data_4QPL
# 
_entry.id   4QPL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4QPL         
RCSB  RCSB086352   
WWPDB D_1000086352 
# 
_pdbx_database_status.entry_id                        4QPL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-06-23 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, Z.'     1 
'DaRosa, P.A.' 2 
'Klevit, R.E.' 3 
'Xu, W.'       4 
# 
_citation.id                        primary 
_citation.title                     'Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            517 
_citation.page_first                223 
_citation.page_last                 226 
_citation.year                      2015 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25327252 
_citation.pdbx_database_id_DOI      10.1038/nature13826 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'DaRosa, P.A.'  1 
primary 'Wang, Z.'      2 
primary 'Jiang, X.'     3 
primary 'Pruneda, J.N.' 4 
primary 'Cong, F.'      5 
primary 'Klevit, R.E.'  6 
primary 'Xu, W.'        7 
# 
_cell.length_a           133.665 
_cell.length_b           61.688 
_cell.length_c           94.346 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4QPL 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.entry_id                         4QPL 
_symmetry.Int_Tables_number                18 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'E3 ubiquitin-protein ligase RNF146'                                            17857.580 2   6.3.2.-  ? 
'UNP residues 32-185' ? 
2 polymer     man 'Ubiquitin-conjugating enzyme E2 D1'                                            17521.973 2   6.3.2.19 ? ? ? 
3 non-polymer syn 
;2'-O-(5-O-phosphono-alpha-D-ribofuranosyl)adenosine 5'-(dihydrogen phosphate)
;
559.316   2   ?        ? ?                     ? 
4 non-polymer syn 'ZINC ION'                                                                      65.409    4   ?        ? ? ? 
5 water       nat water                                                                           18.015    371 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Iduna, RING finger protein 146' 
2 
;Stimulator of Fe transport, SFT, UBC4/5 homolog, UbcH5, Ubiquitin carrier protein D1, Ubiquitin-conjugating enzyme E2(17)KB 1, Ubiquitin-conjugating enzyme E2-17 kDa 1, Ubiquitin-protein ligase D1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYE
GRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLD
;
;GSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYE
GRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLD
;
A,C ? 
2 'polypeptide(L)' no no 
;HHHHHHAMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKI
YHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
;
;HHHHHHAMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKI
YHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   LEU n 
1 4   THR n 
1 5   VAL n 
1 6   PRO n 
1 7   GLU n 
1 8   CYS n 
1 9   ALA n 
1 10  ILE n 
1 11  CYS n 
1 12  LEU n 
1 13  GLN n 
1 14  THR n 
1 15  CYS n 
1 16  VAL n 
1 17  HIS n 
1 18  PRO n 
1 19  VAL n 
1 20  SER n 
1 21  LEU n 
1 22  PRO n 
1 23  CYS n 
1 24  LYS n 
1 25  HIS n 
1 26  VAL n 
1 27  PHE n 
1 28  CYS n 
1 29  TYR n 
1 30  LEU n 
1 31  CYS n 
1 32  VAL n 
1 33  LYS n 
1 34  GLY n 
1 35  ALA n 
1 36  SER n 
1 37  TRP n 
1 38  LEU n 
1 39  GLY n 
1 40  LYS n 
1 41  ARG n 
1 42  CYS n 
1 43  ALA n 
1 44  LEU n 
1 45  CYS n 
1 46  ARG n 
1 47  GLN n 
1 48  GLU n 
1 49  ILE n 
1 50  PRO n 
1 51  GLU n 
1 52  ASP n 
1 53  PHE n 
1 54  LEU n 
1 55  ASP n 
1 56  LYS n 
1 57  PRO n 
1 58  THR n 
1 59  LEU n 
1 60  LEU n 
1 61  SER n 
1 62  PRO n 
1 63  GLU n 
1 64  GLU n 
1 65  LEU n 
1 66  LYS n 
1 67  ALA n 
1 68  ALA n 
1 69  SER n 
1 70  ARG n 
1 71  GLY n 
1 72  ASN n 
1 73  GLY n 
1 74  GLU n 
1 75  TYR n 
1 76  ALA n 
1 77  TRP n 
1 78  TYR n 
1 79  TYR n 
1 80  GLU n 
1 81  GLY n 
1 82  ARG n 
1 83  ASN n 
1 84  GLY n 
1 85  TRP n 
1 86  TRP n 
1 87  GLN n 
1 88  TYR n 
1 89  ASP n 
1 90  GLU n 
1 91  ARG n 
1 92  THR n 
1 93  SER n 
1 94  ARG n 
1 95  GLU n 
1 96  LEU n 
1 97  GLU n 
1 98  ASP n 
1 99  ALA n 
1 100 PHE n 
1 101 SER n 
1 102 LYS n 
1 103 GLY n 
1 104 LYS n 
1 105 LYS n 
1 106 ASN n 
1 107 THR n 
1 108 GLU n 
1 109 MET n 
1 110 LEU n 
1 111 ILE n 
1 112 ALA n 
1 113 GLY n 
1 114 PHE n 
1 115 LEU n 
1 116 TYR n 
1 117 VAL n 
1 118 ALA n 
1 119 ASP n 
1 120 LEU n 
1 121 GLU n 
1 122 ASN n 
1 123 MET n 
1 124 VAL n 
1 125 GLN n 
1 126 TYR n 
1 127 ARG n 
1 128 ARG n 
1 129 ASN n 
1 130 GLU n 
1 131 HIS n 
1 132 GLY n 
1 133 ARG n 
1 134 ARG n 
1 135 ARG n 
1 136 LYS n 
1 137 ILE n 
1 138 LYS n 
1 139 ARG n 
1 140 ASP n 
1 141 ILE n 
1 142 ILE n 
1 143 ASP n 
1 144 ILE n 
1 145 PRO n 
1 146 LYS n 
1 147 LYS n 
1 148 GLY n 
1 149 VAL n 
1 150 ALA n 
1 151 GLY n 
1 152 LEU n 
1 153 ARG n 
1 154 LEU n 
1 155 ASP n 
2 1   HIS n 
2 2   HIS n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   ALA n 
2 8   MET n 
2 9   ALA n 
2 10  LEU n 
2 11  LYS n 
2 12  ARG n 
2 13  ILE n 
2 14  GLN n 
2 15  LYS n 
2 16  GLU n 
2 17  LEU n 
2 18  SER n 
2 19  ASP n 
2 20  LEU n 
2 21  GLN n 
2 22  ARG n 
2 23  ASP n 
2 24  PRO n 
2 25  PRO n 
2 26  ALA n 
2 27  HIS n 
2 28  CYS n 
2 29  SER n 
2 30  ALA n 
2 31  GLY n 
2 32  PRO n 
2 33  VAL n 
2 34  GLY n 
2 35  ASP n 
2 36  ASP n 
2 37  LEU n 
2 38  PHE n 
2 39  HIS n 
2 40  TRP n 
2 41  GLN n 
2 42  ALA n 
2 43  THR n 
2 44  ILE n 
2 45  MET n 
2 46  GLY n 
2 47  PRO n 
2 48  PRO n 
2 49  ASP n 
2 50  SER n 
2 51  ALA n 
2 52  TYR n 
2 53  GLN n 
2 54  GLY n 
2 55  GLY n 
2 56  VAL n 
2 57  PHE n 
2 58  PHE n 
2 59  LEU n 
2 60  THR n 
2 61  VAL n 
2 62  HIS n 
2 63  PHE n 
2 64  PRO n 
2 65  THR n 
2 66  ASP n 
2 67  TYR n 
2 68  PRO n 
2 69  PHE n 
2 70  LYS n 
2 71  PRO n 
2 72  PRO n 
2 73  LYS n 
2 74  ILE n 
2 75  ALA n 
2 76  PHE n 
2 77  THR n 
2 78  THR n 
2 79  LYS n 
2 80  ILE n 
2 81  TYR n 
2 82  HIS n 
2 83  PRO n 
2 84  ASN n 
2 85  ILE n 
2 86  ASN n 
2 87  SER n 
2 88  ASN n 
2 89  GLY n 
2 90  SER n 
2 91  ILE n 
2 92  CYS n 
2 93  LEU n 
2 94  ASP n 
2 95  ILE n 
2 96  LEU n 
2 97  ARG n 
2 98  SER n 
2 99  GLN n 
2 100 TRP n 
2 101 SER n 
2 102 PRO n 
2 103 ALA n 
2 104 LEU n 
2 105 THR n 
2 106 VAL n 
2 107 SER n 
2 108 LYS n 
2 109 VAL n 
2 110 LEU n 
2 111 LEU n 
2 112 SER n 
2 113 ILE n 
2 114 CYS n 
2 115 SER n 
2 116 LEU n 
2 117 LEU n 
2 118 CYS n 
2 119 ASP n 
2 120 PRO n 
2 121 ASN n 
2 122 PRO n 
2 123 ASP n 
2 124 ASP n 
2 125 PRO n 
2 126 LEU n 
2 127 VAL n 
2 128 PRO n 
2 129 ASP n 
2 130 ILE n 
2 131 ALA n 
2 132 GLN n 
2 133 ILE n 
2 134 TYR n 
2 135 LYS n 
2 136 SER n 
2 137 ASP n 
2 138 LYS n 
2 139 GLU n 
2 140 LYS n 
2 141 TYR n 
2 142 ASN n 
2 143 ARG n 
2 144 HIS n 
2 145 ALA n 
2 146 ARG n 
2 147 GLU n 
2 148 TRP n 
2 149 THR n 
2 150 GLN n 
2 151 LYS n 
2 152 TYR n 
2 153 ALA n 
2 154 MET n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? mouse ? Rnf146                              ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? 'UBE2D1, SFT, UBC5A, UBCH5, UBCH5A' ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RN146_MOUSE Q9CZW6 1 
;SLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEG
RNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLD
;
32 ? 
2 UNP UB2D1_HUMAN P51668 2 
;MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINS
NGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
;
1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4QPL A 2 ? 155 ? Q9CZW6 32 ? 185 ? 30 183 
2 2 4QPL B 8 ? 154 ? P51668 1  ? 147 ? 1  147 
3 1 4QPL C 2 ? 155 ? Q9CZW6 32 ? 185 ? 30 183 
4 2 4QPL D 8 ? 154 ? P51668 1  ? 147 ? 1  147 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4QPL GLY A 1 ? UNP Q9CZW6 ? ? 'EXPRESSION TAG' 29 1  
2 4QPL HIS B 1 ? UNP P51668 ? ? 'EXPRESSION TAG' -6 2  
2 4QPL HIS B 2 ? UNP P51668 ? ? 'EXPRESSION TAG' -5 3  
2 4QPL HIS B 3 ? UNP P51668 ? ? 'EXPRESSION TAG' -4 4  
2 4QPL HIS B 4 ? UNP P51668 ? ? 'EXPRESSION TAG' -3 5  
2 4QPL HIS B 5 ? UNP P51668 ? ? 'EXPRESSION TAG' -2 6  
2 4QPL HIS B 6 ? UNP P51668 ? ? 'EXPRESSION TAG' -1 7  
2 4QPL ALA B 7 ? UNP P51668 ? ? 'EXPRESSION TAG' 0  8  
3 4QPL GLY C 1 ? UNP Q9CZW6 ? ? 'EXPRESSION TAG' 29 9  
4 4QPL HIS D 1 ? UNP P51668 ? ? 'EXPRESSION TAG' -6 10 
4 4QPL HIS D 2 ? UNP P51668 ? ? 'EXPRESSION TAG' -5 11 
4 4QPL HIS D 3 ? UNP P51668 ? ? 'EXPRESSION TAG' -4 12 
4 4QPL HIS D 4 ? UNP P51668 ? ? 'EXPRESSION TAG' -3 13 
4 4QPL HIS D 5 ? UNP P51668 ? ? 'EXPRESSION TAG' -2 14 
4 4QPL HIS D 6 ? UNP P51668 ? ? 'EXPRESSION TAG' -1 15 
4 4QPL ALA D 7 ? UNP P51668 ? ? 'EXPRESSION TAG' 0  16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                         ? 'C3 H7 N O2'        
89.093  
ARG 'L-peptide linking' y ARGININE                                                                        ? 'C6 H15 N4 O2 1'    
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                      ? 'C4 H8 N2 O3'       
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                 ? 'C4 H7 N O4'        
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                        ? 'C3 H7 N O2 S'      
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                       ? 'C5 H10 N2 O3'      
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                 ? 'C5 H9 N O4'        
147.129 
GLY 'peptide linking'   y GLYCINE                                                                         ? 'C2 H5 N O2'        
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                       ? 'C6 H10 N3 O2 1'    
156.162 
HOH non-polymer         . WATER                                                                           ? 'H2 O'              
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                      ? 'C6 H13 N O2'       
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                         ? 'C6 H13 N O2'       
131.173 
LYS 'L-peptide linking' y LYSINE                                                                          ? 'C6 H15 N2 O2 1'    
147.195 
MET 'L-peptide linking' y METHIONINE                                                                      ? 'C5 H11 N O2 S'     
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                   ? 'C9 H11 N O2'       
165.189 
PRO 'L-peptide linking' y PROLINE                                                                         ? 'C5 H9 N O2'        
115.130 
SER 'L-peptide linking' y SERINE                                                                          ? 'C3 H7 N O3'        
105.093 
THR 'L-peptide linking' y THREONINE                                                                       ? 'C4 H9 N O3'        
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                      ? 'C11 H12 N2 O2'     
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                        ? 'C9 H11 N O3'       
181.189 
V3L 'RNA linking'       n 
;2'-O-(5-O-phosphono-alpha-D-ribofuranosyl)adenosine 5'-(dihydrogen phosphate)
;
? 'C15 H23 N5 O14 P2' 559.316 
VAL 'L-peptide linking' y VALINE                                                                          ? 'C5 H11 N O2'       
117.146 
ZN  non-polymer         . 'ZINC ION'                                                                      ? 'Zn 2'              
65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          4QPL 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   55.25 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;0.8 M sodium citrate, 80 mM Tris HCl pH7.0, 160 mM NaCl, 4 mMDTT, 20 mM trimethylamin HCl, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-11-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL, SI(111)' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.2830 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.2830 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
# 
_reflns.entry_id                     4QPL 
_reflns.d_resolution_high            1.900 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   55779 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_chi_squared             2.348 
_reflns.pdbx_redundancy              7.800 
_reflns.percent_possible_obs         94.94 
_reflns.observed_criterion_sigma_F   2.5 
_reflns.observed_criterion_sigma_I   2.5 
_reflns.number_all                   58752 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.900 
_reflns_shell.d_res_low              1.960 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.807 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.percent_possible_all   71.400 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4QPL 
_refine.ls_d_res_high                            1.9000 
_refine.ls_d_res_low                             50.0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    94.9400 
_refine.ls_number_reflns_obs                     55779 
_refine.ls_number_reflns_all                     58752 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.ls_R_factor_all                          0.1882 
_refine.ls_R_factor_obs                          0.1882 
_refine.ls_R_factor_R_work                       0.1864 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2220 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_number_reflns_R_free                  2994 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               39.6580 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -2.2700 
_refine.aniso_B[2][2]                            6.0700 
_refine.aniso_B[3][3]                            -3.8100 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9640 
_refine.correlation_coeff_Fo_to_Fc_free          0.9480 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.1450 
_refine.pdbx_overall_ESU_R_Free                  0.1350 
_refine.overall_SU_ML                            0.0800 
_refine.overall_SU_B                             4.6560 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                117.750 
_refine.B_iso_min                                17.920 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4886 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         76 
_refine_hist.number_atoms_solvent             371 
_refine_hist.number_atoms_total               5333 
_refine_hist.d_res_high                       1.9000 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       5116  0.009  0.019  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         4794  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    6944  1.400  1.980  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      11066 0.790  3.003  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 604   6.200  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 230   33.877 23.304 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 858   14.196 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 36    15.159 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         734   0.076  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   5634  0.006  0.021  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     1170  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            2428  2.012  3.427  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         2427  2.012  3.427  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           3028  2.940  5.748  ? ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4QPL 
_struct.title                     'Crystal structure of RNF146(RING-WWE)/UbcH5a/iso-ADPr complex' 
_struct.pdbx_descriptor           
'E3 ubiquitin-protein ligase RNF146 (E.C.6.3.2.-), Ubiquitin-conjugating enzyme E2 D1 (E.C.6.3.2.19)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4QPL 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            
'Protein poly(ADP-ribosy)lation, ubiquitination, E2/E3 ubiquitin ligase, Wnt signaling, RNF146, UbcH5a, iso-ADPR, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 29  ? TRP A 37  ? TYR A 57  TRP A 65  1 ? 9  
HELX_P HELX_P2  2  SER A 61  ? SER A 69  ? SER A 89  SER A 97  1 ? 9  
HELX_P HELX_P3  3  ASP A 89  ? LYS A 102 ? ASP A 117 LYS A 130 1 ? 14 
HELX_P HELX_P4  4  ALA B 7   ? ASP B 23  ? ALA B 0   ASP B 16  1 ? 17 
HELX_P HELX_P5  5  LEU B 93  ? ARG B 97  ? LEU B 86  ARG B 90  5 ? 5  
HELX_P HELX_P6  6  THR B 105 ? ASP B 119 ? THR B 98  ASP B 112 1 ? 15 
HELX_P HELX_P7  7  VAL B 127 ? ASP B 137 ? VAL B 120 ASP B 130 1 ? 11 
HELX_P HELX_P8  8  ASP B 137 ? MET B 154 ? ASP B 130 MET B 147 1 ? 18 
HELX_P HELX_P9  9  TYR C 29  ? TRP C 37  ? TYR C 57  TRP C 65  1 ? 9  
HELX_P HELX_P10 10 SER C 61  ? GLY C 71  ? SER C 89  GLY C 99  1 ? 11 
HELX_P HELX_P11 11 ASP C 89  ? LYS C 102 ? ASP C 117 LYS C 130 1 ? 14 
HELX_P HELX_P12 12 HIS D 6   ? ASP D 23  ? HIS D -1  ASP D 16  1 ? 18 
HELX_P HELX_P13 13 LEU D 93  ? ARG D 97  ? LEU D 86  ARG D 90  5 ? 5  
HELX_P HELX_P14 14 THR D 105 ? ASP D 119 ? THR D 98  ASP D 112 1 ? 15 
HELX_P HELX_P15 15 VAL D 127 ? ASP D 137 ? VAL D 120 ASP D 130 1 ? 11 
HELX_P HELX_P16 16 ASP D 137 ? MET D 154 ? ASP D 130 MET D 147 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C HIS 25 ND1 ? ? ? 1_555 J ZN . ZN ? ? C HIS 53 C ZN 203 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc2  metalc ? ? A HIS 25 ND1 ? ? ? 1_555 G ZN . ZN ? ? A HIS 53 A ZN 203 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc3  metalc ? ? A CYS 23 SG  ? ? ? 1_555 G ZN . ZN ? ? A CYS 51 A ZN 203 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc4  metalc ? ? A CYS 11 SG  ? ? ? 1_555 F ZN . ZN ? ? A CYS 39 A ZN 202 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc5  metalc ? ? C CYS 23 SG  ? ? ? 1_555 J ZN . ZN ? ? C CYS 51 C ZN 203 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc6  metalc ? ? C CYS 8  SG  ? ? ? 1_555 I ZN . ZN ? ? C CYS 36 C ZN 202 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc7  metalc ? ? C CYS 45 SG  ? ? ? 1_555 J ZN . ZN ? ? C CYS 73 C ZN 203 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc8  metalc ? ? C CYS 11 SG  ? ? ? 1_555 I ZN . ZN ? ? C CYS 39 C ZN 202 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc9  metalc ? ? A CYS 8  SG  ? ? ? 1_555 F ZN . ZN ? ? A CYS 36 A ZN 202 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc10 metalc ? ? A CYS 31 SG  ? ? ? 1_555 F ZN . ZN ? ? A CYS 59 A ZN 202 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc11 metalc ? ? A CYS 42 SG  ? ? ? 1_555 G ZN . ZN ? ? A CYS 70 A ZN 203 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc12 metalc ? ? A CYS 45 SG  ? ? ? 1_555 G ZN . ZN ? ? A CYS 73 A ZN 203 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc13 metalc ? ? C CYS 28 SG  ? ? ? 1_555 I ZN . ZN ? ? C CYS 56 C ZN 202 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc14 metalc ? ? C CYS 42 SG  ? ? ? 1_555 J ZN . ZN ? ? C CYS 70 C ZN 203 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc15 metalc ? ? A CYS 28 SG  ? ? ? 1_555 F ZN . ZN ? ? A CYS 56 A ZN 202 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc16 metalc ? ? C CYS 31 SG  ? ? ? 1_555 I ZN . ZN ? ? C CYS 59 C ZN 202 1_555 ? ? ? ? ? ? ? 2.355 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 67 B . ? TYR 60 B PRO 68 B ? PRO 61 B 1 10.19 
2 TYR 67 D . ? TYR 60 D PRO 68 D ? PRO 61 D 1 4.00  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 8 ? 
C ? 4 ? 
D ? 2 ? 
E ? 8 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? parallel      
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
E 6 7 ? parallel      
E 7 8 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PRO A 18  ? SER A 20  ? PRO A 46  SER A 48  
A 2 VAL A 26  ? CYS A 28  ? VAL A 54  CYS A 56  
B 1 ASN A 106 ? ILE A 111 ? ASN A 134 ILE A 139 
B 2 PHE A 114 ? ASP A 119 ? PHE A 142 ASP A 147 
B 3 VAL A 124 ? ARG A 127 ? VAL A 152 ARG A 155 
B 4 ARG A 134 ? ILE A 141 ? ARG A 162 ILE A 169 
B 5 TYR A 75  ? GLY A 81  ? TYR A 103 GLY A 109 
B 6 GLY A 84  ? GLN A 87  ? GLY A 112 GLN A 115 
B 7 GLY A 148 ? VAL A 149 ? GLY A 176 VAL A 177 
B 8 LEU A 152 ? ARG A 153 ? LEU A 180 ARG A 181 
C 1 CYS B 28  ? VAL B 33  ? CYS B 21  VAL B 26  
C 2 ASP B 36  ? MET B 45  ? ASP B 29  MET B 38  
C 3 VAL B 56  ? HIS B 62  ? VAL B 49  HIS B 55  
C 4 LYS B 73  ? PHE B 76  ? LYS B 66  PHE B 69  
D 1 PRO C 18  ? SER C 20  ? PRO C 46  SER C 48  
D 2 VAL C 26  ? CYS C 28  ? VAL C 54  CYS C 56  
E 1 ASN C 106 ? ILE C 111 ? ASN C 134 ILE C 139 
E 2 PHE C 114 ? ASP C 119 ? PHE C 142 ASP C 147 
E 3 VAL C 124 ? ARG C 127 ? VAL C 152 ARG C 155 
E 4 ARG C 135 ? ILE C 141 ? ARG C 163 ILE C 169 
E 5 TYR C 75  ? GLY C 81  ? TYR C 103 GLY C 109 
E 6 GLY C 84  ? GLN C 87  ? GLY C 112 GLN C 115 
E 7 GLY C 148 ? VAL C 149 ? GLY C 176 VAL C 177 
E 8 LEU C 152 ? ARG C 153 ? LEU C 180 ARG C 181 
F 1 CYS D 28  ? VAL D 33  ? CYS D 21  VAL D 26  
F 2 ASP D 36  ? MET D 45  ? ASP D 29  MET D 38  
F 3 VAL D 56  ? HIS D 62  ? VAL D 49  HIS D 55  
F 4 LYS D 73  ? PHE D 76  ? LYS D 66  PHE D 69  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 19  ? N VAL A 47  O PHE A 27  ? O PHE A 55  
B 1 2 N THR A 107 ? N THR A 135 O ALA A 118 ? O ALA A 146 
B 2 3 N ASP A 119 ? N ASP A 147 O VAL A 124 ? O VAL A 152 
B 3 4 N GLN A 125 ? N GLN A 153 O ARG A 135 ? O ARG A 163 
B 4 5 O LYS A 138 ? O LYS A 166 N TYR A 78  ? N TYR A 106 
B 5 6 N TYR A 79  ? N TYR A 107 O TRP A 86  ? O TRP A 114 
B 6 7 N GLN A 87  ? N GLN A 115 O GLY A 148 ? O GLY A 176 
B 7 8 N VAL A 149 ? N VAL A 177 O LEU A 152 ? O LEU A 180 
C 1 2 N GLY B 31  ? N GLY B 24  O GLN B 41  ? O GLN B 34  
C 2 3 N ILE B 44  ? N ILE B 37  O PHE B 57  ? O PHE B 50  
C 3 4 N HIS B 62  ? N HIS B 55  O LYS B 73  ? O LYS B 66  
D 1 2 N VAL C 19  ? N VAL C 47  O PHE C 27  ? O PHE C 55  
E 1 2 N MET C 109 ? N MET C 137 O TYR C 116 ? O TYR C 144 
E 2 3 N ASP C 119 ? N ASP C 147 O VAL C 124 ? O VAL C 152 
E 3 4 N GLN C 125 ? N GLN C 153 O ARG C 135 ? O ARG C 163 
E 4 5 O ASP C 140 ? O ASP C 168 N ALA C 76  ? N ALA C 104 
E 5 6 N TYR C 79  ? N TYR C 107 O TRP C 86  ? O TRP C 114 
E 6 7 N GLN C 87  ? N GLN C 115 O GLY C 148 ? O GLY C 176 
E 7 8 N VAL C 149 ? N VAL C 177 O LEU C 152 ? O LEU C 180 
F 1 2 N VAL D 33  ? N VAL D 26  O HIS D 39  ? O HIS D 32  
F 2 3 N ILE D 44  ? N ILE D 37  O PHE D 57  ? O PHE D 50  
F 3 4 N HIS D 62  ? N HIS D 55  O LYS D 73  ? O LYS D 66  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE V3L A 201' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 202'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 203'  
AC4 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE V3L C 201' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 202'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 203'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 LYS A 33  ? LYS A 61  . ? 1_555 ? 
2  AC1 18 TYR A 79  ? TYR A 107 . ? 1_555 ? 
3  AC1 18 GLY A 81  ? GLY A 109 . ? 1_555 ? 
4  AC1 18 ARG A 82  ? ARG A 110 . ? 1_555 ? 
5  AC1 18 TRP A 86  ? TRP A 114 . ? 1_555 ? 
6  AC1 18 TYR A 88  ? TYR A 116 . ? 1_555 ? 
7  AC1 18 ILE A 111 ? ILE A 139 . ? 1_555 ? 
8  AC1 18 TYR A 116 ? TYR A 144 . ? 1_555 ? 
9  AC1 18 GLN A 125 ? GLN A 153 . ? 1_555 ? 
10 AC1 18 ARG A 133 ? ARG A 161 . ? 1_555 ? 
11 AC1 18 ARG A 135 ? ARG A 163 . ? 1_555 ? 
12 AC1 18 LYS A 147 ? LYS A 175 . ? 1_555 ? 
13 AC1 18 GLY A 151 ? GLY A 179 . ? 1_555 ? 
14 AC1 18 HOH K .   ? HOH A 302 . ? 1_555 ? 
15 AC1 18 HOH K .   ? HOH A 305 . ? 1_555 ? 
16 AC1 18 HOH K .   ? HOH A 306 . ? 1_555 ? 
17 AC1 18 HOH K .   ? HOH A 318 . ? 1_555 ? 
18 AC1 18 HOH K .   ? HOH A 330 . ? 1_555 ? 
19 AC2 4  CYS A 8   ? CYS A 36  . ? 1_555 ? 
20 AC2 4  CYS A 11  ? CYS A 39  . ? 1_555 ? 
21 AC2 4  CYS A 28  ? CYS A 56  . ? 1_555 ? 
22 AC2 4  CYS A 31  ? CYS A 59  . ? 1_555 ? 
23 AC3 4  CYS A 23  ? CYS A 51  . ? 1_555 ? 
24 AC3 4  HIS A 25  ? HIS A 53  . ? 1_555 ? 
25 AC3 4  CYS A 42  ? CYS A 70  . ? 1_555 ? 
26 AC3 4  CYS A 45  ? CYS A 73  . ? 1_555 ? 
27 AC4 19 LYS C 33  ? LYS C 61  . ? 1_555 ? 
28 AC4 19 TYR C 79  ? TYR C 107 . ? 1_555 ? 
29 AC4 19 GLY C 81  ? GLY C 109 . ? 1_555 ? 
30 AC4 19 ARG C 82  ? ARG C 110 . ? 1_555 ? 
31 AC4 19 TRP C 86  ? TRP C 114 . ? 1_555 ? 
32 AC4 19 TYR C 88  ? TYR C 116 . ? 1_555 ? 
33 AC4 19 ILE C 111 ? ILE C 139 . ? 1_555 ? 
34 AC4 19 TYR C 116 ? TYR C 144 . ? 1_555 ? 
35 AC4 19 GLN C 125 ? GLN C 153 . ? 1_555 ? 
36 AC4 19 ARG C 133 ? ARG C 161 . ? 1_555 ? 
37 AC4 19 ARG C 135 ? ARG C 163 . ? 1_555 ? 
38 AC4 19 LYS C 147 ? LYS C 175 . ? 1_555 ? 
39 AC4 19 GLY C 151 ? GLY C 179 . ? 1_555 ? 
40 AC4 19 HOH M .   ? HOH C 301 . ? 1_555 ? 
41 AC4 19 HOH M .   ? HOH C 303 . ? 1_555 ? 
42 AC4 19 HOH M .   ? HOH C 304 . ? 1_555 ? 
43 AC4 19 HOH M .   ? HOH C 319 . ? 1_555 ? 
44 AC4 19 HOH M .   ? HOH C 320 . ? 1_555 ? 
45 AC4 19 HOH M .   ? HOH C 345 . ? 1_555 ? 
46 AC5 4  CYS C 8   ? CYS C 36  . ? 1_555 ? 
47 AC5 4  CYS C 11  ? CYS C 39  . ? 1_555 ? 
48 AC5 4  CYS C 28  ? CYS C 56  . ? 1_555 ? 
49 AC5 4  CYS C 31  ? CYS C 59  . ? 1_555 ? 
50 AC6 4  CYS C 23  ? CYS C 51  . ? 1_555 ? 
51 AC6 4  HIS C 25  ? HIS C 53  . ? 1_555 ? 
52 AC6 4  CYS C 42  ? CYS C 70  . ? 1_555 ? 
53 AC6 4  CYS C 45  ? CYS C 73  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4QPL 
_atom_sites.fract_transf_matrix[1][1]   0.007481 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016211 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010599 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 2   ? 42.012  38.738 24.655 1.00 66.36  ? 30  SER A N     1 
ATOM   2    C  CA    . SER A 1 2   ? 41.187  38.117 25.744 1.00 65.32  ? 30  SER A CA    1 
ATOM   3    C  C     . SER A 1 2   ? 41.846  38.201 27.132 1.00 66.60  ? 30  SER A C     1 
ATOM   4    O  O     . SER A 1 2   ? 42.952  37.694 27.327 1.00 62.25  ? 30  SER A O     1 
ATOM   5    C  CB    . SER A 1 2   ? 40.889  36.652 25.412 1.00 62.47  ? 30  SER A CB    1 
ATOM   6    O  OG    . SER A 1 2   ? 40.043  36.084 26.396 1.00 62.56  ? 30  SER A OG    1 
ATOM   7    N  N     . LEU A 1 3   ? 41.155  38.838 28.083 1.00 69.27  ? 31  LEU A N     1 
ATOM   8    C  CA    . LEU A 1 3   ? 41.587  38.889 29.490 1.00 69.09  ? 31  LEU A CA    1 
ATOM   9    C  C     . LEU A 1 3   ? 41.589  37.500 30.133 1.00 69.62  ? 31  LEU A C     1 
ATOM   10   O  O     . LEU A 1 3   ? 42.353  37.251 31.072 1.00 69.64  ? 31  LEU A O     1 
ATOM   11   C  CB    . LEU A 1 3   ? 40.670  39.812 30.307 1.00 72.92  ? 31  LEU A CB    1 
ATOM   12   C  CG    . LEU A 1 3   ? 40.851  41.341 30.309 1.00 76.81  ? 31  LEU A CG    1 
ATOM   13   C  CD1   . LEU A 1 3   ? 42.001  41.831 29.442 1.00 76.31  ? 31  LEU A CD1   1 
ATOM   14   C  CD2   . LEU A 1 3   ? 39.545  42.024 29.936 1.00 77.76  ? 31  LEU A CD2   1 
ATOM   15   N  N     . THR A 1 4   ? 40.729  36.606 29.638 1.00 64.38  ? 32  THR A N     1 
ATOM   16   C  CA    . THR A 1 4   ? 40.625  35.255 30.179 1.00 60.70  ? 32  THR A CA    1 
ATOM   17   C  C     . THR A 1 4   ? 41.572  34.313 29.435 1.00 56.48  ? 32  THR A C     1 
ATOM   18   O  O     . THR A 1 4   ? 41.997  34.604 28.320 1.00 56.35  ? 32  THR A O     1 
ATOM   19   C  CB    . THR A 1 4   ? 39.174  34.722 30.083 1.00 63.63  ? 32  THR A CB    1 
ATOM   20   O  OG1   . THR A 1 4   ? 38.727  34.757 28.719 1.00 62.18  ? 32  THR A OG1   1 
ATOM   21   C  CG2   . THR A 1 4   ? 38.218  35.555 30.956 1.00 67.13  ? 32  THR A CG2   1 
ATOM   22   N  N     . VAL A 1 5   ? 41.900  33.192 30.064 1.00 49.32  ? 33  VAL A N     1 
ATOM   23   C  CA    . VAL A 1 5   ? 42.733  32.157 29.436 1.00 50.20  ? 33  VAL A CA    1 
ATOM   24   C  C     . VAL A 1 5   ? 41.888  31.399 28.399 1.00 47.62  ? 33  VAL A C     1 
ATOM   25   O  O     . VAL A 1 5   ? 40.742  31.038 28.688 1.00 44.33  ? 33  VAL A O     1 
ATOM   26   C  CB    . VAL A 1 5   ? 43.264  31.172 30.501 1.00 49.56  ? 33  VAL A CB    1 
ATOM   27   C  CG1   . VAL A 1 5   ? 44.083  30.042 29.874 1.00 47.70  ? 33  VAL A CG1   1 
ATOM   28   C  CG2   . VAL A 1 5   ? 44.077  31.926 31.550 1.00 50.33  ? 33  VAL A CG2   1 
ATOM   29   N  N     . PRO A 1 6   ? 42.435  31.168 27.190 1.00 48.30  ? 34  PRO A N     1 
ATOM   30   C  CA    . PRO A 1 6   ? 41.626  30.526 26.150 1.00 50.63  ? 34  PRO A CA    1 
ATOM   31   C  C     . PRO A 1 6   ? 41.196  29.107 26.520 1.00 47.16  ? 34  PRO A C     1 
ATOM   32   O  O     . PRO A 1 6   ? 41.869  28.422 27.300 1.00 38.53  ? 34  PRO A O     1 
ATOM   33   C  CB    . PRO A 1 6   ? 42.556  30.497 24.928 1.00 51.79  ? 34  PRO A CB    1 
ATOM   34   C  CG    . PRO A 1 6   ? 43.928  30.598 25.493 1.00 55.32  ? 34  PRO A CG    1 
ATOM   35   C  CD    . PRO A 1 6   ? 43.793  31.472 26.708 1.00 52.78  ? 34  PRO A CD    1 
ATOM   36   N  N     . GLU A 1 7   ? 40.063  28.699 25.966 1.00 43.35  ? 35  GLU A N     1 
ATOM   37   C  CA    . GLU A 1 7   ? 39.530  27.366 26.188 1.00 41.23  ? 35  GLU A CA    1 
ATOM   38   C  C     . GLU A 1 7   ? 40.187  26.430 25.189 1.00 35.66  ? 35  GLU A C     1 
ATOM   39   O  O     . GLU A 1 7   ? 40.408  26.807 24.039 1.00 35.03  ? 35  GLU A O     1 
ATOM   40   C  CB    . GLU A 1 7   ? 38.015  27.384 25.998 1.00 50.29  ? 35  GLU A CB    1 
ATOM   41   C  CG    . GLU A 1 7   ? 37.313  26.064 26.277 1.00 56.30  ? 35  GLU A CG    1 
ATOM   42   C  CD    . GLU A 1 7   ? 35.806  26.165 26.101 1.00 64.21  ? 35  GLU A CD    1 
ATOM   43   O  OE1   . GLU A 1 7   ? 35.234  27.220 26.459 1.00 63.34  ? 35  GLU A OE1   1 
ATOM   44   O  OE2   . GLU A 1 7   ? 35.198  25.189 25.606 1.00 64.36  ? 35  GLU A OE2   1 
ATOM   45   N  N     . CYS A 1 8   ? 40.493  25.216 25.632 1.00 31.28  ? 36  CYS A N     1 
ATOM   46   C  CA    . CYS A 1 8   ? 41.101  24.190 24.782 1.00 30.62  ? 36  CYS A CA    1 
ATOM   47   C  C     . CYS A 1 8   ? 40.021  23.392 24.039 1.00 28.06  ? 36  CYS A C     1 
ATOM   48   O  O     . CYS A 1 8   ? 39.112  22.825 24.672 1.00 29.62  ? 36  CYS A O     1 
ATOM   49   C  CB    . CYS A 1 8   ? 41.945  23.249 25.664 1.00 30.31  ? 36  CYS A CB    1 
ATOM   50   S  SG    . CYS A 1 8   ? 42.656  21.742 24.932 1.00 27.60  ? 36  CYS A SG    1 
ATOM   51   N  N     . ALA A 1 9   ? 40.141  23.303 22.715 1.00 27.08  ? 37  ALA A N     1 
ATOM   52   C  CA    . ALA A 1 9   ? 39.133  22.601 21.898 1.00 27.21  ? 37  ALA A CA    1 
ATOM   53   C  C     . ALA A 1 9   ? 39.230  21.072 22.002 1.00 26.12  ? 37  ALA A C     1 
ATOM   54   O  O     . ALA A 1 9   ? 38.327  20.372 21.553 1.00 27.31  ? 37  ALA A O     1 
ATOM   55   C  CB    . ALA A 1 9   ? 39.205  23.027 20.442 1.00 27.73  ? 37  ALA A CB    1 
ATOM   56   N  N     . ILE A 1 10  ? 40.311  20.555 22.572 1.00 24.93  ? 38  ILE A N     1 
ATOM   57   C  CA    . ILE A 1 10  ? 40.413  19.121 22.807 1.00 25.15  ? 38  ILE A CA    1 
ATOM   58   C  C     . ILE A 1 10  ? 39.619  18.717 24.054 1.00 26.16  ? 38  ILE A C     1 
ATOM   59   O  O     . ILE A 1 10  ? 38.672  17.921 23.955 1.00 26.65  ? 38  ILE A O     1 
ATOM   60   C  CB    . ILE A 1 10  ? 41.871  18.627 22.875 1.00 24.36  ? 38  ILE A CB    1 
ATOM   61   C  CG1   . ILE A 1 10  ? 42.534  18.760 21.509 1.00 24.87  ? 38  ILE A CG1   1 
ATOM   62   C  CG2   . ILE A 1 10  ? 41.915  17.141 23.308 1.00 25.24  ? 38  ILE A CG2   1 
ATOM   63   C  CD1   . ILE A 1 10  ? 44.041  18.647 21.510 1.00 24.91  ? 38  ILE A CD1   1 
ATOM   64   N  N     . CYS A 1 11  ? 39.978  19.262 25.222 1.00 27.58  ? 39  CYS A N     1 
ATOM   65   C  CA    . CYS A 1 11  ? 39.369  18.818 26.486 1.00 28.76  ? 39  CYS A CA    1 
ATOM   66   C  C     . CYS A 1 11  ? 38.144  19.647 26.909 1.00 28.00  ? 39  CYS A C     1 
ATOM   67   O  O     . CYS A 1 11  ? 37.431  19.258 27.808 1.00 30.28  ? 39  CYS A O     1 
ATOM   68   C  CB    . CYS A 1 11  ? 40.422  18.774 27.614 1.00 28.53  ? 39  CYS A CB    1 
ATOM   69   S  SG    . CYS A 1 11  ? 41.072  20.403 28.079 1.00 31.07  ? 39  CYS A SG    1 
ATOM   70   N  N     . LEU A 1 12  ? 37.928  20.790 26.261 1.00 27.97  ? 40  LEU A N     1 
ATOM   71   C  CA    . LEU A 1 12  ? 36.850  21.742 26.550 1.00 29.63  ? 40  LEU A CA    1 
ATOM   72   C  C     . LEU A 1 12  ? 37.004  22.480 27.880 1.00 31.48  ? 40  LEU A C     1 
ATOM   73   O  O     . LEU A 1 12  ? 36.048  23.079 28.368 1.00 33.89  ? 40  LEU A O     1 
ATOM   74   C  CB    . LEU A 1 12  ? 35.443  21.108 26.440 1.00 30.44  ? 40  LEU A CB    1 
ATOM   75   C  CG    . LEU A 1 12  ? 35.027  20.637 25.040 1.00 30.52  ? 40  LEU A CG    1 
ATOM   76   C  CD1   . LEU A 1 12  ? 33.594  20.128 25.073 1.00 32.13  ? 40  LEU A CD1   1 
ATOM   77   C  CD2   . LEU A 1 12  ? 35.185  21.742 23.995 1.00 30.27  ? 40  LEU A CD2   1 
ATOM   78   N  N     . GLN A 1 13  ? 38.200  22.471 28.449 1.00 32.13  ? 41  GLN A N     1 
ATOM   79   C  CA    . GLN A 1 13  ? 38.454  23.201 29.685 1.00 34.45  ? 41  GLN A CA    1 
ATOM   80   C  C     . GLN A 1 13  ? 39.301  24.426 29.371 1.00 35.28  ? 41  GLN A C     1 
ATOM   81   O  O     . GLN A 1 13  ? 39.792  24.599 28.250 1.00 33.64  ? 41  GLN A O     1 
ATOM   82   C  CB    . GLN A 1 13  ? 39.172  22.357 30.715 1.00 34.90  ? 41  GLN A CB    1 
ATOM   83   C  CG    . GLN A 1 13  ? 38.672  20.940 30.919 1.00 38.70  ? 41  GLN A CG    1 
ATOM   84   C  CD    . GLN A 1 13  ? 37.512  20.821 31.882 1.00 46.87  ? 41  GLN A CD    1 
ATOM   85   O  OE1   . GLN A 1 13  ? 36.925  21.814 32.320 1.00 48.02  ? 41  GLN A OE1   1 
ATOM   86   N  NE2   . GLN A 1 13  ? 37.166  19.580 32.217 1.00 51.84  ? 41  GLN A NE2   1 
ATOM   87   N  N     . THR A 1 14  ? 39.449  25.295 30.362 1.00 35.45  ? 42  THR A N     1 
ATOM   88   C  CA    . THR A 1 14  ? 40.415  26.375 30.272 1.00 37.65  ? 42  THR A CA    1 
ATOM   89   C  C     . THR A 1 14  ? 41.797  25.751 30.052 1.00 33.82  ? 42  THR A C     1 
ATOM   90   O  O     . THR A 1 14  ? 42.142  24.759 30.705 1.00 31.60  ? 42  THR A O     1 
ATOM   91   C  CB    . THR A 1 14  ? 40.374  27.249 31.543 1.00 41.86  ? 42  THR A CB    1 
ATOM   92   O  OG1   . THR A 1 14  ? 39.031  27.703 31.753 1.00 45.67  ? 42  THR A OG1   1 
ATOM   93   C  CG2   . THR A 1 14  ? 41.263  28.448 31.388 1.00 42.71  ? 42  THR A CG2   1 
ATOM   94   N  N     . CYS A 1 15  ? 42.558  26.275 29.087 1.00 32.35  ? 43  CYS A N     1 
ATOM   95   C  CA    . CYS A 1 15  ? 43.886  25.737 28.799 1.00 32.05  ? 43  CYS A CA    1 
ATOM   96   C  C     . CYS A 1 15  ? 44.788  25.788 30.027 1.00 32.08  ? 43  CYS A C     1 
ATOM   97   O  O     . CYS A 1 15  ? 44.814  26.789 30.743 1.00 32.13  ? 43  CYS A O     1 
ATOM   98   C  CB    . CYS A 1 15  ? 44.587  26.484 27.663 1.00 33.52  ? 43  CYS A CB    1 
ATOM   99   S  SG    . CYS A 1 15  ? 43.988  26.202 25.969 1.00 37.71  ? 43  CYS A SG    1 
ATOM   100  N  N     . VAL A 1 16  ? 45.501  24.698 30.272 1.00 30.20  ? 44  VAL A N     1 
ATOM   101  C  CA    . VAL A 1 16  ? 46.570  24.668 31.271 1.00 34.39  ? 44  VAL A CA    1 
ATOM   102  C  C     . VAL A 1 16  ? 47.873  24.510 30.511 1.00 33.35  ? 44  VAL A C     1 
ATOM   103  O  O     . VAL A 1 16  ? 48.006  23.582 29.698 1.00 32.10  ? 44  VAL A O     1 
ATOM   104  C  CB    . VAL A 1 16  ? 46.404  23.512 32.274 1.00 37.64  ? 44  VAL A CB    1 
ATOM   105  C  CG1   . VAL A 1 16  ? 47.618  23.426 33.197 1.00 41.27  ? 44  VAL A CG1   1 
ATOM   106  C  CG2   . VAL A 1 16  ? 45.138  23.720 33.088 1.00 41.47  ? 44  VAL A CG2   1 
ATOM   107  N  N     . HIS A 1 17  ? 48.819  25.415 30.782 1.00 32.40  ? 45  HIS A N     1 
ATOM   108  C  CA    . HIS A 1 17  ? 50.058  25.552 30.002 1.00 35.40  ? 45  HIS A CA    1 
ATOM   109  C  C     . HIS A 1 17  ? 49.728  25.575 28.529 1.00 32.64  ? 45  HIS A C     1 
ATOM   110  O  O     . HIS A 1 17  ? 50.090  24.650 27.794 1.00 33.08  ? 45  HIS A O     1 
ATOM   111  C  CB    . HIS A 1 17  ? 51.057  24.445 30.335 1.00 39.10  ? 45  HIS A CB    1 
ATOM   112  C  CG    . HIS A 1 17  ? 51.370  24.373 31.789 1.00 43.08  ? 45  HIS A CG    1 
ATOM   113  N  ND1   . HIS A 1 17  ? 51.902  25.443 32.477 1.00 47.84  ? 45  HIS A ND1   1 
ATOM   114  C  CD2   . HIS A 1 17  ? 51.169  23.394 32.699 1.00 46.28  ? 45  HIS A CD2   1 
ATOM   115  C  CE1   . HIS A 1 17  ? 52.028  25.119 33.749 1.00 47.57  ? 45  HIS A CE1   1 
ATOM   116  N  NE2   . HIS A 1 17  ? 51.587  23.884 33.911 1.00 52.13  ? 45  HIS A NE2   1 
ATOM   117  N  N     . PRO A 1 18  ? 48.983  26.612 28.109 1.00 32.50  ? 46  PRO A N     1 
ATOM   118  C  CA    . PRO A 1 18  ? 48.587  26.717 26.723 1.00 32.36  ? 46  PRO A CA    1 
ATOM   119  C  C     . PRO A 1 18  ? 49.804  26.861 25.832 1.00 34.79  ? 46  PRO A C     1 
ATOM   120  O  O     . PRO A 1 18  ? 50.700  27.681 26.109 1.00 35.80  ? 46  PRO A O     1 
ATOM   121  C  CB    . PRO A 1 18  ? 47.769  28.027 26.679 1.00 33.28  ? 46  PRO A CB    1 
ATOM   122  C  CG    . PRO A 1 18  ? 48.195  28.795 27.888 1.00 33.97  ? 46  PRO A CG    1 
ATOM   123  C  CD    . PRO A 1 18  ? 48.459  27.736 28.914 1.00 33.70  ? 46  PRO A CD    1 
ATOM   124  N  N     . VAL A 1 19  ? 49.814  26.094 24.754 1.00 33.07  ? 47  VAL A N     1 
ATOM   125  C  CA    . VAL A 1 19  ? 50.857  26.186 23.755 1.00 34.96  ? 47  VAL A CA    1 
ATOM   126  C  C     . VAL A 1 19  ? 50.247  26.559 22.420 1.00 35.82  ? 47  VAL A C     1 
ATOM   127  O  O     . VAL A 1 19  ? 49.091  26.227 22.129 1.00 35.20  ? 47  VAL A O     1 
ATOM   128  C  CB    . VAL A 1 19  ? 51.687  24.887 23.660 1.00 36.50  ? 47  VAL A CB    1 
ATOM   129  C  CG1   . VAL A 1 19  ? 52.384  24.623 24.982 1.00 37.97  ? 47  VAL A CG1   1 
ATOM   130  C  CG2   . VAL A 1 19  ? 50.838  23.704 23.254 1.00 34.28  ? 47  VAL A CG2   1 
ATOM   131  N  N     . SER A 1 20  ? 51.029  27.288 21.633 1.00 38.84  ? 48  SER A N     1 
ATOM   132  C  CA    . SER A 1 20  ? 50.588  27.829 20.369 1.00 38.88  ? 48  SER A CA    1 
ATOM   133  C  C     . SER A 1 20  ? 51.273  27.057 19.247 1.00 37.54  ? 48  SER A C     1 
ATOM   134  O  O     . SER A 1 20  ? 52.485  26.917 19.237 1.00 38.38  ? 48  SER A O     1 
ATOM   135  C  CB    . SER A 1 20  ? 50.924  29.321 20.312 1.00 41.70  ? 48  SER A CB    1 
ATOM   136  O  OG    . SER A 1 20  ? 50.233  29.944 19.256 1.00 50.26  ? 48  SER A OG    1 
ATOM   137  N  N     . LEU A 1 21  ? 50.478  26.486 18.346 1.00 38.64  ? 49  LEU A N     1 
ATOM   138  C  CA    . LEU A 1 21  ? 51.016  25.771 17.195 1.00 38.61  ? 49  LEU A CA    1 
ATOM   139  C  C     . LEU A 1 21  ? 51.373  26.802 16.128 1.00 41.11  ? 49  LEU A C     1 
ATOM   140  O  O     . LEU A 1 21  ? 50.940  27.952 16.232 1.00 39.28  ? 49  LEU A O     1 
ATOM   141  C  CB    . LEU A 1 21  ? 49.984  24.774 16.664 1.00 37.04  ? 49  LEU A CB    1 
ATOM   142  C  CG    . LEU A 1 21  ? 49.520  23.689 17.640 1.00 36.46  ? 49  LEU A CG    1 
ATOM   143  C  CD1   . LEU A 1 21  ? 48.479  22.789 16.988 1.00 36.72  ? 49  LEU A CD1   1 
ATOM   144  C  CD2   . LEU A 1 21  ? 50.697  22.858 18.152 1.00 37.25  ? 49  LEU A CD2   1 
ATOM   145  N  N     . PRO A 1 22  ? 52.149  26.405 15.095 1.00 43.17  ? 50  PRO A N     1 
ATOM   146  C  CA    . PRO A 1 22  ? 52.475  27.320 13.986 1.00 44.43  ? 50  PRO A CA    1 
ATOM   147  C  C     . PRO A 1 22  ? 51.246  27.936 13.312 1.00 43.10  ? 50  PRO A C     1 
ATOM   148  O  O     . PRO A 1 22  ? 51.282  29.092 12.883 1.00 41.70  ? 50  PRO A O     1 
ATOM   149  C  CB    . PRO A 1 22  ? 53.221  26.418 13.000 1.00 46.37  ? 50  PRO A CB    1 
ATOM   150  C  CG    . PRO A 1 22  ? 53.840  25.372 13.862 1.00 45.21  ? 50  PRO A CG    1 
ATOM   151  C  CD    . PRO A 1 22  ? 52.838  25.106 14.950 1.00 43.62  ? 50  PRO A CD    1 
ATOM   152  N  N     . CYS A 1 23  ? 50.170  27.164 13.227 1.00 37.35  ? 51  CYS A N     1 
ATOM   153  C  CA    . CYS A 1 23  ? 48.896  27.648 12.697 1.00 38.38  ? 51  CYS A CA    1 
ATOM   154  C  C     . CYS A 1 23  ? 48.169  28.607 13.649 1.00 38.95  ? 51  CYS A C     1 
ATOM   155  O  O     . CYS A 1 23  ? 47.125  29.169 13.281 1.00 37.66  ? 51  CYS A O     1 
ATOM   156  C  CB    . CYS A 1 23  ? 47.982  26.464 12.404 1.00 38.05  ? 51  CYS A CB    1 
ATOM   157  S  SG    . CYS A 1 23  ? 47.662  25.462 13.867 1.00 35.85  ? 51  CYS A SG    1 
ATOM   158  N  N     . LYS A 1 24  ? 48.695  28.726 14.873 1.00 39.02  ? 52  LYS A N     1 
ATOM   159  C  CA    . LYS A 1 24  ? 48.261  29.683 15.896 1.00 41.99  ? 52  LYS A CA    1 
ATOM   160  C  C     . LYS A 1 24  ? 47.054  29.224 16.703 1.00 37.94  ? 52  LYS A C     1 
ATOM   161  O  O     . LYS A 1 24  ? 46.487  29.990 17.496 1.00 37.92  ? 52  LYS A O     1 
ATOM   162  C  CB    . LYS A 1 24  ? 48.036  31.097 15.320 1.00 44.29  ? 52  LYS A CB    1 
ATOM   163  C  CG    . LYS A 1 24  ? 49.282  31.715 14.729 1.00 53.40  ? 52  LYS A CG    1 
ATOM   164  C  CD    . LYS A 1 24  ? 48.982  33.131 14.267 1.00 60.57  ? 52  LYS A CD    1 
ATOM   165  C  CE    . LYS A 1 24  ? 50.234  33.881 13.835 1.00 69.78  ? 52  LYS A CE    1 
ATOM   166  N  NZ    . LYS A 1 24  ? 49.880  35.065 13.001 1.00 70.70  ? 52  LYS A NZ    1 
ATOM   167  N  N     . HIS A 1 25  ? 46.678  27.963 16.547 1.00 34.15  ? 53  HIS A N     1 
ATOM   168  C  CA    . HIS A 1 25  ? 45.716  27.385 17.446 1.00 32.77  ? 53  HIS A CA    1 
ATOM   169  C  C     . HIS A 1 25  ? 46.380  27.070 18.756 1.00 30.45  ? 53  HIS A C     1 
ATOM   170  O  O     . HIS A 1 25  ? 47.569  26.764 18.800 1.00 29.52  ? 53  HIS A O     1 
ATOM   171  C  CB    . HIS A 1 25  ? 45.061  26.156 16.821 1.00 31.26  ? 53  HIS A CB    1 
ATOM   172  C  CG    . HIS A 1 25  ? 44.119  26.525 15.731 1.00 34.05  ? 53  HIS A CG    1 
ATOM   173  N  ND1   . HIS A 1 25  ? 44.367  26.257 14.402 1.00 37.81  ? 53  HIS A ND1   1 
ATOM   174  C  CD2   . HIS A 1 25  ? 42.963  27.222 15.770 1.00 37.13  ? 53  HIS A CD2   1 
ATOM   175  C  CE1   . HIS A 1 25  ? 43.378  26.746 13.673 1.00 39.04  ? 53  HIS A CE1   1 
ATOM   176  N  NE2   . HIS A 1 25  ? 42.506  27.322 14.480 1.00 38.11  ? 53  HIS A NE2   1 
ATOM   177  N  N     . VAL A 1 26  ? 45.595  27.177 19.822 1.00 30.27  ? 54  VAL A N     1 
ATOM   178  C  CA    . VAL A 1 26  ? 46.103  27.007 21.166 1.00 30.43  ? 54  VAL A CA    1 
ATOM   179  C  C     . VAL A 1 26  ? 45.423  25.815 21.848 1.00 29.71  ? 54  VAL A C     1 
ATOM   180  O  O     . VAL A 1 26  ? 44.194  25.654 21.767 1.00 31.84  ? 54  VAL A O     1 
ATOM   181  C  CB    . VAL A 1 26  ? 45.888  28.274 22.001 1.00 31.38  ? 54  VAL A CB    1 
ATOM   182  C  CG1   . VAL A 1 26  ? 46.426  28.094 23.406 1.00 30.57  ? 54  VAL A CG1   1 
