H  HA     . PHE A 1 206 ? 31.106  -46.420 -2.742  1.00 20.89 ? 206 PHE A HA     1 
ATOM   2916 H  HB2    . PHE A 1 206 ? 28.810  -46.554 -3.025  1.00 20.67 ? 206 PHE A HB2    1 
ATOM   2917 H  HB3    . PHE A 1 206 ? 28.783  -47.976 -2.316  1.00 20.67 ? 206 PHE A HB3    1 
ATOM   2918 H  HD1    . PHE A 1 206 ? 29.977  -44.748 -1.432  1.00 22.02 ? 206 PHE A HD1    1 
ATOM   2919 H  HD2    . PHE A 1 206 ? 27.937  -47.929 -0.158  1.00 23.79 ? 206 PHE A HD2    1 
ATOM   2920 H  HE1    . PHE A 1 206 ? 29.660  -43.723 0.605   1.00 23.85 ? 206 PHE A HE1    1 
ATOM   2921 H  HE2    . PHE A 1 206 ? 27.618  -46.905 1.881   1.00 22.95 ? 206 PHE A HE2    1 
ATOM   2922 H  HZ     . PHE A 1 206 ? 28.479  -44.801 2.264   1.00 23.37 ? 206 PHE A HZ     1 
ATOM   2923 N  N      . PRO A 1 207 ? 32.347  -47.395 -0.837  1.00 17.11 ? 207 PRO A N      1 
ATOM   2924 C  CA     . PRO A 1 207 ? 33.170  -48.130 0.135   1.00 18.91 ? 207 PRO A CA     1 
ATOM   2925 C  C      . PRO A 1 207 ? 32.537  -48.320 1.515   1.00 19.36 ? 207 PRO A C      1 
ATOM   2926 O  O      . PRO A 1 207 ? 33.182  -48.879 2.403   1.00 20.44 ? 207 PRO A O      1 
ATOM   2927 C  CB     . PRO A 1 207 ? 34.422  -47.261 0.241   1.00 18.71 ? 207 PRO A CB     1 
ATOM   2928 C  CG     . PRO A 1 207 ? 33.937  -45.890 -0.020  1.00 18.91 ? 207 PRO A CG     1 
ATOM   2929 C  CD     . PRO A 1 207 ? 32.873  -46.037 -1.070  1.00 15.64 ? 207 PRO A CD     1 
ATOM   2930 H  HA     . PRO A 1 207 ? 33.415  -48.997 -0.225  1.00 22.70 ? 207 PRO A HA     1 
ATOM   2931 H  HB2    . PRO A 1 207 ? 34.797  -47.331 1.133   1.00 22.46 ? 207 PRO A HB2    1 
ATOM   2932 H  HB3    . PRO A 1 207 ? 35.069  -47.532 -0.429  1.00 22.46 ? 207 PRO A HB3    1 
ATOM   2933 H  HG2    . PRO A 1 207 ? 33.566  -45.515 0.794   1.00 22.69 ? 207 PRO A HG2    1 
ATOM   2934 H  HG3    . PRO A 1 207 ? 34.668  -45.343 -0.347  1.00 22.69 ? 207 PRO A HG3    1 
ATOM   2935 H  HD2    . PRO A 1 207 ? 32.175  -45.376 -0.937  1.00 18.77 ? 207 PRO A HD2    1 
ATOM   2936 H  HD3    . PRO A 1 207 ? 33.261  -45.972 -1.956  1.00 18.77 ? 207 PRO A HD3    1 
ATOM   2937 N  N      . GLY A 1 208 ? 31.301  -47.862 1.690   1.00 16.32 ? 208 GLY A N      1 
ATOM   2938 C  CA     . GLY A 1 208 ? 30.583  -48.056 2.937   1.00 16.40 ? 208 GLY A CA     1 
ATOM   2939 C  C      . GLY A 1 208 ? 30.638  -46.865 3.876   1.00 17.25 ? 208 GLY A C      1 
ATOM   2940 O  O      . GLY A 1 208 ? 31.384  -45.911 3.647   1.00 18.57 ? 208 GLY A O      1 
ATOM   2941 H  H      . GLY A 1 208 ? 30.855  -47.432 1.093   1.00 19.58 ? 208 GLY A H      1 
ATOM   2942 H  HA2    . GLY A 1 208 ? 29.652  -48.242 2.741   1.00 19.68 ? 208 GLY A HA2    1 
ATOM   2943 H  HA3    . GLY A 1 208 ? 30.954  -48.823 3.400   1.00 19.68 ? 208 GLY A HA3    1 
ATOM   2944 N  N      . PHE A 1 209 ? 29.833  -46.933 4.932   1.00 16.81 ? 209 PHE A N      1 
ATOM   2945 C  CA     . PHE A 1 209 ? 29.813  -45.921 5.988   1.00 16.23 ? 209 PHE A CA     1 
ATOM   2946 C  C      . PHE A 1 209 ? 30.486  -46.455 7.249   1.00 13.54 ? 209 PHE A C      1 
ATOM   2947 O  O      . PHE A 1 209 ? 30.165  -47.557 7.703   1.00 16.25 ? 209 PHE A O      1 
ATOM   2948 C  CB     . PHE A 1 209 ? 28.383  -45.512 6.352   1.00 16.36 ? 209 PHE A CB     1 
ATOM   2949 C  CG     . PHE A 1 209 ? 27.619  -44.830 5.248   1.00 16.27 ? 209 PHE A CG     1 
ATOM   2950 C  CD1    . PHE A 1 209 ? 27.878  -43.513 4.911   1.00 17.35 ? 209 PHE A CD1    1 
ATOM   2951 C  CD2    . PHE A 1 209 ? 26.601  -45.493 4.589   1.00 19.44 ? 209 PHE A CD2    1 
ATOM   2952 C  CE1    . PHE A 1 209 ? 27.159  -42.886 3.915   1.00 20.88 ? 209 PHE A CE1    1 
ATOM   2953 C  CE2    . PHE A 1 209 ? 25.873  -44.864 3.592   1.00 18.65 ? 209 PHE A CE2    1 
ATOM   2954 C  CZ     . PHE A 1 209 ? 26.152  -43.562 3.257   1.00 20.15 ? 209 PHE A CZ     1 
ATOM   2955 H  H      . PHE A 1 209 ? 29.273  -47.573 5.064   1.00 20.17 ? 209 PHE A H      1 
ATOM   2956 H  HA     . PHE A 1 209 ? 30.294  -45.133 5.691   1.00 19.47 ? 209 PHE A HA     1 
ATOM   2957 H  HB2    . PHE A 1 209 ? 27.888  -46.307 6.603   1.00 19.63 ? 209 PHE A HB2    1 
ATOM   2958 H  HB3    . PHE A 1 209 ? 28.418  -44.900 7.104   1.00 19.63 ? 209 PHE A HB3    1 
ATOM   2959 H  HD1    . PHE A 1 209 ? 28.555  -43.050 5.351   1.00 20.82 ? 209 PHE A HD1    1 
ATOM   2960 H  HD2    . PHE A 1 209 ? 26.407  -46.375 4.814   1.00 23.33 ? 209 PHE A HD2    1 
ATOM   2961 H  HE1    . PHE A 1 209 ? 27.349  -42.003 3.690   1.00 25.06 ? 209 PHE A HE1    1 
ATOM   2962 H  HE2    . PHE A 1 209 ? 25.198  -45.324 3.148   1.00 22.39 ? 209 PHE A HE2    1 
ATOM   2963 H  HZ     . PHE A 1 209 ? 25.669  -43.140 2.584   1.00 24.18 ? 209 PHE A HZ     1 
ATOM   2964 N  N      . THR A 1 210 ? 31.382  -45.669 7.837   1.00 15.84 ? 210 THR A N      1 
ATOM   2965 C  CA     . THR A 1 210 ? 31.936  -46.022 9.138   1.00 17.02 ? 210 THR A CA     1 
ATOM   2966 C  C      . THR A 1 210 ? 30.863  -45.903 10.212  1.00 13.69 ? 210 THR A C      1 
ATOM   2967 O  O      . THR A 1 210 ? 29.812  -45.297 9.990   1.00 15.52 ? 210 THR A O      1 
ATOM   2968 C  CB     . THR A 1 210 ? 33.104  -45.127 9.542   1.00 19.34 ? 210 THR A CB     1 
ATOM   2969 O  OG1    . THR A 1 210 ? 32.615  -43.801 9.762   1.00 18.03 ? 210 THR A OG1    1 
ATOM   2970 C  CG2    . THR A 1 210 ? 34.195  -45.121 8.473   1.00 18.40 ? 210 THR A CG2    1 
ATOM   2971 H  H      . THR A 1 210 ? 31.682  -44.933 7.508   1.00 19.00 ? 210 THR A H      1 
ATOM   2972 H  HA     . THR A 1 210 ? 32.248  -46.941 9.117   1.00 20.43 ? 210 THR A HA     1 
ATOM   2973 H  HB     . THR A 1 210 ? 33.491  -45.463 10.366  1.00 23.20 ? 210 THR A HB     1 
ATOM   2974 H  HG1    . THR A 1 210 ? 33.247  -43.295 9.985   1.00 21.64 ? 210 THR A HG1    1 
ATOM   2975 H  HG21   . THR A 1 210 ? 34.926  -44.547 8.749   1.00 22.08 ? 210 THR A HG21   1 
ATOM   2976 H  HG22   . THR A 1 210 ? 34.533  -46.020 8.340   1.00 22.08 ? 210 THR A HG22   1 
ATOM   2977 H  HG23   . THR A 1 210 ? 33.835  -44.792 7.634   1.00 22.08 ? 210 THR A HG23   1 
ATOM   2978 N  N      . GLU A 1 211 ? 31.137  -46.469 11.382  1.00 16.48 ? 211 GLU A N      1 
ATOM   2979 C  CA     . GLU A 1 211 ? 30.225  -46.355 12.509  1.00 16.10 ? 211 GLU A CA     1 
ATOM   2980 C  C      . GLU A 1 211 ? 30.038  -44.882 12.895  1.00 15.50 ? 211 GLU A C      1 
ATOM   2981 O  O      . GLU A 1 211 ? 28.935  -44.478 13.260  1.00 19.31 ? 211 GLU A O      1 
ATOM   2982 C  CB     . GLU A 1 211 ? 30.741  -47.171 13.697  1.00 18.83 ? 211 GLU A CB     1 
ATOM   2983 C  CG     . GLU A 1 211 ? 29.765  -47.287 14.870  1.00 19.66 ? 211 GLU A CG     1 
ATOM   2984 C  CD     . GLU A 1 211 ? 28.588  -48.233 14.623  1.00 20.57 ? 211 GLU A CD     1 
ATOM   2985 O  OE1    . GLU A 1 211 ? 28.474  -48.830 13.528  1.00 19.60 ? 211 GLU A OE1    1 
ATOM   2986 O  OE2    . GLU A 1 211 ? 27.763  -48.376 15.549  1.00 22.44 ? 211 GLU A OE2    1 
ATOM   2987 H  H      . GLU A 1 211 ? 31.846  -46.926 11.547  1.00 19.78 ? 211 GLU A H      1 
ATOM   2988 H  HA     . GLU A 1 211 ? 29.359  -46.711 12.253  1.00 19.32 ? 211 GLU A HA     1 
ATOM   2989 H  HB2    . GLU A 1 211 ? 30.940  -48.070 13.391  1.00 22.60 ? 211 GLU A HB2    1 
ATOM   2990 H  HB3    . GLU A 1 211 ? 31.551  -46.753 14.030  1.00 22.60 ? 211 GLU A HB3    1 
ATOM   2991 H  HG2    . GLU A 1 211 ? 30.248  -47.614 15.645  1.00 23.60 ? 211 GLU A HG2    1 
ATOM   2992 H  HG3    . GLU A 1 211 ? 29.402  -46.408 15.059  1.00 23.60 ? 211 GLU A HG3    1 
ATOM   2993 N  N      . ARG A 1 212 ? 31.103  -44.083 12.810  1.00 17.61 ? 212 ARG A N      1 
ATOM   2994 C  CA     . ARG A 1 212 ? 30.991  -42.645 13.086  1.00 17.44 ? 212 ARG A CA     1 
ATOM   2995 C  C      . ARG A 1 212 ? 29.998  -41.980 12.135  1.00 17.00 ? 212 ARG A C      1 
ATOM   2996 O  O      . ARG A 1 212 ? 29.163  -41.171 12.549  1.00 17.82 ? 212 ARG A O      1 
ATOM   2997 C  CB     . ARG A 1 212 ? 32.353  -41.946 12.976  1.00 23.04 ? 212 ARG A CB     1 
ATOM   2998 C  CG     . ARG A 1 212 ? 32.285  -40.424 13.202  1.00 28.67 ? 212 ARG A CG     1 
ATOM   2999 C  CD     . ARG A 1 212 ? 33.656  -39.751 13.128  1.00 35.84 ? 212 ARG A CD     1 
ATOM   3000 N  NE     . ARG A 1 212 ? 33.554  -38.295 13.273  1.00 44.00 ? 212 ARG A NE     1 
ATOM   3001 C  CZ     . ARG A 1 212 ? 33.894  -37.401 12.344  1.00 47.28 ? 212 ARG A CZ     1 
ATOM   3002 N  NH1    . ARG A 1 212 ? 34.386  -37.779 11.171  1.00 46.64 ? 212 ARG A NH1    1 
ATOM   3003 N  NH2    . ARG A 1 212 ? 33.750  -36.107 12.596  1.00 48.49 ? 212 ARG A NH2    1 
ATOM   3004 H  H      . ARG A 1 212 ? 31.894  -44.343 12.596  1.00 21.13 ? 212 ARG A H      1 
ATOM   3005 H  HA     . ARG A 1 212 ? 30.665  -42.523 13.991  1.00 20.93 ? 212 ARG A HA     1 
ATOM   3006 H  HB2    . ARG A 1 212 ? 32.951  -42.319 13.642  1.00 27.65 ? 212 ARG A HB2    1 
ATOM   3007 H  HB3    . ARG A 1 212 ? 32.713  -42.099 12.088  1.00 27.65 ? 212 ARG A HB3    1 
ATOM   3008 H  HG2    . ARG A 1 212 ? 31.720  -40.028 12.520  1.00 34.41 ? 212 ARG A HG2    1 
ATOM   3009 H  HG3    . ARG A 1 212 ? 31.914  -40.252 14.082  1.00 34.41 ? 212 ARG A HG3    1 
ATOM   3010 H  HD2    . ARG A 1 212 ? 34.216  -40.089 13.844  1.00 43.00 ? 212 ARG A HD2    1 
ATOM   3011 H  HD3    . ARG A 1 212 ? 34.059  -39.943 12.267  1.00 43.00 ? 212 ARG A HD3    1 
ATOM   3012 H  HE     . ARG A 1 212 ? 33.251  -37.993 14.019  1.00 52.80 ? 212 ARG A HE     1 
ATOM   3013 H  HH11   . ARG A 1 212 ? 34.484  -38.615 10.995  1.00 55.97 ? 212 ARG A HH11   1 
ATOM   3014 H  HH12   . ARG A 1 212 ? 34.602  -37.188 10.585  1.00 55.97 ? 212 ARG A HH12   1 
ATOM   3015 H  HH21   . ARG A 1 212 ? 33.435  -35.849 13.353  1.00 58.19 ? 212 ARG A HH21   1 
ATOM   3016 H  HH22   . ARG A 1 212 ? 33.972  -35.526 12.002  1.00 58.19 ? 212 ARG A HH22   1 
ATOM   3017 N  N      . ALA A 1 213 ? 30.099  -42.315 10.857  1.00 15.93 ? 213 ALA A N      1 
ATOM   3018 C  CA     . ALA A 1 213 ? 29.198  -41.757 9.852   1.00 16.78 ? 213 ALA A CA     1 
ATOM   3019 C  C      . ALA A 1 213 ? 27.759  -42.191 10.125  1.00 15.60 ? 213 ALA A C      1 
ATOM   3020 O  O      . ALA A 1 213 ? 26.823  -41.392 10.018  1.00 17.51 ? 213 ALA A O      1 
ATOM   3021 C  CB     . ALA A 1 213 ? 29.629  -42.181 8.455   1.00 18.13 ? 213 ALA A CB     1 
ATOM   3022 H  H      . ALA A 1 213 ? 30.682  -42.863 10.542  1.00 19.12 ? 213 ALA A H      1 
ATOM   3023 H  HA     . ALA A 1 213 ? 29.233  -40.789 9.897   1.00 20.14 ? 213 ALA A HA     1 
ATOM   3024 H  HB1    . ALA A 1 213 ? 29.016  -41.800 7.806   1.00 21.76 ? 213 ALA A HB1    1 
ATOM   3025 H  HB2    . ALA A 1 213 ? 30.529  -41.858 8.291   1.00 21.76 ? 213 ALA A HB2    1 
ATOM   3026 H  HB3    . ALA A 1 213 ? 29.610  -43.150 8.399   1.00 21.76 ? 213 ALA A HB3    1 
ATOM   3027 N  N      . ARG A 1 214 ? 27.584  -43.457 10.486  1.00 16.95 ? 214 ARG A N      1 
ATOM   3028 C  CA     . ARG A 1 214 ? 26.253  -43.977 10.781  1.00 14.87 ? 214 ARG A CA     1 
ATOM   3029 C  C      . ARG A 1 214 ? 25.647  -43.276 11.994  1.00 16.49 ? 214 ARG A C      1 
ATOM   3030 O  O      . ARG A 1 214 ? 24.459  -42.964 12.005  1.00 17.75 ? 214 ARG A O      1 
ATOM   3031 C  CB     . ARG A 1 214 ? 26.313  -45.489 11.012  1.00 16.14 ? 214 ARG A CB     1 
ATOM   3032 C  CG     . ARG A 1 214 ? 26.686  -46.246 9.762   1.00 16.83 ? 214 ARG A CG     1 
ATOM   3033 C  CD     . ARG A 1 214 ? 27.260  -47.624 10.050  1.00 16.96 ? 214 ARG A CD     1 
ATOM   3034 N  NE     . ARG A 1 214 ? 27.497  -48.337 8.798   1.00 17.42 ? 214 ARG A NE     1 
ATOM   3035 C  CZ     . ARG A 1 214 ? 26.565  -49.010 8.130   1.00 19.23 ? 214 ARG A CZ     1 
ATOM   3036 N  NH1    . ARG A 1 214 ? 25.331  -49.097 8.604   1.00 19.73 ? 214 ARG A NH1    1 
ATOM   3037 N  NH2    . ARG A 1 214 ? 26.874  -49.607 6.992   1.00 22.98 ? 214 ARG A NH2    1 
ATOM   3038 H  H      . ARG A 1 214 ? 28.217  -44.034 10.568  1.00 20.34 ? 214 ARG A H      1 
ATOM   3039 H  HA     . ARG A 1 214 ? 25.674  -43.813 10.020  1.00 17.85 ? 214 ARG A HA     1 
ATOM   3040 H  HB2    . ARG A 1 214 ? 26.980  -45.680 11.690  1.00 19.37 ? 214 ARG A HB2    1 
ATOM   3041 H  HB3    . ARG A 1 214 ? 25.442  -45.800 11.303  1.00 19.37 ? 214 ARG A HB3    1 
ATOM   3042 H  HG2    . ARG A 1 214 ? 25.894  -46.361 9.214   1.00 20.20 ? 214 ARG A HG2    1 
ATOM   3043 H  HG3    . ARG A 1 214 ? 27.355  -45.740 9.275   1.00 20.20 ? 214 ARG A HG3    1 
ATOM   3044 H  HD2    . ARG A 1 214 ? 28.104  -47.534 10.519  1.00 20.35 ? 214 ARG A HD2    1 
ATOM   3045 H  HD3    . ARG A 1 214 ? 26.628  -48.135 10.581  1.00 20.35 ? 214 ARG A HD3    1 
ATOM   3046 H  HE     . ARG A 1 214 ? 28.292  -48.320 8.470   1.00 20.90 ? 214 ARG A HE     1 
ATOM   3047 H  HH11   . ARG A 1 214 ? 25.125  -48.706 9.341   1.00 23.67 ? 214 ARG A HH11   1 
ATOM   3048 H  HH12   . ARG A 1 214 ? 24.734  -49.538 8.169   1.00 23.67 ? 214 ARG A HH12   1 
ATOM   3049 H  HH21   . ARG A 1 214 ? 27.676  -49.559 6.685   1.00 27.57 ? 214 ARG A HH21   1 
ATOM   3050 H  HH22   . ARG A 1 214 ? 26.276  -50.053 6.564   1.00 27.57 ? 214 ARG A HH22   1 
ATOM   3051 N  N      . GLU A 1 215 ? 26.468  -43.036 13.013  1.00 17.47 ? 215 GLU A N      1 
ATOM   3052 C  CA     . GLU A 1 215 ? 26.030  -42.322 14.203  1.00 18.19 ? 215 GLU A CA     1 
ATOM   3053 C  C      . GLU A 1 215 ? 25.562  -40.921 13.823  1.00 20.05 ? 215 GLU A C      1 
ATOM   3054 O  O      . GLU A 1 215 ? 24.513  -40.460 14.269  1.00 21.24 ? 215 GLU A O      1 
ATOM   3055 C  CB     . GLU A 1 215 ? 27.161  -42.250 15.234  1.00 22.81 ? 215 GLU A CB     1 
ATOM   3056 H  H      . GLU A 1 215 ? 27.293  -43.279 13.036  1.00 20.97 ? 215 GLU A H      1 
ATOM   3057 H  HA     . GLU A 1 215 ? 25.283  -42.794 14.603  1.00 21.83 ? 215 GLU A HA     1 
ATOM   3058 N  N      . THR A 1 216 ? 26.344  -40.251 12.983  1.00 18.64 ? 216 THR A N      1 
ATOM   3059 C  CA     . THR A 1 216 ? 26.007  -38.903 12.540  1.00 19.47 ? 216 THR A CA     1 
ATOM   3060 C  C      . THR A 1 216 ? 24.679  -38.900 11.785  1.00 19.12 ? 216 THR A C      1 
ATOM   3061 O  O      . THR A 1 216 ? 23.815  -38.053 12.028  1.00 22.68 ? 216 THR A O      1 
ATOM   3062 C  CB     . THR A 1 216 ? 27.116  -38.318 11.646  1.00 22.23 ? 216 THR A CB     1 
ATOM   3063 O  OG1    . THR A 1 216 ? 28.354  -38.299 12.372  1.00 25.47 ? 216 THR A OG1    1 
ATOM   3064 C  CG2    . THR A 1 216 ? 26.772  -36.905 11.203  1.00 23.40 ? 216 THR A CG2    1 
ATOM   3065 H  H      . THR A 1 216 ? 27.078  -40.556 12.654  1.00 22.37 ? 216 THR A H      1 
ATOM   3066 H  HA     . THR A 1 216 ? 25.912  -38.329 13.317  1.00 23.36 ? 216 THR A HA     1 
ATOM   3067 H  HB     . THR A 1 216 ? 27.216  -38.870 10.855  1.00 26.68 ? 216 THR A HB     1 
ATOM   3068 H  HG1    . THR A 1 216 ? 28.565  -39.079 12.600  1.00 30.56 ? 216 THR A HG1    1 
ATOM   3069 H  HG21   . THR A 1 216 ? 27.479  -36.551 10.642  1.00 28.08 ? 216 THR A HG21   1 
ATOM   3070 H  HG22   . THR A 1 216 ? 25.942  -36.908 10.700  1.00 28.08 ? 216 THR A HG22   1 
ATOM   3071 H  HG23   . THR A 1 216 ? 26.668  -36.330 11.978  1.00 28.08 ? 216 THR A HG23   1 
ATOM   3072 N  N      . LEU A 1 217 ? 24.513  -39.856 10.877  1.00 19.57 ? 217 LEU A N      1 
ATOM   3073 C  CA     . LEU A 1 217 ? 23.302  -39.939 10.069  1.00 19.87 ? 217 LEU A CA     1 
ATOM   3074 C  C      . LEU A 1 217 ? 22.063  -40.247 10.909  1.00 19.41 ? 217 LEU A C      1 
ATOM   3075 O  O      . LEU A 1 217 ? 20.994  -39.678 10.690  1.00 22.05 ? 217 LEU A O      1 
ATOM   3076 C  CB     . LEU A 1 217 ? 23.459  -41.008 8.986   1.00 17.89 ? 217 LEU A CB     1 
ATOM   3077 C  CG     . LEU A 1 217 ? 24.406  -40.686 7.831   1.00 16.82 ? 217 LEU A CG     1 
ATOM   3078 C  CD1    . LEU A 1 217 ? 24.701  -41.945 7.029   1.00 20.14 ? 217 LEU A CD1    1 
ATOM   3079 C  CD2    . LEU A 1 217 ? 23.813  -39.606 6.935   1.00 20.43 ? 217 LEU A CD2    1 
ATOM   3080 H  H      . LEU A 1 217 ? 25.090  -40.471 10.709  1.00 23.48 ? 217 LEU A H      1 
ATOM   3081 H  HA     . LEU A 1 217 ? 23.159  -39.086 9.628   1.00 23.84 ? 217 LEU A HA     1 
ATOM   3082 H  HB2    . LEU A 1 217 ? 23.786  -41.819 9.407   1.00 21.47 ? 217 LEU A HB2    1 
ATOM   3083 H  HB3    . LEU A 1 217 ? 22.585  -41.178 8.600   1.00 21.47 ? 217 LEU A HB3    1 
ATOM   3084 H  HG     . LEU A 1 217 ? 25.243  -40.353 8.191   1.00 20.18 ? 217 LEU A HG     1 
ATOM   3085 H  HD11   . LEU A 1 217 ? 25.303  -41.721 6.302   1.00 24.16 ? 217 LEU A HD11   1 
ATOM   3086 H  HD12   . LEU A 1 217 ? 25.115  -42.600 7.612   1.00 24.16 ? 217 LEU A HD12   1 
ATOM   3087 H  HD13   . LEU A 1 217 ? 23.869  -42.295 6.675   1.00 24.16 ? 217 LEU A HD13   1 
ATOM   3088 H  HD21   . LEU A 1 217 ? 24.433  -39.421 6.212   1.00 24.52 ? 217 LEU A HD21   1 
ATOM   3089 H  HD22   . LEU A 1 217 ? 22.970  -39.923 6.575   1.00 24.52 ? 217 LEU A HD22   1 
ATOM   3090 H  HD23   . LEU A 1 217 ? 23.669  -38.804 7.460   1.00 24.52 ? 217 LEU A HD23   1 
ATOM   3091 N  N      . LEU A 1 218 ? 22.210  -41.153 11.869  1.00 18.55 ? 218 LEU A N      1 
ATOM   3092 C  CA     . LEU A 1 218 ? 21.063  -41.640 12.624  1.00 22.26 ? 218 LEU A CA     1 
ATOM   3093 C  C      . LEU A 1 218 ? 20.683  -40.722 13.790  1.00 24.95 ? 218 LEU A C      1 
ATOM   3094 O  O      . LEU A 1 218 ? 19.553  -40.768 14.269  1.00 25.74 ? 218 LEU A O      1 
ATOM   3095 C  CB     . LEU A 1 218 ? 21.345  -43.055 13.130  1.00 19.27 ? 218 LEU A CB     1 
ATOM   3096 C  CG     . LEU A 1 218 ? 21.367  -44.125 12.036  1.00 21.94 ? 218 LEU A CG     1 
ATOM   3097 C  CD1    . LEU A 1 218 ? 22.056  -45.397 12.528  1.00 24.00 ? 218 LEU A CD1    1 
ATOM   3098 C  CD2    . LEU A 1 218 ? 19.955  -44.435 11.555  1.00 25.26 ? 218 LEU A CD2    1 
ATOM   3099 H  H      . LEU A 1 218 ? 22.961  -41.501 12.101  1.00 22.25 ? 218 LEU A H      1 
ATOM   3100 H  HA     . LEU A 1 218 ? 20.299  -41.688 12.029  1.00 26.71 ? 218 LEU A HA     1 
ATOM   3101 H  HB2    . LEU A 1 218 ? 22.211  -43.062 13.567  1.00 23.12 ? 218 LEU A HB2    1 
ATOM   3102 H  HB3    . LEU A 1 218 ? 20.655  -43.299 13.767  1.00 23.12 ? 218 LEU A HB3    1 
ATOM   3103 H  HG     . LEU A 1 218 ? 21.872  -43.789 11.279  1.00 26.32 ? 218 LEU A HG     1 
ATOM   3104 H  HD11   . LEU A 1 218 ? 22.053  -46.054 11.814  1.00 28.80 ? 218 LEU A HD11   1 
ATOM   3105 H  HD12   . LEU A 1 218 ? 22.968  -45.185 12.780  1.00 28.80 ? 218 LEU A HD12   1 
ATOM   3106 H  HD13   . LEU A 1 218 ? 21.572  -45.741 13.296  1.00 28.80 ? 218 LEU A HD13   1 
ATOM   3107 H  HD21   . LEU A 1 218 ? 19.999  -45.114 10.864  1.00 30.31 ? 218 LEU A HD21   1 
ATOM   3108 H  HD22   . LEU A 1 218 ? 19.430  -44.757 12.304  1.00 30.31 ? 218 LEU A HD22   1 
ATOM   3109 H  HD23   . LEU A 1 218 ? 19.559  -43.624 11.198  1.00 30.31 ? 218 LEU A HD23   1 
ATOM   3110 N  N      . ASN A 1 219 ? 21.614  -39.882 14.234  1.00 25.75 ? 219 ASN A N      1 
ATOM   3111 C  CA     . ASN A 1 219 ? 21.341  -38.971 15.349  1.00 27.80 ? 219 ASN A CA     1 
ATOM   3112 C  C      . ASN A 1 219 ? 20.798  -37.619 14.890  1.00 22.66 ? 219 ASN A C      1 
ATOM   3113 O  O      . ASN A 1 219 ? 20.154  -36.910 15.667  1.00 28.82 ? 219 ASN A O      1 
ATOM   3114 C  CB     . ASN A 1 219 ? 22.605  -38.757 16.188  1.00 30.32 ? 219 ASN A CB     1 
ATOM   3115 C  CG     . ASN A 1 219 ? 22.925  -39.947 17.078  1.00 43.41 ? 219 ASN A CG     1 
ATOM   3116 O  OD1    . ASN A 1 219 ? 22.026  -40.615 17.590  1.00 49.46 ? 219 ASN A OD1    1 
ATOM   3117 N  ND2    . ASN A 1 219 ? 24.212  -40.213 17.269  1.00 50.96 ? 219 ASN A ND2    1 
ATOM   3118 H  H      . ASN A 1 219 ? 22.409  -39.818 13.911  1.00 30.90 ? 219 ASN A H      1 
ATOM   3119 H  HA     . ASN A 1 219 ? 20.673  -39.376 15.923  1.00 33.36 ? 219 ASN A HA     1 
ATOM   3120 N  N      . TYR A 1 220 ? 21.053  -37.264 13.636  1.00 19.99 ? 220 TYR A N      1 
ATOM   3121 C  CA     . TYR A 1 220 ? 20.558  -36.004 13.073  1.00 19.94 ? 220 TYR A CA     1 
ATOM   3122 C  C      . TYR A 1 220 ? 19.041  -36.071 12.866  1.00 20.04 ? 220 TYR A C      1 
ATOM   3123 O  O      . TYR A 1 220 ? 18.515  -37.114 12.490  1.00 21.21 ? 220 TYR A O      1 
ATOM   3124 C  CB     . TYR A 1 220 ? 21.281  -35.700 11.758  1.00 20.42 ? 220 TYR A CB     1 
ATOM   3125 C  CG     . TYR A 1 220 ? 20.941  -34.360 11.148  1.00 19.39 ? 220 TYR A CG     1 
ATOM   3126 C  CD1    . TYR A 1 220 ? 21.061  -33.190 11.880  1.00 17.87 ? 220 TYR A CD1    1 
ATOM   3127 C  CD2    . TYR A 1 220 ? 20.525  -34.267 9.829   1.00 17.71 ? 220 TYR A CD2    1 
ATOM   3128 C  CE1    . TYR A 1 220 ? 20.757  -31.965 11.322  1.00 19.28 ? 220 TYR A CE1    1 
ATOM   3129 C  CE2    . TYR A 1 220 ? 20.218  -33.044 9.257   1.00 16.42 ? 220 TYR A CE2    1 
ATOM   3130 C  CZ     . TYR A 1 220 ? 20.338  -31.897 10.008  1.00 19.79 ? 220 TYR A CZ     1 
ATOM   3131 O  OH     . TYR A 1 220 ? 20.036  -30.675 9.445   1.00 18.65 ? 220 TYR A OH     1 
ATOM   3132 H  H      . TYR A 1 220 ? 21.514  -37.736 13.083  1.00 23.99 ? 220 TYR A H      1 
ATOM   3133 H  HA     . TYR A 1 220 ? 20.746  -35.283 13.694  1.00 23.93 ? 220 TYR A HA     1 
ATOM   3134 H  HB2    . TYR A 1 220 ? 22.237  -35.716 11.919  1.00 24.50 ? 220 TYR A HB2    1 
ATOM   3135 H  HB3    . TYR A 1 220 ? 21.048  -36.385 11.112  1.00 24.50 ? 220 TYR A HB3    1 
ATOM   3136 H  HD1    . TYR A 1 220 ? 21.341  -33.232 12.766  1.00 21.44 ? 220 TYR A HD1    1 
ATOM   3137 H  HD2    . TYR A 1 220 ? 20.443  -35.041 9.321   1.00 21.25 ? 220 TYR A HD2    1 
ATOM   3138 H  HE1    . TYR A 1 220 ? 20.838  -31.189 11.827  1.00 23.14 ? 220 TYR A HE1    1 
ATOM   3139 H  HE2    . TYR A 1 220 ? 19.936  -32.998 8.372   1.00 19.71 ? 220 TYR A HE2    1 
ATOM   3140 H  HH     . TYR A 1 220 ? 19.796  -30.778 8.646   1.00 22.38 ? 220 TYR A HH     1 
ATOM   3141 N  N      . ARG A 1 221 ? 18.336  -34.963 13.094  1.00 20.93 ? 221 ARG A N      1 
ATOM   3142 C  CA     A ARG A 1 221 ? 16.875  -34.990 13.094  0.47 21.75 ? 221 ARG A CA     1 
ATOM   3143 C  CA     B ARG A 1 221 ? 16.876  -34.995 13.095  0.53 21.93 ? 221 ARG A CA     1 
ATOM   3144 C  C      . ARG A 1 221 ? 16.271  -34.775 11.703  1.00 20.15 ? 221 ARG A C      1 
ATOM   3145 O  O      . ARG A 1 221 ? 15.063  -34.907 11.526  1.00 20.50 ? 221 ARG A O      1 
ATOM   3146 C  CB     A ARG A 1 221 ? 16.325  -33.943 14.068  0.47 27.00 ? 221 ARG A CB     1 
ATOM   3147 C  CB     B ARG A 1 221 ? 16.332  -33.962 14.086  0.53 27.80 ? 221 ARG A CB     1 
ATOM   3148 C  CG     A ARG A 1 221 ? 16.758  -32.508 13.802  0.47 30.81 ? 221 ARG A CG     1 
ATOM   3149 C  CG     B ARG A 1 221 ? 15.906  -32.639 13.486  0.53 33.53 ? 221 ARG A CG     1 
ATOM   3150 C  CD     A ARG A 1 221 ? 15.990  -31.552 14.711  0.47 39.45 ? 221 ARG A CD     1 
ATOM   3151 C  CD     B ARG A 1 221 ? 15.456  -31.690 14.585  0.53 40.26 ? 221 ARG A CD     1 
ATOM   3152 N  NE     A ARG A 1 221 ? 16.352  -30.151 14.517  0.47 45.26 ? 221 ARG A NE     1 
ATOM   3153 N  NE     B ARG A 1 221 ? 14.835  -32.409 15.695  0.53 45.01 ? 221 ARG A NE     1 
ATOM   3154 C  CZ     A ARG A 1 221 ? 17.140  -29.460 15.336  0.47 46.34 ? 221 ARG A CZ     1 
ATOM   3155 C  CZ     B ARG A 1 221 ? 13.533  -32.658 15.794  0.53 47.29 ? 221 ARG A CZ     1 
ATOM   3156 N  NH1    A ARG A 1 221 ? 17.657  -30.036 16.413  0.47 46.89 ? 221 ARG A NH1    1 
ATOM   3157 N  NH1    B ARG A 1 221 ? 12.701  -32.239 14.851  0.53 47.95 ? 221 ARG A NH1    1 
ATOM   3158 N  NH2    A ARG A 1 221 ? 17.408  -28.188 15.078  0.47 46.93 ? 221 ARG A NH2    1 
ATOM   3159 N  NH2    B ARG A 1 221 ? 13.063  -33.322 16.842  0.53 48.33 ? 221 ARG A NH2    1 
ATOM   3160 H  H      . ARG A 1 221 ? 18.674  -34.187 13.249  1.00 25.11 ? 221 ARG A H      1 
ATOM   3161 H  HA     . ARG A 1 221 ? 16.587  -35.866 13.403  0.47 26.32 ? 221 ARG A HA     1 
ATOM   3162 N  N      . TRP A 1 222 ? 17.111  -34.466 10.715  1.00 18.72 ? 222 TRP A N      1 
ATOM   3163 C  CA     . TRP A 1 222 ? 16.667  -34.309 9.318   1.00 17.35 ? 222 TRP A CA     1 
ATOM   3164 C  C      . TRP A 1 222 ? 15.443  -33.410 9.130   1.00 17.93 ? 222 TRP A C      1 
ATOM   3165 O  O      . TRP A 1 222 ? 14.393  -33.859 8.663   1.00 17.77 ? 222 TRP A O      1 
ATOM   3166 C  CB     . TRP A 1 222 ? 16.379  -35.686 8.703   1.00 17.14 ? 222 TRP A CB     1 
ATOM   3167 C  CG     . TRP A 1 222 ? 17.594  -36.546 8.714   1.00 17.22 ? 222 TRP A CG     1 
ATOM   3168 C  CD1    . TRP A 1 222 ? 17.830  -37.624 9.510   1.00 19.65 ? 222 TRP A CD1    1 
ATOM   3169 C  CD2    . TRP A 1 222 ? 18.770  -36.363 7.922   1.00 15.81 ? 222 TRP A CD2    1 
ATOM   3170 N  NE1    . TRP A 1 222 ? 19.079  -38.131 9.257   1.00 16.44 ? 222 TRP A NE1    1 
ATOM   3171 C  CE2    . TRP A 1 222 ? 19.679  -37.375 8.285   1.00 14.96 ? 222 TRP A CE2    1 
ATOM   3172 C  CE3    . TRP A 1 222 ? 19.147  -35.443 6.942   1.00 15.88 ? 222 TRP A CE3    1 
ATOM   3173 C  CZ2    . TRP A 1 222 ? 20.935  -37.493 7.702   1.00 16.37 ? 222 TRP A CZ2    1 
ATOM   3174 C  CZ3    . TRP A 1 222 ? 20.393  -35.560 6.365   1.00 17.39 ? 222 TRP A CZ3    1 
ATOM   3175 C  CH2    . TRP A 1 222 ? 21.273  -36.578 6.747   1.00 16.33 ? 222 TRP A CH2    1 
ATOM   3176 H  H      . TRP A 1 222 ? 17.955  -34.339 10.825  1.00 22.46 ? 222 TRP A H      1 
ATOM   3177 H  HA     . TRP A 1 222 ? 17.394  -33.913 8.812   1.00 20.82 ? 222 TRP A HA     1 
ATOM   3178 H  HB2    . TRP A 1 222 ? 15.687  -36.130 9.218   1.00 20.57 ? 222 TRP A HB2    1 
ATOM   3179 H  HB3    . TRP A 1 222 ? 16.093  -35.574 7.782   1.00 20.57 ? 222 TRP A HB3    1 
ATOM   3180 H  HD1    . TRP A 1 222 ? 17.232  -37.966 10.135  1.00 23.58 ? 222 TRP A HD1    1 
ATOM   3181 H  HE1    . TRP A 1 222 ? 19.428  -38.816 9.643   1.00 19.73 ? 222 TRP A HE1    1 
ATOM   3182 H  HE3    . TRP A 1 222 ? 18.571  -34.759 6.689   1.00 19.05 ? 222 TRP A HE3    1 
ATOM   3183 H  HZ2    . TRP A 1 222 ? 21.520  -38.173 7.949   1.00 19.64 ? 222 TRP A HZ2    1 
ATOM   3184 H  HZ3    . TRP A 1 222 ? 20.652  -34.953 5.709   1.00 20.87 ? 222 TRP A HZ3    1 
ATOM   3185 H  HH2    . TRP A 1 222 ? 22.104  -36.638 6.333   1.00 19.59 ? 222 TRP A HH2    1 
ATOM   3186 N  N      . PRO A 1 223 ? 15.584  -32.122 9.462   1.00 17.11 ? 223 PRO A N      1 
ATOM   3187 C  CA     . PRO A 1 223 ? 14.473  -31.183 9.263   1.00 18.23 ? 223 PRO A CA     1 
ATOM   3188 C  C      . PRO A 1 223 ? 14.026  -31.089 7.802   1.00 16.50 ? 223 PRO A C      1 
ATOM   3189 O  O      . PRO A 1 223 ? 12.862  -30.759 7.548   1.00 19.99 ? 223 PRO A O      1 
ATOM   3190 C  CB     . PRO A 1 223 ? 15.046  -29.849 9.753   1.00 23.22 ? 223 PRO A CB     1 
ATOM   3191 C  CG     . PRO A 1 223 ? 16.525  -30.015 9.700   1.00 20.77 ? 223 PRO A CG     1 
ATOM   3192 C  CD     . PRO A 1 223 ? 16.783  -31.459 9.992   1.00 19.53 ? 223 PRO A CD     1 
ATOM   3193 H  HA     . PRO A 1 223 ? 13.717  -31.432 9.817   1.00 21.87 ? 223 PRO A HA     1 
ATOM   3194 H  HB2    . PRO A 1 223 ? 14.760  -29.134 9.163   1.00 27.87 ? 223 PRO A HB2    1 
ATOM   3195 H  HB3    . PRO A 1 223 ? 14.753  -29.682 10.662  1.00 27.87 ? 223 PRO A HB3    1 
ATOM   3196 H  HG2    . PRO A 1 223 ? 16.846  -29.783 8.815   1.00 24.93 ? 223 PRO A HG2    1 
ATOM   3197 H  HG3    . PRO A 1 223 ? 16.939  -29.452 10.372  1.00 24.93 ? 223 PRO A HG3    1 
ATOM   3198 H  HD2    . PRO A 1 223 ? 17.575  -31.764 9.522   1.00 23.44 ? 223 PRO A HD2    1 
ATOM   3199 H  HD3    . PRO A 1 223 ? 16.857  -31.604 10.948  1.00 23.44 ? 223 PRO A HD3    1 
ATOM   3200 N  N      . GLY A 1 224 ? 14.935  -31.368 6.869   1.00 16.08 ? 224 GLY A N      1 
ATOM   3201 C  CA     . GLY A 1 224 ? 14.618  -31.363 5.449   1.00 18.19 ? 224 GLY A CA     1 
ATOM   3202 C  C      . GLY A 1 224 ? 14.357  -32.755 4.896   1.00 15.46 ? 224 GLY A C      1 
ATOM   3203 O  O      . GLY A 1 224 ? 14.217  -32.941 3.688   1.00 15.02 ? 224 GLY A O      1 
ATOM   3204 H  H      . GLY A 1 224 ? 15.754  -31.567 7.040   1.00 19.30 ? 224 GLY A H      1 
ATOM   3205 H  HA2    . GLY A 1 224 ? 13.829  -30.820 5.297   1.00 21.83 ? 224 GLY A HA2    1 
ATOM   3206 H  HA3    . GLY A 1 224 ? 15.357  -30.972 4.956   1.00 21.83 ? 224 GLY A HA3    1 
ATOM   3207 N  N      . ASN A 1 225 ? 14.311  -33.730 5.799   1.00 14.37 ? 225 ASN A N      1 
ATOM   3208 C  CA     . ASN A 1 225 ? 13.942  -35.111 5.491   1.00 15.06 ? 225 ASN A CA     1 
ATOM   3209 C  C      . ASN A 1 225 ? 14.640  -35.682 4.248   1.00 15.68 ? 225 ASN A C      1 
ATOM   3210 O  O      . ASN A 1 225 ? 15.862  -35.611 4.176   1.00 15.55 ? 225 ASN A O      1 
ATOM   3211 C  CB     . ASN A 1 225 ? 12.425  -35.184 5.409   1.00 16.80 ? 225 ASN A CB     1 
ATOM   3212 C  CG     . ASN A 1 225 ? 11.796  -34.951 6.764   1.00 16.26 ? 225 ASN A CG     1 
ATOM   3213 O  OD1    . ASN A 1 225 ? 11.813  -35.835 7.621   1.00 19.11 ? 225 ASN A OD1    1 
ATOM   3214 N  ND2    . ASN A 1 225 ? 11.305  -33.742 6.995   1.00 17.09 ? 225 ASN A ND2    1 
ATOM   3215 H  H      . ASN A 1 225 ? 14.496  -33.611 6.630   1.00 17.25 ? 225 ASN A H      1 
ATOM   3216 H  HA     . ASN A 1 225 ? 14.211  -35.664 6.241   1.00 18.08 ? 225 ASN A HA     1 
ATOM   3217 H  HB2    . ASN A 1 225 ? 12.102  -34.500 4.801   1.00 20.16 ? 225 ASN A HB2    1 
ATOM   3218 H  HB3    . ASN A 1 225 ? 12.162  -36.064 5.097   1.00 20.16 ? 225 ASN A HB3    1 
ATOM   3219 H  HD21   . ASN A 1 225 ? 10.938  -33.564 7.752   1.00 20.50 ? 225 ASN A HD21   1 
ATOM   3220 H  HD22   . ASN A 1 225 ? 11.353  -33.135 6.388   1.00 20.50 ? 225 ASN A HD22   1 
ATOM   3221 N  N      . ILE A 1 226 ? 13.915  -36.275 3.300   1.00 17.17 ? 226 ILE A N      1 
ATOM   3222 C  CA     . ILE A 1 226 ? 14.578  -37.056 2.243   1.00 17.07 ? 226 ILE A CA     1 
ATOM   3223 C  C      . ILE A 1 226 ? 15.400  -36.177 1.292   1.00 16.08 ? 226 ILE A C      1 
ATOM   3224 O  O      . ILE A 1 226 ? 16.481  -36.572 0.867   1.00 16.85 ? 226 ILE A O      1 
ATOM   3225 C  CB     . ILE A 1 226 ? 13.566  -37.884 1.400   1.00 22.08 ? 226 ILE A CB     1 
ATOM   3226 C  CG1    . ILE A 1 226 ? 12.669  -38.749 2.294   1.00 30.68 ? 226 ILE A CG1    1 
ATOM   3227 C  CG2    . ILE A 1 226 ? 14.292  -38.763 0.396   1.00 20.24 ? 226 ILE A CG2    1 
ATOM   3228 C  CD1    . ILE A 1 226 ? 13.333  -39.308 3.541   1.00 36.59 ? 226 ILE A CD1    1 
ATOM   3229 H  H      . ILE A 1 226 ? 13.057  -36.244 3.241   1.00 20.60 ? 226 ILE A H      1 
ATOM   3230 H  HA     . ILE A 1 226 ? 15.189  -37.682 2.662   1.00 20.48 ? 226 ILE A HA     1 
ATOM   3231 H  HB     . ILE A 1 226 ? 13.001  -37.266 0.910   1.00 26.50 ? 226 ILE A HB     1 
ATOM   3232 H  HG12   . ILE A 1 226 ? 11.914  -38.212 2.582   1.00 36.82 ? 226 ILE A HG12   1 
ATOM   3233 H  HG13   . ILE A 1 226 ? 12.350  -39.502 1.772   1.00 36.82 ? 226 ILE A HG13   1 
ATOM   3234 H  HG21   . ILE A 1 226 ? 13.637  -39.266 -0.114  1.00 24.28 ? 226 ILE A HG21   1 
ATOM   3235 H  HG22   . ILE A 1 226 ? 14.812  -38.199 -0.198  1.00 24.28 ? 226 ILE A HG22   1 
ATOM   3236 H  HG23   . ILE A 1 226 ? 14.877  -39.370 0.874   1.00 24.28 ? 226 ILE A HG23   1 
ATOM   3237 H  HD11   . ILE A 1 226 ? 12.686  -39.836 4.034   1.00 43.91 ? 226 ILE A HD11   1 
ATOM   3238 H  HD12   . ILE A 1 226 ? 14.083  -39.864 3.277   1.00 43.91 ? 226 ILE A HD12   1 
ATOM   3239 H  HD13   . ILE A 1 226 ? 13.645  -38.571 4.090   1.00 43.91 ? 226 ILE A HD13   1 
ATOM   3240 N  N      . ARG A 1 227 ? 14.887  -34.999 0.955   1.00 17.22 ? 227 ARG A N      1 
ATOM   3241 C  CA     . ARG A 1 227 ? 15.623  -34.063 0.104   1.00 16.55 ? 227 ARG A CA     1 
ATOM   3242 C  C      . ARG A 1 227 ? 16.967  -33.715 0.731   1.00 16.69 ? 227 ARG A C      1 
ATOM   3243 O  O      . ARG A 1 227 ? 17.995  -33.680 0.048   1.00 15.76 ? 227 ARG A O      1 
ATOM   3244 C  CB     . ARG A 1 227 ? 14.802  -32.789 -0.130  1.00 17.97 ? 227 ARG A CB     1 
ATOM   3245 C  CG     . ARG A 1 227 ? 15.529  -31.709 -0.936  1.00 19.83 ? 227 ARG A CG     1 
ATOM   3246 C  CD     . ARG A 1 227 ? 14.746  -30.406 -0.993  1.00 21.96 ? 227 ARG A CD     1 
ATOM   3247 N  NE     . ARG A 1 227 ? 13.561  -30.477 -1.848  1.00 20.26 ? 227 ARG A NE     1 
ATOM   3248 C  CZ     . ARG A 1 227 ? 12.300  -30.451 -1.417  1.00 22.28 ? 227 ARG A CZ     1 
ATOM   3249 N  NH1    . ARG A 1 227 ? 12.017  -30.372 -0.121  1.00 20.69 ? 227 ARG A NH1    1 
ATOM   3250 N  NH2    . ARG A 1 227 ? 11.304  -30.502 -2.295  1.00 23.19 ? 227 ARG A NH2    1 
ATOM   3251 H  H      . ARG A 1 227 ? 14.114  -34.715 1.204   1.00 20.66 ? 227 ARG A H      1 
ATOM   3252 H  HA     . ARG A 1 227 ? 15.789  -34.479 -0.757  1.00 19.86 ? 227 ARG A HA     1 
ATOM   3253 H  HB2    . ARG A 1 227 ? 13.994  -33.023 -0.614  1.00 21.57 ? 227 ARG A HB2    1 
ATOM   3254 H  HB3    . ARG A 1 227 ? 14.568  -32.407 0.730   1.00 21.57 ? 227 ARG A HB3    1 
ATOM   3255 H  HG2    . ARG A 1 227 ? 16.387  -31.528 -0.521  1.00 23.79 ? 227 ARG A HG2    1 
ATOM   3256 H  HG3    . ARG A 1 227 ? 15.658  -32.024 -1.844  1.00 23.79 ? 227 ARG A HG3    1 
ATOM   3257 H  HD2    . ARG A 1 227 ? 14.454  -30.175 -0.098  1.00 26.35 ? 227 ARG A HD2    1 
ATOM   3258 H  HD3    . ARG A 1 227 ? 15.323  -29.708 -1.342  1.00 26.35 ? 227 ARG A HD3    1 
ATOM   3259 H  HE     . ARG A 1 227 ? 13.688  -30.540 -2.697  1.00 24.31 ? 227 ARG A HE     1 
ATOM   3260 H  HH11   . ARG A 1 227 ? 12.654  -30.333 0.456   1.00 24.83 ? 227 ARG A HH11   1 
ATOM   3261 H  HH12   . ARG A 1 227 ? 11.198  -30.359 0.141   1.00 24.83 ? 227 ARG A HH12   1 
ATOM   3262 H  HH21   . ARG A 1 227 ? 11.475  -30.558 -3.136  1.00 27.83 ? 227 ARG A HH21   1 
ATOM   3263 H  HH22   . ARG A 1 227 ? 10.489  -30.494 -2.022  1.00 27.83 ? 227 ARG A HH22   1 
ATOM   3264 N  N      . GLU A 1 228 ? 16.955  -33.458 2.034   1.00 15.15 ? 228 GLU A N      1 
ATOM   3265 C  CA     . GLU A 1 228 ? 18.172  -33.099 2.752   1.00 14.10 ? 228 GLU A CA     1 
ATOM   3266 C  C      . GLU A 1 228 ? 19.125  -34.290 2.828   1.00 12.97 ? 228 GLU A C      1 
ATOM   3267 O  O      . GLU A 1 228 ? 20.330  -34.134 2.624   1.00 15.33 ? 228 GLU A O      1 
ATOM   3268 C  CB     . GLU A 1 228 ? 17.848  -32.578 4.163   1.00 15.20 ? 228 GLU A CB     1 
ATOM   3269 C  CG     . GLU A 1 228 ? 19.067  -32.034 4.902   1.00 17.04 ? 228 GLU A CG     1 
ATOM   3270 C  CD     . GLU A 1 228 ? 18.786  -31.612 6.335   1.00 18.68 ? 228 GLU A CD     1 
ATOM   3271 O  OE1    . GLU A 1 228 ? 17.761  -32.043 6.912   1.00 18.98 ? 228 GLU A OE1    1 
ATOM   3272 O  OE2    . GLU A 1 228 ? 19.615  -30.850 6.886   1.00 19.48 ? 228 GLU A OE2    1 
ATOM   3273 H  H      . GLU A 1 228 ? 16.251  -33.485 2.528   1.00 18.18 ? 228 GLU A H      1 
ATOM   3274 H  HA     . GLU A 1 228 ? 18.622  -32.388 2.269   1.00 16.92 ? 228 GLU A HA     1 
ATOM   3275 H  HB2    . GLU A 1 228 ? 17.198  -31.862 4.092   1.00 18.24 ? 228 GLU A HB2    1 
ATOM   3276 H  HB3    . GLU A 1 228 ? 17.481  -33.306 4.690   1.00 18.24 ? 228 GLU A HB3    1 
ATOM   3277 H  HG2    . GLU A 1 228 ? 19.750  -32.722 4.925   1.00 20.44 ? 228 GLU A HG2    1 
ATOM   3278 H  HG3    . GLU A 1 228 ? 19.400  -31.258 4.425   1.00 20.44 ? 228 GLU A HG3    1 
ATOM   3279 N  N      . LEU A 1 229 ? 18.587  -35.474 3.111   1.00 14.05 ? 229 LEU A N      1 
ATOM   3280 C  CA     . LEU A 1 229 ? 19.407  -36.681 3.204   1.00 14.00 ? 229 LEU A CA     1 
ATOM   3281 C  C      . LEU A 1 229 ? 20.156  -36.894 1.900   1.00 14.19 ? 229 LEU A C      1 
ATOM   3282 O  O      . LEU A 1 229 ? 21.356  -37.165 1.907   1.00 14.28 ? 229 LEU A O      1 
ATOM   3283 C  CB     . LEU A 1 229 ? 18.551  -37.908 3.533   1.00 15.15 ? 229 LEU A CB     1 
ATOM   3284 C  CG     . LEU A 1 229 ? 19.303  -39.243 3.611   1.00 15.66 ? 229 LEU A CG     1 
ATOM   3285 C  CD1    . LEU A 1 229 ? 20.306  -39.224 4.758   1.00 16.96 ? 229 LEU A CD1    1 
ATOM   3286 C  CD2    . LEU A 1 229 ? 18.343  -40.415 3.751   1.00 16.54 ? 229 LEU A CD2    1 
ATOM   3287 H  H      . LEU A 1 229 ? 17.749  -35.606 3.254   1.00 16.86 ? 229 LEU A H      1 
ATOM   3288 H  HA     . LEU A 1 229 ? 20.059  -36.568 3.913   1.00 16.80 ? 229 LEU A HA     1 
ATOM   3289 H  HB2    . LEU A 1 229 ? 18.126  -37.763 4.392   1.00 18.18 ? 229 LEU A HB2    1 
ATOM   3290 H  HB3    . LEU A 1 229 ? 17.871  -37.998 2.847   1.00 18.18 ? 229 LEU A HB3    1 
ATOM   3291 H  HG     . LEU A 1 229 ? 19.800  -39.367 2.788   1.00 18.79 ? 229 LEU A HG     1 
ATOM   3292 H  HD11   . LEU A 1 229 ? 20.767  -40.077 4.787   1.00 20.36 ? 229 LEU A HD11   1 
ATOM   3293 H  HD12   . LEU A 1 229 ? 20.943  -38.508 4.609   1.00 20.36 ? 229 LEU A HD12   1 
ATOM   3294 H  HD13   . LEU A 1 229 ? 19.831  -39.076 5.591   1.00 20.36 ? 229 LEU A HD13   1 
ATOM   3295 H  HD21   . LEU A 1 229 ? 18.855  -41.238 3.797   1.00 19.85 ? 229 LEU A HD21   1 
ATOM   3296 H  HD22   . LEU A 1 229 ? 17.823  -40.303 4.562   1.00 19.85 ? 229 LEU A HD22   1 
ATOM   3297 H  HD23   . LEU A 1 229 ? 17.755  -40.435 2.980   1.00 19.85 ? 229 LEU A HD23   1 
ATOM   3298 N  N      . LYS A 1 230 ? 19.454  -36.763 0.779   1.00 13.80 ? 230 LYS A N      1 
ATOM   3299 C  CA     . LYS A 1 230 ? 20.083  -36.955 -0.521  1.00 14.96 ? 230 LYS A CA     1 
ATOM   3300 C  C      . LYS A 1 230 ? 21.217  -35.955 -0.731  1.00 13.34 ? 230 LYS A C      1 
ATOM   3301 O  O      . LYS A 1 230 ? 22.310  -36.334 -1.141  1.00 15.20 ? 230 LYS A O      1 
ATOM   3302 C  CB     . LYS A 1 230 ? 19.054  -36.838 -1.648  1.00 16.96 ? 230 LYS A CB     1 
ATOM   3303 C  CG     . LYS A 1 230 ? 19.645  -36.995 -3.047  1.00 19.20 ? 230 LYS A CG     1 
ATOM   3304 C  CD     . LYS A 1 230 ? 18.554  -37.078 -4.104  1.00 21.18 ? 230 LYS A CD     1 
ATOM   3305 C  CE     . LYS A 1 230 ? 19.119  -37.253 -5.507  1.00 26.80 ? 230 LYS A CE     1 
ATOM   3306 N  NZ     . LYS A 1 230 ? 19.811  -36.031 -6.005  1.00 35.26 ? 230 LYS A NZ     1 
ATOM   3307 H  H      . LYS A 1 230 ? 18.618  -36.564 0.745   1.00 16.57 ? 230 LYS A H      1 
ATOM   3308 H  HA     . LYS A 1 230 ? 20.462  -37.846 -0.556  1.00 17.96 ? 230 LYS A HA     1 
ATOM   3309 H  HB2    . LYS A 1 230 ? 18.384  -37.529 -1.531  1.00 20.35 ? 230 LYS A HB2    1 
ATOM   3310 H  HB3    . LYS A 1 230 ? 18.636  -35.964 -1.600  1.00 20.35 ? 230 LYS A HB3    1 
ATOM   3311 H  HG2    . LYS A 1 230 ? 20.205  -36.227 -3.247  1.00 23.04 ? 230 LYS A HG2    1 
ATOM   3312 H  HG3    . LYS A 1 230 ? 20.168  -37.811 -3.085  1.00 23.04 ? 230 LYS A HG3    1 
ATOM   3313 H  HD2    . LYS A 1 230 ? 17.983  -37.838 -3.911  1.00 25.41 ? 230 LYS A HD2    1 
ATOM   3314 H  HD3    . LYS A 1 230 ? 18.034  -36.259 -4.089  1.00 25.41 ? 230 LYS A HD3    1 
ATOM   3315 H  HE2    . LYS A 1 230 ? 19.762  -37.980 -5.500  1.00 32.16 ? 230 LYS A HE2    1 
ATOM   3316 H  HE3    . LYS A 1 230 ? 18.393  -37.457 -6.117  1.00 32.16 ? 230 LYS A HE3    1 
ATOM   3317 H  HZ1    . LYS A 1 230 ? 20.126  -36.172 -6.825  1.00 42.31 ? 230 LYS A HZ1    1 
ATOM   3318 H  HZ2    . LYS A 1 230 ? 19.241  -35.347 -6.028  1.00 42.31 ? 230 LYS A HZ2    1 
ATOM   3319 H  HZ3    . LYS A 1 230 ? 20.488  -35.824 -5.466  1.00 42.31 ? 230 LYS A HZ3    1 