ATOM   183  C  CG2   . VAL A 1 26  ? 46.543  29.481 21.314 1.00 34.70  ? 54  VAL A CG2   1 
ATOM   184  N  N     . PHE A 1 27  ? 46.220  25.005 22.532 1.00 28.37  ? 55  PHE A N     1 
ATOM   185  C  CA    . PHE A 1 27  ? 45.703  23.877 23.335 1.00 28.34  ? 55  PHE A CA    1 
ATOM   186  C  C     . PHE A 1 27  ? 46.511  23.716 24.619 1.00 27.81  ? 55  PHE A C     1 
ATOM   187  O  O     . PHE A 1 27  ? 47.638  24.193 24.696 1.00 27.69  ? 55  PHE A O     1 
ATOM   188  C  CB    . PHE A 1 27  ? 45.795  22.573 22.529 1.00 28.04  ? 55  PHE A CB    1 
ATOM   189  C  CG    . PHE A 1 27  ? 45.133  22.636 21.174 1.00 26.89  ? 55  PHE A CG    1 
ATOM   190  C  CD1   . PHE A 1 27  ? 45.888  22.846 20.045 1.00 28.75  ? 55  PHE A CD1   1 
ATOM   191  C  CD2   . PHE A 1 27  ? 43.754  22.483 21.037 1.00 28.40  ? 55  PHE A CD2   1 
ATOM   192  C  CE1   . PHE A 1 27  ? 45.294  22.931 18.804 1.00 29.39  ? 55  PHE A CE1   1 
ATOM   193  C  CE2   . PHE A 1 27  ? 43.154  22.539 19.790 1.00 28.29  ? 55  PHE A CE2   1 
ATOM   194  C  CZ    . PHE A 1 27  ? 43.932  22.759 18.667 1.00 29.08  ? 55  PHE A CZ    1 
ATOM   195  N  N     . CYS A 1 28  ? 45.977  22.987 25.604 1.00 27.43  ? 56  CYS A N     1 
ATOM   196  C  CA    . CYS A 1 28  ? 46.805  22.560 26.746 1.00 28.69  ? 56  CYS A CA    1 
ATOM   197  C  C     . CYS A 1 28  ? 48.045  21.827 26.186 1.00 27.52  ? 56  CYS A C     1 
ATOM   198  O  O     . CYS A 1 28  ? 47.951  21.093 25.176 1.00 27.92  ? 56  CYS A O     1 
ATOM   199  C  CB    . CYS A 1 28  ? 46.055  21.594 27.668 1.00 29.00  ? 56  CYS A CB    1 
ATOM   200  S  SG    . CYS A 1 28  ? 44.404  22.054 28.237 1.00 31.78  ? 56  CYS A SG    1 
ATOM   201  N  N     . TYR A 1 29  ? 49.199  22.022 26.812 1.00 26.80  ? 57  TYR A N     1 
ATOM   202  C  CA    . TYR A 1 29  ? 50.387  21.256 26.449 1.00 26.70  ? 57  TYR A CA    1 
ATOM   203  C  C     . TYR A 1 29  ? 50.113  19.731 26.543 1.00 25.51  ? 57  TYR A C     1 
ATOM   204  O  O     . TYR A 1 29  ? 50.470  18.969 25.643 1.00 25.49  ? 57  TYR A O     1 
ATOM   205  C  CB    . TYR A 1 29  ? 51.547  21.607 27.370 1.00 27.49  ? 57  TYR A CB    1 
ATOM   206  C  CG    . TYR A 1 29  ? 52.783  20.757 27.145 1.00 28.45  ? 57  TYR A CG    1 
ATOM   207  C  CD1   . TYR A 1 29  ? 53.509  20.859 25.957 1.00 29.94  ? 57  TYR A CD1   1 
ATOM   208  C  CD2   . TYR A 1 29  ? 53.220  19.845 28.109 1.00 28.47  ? 57  TYR A CD2   1 
ATOM   209  C  CE1   . TYR A 1 29  ? 54.644  20.096 25.740 1.00 31.43  ? 57  TYR A CE1   1 
ATOM   210  C  CE2   . TYR A 1 29  ? 54.353  19.063 27.895 1.00 30.14  ? 57  TYR A CE2   1 
ATOM   211  C  CZ    . TYR A 1 29  ? 55.057  19.195 26.706 1.00 32.69  ? 57  TYR A CZ    1 
ATOM   212  O  OH    . TYR A 1 29  ? 56.177  18.449 26.460 1.00 33.64  ? 57  TYR A OH    1 
ATOM   213  N  N     . LEU A 1 30  ? 49.505  19.303 27.641 1.00 24.97  ? 58  LEU A N     1 
ATOM   214  C  CA    . LEU A 1 30  ? 49.280  17.867 27.880 1.00 25.86  ? 58  LEU A CA    1 
ATOM   215  C  C     . LEU A 1 30  ? 48.213  17.239 26.973 1.00 24.50  ? 58  LEU A C     1 
ATOM   216  O  O     . LEU A 1 30  ? 48.223  16.031 26.753 1.00 26.86  ? 58  LEU A O     1 
ATOM   217  C  CB    . LEU A 1 30  ? 48.953  17.615 29.364 1.00 27.21  ? 58  LEU A CB    1 
ATOM   218  C  CG    . LEU A 1 30  ? 50.120  17.814 30.346 1.00 28.13  ? 58  LEU A CG    1 
ATOM   219  C  CD1   . LEU A 1 30  ? 49.640  17.602 31.764 1.00 26.67  ? 58  LEU A CD1   1 
ATOM   220  C  CD2   . LEU A 1 30  ? 51.319  16.912 30.062 1.00 27.94  ? 58  LEU A CD2   1 
ATOM   221  N  N     . CYS A 1 31  ? 47.269  18.041 26.485 1.00 24.80  ? 59  CYS A N     1 
ATOM   222  C  CA    . CYS A 1 31  ? 46.327  17.580 25.469 1.00 24.63  ? 59  CYS A CA    1 
ATOM   223  C  C     . CYS A 1 31  ? 47.037  17.394 24.114 1.00 24.74  ? 59  CYS A C     1 
ATOM   224  O  O     . CYS A 1 31  ? 46.809  16.416 23.426 1.00 25.44  ? 59  CYS A O     1 
ATOM   225  C  CB    . CYS A 1 31  ? 45.130  18.518 25.331 1.00 26.12  ? 59  CYS A CB    1 
ATOM   226  S  SG    . CYS A 1 31  ? 43.942  18.524 26.696 1.00 27.72  ? 59  CYS A SG    1 
ATOM   227  N  N     . VAL A 1 32  ? 47.924  18.309 23.760 1.00 24.53  ? 60  VAL A N     1 
ATOM   228  C  CA    . VAL A 1 32  ? 48.780  18.126 22.580 1.00 27.38  ? 60  VAL A CA    1 
ATOM   229  C  C     . VAL A 1 32  ? 49.666  16.874 22.719 1.00 27.20  ? 60  VAL A C     1 
ATOM   230  O  O     . VAL A 1 32  ? 49.760  16.081 21.804 1.00 27.63  ? 60  VAL A O     1 
ATOM   231  C  CB    . VAL A 1 32  ? 49.622  19.373 22.287 1.00 28.01  ? 60  VAL A CB    1 
ATOM   232  C  CG1   . VAL A 1 32  ? 50.632  19.108 21.180 1.00 30.74  ? 60  VAL A CG1   1 
ATOM   233  C  CG2   . VAL A 1 32  ? 48.711  20.534 21.904 1.00 29.76  ? 60  VAL A CG2   1 
ATOM   234  N  N     . LYS A 1 33  ? 50.281  16.691 23.882 1.00 27.87  ? 61  LYS A N     1 
ATOM   235  C  CA    . LYS A 1 33  ? 51.104  15.515 24.135 1.00 27.72  ? 61  LYS A CA    1 
ATOM   236  C  C     . LYS A 1 33  ? 50.298  14.209 24.044 1.00 27.97  ? 61  LYS A C     1 
ATOM   237  O  O     . LYS A 1 33  ? 50.750  13.219 23.463 1.00 28.99  ? 61  LYS A O     1 
ATOM   238  C  CB    . LYS A 1 33  ? 51.781  15.645 25.504 1.00 28.43  ? 61  LYS A CB    1 
ATOM   239  C  CG    . LYS A 1 33  ? 52.732  14.503 25.822 1.00 30.37  ? 61  LYS A CG    1 
ATOM   240  C  CD    . LYS A 1 33  ? 53.712  14.898 26.924 1.00 30.85  ? 61  LYS A CD    1 
ATOM   241  C  CE    . LYS A 1 33  ? 54.602  13.735 27.285 1.00 31.85  ? 61  LYS A CE    1 
ATOM   242  N  NZ    . LYS A 1 33  ? 55.794  14.135 28.088 1.00 32.65  ? 61  LYS A NZ    1 
ATOM   243  N  N     . GLY A 1 34  ? 49.112  14.202 24.632 1.00 27.31  ? 62  GLY A N     1 
ATOM   244  C  CA    . GLY A 1 34  ? 48.244  13.050 24.573 1.00 28.93  ? 62  GLY A CA    1 
ATOM   245  C  C     . GLY A 1 34  ? 47.782  12.714 23.172 1.00 30.12  ? 62  GLY A C     1 
ATOM   246  O  O     . GLY A 1 34  ? 47.703  11.533 22.807 1.00 31.38  ? 62  GLY A O     1 
ATOM   247  N  N     . ALA A 1 35  ? 47.475  13.740 22.382 1.00 29.52  ? 63  ALA A N     1 
ATOM   248  C  CA    . ALA A 1 35  ? 47.091  13.523 20.984 1.00 32.38  ? 63  ALA A CA    1 
ATOM   249  C  C     . ALA A 1 35  ? 48.270  13.075 20.093 1.00 33.92  ? 63  ALA A C     1 
ATOM   250  O  O     . ALA A 1 35  ? 48.059  12.523 19.010 1.00 36.58  ? 63  ALA A O     1 
ATOM   251  C  CB    . ALA A 1 35  ? 46.438  14.764 20.400 1.00 31.03  ? 63  ALA A CB    1 
ATOM   252  N  N     . SER A 1 36  ? 49.496  13.331 20.538 1.00 33.16  ? 64  SER A N     1 
ATOM   253  C  CA    . SER A 1 36  ? 50.676  12.931 19.787 1.00 34.70  ? 64  SER A CA    1 
ATOM   254  C  C     . SER A 1 36  ? 50.838  11.419 19.766 1.00 37.59  ? 64  SER A C     1 
ATOM   255  O  O     . SER A 1 36  ? 51.402  10.892 18.822 1.00 37.55  ? 64  SER A O     1 
ATOM   256  C  CB    . SER A 1 36  ? 51.946  13.558 20.379 1.00 37.20  ? 64  SER A CB    1 
ATOM   257  O  OG    . SER A 1 36  ? 52.335  12.906 21.592 1.00 38.09  ? 64  SER A OG    1 
ATOM   258  N  N     . TRP A 1 37  ? 50.342  10.722 20.784 1.00 38.08  ? 65  TRP A N     1 
ATOM   259  C  CA    . TRP A 1 37  ? 50.454  9.265  20.804 1.00 45.45  ? 65  TRP A CA    1 
ATOM   260  C  C     . TRP A 1 37  ? 49.670  8.679  19.630 1.00 45.70  ? 65  TRP A C     1 
ATOM   261  O  O     . TRP A 1 37  ? 50.036  7.645  19.102 1.00 46.30  ? 65  TRP A O     1 
ATOM   262  C  CB    . TRP A 1 37  ? 49.977  8.643  22.135 1.00 48.15  ? 65  TRP A CB    1 
ATOM   263  C  CG    . TRP A 1 37  ? 50.559  9.242  23.429 1.00 55.97  ? 65  TRP A CG    1 
ATOM   264  C  CD1   . TRP A 1 37  ? 49.850  9.621  24.542 1.00 57.58  ? 65  TRP A CD1   1 
ATOM   265  C  CD2   . TRP A 1 37  ? 51.940  9.505  23.734 1.00 59.22  ? 65  TRP A CD2   1 
ATOM   266  N  NE1   . TRP A 1 37  ? 50.698  10.100 25.513 1.00 58.94  ? 65  TRP A NE1   1 
ATOM   267  C  CE2   . TRP A 1 37  ? 51.984  10.047 25.046 1.00 62.66  ? 65  TRP A CE2   1 
ATOM   268  C  CE3   . TRP A 1 37  ? 53.138  9.345  23.030 1.00 65.34  ? 65  TRP A CE3   1 
ATOM   269  C  CZ2   . TRP A 1 37  ? 53.183  10.428 25.667 1.00 59.57  ? 65  TRP A CZ2   1 
ATOM   270  C  CZ3   . TRP A 1 37  ? 54.333  9.725  23.651 1.00 76.93  ? 65  TRP A CZ3   1 
ATOM   271  C  CH2   . TRP A 1 37  ? 54.342  10.260 24.958 1.00 68.64  ? 65  TRP A CH2   1 
ATOM   272  N  N     . LEU A 1 38  ? 48.606  9.364  19.213 1.00 45.65  ? 66  LEU A N     1 
ATOM   273  C  CA    . LEU A 1 38  ? 47.785  8.928  18.086 1.00 47.03  ? 66  LEU A CA    1 
ATOM   274  C  C     . LEU A 1 38  ? 48.251  9.518  16.760 1.00 46.27  ? 66  LEU A C     1 
ATOM   275  O  O     . LEU A 1 38  ? 47.664  9.231  15.722 1.00 48.90  ? 66  LEU A O     1 
ATOM   276  C  CB    . LEU A 1 38  ? 46.314  9.304  18.335 1.00 47.27  ? 66  LEU A CB    1 
ATOM   277  C  CG    . LEU A 1 38  ? 45.717  8.773  19.650 1.00 50.03  ? 66  LEU A CG    1 
ATOM   278  C  CD1   . LEU A 1 38  ? 44.393  9.450  19.992 1.00 49.44  ? 66  LEU A CD1   1 
ATOM   279  C  CD2   . LEU A 1 38  ? 45.555  7.259  19.590 1.00 50.55  ? 66  LEU A CD2   1 
ATOM   280  N  N     . GLY A 1 39  ? 49.281  10.359 16.793 1.00 45.01  ? 67  GLY A N     1 
ATOM   281  C  CA    . GLY A 1 39  ? 49.895  10.887 15.574 1.00 44.98  ? 67  GLY A CA    1 
ATOM   282  C  C     . GLY A 1 39  ? 49.100  12.016 14.952 1.00 42.97  ? 67  GLY A C     1 
ATOM   283  O  O     . GLY A 1 39  ? 49.120  12.194 13.746 1.00 41.16  ? 67  GLY A O     1 
ATOM   284  N  N     . LYS A 1 40  ? 48.411  12.788 15.782 1.00 39.52  ? 68  LYS A N     1 
ATOM   285  C  CA    . LYS A 1 40  ? 47.464  13.779 15.295 1.00 40.63  ? 68  LYS A CA    1 
ATOM   286  C  C     . LYS A 1 40  ? 48.160  15.057 14.837 1.00 39.26  ? 68  LYS A C     1 
ATOM   287  O  O     . LYS A 1 40  ? 49.262  15.405 15.269 1.00 36.49  ? 68  LYS A O     1 
ATOM   288  C  CB    . LYS A 1 40  ? 46.408  14.122 16.366 1.00 38.25  ? 68  LYS A CB    1 
ATOM   289  C  CG    . LYS A 1 40  ? 45.499  12.957 16.751 1.00 38.84  ? 68  LYS A CG    1 
ATOM   290  C  CD    . LYS A 1 40  ? 44.693  12.434 15.568 1.00 39.54  ? 68  LYS A CD    1 
ATOM   291  C  CE    . LYS A 1 40  ? 43.641  11.419 15.996 1.00 41.09  ? 68  LYS A CE    1 
ATOM   292  N  NZ    . LYS A 1 40  ? 43.000  10.728 14.831 1.00 41.38  ? 68  LYS A NZ    1 
ATOM   293  N  N     . ARG A 1 41  ? 47.480  15.741 13.941 1.00 36.53  ? 69  ARG A N     1 
ATOM   294  C  CA    . ARG A 1 41  ? 47.868  17.060 13.498 1.00 36.02  ? 69  ARG A CA    1 
ATOM   295  C  C     . ARG A 1 41  ? 47.054  18.018 14.353 1.00 31.36  ? 69  ARG A C     1 
ATOM   296  O  O     . ARG A 1 41  ? 46.415  17.589 15.325 1.00 30.18  ? 69  ARG A O     1 
ATOM   297  C  CB    . ARG A 1 41  ? 47.588  17.169 11.993 1.00 35.45  ? 69  ARG A CB    1 
ATOM   298  C  CG    . ARG A 1 41  ? 48.498  16.247 11.172 1.00 38.70  ? 69  ARG A CG    1 
ATOM   299  C  CD    . ARG A 1 41  ? 48.154  16.197 9.687  1.00 40.68  ? 69  ARG A CD    1 
ATOM   300  N  NE    . ARG A 1 41  ? 48.633  17.383 8.951  1.00 42.52  ? 69  ARG A NE    1 
ATOM   301  C  CZ    . ARG A 1 41  ? 49.743  17.462 8.214  1.00 43.30  ? 69  ARG A CZ    1 
ATOM   302  N  NH1   . ARG A 1 41  ? 50.547  16.418 8.073  1.00 46.22  ? 69  ARG A NH1   1 
ATOM   303  N  NH2   . ARG A 1 41  ? 50.053  18.606 7.590  1.00 43.62  ? 69  ARG A NH2   1 
ATOM   304  N  N     . CYS A 1 42  ? 47.044  19.300 14.011 1.00 31.10  ? 70  CYS A N     1 
ATOM   305  C  CA    . CYS A 1 42  ? 46.217  20.241 14.739 1.00 29.49  ? 70  CYS A CA    1 
ATOM   306  C  C     . CYS A 1 42  ? 44.769  19.776 14.721 1.00 29.83  ? 70  CYS A C     1 
ATOM   307  O  O     . CYS A 1 42  ? 44.189  19.528 13.655 1.00 31.89  ? 70  CYS A O     1 
ATOM   308  C  CB    . CYS A 1 42  ? 46.331  21.657 14.172 1.00 30.70  ? 70  CYS A CB    1 
ATOM   309  S  SG    . CYS A 1 42  ? 45.187  22.816 14.949 1.00 30.26  ? 70  CYS A SG    1 
ATOM   310  N  N     . ALA A 1 43  ? 44.184  19.648 15.910 1.00 27.86  ? 71  ALA A N     1 
ATOM   311  C  CA    . ALA A 1 43  ? 42.807  19.204 16.032 1.00 27.52  ? 71  ALA A CA    1 
ATOM   312  C  C     . ALA A 1 43  ? 41.826  20.144 15.322 1.00 27.75  ? 71  ALA A C     1 
ATOM   313  O  O     . ALA A 1 43  ? 40.798  19.706 14.833 1.00 27.12  ? 71  ALA A O     1 
ATOM   314  C  CB    . ALA A 1 43  ? 42.433  19.051 17.502 1.00 28.70  ? 71  ALA A CB    1 
ATOM   315  N  N     . LEU A 1 44  ? 42.151  21.429 15.245 1.00 27.60  ? 72  LEU A N     1 
ATOM   316  C  CA    . LEU A 1 44  ? 41.253  22.411 14.624 1.00 29.09  ? 72  LEU A CA    1 
ATOM   317  C  C     . LEU A 1 44  ? 41.399  22.595 13.105 1.00 30.36  ? 72  LEU A C     1 
ATOM   318  O  O     . LEU A 1 44  ? 40.386  22.810 12.417 1.00 32.42  ? 72  LEU A O     1 
ATOM   319  C  CB    . LEU A 1 44  ? 41.360  23.756 15.347 1.00 29.94  ? 72  LEU A CB    1 
ATOM   320  C  CG    . LEU A 1 44  ? 40.710  23.813 16.738 1.00 30.48  ? 72  LEU A CG    1 
ATOM   321  C  CD1   . LEU A 1 44  ? 41.160  25.045 17.518 1.00 30.67  ? 72  LEU A CD1   1 
ATOM   322  C  CD2   . LEU A 1 44  ? 39.195  23.797 16.650 1.00 31.67  ? 72  LEU A CD2   1 
ATOM   323  N  N     . CYS A 1 45  ? 42.616  22.562 12.567 1.00 29.25  ? 73  CYS A N     1 
ATOM   324  C  CA    . CYS A 1 45  ? 42.800  22.856 11.135 1.00 31.95  ? 73  CYS A CA    1 
ATOM   325  C  C     . CYS A 1 45  ? 43.596  21.810 10.328 1.00 31.35  ? 73  CYS A C     1 
ATOM   326  O  O     . CYS A 1 45  ? 43.809  21.976 9.129  1.00 31.91  ? 73  CYS A O     1 
ATOM   327  C  CB    . CYS A 1 45  ? 43.423  24.249 10.990 1.00 33.34  ? 73  CYS A CB    1 
ATOM   328  S  SG    . CYS A 1 45  ? 45.184  24.332 11.355 1.00 33.53  ? 73  CYS A SG    1 
ATOM   329  N  N     . ARG A 1 46  ? 44.042  20.748 10.991 1.00 32.63  ? 74  ARG A N     1 
ATOM   330  C  CA    . ARG A 1 46  ? 44.776  19.630 10.369 1.00 32.14  ? 74  ARG A CA    1 
ATOM   331  C  C     . ARG A 1 46  ? 46.174  19.977 9.849  1.00 32.83  ? 74  ARG A C     1 
ATOM   332  O  O     . ARG A 1 46  ? 46.782  19.172 9.168  1.00 34.30  ? 74  ARG A O     1 
ATOM   333  C  CB    . ARG A 1 46  ? 43.943  18.944 9.273  1.00 34.62  ? 74  ARG A CB    1 
ATOM   334  C  CG    . ARG A 1 46  ? 42.710  18.207 9.781  1.00 36.38  ? 74  ARG A CG    1 
ATOM   335  C  CD    . ARG A 1 46  ? 41.814  17.687 8.650  1.00 39.74  ? 74  ARG A CD    1 
ATOM   336  N  NE    . ARG A 1 46  ? 41.716  18.706 7.627  1.00 44.98  ? 74  ARG A NE    1 
ATOM   337  C  CZ    . ARG A 1 46  ? 40.968  19.803 7.705  1.00 44.89  ? 74  ARG A CZ    1 
ATOM   338  N  NH1   . ARG A 1 46  ? 40.167  20.012 8.747  1.00 43.08  ? 74  ARG A NH1   1 
ATOM   339  N  NH2   . ARG A 1 46  ? 41.027  20.696 6.720  1.00 44.46  ? 74  ARG A NH2   1 
ATOM   340  N  N     . GLN A 1 47  ? 46.706  21.147 10.180 1.00 33.16  ? 75  GLN A N     1 
ATOM   341  C  CA    . GLN A 1 47  ? 48.058  21.492 9.752  1.00 35.03  ? 75  GLN A CA    1 
ATOM   342  C  C     . GLN A 1 47  ? 49.105  20.828 10.667 1.00 34.50  ? 75  GLN A C     1 
ATOM   343  O  O     . GLN A 1 47  ? 48.805  20.400 11.774 1.00 33.66  ? 75  GLN A O     1 
ATOM   344  C  CB    . GLN A 1 47  ? 48.237  23.008 9.659  1.00 36.18  ? 75  GLN A CB    1 
ATOM   345  C  CG    . GLN A 1 47  ? 47.554  23.601 8.426  1.00 38.30  ? 75  GLN A CG    1 
ATOM   346  C  CD    . GLN A 1 47  ? 47.780  25.097 8.237  1.00 43.80  ? 75  GLN A CD    1 
ATOM   347  O  OE1   . GLN A 1 47  ? 48.494  25.740 9.011  1.00 44.60  ? 75  GLN A OE1   1 
ATOM   348  N  NE2   . GLN A 1 47  ? 47.187  25.654 7.178  1.00 45.26  ? 75  GLN A NE2   1 
ATOM   349  N  N     . GLU A 1 48  ? 50.323  20.722 10.180 1.00 38.36  ? 76  GLU A N     1 
ATOM   350  C  CA    . GLU A 1 48  ? 51.311  19.897 10.844 1.00 43.08  ? 76  GLU A CA    1 
ATOM   351  C  C     . GLU A 1 48  ? 51.758  20.464 12.190 1.00 41.88  ? 76  GLU A C     1 
ATOM   352  O  O     . GLU A 1 48  ? 51.822  21.680 12.383 1.00 38.39  ? 76  GLU A O     1 
ATOM   353  C  CB    . GLU A 1 48  ? 52.528  19.645 9.956  1.00 48.76  ? 76  GLU A CB    1 
ATOM   354  C  CG    . GLU A 1 48  ? 53.338  18.451 10.447 1.00 55.99  ? 76  GLU A CG    1 
ATOM   355  C  CD    . GLU A 1 48  ? 54.506  18.081 9.550  1.00 69.52  ? 76  GLU A CD    1 
ATOM   356  O  OE1   . GLU A 1 48  ? 54.863  18.868 8.637  1.00 59.79  ? 76  GLU A OE1   1 
ATOM   357  O  OE2   . GLU A 1 48  ? 55.071  16.987 9.781  1.00 74.02  ? 76  GLU A OE2   1 
ATOM   358  N  N     . ILE A 1 49  ? 52.018  19.553 13.121 1.00 39.91  ? 77  ILE A N     1 
ATOM   359  C  CA    . ILE A 1 49  ? 52.676  19.895 14.377 1.00 40.71  ? 77  ILE A CA    1 
ATOM   360  C  C     . ILE A 1 49  ? 54.155  19.514 14.228 1.00 42.43  ? 77  ILE A C     1 
ATOM   361  O  O     . ILE A 1 49  ? 54.456  18.358 13.960 1.00 44.46  ? 77  ILE A O     1 
ATOM   362  C  CB    . ILE A 1 49  ? 52.019  19.158 15.558 1.00 37.97  ? 77  ILE A CB    1 
ATOM   363  C  CG1   . ILE A 1 49  ? 50.554  19.608 15.689 1.00 37.14  ? 77  ILE A CG1   1 
ATOM   364  C  CG2   . ILE A 1 49  ? 52.771  19.432 16.863 1.00 38.95  ? 77  ILE A CG2   1 
ATOM   365  C  CD1   . ILE A 1 49  ? 49.695  18.707 16.540 1.00 36.49  ? 77  ILE A CD1   1 
ATOM   366  N  N     . PRO A 1 50  ? 55.082  20.480 14.395 1.00 43.92  ? 78  PRO A N     1 
ATOM   367  C  CA    . PRO A 1 50  ? 56.512  20.154 14.282 1.00 46.95  ? 78  PRO A CA    1 
ATOM   368  C  C     . PRO A 1 50  ? 56.935  18.901 15.057 1.00 44.71  ? 78  PRO A C     1 
ATOM   369  O  O     . PRO A 1 50  ? 56.484  18.678 16.183 1.00 41.96  ? 78  PRO A O     1 
ATOM   370  C  CB    . PRO A 1 50  ? 57.207  21.387 14.861 1.00 49.48  ? 78  PRO A CB    1 
ATOM   371  C  CG    . PRO A 1 50  ? 56.228  22.500 14.694 1.00 49.14  ? 78  PRO A CG    1 
ATOM   372  C  CD    . PRO A 1 50  ? 54.859  21.894 14.749 1.00 45.14  ? 78  PRO A CD    1 
ATOM   373  N  N     . GLU A 1 51  ? 57.787  18.104 14.428 1.00 49.21  ? 79  GLU A N     1 
ATOM   374  C  CA    . GLU A 1 51  ? 58.382  16.896 15.011 1.00 55.60  ? 79  GLU A CA    1 
ATOM   375  C  C     . GLU A 1 51  ? 58.937  17.089 16.432 1.00 51.33  ? 79  GLU A C     1 
ATOM   376  O  O     . GLU A 1 51  ? 58.787  16.207 17.285 1.00 51.52  ? 79  GLU A O     1 
ATOM   377  C  CB    . GLU A 1 51  ? 59.511  16.408 14.081 1.00 67.84  ? 79  GLU A CB    1 
ATOM   378  C  CG    . GLU A 1 51  ? 60.222  15.121 14.494 1.00 83.82  ? 79  GLU A CG    1 
ATOM   379  C  CD    . GLU A 1 51  ? 59.455  13.864 14.117 1.00 95.52  ? 79  GLU A CD    1 
ATOM   380  O  OE1   . GLU A 1 51  ? 58.287  13.728 14.546 1.00 92.35  ? 79  GLU A OE1   1 
ATOM   381  O  OE2   . GLU A 1 51  ? 60.025  13.007 13.399 1.00 101.97 ? 79  GLU A OE2   1 
ATOM   382  N  N     . ASP A 1 52  ? 59.573  18.231 16.684 1.00 49.87  ? 80  ASP A N     1 
ATOM   383  C  CA    . ASP A 1 52  ? 60.212  18.494 17.985 1.00 51.22  ? 80  ASP A CA    1 
ATOM   384  C  C     . ASP A 1 52  ? 59.360  19.341 18.939 1.00 46.92  ? 80  ASP A C     1 
ATOM   385  O  O     . ASP A 1 52  ? 59.884  19.925 19.901 1.00 45.92  ? 80  ASP A O     1 
ATOM   386  C  CB    . ASP A 1 52  ? 61.586  19.152 17.774 1.00 57.74  ? 80  ASP A CB    1 
ATOM   387  C  CG    . ASP A 1 52  ? 61.498  20.581 17.218 1.00 61.06  ? 80  ASP A CG    1 
ATOM   388  O  OD1   . ASP A 1 52  ? 60.412  21.001 16.752 1.00 62.83  ? 80  ASP A OD1   1 
ATOM   389  O  OD2   . ASP A 1 52  ? 62.535  21.286 17.241 1.00 68.40  ? 80  ASP A OD2   1 
ATOM   390  N  N     . PHE A 1 53  ? 58.054  19.389 18.698 1.00 40.42  ? 81  PHE A N     1 
ATOM   391  C  CA    . PHE A 1 53  ? 57.198  20.332 19.409 1.00 40.72  ? 81  PHE A CA    1 
ATOM   392  C  C     . PHE A 1 53  ? 57.122  20.035 20.901 1.00 39.60  ? 81  PHE A C     1 
ATOM   393  O  O     . PHE A 1 53  ? 57.168  20.950 21.709 1.00 38.32  ? 81  PHE A O     1 
ATOM   394  C  CB    . PHE A 1 53  ? 55.782  20.394 18.820 1.00 39.93  ? 81  PHE A CB    1 
ATOM   395  C  CG    . PHE A 1 53  ? 55.007  21.600 19.274 1.00 40.53  ? 81  PHE A CG    1 
ATOM   396  C  CD1   . PHE A 1 53  ? 55.242  22.847 18.696 1.00 44.58  ? 81  PHE A CD1   1 
ATOM   397  C  CD2   . PHE A 1 53  ? 54.083  21.508 20.297 1.00 39.99  ? 81  PHE A CD2   1 
ATOM   398  C  CE1   . PHE A 1 53  ? 54.541  23.970 19.114 1.00 43.88  ? 81  PHE A CE1   1 
ATOM   399  C  CE2   . PHE A 1 53  ? 53.382  22.632 20.727 1.00 39.58  ? 81  PHE A CE2   1 
ATOM   400  C  CZ    . PHE A 1 53  ? 53.608  23.859 20.131 1.00 43.66  ? 81  PHE A CZ    1 
ATOM   401  N  N     . LEU A 1 54  ? 57.048  18.764 21.268 1.00 39.65  ? 82  LEU A N     1 
ATOM   402  C  CA    . LEU A 1 54  ? 56.933  18.414 22.685 1.00 43.31  ? 82  LEU A CA    1 
ATOM   403  C  C     . LEU A 1 54  ? 58.197  18.768 23.482 1.00 45.41  ? 82  LEU A C     1 
ATOM   404  O  O     . LEU A 1 54  ? 58.111  19.132 24.659 1.00 43.54  ? 82  LEU A O     1 
ATOM   405  C  CB    . LEU A 1 54  ? 56.582  16.938 22.847 1.00 45.86  ? 82  LEU A CB    1 
ATOM   406  C  CG    . LEU A 1 54  ? 55.233  16.553 22.232 1.00 47.21  ? 82  LEU A CG    1 
ATOM   407  C  CD1   . LEU A 1 54  ? 54.963  15.071 22.445 1.00 47.30  ? 82  LEU A CD1   1 
ATOM   408  C  CD2   . LEU A 1 54  ? 54.094  17.413 22.777 1.00 43.54  ? 82  LEU A CD2   1 
ATOM   409  N  N     . ASP A 1 55  ? 59.355  18.692 22.833 1.00 47.73  ? 83  ASP A N     1 
ATOM   410  C  CA    . ASP A 1 55  ? 60.615  19.062 23.460 1.00 52.40  ? 83  ASP A CA    1 
ATOM   411  C  C     . ASP A 1 55  ? 60.838  20.571 23.483 1.00 52.71  ? 83  ASP A C     1 
ATOM   412  O  O     . ASP A 1 55  ? 61.419  21.088 24.437 1.00 55.14  ? 83  ASP A O     1 
ATOM   413  C  CB    . ASP A 1 55  ? 61.780  18.356 22.766 1.00 58.68  ? 83  ASP A CB    1 
ATOM   414  C  CG    . ASP A 1 55  ? 61.744  16.847 22.957 1.00 63.14  ? 83  ASP A CG    1 
ATOM   415  O  OD1   . ASP A 1 55  ? 60.782  16.329 23.559 1.00 70.58  ? 83  ASP A OD1   1 
ATOM   416  O  OD2   . ASP A 1 55  ? 62.684  16.168 22.507 1.00 73.91  ? 83  ASP A OD2   1 
ATOM   417  N  N     . LYS A 1 56  ? 60.389  21.274 22.443 1.00 50.48  ? 84  LYS A N     1 
ATOM   418  C  CA    . LYS A 1 56  ? 60.518  22.734 22.380 1.00 50.99  ? 84  LYS A CA    1 
ATOM   419  C  C     . LYS A 1 56  ? 59.195  23.384 21.988 1.00 45.97  ? 84  LYS A C     1 
ATOM   420  O  O     . LYS A 1 56  ? 59.086  23.939 20.908 1.00 45.59  ? 84  LYS A O     1 
ATOM   421  C  CB    . LYS A 1 56  ? 61.598  23.143 21.375 1.00 61.23  ? 84  LYS A CB    1 
ATOM   422  C  CG    . LYS A 1 56  ? 62.984  22.599 21.683 1.00 68.93  ? 84  LYS A CG    1 
ATOM   423  C  CD    . LYS A 1 56  ? 64.083  23.454 21.068 1.00 82.33  ? 84  LYS A CD    1 
ATOM   424  C  CE    . LYS A 1 56  ? 63.875  23.679 19.576 1.00 90.55  ? 84  LYS A CE    1 
ATOM   425  N  NZ    . LYS A 1 56  ? 65.093  24.237 18.919 1.00 106.06 ? 84  LYS A NZ    1 
ATOM   426  N  N     . PRO A 1 57  ? 58.179  23.312 22.861 1.00 42.48  ? 85  PRO A N     1 
ATOM   427  C  CA    . PRO A 1 57  ? 56.885  23.920 22.537 1.00 40.70  ? 85  PRO A CA    1 
ATOM   428  C  C     . PRO A 1 57  ? 56.958  25.437 22.554 1.00 42.41  ? 85  PRO A C     1 
ATOM   429  O  O     . PRO A 1 57  ? 57.813  26.004 23.218 1.00 44.70  ? 85  PRO A O     1 
ATOM   430  C  CB    . PRO A 1 57  ? 55.979  23.437 23.663 1.00 41.61  ? 85  PRO A CB    1 
ATOM   431  C  CG    . PRO A 1 57  ? 56.901  23.212 24.819 1.00 42.15  ? 85  PRO A CG    1 
ATOM   432  C  CD    . PRO A 1 57  ? 58.227  22.801 24.242 1.00 44.28  ? 85  PRO A CD    1 
ATOM   433  N  N     . THR A 1 58  ? 56.083  26.084 21.806 1.00 41.19  ? 86  THR A N     1 
ATOM   434  C  CA    . THR A 1 58  ? 55.926  27.521 21.879 1.00 43.46  ? 86  THR A CA    1 
ATOM   435  C  C     . THR A 1 58  ? 54.823  27.798 22.891 1.00 42.81  ? 86  THR A C     1 
ATOM   436  O  O     . THR A 1 58  ? 53.658  27.489 22.636 1.00 39.23  ? 86  THR A O     1 
ATOM   437  C  CB    . THR A 1 58  ? 55.543  28.092 20.504 1.00 46.94  ? 86  THR A CB    1 
ATOM   438  O  OG1   . THR A 1 58  ? 56.569  27.772 19.556 1.00 50.97  ? 86  THR A OG1   1 
ATOM   439  C  CG2   . THR A 1 58  ? 55.356  29.613 20.567 1.00 48.79  ? 86  THR A CG2   1 
ATOM   440  N  N     . LEU A 1 59  ? 55.189  28.359 24.042 1.00 42.71  ? 87  LEU A N     1 
ATOM   441  C  CA    . LEU A 1 59  ? 54.222  28.627 25.107 1.00 43.86  ? 87  LEU A CA    1 
ATOM   442  C  C     . LEU A 1 59  ? 53.462  29.901 24.788 1.00 44.81  ? 87  LEU A C     1 
ATOM   443  O  O     . LEU A 1 59  ? 54.049  30.858 24.320 1.00 44.72  ? 87  LEU A O     1 
ATOM   444  C  CB    . LEU A 1 59  ? 54.932  28.795 26.449 1.00 47.09  ? 87  LEU A CB    1 
ATOM   445  C  CG    . LEU A 1 59  ? 55.387  27.554 27.233 1.00 50.64  ? 87  LEU A CG    1 
ATOM   446  C  CD1   . LEU A 1 59  ? 55.579  26.315 26.369 1.00 54.51  ? 87  LEU A CD1   1 
ATOM   447  C  CD2   . LEU A 1 59  ? 56.684  27.877 27.965 1.00 53.71  ? 87  LEU A CD2   1 
ATOM   448  N  N     . LEU A 1 60  ? 52.157  29.912 25.037 1.00 44.64  ? 88  LEU A N     1 
ATOM   449  C  CA    . LEU A 1 60  ? 51.361  31.109 24.819 1.00 48.76  ? 88  LEU A CA    1 
ATOM   450  C  C     . LEU A 1 60  ? 51.817  32.228 25.769 1.00 53.56  ? 88  LEU A C     1 
ATOM   451  O  O     . LEU A 1 60  ? 51.891  33.379 25.372 1.00 53.74  ? 88  LEU A O     1 
ATOM   452  C  CB    . LEU A 1 60  ? 49.870  30.818 25.002 1.00 47.27  ? 88  LEU A CB    1 
ATOM   453  C  CG    . LEU A 1 60  ? 48.934  31.990 24.678 1.00 52.32  ? 88  LEU A CG    1 
ATOM   454  C  CD1   . LEU A 1 60  ? 48.938  32.305 23.186 1.00 52.87  ? 88  LEU A CD1   1 
ATOM   455  C  CD2   . LEU A 1 60  ? 47.521  31.702 25.169 1.00 51.71  ? 88  LEU A CD2   1 
ATOM   456  N  N     . SER A 1 61  ? 52.120  31.872 27.018 1.00 55.37  ? 89  SER A N     1 
ATOM   457  C  CA    . SER A 1 61  ? 52.652  32.821 27.999 1.00 64.86  ? 89  SER A CA    1 
ATOM   458  C  C     . SER A 1 61  ? 53.752  32.156 28.847 1.00 61.57  ? 89  SER A C     1 
ATOM   459  O  O     . SER A 1 61  ? 53.459  31.513 29.866 1.00 55.66  ? 89  SER A O     1 
ATOM   460  C  CB    . SER A 1 61  ? 51.522  33.384 28.875 1.00 64.91  ? 89  SER A CB    1 
ATOM   461  O  OG    . SER A 1 61  ? 50.476  32.443 29.049 1.00 59.90  ? 89  SER A OG    1 
ATOM   462  N  N     . PRO A 1 62  ? 55.024  32.294 28.416 1.00 64.80  ? 90  PRO A N     1 
ATOM   463  C  CA    . PRO A 1 62  ? 56.157  31.705 29.155 1.00 68.79  ? 90  PRO A CA    1 
ATOM   464  C  C     . PRO A 1 62  ? 56.287  32.254 30.577 1.00 71.74  ? 90  PRO A C     1 
ATOM   465  O  O     . PRO A 1 62  ? 56.590  31.503 31.507 1.00 70.07  ? 90  PRO A O     1 
ATOM   466  C  CB    . PRO A 1 62  ? 57.380  32.107 28.318 1.00 69.93  ? 90  PRO A CB    1 
ATOM   467  C  CG    . PRO A 1 62  ? 56.846  32.441 26.967 1.00 64.59  ? 90  PRO A CG    1 
ATOM   468  C  CD    . PRO A 1 62  ? 55.467  32.979 27.188 1.00 64.67  ? 90  PRO A CD    1 
ATOM   469  N  N     . GLU A 1 63  ? 56.056  33.555 30.730 1.00 70.66  ? 91  GLU A N     1 
ATOM   470  C  CA    . GLU A 1 63  ? 55.996  34.198 32.044 1.00 78.31  ? 91  GLU A CA    1 
ATOM   471  C  C     . GLU A 1 63  ? 55.039  33.507 33.026 1.00 78.50  ? 91  GLU A C     1 
ATOM   472  O  O     . GLU A 1 63  ? 55.302  33.473 34.231 1.00 73.50  ? 91  GLU A O     1 
ATOM   473  C  CB    . GLU A 1 63  ? 55.622  35.686 31.905 1.00 93.05  ? 91  GLU A CB    1 
ATOM   474  C  CG    . GLU A 1 63  ? 54.210  35.983 31.381 1.00 98.26  ? 91  GLU A CG    1 
ATOM   475  C  CD    . GLU A 1 63  ? 54.050  35.842 29.867 1.00 100.61 ? 91  GLU A CD    1 
ATOM   476  O  OE1   . GLU A 1 63  ? 55.047  35.564 29.161 1.00 98.06  ? 91  GLU A OE1   1 
ATOM   477  O  OE2   . GLU A 1 63  ? 52.913  36.015 29.375 1.00 96.81  ? 91  GLU A OE2   1 
ATOM   478  N  N     . GLU A 1 64  ? 53.939  32.959 32.513 1.00 72.64  ? 92  GLU A N     1 
ATOM   479  C  CA    . GLU A 1 64  ? 52.937  32.301 33.357 1.00 80.18  ? 92  GLU A CA    1 
ATOM   480  C  C     . GLU A 1 64  ? 53.387  30.909 33.814 1.00 72.40  ? 92  GLU A C     1 
ATOM   481  O  O     . GLU A 1 64  ? 52.877  30.387 34.809 1.00 75.23  ? 92  GLU A O     1 
ATOM   482  C  CB    . GLU A 1 64  ? 51.587  32.207 32.627 1.00 84.13  ? 92  GLU A CB    1 
ATOM   483  C  CG    . GLU A 1 64  ? 50.375  32.376 33.534 1.00 87.14  ? 92  GLU A CG    1 
ATOM   484  C  CD    . GLU A 1 64  ? 50.292  33.759 34.166 1.00 98.54  ? 92  GLU A CD    1 
ATOM   485  O  OE1   . GLU A 1 64  ? 50.854  34.723 33.598 1.00 98.12  ? 92  GLU A OE1   1 
ATOM   486  O  OE2   . GLU A 1 64  ? 49.661  33.883 35.238 1.00 107.41 ? 92  GLU A OE2   1 
ATOM   487  N  N     . LEU A 1 65  ? 54.317  30.303 33.079 1.00 66.66  ? 93  LEU A N     1 
ATOM   488  C  CA    . LEU A 1 65  ? 54.948  29.060 33.515 1.00 63.01  ? 93  LEU A CA    1 
ATOM   489  C  C     . LEU A 1 65  ? 55.851  29.347 34.711 1.00 61.50  ? 93  LEU A C     1 
ATOM   490  O  O     . LEU A 1 65  ? 55.757  28.697 35.744 1.00 54.66  ? 93  LEU A O     1 
ATOM   491  C  CB    . LEU A 1 65  ? 55.763  28.433 32.380 1.00 62.44  ? 93  LEU A CB    1 
ATOM   492  C  CG    . LEU A 1 65  ? 56.563  27.178 32.745 1.00 63.88  ? 93  LEU A CG    1 
ATOM   493  C  CD1   . LEU A 1 65  ? 55.674  26.142 33.404 1.00 60.08  ? 93  LEU A CD1   1 
ATOM   494  C  CD2   . LEU A 1 65  ? 57.243  26.599 31.516 1.00 69.49  ? 93  LEU A CD2   1 
ATOM   495  N  N     . LYS A 1 66  ? 56.724  30.336 34.558 1.00 64.62  ? 94  LYS A N     1 
ATOM   496  C  CA    . LYS A 1 66  ? 57.576  30.787 35.651 1.00 66.60  ? 94  LYS A CA    1 
ATOM   497  C  C     . LYS A 1 66  ? 56.742  31.119 36.894 1.00 64.63  ? 94  LYS A C     1 
ATOM   498  O  O     . LYS A 1 66  ? 57.147  30.818 38.010 1.00 62.64  ? 94  LYS A O     1 
ATOM   499  C  CB    . LYS A 1 66  ? 58.386  32.003 35.208 1.00 72.54  ? 94  LYS A CB    1 
ATOM   500  C  CG    . LYS A 1 66  ? 59.503  32.395 36.153 1.00 81.74  ? 94  LYS A CG    1 
ATOM   501  C  CD    . LYS A 1 66  ? 60.384  33.465 35.522 1.00 90.29  ? 94  LYS A CD    1 
ATOM   502  C  CE    . LYS A 1 66  ? 61.307  34.123 36.536 1.00 96.52  ? 94  LYS A CE    1 
ATOM   503  N  NZ    . LYS A 1 66  ? 62.402  33.219 36.988 1.00 93.94  ? 94  LYS A NZ    1 
ATOM   504  N  N     . ALA A 1 67  ? 55.572  31.719 36.690 1.00 68.26  ? 95  ALA A N     1 
ATOM   505  C  CA    . ALA A 1 67  ? 54.654  32.040 37.790 1.00 71.28  ? 95  ALA A CA    1 
ATOM   506  C  C     . ALA A 1 67  ? 54.006  30.799 38.409 1.00 68.84  ? 95  ALA A C     1 
ATOM   507  O  O     . ALA A 1 67  ? 53.834  30.743 39.619 1.00 68.85  ? 95  ALA A O     1 
ATOM   508  C  CB    . ALA A 1 67  ? 53.582  33.013 37.317 1.00 77.66  ? 95  ALA A CB    1 
ATOM   509  N  N     . ALA A 1 68  ? 53.646  29.815 37.584 1.00 67.72  ? 96  ALA A N     1 
ATOM   510  C  CA    . ALA A 1 68  ? 53.126  28.525 38.073 1.00 66.55  ? 96  ALA A CA    1 
ATOM   511  C  C     . ALA A 1 68  ? 54.133  27.788 38.974 1.00 69.38  ? 96  ALA A C     1 
ATOM   512  O  O     . ALA A 1 68  ? 53.761  27.195 40.001 1.00 66.51  ? 96  ALA A O     1 
ATOM   513  C  CB    . ALA A 1 68  ? 52.736  27.642 36.899 1.00 63.34  ? 96  ALA A CB    1 
ATOM   514  N  N     . SER A 1 69  ? 55.407  27.843 38.589 1.00 66.74  ? 97  SER A N     1 
ATOM   515  C  CA    . SER A 1 69  ? 56.482  27.205 39.347 1.00 64.58  ? 97  SER A CA    1 
ATOM   516  C  C     . SER A 1 69  ? 56.876  27.991 40.607 1.00 75.53  ? 97  SER A C     1 
ATOM   517  O  O     . SER A 1 69  ? 57.842  27.623 41.277 1.00 69.02  ? 97  SER A O     1 
ATOM   518  C  CB    . SER A 1 69  ? 57.713  27.002 38.455 1.00 64.90  ? 97  SER A CB    1 
ATOM   519  O  OG    . SER A 1 69  ? 58.450  28.200 38.303 1.00 66.29  ? 97  SER A OG    1 
ATOM   520  N  N     . ARG A 1 70  ? 56.159  29.084 40.895 1.00 86.01  ? 98  ARG A N     1 
ATOM   521  C  CA    . ARG A 1 70  ? 56.247  29.787 42.181 1.00 88.53  ? 98  ARG A CA    1 
ATOM   522  C  C     . ARG A 1 70  ? 54.884  30.330 42.671 1.00 90.76  ? 98  ARG A C     1 
ATOM   523  O  O     . ARG A 1 70  ? 54.842  31.179 43.566 1.00 94.44  ? 98  ARG A O     1 
ATOM   524  C  CB    . ARG A 1 70  ? 57.267  30.932 42.092 1.00 94.91  ? 98  ARG A CB    1 
ATOM   525  C  CG    . ARG A 1 70  ? 56.810  32.136 41.275 1.00 102.96 ? 98  ARG A CG    1 
ATOM   526  C  CD    . ARG A 1 70  ? 57.779  33.301 41.400 1.00 112.29 ? 98  ARG A CD    1 
ATOM   527  N  NE    . ARG A 1 70  ? 58.979  33.127 40.582 1.00 113.75 ? 98  ARG A NE    1 
ATOM   528  C  CZ    . ARG A 1 70  ? 60.060  33.905 40.642 1.00 117.75 ? 98  ARG A CZ    1 
ATOM   529  N  NH1   . ARG A 1 70  ? 60.122  34.928 41.493 1.00 114.31 ? 98  ARG A NH1   1 
ATOM   530  N  NH2   . ARG A 1 70  ? 61.094  33.652 39.847 1.00 114.52 ? 98  ARG A NH2   1 
ATOM   531  N  N     . GLY A 1 71  ? 53.784  29.811 42.118 1.00 94.30  ? 99  GLY A N     1 
ATOM   532  C  CA    . GLY A 1 71  ? 52.485  30.507 42.138 1.00 101.38 ? 99  GLY A CA    1 
ATOM   533  C  C     . GLY A 1 71  ? 51.465  30.123 43.194 1.00 108.88 ? 99  GLY A C     1 
ATOM   534  O  O     . GLY A 1 71  ? 50.740  30.986 43.693 1.00 117.00 ? 99  GLY A O     1 
ATOM   535  N  N     . ASN A 1 72  ? 51.395  28.837 43.530 1.00 104.79 ? 100 ASN A N     1 
ATOM   536  C  CA    . ASN A 1 72  ? 50.415  28.341 44.518 1.00 106.08 ? 100 ASN A CA    1 
ATOM   537  C  C     . ASN A 1 72  ? 50.810  28.546 46.004 1.00 113.55 ? 100 ASN A C     1 
ATOM   538  O  O     . ASN A 1 72  ? 50.302  27.848 46.891 1.00 110.55 ? 100 ASN A O     1 
ATOM   539  C  CB    . ASN A 1 72  ? 49.994  26.870 44.234 1.00 104.26 ? 100 ASN A CB    1 
ATOM   540  C  CG    . ASN A 1 72  ? 51.050  26.061 43.474 1.00 99.57  ? 100 ASN A CG    1 
ATOM   541  O  OD1   . ASN A 1 72  ? 51.857  26.608 42.714 1.00 104.83 ? 100 ASN A OD1   1 
ATOM   542  N  ND2   . ASN A 1 72  ? 51.024  24.742 43.657 1.00 82.63  ? 100 ASN A ND2   1 
ATOM   543  N  N     . GLY A 1 73  ? 51.711  29.500 46.264 1.00 110.29 ? 101 GLY A N     1 
ATOM   544  C  CA    . GLY A 1 73  ? 51.981  29.994 47.617 1.00 104.00 ? 101 GLY A CA    1 
ATOM   545  C  C     . GLY A 1 73  ? 52.754  29.067 48.539 1.00 104.17 ? 101 GLY A C     1 
ATOM   546  O  O     . GLY A 1 73  ? 53.976  29.166 48.650 1.00 114.23 ? 101 GLY A O     1 
ATOM   547  N  N     . GLU A 1 74  ? 52.029  28.165 49.199 1.00 92.11  ? 102 GLU A N     1 
ATOM   548  C  CA    . GLU A 1 74  ? 52.565  27.358 50.297 1.00 87.98  ? 102 GLU A CA    1 
ATOM   549  C  C     . GLU A 1 74  ? 53.121  26.000 49.844 1.00 75.11  ? 102 GLU A C     1 
ATOM   550  O  O     . GLU A 1 74  ? 54.216  25.608 50.242 1.00 78.29  ? 102 GLU A O     1 
ATOM   551  C  CB    . GLU A 1 74  ? 51.458  27.124 51.334 1.00 93.49  ? 102 GLU A CB    1 
ATOM   552  C  CG    . GLU A 1 74  ? 51.947  26.872 52.754 1.00 98.46  ? 102 GLU A CG    1 
ATOM   553  C  CD    . GLU A 1 74  ? 51.863  28.110 53.634 1.00 108.09 ? 102 GLU A CD    1 
ATOM   554  O  OE1   . GLU A 1 74  ? 52.914  28.560 54.140 1.00 109.31 ? 102 GLU A OE1   1 
ATOM   555  O  OE2   . GLU A 1 74  ? 50.745  28.637 53.820 1.00 113.23 ? 102 GLU A OE2   1 
ATOM   556  N  N     . TYR A 1 75  ? 52.365  25.303 49.004 1.00 61.54  ? 103 TYR A N     1 
ATOM   557  C  CA    . TYR A 1 75  ? 52.610  23.891 48.691 1.00 58.98  ? 103 TYR A CA    1 
ATOM   558  C  C     . TYR A 1 75  ? 52.399  23.575 47.209 1.00 51.76  ? 103 TYR A C     1 
ATOM   559  O  O     . TYR A 1 75  ? 51.738  24.329 46.488 1.00 55.50  ? 103 TYR A O     1 
ATOM   560  C  CB    . TYR A 1 75  ? 51.640  23.027 49.479 1.00 57.24  ? 103 TYR A CB    1 
ATOM   561  C  CG    . TYR A 1 75  ? 50.204  23.290 49.084 1.00 67.64  ? 103 TYR A CG    1 
ATOM   562  C  CD1   . TYR A 1 75  ? 49.603  22.591 48.037 1.00 65.60  ? 103 TYR A CD1   1 
ATOM   563  C  CD2   . TYR A 1 75  ? 49.458  24.271 49.736 1.00 70.01  ? 103 TYR A CD2   1 
ATOM   564  C  CE1   . TYR A 1 75  ? 48.295  22.851 47.665 1.00 67.23  ? 103 TYR A CE1   1 
ATOM   565  C  CE2   . TYR A 1 75  ? 48.152  24.534 49.374 1.00 69.05  ? 103 TYR A CE2   1 
ATOM   566  C  CZ    . TYR A 1 75  ? 47.576  23.824 48.343 1.00 65.39  ? 103 TYR A CZ    1 
ATOM   567  O  OH    . TYR A 1 75  ? 46.277  24.095 47.995 1.00 75.92  ? 103 TYR A OH    1 
ATOM   568  N  N     . ALA A 1 76  ? 52.946  22.437 46.787 1.00 43.19  ? 104 ALA A N     1 
ATOM   569  C  CA    . ALA A 1 76  ? 52.810  21.930 45.424 1.00 36.38  ? 104 ALA A CA    1 
ATOM   570  C  C     . ALA A 1 76  ? 52.993  20.418 45.418 1.00 32.71  ? 104 ALA A C     1 
ATOM   571  O  O     . ALA A 1 76  ? 53.474  19.835 46.380 1.00 32.78  ? 104 ALA A O     1 
ATOM   572  C  CB    . ALA A 1 76  ? 53.837  22.568 44.507 1.00 37.26  ? 104 ALA A CB    1 
ATOM   573  N  N     . TRP A 1 77  ? 52.639  19.807 44.301 1.00 29.17  ? 105 TRP A N     1 
ATOM   574  C  CA    . TRP A 1 77  ? 52.760  18.371 44.096 1.00 28.80  ? 105 TRP A CA    1 
ATOM   575  C  C     . TRP A 1 77  ? 53.795  18.067 43.024 1.00 29.31  ? 105 TRP A C     1 
ATOM   576  O  O     . TRP A 1 77  ? 53.918  18.812 42.042 1.00 30.66  ? 105 TRP A O     1 
ATOM   577  C  CB    . TRP A 1 77  ? 51.406  17.835 43.694 1.00 28.19  ? 105 TRP A CB    1 
ATOM   578  C  CG    . TRP A 1 77  ? 50.454  17.774 44.816 1.00 29.53  ? 105 TRP A CG    1 
ATOM   579  C  CD1   . TRP A 1 77  ? 49.631  18.767 45.274 1.00 30.33  ? 105 TRP A CD1   1 
ATOM   580  C  CD2   . TRP A 1 77  ? 50.178  16.628 45.610 1.00 30.41  ? 105 TRP A CD2   1 
ATOM   581  N  NE1   . TRP A 1 77  ? 48.894  18.314 46.333 1.00 31.29  ? 105 TRP A NE1   1 
ATOM   582  C  CE2   . TRP A 1 77  ? 49.203  16.996 46.552 1.00 33.19  ? 105 TRP A CE2   1 
ATOM   583  C  CE3   . TRP A 1 77  ? 50.668  15.325 45.619 1.00 32.53  ? 105 TRP A CE3   1 
ATOM   584  C  CZ2   . TRP A 1 77  ? 48.707  16.106 47.488 1.00 33.90  ? 105 TRP A CZ2   1 
ATOM   585  C  CZ3   . TRP A 1 77  ? 50.182  14.442 46.556 1.00 35.40  ? 105 TRP A CZ3   1 
ATOM   586  C  CH2   . TRP A 1 77  ? 49.206  14.836 47.477 1.00 33.75  ? 105 TRP A CH2   1 
ATOM   587  N  N     . TYR A 1 78  ? 54.535  16.974 43.205 1.00 28.65  ? 106 TYR A N     1 
ATOM   588  C  CA    . TYR A 1 78  ? 55.667  16.642 42.342 1.00 28.54  ? 106 TYR A CA    1 
ATOM   589  C  C     . TYR A 1 78  ? 55.650  15.172 42.012 1.00 27.64  ? 106 TYR A C     1 
ATOM   590  O  O     . TYR A 1 78  ? 55.204  14.359 42.831 1.00 27.59  ? 106 TYR A O     1 
ATOM   591  C  CB    . TYR A 1 78  ? 57.002  16.960 43.039 1.00 29.32  ? 106 TYR A CB    1 
ATOM   592  C  CG    . TYR A 1 78  ? 57.202  18.413 43.370 1.00 30.47  ? 106 TYR A CG    1 
ATOM   593  C  CD1   . TYR A 1 78  ? 56.755  18.944 44.582 1.00 30.91  ? 106 TYR A CD1   1 
ATOM   594  C  CD2   . TYR A 1 78  ? 57.838  19.265 42.478 1.00 30.68  ? 106 TYR A CD2   1 
ATOM   595  C  CE1   . TYR A 1 78  ? 56.926  20.290 44.880 1.00 32.68  ? 106 TYR A CE1   1 
ATOM   596  C  CE2   . TYR A 1 78  ? 58.011  20.602 42.768 1.00 32.78  ? 106 TYR A CE2   1 
ATOM   597  C  CZ    . TYR A 1 78  ? 57.550  21.115 43.964 1.00 34.03  ? 106 TYR A CZ    1 
ATOM   598  O  OH    . TYR A 1 78  ? 57.739  22.453 44.247 1.00 37.02  ? 106 TYR A OH    1 
ATOM   599  N  N     . TYR A 1 79  ? 56.152  14.841 40.831 1.00 27.54  ? 107 TYR A N     1 
ATOM   600  C  CA    . TYR A 1 79  ? 56.324  13.452 40.415 1.00 29.19  ? 107 TYR A CA    1 
ATOM   601  C  C     . TYR A 1 79  ? 57.774  13.219 40.004 1.00 30.63  ? 107 TYR A C     1 
ATOM   602  O  O     . TYR A 1 79  ? 58.460  14.121 39.537 1.00 31.92  ? 107 TYR A O     1 
ATOM   603  C  CB    . TYR A 1 79  ? 55.335  13.056 39.294 1.00 29.20  ? 107 TYR A CB    1 
ATOM   604  C  CG    . TYR A 1 79  ? 55.436  13.860 38.008 1.00 29.37  ? 107 TYR A CG    1 
ATOM   605  C  CD1   . TYR A 1 79  ? 54.801  15.099 37.884 1.00 28.49  ? 107 TYR A CD1   1 
ATOM   606  C  CD2   . TYR A 1 79  ? 56.151  13.378 36.912 1.00 30.26  ? 107 TYR A CD2   1 
ATOM   607  C  CE1   . TYR A 1 79  ? 54.902  15.837 36.716 1.00 29.02  ? 107 TYR A CE1   1 
ATOM   608  C  CE2   . TYR A 1 79  ? 56.231  14.105 35.723 1.00 30.27  ? 107 TYR A CE2   1 
ATOM   609  C  CZ    . TYR A 1 79  ? 55.612  15.337 35.636 1.00 29.12  ? 107 TYR A CZ    1 
ATOM   610  O  OH    . TYR A 1 79  ? 55.704  16.087 34.483 1.00 28.46  ? 107 TYR A OH    1 
ATOM   611  N  N     . GLU A 1 80  ? 58.223  11.988 40.174 1.00 31.65  ? 108 GLU A N     1 
ATOM   612  C  CA    . GLU A 1 80  ? 59.615  11.621 40.015 1.00 34.59  ? 108 GLU A CA    1 
ATOM   613  C  C     . GLU A 1 80  ? 60.070  11.713 38.560 1.00 35.51  ? 108 GLU A C     1 
ATOM   614  O  O     . GLU A 1 80  ? 59.421  11.175 37.682 1.00 34.50  ? 108 GLU A O     1 
ATOM   615  C  CB    . GLU A 1 80  ? 59.771  10.184 40.505 1.00 38.93  ? 108 GLU A CB    1 
ATOM   616  C  CG    . GLU A 1 80  ? 61.177  9.626  40.521 1.00 42.72  ? 108 GLU A CG    1 
ATOM   617  C  CD    . GLU A 1 80  ? 61.203  8.129  40.819 1.00 45.73  ? 108 GLU A CD    1 
ATOM   618  O  OE1   . GLU A 1 80  ? 60.139  7.545  41.092 1.00 43.18  ? 108 GLU A OE1   1 
ATOM   619  O  OE2   . GLU A 1 80  ? 62.292  7.534  40.758 1.00 46.29  ? 108 GLU A OE2   1 
ATOM   620  N  N     . GLY A 1 81  ? 61.185  12.401 38.319 1.00 37.75  ? 109 GLY A N     1 
ATOM   621  C  CA    . GLY A 1 81  ? 61.864  12.376 37.013 1.00 40.31  ? 109 GLY A CA    1 
ATOM   622  C  C     . GLY A 1 81  ? 63.263  11.780 37.119 1.00 43.51  ? 109 GLY A C     1 
ATOM   623  O  O     . GLY A 1 81  ? 63.663  11.336 38.187 1.00 42.24  ? 109 GLY A O     1 
ATOM   624  N  N     . ARG A 1 82  ? 64.012  11.769 36.014 1.00 46.84  ? 110 ARG A N     1 
ATOM   625  C  CA    . ARG A 1 82  ? 65.403  11.305 36.047 1.00 53.13  ? 110 ARG A CA    1 
ATOM   626  C  C     . ARG A 1 82  ? 66.250  12.382 36.706 1.00 52.39  ? 110 ARG A C     1 
ATOM   627  O  O     . ARG A 1 82  ? 66.289  13.524 36.229 1.00 50.35  ? 110 ARG A O     1 
ATOM   628  C  CB    . ARG A 1 82  ? 65.936  10.980 34.650 1.00 60.65  ? 110 ARG A CB    1 
ATOM   629  C  CG    . ARG A 1 82  ? 65.505  9.611  34.146 1.00 69.35  ? 110 ARG A CG    1 
ATOM   630  C  CD    . ARG A 1 82  ? 66.189  9.214  32.840 1.00 78.23  ? 110 ARG A CD    1 
ATOM   631  N  NE    . ARG A 1 82  ? 65.682  9.954  31.681 1.00 82.35  ? 110 ARG A NE    1 
ATOM   632  C  CZ    . ARG A 1 82  ? 64.498  9.756  31.091 1.00 88.84  ? 110 ARG A CZ    1 
ATOM   633  N  NH1   . ARG A 1 82  ? 63.640  8.844  31.546 1.00 91.03  ? 110 ARG A NH1   1 
ATOM   634  N  NH2   . ARG A 1 82  ? 64.157  10.496 30.039 1.00 86.14  ? 110 ARG A NH2   1 
ATOM   635  N  N     . ASN A 1 83  ? 66.881  12.022 37.823 1.00 51.23  ? 111 ASN A N     1 
ATOM   636  C  CA    . ASN A 1 83  ? 67.704  12.938 38.599 1.00 54.14  ? 111 ASN A CA    1 
ATOM   637  C  C     . ASN A 1 83  ? 67.026  14.270 38.958 1.00 52.73  ? 111 ASN A C     1 
ATOM   638  O  O     . ASN A 1 83  ? 67.647  15.330 38.852 1.00 56.54  ? 111 ASN A O     1 