ATOM   3320 N  N      . ASN A 1 231 ? 20.977  -34.684 -0.427  1.00 14.49 ? 231 ASN A N      1 
ATOM   3321 C  CA     . ASN A 1 231 ? 22.000  -33.671 -0.654  1.00 16.10 ? 231 ASN A CA     1 
ATOM   3322 C  C      . ASN A 1 231 ? 23.219  -33.874 0.255   1.00 14.46 ? 231 ASN A C      1 
ATOM   3323 O  O      . ASN A 1 231 ? 24.368  -33.773 -0.191  1.00 15.51 ? 231 ASN A O      1 
ATOM   3324 C  CB     . ASN A 1 231 ? 21.420  -32.274 -0.446  1.00 17.42 ? 231 ASN A CB     1 
ATOM   3325 C  CG     . ASN A 1 231 ? 22.273  -31.187 -1.079  1.00 26.41 ? 231 ASN A CG     1 
ATOM   3326 O  OD1    . ASN A 1 231 ? 22.863  -31.384 -2.144  1.00 28.42 ? 231 ASN A OD1    1 
ATOM   3327 N  ND2    . ASN A 1 231 ? 22.345  -30.035 -0.426  1.00 32.56 ? 231 ASN A ND2    1 
ATOM   3328 H  H      . ASN A 1 231 ? 20.242  -34.386 -0.093  1.00 17.39 ? 231 ASN A H      1 
ATOM   3329 H  HA     . ASN A 1 231 ? 22.302  -33.733 -1.573  1.00 19.32 ? 231 ASN A HA     1 
ATOM   3330 H  HB2    . ASN A 1 231 ? 20.537  -32.235 -0.846  1.00 20.91 ? 231 ASN A HB2    1 
ATOM   3331 H  HB3    . ASN A 1 231 ? 21.362  -32.094 0.506   1.00 20.91 ? 231 ASN A HB3    1 
ATOM   3332 H  HD21   . ASN A 1 231 ? 22.815  -29.389 -0.744  1.00 39.08 ? 231 ASN A HD21   1 
ATOM   3333 H  HD22   . ASN A 1 231 ? 21.921  -29.934 0.315   1.00 39.08 ? 231 ASN A HD22   1 
ATOM   3334 N  N      . VAL A 1 232 ? 22.967  -34.160 1.528   1.00 14.39 ? 232 VAL A N      1 
ATOM   3335 C  CA     . VAL A 1 232 ? 24.049  -34.406 2.477   1.00 15.05 ? 232 VAL A CA     1 
ATOM   3336 C  C      . VAL A 1 232 ? 24.901  -35.602 2.047   1.00 12.53 ? 232 VAL A C      1 
ATOM   3337 O  O      . VAL A 1 232 ? 26.130  -35.549 2.092   1.00 13.95 ? 232 VAL A O      1 
ATOM   3338 C  CB     . VAL A 1 232 ? 23.505  -34.655 3.902   1.00 16.04 ? 232 VAL A CB     1 
ATOM   3339 C  CG1    . VAL A 1 232 ? 24.598  -35.222 4.819   1.00 13.72 ? 232 VAL A CG1    1 
ATOM   3340 C  CG2    . VAL A 1 232 ? 22.936  -33.368 4.487   1.00 16.93 ? 232 VAL A CG2    1 
ATOM   3341 H  H      . VAL A 1 232 ? 22.180  -34.218 1.868   1.00 17.27 ? 232 VAL A H      1 
ATOM   3342 H  HA     . VAL A 1 232 ? 24.623  -33.625 2.509   1.00 18.06 ? 232 VAL A HA     1 
ATOM   3343 H  HB     . VAL A 1 232 ? 22.786  -35.305 3.855   1.00 19.25 ? 232 VAL A HB     1 
ATOM   3344 H  HG11   . VAL A 1 232 ? 24.224  -35.366 5.703   1.00 16.46 ? 232 VAL A HG11   1 
ATOM   3345 H  HG12   . VAL A 1 232 ? 24.913  -36.063 4.452   1.00 16.46 ? 232 VAL A HG12   1 
ATOM   3346 H  HG13   . VAL A 1 232 ? 25.329  -34.587 4.869   1.00 16.46 ? 232 VAL A HG13   1 
ATOM   3347 H  HG21   . VAL A 1 232 ? 22.601  -33.548 5.379   1.00 20.31 ? 232 VAL A HG21   1 
ATOM   3348 H  HG22   . VAL A 1 232 ? 23.639  -32.701 4.525   1.00 20.31 ? 232 VAL A HG22   1 
ATOM   3349 H  HG23   . VAL A 1 232 ? 22.214  -33.055 3.919   1.00 20.31 ? 232 VAL A HG23   1 
ATOM   3350 N  N      . VAL A 1 233 ? 24.254  -36.685 1.641   1.00 13.64 ? 233 VAL A N      1 
ATOM   3351 C  CA     . VAL A 1 233 ? 24.987  -37.886 1.257   1.00 13.33 ? 233 VAL A CA     1 
ATOM   3352 C  C      . VAL A 1 233 ? 25.775  -37.659 -0.033  1.00 12.71 ? 233 VAL A C      1 
ATOM   3353 O  O      . VAL A 1 233 ? 26.925  -38.073 -0.130  1.00 13.99 ? 233 VAL A O      1 
ATOM   3354 C  CB     . VAL A 1 233 ? 24.039  -39.095 1.101   1.00 15.23 ? 233 VAL A CB     1 
ATOM   3355 C  CG1    . VAL A 1 233 ? 24.753  -40.290 0.436   1.00 14.67 ? 233 VAL A CG1    1 
ATOM   3356 C  CG2    . VAL A 1 233 ? 23.507  -39.506 2.456   1.00 16.66 ? 233 VAL A CG2    1 
ATOM   3357 H  H      . VAL A 1 233 ? 23.399  -36.753 1.578   1.00 16.37 ? 233 VAL A H      1 
ATOM   3358 H  HA     . VAL A 1 233 ? 25.623  -38.099 1.957   1.00 16.00 ? 233 VAL A HA     1 
ATOM   3359 H  HB     . VAL A 1 233 ? 23.286  -38.842 0.544   1.00 18.28 ? 233 VAL A HB     1 
ATOM   3360 H  HG11   . VAL A 1 233 ? 24.127  -41.027 0.356   1.00 17.60 ? 233 VAL A HG11   1 
ATOM   3361 H  HG12   . VAL A 1 233 ? 25.064  -40.023 -0.443  1.00 17.60 ? 233 VAL A HG12   1 
ATOM   3362 H  HG13   . VAL A 1 233 ? 25.507  -40.554 0.987   1.00 17.60 ? 233 VAL A HG13   1 
ATOM   3363 H  HG21   . VAL A 1 233 ? 22.913  -40.265 2.344   1.00 19.99 ? 233 VAL A HG21   1 
ATOM   3364 H  HG22   . VAL A 1 233 ? 24.252  -39.749 3.027   1.00 19.99 ? 233 VAL A HG22   1 
ATOM   3365 H  HG23   . VAL A 1 233 ? 23.022  -38.761 2.844   1.00 19.99 ? 233 VAL A HG23   1 
ATOM   3366 N  N      . GLU A 1 234 ? 25.171  -37.004 -1.018  1.00 13.39 ? 234 GLU A N      1 
ATOM   3367 C  CA     . GLU A 1 234 ? 25.873  -36.725 -2.269  1.00 15.27 ? 234 GLU A CA     1 
ATOM   3368 C  C      . GLU A 1 234 ? 27.104  -35.855 -2.017  1.00 12.08 ? 234 GLU A C      1 
ATOM   3369 O  O      . GLU A 1 234 ? 28.185  -36.146 -2.530  1.00 14.65 ? 234 GLU A O      1 
ATOM   3370 C  CB     . GLU A 1 234 ? 24.942  -36.056 -3.286  1.00 15.33 ? 234 GLU A CB     1 
ATOM   3371 C  CG     . GLU A 1 234 ? 23.874  -37.001 -3.832  1.00 16.35 ? 234 GLU A CG     1 
ATOM   3372 C  CD     . GLU A 1 234 ? 23.141  -36.451 -5.039  1.00 20.05 ? 234 GLU A CD     1 
ATOM   3373 O  OE1    . GLU A 1 234 ? 23.201  -35.223 -5.273  1.00 25.35 ? 234 GLU A OE1    1 
ATOM   3374 O  OE2    . GLU A 1 234 ? 22.500  -37.255 -5.754  1.00 24.34 ? 234 GLU A OE2    1 
ATOM   3375 H  H      . GLU A 1 234 ? 24.362  -36.711 -0.990  1.00 16.07 ? 234 GLU A H      1 
ATOM   3376 H  HA     . GLU A 1 234 ? 26.176  -37.564 -2.650  1.00 18.32 ? 234 GLU A HA     1 
ATOM   3377 H  HB2    . GLU A 1 234 ? 24.491  -35.311 -2.858  1.00 18.40 ? 234 GLU A HB2    1 
ATOM   3378 H  HB3    . GLU A 1 234 ? 25.470  -35.738 -4.035  1.00 18.40 ? 234 GLU A HB3    1 
ATOM   3379 H  HG2    . GLU A 1 234 ? 24.297  -37.834 -4.095  1.00 19.62 ? 234 GLU A HG2    1 
ATOM   3380 H  HG3    . GLU A 1 234 ? 23.219  -37.169 -3.137  1.00 19.62 ? 234 GLU A HG3    1 
ATOM   3381 N  N      . ARG A 1 235 ? 26.938  -34.790 -1.235  1.00 14.00 ? 235 ARG A N      1 
ATOM   3382 C  CA     . ARG A 1 235 ? 28.065  -33.923 -0.892  1.00 13.67 ? 235 ARG A CA     1 
ATOM   3383 C  C      . ARG A 1 235 ? 29.160  -34.714 -0.172  1.00 12.12 ? 235 ARG A C      1 
ATOM   3384 O  O      . ARG A 1 235 ? 30.350  -34.557 -0.460  1.00 14.62 ? 235 ARG A O      1 
ATOM   3385 C  CB     . ARG A 1 235 ? 27.604  -32.751 -0.018  1.00 15.34 ? 235 ARG A CB     1 
ATOM   3386 C  CG     . ARG A 1 235 ? 28.760  -31.966 0.591   1.00 16.75 ? 235 ARG A CG     1 
ATOM   3387 C  CD     . ARG A 1 235 ? 28.329  -30.710 1.317   1.00 17.81 ? 235 ARG A CD     1 
ATOM   3388 N  NE     . ARG A 1 235 ? 27.271  -30.940 2.298   1.00 18.62 ? 235 ARG A NE     1 
ATOM   3389 C  CZ     . ARG A 1 235 ? 25.996  -30.586 2.145   1.00 20.61 ? 235 ARG A CZ     1 
ATOM   3390 N  NH1    . ARG A 1 235 ? 25.576  -29.988 1.038   1.00 21.69 ? 235 ARG A NH1    1 
ATOM   3391 N  NH2    . ARG A 1 235 ? 25.128  -30.838 3.110   1.00 20.55 ? 235 ARG A NH2    1 
ATOM   3392 H  H      . ARG A 1 235 ? 26.187  -34.548 -0.891  1.00 16.80 ? 235 ARG A H      1 
ATOM   3393 H  HA     . ARG A 1 235 ? 28.444  -33.559 -1.707  1.00 16.40 ? 235 ARG A HA     1 
ATOM   3394 H  HB2    . ARG A 1 235 ? 27.081  -32.141 -0.561  1.00 18.41 ? 235 ARG A HB2    1 
ATOM   3395 H  HB3    . ARG A 1 235 ? 27.061  -33.095 0.708   1.00 18.41 ? 235 ARG A HB3    1 
ATOM   3396 H  HG2    . ARG A 1 235 ? 29.223  -32.533 1.228   1.00 20.10 ? 235 ARG A HG2    1 
ATOM   3397 H  HG3    . ARG A 1 235 ? 29.369  -31.705 -0.118  1.00 20.10 ? 235 ARG A HG3    1 
ATOM   3398 H  HD2    . ARG A 1 235 ? 29.094  -30.340 1.785   1.00 21.38 ? 235 ARG A HD2    1 
ATOM   3399 H  HD3    . ARG A 1 235 ? 27.999  -30.069 0.668   1.00 21.38 ? 235 ARG A HD3    1 
ATOM   3400 H  HE     . ARG A 1 235 ? 27.488  -31.334 3.030   1.00 22.34 ? 235 ARG A HE     1 
ATOM   3401 H  HH11   . ARG A 1 235 ? 26.132  -29.817 0.404   1.00 26.02 ? 235 ARG A HH11   1 
ATOM   3402 H  HH12   . ARG A 1 235 ? 24.749  -29.768 0.955   1.00 26.02 ? 235 ARG A HH12   1 
ATOM   3403 H  HH21   . ARG A 1 235 ? 25.388  -31.228 3.831   1.00 24.66 ? 235 ARG A HH21   1 
ATOM   3404 H  HH22   . ARG A 1 235 ? 24.302  -30.617 3.015   1.00 24.66 ? 235 ARG A HH22   1 
ATOM   3405 N  N      . SER A 1 236 ? 28.755  -35.569 0.760   1.00 14.44 ? 236 SER A N      1 
ATOM   3406 C  CA     . SER A 1 236 ? 29.709  -36.312 1.572   1.00 14.37 ? 236 SER A CA     1 
ATOM   3407 C  C      . SER A 1 236 ? 30.509  -37.294 0.717   1.00 13.25 ? 236 SER A C      1 
ATOM   3408 O  O      . SER A 1 236 ? 31.721  -37.435 0.890   1.00 15.28 ? 236 SER A O      1 
ATOM   3409 C  CB     . SER A 1 236 ? 28.989  -37.047 2.702   1.00 14.88 ? 236 SER A CB     1 
ATOM   3410 O  OG     . SER A 1 236 ? 28.339  -36.128 3.570   1.00 16.70 ? 236 SER A OG     1 
ATOM   3411 H  H      . SER A 1 236 ? 27.931  -35.736 0.943   1.00 17.33 ? 236 SER A H      1 
ATOM   3412 H  HA     . SER A 1 236 ? 30.334  -35.687 1.973   1.00 17.25 ? 236 SER A HA     1 
ATOM   3413 H  HB2    . SER A 1 236 ? 28.326  -37.643 2.319   1.00 17.86 ? 236 SER A HB2    1 
ATOM   3414 H  HB3    . SER A 1 236 ? 29.639  -37.557 3.212   1.00 17.86 ? 236 SER A HB3    1 
ATOM   3415 H  HG     . SER A 1 236 ? 27.773  -35.680 3.141   1.00 20.04 ? 236 SER A HG     1 
ATOM   3416 N  N      . VAL A 1 237 ? 29.837  -37.956 -0.217  1.00 14.63 ? 237 VAL A N      1 
ATOM   3417 C  CA     . VAL A 1 237 ? 30.512  -38.894 -1.113  1.00 13.21 ? 237 VAL A CA     1 
ATOM   3418 C  C      . VAL A 1 237 ? 31.513  -38.143 -1.991  1.00 13.17 ? 237 VAL A C      1 
ATOM   3419 O  O      . VAL A 1 237 ? 32.644  -38.585 -2.186  1.00 15.78 ? 237 VAL A O      1 
ATOM   3420 C  CB     . VAL A 1 237 ? 29.499  -39.667 -1.992  1.00 15.93 ? 237 VAL A CB     1 
ATOM   3421 C  CG1    . VAL A 1 237 ? 30.190  -40.400 -3.141  1.00 16.75 ? 237 VAL A CG1    1 
ATOM   3422 C  CG2    . VAL A 1 237 ? 28.711  -40.655 -1.141  1.00 14.39 ? 237 VAL A CG2    1 
ATOM   3423 H  H      . VAL A 1 237 ? 28.991  -37.882 -0.355  1.00 17.56 ? 237 VAL A H      1 
ATOM   3424 H  HA     . VAL A 1 237 ? 31.003  -39.541 -0.583  1.00 15.85 ? 237 VAL A HA     1 
ATOM   3425 H  HB     . VAL A 1 237 ? 28.870  -39.036 -2.376  1.00 19.12 ? 237 VAL A HB     1 
ATOM   3426 H  HG11   . VAL A 1 237 ? 29.520  -40.868 -3.664  1.00 20.10 ? 237 VAL A HG11   1 
ATOM   3427 H  HG12   . VAL A 1 237 ? 30.650  -39.752 -3.697  1.00 20.10 ? 237 VAL A HG12   1 
ATOM   3428 H  HG13   . VAL A 1 237 ? 30.826  -41.033 -2.774  1.00 20.10 ? 237 VAL A HG13   1 
ATOM   3429 H  HG21   . VAL A 1 237 ? 28.083  -41.128 -1.709  1.00 17.27 ? 237 VAL A HG21   1 
ATOM   3430 H  HG22   . VAL A 1 237 ? 29.328  -41.283 -0.734  1.00 17.27 ? 237 VAL A HG22   1 
ATOM   3431 H  HG23   . VAL A 1 237 ? 28.233  -40.167 -0.453  1.00 17.27 ? 237 VAL A HG23   1 
ATOM   3432 N  N      . TYR A 1 238 ? 31.092  -37.002 -2.523  1.00 15.42 ? 238 TYR A N      1 
ATOM   3433 C  CA     . TYR A 1 238 ? 31.954  -36.202 -3.379  1.00 15.00 ? 238 TYR A CA     1 
ATOM   3434 C  C      . TYR A 1 238 ? 33.203  -35.716 -2.630  1.00 17.33 ? 238 TYR A C      1 
ATOM   3435 O  O      . TYR A 1 238 ? 34.331  -35.820 -3.132  1.00 17.75 ? 238 TYR A O      1 
ATOM   3436 C  CB     . TYR A 1 238 ? 31.170  -35.013 -3.938  1.00 16.12 ? 238 TYR A CB     1 
ATOM   3437 C  CG     . TYR A 1 238 ? 32.053  -33.845 -4.261  1.00 18.21 ? 238 TYR A CG     1 
ATOM   3438 C  CD1    . TYR A 1 238 ? 32.895  -33.883 -5.357  1.00 20.64 ? 238 TYR A CD1    1 
ATOM   3439 C  CD2    . TYR A 1 238 ? 32.067  -32.719 -3.461  1.00 19.75 ? 238 TYR A CD2    1 
ATOM   3440 C  CE1    . TYR A 1 238 ? 33.716  -32.837 -5.652  1.00 22.83 ? 238 TYR A CE1    1 
ATOM   3441 C  CE2    . TYR A 1 238 ? 32.896  -31.658 -3.752  1.00 21.42 ? 238 TYR A CE2    1 
ATOM   3442 C  CZ     . TYR A 1 238 ? 33.714  -31.729 -4.851  1.00 22.60 ? 238 TYR A CZ     1 
ATOM   3443 O  OH     . TYR A 1 238 ? 34.546  -30.685 -5.161  1.00 29.18 ? 238 TYR A OH     1 
ATOM   3444 H  H      . TYR A 1 238 ? 30.308  -36.669 -2.404  1.00 18.50 ? 238 TYR A H      1 
ATOM   3445 H  HA     . TYR A 1 238 ? 32.247  -36.745 -4.127  1.00 18.00 ? 238 TYR A HA     1 
ATOM   3446 H  HB2    . TYR A 1 238 ? 30.721  -35.285 -4.754  1.00 19.34 ? 238 TYR A HB2    1 
ATOM   3447 H  HB3    . TYR A 1 238 ? 30.519  -34.724 -3.280  1.00 19.34 ? 238 TYR A HB3    1 
ATOM   3448 H  HD1    . TYR A 1 238 ? 32.901  -34.636 -5.903  1.00 24.77 ? 238 TYR A HD1    1 
ATOM   3449 H  HD2    . TYR A 1 238 ? 31.512  -32.678 -2.715  1.00 23.70 ? 238 TYR A HD2    1 
ATOM   3450 H  HE1    . TYR A 1 238 ? 34.274  -32.876 -6.395  1.00 27.40 ? 238 TYR A HE1    1 
ATOM   3451 H  HE2    . TYR A 1 238 ? 32.899  -30.901 -3.212  1.00 25.70 ? 238 TYR A HE2    1 
ATOM   3452 H  HH     . TYR A 1 238 ? 34.454  -30.068 -4.598  1.00 35.02 ? 238 TYR A HH     1 
ATOM   3453 N  N      . ARG A 1 239 ? 33.012  -35.200 -1.421  1.00 17.54 ? 239 ARG A N      1 
ATOM   3454 C  CA     . ARG A 1 239 ? 34.143  -34.706 -0.632  1.00 18.26 ? 239 ARG A CA     1 
ATOM   3455 C  C      . ARG A 1 239 ? 35.104  -35.823 -0.228  1.00 18.32 ? 239 ARG A C      1 
ATOM   3456 O  O      . ARG A 1 239 ? 36.315  -35.606 -0.102  1.00 20.94 ? 239 ARG A O      1 
ATOM   3457 C  CB     . ARG A 1 239 ? 33.648  -33.988 0.615   1.00 20.95 ? 239 ARG A CB     1 
ATOM   3458 C  CG     . ARG A 1 239 ? 32.939  -32.685 0.323   1.00 23.74 ? 239 ARG A CG     1 
ATOM   3459 C  CD     . ARG A 1 239 ? 33.483  -31.609 1.212   1.00 30.17 ? 239 ARG A CD     1 
ATOM   3460 N  NE     . ARG A 1 239 ? 32.638  -30.416 1.254   1.00 23.71 ? 239 ARG A NE     1 
ATOM   3461 C  CZ     . ARG A 1 239 ? 32.528  -29.619 2.314   1.00 23.74 ? 239 ARG A CZ     1 
ATOM   3462 N  NH1    . ARG A 1 239 ? 33.194  -29.887 3.434   1.00 28.99 ? 239 ARG A NH1    1 
ATOM   3463 N  NH2    . ARG A 1 239 ? 31.739  -28.555 2.260   1.00 26.46 ? 239 ARG A NH2    1 
ATOM   3464 H  H      . ARG A 1 239 ? 32.247  -35.123 -1.036  1.00 21.04 ? 239 ARG A H      1 
ATOM   3465 H  HA     . ARG A 1 239 ? 34.640  -34.066 -1.165  1.00 21.91 ? 239 ARG A HA     1 
ATOM   3466 H  HB2    . ARG A 1 239 ? 33.025  -34.566 1.083   1.00 25.14 ? 239 ARG A HB2    1 
ATOM   3467 H  HB3    . ARG A 1 239 ? 34.407  -33.791 1.186   1.00 25.14 ? 239 ARG A HB3    1 
ATOM   3468 H  HG2    . ARG A 1 239 ? 33.091  -32.430 -0.601  1.00 28.49 ? 239 ARG A HG2    1 
ATOM   3469 H  HG3    . ARG A 1 239 ? 31.990  -32.783 0.499   1.00 28.49 ? 239 ARG A HG3    1 
ATOM   3470 H  HD2    . ARG A 1 239 ? 33.557  -31.955 2.116   1.00 36.21 ? 239 ARG A HD2    1 
ATOM   3471 H  HD3    . ARG A 1 239 ? 34.358  -31.344 0.887   1.00 36.21 ? 239 ARG A HD3    1 
ATOM   3472 H  HE     . ARG A 1 239 ? 32.130  -30.258 0.578   1.00 28.45 ? 239 ARG A HE     1 
ATOM   3473 H  HH11   . ARG A 1 239 ? 33.707  -30.576 3.474   1.00 34.79 ? 239 ARG A HH11   1 
ATOM   3474 H  HH12   . ARG A 1 239 ? 33.115  -29.368 4.115   1.00 34.79 ? 239 ARG A HH12   1 
ATOM   3475 H  HH21   . ARG A 1 239 ? 31.304  -28.378 1.540   1.00 31.75 ? 239 ARG A HH21   1 
ATOM   3476 H  HH22   . ARG A 1 239 ? 31.663  -28.041 2.945   1.00 31.75 ? 239 ARG A HH22   1 
ATOM   3477 N  N      . HIS A 1 240 ? 34.553  -37.011 -0.013  1.00 17.01 ? 240 HIS A N      1 
ATOM   3478 C  CA     . HIS A 1 240 ? 35.341  -38.199 0.307   1.00 16.76 ? 240 HIS A CA     1 
ATOM   3479 C  C      . HIS A 1 240 ? 36.165  -38.610 -0.912  1.00 20.11 ? 240 HIS A C      1 
ATOM   3480 O  O      . HIS A 1 240 ? 37.396  -38.753 -0.833  1.00 20.90 ? 240 HIS A O      1 
ATOM   3481 C  CB     . HIS A 1 240 ? 34.411  -39.327 0.759   1.00 16.16 ? 240 HIS A CB     1 
ATOM   3482 C  CG     . HIS A 1 240 ? 35.120  -40.558 1.231   1.00 19.00 ? 240 HIS A CG     1 
ATOM   3483 N  ND1    . HIS A 1 240 ? 35.971  -40.557 2.316   1.00 21.33 ? 240 HIS A ND1    1 
ATOM   3484 C  CD2    . HIS A 1 240 ? 35.083  -41.833 0.782   1.00 21.72 ? 240 HIS A CD2    1 
ATOM   3485 C  CE1    . HIS A 1 240 ? 36.439  -41.778 2.504   1.00 21.46 ? 240 HIS A CE1    1 
ATOM   3486 N  NE2    . HIS A 1 240 ? 35.916  -42.572 1.586   1.00 21.76 ? 240 HIS A NE2    1 
ATOM   3487 H  H      . HIS A 1 240 ? 33.706  -37.159 -0.047  1.00 20.42 ? 240 HIS A H      1 
ATOM   3488 H  HA     . HIS A 1 240 ? 35.951  -37.995 1.034   1.00 20.12 ? 240 HIS A HA     1 
ATOM   3489 H  HB2    . HIS A 1 240 ? 33.863  -39.004 1.491   1.00 19.39 ? 240 HIS A HB2    1 
ATOM   3490 H  HB3    . HIS A 1 240 ? 33.844  -39.581 0.014   1.00 19.39 ? 240 HIS A HB3    1 
ATOM   3491 H  HD2    . HIS A 1 240 ? 34.592  -42.148 0.058   1.00 26.07 ? 240 HIS A HD2    1 
ATOM   3492 H  HE1    . HIS A 1 240 ? 37.035  -42.035 3.170   1.00 25.75 ? 240 HIS A HE1    1 
ATOM   3493 N  N      . GLY A 1 241 ? 35.470  -38.816 -2.028  1.00 18.95 ? 241 GLY A N      1 
ATOM   3494 C  CA     . GLY A 1 241 ? 36.091  -38.934 -3.337  1.00 19.06 ? 241 GLY A CA     1 
ATOM   3495 C  C      . GLY A 1 241 ? 36.977  -40.137 -3.601  1.00 19.66 ? 241 GLY A C      1 
ATOM   3496 O  O      . GLY A 1 241 ? 37.861  -40.068 -4.460  1.00 24.31 ? 241 GLY A O      1 
ATOM   3497 H  H      . GLY A 1 241 ? 34.613  -38.892 -2.048  1.00 22.73 ? 241 GLY A H      1 
ATOM   3498 H  HA2    . GLY A 1 241 ? 35.388  -38.943 -4.006  1.00 22.87 ? 241 GLY A HA2    1 
ATOM   3499 H  HA3    . GLY A 1 241 ? 36.629  -38.142 -3.490  1.00 22.87 ? 241 GLY A HA3    1 
ATOM   3500 N  N      . THR A 1 242 ? 36.744  -41.236 -2.891  1.00 19.39 ? 242 THR A N      1 
ATOM   3501 C  CA     . THR A 1 242 ? 37.547  -42.441 -3.079  1.00 19.30 ? 242 THR A CA     1 
ATOM   3502 C  C      . THR A 1 242 ? 36.790  -43.706 -2.695  1.00 20.04 ? 242 THR A C      1 
ATOM   3503 O  O      . THR A 1 242 ? 35.898  -43.672 -1.849  1.00 20.45 ? 242 THR A O      1 
ATOM   3504 C  CB     . THR A 1 242 ? 38.853  -42.377 -2.254  1.00 25.35 ? 242 THR A CB     1 
ATOM   3505 O  OG1    . THR A 1 242 ? 39.662  -43.526 -2.543  1.00 26.36 ? 242 THR A OG1    1 
ATOM   3506 C  CG2    . THR A 1 242 ? 38.556  -42.333 -0.761  1.00 27.58 ? 242 THR A CG2    1 
ATOM   3507 H  H      . THR A 1 242 ? 36.129  -41.310 -2.295  1.00 23.27 ? 242 THR A H      1 
ATOM   3508 H  HA     . THR A 1 242 ? 37.790  -42.512 -4.015  1.00 23.17 ? 242 THR A HA     1 
ATOM   3509 H  HB     . THR A 1 242 ? 39.342  -41.574 -2.490  1.00 30.42 ? 242 THR A HB     1 
ATOM   3510 H  HG1    . THR A 1 242 ? 40.373  -43.495 -2.096  1.00 31.63 ? 242 THR A HG1    1 
ATOM   3511 H  HG21   . THR A 1 242 ? 39.385  -42.294 -0.259  1.00 33.10 ? 242 THR A HG21   1 
ATOM   3512 H  HG22   . THR A 1 242 ? 38.023  -41.550 -0.552  1.00 33.10 ? 242 THR A HG22   1 
ATOM   3513 H  HG23   . THR A 1 242 ? 38.065  -43.128 -0.497  1.00 33.10 ? 242 THR A HG23   1 
ATOM   3514 N  N      . SER A 1 243 ? 37.161  -44.818 -3.325  1.00 20.52 ? 243 SER A N      1 
ATOM   3515 C  CA     . SER A 1 243 ? 36.617  -46.129 -2.982  1.00 19.43 ? 243 SER A CA     1 
ATOM   3516 C  C      . SER A 1 243 ? 37.589  -46.912 -2.100  1.00 21.39 ? 243 SER A C      1 
ATOM   3517 O  O      . SER A 1 243 ? 37.299  -48.043 -1.702  1.00 23.18 ? 243 SER A O      1 
ATOM   3518 C  CB     . SER A 1 243 ? 36.309  -46.934 -4.250  1.00 20.62 ? 243 SER A CB     1 
ATOM   3519 O  OG     . SER A 1 243 ? 35.323  -46.300 -5.048  1.00 21.08 ? 243 SER A OG     1 
ATOM   3520 H  H      . SER A 1 243 ? 37.736  -44.839 -3.964  1.00 24.63 ? 243 SER A H      1 
ATOM   3521 H  HA     . SER A 1 243 ? 35.790  -46.011 -2.490  1.00 23.31 ? 243 SER A HA     1 
ATOM   3522 H  HB2    . SER A 1 243 ? 37.123  -47.023 -4.770  1.00 24.75 ? 243 SER A HB2    1 
ATOM   3523 H  HB3    . SER A 1 243 ? 35.986  -47.812 -3.993  1.00 24.75 ? 243 SER A HB3    1 
ATOM   3524 H  HG     . SER A 1 243 ? 34.610  -46.218 -4.612  1.00 25.30 ? 243 SER A HG     1 
ATOM   3525 N  N      . ASP A 1 244 ? 38.734  -46.306 -1.787  1.00 23.82 ? 244 ASP A N      1 
ATOM   3526 C  CA     . ASP A 1 244 ? 39.824  -47.020 -1.118  1.00 25.55 ? 244 ASP A CA     1 
ATOM   3527 C  C      . ASP A 1 244 ? 39.564  -47.274 0.366   1.00 27.06 ? 244 ASP A C      1 
ATOM   3528 O  O      . ASP A 1 244 ? 40.128  -48.204 0.945   1.00 30.03 ? 244 ASP A O      1 
ATOM   3529 C  CB     . ASP A 1 244 ? 41.136  -46.249 -1.277  1.00 30.85 ? 244 ASP A CB     1 
ATOM   3530 C  CG     . ASP A 1 244 ? 41.676  -46.299 -2.692  1.00 39.13 ? 244 ASP A CG     1 
ATOM   3531 O  OD1    . ASP A 1 244 ? 41.182  -47.115 -3.499  1.00 43.10 ? 244 ASP A OD1    1 
ATOM   3532 O  OD2    . ASP A 1 244 ? 42.607  -45.525 -2.993  1.00 43.21 ? 244 ASP A OD2    1 
ATOM   3533 H  H      . ASP A 1 244 ? 38.906  -45.480 -1.952  1.00 28.59 ? 244 ASP A H      1 
ATOM   3534 H  HA     . ASP A 1 244 ? 39.937  -47.882 -1.547  1.00 30.66 ? 244 ASP A HA     1 
ATOM   3535 H  HB2    . ASP A 1 244 ? 40.986  -45.319 -1.046  1.00 37.02 ? 244 ASP A HB2    1 
ATOM   3536 H  HB3    . ASP A 1 244 ? 41.803  -46.635 -0.688  1.00 37.02 ? 244 ASP A HB3    1 
ATOM   3537 N  N      . TYR A 1 245 ? 38.729  -46.448 0.986   1.00 25.59 ? 245 TYR A N      1 
ATOM   3538 C  CA     . TYR A 1 245 ? 38.327  -46.693 2.364   1.00 27.39 ? 245 TYR A CA     1 
ATOM   3539 C  C      . TYR A 1 245 ? 36.960  -46.083 2.640   1.00 21.33 ? 245 TYR A C      1 
ATOM   3540 O  O      . TYR A 1 245 ? 36.486  -45.241 1.870   1.00 20.02 ? 245 TYR A O      1 
ATOM   3541 C  CB     . TYR A 1 245 ? 39.366  -46.149 3.343   1.00 30.61 ? 245 TYR A CB     1 
ATOM   3542 C  CG     . TYR A 1 245 ? 39.840  -44.752 3.056   1.00 33.09 ? 245 TYR A CG     1 
ATOM   3543 C  CD1    . TYR A 1 245 ? 39.159  -43.648 3.553   1.00 39.74 ? 245 TYR A CD1    1 
ATOM   3544 C  CD2    . TYR A 1 245 ? 40.992  -44.534 2.310   1.00 31.48 ? 245 TYR A CD2    1 
ATOM   3545 C  CE1    . TYR A 1 245 ? 39.601  -42.370 3.300   1.00 44.37 ? 245 TYR A CE1    1 
ATOM   3546 C  CE2    . TYR A 1 245 ? 41.437  -43.252 2.049   1.00 39.32 ? 245 TYR A CE2    1 
ATOM   3547 C  CZ     . TYR A 1 245 ? 40.734  -42.174 2.548   1.00 45.28 ? 245 TYR A CZ     1 
ATOM   3548 O  OH     . TYR A 1 245 ? 41.169  -40.891 2.299   1.00 48.75 ? 245 TYR A OH     1 
ATOM   3549 H  H      . TYR A 1 245 ? 38.383  -45.743 0.633   1.00 30.70 ? 245 TYR A H      1 
ATOM   3550 H  HA     . TYR A 1 245 ? 38.259  -47.651 2.505   1.00 32.87 ? 245 TYR A HA     1 
ATOM   3551 N  N      . PRO A 1 246 ? 36.318  -46.519 3.735   1.00 21.61 ? 246 PRO A N      1 
ATOM   3552 C  CA     . PRO A 1 246 ? 34.933  -46.125 4.014   1.00 20.19 ? 246 PRO A CA     1 
ATOM   3553 C  C      . PRO A 1 246 ? 34.753  -44.637 4.273   1.00 17.89 ? 246 PRO A C      1 
ATOM   3554 O  O      . PRO A 1 246 ? 35.662  -43.948 4.744   1.00 21.77 ? 246 PRO A O      1 
ATOM   3555 C  CB     . PRO A 1 246 ? 34.579  -46.929 5.270   1.00 23.55 ? 246 PRO A CB     1 
ATOM   3556 C  CG     . PRO A 1 246 ? 35.879  -47.289 5.878   1.00 31.23 ? 246 PRO A CG     1 
ATOM   3557 C  CD     . PRO A 1 246 ? 36.829  -47.464 4.743   1.00 27.29 ? 246 PRO A CD     1 
ATOM   3558 H  HA     . PRO A 1 246 ? 34.352  -46.396 3.286   1.00 24.22 ? 246 PRO A HA     1 
ATOM   3559 H  HB2    . PRO A 1 246 ? 34.059  -46.378 5.875   1.00 28.25 ? 246 PRO A HB2    1 
ATOM   3560 H  HB3    . PRO A 1 246 ? 34.086  -47.726 5.020   1.00 28.25 ? 246 PRO A HB3    1 
ATOM   3561 H  HG2    . PRO A 1 246 ? 36.174  -46.573 6.462   1.00 37.48 ? 246 PRO A HG2    1 
ATOM   3562 H  HG3    . PRO A 1 246 ? 35.787  -48.117 6.375   1.00 37.48 ? 246 PRO A HG3    1 
ATOM   3563 H  HD2    . PRO A 1 246 ? 37.729  -47.220 5.012   1.00 32.75 ? 246 PRO A HD2    1 
ATOM   3564 H  HD3    . PRO A 1 246 ? 36.792  -48.373 4.406   1.00 32.75 ? 246 PRO A HD3    1 
ATOM   3565 N  N      . LEU A 1 247 ? 33.553  -44.167 3.951   1.00 18.96 ? 247 LEU A N      1 
ATOM   3566 C  CA     . LEU A 1 247 ? 33.143  -42.793 4.192   1.00 17.27 ? 247 LEU A CA     1 
ATOM   3567 C  C      . LEU A 1 247 ? 32.933  -42.578 5.685   1.00 18.96 ? 247 LEU A C      1 
ATOM   3568 O  O      . LEU A 1 247 ? 32.101  -43.243 6.310   1.00 17.27 ? 247 LEU A O      1 
ATOM   3569 C  CB     . LEU A 1 247 ? 31.863  -42.488 3.409   1.00 18.82 ? 247 LEU A CB     1 
ATOM   3570 C  CG     . LEU A 1 247 ? 31.298  -41.064 3.372   1.00 25.87 ? 247 LEU A CG     1 
ATOM   3571 C  CD1    . LEU A 1 247 ? 30.158  -41.027 2.364   1.00 26.52 ? 247 LEU A CD1    1 
ATOM   3572 C  CD2    . LEU A 1 247 ? 30.801  -40.564 4.723   1.00 28.41 ? 247 LEU A CD2    1 
ATOM   3573 H  H      . LEU A 1 247 ? 32.941  -44.643 3.580   1.00 22.75 ? 247 LEU A H      1 
ATOM   3574 H  HA     . LEU A 1 247 ? 33.840  -42.190 3.890   1.00 20.73 ? 247 LEU A HA     1 
ATOM   3575 H  HB2    . LEU A 1 247 ? 32.021  -42.744 2.487   1.00 22.59 ? 247 LEU A HB2    1 
ATOM   3576 H  HB3    . LEU A 1 247 ? 31.161  -43.052 3.771   1.00 22.59 ? 247 LEU A HB3    1 
ATOM   3577 H  HG     . LEU A 1 247 ? 31.990  -40.458 3.064   1.00 31.05 ? 247 LEU A HG     1 
ATOM   3578 H  HD11   . LEU A 1 247 ? 29.793  -40.129 2.334   1.00 31.82 ? 247 LEU A HD11   1 
ATOM   3579 H  HD12   . LEU A 1 247 ? 30.500  -41.276 1.491   1.00 31.82 ? 247 LEU A HD12   1 
ATOM   3580 H  HD13   . LEU A 1 247 ? 29.471  -41.654 2.642   1.00 31.82 ? 247 LEU A HD13   1 
ATOM   3581 H  HD21   . LEU A 1 247 ? 30.461  -39.662 4.620   1.00 34.09 ? 247 LEU A HD21   1 
ATOM   3582 H  HD22   . LEU A 1 247 ? 30.095  -41.151 5.036   1.00 34.09 ? 247 LEU A HD22   1 
ATOM   3583 H  HD23   . LEU A 1 247 ? 31.540  -40.570 5.352   1.00 34.09 ? 247 LEU A HD23   1 
ATOM   3584 N  N      . ASP A 1 248 ? 33.681  -41.631 6.240   1.00 19.49 ? 248 ASP A N      1 
ATOM   3585 C  CA     . ASP A 1 248 ? 33.674  -41.368 7.672   1.00 20.32 ? 248 ASP A CA     1 
ATOM   3586 C  C      . ASP A 1 248 ? 33.065  -40.012 8.018   1.00 21.92 ? 248 ASP A C      1 
ATOM   3587 O  O      . ASP A 1 248 ? 32.449  -39.858 9.070   1.00 23.24 ? 248 ASP A O      1 
ATOM   3588 C  CB     . ASP A 1 248 ? 35.103  -41.441 8.215   1.00 22.45 ? 248 ASP A CB     1 
ATOM   3589 C  CG     . ASP A 1 248 ? 35.168  -41.275 9.718   1.00 26.38 ? 248 ASP A CG     1 
ATOM   3590 O  OD1    . ASP A 1 248 ? 34.623  -42.139 10.432  1.00 24.91 ? 248 ASP A OD1    1 
ATOM   3591 O  OD2    . ASP A 1 248 ? 35.784  -40.291 10.186  1.00 29.61 ? 248 ASP A OD2    1 
ATOM   3592 H  H      . ASP A 1 248 ? 34.212  -41.118 5.798   1.00 23.39 ? 248 ASP A H      1 
ATOM   3593 H  HA     . ASP A 1 248 ? 33.149  -42.053 8.115   1.00 24.38 ? 248 ASP A HA     1 
ATOM   3594 H  HB2    . ASP A 1 248 ? 35.482  -42.306 7.992   1.00 26.94 ? 248 ASP A HB2    1 
ATOM   3595 H  HB3    . ASP A 1 248 ? 35.631  -40.734 7.812   1.00 26.94 ? 248 ASP A HB3    1 
ATOM   3596 N  N      A ASP A 1 249 ? 33.257  -39.041 7.128   0.36 22.89 ? 249 ASP A N      1 
ATOM   3597 N  N      B ASP A 1 249 ? 33.218  -39.043 7.120   0.64 18.84 ? 249 ASP A N      1 
ATOM   3598 C  CA     A ASP A 1 249 ? 32.827  -37.666 7.363   0.36 24.33 ? 249 ASP A CA     1 
ATOM   3599 C  CA     B ASP A 1 249 ? 32.836  -37.662 7.402   0.64 20.59 ? 249 ASP A CA     1 
ATOM   3600 C  C      A ASP A 1 249 ? 31.514  -37.344 6.661   0.36 21.46 ? 249 ASP A C      1 
ATOM   3601 C  C      B ASP A 1 249 ? 31.542  -37.257 6.691   0.64 19.53 ? 249 ASP A C      1 
ATOM   3602 O  O      A ASP A 1 249 ? 31.468  -37.190 5.440   0.36 20.99 ? 249 ASP A O      1 
ATOM   3603 O  O      B ASP A 1 249 ? 31.537  -36.969 5.494   0.64 21.28 ? 249 ASP A O      1 
ATOM   3604 C  CB     A ASP A 1 249 ? 33.904  -36.684 6.893   0.36 28.92 ? 249 ASP A CB     1 
ATOM   3605 C  CB     B ASP A 1 249 ? 33.978  -36.721 7.004   0.64 24.26 ? 249 ASP A CB     1 
ATOM   3606 C  CG     A ASP A 1 249 ? 35.183  -36.786 7.702   0.36 34.36 ? 249 ASP A CG     1 
ATOM   3607 C  CG     B ASP A 1 249 ? 33.830  -35.333 7.599   0.64 32.38 ? 249 ASP A CG     1 
ATOM   3608 O  OD1    A ASP A 1 249 ? 35.108  -37.103 8.907   0.36 35.66 ? 249 ASP A OD1    1 
ATOM   3609 O  OD1    B ASP A 1 249 ? 32.895  -35.111 8.396   0.64 34.62 ? 249 ASP A OD1    1 
ATOM   3610 O  OD2    A ASP A 1 249 ? 36.267  -36.542 7.131   0.36 39.51 ? 249 ASP A OD2    1 
ATOM   3611 O  OD2    B ASP A 1 249 ? 34.666  -34.464 7.274   0.64 36.68 ? 249 ASP A OD2    1 
ATOM   3612 H  H      A ASP A 1 249 ? 33.642  -39.157 6.367   0.36 27.47 ? 249 ASP A H      1 
ATOM   3613 H  H      B ASP A 1 249 ? 33.545  -39.161 6.333   0.64 22.61 ? 249 ASP A H      1 
ATOM   3614 H  HA     A ASP A 1 249 ? 32.697  -37.535 8.315   0.36 29.20 ? 249 ASP A HA     1 
ATOM   3615 H  HA     B ASP A 1 249 ? 32.692  -37.566 8.357   0.64 24.71 ? 249 ASP A HA     1 
ATOM   3616 H  HB2    A ASP A 1 249 ? 34.119  -36.872 5.966   0.36 34.70 ? 249 ASP A HB2    1 
ATOM   3617 H  HB2    B ASP A 1 249 ? 34.817  -37.093 7.317   0.64 29.11 ? 249 ASP A HB2    1 
ATOM   3618 H  HB3    A ASP A 1 249 ? 33.565  -35.779 6.979   0.36 34.70 ? 249 ASP A HB3    1 
ATOM   3619 H  HB3    B ASP A 1 249 ? 33.993  -36.633 6.038   0.64 29.11 ? 249 ASP A HB3    1 
ATOM   3620 N  N      . ILE A 1 250 ? 30.446  -37.238 7.444   1.00 19.94 ? 250 ILE A N      1 
ATOM   3621 C  CA     . ILE A 1 250 ? 29.151  -36.819 6.917   1.00 19.67 ? 250 ILE A CA     1 
ATOM   3622 C  C      . ILE A 1 250 ? 29.031  -35.304 7.071   1.00 18.99 ? 250 ILE A C      1 
ATOM   3623 O  O      . ILE A 1 250 ? 29.042  -34.784 8.189   1.00 22.85 ? 250 ILE A O      1 
ATOM   3624 C  CB     . ILE A 1 250 ? 27.982  -37.529 7.641   1.00 19.78 ? 250 ILE A CB     1 
ATOM   3625 C  CG1    . ILE A 1 250 ? 28.069  -39.045 7.430   1.00 20.37 ? 250 ILE A CG1    1 
ATOM   3626 C  CG2    . ILE A 1 250 ? 26.637  -36.996 7.165   1.00 20.87 ? 250 ILE A CG2    1 
ATOM   3627 C  CD1    . ILE A 1 250 ? 27.819  -39.502 5.997   1.00 22.61 ? 250 ILE A CD1    1 
ATOM   3628 H  H      A ILE A 1 250 ? 30.445  -37.403 8.288   0.36 23.92 ? 250 ILE A H      1 
ATOM   3629 H  H      B ILE A 1 250 ? 30.427  -37.466 8.273   0.64 23.92 ? 250 ILE A H      1 
ATOM   3630 H  HA     . ILE A 1 250 ? 29.102  -37.035 5.973   1.00 23.60 ? 250 ILE A HA     1 
ATOM   3631 H  HB     . ILE A 1 250 ? 28.061  -37.350 8.591   1.00 23.73 ? 250 ILE A HB     1 
ATOM   3632 H  HG12   . ILE A 1 250 ? 28.956  -39.343 7.683   1.00 24.44 ? 250 ILE A HG12   1 
ATOM   3633 H  HG13   . ILE A 1 250 ? 27.407  -39.474 7.995   1.00 24.44 ? 250 ILE A HG13   1 
ATOM   3634 H  HG21   . ILE A 1 250 ? 25.928  -37.461 7.637   1.00 25.04 ? 250 ILE A HG21   1 
ATOM   3635 H  HG22   . ILE A 1 250 ? 26.590  -36.045 7.351   1.00 25.04 ? 250 ILE A HG22   1 
ATOM   3636 H  HG23   . ILE A 1 250 ? 26.556  -37.150 6.211   1.00 25.04 ? 250 ILE A HG23   1 
ATOM   3637 H  HD11   . ILE A 1 250 ? 27.893  -40.468 5.957   1.00 27.14 ? 250 ILE A HD11   1 
ATOM   3638 H  HD12   . ILE A 1 250 ? 26.929  -39.226 5.729   1.00 27.14 ? 250 ILE A HD12   1 
ATOM   3639 H  HD13   . ILE A 1 250 ? 28.481  -39.095 5.417   1.00 27.14 ? 250 ILE A HD13   1 
ATOM   3640 N  N      . ILE A 1 251 ? 28.929  -34.605 5.943   1.00 17.41 ? 251 ILE A N      1 
ATOM   3641 C  CA     . ILE A 1 251 ? 28.919  -33.147 5.924   1.00 18.06 ? 251 ILE A CA     1 
ATOM   3642 C  C      . ILE A 1 251 ? 27.485  -32.629 5.915   1.00 17.27 ? 251 ILE A C      1 
ATOM   3643 O  O      . ILE A 1 251 ? 26.917  -32.358 4.858   1.00 18.17 ? 251 ILE A O      1 
ATOM   3644 C  CB     . ILE A 1 251 ? 29.670  -32.592 4.690   1.00 21.11 ? 251 ILE A CB     1 
ATOM   3645 C  CG1    . ILE A 1 251 ? 31.006  -33.320 4.486   1.00 28.97 ? 251 ILE A CG1    1 
ATOM   3646 C  CG2    . ILE A 1 251 ? 29.869  -31.084 4.822   1.00 23.22 ? 251 ILE A CG2    1 
ATOM   3647 C  CD1    . ILE A 1 251 ? 31.964  -33.236 5.664   1.00 30.89 ? 251 ILE A CD1    1 
ATOM   3648 H  H      . ILE A 1 251 ? 28.863  -34.961 5.163   1.00 20.90 ? 251 ILE A H      1 
ATOM   3649 H  HA     . ILE A 1 251 ? 29.358  -32.814 6.722   1.00 21.67 ? 251 ILE A HA     1 
ATOM   3650 H  HB     . ILE A 1 251 ? 29.119  -32.753 3.908   1.00 25.33 ? 251 ILE A HB     1 
ATOM   3651 H  HG12   . ILE A 1 251 ? 30.825  -34.258 4.321   1.00 34.76 ? 251 ILE A HG12   1 
ATOM   3652 H  HG13   . ILE A 1 251 ? 31.454  -32.934 3.716   1.00 34.76 ? 251 ILE A HG13   1 
ATOM   3653 H  HG21   . ILE A 1 251 ? 30.340  -30.759 4.039   1.00 27.86 ? 251 ILE A HG21   1 
ATOM   3654 H  HG22   . ILE A 1 251 ? 29.001  -30.656 4.887   1.00 27.86 ? 251 ILE A HG22   1 
ATOM   3655 H  HG23   . ILE A 1 251 ? 30.389  -30.903 5.620   1.00 27.86 ? 251 ILE A HG23   1 
ATOM   3656 H  HD11   . ILE A 1 251 ? 32.775  -33.721 5.446   1.00 37.07 ? 251 ILE A HD11   1 
ATOM   3657 H  HD12   . ILE A 1 251 ? 32.171  -32.304 5.836   1.00 37.07 ? 251 ILE A HD12   1 
ATOM   3658 H  HD13   . ILE A 1 251 ? 31.541  -33.631 6.442   1.00 37.07 ? 251 ILE A HD13   1 
ATOM   3659 N  N      . ILE A 1 252 ? 26.902  -32.505 7.101   1.00 16.56 ? 252 ILE A N      1 
ATOM   3660 C  CA     . ILE A 1 252 ? 25.526  -32.039 7.233   1.00 17.39 ? 252 ILE A CA     1 
ATOM   3661 C  C      . ILE A 1 252 ? 25.398  -30.569 6.846   1.00 17.08 ? 252 ILE A C      1 
ATOM   3662 O  O      . ILE A 1 252 ? 24.464  -30.184 6.136   1.00 20.26 ? 252 ILE A O      1 
ATOM   3663 C  CB     . ILE A 1 252 ? 25.009  -32.241 8.672   1.00 19.55 ? 252 ILE A CB     1 
ATOM   3664 C  CG1    . ILE A 1 252 ? 24.864  -33.740 8.958   1.00 26.47 ? 252 ILE A CG1    1 
ATOM   3665 C  CG2    . ILE A 1 252 ? 23.670  -31.517 8.885   1.00 20.09 ? 252 ILE A CG2    1 
ATOM   3666 C  CD1    . ILE A 1 252 ? 24.534  -34.075 10.396  1.00 31.47 ? 252 ILE A CD1    1 
ATOM   3667 H  H      . ILE A 1 252 ? 27.284  -32.686 7.850   1.00 19.87 ? 252 ILE A H      1 
ATOM   3668 H  HA     . ILE A 1 252 ? 24.961  -32.555 6.637   1.00 20.87 ? 252 ILE A HA     1 
ATOM   3669 H  HB     . ILE A 1 252 ? 25.661  -31.871 9.289   1.00 23.46 ? 252 ILE A HB     1 
ATOM   3670 H  HG12   . ILE A 1 252 ? 24.153  -34.095 8.402   1.00 31.77 ? 252 ILE A HG12   1 
ATOM   3671 H  HG13   . ILE A 1 252 ? 25.700  -34.180 8.738   1.00 31.77 ? 252 ILE A HG13   1 
ATOM   3672 H  HG21   . ILE A 1 252 ? 23.374  -31.663 9.797   1.00 24.10 ? 252 ILE A HG21   1 
ATOM   3673 H  HG22   . ILE A 1 252 ? 23.796  -30.568 8.726   1.00 24.10 ? 252 ILE A HG22   1 
ATOM   3674 H  HG23   . ILE A 1 252 ? 23.017  -31.873 8.263   1.00 24.10 ? 252 ILE A HG23   1 
ATOM   3675 H  HD11   . ILE A 1 252 ? 24.461  -35.038 10.487  1.00 37.76 ? 252 ILE A HD11   1 
ATOM   3676 H  HD12   . ILE A 1 252 ? 25.242  -33.741 10.968  1.00 37.76 ? 252 ILE A HD12   1 
ATOM   3677 H  HD13   . ILE A 1 252 ? 23.692  -33.655 10.632  1.00 37.76 ? 252 ILE A HD13   1 
ATOM   3678 N  N      . ASP A 1 253 ? 26.349  -29.767 7.313   1.00 18.87 ? 253 ASP A N      1 
ATOM   3679 C  CA     . ASP A 1 253 ? 26.320  -28.319 7.150   1.00 22.12 ? 253 ASP A CA     1 
ATOM   3680 C  C      . ASP A 1 253 ? 27.481  -27.838 6.276   1.00 23.06 ? 253 ASP A C      1 
ATOM   3681 O  O      . ASP A 1 253 ? 28.617  -27.755 6.747   1.00 28.04 ? 253 ASP A O      1 
ATOM   3682 C  CB     . ASP A 1 253 ? 26.378  -27.646 8.525   1.00 24.19 ? 253 ASP A CB     1 
ATOM   3683 C  CG     . ASP A 1 253 ? 26.305  -26.133 8.441   1.00 31.54 ? 253 ASP A CG     1 
ATOM   3684 O  OD1    . ASP A 1 253 ? 26.057  -25.610 7.336   1.00 29.10 ? 253 ASP A OD1    1 
ATOM   3685 O  OD2    . ASP A 1 253 ? 26.476  -25.467 9.485   1.00 36.81 ? 253 ASP A OD2    1 
ATOM   3686 H  H      . ASP A 1 253 ? 27.040  -30.047 7.740   1.00 22.64 ? 253 ASP A H      1 
ATOM   3687 H  HA     . ASP A 1 253 ? 25.490  -28.061 6.720   1.00 26.54 ? 253 ASP A HA     1 
ATOM   3688 H  HB2    . ASP A 1 253 ? 25.628  -27.953 9.058   1.00 29.03 ? 253 ASP A HB2    1 
ATOM   3689 H  HB3    . ASP A 1 253 ? 27.213  -27.883 8.958   1.00 29.03 ? 253 ASP A HB3    1 
ATOM   3690 N  N      . PRO A 1 254 ? 27.204  -27.499 5.005   1.00 21.22 ? 254 PRO A N      1 
ATOM   3691 C  CA     . PRO A 1 254 ? 28.305  -27.091 4.127   1.00 26.29 ? 254 PRO A CA     1 
ATOM   3692 C  C      . PRO A 1 254 ? 28.812  -25.684 4.418   1.00 27.41 ? 254 PRO A C      1 
ATOM   3693 O  O      . PRO A 1 254 ? 29.815  -25.265 3.835   1.00 30.96 ? 254 PRO A O      1 
ATOM   3694 C  CB     . PRO A 1 254 ? 27.678  -27.157 2.737   1.00 25.41 ? 254 PRO A CB     1 
ATOM   3695 C  CG     . PRO A 1 254 ? 26.255  -26.816 2.979   1.00 21.68 ? 254 PRO A CG     1 
ATOM   3696 C  CD     . PRO A 1 254 ? 25.909  -27.451 4.305   1.00 23.62 ? 254 PRO A CD     1 
ATOM   3697 H  HA     . PRO A 1 254 ? 29.040  -27.721 4.183   1.00 31.54 ? 254 PRO A HA     1 
ATOM   3698 H  HB2    . PRO A 1 254 ? 28.097  -26.506 2.153   1.00 30.49 ? 254 PRO A HB2    1 
ATOM   3699 H  HB3    . PRO A 1 254 ? 27.764  -28.054 2.378   1.00 30.49 ? 254 PRO A HB3    1 
ATOM   3700 H  HG2    . PRO A 1 254 ? 26.154  -25.852 3.025   1.00 26.01 ? 254 PRO A HG2    1 
ATOM   3701 H  HG3    . PRO A 1 254 ? 25.706  -27.185 2.270   1.00 26.01 ? 254 PRO A HG3    1 
ATOM   3702 H  HD2    . PRO A 1 254 ? 25.280  -26.896 4.792   1.00 28.35 ? 254 PRO A HD2    1 
ATOM   3703 H  HD3    . PRO A 1 254 ? 25.563  -28.348 4.171   1.00 28.35 ? 254 PRO A HD3    1 
ATOM   3704 N  N      . PHE A 1 255 ? 28.126  -24.963 5.298   1.00 24.46 ? 255 PHE A N      1 
ATOM   3705 C  CA     . PHE A 1 255 ? 28.522  -23.596 5.626   1.00 28.88 ? 255 PHE A CA     1 
ATOM   3706 C  C      . PHE A 1 255 ? 29.615  -23.574 6.693   1.00 36.80 ? 255 PHE A C      1 
ATOM   3707 O  O      . PHE A 1 255 ? 30.131  -22.510 7.037   1.00 41.43 ? 255 PHE A O      1 
ATOM   3708 C  CB     . PHE A 1 255 ? 27.304  -22.789 6.080   1.00 28.66 ? 255 PHE A CB     1 
ATOM   3709 C  CG     . PHE A 1 255 ? 26.294  -22.561 4.987   1.00 24.92 ? 255 PHE A CG     1 
ATOM   3710 C  CD1    . PHE A 1 255 ? 26.428  -21.493 4.112   1.00 30.38 ? 255 PHE A CD1    1 
ATOM   3711 C  CD2    . PHE A 1 255 ? 25.219  -23.416 4.828   1.00 27.50 ? 255 PHE A CD2    1 
ATOM   3712 C  CE1    . PHE A 1 255 ? 25.506  -21.281 3.106   1.00 28.15 ? 255 PHE A CE1    1 
ATOM   3713 C  CE2    . PHE A 1 255 ? 24.291  -23.208 3.818   1.00 28.99 ? 255 PHE A CE2    1 
ATOM   3714 C  CZ     . PHE A 1 255 ? 24.438  -22.140 2.958   1.00 28.11 ? 255 PHE A CZ     1 
ATOM   3715 H  H      . PHE A 1 255 ? 27.429  -25.240 5.718   1.00 29.35 ? 255 PHE A H      1 
ATOM   3716 H  HA     . PHE A 1 255 ? 28.878  -23.174 4.829   1.00 34.66 ? 255 PHE A HA     1 
ATOM   3717 H  HB2    . PHE A 1 255 ? 26.862  -23.265 6.799   1.00 34.39 ? 255 PHE A HB2    1 
ATOM   3718 H  HB3    . PHE A 1 255 ? 27.603  -21.921 6.394   1.00 34.39 ? 255 PHE A HB3    1 
ATOM   3719 H  HD1    . PHE A 1 255 ? 27.147  -20.910 4.206   1.00 36.45 ? 255 PHE A HD1    1 
ATOM   3720 H  HD2    . PHE A 1 255 ? 25.116  -24.138 5.405   1.00 33.00 ? 255 PHE A HD2    1 
ATOM   3721 H  HE1    . PHE A 1 255 ? 25.608  -20.560 2.527   1.00 33.78 ? 255 PHE A HE1    1 
ATOM   3722 H  HE2    . PHE A 1 255 ? 23.570  -23.788 3.721   1.00 34.79 ? 255 PHE A HE2    1 
ATOM   3723 H  HZ     . PHE A 1 255 ? 23.816  -21.997 2.281   1.00 33.73 ? 255 PHE A HZ     1 
ATOM   3724 N  N      . LYS A 1 256 ? 29.968  -24.751 7.207   1.00 40.24 ? 256 LYS A N      1 
ATOM   3725 C  CA     . LYS A 1 256 ? 31.107  -24.889 8.112   1.00 47.16 ? 256 LYS A CA     1 
ATOM   3726 C  C      . LYS A 1 256 ? 32.401  -25.048 7.319   1.00 54.77 ? 256 LYS A C      1 
ATOM   3727 O  O      . LYS A 1 256 ? 32.404  -25.626 6.230   1.00 54.65 ? 256 LYS A O      1 
ATOM   3728 C  CB     . LYS A 1 256 ? 30.928  -26.088 9.047   1.00 50.57 ? 256 LYS A CB     1 
ATOM   3729 C  CG     . LYS A 1 256 ? 29.752  -25.982 10.000  1.00 51.11 ? 256 LYS A CG     1 
ATOM   3730 C  CD     . LYS A 1 256 ? 29.892  -26.977 11.146  1.00 55.43 ? 256 LYS A CD     1 
ATOM   3731 C  CE     . LYS A 1 256 ? 28.545  -27.350 11.737  1.00 59.80 ? 256 LYS A CE     1 
ATOM   3732 N  NZ     . LYS A 1 256 ? 27.734  -26.161 12.118  1.00 63.49 ? 256 LYS A NZ     1 
ATOM   3733 H  H      . LYS A 1 256 ? 29.560  -25.491 7.045   1.00 48.29 ? 256 LYS A H      1 
ATOM   3734 H  HA     . LYS A 1 256 ? 31.182  -24.089 8.656   1.00 56.59 ? 256 LYS A HA     1 
ATOM   3735 H  HB2    . LYS A 1 256 ? 30.798  -26.884 8.507   1.00 60.69 ? 256 LYS A HB2    1 
ATOM   3736 H  HB3    . LYS A 1 256 ? 31.732  -26.186 9.582   1.00 60.69 ? 256 LYS A HB3    1 
ATOM   3737 H  HG2    . LYS A 1 256 ? 29.720  -25.088 10.374  1.00 61.34 ? 256 LYS A HG2    1 
ATOM   3738 H  HG3    . LYS A 1 256 ? 28.931  -26.179 9.523   1.00 61.34 ? 256 LYS A HG3    1 
ATOM   3739 H  HD2    . LYS A 1 256 ? 30.313  -27.786 10.816  1.00 66.51 ? 256 LYS A HD2    1 
ATOM   3740 H  HD3    . LYS A 1 256 ? 30.432  -26.581 11.847  1.00 66.51 ? 256 LYS A HD3    1 
ATOM   3741 H  HE2    . LYS A 1 256 ? 28.042  -27.859 11.082  1.00 71.75 ? 256 LYS A HE2    1 
ATOM   3742 H  HE3    . LYS A 1 256 ? 28.687  -27.884 12.535  1.00 71.75 ? 256 LYS A HE3    1 
ATOM   3743 H  HZ1    . LYS A 1 256 ? 26.954  -26.422 12.459  1.00 76.19 ? 256 LYS A HZ1    1 
ATOM   3744 H  HZ2    . LYS A 1 256 ? 28.169  -25.678 12.726  1.00 76.19 ? 256 LYS A HZ2    1 
ATOM   3745 H  HZ3    . LYS A 1 256 ? 27.581  -25.656 11.402  1.00 76.19 ? 256 LYS A HZ3    1 
ATOM   3746 N  N      . ARG A 1 257 ? 33.495  -24.541 7.878   1.00 62.94 ? 257 ARG A N      1 
ATOM   3747 C  CA     . ARG A 1 257 ? 34.805  -24.623 7.240   1.00 67.64 ? 257 ARG A CA     1 
ATOM   3748 C  C      . ARG A 1 257 ? 35.768  -25.451 8.084   1.00 69.91 ? 257 ARG A C      1 
ATOM   3749 O  O      . ARG A 1 257 ? 35.691  -26.680 8.107   1.00 70.66 ? 257 ARG A O      1 
ATOM   3750 C  CB     . ARG A 1 257 ? 35.376  -23.223 7.013   1.00 68.02 ? 257 ARG A CB     1 
ATOM   3751 H  H      . ARG A 1 257 ? 33.505  -24.138 8.638   1.00 75.53 ? 257 ARG A H      1 
ATOM   3752 H  HA     . ARG A 1 257 ? 34.712  -25.055 6.377   1.00 81.16 ? 257 ARG A HA     1 
HETATM 3753 P  PG     . ATP B 2 .   ? 8.223   -29.886 -0.073  0.64 34.25 ? 301 ATP A PG     1 
HETATM 3754 O  O1G    . ATP B 2 .   ? 6.878   -29.807 0.602   0.44 39.55 ? 301 ATP A O1G    1 
HETATM 3755 O  O2G    . ATP B 2 .   ? 8.190   -29.638 -1.564  0.60 35.38 ? 301 ATP A O2G    1 
HETATM 3756 O  O3G    . ATP B 2 .   ? 9.316   -29.148 0.657   0.67 37.25 ? 301 ATP A O3G    1 
HETATM 3757 P  PB     . ATP B 2 .   ? 7.661   -32.658 -0.296  0.77 33.21 ? 301 ATP A PB     1 
HETATM 3758 O  O1B    . ATP B 2 .   ? 6.672   -32.292 -1.377  0.90 36.05 ? 301 ATP A O1B    1 
HETATM 3759 O  O2B    . ATP B 2 .   ? 7.114   -33.155 1.011   1.00 27.99 ? 301 ATP A O2B    1 
HETATM 3760 O  O3B    . ATP B 2 .   ? 8.648   -31.434 0.075   0.85 32.51 ? 301 ATP A O3B    1 
HETATM 3761 P  PA     . ATP B 2 .   ? 8.868   -33.999 -2.473  0.61 36.25 ? 301 ATP A PA     1 
HETATM 3762 O  O1A    . ATP B 2 .   ? 7.748   -34.884 -2.973  1.00 42.02 ? 301 ATP A O1A    1 
HETATM 3763 O  O2A    . ATP B 2 .   ? 9.056   -32.658 -3.135  0.34 32.78 ? 301 ATP A O2A    1 
HETATM 3764 O  O3A    . ATP B 2 .   ? 8.707   -33.740 -0.886  0.70 33.89 ? 301 ATP A O3A    1 
HETATM 3765 O  "O5'"  . ATP B 2 .   ? 10.268  -34.799 -2.539  0.73 42.14 ? 301 ATP A "O5'"  1 
HETATM 3766 C  "C5'"  . ATP B 2 .   ? 11.480  -34.102 -2.234  1.00 40.29 ? 301 ATP A "C5'"  1 
HETATM 3767 C  "C4'"  . ATP B 2 .   ? 12.695  -34.980 -2.500  0.70 42.87 ? 301 ATP A "C4'"  1 
HETATM 3768 O  "O4'"  . ATP B 2 .   ? 12.667  -36.119 -1.635  0.77 41.06 ? 301 ATP A "O4'"  1 
HETATM 3769 C  "C3'"  . ATP B 2 .   ? 12.738  -35.472 -3.939  1.00 46.21 ? 301 ATP A "C3'"  1 
HETATM 3770 O  "O3'"  . ATP B 2 .   ? 13.975  -35.092 -4.552  0.58 48.16 ? 301 ATP A "O3'"  1 
HETATM 3771 C  "C2'"  . ATP B 2 .   ? 12.603  -36.978 -3.848  1.00 44.09 ? 301 ATP A "C2'"  1 
HETATM 3772 O  "O2'"  . ATP B 2 .   ? 13.524  -37.671 -4.699  0.28 45.11 ? 301 ATP A "O2'"  1 
HETATM 3773 C  "C1'"  . ATP B 2 .   ? 12.847  -37.316 -2.390  0.83 43.76 ? 301 ATP A "C1'"  1 
HETATM 3774 N  N9     . ATP B 2 .   ? 11.857  -38.341 -2.007  0.81 46.36 ? 301 ATP A N9     1 
HETATM 3775 C  C8     . ATP B 2 .   ? 10.629  -38.118 -1.500  0.99 47.17 ? 301 ATP A C8     1 
HETATM 3776 N  N7     . ATP B 2 .   ? 9.992   -39.295 -1.277  0.74 48.54 ? 301 ATP A N7     1 
HETATM 3777 C  C5     . ATP B 2 .   ? 10.822  -40.284 -1.652  0.85 50.14 ? 301 ATP A C5     1 
HETATM 3778 C  C6     . ATP B 2 .   ? 10.782  -41.758 -1.679  0.85 52.54 ? 301 ATP A C6     1 
HETATM 3779 N  N6     . ATP B 2 .   ? 9.686   -42.432 -1.253  0.57 55.75 ? 301 ATP A N6     1 
HETATM 3780 N  N1     . ATP B 2 .   ? 11.873  -42.403 -2.151  1.00 49.23 ? 301 ATP A N1     1 
HETATM 3781 C  C2     . ATP B 2 .   ? 12.973  -41.756 -2.583  1.00 50.28 ? 301 ATP A C2     1 
HETATM 3782 N  N3     . ATP B 2 .   ? 13.071  -40.417 -2.580  0.88 48.76 ? 301 ATP A N3     1 
HETATM 3783 C  C4     . ATP B 2 .   ? 12.049  -39.648 -2.139  0.95 48.21 ? 301 ATP A C4     1 
HETATM 3784 H  "H5'1" . ATP B 2 .   ? 11.543  -33.198 -2.844  1.00 48.35 ? 301 ATP A "H5'1" 1 
HETATM 3785 H  "H5'2" . ATP B 2 .   ? 11.471  -33.799 -1.185  1.00 48.35 ? 301 ATP A "H5'2" 1 
HETATM 3786 H  "H4'"  . ATP B 2 .   ? 13.602  -34.390 -2.305  0.70 51.44 ? 301 ATP A "H4'"  1 
HETATM 3787 H  "H3'"  . ATP B 2 .   ? 11.884  -35.059 -4.494  1.00 55.46 ? 301 ATP A "H3'"  1 
HETATM 3788 H  "HO3'" . ATP B 2 .   ? 13.992  -35.409 -5.466  0.58 57.79 ? 301 ATP A "HO3'" 1 
HETATM 3789 H  "H2'"  . ATP B 2 .   ? 11.572  -37.256 -4.107  1.00 52.91 ? 301 ATP A "H2'"  1 
HETATM 3790 H  "HO2'" . ATP B 2 .   ? 13.352  -37.433 -5.621  0.28 54.13 ? 301 ATP A "HO2'" 1 
HETATM 3791 H  "H1'"  . ATP B 2 .   ? 13.870  -37.701 -2.270  0.83 52.52 ? 301 ATP A "H1'"  1 
HETATM 3792 H  H8     . ATP B 2 .   ? 10.211  -37.140 -1.297  0.99 56.61 ? 301 ATP A H8     1 
HETATM 3793 H  HN61   . ATP B 2 .   ? 8.885   -41.925 -0.906  0.57 66.90 ? 301 ATP A HN61   1 
HETATM 3794 H  HN62   . ATP B 2 .   ? 9.673   -43.442 -1.279  0.57 66.90 ? 301 ATP A HN62   1 
HETATM 3795 H  H2     . ATP B 2 .   ? 13.810  -42.339 -2.947  1.00 60.33 ? 301 ATP A H2     1 
HETATM 3796 MG MG     . MG  C 3 .   ? 6.000   -30.157 -2.832  1.00 56.56 ? 302 MG  A MG     1 
HETATM 3797 C  C1     . GOL D 4 .   ? 38.266  -35.563 -3.563  1.00 56.25 ? 303 GOL A C1     1 
HETATM 3798 O  O1     . GOL D 4 .   ? 38.185  -36.015 -4.896  1.00 56.15 ? 303 GOL A O1     1 
HETATM 3799 C  C2     . GOL D 4 .   ? 38.067  -34.052 -3.525  1.00 57.49 ? 303 GOL A C2     1 
HETATM 3800 O  O2     . GOL D 4 .   ? 37.239  -33.661 -4.595  1.00 60.48 ? 303 GOL A O2     1 
HETATM 3801 C  C3     . GOL D 4 .   ? 37.409  -33.646 -2.214  1.00 53.95 ? 303 GOL A C3     1 
HETATM 3802 O  O3     . GOL D 4 .   ? 37.021  -32.290 -2.261  1.00 55.60 ? 303 GOL A O3     1 
HETATM 3803 H  H11    . GOL D 4 .   ? 37.501  -36.052 -2.960  1.00 67.51 ? 303 GOL A H11    1 
HETATM 3804 H  H12    . GOL D 4 .   ? 39.241  -35.817 -3.146  1.00 67.51 ? 303 GOL A H12    1 
HETATM 3805 H  HO1    . GOL D 4 .   ? 38.378  -36.975 -4.929  1.00 67.38 ? 303 GOL A HO1    1 
HETATM 3806 H  H2     . GOL D 4 .   ? 39.038  -33.563 -3.602  1.00 68.98 ? 303 GOL A H2     1 
HETATM 3807 H  HO2    . GOL D 4 .   ? 36.364  -34.094 -4.506  1.00 72.58 ? 303 GOL A HO2    1 
HETATM 3808 H  H31    . GOL D 4 .   ? 36.534  -34.271 -2.034  1.00 64.73 ? 303 GOL A H31    1 
HETATM 3809 H  H32    . GOL D 4 .   ? 38.107  -33.798 -1.391  1.00 64.73 ? 303 GOL A H32    1 
HETATM 3810 H  HO3    . GOL D 4 .   ? 37.618  -31.800 -2.863  1.00 66.72 ? 303 GOL A HO3    1 
HETATM 3811 C  C1     . GOL E 4 .   ? -13.685 -16.651 -14.564 1.00 55.54 ? 304 GOL A C1     1 
HETATM 3812 O  O1     . GOL E 4 .   ? -13.879 -16.816 -13.176 1.00 56.21 ? 304 GOL A O1     1 
HETATM 3813 C  C2     . GOL E 4 .   ? -12.269 -17.076 -14.928 1.00 52.78 ? 304 GOL A C2     1 
HETATM 3814 O  O2     . GOL E 4 .   ? -12.068 -18.427 -14.578 1.00 48.39 ? 304 GOL A O2     1 
HETATM 3815 C  C3     . GOL E 4 .   ? -12.029 -16.883 -16.421 1.00 50.54 ? 304 GOL A C3     1 
HETATM 3816 O  O3     . GOL E 4 .   ? -11.232 -17.933 -16.920 1.00 53.69 ? 304 GOL A O3     1 
HETATM 3817 H  H11    . GOL E 4 .   ? -14.406 -17.258 -15.112 1.00 66.65 ? 304 GOL A H11    1 
HETATM 3818 H  H12    . GOL E 4 .   ? -13.839 -15.607 -14.837 1.00 66.65 ? 304 GOL A H12    1 
HETATM 3819 H  HO1    . GOL E 4 .   ? -14.766 -16.482 -12.928 1.00 67.45 ? 304 GOL A HO1    1 
HETATM 3820 H  H2     . GOL E 4 .   ? -11.567 -16.447 -14.381 1.00 63.34 ? 304 GOL A H2     1 
HETATM 3821 H  HO2    . GOL E 4 .   ? -12.685 -18.992 -15.088 1.00 58.06 ? 304 GOL A HO2    1 
HETATM 3822 H  H31    . GOL E 4 .   ? -12.984 -16.865 -16.946 1.00 60.65 ? 304 GOL A H31    1 
HETATM 3823 H  H32    . GOL E 4 .   ? -11.530 -15.930 -16.592 1.00 60.65 ? 304 GOL A H32    1 
HETATM 3824 H  HO3    . GOL E 4 .   ? -11.145 -17.844 -17.892 1.00 64.42 ? 304 GOL A HO3    1 
HETATM 3825 N  N1     . EPE F 5 .   ? 2.012   -21.763 8.058   0.60 37.49 ? 305 EPE A N1     1 
HETATM 3826 C  C2     . EPE F 5 .   ? 1.017   -20.676 7.905   0.82 41.85 ? 305 EPE A C2     1 
HETATM 3827 C  C3     . EPE F 5 .   ? 0.981   -19.741 9.109   0.52 44.73 ? 305 EPE A C3     1 
HETATM 3828 N  N4     . EPE F 5 .   ? 1.473   -20.430 10.275  0.47 44.84 ? 305 EPE A N4     1 
HETATM 3829 C  C5     . EPE F 5 .   ? 1.064   -21.808 10.354  0.83 43.11 ? 305 EPE A C5     1 
HETATM 3830 C  C6     . EPE F 5 .   ? 1.746   -22.593 9.247   0.87 41.40 ? 305 EPE A C6     1 
HETATM 3831 C  C7     . EPE F 5 .   ? 2.824   -20.138 10.703  0.61 46.80 ? 305 EPE A C7     1 
HETATM 3832 C  C8     . EPE F 5 .   ? 2.845   -19.154 11.864  0.73 47.48 ? 305 EPE A C8     1 
HETATM 3833 O  O8     . EPE F 5 .   ? 2.135   -19.699 12.955  0.67 49.08 ? 305 EPE A O8     1 
HETATM 3834 C  C9     . EPE F 5 .   ? 1.882   -22.597 6.850   0.82 33.29 ? 305 EPE A C9     1 
HETATM 3835 C  C10    . EPE F 5 .   ? 2.746   -23.854 6.843   0.74 32.96 ? 305 EPE A C10    1 
HETATM 3836 S  S      . EPE F 5 .   ? 2.535   -24.800 5.307   0.67 26.88 ? 305 EPE A S      1 
HETATM 3837 O  O1S    . EPE F 5 .   ? 1.135   -24.875 4.899   1.00 23.76 ? 305 EPE A O1S    1 
HETATM 3838 O  O2S    . EPE F 5 .   ? 3.306   -24.167 4.241   0.40 28.56 ? 305 EPE A O2S    1 
HETATM 3839 O  O3S    . EPE F 5 .   ? 3.044   -26.158 5.506   1.00 38.49 ? 305 EPE A O3S    1 
HETATM 3840 H  H21    . EPE F 5 .   ? 0.029   -21.113 7.763   0.82 50.22 ? 305 EPE A H21    1 
HETATM 3841 H  H22    . EPE F 5 .   ? 1.254   -20.098 7.011   0.82 50.22 ? 305 EPE A H22    1 
HETATM 3842 H  H31    . EPE F 5 .   ? -0.042  -19.405 9.284   0.52 53.68 ? 305 EPE A H31    1 
HETATM 3843 H  H32    . EPE F 5 .   ? 1.597   -18.863 8.912   0.52 53.68 ? 305 EPE A H32    1 
HETATM 3844 H  H51    . EPE F 5 .   ? -0.018  -21.880 10.246  0.83 51.73 ? 305 EPE A H51    1 
HETATM 3845 H  H52    . EPE F 5 .   ? 1.339   -22.222 11.324  0.83 51.73 ? 305 EPE A H52    1 
HETATM 3846 H  H61    . EPE F 5 .   ? 1.116   -23.435 8.962   0.87 49.68 ? 305 EPE A H61    1 
HETATM 3847 H  H62    . EPE F 5 .   ? 2.688   -22.996 9.620   0.87 49.68 ? 305 EPE A H62    1 
HETATM 3848 H  H71    . EPE F 5 .   ? 3.386   -19.721 9.867   0.61 56.16 ? 305 EPE A H71    1 
HETATM 3849 H  H72    . EPE F 5 .   ? 3.315   -21.063 11.005  0.61 56.16 ? 305 EPE A H72    1 
HETATM 3850 H  H81    . EPE F 5 .   ? 2.387   -18.214 11.559  0.73 56.97 ? 305 EPE A H81    1 
HETATM 3851 H  H82    . EPE F 5 .   ? 3.875   -18.952 12.158  0.73 56.97 ? 305 EPE A H82    1 
HETATM 3852 H  HO8    . EPE F 5 .   ? 1.793   -20.584 12.713  0.67 58.90 ? 305 EPE A HO8    1 
HETATM 3853 H  H91    . EPE F 5 .   ? 0.839   -22.891 6.740   0.82 39.95 ? 305 EPE A H91    1 
HETATM 3854 H  H92    . EPE F 5 .   ? 2.140   -21.993 5.980   0.82 39.95 ? 305 EPE A H92    1 
HETATM 3855 H  H101   . EPE F 5 .   ? 3.793   -23.574 6.954   0.74 39.55 ? 305 EPE A H101   1 
HETATM 3856 H  H102   . EPE F 5 .   ? 2.478   -24.482 7.693   0.74 39.55 ? 305 EPE A H102   1 
HETATM 3857 O  O      . HOH G 6 .   ? 1.933   -44.544 8.934   1.00 34.93 ? 401 HOH A O      1 
HETATM 3858 O  O      . HOH G 6 .   ? -1.859  -41.696 7.193   1.00 24.24 ? 402 HOH A O      1 
HETATM 3859 O  O      . HOH G 6 .   ? -0.148  -46.812 -3.252  1.00 27.91 ? 403 HOH A O      1 
HETATM 3860 O  O      . HOH G 6 .   ? -7.774  -43.823 4.722   1.00 25.29 ? 404 HOH A O      1 
HETATM 3861 O  O      . HOH G 6 .   ? -11.157 -47.745 -2.532  1.00 29.34 ? 405 HOH A O      1 
HETATM 3862 O  O      . HOH G 6 .   ? -13.773 -47.755 -1.671  1.00 28.79 ? 406 HOH A O      1 
HETATM 3863 O  O      . HOH G 6 .   ? -13.848 -48.804 1.029   1.00 26.98 ? 407 HOH A O      1 
HETATM 3864 O  O      . HOH G 6 .   ? -15.830 -44.043 -5.563  1.00 36.22 ? 408 HOH A O      1 
HETATM 3865 O  O      . HOH G 6 .   ? -15.674 -41.292 -4.616  1.00 29.44 ? 409 HOH A O      1 
HETATM 3866 O  O      . HOH G 6 .   ? -7.268  -38.326 -8.605  1.00 21.96 ? 410 HOH A O      1 
HETATM 3867 O  O      . HOH G 6 .   ? -11.901 -33.899 -4.684  1.00 19.96 ? 411 HOH A O      1 
HETATM 3868 O  O      . HOH G 6 .   ? -13.332 -31.654 -4.138  1.00 29.13 ? 412 HOH A O      1 
HETATM 3869 O  O      . HOH G 6 .   ? -12.960 -30.198 -6.574  1.00 28.35 ? 413 HOH A O      1 
HETATM 3870 O  O      . HOH G 6 .   ? -13.929 -34.707 -7.391  1.00 33.35 ? 414 HOH A O      1 
HETATM 3871 O  O      . HOH G 6 .   ? -10.497 -39.986 -8.613  1.00 31.27 ? 415 HOH A O      1 
HETATM 3872 O  O      . HOH G 6 .   ? -10.961 -42.067 -9.653  1.00 34.53 ? 416 HOH A O      1 
HETATM 3873 O  O      . HOH G 6 .   ? -16.575 -33.871 -1.067  1.00 43.28 ? 417 HOH A O      1 
HETATM 3874 O  O      . HOH G 6 .   ? -15.369 -34.176 1.254   1.00 32.78 ? 418 HOH A O      1 
HETATM 3875 O  O      . HOH G 6 .   ? -3.216  -30.486 10.248  1.00 24.90 ? 419 HOH A O      1 
HETATM 3876 O  O      . HOH G 6 .   ? -2.607  -32.259 12.229  1.00 37.07 ? 420 HOH A O      1 
HETATM 3877 O  O      . HOH G 6 .   ? 2.738   -36.262 9.354   1.00 28.52 ? 421 HOH A O      1 
HETATM 3878 O  O      . HOH G 6 .   ? 6.377   -35.387 8.316   1.00 18.62 ? 422 HOH A O      1 
HETATM 3879 O  O      . HOH G 6 .   ? 10.987  -30.044 9.180   1.00 25.06 ? 423 HOH A O      1 
HETATM 3880 O  O      . HOH G 6 .   ? 8.823   -28.919 7.439   1.00 25.21 ? 424 HOH A O      1 
HETATM 3881 O  O      . HOH G 6 .   ? 6.475   -26.808 -0.586  1.00 44.16 ? 425 HOH A O      1 
HETATM 3882 O  O      . HOH G 6 .   ? 6.488   -28.538 2.917   1.00 41.13 ? 426 HOH A O      1 
HETATM 3883 O  O      . HOH G 6 .   ? 13.714  -30.503 2.226   1.00 19.03 ? 427 HOH A O      1 
HETATM 3884 O  O      . HOH G 6 .   ? 13.045  -36.121 10.119  1.00 19.68 ? 428 HOH A O      1 
HETATM 3885 O  O      . HOH G 6 .   ? 17.541  -28.544 6.174   1.00 33.74 ? 429 HOH A O      1 
HETATM 3886 O  O      . HOH G 6 .   ? 21.871  -29.946 5.680   1.00 23.85 ? 430 HOH A O      1 
HETATM 3887 O  O      . HOH G 6 .   ? -1.290  -15.204 -0.927  1.00 30.87 ? 431 HOH A O      1 
HETATM 3888 O  O      . HOH G 6 .   ? -0.170  -17.442 0.403   1.00 27.09 ? 432 HOH A O      1 
HETATM 3889 O  O      . HOH G 6 .   ? -0.989  -13.264 0.931   1.00 39.85 ? 433 HOH A O      1 
HETATM 3890 O  O      . HOH G 6 .   ? -6.262  -13.923 5.210   1.00 37.22 ? 434 HOH A O      1 
HETATM 3891 O  O      . HOH G 6 .   ? -9.530  -22.094 -12.689 1.00 30.40 ? 435 HOH A O      1 
HETATM 3892 O  O      . HOH G 6 .   ? -4.594  -29.005 -18.576 1.00 42.85 ? 436 HOH A O      1 
HETATM 3893 O  O      . HOH G 6 .   ? -10.365 -26.897 15.713  1.00 39.15 ? 437 HOH A O      1 
HETATM 3894 O  O      . HOH G 6 .   ? -11.486 -20.277 12.014  1.00 38.01 ? 438 HOH A O      1 
HETATM 3895 O  O      . HOH G 6 .   ? -13.782 -20.947 10.903  1.00 42.82 ? 439 HOH A O      1 
HETATM 3896 O  O      . HOH G 6 .   ? 0.718   -36.017 10.640  1.00 39.58 ? 440 HOH A O      1 
HETATM 3897 O  O      . HOH G 6 .   ? -4.851  -40.140 9.225   1.00 39.37 ? 441 HOH A O      1 
HETATM 3898 O  O      . HOH G 6 .   ? 18.882  -46.973 9.517   1.00 26.06 ? 442 HOH A O      1 
HETATM 3899 O  O      . HOH G 6 .   ? 19.803  -49.317 -0.302  1.00 30.58 ? 443 HOH A O      1 
HETATM 3900 O  O      . HOH G 6 .   ? 21.964  -39.741 -5.030  1.00 18.83 ? 444 HOH A O      1 
HETATM 3901 O  O      . HOH G 6 .   ? 23.562  -38.776 -7.882  1.00 32.09 ? 445 HOH A O      1 
HETATM 3902 O  O      . HOH G 6 .   ? 23.648  -41.748 -10.809 1.00 29.91 ? 446 HOH A O      1 
HETATM 3903 O  O      . HOH G 6 .   ? 30.877  -45.592 -11.344 1.00 20.93 ? 447 HOH A O      1 
HETATM 3904 O  O      . HOH G 6 .   ? 24.677  -48.294 -9.434  1.00 24.92 ? 448 HOH A O      1 
HETATM 3905 O  O      . HOH G 6 .   ? 38.963  -44.769 -5.691  1.00 31.55 ? 449 HOH A O      1 
HETATM 3906 O  O      . HOH G 6 .   ? 28.949  -51.185 -1.884  1.00 30.12 ? 450 HOH A O      1 
HETATM 3907 O  O      . HOH G 6 .   ? 29.122  -49.690 5.361   1.00 28.12 ? 451 HOH A O      1 
HETATM 3908 O  O      . HOH G 6 .   ? 32.218  -49.561 7.440   1.00 39.95 ? 452 HOH A O      1 
HETATM 3909 O  O      . HOH G 6 .   ? 33.731  -48.030 11.613  1.00 22.88 ? 453 HOH A O      1 
HETATM 3910 O  O      . HOH G 6 .   ? 33.890  -45.207 13.176  1.00 21.36 ? 454 HOH A O      1 
HETATM 3911 O  O      . HOH G 6 .   ? 35.782  -43.481 12.334  1.00 29.18 ? 455 HOH A O      1 
HETATM 3912 O  O      . HOH G 6 .   ? 30.511  -38.224 10.268  1.00 21.94 ? 456 HOH A O      1 
HETATM 3913 O  O      . HOH G 6 .   ? 33.091  -36.661 3.227   1.00 20.91 ? 457 HOH A O      1 
HETATM 3914 O  O      . HOH G 6 .   ? 35.328  -35.131 3.699   1.00 33.84 ? 458 HOH A O      1 
HETATM 3915 O  O      . HOH G 6 .   ? 35.296  -39.510 4.981   1.00 25.18 ? 459 HOH A O      1 
HETATM 3916 O  O      . HOH G 6 .   ? 24.327  -36.268 14.092  1.00 32.55 ? 460 HOH A O      1 
HETATM 3917 O  O      . HOH G 6 .   ? 18.012  -33.417 -2.750  1.00 25.90 ? 461 HOH A O      1 
HETATM 3918 O  O      . HOH G 6 .   ? 19.827  -33.672 -4.677  1.00 29.56 ? 462 HOH A O      1 
HETATM 3919 O  O      . HOH G 6 .   ? 28.467  -30.778 9.274   1.00 25.34 ? 463 HOH A O      1 
HETATM 3920 O  O      . HOH G 6 .   ? 31.539  -28.080 5.569   1.00 36.46 ? 464 HOH A O      1 
HETATM 3921 O  O      . HOH G 6 .   ? -8.017  -12.764 2.828   1.00 29.12 ? 465 HOH A O      1 
HETATM 3922 O  O      . HOH G 6 .   ? 22.400  -32.757 -4.470  1.00 30.30 ? 466 HOH A O      1 
HETATM 3923 O  O      . HOH G 6 .   ? -12.831 -16.246 4.665   1.00 31.12 ? 467 HOH A O      1 
HETATM 3924 O  O      . HOH G 6 .   ? -8.334  -41.240 -17.090 1.00 32.95 ? 468 HOH A O      1 
HETATM 3925 O  O      . HOH G 6 .   ? 17.203  -39.331 13.254  1.00 29.82 ? 469 HOH A O      1 
HETATM 3926 O  O      . HOH G 6 .   ? 15.689  -33.905 -3.822  1.00 40.58 ? 470 HOH A O      1 
HETATM 3927 O  O      . HOH G 6 .   ? 1.176   -28.037 -12.840 1.00 33.32 ? 471 HOH A O      1 
HETATM 3928 O  O      . HOH G 6 .   ? 22.792  -44.138 -11.012 1.00 51.90 ? 472 HOH A O      1 
HETATM 3929 O  O      . HOH G 6 .   ? 35.255  -32.121 3.941   1.00 32.21 ? 473 HOH A O      1 
HETATM 3930 O  O      . HOH G 6 .   ? 29.308  -39.497 15.022  1.00 37.90 ? 474 HOH A O      1 
HETATM 3931 O  O      . HOH G 6 .   ? 6.837   -28.120 9.228   1.00 49.68 ? 475 HOH A O      1 
HETATM 3932 O  O      . HOH G 6 .   ? 4.047   -33.806 10.200  1.00 35.84 ? 476 HOH A O      1 
HETATM 3933 O  O      . HOH G 6 .   ? 27.259  -22.974 9.922   1.00 42.07 ? 477 HOH A O      1 
HETATM 3934 O  O      . HOH G 6 .   ? -2.867  -48.359 5.663   1.00 33.02 ? 478 HOH A O      1 
HETATM 3935 O  O      . HOH G 6 .   ? 28.399  -32.965 9.890   1.00 37.51 ? 479 HOH A O      1 
HETATM 3936 O  O      . HOH G 6 .   ? 25.541  -51.851 5.721   1.00 33.66 ? 480 HOH A O      1 
HETATM 3937 O  O      . HOH G 6 .   ? -15.952 -32.874 8.719   1.00 39.21 ? 481 HOH A O      1 
HETATM 3938 O  O      . HOH G 6 .   ? 6.691   -31.273 12.441  1.00 46.33 ? 482 HOH A O      1 
HETATM 3939 O  O      . HOH G 6 .   ? 4.956   -14.292 -3.319  1.00 44.80 ? 483 HOH A O      1 
HETATM 3940 O  O      . HOH G 6 .   ? 18.501  -49.665 8.349   1.00 41.54 ? 484 HOH A O      1 
HETATM 3941 O  O      . HOH G 6 .   ? 37.666  -43.967 6.642   1.00 40.32 ? 485 HOH A O      1 
HETATM 3942 O  O      . HOH G 6 .   ? 22.551  -29.689 2.889   1.00 35.61 ? 486 HOH A O      1 
HETATM 3943 O  O      . HOH G 6 .   ? -17.769 -20.954 -7.158  1.00 45.22 ? 487 HOH A O      1 
HETATM 3944 O  O      . HOH G 6 .   ? 11.736  -30.117 12.327  1.00 53.28 ? 488 HOH A O      1 
HETATM 3945 O  O      . HOH G 6 .   ? -16.189 -35.035 -3.701  1.00 48.76 ? 489 HOH A O      1 
HETATM 3946 O  O      . HOH G 6 .   ? 7.396   -44.187 11.687  1.00 43.32 ? 490 HOH A O      1 
HETATM 3947 O  O      . HOH G 6 .   ? -2.593  -9.034  -3.006  1.00 44.77 ? 491 HOH A O      1 
HETATM 3948 O  O      . HOH G 6 .   ? 26.610  -52.982 4.013   1.00 45.55 ? 492 HOH A O      1 
HETATM 3949 O  O      . HOH G 6 .   ? 23.470  -34.119 -11.094 1.00 42.61 ? 493 HOH A O      1 
HETATM 3950 O  O      . HOH G 6 .   ? 37.077  -39.895 12.675  1.00 49.03 ? 494 HOH A O      1 
HETATM 3951 O  O      . HOH G 6 .   ? -0.582  -10.854 -0.242  1.00 42.22 ? 495 HOH A O      1 
HETATM 3952 O  O      . HOH G 6 .   ? 21.084  -49.664 -2.554  1.00 48.36 ? 496 HOH A O      1 
HETATM 3953 O  O      . HOH G 6 .   ? 4.631   -41.028 -7.152  1.00 38.90 ? 497 HOH A O      1 
HETATM 3954 O  O      . HOH G 6 .   ? -2.533  -19.255 13.088  1.00 41.29 ? 498 HOH A O      1 
HETATM 3955 O  O      . HOH G 6 .   ? 8.029   -40.016 4.500   1.00 43.48 ? 499 HOH A O      1 
HETATM 3956 O  O      . HOH G 6 .   ? -13.233 -27.505 11.278  1.00 36.62 ? 500 HOH A O      1 
HETATM 3957 O  O      . HOH G 6 .   ? -12.592 -14.965 6.962   1.00 37.55 ? 501 HOH A O      1 
HETATM 3958 O  O      . HOH G 6 .   ? 31.540  -51.219 5.483   1.00 51.92 ? 502 HOH A O      1 
HETATM 3959 O  O      . HOH G 6 .   ? 5.675   -42.043 12.785  1.00 53.98 ? 503 HOH A O      1 
HETATM 3960 O  O      . HOH G 6 .   ? -5.808  -48.259 -8.493  1.00 41.76 ? 504 HOH A O      1 
HETATM 3961 O  O      . HOH G 6 .   ? 11.877  -28.971 14.836  1.00 49.91 ? 505 HOH A O      1 
HETATM 3962 O  O      . HOH G 6 .   ? -5.355  -48.396 -6.237  1.00 42.92 ? 506 HOH A O      1 
HETATM 3963 O  O      . HOH G 6 .   ? 23.287  -50.265 7.041   1.00 27.04 ? 507 HOH A O      1 
HETATM 3964 O  O      . HOH G 6 .   ? 9.105   -29.128 -4.683  1.00 45.73 ? 508 HOH A O      1 
HETATM 3965 O  O      . HOH G 6 .   ? -19.910 -23.314 0.072   1.00 46.00 ? 509 HOH A O      1 
HETATM 3966 O  O      . HOH G 6 .   ? 9.531   -50.894 9.682   1.00 51.91 ? 510 HOH A O      1 
HETATM 3967 O  O      . HOH G 6 .   ? 8.700   -27.630 -2.707  1.00 46.75 ? 511 HOH A O      1 
HETATM 3968 O  O      . HOH G 6 .   ? 4.791   -43.485 -6.872  1.00 40.09 ? 512 HOH A O      1 
HETATM 3969 O  O      . HOH G 6 .   ? 35.712  -48.475 9.719   1.00 46.33 ? 513 HOH A O      1 
HETATM 3970 O  O      . HOH G 6 .   ? -2.446  -34.942 11.805  1.00 44.88 ? 514 HOH A O      1 
HETATM 3971 O  O      . HOH G 6 .   ? 2.273   -16.271 1.537   1.00 45.15 ? 515 HOH A O      1 
HETATM 3972 O  O      . HOH G 6 .   ? -5.647  -47.998 4.637   1.00 42.64 ? 516 HOH A O      1 
HETATM 3973 O  O      . HOH G 6 .   ? -3.077  -21.357 -14.596 1.00 44.58 ? 517 HOH A O      1 
HETATM 3974 O  O      . HOH G 6 .   ? -13.133 -29.780 10.932  1.00 44.78 ? 518 HOH A O      1 
HETATM 3975 O  O      . HOH G 6 .   ? 27.050  -50.627 -0.227  1.00 48.33 ? 519 HOH A O      1 
HETATM 3976 O  O      . HOH G 6 .   ? -1.940  -15.851 4.214   1.00 52.18 ? 520 HOH A O      1 
HETATM 3977 O  O      . HOH G 6 .   ? -15.174 -50.979 -0.154  1.00 40.44 ? 521 HOH A O      1 
HETATM 3978 O  O      . HOH G 6 .   ? -15.997 -32.654 -4.071  1.00 48.21 ? 522 HOH A O      1 
HETATM 3979 O  O      . HOH G 6 .   ? -11.444 -15.447 11.532  1.00 50.58 ? 523 HOH A O      1 
HETATM 3980 O  O      . HOH G 6 .   ? -14.738 -46.607 -5.813  1.00 48.82 ? 524 HOH A O      1 
HETATM 3981 O  O      . HOH G 6 .   ? 7.692   -47.873 11.108  1.00 43.15 ? 525 HOH A O      1 
HETATM 3982 O  O      . HOH G 6 .   ? -5.033  -46.384 -12.514 1.00 44.08 ? 526 HOH A O      1 
HETATM 3983 O  O      . HOH G 6 .   ? -7.778  -31.861 0.403   1.00 41.30 ? 527 HOH A O      1 
HETATM 3984 O  O      . HOH G 6 .   ? 2.951   -22.957 -8.045  1.00 35.29 ? 528 HOH A O      1 
HETATM 3985 O  O      . HOH G 6 .   ? -8.447  -43.396 -19.179 1.00 54.63 ? 529 HOH A O      1 
HETATM 3986 O  O      . HOH G 6 .   ? 5.613   -36.126 13.243  1.00 50.55 ? 530 HOH A O      1 
HETATM 3987 O  O      . HOH G 6 .   ? -0.716  -33.775 -16.566 1.00 44.23 ? 531 HOH A O      1 
HETATM 3988 O  O      . HOH G 6 .   ? 17.497  -31.846 18.701  1.00 44.18 ? 532 HOH A O      1 
HETATM 3989 O  O      . HOH G 6 .   ? 35.732  -29.211 -3.736  1.00 35.25 ? 533 HOH A O      1 
HETATM 3990 O  O      . HOH G 6 .   ? 3.340   -43.803 -8.763  1.00 59.02 ? 534 HOH A O      1 
HETATM 3991 O  O      . HOH G 6 .   ? 5.905   -51.956 12.792  1.00 59.68 ? 535 HOH A O      1 
HETATM 3992 O  O      . HOH G 6 .   ? -16.722 -17.448 -5.211  1.00 47.41 ? 536 HOH A O      1 
HETATM 3993 O  O      . HOH G 6 .   ? 10.204  -42.645 0.971   1.00 46.61 ? 537 HOH A O      1 
HETATM 3994 O  O      . HOH G 6 .   ? -15.519 -19.684 -5.806  1.00 33.54 ? 538 HOH A O      1 
HETATM 3995 O  O      . HOH G 6 .   ? -14.129 -17.328 -10.628 1.00 36.15 ? 539 HOH A O      1 
HETATM 3996 O  O      . HOH G 6 .   ? -12.533 -14.410 -11.802 1.00 49.00 ? 540 HOH A O      1 
HETATM 3997 O  O      . HOH G 6 .   ? 13.108  -49.513 6.817   1.00 44.36 ? 541 HOH A O      1 
HETATM 3998 O  O      . HOH G 6 .   ? -10.115 -13.185 -9.948  1.00 58.29 ? 542 HOH A O      1 
HETATM 3999 O  O      . HOH G 6 .   ? 22.013  -39.929 -10.405 1.00 51.73 ? 543 HOH A O      1 
HETATM 4000 O  O      . HOH G 6 .   ? 31.348  -37.324 14.772  1.00 46.03 ? 544 HOH A O      1 
HETATM 4001 O  O      . HOH G 6 .   ? 6.047   -34.713 11.484  1.00 39.26 ? 545 HOH A O      1 
HETATM 4002 O  O      . HOH G 6 .   ? 7.883   -30.918 -3.627  1.00 45.68 ? 546 HOH A O      1 
HETATM 4003 O  O      . HOH G 6 .   ? 3.394   -41.670 -9.700  1.00 48.81 ? 547 HOH A O      1 
HETATM 4004 O  O      . HOH G 6 .   ? -8.254  -10.521 -5.652  1.00 51.75 ? 548 HOH A O      1 
HETATM 4005 O  O      . HOH G 6 .   ? 27.460  -30.098 11.790  1.00 49.91 ? 549 HOH A O      1 
HETATM 4006 O  O      . HOH G 6 .   ? 17.097  -40.085 -6.446  1.00 37.56 ? 550 HOH A O      1 
HETATM 4007 O  O      . HOH G 6 .   ? 38.797  -36.312 0.861   1.00 49.82 ? 551 HOH A O      1 
HETATM 4008 O  O      . HOH G 6 .   ? -2.520  -15.023 -12.921 1.00 51.74 ? 552 HOH A O      1 
HETATM 4009 O  O      . HOH G 6 .   ? 27.857  -33.353 12.643  1.00 46.45 ? 553 HOH A O      1 
HETATM 4010 O  O      . HOH G 6 .   ? -15.329 -49.712 -2.663  1.00 49.07 ? 554 HOH A O      1 
HETATM 4011 O  O      . HOH G 6 .   ? -11.545 -22.619 -19.023 1.00 50.07 ? 555 HOH A O      1 
HETATM 4012 O  O      . HOH G 6 .   ? 14.032  -52.354 6.466   1.00 51.47 ? 556 HOH A O      1 
HETATM 4013 O  O      . HOH G 6 .   ? 3.622   -40.287 11.356  1.00 49.39 ? 557 HOH A O      1 
HETATM 4014 O  O      . HOH G 6 .   ? 27.761  -54.082 5.770   1.00 42.04 ? 558 HOH A O      1 
HETATM 4015 O  O      . HOH G 6 .   ? 8.570   -40.864 1.221   1.00 44.99 ? 559 HOH A O      1 
HETATM 4016 O  O      . HOH G 6 .   ? -5.658  -42.880 9.773   1.00 49.72 ? 560 HOH A O      1 
HETATM 4017 O  O      . HOH G 6 .   ? 22.295  -43.632 18.328  1.00 60.55 ? 561 HOH A O      1 
HETATM 4018 O  O      . HOH G 6 .   ? -3.070  -20.675 -17.737 1.00 46.02 ? 562 HOH A O      1 
HETATM 4019 O  O      . HOH G 6 .   ? 2.271   -50.928 1.348   1.00 39.20 ? 563 HOH A O      1 
HETATM 4020 O  O      . HOH G 6 .   ? 19.940  -40.702 -6.615  1.00 28.98 ? 564 HOH A O      1 
HETATM 4021 O  O      . HOH G 6 .   ? 7.174   -20.837 2.375   1.00 41.15 ? 565 HOH A O      1 
HETATM 4022 O  O      . HOH G 6 .   ? -7.537  -9.341  -3.113  1.00 54.28 ? 566 HOH A O      1 
HETATM 4023 O  O      . HOH G 6 .   ? 21.495  -46.378 -6.175  1.00 28.63 ? 567 HOH A O      1 
HETATM 4024 O  O      . HOH G 6 .   ? 35.352  -49.147 13.567  1.00 46.05 ? 568 HOH A O      1 
HETATM 4025 O  O      . HOH G 6 .   ? 24.007  -49.408 4.500   1.00 44.28 ? 569 HOH A O      1 
HETATM 4026 O  O      . HOH G 6 .   ? -6.580  -45.072 7.949   1.00 54.89 ? 570 HOH A O      1 
HETATM 4027 O  O      . HOH G 6 .   ? -0.364  -49.388 -4.996  1.00 45.29 ? 571 HOH A O      1 
HETATM 4028 O  O      . HOH G 6 .   ? -14.917 -30.527 -9.268  1.00 28.52 ? 572 HOH A O      1 
HETATM 4029 O  O      . HOH G 6 .   ? -15.351 -29.787 -7.350  1.00 49.70 ? 573 HOH A O      1 
HETATM 4030 O  O      . HOH G 6 .   ? -18.268 -35.526 -2.751  1.00 48.48 ? 574 HOH A O      1 
HETATM 4031 O  O      . HOH G 6 .   ? 37.367  -32.980 0.905   1.00 47.95 ? 575 HOH A O      1 
HETATM 4032 O  O      . HOH G 6 .   ? -1.119  -36.514 -16.907 1.00 54.17 ? 576 HOH A O      1 
HETATM 4033 O  O      . HOH G 6 .   ? 29.882  -53.727 -1.037  1.00 48.64 ? 577 HOH A O      1 
HETATM 4034 O  O      . HOH G 6 .   ? -11.640 -49.144 -7.388  1.00 42.56 ? 578 HOH A O      1 
HETATM 4035 O  O      . HOH G 6 .   ? 27.150  -49.850 2.903   1.00 43.12 ? 579 HOH A O      1 
HETATM 4036 O  O      . HOH G 6 .   ? -14.723 -18.963 -8.136  1.00 45.01 ? 580 HOH A O      1 
HETATM 4037 O  O      . HOH G 6 .   ? 39.285  -38.463 1.254   1.00 50.97 ? 581 HOH A O      1 
HETATM 4038 O  O      . HOH G 6 .   ? -8.833  -49.123 -8.690  1.00 55.47 ? 582 HOH A O      1 
HETATM 4039 O  O      . HOH G 6 .   ? 19.718  -33.038 15.120  1.00 29.84 ? 583 HOH A O      1 
HETATM 4040 O  O      . HOH G 6 .   ? 35.702  -50.022 2.289   1.00 42.55 ? 584 HOH A O      1 
HETATM 4041 O  O      . HOH G 6 .   ? 31.407  -51.852 0.363   1.00 50.47 ? 585 HOH A O      1 
HETATM 4042 O  O      . HOH G 6 .   ? -22.315 -14.354 -13.383 1.00 53.85 ? 586 HOH A O      1 
HETATM 4043 O  O      . HOH G 6 .   ? 33.622  -45.490 16.011  1.00 50.42 ? 587 HOH A O      1 
HETATM 4044 O  O      . HOH G 6 .   ? -24.485 -25.894 -1.552  1.00 49.69 ? 588 HOH A O      1 
HETATM 4045 O  O      . HOH G 6 .   ? -2.390  -50.558 5.978   1.00 55.86 ? 589 HOH A O      1 
HETATM 4046 O  O      . HOH G 6 .   ? -20.366 -19.928 -7.479  1.00 52.71 ? 590 HOH A O      1 
HETATM 4047 O  O      . HOH G 6 .   ? 29.739  -51.773 1.943   1.00 63.61 ? 591 HOH A O      1 
HETATM 4048 O  O      . HOH G 6 .   ? 14.861  -39.498 -4.565  1.00 49.64 ? 592 HOH A O      1 
HETATM 4049 O  O      . HOH G 6 .   ? 31.900  -45.666 17.560  1.00 64.97 ? 593 HOH A O      1 
HETATM 4050 O  O      . HOH G 6 .   ? 25.246  -53.996 1.685   1.00 56.06 ? 594 HOH A O      1 
HETATM 4051 O  O      . HOH G 6 .   ? -9.700  -33.358 -19.230 1.00 53.05 ? 595 HOH A O      1 
HETATM 4052 O  O      . HOH G 6 .   ? 4.201   -25.012 -8.052  1.00 50.60 ? 596 HOH A O      1 
HETATM 4053 O  O      . HOH G 6 .   ? 15.665  -40.369 15.111  1.00 48.42 ? 597 HOH A O      1 
HETATM 4054 O  O      . HOH G 6 .   ? 37.818  -38.401 3.210   1.00 44.47 ? 598 HOH A O      1 
HETATM 4055 O  O      . HOH G 6 .   ? 16.488  -37.878 15.621  1.00 47.90 ? 599 HOH A O      1 
HETATM 4056 O  O      . HOH G 6 .   ? 0.927   -42.197 8.915   1.00 45.95 ? 600 HOH A O      1 
HETATM 4057 O  O      . HOH G 6 .   ? -13.056 -47.639 -4.883  1.00 57.74 ? 601 HOH A O      1 
HETATM 4058 O  O      . HOH G 6 .   ? -12.506 -11.758 -12.227 1.00 57.08 ? 602 HOH A O      1 
HETATM 4059 O  O      . HOH G 6 .   ? -16.253 -12.373 -14.176 1.00 54.97 ? 603 HOH A O      1 
HETATM 4060 O  O      . HOH G 6 .   ? 22.647  -34.324 15.756  1.00 49.83 ? 604 HOH A O      1 
HETATM 4061 O  O      . HOH G 6 .   ? -10.016 -39.100 -17.877 1.00 56.54 ? 605 HOH A O      1 
HETATM 4062 O  O      . HOH G 6 .   ? 15.063  -26.188 9.547   1.00 52.03 ? 606 HOH A O      1 
HETATM 4063 O  O      . HOH G 6 .   ? 12.345  -47.819 11.154  1.00 58.27 ? 607 HOH A O      1 
HETATM 4064 O  O      . HOH G 6 .   ? 40.038  -38.512 -2.475  1.00 45.46 ? 608 HOH A O      1 
HETATM 4065 O  O      . HOH G 6 .   ? -27.277 -15.829 -20.062 1.00 57.01 ? 609 HOH A O      1 
HETATM 4066 O  O      . HOH G 6 .   ? 31.071  -35.647 10.469  1.00 61.16 ? 610 HOH A O      1 
HETATM 4067 O  O      . HOH G 6 .   ? -10.334 -27.527 19.977  1.00 54.59 ? 611 HOH A O      1 
HETATM 4068 O  O      . HOH G 6 .   ? -15.265 -42.783 -8.291  1.00 56.83 ? 612 HOH A O      1 
HETATM 4069 O  O      . HOH G 6 .   ? 35.250  -51.285 0.227   1.00 62.66 ? 613 HOH A O      1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . ASN A 7   ? 0.7299 0.7503 0.6741 0.0126  -0.0262 0.0327  7   ASN A N     
2    C  CA    . ASN A 7   ? 0.7216 0.7506 0.6908 0.0112  0.0286  0.0091  7   ASN A CA    
3    C  C     . ASN A 7   ? 0.7173 0.7561 0.7738 0.0540  0.0421  -0.0068 7   ASN A C     
4    O  O     . ASN A 7   ? 0.7201 0.7473 0.7897 0.0844  0.0364  -0.0635 7   ASN A O     
5    C  CB    . ASN A 7   ? 0.7115 0.7285 0.6765 -0.0316 0.0470  -0.0002 7   ASN A CB    
6    N  N     . LEU A 8   ? 0.7043 0.7707 0.8959 0.0731  0.0333  0.0011  8   LEU A N     
7    C  CA    . LEU A 8   ? 0.6772 0.7569 0.9612 0.0469  0.0284  -0.0048 8   LEU A CA    
8    C  C     . LEU A 8   ? 0.6259 0.7242 0.9641 0.0190  0.0012  -0.0155 8   LEU A C     
9    O  O     . LEU A 8   ? 0.6457 0.7375 1.0577 0.0206  -0.0158 -0.0171 8   LEU A O     
10   C  CB    . LEU A 8   ? 0.7042 0.7579 0.9576 0.0403  0.0370  -0.0531 8   LEU A CB    
11   C  CG    . LEU A 8   ? 0.7177 0.7698 0.9152 0.0492  0.0463  -0.0770 8   LEU A CG    
12   C  CD1   . LEU A 8   ? 0.7260 0.7614 0.7963 0.0651  0.0257  -0.1197 8   LEU A CD1   
13   C  CD2   . LEU A 8   ? 0.7240 0.7911 0.9473 0.0532  0.0683  -0.0544 8   LEU A CD2   
25   N  N     . LEU A 9   ? 0.5438 0.6728 0.8204 -0.0320 -0.0336 -0.0247 9   LEU A N     
26   C  CA    . LEU A 9   ? 0.4635 0.6293 0.7260 -0.0795 -0.0321 -0.0566 9   LEU A CA    
27   C  C     . LEU A 9   ? 0.4285 0.5638 0.7374 -0.0712 -0.0176 -0.0725 9   LEU A C     
28   O  O     . LEU A 9   ? 0.3824 0.4935 0.6730 -0.1403 0.0297  -0.0299 9   LEU A O     
29   C  CB    . LEU A 9   ? 0.4158 0.6781 0.7121 -0.1102 -0.0560 -0.0597 9   LEU A CB    
30   C  CG    . LEU A 9   ? 0.4217 0.7331 0.7625 -0.0847 -0.0359 -0.0255 9   LEU A CG    
31   C  CD1   . LEU A 9   ? 0.3890 0.7375 0.7885 -0.1220 -0.0287 -0.0085 9   LEU A CD1   
32   C  CD2   . LEU A 9   ? 0.4388 0.7477 0.7368 -0.0556 0.0301  0.0063  9   LEU A CD2   
44   N  N     . GLY A 10  ? 0.4259 0.5630 0.7343 0.0041  0.0145  -0.1009 10  GLY A N     
45   C  CA    . GLY A 10  ? 0.4035 0.5200 0.7594 0.0031  0.0135  -0.0926 10  GLY A CA    
46   C  C     . GLY A 10  ? 0.4060 0.4987 0.7646 0.0262  0.0612  -0.0731 10  GLY A C     
47   O  O     . GLY A 10  ? 0.4338 0.4801 0.7919 0.0150  0.0731  -0.1279 10  GLY A O     
51   N  N     . GLU A 11  ? 0.3979 0.4437 0.7551 0.0352  0.0404  -0.0195 11  GLU A N     
52   C  CA    . GLU A 11  ? 0.4090 0.4200 0.8621 0.0712  -0.0562 -0.0983 11  GLU A CA    
53   C  C     . GLU A 11  ? 0.3267 0.3631 0.8782 0.0391  -0.0522 -0.1036 11  GLU A C     
54   O  O     . GLU A 11  ? 0.3542 0.3819 0.9829 0.0473  -0.0770 -0.1258 11  GLU A O     
55   C  CB    . GLU A 11  ? 0.4834 0.4446 0.9455 0.1194  -0.0179 -0.0503 11  GLU A CB    
56   C  CG    . GLU A 11  ? 0.5298 0.4567 1.0503 0.1230  -0.0239 -0.0381 11  GLU A CG    
57   C  CD    . GLU A 11  ? 0.5883 0.5272 1.1244 0.1301  -0.0394 0.0147  11  GLU A CD    
58   O  OE1   . GLU A 11  ? 0.6136 0.5520 1.0836 0.1135  -0.0280 -0.0163 11  GLU A OE1   
59   O  OE2   . GLU A 11  ? 0.5993 0.5377 1.1511 0.1398  -0.0888 0.1073  11  GLU A OE2   
66   N  N     . ALA A 12  ? 0.2236 0.3172 0.8262 -0.0048 -0.0618 -0.1020 12  ALA A N     
67   C  CA    . ALA A 12  ? 0.2472 0.2826 0.7561 0.0210  -0.0627 -0.0008 12  ALA A CA    
68   C  C     . ALA A 12  ? 0.2447 0.2545 0.6931 -0.0046 -0.0756 0.0368  12  ALA A C     
69   O  O     . ALA A 12  ? 0.2525 0.2442 0.6298 0.0083  -0.0717 0.0706  12  ALA A O     
70   C  CB    . ALA A 12  ? 0.3044 0.2949 0.7414 -0.0039 -0.0510 0.0351  12  ALA A CB    
76   N  N     . ASN A 13  ? 0.2721 0.2642 0.7018 -0.0134 -0.0600 0.0935  13  ASN A N     
77   C  CA    . ASN A 13  ? 0.3208 0.3300 0.6577 0.0098  -0.0207 0.1388  13  ASN A CA    
78   C  C     . ASN A 13  ? 0.2934 0.3090 0.5521 0.0007  -0.0007 0.1297  13  ASN A C     
79   O  O     . ASN A 13  ? 0.2499 0.3158 0.5736 -0.0206 -0.0440 0.1240  13  ASN A O     
80   C  CB    . ASN A 13  ? 0.4124 0.3831 0.7504 0.0456  -0.0501 0.1597  13  ASN A CB    
81   C  CG    . ASN A 13  ? 0.5380 0.4641 0.9251 0.0941  0.0045  0.1599  13  ASN A CG    
82   O  OD1   . ASN A 13  ? 0.5863 0.4866 1.0091 0.1214  0.0242  0.1600  13  ASN A OD1   
83   N  ND2   . ASN A 13  ? 0.5840 0.5018 1.0165 0.0941  0.0172  0.1151  13  ASN A ND2   
90   N  N     . SER A 14  ? 0.3004 0.3079 0.5023 0.0085  -0.0010 0.1219  14  SER A N     
91   C  CA    . SER A 14  ? 0.2720 0.3059 0.5324 0.0097  0.0198  0.1129  14  SER A CA    
92   C  C     . SER A 14  ? 0.2581 0.2562 0.4825 0.0408  0.0180  0.1055  14  SER A C     
93   O  O     . SER A 14  ? 0.2658 0.2535 0.5537 0.0797  0.0156  0.1099  14  SER A O     
94   C  CB    . SER A 14  ? 0.2802 0.3427 0.6075 0.0521  -0.0644 0.0878  14  SER A CB    
95   O  OG    . SER A 14  ? 0.2658 0.3154 0.5975 0.0181  -0.0747 0.0962  14  SER A OG    
101  N  N     . PHE A 15  ? 0.2003 0.2387 0.4275 0.0082  0.0217  0.0937  15  PHE A N     
102  C  CA    . PHE A 15  ? 0.2007 0.2076 0.5063 -0.0004 0.0205  0.0462  15  PHE A CA    
103  C  C     . PHE A 15  ? 0.2082 0.1896 0.5033 0.0197  0.0072  0.0810  15  PHE A C     
104  O  O     . PHE A 15  ? 0.2059 0.1679 0.4715 -0.0095 -0.0077 0.0440  15  PHE A O     
105  C  CB    . PHE A 15  ? 0.1946 0.2671 0.5014 -0.0501 0.0205  0.0481  15  PHE A CB    
106  C  CG    . PHE A 15  ? 0.2345 0.3707 0.6134 -0.0770 0.0876  0.0189  15  PHE A CG    
107  C  CD1   . PHE A 15  ? 0.2785 0.4344 0.6033 -0.0214 0.1186  0.0516  15  PHE A CD1   
108  C  CD2   . PHE A 15  ? 0.2685 0.4292 0.6221 -0.0718 0.0429  -0.0187 15  PHE A CD2   
109  C  CE1   . PHE A 15  ? 0.3323 0.4715 0.7321 -0.0052 0.1071  0.0318  15  PHE A CE1   