ATOM   639  C  CB    . ASN A 1 83  ? 69.014  13.201 37.855 1.00 59.91  ? 111 ASN A CB    1 
ATOM   640  C  CG    . ASN A 1 83  ? 69.716  11.917 37.424 1.00 63.46  ? 111 ASN A CG    1 
ATOM   641  O  OD1   . ASN A 1 83  ? 70.132  11.107 38.253 1.00 66.09  ? 111 ASN A OD1   1 
ATOM   642  N  ND2   . ASN A 1 83  ? 69.857  11.736 36.119 1.00 67.67  ? 111 ASN A ND2   1 
ATOM   643  N  N     . GLY A 1 84  ? 65.761  14.210 39.377 1.00 46.28  ? 112 GLY A N     1 
ATOM   644  C  CA    . GLY A 1 84  ? 65.035  15.393 39.855 1.00 43.64  ? 112 GLY A CA    1 
ATOM   645  C  C     . GLY A 1 84  ? 63.517  15.225 39.869 1.00 40.37  ? 112 GLY A C     1 
ATOM   646  O  O     . GLY A 1 84  ? 62.983  14.204 39.424 1.00 39.71  ? 112 GLY A O     1 
ATOM   647  N  N     . TRP A 1 85  ? 62.832  16.243 40.385 1.00 37.35  ? 113 TRP A N     1 
ATOM   648  C  CA    . TRP A 1 85  ? 61.386  16.259 40.471 1.00 35.02  ? 113 TRP A CA    1 
ATOM   649  C  C     . TRP A 1 85  ? 60.778  17.166 39.423 1.00 34.04  ? 113 TRP A C     1 
ATOM   650  O  O     . TRP A 1 85  ? 61.273  18.266 39.185 1.00 36.11  ? 113 TRP A O     1 
ATOM   651  C  CB    . TRP A 1 85  ? 60.929  16.787 41.833 1.00 34.85  ? 113 TRP A CB    1 
ATOM   652  C  CG    . TRP A 1 85  ? 61.229  15.916 42.993 1.00 34.80  ? 113 TRP A CG    1 
ATOM   653  C  CD1   . TRP A 1 85  ? 62.263  16.066 43.893 1.00 37.28  ? 113 TRP A CD1   1 
ATOM   654  C  CD2   . TRP A 1 85  ? 60.481  14.777 43.429 1.00 34.37  ? 113 TRP A CD2   1 
ATOM   655  N  NE1   . TRP A 1 85  ? 62.200  15.083 44.848 1.00 36.78  ? 113 TRP A NE1   1 
ATOM   656  C  CE2   . TRP A 1 85  ? 61.119  14.278 44.592 1.00 36.11  ? 113 TRP A CE2   1 
ATOM   657  C  CE3   . TRP A 1 85  ? 59.333  14.126 42.953 1.00 33.53  ? 113 TRP A CE3   1 
ATOM   658  C  CZ2   . TRP A 1 85  ? 60.649  13.156 45.279 1.00 35.03  ? 113 TRP A CZ2   1 
ATOM   659  C  CZ3   . TRP A 1 85  ? 58.870  13.008 43.641 1.00 33.15  ? 113 TRP A CZ3   1 
ATOM   660  C  CH2   . TRP A 1 85  ? 59.525  12.542 44.792 1.00 34.69  ? 113 TRP A CH2   1 
ATOM   661  N  N     . TRP A 1 86  ? 59.682  16.703 38.830 1.00 32.36  ? 114 TRP A N     1 
ATOM   662  C  CA    . TRP A 1 86  ? 58.798  17.527 38.012 1.00 31.54  ? 114 TRP A CA    1 
ATOM   663  C  C     . TRP A 1 86  ? 57.623  17.961 38.865 1.00 29.79  ? 114 TRP A C     1 
ATOM   664  O  O     . TRP A 1 86  ? 57.091  17.173 39.640 1.00 29.17  ? 114 TRP A O     1 
ATOM   665  C  CB    . TRP A 1 86  ? 58.216  16.720 36.852 1.00 30.48  ? 114 TRP A CB    1 
ATOM   666  C  CG    . TRP A 1 86  ? 59.173  16.288 35.827 1.00 32.33  ? 114 TRP A CG    1 
ATOM   667  C  CD1   . TRP A 1 86  ? 59.722  15.044 35.685 1.00 33.86  ? 114 TRP A CD1   1 
ATOM   668  C  CD2   . TRP A 1 86  ? 59.665  17.074 34.743 1.00 33.24  ? 114 TRP A CD2   1 
ATOM   669  N  NE1   . TRP A 1 86  ? 60.552  15.017 34.590 1.00 35.69  ? 114 TRP A NE1   1 
ATOM   670  C  CE2   . TRP A 1 86  ? 60.537  16.259 34.000 1.00 36.12  ? 114 TRP A CE2   1 
ATOM   671  C  CE3   . TRP A 1 86  ? 59.478  18.408 34.346 1.00 34.30  ? 114 TRP A CE3   1 
ATOM   672  C  CZ2   . TRP A 1 86  ? 61.207  16.726 32.866 1.00 37.61  ? 114 TRP A CZ2   1 
ATOM   673  C  CZ3   . TRP A 1 86  ? 60.146  18.872 33.223 1.00 35.19  ? 114 TRP A CZ3   1 
ATOM   674  C  CH2   . TRP A 1 86  ? 60.993  18.036 32.499 1.00 37.93  ? 114 TRP A CH2   1 
ATOM   675  N  N     . GLN A 1 87  ? 57.201  19.206 38.710 1.00 29.10  ? 115 GLN A N     1 
ATOM   676  C  CA    . GLN A 1 87  ? 55.981  19.667 39.329 1.00 28.89  ? 115 GLN A CA    1 
ATOM   677  C  C     . GLN A 1 87  ? 54.790  19.252 38.484 1.00 27.60  ? 115 GLN A C     1 
ATOM   678  O  O     . GLN A 1 87  ? 54.830  19.345 37.250 1.00 26.99  ? 115 GLN A O     1 
ATOM   679  C  CB    . GLN A 1 87  ? 56.017  21.189 39.487 1.00 31.45  ? 115 GLN A CB    1 
ATOM   680  C  CG    . GLN A 1 87  ? 54.924  21.746 40.380 1.00 32.15  ? 115 GLN A CG    1 
ATOM   681  C  CD    . GLN A 1 87  ? 55.072  23.242 40.591 1.00 36.30  ? 115 GLN A CD    1 
ATOM   682  O  OE1   . GLN A 1 87  ? 56.169  23.737 40.760 1.00 38.50  ? 115 GLN A OE1   1 
ATOM   683  N  NE2   . GLN A 1 87  ? 53.965  23.960 40.566 1.00 39.56  ? 115 GLN A NE2   1 
ATOM   684  N  N     . TYR A 1 88  ? 53.733  18.785 39.145 1.00 26.56  ? 116 TYR A N     1 
ATOM   685  C  CA    . TYR A 1 88  ? 52.464  18.534 38.471 1.00 25.15  ? 116 TYR A CA    1 
ATOM   686  C  C     . TYR A 1 88  ? 51.888  19.848 37.923 1.00 27.17  ? 116 TYR A C     1 
ATOM   687  O  O     . TYR A 1 88  ? 52.024  20.908 38.551 1.00 26.75  ? 116 TYR A O     1 
ATOM   688  C  CB    . TYR A 1 88  ? 51.436  17.918 39.423 1.00 25.35  ? 116 TYR A CB    1 
ATOM   689  C  CG    . TYR A 1 88  ? 51.532  16.411 39.616 1.00 24.99  ? 116 TYR A CG    1 
ATOM   690  C  CD1   . TYR A 1 88  ? 50.856  15.535 38.780 1.00 24.54  ? 116 TYR A CD1   1 
ATOM   691  C  CD2   . TYR A 1 88  ? 52.274  15.873 40.663 1.00 25.19  ? 116 TYR A CD2   1 
ATOM   692  C  CE1   . TYR A 1 88  ? 50.930  14.144 38.975 1.00 25.95  ? 116 TYR A CE1   1 
ATOM   693  C  CE2   . TYR A 1 88  ? 52.349  14.494 40.867 1.00 25.79  ? 116 TYR A CE2   1 
ATOM   694  C  CZ    . TYR A 1 88  ? 51.689  13.634 40.015 1.00 25.55  ? 116 TYR A CZ    1 
ATOM   695  O  OH    . TYR A 1 88  ? 51.743  12.250 40.207 1.00 26.90  ? 116 TYR A OH    1 
ATOM   696  N  N     . ASP A 1 89  ? 51.215  19.729 36.778 1.00 27.26  ? 117 ASP A N     1 
ATOM   697  C  CA    . ASP A 1 89  ? 50.371  20.788 36.225 1.00 30.01  ? 117 ASP A CA    1 
ATOM   698  C  C     . ASP A 1 89  ? 49.324  21.203 37.251 1.00 30.04  ? 117 ASP A C     1 
ATOM   699  O  O     . ASP A 1 89  ? 48.940  20.422 38.114 1.00 27.41  ? 117 ASP A O     1 
ATOM   700  C  CB    . ASP A 1 89  ? 49.719  20.331 34.909 1.00 28.87  ? 117 ASP A CB    1 
ATOM   701  C  CG    . ASP A 1 89  ? 48.515  19.429 35.113 1.00 30.32  ? 117 ASP A CG    1 
ATOM   702  O  OD1   . ASP A 1 89  ? 48.652  18.178 35.070 1.00 33.30  ? 117 ASP A OD1   1 
ATOM   703  O  OD2   . ASP A 1 89  ? 47.408  19.975 35.295 1.00 32.68  ? 117 ASP A OD2   1 
ATOM   704  N  N     . GLU A 1 90  ? 48.875  22.445 37.152 1.00 30.41  ? 118 GLU A N     1 
ATOM   705  C  CA    . GLU A 1 90  ? 48.033  23.037 38.178 1.00 34.45  ? 118 GLU A CA    1 
ATOM   706  C  C     . GLU A 1 90  ? 46.669  22.373 38.336 1.00 32.68  ? 118 GLU A C     1 
ATOM   707  O  O     . GLU A 1 90  ? 46.140  22.327 39.446 1.00 32.71  ? 118 GLU A O     1 
ATOM   708  C  CB    . GLU A 1 90  ? 47.869  24.563 37.960 1.00 40.15  ? 118 GLU A CB    1 
ATOM   709  C  CG    . GLU A 1 90  ? 47.134  24.959 36.676 1.00 45.31  ? 118 GLU A CG    1 
ATOM   710  C  CD    . GLU A 1 90  ? 46.553  26.371 36.717 1.00 58.46  ? 118 GLU A CD    1 
ATOM   711  O  OE1   . GLU A 1 90  ? 47.332  27.350 36.704 1.00 60.01  ? 118 GLU A OE1   1 
ATOM   712  O  OE2   . GLU A 1 90  ? 45.307  26.503 36.746 1.00 62.36  ? 118 GLU A OE2   1 
ATOM   713  N  N     . ARG A 1 91  ? 46.109  21.855 37.247 1.00 31.67  ? 119 ARG A N     1 
ATOM   714  C  CA    . ARG A 1 91  ? 44.805  21.200 37.292 1.00 32.00  ? 119 ARG A CA    1 
ATOM   715  C  C     . ARG A 1 91  ? 44.879  19.831 37.994 1.00 30.80  ? 119 ARG A C     1 
ATOM   716  O  O     . ARG A 1 91  ? 44.055  19.542 38.872 1.00 29.54  ? 119 ARG A O     1 
ATOM   717  C  CB    . ARG A 1 91  ? 44.219  21.071 35.885 1.00 32.80  ? 119 ARG A CB    1 
ATOM   718  C  CG    . ARG A 1 91  ? 42.923  20.288 35.788 1.00 36.42  ? 119 ARG A CG    1 
ATOM   719  C  CD    . ARG A 1 91  ? 42.344  20.416 34.391 1.00 41.31  ? 119 ARG A CD    1 
ATOM   720  N  NE    . ARG A 1 91  ? 41.845  21.781 34.208 1.00 40.60  ? 119 ARG A NE    1 
ATOM   721  C  CZ    . ARG A 1 91  ? 41.976  22.520 33.108 1.00 39.02  ? 119 ARG A CZ    1 
ATOM   722  N  NH1   . ARG A 1 91  ? 42.603  22.061 32.027 1.00 44.98  ? 119 ARG A NH1   1 
ATOM   723  N  NH2   . ARG A 1 91  ? 41.482  23.754 33.106 1.00 38.75  ? 119 ARG A NH2   1 
ATOM   724  N  N     . THR A 1 92  ? 45.860  19.012 37.629 1.00 28.40  ? 120 THR A N     1 
ATOM   725  C  CA    . THR A 1 92  ? 46.078  17.753 38.345 1.00 29.81  ? 120 THR A CA    1 
ATOM   726  C  C     . THR A 1 92  ? 46.447  18.028 39.820 1.00 30.09  ? 120 THR A C     1 
ATOM   727  O  O     . THR A 1 92  ? 45.983  17.324 40.712 1.00 29.69  ? 120 THR A O     1 
ATOM   728  C  CB    . THR A 1 92  ? 47.171  16.887 37.687 1.00 29.35  ? 120 THR A CB    1 
ATOM   729  O  OG1   . THR A 1 92  ? 46.897  16.736 36.285 1.00 32.04  ? 120 THR A OG1   1 
ATOM   730  C  CG2   . THR A 1 92  ? 47.221  15.491 38.326 1.00 30.33  ? 120 THR A CG2   1 
ATOM   731  N  N     . SER A 1 93  ? 47.257  19.054 40.077 1.00 30.49  ? 121 SER A N     1 
ATOM   732  C  CA    . SER A 1 93  ? 47.615  19.416 41.450 1.00 35.17  ? 121 SER A CA    1 
ATOM   733  C  C     . SER A 1 93  ? 46.390  19.713 42.320 1.00 34.59  ? 121 SER A C     1 
ATOM   734  O  O     . SER A 1 93  ? 46.368  19.332 43.490 1.00 33.78  ? 121 SER A O     1 
ATOM   735  C  CB    . SER A 1 93  ? 48.562  20.609 41.493 1.00 37.75  ? 121 SER A CB    1 
ATOM   736  O  OG    . SER A 1 93  ? 49.772  20.292 40.833 1.00 43.90  ? 121 SER A OG    1 
ATOM   737  N  N     . ARG A 1 94  ? 45.379  20.372 41.758 1.00 34.17  ? 122 ARG A N     1 
ATOM   738  C  CA    . ARG A 1 94  ? 44.150  20.650 42.511 1.00 34.99  ? 122 ARG A CA    1 
ATOM   739  C  C     . ARG A 1 94  ? 43.391  19.373 42.866 1.00 35.11  ? 122 ARG A C     1 
ATOM   740  O  O     . ARG A 1 94  ? 42.863  19.245 43.979 1.00 34.50  ? 122 ARG A O     1 
ATOM   741  C  CB    . ARG A 1 94  ? 43.243  21.631 41.758 1.00 38.98  ? 122 ARG A CB    1 
ATOM   742  C  CG    . ARG A 1 94  ? 43.754  23.065 41.769 1.00 40.56  ? 122 ARG A CG    1 
ATOM   743  C  CD    . ARG A 1 94  ? 42.702  24.062 41.283 1.00 48.75  ? 122 ARG A CD    1 
ATOM   744  N  NE    . ARG A 1 94  ? 42.387  23.941 39.854 1.00 49.92  ? 122 ARG A NE    1 
ATOM   745  C  CZ    . ARG A 1 94  ? 43.095  24.482 38.857 1.00 49.55  ? 122 ARG A CZ    1 
ATOM   746  N  NH1   . ARG A 1 94  ? 44.194  25.192 39.101 1.00 51.99  ? 122 ARG A NH1   1 
ATOM   747  N  NH2   . ARG A 1 94  ? 42.704  24.306 37.600 1.00 48.26  ? 122 ARG A NH2   1 
ATOM   748  N  N     . GLU A 1 95  ? 43.355  18.430 41.932 1.00 32.29  ? 123 GLU A N     1 
ATOM   749  C  CA    . GLU A 1 95  ? 42.751  17.133 42.181 1.00 35.36  ? 123 GLU A CA    1 
ATOM   750  C  C     . GLU A 1 95  ? 43.495  16.387 43.294 1.00 32.35  ? 123 GLU A C     1 
ATOM   751  O  O     . GLU A 1 95  ? 42.848  15.885 44.212 1.00 32.92  ? 123 GLU A O     1 
ATOM   752  C  CB    . GLU A 1 95  ? 42.698  16.285 40.911 1.00 35.55  ? 123 GLU A CB    1 
ATOM   753  C  CG    . GLU A 1 95  ? 42.203  14.853 41.127 1.00 39.76  ? 123 GLU A CG    1 
ATOM   754  C  CD    . GLU A 1 95  ? 40.826  14.769 41.781 1.00 46.42  ? 123 GLU A CD    1 
ATOM   755  O  OE1   . GLU A 1 95  ? 39.956  15.610 41.457 1.00 56.59  ? 123 GLU A OE1   1 
ATOM   756  O  OE2   . GLU A 1 95  ? 40.605  13.861 42.618 1.00 46.50  ? 123 GLU A OE2   1 
ATOM   757  N  N     . LEU A 1 96  ? 44.826  16.326 43.214 1.00 29.91  ? 124 LEU A N     1 
ATOM   758  C  CA    . LEU A 1 96  ? 45.640  15.681 44.258 1.00 29.62  ? 124 LEU A CA    1 
ATOM   759  C  C     . LEU A 1 96  ? 45.419  16.321 45.623 1.00 30.82  ? 124 LEU A C     1 
ATOM   760  O  O     . LEU A 1 96  ? 45.235  15.630 46.627 1.00 29.62  ? 124 LEU A O     1 
ATOM   761  C  CB    . LEU A 1 96  ? 47.142  15.705 43.897 1.00 29.86  ? 124 LEU A CB    1 
ATOM   762  C  CG    . LEU A 1 96  ? 47.540  14.900 42.651 1.00 29.39  ? 124 LEU A CG    1 
ATOM   763  C  CD1   . LEU A 1 96  ? 48.938  15.243 42.161 1.00 29.70  ? 124 LEU A CD1   1 
ATOM   764  C  CD2   . LEU A 1 96  ? 47.403  13.401 42.884 1.00 30.44  ? 124 LEU A CD2   1 
ATOM   765  N  N     . GLU A 1 97  ? 45.438  17.646 45.663 1.00 30.34  ? 125 GLU A N     1 
ATOM   766  C  CA    . GLU A 1 97  ? 45.241  18.368 46.898 1.00 33.13  ? 125 GLU A CA    1 
ATOM   767  C  C     . GLU A 1 97  ? 43.856  18.084 47.483 1.00 33.77  ? 125 GLU A C     1 
ATOM   768  O  O     . GLU A 1 97  ? 43.731  17.925 48.699 1.00 34.87  ? 125 GLU A O     1 
ATOM   769  C  CB    . GLU A 1 97  ? 45.430  19.870 46.665 1.00 34.22  ? 125 GLU A CB    1 
ATOM   770  C  CG    . GLU A 1 97  ? 45.492  20.719 47.919 1.00 36.46  ? 125 GLU A CG    1 
ATOM   771  C  CD    . GLU A 1 97  ? 46.588  20.312 48.889 1.00 37.22  ? 125 GLU A CD    1 
ATOM   772  O  OE1   . GLU A 1 97  ? 47.582  19.646 48.505 1.00 37.10  ? 125 GLU A OE1   1 
ATOM   773  O  OE2   . GLU A 1 97  ? 46.442  20.663 50.063 1.00 38.37  ? 125 GLU A OE2   1 
ATOM   774  N  N     . ASP A 1 98  ? 42.839  18.029 46.622 1.00 34.65  ? 126 ASP A N     1 
ATOM   775  C  CA    . ASP A 1 98  ? 41.457  17.745 47.049 1.00 38.63  ? 126 ASP A CA    1 
ATOM   776  C  C     . ASP A 1 98  ? 41.365  16.367 47.706 1.00 36.59  ? 126 ASP A C     1 
ATOM   777  O  O     . ASP A 1 98  ? 40.803  16.220 48.795 1.00 40.61  ? 126 ASP A O     1 
ATOM   778  C  CB    . ASP A 1 98  ? 40.498  17.795 45.857 1.00 39.24  ? 126 ASP A CB    1 
ATOM   779  C  CG    . ASP A 1 98  ? 39.043  17.529 46.255 1.00 46.46  ? 126 ASP A CG    1 
ATOM   780  O  OD1   . ASP A 1 98  ? 38.405  18.430 46.848 1.00 46.68  ? 126 ASP A OD1   1 
ATOM   781  O  OD2   . ASP A 1 98  ? 38.536  16.419 45.975 1.00 45.98  ? 126 ASP A OD2   1 
ATOM   782  N  N     . ALA A 1 99  ? 41.922  15.374 47.027 1.00 33.81  ? 127 ALA A N     1 
ATOM   783  C  CA    . ALA A 1 99  ? 41.889  14.000 47.484 1.00 34.73  ? 127 ALA A CA    1 
ATOM   784  C  C     . ALA A 1 99  ? 42.649  13.864 48.786 1.00 34.37  ? 127 ALA A C     1 
ATOM   785  O  O     . ALA A 1 99  ? 42.152  13.277 49.736 1.00 34.97  ? 127 ALA A O     1 
ATOM   786  C  CB    . ALA A 1 99  ? 42.480  13.081 46.434 1.00 33.84  ? 127 ALA A CB    1 
ATOM   787  N  N     . PHE A 1 100 ? 43.859  14.411 48.817 1.00 32.50  ? 128 PHE A N     1 
ATOM   788  C  CA    . PHE A 1 100 ? 44.688  14.370 50.004 1.00 33.02  ? 128 PHE A CA    1 
ATOM   789  C  C     . PHE A 1 100 ? 44.005  15.006 51.217 1.00 34.44  ? 128 PHE A C     1 
ATOM   790  O  O     . PHE A 1 100 ? 43.976  14.417 52.302 1.00 34.17  ? 128 PHE A O     1 
ATOM   791  C  CB    . PHE A 1 100 ? 46.037  15.044 49.731 1.00 32.01  ? 128 PHE A CB    1 
ATOM   792  C  CG    . PHE A 1 100 ? 46.956  15.026 50.907 1.00 32.86  ? 128 PHE A CG    1 
ATOM   793  C  CD1   . PHE A 1 100 ? 47.692  13.887 51.212 1.00 33.05  ? 128 PHE A CD1   1 
ATOM   794  C  CD2   . PHE A 1 100 ? 47.053  16.127 51.745 1.00 34.39  ? 128 PHE A CD2   1 
ATOM   795  C  CE1   . PHE A 1 100 ? 48.530  13.861 52.320 1.00 33.53  ? 128 PHE A CE1   1 
ATOM   796  C  CE2   . PHE A 1 100 ? 47.890  16.105 52.858 1.00 35.54  ? 128 PHE A CE2   1 
ATOM   797  C  CZ    . PHE A 1 100 ? 48.627  14.971 53.146 1.00 34.68  ? 128 PHE A CZ    1 
ATOM   798  N  N     . SER A 1 101 ? 43.434  16.192 51.007 1.00 35.35  ? 129 SER A N     1 
ATOM   799  C  CA    . SER A 1 101 ? 42.812  16.961 52.059 1.00 38.55  ? 129 SER A CA    1 
ATOM   800  C  C     . SER A 1 101 ? 41.550  16.282 52.601 1.00 39.99  ? 129 SER A C     1 
ATOM   801  O  O     . SER A 1 101 ? 41.218  16.451 53.768 1.00 42.69  ? 129 SER A O     1 
ATOM   802  C  CB    . SER A 1 101 ? 42.506  18.403 51.592 1.00 39.78  ? 129 SER A CB    1 
ATOM   803  O  OG    . SER A 1 101 ? 41.355  18.483 50.760 1.00 41.18  ? 129 SER A OG    1 
ATOM   804  N  N     . LYS A 1 102 ? 40.886  15.492 51.765 1.00 39.22  ? 130 LYS A N     1 
ATOM   805  C  CA    . LYS A 1 102 ? 39.734  14.700 52.190 1.00 42.47  ? 130 LYS A CA    1 
ATOM   806  C  C     . LYS A 1 102 ? 40.104  13.322 52.778 1.00 42.32  ? 130 LYS A C     1 
ATOM   807  O  O     . LYS A 1 102 ? 39.230  12.604 53.228 1.00 45.18  ? 130 LYS A O     1 
ATOM   808  C  CB    . LYS A 1 102 ? 38.773  14.487 51.025 1.00 43.61  ? 130 LYS A CB    1 
ATOM   809  C  CG    . LYS A 1 102 ? 38.033  15.725 50.541 1.00 47.86  ? 130 LYS A CG    1 
ATOM   810  C  CD    . LYS A 1 102 ? 37.091  15.334 49.404 1.00 50.06  ? 130 LYS A CD    1 
ATOM   811  C  CE    . LYS A 1 102 ? 36.551  16.518 48.612 1.00 56.91  ? 130 LYS A CE    1 
ATOM   812  N  NZ    . LYS A 1 102 ? 36.222  17.699 49.459 1.00 60.93  ? 130 LYS A NZ    1 
ATOM   813  N  N     . GLY A 1 103 ? 41.382  12.956 52.770 1.00 39.76  ? 131 GLY A N     1 
ATOM   814  C  CA    . GLY A 1 103 ? 41.821  11.650 53.265 1.00 40.61  ? 131 GLY A CA    1 
ATOM   815  C  C     . GLY A 1 103 ? 41.548  10.469 52.336 1.00 40.85  ? 131 GLY A C     1 
ATOM   816  O  O     . GLY A 1 103 ? 41.502  9.326  52.782 1.00 41.30  ? 131 GLY A O     1 
ATOM   817  N  N     . LYS A 1 104 ? 41.391  10.721 51.042 1.00 39.64  ? 132 LYS A N     1 
ATOM   818  C  CA    . LYS A 1 104 ? 41.213  9.628  50.077 1.00 40.68  ? 132 LYS A CA    1 
ATOM   819  C  C     . LYS A 1 104 ? 42.479  8.798  49.939 1.00 39.61  ? 132 LYS A C     1 
ATOM   820  O  O     . LYS A 1 104 ? 43.583  9.337  49.904 1.00 37.59  ? 132 LYS A O     1 
ATOM   821  C  CB    . LYS A 1 104 ? 40.820  10.171 48.708 1.00 40.82  ? 132 LYS A CB    1 
ATOM   822  C  CG    . LYS A 1 104 ? 39.476  10.841 48.700 1.00 43.93  ? 132 LYS A CG    1 
ATOM   823  C  CD    . LYS A 1 104 ? 39.059  11.153 47.286 1.00 45.57  ? 132 LYS A CD    1 
ATOM   824  C  CE    . LYS A 1 104 ? 37.710  11.825 47.265 1.00 49.64  ? 132 LYS A CE    1 
ATOM   825  N  NZ    . LYS A 1 104 ? 37.470  12.396 45.921 1.00 51.14  ? 132 LYS A NZ    1 
ATOM   826  N  N     . LYS A 1 105 ? 42.330  7.481  49.856 1.00 41.00  ? 133 LYS A N     1 
ATOM   827  C  CA    . LYS A 1 105 ? 43.492  6.606  49.703 1.00 41.36  ? 133 LYS A CA    1 
ATOM   828  C  C     . LYS A 1 105 ? 44.101  6.732  48.295 1.00 39.41  ? 133 LYS A C     1 
ATOM   829  O  O     . LYS A 1 105 ? 45.287  6.528  48.117 1.00 38.08  ? 133 LYS A O     1 
ATOM   830  C  CB    . LYS A 1 105 ? 43.120  5.155  50.013 1.00 45.27  ? 133 LYS A CB    1 
ATOM   831  C  CG    . LYS A 1 105 ? 42.899  4.901  51.503 1.00 50.90  ? 133 LYS A CG    1 
ATOM   832  C  CD    . LYS A 1 105 ? 41.721  3.975  51.763 1.00 58.61  ? 133 LYS A CD    1 
ATOM   833  C  CE    . LYS A 1 105 ? 41.246  4.010  53.213 1.00 65.19  ? 133 LYS A CE    1 
ATOM   834  N  NZ    . LYS A 1 105 ? 41.624  2.782  53.970 1.00 68.79  ? 133 LYS A NZ    1 
ATOM   835  N  N     . ASN A 1 106 ? 43.279  7.068  47.310 1.00 39.88  ? 134 ASN A N     1 
ATOM   836  C  CA    . ASN A 1 106 ? 43.752  7.266  45.945 1.00 39.92  ? 134 ASN A CA    1 
ATOM   837  C  C     . ASN A 1 106 ? 42.760  8.056  45.123 1.00 39.26  ? 134 ASN A C     1 
ATOM   838  O  O     . ASN A 1 106 ? 41.659  8.351  45.585 1.00 41.68  ? 134 ASN A O     1 
ATOM   839  C  CB    . ASN A 1 106 ? 44.056  5.922  45.269 1.00 43.01  ? 134 ASN A CB    1 
ATOM   840  C  CG    . ASN A 1 106 ? 42.926  4.931  45.401 1.00 48.20  ? 134 ASN A CG    1 
ATOM   841  O  OD1   . ASN A 1 106 ? 41.828  5.147  44.895 1.00 52.80  ? 134 ASN A OD1   1 
ATOM   842  N  ND2   . ASN A 1 106 ? 43.190  3.835  46.087 1.00 50.86  ? 134 ASN A ND2   1 
ATOM   843  N  N     . THR A 1 107 ? 43.170  8.409  43.911 1.00 36.27  ? 135 THR A N     1 
ATOM   844  C  CA    . THR A 1 107 ? 42.312  9.089  42.960 1.00 37.69  ? 135 THR A CA    1 
ATOM   845  C  C     . THR A 1 107 ? 42.896  8.873  41.566 1.00 36.91  ? 135 THR A C     1 
ATOM   846  O  O     . THR A 1 107 ? 44.060  8.510  41.424 1.00 38.37  ? 135 THR A O     1 
ATOM   847  C  CB    . THR A 1 107 ? 42.170  10.598 43.303 1.00 37.89  ? 135 THR A CB    1 
ATOM   848  O  OG1   . THR A 1 107 ? 41.209  11.217 42.444 1.00 41.83  ? 135 THR A OG1   1 
ATOM   849  C  CG2   . THR A 1 107 ? 43.495  11.333 43.186 1.00 35.70  ? 135 THR A CG2   1 
ATOM   850  N  N     . GLU A 1 108 ? 42.092  9.098  40.539 1.00 38.05  ? 136 GLU A N     1 
ATOM   851  C  CA    . GLU A 1 108 ? 42.528  8.891  39.162 1.00 37.11  ? 136 GLU A CA    1 
ATOM   852  C  C     . GLU A 1 108 ? 42.683  10.228 38.480 1.00 37.68  ? 136 GLU A C     1 
ATOM   853  O  O     . GLU A 1 108 ? 41.969  11.165 38.803 1.00 42.73  ? 136 GLU A O     1 
ATOM   854  C  CB    . GLU A 1 108 ? 41.528  8.008  38.414 1.00 42.17  ? 136 GLU A CB    1 
ATOM   855  C  CG    . GLU A 1 108 ? 41.548  6.555  38.877 1.00 48.21  ? 136 GLU A CG    1 
ATOM   856  C  CD    . GLU A 1 108 ? 40.705  5.623  38.012 1.00 57.32  ? 136 GLU A CD    1 
ATOM   857  O  OE1   . GLU A 1 108 ? 40.170  6.069  36.965 1.00 62.01  ? 136 GLU A OE1   1 
ATOM   858  O  OE2   . GLU A 1 108 ? 40.587  4.433  38.386 1.00 62.03  ? 136 GLU A OE2   1 
ATOM   859  N  N     . MET A 1 109 ? 43.635  10.317 37.559 1.00 34.42  ? 137 MET A N     1 
ATOM   860  C  CA    . MET A 1 109 ? 43.938  11.566 36.867 1.00 35.26  ? 137 MET A CA    1 
ATOM   861  C  C     . MET A 1 109 ? 44.159  11.240 35.382 1.00 34.05  ? 137 MET A C     1 
ATOM   862  O  O     . MET A 1 109 ? 44.780  10.225 35.051 1.00 32.04  ? 137 MET A O     1 
ATOM   863  C  CB    . MET A 1 109 ? 45.209  12.221 37.443 1.00 36.29  ? 137 MET A CB    1 
ATOM   864  C  CG    . MET A 1 109 ? 45.827  11.520 38.649 1.00 43.32  ? 137 MET A CG    1 
ATOM   865  S  SD    . MET A 1 109 ? 47.452  12.160 39.100 1.00 47.11  ? 137 MET A SD    1 
ATOM   866  C  CE    . MET A 1 109 ? 48.455  10.667 39.026 1.00 42.39  ? 137 MET A CE    1 
ATOM   867  N  N     . LEU A 1 110 ? 43.650  12.093 34.502 1.00 32.33  ? 138 LEU A N     1 
ATOM   868  C  CA    . LEU A 1 110 ? 43.936  11.990 33.075 1.00 32.37  ? 138 LEU A CA    1 
ATOM   869  C  C     . LEU A 1 110 ? 45.192  12.787 32.813 1.00 30.95  ? 138 LEU A C     1 
ATOM   870  O  O     . LEU A 1 110 ? 45.231  13.985 33.050 1.00 30.72  ? 138 LEU A O     1 
ATOM   871  C  CB    . LEU A 1 110 ? 42.800  12.528 32.205 1.00 31.76  ? 138 LEU A CB    1 
ATOM   872  C  CG    . LEU A 1 110 ? 43.108  12.509 30.691 1.00 32.86  ? 138 LEU A CG    1 
ATOM   873  C  CD1   . LEU A 1 110 ? 43.178  11.102 30.118 1.00 33.71  ? 138 LEU A CD1   1 
ATOM   874  C  CD2   . LEU A 1 110 ? 42.098  13.346 29.904 1.00 35.53  ? 138 LEU A CD2   1 
ATOM   875  N  N     . ILE A 1 111 ? 46.219  12.127 32.315 1.00 30.51  ? 139 ILE A N     1 
ATOM   876  C  CA    . ILE A 1 111 ? 47.467  12.826 32.027 1.00 31.40  ? 139 ILE A CA    1 
ATOM   877  C  C     . ILE A 1 111 ? 47.984  12.393 30.663 1.00 30.43  ? 139 ILE A C     1 
ATOM   878  O  O     . ILE A 1 111 ? 48.302  11.210 30.439 1.00 30.81  ? 139 ILE A O     1 
ATOM   879  C  CB    . ILE A 1 111 ? 48.529  12.573 33.115 1.00 35.11  ? 139 ILE A CB    1 
ATOM   880  C  CG1   . ILE A 1 111 ? 47.961  12.867 34.509 1.00 35.99  ? 139 ILE A CG1   1 
ATOM   881  C  CG2   . ILE A 1 111 ? 49.756  13.443 32.859 1.00 38.36  ? 139 ILE A CG2   1 
ATOM   882  C  CD1   . ILE A 1 111 ? 48.984  12.813 35.614 1.00 43.22  ? 139 ILE A CD1   1 
ATOM   883  N  N     . ALA A 1 112 ? 48.043  13.368 29.761 1.00 33.02  ? 140 ALA A N     1 
ATOM   884  C  CA    . ALA A 1 112 ? 48.503  13.178 28.381 1.00 34.14  ? 140 ALA A CA    1 
ATOM   885  C  C     . ALA A 1 112 ? 47.958  11.910 27.750 1.00 36.72  ? 140 ALA A C     1 
ATOM   886  O  O     . ALA A 1 112 ? 48.712  11.032 27.343 1.00 43.49  ? 140 ALA A O     1 
ATOM   887  C  CB    . ALA A 1 112 ? 50.027  13.203 28.327 1.00 40.02  ? 140 ALA A CB    1 
ATOM   888  N  N     . GLY A 1 113 ? 46.633  11.801 27.700 1.00 37.85  ? 141 GLY A N     1 
ATOM   889  C  CA    . GLY A 1 113 ? 45.992  10.698 26.987 1.00 40.05  ? 141 GLY A CA    1 
ATOM   890  C  C     . GLY A 1 113 ? 45.858  9.361  27.702 1.00 36.74  ? 141 GLY A C     1 
ATOM   891  O  O     . GLY A 1 113 ? 45.268  8.432  27.142 1.00 40.27  ? 141 GLY A O     1 
ATOM   892  N  N     . PHE A 1 114 ? 46.379  9.244  28.924 1.00 34.14  ? 142 PHE A N     1 
ATOM   893  C  CA    . PHE A 1 114 ? 46.156  8.031  29.719 1.00 34.94  ? 142 PHE A CA    1 
ATOM   894  C  C     . PHE A 1 114 ? 45.699  8.305  31.143 1.00 32.31  ? 142 PHE A C     1 
ATOM   895  O  O     . PHE A 1 114 ? 46.016  9.339  31.716 1.00 31.71  ? 142 PHE A O     1 
ATOM   896  C  CB    . PHE A 1 114 ? 47.424  7.206  29.763 1.00 37.80  ? 142 PHE A CB    1 
ATOM   897  C  CG    . PHE A 1 114 ? 47.812  6.654  28.428 1.00 42.91  ? 142 PHE A CG    1 
ATOM   898  C  CD1   . PHE A 1 114 ? 48.648  7.372  27.586 1.00 42.41  ? 142 PHE A CD1   1 
ATOM   899  C  CD2   . PHE A 1 114 ? 47.329  5.428  28.007 1.00 43.09  ? 142 PHE A CD2   1 
ATOM   900  C  CE1   . PHE A 1 114 ? 49.015  6.865  26.354 1.00 44.40  ? 142 PHE A CE1   1 
ATOM   901  C  CE2   . PHE A 1 114 ? 47.677  4.923  26.769 1.00 47.65  ? 142 PHE A CE2   1 
ATOM   902  C  CZ    . PHE A 1 114 ? 48.524  5.640  25.939 1.00 46.46  ? 142 PHE A CZ    1 
ATOM   903  N  N     . LEU A 1 115 ? 44.959  7.351  31.699 1.00 34.56  ? 143 LEU A N     1 
ATOM   904  C  CA    . LEU A 1 115 ? 44.505  7.420  33.085 1.00 35.82  ? 143 LEU A CA    1 
ATOM   905  C  C     . LEU A 1 115 ? 45.586  6.900  33.992 1.00 34.87  ? 143 LEU A C     1 
ATOM   906  O  O     . LEU A 1 115 ? 46.114  5.814  33.764 1.00 37.89  ? 143 LEU A O     1 
ATOM   907  C  CB    . LEU A 1 115 ? 43.216  6.604  33.295 1.00 41.94  ? 143 LEU A CB    1 
ATOM   908  C  CG    . LEU A 1 115 ? 41.955  7.324  32.797 1.00 46.64  ? 143 LEU A CG    1 
ATOM   909  C  CD1   . LEU A 1 115 ? 40.731  6.427  32.910 1.00 50.92  ? 143 LEU A CD1   1 
ATOM   910  C  CD2   . LEU A 1 115 ? 41.742  8.630  33.559 1.00 45.73  ? 143 LEU A CD2   1 
ATOM   911  N  N     . TYR A 1 116 ? 45.891  7.680  35.027 1.00 32.09  ? 144 TYR A N     1 
ATOM   912  C  CA    . TYR A 1 116 ? 46.854  7.332  36.062 1.00 33.05  ? 144 TYR A CA    1 
ATOM   913  C  C     . TYR A 1 116 ? 46.118  7.179  37.390 1.00 33.52  ? 144 TYR A C     1 
ATOM   914  O  O     . TYR A 1 116 ? 45.115  7.834  37.620 1.00 34.56  ? 144 TYR A O     1 
ATOM   915  C  CB    . TYR A 1 116 ? 47.928  8.427  36.172 1.00 31.11  ? 144 TYR A CB    1 
ATOM   916  C  CG    . TYR A 1 116 ? 48.938  8.363  35.052 1.00 30.55  ? 144 TYR A CG    1 
ATOM   917  C  CD1   . TYR A 1 116 ? 48.656  8.905  33.799 1.00 30.77  ? 144 TYR A CD1   1 
ATOM   918  C  CD2   . TYR A 1 116 ? 50.160  7.732  35.230 1.00 32.13  ? 144 TYR A CD2   1 
ATOM   919  C  CE1   . TYR A 1 116 ? 49.569  8.824  32.757 1.00 31.77  ? 144 TYR A CE1   1 
ATOM   920  C  CE2   . TYR A 1 116 ? 51.080  7.650  34.197 1.00 34.50  ? 144 TYR A CE2   1 
ATOM   921  C  CZ    . TYR A 1 116 ? 50.776  8.199  32.960 1.00 34.87  ? 144 TYR A CZ    1 
ATOM   922  O  OH    . TYR A 1 116 ? 51.686  8.113  31.935 1.00 38.26  ? 144 TYR A OH    1 
ATOM   923  N  N     . VAL A 1 117 ? 46.588  6.274  38.230 1.00 34.11  ? 145 VAL A N     1 
ATOM   924  C  CA    . VAL A 1 117 ? 46.163  6.211  39.612 1.00 35.28  ? 145 VAL A CA    1 
ATOM   925  C  C     . VAL A 1 117 ? 47.217  6.988  40.410 1.00 33.49  ? 145 VAL A C     1 
ATOM   926  O  O     . VAL A 1 117 ? 48.422  6.826  40.199 1.00 34.16  ? 145 VAL A O     1 
ATOM   927  C  CB    . VAL A 1 117 ? 46.064  4.759  40.130 1.00 38.86  ? 145 VAL A CB    1 
ATOM   928  C  CG1   . VAL A 1 117 ? 45.761  4.722  41.629 1.00 41.25  ? 145 VAL A CG1   1 
ATOM   929  C  CG2   . VAL A 1 117 ? 45.002  3.967  39.376 1.00 40.78  ? 145 VAL A CG2   1 
ATOM   930  N  N     . ALA A 1 118 ? 46.765  7.873  41.286 1.00 32.33  ? 146 ALA A N     1 
ATOM   931  C  CA    . ALA A 1 118 ? 47.630  8.450  42.303 1.00 31.49  ? 146 ALA A CA    1 
ATOM   932  C  C     . ALA A 1 118 ? 47.325  7.696  43.584 1.00 32.57  ? 146 ALA A C     1 
ATOM   933  O  O     . ALA A 1 118 ? 46.208  7.765  44.097 1.00 33.19  ? 146 ALA A O     1 
ATOM   934  C  CB    . ALA A 1 118 ? 47.373  9.950  42.468 1.00 30.71  ? 146 ALA A CB    1 
ATOM   935  N  N     . ASP A 1 119 ? 48.313  6.954  44.075 1.00 33.97  ? 147 ASP A N     1 
ATOM   936  C  CA    . ASP A 1 119 ? 48.174  6.133  45.269 1.00 36.86  ? 147 ASP A CA    1 
ATOM   937  C  C     . ASP A 1 119 ? 48.728  6.972  46.409 1.00 35.14  ? 147 ASP A C     1 
ATOM   938  O  O     . ASP A 1 119 ? 49.935  7.052  46.595 1.00 33.16  ? 147 ASP A O     1 
ATOM   939  C  CB    . ASP A 1 119 ? 48.938  4.811  45.105 1.00 38.51  ? 147 ASP A CB    1 
ATOM   940  C  CG    . ASP A 1 119 ? 48.966  3.957  46.377 1.00 42.36  ? 147 ASP A CG    1 
ATOM   941  O  OD1   . ASP A 1 119 ? 48.727  4.461  47.498 1.00 40.58  ? 147 ASP A OD1   1 
ATOM   942  O  OD2   . ASP A 1 119 ? 49.252  2.743  46.246 1.00 46.61  ? 147 ASP A OD2   1 
ATOM   943  N  N     . LEU A 1 120 ? 47.822  7.588  47.158 1.00 36.06  ? 148 LEU A N     1 
ATOM   944  C  CA    . LEU A 1 120 ? 48.189  8.527  48.208 1.00 37.66  ? 148 LEU A CA    1 
ATOM   945  C  C     . LEU A 1 120 ? 48.633  7.865  49.522 1.00 41.89  ? 148 LEU A C     1 
ATOM   946  O  O     . LEU A 1 120 ? 49.182  8.533  50.398 1.00 41.12  ? 148 LEU A O     1 
ATOM   947  C  CB    . LEU A 1 120 ? 47.037  9.509  48.451 1.00 36.89  ? 148 LEU A CB    1 
ATOM   948  C  CG    . LEU A 1 120 ? 46.673  10.383 47.261 1.00 36.61  ? 148 LEU A CG    1 
ATOM   949  C  CD1   . LEU A 1 120 ? 45.538  11.319 47.636 1.00 39.74  ? 148 LEU A CD1   1 
ATOM   950  C  CD2   . LEU A 1 120 ? 47.869  11.175 46.735 1.00 35.57  ? 148 LEU A CD2   1 
ATOM   951  N  N     . GLU A 1 121 ? 48.421  6.559  49.661 1.00 44.29  ? 149 GLU A N     1 
ATOM   952  C  CA    . GLU A 1 121 ? 48.936  5.839  50.821 1.00 46.36  ? 149 GLU A CA    1 
ATOM   953  C  C     . GLU A 1 121 ? 50.429  5.601  50.675 1.00 48.68  ? 149 GLU A C     1 
ATOM   954  O  O     . GLU A 1 121 ? 51.196  5.824  51.622 1.00 50.13  ? 149 GLU A O     1 
ATOM   955  C  CB    . GLU A 1 121 ? 48.229  4.490  51.004 1.00 50.36  ? 149 GLU A CB    1 
ATOM   956  C  CG    . GLU A 1 121 ? 46.824  4.577  51.570 1.00 54.33  ? 149 GLU A CG    1 
ATOM   957  C  CD    . GLU A 1 121 ? 46.283  3.203  51.956 1.00 59.38  ? 149 GLU A CD    1 
ATOM   958  O  OE1   . GLU A 1 121 ? 45.853  2.449  51.055 1.00 57.64  ? 149 GLU A OE1   1 
ATOM   959  O  OE2   . GLU A 1 121 ? 46.286  2.877  53.162 1.00 67.07  ? 149 GLU A OE2   1 
ATOM   960  N  N     . ASN A 1 122 ? 50.826  5.125  49.495 1.00 44.22  ? 150 ASN A N     1 
ATOM   961  C  CA    . ASN A 1 122 ? 52.224  4.807  49.185 1.00 44.49  ? 150 ASN A CA    1 
ATOM   962  C  C     . ASN A 1 122 ? 52.951  5.893  48.405 1.00 41.37  ? 150 ASN A C     1 
ATOM   963  O  O     . ASN A 1 122 ? 54.129  5.739  48.095 1.00 44.39  ? 150 ASN A O     1 
ATOM   964  C  CB    . ASN A 1 122 ? 52.291  3.518  48.382 1.00 45.08  ? 150 ASN A CB    1 
ATOM   965  C  CG    . ASN A 1 122 ? 51.767  2.336  49.159 1.00 48.69  ? 150 ASN A CG    1 
ATOM   966  O  OD1   . ASN A 1 122 ? 52.367  1.920  50.150 1.00 54.07  ? 150 ASN A OD1   1 
ATOM   967  N  ND2   . ASN A 1 122 ? 50.640  1.795  48.724 1.00 48.20  ? 150 ASN A ND2   1 
ATOM   968  N  N     . MET A 1 123 ? 52.241  6.969  48.074 1.00 38.67  ? 151 MET A N     1 
ATOM   969  C  CA    . MET A 1 123 ? 52.813  8.116  47.353 1.00 36.53  ? 151 MET A CA    1 
ATOM   970  C  C     . MET A 1 123 ? 53.565  7.729  46.072 1.00 35.12  ? 151 MET A C     1 
ATOM   971  O  O     . MET A 1 123 ? 54.768  8.003  45.892 1.00 33.49  ? 151 MET A O     1 
ATOM   972  C  CB    . MET A 1 123 ? 53.658  8.958  48.312 1.00 40.23  ? 151 MET A CB    1 
ATOM   973  C  CG    . MET A 1 123 ? 52.834  9.529  49.466 1.00 40.57  ? 151 MET A CG    1 
ATOM   974  S  SD    . MET A 1 123 ? 51.531  10.655 48.937 1.00 44.30  ? 151 MET A SD    1 
ATOM   975  C  CE    . MET A 1 123 ? 52.477  12.102 48.516 1.00 38.71  ? 151 MET A CE    1 
ATOM   976  N  N     . VAL A 1 124 ? 52.816  7.104  45.192 1.00 35.04  ? 152 VAL A N     1 
ATOM   977  C  CA    . VAL A 1 124 ? 53.271  6.679  43.890 1.00 35.14  ? 152 VAL A CA    1 
ATOM   978  C  C     . VAL A 1 124 ? 52.145  6.875  42.873 1.00 34.37  ? 152 VAL A C     1 
ATOM   979  O  O     . VAL A 1 124 ? 51.005  6.798  43.228 1.00 35.01  ? 152 VAL A O     1 
ATOM   980  C  CB    . VAL A 1 124 ? 53.729  5.197  43.915 1.00 39.20  ? 152 VAL A CB    1 
ATOM   981  C  CG1   . VAL A 1 124 ? 52.553  4.277  43.992 1.00 41.19  ? 152 VAL A CG1   1 
ATOM   982  C  CG2   . VAL A 1 124 ? 54.512  4.877  42.690 1.00 40.78  ? 152 VAL A CG2   1 
ATOM   983  N  N     . GLN A 1 125 ? 52.483  7.178  41.630 1.00 32.45  ? 153 GLN A N     1 
ATOM   984  C  CA    . GLN A 1 125 ? 51.510  7.219  40.554 1.00 32.69  ? 153 GLN A CA    1 
ATOM   985  C  C     . GLN A 1 125 ? 51.882  6.184  39.533 1.00 33.81  ? 153 GLN A C     1 
ATOM   986  O  O     . GLN A 1 125 ? 53.034  5.952  39.308 1.00 34.25  ? 153 GLN A O     1 
ATOM   987  C  CB    . GLN A 1 125 ? 51.484  8.572  39.836 1.00 30.50  ? 153 GLN A CB    1 
ATOM   988  C  CG    . GLN A 1 125 ? 52.691  8.822  38.964 1.00 31.56  ? 153 GLN A CG    1 
ATOM   989  C  CD    . GLN A 1 125 ? 52.501  9.831  37.844 1.00 31.74  ? 153 GLN A CD    1 
ATOM   990  O  OE1   . GLN A 1 125 ? 51.990  10.910 38.033 1.00 34.75  ? 153 GLN A OE1   1 
ATOM   991  N  NE2   . GLN A 1 125 ? 52.939  9.465  36.685 1.00 29.28  ? 153 GLN A NE2   1 
ATOM   992  N  N     . TYR A 1 126 ? 50.891  5.623  38.873 1.00 34.24  ? 154 TYR A N     1 
ATOM   993  C  CA    . TYR A 1 126 ? 51.131  4.699  37.793 1.00 36.83  ? 154 TYR A CA    1 
ATOM   994  C  C     . TYR A 1 126 ? 49.980  4.624  36.796 1.00 36.71  ? 154 TYR A C     1 
ATOM   995  O  O     . TYR A 1 126 ? 48.869  4.900  37.121 1.00 33.72  ? 154 TYR A O     1 
ATOM   996  C  CB    . TYR A 1 126 ? 51.425  3.327  38.379 1.00 39.02  ? 154 TYR A CB    1 
ATOM   997  C  CG    . TYR A 1 126 ? 50.328  2.817  39.245 1.00 41.03  ? 154 TYR A CG    1 
ATOM   998  C  CD1   . TYR A 1 126 ? 50.392  2.919  40.601 1.00 41.89  ? 154 TYR A CD1   1 
ATOM   999  C  CD2   . TYR A 1 126 ? 49.214  2.246  38.705 1.00 43.58  ? 154 TYR A CD2   1 
ATOM   1000 C  CE1   . TYR A 1 126 ? 49.377  2.456  41.392 1.00 43.75  ? 154 TYR A CE1   1 
ATOM   1001 C  CE2   . TYR A 1 126 ? 48.197  1.778  39.493 1.00 44.47  ? 154 TYR A CE2   1 
ATOM   1002 C  CZ    . TYR A 1 126 ? 48.296  1.888  40.837 1.00 44.99  ? 154 TYR A CZ    1 
ATOM   1003 O  OH    . TYR A 1 126 ? 47.290  1.438  41.624 1.00 48.01  ? 154 TYR A OH    1 
ATOM   1004 N  N     . ARG A 1 127 ? 50.300  4.244  35.575 1.00 38.15  ? 155 ARG A N     1 
ATOM   1005 C  CA    . ARG A 1 127 ? 49.322  4.132  34.510 1.00 43.68  ? 155 ARG A CA    1 
ATOM   1006 C  C     . ARG A 1 127 ? 48.364  2.986  34.871 1.00 46.47  ? 155 ARG A C     1 
ATOM   1007 O  O     . ARG A 1 127 ? 48.781  1.882  35.200 1.00 46.63  ? 155 ARG A O     1 
ATOM   1008 C  CB    . ARG A 1 127 ? 50.042  3.910  33.173 1.00 48.31  ? 155 ARG A CB    1 
ATOM   1009 C  CG    . ARG A 1 127 ? 49.194  4.151  31.947 1.00 53.26  ? 155 ARG A CG    1 
ATOM   1010 C  CD    . ARG A 1 127 ? 50.008  4.121  30.662 1.00 56.97  ? 155 ARG A CD    1 
ATOM   1011 N  NE    . ARG A 1 127 ? 50.514  5.443  30.291 1.00 60.75  ? 155 ARG A NE    1 
ATOM   1012 C  CZ    . ARG A 1 127 ? 51.019  5.759  29.095 1.00 65.05  ? 155 ARG A CZ    1 
ATOM   1013 N  NH1   . ARG A 1 127 ? 51.099  4.850  28.127 1.00 62.99  ? 155 ARG A NH1   1 
ATOM   1014 N  NH2   . ARG A 1 127 ? 51.447  6.998  28.859 1.00 64.62  ? 155 ARG A NH2   1 
ATOM   1015 N  N     . ARG A 1 128 ? 47.072  3.285  34.857 1.00 49.03  ? 156 ARG A N     1 
ATOM   1016 C  CA    . ARG A 1 128 ? 46.072  2.372  35.385 1.00 54.45  ? 156 ARG A CA    1 
ATOM   1017 C  C     . ARG A 1 128 ? 46.079  1.041  34.638 1.00 58.90  ? 156 ARG A C     1 
ATOM   1018 O  O     . ARG A 1 128 ? 45.859  -0.011 35.244 1.00 59.94  ? 156 ARG A O     1 
ATOM   1019 C  CB    . ARG A 1 128 ? 44.691  3.015  35.299 1.00 53.55  ? 156 ARG A CB    1 
ATOM   1020 C  CG    . ARG A 1 128 ? 43.618  2.342  36.133 1.00 59.57  ? 156 ARG A CG    1 
ATOM   1021 C  CD    . ARG A 1 128 ? 42.262  2.922  35.779 1.00 67.25  ? 156 ARG A CD    1 
ATOM   1022 N  NE    . ARG A 1 128 ? 41.170  2.007  36.099 1.00 73.60  ? 156 ARG A NE    1 
ATOM   1023 C  CZ    . ARG A 1 128 ? 39.969  2.026  35.518 1.00 82.70  ? 156 ARG A CZ    1 
ATOM   1024 N  NH1   . ARG A 1 128 ? 39.678  2.918  34.571 1.00 78.28  ? 156 ARG A NH1   1 
ATOM   1025 N  NH2   . ARG A 1 128 ? 39.047  1.140  35.884 1.00 86.19  ? 156 ARG A NH2   1 
ATOM   1026 N  N     . ASN A 1 129 ? 46.339  1.096  33.332 1.00 63.16  ? 157 ASN A N     1 
ATOM   1027 C  CA    . ASN A 1 129 ? 46.388  -0.108 32.496 1.00 78.13  ? 157 ASN A CA    1 
ATOM   1028 C  C     . ASN A 1 129 ? 47.600  -1.006 32.794 1.00 79.45  ? 157 ASN A C     1 
ATOM   1029 O  O     . ASN A 1 129 ? 47.491  -2.231 32.755 1.00 89.18  ? 157 ASN A O     1 
ATOM   1030 C  CB    . ASN A 1 129 ? 46.307  0.256  30.993 1.00 79.86  ? 157 ASN A CB    1 
ATOM   1031 C  CG    . ASN A 1 129 ? 47.591  0.882  30.445 1.00 81.27  ? 157 ASN A CG    1 
ATOM   1032 O  OD1   . ASN A 1 129 ? 48.694  0.373  30.655 1.00 87.18  ? 157 ASN A OD1   1 
ATOM   1033 N  ND2   . ASN A 1 129 ? 47.443  1.975  29.705 1.00 77.11  ? 157 ASN A ND2   1 
ATOM   1034 N  N     . GLU A 1 130 ? 48.741  -0.387 33.096 1.00 80.25  ? 158 GLU A N     1 
ATOM   1035 C  CA    . GLU A 1 130 ? 49.988  -1.109 33.352 1.00 89.16  ? 158 GLU A CA    1 
ATOM   1036 C  C     . GLU A 1 130 ? 50.681  -0.529 34.580 1.00 87.31  ? 158 GLU A C     1 
ATOM   1037 O  O     . GLU A 1 130 ? 51.202  0.591  34.544 1.00 84.24  ? 158 GLU A O     1 
ATOM   1038 C  CB    . GLU A 1 130 ? 50.907  -1.006 32.139 1.00 94.25  ? 158 GLU A CB    1 
ATOM   1039 C  CG    . GLU A 1 130 ? 52.242  -1.719 32.292 1.00 100.64 ? 158 GLU A CG    1 
ATOM   1040 C  CD    . GLU A 1 130 ? 53.270  -1.248 31.283 1.00 105.13 ? 158 GLU A CD    1 
ATOM   1041 O  OE1   . GLU A 1 130 ? 52.919  -0.453 30.381 1.00 93.40  ? 158 GLU A OE1   1 
ATOM   1042 O  OE2   . GLU A 1 130 ? 54.438  -1.671 31.398 1.00 107.38 ? 158 GLU A OE2   1 
ATOM   1043 N  N     . HIS A 1 131 ? 50.711  -1.312 35.653 1.00 87.20  ? 159 HIS A N     1 
ATOM   1044 C  CA    . HIS A 1 131 ? 51.180  -0.839 36.957 1.00 89.84  ? 159 HIS A CA    1 
ATOM   1045 C  C     . HIS A 1 131 ? 52.700  -0.642 37.033 1.00 85.23  ? 159 HIS A C     1 
ATOM   1046 O  O     . HIS A 1 131 ? 53.194  -0.034 37.981 1.00 80.99  ? 159 HIS A O     1 
ATOM   1047 C  CB    . HIS A 1 131 ? 50.726  -1.807 38.057 1.00 100.35 ? 159 HIS A CB    1 
ATOM   1048 C  CG    . HIS A 1 131 ? 49.240  -1.854 38.251 1.00 104.44 ? 159 HIS A CG    1 
ATOM   1049 N  ND1   . HIS A 1 131 ? 48.658  -1.959 39.496 1.00 107.93 ? 159 HIS A ND1   1 
ATOM   1050 C  CD2   . HIS A 1 131 ? 48.219  -1.797 37.362 1.00 104.59 ? 159 HIS A CD2   1 
ATOM   1051 C  CE1   . HIS A 1 131 ? 47.343  -1.974 39.365 1.00 109.77 ? 159 HIS A CE1   1 
ATOM   1052 N  NE2   . HIS A 1 131 ? 47.051  -1.875 38.080 1.00 109.25 ? 159 HIS A NE2   1 
ATOM   1053 N  N     . GLY A 1 132 ? 53.429  -1.164 36.047 1.00 85.74  ? 160 GLY A N     1 
ATOM   1054 C  CA    . GLY A 1 132 ? 54.885  -1.024 35.978 1.00 82.17  ? 160 GLY A CA    1 
ATOM   1055 C  C     . GLY A 1 132 ? 55.408  0.385  35.741 1.00 71.32  ? 160 GLY A C     1 
ATOM   1056 O  O     . GLY A 1 132 ? 56.461  0.746  36.257 1.00 73.40  ? 160 GLY A O     1 
ATOM   1057 N  N     . ARG A 1 133 ? 54.701  1.175  34.941 1.00 65.33  ? 161 ARG A N     1 
ATOM   1058 C  CA    . ARG A 1 133 ? 55.049  2.588  34.767 1.00 65.93  ? 161 ARG A CA    1 
ATOM   1059 C  C     . ARG A 1 133 ? 54.809  3.340  36.080 1.00 56.66  ? 161 ARG A C     1 
ATOM   1060 O  O     . ARG A 1 133 ? 53.712  3.838  36.296 1.00 51.24  ? 161 ARG A O     1 
ATOM   1061 C  CB    . ARG A 1 133 ? 54.178  3.225  33.679 1.00 73.93  ? 161 ARG A CB    1 
ATOM   1062 C  CG    . ARG A 1 133 ? 54.529  2.874  32.242 1.00 82.11  ? 161 ARG A CG    1 
ATOM   1063 C  CD    . ARG A 1 133 ? 53.420  3.359  31.315 1.00 88.15  ? 161 ARG A CD    1 
ATOM   1064 N  NE    . ARG A 1 133 ? 53.919  4.076  30.143 1.00 87.06  ? 161 ARG A NE    1 
ATOM   1065 C  CZ    . ARG A 1 133 ? 54.348  3.505  29.018 1.00 99.54  ? 161 ARG A CZ    1 
ATOM   1066 N  NH1   . ARG A 1 133 ? 54.355  2.182  28.880 1.00 104.46 ? 161 ARG A NH1   1 
ATOM   1067 N  NH2   . ARG A 1 133 ? 54.779  4.268  28.019 1.00 101.02 ? 161 ARG A NH2   1 
ATOM   1068 N  N     . ARG A 1 134 ? 55.819  3.411  36.946 1.00 55.77  ? 162 ARG A N     1 
ATOM   1069 C  CA    . ARG A 1 134 ? 55.663  3.989  38.294 1.00 53.43  ? 162 ARG A CA    1 
ATOM   1070 C  C     . ARG A 1 134 ? 56.571  5.176  38.533 1.00 50.37  ? 162 ARG A C     1 
ATOM   1071 O  O     . ARG A 1 134 ? 57.741  5.159  38.152 1.00 57.87  ? 162 ARG A O     1 
ATOM   1072 C  CB    . ARG A 1 134 ? 55.943  2.946  39.374 1.00 56.50  ? 162 ARG A CB    1 
ATOM   1073 C  CG    . ARG A 1 134 ? 54.692  2.278  39.894 1.00 59.34  ? 162 ARG A CG    1 
ATOM   1074 C  CD    . ARG A 1 134 ? 54.954  0.922  40.534 1.00 64.68  ? 162 ARG A CD    1 
ATOM   1075 N  NE    . ARG A 1 134 ? 53.677  0.228  40.720 1.00 71.40  ? 162 ARG A NE    1 
ATOM   1076 C  CZ    . ARG A 1 134 ? 52.941  0.237  41.833 1.00 74.22  ? 162 ARG A CZ    1 
ATOM   1077 N  NH1   . ARG A 1 134 ? 53.344  0.878  42.928 1.00 72.54  ? 162 ARG A NH1   1 
ATOM   1078 N  NH2   . ARG A 1 134 ? 51.787  -0.424 41.854 1.00 80.99  ? 162 ARG A NH2   1 
ATOM   1079 N  N     . ARG A 1 135 ? 56.016  6.200  39.166 1.00 40.75  ? 163 ARG A N     1 
ATOM   1080 C  CA    . ARG A 1 135 ? 56.770  7.372  39.590 1.00 38.09  ? 163 ARG A CA    1 
ATOM   1081 C  C     . ARG A 1 135 ? 56.374  7.738  41.028 1.00 36.29  ? 163 ARG A C     1 
ATOM   1082 O  O     . ARG A 1 135 ? 55.188  7.759  41.378 1.00 34.58  ? 163 ARG A O     1 
ATOM   1083 C  CB    . ARG A 1 135 ? 56.514  8.542  38.656 1.00 36.88  ? 163 ARG A CB    1 
ATOM   1084 C  CG    . ARG A 1 135 ? 57.026  8.336  37.240 1.00 36.73  ? 163 ARG A CG    1 
ATOM   1085 C  CD    . ARG A 1 135 ? 56.697  9.521  36.348 1.00 34.73  ? 163 ARG A CD    1 
ATOM   1086 N  NE    . ARG A 1 135 ? 57.020  9.227  34.951 1.00 35.58  ? 163 ARG A NE    1 
ATOM   1087 C  CZ    . ARG A 1 135 ? 58.127  9.611  34.318 1.00 36.38  ? 163 ARG A CZ    1 
ATOM   1088 N  NH1   . ARG A 1 135 ? 59.045  10.355 34.929 1.00 36.26  ? 163 ARG A NH1   1 
ATOM   1089 N  NH2   . ARG A 1 135 ? 58.315  9.260  33.043 1.00 37.13  ? 163 ARG A NH2   1 
ATOM   1090 N  N     . LYS A 1 136 ? 57.375  8.006  41.857 1.00 36.28  ? 164 LYS A N     1 
ATOM   1091 C  CA    . LYS A 1 136 ? 57.125  8.488  43.204 1.00 37.37  ? 164 LYS A CA    1 
ATOM   1092 C  C     . LYS A 1 136 ? 56.509  9.876  43.116 1.00 33.33  ? 164 LYS A C     1 
ATOM   1093 O  O     . LYS A 1 136 ? 56.795  10.635 42.180 1.00 32.20  ? 164 LYS A O     1 