110  C  CE2   . PHE A 15  ? 0.3055 0.4859 0.7114 -0.0399 0.0533  -0.0366 15  PHE A CE2   
111  C  CZ    . PHE A 15  ? 0.3250 0.4851 0.7367 -0.0042 0.0869  -0.0057 15  PHE A CZ    
121  N  N     . LEU A 16  ? 0.1958 0.1914 0.5679 0.0236  -0.0111 0.0481  16  LEU A N     
122  C  CA    . LEU A 16  ? 0.2152 0.1949 0.5839 0.0364  0.0246  0.0091  16  LEU A CA    
123  C  C     . LEU A 16  ? 0.2123 0.1870 0.6376 0.0254  0.0071  0.0276  16  LEU A C     
124  O  O     . LEU A 16  ? 0.2045 0.2078 0.6442 -0.0136 0.0134  0.0453  16  LEU A O     
125  C  CB    . LEU A 16  ? 0.2559 0.2127 0.6949 0.0420  -0.0114 -0.0081 16  LEU A CB    
126  C  CG    . LEU A 16  ? 0.2534 0.2506 0.6547 0.0582  -0.0005 0.0065  16  LEU A CG    
127  C  CD1   . LEU A 16  ? 0.2937 0.2786 0.6709 0.1147  -0.0477 -0.0051 16  LEU A CD1   
128  C  CD2   . LEU A 16  ? 0.2132 0.2821 0.6239 0.0285  0.0403  -0.0232 16  LEU A CD2   
140  N  N     . GLU A 17  ? 0.1991 0.2143 0.5298 0.0199  0.0360  0.1080  17  GLU A N     
141  C  CA    . GLU A 17  ? 0.2273 0.2407 0.5403 -0.0071 0.0272  0.1680  17  GLU A CA    
142  C  C     . GLU A 17  ? 0.2079 0.1888 0.5029 -0.0205 0.0183  0.0906  17  GLU A C     
143  O  O     . GLU A 17  ? 0.2027 0.2251 0.4951 -0.0061 0.0164  0.0417  17  GLU A O     
144  C  CB    . GLU A 17  ? 0.2950 0.3501 0.5385 0.0185  0.0051  0.1605  17  GLU A CB    
145  C  CG    . GLU A 17  ? 0.3802 0.4746 0.7392 0.0654  0.0691  0.1586  17  GLU A CG    
146  C  CD    . GLU A 17  ? 0.4693 0.6035 0.8056 0.1280  0.0285  0.0891  17  GLU A CD    
147  O  OE1   . GLU A 17  ? 0.5059 0.6550 0.8537 0.1052  0.0694  0.0400  17  GLU A OE1   
148  O  OE2   . GLU A 17  ? 0.5180 0.6518 0.9182 0.1384  0.0051  0.0283  17  GLU A OE2   
155  N  N     . VAL A 18  ? 0.1942 0.1453 0.4305 -0.0120 -0.0062 0.0530  18  VAL A N     
156  C  CA    . VAL A 18  ? 0.2138 0.1399 0.5229 0.0019  0.0481  -0.0034 18  VAL A CA    
157  C  C     . VAL A 18  ? 0.1875 0.1533 0.5351 0.0101  0.0728  0.0071  18  VAL A C     
158  O  O     . VAL A 18  ? 0.1644 0.1587 0.4788 0.0055  -0.0013 0.0109  18  VAL A O     
159  C  CB    . VAL A 18  ? 0.2093 0.1592 0.5706 0.0147  0.0181  -0.0148 18  VAL A CB    
160  C  CG1   . VAL A 18  ? 0.1846 0.1609 0.5924 -0.0115 -0.0071 -0.0492 18  VAL A CG1   
161  C  CG2   . VAL A 18  ? 0.2270 0.1671 0.5981 0.0342  -0.0317 -0.0323 18  VAL A CG2   
171  N  N     . LEU A 19  ? 0.1539 0.1718 0.5307 -0.0007 0.0437  0.0042  19  LEU A N     
172  C  CA    . LEU A 19  ? 0.1764 0.1931 0.5012 0.0219  0.0526  0.0078  19  LEU A CA    
173  C  C     . LEU A 19  ? 0.1597 0.2151 0.4355 -0.0023 0.0433  -0.0243 19  LEU A C     
174  O  O     . LEU A 19  ? 0.1840 0.2003 0.5301 0.0244  0.0056  -0.0295 19  LEU A O     
175  C  CB    . LEU A 19  ? 0.1901 0.2406 0.5300 0.0162  0.0601  -0.0013 19  LEU A CB    
176  C  CG    . LEU A 19  ? 0.2057 0.2963 0.6236 0.0251  0.0630  0.0002  19  LEU A CG    
177  C  CD1   . LEU A 19  ? 0.2280 0.3572 0.6735 0.0429  0.0591  -0.0691 19  LEU A CD1   
178  C  CD2   . LEU A 19  ? 0.2110 0.2898 0.6646 0.0173  0.0970  -0.0054 19  LEU A CD2   
190  N  N     . GLU A 20  ? 0.1752 0.2151 0.4587 0.0285  0.0351  -0.0110 20  GLU A N     
191  C  CA    . GLU A 20  ? 0.1717 0.2034 0.5343 -0.0071 0.0062  -0.0078 20  GLU A CA    
192  C  C     . GLU A 20  ? 0.1771 0.1712 0.5707 0.0008  0.0362  -0.0168 20  GLU A C     
193  O  O     . GLU A 20  ? 0.1948 0.1789 0.5323 0.0046  0.0173  -0.0042 20  GLU A O     
194  C  CB    . GLU A 20  ? 0.1937 0.2189 0.7087 -0.0205 0.0097  0.0090  20  GLU A CB    
195  C  CG    . GLU A 20  ? 0.2870 0.3329 0.9057 -0.0050 0.0046  0.0166  20  GLU A CG    
196  C  CD    . GLU A 20  ? 0.3807 0.4409 1.0959 0.0308  0.0101  0.0303  20  GLU A CD    
197  O  OE1   . GLU A 20  ? 0.4489 0.4719 1.2086 0.0672  0.0153  0.0252  20  GLU A OE1   
198  O  OE2   . GLU A 20  ? 0.4008 0.4853 1.1145 0.0296  0.0048  0.0909  20  GLU A OE2   
205  N  N     . GLN A 21  ? 0.1610 0.1504 0.4681 -0.0194 0.0231  0.0189  21  GLN A N     
206  C  CA    . GLN A 21  ? 0.1487 0.1598 0.4205 -0.0216 0.0019  0.0188  21  GLN A CA    
207  C  C     . GLN A 21  ? 0.1550 0.1438 0.4343 -0.0071 0.0153  0.0068  21  GLN A C     
208  O  O     . GLN A 21  ? 0.1573 0.1707 0.4506 -0.0120 0.0301  0.0300  21  GLN A O     
209  C  CB    . GLN A 21  ? 0.1589 0.2005 0.4649 -0.0078 0.0419  0.0464  21  GLN A CB    
210  C  CG    . GLN A 21  ? 0.1853 0.2174 0.4896 -0.0102 0.0340  0.0104  21  GLN A CG    
211  C  CD    . GLN A 21  ? 0.1711 0.2152 0.4173 -0.0395 0.0125  0.0175  21  GLN A CD    
212  O  OE1   . GLN A 21  ? 0.1964 0.2521 0.5008 -0.0288 -0.0040 -0.0723 21  GLN A OE1   
213  N  NE2   . GLN A 21  ? 0.1959 0.1849 0.5488 -0.0020 0.0361  0.0272  21  GLN A NE2   
222  N  N     . VAL A 22  ? 0.1457 0.1707 0.4332 0.0032  0.0197  0.0357  22  VAL A N     
223  C  CA    . VAL A 22  ? 0.1518 0.1590 0.5432 -0.0150 0.0259  0.0263  22  VAL A CA    
224  C  C     . VAL A 22  ? 0.1680 0.1637 0.4738 -0.0294 0.0352  0.0044  22  VAL A C     
225  O  O     . VAL A 22  ? 0.1847 0.2071 0.4826 -0.0069 0.0264  0.0041  22  VAL A O     
226  C  CB    . VAL A 22  ? 0.1697 0.1656 0.5175 0.0002  0.0549  0.0911  22  VAL A CB    
227  C  CG1   . VAL A 22  ? 0.1760 0.1993 0.5872 0.0143  0.0497  0.1232  22  VAL A CG1   
228  C  CG2   . VAL A 22  ? 0.1800 0.1574 0.5001 -0.0270 0.0565  0.0387  22  VAL A CG2   
238  N  N     . SER A 23  ? 0.1666 0.1646 0.4900 -0.0085 0.0302  -0.0063 23  SER A N     
239  C  CA    . SER A 23  ? 0.2082 0.1833 0.5164 0.0113  0.0399  -0.0614 23  SER A CA    
240  C  C     . SER A 23  ? 0.2078 0.1930 0.4900 0.0183  0.0132  -0.0346 23  SER A C     
241  O  O     . SER A 23  ? 0.2346 0.2668 0.4629 0.0044  0.0015  -0.0450 23  SER A O     
242  C  CB    . SER A 23  ? 0.3181 0.2256 0.6348 0.0358  0.0275  -0.0894 23  SER A CB    
243  O  OG    . SER A 23  ? 0.3668 0.3424 0.7908 0.0929  -0.0146 -0.1650 23  SER A OG    
249  N  N     . HIS A 24  ? 0.1618 0.1767 0.4372 -0.0015 0.0190  0.0029  24  HIS A N     
250  C  CA    . HIS A 24  ? 0.1911 0.1650 0.3932 -0.0071 0.0239  -0.0465 24  HIS A CA    
251  C  C     . HIS A 24  ? 0.1734 0.1492 0.4322 -0.0161 0.0477  -0.0253 24  HIS A C     
252  O  O     . HIS A 24  ? 0.1977 0.1919 0.5120 0.0061  0.0354  0.0140  24  HIS A O     
253  C  CB    . HIS A 24  ? 0.2292 0.1640 0.5168 -0.0138 0.0705  0.0601  24  HIS A CB    
254  C  CG    . HIS A 24  ? 0.2762 0.1875 0.6187 -0.0442 0.0731  0.0423  24  HIS A CG    
255  N  ND1   . HIS A 24  ? 0.3486 0.1989 0.7783 -0.0052 -0.0369 0.0371  24  HIS A ND1   
256  C  CD2   . HIS A 24  ? 0.2925 0.2115 0.6970 -0.0525 -0.0267 0.0806  24  HIS A CD2   
257  C  CE1   . HIS A 24  ? 0.3426 0.2196 0.7604 0.0138  -0.0634 0.0275  24  HIS A CE1   
258  N  NE2   . HIS A 24  ? 0.2987 0.2302 0.8366 -0.0305 -0.0183 0.0758  24  HIS A NE2   
265  N  N     . LEU A 25  ? 0.1635 0.1336 0.3539 -0.0026 0.0012  0.0029  25  LEU A N     
266  C  CA    . LEU A 25  ? 0.1453 0.1629 0.3409 -0.0129 0.0419  -0.0210 25  LEU A CA    
267  C  C     . LEU A 25  ? 0.1562 0.1733 0.3778 -0.0258 0.0361  -0.0251 25  LEU A C     
268  O  O     . LEU A 25  ? 0.1616 0.2086 0.3754 0.0130  0.0393  -0.0472 25  LEU A O     
269  C  CB    . LEU A 25  ? 0.1417 0.1561 0.3530 -0.0092 0.0285  -0.0301 25  LEU A CB    
270  C  CG    . LEU A 25  ? 0.1851 0.1475 0.4271 -0.0018 0.0426  -0.0198 25  LEU A CG    
271  C  CD1   . LEU A 25  ? 0.1911 0.1547 0.3908 -0.0308 0.0275  -0.0129 25  LEU A CD1   
272  C  CD2   . LEU A 25  ? 0.2140 0.1762 0.4082 0.0156  0.0828  -0.0276 25  LEU A CD2   
284  N  N     . ALA A 26  ? 0.1804 0.1908 0.3445 0.0312  0.0380  0.0079  26  ALA A N     
285  C  CA    . ALA A 26  ? 0.1905 0.2051 0.3346 0.0076  0.0492  -0.0466 26  ALA A CA    
286  C  C     . ALA A 26  ? 0.1857 0.2242 0.3175 -0.0045 0.0795  -0.0242 26  ALA A C     
287  O  O     . ALA A 26  ? 0.1886 0.2114 0.3777 0.0006  0.0258  0.0074  26  ALA A O     
288  C  CB    . ALA A 26  ? 0.2280 0.1808 0.3907 -0.0148 0.0410  -0.0194 26  ALA A CB    
294  N  N     . PRO A 27  ? 0.1899 0.1927 0.3812 -0.0145 0.0307  -0.0479 27  PRO A N     
295  C  CA    . PRO A 27  ? 0.1950 0.2221 0.4554 -0.0154 0.0383  -0.0469 27  PRO A CA    
296  C  C     . PRO A 27  ? 0.1755 0.2553 0.4474 -0.0052 -0.0023 -0.0492 27  PRO A C     
297  O  O     . PRO A 27  ? 0.1964 0.3130 0.4390 0.0075  0.0010  -0.0167 27  PRO A O     
298  C  CB    . PRO A 27  ? 0.2273 0.2018 0.4552 -0.0471 0.0494  -0.0779 27  PRO A CB    
299  C  CG    . PRO A 27  ? 0.2926 0.2508 0.4773 0.0156  0.0565  -0.0510 27  PRO A CG    
300  C  CD    . PRO A 27  ? 0.2392 0.2018 0.4141 -0.0163 0.0122  -0.0530 27  PRO A CD    
308  N  N     . LEU A 28  ? 0.1557 0.2103 0.3855 -0.0196 -0.0007 0.0053  28  LEU A N     
309  C  CA    . LEU A 28  ? 0.1503 0.2061 0.3867 -0.0062 -0.0228 0.0034  28  LEU A CA    
310  C  C     . LEU A 28  ? 0.1798 0.2202 0.3908 0.0151  -0.0302 0.0307  28  LEU A C     
311  O  O     . LEU A 28  ? 0.1947 0.2373 0.4884 0.0141  0.0308  0.0231  28  LEU A O     
312  C  CB    . LEU A 28  ? 0.1843 0.2501 0.3638 0.0173  0.0202  0.0098  28  LEU A CB    
313  C  CG    . LEU A 28  ? 0.2257 0.3189 0.3759 0.0041  -0.0139 0.0788  28  LEU A CG    
314  C  CD1   . LEU A 28  ? 0.2530 0.3095 0.4188 -0.0394 0.0040  0.1117  28  LEU A CD1   
315  C  CD2   . LEU A 28  ? 0.2010 0.3461 0.4151 -0.0480 -0.0308 0.0636  28  LEU A CD2   
327  N  N     . ASP A 29  ? 0.2020 0.2165 0.4229 0.0116  -0.0431 -0.0046 29  ASP A N     
328  C  CA    . ASP A 29  ? 0.2648 0.2539 0.3680 0.0587  -0.0115 0.0139  29  ASP A CA    
329  C  C     . ASP A 29  ? 0.2556 0.2609 0.4438 0.0739  0.0558  0.0804  29  ASP A C     
330  O  O     . ASP A 29  ? 0.2720 0.2887 0.4959 0.0108  -0.0059 0.0837  29  ASP A O     
331  C  CB    . ASP A 29  ? 0.3461 0.3478 0.2897 0.0715  -0.0455 -0.0246 29  ASP A CB    
332  C  CG    . ASP A 29  ? 0.4440 0.4221 0.5734 0.1106  -0.0718 -0.0576 29  ASP A CG    
333  O  OD1   . ASP A 29  ? 0.5077 0.4391 0.5290 0.1618  -0.0043 0.0553  29  ASP A OD1   
334  O  OD2   . ASP A 29  ? 0.5238 0.5123 0.7844 0.1865  -0.0414 -0.0719 29  ASP A OD2   
339  N  N     . LYS A 30  ? 0.2190 0.1811 0.4019 0.0281  0.0423  0.0667  30  LYS A N     
340  C  CA    . LYS A 30  ? 0.1691 0.1728 0.3720 0.0001  0.0412  0.0256  30  LYS A CA    
341  C  C     . LYS A 30  ? 0.1519 0.1574 0.3324 -0.0159 0.0339  0.0192  30  LYS A C     
342  O  O     . LYS A 30  ? 0.1708 0.1722 0.3862 0.0213  0.0150  0.0266  30  LYS A O     
343  C  CB    . LYS A 30  ? 0.1680 0.1969 0.3809 -0.0108 0.0094  0.0613  30  LYS A CB    
344  C  CG    . LYS A 30  ? 0.1848 0.2052 0.3924 -0.0271 -0.0158 0.0432  30  LYS A CG    
345  C  CD    . LYS A 30  ? 0.1943 0.2170 0.4176 -0.0489 0.0293  0.0773  30  LYS A CD    
346  C  CE    . LYS A 30  ? 0.2094 0.2506 0.5028 -0.0629 0.0406  0.0745  30  LYS A CE    
347  N  NZ    . LYS A 30  ? 0.1893 0.2982 0.4861 -0.0474 -0.0348 -0.0072 30  LYS A NZ    
361  N  N     . PRO A 31  ? 0.1264 0.1600 0.3518 -0.0375 0.0142  0.0187  31  PRO A N     
362  C  CA    . PRO A 31  ? 0.1145 0.1913 0.3907 -0.0244 0.0094  0.0446  31  PRO A CA    
363  C  C     . PRO A 31  ? 0.1395 0.2142 0.3371 -0.0277 0.0443  0.0448  31  PRO A C     
364  O  O     . PRO A 31  ? 0.1332 0.2862 0.3328 -0.0121 0.0086  0.0727  31  PRO A O     
365  C  CB    . PRO A 31  ? 0.1409 0.1998 0.5041 -0.0048 0.0582  0.0293  31  PRO A CB    
366  C  CG    . PRO A 31  ? 0.1711 0.2402 0.4813 0.0236  0.0557  -0.0859 31  PRO A CG    
367  C  CD    . PRO A 31  ? 0.1421 0.1746 0.3582 0.0054  0.0307  -0.0029 31  PRO A CD    
375  N  N     . VAL A 32  ? 0.1257 0.1758 0.4257 -0.0170 0.0441  0.0427  32  VAL A N     
376  C  CA    . VAL A 32  ? 0.1285 0.1486 0.3766 -0.0323 0.0238  0.0229  32  VAL A CA    
377  C  C     . VAL A 32  ? 0.1084 0.1462 0.3944 -0.0164 0.0019  0.0302  32  VAL A C     
378  O  O     . VAL A 32  ? 0.1791 0.1709 0.3495 -0.0393 0.0204  0.0357  32  VAL A O     
379  C  CB    . VAL A 32  ? 0.1536 0.1759 0.4152 -0.0139 0.0175  -0.0023 32  VAL A CB    
380  C  CG1   . VAL A 32  ? 0.1225 0.1970 0.3636 0.0171  0.0363  0.0327  32  VAL A CG1   
381  C  CG2   . VAL A 32  ? 0.2272 0.2091 0.3905 0.0134  -0.0249 -0.0079 32  VAL A CG2   
391  N  N     . LEU A 33  ? 0.1144 0.1443 0.4259 -0.0056 0.0153  0.0262  33  LEU A N     
392  C  CA    . LEU A 33  ? 0.1403 0.1719 0.3071 -0.0068 0.0313  0.0270  33  LEU A CA    
393  C  C     . LEU A 33  ? 0.1205 0.1461 0.3243 0.0003  -0.0041 0.0161  33  LEU A C     
394  O  O     . LEU A 33  ? 0.1114 0.1638 0.4159 0.0056  0.0324  0.0578  33  LEU A O     
395  C  CB    . LEU A 33  ? 0.1944 0.1649 0.3442 -0.0096 0.0051  0.0277  33  LEU A CB    
396  C  CG    . LEU A 33  ? 0.2456 0.1864 0.3749 0.0099  0.0241  0.0283  33  LEU A CG    
397  C  CD1   . LEU A 33  ? 0.2505 0.2218 0.4386 0.0218  -0.0218 -0.0201 33  LEU A CD1   
398  C  CD2   . LEU A 33  ? 0.3435 0.2378 0.3316 0.0466  0.0391  -0.0028 33  LEU A CD2   
410  N  N     . ILE A 34  ? 0.1075 0.1542 0.4014 0.0051  0.0397  0.0205  34  ILE A N     
411  C  CA    . ILE A 34  ? 0.1353 0.1493 0.3438 -0.0005 0.0439  0.0556  34  ILE A CA    
412  C  C     . ILE A 34  ? 0.1527 0.1860 0.3401 -0.0028 0.0276  0.0327  34  ILE A C     
413  O  O     . ILE A 34  ? 0.1807 0.1903 0.3968 -0.0038 0.0068  0.0364  34  ILE A O     
414  C  CB    . ILE A 34  ? 0.1209 0.1528 0.3604 0.0031  0.0403  0.0625  34  ILE A CB    
415  C  CG1   . ILE A 34  ? 0.1177 0.2005 0.3834 0.0310  0.0111  0.0388  34  ILE A CG1   
416  C  CG2   . ILE A 34  ? 0.1354 0.1936 0.3410 0.0221  0.0357  0.0445  34  ILE A CG2   
417  C  CD1   . ILE A 34  ? 0.1825 0.1711 0.4001 0.0433  -0.0018 0.0281  34  ILE A CD1   
429  N  N     . ILE A 35  ? 0.1173 0.1886 0.4294 0.0122  0.0214  0.0354  35  ILE A N     
430  C  CA    . ILE A 35  ? 0.1175 0.1865 0.3517 -0.0103 0.0145  0.0752  35  ILE A CA    
431  C  C     . ILE A 35  ? 0.1017 0.1636 0.3359 -0.0021 -0.0222 0.0380  35  ILE A C     
432  O  O     . ILE A 35  ? 0.1521 0.1560 0.5235 0.0146  -0.0059 0.0613  35  ILE A O     
433  C  CB    . ILE A 35  ? 0.1455 0.2972 0.3525 0.0294  -0.0120 -0.0125 35  ILE A CB    
434  C  CG1   . ILE A 35  ? 0.1932 0.3296 0.5555 0.0161  0.0059  -0.0382 35  ILE A CG1   
435  C  CG2   . ILE A 35  ? 0.1711 0.3275 0.3500 0.0305  0.0523  -0.0199 35  ILE A CG2   
436  C  CD1   . ILE A 35  ? 0.1916 0.3489 0.6890 0.0080  -0.0157 -0.0298 35  ILE A CD1   
448  N  N     . GLY A 36  ? 0.1057 0.1681 0.4223 -0.0007 -0.0048 0.0077  36  GLY A N     
449  C  CA    . GLY A 36  ? 0.1226 0.1797 0.3527 -0.0095 0.0322  0.0305  36  GLY A CA    
450  C  C     . GLY A 36  ? 0.1041 0.1682 0.2796 0.0089  0.0246  0.0252  36  GLY A C     
451  O  O     . GLY A 36  ? 0.1126 0.1830 0.3564 0.0122  0.0146  0.0303  36  GLY A O     
455  N  N     . GLU A 37  ? 0.1057 0.1979 0.3745 0.0321  0.0093  -0.0042 37  GLU A N     
456  C  CA    . GLU A 37  ? 0.1244 0.1899 0.3879 0.0316  0.0225  -0.0086 37  GLU A CA    
457  C  C     . GLU A 37  ? 0.0997 0.1753 0.3721 0.0186  -0.0241 -0.0119 37  GLU A C     
458  O  O     . GLU A 37  ? 0.0899 0.1760 0.3435 0.0021  0.0132  0.0103  37  GLU A O     
459  C  CB    . GLU A 37  ? 0.1358 0.1988 0.3654 0.0102  0.0083  0.0459  37  GLU A CB    
460  C  CG    . GLU A 37  ? 0.1544 0.2247 0.4071 -0.0103 -0.0248 0.0269  37  GLU A CG    
461  C  CD    . GLU A 37  ? 0.1934 0.2768 0.4648 -0.0152 0.0010  0.0572  37  GLU A CD    
462  O  OE1   . GLU A 37  ? 0.1839 0.2904 0.4116 -0.0012 0.0162  0.0422  37  GLU A OE1   
463  O  OE2   . GLU A 37  ? 0.2265 0.3652 0.4316 0.0001  -0.0124 0.0313  37  GLU A OE2   
470  N  N     . ARG A 38  ? 0.1208 0.1358 0.3846 0.0228  0.0013  -0.0051 38  ARG A N     
471  C  CA    . ARG A 38  ? 0.1581 0.1290 0.3897 0.0235  0.0052  0.0371  38  ARG A CA    
472  C  C     . ARG A 38  ? 0.1247 0.1333 0.3120 -0.0007 0.0387  0.0325  38  ARG A C     
473  O  O     . ARG A 38  ? 0.1220 0.1400 0.3376 0.0112  0.0137  0.0237  38  ARG A O     
474  C  CB    . ARG A 38  ? 0.2130 0.1096 0.3901 0.0251  0.0226  0.0200  38  ARG A CB    
475  C  CG    . ARG A 38  ? 0.2039 0.1152 0.4235 0.0098  -0.0238 -0.0454 38  ARG A CG    
476  C  CD    . ARG A 38  ? 0.1994 0.1290 0.5069 -0.0084 -0.0135 0.0202  38  ARG A CD    
477  N  NE    . ARG A 38  ? 0.2277 0.1483 0.5171 -0.0031 -0.0233 0.0001  38  ARG A NE    
478  C  CZ    . ARG A 38  ? 0.2838 0.1526 0.5488 -0.0447 -0.0372 0.0157  38  ARG A CZ    
479  N  NH1   . ARG A 38  ? 0.3678 0.1669 0.5390 0.0138  0.0343  -0.0420 38  ARG A NH1   
480  N  NH2   . ARG A 38  ? 0.3095 0.2521 0.6608 -0.0147 -0.1165 0.0737  38  ARG A NH2   
494  N  N     . GLY A 39  ? 0.1325 0.1567 0.3358 0.0055  -0.0209 0.0410  39  GLY A N     
495  C  CA    . GLY A 39  ? 0.1211 0.1484 0.3089 0.0255  -0.0360 0.0412  39  GLY A CA    
496  C  C     . GLY A 39  ? 0.1194 0.1507 0.3609 0.0337  0.0116  0.0208  39  GLY A C     
497  O  O     . GLY A 39  ? 0.1163 0.1712 0.3684 0.0403  -0.0301 -0.0102 39  GLY A O     
501  N  N     . THR A 40  ? 0.1043 0.1618 0.3643 0.0301  0.0055  0.0155  40  THR A N     
502  C  CA    . THR A 40  ? 0.1168 0.1500 0.4414 0.0152  0.0125  0.0090  40  THR A CA    
503  C  C     . THR A 40  ? 0.1555 0.1868 0.5214 0.0148  0.0501  -0.0448 40  THR A C     
504  O  O     . THR A 40  ? 0.2258 0.1926 0.7000 -0.0203 0.0951  -0.0654 40  THR A O     
505  C  CB    . THR A 40  ? 0.1307 0.1544 0.4708 0.0205  0.0241  0.0238  40  THR A CB    
506  O  OG1   . THR A 40  ? 0.1121 0.1750 0.4054 0.0083  0.0487  0.0015  40  THR A OG1   
507  C  CG2   . THR A 40  ? 0.1380 0.1536 0.4182 0.0301  0.0516  0.0865  40  THR A CG2   
515  N  N     . GLY A 41  ? 0.1471 0.2589 0.4272 0.0292  -0.0085 -0.1223 41  GLY A N     
516  C  CA    . GLY A 41  ? 0.1513 0.2988 0.4703 0.0521  0.0044  -0.0840 41  GLY A CA    
517  C  C     . GLY A 41  ? 0.1625 0.2739 0.4364 0.0250  0.0065  -0.0399 41  GLY A C     
518  O  O     . GLY A 41  ? 0.1894 0.3111 0.4415 0.0196  -0.0090 -0.0775 41  GLY A O     
522  N  N     . LYS A 42  ? 0.1354 0.2759 0.3625 -0.0153 -0.0304 -0.0491 42  LYS A N     
523  C  CA    . LYS A 42  ? 0.1484 0.2118 0.3285 -0.0018 -0.0057 0.0260  42  LYS A CA    
524  C  C     . LYS A 42  ? 0.1999 0.1868 0.3944 -0.0152 0.0484  -0.0195 42  LYS A C     
525  O  O     . LYS A 42  ? 0.1942 0.2076 0.3939 -0.0117 0.0239  -0.0127 42  LYS A O     
526  C  CB    . LYS A 42  ? 0.1317 0.2554 0.4707 0.0139  -0.0314 -0.0303 42  LYS A CB    
527  C  CG    . LYS A 42  ? 0.1489 0.2540 0.4370 0.0252  -0.0404 -0.0637 42  LYS A CG    
528  C  CD    . LYS A 42  ? 0.1919 0.2957 0.5053 0.0177  -0.0092 -0.0016 42  LYS A CD    
529  C  CE    . LYS A 42  ? 0.1934 0.2505 0.4933 -0.0237 -0.0062 0.0519  42  LYS A CE    
530  N  NZ    . LYS A 42  ? 0.1909 0.2860 0.4680 -0.0392 -0.0407 0.0106  42  LYS A NZ    
544  N  N     . GLU A 43  ? 0.2623 0.2351 0.3700 -0.0457 0.0820  -0.0034 43  GLU A N     
545  C  CA    . GLU A 43  ? 0.3173 0.2726 0.2982 0.0025  0.0882  0.0278  43  GLU A CA    
546  C  C     . GLU A 43  ? 0.2943 0.3217 0.3974 -0.0097 0.0802  -0.0318 43  GLU A C     
547  O  O     . GLU A 43  ? 0.2715 0.2746 0.3799 -0.0758 0.0435  -0.0071 43  GLU A O     
548  C  CB    . GLU A 43  ? 0.3618 0.2700 0.3275 -0.0200 0.1208  0.0446  43  GLU A CB    
549  C  CG    . GLU A 43  ? 0.4342 0.2909 0.4673 0.0128  0.1112  0.1358  43  GLU A CG    
550  C  CD    . GLU A 43  ? 0.4781 0.3659 0.5635 -0.0139 0.0655  0.0854  43  GLU A CD    
551  O  OE1   . GLU A 43  ? 0.4969 0.3770 0.5833 -0.0515 0.0499  0.0750  43  GLU A OE1   
552  O  OE2   . GLU A 43  ? 0.4621 0.3769 0.5335 -0.0122 0.0390  0.0926  43  GLU A OE2   
555  N  N     . LEU A 44  ? 0.2413 0.3701 0.4956 -0.0498 0.1693  0.0021  44  LEU A N     
556  C  CA    . LEU A 44  ? 0.2425 0.3657 0.4616 -0.0392 0.1154  -0.0189 44  LEU A CA    
557  C  C     . LEU A 44  ? 0.2259 0.2989 0.4146 0.0239  0.0461  0.0014  44  LEU A C     
558  O  O     . LEU A 44  ? 0.2383 0.2765 0.3552 0.0324  0.0412  -0.0554 44  LEU A O     
559  C  CB    . LEU A 44  ? 0.2837 0.4108 0.4831 -0.0728 0.0727  -0.0346 44  LEU A CB    
560  C  CG    . LEU A 44  ? 0.3611 0.5034 0.6429 0.0005  0.0967  0.0041  44  LEU A CG    
561  C  CD1   . LEU A 44  ? 0.3730 0.5128 0.6842 -0.0007 0.0777  0.0462  44  LEU A CD1   
562  C  CD2   . LEU A 44  ? 0.3897 0.5842 0.7265 0.0379  0.0875  0.0263  44  LEU A CD2   
574  N  N     . ILE A 45  ? 0.2047 0.2262 0.3770 0.0066  0.0377  0.0278  45  ILE A N     
575  C  CA    . ILE A 45  ? 0.2047 0.1969 0.3446 -0.0002 0.0711  -0.0086 45  ILE A CA    
576  C  C     . ILE A 45  ? 0.1862 0.1704 0.3199 -0.0349 0.0465  0.0380  45  ILE A C     
577  O  O     . ILE A 45  ? 0.1738 0.1492 0.3986 -0.0206 0.0592  0.0166  45  ILE A O     
578  C  CB    . ILE A 45  ? 0.2137 0.1828 0.3811 -0.0021 0.0262  0.0149  45  ILE A CB    
579  C  CG1   . ILE A 45  ? 0.2356 0.1991 0.3776 0.0065  -0.0232 0.0473  45  ILE A CG1   
580  C  CG2   . ILE A 45  ? 0.2150 0.2236 0.3375 -0.0003 0.0257  -0.0415 45  ILE A CG2   
581  C  CD1   . ILE A 45  ? 0.2572 0.2506 0.5105 0.0526  0.0228  0.1015  45  ILE A CD1   
593  N  N     . ALA A 46  ? 0.1909 0.2083 0.3380 -0.0194 -0.0016 0.0215  46  ALA A N     
594  C  CA    . ALA A 46  ? 0.1834 0.1978 0.3312 -0.0177 0.0204  0.0385  46  ALA A CA    
595  C  C     . ALA A 46  ? 0.2042 0.1949 0.3337 0.0169  0.0277  0.0236  46  ALA A C     
596  O  O     . ALA A 46  ? 0.2097 0.2215 0.3667 0.0093  0.0420  0.0458  46  ALA A O     
597  C  CB    . ALA A 46  ? 0.1742 0.2142 0.3547 0.0239  0.0226  0.0631  46  ALA A CB    
603  N  N     . SER A 47  ? 0.2377 0.1896 0.3402 -0.0071 0.0104  -0.0041 47  SER A N     
604  C  CA    . SER A 47  ? 0.2754 0.2337 0.3428 -0.0246 0.0732  -0.0015 47  SER A CA    
605  C  C     . SER A 47  ? 0.2583 0.2705 0.3064 0.0042  0.0669  -0.0053 47  SER A C     
606  O  O     . SER A 47  ? 0.2429 0.2740 0.3441 -0.0090 0.0364  -0.0119 47  SER A O     
607  C  CB    . SER A 47  ? 0.3327 0.3162 0.3552 -0.0745 0.1119  -0.0467 47  SER A CB    
608  O  OG    . SER A 47  ? 0.3747 0.4013 0.6401 -0.0345 0.1625  -0.0575 47  SER A OG    
614  N  N     . ARG A 48  ? 0.2997 0.2257 0.3351 -0.0024 0.0693  -0.0114 48  ARG A N     
615  C  CA    . ARG A 48  ? 0.3333 0.2249 0.3606 -0.0068 0.0912  -0.0289 48  ARG A CA    
616  C  C     . ARG A 48  ? 0.3239 0.1772 0.2933 -0.0383 0.0958  0.0278  48  ARG A C     
617  O  O     . ARG A 48  ? 0.3580 0.1903 0.3326 0.0002  0.0247  -0.0348 48  ARG A O     
618  C  CB    . ARG A 48  ? 0.3809 0.2441 0.3515 0.0021  0.0038  -0.0854 48  ARG A CB    
619  C  CG    . ARG A 48  ? 0.4017 0.2783 0.4563 0.0083  0.0314  -0.0497 48  ARG A CG    
620  C  CD    . ARG A 48  ? 0.3865 0.2918 0.4340 0.0210  0.0344  0.0019  48  ARG A CD    
621  N  NE    . ARG A 48  ? 0.4067 0.3406 0.6292 0.0072  0.1065  0.0299  48  ARG A NE    
622  C  CZ    . ARG A 48  ? 0.4392 0.3597 0.7549 0.0199  0.1278  0.0268  48  ARG A CZ    
623  N  NH1   . ARG A 48  ? 0.4552 0.3695 0.8420 0.0035  0.1468  0.0177  48  ARG A NH1   
624  N  NH2   . ARG A 48  ? 0.4659 0.3608 0.8551 0.0426  0.1380  0.0997  48  ARG A NH2   
638  N  N     . LEU A 49  ? 0.2777 0.2243 0.3557 -0.0416 0.0172  -0.0486 49  LEU A N     
639  C  CA    . LEU A 49  ? 0.2555 0.2275 0.3767 -0.0180 0.0423  0.0191  49  LEU A CA    
640  C  C     . LEU A 49  ? 0.2318 0.2710 0.3251 -0.0638 0.0264  0.0369  49  LEU A C     
641  O  O     . LEU A 49  ? 0.2914 0.3577 0.3797 -0.1141 -0.0179 0.0425  49  LEU A O     
642  C  CB    . LEU A 49  ? 0.2102 0.2337 0.3940 -0.0366 0.0357  0.0280  49  LEU A CB    
643  C  CG    . LEU A 49  ? 0.2104 0.2165 0.4075 -0.0208 0.0465  -0.0001 49  LEU A CG    
644  C  CD1   . LEU A 49  ? 0.2162 0.2038 0.4107 -0.0181 0.0344  -0.0197 49  LEU A CD1   
645  C  CD2   . LEU A 49  ? 0.2134 0.2030 0.3490 -0.0044 0.0442  -0.0096 49  LEU A CD2   
657  N  N     . HIS A 50  ? 0.2139 0.1827 0.3179 -0.0174 0.0420  -0.0283 50  HIS A N     
658  C  CA    . HIS A 50  ? 0.2417 0.1778 0.2824 0.0192  0.0446  0.0087  50  HIS A CA    
659  C  C     . HIS A 50  ? 0.2510 0.2289 0.3336 0.0156  0.0871  -0.0199 50  HIS A C     
660  O  O     . HIS A 50  ? 0.2699 0.2205 0.3682 0.0143  0.0364  -0.0216 50  HIS A O     
661  C  CB    . HIS A 50  ? 0.2778 0.1581 0.3828 0.0242  0.0567  -0.0087 50  HIS A CB    
662  C  CG    . HIS A 50  ? 0.3005 0.1978 0.3893 0.0058  0.0235  0.0072  50  HIS A CG    
663  N  ND1   . HIS A 50  ? 0.3169 0.2472 0.2622 0.0401  -0.0062 -0.0037 50  HIS A ND1   
664  C  CD2   . HIS A 50  ? 0.3296 0.2371 0.3931 0.0260  -0.0199 -0.0222 50  HIS A CD2   
665  C  CE1   . HIS A 50  ? 0.3234 0.2406 0.3086 0.0551  -0.0574 -0.0494 50  HIS A CE1   
666  N  NE2   . HIS A 50  ? 0.3470 0.2319 0.3860 0.0500  -0.0038 -0.0378 50  HIS A NE2   
673  N  N     . TYR A 51  ? 0.2462 0.2247 0.2958 0.0238  0.0824  -0.0518 51  TYR A N     
674  C  CA    . TYR A 51  ? 0.2540 0.2684 0.3117 -0.0050 0.0924  -0.0420 51  TYR A CA    
675  C  C     . TYR A 51  ? 0.2430 0.2469 0.3659 0.0026  0.0732  -0.0686 51  TYR A C     
676  O  O     . TYR A 51  ? 0.3043 0.2518 0.3696 0.0244  -0.0033 -0.0861 51  TYR A O     
677  C  CB    . TYR A 51  ? 0.3239 0.3423 0.4521 -0.0163 0.1085  -0.0496 51  TYR A CB    
678  C  CG    . TYR A 51  ? 0.3693 0.4127 0.5306 -0.0596 0.1589  -0.0648 51  TYR A CG    
679  C  CD1   . TYR A 51  ? 0.4367 0.4539 0.5031 -0.0397 0.2149  -0.0645 51  TYR A CD1   
680  C  CD2   . TYR A 51  ? 0.3622 0.4564 0.4612 -0.0810 0.1837  -0.0424 51  TYR A CD2   
681  C  CE1   . TYR A 51  ? 0.4696 0.4844 0.4152 -0.0269 0.1735  0.0016  51  TYR A CE1   
682  C  CE2   . TYR A 51  ? 0.3997 0.4560 0.5678 -0.1066 0.1127  -0.0514 51  TYR A CE2   
683  C  CZ    . TYR A 51  ? 0.4452 0.4639 0.5292 -0.0933 0.1259  0.0233  51  TYR A CZ    
684  O  OH    . TYR A 51  ? 0.4753 0.5283 0.6541 -0.0724 0.1016  0.0118  51  TYR A OH    
694  N  N     . LEU A 52  ? 0.2192 0.2074 0.3895 -0.0103 0.0298  -0.0462 52  LEU A N     
695  C  CA    . LEU A 52  ? 0.2611 0.2040 0.4739 -0.0163 -0.0197 -0.0776 52  LEU A CA    
696  C  C     . LEU A 52  ? 0.2725 0.1763 0.4109 -0.0297 0.0246  0.0044  52  LEU A C     
697  O  O     . LEU A 52  ? 0.3039 0.2283 0.5470 -0.0480 0.0072  0.0049  52  LEU A O     
698  C  CB    . LEU A 52  ? 0.2990 0.1965 0.5179 -0.0107 0.0149  -0.1160 52  LEU A CB    
699  C  CG    . LEU A 52  ? 0.3257 0.2296 0.4994 0.0356  0.0141  -0.1183 52  LEU A CG    
700  C  CD1   . LEU A 52  ? 0.3348 0.2611 0.5264 0.0439  -0.0095 -0.0628 52  LEU A CD1   
701  C  CD2   . LEU A 52  ? 0.3698 0.2967 0.5111 0.0812  0.0148  -0.0997 52  LEU A CD2   
713  N  N     . SER A 53  ? 0.2604 0.1957 0.3959 0.0033  -0.0091 0.0175  53  SER A N     
714  C  CA    . SER A 53  ? 0.2459 0.2200 0.4124 -0.0056 -0.0326 0.0330  53  SER A CA    
715  C  C     . SER A 53  ? 0.2638 0.2533 0.4298 -0.0029 -0.0241 -0.0530 53  SER A C     
716  O  O     . SER A 53  ? 0.2804 0.2693 0.4065 0.0031  -0.0158 -0.0917 53  SER A O     
717  C  CB    . SER A 53  ? 0.2341 0.2445 0.3566 -0.0082 -0.0163 0.0305  53  SER A CB    
718  O  OG    . SER A 53  ? 0.2498 0.2819 0.3663 0.0025  0.0104  -0.0001 53  SER A OG    
724  N  N     . SER A 54  ? 0.2933 0.2704 0.4686 0.0047  -0.0432 0.0099  54  SER A N     
725  C  CA    . SER A 54  ? 0.2991 0.3535 0.4827 -0.0143 -0.0470 -0.0104 54  SER A CA    
726  C  C     . SER A 54  ? 0.3288 0.3750 0.3517 0.0275  -0.0146 -0.0518 54  SER A C     
727  O  O     . SER A 54  ? 0.3796 0.4175 0.4055 0.0648  -0.0079 -0.0532 54  SER A O     
728  C  CB    . SER A 54  ? 0.3158 0.4307 0.4765 -0.0386 -0.0309 -0.0046 54  SER A CB    
729  O  OG    . SER A 54  ? 0.3259 0.4666 0.5400 -0.0533 -0.0184 0.0173  54  SER A OG    
735  N  N     . ARG A 55  ? 0.3484 0.3079 0.4147 0.0199  0.0102  -0.0710 55  ARG A N     
736  C  CA    . ARG A 55  ? 0.3909 0.3168 0.3484 0.0309  0.0205  -0.0904 55  ARG A CA    
737  C  C     . ARG A 55  ? 0.3922 0.3267 0.3100 0.0326  0.0573  -0.0583 55  ARG A C     
738  O  O     . ARG A 55  ? 0.3949 0.3109 0.3877 0.0188  0.0158  -0.0679 55  ARG A O     
739  C  CB    . ARG A 55  ? 0.3964 0.3074 0.4401 0.0210  0.1018  -0.0058 55  ARG A CB    
740  C  CG    . ARG A 55  ? 0.3855 0.3409 0.5041 -0.0017 0.0579  -0.0390 55  ARG A CG    
741  C  CD    . ARG A 55  ? 0.3330 0.2643 0.4524 -0.0689 0.0447  -0.0610 55  ARG A CD    
742  N  NE    . ARG A 55  ? 0.3230 0.2981 0.5098 -0.0400 0.0207  -0.0087 55  ARG A NE    
743  C  CZ    . ARG A 55  ? 0.3064 0.3177 0.4574 0.0289  0.0219  -0.0562 55  ARG A CZ    
744  N  NH1   . ARG A 55  ? 0.2746 0.2725 0.3975 0.0276  0.0100  -0.0236 55  ARG A NH1   
745  N  NH2   . ARG A 55  ? 0.2938 0.3637 0.5587 0.0313  0.0415  0.0500  55  ARG A NH2   
759  N  N     . TRP A 56  ? 0.3876 0.3265 0.3390 0.0475  0.0241  -0.0492 56  TRP A N     
760  C  CA    . TRP A 56  ? 0.3853 0.2983 0.3933 0.0296  -0.0169 -0.0313 56  TRP A CA    
761  C  C     . TRP A 56  ? 0.3747 0.3275 0.3740 0.0032  -0.0396 -0.0430 56  TRP A C     
762  O  O     . TRP A 56  ? 0.3642 0.3087 0.3878 -0.0339 -0.0341 -0.0300 56  TRP A O     
763  C  CB    . TRP A 56  ? 0.4188 0.2994 0.3610 0.0387  0.0074  -0.1004 56  TRP A CB    
764  C  CG    . TRP A 56  ? 0.4736 0.3437 0.3649 0.0636  -0.0374 -0.1257 56  TRP A CG    
765  C  CD1   . TRP A 56  ? 0.5004 0.3811 0.4058 0.0646  -0.0792 -0.1286 56  TRP A CD1   
766  C  CD2   . TRP A 56  ? 0.5330 0.4293 0.4544 0.1039  -0.0011 -0.1172 56  TRP A CD2   
767  N  NE1   . TRP A 56  ? 0.5324 0.4149 0.3898 0.0882  -0.0120 -0.0786 56  TRP A NE1   
768  C  CE2   . TRP A 56  ? 0.5515 0.4360 0.4383 0.1112  0.0405  -0.1661 56  TRP A CE2   
769  C  CE3   . TRP A 56  ? 0.5560 0.4654 0.5416 0.1251  0.0612  -0.1526 56  TRP A CE3   
770  C  CZ2   . TRP A 56  ? 0.5860 0.4754 0.4836 0.1164  0.0505  -0.1533 56  TRP A CZ2   
771  C  CZ3   . TRP A 56  ? 0.5724 0.4865 0.4380 0.1035  0.0862  -0.1421 56  TRP A CZ3   
772  C  CH2   . TRP A 56  ? 0.5870 0.4882 0.4897 0.1129  0.0688  -0.1274 56  TRP A CH2   
783  N  N     . GLN A 57  ? 0.3945 0.3287 0.2791 0.0024  0.0369  -0.0330 57  GLN A N     
784  C  CA    . GLN A 57  ? 0.4582 0.3580 0.2911 0.0017  0.0527  -0.0535 57  GLN A CA    
785  C  C     . GLN A 57  ? 0.4804 0.3082 0.2741 -0.0269 0.0873  0.0449  57  GLN A C     
786  O  O     . GLN A 57  ? 0.5034 0.3185 0.3348 -0.0284 0.0001  0.0071  57  GLN A O     
787  C  CB    . GLN A 57  ? 0.5033 0.4100 0.3987 0.0167  0.0240  -0.0955 57  GLN A CB    
788  C  CG    . GLN A 57  ? 0.5566 0.4622 0.5414 0.0601  -0.0184 -0.1321 57  GLN A CG    
789  C  CD    . GLN A 57  ? 0.5875 0.5109 0.5974 0.1010  -0.0658 -0.1700 57  GLN A CD    
790  O  OE1   . GLN A 57  ? 0.6091 0.5569 0.7382 0.1483  -0.0490 -0.1435 57  GLN A OE1   
791  N  NE2   . GLN A 57  ? 0.5851 0.4588 0.6384 0.0750  -0.1116 -0.2246 57  GLN A NE2   
800  N  N     . GLY A 58  ? 0.4773 0.2892 0.3402 0.0031  0.0644  -0.0563 58  GLY A N     
801  C  CA    . GLY A 58  ? 0.4371 0.2718 0.3434 -0.0153 -0.0653 -0.0598 58  GLY A CA    
802  C  C     . GLY A 58  ? 0.4394 0.2806 0.4100 0.0357  0.0364  -0.0453 58  GLY A C     
803  O  O     . GLY A 58  ? 0.4373 0.3191 0.3220 0.0534  0.0212  -0.0980 58  GLY A O     
807  N  N     . PRO A 59  ? 0.4247 0.2356 0.3421 0.0154  0.0424  -0.0693 59  PRO A N     
808  C  CA    . PRO A 59  ? 0.3905 0.2401 0.3679 -0.0211 0.0869  -0.0489 59  PRO A CA    
809  C  C     . PRO A 59  ? 0.3317 0.2330 0.3980 -0.0308 0.0625  -0.0621 59  PRO A C     
810  O  O     . PRO A 59  ? 0.3095 0.2932 0.3374 -0.0409 0.0531  -0.0602 59  PRO A O     
811  C  CB    . PRO A 59  ? 0.4247 0.2498 0.3190 -0.0053 0.0363  0.0113  59  PRO A CB    
812  C  CG    . PRO A 59  ? 0.4360 0.2626 0.3790 0.0232  -0.0004 -0.0285 59  PRO A CG    
813  C  CD    . PRO A 59  ? 0.4458 0.2757 0.3831 0.0319  0.0602  -0.0382 59  PRO A CD    
821  N  N     . PHE A 60  ? 0.2766 0.2734 0.3274 -0.0284 0.0466  -0.0216 60  PHE A N     
822  C  CA    . PHE A 60  ? 0.3012 0.2530 0.3386 -0.0193 0.0928  -0.0060 60  PHE A CA    
823  C  C     . PHE A 60  ? 0.3311 0.2619 0.3608 -0.0309 0.0911  0.0112  60  PHE A C     
824  O  O     . PHE A 60  ? 0.3431 0.2905 0.3714 -0.0271 0.1294  -0.0188 60  PHE A O     
825  C  CB    . PHE A 60  ? 0.2790 0.2566 0.3087 -0.0302 0.0791  -0.0440 60  PHE A CB    
826  C  CG    . PHE A 60  ? 0.2964 0.2741 0.4134 -0.0885 0.0371  -0.0766 60  PHE A CG    
827  C  CD1   . PHE A 60  ? 0.3070 0.2726 0.3298 -0.0693 0.0699  0.0027  60  PHE A CD1   
828  C  CD2   . PHE A 60  ? 0.3103 0.3728 0.3321 -0.0699 0.0741  0.0052  60  PHE A CD2   
829  C  CE1   . PHE A 60  ? 0.3047 0.3123 0.3217 -0.0292 0.1016  0.0205  60  PHE A CE1   
830  C  CE2   . PHE A 60  ? 0.3287 0.3742 0.3938 -0.0345 0.1192  0.0154  60  PHE A CE2   
831  C  CZ    . PHE A 60  ? 0.3210 0.3409 0.3729 -0.0091 0.1477  0.0384  60  PHE A CZ    
841  N  N     . ILE A 61  ? 0.3167 0.2653 0.3123 -0.0180 0.0387  -0.0070 61  ILE A N     
842  C  CA    . ILE A 61  ? 0.3266 0.2736 0.2690 0.0022  0.1016  -0.0107 61  ILE A CA    
843  C  C     . ILE A 61  ? 0.3050 0.2708 0.2646 -0.0254 0.0740  0.0106  61  ILE A C     
844  O  O     . ILE A 61  ? 0.2780 0.3098 0.2906 -0.0685 0.0828  -0.0022 61  ILE A O     
845  C  CB    . ILE A 61  ? 0.3903 0.2613 0.3086 -0.0055 0.0584  -0.0168 61  ILE A CB    
846  C  CG1   . ILE A 61  ? 0.4214 0.2769 0.2647 -0.0306 0.0758  0.0184  61  ILE A CG1   
847  C  CG2   . ILE A 61  ? 0.3687 0.2064 0.4120 -0.0200 0.0461  -0.0076 61  ILE A CG2   
848  C  CD1   . ILE A 61  ? 0.4489 0.3145 0.2760 -0.0100 0.0676  0.0132  61  ILE A CD1   
860  N  N     . SER A 62  ? 0.2945 0.2414 0.3145 -0.0712 0.0602  -0.0521 62  SER A N     
861  C  CA    A SER A 62  ? 0.2968 0.2243 0.4018 -0.1018 0.1526  -0.0408 62  SER A CA    
862  C  CA    B SER A 62  ? 0.3189 0.2365 0.4272 -0.0905 0.1119  -0.0456 62  SER A CA    
863  C  C     . SER A 62  ? 0.3481 0.2422 0.3667 -0.0770 0.0982  -0.0058 62  SER A C     
864  O  O     . SER A 62  ? 0.4227 0.2857 0.3166 -0.0160 0.0596  -0.0009 62  SER A O     
865  C  CB    A SER A 62  ? 0.3412 0.2634 0.5323 -0.0313 0.1501  0.0138  62  SER A CB    
866  C  CB    B SER A 62  ? 0.3526 0.2685 0.5531 -0.0518 0.0987  -0.0421 62  SER A CB    
867  O  OG    A SER A 62  ? 0.3634 0.3449 0.5622 0.0088  0.1610  -0.0197 62  SER A OG    
868  O  OG    B SER A 62  ? 0.3682 0.3057 0.6565 -0.0387 0.0941  -0.0885 62  SER A OG    
877  N  N     . LEU A 63  ? 0.3269 0.2322 0.3497 -0.0884 0.0824  0.0046  63  LEU A N     
878  C  CA    . LEU A 63  ? 0.3167 0.2035 0.3143 -0.0561 0.0969  -0.0181 63  LEU A CA    
879  C  C     . LEU A 63  ? 0.2895 0.2155 0.3434 -0.0707 0.0625  0.0186  63  LEU A C     
880  O  O     . LEU A 63  ? 0.2993 0.2507 0.3493 -0.0726 0.0568  0.0074  63  LEU A O     
881  C  CB    . LEU A 63  ? 0.3846 0.2593 0.3894 -0.0172 0.1188  0.0277  63  LEU A CB    
882  C  CG    . LEU A 63  ? 0.4451 0.2511 0.5322 -0.0078 0.0626  0.0421  63  LEU A CG    
883  C  CD1   . LEU A 63  ? 0.4696 0.2013 0.7010 -0.0315 0.0176  0.0535  63  LEU A CD1   
884  C  CD2   . LEU A 63  ? 0.4798 0.2471 0.6375 0.0182  0.0558  -0.0574 63  LEU A CD2   
896  N  N     . ASN A 64  ? 0.2760 0.2279 0.3561 -0.0925 0.0400  0.0209  64  ASN A N     
897  C  CA    . ASN A 64  ? 0.2459 0.2362 0.3907 -0.0977 0.0897  -0.0007 64  ASN A CA    
898  C  C     . ASN A 64  ? 0.2763 0.2469 0.3648 -0.0673 0.1135  -0.0198 64  ASN A C     
899  O  O     . ASN A 64  ? 0.3424 0.2222 0.4692 -0.0742 0.0819  -0.0169 64  ASN A O     
900  C  CB    . ASN A 64  ? 0.2319 0.2710 0.4476 -0.0736 0.0543  -0.0617 64  ASN A CB    
901  C  CG    . ASN A 64  ? 0.2473 0.3472 0.5109 -0.0616 0.0187  -0.0513 64  ASN A CG    
902  O  OD1   . ASN A 64  ? 0.3234 0.4681 0.5374 0.0439  -0.0607 -0.1231 64  ASN A OD1   
903  N  ND2   . ASN A 64  ? 0.2685 0.3862 0.4019 -0.0694 0.0160  -0.0261 64  ASN A ND2   
910  N  N     . CYS A 65  ? 0.2077 0.2387 0.3993 -0.0579 0.0809  -0.0252 65  CYS A N     
911  C  CA    . CYS A 65  ? 0.2050 0.2337 0.3765 -0.0261 0.0033  0.0154  65  CYS A CA    
912  C  C     . CYS A 65  ? 0.2554 0.2265 0.4427 -0.0105 0.0107  -0.0045 65  CYS A C     
913  O  O     . CYS A 65  ? 0.3239 0.2154 0.5065 0.0369  -0.0307 0.0451  65  CYS A O     
914  C  CB    . CYS A 65  ? 0.1805 0.2590 0.4705 -0.0082 -0.0571 0.0367  65  CYS A CB    
915  S  SG    . CYS A 65  ? 0.2028 0.2568 0.5248 -0.0107 -0.0040 0.0206  65  CYS A SG    
921  N  N     . ALA A 66  ? 0.2290 0.2325 0.4600 -0.0769 0.0353  -0.0245 66  ALA A N     
922  C  CA    . ALA A 66  ? 0.2415 0.2589 0.4475 -0.0800 0.0894  0.0225  66  ALA A CA    
923  C  C     . ALA A 66  ? 0.2885 0.2985 0.4367 -0.0788 0.0474  -0.1116 66  ALA A C     
924  O  O     . ALA A 66  ? 0.3344 0.3034 0.4869 -0.1159 0.0384  -0.0324 66  ALA A O     
925  C  CB    . ALA A 66  ? 0.2107 0.2638 0.4429 -0.0634 -0.0340 0.0376  66  ALA A CB    
931  N  N     . ALA A 67  ? 0.2448 0.3180 0.4033 -0.1154 0.0750  -0.0912 67  ALA A N     
932  C  CA    . ALA A 67  ? 0.3057 0.3625 0.4375 -0.0803 0.1360  0.0423  67  ALA A CA    
933  C  C     . ALA A 67  ? 0.2897 0.3437 0.6905 -0.1084 0.0652  0.0435  67  ALA A C     
934  O  O     . ALA A 67  ? 0.3103 0.3979 0.8731 -0.0935 0.0907  0.0950  67  ALA A O     
935  C  CB    . ALA A 67  ? 0.3323 0.4264 0.5246 -0.0410 0.2351  -0.0154 67  ALA A CB    
941  N  N     . LEU A 68  ? 0.2538 0.3482 0.6029 -0.0723 0.0714  0.0409  68  LEU A N     
942  C  CA    . LEU A 68  ? 0.3269 0.3187 0.5303 -0.0523 0.1027  0.0961  68  LEU A CA    
943  C  C     . LEU A 68  ? 0.3805 0.3223 0.5372 -0.0443 0.0477  0.0314  68  LEU A C     
944  O  O     . LEU A 68  ? 0.3600 0.3679 0.4530 -0.0195 0.0326  0.0218  68  LEU A O     
945  C  CB    . LEU A 68  ? 0.3384 0.3568 0.6121 -0.0341 0.0567  -0.0458 68  LEU A CB    
946  C  CG    . LEU A 68  ? 0.3429 0.3987 0.6341 -0.0286 0.0770  -0.0702 68  LEU A CG    
947  C  CD1   . LEU A 68  ? 0.3354 0.4482 0.6307 0.0005  0.0095  -0.1283 68  LEU A CD1   
948  C  CD2   . LEU A 68  ? 0.3427 0.4005 0.7060 -0.0492 0.0677  -0.1050 68  LEU A CD2   
960  N  N     . ASN A 69  ? 0.4159 0.2984 0.5325 -0.0657 -0.0227 0.0177  69  ASN A N     
961  C  CA    . ASN A 69  ? 0.4038 0.2628 0.5184 -0.1463 -0.0231 -0.0239 69  ASN A CA    
962  C  C     . ASN A 69  ? 0.4114 0.2660 0.5808 -0.1331 0.0585  -0.0654 69  ASN A C     
963  O  O     . ASN A 69  ? 0.4202 0.2619 0.5724 -0.1031 0.0791  -0.0502 69  ASN A O     
964  C  CB    . ASN A 69  ? 0.4089 0.3378 0.6041 -0.1526 -0.0353 -0.0371 69  ASN A CB    
965  C  CG    . ASN A 69  ? 0.4258 0.4147 0.6645 -0.1271 -0.0027 0.0419  69  ASN A CG    
966  O  OD1   . ASN A 69  ? 0.4109 0.4044 0.7154 -0.1264 -0.0078 0.0092  69  ASN A OD1   
967  N  ND2   . ASN A 69  ? 0.4511 0.4824 0.7560 -0.1048 0.0064  0.0772  69  ASN A ND2   
974  N  N     . GLU A 70  ? 0.4382 0.2724 0.6022 -0.0976 0.0573  0.0135  70  GLU A N     
975  C  CA    . GLU A 70  ? 0.4602 0.2608 0.4194 -0.0575 0.0435  0.0645  70  GLU A CA    
976  C  C     . GLU A 70  ? 0.4707 0.2519 0.4795 0.0014  0.0045  0.0615  70  GLU A C     
977  O  O     . GLU A 70  ? 0.4322 0.2161 0.4259 0.0113  -0.0332 -0.0406 70  GLU A O     
978  C  CB    . GLU A 70  ? 0.5051 0.2817 0.4635 -0.0015 0.0663  0.0218  70  GLU A CB    
979  C  CG    . GLU A 70  ? 0.5663 0.3363 0.5094 0.0311  0.0856  -0.0093 70  GLU A CG    
980  C  CD    . GLU A 70  ? 0.6440 0.3903 0.7310 0.0517  0.0845  0.0193  70  GLU A CD    
981  O  OE1   . GLU A 70  ? 0.7024 0.3966 0.8615 0.0404  0.0888  -0.0167 70  GLU A OE1   
982  O  OE2   . GLU A 70  ? 0.6459 0.4183 0.7898 0.0721  0.1130  0.0898  70  GLU A OE2   
989  N  N     . ASN A 71  ? 0.4982 0.2529 0.5461 -0.0321 0.0139  0.1040  71  ASN A N     
990  C  CA    . ASN A 71  ? 0.5216 0.2426 0.5857 -0.0296 -0.0015 0.1196  71  ASN A CA    
991  C  C     . ASN A 71  ? 0.4802 0.2647 0.5230 -0.0294 -0.0138 0.0637  71  ASN A C     
992  O  O     . ASN A 71  ? 0.4780 0.2448 0.4763 -0.0338 -0.0515 0.0825  71  ASN A O     
993  C  CB    . ASN A 71  ? 0.5971 0.3076 0.7679 0.0171  0.0276  0.1589  71  ASN A CB    
994  C  CG    . ASN A 71  ? 0.6647 0.3992 0.9613 0.0187  0.0505  0.0952  71  ASN A CG    
995  O  OD1   . ASN A 71  ? 0.7094 0.4463 1.0221 0.0421  0.0271  0.0731  71  ASN A OD1   
996  N  ND2   . ASN A 71  ? 0.6798 0.4528 1.1113 0.0054  0.0466  0.0435  71  ASN A ND2   
1003 N  N     . LEU A 72  ? 0.4328 0.2619 0.4336 -0.0570 -0.0387 0.0353  72  LEU A N     
1004 C  CA    . LEU A 72  ? 0.3981 0.2564 0.5652 -0.0723 0.0072  0.0530  72  LEU A CA    
1005 C  C     . LEU A 72  ? 0.3727 0.2516 0.4562 -0.0690 0.0139  0.0367  72  LEU A C     
1006 O  O     . LEU A 72  ? 0.3931 0.2597 0.4866 -0.0721 0.1125  0.0714  72  LEU A O     
1007 C  CB    . LEU A 72  ? 0.4043 0.2521 0.5461 -0.1051 0.0621  0.1258  72  LEU A CB    
1010 N  N     . LEU A 73  ? 0.3449 0.2349 0.3875 -0.0240 0.0256  0.0333  73  LEU A N     
1011 C  CA    . LEU A 73  ? 0.3040 0.2340 0.4034 -0.0191 0.0428  0.0293  73  LEU A CA    
1012 C  C     . LEU A 73  ? 0.2848 0.2247 0.3889 -0.0075 0.0932  0.0225  73  LEU A C     
1013 O  O     . LEU A 73  ? 0.2883 0.2138 0.4171 0.0395  0.0565  0.0088  73  LEU A O     
1014 C  CB    . LEU A 73  ? 0.2706 0.2302 0.4446 -0.0345 0.0553  0.0040  73  LEU A CB    
1015 C  CG    . LEU A 73  ? 0.2516 0.2218 0.3736 -0.0288 0.0726  0.0148  73  LEU A CG    
1016 C  CD1   . LEU A 73  ? 0.2912 0.2244 0.3814 -0.0060 0.0485  -0.0112 73  LEU A CD1   
1017 C  CD2   . LEU A 73  ? 0.2619 0.2228 0.4424 -0.0451 0.0074  0.0004  73  LEU A CD2   
1029 N  N     . ASP A 74  ? 0.3175 0.2416 0.3616 0.0187  0.0258  -0.0105 74  ASP A N     
1030 C  CA    . ASP A 74  ? 0.3333 0.2367 0.3611 0.0371  0.0719  0.0596  74  ASP A CA    
1031 C  C     . ASP A 74  ? 0.3338 0.2329 0.4262 0.0110  0.0754  0.0925  74  ASP A C     
1032 O  O     . ASP A 74  ? 0.2830 0.2356 0.4339 0.0337  0.0137  0.0339  74  ASP A O     
1033 C  CB    . ASP A 74  ? 0.3569 0.2316 0.5323 0.0879  0.0171  0.0820  74  ASP A CB    
1034 C  CG    . ASP A 74  ? 0.3903 0.2667 0.8325 0.0774  -0.0236 0.0394  74  ASP A CG    
1035 O  OD1   . ASP A 74  ? 0.4465 0.3327 1.0786 0.0981  -0.0211 0.0479  74  ASP A OD1   
1036 O  OD2   . ASP A 74  ? 0.3693 0.2337 0.8147 0.0043  -0.0161 0.0395  74  ASP A OD2   
1041 N  N     A SER A 75  ? 0.3749 0.2315 0.4459 0.0223  0.0601  0.0834  75  SER A N     
1042 N  N     B SER A 75  ? 0.3762 0.2307 0.4457 0.0186  0.0602  0.0848  75  SER A N     
1043 C  CA    A SER A 75  ? 0.4082 0.3051 0.4250 0.0466  0.0630  0.0900  75  SER A CA    
1044 C  CA    B SER A 75  ? 0.4136 0.3009 0.4243 0.0445  0.0594  0.0905  75  SER A CA    
1045 C  C     A SER A 75  ? 0.4159 0.3155 0.3582 0.0295  0.0305  0.0707  75  SER A C     
1046 C  C     B SER A 75  ? 0.4176 0.3170 0.3582 0.0277  0.0302  0.0693  75  SER A C     
1047 O  O     A SER A 75  ? 0.4321 0.3543 0.3518 0.0308  0.0503  0.0666  75  SER A O     
1048 O  O     B SER A 75  ? 0.4332 0.3612 0.3530 0.0315  0.0500  0.0631  75  SER A O     
1049 C  CB    A SER A 75  ? 0.4385 0.3493 0.5154 0.0823  0.0955  0.1151  75  SER A CB    
1050 C  CB    B SER A 75  ? 0.4532 0.3411 0.5218 0.0951  0.0713  0.1086  75  SER A CB    
1051 O  OG    A SER A 75  ? 0.4664 0.3661 0.5955 0.0697  0.1340  0.2017  75  SER A OG    
1052 O  OG    B SER A 75  ? 0.4887 0.3588 0.6264 0.1054  0.0491  0.1448  75  SER A OG    
1063 N  N     . GLU A 76  ? 0.4026 0.2772 0.3631 0.0081  0.0301  0.0424  76  GLU A N     
1064 C  CA    . GLU A 76  ? 0.3946 0.2836 0.3493 -0.0489 -0.0431 0.0266  76  GLU A CA    
1065 C  C     . GLU A 76  ? 0.3787 0.2833 0.3312 -0.0491 0.0145  0.0705  76  GLU A C     
1066 O  O     . GLU A 76  ? 0.3999 0.2898 0.3430 -0.0923 0.0513  -0.0063 76  GLU A O     
1067 C  CB    . GLU A 76  ? 0.4061 0.2971 0.4095 -0.0612 -0.0935 0.0049  76  GLU A CB    
1068 C  CG    . GLU A 76  ? 0.4521 0.3753 0.4792 -0.0586 -0.0663 -0.0464 76  GLU A CG    
1069 C  CD    . GLU A 76  ? 0.5120 0.4428 0.4865 -0.0172 0.0386  -0.0294 76  GLU A CD    
1070 O  OE1   . GLU A 76  ? 0.5425 0.4420 0.5915 -0.0176 0.1323  0.0455  76  GLU A OE1   
1071 O  OE2   . GLU A 76  ? 0.5214 0.5121 0.4145 -0.0118 0.0280  -0.0588 76  GLU A OE2   
1078 N  N     . LEU A 77  ? 0.3447 0.2642 0.3673 -0.0191 0.0231  0.0544  77  LEU A N     
1079 C  CA    . LEU A 77  ? 0.2945 0.2292 0.3088 -0.0336 0.0802  0.0186  77  LEU A CA    
1080 C  C     . LEU A 77  ? 0.3354 0.2407 0.3636 0.0022  0.0286  0.0734  77  LEU A C     
1081 O  O     . LEU A 77  ? 0.3322 0.2456 0.3710 -0.0061 0.0097  0.0398  77  LEU A O     
1082 C  CB    . LEU A 77  ? 0.3227 0.2323 0.3559 -0.0152 0.0640  0.0162  77  LEU A CB    
1083 C  CG    . LEU A 77  ? 0.3546 0.2878 0.4357 0.0106  0.1300  -0.0008 77  LEU A CG    
1084 C  CD1   . LEU A 77  ? 0.3963 0.2660 0.5709 0.0560  0.1241  0.1017  77  LEU A CD1   
1085 C  CD2   . LEU A 77  ? 0.3693 0.3723 0.3978 0.0298  0.1476  0.0232  77  LEU A CD2   
1097 N  N     . PHE A 78  ? 0.3196 0.2404 0.3288 0.0101  -0.0033 0.0549  78  PHE A N     
1098 C  CA    . PHE A 78  ? 0.3370 0.2683 0.3309 0.0227  -0.0243 0.0780  78  PHE A CA    
1099 C  C     . PHE A 78  ? 0.4044 0.2610 0.4371 0.0364  -0.0383 0.0464  78  PHE A C     
1100 O  O     . PHE A 78  ? 0.4268 0.3010 0.4161 0.0080  0.0071  0.0984  78  PHE A O     
1101 C  CB    . PHE A 78  ? 0.2894 0.2721 0.3518 0.0094  0.0255  0.0487  78  PHE A CB    
1102 C  CG    . PHE A 78  ? 0.2784 0.2809 0.2581 0.0081  0.0243  -0.0447 78  PHE A CG    
1103 C  CD1   . PHE A 78  ? 0.2933 0.2968 0.4029 -0.0101 0.0826  0.0067  78  PHE A CD1   
1104 C  CD2   . PHE A 78  ? 0.2946 0.2392 0.3762 0.0259  0.0053  -0.0254 78  PHE A CD2   
1105 C  CE1   . PHE A 78  ? 0.2941 0.3024 0.3904 -0.0098 0.0950  0.0169  78  PHE A CE1   
1106 C  CE2   . PHE A 78  ? 0.3028 0.2582 0.4041 0.0154  0.0601  -0.0630 78  PHE A CE2   
1107 C  CZ    . PHE A 78  ? 0.3000 0.2439 0.3999 -0.0244 0.0326  0.0192  78  PHE A CZ    
1117 N  N     . GLY A 79  ? 0.4541 0.2169 0.3586 0.0143  -0.0141 0.0258  79  GLY A N     
1118 C  CA    . GLY A 79  ? 0.5335 0.2345 0.3599 0.0343  0.0654  0.0634  79  GLY A CA    
1119 C  C     . GLY A 79  ? 0.6176 0.2893 0.3508 0.0746  0.1195  0.1186  79  GLY A C     
1120 O  O     . GLY A 79  ? 0.6270 0.2766 0.3917 0.0822  0.1382  0.0879  79  GLY A O     
1124 N  N     . HIS A 80  ? 0.6904 0.3391 0.4200 0.0841  0.0663  0.1751  80  HIS A N     
1125 C  CA    . HIS A 80  ? 0.7649 0.4174 0.4707 0.0859  0.0309  0.1562  80  HIS A CA    
1126 C  C     . HIS A 80  ? 0.8494 0.5011 0.6059 0.1101  0.0207  0.1676  80  HIS A C     
1127 O  O     . HIS A 80  ? 0.8749 0.4608 0.5314 0.1234  0.0934  0.2470  80  HIS A O     
1128 C  CB    . HIS A 80  ? 0.7592 0.4268 0.4271 0.0584  0.0957  0.1669  80  HIS A CB    
1129 C  CG    . HIS A 80  ? 0.7638 0.4373 0.3650 0.0287  0.1238  0.1806  80  HIS A CG    
1130 N  ND1   . HIS A 80  ? 0.7699 0.4454 0.5996 0.0085  0.1494  0.1045  80  HIS A ND1   
1131 C  CD2   . HIS A 80  ? 0.7645 0.4545 0.5141 0.0083  0.1487  0.1273  80  HIS A CD2   
1132 C  CE1   . HIS A 80  ? 0.7764 0.4605 0.5478 0.0060  0.1625  0.1133  80  HIS A CE1   
1133 N  NE2   . HIS A 80  ? 0.7729 0.4714 0.5716 -0.0018 0.1784  0.0892  80  HIS A NE2   
1140 N  N     . GLU A 81  ? 0.8923 0.6405 0.8070 0.1199  -0.0628 0.0985  81  GLU A N     
1141 C  CA    . GLU A 81  ? 0.9343 0.7756 0.9394 0.1196  -0.0765 0.0902  81  GLU A CA    
1142 C  C     . GLU A 81  ? 0.9580 0.8331 1.0800 0.1080  -0.0389 0.0977  81  GLU A C     
1143 O  O     . GLU A 81  ? 0.9737 0.8686 1.1456 0.1324  -0.0378 0.0979  81  GLU A O     
1144 C  CB    . GLU A 81  ? 0.9485 0.8504 0.9985 0.1502  -0.1058 0.1020  81  GLU A CB    
1145 C  CG    . GLU A 81  ? 0.9576 0.8958 1.0102 0.1673  -0.1574 0.1081  81  GLU A CG    
1146 C  CD    . GLU A 81  ? 0.9675 0.9323 1.0350 0.1741  -0.1874 0.1000  81  GLU A CD    
1147 O  OE1   . GLU A 81  ? 0.9570 0.9356 1.0163 0.1675  -0.2112 0.0672  81  GLU A OE1   
1148 O  OE2   . GLU A 81  ? 0.9879 0.9548 1.0751 0.1883  -0.1780 0.1170  81  GLU A OE2   
1155 N  N     . ALA A 82  ? 0.9640 0.8513 1.1296 0.0749  -0.0110 0.0868  82  ALA A N     
1156 C  CA    . ALA A 82  ? 0.9732 0.8351 1.0725 0.0569  -0.0081 0.1293  82  ALA A CA    
1157 C  C     . ALA A 82  ? 0.9813 0.8330 1.1553 0.0371  0.0166  0.1357  82  ALA A C     
1158 O  O     . ALA A 82  ? 0.9890 0.8315 1.1756 0.0206  0.0220  0.1468  82  ALA A O     
1159 C  CB    . ALA A 82  ? 0.9797 0.8261 0.9509 0.0635  -0.0229 0.1420  82  ALA A CB    
1160 N  N     . ARG A 91  ? 0.7793 0.7491 0.4237 0.0837  0.0228  0.2547  91  ARG A N     
1161 C  CA    . ARG A 91  ? 0.7614 0.6947 0.4597 0.0649  0.0422  0.2921  91  ARG A CA    
1162 C  C     . ARG A 91  ? 0.7542 0.6563 0.4431 0.0384  0.0631  0.2329  91  ARG A C     
1163 O  O     . ARG A 91  ? 0.7382 0.6670 0.4941 0.0348  0.1138  0.2273  91  ARG A O     
1164 C  CB    . ARG A 91  ? 0.7577 0.7260 0.6001 0.0804  0.0117  0.1819  91  ARG A CB    
1167 N  N     . HIS A 92  ? 0.7486 0.5583 0.3720 -0.0055 0.0575  0.1973  92  HIS A N     
1168 C  CA    . HIS A 92  ? 0.7392 0.4988 0.3572 -0.0056 0.0077  0.1427  92  HIS A CA    
1169 C  C     . HIS A 92  ? 0.7157 0.4041 0.2686 0.0211  0.0088  0.1257  92  HIS A C     
1170 O  O     . HIS A 92  ? 0.7424 0.3654 0.3365 0.0350  0.0319  0.0640  92  HIS A O     
1171 C  CB    . HIS A 92  ? 0.7464 0.5513 0.4712 -0.0049 -0.0399 0.0627  92  HIS A CB    
1172 C  CG    . HIS A 92  ? 0.7531 0.6056 0.4951 0.0098  -0.0470 0.0672  92  HIS A CG    
1173 N  ND1   . HIS A 92  ? 0.7603 0.6291 0.4930 0.0227  -0.0091 0.0817  92  HIS A ND1   
1174 C  CD2   . HIS A 92  ? 0.7574 0.6321 0.5693 0.0208  -0.0355 0.0862  92  HIS A CD2   
1175 C  CE1   . HIS A 92  ? 0.7656 0.6399 0.5567 0.0354  -0.0066 0.0820  92  HIS A CE1   
1176 N  NE2   . HIS A 92  ? 0.7697 0.6461 0.5894 0.0357  -0.0046 0.0739  92  HIS A NE2   
1183 N  N     . PRO A 93  ? 0.6558 0.3720 0.2683 0.0135  -0.0017 0.0551  93  PRO A N     
1184 C  CA    . PRO A 93  ? 0.6097 0.3407 0.2978 -0.0071 -0.0019 0.0335  93  PRO A CA    
1185 C  C     . PRO A 93  ? 0.5719 0.3176 0.3544 -0.0207 -0.0277 0.0302  93  PRO A C     
1186 O  O     . PRO A 93  ? 0.5672 0.3127 0.3629 -0.0623 -0.0552 -0.0093 93  PRO A O     
1187 C  CB    . PRO A 93  ? 0.6241 0.3508 0.2699 0.0196  -0.0097 -0.0225 93  PRO A CB    
1188 C  CG    . PRO A 93  ? 0.6391 0.3554 0.4113 0.0483  0.0006  0.0251  93  PRO A CG    
1189 C  CD    . PRO A 93  ? 0.6426 0.3818 0.2814 0.0229  -0.0562 0.0256  93  PRO A CD    
1197 N  N     . GLY A 94  ? 0.5257 0.2518 0.4021 -0.0235 -0.0264 0.0003  94  GLY A N     
1198 C  CA    . GLY A 94  ? 0.4759 0.2382 0.3862 -0.0095 -0.0404 -0.0562 94  GLY A CA    
1199 C  C     . GLY A 94  ? 0.4227 0.2290 0.2877 -0.0098 0.0327  -0.0161 94  GLY A C     
1200 O  O     . GLY A 94  ? 0.4499 0.2197 0.2862 0.0017  -0.0252 0.0058  94  GLY A O     
1204 N  N     . ARG A 95  ? 0.3641 0.2155 0.2824 -0.0082 -0.0150 -0.0105 95  ARG A N     
1205 C  CA    . ARG A 95  ? 0.3388 0.2125 0.2790 -0.0216 0.0282  0.0144  95  ARG A CA    
1206 C  C     . ARG A 95  ? 0.3218 0.2223 0.3358 0.0071  0.0038  0.0343  95  ARG A C     
1207 O  O     . ARG A 95  ? 0.3451 0.2203 0.3802 -0.0054 0.0649  0.0237  95  ARG A O     
1208 C  CB    . ARG A 95  ? 0.3556 0.2614 0.4614 -0.0469 0.0786  0.0633  95  ARG A CB    
1209 C  CG    . ARG A 95  ? 0.3805 0.3410 0.5587 -0.0368 0.0748  0.0024  95  ARG A CG    
1210 C  CD    . ARG A 95  ? 0.3673 0.3559 0.5263 -0.0864 0.1164  0.0209  95  ARG A CD    
1211 N  NE    . ARG A 95  ? 0.3827 0.4137 0.5148 -0.0825 0.1269  0.0114  95  ARG A NE    
1212 C  CZ    . ARG A 95  ? 0.4264 0.4448 0.5984 -0.0984 0.1563  0.1643  95  ARG A CZ    
1213 N  NH1   . ARG A 95  ? 0.4518 0.4660 0.6883 -0.0810 0.1722  0.2216  95  ARG A NH1   
1214 N  NH2   . ARG A 95  ? 0.4456 0.4681 0.7074 -0.1032 0.1384  0.1898  95  ARG A NH2   
1228 N  N     . PHE A 96  ? 0.3479 0.2436 0.3550 0.0455  0.0203  0.0067  96  PHE A N     
1229 C  CA    . PHE A 96  ? 0.3208 0.2523 0.3979 0.0222  0.0608  0.0431  96  PHE A CA    
1230 C  C     . PHE A 96  ? 0.3525 0.2531 0.3594 0.0254  0.0678  0.0554  96  PHE A C     
1231 O  O     . PHE A 96  ? 0.3400 0.2288 0.4310 -0.0217 0.0064  0.0254  96  PHE A O     
1232 C  CB    . PHE A 96  ? 0.3301 0.2715 0.4579 0.0047  0.0675  0.0474  96  PHE A CB    
1233 C  CG    . PHE A 96  ? 0.3079 0.2542 0.3491 -0.0058 0.0236  0.0166  96  PHE A CG    
1234 C  CD1   . PHE A 96  ? 0.3184 0.2698 0.3828 -0.0236 0.0890  0.0692  96  PHE A CD1   
1235 C  CD2   . PHE A 96  ? 0.3415 0.2364 0.3929 -0.0179 0.0483  -0.0197 96  PHE A CD2   
1236 C  CE1   . PHE A 96  ? 0.3159 0.2378 0.3868 0.0019  0.0984  0.0647  96  PHE A CE1   
1237 C  CE2   . PHE A 96  ? 0.3857 0.2608 0.4212 0.0289  0.0357  -0.0126 96  PHE A CE2   
1238 C  CZ    . PHE A 96  ? 0.3492 0.2555 0.3414 0.0029  0.0799  -0.0016 96  PHE A CZ    
1248 N  N     . GLU A 97  ? 0.4061 0.2421 0.3705 0.0272  0.0405  0.0419  97  GLU A N     
1249 C  CA    . GLU A 97  ? 0.4683 0.2549 0.3445 0.0120  -0.0242 0.0202  97  GLU A CA    
1250 C  C     . GLU A 97  ? 0.5007 0.2928 0.3643 -0.0123 -0.0154 -0.0089 97  GLU A C     
1251 O  O     . GLU A 97  ? 0.5137 0.2964 0.3727 -0.0285 -0.0999 -0.0403 97  GLU A O     
1252 C  CB    . GLU A 97  ? 0.5285 0.3253 0.4540 0.0367  -0.0235 0.0556  97  GLU A CB    
1253 C  CG    . GLU A 97  ? 0.5812 0.3950 0.5644 0.0682  -0.0098 0.1458  97  GLU A CG    
1254 C  CD    . GLU A 97  ? 0.6112 0.4501 0.6683 0.0597  0.0239  0.2157  97  GLU A CD    
1255 O  OE1   . GLU A 97  ? 0.5713 0.5401 0.5729 0.0580  0.0362  0.2598  97  GLU A OE1   
1256 O  OE2   . GLU A 97  ? 0.6509 0.4059 0.6524 0.0332  -0.0663 0.0921  97  GLU A OE2   
1263 N  N     . ARG A 98  ? 0.4860 0.2662 0.3346 -0.0297 -0.0123 -0.0435 98  ARG A N     
1264 C  CA    . ARG A 98  ? 0.5017 0.2482 0.3450 -0.0432 0.0576  -0.0025 98  ARG A CA    
1265 C  C     . ARG A 98  ? 0.4829 0.2599 0.3064 -0.0131 0.0374  -0.0577 98  ARG A C     
1266 O  O     . ARG A 98  ? 0.5446 0.2759 0.3760 0.0015  0.0859  -0.0540 98  ARG A O     
1267 C  CB    . ARG A 98  ? 0.5435 0.2571 0.3210 -0.0458 0.0867  0.0243  98  ARG A CB    
1268 C  CG    . ARG A 98  ? 0.5939 0.2690 0.3620 -0.0380 0.0387  -0.0028 98  ARG A CG    
1269 C  CD    . ARG A 98  ? 0.6293 0.3339 0.3740 -0.0424 -0.0021 0.0499  98  ARG A CD    
1270 N  NE    . ARG A 98  ? 0.6752 0.4098 0.5285 -0.0277 0.0956  0.0790  98  ARG A NE    
1271 C  CZ    . ARG A 98  ? 0.7193 0.5164 0.7783 0.0343  0.1194  0.0385  98  ARG A CZ    
1272 N  NH1   . ARG A 98  ? 0.7377 0.5674 0.8673 0.0844  0.1282  0.0156  98  ARG A NH1   
1273 N  NH2   . ARG A 98  ? 0.7356 0.5446 0.7926 0.0360  0.1492  0.0412  98  ARG A NH2   
1287 N  N     . ALA A 99  ? 0.4145 0.2426 0.3440 -0.0375 0.0061  -0.0641 99  ALA A N     
1288 C  CA    . ALA A 99  ? 0.3736 0.2432 0.3533 0.0009  0.0173  -0.0294 99  ALA A CA    
1289 C  C     . ALA A 99  ? 0.3726 0.2389 0.3645 0.0141  -0.0469 -0.0443 99  ALA A C     
1290 O  O     . ALA A 99  ? 0.3508 0.2226 0.4036 -0.0001 -0.0467 0.0168  99  ALA A O     
1291 C  CB    . ALA A 99  ? 0.3109 0.2745 0.3751 -0.0298 0.0641  0.0210  99  ALA A CB    
1297 N  N     . ASP A 100 ? 0.4071 0.2866 0.3538 0.0141  -0.0990 -0.0119 100 ASP A N     
1298 C  CA    . ASP A 100 ? 0.4141 0.2627 0.3408 -0.0233 -0.1453 -0.0362 100 ASP A CA    
1299 C  C     . ASP A 100 ? 0.4118 0.2663 0.3646 -0.0262 -0.1130 -0.0647 100 ASP A C     
1300 O  O     . ASP A 100 ? 0.4458 0.2867 0.3422 0.0176  -0.0433 -0.0280 100 ASP A O     
1301 C  CB    . ASP A 100 ? 0.4681 0.3338 0.3206 -0.0150 -0.1386 -0.0031 100 ASP A CB    
1302 C  CG    . ASP A 100 ? 0.5041 0.4281 0.3912 0.0134  -0.2000 0.0097  100 ASP A CG    
1303 O  OD1   . ASP A 100 ? 0.4970 0.4301 0.4564 0.0445  -0.1406 -0.0329 100 ASP A OD1   
1304 O  OD2   . ASP A 100 ? 0.5422 0.5263 0.6593 -0.0030 -0.2118 0.0072  100 ASP A OD2   
1309 N  N     . GLY A 101 ? 0.3801 0.2555 0.4300 -0.0308 -0.0370 -0.0043 101 GLY A N     
1310 C  CA    . GLY A 101 ? 0.3853 0.2647 0.5165 -0.0248 -0.0749 -0.0799 101 GLY A CA    
1311 C  C     . GLY A 101 ? 0.3598 0.2307 0.3647 -0.0490 -0.0253 -0.0694 101 GLY A C     
1312 O  O     . GLY A 101 ? 0.3723 0.2707 0.4501 -0.0365 -0.0499 -0.0804 101 GLY A O     
1316 N  N     . GLY A 102 ? 0.3378 0.2410 0.3971 -0.0270 0.0237  -0.0118 102 GLY A N     
1317 C  CA    . GLY A 102 ? 0.3025 0.2079 0.3366 -0.0267 0.0029  -0.0387 102 GLY A CA    
1318 C  C     . GLY A 102 ? 0.2889 0.1905 0.3710 -0.0161 0.0598  0.0154  102 GLY A C     
1319 O  O     . GLY A 102 ? 0.2614 0.2220 0.3031 -0.0415 0.0216  -0.0299 102 GLY A O     
1323 N  N     . THR A 103 ? 0.2810 0.2179 0.3512 -0.0061 0.0504  -0.0196 103 THR A N     
1324 C  CA    . THR A 103 ? 0.2754 0.1798 0.3943 -0.0343 0.0756  -0.0399 103 THR A CA    
1325 C  C     . THR A 103 ? 0.2759 0.1968 0.2732 -0.0258 0.0676  -0.0271 103 THR A C     
1326 O  O     . THR A 103 ? 0.2859 0.2293 0.3272 -0.0421 0.0880  -0.0064 103 THR A O     
1327 C  CB    . THR A 103 ? 0.2606 0.1951 0.3715 -0.0247 0.0367  -0.0481 103 THR A CB    
1328 O  OG1   . THR A 103 ? 0.2383 0.2324 0.3713 0.0167  0.0083  -0.0429 103 THR A OG1   
1329 C  CG2   . THR A 103 ? 0.2630 0.2189 0.5604 0.0049  0.0188  -0.0146 103 THR A CG2   
1337 N  N     . LEU A 104 ? 0.2367 0.1671 0.3553 -0.0278 0.0862  -0.0409 104 LEU A N     
1338 C  CA    . LEU A 104 ? 0.2588 0.2043 0.2747 -0.0068 0.0792  -0.0249 104 LEU A CA    
1339 C  C     . LEU A 104 ? 0.2167 0.1748 0.3056 -0.0226 0.0737  0.0444  104 LEU A C     
1340 O  O     . LEU A 104 ? 0.1869 0.1727 0.3277 -0.0111 0.0074  0.0427  104 LEU A O     
1341 C  CB    . LEU A 104 ? 0.2733 0.1847 0.2943 -0.0056 0.0749  -0.0195 104 LEU A CB    
1342 C  CG    . LEU A 104 ? 0.2852 0.1764 0.3003 -0.0241 0.0559  -0.0029 104 LEU A CG    
1343 C  CD1   . LEU A 104 ? 0.3139 0.1985 0.3259 -0.0480 0.0129  0.0324  104 LEU A CD1   
1344 C  CD2   . LEU A 104 ? 0.2941 0.1876 0.3123 -0.0099 0.0299  -0.0030 104 LEU A CD2   
1356 N  N     . PHE A 105 ? 0.1887 0.2019 0.2823 -0.0136 0.0600  0.0045  105 PHE A N     
1357 C  CA    . PHE A 105 ? 0.1828 0.1864 0.2721 -0.0293 0.0599  -0.0164 105 PHE A CA    
1358 C  C     . PHE A 105 ? 0.2014 0.1771 0.2694 -0.0225 0.0619  0.0303  105 PHE A C     
1359 O  O     . PHE A 105 ? 0.2332 0.1750 0.3339 -0.0236 0.0809  0.0301  105 PHE A O     
1360 C  CB    . PHE A 105 ? 0.1820 0.1953 0.3789 -0.0323 0.0717  -0.0515 105 PHE A CB    
1361 C  CG    . PHE A 105 ? 0.1613 0.1906 0.3772 0.0054  0.0721  -0.0103 105 PHE A CG    
1362 C  CD1   . PHE A 105 ? 0.1752 0.2030 0.4666 0.0001  0.0448  -0.0378 105 PHE A CD1   
1363 C  CD2   . PHE A 105 ? 0.1903 0.2619 0.3732 -0.0055 0.0533  -0.0030 105 PHE A CD2   
1364 C  CE1   . PHE A 105 ? 0.1572 0.2210 0.4386 -0.0436 0.0628  0.0317  105 PHE A CE1   
1365 C  CE2   . PHE A 105 ? 0.2052 0.2529 0.3991 0.0091  0.0365  -0.0016 105 PHE A CE2   
1366 C  CZ    . PHE A 105 ? 0.1626 0.2284 0.3477 -0.0239 -0.0065 0.0437  105 PHE A CZ    
1376 N  N     . LEU A 106 ? 0.1935 0.1855 0.3351 -0.0353 0.0746  -0.0015 106 LEU A N     
1377 C  CA    . LEU A 106 ? 0.1799 0.2147 0.3005 -0.0223 0.0507  -0.0072 106 LEU A CA    
1378 C  C     . LEU A 106 ? 0.1596 0.2009 0.2913 -0.0094 0.0695  0.0221  106 LEU A C     
1379 O  O     . LEU A 106 ? 0.1695 0.1963 0.3491 -0.0302 0.0605  0.0209  106 LEU A O     
1380 C  CB    . LEU A 106 ? 0.1954 0.1911 0.3284 -0.0252 0.0308  -0.0137 106 LEU A CB    
1381 C  CG    . LEU A 106 ? 0.2206 0.2027 0.3517 -0.0078 0.0147  0.0143  106 LEU A CG    
1382 C  CD1   . LEU A 106 ? 0.2646 0.2005 0.3836 0.0657  0.0046  0.0219  106 LEU A CD1   
1383 C  CD2   . LEU A 106 ? 0.2622 0.2210 0.4534 0.0085  -0.0077 0.0027  106 LEU A CD2   
1395 N  N     . ASP A 107 ? 0.1597 0.1746 0.3918 -0.0197 0.0752  0.0191  107 ASP A N     
1396 C  CA    . ASP A 107 ? 0.1477 0.1753 0.3939 -0.0127 0.0134  -0.0155 107 ASP A CA    
1397 C  C     . ASP A 107 ? 0.1162 0.1801 0.3284 -0.0142 -0.0023 0.0249  107 ASP A C     
1398 O  O     . ASP A 107 ? 0.1946 0.1839 0.3869 0.0353  -0.0241 0.0070  107 ASP A O     
1399 C  CB    . ASP A 107 ? 0.1971 0.2728 0.4593 0.0074  0.0430  -0.1156 107 ASP A CB    
1400 C  CG    . ASP A 107 ? 0.1974 0.3296 0.5998 0.0017  0.0773  -0.0536 107 ASP A CG    
1401 O  OD1   . ASP A 107 ? 0.2043 0.2134 0.6530 -0.0243 -0.0052 -0.0040 107 ASP A OD1   
1402 O  OD2   . ASP A 107 ? 0.2070 0.4375 0.6624 -0.0119 0.1263  -0.0165 107 ASP A OD2   
1407 N  N     . GLN A 108 ? 0.1197 0.2320 0.3976 0.0042  0.0183  -0.0093 108 GLN A N     
1408 C  CA    . GLN A 108 ? 0.1285 0.1951 0.3860 -0.0187 0.0374  -0.0429 108 GLN A CA    
1409 C  C     . GLN A 108 ? 0.1382 0.1856 0.3378 -0.0210 -0.0063 0.0516  108 GLN A C     
1410 O  O     . GLN A 108 ? 0.1597 0.2170 0.3809 0.0075  0.0125  0.0384  108 GLN A O     
1411 C  CB    . GLN A 108 ? 0.1319 0.2049 0.4607 -0.0126 0.0626  -0.0470 108 GLN A CB    
1412 C  CG    . GLN A 108 ? 0.1238 0.2389 0.4217 -0.0368 0.0340  -0.0305 108 GLN A CG    
1413 C  CD    . GLN A 108 ? 0.1962 0.2917 0.4561 -0.0177 0.0574  -0.0227 108 GLN A CD    
1414 O  OE1   . GLN A 108 ? 0.2566 0.2924 0.5194 -0.0257 0.0018  -0.0162 108 GLN A OE1   
1415 N  NE2   . GLN A 108 ? 0.2237 0.3453 0.5062 0.0028  -0.0078 -0.0544 108 GLN A NE2   
1424 N  N     . LEU A 109 ? 0.1377 0.1719 0.4395 -0.0270 0.0609  0.0066  109 LEU A N     
1425 C  CA    . LEU A 109 ? 0.1304 0.2240 0.3624 -0.0121 0.0403  -0.0112 109 LEU A CA    
1426 C  C     . LEU A 109 ? 0.1638 0.2095 0.3758 -0.0087 0.0321  -0.0239 109 LEU A C     
1427 O  O     . LEU A 109 ? 0.1729 0.1819 0.4340 -0.0002 0.0377  -0.0011 109 LEU A O     
1428 C  CB    . LEU A 109 ? 0.1431 0.2478 0.3813 -0.0313 0.0509  -0.0449 109 LEU A CB    
1429 C  CG    . LEU A 109 ? 0.1942 0.2723 0.5091 -0.0367 0.0165  -0.0072 109 LEU A CG    
1430 C  CD1   . LEU A 109 ? 0.2385 0.3092 0.6365 0.0693  -0.0659 -0.0178 109 LEU A CD1   
1431 C  CD2   . LEU A 109 ? 0.2025 0.2811 0.5071 -0.0888 0.0317  -0.0945 109 LEU A CD2   
1443 N  N     . ALA A 110 ? 0.1852 0.2275 0.3147 0.0195  0.0371  -0.0179 110 ALA A N     
1444 C  CA    . ALA A 110 ? 0.2211 0.1792 0.3480 0.0180  0.0743  0.0397  110 ALA A CA    
1445 C  C     . ALA A 110 ? 0.2394 0.1626 0.4081 0.0299  0.0334  -0.0256 110 ALA A C     
1446 O  O     . ALA A 110 ? 0.2659 0.1843 0.5057 -0.0081 0.0519  -0.0405 110 ALA A O     
1447 C  CB    . ALA A 110 ? 0.3006 0.2303 0.3835 0.0476  0.0293  0.0251  110 ALA A CB    
1453 N  N     . THR A 111 ? 0.2059 0.1727 0.3787 0.0085  0.0419  -0.0333 111 THR A N     
1454 C  CA    . THR A 111 ? 0.1915 0.2031 0.2796 0.0207  0.0027  -0.0703 111 THR A CA    
1455 C  C     . THR A 111 ? 0.1587 0.2310 0.3039 -0.0143 0.0190  -0.0093 111 THR A C     
1456 O  O     . THR A 111 ? 0.1887 0.1927 0.4662 -0.0133 0.0460  -0.0028 111 THR A O     
1457 C  CB    . THR A 111 ? 0.1893 0.1981 0.3935 0.0003  0.0392  -0.0610 111 THR A CB    
1458 O  OG1   . THR A 111 ? 0.1969 0.2039 0.3996 -0.0295 0.0229  -0.0112 111 THR A OG1   
1459 C  CG2   . THR A 111 ? 0.1528 0.2598 0.3908 -0.0075 0.0125  -0.0897 111 THR A CG2   
1467 N  N     . ALA A 112 ? 0.1185 0.2178 0.3843 -0.0116 0.0331  0.0080  112 ALA A N     
1468 C  CA    . ALA A 112 ? 0.1546 0.2191 0.3258 0.0054  0.0371  0.0098  112 ALA A CA    
1469 C  C     . ALA A 112 ? 0.1856 0.1831 0.4103 0.0139  0.0263  0.0486  112 ALA A C     
1470 O  O     . ALA A 112 ? 0.1869 0.2121 0.3605 0.0287  0.0208  0.0366  112 ALA A O     
1471 C  CB    . ALA A 112 ? 0.1716 0.2554 0.3402 0.0137  0.0042  0.0144  112 ALA A CB    
1477 N  N     . PRO A 113 ? 0.1982 0.1831 0.3693 0.0088  -0.0046 0.0045  113 PRO A N     
1478 C  CA    . PRO A 113 ? 0.2140 0.2271 0.3672 -0.0092 -0.0562 0.0024  113 PRO A CA    
1479 C  C     . PRO A 113 ? 0.1947 0.2100 0.3475 -0.0072 -0.0443 -0.0133 113 PRO A C     
1480 O  O     . PRO A 113 ? 0.2084 0.1974 0.3702 0.0150  -0.0018 -0.0350 113 PRO A O     
1481 C  CB    . PRO A 113 ? 0.2540 0.1989 0.5538 -0.0107 0.0150  0.0369  113 PRO A CB    
1482 C  CG    . PRO A 113 ? 0.2739 0.2254 0.6001 0.0170  0.0141  0.0383  113 PRO A CG    
1483 C  CD    . PRO A 113 ? 0.2251 0.2195 0.3605 0.0348  0.0310  0.0054  113 PRO A CD    
1491 N  N     . MET A 114 ? 0.2389 0.2946 0.3468 0.0583  0.0292  -0.0260 114 MET A N     
1492 C  CA    . MET A 114 ? 0.2540 0.3176 0.3961 0.0587  0.0339  -0.0841 114 MET A CA    
1493 C  C     . MET A 114 ? 0.2585 0.2913 0.3313 0.0900  0.0158  -0.0184 114 MET A C     
1494 O  O     . MET A 114 ? 0.1948 0.2609 0.6550 0.0238  0.0323  -0.1243 114 MET A O     
1495 C  CB    . MET A 114 ? 0.2797 0.3875 0.3591 0.0351  0.0180  -0.0392 114 MET A CB    
1496 C  CG    . MET A 114 ? 0.3199 0.3711 0.4421 -0.0064 0.0230  -0.0304 114 MET A CG    
1497 S  SD    . MET A 114 ? 0.3675 0.4716 0.4927 0.1033  -0.0127 -0.0712 114 MET A SD    
1498 C  CE    . MET A 114 ? 0.3618 0.4476 0.4934 0.1180  0.0738  -0.1166 114 MET A CE    
1508 N  N     A MET A 115 ? 0.2678 0.2579 0.3816 0.1188  -0.0504 -0.1007 115 MET A N     
1509 N  N     B MET A 115 ? 0.3044 0.3416 0.4250 0.1079  -0.0734 -0.0526 115 MET A N     
1510 C  CA    A MET A 115 ? 0.2733 0.2368 0.3977 0.1224  -0.0248 -0.0073 115 MET A CA    
1511 C  CA    B MET A 115 ? 0.3369 0.3722 0.4622 0.0707  -0.0548 -0.0059 115 MET A CA    
1512 C  C     A MET A 115 ? 0.2414 0.2325 0.4308 0.1102  -0.0008 -0.0008 115 MET A C     
1513 C  C     B MET A 115 ? 0.2964 0.3680 0.5218 0.0484  -0.0335 -0.0400 115 MET A C     
1514 O  O     A MET A 115 ? 0.2120 0.2408 0.4065 0.1176  -0.0001 0.0183  115 MET A O     
1515 O  O     B MET A 115 ? 0.3037 0.4368 0.5762 0.0282  -0.0958 -0.0895 115 MET A O     
1516 C  CB    A MET A 115 ? 0.3217 0.2396 0.4273 0.1476  -0.0463 0.0407  115 MET A CB    
1517 C  CB    B MET A 115 ? 0.4174 0.4129 0.5665 0.0802  -0.0429 0.0294  115 MET A CB    
1518 C  CG    A MET A 115 ? 0.4217 0.2413 0.5004 0.1290  0.0310  0.1218  115 MET A CG    
1519 C  CG    B MET A 115 ? 0.5132 0.4370 0.6616 0.1179  0.0264  0.1069  115 MET A CG    
1520 S  SD    A MET A 115 ? 0.5313 0.3209 0.7469 0.1471  0.0651  0.0300  115 MET A SD    
1521 S  SD    B MET A 115 ? 0.5889 0.4884 0.9093 0.1506  0.1025  0.0888  115 MET A SD    
1522 C  CE    A MET A 115 ? 0.5322 0.3635 0.8129 0.1603  0.0597  0.0660  115 MET A CE    
1523 C  CE    B MET A 115 ? 0.5766 0.4479 0.8612 0.1919  0.0872  0.0587  115 MET A CE    
1542 N  N     . VAL A 116 ? 0.2284 0.2743 0.3414 0.0440  -0.0181 -0.0043 116 VAL A N     
1543 C  CA    . VAL A 116 ? 0.2299 0.2600 0.3064 0.0696  0.0487  0.0086  116 VAL A CA    
1544 C  C     . VAL A 116 ? 0.1915 0.2442 0.3939 0.0693  0.0680  0.0805  116 VAL A C     
1545 O  O     . VAL A 116 ? 0.1700 0.2403 0.3907 0.0308  0.0033  -0.0073 116 VAL A O     
1546 C  CB    . VAL A 116 ? 0.2400 0.2233 0.3681 0.0576  0.0351  0.0541  116 VAL A CB    
1547 C  CG1   . VAL A 116 ? 0.2303 0.2114 0.3800 0.0446  0.0416  0.0104  116 VAL A CG1   
1548 C  CG2   . VAL A 116 ? 0.2658 0.2355 0.3800 0.0637  0.0247  -0.0159 116 VAL A CG2   
1558 N  N     . GLN A 117 ? 0.1571 0.2214 0.3564 0.0232  0.0557  -0.0099 117 GLN A N     
1559 C  CA    . GLN A 117 ? 0.1439 0.2009 0.3325 0.0269  0.0804  -0.0021 117 GLN A CA    
1560 C  C     . GLN A 117 ? 0.1676 0.2092 0.3943 0.0569  0.0943  0.0100  117 GLN A C     
1561 O  O     . GLN A 117 ? 0.1755 0.2323 0.4473 0.0201  0.0707  -0.0082 117 GLN A O     
1562 C  CB    . GLN A 117 ? 0.1365 0.1987 0.3973 0.0331  0.0568  0.0180  117 GLN A CB    
1563 C  CG    . GLN A 117 ? 0.1409 0.2298 0.3553 0.0333  0.0530  0.0234  117 GLN A CG    
1564 C  CD    . GLN A 117 ? 0.1560 0.2629 0.3534 -0.0192 0.0193  0.0284  117 GLN A CD    
1565 O  OE1   . GLN A 117 ? 0.2145 0.2847 0.3132 -0.0283 0.0253  0.0154  117 GLN A OE1   
1566 N  NE2   . GLN A 117 ? 0.1604 0.2446 0.3710 -0.0245 0.0169  -0.0012 117 GLN A NE2   
1575 N  N     . GLU A 118 ? 0.1442 0.2325 0.4054 0.0567  0.0149  -0.0679 118 GLU A N     
1576 C  CA    . GLU A 118 ? 0.1638 0.2867 0.4373 0.0883  -0.0285 -0.0592 118 GLU A CA    
1577 C  C     . GLU A 118 ? 0.1767 0.3093 0.4081 0.0672  0.0391  -0.0836 118 GLU A C     
1578 O  O     . GLU A 118 ? 0.1801 0.3053 0.4320 0.0489  0.0082  -0.1116 118 GLU A O     
1579 C  CB    . GLU A 118 ? 0.1919 0.3229 0.4475 0.1013  -0.0578 -0.1156 118 GLU A CB    
1580 C  CG    . GLU A 118 ? 0.2408 0.3955 0.4564 0.1210  -0.0942 -0.1663 118 GLU A CG    
1581 C  CD    . GLU A 118 ? 0.2971 0.4722 0.5886 0.1399  -0.0732 -0.1967 118 GLU A CD    
1582 O  OE1   . GLU A 118 ? 0.3264 0.4682 0.5677 0.1587  -0.0834 -0.1323 118 GLU A OE1   
1583 O  OE2   . GLU A 118 ? 0.3024 0.5415 0.6149 0.1617  0.0067  -0.1877 118 GLU A OE2   
1590 N  N     . LYS A 119 ? 0.2102 0.2867 0.4137 0.0786  0.0194  -0.0826 119 LYS A N     
1591 C  CA    . LYS A 119 ? 0.2261 0.3298 0.3600 0.0788  -0.0146 -0.0315 119 LYS A CA    
1592 C  C     . LYS A 119 ? 0.2162 0.3242 0.2884 0.0536  -0.0457 0.0010  119 LYS A C     
1593 O  O     . LYS A 119 ? 0.2131 0.3610 0.3298 0.0447  -0.0432 -0.0415 119 LYS A O     
1594 C  CB    . LYS A 119 ? 0.2843 0.3413 0.4142 0.1117  -0.0083 -0.0299 119 LYS A CB    
1595 C  CG    . LYS A 119 ? 0.3483 0.3718 0.5293 0.1237  0.0132  0.0277  119 LYS A CG    
1596 C  CD    . LYS A 119 ? 0.4200 0.4072 0.5384 0.1377  0.0306  0.0730  119 LYS A CD    
1597 C  CE    . LYS A 119 ? 0.4807 0.4574 0.6514 0.1339  0.0075  0.0886  119 LYS A CE    
1598 N  NZ    . LYS A 119 ? 0.5101 0.5249 0.7646 0.1140  0.0161  0.0330  119 LYS A NZ    
1612 N  N     . LEU A 120 ? 0.1974 0.2639 0.3860 0.0395  0.0010  -0.0723 120 LEU A N     
1613 C  CA    . LEU A 120 ? 0.1870 0.2742 0.3360 -0.0063 0.0317  -0.0483 120 LEU A CA    
1614 C  C     . LEU A 120 ? 0.2081 0.2854 0.4362 0.0341  0.0013  -0.0949 120 LEU A C     
1615 O  O     . LEU A 120 ? 0.2013 0.2907 0.3932 0.0276  0.0317  -0.0866 120 LEU A O     
1616 C  CB    . LEU A 120 ? 0.2098 0.2862 0.3760 0.0494  0.0123  -0.1041 120 LEU A CB    
1617 C  CG    . LEU A 120 ? 0.2448 0.2677 0.4506 0.0603  0.0455  -0.0587 120 LEU A CG    
1618 C  CD1   . LEU A 120 ? 0.2809 0.2690 0.4912 0.0428  0.0849  -0.0643 120 LEU A CD1   
1619 C  CD2   . LEU A 120 ? 0.2222 0.2866 0.4533 0.0523  0.0745  -0.0193 120 LEU A CD2   
1631 N  N     . LEU A 121 ? 0.1716 0.2797 0.4235 -0.0104 0.0076  -0.1076 121 LEU A N     
1632 C  CA    . LEU A 121 ? 0.1691 0.3416 0.3839 -0.0265 0.0077  -0.0840 121 LEU A CA    
1633 C  C     . LEU A 121 ? 0.1632 0.4126 0.3749 -0.0206 0.0405  -0.0317 121 LEU A C     
1634 O  O     . LEU A 121 ? 0.1689 0.4032 0.3611 -0.0344 0.0223  -0.0839 121 LEU A O     
1635 C  CB    . LEU A 121 ? 0.1507 0.3773 0.3091 -0.0742 -0.0019 -0.0694 121 LEU A CB    
1636 C  CG    . LEU A 121 ? 0.2007 0.4024 0.3717 -0.0666 -0.0118 -0.0803 121 LEU A CG    
1637 C  CD1   . LEU A 121 ? 0.2254 0.4052 0.4295 -0.0969 -0.0102 -0.0296 121 LEU A CD1   
1638 C  CD2   . LEU A 121 ? 0.2204 0.4322 0.3794 -0.0432 -0.0064 -0.0513 121 LEU A CD2   
1650 N  N     . ARG A 122 ? 0.1828 0.4356 0.3579 -0.0386 -0.0187 -0.0742 122 ARG A N     
1651 C  CA    . ARG A 122 ? 0.2154 0.4967 0.3542 -0.0301 0.0261  -0.0802 122 ARG A CA    
1652 C  C     . ARG A 122 ? 0.2171 0.4699 0.3473 -0.0770 0.0360  -0.0855 122 ARG A C     
1653 O  O     . ARG A 122 ? 0.2222 0.4569 0.4885 -0.0850 0.0308  -0.1170 122 ARG A O     
1654 C  CB    . ARG A 122 ? 0.2676 0.5451 0.4066 0.0426  -0.0753 -0.1555 122 ARG A CB    
1655 C  CG    . ARG A 122 ? 0.3473 0.6433 0.5709 0.1152  -0.0665 -0.1299 122 ARG A CG    
1656 C  CD    . ARG A 122 ? 0.3806 0.7076 0.6745 0.1491  -0.0932 -0.1862 122 ARG A CD    
1657 N  NE    . ARG A 122 ? 0.4197 0.7678 0.7476 0.1798  -0.0497 -0.1521 122 ARG A NE    
1658 C  CZ    . ARG A 122 ? 0.4343 0.7812 0.7308 0.2013  0.0293  -0.1283 122 ARG A CZ    
1659 N  NH1   . ARG A 122 ? 0.4354 0.7939 0.6419 0.2075  0.1136  -0.1378 122 ARG A NH1   
1660 N  NH2   . ARG A 122 ? 0.4465 0.7666 0.6627 0.2094  0.0262  -0.1032 122 ARG A NH2   
1663 N  N     . VAL A 123 ? 0.2005 0.5044 0.3710 -0.0429 0.0594  -0.1245 123 VAL A N     
1664 C  CA    . VAL A 123 ? 0.2196 0.4576 0.3617 -0.0698 0.0827  -0.1425 123 VAL A CA    
1665 C  C     . VAL A 123 ? 0.2569 0.4329 0.4289 -0.1019 0.0322  -0.1301 123 VAL A C     
1666 O  O     . VAL A 123 ? 0.2805 0.4368 0.5492 -0.0688 0.0722  -0.1920 123 VAL A O     
1667 C  CB    . VAL A 123 ? 0.2600 0.4307 0.4309 -0.0415 0.1097  -0.1247 123 VAL A CB    
1668 C  CG1   . VAL A 123 ? 0.2910 0.3921 0.4132 -0.0240 0.0561  -0.1203 123 VAL A CG1   
1669 C  CG2   . VAL A 123 ? 0.2500 0.4401 0.4855 -0.0370 0.1341  -0.1329 123 VAL A CG2   
1679 N  N     . ILE A 124 ? 0.2932 0.4281 0.3472 -0.0968 0.0327  -0.1363 124 ILE A N     
1680 C  CA    . ILE A 124 ? 0.2847 0.4100 0.4064 -0.0928 0.0520  -0.1484 124 ILE A CA    
1681 C  C     . ILE A 124 ? 0.3031 0.4629 0.3953 -0.0994 0.0576  -0.1830 124 ILE A C     
1682 O  O     . ILE A 124 ? 0.3323 0.4465 0.4928 -0.1123 0.0665  -0.1534 124 ILE A O     
1683 C  CB    . ILE A 124 ? 0.2611 0.3612 0.4403 -0.0786 0.0654  -0.1459 124 ILE A CB    
1684 C  CG1   . ILE A 124 ? 0.2567 0.3251 0.5159 -0.0442 0.0242  -0.0972 124 ILE A CG1   
1685 C  CG2   . ILE A 124 ? 0.2401 0.3725 0.5443 -0.1031 0.0841  -0.0958 124 ILE A CG2   
1686 C  CD1   . ILE A 124 ? 0.2384 0.3196 0.5349 -0.0449 0.0480  -0.0754 124 ILE A CD1   
1698 N  N     . GLU A 125 ? 0.2742 0.4950 0.3716 -0.1340 0.0256  -0.1697 125 GLU A N     
1699 C  CA    . GLU A 125 ? 0.2708 0.5239 0.4766 -0.1334 0.0133  -0.1855 125 GLU A CA    
1700 C  C     . GLU A 125 ? 0.3002 0.5665 0.5117 -0.1286 -0.0136 -0.1232 125 GLU A C     
1701 O  O     . GLU A 125 ? 0.3119 0.5518 0.5866 -0.1767 -0.0459 -0.0919 125 GLU A O     
1702 C  CB    . GLU A 125 ? 0.2687 0.5027 0.5462 -0.0987 0.0308  -0.0948 125 GLU A CB    
1703 C  CG    . GLU A 125 ? 0.3041 0.4478 0.4495 -0.0320 0.0202  -0.0561 125 GLU A CG    
1704 C  CD    . GLU A 125 ? 0.3237 0.3852 0.4437 -0.0170 0.0195  -0.0064 125 GLU A CD    
1705 O  OE1   . GLU A 125 ? 0.3284 0.3545 0.4223 -0.0521 0.0426  0.0012  125 GLU A OE1   
1706 O  OE2   . GLU A 125 ? 0.3363 0.3619 0.4833 0.0360  -0.0746 -0.0755 125 GLU A OE2   
1713 N  N     . TYR A 126 ? 0.3082 0.5609 0.5795 -0.1234 -0.0665 -0.1970 126 TYR A N     
1714 C  CA    . TYR A 126 ? 0.3382 0.5623 0.5123 -0.0877 -0.0766 -0.2362 126 TYR A CA    
1715 C  C     . TYR A 126 ? 0.3644 0.5231 0.5236 -0.0636 -0.0690 -0.1778 126 TYR A C     
1716 O  O     . TYR A 126 ? 0.3700 0.5396 0.5204 -0.0664 -0.0695 -0.1095 126 TYR A O     
1717 C  CB    . TYR A 126 ? 0.3385 0.6414 0.5078 -0.0309 -0.0436 -0.2770 126 TYR A CB    
1718 C  CG    . TYR A 126 ? 0.3596 0.6925 0.5699 0.0077  0.0042  -0.3233 126 TYR A CG    
1719 C  CD1   . TYR A 126 ? 0.3698 0.7067 0.6793 0.0012  -0.0075 -0.3077 126 TYR A CD1   
1720 C  CD2   . TYR A 126 ? 0.3809 0.7101 0.6698 0.0044  -0.0101 -0.3095 126 TYR A CD2   
1721 C  CE1   . TYR A 126 ? 0.3887 0.7300 0.7198 0.0107  0.0097  -0.2958 126 TYR A CE1   
1722 C  CE2   . TYR A 126 ? 0.3956 0.7331 0.7570 0.0032  0.0390  -0.2553 126 TYR A CE2   
1723 C  CZ    . TYR A 126 ? 0.4009 0.7479 0.7788 0.0151  0.0514  -0.2421 126 TYR A CZ    
1724 O  OH    . TYR A 126 ? 0.4130 0.7605 0.8341 0.0158  0.1094  -0.1589 126 TYR A OH    
1734 N  N     . GLY A 127 ? 0.3877 0.4711 0.5265 -0.0223 -0.0354 -0.1194 127 GLY A N     
1735 C  CA    . GLY A 127 ? 0.3845 0.4470 0.5421 -0.0031 -0.0340 -0.0831 127 GLY A CA    
1736 C  C     . GLY A 127 ? 0.3813 0.4237 0.5381 0.0376  -0.0723 -0.1159 127 GLY A C     
1737 O  O     . GLY A 127 ? 0.3680 0.3817 0.5840 0.0856  -0.0443 -0.0480 127 GLY A O     
1741 N  N     . GLU A 128 ? 0.3716 0.4265 0.5926 0.0029  -0.0982 -0.1166 128 GLU A N     
1742 C  CA    . GLU A 128 ? 0.3535 0.4496 0.6281 0.0225  -0.1557 -0.1746 128 GLU A CA    
1743 C  C     . GLU A 128 ? 0.3553 0.4334 0.5224 0.0324  -0.0989 -0.1640 128 GLU A C     
1744 O  O     . GLU A 128 ? 0.3490 0.4488 0.4983 -0.0228 -0.0664 -0.1207 128 GLU A O     
1745 C  CB    . GLU A 128 ? 0.3571 0.5294 0.7582 0.0470  -0.2168 -0.1739 128 GLU A CB    
1746 C  CG    . GLU A 128 ? 0.3885 0.5991 0.8283 0.1239  -0.1818 -0.1868 128 GLU A CG    
1747 C  CD    . GLU A 128 ? 0.4040 0.6310 0.9355 0.1512  -0.1603 -0.1427 128 GLU A CD    
1748 O  OE1   . GLU A 128 ? 0.4208 0.6368 1.0175 0.1482  -0.1245 -0.1058 128 GLU A OE1   
1749 O  OE2   . GLU A 128 ? 0.4022 0.6573 0.9635 0.2003  -0.1607 -0.0564 128 GLU A OE2   
1756 N  N     . LEU A 129 ? 0.3795 0.4352 0.6050 0.0925  -0.1425 -0.0888 129 LEU A N     
1757 C  CA    . LEU A 129 ? 0.4081 0.4591 0.5884 0.0677  -0.1041 -0.1098 129 LEU A CA    
1758 C  C     . LEU A 129 ? 0.4593 0.4792 0.6082 0.0952  -0.0645 -0.0474 129 LEU A C     
1759 O  O     . LEU A 129 ? 0.4708 0.4752 0.6913 0.0854  -0.0328 -0.1114 129 LEU A O     
1760 C  CB    . LEU A 129 ? 0.4113 0.4816 0.5838 0.0513  -0.0569 -0.1136 129 LEU A CB    
1761 C  CG    . LEU A 129 ? 0.3818 0.4836 0.5047 0.0297  0.0395  -0.1153 129 LEU A CG    
1762 C  CD1   . LEU A 129 ? 0.3808 0.4958 0.5081 0.0412  0.0252  -0.1186 129 LEU A CD1   
1763 C  CD2   . LEU A 129 ? 0.3771 0.5016 0.5683 0.0177  0.0471  -0.0883 129 LEU A CD2   
1775 N  N     . GLU A 130 ? 0.5207 0.4993 0.6098 0.1367  -0.0980 -0.0728 130 GLU A N     
1776 C  CA    . GLU A 130 ? 0.5899 0.5459 0.6649 0.1258  -0.0829 -0.0354 130 GLU A CA    
1777 C  C     . GLU A 130 ? 0.6285 0.5561 0.5920 0.0837  -0.1174 -0.0140 130 GLU A C     
1778 O  O     . GLU A 130 ? 0.6504 0.5404 0.5814 0.0502  -0.0935 -0.0596 130 GLU A O     
1779 C  CB    . GLU A 130 ? 0.6133 0.5910 0.6926 0.1636  -0.0235 -0.0672 130 GLU A CB    
1780 C  CG    . GLU A 130 ? 0.6382 0.6392 0.7357 0.1737  -0.0315 -0.0634 130 GLU A CG    
1781 C  CD    . GLU A 130 ? 0.6678 0.6705 0.8110 0.1772  -0.0162 -0.0839 130 GLU A CD    
1782 O  OE1   . GLU A 130 ? 0.6725 0.6821 0.8423 0.1858  0.0017  -0.0900 130 GLU A OE1   
1783 O  OE2   . GLU A 130 ? 0.6863 0.6854 0.8887 0.1645  -0.0362 -0.0665 130 GLU A OE2   
1784 N  N     . ARG A 131 ? 0.6553 0.5680 0.5624 0.0707  -0.1105 -0.0049 131 ARG A N     