ATOM   1094 C  CB    . LYS A 1 136 ? 58.422  8.525  44.039 1.00 42.67  ? 164 LYS A CB    1 
ATOM   1095 C  CG    . LYS A 1 136 ? 58.762  7.210  44.725 1.00 49.91  ? 164 LYS A CG    1 
ATOM   1096 C  CD    . LYS A 1 136 ? 59.163  6.120  43.737 1.00 60.85  ? 164 LYS A CD    1 
ATOM   1097 C  CE    . LYS A 1 136 ? 58.996  4.712  44.302 1.00 70.16  ? 164 LYS A CE    1 
ATOM   1098 N  NZ    . LYS A 1 136 ? 58.749  3.729  43.204 1.00 72.26  ? 164 LYS A NZ    1 
ATOM   1099 N  N     . ILE A 1 137 ? 55.636  10.189 44.062 1.00 31.86  ? 165 ILE A N     1 
ATOM   1100 C  CA    . ILE A 1 137 ? 55.104  11.534 44.171 1.00 31.55  ? 165 ILE A CA    1 
ATOM   1101 C  C     . ILE A 1 137 ? 55.341  12.053 45.574 1.00 31.23  ? 165 ILE A C     1 
ATOM   1102 O  O     . ILE A 1 137 ? 55.577  11.278 46.505 1.00 30.78  ? 165 ILE A O     1 
ATOM   1103 C  CB    . ILE A 1 137 ? 53.604  11.636 43.761 1.00 33.21  ? 165 ILE A CB    1 
ATOM   1104 C  CG1   . ILE A 1 137 ? 52.693  10.872 44.720 1.00 35.50  ? 165 ILE A CG1   1 
ATOM   1105 C  CG2   . ILE A 1 137 ? 53.419  11.121 42.340 1.00 34.45  ? 165 ILE A CG2   1 
ATOM   1106 C  CD1   . ILE A 1 137 ? 51.233  10.822 44.291 1.00 36.05  ? 165 ILE A CD1   1 
ATOM   1107 N  N     . LYS A 1 138 ? 55.312  13.375 45.704 1.00 29.22  ? 166 LYS A N     1 
ATOM   1108 C  CA    . LYS A 1 138 ? 55.375  14.017 47.013 1.00 30.86  ? 166 LYS A CA    1 
ATOM   1109 C  C     . LYS A 1 138 ? 54.638  15.354 46.959 1.00 30.28  ? 166 LYS A C     1 
ATOM   1110 O  O     . LYS A 1 138 ? 54.380  15.897 45.890 1.00 29.04  ? 166 LYS A O     1 
ATOM   1111 C  CB    . LYS A 1 138 ? 56.829  14.206 47.487 1.00 31.96  ? 166 LYS A CB    1 
ATOM   1112 C  CG    . LYS A 1 138 ? 57.653  15.271 46.741 1.00 31.63  ? 166 LYS A CG    1 
ATOM   1113 C  CD    . LYS A 1 138 ? 59.011  15.502 47.378 1.00 32.51  ? 166 LYS A CD    1 
ATOM   1114 C  CE    . LYS A 1 138 ? 59.781  16.640 46.711 1.00 33.70  ? 166 LYS A CE    1 
ATOM   1115 N  NZ    . LYS A 1 138 ? 60.968  17.099 47.508 1.00 36.10  ? 166 LYS A NZ    1 
ATOM   1116 N  N     . ARG A 1 139 ? 54.321  15.854 48.134 1.00 32.68  ? 167 ARG A N     1 
ATOM   1117 C  CA    . ARG A 1 139 ? 53.672  17.126 48.330 1.00 34.36  ? 167 ARG A CA    1 
ATOM   1118 C  C     . ARG A 1 139 ? 54.612  17.944 49.207 1.00 37.30  ? 167 ARG A C     1 
ATOM   1119 O  O     . ARG A 1 139 ? 54.751  17.689 50.416 1.00 40.85  ? 167 ARG A O     1 
ATOM   1120 C  CB    . ARG A 1 139 ? 52.307  16.902 48.977 1.00 34.23  ? 167 ARG A CB    1 
ATOM   1121 C  CG    . ARG A 1 139 ? 51.532  18.175 49.294 1.00 37.40  ? 167 ARG A CG    1 
ATOM   1122 C  CD    . ARG A 1 139 ? 50.303  17.859 50.120 1.00 39.18  ? 167 ARG A CD    1 
ATOM   1123 N  NE    . ARG A 1 139 ? 49.504  19.051 50.390 1.00 41.48  ? 167 ARG A NE    1 
ATOM   1124 C  CZ    . ARG A 1 139 ? 49.540  19.762 51.514 1.00 45.59  ? 167 ARG A CZ    1 
ATOM   1125 N  NH1   . ARG A 1 139 ? 50.358  19.435 52.510 1.00 50.17  ? 167 ARG A NH1   1 
ATOM   1126 N  NH2   . ARG A 1 139 ? 48.755  20.827 51.647 1.00 48.33  ? 167 ARG A NH2   1 
ATOM   1127 N  N     . ASP A 1 140 ? 55.294  18.905 48.592 1.00 37.26  ? 168 ASP A N     1 
ATOM   1128 C  CA    . ASP A 1 140 ? 56.325  19.673 49.274 1.00 39.64  ? 168 ASP A CA    1 
ATOM   1129 C  C     . ASP A 1 140 ? 56.095  21.160 49.016 1.00 41.35  ? 168 ASP A C     1 
ATOM   1130 O  O     . ASP A 1 140 ? 55.130  21.532 48.341 1.00 42.23  ? 168 ASP A O     1 
ATOM   1131 C  CB    . ASP A 1 140 ? 57.699  19.219 48.765 1.00 39.60  ? 168 ASP A CB    1 
ATOM   1132 C  CG    . ASP A 1 140 ? 58.826  19.475 49.756 1.00 43.08  ? 168 ASP A CG    1 
ATOM   1133 O  OD1   . ASP A 1 140 ? 58.685  20.362 50.632 1.00 44.41  ? 168 ASP A OD1   1 
ATOM   1134 O  OD2   . ASP A 1 140 ? 59.877  18.800 49.633 1.00 41.59  ? 168 ASP A OD2   1 
ATOM   1135 N  N     . ILE A 1 141 ? 56.956  22.012 49.562 1.00 44.73  ? 169 ILE A N     1 
ATOM   1136 C  CA    . ILE A 1 141 ? 56.878  23.448 49.277 1.00 46.17  ? 169 ILE A CA    1 
ATOM   1137 C  C     . ILE A 1 141 ? 57.215  23.755 47.816 1.00 46.88  ? 169 ILE A C     1 
ATOM   1138 O  O     . ILE A 1 141 ? 57.816  22.950 47.103 1.00 43.89  ? 169 ILE A O     1 
ATOM   1139 C  CB    . ILE A 1 141 ? 57.767  24.311 50.225 1.00 49.57  ? 169 ILE A CB    1 
ATOM   1140 C  CG1   . ILE A 1 141 ? 59.266  24.015 50.041 1.00 49.05  ? 169 ILE A CG1   1 
ATOM   1141 C  CG2   . ILE A 1 141 ? 57.341  24.123 51.674 1.00 50.24  ? 169 ILE A CG2   1 
ATOM   1142 C  CD1   . ILE A 1 141 ? 60.172  24.974 50.786 1.00 54.29  ? 169 ILE A CD1   1 
ATOM   1143 N  N     . ILE A 1 142 ? 56.813  24.943 47.388 1.00 51.78  ? 170 ILE A N     1 
ATOM   1144 C  CA    . ILE A 1 142 ? 57.088  25.423 46.046 1.00 52.64  ? 170 ILE A CA    1 
ATOM   1145 C  C     . ILE A 1 142 ? 58.572  25.737 45.823 1.00 50.32  ? 170 ILE A C     1 
ATOM   1146 O  O     . ILE A 1 142 ? 59.100  25.498 44.742 1.00 49.52  ? 170 ILE A O     1 
ATOM   1147 C  CB    . ILE A 1 142 ? 56.215  26.653 45.749 1.00 60.12  ? 170 ILE A CB    1 
ATOM   1148 C  CG1   . ILE A 1 142 ? 54.775  26.192 45.521 1.00 61.34  ? 170 ILE A CG1   1 
ATOM   1149 C  CG2   . ILE A 1 142 ? 56.727  27.420 44.542 1.00 62.01  ? 170 ILE A CG2   1 
ATOM   1150 C  CD1   . ILE A 1 142 ? 53.831  27.289 45.094 1.00 68.63  ? 170 ILE A CD1   1 
ATOM   1151 N  N     . ASP A 1 143 ? 59.249  26.253 46.839 1.00 54.17  ? 171 ASP A N     1 
ATOM   1152 C  CA    . ASP A 1 143 ? 60.659  26.642 46.692 1.00 55.98  ? 171 ASP A CA    1 
ATOM   1153 C  C     . ASP A 1 143 ? 61.632  25.456 46.847 1.00 52.02  ? 171 ASP A C     1 
ATOM   1154 O  O     . ASP A 1 143 ? 62.436  25.434 47.764 1.00 52.96  ? 171 ASP A O     1 
ATOM   1155 C  CB    . ASP A 1 143 ? 60.994  27.759 47.691 1.00 62.12  ? 171 ASP A CB    1 
ATOM   1156 C  CG    . ASP A 1 143 ? 62.303  28.463 47.377 1.00 67.14  ? 171 ASP A CG    1 
ATOM   1157 O  OD1   . ASP A 1 143 ? 62.825  29.155 48.279 1.00 78.92  ? 171 ASP A OD1   1 
ATOM   1158 O  OD2   . ASP A 1 143 ? 62.811  28.341 46.238 1.00 69.32  ? 171 ASP A OD2   1 
ATOM   1159 N  N     . ILE A 1 144 ? 61.550  24.469 45.950 1.00 48.65  ? 172 ILE A N     1 
ATOM   1160 C  CA    . ILE A 1 144 ? 62.604  23.451 45.833 1.00 46.24  ? 172 ILE A CA    1 
ATOM   1161 C  C     . ILE A 1 144 ? 63.139  23.427 44.415 1.00 45.86  ? 172 ILE A C     1 
ATOM   1162 O  O     . ILE A 1 144 ? 62.476  23.907 43.496 1.00 46.02  ? 172 ILE A O     1 
ATOM   1163 C  CB    . ILE A 1 144 ? 62.139  22.028 46.207 1.00 43.09  ? 172 ILE A CB    1 
ATOM   1164 C  CG1   . ILE A 1 144 ? 60.904  21.609 45.404 1.00 40.73  ? 172 ILE A CG1   1 
ATOM   1165 C  CG2   . ILE A 1 144 ? 61.860  21.938 47.702 1.00 44.72  ? 172 ILE A CG2   1 
ATOM   1166 C  CD1   . ILE A 1 144 ? 60.684  20.109 45.369 1.00 38.26  ? 172 ILE A CD1   1 
ATOM   1167 N  N     . PRO A 1 145 ? 64.336  22.863 44.220 1.00 46.33  ? 173 PRO A N     1 
ATOM   1168 C  CA    . PRO A 1 145 ? 64.771  22.711 42.827 1.00 47.14  ? 173 PRO A CA    1 
ATOM   1169 C  C     . PRO A 1 145 ? 63.921  21.671 42.090 1.00 43.73  ? 173 PRO A C     1 
ATOM   1170 O  O     . PRO A 1 145 ? 63.481  20.690 42.696 1.00 41.66  ? 173 PRO A O     1 
ATOM   1171 C  CB    . PRO A 1 145 ? 66.238  22.258 42.955 1.00 49.46  ? 173 PRO A CB    1 
ATOM   1172 C  CG    . PRO A 1 145 ? 66.651  22.656 44.330 1.00 51.10  ? 173 PRO A CG    1 
ATOM   1173 C  CD    . PRO A 1 145 ? 65.413  22.554 45.176 1.00 48.47  ? 173 PRO A CD    1 
ATOM   1174 N  N     . LYS A 1 146 ? 63.679  21.906 40.802 1.00 42.33  ? 174 LYS A N     1 
ATOM   1175 C  CA    . LYS A 1 146 ? 62.824  21.045 40.003 1.00 41.00  ? 174 LYS A CA    1 
ATOM   1176 C  C     . LYS A 1 146 ? 63.220  21.090 38.530 1.00 41.57  ? 174 LYS A C     1 
ATOM   1177 O  O     . LYS A 1 146 ? 63.818  22.051 38.065 1.00 43.13  ? 174 LYS A O     1 
ATOM   1178 C  CB    . LYS A 1 146 ? 61.350  21.433 40.178 1.00 38.66  ? 174 LYS A CB    1 
ATOM   1179 C  CG    . LYS A 1 146 ? 61.031  22.846 39.714 1.00 39.90  ? 174 LYS A CG    1 
ATOM   1180 C  CD    . LYS A 1 146 ? 59.676  23.314 40.197 1.00 38.78  ? 174 LYS A CD    1 
ATOM   1181 C  CE    . LYS A 1 146 ? 59.730  23.804 41.637 1.00 39.75  ? 174 LYS A CE    1 
ATOM   1182 N  NZ    . LYS A 1 146 ? 58.518  24.603 41.963 1.00 40.65  ? 174 LYS A NZ    1 
ATOM   1183 N  N     . LYS A 1 147 ? 62.871  20.029 37.818 1.00 41.43  ? 175 LYS A N     1 
ATOM   1184 C  CA    . LYS A 1 147 ? 63.158  19.893 36.395 1.00 42.03  ? 175 LYS A CA    1 
ATOM   1185 C  C     . LYS A 1 147 ? 62.297  20.823 35.544 1.00 40.58  ? 175 LYS A C     1 
ATOM   1186 O  O     . LYS A 1 147 ? 62.705  21.240 34.458 1.00 40.24  ? 175 LYS A O     1 
ATOM   1187 C  CB    . LYS A 1 147 ? 62.933  18.442 35.960 1.00 40.77  ? 175 LYS A CB    1 
ATOM   1188 C  CG    . LYS A 1 147 ? 63.822  17.452 36.700 1.00 42.12  ? 175 LYS A CG    1 
ATOM   1189 C  CD    . LYS A 1 147 ? 63.888  16.091 36.023 1.00 41.77  ? 175 LYS A CD    1 
ATOM   1190 C  CE    . LYS A 1 147 ? 64.496  16.201 34.631 1.00 44.31  ? 175 LYS A CE    1 
ATOM   1191 N  NZ    . LYS A 1 147 ? 65.090  14.921 34.171 1.00 47.54  ? 175 LYS A NZ    1 
ATOM   1192 N  N     . GLY A 1 148 ? 61.110  21.143 36.044 1.00 38.59  ? 176 GLY A N     1 
ATOM   1193 C  CA    . GLY A 1 148 ? 60.139  21.934 35.304 1.00 37.60  ? 176 GLY A CA    1 
ATOM   1194 C  C     . GLY A 1 148 ? 58.739  21.672 35.818 1.00 35.45  ? 176 GLY A C     1 
ATOM   1195 O  O     . GLY A 1 148 ? 58.557  21.213 36.958 1.00 34.95  ? 176 GLY A O     1 
ATOM   1196 N  N     . VAL A 1 149 ? 57.752  21.952 34.974 1.00 33.11  ? 177 VAL A N     1 
ATOM   1197 C  CA    . VAL A 1 149 ? 56.343  21.722 35.290 1.00 32.75  ? 177 VAL A CA    1 
ATOM   1198 C  C     . VAL A 1 149 ? 55.730  20.888 34.172 1.00 31.31  ? 177 VAL A C     1 
ATOM   1199 O  O     . VAL A 1 149 ? 55.734  21.306 33.016 1.00 31.84  ? 177 VAL A O     1 
ATOM   1200 C  CB    . VAL A 1 149 ? 55.578  23.060 35.443 1.00 32.85  ? 177 VAL A CB    1 
ATOM   1201 C  CG1   . VAL A 1 149 ? 54.117  22.830 35.805 1.00 32.75  ? 177 VAL A CG1   1 
ATOM   1202 C  CG2   . VAL A 1 149 ? 56.246  23.945 36.483 1.00 35.11  ? 177 VAL A CG2   1 
ATOM   1203 N  N     . ALA A 1 150 ? 55.264  19.683 34.502 1.00 31.19  ? 178 ALA A N     1 
ATOM   1204 C  CA    . ALA A 1 150 ? 54.496  18.838 33.586 1.00 30.13  ? 178 ALA A CA    1 
ATOM   1205 C  C     . ALA A 1 150 ? 55.229  18.467 32.282 1.00 29.28  ? 178 ALA A C     1 
ATOM   1206 O  O     . ALA A 1 150 ? 54.586  18.232 31.253 1.00 29.98  ? 178 ALA A O     1 
ATOM   1207 C  CB    . ALA A 1 150 ? 53.160  19.497 33.268 1.00 30.60  ? 178 ALA A CB    1 
ATOM   1208 N  N     . GLY A 1 151 ? 56.553  18.409 32.336 1.00 29.06  ? 179 GLY A N     1 
ATOM   1209 C  CA    . GLY A 1 151 ? 57.391  18.154 31.149 1.00 31.43  ? 179 GLY A CA    1 
ATOM   1210 C  C     . GLY A 1 151 ? 57.951  19.399 30.464 1.00 33.22  ? 179 GLY A C     1 
ATOM   1211 O  O     . GLY A 1 151 ? 58.772  19.293 29.569 1.00 36.56  ? 179 GLY A O     1 
ATOM   1212 N  N     . LEU A 1 152 ? 57.530  20.579 30.907 1.00 34.45  ? 180 LEU A N     1 
ATOM   1213 C  CA    . LEU A 1 152 ? 58.028  21.845 30.374 1.00 36.04  ? 180 LEU A CA    1 
ATOM   1214 C  C     . LEU A 1 152 ? 59.211  22.336 31.190 1.00 40.23  ? 180 LEU A C     1 
ATOM   1215 O  O     . LEU A 1 152 ? 59.078  22.545 32.393 1.00 37.33  ? 180 LEU A O     1 
ATOM   1216 C  CB    . LEU A 1 152 ? 56.909  22.886 30.400 1.00 35.55  ? 180 LEU A CB    1 
ATOM   1217 C  CG    . LEU A 1 152 ? 55.666  22.483 29.595 1.00 34.54  ? 180 LEU A CG    1 
ATOM   1218 C  CD1   . LEU A 1 152 ? 54.469  23.329 29.998 1.00 33.87  ? 180 LEU A CD1   1 
ATOM   1219 C  CD2   . LEU A 1 152 ? 55.972  22.614 28.102 1.00 35.60  ? 180 LEU A CD2   1 
ATOM   1220 N  N     . ARG A 1 153 ? 60.354  22.524 30.526 1.00 43.75  ? 181 ARG A N     1 
ATOM   1221 C  CA    . ARG A 1 153 ? 61.624  22.837 31.190 1.00 52.72  ? 181 ARG A CA    1 
ATOM   1222 C  C     . ARG A 1 153 ? 61.655  24.234 31.796 1.00 56.59  ? 181 ARG A C     1 
ATOM   1223 O  O     . ARG A 1 153 ? 61.156  25.185 31.201 1.00 55.56  ? 181 ARG A O     1 
ATOM   1224 C  CB    . ARG A 1 153 ? 62.808  22.736 30.218 1.00 57.99  ? 181 ARG A CB    1 
ATOM   1225 C  CG    . ARG A 1 153 ? 63.055  21.374 29.580 1.00 64.46  ? 181 ARG A CG    1 
ATOM   1226 C  CD    . ARG A 1 153 ? 63.266  20.231 30.565 1.00 69.82  ? 181 ARG A CD    1 
ATOM   1227 N  NE    . ARG A 1 153 ? 64.346  20.464 31.535 1.00 88.21  ? 181 ARG A NE    1 
ATOM   1228 C  CZ    . ARG A 1 153 ? 65.077  19.510 32.123 1.00 82.79  ? 181 ARG A CZ    1 
ATOM   1229 N  NH1   . ARG A 1 153 ? 64.898  18.219 31.844 1.00 80.53  ? 181 ARG A NH1   1 
ATOM   1230 N  NH2   . ARG A 1 153 ? 66.017  19.858 32.992 1.00 85.44  ? 181 ARG A NH2   1 
ATOM   1231 N  N     . LEU A 1 154 ? 62.257  24.326 32.982 1.00 63.24  ? 182 LEU A N     1 
ATOM   1232 C  CA    . LEU A 1 154 ? 62.557  25.594 33.642 1.00 79.83  ? 182 LEU A CA    1 
ATOM   1233 C  C     . LEU A 1 154 ? 63.966  25.537 34.223 1.00 76.87  ? 182 LEU A C     1 
ATOM   1234 O  O     . LEU A 1 154 ? 64.934  25.369 33.484 1.00 74.51  ? 182 LEU A O     1 
ATOM   1235 C  CB    . LEU A 1 154 ? 61.534  25.887 34.746 1.00 84.65  ? 182 LEU A CB    1 
ATOM   1236 C  CG    . LEU A 1 154 ? 60.630  27.117 34.595 1.00 93.73  ? 182 LEU A CG    1 
ATOM   1237 C  CD1   . LEU A 1 154 ? 60.126  27.325 33.173 1.00 95.38  ? 182 LEU A CD1   1 
ATOM   1238 C  CD2   . LEU A 1 154 ? 59.452  26.991 35.551 1.00 93.44  ? 182 LEU A CD2   1 
ATOM   1239 N  N     . HIS B 2 6   ? 41.186  4.424  25.633 1.00 53.07  ? -1  HIS B N     1 
ATOM   1240 C  CA    . HIS B 2 6   ? 40.824  5.629  24.848 1.00 50.99  ? -1  HIS B CA    1 
ATOM   1241 C  C     . HIS B 2 6   ? 40.362  6.718  25.819 1.00 44.08  ? -1  HIS B C     1 
ATOM   1242 O  O     . HIS B 2 6   ? 39.216  7.212  25.753 1.00 35.81  ? -1  HIS B O     1 
ATOM   1243 C  CB    . HIS B 2 6   ? 39.739  5.266  23.813 1.00 56.77  ? -1  HIS B CB    1 
ATOM   1244 C  CG    . HIS B 2 6   ? 40.035  4.002  23.053 1.00 66.47  ? -1  HIS B CG    1 
ATOM   1245 N  ND1   . HIS B 2 6   ? 39.320  2.835  23.233 1.00 64.72  ? -1  HIS B ND1   1 
ATOM   1246 C  CD2   . HIS B 2 6   ? 40.997  3.715  22.141 1.00 69.01  ? -1  HIS B CD2   1 
ATOM   1247 C  CE1   . HIS B 2 6   ? 39.813  1.892  22.449 1.00 72.10  ? -1  HIS B CE1   1 
ATOM   1248 N  NE2   . HIS B 2 6   ? 40.829  2.400  21.774 1.00 76.34  ? -1  HIS B NE2   1 
ATOM   1249 N  N     . ALA B 2 7   ? 41.285  7.093  26.710 1.00 39.98  ? 0   ALA B N     1 
ATOM   1250 C  CA    . ALA B 2 7   ? 40.952  7.934  27.846 1.00 36.71  ? 0   ALA B CA    1 
ATOM   1251 C  C     . ALA B 2 7   ? 40.705  9.399  27.501 1.00 33.97  ? 0   ALA B C     1 
ATOM   1252 O  O     . ALA B 2 7   ? 39.876  10.019 28.143 1.00 30.99  ? 0   ALA B O     1 
ATOM   1253 C  CB    . ALA B 2 7   ? 42.010  7.816  28.929 1.00 38.95  ? 0   ALA B CB    1 
ATOM   1254 N  N     . MET B 2 8   ? 41.392  9.948  26.501 1.00 33.04  ? 1   MET B N     1 
ATOM   1255 C  CA    . MET B 2 8   ? 41.098  11.326 26.028 1.00 32.84  ? 1   MET B CA    1 
ATOM   1256 C  C     . MET B 2 8   ? 39.624  11.453 25.617 1.00 29.22  ? 1   MET B C     1 
ATOM   1257 O  O     . MET B 2 8   ? 38.923  12.381 26.067 1.00 27.49  ? 1   MET B O     1 
ATOM   1258 C  CB    . MET B 2 8   ? 42.028  11.732 24.859 1.00 37.77  ? 1   MET B CB    1 
ATOM   1259 C  CG    . MET B 2 8   ? 41.719  13.080 24.175 1.00 43.62  ? 1   MET B CG    1 
ATOM   1260 S  SD    . MET B 2 8   ? 42.500  13.420 22.550 1.00 50.36  ? 1   MET B SD    1 
ATOM   1261 C  CE    . MET B 2 8   ? 41.743  12.197 21.466 1.00 48.34  ? 1   MET B CE    1 
ATOM   1262 N  N     . ALA B 2 9   ? 39.162  10.536 24.763 1.00 27.42  ? 2   ALA B N     1 
ATOM   1263 C  CA    . ALA B 2 9   ? 37.782  10.536 24.305 1.00 26.42  ? 2   ALA B CA    1 
ATOM   1264 C  C     . ALA B 2 9   ? 36.806  10.415 25.474 1.00 26.73  ? 2   ALA B C     1 
ATOM   1265 O  O     . ALA B 2 9   ? 35.893  11.248 25.611 1.00 26.69  ? 2   ALA B O     1 
ATOM   1266 C  CB    . ALA B 2 9   ? 37.539  9.442  23.278 1.00 27.24  ? 2   ALA B CB    1 
ATOM   1267 N  N     . LEU B 2 10  ? 37.038  9.412  26.323 1.00 28.59  ? 3   LEU B N     1 
ATOM   1268 C  CA    . LEU B 2 10  ? 36.178  9.126  27.458 1.00 30.52  ? 3   LEU B CA    1 
ATOM   1269 C  C     . LEU B 2 10  ? 35.944  10.359 28.330 1.00 29.42  ? 3   LEU B C     1 
ATOM   1270 O  O     . LEU B 2 10  ? 34.808  10.671 28.659 1.00 27.73  ? 3   LEU B O     1 
ATOM   1271 C  CB    . LEU B 2 10  ? 36.752  7.998  28.313 1.00 33.91  ? 3   LEU B CB    1 
ATOM   1272 C  CG    . LEU B 2 10  ? 35.964  7.653  29.577 1.00 36.13  ? 3   LEU B CG    1 
ATOM   1273 C  CD1   . LEU B 2 10  ? 34.510  7.376  29.224 1.00 37.54  ? 3   LEU B CD1   1 
ATOM   1274 C  CD2   . LEU B 2 10  ? 36.577  6.463  30.285 1.00 43.78  ? 3   LEU B CD2   1 
ATOM   1275 N  N     . LYS B 2 11  ? 37.023  11.018 28.719 1.00 30.55  ? 4   LYS B N     1 
ATOM   1276 C  CA    . LYS B 2 11  ? 36.937  12.209 29.563 1.00 33.06  ? 4   LYS B CA    1 
ATOM   1277 C  C     . LYS B 2 11  ? 36.276  13.384 28.864 1.00 28.84  ? 4   LYS B C     1 
ATOM   1278 O  O     . LYS B 2 11  ? 35.489  14.084 29.492 1.00 28.86  ? 4   LYS B O     1 
ATOM   1279 C  CB    . LYS B 2 11  ? 38.319  12.607 30.107 1.00 35.04  ? 4   LYS B CB    1 
ATOM   1280 C  CG    . LYS B 2 11  ? 38.823  11.652 31.170 1.00 42.89  ? 4   LYS B CG    1 
ATOM   1281 C  CD    . LYS B 2 11  ? 38.122  11.912 32.500 1.00 50.06  ? 4   LYS B CD    1 
ATOM   1282 C  CE    . LYS B 2 11  ? 38.370  10.798 33.509 1.00 59.72  ? 4   LYS B CE    1 
ATOM   1283 N  NZ    . LYS B 2 11  ? 37.964  9.463  32.980 1.00 58.94  ? 4   LYS B NZ    1 
ATOM   1284 N  N     . ARG B 2 12  ? 36.567  13.585 27.577 1.00 26.64  ? 5   ARG B N     1 
ATOM   1285 C  CA    . ARG B 2 12  ? 35.856  14.571 26.782 1.00 25.36  ? 5   ARG B CA    1 
ATOM   1286 C  C     . ARG B 2 12  ? 34.343  14.288 26.735 1.00 25.31  ? 5   ARG B C     1 
ATOM   1287 O  O     . ARG B 2 12  ? 33.533  15.196 26.890 1.00 23.41  ? 5   ARG B O     1 
ATOM   1288 C  CB    . ARG B 2 12  ? 36.463  14.685 25.378 1.00 24.78  ? 5   ARG B CB    1 
ATOM   1289 C  CG    . ARG B 2 12  ? 35.608  15.369 24.310 1.00 23.98  ? 5   ARG B CG    1 
ATOM   1290 C  CD    . ARG B 2 12  ? 35.440  16.874 24.509 1.00 24.21  ? 5   ARG B CD    1 
ATOM   1291 N  NE    . ARG B 2 12  ? 34.629  17.434 23.437 1.00 25.18  ? 5   ARG B NE    1 
ATOM   1292 C  CZ    . ARG B 2 12  ? 35.057  18.228 22.444 1.00 25.16  ? 5   ARG B CZ    1 
ATOM   1293 N  NH1   . ARG B 2 12  ? 36.318  18.624 22.344 1.00 24.88  ? 5   ARG B NH1   1 
ATOM   1294 N  NH2   . ARG B 2 12  ? 34.185  18.666 21.558 1.00 26.56  ? 5   ARG B NH2   1 
ATOM   1295 N  N     . ILE B 2 13  ? 33.969  13.024 26.549 1.00 24.28  ? 6   ILE B N     1 
ATOM   1296 C  CA    . ILE B 2 13  ? 32.574  12.650 26.457 1.00 24.22  ? 6   ILE B CA    1 
ATOM   1297 C  C     . ILE B 2 13  ? 31.866  12.862 27.792 1.00 24.26  ? 6   ILE B C     1 
ATOM   1298 O  O     . ILE B 2 13  ? 30.742  13.377 27.825 1.00 23.63  ? 6   ILE B O     1 
ATOM   1299 C  CB    . ILE B 2 13  ? 32.409  11.178 25.978 1.00 24.45  ? 6   ILE B CB    1 
ATOM   1300 C  CG1   . ILE B 2 13  ? 32.878  11.012 24.539 1.00 24.34  ? 6   ILE B CG1   1 
ATOM   1301 C  CG2   . ILE B 2 13  ? 30.945  10.743 26.064 1.00 24.95  ? 6   ILE B CG2   1 
ATOM   1302 C  CD1   . ILE B 2 13  ? 33.232  9.583  24.180 1.00 25.33  ? 6   ILE B CD1   1 
ATOM   1303 N  N     . GLN B 2 14  ? 32.524  12.456 28.883 1.00 26.11  ? 7   GLN B N     1 
ATOM   1304 C  CA    . GLN B 2 14  ? 32.027  12.675 30.238 1.00 28.54  ? 7   GLN B CA    1 
ATOM   1305 C  C     . GLN B 2 14  ? 31.767  14.168 30.519 1.00 29.37  ? 7   GLN B C     1 
ATOM   1306 O  O     . GLN B 2 14  ? 30.738  14.532 31.099 1.00 28.18  ? 7   GLN B O     1 
ATOM   1307 C  CB    . GLN B 2 14  ? 32.990  12.090 31.294 1.00 32.61  ? 7   GLN B CB    1 
ATOM   1308 C  CG    . GLN B 2 14  ? 32.909  10.573 31.470 1.00 38.71  ? 7   GLN B CG    1 
ATOM   1309 C  CD    . GLN B 2 14  ? 34.055  9.967  32.297 1.00 44.47  ? 7   GLN B CD    1 
ATOM   1310 O  OE1   . GLN B 2 14  ? 35.108  10.575 32.486 1.00 49.11  ? 7   GLN B OE1   1 
ATOM   1311 N  NE2   . GLN B 2 14  ? 33.850  8.756  32.771 1.00 47.98  ? 7   GLN B NE2   1 
ATOM   1312 N  N     . LYS B 2 15  ? 32.708  15.014 30.103 1.00 29.19  ? 8   LYS B N     1 
ATOM   1313 C  CA    . LYS B 2 15  ? 32.571  16.467 30.229 1.00 28.68  ? 8   LYS B CA    1 
ATOM   1314 C  C     . LYS B 2 15  ? 31.362  16.994 29.422 1.00 27.18  ? 8   LYS B C     1 
ATOM   1315 O  O     . LYS B 2 15  ? 30.565  17.777 29.943 1.00 28.04  ? 8   LYS B O     1 
ATOM   1316 C  CB    . LYS B 2 15  ? 33.886  17.137 29.827 1.00 30.59  ? 8   LYS B CB    1 
ATOM   1317 C  CG    . LYS B 2 15  ? 33.855  18.624 29.504 1.00 31.80  ? 8   LYS B CG    1 
ATOM   1318 C  CD    . LYS B 2 15  ? 33.515  19.504 30.669 1.00 37.53  ? 8   LYS B CD    1 
ATOM   1319 C  CE    . LYS B 2 15  ? 33.770  20.958 30.286 1.00 39.35  ? 8   LYS B CE    1 
ATOM   1320 N  NZ    . LYS B 2 15  ? 33.114  21.885 31.229 1.00 42.62  ? 8   LYS B NZ    1 
ATOM   1321 N  N     . GLU B 2 16  ? 31.216  16.558 28.176 1.00 25.55  ? 9   GLU B N     1 
ATOM   1322 C  CA    . GLU B 2 16  ? 30.058  16.965 27.373 1.00 25.97  ? 9   GLU B CA    1 
ATOM   1323 C  C     . GLU B 2 16  ? 28.765  16.519 28.021 1.00 25.56  ? 9   GLU B C     1 
ATOM   1324 O  O     . GLU B 2 16  ? 27.812  17.273 28.055 1.00 25.20  ? 9   GLU B O     1 
ATOM   1325 C  CB    . GLU B 2 16  ? 30.109  16.415 25.956 1.00 25.14  ? 9   GLU B CB    1 
ATOM   1326 C  CG    . GLU B 2 16  ? 31.093  17.130 25.044 1.00 26.75  ? 9   GLU B CG    1 
ATOM   1327 C  CD    . GLU B 2 16  ? 30.866  16.837 23.570 1.00 26.39  ? 9   GLU B CD    1 
ATOM   1328 O  OE1   . GLU B 2 16  ? 29.699  16.727 23.123 1.00 26.99  ? 9   GLU B OE1   1 
ATOM   1329 O  OE2   . GLU B 2 16  ? 31.863  16.754 22.845 1.00 28.05  ? 9   GLU B OE2   1 
ATOM   1330 N  N     . LEU B 2 17  ? 28.727  15.284 28.513 1.00 25.71  ? 10  LEU B N     1 
ATOM   1331 C  CA    . LEU B 2 17  ? 27.518  14.770 29.133 1.00 27.62  ? 10  LEU B CA    1 
ATOM   1332 C  C     . LEU B 2 17  ? 27.084  15.619 30.317 1.00 29.49  ? 10  LEU B C     1 
ATOM   1333 O  O     . LEU B 2 17  ? 25.912  15.987 30.422 1.00 29.86  ? 10  LEU B O     1 
ATOM   1334 C  CB    . LEU B 2 17  ? 27.690  13.315 29.567 1.00 27.66  ? 10  LEU B CB    1 
ATOM   1335 C  CG    . LEU B 2 17  ? 26.398  12.685 30.095 1.00 29.48  ? 10  LEU B CG    1 
ATOM   1336 C  CD1   . LEU B 2 17  ? 25.355  12.616 28.988 1.00 28.34  ? 10  LEU B CD1   1 
ATOM   1337 C  CD2   . LEU B 2 17  ? 26.716  11.302 30.617 1.00 31.40  ? 10  LEU B CD2   1 
ATOM   1338 N  N     . SER B 2 18  ? 28.030  15.908 31.215 1.00 28.76  ? 11  SER B N     1 
ATOM   1339 C  CA    . SER B 2 18  ? 27.777  16.688 32.384 1.00 32.11  ? 11  SER B CA    1 
ATOM   1340 C  C     . SER B 2 18  ? 27.243  18.074 32.018 1.00 31.68  ? 11  SER B C     1 
ATOM   1341 O  O     . SER B 2 18  ? 26.270  18.544 32.624 1.00 32.90  ? 11  SER B O     1 
ATOM   1342 C  CB    . SER B 2 18  ? 29.060  16.812 33.227 1.00 34.93  ? 11  SER B CB    1 
ATOM   1343 O  OG    . SER B 2 18  ? 28.840  17.671 34.330 1.00 43.89  ? 11  SER B OG    1 
ATOM   1344 N  N     . ASP B 2 19  ? 27.875  18.703 31.034 1.00 30.22  ? 12  ASP B N     1 
ATOM   1345 C  CA    . ASP B 2 19  ? 27.471  20.034 30.572 1.00 32.75  ? 12  ASP B CA    1 
ATOM   1346 C  C     . ASP B 2 19  ? 26.091  19.980 29.913 1.00 30.12  ? 12  ASP B C     1 
ATOM   1347 O  O     . ASP B 2 19  ? 25.284  20.885 30.134 1.00 31.76  ? 12  ASP B O     1 
ATOM   1348 C  CB    . ASP B 2 19  ? 28.465  20.633 29.572 1.00 31.98  ? 12  ASP B CB    1 
ATOM   1349 C  CG    . ASP B 2 19  ? 29.831  20.980 30.191 1.00 37.95  ? 12  ASP B CG    1 
ATOM   1350 O  OD1   . ASP B 2 19  ? 29.953  21.143 31.417 1.00 38.09  ? 12  ASP B OD1   1 
ATOM   1351 O  OD2   . ASP B 2 19  ? 30.802  21.099 29.416 1.00 42.20  ? 12  ASP B OD2   1 
ATOM   1352 N  N     . LEU B 2 20  ? 25.820  18.926 29.137 1.00 27.85  ? 13  LEU B N     1 
ATOM   1353 C  CA    . LEU B 2 20  ? 24.531  18.795 28.432 1.00 27.99  ? 13  LEU B CA    1 
ATOM   1354 C  C     . LEU B 2 20  ? 23.392  18.577 29.440 1.00 31.48  ? 13  LEU B C     1 
ATOM   1355 O  O     . LEU B 2 20  ? 22.381  19.290 29.425 1.00 31.97  ? 13  LEU B O     1 
ATOM   1356 C  CB    . LEU B 2 20  ? 24.579  17.678 27.366 1.00 27.80  ? 13  LEU B CB    1 
ATOM   1357 C  CG    . LEU B 2 20  ? 23.335  17.417 26.498 1.00 28.56  ? 13  LEU B CG    1 
ATOM   1358 C  CD1   . LEU B 2 20  ? 23.707  16.783 25.176 1.00 29.68  ? 13  LEU B CD1   1 
ATOM   1359 C  CD2   . LEU B 2 20  ? 22.297  16.549 27.210 1.00 31.08  ? 13  LEU B CD2   1 
ATOM   1360 N  N     . GLN B 2 21  ? 23.579  17.643 30.364 1.00 30.59  ? 14  GLN B N     1 
ATOM   1361 C  CA    . GLN B 2 21  ? 22.500  17.288 31.286 1.00 34.85  ? 14  GLN B CA    1 
ATOM   1362 C  C     . GLN B 2 21  ? 22.223  18.414 32.282 1.00 38.77  ? 14  GLN B C     1 
ATOM   1363 O  O     . GLN B 2 21  ? 21.092  18.589 32.728 1.00 42.78  ? 14  GLN B O     1 
ATOM   1364 C  CB    . GLN B 2 21  ? 22.786  15.937 31.945 1.00 32.38  ? 14  GLN B CB    1 
ATOM   1365 C  CG    . GLN B 2 21  ? 22.842  14.840 30.891 1.00 29.27  ? 14  GLN B CG    1 
ATOM   1366 C  CD    . GLN B 2 21  ? 22.798  13.436 31.464 1.00 30.89  ? 14  GLN B CD    1 
ATOM   1367 O  OE1   . GLN B 2 21  ? 23.323  13.180 32.542 1.00 33.34  ? 14  GLN B OE1   1 
ATOM   1368 N  NE2   . GLN B 2 21  ? 22.161  12.517 30.731 1.00 29.80  ? 14  GLN B NE2   1 
ATOM   1369 N  N     . ARG B 2 22  ? 23.238  19.224 32.554 1.00 39.08  ? 15  ARG B N     1 
ATOM   1370 C  CA    . ARG B 2 22  ? 23.085  20.450 33.329 1.00 41.15  ? 15  ARG B CA    1 
ATOM   1371 C  C     . ARG B 2 22  ? 22.298  21.589 32.624 1.00 41.58  ? 15  ARG B C     1 
ATOM   1372 O  O     . ARG B 2 22  ? 21.484  22.273 33.264 1.00 42.15  ? 15  ARG B O     1 
ATOM   1373 C  CB    . ARG B 2 22  ? 24.473  20.968 33.724 1.00 45.52  ? 15  ARG B CB    1 
ATOM   1374 C  CG    . ARG B 2 22  ? 24.475  22.250 34.544 1.00 57.64  ? 15  ARG B CG    1 
ATOM   1375 C  CD    . ARG B 2 22  ? 25.886  22.776 34.790 1.00 64.25  ? 15  ARG B CD    1 
ATOM   1376 N  NE    . ARG B 2 22  ? 26.670  21.898 35.664 1.00 72.64  ? 15  ARG B NE    1 
ATOM   1377 C  CZ    . ARG B 2 22  ? 27.672  21.101 35.279 1.00 77.52  ? 15  ARG B CZ    1 
ATOM   1378 N  NH1   . ARG B 2 22  ? 28.069  21.035 34.009 1.00 72.00  ? 15  ARG B NH1   1 
ATOM   1379 N  NH2   . ARG B 2 22  ? 28.296  20.356 36.188 1.00 81.38  ? 15  ARG B NH2   1 
ATOM   1380 N  N     . ASP B 2 23  ? 22.599  21.842 31.352 1.00 40.13  ? 16  ASP B N     1 
ATOM   1381 C  CA    . ASP B 2 23  ? 21.936  22.903 30.569 1.00 40.98  ? 16  ASP B CA    1 
ATOM   1382 C  C     . ASP B 2 23  ? 21.558  22.328 29.208 1.00 34.24  ? 16  ASP B C     1 
ATOM   1383 O  O     . ASP B 2 23  ? 22.242  22.551 28.220 1.00 32.78  ? 16  ASP B O     1 
ATOM   1384 C  CB    . ASP B 2 23  ? 22.854  24.132 30.397 1.00 41.85  ? 16  ASP B CB    1 
ATOM   1385 C  CG    . ASP B 2 23  ? 23.153  24.841 31.710 1.00 50.97  ? 16  ASP B CG    1 
ATOM   1386 O  OD1   . ASP B 2 23  ? 22.206  25.281 32.399 1.00 50.67  ? 16  ASP B OD1   1 
ATOM   1387 O  OD2   . ASP B 2 23  ? 24.346  24.985 32.055 1.00 53.23  ? 16  ASP B OD2   1 
ATOM   1388 N  N     . PRO B 2 24  ? 20.475  21.543 29.155 1.00 33.77  ? 17  PRO B N     1 
ATOM   1389 C  CA    . PRO B 2 24  ? 20.182  20.811 27.921 1.00 32.21  ? 17  PRO B CA    1 
ATOM   1390 C  C     . PRO B 2 24  ? 19.736  21.742 26.813 1.00 31.34  ? 17  PRO B C     1 
ATOM   1391 O  O     . PRO B 2 24  ? 19.140  22.779 27.084 1.00 31.29  ? 17  PRO B O     1 
ATOM   1392 C  CB    . PRO B 2 24  ? 19.059  19.843 28.302 1.00 33.75  ? 17  PRO B CB    1 
ATOM   1393 C  CG    . PRO B 2 24  ? 18.665  20.167 29.676 1.00 35.21  ? 17  PRO B CG    1 
ATOM   1394 C  CD    . PRO B 2 24  ? 19.547  21.236 30.253 1.00 36.68  ? 17  PRO B CD    1 
ATOM   1395 N  N     . PRO B 2 25  ? 20.057  21.397 25.579 1.00 29.77  ? 18  PRO B N     1 
ATOM   1396 C  CA    . PRO B 2 25  ? 19.607  22.245 24.496 1.00 29.91  ? 18  PRO B CA    1 
ATOM   1397 C  C     . PRO B 2 25  ? 18.076  22.220 24.345 1.00 30.60  ? 18  PRO B C     1 
ATOM   1398 O  O     . PRO B 2 25  ? 17.430  21.189 24.566 1.00 27.62  ? 18  PRO B O     1 
ATOM   1399 C  CB    . PRO B 2 25  ? 20.307  21.665 23.272 1.00 32.59  ? 18  PRO B CB    1 
ATOM   1400 C  CG    . PRO B 2 25  ? 20.754  20.292 23.643 1.00 29.05  ? 18  PRO B CG    1 
ATOM   1401 C  CD    . PRO B 2 25  ? 20.605  20.110 25.119 1.00 28.59  ? 18  PRO B CD    1 
ATOM   1402 N  N     . ALA B 2 26  ? 17.506  23.353 23.966 1.00 29.08  ? 19  ALA B N     1 
ATOM   1403 C  CA    . ALA B 2 26  ? 16.073  23.428 23.714 1.00 31.15  ? 19  ALA B CA    1 
ATOM   1404 C  C     . ALA B 2 26  ? 15.581  22.307 22.789 1.00 26.53  ? 19  ALA B C     1 
ATOM   1405 O  O     . ALA B 2 26  ? 16.236  21.925 21.833 1.00 26.01  ? 19  ALA B O     1 
ATOM   1406 C  CB    . ALA B 2 26  ? 15.707  24.799 23.152 1.00 33.28  ? 19  ALA B CB    1 
ATOM   1407 N  N     . HIS B 2 27  ? 14.425  21.755 23.127 1.00 27.65  ? 20  HIS B N     1 
ATOM   1408 C  CA    . HIS B 2 27  ? 13.763  20.704 22.353 1.00 27.81  ? 20  HIS B CA    1 
ATOM   1409 C  C     . HIS B 2 27  ? 14.419  19.334 22.400 1.00 26.84  ? 20  HIS B C     1 
ATOM   1410 O  O     . HIS B 2 27  ? 13.923  18.406 21.743 1.00 24.92  ? 20  HIS B O     1 
ATOM   1411 C  CB    . HIS B 2 27  ? 13.559  21.126 20.879 1.00 29.50  ? 20  HIS B CB    1 
ATOM   1412 C  CG    . HIS B 2 27  ? 12.991  22.499 20.731 1.00 32.39  ? 20  HIS B CG    1 
ATOM   1413 N  ND1   . HIS B 2 27  ? 11.829  22.891 21.358 1.00 37.90  ? 20  HIS B ND1   1 
ATOM   1414 C  CD2   . HIS B 2 27  ? 13.475  23.603 20.113 1.00 34.24  ? 20  HIS B CD2   1 
ATOM   1415 C  CE1   . HIS B 2 27  ? 11.596  24.166 21.098 1.00 35.78  ? 20  HIS B CE1   1 
ATOM   1416 N  NE2   . HIS B 2 27  ? 12.577  24.619 20.338 1.00 34.82  ? 20  HIS B NE2   1 
ATOM   1417 N  N     . CYS B 2 28  ? 15.506  19.186 23.161 1.00 26.23  ? 21  CYS B N     1 
ATOM   1418 C  CA    . CYS B 2 28  ? 16.346  17.991 23.078 1.00 27.92  ? 21  CYS B CA    1 
ATOM   1419 C  C     . CYS B 2 28  ? 16.590  17.328 24.435 1.00 29.24  ? 21  CYS B C     1 
ATOM   1420 O  O     . CYS B 2 28  ? 16.532  17.961 25.481 1.00 29.40  ? 21  CYS B O     1 
ATOM   1421 C  CB    . CYS B 2 28  ? 17.697  18.318 22.416 1.00 27.58  ? 21  CYS B CB    1 
ATOM   1422 S  SG    . CYS B 2 28  ? 17.578  19.073 20.781 1.00 30.65  ? 21  CYS B SG    1 
ATOM   1423 N  N     . SER B 2 29  ? 16.857  16.026 24.386 1.00 29.60  ? 22  SER B N     1 
ATOM   1424 C  CA    . SER B 2 29  ? 17.236  15.215 25.550 1.00 29.36  ? 22  SER B CA    1 
ATOM   1425 C  C     . SER B 2 29  ? 18.293  14.245 25.043 1.00 28.77  ? 22  SER B C     1 
ATOM   1426 O  O     . SER B 2 29  ? 18.243  13.843 23.883 1.00 24.72  ? 22  SER B O     1 
ATOM   1427 C  CB    . SER B 2 29  ? 16.047  14.436 26.096 1.00 31.55  ? 22  SER B CB    1 
ATOM   1428 O  OG    . SER B 2 29  ? 16.377  13.588 27.203 1.00 32.30  ? 22  SER B OG    1 
ATOM   1429 N  N     . ALA B 2 30  ? 19.285  13.945 25.873 1.00 26.24  ? 23  ALA B N     1 
ATOM   1430 C  CA    . ALA B 2 30  ? 20.290  12.955 25.520 1.00 26.82  ? 23  ALA B CA    1 
ATOM   1431 C  C     . ALA B 2 30  ? 20.908  12.352 26.774 1.00 28.16  ? 23  ALA B C     1 
ATOM   1432 O  O     . ALA B 2 30  ? 20.913  12.961 27.859 1.00 26.97  ? 23  ALA B O     1 
ATOM   1433 C  CB    . ALA B 2 30  ? 21.361  13.542 24.620 1.00 26.71  ? 23  ALA B CB    1 
ATOM   1434 N  N     . GLY B 2 31  ? 21.403  11.133 26.617 1.00 26.38  ? 24  GLY B N     1 
ATOM   1435 C  CA    . GLY B 2 31  ? 22.027  10.415 27.697 1.00 27.85  ? 24  GLY B CA    1 
ATOM   1436 C  C     . GLY B 2 31  ? 22.639  9.096  27.214 1.00 27.70  ? 24  GLY B C     1 
ATOM   1437 O  O     . GLY B 2 31  ? 22.288  8.597  26.150 1.00 24.92  ? 24  GLY B O     1 
ATOM   1438 N  N     . PRO B 2 32  ? 23.565  8.537  28.000 1.00 30.15  ? 25  PRO B N     1 
ATOM   1439 C  CA    . PRO B 2 32  ? 24.189  7.271  27.642 1.00 31.96  ? 25  PRO B CA    1 
ATOM   1440 C  C     . PRO B 2 32  ? 23.226  6.084  27.702 1.00 33.96  ? 25  PRO B C     1 
ATOM   1441 O  O     . PRO B 2 32  ? 22.214  6.117  28.401 1.00 35.14  ? 25  PRO B O     1 
ATOM   1442 C  CB    . PRO B 2 32  ? 25.284  7.125  28.690 1.00 32.18  ? 25  PRO B CB    1 
ATOM   1443 C  CG    . PRO B 2 32  ? 24.757  7.851  29.884 1.00 33.53  ? 25  PRO B CG    1 
ATOM   1444 C  CD    . PRO B 2 32  ? 24.074  9.044  29.292 1.00 31.40  ? 25  PRO B CD    1 
ATOM   1445 N  N     . VAL B 2 33  ? 23.568  5.033  26.976 1.00 36.71  ? 26  VAL B N     1 
ATOM   1446 C  CA    . VAL B 2 33  ? 22.845  3.784  27.034 1.00 39.47  ? 26  VAL B CA    1 
ATOM   1447 C  C     . VAL B 2 33  ? 23.457  2.979  28.168 1.00 46.22  ? 26  VAL B C     1 
ATOM   1448 O  O     . VAL B 2 33  ? 24.550  2.432  28.028 1.00 48.61  ? 26  VAL B O     1 
ATOM   1449 C  CB    . VAL B 2 33  ? 22.981  3.006  25.715 1.00 40.62  ? 26  VAL B CB    1 
ATOM   1450 C  CG1   . VAL B 2 33  ? 22.263  1.659  25.800 1.00 45.66  ? 26  VAL B CG1   1 
ATOM   1451 C  CG2   . VAL B 2 33  ? 22.462  3.831  24.556 1.00 37.24  ? 26  VAL B CG2   1 
ATOM   1452 N  N     . GLY B 2 34  ? 22.772  2.933  29.304 1.00 48.79  ? 27  GLY B N     1 
ATOM   1453 C  CA    . GLY B 2 34  ? 23.312  2.275  30.480 1.00 54.51  ? 27  GLY B CA    1 
ATOM   1454 C  C     . GLY B 2 34  ? 24.603  2.934  30.940 1.00 54.27  ? 27  GLY B C     1 
ATOM   1455 O  O     . GLY B 2 34  ? 24.692  4.160  31.007 1.00 52.54  ? 27  GLY B O     1 
ATOM   1456 N  N     . ASP B 2 35  ? 25.610  2.118  31.234 1.00 53.04  ? 28  ASP B N     1 
ATOM   1457 C  CA    . ASP B 2 35  ? 26.898  2.619  31.727 1.00 53.93  ? 28  ASP B CA    1 
ATOM   1458 C  C     . ASP B 2 35  ? 27.900  2.921  30.613 1.00 48.51  ? 28  ASP B C     1 
ATOM   1459 O  O     . ASP B 2 35  ? 29.065  3.215  30.888 1.00 48.71  ? 28  ASP B O     1 
ATOM   1460 C  CB    . ASP B 2 35  ? 27.526  1.603  32.703 1.00 57.85  ? 28  ASP B CB    1 
ATOM   1461 C  CG    . ASP B 2 35  ? 26.717  1.436  33.989 1.00 69.74  ? 28  ASP B CG    1 
ATOM   1462 O  OD1   . ASP B 2 35  ? 25.738  2.192  34.192 1.00 75.08  ? 28  ASP B OD1   1 
ATOM   1463 O  OD2   . ASP B 2 35  ? 27.062  0.542  34.803 1.00 74.70  ? 28  ASP B OD2   1 
ATOM   1464 N  N     . ASP B 2 36  ? 27.468  2.857  29.360 1.00 46.39  ? 29  ASP B N     1 
ATOM   1465 C  CA    . ASP B 2 36  ? 28.399  2.970  28.237 1.00 45.50  ? 29  ASP B CA    1 
ATOM   1466 C  C     . ASP B 2 36  ? 28.422  4.386  27.670 1.00 40.53  ? 29  ASP B C     1 
ATOM   1467 O  O     . ASP B 2 36  ? 27.525  4.785  26.921 1.00 39.16  ? 29  ASP B O     1 
ATOM   1468 C  CB    . ASP B 2 36  ? 28.015  1.969  27.158 1.00 47.80  ? 29  ASP B CB    1 
ATOM   1469 C  CG    . ASP B 2 36  ? 28.917  2.035  25.942 1.00 51.26  ? 29  ASP B CG    1 
ATOM   1470 O  OD1   . ASP B 2 36  ? 30.026  2.625  25.992 1.00 46.63  ? 29  ASP B OD1   1 
ATOM   1471 O  OD2   . ASP B 2 36  ? 28.496  1.462  24.921 1.00 55.24  ? 29  ASP B OD2   1 
ATOM   1472 N  N     . LEU B 2 37  ? 29.462  5.144  27.994 1.00 36.40  ? 30  LEU B N     1 
ATOM   1473 C  CA    . LEU B 2 37  ? 29.481  6.559  27.569 1.00 37.07  ? 30  LEU B CA    1 
ATOM   1474 C  C     . LEU B 2 37  ? 29.672  6.749  26.069 1.00 31.25  ? 30  LEU B C     1 
ATOM   1475 O  O     . LEU B 2 37  ? 29.430  7.829  25.566 1.00 27.94  ? 30  LEU B O     1 
ATOM   1476 C  CB    . LEU B 2 37  ? 30.546  7.358  28.331 1.00 39.80  ? 30  LEU B CB    1 
ATOM   1477 C  CG    . LEU B 2 37  ? 30.197  7.798  29.753 1.00 46.05  ? 30  LEU B CG    1 
ATOM   1478 C  CD1   . LEU B 2 37  ? 29.104  8.855  29.750 1.00 47.14  ? 30  LEU B CD1   1 
ATOM   1479 C  CD2   . LEU B 2 37  ? 29.783  6.619  30.623 1.00 54.18  ? 30  LEU B CD2   1 
ATOM   1480 N  N     . PHE B 2 38  ? 30.125  5.731  25.345 1.00 30.56  ? 31  PHE B N     1 
ATOM   1481 C  CA    . PHE B 2 38  ? 30.350  5.895  23.904 1.00 28.73  ? 31  PHE B CA    1 
ATOM   1482 C  C     . PHE B 2 38  ? 29.079  5.741  23.046 1.00 28.32  ? 31  PHE B C     1 
ATOM   1483 O  O     . PHE B 2 38  ? 29.098  6.068  21.854 1.00 26.44  ? 31  PHE B O     1 
ATOM   1484 C  CB    . PHE B 2 38  ? 31.476  4.983  23.418 1.00 32.45  ? 31  PHE B CB    1 
ATOM   1485 C  CG    . PHE B 2 38  ? 32.851  5.466  23.794 1.00 33.22  ? 31  PHE B CG    1 
ATOM   1486 C  CD1   . PHE B 2 38  ? 33.335  5.287  25.088 1.00 37.47  ? 31  PHE B CD1   1 
ATOM   1487 C  CD2   . PHE B 2 38  ? 33.668  6.080  22.863 1.00 33.04  ? 31  PHE B CD2   1 
ATOM   1488 C  CE1   . PHE B 2 38  ? 34.610  5.734  25.442 1.00 39.33  ? 31  PHE B CE1   1 
ATOM   1489 C  CE2   . PHE B 2 38  ? 34.934  6.518  23.204 1.00 35.69  ? 31  PHE B CE2   1 
ATOM   1490 C  CZ    . PHE B 2 38  ? 35.408  6.347  24.499 1.00 37.12  ? 31  PHE B CZ    1 
ATOM   1491 N  N     . HIS B 2 39  ? 27.979  5.274  23.646 1.00 28.01  ? 32  HIS B N     1 
ATOM   1492 C  CA    . HIS B 2 39  ? 26.691  5.154  22.953 1.00 28.38  ? 32  HIS B CA    1 
ATOM   1493 C  C     . HIS B 2 39  ? 25.670  5.980  23.706 1.00 27.29  ? 32  HIS B C     1 
ATOM   1494 O  O     . HIS B 2 39  ? 25.476  5.742  24.884 1.00 31.24  ? 32  HIS B O     1 
ATOM   1495 C  CB    . HIS B 2 39  ? 26.219  3.697  22.935 1.00 33.03  ? 32  HIS B CB    1 
ATOM   1496 C  CG    . HIS B 2 39  ? 27.036  2.796  22.065 1.00 35.68  ? 32  HIS B CG    1 
ATOM   1497 N  ND1   . HIS B 2 39  ? 28.107  2.071  22.542 1.00 41.51  ? 32  HIS B ND1   1 
ATOM   1498 C  CD2   . HIS B 2 39  ? 26.924  2.476  20.753 1.00 37.62  ? 32  HIS B CD2   1 
ATOM   1499 C  CE1   . HIS B 2 39  ? 28.623  1.347  21.565 1.00 43.26  ? 32  HIS B CE1   1 
ATOM   1500 N  NE2   . HIS B 2 39  ? 27.927  1.581  20.467 1.00 40.93  ? 32  HIS B NE2   1 
ATOM   1501 N  N     . TRP B 2 40  ? 25.064  6.971  23.066 1.00 26.93  ? 33  TRP B N     1 
ATOM   1502 C  CA    . TRP B 2 40  ? 24.002  7.725  23.654 1.00 24.45  ? 33  TRP B CA    1 
ATOM   1503 C  C     . TRP B 2 40  ? 22.765  7.581  22.848 1.00 23.50  ? 33  TRP B C     1 
ATOM   1504 O  O     . TRP B 2 40  ? 22.833  7.342  21.677 1.00 23.31  ? 33  TRP B O     1 
ATOM   1505 C  CB    . TRP B 2 40  ? 24.314  9.228  23.700 1.00 23.46  ? 33  TRP B CB    1 
ATOM   1506 C  CG    . TRP B 2 40  ? 25.469  9.730  24.505 1.00 24.68  ? 33  TRP B CG    1 
ATOM   1507 C  CD1   . TRP B 2 40  ? 26.423  9.022  25.182 1.00 27.07  ? 33  TRP B CD1   1 
ATOM   1508 C  CD2   . TRP B 2 40  ? 25.836  11.114 24.707 1.00 25.82  ? 33  TRP B CD2   1 
ATOM   1509 N  NE1   . TRP B 2 40  ? 27.306  9.838  25.769 1.00 26.15  ? 33  TRP B NE1   1 
ATOM   1510 C  CE2   . TRP B 2 40  ? 27.015  11.104 25.525 1.00 25.85  ? 33  TRP B CE2   1 
ATOM   1511 C  CE3   . TRP B 2 40  ? 25.313  12.312 24.306 1.00 25.95  ? 33  TRP B CE3   1 
ATOM   1512 C  CZ2   . TRP B 2 40  ? 27.650  12.259 25.895 1.00 25.30  ? 33  TRP B CZ2   1 
ATOM   1513 C  CZ3   . TRP B 2 40  ? 25.961  13.475 24.683 1.00 28.57  ? 33  TRP B CZ3   1 
ATOM   1514 C  CH2   . TRP B 2 40  ? 27.087  13.447 25.475 1.00 28.97  ? 33  TRP B CH2   1 
ATOM   1515 N  N     . GLN B 2 41  ? 21.626  7.805  23.477 1.00 24.80  ? 34  GLN B N     1 
ATOM   1516 C  CA    . GLN B 2 41  ? 20.388  8.045  22.798 1.00 27.90  ? 34  GLN B CA    1 
ATOM   1517 C  C     . GLN B 2 41  ? 20.028  9.507  22.928 1.00 25.89  ? 34  GLN B C     1 
ATOM   1518 O  O     . GLN B 2 41  ? 20.353  10.111 23.888 1.00 25.48  ? 34  GLN B O     1 
ATOM   1519 C  CB    . GLN B 2 41  ? 19.243  7.221  23.345 1.00 35.59  ? 34  GLN B CB    1 
ATOM   1520 C  CG    . GLN B 2 41  ? 18.803  6.103  22.415 1.00 53.10  ? 34  GLN B CG    1 
ATOM   1521 C  CD    . GLN B 2 41  ? 17.457  6.291  21.640 1.00 69.22  ? 34  GLN B CD    1 
ATOM   1522 O  OE1   . GLN B 2 41  ? 17.366  5.944  20.460 1.00 63.40  ? 34  GLN B OE1   1 
ATOM   1523 N  NE2   . GLN B 2 41  ? 16.424  6.802  22.317 1.00 65.86  ? 34  GLN B NE2   1 
ATOM   1524 N  N     . ALA B 2 42  ? 19.356  10.015 21.937 1.00 25.15  ? 35  ALA B N     1 
ATOM   1525 C  CA    . ALA B 2 42  ? 18.853  11.365 21.971 1.00 26.46  ? 35  ALA B CA    1 
ATOM   1526 C  C     . ALA B 2 42  ? 17.423  11.403 21.475 1.00 25.39  ? 35  ALA B C     1 
ATOM   1527 O  O     . ALA B 2 42  ? 16.992  10.556 20.757 1.00 25.63  ? 35  ALA B O     1 
ATOM   1528 C  CB    . ALA B 2 42  ? 19.720  12.286 21.155 1.00 24.93  ? 35  ALA B CB    1 
ATOM   1529 N  N     . THR B 2 43  ? 16.730  12.448 21.882 1.00 25.60  ? 36  THR B N     1 
ATOM   1530 C  CA    . THR B 2 43  ? 15.350  12.695 21.517 1.00 24.70  ? 36  THR B CA    1 
ATOM   1531 C  C     . THR B 2 43  ? 15.218  14.175 21.126 1.00 27.11  ? 36  THR B C     1 
ATOM   1532 O  O     . THR B 2 43  ? 15.717  15.059 21.831 1.00 24.34  ? 36  THR B O     1 
ATOM   1533 C  CB    . THR B 2 43  ? 14.390  12.402 22.692 1.00 27.72  ? 36  THR B CB    1 
ATOM   1534 O  OG1   . THR B 2 43  ? 14.510  11.037 23.088 1.00 28.65  ? 36  THR B OG1   1 
ATOM   1535 C  CG2   . THR B 2 43  ? 12.940  12.657 22.303 1.00 29.40  ? 36  THR B CG2   1 
ATOM   1536 N  N     . ILE B 2 44  ? 14.545  14.419 20.004 1.00 25.19  ? 37  ILE B N     1 
ATOM   1537 C  CA    . ILE B 2 44  ? 14.196  15.759 19.568 1.00 25.06  ? 37  ILE B CA    1 
ATOM   1538 C  C     . ILE B 2 44  ? 12.671  15.828 19.471 1.00 26.01  ? 37  ILE B C     1 
ATOM   1539 O  O     . ILE B 2 44  ? 12.033  14.972 18.849 1.00 26.25  ? 37  ILE B O     1 
ATOM   1540 C  CB    . ILE B 2 44  ? 14.855  16.124 18.226 1.00 24.37  ? 37  ILE B CB    1 
ATOM   1541 C  CG1   . ILE B 2 44  ? 16.380  16.111 18.385 1.00 23.74  ? 37  ILE B CG1   1 
ATOM   1542 C  CG2   . ILE B 2 44  ? 14.338  17.488 17.716 1.00 25.44  ? 37  ILE B CG2   1 
ATOM   1543 C  CD1   . ILE B 2 44  ? 17.150  16.032 17.089 1.00 27.66  ? 37  ILE B CD1   1 
ATOM   1544 N  N     . MET B 2 45  ? 12.095  16.818 20.129 1.00 25.41  ? 38  MET B N     1 
ATOM   1545 C  CA    . MET B 2 45  ? 10.682  17.143 19.958 1.00 31.36  ? 38  MET B CA    1 
ATOM   1546 C  C     . MET B 2 45  ? 10.640  18.187 18.833 1.00 32.23  ? 38  MET B C     1 
ATOM   1547 O  O     . MET B 2 45  ? 11.358  19.212 18.894 1.00 31.83  ? 38  MET B O     1 
ATOM   1548 C  CB    . MET B 2 45  ? 10.087  17.671 21.266 1.00 34.91  ? 38  MET B CB    1 
ATOM   1549 C  CG    . MET B 2 45  ? 8.653   18.191 21.209 1.00 45.52  ? 38  MET B CG    1 
ATOM   1550 S  SD    . MET B 2 45  ? 7.377   16.919 21.353 1.00 56.27  ? 38  MET B SD    1 
ATOM   1551 C  CE    . MET B 2 45  ? 7.506   16.437 23.066 1.00 42.82  ? 38  MET B CE    1 
ATOM   1552 N  N     . GLY B 2 46  ? 9.828   17.923 17.810 1.00 28.31  ? 39  GLY B N     1 
ATOM   1553 C  CA    . GLY B 2 46  ? 9.784   18.772 16.623 1.00 27.87  ? 39  GLY B CA    1 
ATOM   1554 C  C     . GLY B 2 46  ? 9.540   20.225 17.021 1.00 28.96  ? 39  GLY B C     1 
ATOM   1555 O  O     . GLY B 2 46  ? 8.606   20.507 17.739 1.00 30.38  ? 39  GLY B O     1 
ATOM   1556 N  N     . PRO B 2 47  ? 10.397  21.152 16.564 1.00 30.15  ? 40  PRO B N     1 
ATOM   1557 C  CA    . PRO B 2 47  ? 10.290  22.548 16.973 1.00 33.46  ? 40  PRO B CA    1 
ATOM   1558 C  C     . PRO B 2 47  ? 8.935   23.179 16.682 1.00 34.11  ? 40  PRO B C     1 
ATOM   1559 O  O     . PRO B 2 47  ? 8.340   22.913 15.637 1.00 32.64  ? 40  PRO B O     1 
ATOM   1560 C  CB    . PRO B 2 47  ? 11.369  23.239 16.139 1.00 34.83  ? 40  PRO B CB    1 
ATOM   1561 C  CG    . PRO B 2 47  ? 12.359  22.182 15.862 1.00 34.04  ? 40  PRO B CG    1 
ATOM   1562 C  CD    . PRO B 2 47  ? 11.597  20.906 15.747 1.00 31.15  ? 40  PRO B CD    1 
ATOM   1563 N  N     . PRO B 2 48  ? 8.451   24.026 17.589 1.00 39.07  ? 41  PRO B N     1 
ATOM   1564 C  CA    . PRO B 2 48  ? 7.218   24.735 17.303 1.00 43.50  ? 41  PRO B CA    1 
ATOM   1565 C  C     . PRO B 2 48  ? 7.305   25.479 15.958 1.00 43.86  ? 41  PRO B C     1 
ATOM   1566 O  O     . PRO B 2 48  ? 8.379   25.914 15.551 1.00 43.44  ? 41  PRO B O     1 
ATOM   1567 C  CB    . PRO B 2 48  ? 7.091   25.714 18.467 1.00 47.39  ? 41  PRO B CB    1 
ATOM   1568 C  CG    . PRO B 2 48  ? 7.936   25.154 19.551 1.00 45.89  ? 41  PRO B CG    1 
ATOM   1569 C  CD    . PRO B 2 48  ? 9.054   24.448 18.864 1.00 40.94  ? 41  PRO B CD    1 
ATOM   1570 N  N     . ASP B 2 49  ? 6.201   25.559 15.241 1.00 46.45  ? 42  ASP B N     1 
ATOM   1571 C  CA    . ASP B 2 49  ? 6.197   26.269 13.955 1.00 55.55  ? 42  ASP B CA    1 
ATOM   1572 C  C     . ASP B 2 49  ? 6.937   25.539 12.821 1.00 47.70  ? 42  ASP B C     1 
ATOM   1573 O  O     . ASP B 2 49  ? 6.792   25.937 11.666 1.00 53.26  ? 42  ASP B O     1 
ATOM   1574 C  CB    . ASP B 2 49  ? 6.780   27.694 14.089 1.00 59.56  ? 42  ASP B CB    1 
ATOM   1575 C  CG    . ASP B 2 49  ? 6.140   28.499 15.213 1.00 65.05  ? 42  ASP B CG    1 
ATOM   1576 O  OD1   . ASP B 2 49  ? 4.893   28.570 15.280 1.00 63.41  ? 42  ASP B OD1   1 
ATOM   1577 O  OD2   . ASP B 2 49  ? 6.895   29.084 16.021 1.00 74.35  ? 42  ASP B OD2   1 
ATOM   1578 N  N     . SER B 2 50  ? 7.724   24.502 13.120 1.00 41.70  ? 43  SER B N     1 
ATOM   1579 C  CA    . SER B 2 50  ? 8.223   23.615 12.061 1.00 37.83  ? 43  SER B CA    1 
ATOM   1580 C  C     . SER B 2 50  ? 7.063   22.742 11.602 1.00 38.05  ? 43  SER B C     1 
ATOM   1581 O  O     . SER B 2 50  ? 6.025   22.642 12.290 1.00 37.31  ? 43  SER B O     1 
ATOM   1582 C  CB    . SER B 2 50  ? 9.440   22.770 12.499 1.00 34.81  ? 43  SER B CB    1 
ATOM   1583 O  OG    . SER B 2 50  ? 9.095   21.555 13.166 1.00 32.76  ? 43  SER B OG    1 
ATOM   1584 N  N     . ALA B 2 51  ? 7.222   22.126 10.435 1.00 36.02  ? 44  ALA B N     1 
ATOM   1585 C  CA    . ALA B 2 51  ? 6.251   21.153 9.953  1.00 36.47  ? 44  ALA B CA    1 
ATOM   1586 C  C     . ALA B 2 51  ? 6.293   19.864 10.786 1.00 34.38  ? 44  ALA B C     1 
ATOM   1587 O  O     . ALA B 2 51  ? 5.400   19.011 10.669 1.00 36.15  ? 44  ALA B O     1 
ATOM   1588 C  CB    . ALA B 2 51  ? 6.506   20.838 8.488  1.00 38.15  ? 44  ALA B CB    1 
ATOM   1589 N  N     . TYR B 2 52  ? 7.322   19.731 11.619 1.00 29.59  ? 45  TYR B N     1 
ATOM   1590 C  CA    . TYR B 2 52  ? 7.520   18.554 12.460 1.00 27.66  ? 45  TYR B CA    1 
ATOM   1591 C  C     . TYR B 2 52  ? 7.037   18.744 13.887 1.00 27.56  ? 45  TYR B C     1 
ATOM   1592 O  O     . TYR B 2 52  ? 7.257   17.885 14.742 1.00 26.87  ? 45  TYR B O     1 
ATOM   1593 C  CB    . TYR B 2 52  ? 8.989   18.195 12.448 1.00 27.77  ? 45  TYR B CB    1 
ATOM   1594 C  CG    . TYR B 2 52  ? 9.493   18.107 11.027 1.00 28.33  ? 45  TYR B CG    1 
ATOM   1595 C  CD1   . TYR B 2 52  ? 9.241   16.981 10.251 1.00 26.20  ? 45  TYR B CD1   1 
ATOM   1596 C  CD2   . TYR B 2 52  ? 10.183  19.173 10.449 1.00 27.87  ? 45  TYR B CD2   1 
ATOM   1597 C  CE1   . TYR B 2 52  ? 9.666   16.910 8.941  1.00 27.68  ? 45  TYR B CE1   1 
ATOM   1598 C  CE2   . TYR B 2 52  ? 10.623  19.110 9.144  1.00 28.12  ? 45  TYR B CE2   1 
ATOM   1599 C  CZ    . TYR B 2 52  ? 10.370  17.981 8.392  1.00 28.44  ? 45  TYR B CZ    1 
ATOM   1600 O  OH    . TYR B 2 52  ? 10.804  17.937 7.096  1.00 30.34  ? 45  TYR B OH    1 
ATOM   1601 N  N     . GLN B 2 53  ? 6.368   19.856 14.150 1.00 29.19  ? 46  GLN B N     1 
ATOM   1602 C  CA    . GLN B 2 53  ? 5.912   20.163 15.509 1.00 30.87  ? 46  GLN B CA    1 
ATOM   1603 C  C     . GLN B 2 53  ? 5.027   19.076 16.089 1.00 29.93  ? 46  GLN B C     1 
ATOM   1604 O  O     . GLN B 2 53  ? 4.114   18.608 15.434 1.00 29.90  ? 46  GLN B O     1 
ATOM   1605 C  CB    . GLN B 2 53  ? 5.168   21.499 15.570 1.00 34.70  ? 46  GLN B CB    1 
ATOM   1606 C  CG    . GLN B 2 53  ? 3.888   21.586 14.786 1.00 37.20  ? 46  GLN B CG    1 
ATOM   1607 C  CD    . GLN B 2 53  ? 3.152   22.893 15.022 1.00 44.52  ? 46  GLN B CD    1 
ATOM   1608 O  OE1   . GLN B 2 53  ? 3.700   23.845 15.579 1.00 50.83  ? 46  GLN B OE1   1 
ATOM   1609 N  NE2   . GLN B 2 53  ? 1.897   22.933 14.621 1.00 46.56  ? 46  GLN B NE2   1 
ATOM   1610 N  N     . GLY B 2 54  ? 5.313   18.706 17.329 1.00 30.28  ? 47  GLY B N     1 
ATOM   1611 C  CA    . GLY B 2 54  ? 4.558   17.671 18.026 1.00 31.68  ? 47  GLY B CA    1 
ATOM   1612 C  C     . GLY B 2 54  ? 5.096   16.271 17.760 1.00 29.64  ? 47  GLY B C     1 
ATOM   1613 O  O     . GLY B 2 54  ? 4.597   15.307 18.326 1.00 31.73  ? 47  GLY B O     1 
ATOM   1614 N  N     . GLY B 2 55  ? 6.074   16.159 16.869 1.00 29.15  ? 48  GLY B N     1 
ATOM   1615 C  CA    . GLY B 2 55  ? 6.700   14.881 16.558 1.00 28.46  ? 48  GLY B CA    1 
ATOM   1616 C  C     . GLY B 2 55  ? 7.771   14.581 17.585 1.00 28.29  ? 48  GLY B C     1 
ATOM   1617 O  O     . GLY B 2 55  ? 8.401   15.497 18.100 1.00 27.04  ? 48  GLY B O     1 
ATOM   1618 N  N     . VAL B 2 56  ? 7.915   13.307 17.949 1.00 28.62  ? 49  VAL B N     1 
ATOM   1619 C  CA    . VAL B 2 56  ? 9.008   12.857 18.807 1.00 28.31  ? 49  VAL B CA    1 
ATOM   1620 C  C     . VAL B 2 56  ? 9.934   12.038 17.931 1.00 28.84  ? 49  VAL B C     1 
ATOM   1621 O  O     . VAL B 2 56  ? 9.515   11.041 17.361 1.00 27.65  ? 49  VAL B O     1 
ATOM   1622 C  CB    . VAL B 2 56  ? 8.526   11.958 19.959 1.00 31.17  ? 49  VAL B CB    1 
ATOM   1623 C  CG1   . VAL B 2 56  ? 9.680   11.585 20.875 1.00 31.62  ? 49  VAL B CG1   1 
ATOM   1624 C  CG2   . VAL B 2 56  ? 7.408   12.631 20.742 1.00 31.36  ? 49  VAL B CG2   1 
ATOM   1625 N  N     . PHE B 2 57  ? 11.187  12.462 17.841 1.00 24.80  ? 50  PHE B N     1 
ATOM   1626 C  CA    . PHE B 2 57  ? 12.176  11.807 17.020 1.00 26.25  ? 50  PHE B CA    1 
ATOM   1627 C  C     . PHE B 2 57  ? 13.327  11.242 17.862 1.00 24.55  ? 50  PHE B C     1 
ATOM   1628 O  O     . PHE B 2 57  ? 13.918  11.929 18.673 1.00 25.65  ? 50  PHE B O     1 
ATOM   1629 C  CB    . PHE B 2 57  ? 12.675  12.793 15.966 1.00 24.34  ? 50  PHE B CB    1 
ATOM   1630 C  CG    . PHE B 2 57  ? 11.569  13.347 15.097 1.00 25.31  ? 50  PHE B CG    1 
ATOM   1631 C  CD1   . PHE B 2 57  ? 11.172  12.678 13.965 1.00 25.50  ? 50  PHE B CD1   1 
ATOM   1632 C  CD2   . PHE B 2 57  ? 10.953  14.567 15.401 1.00 26.50  ? 50  PHE B CD2   1 
ATOM   1633 C  CE1   . PHE B 2 57  ? 10.160  13.173 13.159 1.00 26.59  ? 50  PHE B CE1   1 
ATOM   1634 C  CE2   . PHE B 2 57  ? 9.945   15.079 14.596 1.00 27.01  ? 50  PHE B CE2   1 
ATOM   1635 C  CZ    . PHE B 2 57  ? 9.559   14.389 13.461 1.00 27.37  ? 50  PHE B CZ    1 
ATOM   1636 N  N     . PHE B 2 58  ? 13.609  9.963  17.666 1.00 25.40  ? 51  PHE B N     1 
ATOM   1637 C  CA    . PHE B 2 58  ? 14.650  9.291  18.381 1.00 24.51  ? 51  PHE B CA    1 
ATOM   1638 C  C     . PHE B 2 58  ? 15.869  9.127  17.480 1.00 23.43  ? 51  PHE B C     1 
ATOM   1639 O  O     . PHE B 2 58  ? 15.756  8.768  16.298 1.00 24.70  ? 51  PHE B O     1 
ATOM   1640 C  CB    . PHE B 2 58  ? 14.116  7.932  18.891 1.00 28.08  ? 51  PHE B CB    1 
ATOM   1641 C  CG    . PHE B 2 58  ? 12.928  8.057  19.810 1.00 29.46  ? 51  PHE B CG    1 
ATOM   1642 C  CD1   . PHE B 2 58  ? 13.048  8.698  21.033 1.00 30.25  ? 51  PHE B CD1   1 
ATOM   1643 C  CD2   . PHE B 2 58  ? 11.696  7.509  19.463 1.00 33.29  ? 51  PHE B CD2   1 
ATOM   1644 C  CE1   . PHE B 2 58  ? 11.962  8.801  21.894 1.00 31.80  ? 51  PHE B CE1   1 
ATOM   1645 C  CE2   . PHE B 2 58  ? 10.601  7.618  20.308 1.00 37.30  ? 51  PHE B CE2   1 
ATOM   1646 C  CZ    . PHE B 2 58  ? 10.737  8.262  21.534 1.00 35.13  ? 51  PHE B CZ    1 
ATOM   1647 N  N     . LEU B 2 59  ? 17.032  9.404  18.064 1.00 22.11  ? 52  LEU B N     1 
ATOM   1648 C  CA    . LEU B 2 59  ? 18.315  9.381  17.400 1.00 22.06  ? 52  LEU B CA    1 
ATOM   1649 C  C     . LEU B 2 59  ? 19.310  8.549  18.204 1.00 22.90  ? 52  LEU B C     1 
ATOM   1650 O  O     . LEU B 2 59  ? 19.162  8.378  19.415 1.00 23.50  ? 52  LEU B O     1 
ATOM   1651 C  CB    . LEU B 2 59  ? 18.898  10.795 17.270 1.00 21.69  ? 52  LEU B CB    1 
ATOM   1652 C  CG    . LEU B 2 59  ? 18.287  11.788 16.272 1.00 24.05  ? 52  LEU B CG    1 
ATOM   1653 C  CD1   . LEU B 2 59  ? 16.989  12.364 16.827 1.00 28.06  ? 52  LEU B CD1   1 
ATOM   1654 C  CD2   . LEU B 2 59  ? 19.224  12.941 16.000 1.00 26.65  ? 52  LEU B CD2   1 
ATOM   1655 N  N     . THR B 2 60  ? 20.335  8.060  17.512 1.00 24.56  ? 53  THR B N     1 
ATOM   1656 C  CA    . THR B 2 60  ? 21.466  7.356  18.134 1.00 26.26  ? 53  THR B CA    1 
ATOM   1657 C  C     . THR B 2 60  ? 22.726  8.151  17.895 1.00 23.03  ? 53  THR B C     1 
ATOM   1658 O  O     . THR B 2 60  ? 22.891  8.744  16.833 1.00 23.65  ? 53  THR B O     1 
ATOM   1659 C  CB    . THR B 2 60  ? 21.643  5.906  17.574 1.00 27.17  ? 53  THR B CB    1 
ATOM   1660 O  OG1   . THR B 2 60  ? 21.848  5.914  16.146 1.00 26.49  ? 53  THR B OG1   1 
ATOM   1661 C  CG2   . THR B 2 60  ? 20.448  5.090  17.863 1.00 33.13  ? 53  THR B CG2   1 
ATOM   1662 N  N     . VAL B 2 61  ? 23.592  8.164  18.908 1.00 22.88  ? 54  VAL B N     1 
ATOM   1663 C  CA    . VAL B 2 61  ? 24.903  8.783  18.864 1.00 22.82  ? 54  VAL B CA    1 
ATOM   1664 C  C     . VAL B 2 61  ? 25.983  7.762  19.238 1.00 22.40  ? 54  VAL B C     1 
ATOM   1665 O  O     . VAL B 2 61  ? 25.946  7.169  20.328 1.00 21.72  ? 54  VAL B O     1 
ATOM   1666 C  CB    . VAL B 2 61  ? 25.006  9.969  19.848 1.00 22.31  ? 54  VAL B CB    1 
ATOM   1667 C  CG1   . VAL B 2 61  ? 26.338  10.686 19.688 1.00 24.26  ? 54  VAL B CG1   1 
ATOM   1668 C  CG2   . VAL B 2 61  ? 23.859  10.946 19.639 1.00 20.67  ? 54  VAL B CG2   1 
ATOM   1669 N  N     . HIS B 2 62  ? 26.962  7.610  18.352 1.00 22.63  ? 55  HIS B N     1 
ATOM   1670 C  CA    . HIS B 2 62  ? 28.144  6.826  18.655 1.00 26.03  ? 55  HIS B CA    1 
ATOM   1671 C  C     . HIS B 2 62  ? 29.431  7.640  18.473 1.00 24.23  ? 55  HIS B C     1 
ATOM   1672 O  O     . HIS B 2 62  ? 29.647  8.290  17.467 1.00 23.89  ? 55  HIS B O     1 
ATOM   1673 C  CB    . HIS B 2 62  ? 28.167  5.511  17.852 1.00 27.42  ? 55  HIS B CB    1 
ATOM   1674 C  CG    . HIS B 2 62  ? 29.367  4.669  18.139 1.00 31.66  ? 55  HIS B CG    1 
ATOM   1675 N  ND1   . HIS B 2 62  ? 29.605  4.092  19.374 1.00 34.47  ? 55  HIS B ND1   1 
ATOM   1676 C  CD2   . HIS B 2 62  ? 30.406  4.308  17.354 1.00 33.00  ? 55  HIS B CD2   1 
ATOM   1677 C  CE1   . HIS B 2 62  ? 30.737  3.415  19.329 1.00 33.67  ? 55  HIS B CE1   1 
ATOM   1678 N  NE2   . HIS B 2 62  ? 31.239  3.520  18.111 1.00 35.19  ? 55  HIS B NE2   1 
ATOM   1679 N  N     . PHE B 2 63  ? 30.272  7.596  19.498 1.00 25.46  ? 56  PHE B N     1 
ATOM   1680 C  CA    . PHE B 2 63  ? 31.515  8.335  19.535 1.00 24.42  ? 56  PHE B CA    1 
ATOM   1681 C  C     . PHE B 2 63  ? 32.634  7.429  19.065 1.00 28.06  ? 56  PHE B C     1 
ATOM   1682 O  O     . PHE B 2 63  ? 32.656  6.233  19.402 1.00 27.33  ? 56  PHE B O     1 
ATOM   1683 C  CB    . PHE B 2 63  ? 31.789  8.840  20.965 1.00 24.80  ? 56  PHE B CB    1 
ATOM   1684 C  CG    . PHE B 2 63  ? 30.802  9.871  21.457 1.00 22.96  ? 56  PHE B CG    1 
ATOM   1685 C  CD1   . PHE B 2 63  ? 30.992  11.215 21.190 1.00 24.82  ? 56  PHE B CD1   1 
ATOM   1686 C  CD2   . PHE B 2 63  ? 29.714  9.509  22.216 1.00 24.61  ? 56  PHE B CD2   1 
ATOM   1687 C  CE1   . PHE B 2 63  ? 30.108  12.166 21.662 1.00 21.73  ? 56  PHE B CE1   1 
ATOM   1688 C  CE2   . PHE B 2 63  ? 28.810  10.437 22.681 1.00 23.11  ? 56  PHE B CE2   1 
ATOM   1689 C  CZ    . PHE B 2 63  ? 29.007  11.785 22.426 1.00 23.09  ? 56  PHE B CZ    1 
ATOM   1690 N  N     . PRO B 2 64  ? 33.538  7.980  18.251 1.00 27.92  ? 57  PRO B N     1 
ATOM   1691 C  CA    . PRO B 2 64  ? 34.736  7.313  17.847 1.00 30.29  ? 57  PRO B CA    1 
ATOM   1692 C  C     . PRO B 2 64  ? 35.772  7.318  18.985 1.00 30.85  ? 57  PRO B C     1 
ATOM   1693 O  O     . PRO B 2 64  ? 35.760  8.191  19.898 1.00 29.34  ? 57  PRO B O     1 
ATOM   1694 C  CB    . PRO B 2 64  ? 35.185  8.152  16.653 1.00 30.17  ? 57  PRO B CB    1 
ATOM   1695 C  CG    . PRO B 2 64  ? 34.837  9.551  17.077 1.00 27.32  ? 57  PRO B CG    1 
ATOM   1696 C  CD    . PRO B 2 64  ? 33.518  9.392  17.787 1.00 27.27  ? 57  PRO B CD    1 
ATOM   1697 N  N     . THR B 2 65  ? 36.656  6.334  18.932 1.00 32.12  ? 58  THR B N     1 
ATOM   1698 C  CA    . THR B 2 65  ? 37.685  6.162  19.949 1.00 34.24  ? 58  THR B CA    1 
ATOM   1699 C  C     . THR B 2 65  ? 38.690  7.309  20.002 1.00 34.39  ? 58  THR B C     1 
ATOM   1700 O  O     . THR B 2 65  ? 39.336  7.501  21.021 1.00 35.23  ? 58  THR B O     1 
ATOM   1701 C  CB    . THR B 2 65  ? 38.457  4.848  19.754 1.00 37.15  ? 58  THR B CB    1 
ATOM   1702 O  OG1   . THR B 2 65  ? 39.124  4.854  18.489 1.00 40.34  ? 58  THR B OG1   1 
ATOM   1703 C  CG2   . THR B 2 65  ? 37.520  3.657  19.837 1.00 37.22  ? 58  THR B CG2   1 
ATOM   1704 N  N     . ASP B 2 66  ? 38.840  8.042  18.897 1.00 34.70  ? 59  ASP B N     1 
ATOM   1705 C  CA    . ASP B 2 66  ? 39.682  9.244  18.867 1.00 34.28  ? 59  ASP B CA    1 
ATOM   1706 C  C     . ASP B 2 66  ? 38.889  10.558 18.908 1.00 32.93  ? 59  ASP B C     1 
ATOM   1707 O  O     . ASP B 2 66  ? 39.367  11.588 18.445 1.00 33.20  ? 59  ASP B O     1 
ATOM   1708 C  CB    . ASP B 2 66  ? 40.644  9.205  17.661 1.00 36.40  ? 59  ASP B CB    1 
ATOM   1709 C  CG    . ASP B 2 66  ? 39.923  9.155  16.319 1.00 36.49  ? 59  ASP B CG    1 
ATOM   1710 O  OD1   . ASP B 2 66  ? 38.708  8.880  16.268 1.00 35.86  ? 59  ASP B OD1   1 
ATOM   1711 O  OD2   . ASP B 2 66  ? 40.581  9.384  15.296 1.00 37.89  ? 59  ASP B OD2   1 
ATOM   1712 N  N     . TYR B 2 67  ? 37.695  10.531 19.495 1.00 32.91  ? 60  TYR B N     1 
ATOM   1713 C  CA    . TYR B 2 67  ? 36.938  11.750 19.739 1.00 29.84  ? 60  TYR B CA    1 
ATOM   1714 C  C     . TYR B 2 67  ? 37.774  12.700 20.603 1.00 30.30  ? 60  TYR B C     1 
ATOM   1715 O  O     . TYR B 2 67  ? 38.408  12.277 21.569 1.00 30.27  ? 60  TYR B O     1 
ATOM   1716 C  CB    . TYR B 2 67  ? 35.598  11.394 20.404 1.00 30.51  ? 60  TYR B CB    1 
ATOM   1717 C  CG    . TYR B 2 67  ? 34.570  12.501 20.467 1.00 25.83  ? 60  TYR B CG    1 
ATOM   1718 C  CD1   . TYR B 2 67  ? 34.244  13.107 21.665 1.00 26.30  ? 60  TYR B CD1   1 
ATOM   1719 C  CD2   . TYR B 2 67  ? 33.924  12.932 19.329 1.00 26.40  ? 60  TYR B CD2   1 
ATOM   1720 C  CE1   . TYR B 2 67  ? 33.315  14.142 21.724 1.00 25.95  ? 60  TYR B CE1   1 
ATOM   1721 C  CE2   . TYR B 2 67  ? 32.967  13.932 19.382 1.00 26.99  ? 60  TYR B CE2   1 
ATOM   1722 C  CZ    . TYR B 2 67  ? 32.675  14.536 20.577 1.00 25.94  ? 60  TYR B CZ    1 
ATOM   1723 O  OH    . TYR B 2 67  ? 31.738  15.526 20.586 1.00 26.21  ? 60  TYR B OH    1 
ATOM   1724 N  N     . PRO B 2 68  ? 37.757  14.009 20.300 1.00 28.92  ? 61  PRO B N     1 
ATOM   1725 C  CA    . PRO B 2 68  ? 36.917  14.781 19.379 1.00 28.10  ? 61  PRO B CA    1 
ATOM   1726 C  C     . PRO B 2 68  ? 37.540  15.069 18.008 1.00 29.24  ? 61  PRO B C     1 
ATOM   1727 O  O     . PRO B 2 68  ? 37.137  16.042 17.343 1.00 29.12  ? 61  PRO B O     1 
ATOM   1728 C  CB    . PRO B 2 68  ? 36.763  16.091 20.140 1.00 28.41  ? 61  PRO B CB    1 
ATOM   1729 C  CG    . PRO B 2 68  ? 38.121  16.271 20.736 1.00 31.08  ? 61  PRO B CG    1 
ATOM   1730 C  CD    . PRO B 2 68  ? 38.567  14.898 21.147 1.00 29.96  ? 61  PRO B CD    1 
ATOM   1731 N  N     . PHE B 2 69  ? 38.520  14.270 17.596 1.00 28.31  ? 62  PHE B N     1 
ATOM   1732 C  CA    . PHE B 2 69  ? 39.220  14.500 16.334 1.00 30.27  ? 62  PHE B CA    1 
ATOM   1733 C  C     . PHE B 2 69  ? 38.375  14.085 15.136 1.00 30.22  ? 62  PHE B C     1 
ATOM   1734 O  O     . PHE B 2 69  ? 38.631  14.511 14.017 1.00 31.06  ? 62  PHE B O     1 
ATOM   1735 C  CB    . PHE B 2 69  ? 40.567  13.782 16.305 1.00 31.98  ? 62  PHE B CB    1 
ATOM   1736 C  CG    . PHE B 2 69  ? 41.636  14.487 17.078 1.00 33.60  ? 62  PHE B CG    1 
ATOM   1737 C  CD1   . PHE B 2 69  ? 41.721  14.350 18.450 1.00 32.49  ? 62  PHE B CD1   1 
ATOM   1738 C  CD2   . PHE B 2 69  ? 42.562  15.296 16.429 1.00 36.09  ? 62  PHE B CD2   1 
ATOM   1739 C  CE1   . PHE B 2 69  ? 42.697  15.010 19.165 1.00 33.03  ? 62  PHE B CE1   1 
ATOM   1740 C  CE2   . PHE B 2 69  ? 43.553  15.952 17.132 1.00 37.18  ? 62  PHE B CE2   1 
ATOM   1741 C  CZ    . PHE B 2 69  ? 43.619  15.806 18.511 1.00 36.62  ? 62  PHE B CZ    1 
ATOM   1742 N  N     . LYS B 2 70  ? 37.384  13.238 15.374 1.00 30.71  ? 63  LYS B N     1 
ATOM   1743 C  CA    . LYS B 2 70  ? 36.403  12.883 14.351 1.00 31.77  ? 63  LYS B CA    1 
ATOM   1744 C  C     . LYS B 2 70  ? 35.040  13.136 14.942 1.00 29.39  ? 63  LYS B C     1 
ATOM   1745 O  O     . LYS B 2 70  ? 34.886  13.144 16.164 1.00 27.84  ? 63  LYS B O     1 
ATOM   1746 C  CB    . LYS B 2 70  ? 36.562  11.413 13.946 1.00 34.50  ? 63  LYS B CB    1 
ATOM   1747 C  CG    . LYS B 2 70  ? 37.758  11.171 13.049 1.00 41.10  ? 63  LYS B CG    1 
ATOM   1748 C  CD    . LYS B 2 70  ? 37.834  9.722  12.612 1.00 50.06  ? 63  LYS B CD    1 
ATOM   1749 C  CE    . LYS B 2 70  ? 39.080  9.468  11.773 1.00 57.28  ? 63  LYS B CE    1 
ATOM   1750 N  NZ    . LYS B 2 70  ? 40.344  9.444  12.571 1.00 56.96  ? 63  LYS B NZ    1 
ATOM   1751 N  N     . PRO B 2 71  ? 34.038  13.379 14.086 1.00 28.15  ? 64  PRO B N     1 
ATOM   1752 C  CA    . PRO B 2 71  ? 32.707  13.616 14.605 1.00 26.71  ? 64  PRO B CA    1 
ATOM   1753 C  C     . PRO B 2 71  ? 32.021  12.355 15.140 1.00 26.28  ? 64  PRO B C     1 
ATOM   1754 O  O     . PRO B 2 71  ? 32.380  11.254 14.756 1.00 28.17  ? 64  PRO B O     1 
ATOM   1755 C  CB    . PRO B 2 71  ? 31.946  14.127 13.380 1.00 26.92  ? 64  PRO B CB    1 
ATOM   1756 C  CG    . PRO B 2 71  ? 32.633  13.534 12.233 1.00 30.05  ? 64  PRO B CG    1 
ATOM   1757 C  CD    . PRO B 2 71  ? 34.080  13.430 12.615 1.00 31.27  ? 64  PRO B CD    1 
ATOM   1758 N  N     . PRO B 2 72  ? 31.011  12.531 15.990 1.00 26.16  ? 65  PRO B N     1 
ATOM   1759 C  CA    . PRO B 2 72  ? 30.172  11.404 16.325 1.00 25.78  ? 65  PRO B CA    1 
ATOM   1760 C  C     . PRO B 2 72  ? 29.328  10.993 15.124 1.00 26.69  ? 65  PRO B C     1 
ATOM   1761 O  O     . PRO B 2 72  ? 29.106  11.799 14.227 1.00 26.97  ? 65  PRO B O     1 
ATOM   1762 C  CB    . PRO B 2 72  ? 29.294  11.938 17.434 1.00 27.48  ? 65  PRO B CB    1 
ATOM   1763 C  CG    . PRO B 2 72  ? 29.214  13.412 17.202 1.00 26.98  ? 65  PRO B CG    1 
ATOM   1764 C  CD    . PRO B 2 72  ? 30.405  13.813 16.387 1.00 25.22  ? 65  PRO B CD    1 
ATOM   1765 N  N     . LYS B 2 73  ? 28.921  9.730  15.108 1.00 27.17  ? 66  LYS B N     1 
ATOM   1766 C  CA    . LYS B 2 73  ? 27.989  9.210  14.137 1.00 29.54  ? 66  LYS B CA    1 
ATOM   1767 C  C     . LYS B 2 73  ? 26.598  9.340  14.740 1.00 26.15  ? 66  LYS B C     1 
ATOM   1768 O  O     . LYS B 2 73  ? 26.314  8.758  15.778 1.00 26.48  ? 66  LYS B O     1 
ATOM   1769 C  CB    . LYS B 2 73  ? 28.290  7.747  13.886 1.00 32.84  ? 66  LYS B CB    1 
ATOM   1770 C  CG    . LYS B 2 73  ? 27.603  7.140  12.676 1.00 41.08  ? 66  LYS B CG    1 
ATOM   1771 C  CD    . LYS B 2 73  ? 28.490  7.260  11.445 1.00 50.61  ? 66  LYS B CD    1 
ATOM   1772 C  CE    . LYS B 2 73  ? 29.705  6.327  11.485 1.00 49.18  ? 66  LYS B CE    1 
ATOM   1773 N  NZ    . LYS B 2 73  ? 30.816  6.817  10.619 1.00 41.08  ? 66  LYS B NZ    1 
ATOM   1774 N  N     . ILE B 2 74  ? 25.742  10.106 14.086 1.00 24.53  ? 67  ILE B N     1 
ATOM   1775 C  CA    . ILE B 2 74  ? 24.414  10.377 14.594 1.00 24.64  ? 67  ILE B CA    1 
ATOM   1776 C  C     . ILE B 2 74  ? 23.415  10.009 13.532 1.00 25.60  ? 67  ILE B C     1 
ATOM   1777 O  O     . ILE B 2 74  ? 23.559  10.421 12.379 1.00 27.64  ? 67  ILE B O     1 
ATOM   1778 C  CB    . ILE B 2 74  ? 24.224  11.854 14.996 1.00 24.30  ? 67  ILE B CB    1 
ATOM   1779 C  CG1   . ILE B 2 74  ? 25.268  12.273 16.050 1.00 25.52  ? 67  ILE B CG1   1 
ATOM   1780 C  CG2   . ILE B 2 74  ? 22.799  12.046 15.503 1.00 25.26  ? 67  ILE B CG2   1 
ATOM   1781 C  CD1   . ILE B 2 74  ? 25.140  13.697 16.588 1.00 25.48  ? 67  ILE B CD1   1 
ATOM   1782 N  N     . ALA B 2 75  ? 22.403  9.224  13.911 1.00 25.96  ? 68  ALA B N     1 
ATOM   1783 C  CA    . ALA B 2 75  ? 21.384  8.801  12.957 1.00 27.51  ? 68  ALA B CA    1 
ATOM   1784 C  C     . ALA B 2 75  ? 19.997  8.941  13.554 1.00 24.54  ? 68  ALA B C     1 
ATOM   1785 O  O     . ALA B 2 75  ? 19.819  8.782  14.758 1.00 23.34  ? 68  ALA B O     1 
ATOM   1786 C  CB    . ALA B 2 75  ? 21.637  7.359  12.537 1.00 27.79  ? 68  ALA B CB    1 
ATOM   1787 N  N     . PHE B 2 76  ? 19.016  9.236  12.709 1.00 24.54  ? 69  PHE B N     1 
ATOM   1788 C  CA    . PHE B 2 76  ? 17.609  9.099  13.097 1.00 25.07  ? 69  PHE B CA    1 
ATOM   1789 C  C     . PHE B 2 76  ? 17.179  7.654  13.098 1.00 28.53  ? 69  PHE B C     1 
ATOM   1790 O  O     . PHE B 2 76  ? 17.470  6.928  12.175 1.00 30.78  ? 69  PHE B O     1 
ATOM   1791 C  CB    . PHE B 2 76  ? 16.701  9.811  12.124 1.00 26.87  ? 69  PHE B CB    1 
ATOM   1792 C  CG    . PHE B 2 76  ? 16.500  11.270 12.443 1.00 25.24  ? 69  PHE B CG    1 
ATOM   1793 C  CD1   . PHE B 2 76  ? 17.534  12.162 12.284 1.00 23.94  ? 69  PHE B CD1   1 
ATOM   1794 C  CD2   . PHE B 2 76  ? 15.274  11.738 12.869 1.00 26.01  ? 69  PHE B CD2   1 
ATOM   1795 C  CE1   . PHE B 2 76  ? 17.343  13.520 12.567 1.00 23.36  ? 69  PHE B CE1   1 
ATOM   1796 C  CE2   . PHE B 2 76  ? 15.077  13.084 13.141 1.00 26.26  ? 69  PHE B CE2   1 
ATOM   1797 C  CZ    . PHE B 2 76  ? 16.129  13.964 13.020 1.00 22.31  ? 69  PHE B CZ    1 
ATOM   1798 N  N     . THR B 2 77  ? 16.471  7.258  14.131 1.00 27.95  ? 70  THR B N     1 
ATOM   1799 C  CA    . THR B 2 77  ? 15.780  5.989  14.144 1.00 30.07  ? 70  THR B CA    1 
ATOM   1800 C  C     . THR B 2 77  ? 14.286  6.166  13.843 1.00 31.29  ? 70  THR B C     1 
ATOM   1801 O  O     . THR B 2 77  ? 13.595  5.202  13.509 1.00 29.71  ? 70  THR B O     1 
ATOM   1802 C  CB    . THR B 2 77  ? 16.000  5.291  15.478 1.00 33.56  ? 70  THR B CB    1 
ATOM   1803 O  OG1   . THR B 2 77  ? 15.555  6.136  16.531 1.00 36.11  ? 70  THR B OG1   1 
ATOM   1804 C  CG2   . THR B 2 77  ? 17.477  5.016  15.671 1.00 34.27  ? 70  THR B CG2   1 
ATOM   1805 N  N     . THR B 2 78  ? 13.791  7.393  13.920 1.00 27.91  ? 71  THR B N     1 
ATOM   1806 C  CA    . THR B 2 78  ? 12.389  7.661  13.604 1.00 27.29  ? 71  THR B CA    1 
ATOM   1807 C  C     . THR B 2 78  ? 12.266  8.106  12.153 1.00 28.68  ? 71  THR B C     1 
ATOM   1808 O  O     . THR B 2 78  ? 13.042  8.952  11.686 1.00 27.60  ? 71  THR B O     1 
ATOM   1809 C  CB    . THR B 2 78  ? 11.799  8.749  14.530 1.00 26.02  ? 71  THR B CB    1 
ATOM   1810 O  OG1   . THR B 2 78  ? 11.960  8.364  15.898 1.00 25.01  ? 71  THR B OG1   1 
ATOM   1811 C  CG2   . THR B 2 78  ? 10.322  8.945  14.250 1.00 26.71  ? 71  THR B CG2   1 
ATOM   1812 N  N     . LYS B 2 79  ? 11.305  7.530  11.434 1.00 29.51  ? 72  LYS B N     1 
ATOM   1813 C  CA    . LYS B 2 79  ? 11.028  7.931  10.049 1.00 31.60  ? 72  LYS B CA    1 
ATOM   1814 C  C     . LYS B 2 79  ? 10.616  9.421  9.957  1.00 30.58  ? 72  LYS B C     1 
ATOM   1815 O  O     . LYS B 2 79  ? 9.847   9.921  10.778 1.00 29.28  ? 72  LYS B O     1 
ATOM   1816 C  CB    . LYS B 2 79  ? 9.959   7.025  9.450  1.00 35.97  ? 72  LYS B CB    1 
ATOM   1817 C  CG    . LYS B 2 79  ? 9.726   7.181  7.957  1.00 38.18  ? 72  LYS B CG    1 
ATOM   1818 C  CD    . LYS B 2 79  ? 8.888   6.016  7.424  1.00 40.82  ? 72  LYS B CD    1 
ATOM   1819 C  CE    . LYS B 2 79  ? 8.539   6.191  5.952  1.00 43.21  ? 72  LYS B CE    1 
ATOM   1820 N  NZ    . LYS B 2 79  ? 9.752   6.215  5.080  1.00 44.63  ? 72  LYS B NZ    1 
ATOM   1821 N  N     . ILE B 2 80  ? 11.180  10.123 8.979  1.00 27.86  ? 73  ILE B N     1 
ATOM   1822 C  CA    . ILE B 2 80  ? 10.932  11.536 8.799  1.00 27.26  ? 73  ILE B CA    1 
ATOM   1823 C  C     . ILE B 2 80  ? 10.987  11.899 7.304  1.00 28.53  ? 73  ILE B C     1 
ATOM   1824 O  O     . ILE B 2 80  ? 11.740  11.296 6.530  1.00 30.76  ? 73  ILE B O     1 
ATOM   1825 C  CB    . ILE B 2 80  ? 11.925  12.375 9.654  1.00 27.02  ? 73  ILE B CB    1 
ATOM   1826 C  CG1   . ILE B 2 80  ? 11.596  13.869 9.586  1.00 26.92  ? 73  ILE B CG1   1 
ATOM   1827 C  CG2   . ILE B 2 80  ? 13.365  12.106 9.238  1.00 26.42  ? 73  ILE B CG2   1 
ATOM   1828 C  CD1   . ILE B 2 80  ? 12.396  14.689 10.577 1.00 27.33  ? 73  ILE B CD1   1 
ATOM   1829 N  N     . TYR B 2 81  ? 10.146  12.845 6.902  1.00 28.48  ? 74  TYR B N     1 
ATOM   1830 C  CA    . TYR B 2 81  ? 10.073  13.323 5.527  1.00 30.25  ? 74  TYR B CA    1 
ATOM   1831 C  C     . TYR B 2 81  ? 10.882  14.605 5.467  1.00 29.29  ? 74  TYR B C     1 
ATOM   1832 O  O     . TYR B 2 81  ? 10.462  15.629 6.018  1.00 29.47  ? 74  TYR B O     1 
ATOM   1833 C  CB    . TYR B 2 81  ? 8.622   13.600 5.136  1.00 31.97  ? 74  TYR B CB    1 
ATOM   1834 C  CG    . TYR B 2 81  ? 8.374   13.959 3.699  1.00 33.22  ? 74  TYR B CG    1 
ATOM   1835 C  CD1   . TYR B 2 81  ? 8.350   15.283 3.295  1.00 34.08  ? 74  TYR B CD1   1 
ATOM   1836 C  CD2   . TYR B 2 81  ? 8.137   12.975 2.741  1.00 33.93  ? 74  TYR B CD2   1 
ATOM   1837 C  CE1   . TYR B 2 81  ? 8.115   15.618 1.984  1.00 35.62  ? 74  TYR B CE1   1 
ATOM   1838 C  CE2   . TYR B 2 81  ? 7.901   13.306 1.423  1.00 35.88  ? 74  TYR B CE2   1 
ATOM   1839 C  CZ    . TYR B 2 81  ? 7.895   14.628 1.057  1.00 36.52  ? 74  TYR B CZ    1 
ATOM   1840 O  OH    . TYR B 2 81  ? 7.657   14.988 -0.232 1.00 38.44  ? 74  TYR B OH    1 
ATOM   1841 N  N     . HIS B 2 82  ? 12.044  14.541 4.814  1.00 28.32  ? 75  HIS B N     1 
ATOM   1842 C  CA    . HIS B 2 82  ? 13.034  15.620 4.867  1.00 28.73  ? 75  HIS B CA    1 
ATOM   1843 C  C     . HIS B 2 82  ? 14.093  15.421 3.775  1.00 29.64  ? 75  HIS B C     1 
ATOM   1844 O  O     . HIS B 2 82  ? 14.552  14.308 3.573  1.00 29.60  ? 75  HIS B O     1 
ATOM   1845 C  CB    . HIS B 2 82  ? 13.696  15.632 6.257  1.00 27.35  ? 75  HIS B CB    1 
ATOM   1846 C  CG    . HIS B 2 82  ? 14.383  16.920 6.591  1.00 27.76  ? 75  HIS B CG    1 
ATOM   1847 N  ND1   . HIS B 2 82  ? 15.615  17.259 6.083  1.00 28.97  ? 75  HIS B ND1   1 
ATOM   1848 C  CD2   . HIS B 2 82  ? 14.003  17.959 7.366  1.00 28.29  ? 75  HIS B CD2   1 
ATOM   1849 C  CE1   . HIS B 2 82  ? 15.968  18.450 6.530  1.00 28.91  ? 75  HIS B CE1   1 
ATOM   1850 N  NE2   . HIS B 2 82  ? 15.017  18.885 7.332  1.00 28.73  ? 75  HIS B NE2   1 
ATOM   1851 N  N     . PRO B 2 83  ? 14.506  16.504 3.086  1.00 30.85  ? 76  PRO B N     1 
ATOM   1852 C  CA    . PRO B 2 83  ? 15.481  16.339 2.000  1.00 31.37  ? 76  PRO B CA    1 
ATOM   1853 C  C     . PRO B 2 83  ? 16.885  15.931 2.428  1.00 30.54  ? 76  PRO B C     1 
ATOM   1854 O  O     . PRO B 2 83  ? 17.629  15.403 1.600  1.00 31.90  ? 76  PRO B O     1 
ATOM   1855 C  CB    . PRO B 2 83  ? 15.474  17.703 1.309  1.00 33.01  ? 76  PRO B CB    1 
ATOM   1856 C  CG    . PRO B 2 83  ? 15.072  18.648 2.365  1.00 32.96  ? 76  PRO B CG    1 
ATOM   1857 C  CD    . PRO B 2 83  ? 14.120  17.917 3.263  1.00 31.20  ? 76  PRO B CD    1 
ATOM   1858 N  N     . ASN B 2 84  ? 17.231  16.174 3.695  1.00 28.94  ? 77  ASN B N     1 
ATOM   1859 C  CA    . ASN B 2 84  ? 18.561  15.904 4.243  1.00 28.95  ? 77  ASN B CA    1 
ATOM   1860 C  C     . ASN B 2 84  ? 18.630  14.697 5.161  1.00 28.05  ? 77  ASN B C     1 
ATOM   1861 O  O     . ASN B 2 84  ? 19.661  14.470 5.803  1.00 26.96  ? 77  ASN B O     1 
ATOM   1862 C  CB    . ASN B 2 84  ? 19.063  17.118 5.019  1.00 27.74  ? 77  ASN B CB    1 
ATOM   1863 C  CG    . ASN B 2 84  ? 18.937  18.400 4.231  1.00 29.44  ? 77  ASN B CG    1 
ATOM   1864 O  OD1   . ASN B 2 84  ? 18.281  19.337 4.667  1.00 29.59  ? 77  ASN B OD1   1 
ATOM   1865 N  ND2   . ASN B 2 84  ? 19.547  18.441 3.055  1.00 32.32  ? 77  ASN B ND2   1 
ATOM   1866 N  N     . ILE B 2 85  ? 17.533  13.945 5.250  1.00 29.17  ? 78  ILE B N     1 
ATOM   1867 C  CA    . ILE B 2 85  ? 17.463  12.763 6.110  1.00 27.88  ? 78  ILE B CA    1 
ATOM   1868 C  C     . ILE B 2 85  ? 16.733  11.632 5.392  1.00 28.57  ? 78  ILE B C     1 
ATOM   1869 O  O     . ILE B 2 85  ? 15.537  11.752 5.091  1.00 31.22  ? 78  ILE B O     1 
ATOM   1870 C  CB    . ILE B 2 85  ? 16.725  13.052 7.438  1.00 27.43  ? 78  ILE B CB    1 
ATOM   1871 C  CG1   . ILE B 2 85  ? 17.246  14.318 8.134  1.00 28.36  ? 78  ILE B CG1   1 
ATOM   1872 C  CG2   . ILE B 2 85  ? 16.858  11.863 8.380  1.00 26.82  ? 78  ILE B CG2   1 
ATOM   1873 C  CD1   . ILE B 2 85  ? 16.373  14.783 9.261  1.00 27.53  ? 78  ILE B CD1   1 
ATOM   1874 N  N     . ASN B 2 86  ? 17.416  10.516 5.159  1.00 28.88  ? 79  ASN B N     1 
ATOM   1875 C  CA    . ASN B 2 86  ? 16.830  9.441  4.358  1.00 31.72  ? 79  ASN B CA    1 
ATOM   1876 C  C     . ASN B 2 86  ? 16.229  8.324  5.206  1.00 32.80  ? 79  ASN B C     1 
ATOM   1877 O  O     . ASN B 2 86  ? 16.232  8.408  6.440  1.00 31.45  ? 79  ASN B O     1 
ATOM   1878 C  CB    . ASN B 2 86  ? 17.837  8.904  3.329  1.00 31.98  ? 79  ASN B CB    1 
ATOM   1879 C  CG    . ASN B 2 86  ? 19.024  8.184  3.950  1.00 31.43  ? 79  ASN B CG    1 
ATOM   1880 O  OD1   . ASN B 2 86  ? 19.037  7.813  5.126  1.00 29.23  ? 79  ASN B OD1   1 
ATOM   1881 N  ND2   . ASN B 2 86  ? 20.031  7.971  3.138  1.00 32.87  ? 79  ASN B ND2   1 
ATOM   1882 N  N     . SER B 2 87  ? 15.755  7.273  4.534  1.00 35.53  ? 80  SER B N     1 
ATOM   1883 C  CA    . SER B 2 87  ? 15.055  6.169  5.192  1.00 41.53  ? 80  SER B CA    1 
ATOM   1884 C  C     . SER B 2 87  ? 15.951  5.303  6.082  1.00 43.26  ? 80  SER B C     1 
ATOM   1885 O  O     . SER B 2 87  ? 15.442  4.565  6.924  1.00 43.63  ? 80  SER B O     1 
ATOM   1886 C  CB    . SER B 2 87  ? 14.336  5.296  4.157  1.00 42.53  ? 80  SER B CB    1 
ATOM   1887 O  OG    . SER B 2 87  ? 15.212  4.883  3.118  1.00 43.88  ? 80  SER B OG    1 
ATOM   1888 N  N     . ASN B 2 88  ? 17.265  5.380  5.894  1.00 40.05  ? 81  ASN B N     1 
ATOM   1889 C  CA    . ASN B 2 88  ? 18.201  4.748  6.818  1.00 44.07  ? 81  ASN B CA    1 
ATOM   1890 C  C     . ASN B 2 88  ? 18.490  5.624  8.049  1.00 38.34  ? 81  ASN B C     1 
ATOM   1891 O  O     . ASN B 2 88  ? 19.162  5.198  8.975  1.00 41.75  ? 81  ASN B O     1 
ATOM   1892 C  CB    . ASN B 2 88  ? 19.507  4.389  6.102  1.00 46.02  ? 81  ASN B CB    1 
ATOM   1893 C  CG    . ASN B 2 88  ? 19.324  3.303  5.051  1.00 51.97  ? 81  ASN B CG    1 
ATOM   1894 O  OD1   . ASN B 2 88  ? 18.385  2.496  5.106  1.00 50.55  ? 81  ASN B OD1   1 
ATOM   1895 N  ND2   . ASN B 2 88  ? 20.219  3.287  4.071  1.00 56.31  ? 81  ASN B ND2   1 
ATOM   1896 N  N     . GLY B 2 89  ? 17.987  6.851  8.058  1.00 35.08  ? 82  GLY B N     1 
ATOM   1897 C  CA    . GLY B 2 89  ? 18.226  7.750  9.171  1.00 32.49  ? 82  GLY B CA    1 
ATOM   1898 C  C     . GLY B 2 89  ? 19.506  8.535  9.057  1.00 30.11  ? 82  GLY B C     1 
ATOM   1899 O  O     . GLY B 2 89  ? 19.874  9.236  10.006 1.00 28.10  ? 82  GLY B O     1 
ATOM   1900 N  N     . SER B 2 90  ? 20.180  8.445  7.906  1.00 31.34  ? 83  SER B N     1 
ATOM   1901 C  CA    . SER B 2 90  ? 21.412  9.184  7.699  1.00 32.84  ? 83  SER B CA    1 
ATOM   1902 C  C     . SER B 2 90  ? 21.092  10.668 7.582  1.00 29.11  ? 83  SER B C     1 
ATOM   1903 O  O     . SER B 2 90  ? 20.082  11.049 6.987  1.00 27.82  ? 83  SER B O     1 
ATOM   1904 C  CB    . SER B 2 90  ? 22.146  8.699  6.451  1.00 38.94  ? 83  SER B CB    1 
ATOM   1905 O  OG    . SER B 2 90  ? 22.446  7.317  6.553  1.00 45.34  ? 83  SER B OG    1 
ATOM   1906 N  N     . ILE B 2 91  ? 21.935  11.483 8.197  1.00 28.40  ? 84  ILE B N     1 
ATOM   1907 C  CA    . ILE B 2 91  ? 21.707  12.932 8.300  1.00 28.33  ? 84  ILE B CA    1 
ATOM   1908 C  C     . ILE B 2 91  ? 22.746  13.643 7.447  1.00 27.12  ? 84  ILE B C     1 
ATOM   1909 O  O     . ILE B 2 91  ? 23.940  13.541 7.712  1.00 29.17  ? 84  ILE B O     1 
ATOM   1910 C  CB    . ILE B 2 91  ? 21.837  13.467 9.732  1.00 26.36  ? 84  ILE B CB    1 
ATOM   1911 C  CG1   . ILE B 2 91  ? 20.876  12.756 10.677 1.00 30.04  ? 84  ILE B CG1   1 
ATOM   1912 C  CG2   . ILE B 2 91  ? 21.570  14.980 9.743  1.00 29.04  ? 84  ILE B CG2   1 
ATOM   1913 C  CD1   . ILE B 2 91  ? 21.107  13.096 12.133 1.00 25.49  ? 84  ILE B CD1   1 
ATOM   1914 N  N     . CYS B 2 92  ? 22.289  14.371 6.438  1.00 28.46  ? 85  CYS B N     1 
ATOM   1915 C  CA    . CYS B 2 92  ? 23.171  15.092 5.551  1.00 31.44  ? 85  CYS B CA    1 
ATOM   1916 C  C     . CYS B 2 92  ? 23.413  16.497 6.104  1.00 32.20  ? 85  CYS B C     1 
ATOM   1917 O  O     . CYS B 2 92  ? 22.609  17.384 5.879  1.00 30.79  ? 85  CYS B O     1 
ATOM   1918 C  CB    . CYS B 2 92  ? 22.514  15.188 4.190  1.00 37.43  ? 85  CYS B CB    1 
ATOM   1919 S  SG    . CYS B 2 92  ? 23.661  15.474 2.864  1.00 43.04  ? 85  CYS B SG    1 
ATOM   1920 N  N     . LEU B 2 93  ? 24.517  16.664 6.835  1.00 30.08  ? 86  LEU B N     1 
ATOM   1921 C  CA    . LEU B 2 93  ? 24.844  17.892 7.567  1.00 28.39  ? 86  LEU B CA    1 
ATOM   1922 C  C     . LEU B 2 93  ? 26.374  18.102 7.554  1.00 28.18  ? 86  LEU B C     1 
ATOM   1923 O  O     . LEU B 2 93  ? 27.118  17.210 7.941  1.00 28.08  ? 86  LEU B O     1 
ATOM   1924 C  CB    . LEU B 2 93  ? 24.290  17.789 9.006  1.00 26.26  ? 86  LEU B CB    1 
ATOM   1925 C  CG    . LEU B 2 93  ? 24.538  18.943 9.963  1.00 26.71  ? 86  LEU B CG    1 
ATOM   1926 C  CD1   . LEU B 2 93  ? 23.975  20.242 9.396  1.00 28.59  ? 86  LEU B CD1   1 
ATOM   1927 C  CD2   . LEU B 2 93  ? 23.917  18.644 11.320 1.00 28.69  ? 86  LEU B CD2   1 
ATOM   1928 N  N     . ASP B 2 94  ? 26.848  19.273 7.108  1.00 28.18  ? 87  ASP B N     1 
ATOM   1929 C  CA    . ASP B 2 94  ? 28.294  19.484 6.935  1.00 29.62  ? 87  ASP B CA    1 
ATOM   1930 C  C     . ASP B 2 94  ? 29.124  19.303 8.207  1.00 28.03  ? 87  ASP B C     1 
ATOM   1931 O  O     . ASP B 2 94  ? 30.241  18.808 8.119  1.00 28.80  ? 87  ASP B O     1 
ATOM   1932 C  CB    . ASP B 2 94  ? 28.608  20.827 6.256  1.00 32.17  ? 87  ASP B CB    1 
ATOM   1933 C  CG    . ASP B 2 94  ? 28.178  22.044 7.089  1.00 34.95  ? 87  ASP B CG    1 
ATOM   1934 O  OD1   . ASP B 2 94  ? 27.461  21.897 8.109  1.00 35.98  ? 87  ASP B OD1   1 
ATOM   1935 O  OD2   . ASP B 2 94  ? 28.558  23.168 6.699  1.00 46.67  ? 87  ASP B OD2   1 
ATOM   1936 N  N     . ILE B 2 95  ? 28.591  19.661 9.378  1.00 25.94  ? 88  ILE B N     1 
ATOM   1937 C  CA    . ILE B 2 95  ? 29.367  19.517 10.616 1.00 26.38  ? 88  ILE B CA    1 
ATOM   1938 C  C     . ILE B 2 95  ? 29.411  18.056 11.118 1.00 24.64  ? 88  ILE B C     1 
ATOM   1939 O  O     . ILE B 2 95  ? 30.109  17.761 12.072 1.00 27.79  ? 88  ILE B O     1 
ATOM   1940 C  CB    . ILE B 2 95  ? 28.911  20.479 11.736 1.00 26.40  ? 88  ILE B CB    1 
ATOM   1941 C  CG1   . ILE B 2 95  ? 27.441  20.239 12.125 1.00 27.83  ? 88  ILE B CG1   1 
ATOM   1942 C  CG2   . ILE B 2 95  ? 29.111  21.931 11.307 1.00 28.76  ? 88  ILE B CG2   1 
ATOM   1943 C  CD1   . ILE B 2 95  ? 27.033  20.938 13.397 1.00 28.62  ? 88  ILE B CD1   1 
ATOM   1944 N  N     . LEU B 2 96  ? 28.675  17.148 10.485 1.00 25.63  ? 89  LEU B N     1 
ATOM   1945 C  CA    . LEU B 2 96  ? 28.891  15.701 10.716 1.00 26.53  ? 89  LEU B CA    1 
ATOM   1946 C  C     . LEU B 2 96  ? 29.832  15.079 9.679  1.00 27.83  ? 89  LEU B C     1 
ATOM   1947 O  O     . LEU B 2 96  ? 30.069  13.879 9.729  1.00 30.19  ? 89  LEU B O     1 
ATOM   1948 C  CB    . LEU B 2 96  ? 27.562  14.928 10.767 1.00 28.07  ? 89  LEU B CB    1 
ATOM   1949 C  CG    . LEU B 2 96  ? 26.636  15.245 11.959 1.00 25.68  ? 89  LEU B CG    1 
ATOM   1950 C  CD1   . LEU B 2 96  ? 25.262  14.614 11.824 1.00 25.76  ? 89  LEU B CD1   1 
ATOM   1951 C  CD2   . LEU B 2 96  ? 27.270  14.875 13.285 1.00 25.49  ? 89  LEU B CD2   1 
ATOM   1952 N  N     . ARG B 2 97  ? 30.347  15.895 8.753  1.00 30.52  ? 90  ARG B N     1 
ATOM   1953 C  CA    . ARG B 2 97  ? 31.313  15.469 7.728  1.00 34.58  ? 90  ARG B CA    1 
ATOM   1954 C  C     . ARG B 2 97  ? 32.574  16.321 7.891  1.00 36.52  ? 90  ARG B C     1 
ATOM   1955 O  O     . ARG B 2 97  ? 33.074  16.468 9.003  1.00 37.07  ? 90  ARG B O     1 
ATOM   1956 C  CB    . ARG B 2 97  ? 30.744  15.662 6.310  1.00 33.78  ? 90  ARG B CB    1 
ATOM   1957 C  CG    . ARG B 2 97  ? 29.335  15.223 6.089  1.00 34.94  ? 90  ARG B CG    1 
ATOM   1958 C  CD    . ARG B 2 97  ? 28.979  15.334 4.615  1.00 35.71  ? 90  ARG B CD    1 
ATOM   1959 N  NE    . ARG B 2 97  ? 28.983  16.722 4.110  1.00 35.95  ? 90  ARG B NE    1 
ATOM   1960 C  CZ    . ARG B 2 97  ? 27.898  17.428 3.804  1.00 34.28  ? 90  ARG B CZ    1 
ATOM   1961 N  NH1   . ARG B 2 97  ? 26.685  16.900 3.915  1.00 34.37  ? 90  ARG B NH1   1 
ATOM   1962 N  NH2   . ARG B 2 97  ? 28.014  18.669 3.361  1.00 35.40  ? 90  ARG B NH2   1 
ATOM   1963 N  N     . SER B 2 98  ? 33.057  16.907 6.792  1.00 36.25  ? 91  SER B N     1 
ATOM   1964 C  CA    . SER B 2 98  ? 34.317  17.632 6.759  1.00 38.45  ? 91  SER B CA    1 
ATOM   1965 C  C     . SER B 2 98  ? 34.326  18.895 7.603  1.00 37.34  ? 91  SER B C     1 
ATOM   1966 O  O     . SER B 2 98  ? 35.390  19.380 7.937  1.00 34.62  ? 91  SER B O     1 
ATOM   1967 C  CB    . SER B 2 98  ? 34.686  18.027 5.321  1.00 42.22  ? 91  SER B CB    1 
ATOM   1968 O  OG    . SER B 2 98  ? 34.210  19.334 4.983  1.00 44.40  ? 91  SER B OG    1 
ATOM   1969 N  N     . GLN B 2 99  ? 33.165  19.454 7.927  1.00 33.72  ? 92  GLN B N     1 
ATOM   1970 C  CA    . GLN B 2 99  ? 33.158  20.694 8.682  1.00 34.25  ? 92  GLN B CA    1 
ATOM   1971 C  C     . GLN B 2 99  ? 33.064  20.444 10.183 1.00 31.78  ? 92  GLN B C     1 
ATOM   1972 O  O     . GLN B 2 99  ? 32.951  21.394 10.946 1.00 31.85  ? 92  GLN B O     1 
ATOM   1973 C  CB    . GLN B 2 99  ? 32.036  21.620 8.196  1.00 36.39  ? 92  GLN B CB    1 
ATOM   1974 C  CG    . GLN B 2 99  ? 32.183  22.000 6.735  1.00 41.97  ? 92  GLN B CG    1 
ATOM   1975 C  CD    . GLN B 2 99  ? 33.497  22.718 6.469  1.00 45.27  ? 92  GLN B CD    1 
ATOM   1976 O  OE1   . GLN B 2 99  ? 33.646  23.895 6.811  1.00 48.75  ? 92  GLN B OE1   1 
ATOM   1977 N  NE2   . GLN B 2 99  ? 34.461  22.014 5.870  1.00 44.71  ? 92  GLN B NE2   1 
ATOM   1978 N  N     . TRP B 2 100 ? 33.124  19.177 10.607 1.00 28.36  ? 93  TRP B N     1 
ATOM   1979 C  CA    . TRP B 2 100 ? 33.330  18.873 12.024 1.00 27.65  ? 93  TRP B CA    1 
ATOM   1980 C  C     . TRP B 2 100 ? 34.521  19.619 12.569 1.00 29.57  ? 93  TRP B C     1 
ATOM   1981 O  O     . TRP B 2 100 ? 35.531  19.781 11.889 1.00 32.97  ? 93  TRP B O     1 
ATOM   1982 C  CB    . TRP B 2 100 ? 33.539  17.368 12.272 1.00 26.83  ? 93  TRP B CB    1 
ATOM   1983 C  CG    . TRP B 2 100 ? 33.929  17.074 13.717 1.00 25.38  ? 93  TRP B CG    1 
ATOM   1984 C  CD1   . TRP B 2 100 ? 35.164  16.731 14.169 1.00 27.01  ? 93  TRP B CD1   1 
ATOM   1985 C  CD2   . TRP B 2 100 ? 33.092  17.161 14.873 1.00 24.26  ? 93  TRP B CD2   1 
ATOM   1986 N  NE1   . TRP B 2 100 ? 35.147  16.580 15.521 1.00 24.89  ? 93  TRP B NE1   1 
ATOM   1987 C  CE2   . TRP B 2 100 ? 33.886  16.827 15.983 1.00 23.90  ? 93  TRP B CE2   1 
ATOM   1988 C  CE3   . TRP B 2 100 ? 31.741  17.464 15.074 1.00 23.02  ? 93  TRP B CE3   1 
ATOM   1989 C  CZ2   . TRP B 2 100 ? 33.387  16.804 17.278 1.00 23.27  ? 93  TRP B CZ2   1 
ATOM   1990 C  CZ3   . TRP B 2 100 ? 31.240  17.434 16.358 1.00 24.27  ? 93  TRP B CZ3   1 
ATOM   1991 C  CH2   . TRP B 2 100 ? 32.062  17.108 17.454 1.00 22.65  ? 93  TRP B CH2   1 
ATOM   1992 N  N     . SER B 2 101 ? 34.391  20.085 13.802 1.00 27.89  ? 94  SER B N     1 
ATOM   1993 C  CA    . SER B 2 101 ? 35.487  20.684 14.526 1.00 28.99  ? 94  SER B CA    1 
ATOM   1994 C  C     . SER B 2 101 ? 35.379  20.218 15.976 1.00 26.89  ? 94  SER B C     1 
ATOM   1995 O  O     . SER B 2 101 ? 34.285  20.114 16.488 1.00 25.25  ? 94  SER B O     1 
ATOM   1996 C  CB    . SER B 2 101 ? 35.356  22.220 14.446 1.00 30.94  ? 94  SER B CB    1 
ATOM   1997 O  OG    . SER B 2 101 ? 36.040  22.832 15.510 1.00 31.03  ? 94  SER B OG    1 
ATOM   1998 N  N     . PRO B 2 102 ? 36.510  19.959 16.652 1.00 28.29  ? 95  PRO B N     1 
ATOM   1999 C  CA    . PRO B 2 102 ? 36.470  19.616 18.080 1.00 27.83  ? 95  PRO B CA    1 
ATOM   2000 C  C     . PRO B 2 102 ? 35.922  20.731 18.975 1.00 28.44  ? 95  PRO B C     1 
ATOM   2001 O  O     . PRO B 2 102 ? 35.549  20.469 20.107 1.00 27.02  ? 95  PRO B O     1 
ATOM   2002 C  CB    . PRO B 2 102 ? 37.922  19.333 18.410 1.00 29.52  ? 95  PRO B CB    1 
ATOM   2003 C  CG    . PRO B 2 102 ? 38.706  20.061 17.400 1.00 31.39  ? 95  PRO B CG    1 
ATOM   2004 C  CD    . PRO B 2 102 ? 37.887  20.080 16.153 1.00 30.48  ? 95  PRO B CD    1 