1785 C  CA    . ARG A 131 ? 0.6653 0.5928 0.5654 0.0589  -0.1404 0.0002  131 ARG A CA    
1786 C  C     . ARG A 131 ? 0.6667 0.6068 0.6352 0.0672  -0.1205 0.0725  131 ARG A C     
1787 O  O     . ARG A 131 ? 0.6643 0.6349 0.7589 0.0786  -0.1323 0.1247  131 ARG A O     
1788 C  CB    . ARG A 131 ? 0.6695 0.6221 0.5606 0.0567  -0.0945 0.0250  131 ARG A CB    
1789 N  N     . VAL A 132 ? 0.6679 0.6032 0.6303 0.0796  -0.0932 0.0863  132 VAL A N     
1790 C  CA    . VAL A 132 ? 0.6703 0.6244 0.6742 0.0713  -0.0666 0.0357  132 VAL A CA    
1791 C  C     . VAL A 132 ? 0.6679 0.6218 0.6163 0.0709  -0.0973 0.0279  132 VAL A C     
1792 O  O     . VAL A 132 ? 0.6612 0.6348 0.6060 0.0561  -0.1257 0.0323  132 VAL A O     
1793 C  CB    . VAL A 132 ? 0.6696 0.6424 0.7434 0.0709  -0.0354 0.0007  132 VAL A CB    
1794 C  CG1   . VAL A 132 ? 0.6721 0.6430 0.7094 0.0549  -0.0334 -0.0074 132 VAL A CG1   
1795 C  CG2   . VAL A 132 ? 0.6636 0.6522 0.7702 0.0758  -0.0622 0.0065  132 VAL A CG2   
1796 N  N     . GLY A 133 ? 0.6696 0.6037 0.6156 0.0852  -0.0679 0.0114  133 GLY A N     
1797 C  CA    . GLY A 133 ? 0.6561 0.5829 0.4941 0.0896  -0.0856 0.0452  133 GLY A CA    
1798 C  C     . GLY A 133 ? 0.6207 0.5586 0.5957 0.0828  -0.0952 0.0595  133 GLY A C     
1799 O  O     . GLY A 133 ? 0.6294 0.5795 0.5386 0.0778  -0.0763 0.1027  133 GLY A O     
1800 N  N     . GLY A 134 ? 0.5695 0.5153 0.6965 0.0926  -0.1243 0.0428  134 GLY A N     
1801 C  CA    . GLY A 134 ? 0.5295 0.4850 0.6466 0.1218  -0.1496 0.0028  134 GLY A CA    
1802 C  C     . GLY A 134 ? 0.4898 0.4573 0.6175 0.1374  -0.1677 -0.0244 134 GLY A C     
1803 O  O     . GLY A 134 ? 0.4428 0.4468 0.5413 0.1337  -0.1994 -0.0340 134 GLY A O     
1807 N  N     . SER A 135 ? 0.4948 0.4547 0.5793 0.1641  -0.1765 -0.0014 135 SER A N     
1808 C  CA    . SER A 135 ? 0.4915 0.4736 0.5619 0.1569  -0.1265 0.0467  135 SER A CA    
1809 C  C     . SER A 135 ? 0.4845 0.4789 0.5892 0.1526  -0.1360 -0.0443 135 SER A C     
1810 O  O     . SER A 135 ? 0.4874 0.5013 0.5358 0.1755  -0.1111 -0.0777 135 SER A O     
1811 C  CB    . SER A 135 ? 0.4989 0.4883 0.6021 0.1400  -0.0193 0.1431  135 SER A CB    
1812 O  OG    . SER A 135 ? 0.5055 0.4974 0.5836 0.1285  0.0100  0.1954  135 SER A OG    
1813 N  N     . GLN A 136 ? 0.4888 0.4796 0.5755 0.1296  -0.2015 -0.0373 136 GLN A N     
1814 C  CA    . GLN A 136 ? 0.5271 0.4843 0.6291 0.1438  -0.2101 0.0098  136 GLN A CA    
1815 C  C     . GLN A 136 ? 0.5243 0.4321 0.5394 0.0874  -0.1900 0.0010  136 GLN A C     
1816 O  O     . GLN A 136 ? 0.5557 0.3858 0.5301 0.0937  -0.1652 0.0360  136 GLN A O     
1817 C  CB    . GLN A 136 ? 0.5701 0.5348 0.6783 0.2042  -0.2125 0.0660  136 GLN A CB    
1818 C  CG    . GLN A 136 ? 0.6160 0.5776 0.7396 0.2296  -0.1814 0.0609  136 GLN A CG    
1819 C  CD    . GLN A 136 ? 0.6515 0.5942 0.7947 0.2427  -0.1581 0.0490  136 GLN A CD    
1820 O  OE1   . GLN A 136 ? 0.6622 0.6057 0.7798 0.2431  -0.1268 0.0616  136 GLN A OE1   
1821 N  NE2   . GLN A 136 ? 0.6798 0.5835 0.7484 0.2442  -0.1606 0.0767  136 GLN A NE2   
1830 N  N     . PRO A 137 ? 0.4948 0.4568 0.5625 0.0480  -0.1482 0.0214  137 PRO A N     
1831 C  CA    . PRO A 137 ? 0.4916 0.4403 0.5537 0.0429  -0.1559 0.0493  137 PRO A CA    
1832 C  C     . PRO A 137 ? 0.5045 0.4374 0.5728 0.0723  -0.1984 0.0418  137 PRO A C     
1833 O  O     . PRO A 137 ? 0.5059 0.4251 0.6137 0.0710  -0.1348 0.0866  137 PRO A O     
1834 C  CB    . PRO A 137 ? 0.4921 0.4730 0.4892 0.0648  -0.1070 0.1024  137 PRO A CB    
1835 C  CG    . PRO A 137 ? 0.4848 0.5084 0.5745 0.0781  -0.0991 0.1341  137 PRO A CG    
1836 C  CD    . PRO A 137 ? 0.4915 0.5004 0.6562 0.0453  -0.1125 0.0451  137 PRO A CD    
1844 N  N     . LEU A 138 ? 0.5109 0.4221 0.5766 0.0909  -0.2897 0.0060  138 LEU A N     
1845 C  CA    . LEU A 138 ? 0.5483 0.4107 0.5939 0.1056  -0.2404 0.0554  138 LEU A CA    
1846 C  C     . LEU A 138 ? 0.5551 0.3477 0.5786 0.0888  -0.2926 -0.0287 138 LEU A C     
1847 O  O     . LEU A 138 ? 0.5836 0.3067 0.5937 0.0640  -0.2679 -0.0418 138 LEU A O     
1848 C  CB    . LEU A 138 ? 0.5775 0.5002 0.6734 0.1229  -0.1923 0.0895  138 LEU A CB    
1849 C  CG    . LEU A 138 ? 0.6263 0.5858 0.8223 0.1245  -0.1332 0.1318  138 LEU A CG    
1850 C  CD1   . LEU A 138 ? 0.6467 0.6262 0.8801 0.1574  -0.1364 0.1682  138 LEU A CD1   
1851 C  CD2   . LEU A 138 ? 0.6612 0.6175 0.9210 0.1273  -0.0711 0.1384  138 LEU A CD2   
1863 N  N     . GLN A 139 ? 0.5259 0.3376 0.5622 0.0807  -0.2349 -0.0753 139 GLN A N     
1864 C  CA    . GLN A 139 ? 0.5296 0.3330 0.5077 0.0825  -0.1687 -0.1482 139 GLN A CA    
1865 C  C     . GLN A 139 ? 0.5312 0.3563 0.4712 0.1345  -0.0885 -0.0784 139 GLN A C     
1866 O  O     . GLN A 139 ? 0.5809 0.4045 0.4895 0.1931  -0.0763 -0.0010 139 GLN A O     
1867 C  CB    . GLN A 139 ? 0.5456 0.3504 0.5313 0.0256  -0.2395 -0.1485 139 GLN A CB    
1870 N  N     . VAL A 140 ? 0.4640 0.2880 0.3683 0.1112  -0.0271 -0.0023 140 VAL A N     
1871 C  CA    . VAL A 140 ? 0.4499 0.2850 0.4157 0.0858  -0.0308 0.0492  140 VAL A CA    
1872 C  C     . VAL A 140 ? 0.3923 0.2976 0.3078 0.0774  -0.0662 -0.0373 140 VAL A C     
1873 O  O     . VAL A 140 ? 0.3530 0.3015 0.4009 0.0664  -0.0276 0.0237  140 VAL A O     
1874 C  CB    . VAL A 140 ? 0.4791 0.2926 0.5554 0.0912  0.0130  0.0839  140 VAL A CB    
1875 C  CG1   . VAL A 140 ? 0.5081 0.3158 0.6432 0.0909  0.0511  0.1404  140 VAL A CG1   
1876 C  CG2   . VAL A 140 ? 0.4794 0.2999 0.4893 0.0435  0.0238  0.0515  140 VAL A CG2   
1886 N  N     . ASN A 141 ? 0.3547 0.3415 0.4037 0.0482  -0.0473 -0.0785 141 ASN A N     
1887 C  CA    . ASN A 141 ? 0.3466 0.3394 0.4096 0.0155  -0.1143 -0.0590 141 ASN A CA    
1888 C  C     . ASN A 141 ? 0.3217 0.2753 0.3457 0.0120  -0.0867 -0.0567 141 ASN A C     
1889 O  O     . ASN A 141 ? 0.3646 0.2868 0.3573 0.0668  -0.0760 -0.0612 141 ASN A O     
1890 C  CB    . ASN A 141 ? 0.3999 0.3738 0.5806 0.0282  -0.1761 -0.1320 141 ASN A CB    
1891 C  CG    . ASN A 141 ? 0.4598 0.3971 0.7092 0.0519  -0.1548 -0.1677 141 ASN A CG    
1892 O  OD1   . ASN A 141 ? 0.4572 0.3762 0.7193 0.0171  -0.1566 -0.1149 141 ASN A OD1   
1893 N  ND2   . ASN A 141 ? 0.5209 0.4702 0.8908 0.0977  -0.1699 -0.1362 141 ASN A ND2   
1900 N  N     . VAL A 142 ? 0.2988 0.2799 0.3655 0.0278  -0.0572 0.0245  142 VAL A N     
1901 C  CA    . VAL A 142 ? 0.2618 0.2545 0.2592 0.0264  -0.0128 -0.0097 142 VAL A CA    
1902 C  C     . VAL A 142 ? 0.2406 0.2200 0.2868 0.0227  0.0054  -0.0186 142 VAL A C     
1903 O  O     . VAL A 142 ? 0.2349 0.2655 0.3180 0.0341  -0.0047 -0.0001 142 VAL A O     
1904 C  CB    . VAL A 142 ? 0.2961 0.2334 0.3392 0.0109  -0.0611 0.0222  142 VAL A CB    
1905 C  CG1   . VAL A 142 ? 0.2835 0.2125 0.4047 -0.0258 -0.0488 0.0271  142 VAL A CG1   
1906 C  CG2   . VAL A 142 ? 0.3233 0.2066 0.4019 0.0182  -0.1412 0.0166  142 VAL A CG2   
1916 N  N     . ARG A 143 ? 0.2209 0.2083 0.3449 0.0058  -0.0045 -0.0125 143 ARG A N     
1917 C  CA    . ARG A 143 ? 0.1903 0.1830 0.3520 -0.0143 0.0283  -0.0206 143 ARG A CA    
1918 C  C     . ARG A 143 ? 0.1848 0.1807 0.3996 -0.0023 -0.0234 0.0412  143 ARG A C     
1919 O  O     . ARG A 143 ? 0.2183 0.1974 0.3359 -0.0209 0.0429  0.0034  143 ARG A O     
1920 C  CB    . ARG A 143 ? 0.2432 0.1656 0.3950 -0.0005 0.0109  -0.0113 143 ARG A CB    
1921 C  CG    . ARG A 143 ? 0.2410 0.1762 0.3691 0.0317  -0.0072 0.0076  143 ARG A CG    
1922 C  CD    . ARG A 143 ? 0.2014 0.2205 0.3981 0.0043  0.0432  -0.0101 143 ARG A CD    
1923 N  NE    . ARG A 143 ? 0.1823 0.1969 0.4245 -0.0160 0.0316  0.0422  143 ARG A NE    
1924 C  CZ    . ARG A 143 ? 0.2133 0.2363 0.3627 0.0202  -0.0596 0.0203  143 ARG A CZ    
1925 N  NH1   . ARG A 143 ? 0.2485 0.1788 0.3758 -0.0128 0.0339  0.0706  143 ARG A NH1   
1926 N  NH2   . ARG A 143 ? 0.2465 0.1856 0.3618 0.0015  -0.0191 0.0305  143 ARG A NH2   
1940 N  N     . LEU A 144 ? 0.1759 0.2065 0.3962 -0.0008 -0.0041 0.0364  144 LEU A N     
1941 C  CA    . LEU A 144 ? 0.1829 0.2229 0.2863 -0.0107 0.0360  0.0320  144 LEU A CA    
1942 C  C     . LEU A 144 ? 0.1765 0.2187 0.2921 -0.0133 0.0209  0.0148  144 LEU A C     
1943 O  O     . LEU A 144 ? 0.1523 0.2108 0.3372 -0.0377 0.0381  0.0495  144 LEU A O     
1944 C  CB    . LEU A 144 ? 0.2188 0.2246 0.3047 -0.0292 0.0528  -0.0262 144 LEU A CB    
1945 C  CG    . LEU A 144 ? 0.2843 0.2728 0.4175 -0.0202 0.1049  0.0170  144 LEU A CG    
1946 C  CD1   . LEU A 144 ? 0.3056 0.2501 0.4067 -0.0195 0.1079  -0.0238 144 LEU A CD1   
1947 C  CD2   . LEU A 144 ? 0.3057 0.2585 0.4694 -0.0114 0.1520  -0.0245 144 LEU A CD2   
1959 N  N     . VAL A 145 ? 0.1528 0.1952 0.3344 -0.0095 0.0296  0.0333  145 VAL A N     
1960 C  CA    . VAL A 145 ? 0.1367 0.1817 0.3607 -0.0137 0.0414  0.0291  145 VAL A CA    
1961 C  C     . VAL A 145 ? 0.1379 0.1748 0.2796 -0.0138 0.0225  0.0146  145 VAL A C     
1962 O  O     . VAL A 145 ? 0.2050 0.2115 0.3388 -0.0281 0.0593  0.0387  145 VAL A O     
1963 C  CB    . VAL A 145 ? 0.1455 0.1718 0.4395 -0.0112 0.0352  0.0210  145 VAL A CB    
1964 C  CG1   . VAL A 145 ? 0.1522 0.1677 0.4752 0.0259  0.0063  0.0266  145 VAL A CG1   
1965 C  CG2   . VAL A 145 ? 0.1683 0.2213 0.3834 0.0072  0.0261  0.0408  145 VAL A CG2   
1975 N  N     . CYS A 146 ? 0.1306 0.1851 0.3683 -0.0308 0.0323  0.0617  146 CYS A N     
1976 C  CA    . CYS A 146 ? 0.1257 0.1735 0.3076 -0.0421 0.0412  0.0555  146 CYS A CA    
1977 C  C     . CYS A 146 ? 0.1257 0.1548 0.3311 -0.0193 -0.0095 0.0481  146 CYS A C     
1978 O  O     . CYS A 146 ? 0.1750 0.1767 0.4275 -0.0461 -0.0146 0.0730  146 CYS A O     
1979 C  CB    . CYS A 146 ? 0.1247 0.2096 0.3976 -0.0177 0.0130  0.0065  146 CYS A CB    
1980 S  SG    . CYS A 146 ? 0.1382 0.2488 0.4168 0.0221  0.0180  0.0448  146 CYS A SG    
1986 N  N     . ALA A 147 ? 0.1355 0.1556 0.3396 -0.0191 0.0077  0.0417  147 ALA A N     
1987 C  CA    . ALA A 147 ? 0.1391 0.1860 0.3113 -0.0054 0.0007  0.0707  147 ALA A CA    
1988 C  C     . ALA A 147 ? 0.1236 0.2145 0.4197 -0.0087 -0.0169 0.0093  147 ALA A C     
1989 O  O     . ALA A 147 ? 0.1492 0.2132 0.4182 0.0036  -0.0162 -0.0335 147 ALA A O     
1990 C  CB    . ALA A 147 ? 0.1652 0.1769 0.4513 0.0214  -0.0055 -0.0167 147 ALA A CB    
1996 N  N     . THR A 148 ? 0.1390 0.2211 0.3668 0.0324  -0.0526 0.0092  148 THR A N     
1997 C  CA    . THR A 148 ? 0.1616 0.2138 0.4068 -0.0113 -0.0584 -0.0041 148 THR A CA    
1998 C  C     . THR A 148 ? 0.1528 0.1968 0.3892 -0.0403 -0.0093 -0.0523 148 THR A C     
1999 O  O     . THR A 148 ? 0.1917 0.1762 0.3937 -0.0085 -0.0276 -0.0377 148 THR A O     
2000 C  CB    . THR A 148 ? 0.1599 0.2858 0.4801 0.0372  -0.0608 -0.0387 148 THR A CB    
2001 O  OG1   . THR A 148 ? 0.2008 0.3056 0.4450 0.0608  -0.0488 -0.0340 148 THR A OG1   
2002 C  CG2   . THR A 148 ? 0.1485 0.3383 0.4395 0.0493  0.0355  -0.0530 148 THR A CG2   
2010 N  N     . ASN A 149 ? 0.2036 0.2356 0.4572 0.0255  -0.0243 -0.0621 149 ASN A N     
2011 C  CA    . ASN A 149 ? 0.2361 0.3507 0.4454 0.0828  -0.0957 -0.0781 149 ASN A CA    
2012 C  C     . ASN A 149 ? 0.2385 0.3185 0.4068 0.0269  -0.1566 -0.0647 149 ASN A C     
2013 O  O     . ASN A 149 ? 0.2953 0.3890 0.4076 0.1084  -0.1219 -0.0393 149 ASN A O     
2014 C  CB    . ASN A 149 ? 0.2896 0.4432 0.4811 0.1380  -0.0756 -0.1218 149 ASN A CB    
2015 C  CG    . ASN A 149 ? 0.3467 0.5209 0.5037 0.1940  -0.0527 -0.0997 149 ASN A CG    
2016 O  OD1   . ASN A 149 ? 0.3894 0.5051 0.4083 0.2162  0.0034  0.0087  149 ASN A OD1   
2017 N  ND2   . ASN A 149 ? 0.3284 0.5667 0.6568 0.2148  -0.0737 -0.1004 149 ASN A ND2   
2024 N  N     . ALA A 150 ? 0.2298 0.2478 0.3533 0.0194  -0.0868 -0.0263 150 ALA A N     
2025 C  CA    . ALA A 150 ? 0.2385 0.2412 0.3941 -0.0160 -0.0350 -0.0636 150 ALA A CA    
2026 C  C     . ALA A 150 ? 0.2024 0.2413 0.3638 -0.0259 -0.0260 -0.0233 150 ALA A C     
2027 O  O     . ALA A 150 ? 0.2329 0.2659 0.4081 -0.0124 -0.0277 -0.0257 150 ALA A O     
2028 C  CB    . ALA A 150 ? 0.2648 0.2616 0.4477 0.0102  0.0025  -0.0237 150 ALA A CB    
2034 N  N     . ASP A 151 ? 0.2092 0.2926 0.3625 0.0198  -0.0535 -0.0099 151 ASP A N     
2035 C  CA    . ASP A 151 ? 0.2529 0.3646 0.3581 0.0472  -0.0469 0.0792  151 ASP A CA    
2036 C  C     . ASP A 151 ? 0.2223 0.3110 0.3762 -0.0100 -0.0506 0.0127  151 ASP A C     
2037 O  O     . ASP A 151 ? 0.2175 0.2787 0.3965 0.0134  -0.0642 -0.0160 151 ASP A O     
2038 C  CB    . ASP A 151 ? 0.3150 0.4395 0.3790 0.0622  -0.0517 0.1072  151 ASP A CB    
2039 C  CG    . ASP A 151 ? 0.3754 0.4959 0.4973 0.1040  -0.0657 0.1244  151 ASP A CG    
2040 O  OD1   . ASP A 151 ? 0.3486 0.4956 0.4839 0.1234  -0.0257 0.1391  151 ASP A OD1   
2041 O  OD2   . ASP A 151 ? 0.4300 0.5478 0.5400 0.1156  -0.0959 0.0824  151 ASP A OD2   
2046 N  N     . LEU A 152 ? 0.2389 0.2614 0.3901 -0.0112 -0.0682 0.0371  152 LEU A N     
2047 C  CA    . LEU A 152 ? 0.1914 0.2654 0.2571 -0.0269 -0.0227 0.0053  152 LEU A CA    
2048 C  C     . LEU A 152 ? 0.1984 0.2628 0.3430 -0.0454 -0.0233 0.0163  152 LEU A C     
2049 O  O     . LEU A 152 ? 0.2166 0.2360 0.4035 -0.0055 -0.0090 0.0050  152 LEU A O     
2050 C  CB    . LEU A 152 ? 0.1884 0.2588 0.4462 0.0321  0.0029  -0.0009 152 LEU A CB    
2051 C  CG    . LEU A 152 ? 0.1504 0.2650 0.3892 -0.0351 -0.0244 -0.0466 152 LEU A CG    
2052 C  CD1   . LEU A 152 ? 0.2343 0.3305 0.4545 -0.0113 -0.0033 -0.0472 152 LEU A CD1   
2053 C  CD2   . LEU A 152 ? 0.1848 0.3366 0.4699 -0.0235 0.0170  0.0058  152 LEU A CD2   
2065 N  N     . PRO A 153 ? 0.2262 0.2587 0.3910 0.0006  -0.0044 0.0103  153 PRO A N     
2066 C  CA    . PRO A 153 ? 0.2608 0.2908 0.3832 0.0120  0.0240  0.0278  153 PRO A CA    
2067 C  C     . PRO A 153 ? 0.2483 0.3226 0.2794 -0.0177 0.0047  0.0024  153 PRO A C     
2068 O  O     . PRO A 153 ? 0.2764 0.3506 0.3538 0.0517  0.0240  0.0552  153 PRO A O     
2069 C  CB    . PRO A 153 ? 0.2687 0.2619 0.5661 -0.0197 0.0502  0.0871  153 PRO A CB    
2070 C  CG    . PRO A 153 ? 0.3085 0.2693 0.5990 0.0414  -0.0177 0.0611  153 PRO A CG    
2071 C  CD    . PRO A 153 ? 0.2764 0.2380 0.5025 0.0240  -0.0446 0.1133  153 PRO A CD    
2079 N  N     . ALA A 154 ? 0.2914 0.3565 0.3247 0.0199  -0.0076 0.0566  154 ALA A N     
2080 C  CA    . ALA A 154 ? 0.2979 0.3252 0.2656 -0.0101 -0.0314 0.0399  154 ALA A CA    
2081 C  C     . ALA A 154 ? 0.3071 0.3406 0.3906 -0.0166 -0.0539 -0.0005 154 ALA A C     
2082 O  O     . ALA A 154 ? 0.3422 0.3847 0.3105 0.0146  -0.0194 0.0069  154 ALA A O     
2083 C  CB    . ALA A 154 ? 0.3213 0.3133 0.3653 0.0195  -0.0550 0.0564  154 ALA A CB    
2089 N  N     . MET A 155 ? 0.2808 0.3110 0.3696 -0.0176 -0.0166 0.0225  155 MET A N     
2090 C  CA    . MET A 155 ? 0.2656 0.2796 0.3012 -0.0152 0.0033  -0.0284 155 MET A CA    
2091 C  C     . MET A 155 ? 0.2731 0.2641 0.3198 -0.0017 0.0358  0.1128  155 MET A C     
2092 O  O     . MET A 155 ? 0.2916 0.2488 0.3547 0.0388  -0.0063 0.0132  155 MET A O     
2093 C  CB    . MET A 155 ? 0.2478 0.2733 0.2886 -0.0173 0.0040  -0.0575 155 MET A CB    
2094 C  CG    . MET A 155 ? 0.2517 0.2699 0.3508 -0.0177 0.0032  -0.0353 155 MET A CG    
2095 S  SD    . MET A 155 ? 0.2425 0.2709 0.3762 -0.0080 0.0263  -0.0179 155 MET A SD    
2096 C  CE    . MET A 155 ? 0.2460 0.2159 0.5043 0.0047  0.0930  -0.0100 155 MET A CE    
2106 N  N     . VAL A 156 ? 0.2495 0.2789 0.3522 -0.0128 0.0923  0.0540  156 VAL A N     
2107 C  CA    . VAL A 156 ? 0.2722 0.2975 0.3349 -0.0173 0.0298  0.0528  156 VAL A CA    
2108 C  C     . VAL A 156 ? 0.3402 0.3431 0.3477 -0.0004 0.0101  0.0287  156 VAL A C     
2109 O  O     . VAL A 156 ? 0.3873 0.3508 0.3841 0.0656  0.0348  0.0543  156 VAL A O     
2110 C  CB    . VAL A 156 ? 0.2385 0.2889 0.2560 -0.0191 0.0642  -0.0250 156 VAL A CB    
2111 C  CG1   . VAL A 156 ? 0.2519 0.3100 0.4272 0.0356  0.0975  0.0154  156 VAL A CG1   
2112 C  CG2   . VAL A 156 ? 0.2176 0.2673 0.3407 -0.0104 0.0423  -0.0274 156 VAL A CG2   
2122 N  N     . ASN A 157 ? 0.3767 0.3792 0.3034 -0.0330 0.0523  -0.0583 157 ASN A N     
2123 C  CA    . ASN A 157 ? 0.4686 0.3853 0.2954 -0.0040 0.0777  -0.0531 157 ASN A CA    
2124 C  C     . ASN A 157 ? 0.5330 0.3648 0.3713 0.0114  0.0350  -0.0390 157 ASN A C     
2125 O  O     . ASN A 157 ? 0.5863 0.4261 0.3632 0.0338  0.1039  0.0103  157 ASN A O     
2126 C  CB    . ASN A 157 ? 0.5021 0.4204 0.3614 0.0056  0.0425  0.0001  157 ASN A CB    
2127 C  CG    . ASN A 157 ? 0.5408 0.4385 0.4996 0.0059  0.0136  -0.0025 157 ASN A CG    
2128 O  OD1   . ASN A 157 ? 0.5586 0.4699 0.6125 -0.0206 0.0486  0.0407  157 ASN A OD1   
2129 N  ND2   . ASN A 157 ? 0.5704 0.4329 0.5039 0.0428  0.0098  0.0502  157 ASN A ND2   
2136 N  N     . GLU A 158 ? 0.5259 0.2975 0.3366 -0.0394 -0.0290 -0.0405 158 GLU A N     
2137 C  CA    . GLU A 158 ? 0.5451 0.3025 0.3336 -0.0291 -0.0469 -0.0793 158 GLU A CA    
2138 C  C     . GLU A 158 ? 0.5670 0.2978 0.3853 0.0188  -0.0134 -0.0774 158 GLU A C     
2139 O  O     . GLU A 158 ? 0.6226 0.2886 0.4374 0.0067  -0.0942 -0.0749 158 GLU A O     
2140 C  CB    . GLU A 158 ? 0.5359 0.3287 0.4725 -0.0730 0.0249  -0.0641 158 GLU A CB    
2143 N  N     . GLY A 159 ? 0.4961 0.3054 0.3050 0.0352  -0.0120 -0.0366 159 GLY A N     
2144 C  CA    . GLY A 159 ? 0.4595 0.3323 0.3744 0.0532  0.0570  -0.0156 159 GLY A CA    
2145 C  C     . GLY A 159 ? 0.3944 0.2860 0.3366 0.0269  0.0394  0.0821  159 GLY A C     
2146 O  O     . GLY A 159 ? 0.4264 0.2988 0.3634 0.0633  0.0417  0.0306  159 GLY A O     
2150 N  N     . THR A 160 ? 0.3085 0.2807 0.3727 -0.0273 -0.0348 -0.0397 160 THR A N     
2151 C  CA    . THR A 160 ? 0.2610 0.2476 0.4104 -0.0573 -0.0332 -0.0084 160 THR A CA    
2152 C  C     . THR A 160 ? 0.2049 0.2509 0.4645 -0.0660 0.0674  0.0498  160 THR A C     
2153 O  O     . THR A 160 ? 0.2028 0.2852 0.4287 -0.0326 0.0261  0.0071  160 THR A O     
2154 C  CB    . THR A 160 ? 0.3058 0.2397 0.4181 -0.0643 -0.0051 -0.0362 160 THR A CB    
2155 O  OG1   . THR A 160 ? 0.3173 0.2376 0.4354 -0.0302 0.0248  0.0081  160 THR A OG1   
2156 C  CG2   . THR A 160 ? 0.3321 0.2468 0.4614 -0.0606 -0.0197 0.0177  160 THR A CG2   
2164 N  N     . PHE A 161 ? 0.1888 0.2640 0.3517 -0.0476 0.0492  -0.0343 161 PHE A N     
2165 C  CA    . PHE A 161 ? 0.2025 0.2552 0.3134 0.0118  0.0246  0.0112  161 PHE A CA    
2166 C  C     . PHE A 161 ? 0.1795 0.2276 0.2880 0.0133  0.0355  0.0208  161 PHE A C     
2167 O  O     . PHE A 161 ? 0.1941 0.2631 0.3128 -0.0264 0.0359  0.0434  161 PHE A O     
2168 C  CB    . PHE A 161 ? 0.1553 0.2806 0.3391 -0.0084 -0.0053 0.0101  161 PHE A CB    
2169 C  CG    . PHE A 161 ? 0.1420 0.2680 0.4078 0.0255  -0.0280 -0.0744 161 PHE A CG    
2170 C  CD1   . PHE A 161 ? 0.1322 0.2397 0.4072 0.0038  0.0033  -0.0610 161 PHE A CD1   
2171 C  CD2   . PHE A 161 ? 0.1763 0.2552 0.4537 0.0475  -0.0355 -0.0642 161 PHE A CD2   
2172 C  CE1   . PHE A 161 ? 0.1422 0.2277 0.5180 -0.0065 -0.0126 -0.0383 161 PHE A CE1   
2173 C  CE2   . PHE A 161 ? 0.1623 0.2770 0.3788 0.0289  0.0097  0.0059  161 PHE A CE2   
2174 C  CZ    . PHE A 161 ? 0.1360 0.2615 0.3952 0.0013  -0.0271 -0.0324 161 PHE A CZ    
2184 N  N     . ARG A 162 ? 0.1581 0.1991 0.3333 -0.0089 0.0377  -0.0133 162 ARG A N     
2185 C  CA    . ARG A 162 ? 0.1454 0.2446 0.4075 0.0028  0.0782  0.0021  162 ARG A CA    
2186 C  C     . ARG A 162 ? 0.1303 0.2372 0.3794 -0.0140 0.0111  0.0207  162 ARG A C     
2187 O  O     . ARG A 162 ? 0.1475 0.2179 0.4165 -0.0099 0.0131  0.0489  162 ARG A O     
2188 C  CB    . ARG A 162 ? 0.1461 0.2182 0.4414 0.0015  0.0954  -0.0123 162 ARG A CB    
2189 C  CG    . ARG A 162 ? 0.1967 0.2125 0.3813 0.0132  0.0457  -0.0401 162 ARG A CG    
2190 C  CD    . ARG A 162 ? 0.2068 0.2623 0.4046 -0.0123 0.0641  0.0335  162 ARG A CD    
2191 N  NE    . ARG A 162 ? 0.2213 0.2807 0.4088 0.0035  0.0383  -0.0018 162 ARG A NE    
2192 C  CZ    . ARG A 162 ? 0.2237 0.2584 0.4077 -0.0059 0.0456  0.0817  162 ARG A CZ    
2193 N  NH1   . ARG A 162 ? 0.2554 0.2230 0.4922 0.0284  0.0444  0.0672  162 ARG A NH1   
2194 N  NH2   . ARG A 162 ? 0.2114 0.2957 0.4776 0.0053  0.0795  -0.0213 162 ARG A NH2   
2208 N  N     . ALA A 163 ? 0.1503 0.2637 0.4369 -0.0159 0.0019  0.0014  163 ALA A N     
2209 C  CA    . ALA A 163 ? 0.1522 0.2691 0.4005 -0.0654 0.0077  0.0245  163 ALA A CA    
2210 C  C     . ALA A 163 ? 0.1722 0.2684 0.4683 -0.0387 0.0006  0.0369  163 ALA A C     
2211 O  O     . ALA A 163 ? 0.1582 0.3281 0.4016 -0.0320 0.0184  0.0874  163 ALA A O     
2212 C  CB    . ALA A 163 ? 0.1817 0.3052 0.3712 -0.0493 -0.0444 0.0644  163 ALA A CB    
2218 N  N     . ASP A 164 ? 0.1634 0.2753 0.4111 -0.0327 0.0265  0.0530  164 ASP A N     
2219 C  CA    . ASP A 164 ? 0.1613 0.2617 0.3760 -0.0305 0.0289  0.0363  164 ASP A CA    
2220 C  C     . ASP A 164 ? 0.1876 0.2117 0.3905 -0.0463 0.0104  0.0353  164 ASP A C     
2221 O  O     . ASP A 164 ? 0.1645 0.2151 0.4921 -0.0600 0.0091  0.0080  164 ASP A O     
2222 C  CB    . ASP A 164 ? 0.1690 0.2611 0.4548 -0.0028 0.0090  0.0589  164 ASP A CB    
2223 C  CG    . ASP A 164 ? 0.1726 0.3211 0.3948 0.0452  -0.0485 0.0308  164 ASP A CG    
2224 O  OD1   . ASP A 164 ? 0.2010 0.2930 0.4606 0.0084  -0.0370 0.0329  164 ASP A OD1   
2225 O  OD2   . ASP A 164 ? 0.2005 0.3239 0.3974 0.0952  0.0204  0.0322  164 ASP A OD2   
2230 N  N     . LEU A 165 ? 0.1910 0.1892 0.3952 -0.0263 -0.0161 0.0179  165 LEU A N     
2231 C  CA    . LEU A 165 ? 0.1837 0.1915 0.3892 0.0121  -0.0292 -0.0277 165 LEU A CA    
2232 C  C     . LEU A 165 ? 0.1830 0.2018 0.4823 0.0008  -0.0310 -0.0023 165 LEU A C     
2233 O  O     . LEU A 165 ? 0.2159 0.1922 0.5190 -0.0138 0.0174  -0.0080 165 LEU A O     
2234 C  CB    . LEU A 165 ? 0.1420 0.1854 0.3802 -0.0196 -0.0138 -0.0062 165 LEU A CB    
2235 C  CG    . LEU A 165 ? 0.1620 0.2038 0.4756 -0.0015 0.0442  -0.0553 165 LEU A CG    
2236 C  CD1   . LEU A 165 ? 0.1892 0.1736 0.4482 0.0003  0.1176  -0.0197 165 LEU A CD1   
2237 C  CD2   . LEU A 165 ? 0.1681 0.2560 0.3751 -0.0070 0.0599  -0.0750 165 LEU A CD2   
2249 N  N     . LEU A 166 ? 0.2000 0.1845 0.4649 -0.0045 0.0270  0.0130  166 LEU A N     
2250 C  CA    . LEU A 166 ? 0.1916 0.2202 0.4346 -0.0074 -0.0119 0.0383  166 LEU A CA    
2251 C  C     . LEU A 166 ? 0.2043 0.2116 0.4844 -0.0097 -0.0820 0.0433  166 LEU A C     
2252 O  O     . LEU A 166 ? 0.2597 0.1901 0.5275 0.0034  -0.0478 0.0194  166 LEU A O     
2253 C  CB    . LEU A 166 ? 0.1817 0.2370 0.4781 0.0056  -0.0696 0.0517  166 LEU A CB    
2254 C  CG    . LEU A 166 ? 0.1873 0.2351 0.5738 -0.0237 -0.0671 0.0174  166 LEU A CG    
2255 C  CD1   . LEU A 166 ? 0.1644 0.2636 0.6085 -0.0226 -0.0210 -0.0107 166 LEU A CD1   
2256 C  CD2   . LEU A 166 ? 0.2213 0.2466 0.5620 -0.0110 -0.0259 0.0946  166 LEU A CD2   
2268 N  N     . ASP A 167 ? 0.1677 0.2284 0.5786 -0.0215 -0.0406 0.0394  167 ASP A N     
2269 C  CA    . ASP A 167 ? 0.1835 0.2277 0.5494 -0.0188 -0.0853 -0.0357 167 ASP A CA    
2270 C  C     . ASP A 167 ? 0.2599 0.2200 0.6261 -0.0198 -0.0762 -0.0447 167 ASP A C     
2271 O  O     . ASP A 167 ? 0.2938 0.2217 0.8335 -0.0039 -0.0394 -0.0434 167 ASP A O     
2272 C  CB    . ASP A 167 ? 0.1661 0.2719 0.5695 -0.0136 -0.0538 0.0829  167 ASP A CB    
2273 C  CG    . ASP A 167 ? 0.1957 0.3213 0.6535 0.0085  0.0142  0.0765  167 ASP A CG    
2274 O  OD1   . ASP A 167 ? 0.2742 0.3451 0.6592 0.0482  0.0202  0.0834  167 ASP A OD1   
2275 O  OD2   . ASP A 167 ? 0.1936 0.3166 0.5832 -0.0234 0.0547  0.1020  167 ASP A OD2   
2280 N  N     . ARG A 168 ? 0.3165 0.2533 0.6016 -0.0217 -0.0619 -0.0446 168 ARG A N     
2281 C  CA    . ARG A 168 ? 0.4325 0.2441 0.5825 -0.0199 -0.1145 -0.0712 168 ARG A CA    
2282 C  C     . ARG A 168 ? 0.4781 0.2217 0.5883 -0.0568 -0.1468 -0.0510 168 ARG A C     
2283 O  O     . ARG A 168 ? 0.5232 0.2511 0.7155 -0.0380 -0.1920 -0.0420 168 ARG A O     
2284 C  CB    . ARG A 168 ? 0.4862 0.3387 0.5687 -0.0234 -0.0740 -0.0637 168 ARG A CB    
2285 C  CG    . ARG A 168 ? 0.5045 0.3738 0.5035 -0.0536 0.0301  0.0689  168 ARG A CG    
2286 C  CD    . ARG A 168 ? 0.5024 0.3483 0.6218 -0.1029 0.1138  0.0983  168 ARG A CD    
2287 N  NE    . ARG A 168 ? 0.5433 0.4224 0.6845 -0.0563 0.0663  0.1181  168 ARG A NE    
2288 C  CZ    . ARG A 168 ? 0.6222 0.5056 0.7624 0.0481  0.0336  0.0394  168 ARG A CZ    
2289 N  NH1   . ARG A 168 ? 0.6344 0.5284 0.7517 0.0770  0.0427  -0.0279 168 ARG A NH1   
2290 N  NH2   . ARG A 168 ? 0.6572 0.4957 0.7713 0.0682  0.0164  -0.0810 168 ARG A NH2   
2304 N  N     . LEU A 169 ? 0.4633 0.1901 0.5205 -0.0903 -0.1124 -0.0049 169 LEU A N     
2305 C  CA    . LEU A 169 ? 0.4132 0.2363 0.5434 -0.0751 -0.0914 0.0120  169 LEU A CA    
2306 C  C     . LEU A 169 ? 0.3575 0.2300 0.4831 -0.0511 -0.0373 -0.0594 169 LEU A C     
2307 O  O     . LEU A 169 ? 0.3928 0.2940 0.5777 -0.0164 -0.0122 -0.0172 169 LEU A O     
2308 C  CB    . LEU A 169 ? 0.4196 0.3430 0.5636 -0.0588 -0.0801 -0.0514 169 LEU A CB    
2309 C  CG    . LEU A 169 ? 0.3588 0.3971 0.6655 -0.1387 0.0491  -0.0898 169 LEU A CG    
2310 C  CD1   . LEU A 169 ? 0.3332 0.4349 0.7359 -0.1717 0.0412  -0.1104 169 LEU A CD1   
2311 C  CD2   . LEU A 169 ? 0.3474 0.3677 0.6745 -0.1632 0.1261  -0.0630 169 LEU A CD2   
2323 N  N     . ALA A 170 ? 0.3041 0.2000 0.5881 -0.0368 -0.0438 0.0364  170 ALA A N     
2324 C  CA    . ALA A 170 ? 0.2440 0.1965 0.6189 -0.0560 -0.0566 0.0087  170 ALA A CA    
2325 C  C     . ALA A 170 ? 0.2187 0.1670 0.5959 -0.0060 -0.0248 0.0055  170 ALA A C     
2326 O  O     . ALA A 170 ? 0.2491 0.1886 0.5112 -0.0652 -0.0362 -0.0514 170 ALA A O     
2327 C  CB    . ALA A 170 ? 0.2583 0.2216 0.6610 -0.0691 -0.0579 0.0303  170 ALA A CB    
2333 N  N     . PHE A 171 ? 0.1482 0.1494 0.4512 -0.0282 -0.0163 0.0648  171 PHE A N     
2334 C  CA    . PHE A 171 ? 0.1548 0.1654 0.5293 -0.0179 0.0241  0.0532  171 PHE A CA    
2335 C  C     . PHE A 171 ? 0.1327 0.1513 0.3708 -0.0442 0.0356  -0.0005 171 PHE A C     
2336 O  O     . PHE A 171 ? 0.1305 0.1892 0.3731 -0.0417 0.0646  -0.0079 171 PHE A O     
2337 C  CB    . PHE A 171 ? 0.1799 0.2139 0.4380 -0.0102 0.0457  0.0726  171 PHE A CB    
2338 C  CG    . PHE A 171 ? 0.1753 0.2081 0.3398 -0.0298 0.0568  0.0218  171 PHE A CG    
2339 C  CD1   . PHE A 171 ? 0.1626 0.1841 0.3639 -0.0459 0.0726  0.0133  171 PHE A CD1   
2340 C  CD2   . PHE A 171 ? 0.1536 0.1718 0.3558 -0.0509 0.0238  -0.0128 171 PHE A CD2   
2341 C  CE1   . PHE A 171 ? 0.1502 0.2014 0.3517 -0.0425 0.0490  0.0337  171 PHE A CE1   
2342 C  CE2   . PHE A 171 ? 0.1536 0.1991 0.3705 -0.0033 0.0258  -0.0253 171 PHE A CE2   
2343 C  CZ    . PHE A 171 ? 0.1603 0.2104 0.3492 -0.0350 0.0328  0.0043  171 PHE A CZ    
2353 N  N     . ASP A 172 ? 0.1420 0.1647 0.3737 -0.0241 0.0540  0.0412  172 ASP A N     
2354 C  CA    . ASP A 172 ? 0.1451 0.1771 0.3907 -0.0402 0.0634  0.0272  172 ASP A CA    
2355 C  C     . ASP A 172 ? 0.1384 0.1891 0.3043 -0.0084 0.0315  -0.0060 172 ASP A C     
2356 O  O     . ASP A 172 ? 0.1164 0.1685 0.3770 -0.0029 0.0027  0.0318  172 ASP A O     
2357 C  CB    . ASP A 172 ? 0.1644 0.1972 0.3587 -0.0448 -0.0225 -0.0028 172 ASP A CB    
2358 C  CG    . ASP A 172 ? 0.2260 0.1879 0.4549 0.0090  -0.0260 -0.0668 172 ASP A CG    
2359 O  OD1   . ASP A 172 ? 0.2167 0.1742 0.4184 -0.0274 -0.0026 0.0219  172 ASP A OD1   
2360 O  OD2   . ASP A 172 ? 0.2557 0.1930 0.4554 -0.0353 -0.0622 -0.0143 172 ASP A OD2   
2365 N  N     . VAL A 173 ? 0.1110 0.1567 0.3688 -0.0149 -0.0052 0.0345  173 VAL A N     
2366 C  CA    . VAL A 173 ? 0.1246 0.1373 0.3499 0.0047  -0.0011 0.0126  173 VAL A CA    
2367 C  C     . VAL A 173 ? 0.1253 0.1687 0.3542 0.0230  0.0001  0.0097  173 VAL A C     
2368 O  O     . VAL A 173 ? 0.1342 0.1802 0.4264 0.0081  0.0254  0.0394  173 VAL A O     
2369 C  CB    . VAL A 173 ? 0.1318 0.1842 0.4153 -0.0032 -0.0190 0.0334  173 VAL A CB    
2370 C  CG1   . VAL A 173 ? 0.1727 0.2195 0.4804 0.0161  -0.0615 0.0067  173 VAL A CG1   
2371 C  CG2   . VAL A 173 ? 0.1094 0.1955 0.4077 -0.0240 0.0184  -0.0109 173 VAL A CG2   
2381 N  N     . VAL A 174 ? 0.1171 0.1436 0.4456 0.0089  0.0307  0.0108  174 VAL A N     
2382 C  CA    . VAL A 174 ? 0.1312 0.1323 0.4576 -0.0110 0.0121  0.0432  174 VAL A CA    
2383 C  C     . VAL A 174 ? 0.1343 0.1894 0.3639 0.0206  0.0046  0.0096  174 VAL A C     
2384 O  O     . VAL A 174 ? 0.1506 0.1700 0.4053 0.0118  -0.0016 0.0744  174 VAL A O     
2385 C  CB    . VAL A 174 ? 0.1336 0.1602 0.4241 0.0050  0.0393  0.0265  174 VAL A CB    
2386 C  CG1   . VAL A 174 ? 0.1336 0.1782 0.5070 0.0088  0.0405  0.0335  174 VAL A CG1   
2387 C  CG2   . VAL A 174 ? 0.2025 0.2205 0.4786 0.0103  0.0729  0.0075  174 VAL A CG2   
2397 N  N     . GLN A 175 ? 0.1259 0.1972 0.4043 0.0320  0.0139  0.0195  175 GLN A N     
2398 C  CA    . GLN A 175 ? 0.1278 0.2078 0.4708 0.0121  -0.0034 0.0462  175 GLN A CA    
2399 C  C     . GLN A 175 ? 0.1434 0.1635 0.3750 0.0058  0.0068  0.0686  175 GLN A C     
2400 O  O     . GLN A 175 ? 0.1563 0.1681 0.4273 0.0130  0.0017  0.0145  175 GLN A O     
2401 C  CB    . GLN A 175 ? 0.1745 0.3400 0.4602 0.0357  -0.0069 -0.0132 175 GLN A CB    
2402 C  CG    . GLN A 175 ? 0.2707 0.4669 0.5117 0.0561  0.0550  0.0036  175 GLN A CG    
2403 C  CD    . GLN A 175 ? 0.3586 0.6005 0.5802 0.0421  -0.0042 -0.0506 175 GLN A CD    
2404 O  OE1   . GLN A 175 ? 0.4187 0.6583 0.6657 0.0378  -0.0358 -0.1924 175 GLN A OE1   
2405 N  NE2   . GLN A 175 ? 0.3682 0.6203 0.4049 0.0396  0.0417  -0.0084 175 GLN A NE2   
2414 N  N     . LEU A 176 ? 0.1478 0.1425 0.3797 0.0010  0.0119  0.0583  176 LEU A N     
2415 C  CA    . LEU A 176 ? 0.1518 0.1566 0.4217 0.0093  0.0539  0.0406  176 LEU A CA    
2416 C  C     . LEU A 176 ? 0.1472 0.1693 0.3849 0.0072  0.0268  0.0752  176 LEU A C     
2417 O  O     . LEU A 176 ? 0.1373 0.1816 0.5180 0.0031  0.0101  0.0248  176 LEU A O     
2418 C  CB    . LEU A 176 ? 0.1904 0.1540 0.5062 0.0187  0.0162  0.0676  176 LEU A CB    
2419 C  CG    . LEU A 176 ? 0.2136 0.2326 0.4529 -0.0291 0.0392  0.0841  176 LEU A CG    
2420 C  CD1   . LEU A 176 ? 0.2085 0.2727 0.4002 -0.0638 0.0112  0.0144  176 LEU A CD1   
2421 C  CD2   . LEU A 176 ? 0.2460 0.3106 0.4358 -0.0393 0.0232  0.0932  176 LEU A CD2   
2433 N  N     . PRO A 177 ? 0.1709 0.2044 0.3961 0.0201  0.0123  0.0610  177 PRO A N     
2434 C  CA    . PRO A 177 ? 0.1997 0.2400 0.3707 0.0082  0.0279  0.0848  177 PRO A CA    
2435 C  C     . PRO A 177 ? 0.1887 0.2322 0.3099 0.0005  0.0060  0.0391  177 PRO A C     
2436 O  O     . PRO A 177 ? 0.1809 0.2673 0.3787 -0.0291 0.0251  0.0139  177 PRO A O     
2437 C  CB    . PRO A 177 ? 0.2012 0.2430 0.5222 0.0039  -0.0292 0.1343  177 PRO A CB    
2438 C  CG    . PRO A 177 ? 0.2049 0.2523 0.6221 0.0006  -0.0602 0.0627  177 PRO A CG    
2439 C  CD    . PRO A 177 ? 0.1919 0.2272 0.5228 0.0269  -0.0406 0.0424  177 PRO A CD    
2447 N  N     . PRO A 178 ? 0.1696 0.2083 0.4053 0.0239  0.0188  0.0294  178 PRO A N     
2448 C  CA    . PRO A 178 ? 0.1448 0.2349 0.3902 0.0308  0.0343  0.0709  178 PRO A CA    
2449 C  C     . PRO A 178 ? 0.1208 0.1900 0.3924 -0.0153 0.0230  0.0612  178 PRO A C     
2450 O  O     . PRO A 178 ? 0.1392 0.2047 0.4035 0.0164  0.0448  0.0799  178 PRO A O     
2451 C  CB    . PRO A 178 ? 0.1500 0.2788 0.4362 0.0656  0.0621  0.0502  178 PRO A CB    
2452 C  CG    . PRO A 178 ? 0.1699 0.2853 0.5243 0.0645  0.0610  0.0557  178 PRO A CG    
2453 C  CD    . PRO A 178 ? 0.1632 0.2565 0.4398 -0.0020 0.0762  0.0366  178 PRO A CD    
2461 N  N     . LEU A 179 ? 0.1427 0.1989 0.4027 0.0220  0.0403  0.0316  179 LEU A N     
2462 C  CA    . LEU A 179 ? 0.1338 0.2197 0.4131 0.0107  0.0610  -0.0107 179 LEU A CA    
2463 C  C     . LEU A 179 ? 0.1456 0.2462 0.3664 0.0555  0.0335  0.0371  179 LEU A C     
2464 O  O     . LEU A 179 ? 0.1879 0.2602 0.4740 0.0489  0.0209  0.0956  179 LEU A O     
2465 C  CB    . LEU A 179 ? 0.1648 0.2244 0.4263 -0.0082 0.0604  0.0306  179 LEU A CB    
2466 C  CG    . LEU A 179 ? 0.2191 0.2171 0.4547 -0.0212 0.0328  -0.0368 179 LEU A CG    
2467 C  CD1   . LEU A 179 ? 0.2676 0.2138 0.4465 0.0148  0.0777  -0.0041 179 LEU A CD1   
2468 C  CD2   . LEU A 179 ? 0.2054 0.2267 0.5300 -0.0373 0.1258  -0.0441 179 LEU A CD2   
2480 N  N     . ARG A 180 ? 0.1783 0.2666 0.3723 0.0800  0.0003  0.0647  180 ARG A N     
2481 C  CA    . ARG A 180 ? 0.2197 0.2861 0.4126 0.0740  0.0110  0.0978  180 ARG A CA    
2482 C  C     . ARG A 180 ? 0.2724 0.2827 0.4316 0.0951  -0.0027 0.1216  180 ARG A C     
2483 O  O     . ARG A 180 ? 0.2980 0.3085 0.5018 0.0726  -0.0334 0.1347  180 ARG A O     
2484 C  CB    . ARG A 180 ? 0.2143 0.3283 0.3373 0.0530  -0.0415 0.0904  180 ARG A CB    
2485 C  CG    . ARG A 180 ? 0.2362 0.3480 0.3728 0.0700  -0.0275 0.0425  180 ARG A CG    
2486 C  CD    . ARG A 180 ? 0.2932 0.4111 0.3983 0.0951  -0.0453 -0.1448 180 ARG A CD    
2487 N  NE    . ARG A 180 ? 0.4110 0.4357 0.5127 0.1386  0.0064  -0.0502 180 ARG A NE    
2488 C  CZ    . ARG A 180 ? 0.4665 0.4360 0.4479 0.2135  -0.0866 0.0136  180 ARG A CZ    
2489 N  NH1   . ARG A 180 ? 0.4939 0.4632 0.6266 0.1657  -0.0676 0.0301  180 ARG A NH1   
2490 N  NH2   . ARG A 180 ? 0.5342 0.4494 0.4378 0.2641  -0.1866 -0.1670 180 ARG A NH2   
2504 N  N     . GLU A 181 ? 0.2412 0.2753 0.3785 0.0218  0.0369  0.1285  181 GLU A N     
2505 C  CA    . GLU A 181 ? 0.2792 0.2984 0.4066 0.0155  0.0113  0.0973  181 GLU A CA    
2506 C  C     . GLU A 181 ? 0.3099 0.2749 0.5336 -0.0108 0.0276  0.0835  181 GLU A C     
2507 O  O     . GLU A 181 ? 0.3616 0.3250 0.5752 0.0079  0.1124  0.1064  181 GLU A O     
2508 C  CB    . GLU A 181 ? 0.3197 0.3401 0.5083 0.0199  0.0481  0.1465  181 GLU A CB    
2509 C  CG    . GLU A 181 ? 0.3718 0.4240 0.5138 0.0605  0.1168  0.1447  181 GLU A CG    
2510 C  CD    . GLU A 181 ? 0.4376 0.5111 0.6306 0.0604  0.1749  0.0799  181 GLU A CD    
2511 O  OE1   . GLU A 181 ? 0.4755 0.5566 0.5486 0.0749  0.1697  0.0839  181 GLU A OE1   
2512 O  OE2   . GLU A 181 ? 0.4660 0.5621 0.7242 0.0784  0.1943  0.0184  181 GLU A OE2   
2519 N  N     . ARG A 182 ? 0.3244 0.3058 0.5705 0.0259  0.0743  0.0693  182 ARG A N     
2520 C  CA    . ARG A 182 ? 0.3292 0.3056 0.5998 0.0325  0.0842  0.0836  182 ARG A CA    
2521 C  C     . ARG A 182 ? 0.3253 0.2541 0.5307 0.0463  0.0274  0.1188  182 ARG A C     
2522 O  O     . ARG A 182 ? 0.3071 0.2115 0.4679 0.0455  -0.0088 0.0720  182 ARG A O     
2523 C  CB    . ARG A 182 ? 0.3084 0.3868 0.5225 0.0316  0.0239  -0.1164 182 ARG A CB    
2524 C  CG    . ARG A 182 ? 0.2854 0.4667 0.5524 0.0333  0.1171  -0.1053 182 ARG A CG    
2525 C  CD    . ARG A 182 ? 0.2508 0.4228 0.4530 -0.0225 0.0967  -0.2170 182 ARG A CD    
2526 N  NE    . ARG A 182 ? 0.2587 0.4789 0.6283 0.0034  -0.0134 -0.0789 182 ARG A NE    
2527 C  CZ    . ARG A 182 ? 0.2793 0.4865 0.6293 0.0108  0.0159  0.0007  182 ARG A CZ    
2528 N  NH1   . ARG A 182 ? 0.3063 0.5475 0.7590 0.0427  -0.0528 -0.0256 182 ARG A NH1   
2529 N  NH2   . ARG A 182 ? 0.2898 0.4877 0.7123 0.0051  0.0421  0.0411  182 ARG A NH2   
2543 N  N     . GLU A 183 ? 0.3450 0.3090 0.6027 0.0372  0.0265  0.1303  183 GLU A N     
2544 C  CA    . GLU A 183 ? 0.3918 0.4125 0.6258 0.0928  -0.0109 0.1135  183 GLU A CA    
2545 C  C     . GLU A 183 ? 0.3211 0.3512 0.5826 0.0393  -0.0959 0.0774  183 GLU A C     
2546 O  O     . GLU A 183 ? 0.3445 0.3563 0.6157 0.0191  -0.0999 0.1284  183 GLU A O     
2547 C  CB    . GLU A 183 ? 0.4829 0.5425 0.5821 0.1406  -0.0338 0.0189  183 GLU A CB    
2548 C  CG    . GLU A 183 ? 0.5549 0.6261 0.5934 0.1224  0.0065  -0.0122 183 GLU A CG    
2549 C  CD    . GLU A 183 ? 0.6237 0.6716 0.6631 0.1414  0.0535  -0.0084 183 GLU A CD    
2550 O  OE1   . GLU A 183 ? 0.6369 0.6805 0.5738 0.1583  0.0076  0.0157  183 GLU A OE1   
2551 O  OE2   . GLU A 183 ? 0.6518 0.6782 0.7493 0.1386  0.1259  -0.0050 183 GLU A OE2   
2554 N  N     . SER A 184 ? 0.2657 0.2748 0.6847 -0.0157 -0.1102 0.1740  184 SER A N     
2555 C  CA    . SER A 184 ? 0.2520 0.2990 0.8485 -0.0064 -0.0709 0.1239  184 SER A CA    
2556 C  C     . SER A 184 ? 0.2256 0.3359 0.7308 0.0539  -0.0541 0.0186  184 SER A C     
2557 O  O     . SER A 184 ? 0.2834 0.3936 0.8447 0.0975  -0.0496 -0.1477 184 SER A O     
2558 C  CB    . SER A 184 ? 0.2743 0.3073 0.8768 -0.0497 -0.0721 0.1681  184 SER A CB    
2559 O  OG    . SER A 184 ? 0.3032 0.3543 0.9948 -0.0245 -0.1050 0.2140  184 SER A OG    
2565 N  N     . ASP A 185 ? 0.1779 0.2930 0.5892 0.0233  0.0979  0.0405  185 ASP A N     
2566 C  CA    . ASP A 185 ? 0.1538 0.3437 0.5327 0.0106  0.0434  -0.0827 185 ASP A CA    
2567 C  C     . ASP A 185 ? 0.1595 0.3471 0.3980 -0.0126 0.0491  -0.0857 185 ASP A C     
2568 O  O     . ASP A 185 ? 0.1697 0.3760 0.3890 -0.0189 0.0294  -0.0518 185 ASP A O     
2569 C  CB    . ASP A 185 ? 0.1475 0.3544 0.5171 -0.0154 0.0377  -0.0992 185 ASP A CB    
2570 C  CG    . ASP A 185 ? 0.1980 0.3695 0.6906 0.0088  0.0383  -0.1608 185 ASP A CG    
2571 O  OD1   . ASP A 185 ? 0.2201 0.3578 0.8178 0.0261  0.0360  -0.1013 185 ASP A OD1   
2572 O  OD2   . ASP A 185 ? 0.2079 0.3836 0.7384 -0.0331 0.0237  -0.1675 185 ASP A OD2   
2577 N  N     . ILE A 186 ? 0.1823 0.2771 0.4175 -0.0322 0.0363  -0.0808 186 ILE A N     
2578 C  CA    . ILE A 186 ? 0.1671 0.2306 0.4194 0.0147  -0.0167 -0.0600 186 ILE A CA    
2579 C  C     . ILE A 186 ? 0.1741 0.1619 0.2870 0.0149  0.0179  0.0454  186 ILE A C     
2580 O  O     . ILE A 186 ? 0.1598 0.1454 0.3230 0.0132  0.0372  0.0366  186 ILE A O     
2581 C  CB    . ILE A 186 ? 0.1316 0.2512 0.3703 0.0250  0.0383  0.0103  186 ILE A CB    
2582 C  CG1   . ILE A 186 ? 0.1765 0.2561 0.4107 0.0596  0.0349  -0.0004 186 ILE A CG1   
2583 C  CG2   . ILE A 186 ? 0.1436 0.2279 0.3583 0.0601  0.0216  -0.0265 186 ILE A CG2   
2584 C  CD1   . ILE A 186 ? 0.1754 0.2482 0.4114 0.0689  0.0439  -0.0415 186 ILE A CD1   
2596 N  N     . MET A 187 ? 0.2170 0.1829 0.3251 0.0287  0.0554  0.0297  187 MET A N     
2597 C  CA    . MET A 187 ? 0.2483 0.1552 0.2537 0.0509  0.0199  0.0100  187 MET A CA    
2598 C  C     . MET A 187 ? 0.2397 0.1294 0.3352 -0.0180 0.0236  0.0594  187 MET A C     
2599 O  O     . MET A 187 ? 0.2169 0.1501 0.3625 -0.0007 0.0455  0.0442  187 MET A O     
2600 C  CB    . MET A 187 ? 0.3157 0.2369 0.3672 0.1072  -0.0202 0.0274  187 MET A CB    
2601 C  CG    . MET A 187 ? 0.3072 0.2493 0.3784 0.1038  -0.0350 0.0578  187 MET A CG    
2602 S  SD    . MET A 187 ? 0.2420 0.2878 0.3641 0.0851  -0.0152 0.0185  187 MET A SD    
2603 C  CE    . MET A 187 ? 0.2793 0.3189 0.3549 0.1715  -0.0528 -0.0128 187 MET A CE    
2613 N  N     . LEU A 188 ? 0.2679 0.1397 0.4151 -0.0220 0.0808  0.0336  188 LEU A N     
2614 C  CA    . LEU A 188 ? 0.2546 0.1572 0.3878 -0.0493 0.0332  0.0073  188 LEU A CA    
2615 C  C     . LEU A 188 ? 0.1676 0.1613 0.3933 -0.0413 0.0499  -0.0145 188 LEU A C     
2616 O  O     . LEU A 188 ? 0.1691 0.1488 0.4117 -0.0221 0.0484  0.0228  188 LEU A O     
2617 C  CB    . LEU A 188 ? 0.3095 0.1985 0.5163 -0.0508 0.0361  0.0078  188 LEU A CB    
2618 C  CG    . LEU A 188 ? 0.3557 0.2845 0.7555 -0.0450 0.0941  0.0286  188 LEU A CG    
2619 C  CD1   . LEU A 188 ? 0.4047 0.3942 0.8419 0.0371  0.1189  0.0363  188 LEU A CD1   
2620 C  CD2   . LEU A 188 ? 0.4009 0.3439 0.8589 -0.0390 0.0436  -0.0202 188 LEU A CD2   
2632 N  N     . MET A 189 ? 0.1624 0.1372 0.3730 -0.0229 0.0754  -0.0498 189 MET A N     
2633 C  CA    . MET A 189 ? 0.1306 0.1439 0.3406 0.0008  0.0039  -0.0405 189 MET A CA    
2634 C  C     . MET A 189 ? 0.1410 0.1451 0.3434 0.0219  -0.0097 -0.0737 189 MET A C     
2635 O  O     . MET A 189 ? 0.1496 0.1393 0.3270 0.0158  -0.0210 -0.0237 189 MET A O     
2636 C  CB    . MET A 189 ? 0.1106 0.2292 0.4198 0.0048  0.0258  0.0045  189 MET A CB    
2637 C  CG    . MET A 189 ? 0.1812 0.2842 0.6495 0.0228  0.0594  -0.0217 189 MET A CG    
2638 S  SD    . MET A 189 ? 0.2547 0.4002 0.8289 0.0764  0.0779  -0.0351 189 MET A SD    
2639 C  CE    . MET A 189 ? 0.3217 0.3968 0.9190 0.1173  0.0523  -0.0280 189 MET A CE    
2649 N  N     . ALA A 190 ? 0.1569 0.0873 0.2916 -0.0086 0.0399  -0.0131 190 ALA A N     
2650 C  CA    . ALA A 190 ? 0.1352 0.0868 0.3284 -0.0042 0.0162  -0.0282 190 ALA A CA    
2651 C  C     . ALA A 190 ? 0.1236 0.0780 0.2680 -0.0206 -0.0023 0.0057  190 ALA A C     
2652 O  O     . ALA A 190 ? 0.1348 0.0856 0.2968 -0.0182 0.0319  -0.0094 190 ALA A O     
2653 C  CB    . ALA A 190 ? 0.1296 0.0971 0.3049 -0.0014 0.0123  -0.0359 190 ALA A CB    
2659 N  N     . GLU A 191 ? 0.1494 0.1072 0.2498 -0.0100 0.0395  -0.0151 191 GLU A N     
2660 C  CA    . GLU A 191 ? 0.1824 0.0908 0.2610 -0.0214 0.0205  -0.0478 191 GLU A CA    
2661 C  C     . GLU A 191 ? 0.1681 0.0961 0.3154 -0.0110 0.0156  -0.0548 191 GLU A C     
2662 O  O     . GLU A 191 ? 0.1789 0.1058 0.3346 0.0155  -0.0078 -0.0192 191 GLU A O     
2663 C  CB    . GLU A 191 ? 0.2196 0.1207 0.4305 -0.0072 0.1109  -0.0169 191 GLU A CB    
2666 N  N     . TYR A 192 ? 0.1353 0.0999 0.3538 -0.0161 0.0205  0.0022  192 TYR A N     
2667 C  CA    . TYR A 192 ? 0.1374 0.1090 0.3309 0.0004  0.0249  -0.0427 192 TYR A CA    
2668 C  C     . TYR A 192 ? 0.1308 0.1095 0.3321 0.0002  -0.0005 -0.0434 192 TYR A C     
2669 O  O     . TYR A 192 ? 0.1334 0.1394 0.3205 0.0139  0.0113  -0.0288 192 TYR A O     
2670 C  CB    . TYR A 192 ? 0.1676 0.1384 0.3020 -0.0284 0.0157  -0.0277 192 TYR A CB    
2671 C  CG    . TYR A 192 ? 0.2126 0.2394 0.3871 -0.0738 -0.0289 -0.0104 192 TYR A CG    
2672 C  CD1   . TYR A 192 ? 0.3140 0.3853 0.4697 -0.0021 -0.0924 -0.0943 192 TYR A CD1   
2673 C  CD2   . TYR A 192 ? 0.2446 0.2897 0.3743 -0.0594 -0.0902 -0.0133 192 TYR A CD2   
2674 C  CE1   . TYR A 192 ? 0.3351 0.4830 0.4007 0.0478  -0.1293 -0.0501 192 TYR A CE1   
2675 C  CE2   . TYR A 192 ? 0.2948 0.3950 0.4451 -0.0148 -0.1293 0.0160  192 TYR A CE2   
2676 C  CZ    . TYR A 192 ? 0.3519 0.5102 0.4763 0.0408  -0.1782 -0.0267 192 TYR A CZ    
2677 O  OH    . TYR A 192 ? 0.4439 0.5661 0.6101 0.0723  -0.2140 -0.0151 192 TYR A OH    
2687 N  N     . PHE A 193 ? 0.1288 0.0898 0.2605 0.0108  0.0272  -0.0164 193 PHE A N     
2688 C  CA    . PHE A 193 ? 0.1491 0.0820 0.3022 0.0216  -0.0005 0.0036  193 PHE A CA    
2689 C  C     . PHE A 193 ? 0.1497 0.0934 0.3038 0.0309  -0.0056 -0.0293 193 PHE A C     
2690 O  O     . PHE A 193 ? 0.1426 0.1112 0.3267 0.0165  0.0094  -0.0154 193 PHE A O     
2691 C  CB    . PHE A 193 ? 0.1644 0.1053 0.3087 0.0227  0.0063  -0.0014 193 PHE A CB    
2692 C  CG    . PHE A 193 ? 0.1629 0.1407 0.3720 0.0273  -0.0131 -0.0305 193 PHE A CG    
2693 C  CD1   . PHE A 193 ? 0.1320 0.2005 0.4247 0.0231  0.0040  -0.1079 193 PHE A CD1   
2694 C  CD2   . PHE A 193 ? 0.1522 0.1364 0.3468 0.0127  0.0013  -0.0411 193 PHE A CD2   
2695 C  CE1   . PHE A 193 ? 0.1637 0.2190 0.4827 0.0500  -0.0508 -0.1103 193 PHE A CE1   
2696 C  CE2   . PHE A 193 ? 0.1485 0.1585 0.3508 0.0216  0.0140  -0.0087 193 PHE A CE2   
2697 C  CZ    . PHE A 193 ? 0.1325 0.1660 0.4521 0.0197  -0.0163 -0.0776 193 PHE A CZ    
2707 N  N     . ALA A 194 ? 0.1356 0.0956 0.2558 0.0162  0.0175  0.0056  194 ALA A N     
2708 C  CA    . ALA A 194 ? 0.1125 0.1351 0.2697 0.0235  0.0396  -0.0163 194 ALA A CA    
2709 C  C     . ALA A 194 ? 0.1294 0.1253 0.2486 0.0122  0.0119  0.0251  194 ALA A C     
2710 O  O     . ALA A 194 ? 0.1644 0.1075 0.2620 0.0167  0.0204  -0.0064 194 ALA A O     
2711 C  CB    . ALA A 194 ? 0.1128 0.0914 0.2946 -0.0024 0.0298  -0.0387 194 ALA A CB    
2717 N  N     . ILE A 195 ? 0.1286 0.1108 0.2971 -0.0115 0.0462  -0.0059 195 ILE A N     
2718 C  CA    . ILE A 195 ? 0.1444 0.1214 0.3140 0.0111  0.0284  -0.0146 195 ILE A CA    
2719 C  C     . ILE A 195 ? 0.1499 0.1201 0.2749 -0.0098 -0.0024 -0.0302 195 ILE A C     
2720 O  O     . ILE A 195 ? 0.1901 0.1383 0.3222 0.0063  0.0435  -0.0069 195 ILE A O     
2721 C  CB    . ILE A 195 ? 0.1361 0.1242 0.3589 0.0227  0.0315  -0.0384 195 ILE A CB    
2722 C  CG1   . ILE A 195 ? 0.1513 0.1297 0.3217 0.0187  0.0498  -0.0416 195 ILE A CG1   
2723 C  CG2   . ILE A 195 ? 0.1666 0.1156 0.3585 0.0186  0.0486  -0.0491 195 ILE A CG2   
2724 C  CD1   . ILE A 195 ? 0.1742 0.1093 0.4100 0.0082  0.0534  -0.0203 195 ILE A CD1   
2736 N  N     . GLN A 196 ? 0.1806 0.1298 0.2723 0.0092  0.0088  -0.0238 196 GLN A N     
2737 C  CA    . GLN A 196 ? 0.1804 0.1605 0.2966 0.0141  0.0129  -0.0575 196 GLN A CA    
2738 C  C     . GLN A 196 ? 0.1772 0.1539 0.3132 0.0202  -0.0267 -0.0049 196 GLN A C     
2739 O  O     . GLN A 196 ? 0.2053 0.1431 0.3043 0.0218  0.0046  -0.0060 196 GLN A O     
2740 C  CB    . GLN A 196 ? 0.1397 0.2211 0.3992 -0.0377 0.0070  -0.0568 196 GLN A CB    
2743 N  N     . MET A 197 ? 0.1526 0.1307 0.2674 0.0047  -0.0307 -0.0008 197 MET A N     
2744 C  CA    . MET A 197 ? 0.1470 0.1152 0.3480 0.0015  -0.0568 -0.0251 197 MET A CA    
2745 C  C     . MET A 197 ? 0.1766 0.1104 0.3066 0.0021  0.0076  -0.0023 197 MET A C     
2746 O  O     . MET A 197 ? 0.1993 0.1180 0.3531 0.0103  0.0408  0.0212  197 MET A O     
2747 C  CB    . MET A 197 ? 0.1420 0.0931 0.3238 0.0204  -0.0301 -0.0176 197 MET A CB    
2748 C  CG    . MET A 197 ? 0.1873 0.0983 0.3106 0.0144  0.0088  -0.0396 197 MET A CG    
2749 S  SD    . MET A 197 ? 0.1863 0.1183 0.3599 0.0097  -0.0071 0.0194  197 MET A SD    
2750 C  CE    . MET A 197 ? 0.2162 0.1408 0.3993 0.0123  0.0040  0.0132  197 MET A CE    
2760 N  N     . CYS A 198 ? 0.1784 0.1231 0.2497 0.0327  0.0218  0.0051  198 CYS A N     
2761 C  CA    . CYS A 198 ? 0.1716 0.1219 0.2786 0.0131  0.0299  0.0163  198 CYS A CA    
2762 C  C     . CYS A 198 ? 0.2132 0.1344 0.2869 0.0013  0.0028  0.0094  198 CYS A C     
2763 O  O     . CYS A 198 ? 0.2252 0.1678 0.3073 -0.0146 0.0501  0.0134  198 CYS A O     
2764 C  CB    . CYS A 198 ? 0.1580 0.1571 0.2782 0.0465  0.0261  0.0027  198 CYS A CB    
2765 S  SG    . CYS A 198 ? 0.1850 0.1670 0.3554 0.0534  0.0147  0.0139  198 CYS A SG    
2771 N  N     . ARG A 199 ? 0.2184 0.1376 0.2936 0.0176  0.0429  -0.0036 199 ARG A N     
2772 C  CA    . ARG A 199 ? 0.2401 0.1319 0.2927 0.0169  0.0092  -0.0162 199 ARG A CA    
2773 C  C     . ARG A 199 ? 0.2618 0.1496 0.3377 0.0407  0.0422  -0.0264 199 ARG A C     
2774 O  O     . ARG A 199 ? 0.2836 0.1837 0.3791 0.0602  0.0464  0.0068  199 ARG A O     
2775 C  CB    . ARG A 199 ? 0.2528 0.1775 0.2600 0.0591  -0.0079 -0.0104 199 ARG A CB    
2776 C  CG    . ARG A 199 ? 0.2366 0.1572 0.3603 0.0520  -0.0284 -0.0365 199 ARG A CG    
2777 C  CD    . ARG A 199 ? 0.2567 0.1700 0.4282 0.0687  0.0426  0.0222  199 ARG A CD    
2778 N  NE    . ARG A 199 ? 0.2120 0.1483 0.3638 0.0280  0.0717  0.0093  199 ARG A NE    
2779 C  CZ    . ARG A 199 ? 0.1871 0.1262 0.4037 0.0265  0.0592  -0.0366 199 ARG A CZ    
2780 N  NH1   . ARG A 199 ? 0.1852 0.1434 0.3976 0.0593  0.0196  -0.0122 199 ARG A NH1   
2781 N  NH2   . ARG A 199 ? 0.1824 0.1515 0.3874 0.0543  0.0409  -0.0226 199 ARG A NH2   
2795 N  N     . GLU A 200 ? 0.3039 0.1259 0.3369 0.0230  0.0392  0.0267  200 GLU A N     
2796 C  CA    . GLU A 200 ? 0.3203 0.1437 0.3123 0.0154  0.0373  0.0097  200 GLU A CA    
2797 C  C     . GLU A 200 ? 0.3269 0.1242 0.3649 0.0199  0.0546  0.0294  200 GLU A C     
2798 O  O     . GLU A 200 ? 0.3402 0.2104 0.4017 -0.0073 0.0673  0.0193  200 GLU A O     
2799 C  CB    . GLU A 200 ? 0.3595 0.1441 0.3410 0.0258  0.0480  0.0176  200 GLU A CB    
2800 C  CG    . GLU A 200 ? 0.3717 0.1693 0.5259 -0.0222 0.0967  0.0765  200 GLU A CG    
2801 C  CD    . GLU A 200 ? 0.3970 0.2000 0.6346 0.0135  0.0367  0.0563  200 GLU A CD    
2802 O  OE1   . GLU A 200 ? 0.3767 0.1884 0.4907 0.0134  0.0096  -0.0140 200 GLU A OE1   
2803 O  OE2   . GLU A 200 ? 0.4278 0.2294 0.6444 0.0073  0.0222  0.0836  200 GLU A OE2   
2810 N  N     . ILE A 201 ? 0.3253 0.1345 0.3069 0.0213  0.0679  0.0195  201 ILE A N     
2811 C  CA    . ILE A 201 ? 0.2724 0.1598 0.2964 -0.0208 0.0339  0.0494  201 ILE A CA    
2812 C  C     . ILE A 201 ? 0.2568 0.1667 0.3599 -0.0146 0.0687  0.0061  201 ILE A C     
2813 O  O     . ILE A 201 ? 0.2693 0.2030 0.4254 -0.0003 0.0838  -0.0183 201 ILE A O     
2814 C  CB    . ILE A 201 ? 0.2832 0.1417 0.4304 -0.0391 0.0693  0.0131  201 ILE A CB    
2815 C  CG1   . ILE A 201 ? 0.2517 0.1767 0.3837 -0.0426 0.0773  -0.1033 201 ILE A CG1   
2816 C  CG2   . ILE A 201 ? 0.3474 0.1489 0.3583 0.0276  0.0155  0.0116  201 ILE A CG2   
2817 C  CD1   . ILE A 201 ? 0.2631 0.1864 0.4784 -0.0710 0.1385  -0.0504 201 ILE A CD1   
2829 N  N     . LYS A 202 ? 0.2533 0.1735 0.3439 -0.0071 0.0570  0.0234  202 LYS A N     
2830 C  CA    . LYS A 202 ? 0.2883 0.2021 0.3573 0.0273  0.1089  0.0391  202 LYS A CA    
2831 C  C     . LYS A 202 ? 0.2337 0.1703 0.3861 0.0061  0.0967  0.0071  202 LYS A C     
2832 O  O     . LYS A 202 ? 0.2772 0.2511 0.4695 0.0466  0.0841  -0.0039 202 LYS A O     
2833 C  CB    . LYS A 202 ? 0.3438 0.2884 0.3974 0.0375  0.1396  -0.0010 202 LYS A CB    
2834 C  CG    . LYS A 202 ? 0.4223 0.3689 0.3820 0.0842  0.1867  0.1323  202 LYS A CG    
2835 C  CD    . LYS A 202 ? 0.4686 0.4685 0.5907 0.1216  0.0834  0.0702  202 LYS A CD    
2836 C  CE    . LYS A 202 ? 0.5084 0.5465 0.7608 0.1481  0.0319  0.0493  202 LYS A CE    
2837 N  NZ    . LYS A 202 ? 0.5258 0.5722 0.8278 0.1449  -0.0092 0.0750  202 LYS A NZ    
2851 N  N     . LEU A 203 ? 0.2299 0.1553 0.3466 0.0143  0.0886  0.0046  203 LEU A N     
2852 C  CA    . LEU A 203 ? 0.1725 0.1955 0.3570 0.0158  0.0546  -0.0174 203 LEU A CA    
2853 C  C     . LEU A 203 ? 0.1568 0.1994 0.4216 0.0015  0.0480  0.0008  203 LEU A C     
2854 O  O     . LEU A 203 ? 0.1564 0.2026 0.4191 0.0022  0.0181  0.0159  203 LEU A O     
2855 C  CB    . LEU A 203 ? 0.1862 0.1894 0.4228 -0.0106 -0.0072 -0.0002 203 LEU A CB    
2856 C  CG    . LEU A 203 ? 0.2235 0.2140 0.4402 0.0161  -0.0301 -0.0064 203 LEU A CG    
2857 C  CD1   . LEU A 203 ? 0.2590 0.2608 0.4256 0.0073  -0.0177 -0.0322 203 LEU A CD1   
2858 C  CD2   . LEU A 203 ? 0.1970 0.2089 0.5458 -0.0187 -0.0111 -0.0388 203 LEU A CD2   
2870 N  N     . PRO A 204 ? 0.1889 0.2032 0.3042 0.0050  0.0175  -0.0192 204 PRO A N     
2871 C  CA    . PRO A 204 ? 0.1880 0.1877 0.3854 0.0121  0.0680  -0.0721 204 PRO A CA    
2872 C  C     . PRO A 204 ? 0.1677 0.1738 0.3391 0.0217  0.0633  -0.0243 204 PRO A C     
2873 O  O     . PRO A 204 ? 0.1960 0.1547 0.3323 -0.0145 0.0122  -0.0190 204 PRO A O     
2874 C  CB    . PRO A 204 ? 0.1725 0.2413 0.3990 0.0084  0.0649  -0.0416 204 PRO A CB    
2875 C  CG    . PRO A 204 ? 0.1762 0.2616 0.4636 0.0052  0.0376  -0.0238 204 PRO A CG    
2876 C  CD    . PRO A 204 ? 0.1605 0.2175 0.4007 -0.0004 0.0394  -0.0282 204 PRO A CD    
2884 N  N     . LEU A 205 ? 0.1595 0.1873 0.3646 0.0207  0.0409  -0.0209 205 LEU A N     
2885 C  CA    . LEU A 205 ? 0.1696 0.2117 0.3000 0.0530  0.0234  -0.0299 205 LEU A CA    
2886 C  C     . LEU A 205 ? 0.1711 0.2121 0.2760 0.0524  0.0155  -0.0436 205 LEU A C     
2887 O  O     . LEU A 205 ? 0.1823 0.2506 0.3846 0.0122  -0.0169 -0.0704 205 LEU A O     
2888 C  CB    . LEU A 205 ? 0.1985 0.1863 0.3444 0.0328  0.0060  -0.0509 205 LEU A CB    
2889 C  CG    . LEU A 205 ? 0.2687 0.2161 0.3609 0.0547  0.0140  -0.0294 205 LEU A CG    
2890 C  CD1   . LEU A 205 ? 0.2888 0.1736 0.4213 0.0492  0.0828  -0.0265 205 LEU A CD1   
2891 C  CD2   . LEU A 205 ? 0.3456 0.3111 0.5014 0.1039  -0.0426 -0.0338 205 LEU A CD2   
2903 N  N     . PHE A 206 ? 0.1369 0.1750 0.3547 0.0372  0.0440  -0.0065 206 PHE A N     
2904 C  CA    . PHE A 206 ? 0.1700 0.1569 0.3346 0.0348  0.0220  -0.0030 206 PHE A CA    
2905 C  C     . PHE A 206 ? 0.1589 0.1453 0.2513 0.0322  0.0031  0.0129  206 PHE A C     
2906 O  O     . PHE A 206 ? 0.1866 0.1429 0.3537 0.0136  0.0327  -0.0272 206 PHE A O     
2907 C  CB    . PHE A 206 ? 0.1773 0.1378 0.3394 0.0294  0.0167  0.0079  206 PHE A CB    
2908 C  CG    . PHE A 206 ? 0.1729 0.1832 0.3373 0.0650  0.0448  0.0021  206 PHE A CG    
2909 C  CD1   . PHE A 206 ? 0.1608 0.1771 0.3592 0.0627  0.0174  -0.0003 206 PHE A CD1   
2910 C  CD2   . PHE A 206 ? 0.2089 0.1732 0.3711 0.0486  0.0645  0.0146  206 PHE A CD2   
2911 C  CE1   . PHE A 206 ? 0.1676 0.2145 0.3732 0.0940  0.0085  0.0144  206 PHE A CE1   
2912 C  CE2   . PHE A 206 ? 0.2150 0.2061 0.3058 0.0674  0.0308  0.0290  206 PHE A CE2   
2913 C  CZ    . PHE A 206 ? 0.1731 0.1956 0.3713 0.0888  0.0080  -0.0147 206 PHE A CZ    
2923 N  N     . PRO A 207 ? 0.1500 0.1380 0.3620 0.0164  -0.0434 -0.0165 207 PRO A N     
2924 C  CA    . PRO A 207 ? 0.1925 0.1629 0.3631 0.0787  -0.0075 0.0000  207 PRO A CA    
2925 C  C     . PRO A 207 ? 0.2164 0.1432 0.3759 0.0710  -0.0443 0.0048  207 PRO A C     
2926 O  O     . PRO A 207 ? 0.2404 0.2014 0.3349 0.0809  0.0199  0.0400  207 PRO A O     
2927 C  CB    . PRO A 207 ? 0.1604 0.2024 0.3482 0.0599  -0.0119 0.0210  207 PRO A CB    
2928 C  CG    . PRO A 207 ? 0.1514 0.1654 0.4017 0.0559  -0.0046 0.0219  207 PRO A CG    
2929 C  CD    . PRO A 207 ? 0.1352 0.1386 0.3206 0.0358  -0.0050 0.0190  207 PRO A CD    
2937 N  N     . GLY A 208 ? 0.1985 0.1243 0.2972 0.0557  -0.0409 0.0328  208 GLY A N     
2938 C  CA    . GLY A 208 ? 0.1650 0.1151 0.3429 0.0121  -0.0676 0.0379  208 GLY A CA    
2939 C  C     . GLY A 208 ? 0.1461 0.1341 0.3752 0.0148  -0.0179 0.0067  208 GLY A C     
2940 O  O     . GLY A 208 ? 0.1864 0.1735 0.3456 0.0322  0.0243  -0.0135 208 GLY A O     
2944 N  N     . PHE A 209 ? 0.1401 0.1461 0.3525 0.0196  0.0418  -0.0128 209 PHE A N     
2945 C  CA    . PHE A 209 ? 0.1518 0.1116 0.3532 0.0252  -0.0286 0.0368  209 PHE A CA    
2946 C  C     . PHE A 209 ? 0.1472 0.0965 0.2708 0.0184  -0.0184 -0.0039 209 PHE A C     
2947 O  O     . PHE A 209 ? 0.1628 0.1193 0.3355 0.0127  -0.0091 0.0266  209 PHE A O     
2948 C  CB    . PHE A 209 ? 0.1300 0.1385 0.3531 0.0063  -0.0250 0.0112  209 PHE A CB    
2949 C  CG    . PHE A 209 ? 0.1398 0.1656 0.3129 0.0384  -0.0005 0.0105  209 PHE A CG    
2950 C  CD1   . PHE A 209 ? 0.1484 0.2006 0.3102 0.0691  -0.0253 0.0043  209 PHE A CD1   
2951 C  CD2   . PHE A 209 ? 0.1687 0.2436 0.3264 0.0195  -0.0169 0.0724  209 PHE A CD2   
2952 C  CE1   . PHE A 209 ? 0.2236 0.2351 0.3347 0.1278  -0.0196 -0.0111 209 PHE A CE1   
2953 C  CE2   . PHE A 209 ? 0.1668 0.2815 0.2606 -0.0014 0.0042  0.0123  209 PHE A CE2   
2954 C  CZ    . PHE A 209 ? 0.1717 0.3007 0.2932 0.0994  -0.0004 0.0248  209 PHE A CZ    
2964 N  N     . THR A 210 ? 0.1801 0.0895 0.3321 0.0213  -0.0317 -0.0048 210 THR A N     
2965 C  CA    . THR A 210 ? 0.1942 0.1067 0.3459 0.0372  -0.0456 0.0130  210 THR A CA    
2966 C  C     . THR A 210 ? 0.1730 0.1130 0.2342 0.0076  -0.0625 0.0301  210 THR A C     
2967 O  O     . THR A 210 ? 0.1644 0.1293 0.2961 0.0272  -0.0619 0.0372  210 THR A O     
2968 C  CB    . THR A 210 ? 0.1862 0.1649 0.3835 0.0124  -0.0036 0.0718  210 THR A CB    
2969 O  OG1   . THR A 210 ? 0.1629 0.1755 0.3467 -0.0094 -0.0578 0.0166  210 THR A OG1   
2970 C  CG2   . THR A 210 ? 0.2015 0.2056 0.2920 0.0250  -0.0668 0.0255  210 THR A CG2   
2978 N  N     . GLU A 211 ? 0.2163 0.1395 0.2705 0.0361  -0.0297 0.0553  211 GLU A N     
2979 C  CA    . GLU A 211 ? 0.2144 0.1644 0.2329 0.0473  -0.0602 0.0182  211 GLU A CA    
2980 C  C     . GLU A 211 ? 0.2064 0.1016 0.2810 0.0271  -0.0276 0.0038  211 GLU A C     
2981 O  O     . GLU A 211 ? 0.2303 0.1413 0.3622 0.0603  0.0098  0.0427  211 GLU A O     
2982 C  CB    . GLU A 211 ? 0.2036 0.1679 0.3441 -0.0041 -0.0942 0.0463  211 GLU A CB    
2983 C  CG    . GLU A 211 ? 0.2050 0.1607 0.3814 0.0262  -0.0448 0.0714  211 GLU A CG    
2984 C  CD    . GLU A 211 ? 0.2104 0.2010 0.3703 0.0573  -0.0643 -0.0061 211 GLU A CD    
2985 O  OE1   . GLU A 211 ? 0.1910 0.1872 0.3666 0.0241  -0.0231 0.0054  211 GLU A OE1   
2986 O  OE2   . GLU A 211 ? 0.2462 0.2141 0.3923 0.0140  -0.0022 -0.0216 211 GLU A OE2   
2993 N  N     . ARG A 212 ? 0.2153 0.1232 0.3307 0.0120  -0.0731 -0.0202 212 ARG A N     
2994 C  CA    . ARG A 212 ? 0.2066 0.1506 0.3053 0.0108  -0.0979 -0.0284 212 ARG A CA    
2995 C  C     . ARG A 212 ? 0.1831 0.1323 0.3303 -0.0099 -0.0788 -0.0026 212 ARG A C     
2996 O  O     . ARG A 212 ? 0.2163 0.1540 0.3070 0.0397  -0.0575 0.0036  212 ARG A O     
2997 C  CB    . ARG A 212 ? 0.2687 0.1537 0.4530 0.0313  -0.1859 -0.0378 212 ARG A CB    
2998 C  CG    . ARG A 212 ? 0.3070 0.1928 0.5897 0.0213  -0.2137 -0.0588 212 ARG A CG    
2999 C  CD    . ARG A 212 ? 0.3720 0.2393 0.7504 0.0050  -0.1708 -0.0589 212 ARG A CD    
3000 N  NE    . ARG A 212 ? 0.4820 0.3480 0.8417 0.0223  -0.1423 -0.0446 212 ARG A NE    
3001 C  CZ    . ARG A 212 ? 0.5658 0.3905 0.8400 0.0379  -0.1766 -0.0999 212 ARG A CZ    
3002 N  NH1   . ARG A 212 ? 0.5952 0.3975 0.7795 0.0282  -0.2165 -0.1824 212 ARG A NH1   
3003 N  NH2   . ARG A 212 ? 0.5981 0.4090 0.8354 0.0420  -0.2059 -0.0635 212 ARG A NH2   
3017 N  N     . ALA A 213 ? 0.1814 0.1299 0.2940 0.0079  -0.0418 -0.0347 213 ALA A N     
3018 C  CA    . ALA A 213 ? 0.1728 0.1579 0.3069 0.0094  -0.0564 0.0279  213 ALA A CA    
3019 C  C     . ALA A 213 ? 0.1785 0.1306 0.2836 0.0211  -0.0387 0.0050  213 ALA A C     
3020 O  O     . ALA A 213 ? 0.1841 0.1618 0.3194 0.0785  0.0010  0.0145  213 ALA A O     
3021 C  CB    . ALA A 213 ? 0.1726 0.1618 0.3545 0.0010  -0.0545 0.0825  213 ALA A CB    
3027 N  N     . ARG A 214 ? 0.1944 0.0991 0.3505 0.0059  -0.0169 0.0363  214 ARG A N     
3028 C  CA    . ARG A 214 ? 0.1800 0.1310 0.2540 0.0148  -0.0584 0.0087  214 ARG A CA    
3029 C  C     . ARG A 214 ? 0.1866 0.1544 0.2854 0.0274  -0.0423 -0.0038 214 ARG A C     
3030 O  O     . ARG A 214 ? 0.1764 0.1841 0.3138 0.0474  -0.0329 0.0221  214 ARG A O     
3031 C  CB    . ARG A 214 ? 0.1766 0.1241 0.3127 0.0129  -0.0432 0.0147  214 ARG A CB    
3032 C  CG    . ARG A 214 ? 0.1829 0.1208 0.3359 0.0277  -0.0590 0.0111  214 ARG A CG    
3033 C  CD    . ARG A 214 ? 0.1860 0.1230 0.3352 0.0603  -0.0076 0.0163  214 ARG A CD    
3034 N  NE    . ARG A 214 ? 0.1746 0.1388 0.3483 0.0585  0.0366  0.0505  214 ARG A NE    
3035 C  CZ    . ARG A 214 ? 0.2497 0.1499 0.3311 0.0549  0.0009  0.0408  214 ARG A CZ    
3036 N  NH1   . ARG A 214 ? 0.2599 0.2064 0.2833 0.0040  -0.0604 -0.0127 214 ARG A NH1   
3037 N  NH2   . ARG A 214 ? 0.2827 0.1810 0.4093 0.0501  0.0103  -0.0222 214 ARG A NH2   
3051 N  N     . GLU A 215 ? 0.1889 0.1942 0.2809 0.0269  -0.0443 -0.0064 215 GLU A N     
3052 C  CA    . GLU A 215 ? 0.2321 0.2274 0.2316 0.0504  -0.0395 -0.0104 215 GLU A CA    
3053 C  C     . GLU A 215 ? 0.2573 0.2204 0.2841 0.0945  -0.0198 -0.0199 215 GLU A C     
3054 O  O     . GLU A 215 ? 0.2592 0.2371 0.3105 0.0972  0.0002  0.0014  215 GLU A O     
3055 C  CB    . GLU A 215 ? 0.2423 0.3525 0.2720 0.0690  -0.0341 -0.0491 215 GLU A CB    
3058 N  N     . THR A 216 ? 0.2559 0.1821 0.2703 0.1101  -0.0601 -0.0206 216 THR A N     
3059 C  CA    . THR A 216 ? 0.2920 0.1862 0.2616 0.1216  -0.0740 -0.0362 216 THR A CA    
3060 C  C     . THR A 216 ? 0.2753 0.1700 0.2813 0.0988  -0.0423 0.0134  216 THR A C     
3061 O  O     . THR A 216 ? 0.3289 0.2296 0.3031 0.1559  -0.0398 -0.0163 216 THR A O     
3062 C  CB    . THR A 216 ? 0.3429 0.1845 0.3173 0.0959  -0.1204 -0.0174 216 THR A CB    
3063 O  OG1   . THR A 216 ? 0.3659 0.1804 0.4214 0.0655  -0.1138 0.0467  216 THR A OG1   
3064 C  CG2   . THR A 216 ? 0.3720 0.1681 0.3490 0.0855  -0.0806 -0.0215 216 THR A CG2   
3072 N  N     . LEU A 217 ? 0.2400 0.1664 0.3370 0.0792  -0.0115 -0.0168 217 LEU A N     
3073 C  CA    . LEU A 217 ? 0.2311 0.2137 0.3100 0.0740  0.0156  0.0275  217 LEU A CA    
3074 C  C     . LEU A 217 ? 0.2257 0.2305 0.2813 0.0726  -0.0436 0.0074  217 LEU A C     
3075 O  O     . LEU A 217 ? 0.2272 0.3045 0.3059 0.1068  0.0211  0.0788  217 LEU A O     
3076 C  CB    . LEU A 217 ? 0.1815 0.2070 0.2913 0.0780  -0.0229 0.0407  217 LEU A CB    
3077 C  CG    . LEU A 217 ? 0.1815 0.2082 0.2494 0.0411  -0.0189 0.0334  217 LEU A CG    
3078 C  CD1   . LEU A 217 ? 0.2015 0.2445 0.3191 0.0489  -0.0262 -0.0083 217 LEU A CD1   
3079 C  CD2   . LEU A 217 ? 0.2304 0.2850 0.2610 0.0777  0.0315  0.0565  217 LEU A CD2   
3091 N  N     . LEU A 218 ? 0.2343 0.2156 0.2547 0.0721  -0.0176 0.0361  218 LEU A N     
3092 C  CA    . LEU A 218 ? 0.2788 0.2619 0.3049 0.1114  0.0247  0.0821  218 LEU A CA    
3093 C  C     . LEU A 218 ? 0.3204 0.2971 0.3304 0.1315  0.0853  0.0934  218 LEU A C     
3094 O  O     . LEU A 218 ? 0.2768 0.3304 0.3709 0.0779  0.1114  0.0594  218 LEU A O     
3095 C  CB    . LEU A 218 ? 0.2198 0.2632 0.2490 0.0428  0.0152  0.0829  218 LEU A CB    
3096 C  CG    . LEU A 218 ? 0.2146 0.2553 0.3636 0.0317  -0.0058 0.0631  218 LEU A CG    
3097 C  CD1   . LEU A 218 ? 0.2426 0.2856 0.3836 0.0708  -0.0212 0.0737  218 LEU A CD1   
3098 C  CD2   . LEU A 218 ? 0.2847 0.2774 0.3977 0.0891  -0.0149 0.0089  218 LEU A CD2   
3110 N  N     . ASN A 219 ? 0.3455 0.2868 0.3460 0.1502  0.0772  0.0663  219 ASN A N     
3111 C  CA    . ASN A 219 ? 0.4060 0.3302 0.3202 0.1846  0.0388  0.0164  219 ASN A CA    
3112 C  C     . ASN A 219 ? 0.3654 0.2835 0.2122 0.1602  0.0127  0.0015  219 ASN A C     
3113 O  O     . ASN A 219 ? 0.4676 0.3235 0.3040 0.2007  0.1007  0.0149  219 ASN A O     
3114 C  CB    . ASN A 219 ? 0.5016 0.4199 0.2304 0.2341  0.0257  0.0251  219 ASN A CB    
3115 C  CG    . ASN A 219 ? 0.6134 0.5588 0.4771 0.2362  0.0501  0.1118  219 ASN A CG    
3116 O  OD1   . ASN A 219 ? 0.6710 0.5680 0.6403 0.2021  0.0126  0.1693  219 ASN A OD1   
3117 N  ND2   . ASN A 219 ? 0.6475 0.6546 0.6340 0.2789  0.0425  0.0978  219 ASN A ND2   
3120 N  N     . TYR A 220 ? 0.2568 0.2345 0.2682 0.1214  -0.0211 -0.0083 220 TYR A N     
3121 C  CA    . TYR A 220 ? 0.2405 0.2026 0.3147 0.0957  -0.0491 -0.0318 220 TYR A CA    
3122 C  C     . TYR A 220 ? 0.2518 0.1738 0.3360 0.0921  0.0349  -0.0150 220 TYR A C     
3123 O  O     . TYR A 220 ? 0.2570 0.1934 0.3556 0.0606  -0.0172 -0.0008 220 TYR A O     
3124 C  CB    . TYR A 220 ? 0.2282 0.2404 0.3072 0.0783  -0.0253 0.0052  220 TYR A CB    
3125 C  CG    . TYR A 220 ? 0.2062 0.1912 0.3393 0.0531  -0.0408 -0.0374 220 TYR A CG    
3126 C  CD1   . TYR A 220 ? 0.2267 0.2106 0.2415 0.0189  -0.0644 -0.0137 220 TYR A CD1   
3127 C  CD2   . TYR A 220 ? 0.1806 0.2132 0.2792 0.0687  -0.0428 -0.0017 220 TYR A CD2   
3128 C  CE1   . TYR A 220 ? 0.2412 0.1507 0.3408 0.0144  0.0033  -0.0090 220 TYR A CE1   
3129 C  CE2   . TYR A 220 ? 0.1866 0.2018 0.2356 0.0359  -0.0255 0.0075  220 TYR A CE2   
3130 C  CZ    . TYR A 220 ? 0.2143 0.1794 0.3582 0.0316  -0.0484 -0.0160 220 TYR A CZ    
3131 O  OH    . TYR A 220 ? 0.2235 0.1838 0.3012 0.0401  -0.0278 -0.0278 220 TYR A OH    
3141 N  N     . ARG A 221 ? 0.2387 0.2329 0.3236 0.0652  0.0146  -0.0299 221 ARG A N     
3142 C  CA    A ARG A 221 ? 0.2529 0.2400 0.3336 0.0759  0.0210  -0.0169 221 ARG A CA    
3143 C  CA    B ARG A 221 ? 0.2579 0.2404 0.3351 0.0694  0.0244  -0.0171 221 ARG A CA    
3144 C  C     . ARG A 221 ? 0.2219 0.2230 0.3206 0.0670  0.0359  0.0212  221 ARG A C     
3145 O  O     . ARG A 221 ? 0.2057 0.2084 0.3646 0.0290  0.0058  0.0265  221 ARG A O     
3146 C  CB    A ARG A 221 ? 0.3026 0.3044 0.4189 0.0915  -0.0050 -0.0885 221 ARG A CB    
3147 C  CB    B ARG A 221 ? 0.3192 0.3061 0.4308 0.0750  0.0073  -0.0870 221 ARG A CB    
3148 C  CG    A ARG A 221 ? 0.3625 0.3586 0.4493 0.1316  0.0002  -0.1259 221 ARG A CG    
3149 C  CG    B ARG A 221 ? 0.3957 0.3645 0.5136 0.1119  0.0347  -0.1042 221 ARG A CG    
3150 C  CD    A ARG A 221 ? 0.4067 0.4376 0.6545 0.1562  0.0517  -0.0670 221 ARG A CD    
3151 C  CD    B ARG A 221 ? 0.4509 0.4386 0.6402 0.1178  0.0463  -0.0732 221 ARG A CD    
3152 N  NE    A ARG A 221 ? 0.4555 0.5037 0.7604 0.1800  0.0794  -0.0929 221 ARG A NE    
3153 N  NE    B ARG A 221 ? 0.4943 0.4878 0.7282 0.1315  0.0586  -0.0935 221 ARG A NE    
3154 C  CZ    A ARG A 221 ? 0.4825 0.5197 0.7585 0.1659  0.0631  -0.0671 221 ARG A CZ    
3155 C  CZ    B ARG A 221 ? 0.5277 0.5127 0.7566 0.1441  0.0439  -0.0935 221 ARG A CZ    
3156 N  NH1   A ARG A 221 ? 0.4787 0.5228 0.7801 0.1544  0.0758  -0.0801 221 ARG A NH1   
3157 N  NH1   B ARG A 221 ? 0.5434 0.5190 0.7595 0.1583  0.0100  -0.1455 221 ARG A NH1   
3158 N  NH2   A ARG A 221 ? 0.4978 0.5405 0.7447 0.1572  0.0399  -0.0017 221 ARG A NH2   
3159 N  NH2   B ARG A 221 ? 0.5370 0.5240 0.7755 0.1371  0.0643  -0.0618 221 ARG A NH2   
3162 N  N     . TRP A 222 ? 0.1601 0.1886 0.3624 0.0555  -0.0028 0.0176  222 TRP A N     
3163 C  CA    . TRP A 222 ? 0.1689 0.1477 0.3425 0.0631  0.0546  0.0084  222 TRP A CA    
3164 C  C     . TRP A 222 ? 0.1882 0.1327 0.3603 0.0460  0.0691  -0.0082 222 TRP A C     
3165 O  O     . TRP A 222 ? 0.1782 0.1481 0.3488 0.0512  0.0095  0.0280  222 TRP A O     
3166 C  CB    . TRP A 222 ? 0.1579 0.1771 0.3163 0.0634  0.0249  -0.0038 222 TRP A CB    
3167 C  CG    . TRP A 222 ? 0.1529 0.1640 0.3375 0.0446  -0.0305 -0.0306 222 TRP A CG    
3168 C  CD1   . TRP A 222 ? 0.1489 0.1657 0.4321 0.0473  0.0001  -0.0025 222 TRP A CD1   
3169 C  CD2   . TRP A 222 ? 0.1518 0.1187 0.3304 0.0322  -0.0416 -0.0371 222 TRP A CD2   
3170 N  NE1   . TRP A 222 ? 0.1696 0.1494 0.3057 0.0508  -0.0233 0.0070  222 TRP A NE1   
3171 C  CE2   . TRP A 222 ? 0.1653 0.1335 0.2694 0.0393  -0.0269 -0.0047 222 TRP A CE2   
3172 C  CE3   . TRP A 222 ? 0.1510 0.1192 0.3331 0.0290  -0.0419 0.0316  222 TRP A CE3   
3173 C  CZ2   . TRP A 222 ? 0.1601 0.1718 0.2900 0.0788  -0.0516 -0.0217 222 TRP A CZ2   
3174 C  CZ3   . TRP A 222 ? 0.1695 0.1337 0.3577 0.0278  -0.0125 0.0298  222 TRP A CZ3   
3175 C  CH2   . TRP A 222 ? 0.1655 0.1523 0.3025 0.0389  -0.0193 -0.0167 222 TRP A CH2   
3186 N  N     . PRO A 223 ? 0.2001 0.1718 0.2784 0.0505  0.0131  0.0084  223 PRO A N     
3187 C  CA    . PRO A 223 ? 0.2096 0.1862 0.2968 0.0948  0.0173  0.0038  223 PRO A CA    
3188 C  C     . PRO A 223 ? 0.1840 0.1255 0.3175 0.0657  -0.0070 0.0238  223 PRO A C     
3189 O  O     . PRO A 223 ? 0.1850 0.1812 0.3935 0.0766  -0.0152 0.0262  223 PRO A O     
3190 C  CB    . PRO A 223 ? 0.2517 0.2130 0.4177 0.1220  0.0017  -0.0336 223 PRO A CB    
3191 C  CG    . PRO A 223 ? 0.2198 0.2025 0.3670 0.0861  -0.0327 -0.1036 223 PRO A CG    
3192 C  CD    . PRO A 223 ? 0.2272 0.2136 0.3013 0.0906  -0.0466 -0.0770 223 PRO A CD    
3200 N  N     . GLY A 224 ? 0.1418 0.1474 0.3218 0.0524  0.0069  -0.0043 224 GLY A N     
3201 C  CA    . GLY A 224 ? 0.1654 0.1562 0.3694 0.0669  0.0240  0.0083  224 GLY A CA    
3202 C  C     . GLY A 224 ? 0.1311 0.1687 0.2876 0.0606  -0.0042 -0.0074 224 GLY A C     
3203 O  O     . GLY A 224 ? 0.1235 0.1306 0.3166 0.0237  0.0068  0.0033  224 GLY A O     
3207 N  N     . ASN A 225 ? 0.1150 0.1481 0.2830 0.0360  0.0110  0.0103  225 ASN A N     
3208 C  CA    . ASN A 225 ? 0.1011 0.1454 0.3258 0.0304  0.0230  0.0495  225 ASN A CA    
3209 C  C     . ASN A 225 ? 0.1130 0.1266 0.3560 0.0175  0.0045  0.0055  225 ASN A C     
3210 O  O     . ASN A 225 ? 0.1007 0.1175 0.3726 0.0099  -0.0146 0.0262  225 ASN A O     
3211 C  CB    . ASN A 225 ? 0.1556 0.1211 0.3615 0.0272  0.0577  0.0508  225 ASN A CB    
3212 C  CG    . ASN A 225 ? 0.1239 0.1500 0.3440 -0.0082 0.0600  0.0120  225 ASN A CG    
3213 O  OD1   . ASN A 225 ? 0.1850 0.1822 0.3588 0.0404  0.0336  0.0624  225 ASN A OD1   
3214 N  ND2   . ASN A 225 ? 0.1506 0.1779 0.3207 -0.0017 0.0283  0.0303  225 ASN A ND2   
3221 N  N     . ILE A 226 ? 0.1172 0.1448 0.3904 0.0268  0.0242  0.0000  226 ILE A N     
3222 C  CA    . ILE A 226 ? 0.1261 0.1187 0.4037 0.0149  -0.0468 0.0032  226 ILE A CA    
3223 C  C     . ILE A 226 ? 0.1297 0.1387 0.3427 0.0152  -0.0115 -0.0175 226 ILE A C     
3224 O  O     . ILE A 226 ? 0.1105 0.1438 0.3858 0.0230  -0.0184 0.0140  226 ILE A O     
3225 C  CB    . ILE A 226 ? 0.1737 0.1631 0.5022 0.0092  -0.0083 -0.0737 226 ILE A CB    
3226 C  CG1   . ILE A 226 ? 0.2712 0.2621 0.6325 0.1036  0.0078  -0.0475 226 ILE A CG1   
3227 C  CG2   . ILE A 226 ? 0.1713 0.1381 0.4595 0.0029  -0.0696 -0.0660 226 ILE A CG2   
3228 C  CD1   . ILE A 226 ? 0.2597 0.2798 0.8509 0.0342  -0.0425 -0.0241 226 ILE A CD1   
3240 N  N     . ARG A 227 ? 0.1361 0.1366 0.3815 0.0226  -0.0024 0.0012  227 ARG A N     
3241 C  CA    . ARG A 227 ? 0.1354 0.1452 0.3483 0.0305  0.0130  -0.0570 227 ARG A CA    
3242 C  C     . ARG A 227 ? 0.1283 0.1579 0.3479 0.0236  0.0234  0.0760  227 ARG A C     
3243 O  O     . ARG A 227 ? 0.1317 0.1451 0.3221 0.0278  0.0052  0.0006  227 ARG A O     
3244 C  CB    . ARG A 227 ? 0.1319 0.1328 0.4181 0.0202  -0.0357 0.0255  227 ARG A CB    
3245 C  CG    . ARG A 227 ? 0.1531 0.1576 0.4427 0.0381  -0.0122 0.0444  227 ARG A CG    
3246 C  CD    . ARG A 227 ? 0.1895 0.2102 0.4348 0.0692  -0.0087 0.0789  227 ARG A CD    
3247 N  NE    . ARG A 227 ? 0.1854 0.1958 0.3886 0.0447  0.0041  0.0324  227 ARG A NE    
3248 C  CZ    . ARG A 227 ? 0.2021 0.1878 0.4566 0.0043  -0.0080 0.0363  227 ARG A CZ    
3249 N  NH1   . ARG A 227 ? 0.1748 0.1939 0.4173 -0.0071 -0.0611 0.0660  227 ARG A NH1   
3250 N  NH2   . ARG A 227 ? 0.2205 0.2259 0.4348 0.0293  -0.0199 0.0777  227 ARG A NH2   
3264 N  N     . GLU A 228 ? 0.1180 0.1335 0.3240 0.0061  0.0154  0.0255  228 GLU A N     
3265 C  CA    . GLU A 228 ? 0.1320 0.1030 0.3007 0.0211  -0.0113 0.0048  228 GLU A CA    
3266 C  C     . GLU A 228 ? 0.1265 0.0986 0.2678 0.0149  -0.0003 -0.0151 228 GLU A C     
3267 O  O     . GLU A 228 ? 0.1431 0.1250 0.3144 0.0287  0.0037  -0.0010 228 GLU A O     
3268 C  CB    . GLU A 228 ? 0.1657 0.1107 0.3012 0.0535  0.0123  -0.0186 228 GLU A CB    
3269 C  CG    . GLU A 228 ? 0.1685 0.1461 0.3327 0.0479  0.0460  0.0007  228 GLU A CG    
3270 C  CD    . GLU A 228 ? 0.1422 0.1654 0.4024 -0.0075 0.0053  -0.0208 228 GLU A CD    
3271 O  OE1   . GLU A 228 ? 0.1793 0.1896 0.3523 0.0576  -0.0107 0.0012  228 GLU A OE1   
3272 O  OE2   . GLU A 228 ? 0.1885 0.1824 0.3691 -0.0183 -0.0140 -0.0405 228 GLU A OE2   
3279 N  N     . LEU A 229 ? 0.0929 0.0984 0.3426 0.0095  -0.0066 -0.0036 229 LEU A N     
3280 C  CA    . LEU A 229 ? 0.1305 0.0916 0.3097 0.0226  -0.0457 -0.0058 229 LEU A CA    
3281 C  C     . LEU A 229 ? 0.1214 0.0999 0.3179 0.0276  0.0222  -0.0029 229 LEU A C     
3282 O  O     . LEU A 229 ? 0.1215 0.1043 0.3169 0.0252  0.0101  -0.0091 229 LEU A O     
3283 C  CB    . LEU A 229 ? 0.1463 0.1103 0.3189 0.0133  -0.0047 0.0104  229 LEU A CB    
3284 C  CG    . LEU A 229 ? 0.1191 0.1291 0.3468 0.0057  0.0240  0.0281  229 LEU A CG    
3285 C  CD1   . LEU A 229 ? 0.1551 0.1303 0.3591 0.0486  0.0363  0.0092  229 LEU A CD1   
3286 C  CD2   . LEU A 229 ? 0.1179 0.1529 0.3575 0.0342  0.0238  0.0004  229 LEU A CD2   
3298 N  N     . LYS A 230 ? 0.1106 0.1191 0.2949 0.0334  -0.0137 0.0209  230 LYS A N     
3299 C  CA    . LYS A 230 ? 0.1648 0.1168 0.2868 0.0188  -0.0176 -0.0084 230 LYS A CA    
3300 C  C     . LYS A 230 ? 0.1418 0.0906 0.2744 0.0289  0.0097  0.0021  230 LYS A C     
3301 O  O     . LYS A 230 ? 0.1327 0.1026 0.3423 0.0280  -0.0005 -0.0091 230 LYS A O     
3302 C  CB    . LYS A 230 ? 0.1881 0.1269 0.3294 -0.0030 -0.0131 0.0210  230 LYS A CB    
3303 C  CG    . LYS A 230 ? 0.2367 0.1734 0.3194 0.0474  -0.0435 0.0110  230 LYS A CG    
3304 C  CD    . LYS A 230 ? 0.2894 0.2309 0.2843 0.0360  0.0008  0.0131  230 LYS A CD    
3305 C  CE    . LYS A 230 ? 0.3321 0.2767 0.4095 0.0246  -0.0543 0.0299  230 LYS A CE    
3306 N  NZ    . LYS A 230 ? 0.3909 0.3843 0.5646 0.0877  -0.0663 0.0104  230 LYS A NZ    
3320 N  N     . ASN A 231 ? 0.1103 0.1084 0.3318 0.0147  0.0029  0.0161  231 ASN A N     
3321 C  CA    . ASN A 231 ? 0.1854 0.0980 0.3283 0.0112  -0.0058 -0.0251 231 ASN A CA    
3322 C  C     . ASN A 231 ? 0.1507 0.0827 0.3162 -0.0123 0.0031  -0.0014 231 ASN A C     
3323 O  O     . ASN A 231 ? 0.1461 0.0970 0.3463 0.0154  0.0093  0.0186  231 ASN A O     
3324 C  CB    . ASN A 231 ? 0.1818 0.1254 0.3549 -0.0188 0.0048  -0.0230 231 ASN A CB    
3325 C  CG    . ASN A 231 ? 0.2416 0.2201 0.5418 0.0325  0.1297  0.0427  231 ASN A CG    
3326 O  OD1   . ASN A 231 ? 0.2624 0.2534 0.5641 -0.0086 0.1044  0.1162  231 ASN A OD1   
3327 N  ND2   . ASN A 231 ? 0.3004 0.2268 0.7101 0.0491  0.1343  -0.0218 231 ASN A ND2   
3334 N  N     . VAL A 232 ? 0.1540 0.1093 0.2835 0.0059  0.0008  -0.0290 232 VAL A N     
3335 C  CA    . VAL A 232 ? 0.1249 0.1112 0.3358 0.0120  -0.0022 -0.0502 232 VAL A CA    
3336 C  C     . VAL A 232 ? 0.0766 0.1105 0.2888 -0.0062 -0.0091 -0.0025 232 VAL A C     
3337 O  O     . VAL A 232 ? 0.0988 0.0999 0.3314 -0.0050 -0.0117 -0.0194 232 VAL A O     
3338 C  CB    . VAL A 232 ? 0.1313 0.1219 0.3563 0.0289  0.0088  -0.0374 232 VAL A CB    
3339 C  CG1   . VAL A 232 ? 0.1547 0.1507 0.2158 0.0068  -0.0053 -0.0085 232 VAL A CG1   
3340 C  CG2   . VAL A 232 ? 0.1504 0.1351 0.3576 0.0174  -0.0009 -0.0429 232 VAL A CG2   
3350 N  N     . VAL A 233 ? 0.1006 0.1040 0.3138 0.0126  -0.0174 -0.0224 233 VAL A N     
3351 C  CA    . VAL A 233 ? 0.1257 0.1020 0.2789 0.0084  -0.0003 -0.0212 233 VAL A CA    
3352 C  C     . VAL A 233 ? 0.1346 0.0697 0.2787 -0.0013 0.0049  -0.0008 233 VAL A C     
3353 O  O     . VAL A 233 ? 0.1170 0.1070 0.3075 0.0065  0.0145  0.0136  233 VAL A O     
3354 C  CB    . VAL A 233 ? 0.1214 0.0981 0.3592 -0.0133 0.0178  0.0131  233 VAL A CB    
3355 C  CG1   . VAL A 233 ? 0.1300 0.0899 0.3375 -0.0024 0.0197  0.0303  233 VAL A CG1   
3356 C  CG2   . VAL A 233 ? 0.1225 0.1094 0.4011 0.0057  0.0472  -0.0183 233 VAL A CG2   
3366 N  N     . GLU A 234 ? 0.1090 0.1100 0.2898 0.0064  0.0053  -0.0102 234 GLU A N     
3367 C  CA    . GLU A 234 ? 0.1235 0.1044 0.3522 0.0059  0.0111  -0.0022 234 GLU A CA    
3368 C  C     . GLU A 234 ? 0.1124 0.0760 0.2707 -0.0130 -0.0166 0.0185  234 GLU A C     
3369 O  O     . GLU A 234 ? 0.1179 0.1148 0.3238 0.0000  0.0034  -0.0036 234 GLU A O     
3370 C  CB    . GLU A 234 ? 0.1665 0.1126 0.3035 -0.0021 0.0557  0.0068  234 GLU A CB    
3371 C  CG    . GLU A 234 ? 0.1806 0.1363 0.3044 -0.0136 0.0196  0.0051  234 GLU A CG    
3372 C  CD    . GLU A 234 ? 0.2372 0.1566 0.3679 -0.0234 -0.0796 0.0267  234 GLU A CD    
3373 O  OE1   . GLU A 234 ? 0.2704 0.1745 0.5185 -0.0198 -0.1457 0.0777  234 GLU A OE1   
3374 O  OE2   . GLU A 234 ? 0.2682 0.2081 0.4484 -0.0462 -0.1381 0.0601  234 GLU A OE2   
3381 N  N     . ARG A 235 ? 0.1411 0.0786 0.3123 -0.0025 -0.0135 -0.0041 235 ARG A N     
3382 C  CA    . ARG A 235 ? 0.1551 0.0776 0.2866 0.0075  -0.0014 0.0296  235 ARG A CA    
3383 C  C     . ARG A 235 ? 0.1126 0.0824 0.2654 -0.0099 -0.0057 -0.0238 235 ARG A C     
3384 O  O     . ARG A 235 ? 0.1160 0.0921 0.3473 0.0091  0.0020  -0.0005 235 ARG A O     
3385 C  CB    . ARG A 235 ? 0.1310 0.0921 0.3599 0.0030  -0.0391 0.0046  235 ARG A CB    
3386 C  CG    . ARG A 235 ? 0.1438 0.1214 0.3712 0.0111  0.0177  0.0282  235 ARG A CG    
3387 C  CD    . ARG A 235 ? 0.1615 0.1447 0.3707 0.0183  -0.0272 -0.0382 235 ARG A CD    
3388 N  NE    . ARG A 235 ? 0.1751 0.1577 0.3746 0.0130  0.0084  -0.0283 235 ARG A NE    
3389 C  CZ    . ARG A 235 ? 0.1908 0.1537 0.4385 0.0173  -0.0339 -0.0204 235 ARG A CZ    
3390 N  NH1   . ARG A 235 ? 0.2209 0.1789 0.4242 -0.0357 0.0142  0.0007  235 ARG A NH1   
3391 N  NH2   . ARG A 235 ? 0.2214 0.1924 0.3669 0.0081  0.0230  0.0080  235 ARG A NH2   
3405 N  N     . SER A 236 ? 0.1211 0.0930 0.3345 -0.0166 0.0178  0.0113  236 SER A N     
3406 C  CA    . SER A 236 ? 0.1212 0.1090 0.3159 0.0116  -0.0287 0.0013  236 SER A CA    
3407 C  C     . SER A 236 ? 0.1224 0.1070 0.2740 0.0062  -0.0031 0.0467  236 SER A C     
3408 O  O     . SER A 236 ? 0.1050 0.1409 0.3348 0.0116  -0.0349 -0.0142 236 SER A O     
3409 C  CB    . SER A 236 ? 0.1215 0.1181 0.3260 0.0189  -0.0072 0.0042  236 SER A CB    
3410 O  OG    . SER A 236 ? 0.1590 0.1579 0.3177 0.0273  -0.0074 0.0198  236 SER A OG    
3416 N  N     . VAL A 237 ? 0.1156 0.1337 0.3067 0.0129  -0.0069 0.0091  237 VAL A N     
3417 C  CA    . VAL A 237 ? 0.1470 0.0948 0.2602 0.0265  -0.0015 0.0175  237 VAL A CA    
3418 C  C     . VAL A 237 ? 0.1387 0.1116 0.2501 0.0293  0.0065  0.0191  237 VAL A C     
3419 O  O     . VAL A 237 ? 0.1170 0.1201 0.3623 0.0263  0.0106  0.0157  237 VAL A O     
3420 C  CB    . VAL A 237 ? 0.1610 0.1007 0.3436 0.0326  -0.0074 0.0082  237 VAL A CB    
3421 C  CG1   . VAL A 237 ? 0.1704 0.0944 0.3714 0.0099  -0.0029 0.0076  237 VAL A CG1   
3422 C  CG2   . VAL A 237 ? 0.1618 0.1278 0.2572 0.0235  -0.0476 -0.0064 237 VAL A CG2   
3432 N  N     . TYR A 238 ? 0.1239 0.1380 0.3241 0.0203  0.0199  0.0243  238 TYR A N     
3433 C  CA    . TYR A 238 ? 0.1344 0.1381 0.2975 0.0160  0.0101  0.0006  238 TYR A CA    
3434 C  C     . TYR A 238 ? 0.1242 0.1402 0.3941 0.0081  -0.0008 0.0469  238 TYR A C     
3435 O  O     . TYR A 238 ? 0.1154 0.1516 0.4075 0.0027  -0.0135 0.0305  238 TYR A O     
3436 C  CB    . TYR A 238 ? 0.1478 0.1408 0.3240 0.0101  0.0036  0.0337  238 TYR A CB    
3437 C  CG    . TYR A 238 ? 0.1748 0.1740 0.3430 0.0087  0.0009  0.0716  238 TYR A CG    
3438 C  CD1   . TYR A 238 ? 0.2217 0.2371 0.3255 0.0431  0.0571  0.0635  238 TYR A CD1   
3439 C  CD2   . TYR A 238 ? 0.1930 0.1719 0.3855 -0.0008 -0.0300 0.0744  238 TYR A CD2   
3440 C  CE1   . TYR A 238 ? 0.2137 0.2597 0.3942 0.0087  0.0733  0.0649  238 TYR A CE1   
3441 C  CE2   . TYR A 238 ? 0.2366 0.1508 0.4264 -0.0226 -0.0209 0.0984  238 TYR A CE2   
3442 C  CZ    . TYR A 238 ? 0.1955 0.1953 0.4681 -0.0607 0.0130  0.0732  238 TYR A CZ    
3443 O  OH    . TYR A 238 ? 0.2372 0.2259 0.6456 -0.0586 -0.0098 0.0842  238 TYR A OH    