ATOM   2005 N  N     . ALA B 2 103 ? 35.898  21.967 18.480 1.00 29.87  ? 96  ALA B N     1 
ATOM   2006 C  CA    . ALA B 2 103 ? 35.174  23.031 19.155 1.00 31.59  ? 96  ALA B CA    1 
ATOM   2007 C  C     . ALA B 2 103 ? 33.660  22.790 19.264 1.00 32.25  ? 96  ALA B C     1 
ATOM   2008 O  O     . ALA B 2 103 ? 33.012  23.402 20.107 1.00 30.58  ? 96  ALA B O     1 
ATOM   2009 C  CB    . ALA B 2 103 ? 35.442  24.364 18.481 1.00 34.58  ? 96  ALA B CB    1 
ATOM   2010 N  N     . LEU B 2 104 ? 33.099  21.903 18.440 1.00 30.87  ? 97  LEU B N     1 
ATOM   2011 C  CA    . LEU B 2 104 ? 31.672  21.570 18.533 1.00 30.80  ? 97  LEU B CA    1 
ATOM   2012 C  C     . LEU B 2 104 ? 31.410  20.463 19.535 1.00 31.00  ? 97  LEU B C     1 
ATOM   2013 O  O     . LEU B 2 104 ? 32.294  19.689 19.892 1.00 30.07  ? 97  LEU B O     1 
ATOM   2014 C  CB    . LEU B 2 104 ? 31.105  21.149 17.175 1.00 29.49  ? 97  LEU B CB    1 
ATOM   2015 C  CG    . LEU B 2 104 ? 31.188  22.162 16.045 1.00 35.89  ? 97  LEU B CG    1 
ATOM   2016 C  CD1   . LEU B 2 104 ? 30.754  21.538 14.724 1.00 36.72  ? 97  LEU B CD1   1 
ATOM   2017 C  CD2   . LEU B 2 104 ? 30.336  23.380 16.374 1.00 40.08  ? 97  LEU B CD2   1 
ATOM   2018 N  N     . THR B 2 105 ? 30.168  20.407 19.980 1.00 30.43  ? 98  THR B N     1 
ATOM   2019 C  CA    . THR B 2 105 ? 29.692  19.396 20.924 1.00 28.06  ? 98  THR B CA    1 
ATOM   2020 C  C     . THR B 2 105 ? 28.455  18.741 20.357 1.00 27.25  ? 98  THR B C     1 
ATOM   2021 O  O     . THR B 2 105 ? 27.841  19.301 19.437 1.00 25.06  ? 98  THR B O     1 
ATOM   2022 C  CB    . THR B 2 105 ? 29.315  20.028 22.264 1.00 28.47  ? 98  THR B CB    1 
ATOM   2023 O  OG1   . THR B 2 105 ? 28.271  20.992 22.079 1.00 27.06  ? 98  THR B OG1   1 
ATOM   2024 C  CG2   . THR B 2 105 ? 30.507  20.688 22.903 1.00 30.25  ? 98  THR B CG2   1 
ATOM   2025 N  N     . VAL B 2 106 ? 28.099  17.564 20.890 1.00 25.24  ? 99  VAL B N     1 
ATOM   2026 C  CA    . VAL B 2 106 ? 26.821  16.933 20.582 1.00 23.94  ? 99  VAL B CA    1 
ATOM   2027 C  C     . VAL B 2 106 ? 25.645  17.889 20.809 1.00 24.59  ? 99  VAL B C     1 
ATOM   2028 O  O     . VAL B 2 106 ? 24.740  17.958 19.983 1.00 23.91  ? 99  VAL B O     1 
ATOM   2029 C  CB    . VAL B 2 106 ? 26.627  15.625 21.357 1.00 26.44  ? 99  VAL B CB    1 
ATOM   2030 C  CG1   . VAL B 2 106 ? 25.204  15.098 21.197 1.00 25.09  ? 99  VAL B CG1   1 
ATOM   2031 C  CG2   . VAL B 2 106 ? 27.622  14.574 20.866 1.00 27.98  ? 99  VAL B CG2   1 
ATOM   2032 N  N     . SER B 2 107 ? 25.672  18.633 21.906 1.00 26.00  ? 100 SER B N     1 
ATOM   2033 C  CA    . SER B 2 107 ? 24.662  19.634 22.171 1.00 29.75  ? 100 SER B CA    1 
ATOM   2034 C  C     . SER B 2 107 ? 24.481  20.573 20.978 1.00 26.59  ? 100 SER B C     1 
ATOM   2035 O  O     . SER B 2 107 ? 23.347  20.773 20.507 1.00 23.93  ? 100 SER B O     1 
ATOM   2036 C  CB    . SER B 2 107 ? 25.019  20.436 23.405 1.00 29.89  ? 100 SER B CB    1 
ATOM   2037 O  OG    . SER B 2 107 ? 24.041  21.429 23.604 1.00 34.32  ? 100 SER B OG    1 
ATOM   2038 N  N     . LYS B 2 108 ? 25.593  21.107 20.481 1.00 27.51  ? 101 LYS B N     1 
ATOM   2039 C  CA    . LYS B 2 108 ? 25.563  21.983 19.291 1.00 28.44  ? 101 LYS B CA    1 
ATOM   2040 C  C     . LYS B 2 108 ? 25.114  21.265 18.033 1.00 25.36  ? 101 LYS B C     1 
ATOM   2041 O  O     . LYS B 2 108 ? 24.365  21.834 17.233 1.00 23.46  ? 101 LYS B O     1 
ATOM   2042 C  CB    . LYS B 2 108 ? 26.910  22.657 19.046 1.00 31.49  ? 101 LYS B CB    1 
ATOM   2043 C  CG    . LYS B 2 108 ? 27.296  23.693 20.085 1.00 34.79  ? 101 LYS B CG    1 
ATOM   2044 C  CD    . LYS B 2 108 ? 28.785  23.976 20.029 1.00 39.83  ? 101 LYS B CD    1 
ATOM   2045 C  CE    . LYS B 2 108 ? 29.165  25.135 20.925 1.00 48.65  ? 101 LYS B CE    1 
ATOM   2046 N  NZ    . LYS B 2 108 ? 30.607  25.458 20.787 1.00 58.67  ? 101 LYS B NZ    1 
ATOM   2047 N  N     . VAL B 2 109 ? 25.495  19.996 17.857 1.00 23.94  ? 102 VAL B N     1 
ATOM   2048 C  CA    . VAL B 2 109 ? 25.018  19.258 16.700 1.00 22.04  ? 102 VAL B CA    1 
ATOM   2049 C  C     . VAL B 2 109 ? 23.503  19.079 16.772 1.00 21.27  ? 102 VAL B C     1 
ATOM   2050 O  O     . VAL B 2 109 ? 22.807  19.260 15.777 1.00 20.17  ? 102 VAL B O     1 
ATOM   2051 C  CB    . VAL B 2 109 ? 25.733  17.892 16.507 1.00 23.25  ? 102 VAL B CB    1 
ATOM   2052 C  CG1   . VAL B 2 109 ? 25.145  17.156 15.315 1.00 25.81  ? 102 VAL B CG1   1 
ATOM   2053 C  CG2   . VAL B 2 109 ? 27.222  18.103 16.284 1.00 25.99  ? 102 VAL B CG2   1 
ATOM   2054 N  N     . LEU B 2 110 ? 22.998  18.724 17.948 1.00 19.68  ? 103 LEU B N     1 
ATOM   2055 C  CA    . LEU B 2 110 ? 21.568  18.594 18.151 1.00 21.71  ? 103 LEU B CA    1 
ATOM   2056 C  C     . LEU B 2 110 ? 20.793  19.853 17.822 1.00 21.81  ? 103 LEU B C     1 
ATOM   2057 O  O     . LEU B 2 110 ? 19.748  19.768 17.177 1.00 23.61  ? 103 LEU B O     1 
ATOM   2058 C  CB    . LEU B 2 110 ? 21.261  18.138 19.577 1.00 23.28  ? 103 LEU B CB    1 
ATOM   2059 C  CG    . LEU B 2 110 ? 21.634  16.669 19.873 1.00 23.13  ? 103 LEU B CG    1 
ATOM   2060 C  CD1   . LEU B 2 110 ? 21.474  16.353 21.344 1.00 25.25  ? 103 LEU B CD1   1 
ATOM   2061 C  CD2   . LEU B 2 110 ? 20.809  15.710 19.059 1.00 27.15  ? 103 LEU B CD2   1 
ATOM   2062 N  N     . LEU B 2 111 ? 21.296  21.017 18.243 1.00 22.32  ? 104 LEU B N     1 
ATOM   2063 C  CA    . LEU B 2 111 ? 20.662  22.268 17.854 1.00 23.40  ? 104 LEU B CA    1 
ATOM   2064 C  C     . LEU B 2 111 ? 20.718  22.504 16.365 1.00 23.48  ? 104 LEU B C     1 
ATOM   2065 O  O     . LEU B 2 111 ? 19.746  23.008 15.798 1.00 23.32  ? 104 LEU B O     1 
ATOM   2066 C  CB    . LEU B 2 111 ? 21.269  23.463 18.596 1.00 25.41  ? 104 LEU B CB    1 
ATOM   2067 C  CG    . LEU B 2 111 ? 20.969  23.402 20.096 1.00 26.54  ? 104 LEU B CG    1 
ATOM   2068 C  CD1   . LEU B 2 111 ? 21.788  24.437 20.827 1.00 31.33  ? 104 LEU B CD1   1 
ATOM   2069 C  CD2   . LEU B 2 111 ? 19.471  23.577 20.382 1.00 26.88  ? 104 LEU B CD2   1 
ATOM   2070 N  N     . SER B 2 112 ? 21.823  22.133 15.722 1.00 22.84  ? 105 SER B N     1 
ATOM   2071 C  CA    . SER B 2 112 ? 21.896  22.246 14.258 1.00 24.55  ? 105 SER B CA    1 
ATOM   2072 C  C     . SER B 2 112 ? 20.935  21.324 13.547 1.00 23.40  ? 105 SER B C     1 
ATOM   2073 O  O     . SER B 2 112 ? 20.421  21.675 12.502 1.00 23.63  ? 105 SER B O     1 
ATOM   2074 C  CB    . SER B 2 112 ? 23.305  21.987 13.738 1.00 25.92  ? 105 SER B CB    1 
ATOM   2075 O  OG    . SER B 2 112 ? 24.178  22.904 14.342 1.00 32.45  ? 105 SER B OG    1 
ATOM   2076 N  N     . ILE B 2 113 ? 20.704  20.137 14.108 1.00 22.31  ? 106 ILE B N     1 
ATOM   2077 C  CA    . ILE B 2 113 ? 19.702  19.256 13.545 1.00 22.11  ? 106 ILE B CA    1 
ATOM   2078 C  C     . ILE B 2 113 ? 18.314  19.877 13.711 1.00 23.10  ? 106 ILE B C     1 
ATOM   2079 O  O     . ILE B 2 113 ? 17.518  19.831 12.779 1.00 24.04  ? 106 ILE B O     1 
ATOM   2080 C  CB    . ILE B 2 113 ? 19.795  17.825 14.140 1.00 21.30  ? 106 ILE B CB    1 
ATOM   2081 C  CG1   . ILE B 2 113 ? 21.151  17.212 13.773 1.00 21.59  ? 106 ILE B CG1   1 
ATOM   2082 C  CG2   . ILE B 2 113 ? 18.613  16.982 13.670 1.00 22.97  ? 106 ILE B CG2   1 
ATOM   2083 C  CD1   . ILE B 2 113 ? 21.473  15.896 14.456 1.00 22.34  ? 106 ILE B CD1   1 
ATOM   2084 N  N     . CYS B 2 114 ? 18.014  20.438 14.892 1.00 24.83  ? 107 CYS B N     1 
ATOM   2085 C  CA    . CYS B 2 114 ? 16.750  21.174 15.097 1.00 27.62  ? 107 CYS B CA    1 
ATOM   2086 C  C     . CYS B 2 114 ? 16.594  22.311 14.092 1.00 27.39  ? 107 CYS B C     1 
ATOM   2087 O  O     . CYS B 2 114 ? 15.511  22.538 13.577 1.00 27.36  ? 107 CYS B O     1 
ATOM   2088 C  CB    . CYS B 2 114 ? 16.638  21.760 16.510 1.00 30.40  ? 107 CYS B CB    1 
ATOM   2089 S  SG    . CYS B 2 114 ? 16.397  20.486 17.761 1.00 33.48  ? 107 CYS B SG    1 
ATOM   2090 N  N     . SER B 2 115 ? 17.688  22.984 13.788 1.00 26.84  ? 108 SER B N     1 
ATOM   2091 C  CA    . SER B 2 115 ? 17.665  24.084 12.814 1.00 31.40  ? 108 SER B CA    1 
ATOM   2092 C  C     . SER B 2 115 ? 17.374  23.613 11.366 1.00 30.55  ? 108 SER B C     1 
ATOM   2093 O  O     . SER B 2 115 ? 16.680  24.293 10.613 1.00 30.79  ? 108 SER B O     1 
ATOM   2094 C  CB    . SER B 2 115 ? 18.996  24.822 12.866 1.00 33.59  ? 108 SER B CB    1 
ATOM   2095 O  OG    . SER B 2 115 ? 19.105  25.678 11.753 1.00 37.62  ? 108 SER B OG    1 
ATOM   2096 N  N     . LEU B 2 116 ? 17.903  22.437 11.024 1.00 29.52  ? 109 LEU B N     1 
ATOM   2097 C  CA    . LEU B 2 116 ? 17.649  21.743 9.758  1.00 30.89  ? 109 LEU B CA    1 
ATOM   2098 C  C     . LEU B 2 116 ? 16.186  21.302 9.598  1.00 28.96  ? 109 LEU B C     1 
ATOM   2099 O  O     . LEU B 2 116 ? 15.636  21.342 8.495  1.00 29.24  ? 109 LEU B O     1 
ATOM   2100 C  CB    . LEU B 2 116 ? 18.573  20.510 9.669  1.00 32.42  ? 109 LEU B CB    1 
ATOM   2101 C  CG    . LEU B 2 116 ? 18.997  19.952 8.315  1.00 36.02  ? 109 LEU B CG    1 
ATOM   2102 C  CD1   . LEU B 2 116 ? 19.804  20.963 7.519  1.00 41.91  ? 109 LEU B CD1   1 
ATOM   2103 C  CD2   . LEU B 2 116 ? 19.804  18.678 8.506  1.00 37.60  ? 109 LEU B CD2   1 
ATOM   2104 N  N     . LEU B 2 117 ? 15.560  20.871 10.695 1.00 28.01  ? 110 LEU B N     1 
ATOM   2105 C  CA    . LEU B 2 117 ? 14.127  20.581 10.725 1.00 28.25  ? 110 LEU B CA    1 
ATOM   2106 C  C     . LEU B 2 117 ? 13.289  21.815 10.424 1.00 30.98  ? 110 LEU B C     1 
ATOM   2107 O  O     . LEU B 2 117 ? 12.294  21.742 9.690  1.00 30.30  ? 110 LEU B O     1 
ATOM   2108 C  CB    . LEU B 2 117 ? 13.728  19.980 12.084 1.00 29.00  ? 110 LEU B CB    1 
ATOM   2109 C  CG    . LEU B 2 117 ? 13.688  18.436 12.194 1.00 31.34  ? 110 LEU B CG    1 
ATOM   2110 C  CD1   . LEU B 2 117 ? 14.770  17.740 11.401 1.00 32.35  ? 110 LEU B CD1   1 
ATOM   2111 C  CD2   . LEU B 2 117 ? 13.707  17.982 13.650 1.00 32.41  ? 110 LEU B CD2   1 
ATOM   2112 N  N     . CYS B 2 118 ? 13.689  22.955 10.974 1.00 31.47  ? 111 CYS B N     1 
ATOM   2113 C  CA    . CYS B 2 118 ? 13.015  24.221 10.686 1.00 33.35  ? 111 CYS B CA    1 
ATOM   2114 C  C     . CYS B 2 118 ? 13.258  24.751 9.274  1.00 35.04  ? 111 CYS B C     1 
ATOM   2115 O  O     . CYS B 2 118 ? 12.363  25.373 8.674  1.00 36.62  ? 111 CYS B O     1 
ATOM   2116 C  CB    . CYS B 2 118 ? 13.415  25.287 11.705 1.00 34.85  ? 111 CYS B CB    1 
ATOM   2117 S  SG    . CYS B 2 118 ? 12.908  24.900 13.401 1.00 40.50  ? 111 CYS B SG    1 
ATOM   2118 N  N     . ASP B 2 119 ? 14.459  24.522 8.751  1.00 35.41  ? 112 ASP B N     1 
ATOM   2119 C  CA    . ASP B 2 119 ? 14.881  25.102 7.479  1.00 38.32  ? 112 ASP B CA    1 
ATOM   2120 C  C     . ASP B 2 119 ? 15.746  24.085 6.750  1.00 35.88  ? 112 ASP B C     1 
ATOM   2121 O  O     . ASP B 2 119 ? 16.954  24.074 6.890  1.00 33.84  ? 112 ASP B O     1 
ATOM   2122 C  CB    . ASP B 2 119 ? 15.656  26.407 7.705  1.00 41.43  ? 112 ASP B CB    1 
ATOM   2123 C  CG    . ASP B 2 119 ? 14.750  27.555 8.132  1.00 47.44  ? 112 ASP B CG    1 
ATOM   2124 O  OD1   . ASP B 2 119 ? 14.004  28.075 7.283  1.00 51.80  ? 112 ASP B OD1   1 
ATOM   2125 O  OD2   . ASP B 2 119 ? 14.779  27.942 9.318  1.00 51.19  ? 112 ASP B OD2   1 
ATOM   2126 N  N     . PRO B 2 120 ? 15.110  23.197 5.986  1.00 37.29  ? 113 PRO B N     1 
ATOM   2127 C  CA    . PRO B 2 120 ? 15.867  22.207 5.246  1.00 37.16  ? 113 PRO B CA    1 
ATOM   2128 C  C     . PRO B 2 120 ? 16.827  22.842 4.244  1.00 40.11  ? 113 PRO B C     1 
ATOM   2129 O  O     . PRO B 2 120 ? 16.659  24.006 3.851  1.00 40.55  ? 113 PRO B O     1 
ATOM   2130 C  CB    . PRO B 2 120 ? 14.782  21.398 4.529  1.00 36.73  ? 113 PRO B CB    1 
ATOM   2131 C  CG    . PRO B 2 120 ? 13.572  21.572 5.355  1.00 36.73  ? 113 PRO B CG    1 
ATOM   2132 C  CD    . PRO B 2 120 ? 13.663  22.952 5.926  1.00 36.60  ? 113 PRO B CD    1 
ATOM   2133 N  N     . ASN B 2 121 ? 17.831  22.069 3.853  1.00 39.57  ? 114 ASN B N     1 
ATOM   2134 C  CA    . ASN B 2 121 ? 18.809  22.489 2.879  1.00 45.19  ? 114 ASN B CA    1 
ATOM   2135 C  C     . ASN B 2 121 ? 18.658  21.708 1.558  1.00 44.44  ? 114 ASN B C     1 
ATOM   2136 O  O     . ASN B 2 121 ? 19.336  20.717 1.345  1.00 43.00  ? 114 ASN B O     1 
ATOM   2137 C  CB    . ASN B 2 121 ? 20.205  22.304 3.465  1.00 47.66  ? 114 ASN B CB    1 
ATOM   2138 C  CG    . ASN B 2 121 ? 21.273  22.948 2.615  1.00 52.48  ? 114 ASN B CG    1 
ATOM   2139 O  OD1   . ASN B 2 121 ? 20.982  23.562 1.582  1.00 61.16  ? 114 ASN B OD1   1 
ATOM   2140 N  ND2   . ASN B 2 121 ? 22.520  22.818 3.044  1.00 54.92  ? 114 ASN B ND2   1 
ATOM   2141 N  N     . PRO B 2 122 ? 17.778  22.175 0.656  1.00 48.04  ? 115 PRO B N     1 
ATOM   2142 C  CA    . PRO B 2 122 ? 17.537  21.436 -0.587 1.00 49.97  ? 115 PRO B CA    1 
ATOM   2143 C  C     . PRO B 2 122 ? 18.756  21.407 -1.535 1.00 52.78  ? 115 PRO B C     1 
ATOM   2144 O  O     . PRO B 2 122 ? 18.788  20.603 -2.464 1.00 54.51  ? 115 PRO B O     1 
ATOM   2145 C  CB    . PRO B 2 122 ? 16.364  22.197 -1.212 1.00 53.79  ? 115 PRO B CB    1 
ATOM   2146 C  CG    . PRO B 2 122 ? 16.590  23.607 -0.771 1.00 55.64  ? 115 PRO B CG    1 
ATOM   2147 C  CD    . PRO B 2 122 ? 17.119  23.494 0.639  1.00 51.38  ? 115 PRO B CD    1 
ATOM   2148 N  N     . ASP B 2 123 ? 19.753  22.257 -1.288 1.00 53.97  ? 116 ASP B N     1 
ATOM   2149 C  CA    . ASP B 2 123 ? 20.987  22.246 -2.067 1.00 59.08  ? 116 ASP B CA    1 
ATOM   2150 C  C     . ASP B 2 123 ? 21.995  21.172 -1.627 1.00 54.40  ? 116 ASP B C     1 
ATOM   2151 O  O     . ASP B 2 123 ? 23.096  21.101 -2.181 1.00 54.44  ? 116 ASP B O     1 
ATOM   2152 C  CB    . ASP B 2 123 ? 21.636  23.634 -2.023 1.00 70.27  ? 116 ASP B CB    1 
ATOM   2153 C  CG    . ASP B 2 123 ? 20.717  24.732 -2.568 1.00 78.94  ? 116 ASP B CG    1 
ATOM   2154 O  OD1   . ASP B 2 123 ? 19.845  24.439 -3.423 1.00 78.38  ? 116 ASP B OD1   1 
ATOM   2155 O  OD2   . ASP B 2 123 ? 20.870  25.894 -2.135 1.00 90.52  ? 116 ASP B OD2   1 
ATOM   2156 N  N     . ASP B 2 124 ? 21.622  20.343 -0.649 1.00 48.21  ? 117 ASP B N     1 
ATOM   2157 C  CA    . ASP B 2 124 ? 22.403  19.166 -0.241 1.00 46.04  ? 117 ASP B CA    1 
ATOM   2158 C  C     . ASP B 2 124 ? 21.423  17.969 -0.269 1.00 45.53  ? 117 ASP B C     1 
ATOM   2159 O  O     . ASP B 2 124 ? 21.043  17.425 0.776  1.00 44.63  ? 117 ASP B O     1 
ATOM   2160 C  CB    . ASP B 2 124 ? 23.012  19.422 1.157  1.00 42.76  ? 117 ASP B CB    1 
ATOM   2161 C  CG    . ASP B 2 124 ? 24.226  18.519 1.493  1.00 38.92  ? 117 ASP B CG    1 
ATOM   2162 O  OD1   . ASP B 2 124 ? 24.646  17.669 0.699  1.00 38.65  ? 117 ASP B OD1   1 
ATOM   2163 O  OD2   . ASP B 2 124 ? 24.753  18.639 2.607  1.00 39.44  ? 117 ASP B OD2   1 
ATOM   2164 N  N     . PRO B 2 125 ? 20.981  17.567 -1.480 1.00 47.69  ? 118 PRO B N     1 
ATOM   2165 C  CA    . PRO B 2 125 ? 19.779  16.725 -1.571 1.00 48.07  ? 118 PRO B CA    1 
ATOM   2166 C  C     . PRO B 2 125 ? 19.987  15.213 -1.374 1.00 45.69  ? 118 PRO B C     1 
ATOM   2167 O  O     . PRO B 2 125 ? 20.083  14.463 -2.352 1.00 49.66  ? 118 PRO B O     1 
ATOM   2168 C  CB    . PRO B 2 125 ? 19.279  17.012 -2.982 1.00 49.99  ? 118 PRO B CB    1 
ATOM   2169 C  CG    . PRO B 2 125 ? 20.524  17.270 -3.749 1.00 53.90  ? 118 PRO B CG    1 
ATOM   2170 C  CD    . PRO B 2 125 ? 21.419  18.024 -2.811 1.00 51.35  ? 118 PRO B CD    1 
ATOM   2171 N  N     . LEU B 2 126 ? 20.013  14.782 -0.117 1.00 38.20  ? 119 LEU B N     1 
ATOM   2172 C  CA    . LEU B 2 126 ? 20.114  13.358 0.220  1.00 38.16  ? 119 LEU B CA    1 
ATOM   2173 C  C     . LEU B 2 126 ? 18.909  12.552 -0.291 1.00 38.74  ? 119 LEU B C     1 
ATOM   2174 O  O     . LEU B 2 126 ? 19.039  11.372 -0.618 1.00 38.17  ? 119 LEU B O     1 
ATOM   2175 C  CB    . LEU B 2 126 ? 20.267  13.182 1.732  1.00 36.53  ? 119 LEU B CB    1 
ATOM   2176 C  CG    . LEU B 2 126 ? 20.571  11.773 2.246  1.00 37.07  ? 119 LEU B CG    1 
ATOM   2177 C  CD1   . LEU B 2 126 ? 21.888  11.260 1.687  1.00 37.60  ? 119 LEU B CD1   1 
ATOM   2178 C  CD2   . LEU B 2 126 ? 20.588  11.766 3.759  1.00 34.41  ? 119 LEU B CD2   1 
ATOM   2179 N  N     . VAL B 2 127 ? 17.737  13.183 -0.322 1.00 38.21  ? 120 VAL B N     1 
ATOM   2180 C  CA    . VAL B 2 127 ? 16.545  12.581 -0.901 1.00 40.99  ? 120 VAL B CA    1 
ATOM   2181 C  C     . VAL B 2 127 ? 16.056  13.512 -2.010 1.00 42.34  ? 120 VAL B C     1 
ATOM   2182 O  O     . VAL B 2 127 ? 15.256  14.419 -1.747 1.00 42.08  ? 120 VAL B O     1 
ATOM   2183 C  CB    . VAL B 2 127 ? 15.427  12.356 0.133  1.00 40.06  ? 120 VAL B CB    1 
ATOM   2184 C  CG1   . VAL B 2 127 ? 14.266  11.619 -0.520 1.00 41.94  ? 120 VAL B CG1   1 
ATOM   2185 C  CG2   . VAL B 2 127 ? 15.936  11.558 1.332  1.00 38.43  ? 120 VAL B CG2   1 
ATOM   2186 N  N     . PRO B 2 128 ? 16.536  13.292 -3.252 1.00 45.96  ? 121 PRO B N     1 
ATOM   2187 C  CA    . PRO B 2 128 ? 16.261  14.179 -4.392 1.00 47.21  ? 121 PRO B CA    1 
ATOM   2188 C  C     . PRO B 2 128 ? 14.792  14.506 -4.627 1.00 47.07  ? 121 PRO B C     1 
ATOM   2189 O  O     . PRO B 2 128 ? 14.449  15.677 -4.828 1.00 46.28  ? 121 PRO B O     1 
ATOM   2190 C  CB    . PRO B 2 128 ? 16.830  13.403 -5.583 1.00 51.29  ? 121 PRO B CB    1 
ATOM   2191 C  CG    . PRO B 2 128 ? 17.931  12.596 -4.998 1.00 49.82  ? 121 PRO B CG    1 
ATOM   2192 C  CD    . PRO B 2 128 ? 17.458  12.204 -3.631 1.00 46.94  ? 121 PRO B CD    1 
ATOM   2193 N  N     . ASP B 2 129 ? 13.936  13.485 -4.614 1.00 47.87  ? 122 ASP B N     1 
ATOM   2194 C  CA    . ASP B 2 129 ? 12.506  13.686 -4.841 1.00 48.81  ? 122 ASP B CA    1 
ATOM   2195 C  C     . ASP B 2 129 ? 11.889  14.678 -3.863 1.00 45.48  ? 122 ASP B C     1 
ATOM   2196 O  O     . ASP B 2 129 ? 11.082  15.522 -4.249 1.00 46.40  ? 122 ASP B O     1 
ATOM   2197 C  CB    . ASP B 2 129 ? 11.759  12.346 -4.786 1.00 52.32  ? 122 ASP B CB    1 
ATOM   2198 C  CG    . ASP B 2 129 ? 12.031  11.474 -6.011 1.00 60.10  ? 122 ASP B CG    1 
ATOM   2199 O  OD1   . ASP B 2 129 ? 11.277  10.498 -6.222 1.00 70.36  ? 122 ASP B OD1   1 
ATOM   2200 O  OD2   . ASP B 2 129 ? 12.991  11.762 -6.770 1.00 60.99  ? 122 ASP B OD2   1 
ATOM   2201 N  N     . ILE B 2 130 ? 12.284  14.576 -2.597 1.00 42.56  ? 123 ILE B N     1 
ATOM   2202 C  CA    . ILE B 2 130 ? 11.810  15.472 -1.553 1.00 40.33  ? 123 ILE B CA    1 
ATOM   2203 C  C     . ILE B 2 130 ? 12.397  16.876 -1.724 1.00 40.06  ? 123 ILE B C     1 
ATOM   2204 O  O     . ILE B 2 130 ? 11.686  17.868 -1.585 1.00 41.64  ? 123 ILE B O     1 
ATOM   2205 C  CB    . ILE B 2 130 ? 12.120  14.891 -0.156 1.00 36.60  ? 123 ILE B CB    1 
ATOM   2206 C  CG1   . ILE B 2 130 ? 11.290  13.617 0.048  1.00 36.89  ? 123 ILE B CG1   1 
ATOM   2207 C  CG2   . ILE B 2 130 ? 11.831  15.912 0.932  1.00 35.30  ? 123 ILE B CG2   1 
ATOM   2208 C  CD1   . ILE B 2 130 ? 11.449  12.975 1.412  1.00 33.51  ? 123 ILE B CD1   1 
ATOM   2209 N  N     . ALA B 2 131 ? 13.685  16.957 -2.035 1.00 40.43  ? 124 ALA B N     1 
ATOM   2210 C  CA    . ALA B 2 131 ? 14.333  18.251 -2.272 1.00 41.28  ? 124 ALA B CA    1 
ATOM   2211 C  C     . ALA B 2 131 ? 13.657  19.034 -3.396 1.00 44.36  ? 124 ALA B C     1 
ATOM   2212 O  O     . ALA B 2 131 ? 13.481  20.250 -3.292 1.00 45.10  ? 124 ALA B O     1 
ATOM   2213 C  CB    . ALA B 2 131 ? 15.806  18.057 -2.585 1.00 40.48  ? 124 ALA B CB    1 
ATOM   2214 N  N     . GLN B 2 132 ? 13.283  18.344 -4.467 1.00 47.87  ? 125 GLN B N     1 
ATOM   2215 C  CA    . GLN B 2 132 ? 12.610  19.002 -5.595 1.00 52.86  ? 125 GLN B CA    1 
ATOM   2216 C  C     . GLN B 2 132 ? 11.262  19.589 -5.190 1.00 52.42  ? 125 GLN B C     1 
ATOM   2217 O  O     . GLN B 2 132 ? 10.915  20.687 -5.613 1.00 53.29  ? 125 GLN B O     1 
ATOM   2218 C  CB    . GLN B 2 132 ? 12.428  18.041 -6.777 1.00 58.34  ? 125 GLN B CB    1 
ATOM   2219 C  CG    . GLN B 2 132 ? 13.717  17.752 -7.525 1.00 64.63  ? 125 GLN B CG    1 
ATOM   2220 C  CD    . GLN B 2 132 ? 14.457  19.024 -7.895 1.00 70.80  ? 125 GLN B CD    1 
ATOM   2221 O  OE1   . GLN B 2 132 ? 15.545  19.301 -7.377 1.00 79.59  ? 125 GLN B OE1   1 
ATOM   2222 N  NE2   . GLN B 2 132 ? 13.848  19.829 -8.755 1.00 71.34  ? 125 GLN B NE2   1 
ATOM   2223 N  N     . ILE B 2 133 ? 10.516  18.862 -4.362 1.00 49.23  ? 126 ILE B N     1 
ATOM   2224 C  CA    . ILE B 2 133 ? 9.214   19.335 -3.898 1.00 49.18  ? 126 ILE B CA    1 
ATOM   2225 C  C     . ILE B 2 133 ? 9.392   20.533 -2.969 1.00 48.34  ? 126 ILE B C     1 
ATOM   2226 O  O     . ILE B 2 133 ? 8.625   21.495 -3.039 1.00 50.72  ? 126 ILE B O     1 
ATOM   2227 C  CB    . ILE B 2 133 ? 8.423   18.202 -3.221 1.00 48.63  ? 126 ILE B CB    1 
ATOM   2228 C  CG1   . ILE B 2 133 ? 8.061   17.135 -4.259 1.00 52.35  ? 126 ILE B CG1   1 
ATOM   2229 C  CG2   . ILE B 2 133 ? 7.144   18.728 -2.571 1.00 50.20  ? 126 ILE B CG2   1 
ATOM   2230 C  CD1   . ILE B 2 133 ? 7.741   15.781 -3.671 1.00 51.60  ? 126 ILE B CD1   1 
ATOM   2231 N  N     . TYR B 2 134 ? 10.413  20.481 -2.113 1.00 46.73  ? 127 TYR B N     1 
ATOM   2232 C  CA    . TYR B 2 134 ? 10.725  21.596 -1.229 1.00 45.89  ? 127 TYR B CA    1 
ATOM   2233 C  C     . TYR B 2 134 ? 10.902  22.866 -2.051 1.00 49.19  ? 127 TYR B C     1 
ATOM   2234 O  O     . TYR B 2 134 ? 10.362  23.912 -1.703 1.00 49.12  ? 127 TYR B O     1 
ATOM   2235 C  CB    . TYR B 2 134 ? 11.973  21.310 -0.377 1.00 44.22  ? 127 TYR B CB    1 
ATOM   2236 C  CG    . TYR B 2 134 ? 12.247  22.404 0.622  1.00 44.62  ? 127 TYR B CG    1 
ATOM   2237 C  CD1   . TYR B 2 134 ? 11.568  22.450 1.829  1.00 41.76  ? 127 TYR B CD1   1 
ATOM   2238 C  CD2   . TYR B 2 134 ? 13.139  23.431 0.328  1.00 48.29  ? 127 TYR B CD2   1 
ATOM   2239 C  CE1   . TYR B 2 134 ? 11.789  23.472 2.730  1.00 43.89  ? 127 TYR B CE1   1 
ATOM   2240 C  CE2   . TYR B 2 134 ? 13.372  24.455 1.224  1.00 49.06  ? 127 TYR B CE2   1 
ATOM   2241 C  CZ    . TYR B 2 134 ? 12.696  24.470 2.424  1.00 47.33  ? 127 TYR B CZ    1 
ATOM   2242 O  OH    . TYR B 2 134 ? 12.926  25.483 3.318  1.00 48.49  ? 127 TYR B OH    1 
ATOM   2243 N  N     . LYS B 2 135 ? 11.630  22.760 -3.159 1.00 52.96  ? 128 LYS B N     1 
ATOM   2244 C  CA    . LYS B 2 135 ? 11.926  23.920 -4.001 1.00 57.91  ? 128 LYS B CA    1 
ATOM   2245 C  C     . LYS B 2 135 ? 10.759  24.366 -4.879 1.00 60.80  ? 128 LYS B C     1 
ATOM   2246 O  O     . LYS B 2 135 ? 10.579  25.563 -5.087 1.00 66.04  ? 128 LYS B O     1 
ATOM   2247 C  CB    . LYS B 2 135 ? 13.161  23.657 -4.865 1.00 60.34  ? 128 LYS B CB    1 
ATOM   2248 C  CG    . LYS B 2 135 ? 14.442  23.599 -4.055 1.00 60.51  ? 128 LYS B CG    1 
ATOM   2249 C  CD    . LYS B 2 135 ? 15.689  23.738 -4.917 1.00 67.66  ? 128 LYS B CD    1 
ATOM   2250 C  CE    . LYS B 2 135 ? 16.040  22.444 -5.630 1.00 70.34  ? 128 LYS B CE    1 
ATOM   2251 N  NZ    . LYS B 2 135 ? 17.340  22.575 -6.347 1.00 77.11  ? 128 LYS B NZ    1 
ATOM   2252 N  N     . SER B 2 136 ? 9.967   23.424 -5.388 1.00 60.95  ? 129 SER B N     1 
ATOM   2253 C  CA    . SER B 2 136 ? 8.911   23.755 -6.354 1.00 64.92  ? 129 SER B CA    1 
ATOM   2254 C  C     . SER B 2 136 ? 7.542   24.014 -5.725 1.00 63.87  ? 129 SER B C     1 
ATOM   2255 O  O     . SER B 2 136 ? 6.772   24.814 -6.251 1.00 65.34  ? 129 SER B O     1 
ATOM   2256 C  CB    . SER B 2 136 ? 8.783   22.656 -7.413 1.00 67.41  ? 129 SER B CB    1 
ATOM   2257 O  OG    . SER B 2 136 ? 8.289   21.458 -6.844 1.00 66.23  ? 129 SER B OG    1 
ATOM   2258 N  N     . ASP B 2 137 ? 7.240   23.338 -4.615 1.00 61.35  ? 130 ASP B N     1 
ATOM   2259 C  CA    . ASP B 2 137 ? 5.899   23.370 -4.022 1.00 61.42  ? 130 ASP B CA    1 
ATOM   2260 C  C     . ASP B 2 137 ? 5.992   23.211 -2.501 1.00 57.72  ? 130 ASP B C     1 
ATOM   2261 O  O     . ASP B 2 137 ? 5.878   22.112 -1.970 1.00 54.46  ? 130 ASP B O     1 
ATOM   2262 C  CB    . ASP B 2 137 ? 5.040   22.255 -4.644 1.00 62.62  ? 130 ASP B CB    1 
ATOM   2263 C  CG    . ASP B 2 137 ? 3.551   22.418 -4.367 1.00 64.40  ? 130 ASP B CG    1 
ATOM   2264 O  OD1   . ASP B 2 137 ? 3.162   23.147 -3.429 1.00 62.00  ? 130 ASP B OD1   1 
ATOM   2265 O  OD2   . ASP B 2 137 ? 2.756   21.799 -5.105 1.00 69.13  ? 130 ASP B OD2   1 
ATOM   2266 N  N     . LYS B 2 138 ? 6.190   24.328 -1.815 1.00 58.35  ? 131 LYS B N     1 
ATOM   2267 C  CA    . LYS B 2 138 ? 6.494   24.322 -0.392 1.00 60.45  ? 131 LYS B CA    1 
ATOM   2268 C  C     . LYS B 2 138 ? 5.280   23.920 0.438  1.00 58.03  ? 131 LYS B C     1 
ATOM   2269 O  O     . LYS B 2 138 ? 5.413   23.251 1.461  1.00 51.84  ? 131 LYS B O     1 
ATOM   2270 C  CB    . LYS B 2 138 ? 7.013   25.699 0.033  1.00 65.33  ? 131 LYS B CB    1 
ATOM   2271 C  CG    . LYS B 2 138 ? 7.843   25.682 1.309  1.00 72.21  ? 131 LYS B CG    1 
ATOM   2272 C  CD    . LYS B 2 138 ? 9.118   26.501 1.151  1.00 77.88  ? 131 LYS B CD    1 
ATOM   2273 C  CE    . LYS B 2 138 ? 9.964   26.478 2.413  1.00 82.25  ? 131 LYS B CE    1 
ATOM   2274 N  NZ    . LYS B 2 138 ? 9.483   27.449 3.433  1.00 88.81  ? 131 LYS B NZ    1 
ATOM   2275 N  N     . GLU B 2 139 ? 4.097   24.319 -0.018 1.00 62.13  ? 132 GLU B N     1 
ATOM   2276 C  CA    . GLU B 2 139 ? 2.851   23.960 0.654  1.00 63.27  ? 132 GLU B CA    1 
ATOM   2277 C  C     . GLU B 2 139 ? 2.644   22.444 0.638  1.00 58.51  ? 132 GLU B C     1 
ATOM   2278 O  O     . GLU B 2 139 ? 2.273   21.861 1.658  1.00 55.93  ? 132 GLU B O     1 
ATOM   2279 C  CB    . GLU B 2 139 ? 1.671   24.691 0.004  1.00 69.49  ? 132 GLU B CB    1 
ATOM   2280 C  CG    . GLU B 2 139 ? 0.334   24.489 0.702  1.00 75.90  ? 132 GLU B CG    1 
ATOM   2281 C  CD    . GLU B 2 139 ? -0.672  23.734 -0.151 1.00 84.15  ? 132 GLU B CD    1 
ATOM   2282 O  OE1   . GLU B 2 139 ? -1.082  24.271 -1.206 1.00 86.86  ? 132 GLU B OE1   1 
ATOM   2283 O  OE2   . GLU B 2 139 ? -1.067  22.614 0.238  1.00 80.10  ? 132 GLU B OE2   1 
ATOM   2284 N  N     . LYS B 2 140 ? 2.902   21.821 -0.513 1.00 56.15  ? 133 LYS B N     1 
ATOM   2285 C  CA    . LYS B 2 140 ? 2.901   20.359 -0.641 1.00 53.16  ? 133 LYS B CA    1 
ATOM   2286 C  C     . LYS B 2 140 ? 3.947   19.698 0.264  1.00 48.25  ? 133 LYS B C     1 
ATOM   2287 O  O     . LYS B 2 140 ? 3.665   18.681 0.907  1.00 45.55  ? 133 LYS B O     1 
ATOM   2288 C  CB    . LYS B 2 140 ? 3.164   19.972 -2.092 1.00 55.04  ? 133 LYS B CB    1 
ATOM   2289 C  CG    . LYS B 2 140 ? 3.152   18.483 -2.393 1.00 58.15  ? 133 LYS B CG    1 
ATOM   2290 C  CD    . LYS B 2 140 ? 2.959   18.255 -3.895 1.00 66.89  ? 133 LYS B CD    1 
ATOM   2291 C  CE    . LYS B 2 140 ? 2.556   16.826 -4.244 1.00 71.47  ? 133 LYS B CE    1 
ATOM   2292 N  NZ    . LYS B 2 140 ? 3.731   15.924 -4.427 1.00 70.72  ? 133 LYS B NZ    1 
ATOM   2293 N  N     . TYR B 2 141 ? 5.158   20.260 0.295  1.00 44.86  ? 134 TYR B N     1 
ATOM   2294 C  CA    . TYR B 2 141 ? 6.205   19.754 1.170  1.00 41.12  ? 134 TYR B CA    1 
ATOM   2295 C  C     . TYR B 2 141 ? 5.741   19.706 2.625  1.00 39.67  ? 134 TYR B C     1 
ATOM   2296 O  O     . TYR B 2 141 ? 5.863   18.673 3.305  1.00 35.68  ? 134 TYR B O     1 
ATOM   2297 C  CB    . TYR B 2 141 ? 7.475   20.607 1.055  1.00 42.18  ? 134 TYR B CB    1 
ATOM   2298 C  CG    . TYR B 2 141 ? 8.527   20.197 2.047  1.00 39.45  ? 134 TYR B CG    1 
ATOM   2299 C  CD1   . TYR B 2 141 ? 9.399   19.166 1.752  1.00 38.59  ? 134 TYR B CD1   1 
ATOM   2300 C  CD2   . TYR B 2 141 ? 8.627   20.815 3.291  1.00 37.90  ? 134 TYR B CD2   1 
ATOM   2301 C  CE1   . TYR B 2 141 ? 10.349  18.758 2.656  1.00 38.20  ? 134 TYR B CE1   1 
ATOM   2302 C  CE2   . TYR B 2 141 ? 9.580   20.407 4.215  1.00 37.60  ? 134 TYR B CE2   1 
ATOM   2303 C  CZ    . TYR B 2 141 ? 10.439  19.373 3.883  1.00 36.33  ? 134 TYR B CZ    1 
ATOM   2304 O  OH    . TYR B 2 141 ? 11.413  18.940 4.755  1.00 37.93  ? 134 TYR B OH    1 
ATOM   2305 N  N     . ASN B 2 142 ? 5.213   20.835 3.092  1.00 39.79  ? 135 ASN B N     1 
ATOM   2306 C  CA    . ASN B 2 142 ? 4.779   20.983 4.473  1.00 39.72  ? 135 ASN B CA    1 
ATOM   2307 C  C     . ASN B 2 142 ? 3.642   20.040 4.796  1.00 39.44  ? 135 ASN B C     1 
ATOM   2308 O  O     . ASN B 2 142 ? 3.598   19.493 5.882  1.00 39.16  ? 135 ASN B O     1 
ATOM   2309 C  CB    . ASN B 2 142 ? 4.358   22.438 4.762  1.00 43.26  ? 135 ASN B CB    1 
ATOM   2310 C  CG    . ASN B 2 142 ? 5.545   23.387 4.840  1.00 43.68  ? 135 ASN B CG    1 
ATOM   2311 O  OD1   . ASN B 2 142 ? 6.646   22.997 5.213  1.00 42.28  ? 135 ASN B OD1   1 
ATOM   2312 N  ND2   . ASN B 2 142 ? 5.317   24.647 4.498  1.00 49.38  ? 135 ASN B ND2   1 
ATOM   2313 N  N     . ARG B 2 143 ? 2.732   19.844 3.846  1.00 41.67  ? 136 ARG B N     1 
ATOM   2314 C  CA    . ARG B 2 143 ? 1.639   18.888 4.015  1.00 42.67  ? 136 ARG B CA    1 
ATOM   2315 C  C     . ARG B 2 143 ? 2.169   17.467 4.229  1.00 40.40  ? 136 ARG B C     1 
ATOM   2316 O  O     . ARG B 2 143 ? 1.748   16.771 5.150  1.00 39.03  ? 136 ARG B O     1 
ATOM   2317 C  CB    . ARG B 2 143 ? 0.699   18.934 2.807  1.00 47.80  ? 136 ARG B CB    1 
ATOM   2318 C  CG    . ARG B 2 143 ? -0.264  17.762 2.723  1.00 50.92  ? 136 ARG B CG    1 
ATOM   2319 C  CD    . ARG B 2 143 ? -1.415  18.026 1.753  1.00 55.90  ? 136 ARG B CD    1 
ATOM   2320 N  NE    . ARG B 2 143 ? -1.018  17.934 0.346  1.00 56.60  ? 136 ARG B NE    1 
ATOM   2321 C  CZ    . ARG B 2 143 ? -0.802  18.972 -0.468 1.00 63.73  ? 136 ARG B CZ    1 
ATOM   2322 N  NH1   . ARG B 2 143 ? -0.929  20.229 -0.045 1.00 64.08  ? 136 ARG B NH1   1 
ATOM   2323 N  NH2   . ARG B 2 143 ? -0.459  18.751 -1.734 1.00 67.79  ? 136 ARG B NH2   1 
ATOM   2324 N  N     . HIS B 2 144 ? 3.090   17.046 3.368  1.00 39.70  ? 137 HIS B N     1 
ATOM   2325 C  CA    . HIS B 2 144 ? 3.702   15.728 3.481  1.00 38.39  ? 137 HIS B CA    1 
ATOM   2326 C  C     . HIS B 2 144 ? 4.524   15.539 4.752  1.00 35.50  ? 137 HIS B C     1 
ATOM   2327 O  O     . HIS B 2 144 ? 4.494   14.465 5.356  1.00 34.71  ? 137 HIS B O     1 
ATOM   2328 C  CB    . HIS B 2 144 ? 4.604   15.460 2.288  1.00 38.61  ? 137 HIS B CB    1 
ATOM   2329 C  CG    . HIS B 2 144 ? 3.867   15.234 1.012  1.00 44.14  ? 137 HIS B CG    1 
ATOM   2330 N  ND1   . HIS B 2 144 ? 4.502   15.181 -0.205 1.00 44.15  ? 137 HIS B ND1   1 
ATOM   2331 C  CD2   . HIS B 2 144 ? 2.549   15.055 0.760  1.00 46.54  ? 137 HIS B CD2   1 
ATOM   2332 C  CE1   . HIS B 2 144 ? 3.611   14.958 -1.152 1.00 49.54  ? 137 HIS B CE1   1 
ATOM   2333 N  NE2   . HIS B 2 144 ? 2.418   14.881 -0.593 1.00 49.23  ? 137 HIS B NE2   1 
ATOM   2334 N  N     . ALA B 2 145 ? 5.278   16.564 5.135  1.00 33.61  ? 138 ALA B N     1 
ATOM   2335 C  CA    . ALA B 2 145 ? 6.099   16.487 6.328  1.00 32.23  ? 138 ALA B CA    1 
ATOM   2336 C  C     . ALA B 2 145 ? 5.209   16.380 7.561  1.00 32.03  ? 138 ALA B C     1 
ATOM   2337 O  O     . ALA B 2 145 ? 5.534   15.630 8.471  1.00 32.41  ? 138 ALA B O     1 
ATOM   2338 C  CB    . ALA B 2 145 ? 7.029   17.678 6.429  1.00 31.83  ? 138 ALA B CB    1 
ATOM   2339 N  N     . ARG B 2 146 ? 4.072   17.084 7.565  1.00 34.49  ? 139 ARG B N     1 
ATOM   2340 C  CA    . ARG B 2 146 ? 3.138   17.006 8.701  1.00 35.26  ? 139 ARG B CA    1 
ATOM   2341 C  C     . ARG B 2 146 ? 2.453   15.640 8.738  1.00 34.89  ? 139 ARG B C     1 
ATOM   2342 O  O     . ARG B 2 146 ? 2.301   15.051 9.812  1.00 32.37  ? 139 ARG B O     1 
ATOM   2343 C  CB    . ARG B 2 146 ? 2.102   18.138 8.677  1.00 39.05  ? 139 ARG B CB    1 
ATOM   2344 C  CG    . ARG B 2 146 ? 2.672   19.505 9.062  1.00 43.01  ? 139 ARG B CG    1 
ATOM   2345 C  CD    . ARG B 2 146 ? 1.621   20.606 9.194  1.00 51.07  ? 139 ARG B CD    1 
ATOM   2346 N  NE    . ARG B 2 146 ? 0.521   20.427 8.240  1.00 60.45  ? 139 ARG B NE    1 
ATOM   2347 C  CZ    . ARG B 2 146 ? 0.397   21.030 7.052  1.00 63.85  ? 139 ARG B CZ    1 
ATOM   2348 N  NH1   . ARG B 2 146 ? 1.296   21.915 6.611  1.00 63.41  ? 139 ARG B NH1   1 
ATOM   2349 N  NH2   . ARG B 2 146 ? -0.657  20.748 6.294  1.00 64.00  ? 139 ARG B NH2   1 
ATOM   2350 N  N     . GLU B 2 147 ? 2.057   15.148 7.569  1.00 34.90  ? 140 GLU B N     1 
ATOM   2351 C  CA    . GLU B 2 147 ? 1.440   13.827 7.461  1.00 37.22  ? 140 GLU B CA    1 
ATOM   2352 C  C     . GLU B 2 147 ? 2.358   12.729 7.984  1.00 33.62  ? 140 GLU B C     1 
ATOM   2353 O  O     . GLU B 2 147 ? 1.921   11.878 8.751  1.00 33.93  ? 140 GLU B O     1 
ATOM   2354 C  CB    . GLU B 2 147 ? 0.996   13.543 6.016  1.00 39.63  ? 140 GLU B CB    1 
ATOM   2355 C  CG    . GLU B 2 147 ? -0.247  14.334 5.617  1.00 45.86  ? 140 GLU B CG    1 
ATOM   2356 C  CD    . GLU B 2 147 ? -0.632  14.209 4.149  1.00 52.13  ? 140 GLU B CD    1 
ATOM   2357 O  OE1   . GLU B 2 147 ? 0.157   13.661 3.345  1.00 57.46  ? 140 GLU B OE1   1 
ATOM   2358 O  OE2   . GLU B 2 147 ? -1.732  14.683 3.788  1.00 60.21  ? 140 GLU B OE2   1 
ATOM   2359 N  N     . TRP B 2 148 ? 3.631   12.781 7.622  1.00 31.49  ? 141 TRP B N     1 
ATOM   2360 C  CA    . TRP B 2 148 ? 4.590   11.795 8.098  1.00 31.52  ? 141 TRP B CA    1 
ATOM   2361 C  C     . TRP B 2 148 ? 4.897   11.955 9.579  1.00 29.92  ? 141 TRP B C     1 
ATOM   2362 O  O     . TRP B 2 148 ? 5.130   10.959 10.270 1.00 30.34  ? 141 TRP B O     1 
ATOM   2363 C  CB    . TRP B 2 148 ? 5.894   11.842 7.293  1.00 30.66  ? 141 TRP B CB    1 
ATOM   2364 C  CG    . TRP B 2 148 ? 5.857   11.156 5.979  1.00 34.03  ? 141 TRP B CG    1 
ATOM   2365 C  CD1   . TRP B 2 148 ? 4.812   11.084 5.114  1.00 35.95  ? 141 TRP B CD1   1 
ATOM   2366 C  CD2   . TRP B 2 148 ? 6.957   10.496 5.339  1.00 35.81  ? 141 TRP B CD2   1 
ATOM   2367 N  NE1   . TRP B 2 148 ? 5.174   10.382 3.991  1.00 37.46  ? 141 TRP B NE1   1 
ATOM   2368 C  CE2   . TRP B 2 148 ? 6.493   10.024 4.095  1.00 39.15  ? 141 TRP B CE2   1 
ATOM   2369 C  CE3   . TRP B 2 148 ? 8.292   10.258 5.702  1.00 33.66  ? 141 TRP B CE3   1 
ATOM   2370 C  CZ2   . TRP B 2 148 ? 7.316   9.317  3.205  1.00 39.38  ? 141 TRP B CZ2   1 
ATOM   2371 C  CZ3   . TRP B 2 148 ? 9.115   9.563  4.816  1.00 36.70  ? 141 TRP B CZ3   1 
ATOM   2372 C  CH2   . TRP B 2 148 ? 8.620   9.096  3.586  1.00 38.00  ? 141 TRP B CH2   1 
ATOM   2373 N  N     . THR B 2 149 ? 4.947   13.192 10.072 1.00 28.65  ? 142 THR B N     1 
ATOM   2374 C  CA    . THR B 2 149 ? 5.079   13.419 11.508 1.00 28.09  ? 142 THR B CA    1 
ATOM   2375 C  C     . THR B 2 149 ? 3.937   12.732 12.283 1.00 29.98  ? 142 THR B C     1 
ATOM   2376 O  O     . THR B 2 149 ? 4.184   12.024 13.238 1.00 31.74  ? 142 THR B O     1 
ATOM   2377 C  CB    . THR B 2 149 ? 5.145   14.932 11.846 1.00 27.93  ? 142 THR B CB    1 
ATOM   2378 O  OG1   . THR B 2 149 ? 6.233   15.525 11.141 1.00 27.16  ? 142 THR B OG1   1 
ATOM   2379 C  CG2   . THR B 2 149 ? 5.367   15.153 13.316 1.00 27.55  ? 142 THR B CG2   1 
ATOM   2380 N  N     . GLN B 2 150 ? 2.699   12.934 11.853 1.00 32.40  ? 143 GLN B N     1 
ATOM   2381 C  CA    . GLN B 2 150 ? 1.545   12.314 12.497 1.00 35.09  ? 143 GLN B CA    1 
ATOM   2382 C  C     . GLN B 2 150 ? 1.590   10.785 12.403 1.00 36.13  ? 143 GLN B C     1 
ATOM   2383 O  O     . GLN B 2 150 ? 1.328   10.088 13.382 1.00 36.66  ? 143 GLN B O     1 
ATOM   2384 C  CB    . GLN B 2 150 ? 0.260   12.849 11.873 1.00 38.03  ? 143 GLN B CB    1 
ATOM   2385 C  CG    . GLN B 2 150 ? 0.050   14.329 12.157 1.00 40.68  ? 143 GLN B CG    1 
ATOM   2386 C  CD    . GLN B 2 150 ? -0.949  14.966 11.224 1.00 48.21  ? 143 GLN B CD    1 
ATOM   2387 O  OE1   . GLN B 2 150 ? -1.661  14.275 10.507 1.00 50.68  ? 143 GLN B OE1   1 
ATOM   2388 N  NE2   . GLN B 2 150 ? -1.017  16.294 11.241 1.00 51.54  ? 143 GLN B NE2   1 
ATOM   2389 N  N     . LYS B 2 151 ? 1.952   10.283 11.230 1.00 36.69  ? 144 LYS B N     1 
ATOM   2390 C  CA    . LYS B 2 151 ? 1.960   8.846  10.959 1.00 39.61  ? 144 LYS B CA    1 
ATOM   2391 C  C     . LYS B 2 151 ? 3.057   8.108  11.729 1.00 37.57  ? 144 LYS B C     1 
ATOM   2392 O  O     . LYS B 2 151 ? 2.786   7.095  12.379 1.00 36.52  ? 144 LYS B O     1 
ATOM   2393 C  CB    . LYS B 2 151 ? 2.106   8.610  9.451  1.00 43.93  ? 144 LYS B CB    1 
ATOM   2394 C  CG    . LYS B 2 151 ? 1.910   7.171  9.010  1.00 52.98  ? 144 LYS B CG    1 
ATOM   2395 C  CD    . LYS B 2 151 ? 1.279   7.097  7.620  1.00 59.04  ? 144 LYS B CD    1 
ATOM   2396 C  CE    . LYS B 2 151 ? 0.874   5.672  7.248  1.00 67.30  ? 144 LYS B CE    1 
ATOM   2397 N  NZ    . LYS B 2 151 ? 2.014   4.885  6.702  1.00 65.10  ? 144 LYS B NZ    1 
ATOM   2398 N  N     . TYR B 2 152 ? 4.279   8.633  11.688 1.00 34.34  ? 145 TYR B N     1 
ATOM   2399 C  CA    . TYR B 2 152 ? 5.451   7.922  12.193 1.00 34.68  ? 145 TYR B CA    1 
ATOM   2400 C  C     . TYR B 2 152 ? 6.070   8.457  13.489 1.00 34.67  ? 145 TYR B C     1 
ATOM   2401 O  O     . TYR B 2 152 ? 6.792   7.721  14.171 1.00 35.52  ? 145 TYR B O     1 
ATOM   2402 C  CB    . TYR B 2 152 ? 6.540   7.892  11.112 1.00 33.35  ? 145 TYR B CB    1 
ATOM   2403 C  CG    . TYR B 2 152 ? 6.094   7.309  9.809  1.00 36.36  ? 145 TYR B CG    1 
ATOM   2404 C  CD1   . TYR B 2 152 ? 5.696   5.970  9.719  1.00 41.72  ? 145 TYR B CD1   1 
ATOM   2405 C  CD2   . TYR B 2 152 ? 6.042   8.081  8.660  1.00 37.57  ? 145 TYR B CD2   1 
ATOM   2406 C  CE1   . TYR B 2 152 ? 5.276   5.432  8.520  1.00 44.28  ? 145 TYR B CE1   1 
ATOM   2407 C  CE2   . TYR B 2 152 ? 5.628   7.549  7.457  1.00 40.20  ? 145 TYR B CE2   1 
ATOM   2408 C  CZ    . TYR B 2 152 ? 5.251   6.223  7.390  1.00 44.88  ? 145 TYR B CZ    1 
ATOM   2409 O  OH    . TYR B 2 152 ? 4.840   5.693  6.191  1.00 46.71  ? 145 TYR B OH    1 
ATOM   2410 N  N     . ALA B 2 153 ? 5.793   9.714  13.847 1.00 32.40  ? 146 ALA B N     1 
ATOM   2411 C  CA    . ALA B 2 153 ? 6.439   10.333 14.988 1.00 29.51  ? 146 ALA B CA    1 
ATOM   2412 C  C     . ALA B 2 153 ? 5.490   10.855 16.068 1.00 30.15  ? 146 ALA B C     1 
ATOM   2413 O  O     . ALA B 2 153 ? 5.927   11.586 16.940 1.00 30.76  ? 146 ALA B O     1 
ATOM   2414 C  CB    . ALA B 2 153 ? 7.361   11.452 14.517 1.00 27.69  ? 146 ALA B CB    1 
ATOM   2415 N  N     . MET B 2 154 ? 4.211   10.488 16.019 1.00 31.60  ? 147 MET B N     1 
ATOM   2416 C  CA    . MET B 2 154 ? 3.267   10.794 17.094 1.00 34.03  ? 147 MET B CA    1 
ATOM   2417 C  C     . MET B 2 154 ? 2.591   9.529  17.585 1.00 38.09  ? 147 MET B C     1 
ATOM   2418 O  O     . MET B 2 154 ? 2.585   8.500  16.891 1.00 40.90  ? 147 MET B O     1 
ATOM   2419 C  CB    . MET B 2 154 ? 2.181   11.757 16.630 1.00 33.65  ? 147 MET B CB    1 
ATOM   2420 C  CG    . MET B 2 154 ? 2.707   13.110 16.199 1.00 32.92  ? 147 MET B CG    1 
ATOM   2421 S  SD    . MET B 2 154 ? 1.353   14.210 15.807 1.00 35.54  ? 147 MET B SD    1 
ATOM   2422 C  CE    . MET B 2 154 ? 2.297   15.647 15.281 1.00 33.93  ? 147 MET B CE    1 
ATOM   2423 O  OXT   . MET B 2 154 ? 1.996   9.536  18.666 1.00 40.52  ? 147 MET B OXT   1 
ATOM   2424 N  N     . SER C 1 2   ? -16.847 29.704 15.914 1.00 52.09  ? 30  SER C N     1 
ATOM   2425 C  CA    . SER C 1 2   ? -17.966 30.699 15.825 1.00 49.42  ? 30  SER C CA    1 
ATOM   2426 C  C     . SER C 1 2   ? -17.910 31.723 16.956 1.00 48.67  ? 30  SER C C     1 
ATOM   2427 O  O     . SER C 1 2   ? -17.760 31.372 18.138 1.00 44.62  ? 30  SER C O     1 
ATOM   2428 C  CB    . SER C 1 2   ? -19.327 29.989 15.846 1.00 47.75  ? 30  SER C CB    1 
ATOM   2429 O  OG    . SER C 1 2   ? -20.402 30.909 15.756 1.00 44.49  ? 30  SER C OG    1 
ATOM   2430 N  N     . LEU C 1 3   ? -18.033 32.997 16.594 1.00 49.78  ? 31  LEU C N     1 
ATOM   2431 C  CA    . LEU C 1 3   ? -18.157 34.052 17.590 1.00 50.77  ? 31  LEU C CA    1 
ATOM   2432 C  C     . LEU C 1 3   ? -19.614 34.252 18.033 1.00 48.79  ? 31  LEU C C     1 
ATOM   2433 O  O     . LEU C 1 3   ? -19.864 34.871 19.070 1.00 50.39  ? 31  LEU C O     1 
ATOM   2434 C  CB    . LEU C 1 3   ? -17.572 35.361 17.048 1.00 55.40  ? 31  LEU C CB    1 
ATOM   2435 C  CG    . LEU C 1 3   ? -16.045 35.335 16.889 1.00 58.30  ? 31  LEU C CG    1 
ATOM   2436 C  CD1   . LEU C 1 3   ? -15.514 36.585 16.210 1.00 58.61  ? 31  LEU C CD1   1 
ATOM   2437 C  CD2   . LEU C 1 3   ? -15.356 35.146 18.238 1.00 60.42  ? 31  LEU C CD2   1 
ATOM   2438 N  N     . THR C 1 4   ? -20.563 33.733 17.252 1.00 43.59  ? 32  THR C N     1 
ATOM   2439 C  CA    . THR C 1 4   ? -21.985 34.006 17.466 1.00 42.99  ? 32  THR C CA    1 
ATOM   2440 C  C     . THR C 1 4   ? -22.769 32.825 18.071 1.00 41.22  ? 32  THR C C     1 
ATOM   2441 O  O     . THR C 1 4   ? -23.845 33.021 18.619 1.00 41.89  ? 32  THR C O     1 
ATOM   2442 C  CB    . THR C 1 4   ? -22.666 34.448 16.148 1.00 42.88  ? 32  THR C CB    1 
ATOM   2443 O  OG1   . THR C 1 4   ? -22.624 33.389 15.191 1.00 40.09  ? 32  THR C OG1   1 
ATOM   2444 C  CG2   . THR C 1 4   ? -21.973 35.665 15.550 1.00 46.53  ? 32  THR C CG2   1 
ATOM   2445 N  N     . VAL C 1 5   ? -22.257 31.605 17.956 1.00 40.13  ? 33  VAL C N     1 
ATOM   2446 C  CA    . VAL C 1 5   ? -22.934 30.429 18.549 1.00 38.09  ? 33  VAL C CA    1 
ATOM   2447 C  C     . VAL C 1 5   ? -21.938 29.704 19.448 1.00 35.10  ? 33  VAL C C     1 
ATOM   2448 O  O     . VAL C 1 5   ? -20.807 29.451 19.046 1.00 33.91  ? 33  VAL C O     1 
ATOM   2449 C  CB    . VAL C 1 5   ? -23.495 29.495 17.458 1.00 39.38  ? 33  VAL C CB    1 
ATOM   2450 C  CG1   . VAL C 1 5   ? -24.113 28.229 18.043 1.00 37.50  ? 33  VAL C CG1   1 
ATOM   2451 C  CG2   . VAL C 1 5   ? -24.542 30.227 16.626 1.00 44.14  ? 33  VAL C CG2   1 
ATOM   2452 N  N     . PRO C 1 6   ? -22.356 29.350 20.668 1.00 34.33  ? 34  PRO C N     1 
ATOM   2453 C  CA    . PRO C 1 6   ? -21.413 28.733 21.585 1.00 33.04  ? 34  PRO C CA    1 
ATOM   2454 C  C     . PRO C 1 6   ? -20.954 27.351 21.116 1.00 32.79  ? 34  PRO C C     1 
ATOM   2455 O  O     . PRO C 1 6   ? -21.587 26.746 20.257 1.00 28.50  ? 34  PRO C O     1 
ATOM   2456 C  CB    . PRO C 1 6   ? -22.218 28.603 22.879 1.00 32.86  ? 34  PRO C CB    1 
ATOM   2457 C  CG    . PRO C 1 6   ? -23.621 28.535 22.449 1.00 33.68  ? 34  PRO C CG    1 
ATOM   2458 C  CD    . PRO C 1 6   ? -23.715 29.413 21.236 1.00 34.61  ? 34  PRO C CD    1 
ATOM   2459 N  N     . GLU C 1 7   ? -19.841 26.902 21.681 1.00 32.27  ? 35  GLU C N     1 