3453 N  N     . ARG A 239 ? 0.1390 0.1599 0.3674 0.0196  -0.0143 0.0216  239 ARG A N     
3454 C  CA    . ARG A 239 ? 0.1166 0.2046 0.3727 0.0061  -0.0004 0.0385  239 ARG A CA    
3455 C  C     . ARG A 239 ? 0.1197 0.1526 0.4239 0.0011  -0.0082 0.0339  239 ARG A C     
3456 O  O     . ARG A 239 ? 0.1280 0.1816 0.4859 -0.0180 -0.0128 0.0319  239 ARG A O     
3457 C  CB    . ARG A 239 ? 0.1407 0.1842 0.4712 -0.0084 -0.0270 0.0198  239 ARG A CB    
3458 C  CG    . ARG A 239 ? 0.2219 0.2134 0.4668 0.0869  -0.0393 0.0073  239 ARG A CG    
3459 C  CD    . ARG A 239 ? 0.2833 0.2302 0.6329 0.0844  -0.0579 0.0312  239 ARG A CD    
3460 N  NE    . ARG A 239 ? 0.2332 0.1463 0.5213 0.0162  -0.0923 -0.0254 239 ARG A NE    
3461 C  CZ    . ARG A 239 ? 0.2947 0.1732 0.4340 -0.0400 -0.1396 -0.0425 239 ARG A CZ    
3462 N  NH1   . ARG A 239 ? 0.3706 0.2199 0.5112 0.0061  -0.1590 -0.0371 239 ARG A NH1   
3463 N  NH2   . ARG A 239 ? 0.3377 0.2063 0.4613 -0.0079 -0.1143 0.0280  239 ARG A NH2   
3477 N  N     . HIS A 240 ? 0.1311 0.1208 0.3946 0.0224  -0.0120 0.0307  240 HIS A N     
3478 C  CA    . HIS A 240 ? 0.1443 0.1194 0.3732 0.0127  -0.0389 0.0433  240 HIS A CA    
3479 C  C     . HIS A 240 ? 0.1480 0.1638 0.4525 0.0302  -0.0275 -0.0225 240 HIS A C     
3480 O  O     . HIS A 240 ? 0.1441 0.2069 0.4429 0.0332  -0.0398 -0.0276 240 HIS A O     
3481 C  CB    . HIS A 240 ? 0.1556 0.1729 0.2854 0.0318  -0.0296 0.0504  240 HIS A CB    
3482 C  CG    . HIS A 240 ? 0.1552 0.1947 0.3721 0.0270  -0.0121 0.0459  240 HIS A CG    
3483 N  ND1   . HIS A 240 ? 0.1992 0.2308 0.3806 0.0835  -0.0651 0.0055  240 HIS A ND1   
3484 C  CD2   . HIS A 240 ? 0.1547 0.2138 0.4569 0.0275  -0.0044 -0.0420 240 HIS A CD2   
3485 C  CE1   . HIS A 240 ? 0.1645 0.2379 0.4129 0.0573  -0.0398 0.0521  240 HIS A CE1   
3486 N  NE2   . HIS A 240 ? 0.1550 0.2230 0.4489 0.0503  -0.0028 0.0389  240 HIS A NE2   
3493 N  N     . GLY A 241 ? 0.1596 0.1678 0.3925 0.0424  0.0497  0.0049  241 GLY A N     
3494 C  CA    . GLY A 241 ? 0.1730 0.1749 0.3763 0.0248  0.0198  -0.0504 241 GLY A CA    
3495 C  C     . GLY A 241 ? 0.1561 0.1776 0.4134 -0.0157 0.0492  -0.0578 241 GLY A C     
3496 O  O     . GLY A 241 ? 0.2124 0.2277 0.4834 0.0312  0.0894  0.0243  241 GLY A O     
3500 N  N     . THR A 242 ? 0.1358 0.1602 0.4408 0.0143  0.0673  -0.0217 242 THR A N     
3501 C  CA    . THR A 242 ? 0.1286 0.1726 0.4322 0.0258  0.0501  0.0364  242 THR A CA    
3502 C  C     . THR A 242 ? 0.1434 0.1970 0.4210 0.0435  0.0635  0.0444  242 THR A C     
3503 O  O     . THR A 242 ? 0.1775 0.1672 0.4321 0.0429  0.0322  -0.0293 242 THR A O     
3504 C  CB    . THR A 242 ? 0.1630 0.2203 0.5799 0.0367  -0.0060 -0.0066 242 THR A CB    
3505 O  OG1   . THR A 242 ? 0.1811 0.2234 0.5971 0.0469  -0.0124 0.0040  242 THR A OG1   
3506 C  CG2   . THR A 242 ? 0.1701 0.2564 0.6215 0.0318  -0.0443 -0.0390 242 THR A CG2   
3514 N  N     . SER A 243 ? 0.1529 0.2126 0.4142 0.0469  0.0089  0.0039  243 SER A N     
3515 C  CA    . SER A 243 ? 0.1897 0.1733 0.3753 0.0523  0.0585  -0.0092 243 SER A CA    
3516 C  C     . SER A 243 ? 0.1845 0.2085 0.4199 0.0674  0.0930  0.0221  243 SER A C     
3517 O  O     . SER A 243 ? 0.2306 0.1828 0.4675 0.0525  0.0410  0.0450  243 SER A O     
3518 C  CB    . SER A 243 ? 0.2244 0.1944 0.3647 0.0551  0.0292  0.0068  243 SER A CB    
3519 O  OG    . SER A 243 ? 0.2075 0.2091 0.3844 0.0170  0.0358  -0.0186 243 SER A OG    
3525 N  N     . ASP A 244 ? 0.1694 0.2529 0.4828 0.0773  0.0322  0.0154  244 ASP A N     
3526 C  CA    . ASP A 244 ? 0.1887 0.3113 0.4709 0.1001  -0.0087 0.0240  244 ASP A CA    
3527 C  C     . ASP A 244 ? 0.2116 0.3249 0.4916 0.1284  -0.0005 0.0368  244 ASP A C     
3528 O  O     . ASP A 244 ? 0.2866 0.3453 0.5092 0.1766  -0.0299 0.0418  244 ASP A O     
3529 C  CB    . ASP A 244 ? 0.1708 0.4501 0.5512 0.0680  -0.0076 0.0584  244 ASP A CB    
3530 C  CG    . ASP A 244 ? 0.2808 0.5536 0.6523 0.0913  0.0083  0.0135  244 ASP A CG    
3531 O  OD1   . ASP A 244 ? 0.3414 0.6301 0.6660 0.1235  0.0474  -0.0524 244 ASP A OD1   
3532 O  OD2   . ASP A 244 ? 0.3064 0.5854 0.7498 0.0973  0.0228  0.0507  244 ASP A OD2   
3537 N  N     . TYR A 245 ? 0.1880 0.3534 0.4307 0.1191  0.0247  0.0356  245 TYR A N     
3538 C  CA    . TYR A 245 ? 0.1809 0.3749 0.4850 0.0604  -0.0053 -0.0118 245 TYR A CA    
3539 C  C     . TYR A 245 ? 0.1671 0.2603 0.3831 0.0467  0.0101  -0.0141 245 TYR A C     
3540 O  O     . TYR A 245 ? 0.1659 0.2048 0.3902 0.0492  -0.0051 -0.0006 245 TYR A O     
3541 C  CB    . TYR A 245 ? 0.2209 0.4254 0.5168 -0.0131 -0.0242 0.0127  245 TYR A CB    
3542 C  CG    . TYR A 245 ? 0.3032 0.4675 0.4865 0.0093  -0.0457 0.0291  245 TYR A CG    
3543 C  CD1   . TYR A 245 ? 0.3408 0.5357 0.6332 0.0208  -0.0345 0.0824  245 TYR A CD1   
3544 C  CD2   . TYR A 245 ? 0.2781 0.4794 0.4386 -0.0423 0.0069  0.0182  245 TYR A CD2   
3545 C  CE1   . TYR A 245 ? 0.3852 0.5341 0.7665 -0.0046 0.0115  0.0917  245 TYR A CE1   
3546 C  CE2   . TYR A 245 ? 0.3564 0.5253 0.6123 -0.0182 0.0146  0.0504  245 TYR A CE2   
3547 C  CZ    . TYR A 245 ? 0.4245 0.5325 0.7635 -0.0020 -0.0169 0.0564  245 TYR A CZ    
3548 O  OH    . TYR A 245 ? 0.4941 0.4947 0.8636 0.0127  -0.0513 0.0848  245 TYR A OH    
3551 N  N     . PRO A 246 ? 0.2284 0.2776 0.3153 0.1036  -0.0237 0.0361  246 PRO A N     
3552 C  CA    . PRO A 246 ? 0.2142 0.1984 0.3544 0.0668  -0.0313 0.0174  246 PRO A CA    
3553 C  C     . PRO A 246 ? 0.1978 0.1634 0.3187 0.0454  -0.0124 0.0289  246 PRO A C     
3554 O  O     . PRO A 246 ? 0.1787 0.2345 0.4142 0.0534  -0.0280 0.0104  246 PRO A O     
3555 C  CB    . PRO A 246 ? 0.2768 0.2271 0.3907 0.1057  -0.0374 0.0486  246 PRO A CB    
3556 C  CG    . PRO A 246 ? 0.3461 0.3203 0.5204 0.1595  -0.0650 0.0942  246 PRO A CG    
3557 C  CD    . PRO A 246 ? 0.2899 0.3211 0.4259 0.1556  -0.0296 0.0665  246 PRO A CD    
3565 N  N     . LEU A 247 ? 0.1814 0.1463 0.3927 0.0483  -0.0126 0.0179  247 LEU A N     
3566 C  CA    . LEU A 247 ? 0.1465 0.1293 0.3804 -0.0001 0.0142  0.0323  247 LEU A CA    
3567 C  C     . LEU A 247 ? 0.1519 0.1507 0.4179 0.0058  0.0327  0.0652  247 LEU A C     
3568 O  O     . LEU A 247 ? 0.1552 0.1500 0.3510 0.0131  -0.0556 0.0359  247 LEU A O     
3569 C  CB    . LEU A 247 ? 0.1725 0.1822 0.3605 0.0173  -0.0448 0.0137  247 LEU A CB    
3570 C  CG    . LEU A 247 ? 0.2386 0.2279 0.5165 0.0738  -0.0903 0.0128  247 LEU A CG    
3571 C  CD1   . LEU A 247 ? 0.3112 0.1996 0.4969 0.0810  -0.1610 -0.0457 247 LEU A CD1   
3572 C  CD2   . LEU A 247 ? 0.2809 0.2248 0.5736 0.0441  -0.0456 0.0591  247 LEU A CD2   
3584 N  N     . ASP A 248 ? 0.1640 0.1870 0.3896 -0.0005 -0.0094 0.0017  248 ASP A N     
3585 C  CA    . ASP A 248 ? 0.1859 0.2222 0.3638 -0.0253 -0.0323 -0.0201 248 ASP A CA    
3586 C  C     . ASP A 248 ? 0.2190 0.2031 0.4109 -0.0187 -0.0257 -0.0114 248 ASP A C     
3587 O  O     . ASP A 248 ? 0.2485 0.1838 0.4506 0.0250  0.0067  0.0058  248 ASP A O     
3588 C  CB    . ASP A 248 ? 0.1873 0.2018 0.4638 -0.0630 -0.0418 -0.0133 248 ASP A CB    
3589 C  CG    . ASP A 248 ? 0.2273 0.2157 0.5594 -0.0639 -0.0589 -0.0226 248 ASP A CG    
3590 O  OD1   . ASP A 248 ? 0.2090 0.2426 0.4948 -0.0372 -0.0959 -0.0194 248 ASP A OD1   
3591 O  OD2   . ASP A 248 ? 0.2946 0.2849 0.5456 -0.0657 -0.1228 -0.0017 248 ASP A OD2   
3596 N  N     A ASP A 249 ? 0.2317 0.2394 0.3986 0.0090  -0.0778 -0.0341 249 ASP A N     
3597 N  N     B ASP A 249 ? 0.2372 0.1811 0.2977 0.0020  0.0296  0.0275  249 ASP A N     
3598 C  CA    A ASP A 249 ? 0.2580 0.2849 0.3816 0.0386  -0.1122 0.0097  249 ASP A CA    
3599 C  CA    B ASP A 249 ? 0.2693 0.2164 0.2966 0.0166  0.0174  0.0251  249 ASP A CA    
3600 C  C     A ASP A 249 ? 0.2627 0.2257 0.3269 0.0119  -0.1009 -0.0145 249 ASP A C     
3601 C  C     B ASP A 249 ? 0.2557 0.1880 0.2982 0.0025  0.0150  -0.0213 249 ASP A C     
3602 O  O     A ASP A 249 ? 0.2679 0.2285 0.3010 -0.0025 -0.1499 -0.0289 249 ASP A O     
3603 O  O     B ASP A 249 ? 0.2361 0.2359 0.3365 0.0350  0.0813  0.0027  249 ASP A O     
3604 C  CB    A ASP A 249 ? 0.2801 0.3438 0.4749 0.0659  -0.1292 0.0569  249 ASP A CB    
3605 C  CB    B ASP A 249 ? 0.3136 0.1724 0.4356 -0.0085 -0.0170 0.0217  249 ASP A CB    
3606 C  CG    A ASP A 249 ? 0.3125 0.4204 0.5726 0.0796  -0.1222 0.0524  249 ASP A CG    
3607 C  CG    B ASP A 249 ? 0.3762 0.2392 0.6147 -0.0092 -0.0088 -0.0362 249 ASP A CG    
3608 O  OD1   A ASP A 249 ? 0.3249 0.4335 0.5965 0.0809  -0.1354 0.0426  249 ASP A OD1   
3609 O  OD1   B ASP A 249 ? 0.3843 0.2632 0.6681 -0.0054 0.0149  -0.0672 249 ASP A OD1   
3610 O  OD2   A ASP A 249 ? 0.3365 0.4809 0.6839 0.1172  -0.1334 -0.0207 249 ASP A OD2   
3611 O  OD2   B ASP A 249 ? 0.4024 0.2841 0.7071 -0.0035 -0.0315 -0.0109 249 ASP A OD2   
3620 N  N     . ILE A 250 ? 0.2640 0.1950 0.2985 0.0375  -0.0468 -0.0014 250 ILE A N     
3621 C  CA    . ILE A 250 ? 0.2815 0.1599 0.3059 0.0288  -0.0787 -0.0313 250 ILE A CA    
3622 C  C     . ILE A 250 ? 0.3110 0.1209 0.2896 0.0023  0.0219  -0.0330 250 ILE A C     
3623 O  O     . ILE A 250 ? 0.3900 0.1641 0.3140 -0.0155 0.0276  -0.0569 250 ILE A O     
3624 C  CB    . ILE A 250 ? 0.2532 0.1350 0.3632 0.0068  -0.0215 -0.0222 250 ILE A CB    
3625 C  CG1   . ILE A 250 ? 0.2450 0.1443 0.3846 0.0249  0.0031  0.0380  250 ILE A CG1   
3626 C  CG2   . ILE A 250 ? 0.2472 0.1769 0.3687 0.0321  -0.0125 0.0317  250 ILE A CG2   
3627 C  CD1   . ILE A 250 ? 0.2976 0.1365 0.4252 0.0604  0.0332  0.0203  250 ILE A CD1   
3640 N  N     . ILE A 251 ? 0.2443 0.0938 0.3236 0.0155  0.0089  0.0208  251 ILE A N     
3641 C  CA    . ILE A 251 ? 0.1962 0.1383 0.3516 -0.0142 0.0034  0.0341  251 ILE A CA    
3642 C  C     . ILE A 251 ? 0.1775 0.1441 0.3345 0.0062  -0.0062 0.0369  251 ILE A C     
3643 O  O     . ILE A 251 ? 0.1526 0.1674 0.3705 -0.0036 0.0290  -0.0120 251 ILE A O     
3644 C  CB    . ILE A 251 ? 0.1869 0.1845 0.4306 -0.0074 -0.0057 0.0437  251 ILE A CB    
3645 C  CG1   . ILE A 251 ? 0.2284 0.2464 0.6259 0.0259  0.0047  0.0311  251 ILE A CG1   
3646 C  CG2   . ILE A 251 ? 0.2064 0.1916 0.4841 -0.0206 -0.0178 0.0126  251 ILE A CG2   
3647 C  CD1   . ILE A 251 ? 0.2402 0.2661 0.6673 0.0030  0.0281  -0.0003 251 ILE A CD1   
3659 N  N     . ILE A 252 ? 0.1757 0.1588 0.2948 0.0191  -0.0031 -0.0130 252 ILE A N     
3660 C  CA    . ILE A 252 ? 0.1934 0.1355 0.3319 -0.0362 0.0066  -0.0112 252 ILE A CA    
3661 C  C     . ILE A 252 ? 0.1865 0.1448 0.3177 -0.0223 -0.0202 0.0091  252 ILE A C     
3662 O  O     . ILE A 252 ? 0.2261 0.1989 0.3450 0.0152  -0.0539 0.0052  252 ILE A O     
3663 C  CB    . ILE A 252 ? 0.2522 0.1487 0.3421 0.0149  -0.0154 0.0303  252 ILE A CB    
3664 C  CG1   . ILE A 252 ? 0.3146 0.2175 0.4737 0.0894  0.0612  0.0449  252 ILE A CG1   
3665 C  CG2   . ILE A 252 ? 0.2606 0.1741 0.3285 -0.0014 0.0247  -0.0017 252 ILE A CG2   
3666 C  CD1   . ILE A 252 ? 0.3388 0.2260 0.6308 0.0609  0.0397  0.1371  252 ILE A CD1   
3678 N  N     . ASP A 253 ? 0.2039 0.1261 0.3869 -0.0039 -0.0593 -0.0238 253 ASP A N     
3679 C  CA    . ASP A 253 ? 0.2441 0.1474 0.4489 -0.0326 -0.0360 -0.0742 253 ASP A CA    
3680 C  C     . ASP A 253 ? 0.2751 0.1477 0.4534 -0.0413 0.0069  0.0053  253 ASP A C     
3681 O  O     . ASP A 253 ? 0.2791 0.2528 0.5337 -0.0379 -0.0230 0.0760  253 ASP A O     
3682 C  CB    . ASP A 253 ? 0.3331 0.1411 0.4451 -0.0264 -0.0036 -0.0817 253 ASP A CB    
3683 C  CG    . ASP A 253 ? 0.4302 0.2030 0.5651 -0.0115 0.0347  -0.0761 253 ASP A CG    
3684 O  OD1   . ASP A 253 ? 0.4366 0.2152 0.4539 -0.0269 0.0535  -0.0390 253 ASP A OD1   
3685 O  OD2   . ASP A 253 ? 0.4801 0.2599 0.6588 0.0000  -0.0208 -0.0978 253 ASP A OD2   
3690 N  N     . PRO A 254 ? 0.2907 0.1501 0.3654 0.0097  0.0076  0.0442  254 PRO A N     
3691 C  CA    . PRO A 254 ? 0.3100 0.2023 0.4864 -0.0109 -0.0354 0.0879  254 PRO A CA    
3692 C  C     . PRO A 254 ? 0.3413 0.2470 0.4531 -0.0725 -0.0682 0.1016  254 PRO A C     
3693 O  O     . PRO A 254 ? 0.3581 0.3320 0.4861 -0.0967 -0.0683 0.1015  254 PRO A O     
3694 C  CB    . PRO A 254 ? 0.3311 0.1787 0.4558 0.0244  -0.0484 0.0299  254 PRO A CB    
3695 C  CG    . PRO A 254 ? 0.3000 0.1210 0.4027 0.0167  -0.0752 -0.0083 254 PRO A CG    
3696 C  CD    . PRO A 254 ? 0.3114 0.1795 0.4066 0.0505  -0.0102 -0.0044 254 PRO A CD    
3704 N  N     . PHE A 255 ? 0.3833 0.1813 0.3649 -0.0690 -0.0767 0.0456  255 PHE A N     
3705 C  CA    . PHE A 255 ? 0.4328 0.2489 0.4156 -0.1468 -0.0977 0.0151  255 PHE A CA    
3706 C  C     . PHE A 255 ? 0.5170 0.4087 0.4726 -0.2001 -0.1417 -0.0151 255 PHE A C     
3707 O  O     . PHE A 255 ? 0.5652 0.4522 0.5569 -0.2291 -0.1177 -0.0492 255 PHE A O     
3708 C  CB    . PHE A 255 ? 0.4382 0.1926 0.4582 -0.0777 -0.0031 -0.0679 255 PHE A CB    
3709 C  CG    . PHE A 255 ? 0.4155 0.1710 0.3603 0.0056  0.0498  -0.0446 255 PHE A CG    
3710 C  CD1   . PHE A 255 ? 0.4344 0.2094 0.5104 0.0349  0.0395  -0.1029 255 PHE A CD1   
3711 C  CD2   . PHE A 255 ? 0.3873 0.2111 0.4465 0.0382  0.0616  0.0508  255 PHE A CD2   
3712 C  CE1   . PHE A 255 ? 0.3934 0.2315 0.4446 0.0766  0.0656  0.0168  255 PHE A CE1   
3713 C  CE2   . PHE A 255 ? 0.3639 0.2442 0.4935 0.0611  0.1563  0.0413  255 PHE A CE2   
3714 C  CZ    . PHE A 255 ? 0.3485 0.2525 0.4670 0.0783  0.1689  0.0472  255 PHE A CZ    
3724 N  N     . LYS A 256 ? 0.5183 0.5331 0.4776 -0.2411 -0.1701 0.0690  256 LYS A N     
3725 C  CA    . LYS A 256 ? 0.5731 0.6860 0.5326 -0.1861 -0.1172 0.1064  256 LYS A CA    
3726 C  C     . LYS A 256 ? 0.5900 0.7768 0.7144 -0.1842 -0.0782 0.0224  256 LYS A C     
3727 O  O     . LYS A 256 ? 0.5743 0.7768 0.7254 -0.2136 -0.0201 0.0151  256 LYS A O     
3728 C  CB    . LYS A 256 ? 0.5996 0.7439 0.5781 -0.1506 -0.1526 0.0672  256 LYS A CB    
3729 C  CG    . LYS A 256 ? 0.6217 0.7664 0.5540 -0.1367 -0.1850 0.0467  256 LYS A CG    
3730 C  CD    . LYS A 256 ? 0.6502 0.8200 0.6358 -0.0927 -0.1976 0.0614  256 LYS A CD    
3731 C  CE    . LYS A 256 ? 0.6935 0.8558 0.7226 -0.0388 -0.1609 0.0917  256 LYS A CE    
3732 N  NZ    . LYS A 256 ? 0.7230 0.8849 0.8044 -0.0013 -0.1315 0.0953  256 LYS A NZ    
3746 N  N     . ARG A 257 ? 0.6363 0.8555 0.8996 -0.1241 -0.0170 0.0370  257 ARG A N     
3747 C  CA    . ARG A 257 ? 0.6629 0.9050 1.0019 -0.0918 -0.0138 0.0104  257 ARG A CA    
3748 C  C     . ARG A 257 ? 0.6857 0.9425 1.0279 -0.0553 -0.0075 -0.0176 257 ARG A C     
3749 O  O     . ARG A 257 ? 0.6947 0.9551 1.0349 -0.0434 0.0027  -0.0242 257 ARG A O     
3750 C  CB    . ARG A 257 ? 0.6605 0.9002 1.0238 -0.1088 -0.0048 0.0268  257 ARG A CB    
3753 P  PG    . ATP B .   ? 0.4573 0.3142 0.5296 0.0294  -0.0608 -0.0109 301 ATP A PG    
3754 O  O1G   . ATP B .   ? 0.4481 0.3111 0.7434 -0.0068 -0.0582 0.0315  301 ATP A O1G   
3755 O  O2G   . ATP B .   ? 0.4932 0.2739 0.5770 -0.0037 -0.1519 0.1194  301 ATP A O2G   
3756 O  O3G   . ATP B .   ? 0.4482 0.4063 0.5606 0.0227  -0.0613 0.0378  301 ATP A O3G   
3757 P  PB    . ATP B .   ? 0.3204 0.2944 0.6471 0.0351  -0.1096 0.0610  301 ATP A PB    
3758 O  O1B   . ATP B .   ? 0.3413 0.2147 0.8139 0.0059  -0.0096 0.0696  301 ATP A O1B   
3759 O  O2B   . ATP B .   ? 0.2141 0.3238 0.5255 -0.0612 -0.0738 -0.0186 301 ATP A O2B   
3760 O  O3B   . ATP B .   ? 0.3518 0.3435 0.5400 0.0724  -0.0762 -0.0593 301 ATP A O3B   
3761 P  PA    . ATP B .   ? 0.3613 0.4040 0.6121 -0.0943 0.0799  0.0542  301 ATP A PA    
3762 O  O1A   . ATP B .   ? 0.3466 0.4318 0.8184 -0.0930 0.1930  -0.0408 301 ATP A O1A   
3763 O  O2A   . ATP B .   ? 0.3910 0.4014 0.4532 -0.0945 0.1099  0.1833  301 ATP A O2A   
3764 O  O3A   . ATP B .   ? 0.3375 0.3793 0.5709 0.0144  -0.0431 0.1533  301 ATP A O3A   
3765 O  "O5'" . ATP B .   ? 0.4093 0.4310 0.7606 -0.1300 0.0471  -0.0486 301 ATP A "O5'" 
3766 C  "C5'" . ATP B .   ? 0.4727 0.4083 0.6500 -0.1301 0.0233  -0.1227 301 ATP A "C5'" 
3767 C  "C4'" . ATP B .   ? 0.5430 0.4414 0.6444 -0.1034 0.0329  -0.0889 301 ATP A "C4'" 
3768 O  "O4'" . ATP B .   ? 0.5668 0.4578 0.5355 -0.0852 0.0615  -0.0740 301 ATP A "O4'" 
3769 C  "C3'" . ATP B .   ? 0.5863 0.4559 0.7136 -0.0857 0.0308  -0.0965 301 ATP A "C3'" 
3770 O  "O3'" . ATP B .   ? 0.5886 0.4721 0.7691 -0.1189 0.0513  -0.0583 301 ATP A "O3'" 
3771 C  "C2'" . ATP B .   ? 0.6017 0.4614 0.6122 -0.0598 0.0345  -0.1090 301 ATP A "C2'" 
3772 O  "O2'" . ATP B .   ? 0.6185 0.5023 0.5931 -0.0232 0.0434  -0.1103 301 ATP A "O2'" 
3773 C  "C1'" . ATP B .   ? 0.5876 0.4883 0.5869 -0.0375 0.0806  -0.1006 301 ATP A "C1'" 
3774 N  N9    . ATP B .   ? 0.5956 0.5515 0.6144 0.0334  0.0950  -0.1143 301 ATP A N9    
3775 C  C8    . ATP B .   ? 0.5833 0.5754 0.6337 0.0468  0.1429  -0.1186 301 ATP A C8    
3776 N  N7    . ATP B .   ? 0.5909 0.5838 0.6696 0.0779  0.1446  -0.1061 301 ATP A N7    
3777 C  C5    . ATP B .   ? 0.6086 0.5976 0.6990 0.0774  0.0889  -0.1252 301 ATP A C5    
3778 C  C6    . ATP B .   ? 0.6280 0.6111 0.7573 0.0759  0.0536  -0.0999 301 ATP A C6    
3779 N  N6    . ATP B .   ? 0.6503 0.6232 0.8448 0.0798  0.0726  -0.0276 301 ATP A N6    
3780 N  N1    . ATP B .   ? 0.6277 0.6018 0.6412 0.0999  0.0171  -0.1128 301 ATP A N1    
3781 C  C2    . ATP B .   ? 0.6262 0.6083 0.6759 0.0910  -0.0024 -0.1653 301 ATP A C2    
3782 N  N3    . ATP B .   ? 0.6230 0.6089 0.6206 0.0883  0.0600  -0.1955 301 ATP A N3    
3783 C  C4    . ATP B .   ? 0.6112 0.5930 0.6276 0.0760  0.0904  -0.1421 301 ATP A C4    
3796 MG MG    . MG  C .   ? 0.4888 0.8251 0.8350 -0.1702 -0.0345 -0.2222 302 MG  A MG    
3797 C  C1    . GOL D .   ? 0.6731 0.6962 0.7681 -0.1245 -0.0612 0.0089  303 GOL A C1    
3798 O  O1    . GOL D .   ? 0.6588 0.6935 0.7811 -0.1602 -0.0769 -0.0086 303 GOL A O1    
3799 C  C2    . GOL D .   ? 0.6757 0.7111 0.7974 -0.0870 -0.0423 0.0589  303 GOL A C2    
3800 O  O2    . GOL D .   ? 0.6854 0.7330 0.8796 -0.0749 -0.0919 0.0663  303 GOL A O2    
3801 C  C3    . GOL D .   ? 0.6530 0.6798 0.7169 -0.1095 0.0078  0.1059  303 GOL A C3    
3802 O  O3    . GOL D .   ? 0.6329 0.6730 0.8067 -0.1014 -0.0462 0.0200  303 GOL A O3    
3811 C  C1    . GOL E .   ? 0.7511 0.6738 0.6853 0.0619  0.0278  0.0260  304 GOL A C1    
3812 O  O1    . GOL E .   ? 0.7490 0.6961 0.6907 0.0619  0.0270  0.0790  304 GOL A O1    
3813 C  C2    . GOL E .   ? 0.7225 0.6147 0.6683 0.0308  -0.0410 -0.0352 304 GOL A C2    
3814 O  O2    . GOL E .   ? 0.6858 0.4940 0.6586 -0.0429 -0.0588 -0.0700 304 GOL A O2    
3815 C  C3    . GOL E .   ? 0.7091 0.6563 0.5548 0.0659  -0.0489 0.0898  304 GOL A C3    
3816 O  O3    . GOL E .   ? 0.6848 0.6813 0.6737 0.0849  0.0078  0.1459  304 GOL A O3    
3825 N  N1    . EPE F .   ? 0.5253 0.4735 0.4255 0.0183  0.0199  -0.1046 305 EPE A N1    
3826 C  C2    . EPE F .   ? 0.5487 0.5171 0.5244 0.0040  0.0244  -0.0773 305 EPE A C2    
3827 C  C3    . EPE F .   ? 0.5660 0.5519 0.5818 0.0120  0.0155  -0.0374 305 EPE A C3    
3828 N  N4    . EPE F .   ? 0.5773 0.5557 0.5708 0.0092  0.0322  -0.0170 305 EPE A N4    
3829 C  C5    . EPE F .   ? 0.5666 0.5318 0.5397 0.0105  0.0461  -0.0443 305 EPE A C5    
3830 C  C6    . EPE F .   ? 0.5539 0.4901 0.5289 0.0092  0.0240  -0.0531 305 EPE A C6    
3831 C  C7    . EPE F .   ? 0.6011 0.5815 0.5957 0.0187  -0.0125 -0.0399 305 EPE A C7    
3832 C  C8    . EPE F .   ? 0.6319 0.5856 0.5864 0.0422  0.0122  -0.0496 305 EPE A C8    
3833 O  O8    . EPE F .   ? 0.6528 0.5804 0.6318 0.0591  -0.0117 -0.0807 305 EPE A O8    
3834 C  C9    . EPE F .   ? 0.4584 0.3965 0.4100 0.0224  -0.0173 -0.1028 305 EPE A C9    
3835 C  C10   . EPE F .   ? 0.3791 0.3674 0.5058 0.0338  0.0072  -0.0814 305 EPE A C10   
3836 S  S     . EPE F .   ? 0.3057 0.2950 0.4206 0.0254  -0.0072 -0.0348 305 EPE A S     
3837 O  O1S   . EPE F .   ? 0.2961 0.2764 0.3303 0.0307  -0.0278 0.0036  305 EPE A O1S   
3838 O  O2S   . EPE F .   ? 0.3230 0.3175 0.4445 0.0598  0.0706  0.0714  305 EPE A O2S   
3839 O  O3S   . EPE F .   ? 0.3820 0.3430 0.7375 0.0575  -0.0117 -0.0199 305 EPE A O3S   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   GLU 3   3   ?   ?   ?   A . n 
A 1 4   TYR 4   4   ?   ?   ?   A . n 
A 1 5   LYS 5   5   ?   ?   ?   A . n 
A 1 6   ASP 6   6   ?   ?   ?   A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  HIS 24  24  24  HIS HIS A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  HIS 50  50  50  HIS HIS A . n 
A 1 51  TYR 51  51  51  TYR TYR A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  ASN 69  69  69  ASN ASN A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  HIS 80  80  80  HIS HIS A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  GLY 83  83  ?   ?   ?   A . n 
A 1 84  ALA 84  84  ?   ?   ?   A . n 
A 1 85  PHE 85  85  ?   ?   ?   A . n 
A 1 86  THR 86  86  ?   ?   ?   A . n 
A 1 87  GLY 87  87  ?   ?   ?   A . n 
A 1 88  ALA 88  88  ?   ?   ?   A . n 
A 1 89  GLN 89  89  ?   ?   ?   A . n 
A 1 90  LYS 90  90  ?   ?   ?   A . n 
A 1 91  ARG 91  91  91  ARG ARG A . n 
A 1 92  HIS 92  92  92  HIS HIS A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 PHE 105 105 105 PHE PHE A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 GLN 108 108 108 GLN GLN A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 MET 114 114 114 MET MET A . n 
A 1 115 MET 115 115 115 MET MET A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 TYR 126 126 126 TYR TYR A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 GLN 136 136 136 GLN GLN A . n 
A 1 137 PRO 137 137 137 PRO PRO A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLN 139 139 139 GLN GLN A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 ASN 141 141 141 ASN ASN A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 CYS 146 146 146 CYS CYS A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 MET 155 155 155 MET MET A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 GLU 158 158 158 GLU GLU A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 ASP 164 164 164 ASP ASP A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 GLN 175 175 175 GLN GLN A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 PRO 177 177 177 PRO PRO A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 GLU 183 183 183 GLU GLU A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 MET 187 187 187 MET MET A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 MET 189 189 189 MET MET A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 TYR 192 192 192 TYR TYR A . n 
A 1 193 PHE 193 193 193 PHE PHE A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 GLN 196 196 196 GLN GLN A . n 
A 1 197 MET 197 197 197 MET MET A . n 
A 1 198 CYS 198 198 198 CYS CYS A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 ILE 201 201 201 ILE ILE A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 PRO 204 204 204 PRO PRO A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 PHE 206 206 206 PHE PHE A . n 
A 1 207 PRO 207 207 207 PRO PRO A . n 
A 1 208 GLY 208 208 208 GLY GLY A . n 
A 1 209 PHE 209 209 209 PHE PHE A . n 
A 1 210 THR 210 210 210 THR THR A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 TYR 220 220 220 TYR TYR A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 TRP 222 222 222 TRP TRP A . n 
A 1 223 PRO 223 223 223 PRO PRO A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 ILE 226 226 226 ILE ILE A . n 
A 1 227 ARG 227 227 227 ARG ARG A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 LYS 230 230 230 LYS LYS A . n 
A 1 231 ASN 231 231 231 ASN ASN A . n 
A 1 232 VAL 232 232 232 VAL VAL A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 ARG 235 235 235 ARG ARG A . n 
A 1 236 SER 236 236 236 SER SER A . n 
A 1 237 VAL 237 237 237 VAL VAL A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 ARG 239 239 239 ARG ARG A . n 
A 1 240 HIS 240 240 240 HIS HIS A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 THR 242 242 242 THR THR A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 ASP 244 244 244 ASP ASP A . n 
A 1 245 TYR 245 245 245 TYR TYR A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 ASP 248 248 248 ASP ASP A . n 
A 1 249 ASP 249 249 249 ASP ASP A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 ILE 252 252 252 ILE ILE A . n 
A 1 253 ASP 253 253 253 ASP ASP A . n 
A 1 254 PRO 254 254 254 PRO PRO A . n 
A 1 255 PHE 255 255 255 PHE PHE A . n 
A 1 256 LYS 256 256 256 LYS LYS A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 ARG 258 258 ?   ?   ?   A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 PRO 260 260 ?   ?   ?   A . n 
A 1 261 GLU 261 261 ?   ?   ?   A . n 
A 1 262 ASP 262 262 ?   ?   ?   A . n 
A 1 263 ALA 263 263 ?   ?   ?   A . n 
A 1 264 ILE 264 264 ?   ?   ?   A . n 
A 1 265 ALA 265 265 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O   ? G HOH . ? A HOH 546 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O2G ? B ATP .   ? A ATP 301 ? 1_555 61.1  ? 
2 O   ? G HOH . ? A HOH 546 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O1B ? B ATP .   ? A ATP 301 ? 1_555 72.7  ? 
3 O2G ? B ATP . ? A ATP 301 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O1B ? B ATP .   ? A ATP 301 ? 1_555 71.3  ? 
4 O   ? G HOH . ? A HOH 546 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 OD2 ? A ASP 107 ? A ASP 107 ? 1_555 155.3 ? 
5 O2G ? B ATP . ? A ATP 301 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 OD2 ? A ASP 107 ? A ASP 107 ? 1_555 102.4 ? 
6 O1B ? B ATP . ? A ATP 301 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 OD2 ? A ASP 107 ? A ASP 107 ? 1_555 121.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-08-06 
2 'Structure model' 1 1 2014-09-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             1.540 
_diffrn_reflns.pdbx_d_res_low              ? 
_diffrn_reflns.pdbx_number_obs             84394 
_diffrn_reflns.pdbx_Rmerge_I_obs           0.047 
_diffrn_reflns.pdbx_Rsym_value             ? 
_diffrn_reflns.pdbx_chi_squared            1.12 
_diffrn_reflns.pdbx_redundancy             ? 
_diffrn_reflns.pdbx_rejects                ? 
_diffrn_reflns.pdbx_percent_possible_obs   99.80 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.number                      426813 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 3.25 4.56 5733  ? 0.033 ? ? ? ? 
1 2.66 3.25 7407  ? 0.040 ? ? ? ? 
1 2.30 2.66 8780  ? 0.048 ? ? ? ? 
1 2.06 2.30 9963  ? 0.066 ? ? ? ? 
1 1.88 2.06 10980 ? 0.114 ? ? ? ? 
1 1.74 1.88 11977 ? 0.219 ? ? ? ? 
1 1.63 1.74 12819 ? 0.402 ? ? ? ? 
1 1.54 1.63 13488 ? 0.645 ? ? ? ? 
# 
_pdbx_phasing_MR.entry_id                     4QNR 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          6.040 
_pdbx_phasing_MR.d_res_low_rotation           28.390 
_pdbx_phasing_MR.d_res_high_translation       6.040 
_pdbx_phasing_MR.d_res_low_translation        28.390 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 xia2        .          ?                                program 'Graeme Winter' ?                           'data reduction'  
http://www.ccp4.ac.uk/html/xia2.html        ?   ? 
2 PHASER      2.5.2      'Mon Oct 8 13:56:31 2012 (svn )' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/ ?   ? 
3 PHENIX      1.8.4_1496 ?                                package 'Paul D. Adams' PDAdams@lbl.gov             refinement        
http://www.phenix-online.org/               C++ ? 
4 PDB_EXTRACT 3.14       'Dec. 10, 2013'                  package PDB             deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/   C++ ? 
5 GDA         .          ?                                ?       ?               ?                           'data collection' ? 
?   ? 
6 XDS         .          ?                                ?       ?               ?                           'data reduction'  ? 
?   ? 
7 SCALA       .          ?                                ?       ?               ?                           'data scaling'    ? 
?   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HD22 A ASN 149 ? ? O A HOH 475 ? ? 1.42 
2 1 O    A HOH 572 ? ? O A HOH 573 ? ? 2.10 
3 1 O2A  A ATP 301 ? ? O A HOH 546 ? ? 2.16 
4 1 O    A HOH 524 ? ? O A HOH 601 ? ? 2.18 
5 1 ND2  A ASN 149 ? ? O A HOH 475 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     508 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     509 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   6_554 
_pdbx_validate_symm_contact.dist              2.16 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 81  ? ? -139.74 -101.09 
2 1 VAL A 132 ? ? -126.14 -160.17 
3 1 ARG A 182 ? ? -119.64 50.52   
4 1 ASN A 225 ? ? 46.69   -129.61 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 7   ? CG  ? A ASN 7   CG  
2  1 Y 1 A ASN 7   ? OD1 ? A ASN 7   OD1 
3  1 Y 1 A ASN 7   ? ND2 ? A ASN 7   ND2 
4  1 Y 1 A LEU 72  ? CG  ? A LEU 72  CG  
5  1 Y 1 A LEU 72  ? CD1 ? A LEU 72  CD1 
6  1 Y 1 A LEU 72  ? CD2 ? A LEU 72  CD2 
7  1 Y 1 A ARG 91  ? CG  ? A ARG 91  CG  
8  1 Y 1 A ARG 91  ? CD  ? A ARG 91  CD  
9  1 Y 1 A ARG 91  ? NE  ? A ARG 91  NE  
10 1 Y 1 A ARG 91  ? CZ  ? A ARG 91  CZ  
11 1 Y 1 A ARG 91  ? NH1 ? A ARG 91  NH1 
12 1 Y 1 A ARG 91  ? NH2 ? A ARG 91  NH2 
13 1 Y 1 A ARG 131 ? CG  ? A ARG 131 CG  
14 1 Y 1 A ARG 131 ? CD  ? A ARG 131 CD  
15 1 Y 1 A ARG 131 ? NE  ? A ARG 131 NE  
16 1 Y 1 A ARG 131 ? CZ  ? A ARG 131 CZ  
17 1 Y 1 A ARG 131 ? NH1 ? A ARG 131 NH1 
18 1 Y 1 A ARG 131 ? NH2 ? A ARG 131 NH2 
19 1 Y 1 A GLN 139 ? CG  ? A GLN 139 CG  
20 1 Y 1 A GLN 139 ? CD  ? A GLN 139 CD  
21 1 Y 1 A GLN 139 ? OE1 ? A GLN 139 OE1 
22 1 Y 1 A GLN 139 ? NE2 ? A GLN 139 NE2 
23 1 Y 1 A GLU 158 ? CG  ? A GLU 158 CG  
24 1 Y 1 A GLU 158 ? CD  ? A GLU 158 CD  
25 1 Y 1 A GLU 158 ? OE1 ? A GLU 158 OE1 
26 1 Y 1 A GLU 158 ? OE2 ? A GLU 158 OE2 
27 1 Y 1 A GLU 191 ? CG  ? A GLU 191 CG  
28 1 Y 1 A GLU 191 ? CD  ? A GLU 191 CD  
29 1 Y 1 A GLU 191 ? OE1 ? A GLU 191 OE1 
30 1 Y 1 A GLU 191 ? OE2 ? A GLU 191 OE2 
31 1 Y 1 A GLN 196 ? CG  ? A GLN 196 CG  
32 1 Y 1 A GLN 196 ? CD  ? A GLN 196 CD  
33 1 Y 1 A GLN 196 ? OE1 ? A GLN 196 OE1 
34 1 Y 1 A GLN 196 ? NE2 ? A GLN 196 NE2 
35 1 Y 1 A GLU 215 ? CG  ? A GLU 215 CG  
36 1 Y 1 A GLU 215 ? CD  ? A GLU 215 CD  
37 1 Y 1 A GLU 215 ? OE1 ? A GLU 215 OE1 
38 1 Y 1 A GLU 215 ? OE2 ? A GLU 215 OE2 
39 1 Y 1 A ARG 257 ? CG  ? A ARG 257 CG  
40 1 Y 1 A ARG 257 ? CD  ? A ARG 257 CD  
41 1 Y 1 A ARG 257 ? NE  ? A ARG 257 NE  
42 1 Y 1 A ARG 257 ? CZ  ? A ARG 257 CZ  
43 1 Y 1 A ARG 257 ? NH1 ? A ARG 257 NH1 
44 1 Y 1 A ARG 257 ? NH2 ? A ARG 257 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A GLU 3   ? A GLU 3   
4  1 Y 1 A TYR 4   ? A TYR 4   
5  1 Y 1 A LYS 5   ? A LYS 5   
6  1 Y 1 A ASP 6   ? A ASP 6   
7  1 Y 1 A GLY 83  ? A GLY 83  
8  1 Y 1 A ALA 84  ? A ALA 84  
9  1 Y 1 A PHE 85  ? A PHE 85  
10 1 Y 1 A THR 86  ? A THR 86  
11 1 Y 1 A GLY 87  ? A GLY 87  
12 1 Y 1 A ALA 88  ? A ALA 88  
13 1 Y 1 A GLN 89  ? A GLN 89  
14 1 Y 1 A LYS 90  ? A LYS 90  
15 1 Y 1 A ARG 258 ? A ARG 258 
16 1 Y 1 A PRO 259 ? A PRO 259 
17 1 Y 1 A PRO 260 ? A PRO 260 
18 1 Y 1 A GLU 261 ? A GLU 261 
19 1 Y 1 A ASP 262 ? A ASP 262 
20 1 Y 1 A ALA 263 ? A ALA 263 
21 1 Y 1 A ILE 264 ? A ILE 264 
22 1 Y 1 A ALA 265 ? A ALA 265 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-5'-TRIPHOSPHATE"                           ATP 
3 'MAGNESIUM ION'                                       MG  
4 GLYCEROL                                              GOL 
5 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 
6 water                                                 HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ATP 1   301 400 ATP ATP A . 
C 3 MG  1   302 1   MG  MG  A . 
D 4 GOL 1   303 1   GOL GOL A . 
E 4 GOL 1   304 2   GOL GOL A . 
F 5 EPE 1   305 1   EPE EPE A . 
G 6 HOH 1   401 1   HOH HOH A . 
G 6 HOH 2   402 2   HOH HOH A . 
G 6 HOH 3   403 3   HOH HOH A . 
G 6 HOH 4   404 4   HOH HOH A . 
G 6 HOH 5   405 5   HOH HOH A . 
G 6 HOH 6   406 6   HOH HOH A . 
G 6 HOH 7   407 7   HOH HOH A . 
G 6 HOH 8   408 8   HOH HOH A . 
G 6 HOH 9   409 9   HOH HOH A . 
G 6 HOH 10  410 10  HOH HOH A . 
G 6 HOH 11  411 11  HOH HOH A . 
G 6 HOH 12  412 12  HOH HOH A . 
G 6 HOH 13  413 13  HOH HOH A . 
G 6 HOH 14  414 14  HOH HOH A . 
G 6 HOH 15  415 15  HOH HOH A . 
G 6 HOH 16  416 16  HOH HOH A . 
G 6 HOH 17  417 17  HOH HOH A . 
G 6 HOH 18  418 18  HOH HOH A . 
G 6 HOH 19  419 19  HOH HOH A . 
G 6 HOH 20  420 20  HOH HOH A . 
G 6 HOH 21  421 21  HOH HOH A . 
G 6 HOH 22  422 22  HOH HOH A . 
G 6 HOH 23  423 23  HOH HOH A . 
G 6 HOH 24  424 24  HOH HOH A . 
G 6 HOH 25  425 25  HOH HOH A . 
G 6 HOH 26  426 26  HOH HOH A . 
G 6 HOH 27  427 27  HOH HOH A . 
G 6 HOH 28  428 28  HOH HOH A . 
G 6 HOH 29  429 29  HOH HOH A . 
G 6 HOH 30  430 30  HOH HOH A . 
G 6 HOH 31  431 31  HOH HOH A . 
G 6 HOH 32  432 32  HOH HOH A . 
G 6 HOH 33  433 33  HOH HOH A . 
G 6 HOH 34  434 34  HOH HOH A . 
G 6 HOH 35  435 35  HOH HOH A . 
G 6 HOH 36  436 36  HOH HOH A . 
G 6 HOH 37  437 37  HOH HOH A . 
G 6 HOH 38  438 38  HOH HOH A . 
G 6 HOH 39  439 39  HOH HOH A . 
G 6 HOH 40  440 40  HOH HOH A . 
G 6 HOH 41  441 41  HOH HOH A . 
G 6 HOH 42  442 42  HOH HOH A . 
G 6 HOH 43  443 43  HOH HOH A . 
G 6 HOH 44  444 44  HOH HOH A . 
G 6 HOH 45  445 45  HOH HOH A . 
G 6 HOH 46  446 46  HOH HOH A . 
G 6 HOH 47  447 47  HOH HOH A . 
G 6 HOH 48  448 48  HOH HOH A . 
G 6 HOH 49  449 49  HOH HOH A . 
G 6 HOH 50  450 50  HOH HOH A . 
G 6 HOH 51  451 51  HOH HOH A . 
G 6 HOH 52  452 52  HOH HOH A . 
G 6 HOH 53  453 53  HOH HOH A . 
G 6 HOH 54  454 54  HOH HOH A . 
G 6 HOH 55  455 55  HOH HOH A . 
G 6 HOH 56  456 56  HOH HOH A . 
G 6 HOH 57  457 57  HOH HOH A . 
G 6 HOH 58  458 58  HOH HOH A . 
G 6 HOH 59  459 59  HOH HOH A . 
G 6 HOH 60  460 60  HOH HOH A . 
G 6 HOH 61  461 61  HOH HOH A . 
G 6 HOH 62  462 62  HOH HOH A . 
G 6 HOH 63  463 63  HOH HOH A . 
G 6 HOH 64  464 64  HOH HOH A . 
G 6 HOH 65  465 65  HOH HOH A . 
G 6 HOH 66  466 66  HOH HOH A . 
G 6 HOH 67  467 67  HOH HOH A . 
G 6 HOH 68  468 68  HOH HOH A . 
G 6 HOH 69  469 69  HOH HOH A . 
G 6 HOH 70  470 70  HOH HOH A . 
G 6 HOH 71  471 71  HOH HOH A . 
G 6 HOH 72  472 72  HOH HOH A . 
G 6 HOH 73  473 73  HOH HOH A . 
G 6 HOH 74  474 74  HOH HOH A . 
G 6 HOH 75  475 75  HOH HOH A . 
G 6 HOH 76  476 76  HOH HOH A . 
G 6 HOH 77  477 77  HOH HOH A . 
G 6 HOH 78  478 78  HOH HOH A . 
G 6 HOH 79  479 79  HOH HOH A . 
G 6 HOH 80  480 80  HOH HOH A . 
G 6 HOH 81  481 81  HOH HOH A . 
G 6 HOH 82  482 82  HOH HOH A . 
G 6 HOH 83  483 83  HOH HOH A . 
G 6 HOH 84  484 84  HOH HOH A . 
G 6 HOH 85  485 85  HOH HOH A . 
G 6 HOH 86  486 86  HOH HOH A . 
G 6 HOH 87  487 87  HOH HOH A . 
G 6 HOH 88  488 88  HOH HOH A . 
G 6 HOH 89  489 89  HOH HOH A . 
G 6 HOH 90  490 90  HOH HOH A . 
G 6 HOH 91  491 91  HOH HOH A . 
G 6 HOH 92  492 92  HOH HOH A . 
G 6 HOH 93  493 93  HOH HOH A . 
G 6 HOH 94  494 94  HOH HOH A . 
G 6 HOH 95  495 95  HOH HOH A . 
G 6 HOH 96  496 96  HOH HOH A . 
G 6 HOH 97  497 97  HOH HOH A . 
G 6 HOH 98  498 98  HOH HOH A . 
G 6 HOH 99  499 99  HOH HOH A . 
G 6 HOH 100 500 100 HOH HOH A . 
G 6 HOH 101 501 101 HOH HOH A . 
G 6 HOH 102 502 102 HOH HOH A . 
G 6 HOH 103 503 103 HOH HOH A . 
G 6 HOH 104 504 104 HOH HOH A . 
G 6 HOH 105 505 105 HOH HOH A . 
G 6 HOH 106 506 106 HOH HOH A . 
G 6 HOH 107 507 107 HOH HOH A . 
G 6 HOH 108 508 108 HOH HOH A . 
G 6 HOH 109 509 109 HOH HOH A . 
G 6 HOH 110 510 110 HOH HOH A . 
G 6 HOH 111 511 111 HOH HOH A . 
G 6 HOH 112 512 112 HOH HOH A . 
G 6 HOH 113 513 113 HOH HOH A . 
G 6 HOH 114 514 114 HOH HOH A . 
G 6 HOH 115 515 115 HOH HOH A . 
G 6 HOH 116 516 116 HOH HOH A . 
G 6 HOH 117 517 117 HOH HOH A . 
G 6 HOH 118 518 118 HOH HOH A . 
G 6 HOH 119 519 119 HOH HOH A . 
G 6 HOH 120 520 120 HOH HOH A . 
G 6 HOH 121 521 121 HOH HOH A . 
G 6 HOH 122 522 122 HOH HOH A . 
G 6 HOH 123 523 123 HOH HOH A . 
G 6 HOH 124 524 124 HOH HOH A . 
G 6 HOH 125 525 125 HOH HOH A . 
G 6 HOH 126 526 126 HOH HOH A . 
G 6 HOH 127 527 127 HOH HOH A . 
G 6 HOH 128 528 128 HOH HOH A . 
G 6 HOH 129 529 129 HOH HOH A . 
G 6 HOH 130 530 130 HOH HOH A . 
G 6 HOH 131 531 131 HOH HOH A . 
G 6 HOH 132 532 132 HOH HOH A . 
G 6 HOH 133 533 133 HOH HOH A . 
G 6 HOH 134 534 134 HOH HOH A . 
G 6 HOH 135 535 135 HOH HOH A . 
G 6 HOH 136 536 136 HOH HOH A . 
G 6 HOH 137 537 137 HOH HOH A . 
G 6 HOH 138 538 138 HOH HOH A . 
G 6 HOH 139 539 139 HOH HOH A . 
G 6 HOH 140 540 140 HOH HOH A . 
G 6 HOH 141 541 141 HOH HOH A . 
G 6 HOH 142 542 142 HOH HOH A . 
G 6 HOH 143 543 143 HOH HOH A . 
G 6 HOH 144 544 144 HOH HOH A . 
G 6 HOH 145 545 145 HOH HOH A . 
G 6 HOH 146 546 146 HOH HOH A . 
G 6 HOH 147 547 147 HOH HOH A . 
G 6 HOH 148 548 148 HOH HOH A . 
G 6 HOH 149 549 149 HOH HOH A . 
G 6 HOH 150 550 150 HOH HOH A . 
G 6 HOH 151 551 151 HOH HOH A . 
G 6 HOH 152 552 152 HOH HOH A . 
G 6 HOH 153 553 153 HOH HOH A . 
G 6 HOH 154 554 154 HOH HOH A . 
G 6 HOH 155 555 155 HOH HOH A . 
G 6 HOH 156 556 156 HOH HOH A . 
G 6 HOH 157 557 157 HOH HOH A . 
G 6 HOH 158 558 158 HOH HOH A . 
G 6 HOH 159 559 159 HOH HOH A . 
G 6 HOH 160 560 160 HOH HOH A . 
G 6 HOH 161 561 161 HOH HOH A . 
G 6 HOH 162 562 162 HOH HOH A . 
G 6 HOH 163 563 163 HOH HOH A . 
G 6 HOH 164 564 164 HOH HOH A . 
G 6 HOH 165 565 165 HOH HOH A . 
G 6 HOH 166 566 166 HOH HOH A . 
G 6 HOH 167 567 167 HOH HOH A . 
G 6 HOH 168 568 168 HOH HOH A . 
G 6 HOH 169 569 169 HOH HOH A . 
G 6 HOH 170 570 170 HOH HOH A . 
G 6 HOH 171 571 171 HOH HOH A . 
G 6 HOH 172 572 172 HOH HOH A . 
G 6 HOH 173 573 173 HOH HOH A . 
G 6 HOH 174 574 174 HOH HOH A . 
G 6 HOH 175 575 175 HOH HOH A . 
G 6 HOH 176 576 176 HOH HOH A . 
G 6 HOH 177 577 177 HOH HOH A . 
G 6 HOH 178 578 178 HOH HOH A . 
G 6 HOH 179 579 179 HOH HOH A . 
G 6 HOH 180 580 180 HOH HOH A . 
G 6 HOH 181 581 181 HOH HOH A . 
G 6 HOH 182 582 182 HOH HOH A . 
G 6 HOH 183 583 183 HOH HOH A . 
G 6 HOH 184 584 184 HOH HOH A . 
G 6 HOH 185 585 185 HOH HOH A . 
G 6 HOH 186 586 186 HOH HOH A . 
G 6 HOH 187 587 187 HOH HOH A . 
G 6 HOH 188 588 188 HOH HOH A . 
G 6 HOH 189 589 189 HOH HOH A . 
G 6 HOH 190 590 190 HOH HOH A . 
G 6 HOH 191 591 191 HOH HOH A . 
G 6 HOH 192 592 192 HOH HOH A . 
G 6 HOH 193 593 193 HOH HOH A . 
G 6 HOH 194 594 194 HOH HOH A . 
G 6 HOH 195 595 195 HOH HOH A . 
G 6 HOH 196 596 196 HOH HOH A . 
G 6 HOH 197 597 197 HOH HOH A . 
G 6 HOH 198 598 198 HOH HOH A . 
G 6 HOH 199 599 199 HOH HOH A . 
G 6 HOH 200 600 200 HOH HOH A . 
G 6 HOH 201 601 201 HOH HOH A . 
G 6 HOH 202 602 202 HOH HOH A . 
G 6 HOH 203 603 203 HOH HOH A . 
G 6 HOH 204 604 204 HOH HOH A . 
G 6 HOH 205 605 205 HOH HOH A . 
G 6 HOH 206 606 206 HOH HOH A . 
G 6 HOH 207 607 207 HOH HOH A . 
G 6 HOH 208 608 208 HOH HOH A . 
G 6 HOH 209 609 209 HOH HOH A . 
G 6 HOH 210 610 210 HOH HOH A . 
G 6 HOH 211 611 211 HOH HOH A . 
G 6 HOH 212 612 212 HOH HOH A . 
G 6 HOH 213 613 213 HOH HOH A . 
#