ATOM   2460 C  CA    . GLU C 1 7   ? -19.310 25.584 21.439 1.00 33.49  ? 35  GLU C CA    1 
ATOM   2461 C  C     . GLU C 1 7   ? -20.014 24.609 22.380 1.00 30.52  ? 35  GLU C C     1 
ATOM   2462 O  O     . GLU C 1 7   ? -20.204 24.893 23.549 1.00 33.12  ? 35  GLU C O     1 
ATOM   2463 C  CB    . GLU C 1 7   ? -17.800 25.611 21.691 1.00 38.47  ? 35  GLU C CB    1 
ATOM   2464 C  CG    . GLU C 1 7   ? -17.050 24.363 21.266 1.00 40.98  ? 35  GLU C CG    1 
ATOM   2465 C  CD    . GLU C 1 7   ? -15.552 24.478 21.525 1.00 52.16  ? 35  GLU C CD    1 
ATOM   2466 O  OE1   . GLU C 1 7   ? -15.004 23.621 22.262 1.00 48.23  ? 35  GLU C OE1   1 
ATOM   2467 O  OE2   . GLU C 1 7   ? -14.931 25.439 21.003 1.00 54.28  ? 35  GLU C OE2   1 
ATOM   2468 N  N     . CYS C 1 8   ? -20.449 23.491 21.848 1.00 28.18  ? 36  CYS C N     1 
ATOM   2469 C  CA    . CYS C 1 8   ? -20.970 22.392 22.654 1.00 26.74  ? 36  CYS C CA    1 
ATOM   2470 C  C     . CYS C 1 8   ? -19.830 21.649 23.389 1.00 25.49  ? 36  CYS C C     1 
ATOM   2471 O  O     . CYS C 1 8   ? -18.862 21.239 22.772 1.00 26.93  ? 36  CYS C O     1 
ATOM   2472 C  CB    . CYS C 1 8   ? -21.733 21.467 21.734 1.00 25.18  ? 36  CYS C CB    1 
ATOM   2473 S  SG    . CYS C 1 8   ? -22.410 19.957 22.439 1.00 23.71  ? 36  CYS C SG    1 
ATOM   2474 N  N     . ALA C 1 9   ? -19.938 21.490 24.700 1.00 24.09  ? 37  ALA C N     1 
ATOM   2475 C  CA    . ALA C 1 9   ? -18.866 20.868 25.457 1.00 25.17  ? 37  ALA C CA    1 
ATOM   2476 C  C     . ALA C 1 9   ? -18.914 19.341 25.356 1.00 24.76  ? 37  ALA C C     1 
ATOM   2477 O  O     . ALA C 1 9   ? -17.994 18.700 25.797 1.00 26.37  ? 37  ALA C O     1 
ATOM   2478 C  CB    . ALA C 1 9   ? -18.911 21.284 26.908 1.00 25.90  ? 37  ALA C CB    1 
ATOM   2479 N  N     . ILE C 1 10  ? -19.981 18.787 24.796 1.00 23.67  ? 38  ILE C N     1 
ATOM   2480 C  CA    . ILE C 1 10  ? -20.056 17.344 24.520 1.00 24.11  ? 38  ILE C CA    1 
ATOM   2481 C  C     . ILE C 1 10  ? -19.248 16.977 23.258 1.00 24.54  ? 38  ILE C C     1 
ATOM   2482 O  O     . ILE C 1 10  ? -18.308 16.178 23.329 1.00 24.64  ? 38  ILE C O     1 
ATOM   2483 C  CB    . ILE C 1 10  ? -21.530 16.881 24.430 1.00 23.54  ? 38  ILE C CB    1 
ATOM   2484 C  CG1   . ILE C 1 10  ? -22.234 17.079 25.784 1.00 24.65  ? 38  ILE C CG1   1 
ATOM   2485 C  CG2   . ILE C 1 10  ? -21.607 15.417 24.004 1.00 24.29  ? 38  ILE C CG2   1 
ATOM   2486 C  CD1   . ILE C 1 10  ? -23.721 16.738 25.828 1.00 24.96  ? 38  ILE C CD1   1 
ATOM   2487 N  N     . CYS C 1 11  ? -19.616 17.551 22.106 1.00 23.63  ? 39  CYS C N     1 
ATOM   2488 C  CA    . CYS C 1 11  ? -18.969 17.212 20.853 1.00 24.95  ? 39  CYS C CA    1 
ATOM   2489 C  C     . CYS C 1 11  ? -17.768 18.112 20.474 1.00 24.56  ? 39  CYS C C     1 
ATOM   2490 O  O     . CYS C 1 11  ? -17.065 17.816 19.538 1.00 25.29  ? 39  CYS C O     1 
ATOM   2491 C  CB    . CYS C 1 11  ? -20.010 17.197 19.728 1.00 24.80  ? 39  CYS C CB    1 
ATOM   2492 S  SG    . CYS C 1 11  ? -20.678 18.826 19.302 1.00 25.66  ? 39  CYS C SG    1 
ATOM   2493 N  N     . LEU C 1 12  ? -17.574 19.213 21.194 1.00 26.58  ? 40  LEU C N     1 
ATOM   2494 C  CA    . LEU C 1 12  ? -16.539 20.222 20.924 1.00 27.95  ? 40  LEU C CA    1 
ATOM   2495 C  C     . LEU C 1 12  ? -16.659 20.935 19.571 1.00 29.54  ? 40  LEU C C     1 
ATOM   2496 O  O     . LEU C 1 12  ? -15.703 21.559 19.120 1.00 30.90  ? 40  LEU C O     1 
ATOM   2497 C  CB    . LEU C 1 12  ? -15.118 19.660 21.078 1.00 28.91  ? 40  LEU C CB    1 
ATOM   2498 C  CG    . LEU C 1 12  ? -14.722 19.112 22.448 1.00 29.57  ? 40  LEU C CG    1 
ATOM   2499 C  CD1   . LEU C 1 12  ? -13.297 18.592 22.400 1.00 31.50  ? 40  LEU C CD1   1 
ATOM   2500 C  CD2   . LEU C 1 12  ? -14.862 20.179 23.514 1.00 29.80  ? 40  LEU C CD2   1 
ATOM   2501 N  N     . GLN C 1 13  ? -17.822 20.855 18.945 1.00 29.03  ? 41  GLN C N     1 
ATOM   2502 C  CA    . GLN C 1 13  ? -18.115 21.629 17.726 1.00 30.41  ? 41  GLN C CA    1 
ATOM   2503 C  C     . GLN C 1 13  ? -19.013 22.775 18.113 1.00 28.75  ? 41  GLN C C     1 
ATOM   2504 O  O     . GLN C 1 13  ? -19.570 22.772 19.194 1.00 26.99  ? 41  GLN C O     1 
ATOM   2505 C  CB    . GLN C 1 13  ? -18.870 20.795 16.712 1.00 30.66  ? 41  GLN C CB    1 
ATOM   2506 C  CG    . GLN C 1 13  ? -18.264 19.433 16.409 1.00 36.84  ? 41  GLN C CG    1 
ATOM   2507 C  CD    . GLN C 1 13  ? -17.083 19.531 15.481 1.00 46.01  ? 41  GLN C CD    1 
ATOM   2508 O  OE1   . GLN C 1 13  ? -16.715 20.626 15.034 1.00 43.97  ? 41  GLN C OE1   1 
ATOM   2509 N  NE2   . GLN C 1 13  ? -16.476 18.386 15.176 1.00 48.60  ? 41  GLN C NE2   1 
ATOM   2510 N  N     . THR C 1 14  ? -19.146 23.761 17.224 1.00 29.05  ? 42  THR C N     1 
ATOM   2511 C  CA    . THR C 1 14  ? -20.187 24.781 17.341 1.00 29.12  ? 42  THR C CA    1 
ATOM   2512 C  C     . THR C 1 14  ? -21.543 24.115 17.441 1.00 26.64  ? 42  THR C C     1 
ATOM   2513 O  O     . THR C 1 14  ? -21.821 23.198 16.671 1.00 25.41  ? 42  THR C O     1 
ATOM   2514 C  CB    . THR C 1 14  ? -20.175 25.731 16.122 1.00 31.18  ? 42  THR C CB    1 
ATOM   2515 O  OG1   . THR C 1 14  ? -18.903 26.376 16.057 1.00 32.04  ? 42  THR C OG1   1 
ATOM   2516 C  CG2   . THR C 1 14  ? -21.254 26.792 16.264 1.00 32.64  ? 42  THR C CG2   1 
ATOM   2517 N  N     . CYS C 1 15  ? -22.367 24.533 18.408 1.00 25.97  ? 43  CYS C N     1 
ATOM   2518 C  CA    . CYS C 1 15  ? -23.688 23.937 18.606 1.00 25.97  ? 43  CYS C CA    1 
ATOM   2519 C  C     . CYS C 1 15  ? -24.558 23.993 17.349 1.00 26.13  ? 43  CYS C C     1 
ATOM   2520 O  O     . CYS C 1 15  ? -24.654 25.031 16.681 1.00 25.17  ? 43  CYS C O     1 
ATOM   2521 C  CB    . CYS C 1 15  ? -24.476 24.614 19.732 1.00 27.72  ? 43  CYS C CB    1 
ATOM   2522 S  SG    . CYS C 1 15  ? -23.910 24.343 21.431 1.00 30.24  ? 43  CYS C SG    1 
ATOM   2523 N  N     . VAL C 1 16  ? -25.171 22.862 17.043 1.00 24.96  ? 44  VAL C N     1 
ATOM   2524 C  CA    . VAL C 1 16  ? -26.247 22.780 16.068 1.00 26.04  ? 44  VAL C CA    1 
ATOM   2525 C  C     . VAL C 1 16  ? -27.535 22.618 16.856 1.00 24.20  ? 44  VAL C C     1 
ATOM   2526 O  O     . VAL C 1 16  ? -27.629 21.730 17.703 1.00 22.73  ? 44  VAL C O     1 
ATOM   2527 C  CB    . VAL C 1 16  ? -25.998 21.609 15.096 1.00 29.50  ? 44  VAL C CB    1 
ATOM   2528 C  CG1   . VAL C 1 16  ? -27.146 21.444 14.113 1.00 31.31  ? 44  VAL C CG1   1 
ATOM   2529 C  CG2   . VAL C 1 16  ? -24.698 21.852 14.348 1.00 35.30  ? 44  VAL C CG2   1 
ATOM   2530 N  N     . HIS C 1 17  ? -28.518 23.486 16.591 1.00 24.85  ? 45  HIS C N     1 
ATOM   2531 C  CA    . HIS C 1 17  ? -29.762 23.552 17.370 1.00 26.05  ? 45  HIS C CA    1 
ATOM   2532 C  C     . HIS C 1 17  ? -29.493 23.607 18.865 1.00 25.41  ? 45  HIS C C     1 
ATOM   2533 O  O     . HIS C 1 17  ? -29.838 22.669 19.605 1.00 25.86  ? 45  HIS C O     1 
ATOM   2534 C  CB    . HIS C 1 17  ? -30.669 22.375 17.032 1.00 27.30  ? 45  HIS C CB    1 
ATOM   2535 C  CG    . HIS C 1 17  ? -31.059 22.344 15.602 1.00 31.11  ? 45  HIS C CG    1 
ATOM   2536 N  ND1   . HIS C 1 17  ? -31.770 23.369 15.016 1.00 34.59  ? 45  HIS C ND1   1 
ATOM   2537 C  CD2   . HIS C 1 17  ? -30.807 21.443 14.627 1.00 32.93  ? 45  HIS C CD2   1 
ATOM   2538 C  CE1   . HIS C 1 17  ? -31.954 23.090 13.738 1.00 38.30  ? 45  HIS C CE1   1 
ATOM   2539 N  NE2   . HIS C 1 17  ? -31.376 21.930 13.477 1.00 35.51  ? 45  HIS C NE2   1 
ATOM   2540 N  N     . PRO C 1 18  ? -28.854 24.696 19.317 1.00 24.13  ? 46  PRO C N     1 
ATOM   2541 C  CA    . PRO C 1 18  ? -28.471 24.745 20.711 1.00 25.05  ? 46  PRO C CA    1 
ATOM   2542 C  C     . PRO C 1 18  ? -29.703 24.788 21.602 1.00 25.78  ? 46  PRO C C     1 
ATOM   2543 O  O     . PRO C 1 18  ? -30.673 25.505 21.312 1.00 26.81  ? 46  PRO C O     1 
ATOM   2544 C  CB    . PRO C 1 18  ? -27.664 26.049 20.819 1.00 26.32  ? 46  PRO C CB    1 
ATOM   2545 C  CG    . PRO C 1 18  ? -28.073 26.852 19.636 1.00 26.61  ? 46  PRO C CG    1 
ATOM   2546 C  CD    . PRO C 1 18  ? -28.338 25.852 18.559 1.00 25.67  ? 46  PRO C CD    1 
ATOM   2547 N  N     . VAL C 1 19  ? -29.676 24.007 22.669 1.00 25.94  ? 47  VAL C N     1 
ATOM   2548 C  CA    . VAL C 1 19  ? -30.774 23.989 23.629 1.00 26.80  ? 47  VAL C CA    1 
ATOM   2549 C  C     . VAL C 1 19  ? -30.239 24.404 24.979 1.00 28.13  ? 47  VAL C C     1 
ATOM   2550 O  O     . VAL C 1 19  ? -29.078 24.161 25.295 1.00 28.76  ? 47  VAL C O     1 
ATOM   2551 C  CB    . VAL C 1 19  ? -31.506 22.613 23.709 1.00 28.10  ? 47  VAL C CB    1 
ATOM   2552 C  CG1   . VAL C 1 19  ? -32.225 22.315 22.415 1.00 28.51  ? 47  VAL C CG1   1 
ATOM   2553 C  CG2   . VAL C 1 19  ? -30.583 21.476 24.068 1.00 28.19  ? 47  VAL C CG2   1 
ATOM   2554 N  N     . SER C 1 20  ? -31.095 25.043 25.768 1.00 28.66  ? 48  SER C N     1 
ATOM   2555 C  CA    . SER C 1 20  ? -30.710 25.618 27.037 1.00 30.49  ? 48  SER C CA    1 
ATOM   2556 C  C     . SER C 1 20  ? -31.378 24.803 28.147 1.00 31.68  ? 48  SER C C     1 
ATOM   2557 O  O     . SER C 1 20  ? -32.619 24.711 28.201 1.00 32.51  ? 48  SER C O     1 
ATOM   2558 C  CB    . SER C 1 20  ? -31.154 27.088 27.076 1.00 33.78  ? 48  SER C CB    1 
ATOM   2559 O  OG    . SER C 1 20  ? -30.612 27.737 28.198 1.00 39.96  ? 48  SER C OG    1 
ATOM   2560 N  N     . LEU C 1 21  ? -30.563 24.164 28.986 1.00 31.14  ? 49  LEU C N     1 
ATOM   2561 C  CA    . LEU C 1 21  ? -31.072 23.403 30.124 1.00 32.86  ? 49  LEU C CA    1 
ATOM   2562 C  C     . LEU C 1 21  ? -31.511 24.363 31.241 1.00 35.14  ? 49  LEU C C     1 
ATOM   2563 O  O     . LEU C 1 21  ? -31.145 25.557 31.239 1.00 33.21  ? 49  LEU C O     1 
ATOM   2564 C  CB    . LEU C 1 21  ? -30.005 22.420 30.639 1.00 32.19  ? 49  LEU C CB    1 
ATOM   2565 C  CG    . LEU C 1 21  ? -29.500 21.392 29.622 1.00 30.94  ? 49  LEU C CG    1 
ATOM   2566 C  CD1   . LEU C 1 21  ? -28.388 20.534 30.204 1.00 31.55  ? 49  LEU C CD1   1 
ATOM   2567 C  CD2   . LEU C 1 21  ? -30.638 20.529 29.122 1.00 32.46  ? 49  LEU C CD2   1 
ATOM   2568 N  N     . PRO C 1 22  ? -32.285 23.856 32.223 1.00 38.78  ? 50  PRO C N     1 
ATOM   2569 C  CA    . PRO C 1 22  ? -32.695 24.737 33.314 1.00 38.05  ? 50  PRO C CA    1 
ATOM   2570 C  C     . PRO C 1 22  ? -31.533 25.393 34.053 1.00 39.38  ? 50  PRO C C     1 
ATOM   2571 O  O     . PRO C 1 22  ? -31.677 26.518 34.516 1.00 36.87  ? 50  PRO C O     1 
ATOM   2572 C  CB    . PRO C 1 22  ? -33.478 23.812 34.239 1.00 40.48  ? 50  PRO C CB    1 
ATOM   2573 C  CG    . PRO C 1 22  ? -34.022 22.761 33.329 1.00 39.73  ? 50  PRO C CG    1 
ATOM   2574 C  CD    . PRO C 1 22  ? -32.963 22.548 32.291 1.00 37.39  ? 50  PRO C CD    1 
ATOM   2575 N  N     . CYS C 1 23  ? -30.391 24.713 34.122 1.00 36.70  ? 51  CYS C N     1 
ATOM   2576 C  CA    . CYS C 1 23  ? -29.161 25.264 34.702 1.00 37.76  ? 51  CYS C CA    1 
ATOM   2577 C  C     . CYS C 1 23  ? -28.450 26.313 33.829 1.00 38.75  ? 51  CYS C C     1 
ATOM   2578 O  O     . CYS C 1 23  ? -27.441 26.907 34.243 1.00 38.29  ? 51  CYS C O     1 
ATOM   2579 C  CB    . CYS C 1 23  ? -28.183 24.120 34.984 1.00 38.01  ? 51  CYS C CB    1 
ATOM   2580 S  SG    . CYS C 1 23  ? -27.719 23.156 33.518 1.00 34.81  ? 51  CYS C SG    1 
ATOM   2581 N  N     . LYS C 1 24  ? -28.980 26.515 32.630 1.00 38.39  ? 52  LYS C N     1 
ATOM   2582 C  CA    . LYS C 1 24  ? -28.498 27.486 31.648 1.00 40.22  ? 52  LYS C CA    1 
ATOM   2583 C  C     . LYS C 1 24  ? -27.286 27.047 30.827 1.00 35.76  ? 52  LYS C C     1 
ATOM   2584 O  O     . LYS C 1 24  ? -26.816 27.827 29.989 1.00 36.07  ? 52  LYS C O     1 
ATOM   2585 C  CB    . LYS C 1 24  ? -28.281 28.875 32.250 1.00 45.06  ? 52  LYS C CB    1 
ATOM   2586 C  CG    . LYS C 1 24  ? -29.548 29.466 32.837 1.00 54.55  ? 52  LYS C CG    1 
ATOM   2587 C  CD    . LYS C 1 24  ? -29.345 30.926 33.219 1.00 64.47  ? 52  LYS C CD    1 
ATOM   2588 C  CE    . LYS C 1 24  ? -30.492 31.446 34.079 1.00 77.02  ? 52  LYS C CE    1 
ATOM   2589 N  NZ    . LYS C 1 24  ? -31.830 31.167 33.474 1.00 79.21  ? 52  LYS C NZ    1 
ATOM   2590 N  N     . HIS C 1 25  ? -26.815 25.810 31.002 1.00 31.91  ? 53  HIS C N     1 
ATOM   2591 C  CA    . HIS C 1 25  ? -25.831 25.260 30.075 1.00 30.19  ? 53  HIS C CA    1 
ATOM   2592 C  C     . HIS C 1 25  ? -26.492 24.918 28.746 1.00 27.40  ? 53  HIS C C     1 
ATOM   2593 O  O     . HIS C 1 25  ? -27.671 24.543 28.680 1.00 27.23  ? 53  HIS C O     1 
ATOM   2594 C  CB    . HIS C 1 25  ? -25.049 24.083 30.691 1.00 29.94  ? 53  HIS C CB    1 
ATOM   2595 C  CG    . HIS C 1 25  ? -24.164 24.507 31.807 1.00 32.88  ? 53  HIS C CG    1 
ATOM   2596 N  ND1   . HIS C 1 25  ? -24.366 24.115 33.110 1.00 35.03  ? 53  HIS C ND1   1 
ATOM   2597 C  CD2   . HIS C 1 25  ? -23.124 25.372 31.831 1.00 34.78  ? 53  HIS C CD2   1 
ATOM   2598 C  CE1   . HIS C 1 25  ? -23.465 24.690 33.883 1.00 37.77  ? 53  HIS C CE1   1 
ATOM   2599 N  NE2   . HIS C 1 25  ? -22.694 25.451 33.129 1.00 37.91  ? 53  HIS C NE2   1 
ATOM   2600 N  N     . VAL C 1 26  ? -25.718 25.113 27.694 1.00 26.98  ? 54  VAL C N     1 
ATOM   2601 C  CA    . VAL C 1 26  ? -26.157 24.942 26.311 1.00 26.32  ? 54  VAL C CA    1 
ATOM   2602 C  C     . VAL C 1 26  ? -25.373 23.828 25.589 1.00 25.04  ? 54  VAL C C     1 
ATOM   2603 O  O     . VAL C 1 26  ? -24.154 23.767 25.681 1.00 25.66  ? 54  VAL C O     1 
ATOM   2604 C  CB    . VAL C 1 26  ? -25.978 26.259 25.536 1.00 28.08  ? 54  VAL C CB    1 
ATOM   2605 C  CG1   . VAL C 1 26  ? -26.421 26.084 24.093 1.00 28.05  ? 54  VAL C CG1   1 
ATOM   2606 C  CG2   . VAL C 1 26  ? -26.767 27.361 26.216 1.00 28.73  ? 54  VAL C CG2   1 
ATOM   2607 N  N     . PHE C 1 27  ? -26.095 22.988 24.852 1.00 23.46  ? 55  PHE C N     1 
ATOM   2608 C  CA    . PHE C 1 27  ? -25.514 21.881 24.055 1.00 23.47  ? 55  PHE C CA    1 
ATOM   2609 C  C     . PHE C 1 27  ? -26.329 21.693 22.777 1.00 24.06  ? 55  PHE C C     1 
ATOM   2610 O  O     . PHE C 1 27  ? -27.503 22.112 22.700 1.00 23.11  ? 55  PHE C O     1 
ATOM   2611 C  CB    . PHE C 1 27  ? -25.580 20.562 24.845 1.00 22.07  ? 55  PHE C CB    1 
ATOM   2612 C  CG    . PHE C 1 27  ? -24.990 20.641 26.225 1.00 22.62  ? 55  PHE C CG    1 
ATOM   2613 C  CD1   . PHE C 1 27  ? -25.797 20.866 27.321 1.00 23.63  ? 55  PHE C CD1   1 
ATOM   2614 C  CD2   . PHE C 1 27  ? -23.634 20.490 26.428 1.00 22.90  ? 55  PHE C CD2   1 
ATOM   2615 C  CE1   . PHE C 1 27  ? -25.262 20.928 28.584 1.00 23.90  ? 55  PHE C CE1   1 
ATOM   2616 C  CE2   . PHE C 1 27  ? -23.098 20.541 27.696 1.00 23.65  ? 55  PHE C CE2   1 
ATOM   2617 C  CZ    . PHE C 1 27  ? -23.902 20.751 28.774 1.00 24.64  ? 55  PHE C CZ    1 
ATOM   2618 N  N     . CYS C 1 28  ? -25.746 21.032 21.779 1.00 24.68  ? 56  CYS C N     1 
ATOM   2619 C  CA    . CYS C 1 28  ? -26.543 20.638 20.607 1.00 25.38  ? 56  CYS C CA    1 
ATOM   2620 C  C     . CYS C 1 28  ? -27.752 19.808 21.081 1.00 23.85  ? 56  CYS C C     1 
ATOM   2621 O  O     . CYS C 1 28  ? -27.615 18.975 21.982 1.00 22.43  ? 56  CYS C O     1 
ATOM   2622 C  CB    . CYS C 1 28  ? -25.750 19.776 19.608 1.00 23.98  ? 56  CYS C CB    1 
ATOM   2623 S  SG    . CYS C 1 28  ? -24.092 20.299 19.122 1.00 26.41  ? 56  CYS C SG    1 
ATOM   2624 N  N     . TYR C 1 29  ? -28.926 20.022 20.489 1.00 21.64  ? 57  TYR C N     1 
ATOM   2625 C  CA    . TYR C 1 29  ? -30.094 19.187 20.799 1.00 22.79  ? 57  TYR C CA    1 
ATOM   2626 C  C     . TYR C 1 29  ? -29.731 17.700 20.646 1.00 21.51  ? 57  TYR C C     1 
ATOM   2627 O  O     . TYR C 1 29  ? -30.033 16.872 21.526 1.00 20.41  ? 57  TYR C O     1 
ATOM   2628 C  CB    . TYR C 1 29  ? -31.272 19.481 19.864 1.00 23.81  ? 57  TYR C CB    1 
ATOM   2629 C  CG    . TYR C 1 29  ? -32.482 18.584 20.067 1.00 24.08  ? 57  TYR C CG    1 
ATOM   2630 C  CD1   . TYR C 1 29  ? -33.161 18.554 21.281 1.00 24.81  ? 57  TYR C CD1   1 
ATOM   2631 C  CD2   . TYR C 1 29  ? -32.942 17.768 19.048 1.00 23.04  ? 57  TYR C CD2   1 
ATOM   2632 C  CE1   . TYR C 1 29  ? -34.244 17.735 21.481 1.00 27.04  ? 57  TYR C CE1   1 
ATOM   2633 C  CE2   . TYR C 1 29  ? -34.039 16.950 19.241 1.00 25.23  ? 57  TYR C CE2   1 
ATOM   2634 C  CZ    . TYR C 1 29  ? -34.680 16.926 20.467 1.00 26.17  ? 57  TYR C CZ    1 
ATOM   2635 O  OH    . TYR C 1 29  ? -35.774 16.117 20.667 1.00 27.32  ? 57  TYR C OH    1 
ATOM   2636 N  N     . LEU C 1 30  ? -29.078 17.380 19.547 1.00 20.17  ? 58  LEU C N     1 
ATOM   2637 C  CA    . LEU C 1 30  ? -28.799 15.948 19.257 1.00 21.04  ? 58  LEU C CA    1 
ATOM   2638 C  C     . LEU C 1 30  ? -27.726 15.288 20.141 1.00 20.78  ? 58  LEU C C     1 
ATOM   2639 O  O     . LEU C 1 30  ? -27.705 14.053 20.322 1.00 22.61  ? 58  LEU C O     1 
ATOM   2640 C  CB    . LEU C 1 30  ? -28.494 15.787 17.774 1.00 20.86  ? 58  LEU C CB    1 
ATOM   2641 C  CG    . LEU C 1 30  ? -29.700 15.996 16.857 1.00 21.60  ? 58  LEU C CG    1 
ATOM   2642 C  CD1   . LEU C 1 30  ? -29.212 15.868 15.433 1.00 20.85  ? 58  LEU C CD1   1 
ATOM   2643 C  CD2   . LEU C 1 30  ? -30.844 15.033 17.138 1.00 23.36  ? 58  LEU C CD2   1 
ATOM   2644 N  N     . CYS C 1 31  ? -26.858 16.094 20.716 1.00 20.88  ? 59  CYS C N     1 
ATOM   2645 C  CA    . CYS C 1 31  ? -25.916 15.638 21.746 1.00 21.72  ? 59  CYS C CA    1 
ATOM   2646 C  C     . CYS C 1 31  ? -26.615 15.387 23.095 1.00 21.83  ? 59  CYS C C     1 
ATOM   2647 O  O     . CYS C 1 31  ? -26.323 14.428 23.783 1.00 23.09  ? 59  CYS C O     1 
ATOM   2648 C  CB    . CYS C 1 31  ? -24.798 16.660 21.938 1.00 22.92  ? 59  CYS C CB    1 
ATOM   2649 S  SG    . CYS C 1 31  ? -23.620 16.748 20.566 1.00 25.29  ? 59  CYS C SG    1 
ATOM   2650 N  N     . VAL C 1 32  ? -27.547 16.255 23.484 1.00 22.78  ? 60  VAL C N     1 
ATOM   2651 C  CA    . VAL C 1 32  ? -28.392 15.967 24.655 1.00 23.37  ? 60  VAL C CA    1 
ATOM   2652 C  C     . VAL C 1 32  ? -29.197 14.685 24.420 1.00 24.11  ? 60  VAL C C     1 
ATOM   2653 O  O     . VAL C 1 32  ? -29.302 13.831 25.293 1.00 22.52  ? 60  VAL C O     1 
ATOM   2654 C  CB    . VAL C 1 32  ? -29.339 17.110 24.980 1.00 25.41  ? 60  VAL C CB    1 
ATOM   2655 C  CG1   . VAL C 1 32  ? -30.256 16.749 26.149 1.00 26.90  ? 60  VAL C CG1   1 
ATOM   2656 C  CG2   . VAL C 1 32  ? -28.558 18.374 25.294 1.00 25.70  ? 60  VAL C CG2   1 
ATOM   2657 N  N     . LYS C 1 33  ? -29.766 14.555 23.230 1.00 23.68  ? 61  LYS C N     1 
ATOM   2658 C  CA    . LYS C 1 33  ? -30.529 13.359 22.922 1.00 24.49  ? 61  LYS C CA    1 
ATOM   2659 C  C     . LYS C 1 33  ? -29.640 12.109 22.995 1.00 24.59  ? 61  LYS C C     1 
ATOM   2660 O  O     . LYS C 1 33  ? -30.036 11.111 23.596 1.00 26.01  ? 61  LYS C O     1 
ATOM   2661 C  CB    . LYS C 1 33  ? -31.193 13.505 21.553 1.00 24.21  ? 61  LYS C CB    1 
ATOM   2662 C  CG    . LYS C 1 33  ? -32.232 12.468 21.255 1.00 26.40  ? 61  LYS C CG    1 
ATOM   2663 C  CD    . LYS C 1 33  ? -33.199 12.937 20.154 1.00 25.40  ? 61  LYS C CD    1 
ATOM   2664 C  CE    . LYS C 1 33  ? -34.115 11.791 19.780 1.00 29.83  ? 61  LYS C CE    1 
ATOM   2665 N  NZ    . LYS C 1 33  ? -35.275 12.205 18.935 1.00 29.37  ? 61  LYS C NZ    1 
ATOM   2666 N  N     . GLY C 1 34  ? -28.444 12.173 22.413 1.00 23.49  ? 62  GLY C N     1 
ATOM   2667 C  CA    . GLY C 1 34  ? -27.531 11.044 22.429 1.00 25.53  ? 62  GLY C CA    1 
ATOM   2668 C  C     . GLY C 1 34  ? -27.055 10.647 23.820 1.00 26.77  ? 62  GLY C C     1 
ATOM   2669 O  O     . GLY C 1 34  ? -26.843 9.478  24.089 1.00 31.09  ? 62  GLY C O     1 
ATOM   2670 N  N     . ALA C 1 35  ? -26.876 11.627 24.693 1.00 26.42  ? 63  ALA C N     1 
ATOM   2671 C  CA    . ALA C 1 35  ? -26.467 11.393 26.060 1.00 30.21  ? 63  ALA C CA    1 
ATOM   2672 C  C     . ALA C 1 35  ? -27.646 10.943 26.923 1.00 31.19  ? 63  ALA C C     1 
ATOM   2673 O  O     . ALA C 1 35  ? -27.428 10.380 27.983 1.00 34.71  ? 63  ALA C O     1 
ATOM   2674 C  CB    . ALA C 1 35  ? -25.853 12.652 26.659 1.00 30.33  ? 63  ALA C CB    1 
ATOM   2675 N  N     . SER C 1 36  ? -28.877 11.212 26.477 1.00 30.04  ? 64  SER C N     1 
ATOM   2676 C  CA    . SER C 1 36  ? -30.060 10.837 27.226 1.00 32.28  ? 64  SER C CA    1 
ATOM   2677 C  C     . SER C 1 36  ? -30.238 9.309  27.269 1.00 38.46  ? 64  SER C C     1 
ATOM   2678 O  O     . SER C 1 36  ? -30.771 8.780  28.252 1.00 38.77  ? 64  SER C O     1 
ATOM   2679 C  CB    . SER C 1 36  ? -31.304 11.457 26.614 1.00 34.46  ? 64  SER C CB    1 
ATOM   2680 O  OG    . SER C 1 36  ? -31.688 10.789 25.411 1.00 37.50  ? 64  SER C OG    1 
ATOM   2681 N  N     . TRP C 1 37  ? -29.810 8.600  26.225 1.00 39.03  ? 65  TRP C N     1 
ATOM   2682 C  CA    . TRP C 1 37  ? -29.909 7.128  26.233 1.00 47.21  ? 65  TRP C CA    1 
ATOM   2683 C  C     . TRP C 1 37  ? -29.193 6.556  27.468 1.00 52.34  ? 65  TRP C C     1 
ATOM   2684 O  O     . TRP C 1 37  ? -29.638 5.568  28.043 1.00 54.11  ? 65  TRP C O     1 
ATOM   2685 C  CB    . TRP C 1 37  ? -29.330 6.478  24.963 1.00 45.11  ? 65  TRP C CB    1 
ATOM   2686 C  CG    . TRP C 1 37  ? -29.800 7.040  23.632 1.00 44.96  ? 65  TRP C CG    1 
ATOM   2687 C  CD1   . TRP C 1 37  ? -29.005 7.343  22.568 1.00 45.62  ? 65  TRP C CD1   1 
ATOM   2688 C  CD2   . TRP C 1 37  ? -31.143 7.368  23.230 1.00 49.05  ? 65  TRP C CD2   1 
ATOM   2689 N  NE1   . TRP C 1 37  ? -29.757 7.824  21.523 1.00 48.11  ? 65  TRP C NE1   1 
ATOM   2690 C  CE2   . TRP C 1 37  ? -31.072 7.853  21.899 1.00 47.37  ? 65  TRP C CE2   1 
ATOM   2691 C  CE3   . TRP C 1 37  ? -32.394 7.301  23.857 1.00 58.02  ? 65  TRP C CE3   1 
ATOM   2692 C  CZ2   . TRP C 1 37  ? -32.204 8.270  21.181 1.00 49.70  ? 65  TRP C CZ2   1 
ATOM   2693 C  CZ3   . TRP C 1 37  ? -33.524 7.718  23.140 1.00 61.59  ? 65  TRP C CZ3   1 
ATOM   2694 C  CH2   . TRP C 1 37  ? -33.414 8.202  21.816 1.00 54.09  ? 65  TRP C CH2   1 
ATOM   2695 N  N     . LEU C 1 38  ? -28.103 7.203  27.876 1.00 57.34  ? 66  LEU C N     1 
ATOM   2696 C  CA    . LEU C 1 38  ? -27.339 6.797  29.053 1.00 62.42  ? 66  LEU C CA    1 
ATOM   2697 C  C     . LEU C 1 38  ? -27.894 7.394  30.351 1.00 64.18  ? 66  LEU C C     1 
ATOM   2698 O  O     . LEU C 1 38  ? -27.382 7.115  31.432 1.00 61.83  ? 66  LEU C O     1 
ATOM   2699 C  CB    . LEU C 1 38  ? -25.881 7.239  28.894 1.00 73.77  ? 66  LEU C CB    1 
ATOM   2700 C  CG    . LEU C 1 38  ? -25.162 6.821  27.605 1.00 78.80  ? 66  LEU C CG    1 
ATOM   2701 C  CD1   . LEU C 1 38  ? -23.832 7.556  27.470 1.00 74.72  ? 66  LEU C CD1   1 
ATOM   2702 C  CD2   . LEU C 1 38  ? -24.974 5.309  27.574 1.00 76.78  ? 66  LEU C CD2   1 
ATOM   2703 N  N     . GLY C 1 39  ? -28.918 8.233  30.249 1.00 62.60  ? 67  GLY C N     1 
ATOM   2704 C  CA    . GLY C 1 39  ? -29.493 8.887  31.422 1.00 64.49  ? 67  GLY C CA    1 
ATOM   2705 C  C     . GLY C 1 39  ? -28.584 9.912  32.074 1.00 55.18  ? 67  GLY C C     1 
ATOM   2706 O  O     . GLY C 1 39  ? -28.709 10.198 33.259 1.00 48.36  ? 67  GLY C O     1 
ATOM   2707 N  N     . LYS C 1 40  ? -27.672 10.485 31.306 1.00 54.29  ? 68  LYS C N     1 
ATOM   2708 C  CA    . LYS C 1 40  ? -26.801 11.538 31.837 1.00 59.87  ? 68  LYS C CA    1 
ATOM   2709 C  C     . LYS C 1 40  ? -27.623 12.722 32.375 1.00 57.31  ? 68  LYS C C     1 
ATOM   2710 O  O     . LYS C 1 40  ? -28.764 12.951 31.962 1.00 57.26  ? 68  LYS C O     1 
ATOM   2711 C  CB    . LYS C 1 40  ? -25.806 12.021 30.766 1.00 57.22  ? 68  LYS C CB    1 
ATOM   2712 C  CG    . LYS C 1 40  ? -24.864 10.937 30.245 1.00 58.59  ? 68  LYS C CG    1 
ATOM   2713 C  CD    . LYS C 1 40  ? -23.889 10.445 31.310 1.00 66.78  ? 68  LYS C CD    1 
ATOM   2714 C  CE    . LYS C 1 40  ? -23.188 9.157  30.888 1.00 66.37  ? 68  LYS C CE    1 
ATOM   2715 N  NZ    . LYS C 1 40  ? -22.292 8.635  31.966 1.00 66.38  ? 68  LYS C NZ    1 
ATOM   2716 N  N     . ARG C 1 41  ? -27.039 13.446 33.327 1.00 55.08  ? 69  ARG C N     1 
ATOM   2717 C  CA    . ARG C 1 41  ? -27.600 14.716 33.825 1.00 45.34  ? 69  ARG C CA    1 
ATOM   2718 C  C     . ARG C 1 41  ? -26.905 15.775 32.979 1.00 34.25  ? 69  ARG C C     1 
ATOM   2719 O  O     . ARG C 1 41  ? -26.316 15.412 31.989 1.00 33.45  ? 69  ARG C O     1 
ATOM   2720 C  CB    . ARG C 1 41  ? -27.316 14.846 35.318 1.00 42.20  ? 69  ARG C CB    1 
ATOM   2721 C  CG    . ARG C 1 41  ? -27.907 13.684 36.120 1.00 44.65  ? 69  ARG C CG    1 
ATOM   2722 C  CD    . ARG C 1 41  ? -27.559 13.725 37.589 1.00 48.05  ? 69  ARG C CD    1 
ATOM   2723 N  NE    . ARG C 1 41  ? -28.171 14.900 38.206 1.00 50.60  ? 69  ARG C NE    1 
ATOM   2724 C  CZ    . ARG C 1 41  ? -29.172 14.901 39.077 1.00 48.90  ? 69  ARG C CZ    1 
ATOM   2725 N  NH1   . ARG C 1 41  ? -29.707 13.766 39.522 1.00 54.18  ? 69  ARG C NH1   1 
ATOM   2726 N  NH2   . ARG C 1 41  ? -29.618 16.069 39.539 1.00 48.54  ? 69  ARG C NH2   1 
ATOM   2727 N  N     . CYS C 1 42  ? -26.958 17.058 33.332 1.00 35.04  ? 70  CYS C N     1 
ATOM   2728 C  CA    . CYS C 1 42  ? -26.156 18.047 32.605 1.00 32.38  ? 70  CYS C CA    1 
ATOM   2729 C  C     . CYS C 1 42  ? -24.689 17.639 32.670 1.00 30.82  ? 70  CYS C C     1 
ATOM   2730 O  O     . CYS C 1 42  ? -24.164 17.407 33.748 1.00 31.93  ? 70  CYS C O     1 
ATOM   2731 C  CB    . CYS C 1 42  ? -26.309 19.457 33.169 1.00 33.16  ? 70  CYS C CB    1 
ATOM   2732 S  SG    . CYS C 1 42  ? -25.133 20.662 32.464 1.00 32.43  ? 70  CYS C SG    1 
ATOM   2733 N  N     . ALA C 1 43  ? -24.046 17.587 31.512 1.00 30.11  ? 71  ALA C N     1 
ATOM   2734 C  CA    . ALA C 1 43  ? -22.655 17.135 31.382 1.00 29.97  ? 71  ALA C CA    1 
ATOM   2735 C  C     . ALA C 1 43  ? -21.657 18.083 32.067 1.00 29.99  ? 71  ALA C C     1 
ATOM   2736 O  O     . ALA C 1 43  ? -20.581 17.660 32.492 1.00 29.22  ? 71  ALA C O     1 
ATOM   2737 C  CB    . ALA C 1 43  ? -22.309 16.967 29.902 1.00 30.24  ? 71  ALA C CB    1 
ATOM   2738 N  N     . LEU C 1 44  ? -22.008 19.365 32.168 1.00 29.12  ? 72  LEU C N     1 
ATOM   2739 C  CA    . LEU C 1 44  ? -21.141 20.344 32.814 1.00 31.50  ? 72  LEU C CA    1 
ATOM   2740 C  C     . LEU C 1 44  ? -21.338 20.468 34.346 1.00 32.28  ? 72  LEU C C     1 
ATOM   2741 O  O     . LEU C 1 44  ? -20.358 20.530 35.076 1.00 32.31  ? 72  LEU C O     1 
ATOM   2742 C  CB    . LEU C 1 44  ? -21.297 21.714 32.126 1.00 31.68  ? 72  LEU C CB    1 
ATOM   2743 C  CG    . LEU C 1 44  ? -20.644 21.784 30.726 1.00 32.74  ? 72  LEU C CG    1 
ATOM   2744 C  CD1   . LEU C 1 44  ? -21.113 23.019 29.965 1.00 31.22  ? 72  LEU C CD1   1 
ATOM   2745 C  CD2   . LEU C 1 44  ? -19.119 21.803 30.845 1.00 33.62  ? 72  LEU C CD2   1 
ATOM   2746 N  N     . CYS C 1 45  ? -22.575 20.504 34.850 1.00 31.25  ? 73  CYS C N     1 
ATOM   2747 C  CA    . CYS C 1 45  ? -22.771 20.768 36.290 1.00 33.40  ? 73  CYS C CA    1 
ATOM   2748 C  C     . CYS C 1 45  ? -23.539 19.706 37.083 1.00 33.21  ? 73  CYS C C     1 
ATOM   2749 O  O     . CYS C 1 45  ? -23.733 19.873 38.276 1.00 32.42  ? 73  CYS C O     1 
ATOM   2750 C  CB    . CYS C 1 45  ? -23.443 22.128 36.476 1.00 34.81  ? 73  CYS C CB    1 
ATOM   2751 S  SG    . CYS C 1 45  ? -25.202 22.135 36.045 1.00 36.13  ? 73  CYS C SG    1 
ATOM   2752 N  N     . ARG C 1 46  ? -23.977 18.644 36.404 1.00 33.40  ? 74  ARG C N     1 
ATOM   2753 C  CA    . ARG C 1 46  ? -24.690 17.503 37.007 1.00 35.69  ? 74  ARG C CA    1 
ATOM   2754 C  C     . ARG C 1 46  ? -26.128 17.768 37.487 1.00 36.99  ? 74  ARG C C     1 
ATOM   2755 O  O     . ARG C 1 46  ? -26.741 16.886 38.079 1.00 39.08  ? 74  ARG C O     1 
ATOM   2756 C  CB    . ARG C 1 46  ? -23.858 16.857 38.130 1.00 37.15  ? 74  ARG C CB    1 
ATOM   2757 C  CG    . ARG C 1 46  ? -22.591 16.167 37.627 1.00 37.70  ? 74  ARG C CG    1 
ATOM   2758 C  CD    . ARG C 1 46  ? -21.698 15.713 38.774 1.00 39.81  ? 74  ARG C CD    1 
ATOM   2759 N  NE    . ARG C 1 46  ? -21.542 16.789 39.740 1.00 44.18  ? 74  ARG C NE    1 
ATOM   2760 C  CZ    . ARG C 1 46  ? -20.706 17.816 39.626 1.00 45.48  ? 74  ARG C CZ    1 
ATOM   2761 N  NH1   . ARG C 1 46  ? -19.890 17.926 38.578 1.00 45.34  ? 74  ARG C NH1   1 
ATOM   2762 N  NH2   . ARG C 1 46  ? -20.691 18.742 40.578 1.00 49.49  ? 74  ARG C NH2   1 
ATOM   2763 N  N     . GLN C 1 47  ? -26.679 18.949 37.230 1.00 36.00  ? 75  GLN C N     1 
ATOM   2764 C  CA    . GLN C 1 47  ? -28.067 19.228 37.611 1.00 37.91  ? 75  GLN C CA    1 
ATOM   2765 C  C     . GLN C 1 47  ? -29.049 18.502 36.683 1.00 37.62  ? 75  GLN C C     1 
ATOM   2766 O  O     . GLN C 1 47  ? -28.694 18.110 35.577 1.00 34.79  ? 75  GLN C O     1 
ATOM   2767 C  CB    . GLN C 1 47  ? -28.324 20.732 37.672 1.00 37.45  ? 75  GLN C CB    1 
ATOM   2768 C  CG    . GLN C 1 47  ? -27.631 21.347 38.877 1.00 39.79  ? 75  GLN C CG    1 
ATOM   2769 C  CD    . GLN C 1 47  ? -27.885 22.833 39.069 1.00 43.01  ? 75  GLN C CD    1 
ATOM   2770 O  OE1   . GLN C 1 47  ? -28.759 23.426 38.434 1.00 44.14  ? 75  GLN C OE1   1 
ATOM   2771 N  NE2   . GLN C 1 47  ? -27.144 23.431 39.994 1.00 44.94  ? 75  GLN C NE2   1 
ATOM   2772 N  N     . GLU C 1 48  ? -30.269 18.283 37.161 1.00 40.88  ? 76  GLU C N     1 
ATOM   2773 C  CA    . GLU C 1 48  ? -31.176 17.366 36.483 1.00 44.66  ? 76  GLU C CA    1 
ATOM   2774 C  C     . GLU C 1 48  ? -31.686 17.953 35.168 1.00 41.96  ? 76  GLU C C     1 
ATOM   2775 O  O     . GLU C 1 48  ? -31.902 19.173 35.044 1.00 40.42  ? 76  GLU C O     1 
ATOM   2776 C  CB    . GLU C 1 48  ? -32.361 16.974 37.383 1.00 53.77  ? 76  GLU C CB    1 
ATOM   2777 C  CG    . GLU C 1 48  ? -33.120 15.746 36.882 1.00 58.06  ? 76  GLU C CG    1 
ATOM   2778 C  CD    . GLU C 1 48  ? -33.756 14.922 37.999 1.00 75.92  ? 76  GLU C CD    1 
ATOM   2779 O  OE1   . GLU C 1 48  ? -34.334 15.513 38.946 1.00 73.04  ? 76  GLU C OE1   1 
ATOM   2780 O  OE2   . GLU C 1 48  ? -33.678 13.670 37.925 1.00 73.99  ? 76  GLU C OE2   1 
ATOM   2781 N  N     . ILE C 1 49  ? -31.829 17.076 34.186 1.00 37.15  ? 77  ILE C N     1 
ATOM   2782 C  CA    . ILE C 1 49  ? -32.516 17.415 32.945 1.00 38.73  ? 77  ILE C CA    1 
ATOM   2783 C  C     . ILE C 1 49  ? -33.961 16.924 33.060 1.00 39.71  ? 77  ILE C C     1 
ATOM   2784 O  O     . ILE C 1 49  ? -34.179 15.750 33.351 1.00 39.35  ? 77  ILE C O     1 
ATOM   2785 C  CB    . ILE C 1 49  ? -31.827 16.771 31.748 1.00 37.45  ? 77  ILE C CB    1 
ATOM   2786 C  CG1   . ILE C 1 49  ? -30.397 17.309 31.635 1.00 37.35  ? 77  ILE C CG1   1 
ATOM   2787 C  CG2   . ILE C 1 49  ? -32.614 17.048 30.471 1.00 38.94  ? 77  ILE C CG2   1 
ATOM   2788 C  CD1   . ILE C 1 49  ? -29.527 16.561 30.649 1.00 36.00  ? 77  ILE C CD1   1 
ATOM   2789 N  N     . PRO C 1 50  ? -34.947 17.820 32.858 1.00 40.20  ? 78  PRO C N     1 
ATOM   2790 C  CA    . PRO C 1 50  ? -36.361 17.429 32.951 1.00 44.45  ? 78  PRO C CA    1 
ATOM   2791 C  C     . PRO C 1 50  ? -36.712 16.175 32.139 1.00 39.79  ? 78  PRO C C     1 
ATOM   2792 O  O     . PRO C 1 50  ? -36.189 15.964 31.051 1.00 36.34  ? 78  PRO C O     1 
ATOM   2793 C  CB    . PRO C 1 50  ? -37.094 18.656 32.401 1.00 45.92  ? 78  PRO C CB    1 
ATOM   2794 C  CG    . PRO C 1 50  ? -36.200 19.799 32.768 1.00 44.34  ? 78  PRO C CG    1 
ATOM   2795 C  CD    . PRO C 1 50  ? -34.799 19.271 32.639 1.00 41.96  ? 78  PRO C CD    1 
ATOM   2796 N  N     . GLU C 1 51  ? -37.596 15.357 32.689 1.00 43.86  ? 79  GLU C N     1 
ATOM   2797 C  CA    . GLU C 1 51  ? -37.967 14.072 32.087 1.00 47.23  ? 79  GLU C CA    1 
ATOM   2798 C  C     . GLU C 1 51  ? -38.488 14.251 30.660 1.00 44.18  ? 79  GLU C C     1 
ATOM   2799 O  O     . GLU C 1 51  ? -38.153 13.460 29.784 1.00 42.77  ? 79  GLU C O     1 
ATOM   2800 C  CB    . GLU C 1 51  ? -38.974 13.319 33.002 1.00 56.44  ? 79  GLU C CB    1 
ATOM   2801 C  CG    . GLU C 1 51  ? -40.059 12.475 32.327 1.00 67.46  ? 79  GLU C CG    1 
ATOM   2802 C  CD    . GLU C 1 51  ? -39.689 11.009 32.131 1.00 77.06  ? 79  GLU C CD    1 
ATOM   2803 O  OE1   . GLU C 1 51  ? -39.010 10.699 31.129 1.00 81.06  ? 79  GLU C OE1   1 
ATOM   2804 O  OE2   . GLU C 1 51  ? -40.112 10.161 32.962 1.00 76.46  ? 79  GLU C OE2   1 
ATOM   2805 N  N     . ASP C 1 52  ? -39.259 15.309 30.417 1.00 44.13  ? 80  ASP C N     1 
ATOM   2806 C  CA    . ASP C 1 52  ? -39.853 15.534 29.095 1.00 44.17  ? 80  ASP C CA    1 
ATOM   2807 C  C     . ASP C 1 52  ? -39.086 16.543 28.237 1.00 38.87  ? 80  ASP C C     1 
ATOM   2808 O  O     . ASP C 1 52  ? -39.597 17.027 27.233 1.00 37.15  ? 80  ASP C O     1 
ATOM   2809 C  CB    . ASP C 1 52  ? -41.324 15.957 29.253 1.00 52.26  ? 80  ASP C CB    1 
ATOM   2810 C  CG    . ASP C 1 52  ? -42.242 14.779 29.600 1.00 63.43  ? 80  ASP C CG    1 
ATOM   2811 O  OD1   . ASP C 1 52  ? -42.047 13.673 29.043 1.00 69.10  ? 80  ASP C OD1   1 
ATOM   2812 O  OD2   . ASP C 1 52  ? -43.169 14.960 30.420 1.00 78.50  ? 80  ASP C OD2   1 
ATOM   2813 N  N     . PHE C 1 53  ? -37.838 16.823 28.598 1.00 36.00  ? 81  PHE C N     1 
ATOM   2814 C  CA    . PHE C 1 53  ? -37.056 17.836 27.899 1.00 34.24  ? 81  PHE C CA    1 
ATOM   2815 C  C     . PHE C 1 53  ? -36.811 17.554 26.404 1.00 33.65  ? 81  PHE C C     1 
ATOM   2816 O  O     . PHE C 1 53  ? -36.804 18.485 25.599 1.00 32.95  ? 81  PHE C O     1 
ATOM   2817 C  CB    . PHE C 1 53  ? -35.724 18.082 28.631 1.00 33.96  ? 81  PHE C CB    1 
ATOM   2818 C  CG    . PHE C 1 53  ? -34.964 19.262 28.101 1.00 31.24  ? 81  PHE C CG    1 
ATOM   2819 C  CD1   . PHE C 1 53  ? -34.060 19.107 27.078 1.00 30.94  ? 81  PHE C CD1   1 
ATOM   2820 C  CD2   . PHE C 1 53  ? -35.210 20.544 28.589 1.00 33.39  ? 81  PHE C CD2   1 
ATOM   2821 C  CE1   . PHE C 1 53  ? -33.364 20.198 26.566 1.00 31.23  ? 81  PHE C CE1   1 
ATOM   2822 C  CE2   . PHE C 1 53  ? -34.521 21.637 28.085 1.00 30.80  ? 81  PHE C CE2   1 
ATOM   2823 C  CZ    . PHE C 1 53  ? -33.599 21.463 27.075 1.00 29.50  ? 81  PHE C CZ    1 
ATOM   2824 N  N     . LEU C 1 54  ? -36.609 16.293 26.015 1.00 32.33  ? 82  LEU C N     1 
ATOM   2825 C  CA    . LEU C 1 54  ? -36.399 15.967 24.612 1.00 33.63  ? 82  LEU C CA    1 
ATOM   2826 C  C     . LEU C 1 54  ? -37.630 16.207 23.746 1.00 33.56  ? 82  LEU C C     1 
ATOM   2827 O  O     . LEU C 1 54  ? -37.523 16.644 22.589 1.00 30.77  ? 82  LEU C O     1 
ATOM   2828 C  CB    . LEU C 1 54  ? -35.950 14.510 24.462 1.00 36.97  ? 82  LEU C CB    1 
ATOM   2829 C  CG    . LEU C 1 54  ? -34.563 14.230 25.030 1.00 37.48  ? 82  LEU C CG    1 
ATOM   2830 C  CD1   . LEU C 1 54  ? -34.209 12.771 24.759 1.00 43.68  ? 82  LEU C CD1   1 
ATOM   2831 C  CD2   . LEU C 1 54  ? -33.524 15.168 24.457 1.00 34.60  ? 82  LEU C CD2   1 
ATOM   2832 N  N     . ASP C 1 55  ? -38.796 15.902 24.296 1.00 32.96  ? 83  ASP C N     1 
ATOM   2833 C  CA    . ASP C 1 55  ? -40.041 16.121 23.588 1.00 36.95  ? 83  ASP C CA    1 
ATOM   2834 C  C     . ASP C 1 55  ? -40.443 17.599 23.630 1.00 37.83  ? 83  ASP C C     1 
ATOM   2835 O  O     . ASP C 1 55  ? -41.079 18.089 22.700 1.00 38.51  ? 83  ASP C O     1 
ATOM   2836 C  CB    . ASP C 1 55  ? -41.141 15.234 24.161 1.00 41.32  ? 83  ASP C CB    1 
ATOM   2837 C  CG    . ASP C 1 55  ? -42.376 15.178 23.262 1.00 52.46  ? 83  ASP C CG    1 
ATOM   2838 O  OD1   . ASP C 1 55  ? -42.248 14.865 22.050 1.00 55.22  ? 83  ASP C OD1   1 
ATOM   2839 O  OD2   . ASP C 1 55  ? -43.480 15.456 23.769 1.00 60.99  ? 83  ASP C OD2   1 
ATOM   2840 N  N     . LYS C 1 56  ? -40.048 18.309 24.683 1.00 36.89  ? 84  LYS C N     1 
ATOM   2841 C  CA    . LYS C 1 56  ? -40.394 19.714 24.848 1.00 39.43  ? 84  LYS C CA    1 
ATOM   2842 C  C     . LYS C 1 56  ? -39.170 20.540 25.274 1.00 35.31  ? 84  LYS C C     1 
ATOM   2843 O  O     . LYS C 1 56  ? -39.112 21.006 26.410 1.00 36.50  ? 84  LYS C O     1 
ATOM   2844 C  CB    . LYS C 1 56  ? -41.495 19.833 25.904 1.00 45.96  ? 84  LYS C CB    1 
ATOM   2845 C  CG    . LYS C 1 56  ? -42.825 19.188 25.529 1.00 52.60  ? 84  LYS C CG    1 
ATOM   2846 C  CD    . LYS C 1 56  ? -43.836 19.318 26.663 1.00 61.81  ? 84  LYS C CD    1 
ATOM   2847 C  CE    . LYS C 1 56  ? -45.199 18.739 26.307 1.00 69.93  ? 84  LYS C CE    1 
ATOM   2848 N  NZ    . LYS C 1 56  ? -45.834 19.424 25.146 1.00 70.09  ? 84  LYS C NZ    1 
ATOM   2849 N  N     . PRO C 1 57  ? -38.180 20.713 24.369 1.00 32.34  ? 85  PRO C N     1 
ATOM   2850 C  CA    . PRO C 1 57  ? -36.927 21.363 24.736 1.00 31.76  ? 85  PRO C CA    1 
ATOM   2851 C  C     . PRO C 1 57  ? -37.048 22.889 24.721 1.00 33.26  ? 85  PRO C C     1 
ATOM   2852 O  O     . PRO C 1 57  ? -37.923 23.443 24.065 1.00 35.85  ? 85  PRO C O     1 
ATOM   2853 C  CB    . PRO C 1 57  ? -35.958 20.888 23.647 1.00 30.17  ? 85  PRO C CB    1 
ATOM   2854 C  CG    . PRO C 1 57  ? -36.822 20.649 22.457 1.00 30.63  ? 85  PRO C CG    1 
ATOM   2855 C  CD    . PRO C 1 57  ? -38.204 20.331 22.951 1.00 31.94  ? 85  PRO C CD    1 
ATOM   2856 N  N     . THR C 1 58  ? -36.194 23.541 25.483 1.00 32.04  ? 86  THR C N     1 
ATOM   2857 C  CA    . THR C 1 58  ? -36.044 24.983 25.455 1.00 33.07  ? 86  THR C CA    1 
ATOM   2858 C  C     . THR C 1 58  ? -34.917 25.290 24.488 1.00 32.04  ? 86  THR C C     1 
ATOM   2859 O  O     . THR C 1 58  ? -33.765 25.014 24.772 1.00 30.63  ? 86  THR C O     1 
ATOM   2860 C  CB    . THR C 1 58  ? -35.696 25.501 26.858 1.00 33.99  ? 86  THR C CB    1 
ATOM   2861 O  OG1   . THR C 1 58  ? -36.770 25.173 27.743 1.00 36.24  ? 86  THR C OG1   1 
ATOM   2862 C  CG2   . THR C 1 58  ? -35.443 27.039 26.870 1.00 36.53  ? 86  THR C CG2   1 
ATOM   2863 N  N     . LEU C 1 59  ? -35.252 25.821 23.320 1.00 32.35  ? 87  LEU C N     1 
ATOM   2864 C  CA    . LEU C 1 59  ? -34.220 26.258 22.373 1.00 35.18  ? 87  LEU C CA    1 
ATOM   2865 C  C     . LEU C 1 59  ? -33.519 27.516 22.881 1.00 34.16  ? 87  LEU C C     1 
ATOM   2866 O  O     . LEU C 1 59  ? -34.133 28.329 23.535 1.00 33.87  ? 87  LEU C O     1 
ATOM   2867 C  CB    . LEU C 1 59  ? -34.854 26.539 21.018 1.00 36.49  ? 87  LEU C CB    1 
ATOM   2868 C  CG    . LEU C 1 59  ? -35.345 25.257 20.359 1.00 41.99  ? 87  LEU C CG    1 
ATOM   2869 C  CD1   . LEU C 1 59  ? -36.383 25.605 19.302 1.00 45.53  ? 87  LEU C CD1   1 
ATOM   2870 C  CD2   . LEU C 1 59  ? -34.170 24.485 19.771 1.00 43.06  ? 87  LEU C CD2   1 
ATOM   2871 N  N     . LEU C 1 60  ? -32.232 27.658 22.594 1.00 33.09  ? 88  LEU C N     1 
ATOM   2872 C  CA    . LEU C 1 60  ? -31.511 28.882 22.930 1.00 33.28  ? 88  LEU C CA    1 
ATOM   2873 C  C     . LEU C 1 60  ? -32.061 30.070 22.128 1.00 36.01  ? 88  LEU C C     1 
ATOM   2874 O  O     . LEU C 1 60  ? -32.314 31.144 22.685 1.00 36.66  ? 88  LEU C O     1 
ATOM   2875 C  CB    . LEU C 1 60  ? -30.002 28.722 22.686 1.00 31.24  ? 88  LEU C CB    1 
ATOM   2876 C  CG    . LEU C 1 60  ? -29.103 29.962 22.869 1.00 33.64  ? 88  LEU C CG    1 
ATOM   2877 C  CD1   . LEU C 1 60  ? -29.107 30.452 24.312 1.00 35.18  ? 88  LEU C CD1   1 
ATOM   2878 C  CD2   . LEU C 1 60  ? -27.675 29.674 22.401 1.00 33.72  ? 88  LEU C CD2   1 
ATOM   2879 N  N     . SER C 1 61  ? -32.227 29.868 20.829 1.00 36.94  ? 89  SER C N     1 
ATOM   2880 C  CA    . SER C 1 61  ? -32.731 30.902 19.905 1.00 43.14  ? 89  SER C CA    1 
ATOM   2881 C  C     . SER C 1 61  ? -33.920 30.360 19.096 1.00 40.83  ? 89  SER C C     1 
ATOM   2882 O  O     . SER C 1 61  ? -33.736 29.816 18.006 1.00 38.78  ? 89  SER C O     1 
ATOM   2883 C  CB    . SER C 1 61  ? -31.605 31.337 18.960 1.00 46.41  ? 89  SER C CB    1 
ATOM   2884 O  OG    . SER C 1 61  ? -30.479 31.793 19.688 1.00 51.28  ? 89  SER C OG    1 
ATOM   2885 N  N     . PRO C 1 62  ? -35.147 30.482 19.633 1.00 41.72  ? 90  PRO C N     1 
ATOM   2886 C  CA    . PRO C 1 62  ? -36.311 29.861 18.970 1.00 44.18  ? 90  PRO C CA    1 
ATOM   2887 C  C     . PRO C 1 62  ? -36.566 30.271 17.503 1.00 45.50  ? 90  PRO C C     1 
ATOM   2888 O  O     . PRO C 1 62  ? -36.968 29.432 16.680 1.00 40.32  ? 90  PRO C O     1 
ATOM   2889 C  CB    . PRO C 1 62  ? -37.479 30.280 19.863 1.00 47.85  ? 90  PRO C CB    1 
ATOM   2890 C  CG    . PRO C 1 62  ? -36.870 30.439 21.214 1.00 47.84  ? 90  PRO C CG    1 
ATOM   2891 C  CD    . PRO C 1 62  ? -35.473 30.949 20.994 1.00 44.31  ? 90  PRO C CD    1 
ATOM   2892 N  N     . GLU C 1 63  ? -36.329 31.540 17.185 1.00 45.31  ? 91  GLU C N     1 
ATOM   2893 C  CA    . GLU C 1 63  ? -36.458 32.031 15.815 1.00 48.91  ? 91  GLU C CA    1 
ATOM   2894 C  C     . GLU C 1 63  ? -35.428 31.440 14.861 1.00 49.49  ? 91  GLU C C     1 
ATOM   2895 O  O     . GLU C 1 63  ? -35.698 31.276 13.662 1.00 50.11  ? 91  GLU C O     1 
ATOM   2896 C  CB    . GLU C 1 63  ? -36.371 33.557 15.801 1.00 55.31  ? 91  GLU C CB    1 
ATOM   2897 C  CG    . GLU C 1 63  ? -37.611 34.195 16.390 1.00 60.64  ? 91  GLU C CG    1 
ATOM   2898 C  CD    . GLU C 1 63  ? -38.858 33.763 15.630 1.00 69.76  ? 91  GLU C CD    1 
ATOM   2899 O  OE1   . GLU C 1 63  ? -39.065 34.253 14.492 1.00 65.21  ? 91  GLU C OE1   1 
ATOM   2900 O  OE2   . GLU C 1 63  ? -39.606 32.905 16.162 1.00 73.03  ? 91  GLU C OE2   1 
ATOM   2901 N  N     . GLU C 1 64  ? -34.252 31.104 15.376 1.00 45.44  ? 92  GLU C N     1 
ATOM   2902 C  CA    . GLU C 1 64  ? -33.248 30.488 14.534 1.00 45.64  ? 92  GLU C CA    1 
ATOM   2903 C  C     . GLU C 1 64  ? -33.699 29.104 14.028 1.00 40.08  ? 92  GLU C C     1 
ATOM   2904 O  O     . GLU C 1 64  ? -33.218 28.672 13.006 1.00 39.48  ? 92  GLU C O     1 
ATOM   2905 C  CB    . GLU C 1 64  ? -31.881 30.413 15.236 1.00 49.12  ? 92  GLU C CB    1 
ATOM   2906 C  CG    . GLU C 1 64  ? -31.206 31.772 15.445 1.00 55.83  ? 92  GLU C CG    1 
ATOM   2907 C  CD    . GLU C 1 64  ? -30.786 32.477 14.155 1.00 62.81  ? 92  GLU C CD    1 
ATOM   2908 O  OE1   . GLU C 1 64  ? -30.538 31.784 13.147 1.00 59.80  ? 92  GLU C OE1   1 
ATOM   2909 O  OE2   . GLU C 1 64  ? -30.688 33.737 14.152 1.00 66.31  ? 92  GLU C OE2   1 
ATOM   2910 N  N     . LEU C 1 65  ? -34.643 28.445 14.706 1.00 39.89  ? 93  LEU C N     1 
ATOM   2911 C  CA    . LEU C 1 65  ? -35.145 27.132 14.231 1.00 42.90  ? 93  LEU C CA    1 
ATOM   2912 C  C     . LEU C 1 65  ? -36.053 27.315 13.020 1.00 42.23  ? 93  LEU C C     1 
ATOM   2913 O  O     . LEU C 1 65  ? -36.034 26.496 12.108 1.00 38.39  ? 93  LEU C O     1 
ATOM   2914 C  CB    . LEU C 1 65  ? -35.885 26.357 15.326 1.00 40.42  ? 93  LEU C CB    1 
ATOM   2915 C  CG    . LEU C 1 65  ? -36.701 25.122 14.896 1.00 41.87  ? 93  LEU C CG    1 
ATOM   2916 C  CD1   . LEU C 1 65  ? -35.773 23.996 14.486 1.00 39.29  ? 93  LEU C CD1   1 
ATOM   2917 C  CD2   . LEU C 1 65  ? -37.673 24.658 15.979 1.00 45.17  ? 93  LEU C CD2   1 
ATOM   2918 N  N     . LYS C 1 66  ? -36.855 28.376 13.015 1.00 46.64  ? 94  LYS C N     1 
ATOM   2919 C  CA    . LYS C 1 66  ? -37.622 28.726 11.817 1.00 50.33  ? 94  LYS C CA    1 
ATOM   2920 C  C     . LYS C 1 66  ? -36.657 28.985 10.667 1.00 47.71  ? 94  LYS C C     1 
ATOM   2921 O  O     . LYS C 1 66  ? -36.828 28.434 9.564  1.00 42.61  ? 94  LYS C O     1 
ATOM   2922 C  CB    . LYS C 1 66  ? -38.497 29.955 12.046 1.00 60.34  ? 94  LYS C CB    1 
ATOM   2923 C  CG    . LYS C 1 66  ? -39.743 29.703 12.883 1.00 69.49  ? 94  LYS C CG    1 
ATOM   2924 C  CD    . LYS C 1 66  ? -40.219 30.972 13.587 1.00 76.09  ? 94  LYS C CD    1 
ATOM   2925 C  CE    . LYS C 1 66  ? -40.604 32.091 12.617 1.00 88.35  ? 94  LYS C CE    1 
ATOM   2926 N  NZ    . LYS C 1 66  ? -42.050 32.117 12.248 1.00 87.18  ? 94  LYS C NZ    1 
ATOM   2927 N  N     . ALA C 1 67  ? -35.636 29.799 10.936 1.00 45.10  ? 95  ALA C N     1 
ATOM   2928 C  CA    . ALA C 1 67  ? -34.583 30.069 9.957  1.00 49.07  ? 95  ALA C CA    1 
ATOM   2929 C  C     . ALA C 1 67  ? -33.906 28.777 9.505  1.00 43.33  ? 95  ALA C C     1 
ATOM   2930 O  O     . ALA C 1 67  ? -33.730 28.556 8.312  1.00 46.13  ? 95  ALA C O     1 
ATOM   2931 C  CB    . ALA C 1 67  ? -33.552 31.025 10.524 1.00 50.26  ? 95  ALA C CB    1 
ATOM   2932 N  N     . ALA C 1 68  ? -33.537 27.923 10.459 1.00 43.86  ? 96  ALA C N     1 
ATOM   2933 C  CA    . ALA C 1 68  ? -32.946 26.616 10.128 1.00 41.62  ? 96  ALA C CA    1 
ATOM   2934 C  C     . ALA C 1 68  ? -33.856 25.782 9.218  1.00 39.34  ? 96  ALA C C     1 
ATOM   2935 O  O     . ALA C 1 68  ? -33.364 25.083 8.328  1.00 41.28  ? 96  ALA C O     1 
ATOM   2936 C  CB    . ALA C 1 68  ? -32.601 25.847 11.384 1.00 41.65  ? 96  ALA C CB    1 
ATOM   2937 N  N     . SER C 1 69  ? -35.172 25.899 9.401  1.00 36.75  ? 97  SER C N     1 
ATOM   2938 C  CA    . SER C 1 69  ? -36.129 25.189 8.553  1.00 37.42  ? 97  SER C CA    1 
ATOM   2939 C  C     . SER C 1 69  ? -36.047 25.596 7.074  1.00 42.19  ? 97  SER C C     1 
ATOM   2940 O  O     . SER C 1 69  ? -36.213 24.740 6.190  1.00 37.19  ? 97  SER C O     1 
ATOM   2941 C  CB    . SER C 1 69  ? -37.563 25.290 9.103  1.00 37.22  ? 97  SER C CB    1 
ATOM   2942 O  OG    . SER C 1 69  ? -38.197 26.495 8.733  1.00 47.56  ? 97  SER C OG    1 
ATOM   2943 N  N     . ARG C 1 70  ? -35.787 26.886 6.811  1.00 39.99  ? 98  ARG C N     1 
ATOM   2944 C  CA    . ARG C 1 70  ? -35.560 27.381 5.452  1.00 42.23  ? 98  ARG C CA    1 
ATOM   2945 C  C     . ARG C 1 70  ? -34.155 27.049 4.891  1.00 43.72  ? 98  ARG C C     1 
ATOM   2946 O  O     . ARG C 1 70  ? -33.958 27.034 3.658  1.00 42.09  ? 98  ARG C O     1 
ATOM   2947 C  CB    . ARG C 1 70  ? -35.803 28.895 5.379  1.00 44.50  ? 98  ARG C CB    1 
ATOM   2948 C  CG    . ARG C 1 70  ? -37.182 29.311 5.876  1.00 46.53  ? 98  ARG C CG    1 
ATOM   2949 C  CD    . ARG C 1 70  ? -37.463 30.772 5.574  1.00 52.50  ? 98  ARG C CD    1 
ATOM   2950 N  NE    . ARG C 1 70  ? -36.470 31.659 6.193  1.00 55.02  ? 98  ARG C NE    1 
ATOM   2951 C  CZ    . ARG C 1 70  ? -36.555 32.173 7.421  1.00 60.01  ? 98  ARG C CZ    1 
ATOM   2952 N  NH1   . ARG C 1 70  ? -37.597 31.908 8.211  1.00 64.14  ? 98  ARG C NH1   1 
ATOM   2953 N  NH2   . ARG C 1 70  ? -35.588 32.971 7.867  1.00 62.08  ? 98  ARG C NH2   1 
ATOM   2954 N  N     . GLY C 1 71  ? -33.188 26.824 5.781  1.00 43.00  ? 99  GLY C N     1 
ATOM   2955 C  CA    . GLY C 1 71  ? -31.884 26.261 5.401  1.00 44.01  ? 99  GLY C CA    1 
ATOM   2956 C  C     . GLY C 1 71  ? -31.183 27.146 4.397  1.00 47.23  ? 99  GLY C C     1 
ATOM   2957 O  O     . GLY C 1 71  ? -31.177 28.385 4.557  1.00 48.59  ? 99  GLY C O     1 
ATOM   2958 N  N     . ASN C 1 72  ? -30.624 26.551 3.336  1.00 45.20  ? 100 ASN C N     1 
ATOM   2959 C  CA    . ASN C 1 72  ? -29.993 27.383 2.287  1.00 49.60  ? 100 ASN C CA    1 
ATOM   2960 C  C     . ASN C 1 72  ? -30.994 28.073 1.335  1.00 49.27  ? 100 ASN C C     1 
ATOM   2961 O  O     . ASN C 1 72  ? -30.593 28.718 0.365  1.00 45.89  ? 100 ASN C O     1 
ATOM   2962 C  CB    . ASN C 1 72  ? -28.919 26.607 1.501  1.00 53.01  ? 100 ASN C CB    1 
ATOM   2963 C  CG    . ASN C 1 72  ? -29.479 25.439 0.711  1.00 51.88  ? 100 ASN C CG    1 
ATOM   2964 O  OD1   . ASN C 1 72  ? -30.548 25.534 0.101  1.00 48.26  ? 100 ASN C OD1   1 
ATOM   2965 N  ND2   . ASN C 1 72  ? -28.746 24.320 0.714  1.00 51.89  ? 100 ASN C ND2   1 
ATOM   2966 N  N     . GLY C 1 73  ? -32.292 27.901 1.592  1.00 49.07  ? 101 GLY C N     1 
ATOM   2967 C  CA    . GLY C 1 73  ? -33.340 28.535 0.791  1.00 50.66  ? 101 GLY C CA    1 
ATOM   2968 C  C     . GLY C 1 73  ? -33.746 27.776 -0.457 1.00 52.67  ? 101 GLY C C     1 
ATOM   2969 O  O     . GLY C 1 73  ? -34.836 28.010 -0.993 1.00 59.71  ? 101 GLY C O     1 
ATOM   2970 N  N     . GLU C 1 74  ? -32.895 26.855 -0.920 1.00 52.55  ? 102 GLU C N     1 
ATOM   2971 C  CA    . GLU C 1 74  ? -33.121 26.177 -2.182 1.00 48.15  ? 102 GLU C CA    1 
ATOM   2972 C  C     . GLU C 1 74  ? -33.489 24.701 -1.998 1.00 45.53  ? 102 GLU C C     1 
ATOM   2973 O  O     . GLU C 1 74  ? -34.600 24.314 -2.325 1.00 44.58  ? 102 GLU C O     1 
ATOM   2974 C  CB    . GLU C 1 74  ? -31.901 26.310 -3.077 1.00 51.38  ? 102 GLU C CB    1 
ATOM   2975 C  CG    . GLU C 1 74  ? -32.207 25.962 -4.518 1.00 57.31  ? 102 GLU C CG    1 
ATOM   2976 C  CD    . GLU C 1 74  ? -30.979 25.966 -5.402 1.00 67.86  ? 102 GLU C CD    1 
ATOM   2977 O  OE1   . GLU C 1 74  ? -29.851 26.033 -4.867 1.00 69.22  ? 102 GLU C OE1   1 
ATOM   2978 O  OE2   . GLU C 1 74  ? -31.149 25.901 -6.637 1.00 73.99  ? 102 GLU C OE2   1 
ATOM   2979 N  N     . TYR C 1 75  ? -32.568 23.890 -1.483 1.00 39.58  ? 103 TYR C N     1 
ATOM   2980 C  CA    . TYR C 1 75  ? -32.808 22.443 -1.304 1.00 41.69  ? 103 TYR C CA    1 
ATOM   2981 C  C     . TYR C 1 75  ? -32.386 21.996 0.090  1.00 36.95  ? 103 TYR C C     1 
ATOM   2982 O  O     . TYR C 1 75  ? -31.568 22.643 0.743  1.00 36.50  ? 103 TYR C O     1 
ATOM   2983 C  CB    . TYR C 1 75  ? -32.007 21.642 -2.328 1.00 40.33  ? 103 TYR C CB    1 
ATOM   2984 C  CG    . TYR C 1 75  ? -30.540 21.748 -2.065 1.00 42.69  ? 103 TYR C CG    1 
ATOM   2985 C  CD1   . TYR C 1 75  ? -29.903 20.828 -1.239 1.00 44.64  ? 103 TYR C CD1   1 
ATOM   2986 C  CD2   . TYR C 1 75  ? -29.790 22.805 -2.588 1.00 46.79  ? 103 TYR C CD2   1 
ATOM   2987 C  CE1   . TYR C 1 75  ? -28.560 20.939 -0.953 1.00 45.45  ? 103 TYR C CE1   1 
ATOM   2988 C  CE2   . TYR C 1 75  ? -28.432 22.924 -2.309 1.00 47.91  ? 103 TYR C CE2   1 
ATOM   2989 C  CZ    . TYR C 1 75  ? -27.829 21.981 -1.488 1.00 47.94  ? 103 TYR C CZ    1 
ATOM   2990 O  OH    . TYR C 1 75  ? -26.493 22.060 -1.190 1.00 51.25  ? 103 TYR C OH    1 
ATOM   2991 N  N     . ALA C 1 76  ? -32.918 20.865 0.534  1.00 32.56  ? 104 ALA C N     1 
ATOM   2992 C  CA    . ALA C 1 76  ? -32.518 20.311 1.790  1.00 28.43  ? 104 ALA C CA    1 
ATOM   2993 C  C     . ALA C 1 76  ? -32.699 18.797 1.771  1.00 25.17  ? 104 ALA C C     1 
ATOM   2994 O  O     . ALA C 1 76  ? -33.344 18.234 0.869  1.00 24.37  ? 104 ALA C O     1 
ATOM   2995 C  CB    . ALA C 1 76  ? -33.335 20.930 2.913  1.00 30.51  ? 104 ALA C CB    1 
ATOM   2996 N  N     . TRP C 1 77  ? -32.121 18.164 2.776  1.00 22.97  ? 105 TRP C N     1 
ATOM   2997 C  CA    . TRP C 1 77  ? -32.280 16.717 2.998  1.00 22.42  ? 105 TRP C CA    1 
ATOM   2998 C  C     . TRP C 1 77  ? -33.331 16.445 4.085  1.00 21.58  ? 105 TRP C C     1 
ATOM   2999 O  O     . TRP C 1 77  ? -33.400 17.176 5.073  1.00 22.79  ? 105 TRP C O     1 
ATOM   3000 C  CB    . TRP C 1 77  ? -30.928 16.111 3.341  1.00 22.84  ? 105 TRP C CB    1 
ATOM   3001 C  CG    . TRP C 1 77  ? -30.031 16.047 2.128  1.00 23.69  ? 105 TRP C CG    1 
ATOM   3002 C  CD1   . TRP C 1 77  ? -29.245 17.059 1.627  1.00 24.77  ? 105 TRP C CD1   1 
ATOM   3003 C  CD2   . TRP C 1 77  ? -29.873 14.941 1.249  1.00 25.30  ? 105 TRP C CD2   1 
ATOM   3004 N  NE1   . TRP C 1 77  ? -28.601 16.633 0.486  1.00 27.04  ? 105 TRP C NE1   1 
ATOM   3005 C  CE2   . TRP C 1 77  ? -28.959 15.334 0.237  1.00 26.23  ? 105 TRP C CE2   1 
ATOM   3006 C  CE3   . TRP C 1 77  ? -30.392 13.638 1.226  1.00 27.49  ? 105 TRP C CE3   1 
ATOM   3007 C  CZ2   . TRP C 1 77  ? -28.559 14.480 -0.774 1.00 29.49  ? 105 TRP C CZ2   1 
ATOM   3008 C  CZ3   . TRP C 1 77  ? -30.003 12.781 0.207  1.00 32.06  ? 105 TRP C CZ3   1 
ATOM   3009 C  CH2   . TRP C 1 77  ? -29.089 13.209 -0.787 1.00 34.60  ? 105 TRP C CH2   1 
ATOM   3010 N  N     . TYR C 1 78  ? -34.130 15.381 3.894  1.00 20.64  ? 106 TYR C N     1 
ATOM   3011 C  CA    . TYR C 1 78  ? -35.249 15.052 4.751  1.00 20.30  ? 106 TYR C CA    1 
ATOM   3012 C  C     . TYR C 1 78  ? -35.258 13.547 5.044  1.00 20.28  ? 106 TYR C C     1 
ATOM   3013 O  O     . TYR C 1 78  ? -34.815 12.763 4.211  1.00 19.67  ? 106 TYR C O     1 
ATOM   3014 C  CB    . TYR C 1 78  ? -36.587 15.405 4.070  1.00 21.19  ? 106 TYR C CB    1 
ATOM   3015 C  CG    . TYR C 1 78  ? -36.768 16.880 3.751  1.00 22.13  ? 106 TYR C CG    1 
ATOM   3016 C  CD1   . TYR C 1 78  ? -36.368 17.396 2.517  1.00 22.29  ? 106 TYR C CD1   1 
ATOM   3017 C  CD2   . TYR C 1 78  ? -37.328 17.752 4.679  1.00 22.23  ? 106 TYR C CD2   1 
ATOM   3018 C  CE1   . TYR C 1 78  ? -36.519 18.761 2.230  1.00 24.04  ? 106 TYR C CE1   1 
ATOM   3019 C  CE2   . TYR C 1 78  ? -37.474 19.107 4.405  1.00 23.45  ? 106 TYR C CE2   1 
ATOM   3020 C  CZ    . TYR C 1 78  ? -37.089 19.600 3.175  1.00 24.25  ? 106 TYR C CZ    1 
ATOM   3021 O  OH    . TYR C 1 78  ? -37.256 20.943 2.884  1.00 27.89  ? 106 TYR C OH    1 
ATOM   3022 N  N     . TYR C 1 79  ? -35.743 13.186 6.222  1.00 20.56  ? 107 TYR C N     1 
ATOM   3023 C  CA    . TYR C 1 79  ? -35.902 11.781 6.606  1.00 20.93  ? 107 TYR C CA    1 
ATOM   3024 C  C     . TYR C 1 79  ? -37.352 11.565 7.061  1.00 21.46  ? 107 TYR C C     1 
ATOM   3025 O  O     . TYR C 1 79  ? -38.003 12.452 7.620  1.00 21.87  ? 107 TYR C O     1 
ATOM   3026 C  CB    . TYR C 1 79  ? -34.870 11.339 7.675  1.00 20.55  ? 107 TYR C CB    1 
ATOM   3027 C  CG    . TYR C 1 79  ? -34.977 12.052 9.014  1.00 22.49  ? 107 TYR C CG    1 
ATOM   3028 C  CD1   . TYR C 1 79  ? -34.375 13.301 9.212  1.00 20.67  ? 107 TYR C CD1   1 
ATOM   3029 C  CD2   . TYR C 1 79  ? -35.721 11.507 10.074 1.00 22.33  ? 107 TYR C CD2   1 
ATOM   3030 C  CE1   . TYR C 1 79  ? -34.456 13.945 10.441 1.00 21.55  ? 107 TYR C CE1   1 
ATOM   3031 C  CE2   . TYR C 1 79  ? -35.812 12.165 11.299 1.00 23.33  ? 107 TYR C CE2   1 
ATOM   3032 C  CZ    . TYR C 1 79  ? -35.173 13.392 11.462 1.00 21.22  ? 107 TYR C CZ    1 
ATOM   3033 O  OH    . TYR C 1 79  ? -35.283 14.059 12.646 1.00 23.74  ? 107 TYR C OH    1 
ATOM   3034 N  N     . GLU C 1 80  ? -37.818 10.337 6.876  1.00 23.06  ? 108 GLU C N     1 
ATOM   3035 C  CA    . GLU C 1 80  ? -39.203 9.967  7.082  1.00 24.24  ? 108 GLU C CA    1 
ATOM   3036 C  C     . GLU C 1 80  ? -39.580 10.021 8.556  1.00 24.19  ? 108 GLU C C     1 
ATOM   3037 O  O     . GLU C 1 80  ? -38.854 9.543  9.418  1.00 23.67  ? 108 GLU C O     1 
ATOM   3038 C  CB    . GLU C 1 80  ? -39.416 8.534  6.540  1.00 27.55  ? 108 GLU C CB    1 
ATOM   3039 C  CG    . GLU C 1 80  ? -40.846 8.022  6.545  1.00 31.34  ? 108 GLU C CG    1 
ATOM   3040 C  CD    . GLU C 1 80  ? -40.943 6.525  6.181  1.00 39.80  ? 108 GLU C CD    1 
ATOM   3041 O  OE1   . GLU C 1 80  ? -39.915 5.897  5.798  1.00 31.95  ? 108 GLU C OE1   1 
ATOM   3042 O  OE2   . GLU C 1 80  ? -42.065 5.981  6.265  1.00 43.42  ? 108 GLU C OE2   1 
ATOM   3043 N  N     . GLY C 1 81  ? -40.727 10.601 8.832  1.00 24.76  ? 109 GLY C N     1 
ATOM   3044 C  CA    . GLY C 1 81  ? -41.366 10.517 10.146 1.00 27.58  ? 109 GLY C CA    1 
ATOM   3045 C  C     . GLY C 1 81  ? -42.766 9.966  9.984  1.00 30.17  ? 109 GLY C C     1 
ATOM   3046 O  O     . GLY C 1 81  ? -43.133 9.528  8.898  1.00 30.35  ? 109 GLY C O     1 
ATOM   3047 N  N     . ARG C 1 82  ? -43.540 9.976  11.067 1.00 32.79  ? 110 ARG C N     1 
ATOM   3048 C  CA    . ARG C 1 82  ? -44.923 9.559  11.028 1.00 38.81  ? 110 ARG C CA    1 
ATOM   3049 C  C     . ARG C 1 82  ? -45.740 10.674 10.378 1.00 37.50  ? 110 ARG C C     1 
ATOM   3050 O  O     . ARG C 1 82  ? -45.732 11.811 10.857 1.00 35.83  ? 110 ARG C O     1 
ATOM   3051 C  CB    . ARG C 1 82  ? -45.440 9.260  12.444 1.00 46.18  ? 110 ARG C CB    1 
ATOM   3052 C  CG    . ARG C 1 82  ? -46.868 8.718  12.484 1.00 56.70  ? 110 ARG C CG    1 
ATOM   3053 C  CD    . ARG C 1 82  ? -47.416 8.579  13.904 1.00 70.73  ? 110 ARG C CD    1 
ATOM   3054 N  NE    . ARG C 1 82  ? -46.578 7.716  14.747 1.00 81.62  ? 110 ARG C NE    1 
ATOM   3055 C  CZ    . ARG C 1 82  ? -45.656 8.137  15.619 1.00 93.08  ? 110 ARG C CZ    1 
ATOM   3056 N  NH1   . ARG C 1 82  ? -45.420 9.434  15.808 1.00 103.72 ? 110 ARG C NH1   1 
ATOM   3057 N  NH2   . ARG C 1 82  ? -44.959 7.247  16.320 1.00 99.09  ? 110 ARG C NH2   1 
ATOM   3058 N  N     . ASN C 1 83  ? -46.405 10.344 9.271  1.00 38.28  ? 111 ASN C N     1 
ATOM   3059 C  CA    . ASN C 1 83  ? -47.270 11.278 8.565  1.00 39.82  ? 111 ASN C CA    1 
ATOM   3060 C  C     . ASN C 1 83  ? -46.582 12.606 8.231  1.00 40.73  ? 111 ASN C C     1 
ATOM   3061 O  O     . ASN C 1 83  ? -47.149 13.668 8.434  1.00 45.58  ? 111 ASN C O     1 
ATOM   3062 C  CB    . ASN C 1 83  ? -48.542 11.531 9.387  1.00 43.46  ? 111 ASN C CB    1 
ATOM   3063 C  CG    . ASN C 1 83  ? -49.340 10.263 9.645  1.00 46.43  ? 111 ASN C CG    1 
ATOM   3064 O  OD1   . ASN C 1 83  ? -49.386 9.350  8.813  1.00 48.14  ? 111 ASN C OD1   1 
ATOM   3065 N  ND2   . ASN C 1 83  ? -49.995 10.213 10.791 1.00 51.69  ? 111 ASN C ND2   1 
ATOM   3066 N  N     . GLY C 1 84  ? -45.356 12.540 7.724  1.00 38.45  ? 112 GLY C N     1 
ATOM   3067 C  CA    . GLY C 1 84  ? -44.600 13.745 7.406  1.00 35.95  ? 112 GLY C CA    1 
ATOM   3068 C  C     . GLY C 1 84  ? -43.102 13.531 7.332  1.00 32.97  ? 112 GLY C C     1 
ATOM   3069 O  O     . GLY C 1 84  ? -42.594 12.478 7.716  1.00 33.41  ? 112 GLY C O     1 
ATOM   3070 N  N     . TRP C 1 85  ? -42.412 14.541 6.811  1.00 29.64  ? 113 TRP C N     1 
ATOM   3071 C  CA    . TRP C 1 85  ? -40.963 14.545 6.679  1.00 27.83  ? 113 TRP C CA    1 
ATOM   3072 C  C     . TRP C 1 85  ? -40.343 15.402 7.769  1.00 26.42  ? 113 TRP C C     1 
ATOM   3073 O  O     . TRP C 1 85  ? -40.864 16.461 8.102  1.00 29.37  ? 113 TRP C O     1 
ATOM   3074 C  CB    . TRP C 1 85  ? -40.533 15.145 5.321  1.00 27.61  ? 113 TRP C CB    1 
ATOM   3075 C  CG    . TRP C 1 85  ? -40.864 14.294 4.134  1.00 28.19  ? 113 TRP C CG    1 
ATOM   3076 C  CD1   . TRP C 1 85  ? -41.884 14.473 3.252  1.00 31.02  ? 113 TRP C CD1   1 
ATOM   3077 C  CD2   . TRP C 1 85  ? -40.144 13.150 3.695  1.00 27.81  ? 113 TRP C CD2   1 
ATOM   3078 N  NE1   . TRP C 1 85  ? -41.852 13.482 2.289  1.00 31.72  ? 113 TRP C NE1   1 
ATOM   3079 C  CE2   . TRP C 1 85  ? -40.776 12.675 2.529  1.00 29.25  ? 113 TRP C CE2   1 
ATOM   3080 C  CE3   . TRP C 1 85  ? -38.995 12.495 4.156  1.00 27.28  ? 113 TRP C CE3   1 
ATOM   3081 C  CZ2   . TRP C 1 85  ? -40.326 11.541 1.846  1.00 30.83  ? 113 TRP C CZ2   1 
ATOM   3082 C  CZ3   . TRP C 1 85  ? -38.536 11.393 3.466  1.00 28.17  ? 113 TRP C CZ3   1 
ATOM   3083 C  CH2   . TRP C 1 85  ? -39.197 10.927 2.319  1.00 29.38  ? 113 TRP C CH2   1 
ATOM   3084 N  N     . TRP C 1 86  ? -39.209 14.949 8.293  1.00 24.41  ? 114 TRP C N     1 
ATOM   3085 C  CA    . TRP C 1 86  ? -38.327 15.756 9.121  1.00 22.73  ? 114 TRP C CA    1 
ATOM   3086 C  C     . TRP C 1 86  ? -37.168 16.289 8.260  1.00 22.50  ? 114 TRP C C     1 
ATOM   3087 O  O     . TRP C 1 86  ? -36.648 15.582 7.410  1.00 22.84  ? 114 TRP C O     1 
ATOM   3088 C  CB    . TRP C 1 86  ? -37.742 14.900 10.240 1.00 21.33  ? 114 TRP C CB    1 
ATOM   3089 C  CG    . TRP C 1 86  ? -38.682 14.458 11.305 1.00 22.92  ? 114 TRP C CG    1 
ATOM   3090 C  CD1   . TRP C 1 86  ? -39.224 13.212 11.452 1.00 23.33  ? 114 TRP C CD1   1 
ATOM   3091 C  CD2   . TRP C 1 86  ? -39.153 15.234 12.410 1.00 24.18  ? 114 TRP C CD2   1 
ATOM   3092 N  NE1   . TRP C 1 86  ? -40.020 13.175 12.565 1.00 26.12  ? 114 TRP C NE1   1 
ATOM   3093 C  CE2   . TRP C 1 86  ? -39.996 14.406 13.171 1.00 26.02  ? 114 TRP C CE2   1 
ATOM   3094 C  CE3   . TRP C 1 86  ? -38.957 16.567 12.825 1.00 24.37  ? 114 TRP C CE3   1 
ATOM   3095 C  CZ2   . TRP C 1 86  ? -40.627 14.852 14.340 1.00 27.75  ? 114 TRP C CZ2   1 
ATOM   3096 C  CZ3   . TRP C 1 86  ? -39.595 17.011 13.962 1.00 24.39  ? 114 TRP C CZ3   1 
ATOM   3097 C  CH2   . TRP C 1 86  ? -40.412 16.159 14.721 1.00 26.99  ? 114 TRP C CH2   1 
ATOM   3098 N  N     . GLN C 1 87  ? -36.762 17.533 8.462  1.00 22.99  ? 115 GLN C N     1 
ATOM   3099 C  CA    . GLN C 1 87  ? -35.528 18.022 7.856  1.00 22.41  ? 115 GLN C CA    1 
ATOM   3100 C  C     . GLN C 1 87  ? -34.313 17.532 8.679  1.00 21.33  ? 115 GLN C C     1 
ATOM   3101 O  O     . GLN C 1 87  ? -34.330 17.596 9.907  1.00 21.98  ? 115 GLN C O     1 
ATOM   3102 C  CB    . GLN C 1 87  ? -35.552 19.552 7.737  1.00 23.35  ? 115 GLN C CB    1 
ATOM   3103 C  CG    . GLN C 1 87  ? -34.534 20.131 6.763  1.00 23.56  ? 115 GLN C CG    1 
ATOM   3104 C  CD    . GLN C 1 87  ? -34.793 21.601 6.443  1.00 26.95  ? 115 GLN C CD    1 
ATOM   3105 O  OE1   . GLN C 1 87  ? -35.911 21.999 6.138  1.00 27.43  ? 115 GLN C OE1   1 
ATOM   3106 N  NE2   . GLN C 1 87  ? -33.747 22.393 6.481  1.00 27.69  ? 115 GLN C NE2   1 
ATOM   3107 N  N     . TYR C 1 88  ? -33.274 17.029 8.002  1.00 19.62  ? 116 TYR C N     1 
ATOM   3108 C  CA    . TYR C 1 88  ? -31.969 16.807 8.633  1.00 19.16  ? 116 TYR C CA    1 
ATOM   3109 C  C     . TYR C 1 88  ? -31.403 18.097 9.204  1.00 22.57  ? 116 TYR C C     1 
ATOM   3110 O  O     . TYR C 1 88  ? -31.553 19.140 8.596  1.00 20.10  ? 116 TYR C O     1 
ATOM   3111 C  CB    . TYR C 1 88  ? -30.953 16.243 7.638  1.00 19.03  ? 116 TYR C CB    1 
ATOM   3112 C  CG    . TYR C 1 88  ? -31.069 14.732 7.409  1.00 19.57  ? 116 TYR C CG    1 
ATOM   3113 C  CD1   . TYR C 1 88  ? -30.419 13.846 8.235  1.00 18.88  ? 116 TYR C CD1   1 
ATOM   3114 C  CD2   . TYR C 1 88  ? -31.811 14.226 6.348  1.00 19.47  ? 116 TYR C CD2   1 
ATOM   3115 C  CE1   . TYR C 1 88  ? -30.479 12.464 8.011  1.00 20.27  ? 116 TYR C CE1   1 
ATOM   3116 C  CE2   . TYR C 1 88  ? -31.903 12.856 6.126  1.00 21.00  ? 116 TYR C CE2   1 
ATOM   3117 C  CZ    . TYR C 1 88  ? -31.249 11.988 6.975  1.00 19.98  ? 116 TYR C CZ    1 
ATOM   3118 O  OH    . TYR C 1 88  ? -31.310 10.636 6.781  1.00 22.90  ? 116 TYR C OH    1 
ATOM   3119 N  N     . ASP C 1 89  ? -30.739 18.002 10.349 1.00 22.13  ? 117 ASP C N     1 
ATOM   3120 C  CA    . ASP C 1 89  ? -29.916 19.111 10.844 1.00 26.04  ? 117 ASP C CA    1 
ATOM   3121 C  C     . ASP C 1 89  ? -28.873 19.522 9.794  1.00 27.46  ? 117 ASP C C     1 
ATOM   3122 O  O     . ASP C 1 89  ? -28.447 18.714 8.957  1.00 24.30  ? 117 ASP C O     1 
ATOM   3123 C  CB    . ASP C 1 89  ? -29.229 18.728 12.165 1.00 26.60  ? 117 ASP C CB    1 
ATOM   3124 C  CG    . ASP C 1 89  ? -28.009 17.839 11.962 1.00 26.91  ? 117 ASP C CG    1 
ATOM   3125 O  OD1   . ASP C 1 89  ? -28.109 16.578 12.001 1.00 30.71  ? 117 ASP C OD1   1 
ATOM   3126 O  OD2   . ASP C 1 89  ? -26.924 18.395 11.722 1.00 29.78  ? 117 ASP C OD2   1 
ATOM   3127 N  N     . GLU C 1 90  ? -28.446 20.779 9.870  1.00 27.03  ? 118 GLU C N     1 
ATOM   3128 C  CA    . GLU C 1 90  ? -27.569 21.357 8.880  1.00 29.87  ? 118 GLU C CA    1 
ATOM   3129 C  C     . GLU C 1 90  ? -26.233 20.635 8.729  1.00 25.59  ? 118 GLU C C     1 
ATOM   3130 O  O     . GLU C 1 90  ? -25.740 20.497 7.628  1.00 26.79  ? 118 GLU C O     1 
ATOM   3131 C  CB    . GLU C 1 90  ? -27.338 22.864 9.167  1.00 34.84  ? 118 GLU C CB    1 
ATOM   3132 C  CG    . GLU C 1 90  ? -26.373 23.112 10.315 1.00 40.95  ? 118 GLU C CG    1 
ATOM   3133 C  CD    . GLU C 1 90  ? -26.134 24.599 10.591 1.00 55.49  ? 118 GLU C CD    1 
ATOM   3134 O  OE1   . GLU C 1 90  ? -25.367 25.247 9.850  1.00 55.02  ? 118 GLU C OE1   1 
ATOM   3135 O  OE2   . GLU C 1 90  ? -26.699 25.119 11.575 1.00 46.89  ? 118 GLU C OE2   1 
ATOM   3136 N  N     . ARG C 1 91  ? -25.647 20.183 9.829  1.00 26.90  ? 119 ARG C N     1 
ATOM   3137 C  CA    . ARG C 1 91  ? -24.337 19.567 9.786  1.00 29.62  ? 119 ARG C CA    1 
ATOM   3138 C  C     . ARG C 1 91  ? -24.427 18.226 9.030  1.00 27.39  ? 119 ARG C C     1 
ATOM   3139 O  O     . ARG C 1 91  ? -23.661 17.984 8.089  1.00 27.95  ? 119 ARG C O     1 
ATOM   3140 C  CB    . ARG C 1 91  ? -23.812 19.435 11.215 1.00 33.85  ? 119 ARG C CB    1 
ATOM   3141 C  CG    . ARG C 1 91  ? -22.448 18.812 11.407 1.00 39.42  ? 119 ARG C CG    1 
ATOM   3142 C  CD    . ARG C 1 91  ? -22.026 18.966 12.870 1.00 41.88  ? 119 ARG C CD    1 
ATOM   3143 N  NE    . ARG C 1 91  ? -21.531 20.314 13.099 1.00 45.77  ? 119 ARG C NE    1 
ATOM   3144 C  CZ    . ARG C 1 91  ? -21.584 20.965 14.256 1.00 44.27  ? 119 ARG C CZ    1 
ATOM   3145 N  NH1   . ARG C 1 91  ? -22.123 20.402 15.345 1.00 48.47  ? 119 ARG C NH1   1 
ATOM   3146 N  NH2   . ARG C 1 91  ? -21.097 22.197 14.318 1.00 36.91  ? 119 ARG C NH2   1 
ATOM   3147 N  N     . THR C 1 92  ? -25.408 17.410 9.385  1.00 27.12  ? 120 THR C N     1 
ATOM   3148 C  CA    . THR C 1 92  ? -25.617 16.098 8.712  1.00 26.22  ? 120 THR C CA    1 
ATOM   3149 C  C     . THR C 1 92  ? -26.060 16.305 7.261  1.00 27.37  ? 120 THR C C     1 
ATOM   3150 O  O     . THR C 1 92  ? -25.701 15.530 6.381  1.00 25.47  ? 120 THR C O     1 
ATOM   3151 C  CB    . THR C 1 92  ? -26.644 15.259 9.449  1.00 27.38  ? 120 THR C CB    1 
ATOM   3152 O  OG1   . THR C 1 92  ? -26.221 15.087 10.808 1.00 27.40  ? 120 THR C OG1   1 
ATOM   3153 C  CG2   . THR C 1 92  ? -26.806 13.830 8.787  1.00 26.13  ? 120 THR C CG2   1 
ATOM   3154 N  N     . SER C 1 93  ? -26.795 17.397 7.003  1.00 29.32  ? 121 SER C N     1 
ATOM   3155 C  CA    . SER C 1 93  ? -27.261 17.713 5.659  1.00 28.76  ? 121 SER C CA    1 
ATOM   3156 C  C     . SER C 1 93  ? -26.073 18.021 4.709  1.00 29.68  ? 121 SER C C     1 
ATOM   3157 O  O     . SER C 1 93  ? -26.092 17.632 3.540  1.00 29.22  ? 121 SER C O     1 
ATOM   3158 C  CB    . SER C 1 93  ? -28.265 18.875 5.709  1.00 35.72  ? 121 SER C CB    1 
ATOM   3159 O  OG    . SER C 1 93  ? -28.961 19.003 4.476  1.00 41.32  ? 121 SER C OG    1 
ATOM   3160 N  N     . ARG C 1 94  ? -25.042 18.681 5.228  1.00 30.56  ? 122 ARG C N     1 
ATOM   3161 C  CA    . ARG C 1 94  ? -23.849 18.977 4.447  1.00 33.89  ? 122 ARG C CA    1 
ATOM   3162 C  C     . ARG C 1 94  ? -23.068 17.713 4.103  1.00 29.66  ? 122 ARG C C     1 
ATOM   3163 O  O     . ARG C 1 94  ? -22.470 17.629 3.041  1.00 30.31  ? 122 ARG C O     1 
ATOM   3164 C  CB    . ARG C 1 94  ? -22.940 19.965 5.177  1.00 38.37  ? 122 ARG C CB    1 
ATOM   3165 C  CG    . ARG C 1 94  ? -23.418 21.405 5.112  1.00 43.56  ? 122 ARG C CG    1 
ATOM   3166 C  CD    . ARG C 1 94  ? -22.338 22.370 5.583  1.00 47.47  ? 122 ARG C CD    1 
ATOM   3167 N  NE    . ARG C 1 94  ? -22.071 22.253 7.020  1.00 57.18  ? 122 ARG C NE    1 
ATOM   3168 C  CZ    . ARG C 1 94  ? -22.793 22.827 7.986  1.00 52.43  ? 122 ARG C CZ    1 
ATOM   3169 N  NH1   . ARG C 1 94  ? -23.859 23.570 7.694  1.00 61.90  ? 122 ARG C NH1   1 
ATOM   3170 N  NH2   . ARG C 1 94  ? -22.457 22.645 9.258  1.00 51.77  ? 122 ARG C NH2   1 
ATOM   3171 N  N     . GLU C 1 95  ? -23.059 16.752 5.009  1.00 28.76  ? 123 GLU C N     1 
ATOM   3172 C  CA    . GLU C 1 95  ? -22.379 15.495 4.752  1.00 30.78  ? 123 GLU C CA    1 
ATOM   3173 C  C     . GLU C 1 95  ? -23.116 14.729 3.656  1.00 28.16  ? 123 GLU C C     1 
ATOM   3174 O  O     . GLU C 1 95  ? -22.474 14.254 2.726  1.00 27.74  ? 123 GLU C O     1 
ATOM   3175 C  CB    . GLU C 1 95  ? -22.203 14.692 6.038  1.00 30.52  ? 123 GLU C CB    1 
ATOM   3176 C  CG    . GLU C 1 95  ? -21.699 13.250 5.857  1.00 35.72  ? 123 GLU C CG    1 
ATOM   3177 C  CD    . GLU C 1 95  ? -20.400 13.131 5.062  1.00 46.16  ? 123 GLU C CD    1 
ATOM   3178 O  OE1   . GLU C 1 95  ? -19.575 14.072 5.091  1.00 48.25  ? 123 GLU C OE1   1 
ATOM   3179 O  OE2   . GLU C 1 95  ? -20.200 12.083 4.404  1.00 43.47  ? 123 GLU C OE2   1 
ATOM   3180 N  N     . LEU C 1 96  ? -24.453 14.666 3.739  1.00 26.06  ? 124 LEU C N     1 
ATOM   3181 C  CA    . LEU C 1 96  ? -25.285 14.004 2.725  1.00 26.09  ? 124 LEU C CA    1 
ATOM   3182 C  C     . LEU C 1 96  ? -25.079 14.618 1.362  1.00 26.97  ? 124 LEU C C     1 
ATOM   3183 O  O     . LEU C 1 96  ? -24.932 13.906 0.365  1.00 24.49  ? 124 LEU C O     1 
ATOM   3184 C  CB    . LEU C 1 96  ? -26.786 14.046 3.087  1.00 25.01  ? 124 LEU C CB    1 
ATOM   3185 C  CG    . LEU C 1 96  ? -27.181 13.224 4.311  1.00 25.26  ? 124 LEU C CG    1 
ATOM   3186 C  CD1   . LEU C 1 96  ? -28.629 13.496 4.729  1.00 24.09  ? 124 LEU C CD1   1 
ATOM   3187 C  CD2   . LEU C 1 96  ? -26.959 11.738 4.009  1.00 25.74  ? 124 LEU C CD2   1 
ATOM   3188 N  N     . GLU C 1 97  ? -25.061 15.947 1.309  1.00 26.69  ? 125 GLU C N     1 
ATOM   3189 C  CA    . GLU C 1 97  ? -24.914 16.628 0.043  1.00 28.77  ? 125 GLU C CA    1 
ATOM   3190 C  C     . GLU C 1 97  ? -23.549 16.313 -0.577 1.00 28.41  ? 125 GLU C C     1 
ATOM   3191 O  O     . GLU C 1 97  ? -23.448 16.104 -1.784 1.00 29.09  ? 125 GLU C O     1 
ATOM   3192 C  CB    . GLU C 1 97  ? -25.097 18.145 0.229  1.00 31.24  ? 125 GLU C CB    1 
ATOM   3193 C  CG    . GLU C 1 97  ? -25.082 18.936 -1.064 1.00 36.09  ? 125 GLU C CG    1 
ATOM   3194 C  CD    . GLU C 1 97  ? -26.207 18.572 -2.015 1.00 33.68  ? 125 GLU C CD    1 
ATOM   3195 O  OE1   . GLU C 1 97  ? -27.205 17.945 -1.611 1.00 34.75  ? 125 GLU C OE1   1 
ATOM   3196 O  OE2   . GLU C 1 97  ? -26.102 18.922 -3.194 1.00 34.60  ? 125 GLU C OE2   1 
ATOM   3197 N  N     . ASP C 1 98  ? -22.517 16.253 0.260  1.00 29.98  ? 126 ASP C N     1 
ATOM   3198 C  CA    . ASP C 1 98  ? -21.165 15.995 -0.205 1.00 32.05  ? 126 ASP C CA    1 
ATOM   3199 C  C     . ASP C 1 98  ? -21.066 14.595 -0.801 1.00 30.78  ? 126 ASP C C     1 
ATOM   3200 O  O     . ASP C 1 98  ? -20.576 14.415 -1.934 1.00 30.76  ? 126 ASP C O     1 
ATOM   3201 C  CB    . ASP C 1 98  ? -20.168 16.151 0.927  1.00 36.59  ? 126 ASP C CB    1 
ATOM   3202 C  CG    . ASP C 1 98  ? -18.738 16.042 0.446  1.00 42.51  ? 126 ASP C CG    1 
ATOM   3203 O  OD1   . ASP C 1 98  ? -18.248 16.998 -0.181 1.00 46.16  ? 126 ASP C OD1   1 
ATOM   3204 O  OD2   . ASP C 1 98  ? -18.111 14.996 0.693  1.00 43.96  ? 126 ASP C OD2   1 
ATOM   3205 N  N     . ALA C 1 99  ? -21.572 13.623 -0.049 1.00 28.45  ? 127 ALA C N     1 
ATOM   3206 C  CA    . ALA C 1 99  ? -21.601 12.229 -0.487 1.00 28.19  ? 127 ALA C CA    1 
ATOM   3207 C  C     . ALA C 1 99  ? -22.371 12.069 -1.814 1.00 29.08  ? 127 ALA C C     1 
ATOM   3208 O  O     . ALA C 1 99  ? -21.887 11.447 -2.761 1.00 29.18  ? 127 ALA C O     1 
ATOM   3209 C  CB    . ALA C 1 99  ? -22.193 11.371 0.609  1.00 26.28  ? 127 ALA C CB    1 
ATOM   3210 N  N     . PHE C 1 100 ? -23.544 12.696 -1.886 1.00 29.12  ? 128 PHE C N     1 
ATOM   3211 C  CA    . PHE C 1 100 ? -24.404 12.603 -3.049 1.00 29.30  ? 128 PHE C CA    1 
ATOM   3212 C  C     . PHE C 1 100 ? -23.771 13.174 -4.307 1.00 30.17  ? 128 PHE C C     1 
ATOM   3213 O  O     . PHE C 1 100 ? -23.781 12.545 -5.364 1.00 29.70  ? 128 PHE C O     1 
ATOM   3214 C  CB    . PHE C 1 100 ? -25.766 13.272 -2.767 1.00 30.04  ? 128 PHE C CB    1 
ATOM   3215 C  CG    . PHE C 1 100 ? -26.746 13.125 -3.907 1.00 31.30  ? 128 PHE C CG    1 
ATOM   3216 C  CD1   . PHE C 1 100 ? -27.332 11.907 -4.176 1.00 33.17  ? 128 PHE C CD1   1 
ATOM   3217 C  CD2   . PHE C 1 100 ? -27.019 14.185 -4.733 1.00 33.39  ? 128 PHE C CD2   1 
ATOM   3218 C  CE1   . PHE C 1 100 ? -28.209 11.755 -5.247 1.00 34.49  ? 128 PHE C CE1   1 
ATOM   3219 C  CE2   . PHE C 1 100 ? -27.886 14.050 -5.800 1.00 35.44  ? 128 PHE C CE2   1 
ATOM   3220 C  CZ    . PHE C 1 100 ? -28.488 12.830 -6.054 1.00 35.57  ? 128 PHE C CZ    1 
ATOM   3221 N  N     . SER C 1 101 ? -23.203 14.365 -4.188 1.00 32.25  ? 129 SER C N     1 
ATOM   3222 C  CA    . SER C 1 101 ? -22.624 15.048 -5.324 1.00 35.70  ? 129 SER C CA    1 
ATOM   3223 C  C     . SER C 1 101 ? -21.346 14.348 -5.859 1.00 37.68  ? 129 SER C C     1 
ATOM   3224 O  O     . SER C 1 101 ? -20.960 14.570 -7.002 1.00 40.20  ? 129 SER C O     1 
ATOM   3225 C  CB    . SER C 1 101 ? -22.323 16.500 -4.954 1.00 36.71  ? 129 SER C CB    1 
ATOM   3226 O  OG    . SER C 1 101 ? -21.279 16.589 -4.008 1.00 39.03  ? 129 SER C OG    1 
ATOM   3227 N  N     . LYS C 1 102 ? -20.702 13.527 -5.025 1.00 35.66  ? 130 LYS C N     1 
ATOM   3228 C  CA    . LYS C 1 102 ? -19.540 12.734 -5.446 1.00 36.80  ? 130 LYS C CA    1 
ATOM   3229 C  C     . LYS C 1 102 ? -19.915 11.325 -5.917 1.00 35.89  ? 130 LYS C C     1 
ATOM   3230 O  O     . LYS C 1 102 ? -19.050 10.568 -6.331 1.00 39.23  ? 130 LYS C O     1 
ATOM   3231 C  CB    . LYS C 1 102 ? -18.529 12.634 -4.304 1.00 37.59  ? 130 LYS C CB    1 
ATOM   3232 C  CG    . LYS C 1 102 ? -17.862 13.959 -3.995 1.00 39.66  ? 130 LYS C CG    1 
ATOM   3233 C  CD    . LYS C 1 102 ? -17.036 13.891 -2.725 1.00 41.90  ? 130 LYS C CD    1 
ATOM   3234 C  CE    . LYS C 1 102 ? -16.366 15.235 -2.453 1.00 46.18  ? 130 LYS C CE    1 
ATOM   3235 N  NZ    . LYS C 1 102 ? -15.685 15.237 -1.134 1.00 47.70  ? 130 LYS C NZ    1 
ATOM   3236 N  N     . GLY C 1 103 ? -21.200 10.992 -5.874 1.00 33.58  ? 131 GLY C N     1 
ATOM   3237 C  CA    . GLY C 1 103 ? -21.681 9.699  -6.306 1.00 33.92  ? 131 GLY C CA    1 
ATOM   3238 C  C     . GLY C 1 103 ? -21.365 8.556  -5.338 1.00 33.53  ? 131 GLY C C     1 
ATOM   3239 O  O     . GLY C 1 103 ? -21.323 7.402  -5.742 1.00 34.41  ? 131 GLY C O     1 
ATOM   3240 N  N     . LYS C 1 104 ? -21.157 8.859  -4.064 1.00 32.69  ? 132 LYS C N     1 
ATOM   3241 C  CA    . LYS C 1 104 ? -20.957 7.788  -3.083 1.00 33.83  ? 132 LYS C CA    1 
ATOM   3242 C  C     . LYS C 1 104 ? -22.232 6.944  -2.926 1.00 32.12  ? 132 LYS C C     1 
ATOM   3243 O  O     . LYS C 1 104 ? -23.337 7.477  -2.900 1.00 31.65  ? 132 LYS C O     1 
ATOM   3244 C  CB    . LYS C 1 104 ? -20.516 8.360  -1.758 1.00 34.45  ? 132 LYS C CB    1 
ATOM   3245 C  CG    . LYS C 1 104 ? -19.176 9.055  -1.826 1.00 37.18  ? 132 LYS C CG    1 
ATOM   3246 C  CD    . LYS C 1 104 ? -18.694 9.413  -0.441 1.00 40.68  ? 132 LYS C CD    1 
ATOM   3247 C  CE    . LYS C 1 104 ? -17.385 10.187 -0.502 1.00 45.29  ? 132 LYS C CE    1 
ATOM   3248 N  NZ    . LYS C 1 104 ? -17.043 10.791 0.816  1.00 47.51  ? 132 LYS C NZ    1 
ATOM   3249 N  N     . LYS C 1 105 ? -22.084 5.628  -2.868 1.00 34.08  ? 133 LYS C N     1 
ATOM   3250 C  CA    . LYS C 1 105 ? -23.234 4.739  -2.698 1.00 35.20  ? 133 LYS C CA    1 
ATOM   3251 C  C     . LYS C 1 105 ? -23.834 4.911  -1.291 1.00 32.00  ? 133 LYS C C     1 
ATOM   3252 O  O     . LYS C 1 105 ? -25.024 4.796  -1.110 1.00 30.26  ? 133 LYS C O     1 
ATOM   3253 C  CB    . LYS C 1 105 ? -22.842 3.276  -2.945 1.00 41.15  ? 133 LYS C CB    1 
ATOM   3254 C  CG    . LYS C 1 105 ? -22.517 2.965  -4.402 1.00 49.46  ? 133 LYS C CG    1 
ATOM   3255 C  CD    . LYS C 1 105 ? -21.735 1.658  -4.515 1.00 57.32  ? 133 LYS C CD    1 
ATOM   3256 C  CE    . LYS C 1 105 ? -21.405 1.279  -5.952 1.00 67.90  ? 133 LYS C CE    1 
ATOM   3257 N  NZ    . LYS C 1 105 ? -22.539 0.566  -6.607 1.00 69.56  ? 133 LYS C NZ    1 
ATOM   3258 N  N     . ASN C 1 106 ? -22.992 5.184  -0.309 1.00 30.90  ? 134 ASN C N     1 
ATOM   3259 C  CA    . ASN C 1 106 ? -23.455 5.436  1.036  1.00 31.04  ? 134 ASN C CA    1 
ATOM   3260 C  C     . ASN C 1 106 ? -22.485 6.304  1.780  1.00 29.88  ? 134 ASN C C     1 
ATOM   3261 O  O     . ASN C 1 106 ? -21.381 6.538  1.311  1.00 31.02  ? 134 ASN C O     1 
ATOM   3262 C  CB    . ASN C 1 106 ? -23.667 4.103  1.784  1.00 33.18  ? 134 ASN C CB    1 
ATOM   3263 C  CG    . ASN C 1 106 ? -22.489 3.175  1.680  1.00 36.34  ? 134 ASN C CG    1 
ATOM   3264 O  OD1   . ASN C 1 106 ? -21.403 3.460  2.170  1.00 38.79  ? 134 ASN C OD1   1 
ATOM   3265 N  ND2   . ASN C 1 106 ? -22.694 2.055  1.025  1.00 40.43  ? 134 ASN C ND2   1 
ATOM   3266 N  N     . THR C 1 107 ? -22.905 6.786  2.942  1.00 28.19  ? 135 THR C N     1 
ATOM   3267 C  CA    . THR C 1 107 ? -22.013 7.416  3.883  1.00 30.25  ? 135 THR C CA    1 
ATOM   3268 C  C     . THR C 1 107 ? -22.493 7.112  5.313  1.00 29.40  ? 135 THR C C     1 
ATOM   3269 O  O     . THR C 1 107 ? -23.617 6.639  5.505  1.00 27.90  ? 135 THR C O     1 
ATOM   3270 C  CB    . THR C 1 107 ? -21.920 8.946  3.619  1.00 30.81  ? 135 THR C CB    1 
ATOM   3271 O  OG1   . THR C 1 107 ? -20.884 9.513  4.416  1.00 32.74  ? 135 THR C OG1   1 
ATOM   3272 C  CG2   . THR C 1 107 ? -23.229 9.659  3.876  1.00 30.54  ? 135 THR C CG2   1 
ATOM   3273 N  N     . GLU C 1 108 ? -21.633 7.370  6.294  1.00 30.64  ? 136 GLU C N     1 
ATOM   3274 C  CA    . GLU C 1 108 ? -21.981 7.235  7.718  1.00 32.16  ? 136 GLU C CA    1 
ATOM   3275 C  C     . GLU C 1 108 ? -22.137 8.575  8.399  1.00 33.98  ? 136 GLU C C     1 
ATOM   3276 O  O     . GLU C 1 108 ? -21.389 9.519  8.112  1.00 36.19  ? 136 GLU C O     1 
ATOM   3277 C  CB    . GLU C 1 108 ? -20.930 6.428  8.464  1.00 37.96  ? 136 GLU C CB    1 
ATOM   3278 C  CG    . GLU C 1 108 ? -20.975 4.944  8.120  1.00 43.60  ? 136 GLU C CG    1 
ATOM   3279 C  CD    . GLU C 1 108 ? -20.182 4.060  9.075  1.00 52.93  ? 136 GLU C CD    1 
ATOM   3280 O  OE1   . GLU C 1 108 ? -19.665 4.562  10.097 1.00 61.26  ? 136 GLU C OE1   1 
ATOM   3281 O  OE2   . GLU C 1 108 ? -20.096 2.843  8.801  1.00 55.55  ? 136 GLU C OE2   1 
ATOM   3282 N  N     . MET C 1 109 ? -23.084 8.647  9.330  1.00 29.91  ? 137 MET C N     1 
ATOM   3283 C  CA    . MET C 1 109 ? -23.310 9.857  10.108 1.00 32.79  ? 137 MET C CA    1 
ATOM   3284 C  C     . MET C 1 109 ? -23.599 9.460  11.572 1.00 31.01  ? 137 MET C C     1 
ATOM   3285 O  O     . MET C 1 109 ? -24.302 8.481  11.836 1.00 27.32  ? 137 MET C O     1 
ATOM   3286 C  CB    . MET C 1 109 ? -24.455 10.692 9.475  1.00 34.91  ? 137 MET C CB    1 
ATOM   3287 C  CG    . MET C 1 109 ? -25.748 9.915  9.172  1.00 35.26  ? 137 MET C CG    1 
ATOM   3288 S  SD    . MET C 1 109 ? -26.935 10.574 7.949  1.00 46.22  ? 137 MET C SD    1 
ATOM   3289 C  CE    . MET C 1 109 ? -28.078 9.193  7.808  1.00 33.43  ? 137 MET C CE    1 
ATOM   3290 N  N     . LEU C 1 110 ? -23.032 10.206 12.514 1.00 31.64  ? 138 LEU C N     1 
ATOM   3291 C  CA    . LEU C 1 110 ? -23.375 10.069 13.927 1.00 30.00  ? 138 LEU C CA    1 
ATOM   3292 C  C     . LEU C 1 110 ? -24.601 10.897 14.211 1.00 28.83  ? 138 LEU C C     1 
ATOM   3293 O  O     . LEU C 1 110 ? -24.583 12.128 14.072 1.00 28.01  ? 138 LEU C O     1 
ATOM   3294 C  CB    . LEU C 1 110 ? -22.241 10.535 14.837 1.00 31.24  ? 138 LEU C CB    1 
ATOM   3295 C  CG    . LEU C 1 110 ? -22.578 10.458 16.338 1.00 31.60  ? 138 LEU C CG    1 
ATOM   3296 C  CD1   . LEU C 1 110 ? -22.636 9.003  16.787 1.00 34.66  ? 138 LEU C CD1   1 
ATOM   3297 C  CD2   . LEU C 1 110 ? -21.571 11.220 17.177 1.00 34.99  ? 138 LEU C CD2   1 
ATOM   3298 N  N     . ILE C 1 111 ? -25.660 10.247 14.667 1.00 26.15  ? 139 ILE C N     1 
ATOM   3299 C  CA    . ILE C 1 111 ? -26.894 10.978 14.949 1.00 26.43  ? 139 ILE C CA    1 
ATOM   3300 C  C     . ILE C 1 111 ? -27.407 10.539 16.306 1.00 25.58  ? 139 ILE C C     1 
ATOM   3301 O  O     . ILE C 1 111 ? -27.745 9.370  16.509 1.00 25.74  ? 139 ILE C O     1 
ATOM   3302 C  CB    . ILE C 1 111 ? -27.963 10.729 13.862 1.00 29.21  ? 139 ILE C CB    1 
ATOM   3303 C  CG1   . ILE C 1 111 ? -27.421 11.051 12.467 1.00 28.26  ? 139 ILE C CG1   1 
ATOM   3304 C  CG2   . ILE C 1 111 ? -29.221 11.548 14.139 1.00 29.33  ? 139 ILE C CG2   1 
ATOM   3305 C  CD1   . ILE C 1 111 ? -28.450 10.880 11.367 1.00 31.41  ? 139 ILE C CD1   1 
ATOM   3306 N  N     . ALA C 1 112 ? -27.439 11.482 17.239 1.00 26.04  ? 140 ALA C N     1 
ATOM   3307 C  CA    . ALA C 1 112 ? -27.903 11.230 18.608 1.00 26.55  ? 140 ALA C CA    1 
ATOM   3308 C  C     . ALA C 1 112 ? -27.359 9.952  19.229 1.00 29.67  ? 140 ALA C C     1 
ATOM   3309 O  O     . ALA C 1 112 ? -28.118 9.096  19.691 1.00 32.55  ? 140 ALA C O     1 
ATOM   3310 C  CB    . ALA C 1 112 ? -29.419 11.234 18.632 1.00 30.67  ? 140 ALA C CB    1 
ATOM   3311 N  N     . GLY C 1 113 ? -26.033 9.844  19.230 1.00 26.88  ? 141 GLY C N     1 
ATOM   3312 C  CA    . GLY C 1 113 ? -25.323 8.797  19.908 1.00 30.10  ? 141 GLY C CA    1 
ATOM   3313 C  C     . GLY C 1 113 ? -25.086 7.521  19.125 1.00 30.85  ? 141 GLY C C     1 
ATOM   3314 O  O     . GLY C 1 113 ? -24.337 6.673  19.594 1.00 31.80  ? 141 GLY C O     1 
ATOM   3315 N  N     . PHE C 1 114 ? -25.692 7.375  17.944 1.00 28.85  ? 142 PHE C N     1 
ATOM   3316 C  CA    . PHE C 1 114 ? -25.531 6.144  17.158 1.00 30.42  ? 142 PHE C CA    1 
ATOM   3317 C  C     . PHE C 1 114 ? -25.090 6.440  15.744 1.00 27.55  ? 142 PHE C C     1 
ATOM   3318 O  O     . PHE C 1 114 ? -25.415 7.480  15.195 1.00 25.06  ? 142 PHE C O     1 
ATOM   3319 C  CB    . PHE C 1 114 ? -26.826 5.347  17.127 1.00 30.49  ? 142 PHE C CB    1 
ATOM   3320 C  CG    . PHE C 1 114 ? -27.158 4.742  18.449 1.00 33.83  ? 142 PHE C CG    1 
ATOM   3321 C  CD1   . PHE C 1 114 ? -27.852 5.469  19.402 1.00 34.03  ? 142 PHE C CD1   1 
ATOM   3322 C  CD2   . PHE C 1 114 ? -26.731 3.460  18.761 1.00 38.65  ? 142 PHE C CD2   1 
ATOM   3323 C  CE1   . PHE C 1 114 ? -28.141 4.915  20.630 1.00 36.39  ? 142 PHE C CE1   1 
ATOM   3324 C  CE2   . PHE C 1 114 ? -27.024 2.897  19.987 1.00 42.96  ? 142 PHE C CE2   1 
ATOM   3325 C  CZ    . PHE C 1 114 ? -27.730 3.628  20.923 1.00 42.59  ? 142 PHE C CZ    1 
ATOM   3326 N  N     . LEU C 1 115 ? -24.339 5.514  15.173 1.00 28.49  ? 143 LEU C N     1 
ATOM   3327 C  CA    . LEU C 1 115 ? -23.895 5.643  13.797 1.00 28.66  ? 143 LEU C CA    1 
ATOM   3328 C  C     . LEU C 1 115 ? -24.986 5.139  12.900 1.00 27.57  ? 143 LEU C C     1 
ATOM   3329 O  O     . LEU C 1 115 ? -25.479 4.007  13.086 1.00 28.00  ? 143 LEU C O     1 
ATOM   3330 C  CB    . LEU C 1 115 ? -22.606 4.843  13.550 1.00 34.17  ? 143 LEU C CB    1 
ATOM   3331 C  CG    . LEU C 1 115 ? -21.321 5.501  14.067 1.00 38.04  ? 143 LEU C CG    1 
ATOM   3332 C  CD1   . LEU C 1 115 ? -20.107 4.691  13.664 1.00 44.58  ? 143 LEU C CD1   1 
ATOM   3333 C  CD2   . LEU C 1 115 ? -21.197 6.931  13.540 1.00 40.38  ? 143 LEU C CD2   1 
ATOM   3334 N  N     . TYR C 1 116 ? -25.357 5.971  11.933 1.00 23.49  ? 144 TYR C N     1 
ATOM   3335 C  CA    . TYR C 1 116 ? -26.314 5.604  10.905 1.00 24.12  ? 144 TYR C CA    1 
ATOM   3336 C  C     . TYR C 1 116 ? -25.629 5.469  9.553  1.00 25.07  ? 144 TYR C C     1 
ATOM   3337 O  O     . TYR C 1 116 ? -24.599 6.105  9.281  1.00 25.48  ? 144 TYR C O     1 
ATOM   3338 C  CB    . TYR C 1 116 ? -27.416 6.658  10.821 1.00 22.22  ? 144 TYR C CB    1 
ATOM   3339 C  CG    . TYR C 1 116 ? -28.438 6.570  11.922 1.00 21.52  ? 144 TYR C CG    1 
ATOM   3340 C  CD1   . TYR C 1 116 ? -28.146 7.018  13.190 1.00 21.93  ? 144 TYR C CD1   1 
ATOM   3341 C  CD2   . TYR C 1 116 ? -29.706 6.046  11.681 1.00 21.90  ? 144 TYR C CD2   1 
ATOM   3342 C  CE1   . TYR C 1 116 ? -29.063 6.934  14.214 1.00 22.80  ? 144 TYR C CE1   1 
ATOM   3343 C  CE2   . TYR C 1 116 ? -30.639 5.948  12.688 1.00 22.28  ? 144 TYR C CE2   1 
ATOM   3344 C  CZ    . TYR C 1 116 ? -30.318 6.398  13.961 1.00 23.75  ? 144 TYR C CZ    1 
ATOM   3345 O  OH    . TYR C 1 116 ? -31.227 6.328  15.001 1.00 25.01  ? 144 TYR C OH    1 
ATOM   3346 N  N     . VAL C 1 117 ? -26.195 4.627  8.705  1.00 25.46  ? 145 VAL C N     1 
ATOM   3347 C  CA    . VAL C 1 117 ? -25.812 4.567  7.318  1.00 25.92  ? 145 VAL C CA    1 
ATOM   3348 C  C     . VAL C 1 117 ? -26.855 5.313  6.541  1.00 25.70  ? 145 VAL C C     1 
ATOM   3349 O  O     . VAL C 1 117 ? -28.073 5.124  6.751  1.00 24.74  ? 145 VAL C O     1 
ATOM   3350 C  CB    . VAL C 1 117 ? -25.748 3.124  6.790  1.00 28.25  ? 145 VAL C CB    1 
ATOM   3351 C  CG1   . VAL C 1 117 ? -25.419 3.118  5.299  1.00 30.54  ? 145 VAL C CG1   1 
ATOM   3352 C  CG2   . VAL C 1 117 ? -24.713 2.349  7.558  1.00 30.63  ? 145 VAL C CG2   1 
ATOM   3353 N  N     . ALA C 1 118 ? -26.384 6.180  5.655  1.00 25.32  ? 146 ALA C N     1 
ATOM   3354 C  CA    . ALA C 1 118 ? -27.229 6.780  4.659  1.00 25.75  ? 146 ALA C CA    1 
ATOM   3355 C  C     . ALA C 1 118 ? -26.949 6.045  3.371  1.00 25.89  ? 146 ALA C C     1 
ATOM   3356 O  O     . ALA C 1 118 ? -25.853 6.119  2.818  1.00 27.66  ? 146 ALA C O     1 
ATOM   3357 C  CB    . ALA C 1 118 ? -26.951 8.286  4.526  1.00 27.19  ? 146 ALA C CB    1 
ATOM   3358 N  N     . ASP C 1 119 ? -27.938 5.294  2.916  1.00 26.44  ? 147 ASP C N     1 
ATOM   3359 C  CA    . ASP C 1 119 ? -27.823 4.529  1.701  1.00 28.12  ? 147 ASP C CA    1 
ATOM   3360 C  C     . ASP C 1 119 ? -28.384 5.428  0.590  1.00 25.93  ? 147 ASP C C     1 
ATOM   3361 O  O     . ASP C 1 119 ? -29.563 5.684  0.530  1.00 25.69  ? 147 ASP C O     1 
ATOM   3362 C  CB    . ASP C 1 119 ? -28.580 3.194  1.853  1.00 29.60  ? 147 ASP C CB    1 
ATOM   3363 C  CG    . ASP C 1 119 ? -28.626 2.382  0.573  1.00 34.51  ? 147 ASP C CG    1 
ATOM   3364 O  OD1   . ASP C 1 119 ? -28.265 2.925  -0.503 1.00 31.31  ? 147 ASP C OD1   1 
ATOM   3365 O  OD2   . ASP C 1 119 ? -29.037 1.182  0.636  1.00 37.44  ? 147 ASP C OD2   1 
ATOM   3366 N  N     . LEU C 1 120 ? -27.516 5.925  -0.268 1.00 28.17  ? 148 LEU C N     1 
ATOM   3367 C  CA    . LEU C 1 120 ? -27.922 6.936  -1.244 1.00 29.31  ? 148 LEU C CA    1 
ATOM   3368 C  C     . LEU C 1 120 ? -28.365 6.310  -2.558 1.00 33.13  ? 148 LEU C C     1 
ATOM   3369 O  O     . LEU C 1 120 ? -28.797 7.018  -3.474 1.00 33.35  ? 148 LEU C O     1 
ATOM   3370 C  CB    . LEU C 1 120 ? -26.787 7.926  -1.483 1.00 30.39  ? 148 LEU C CB    1 
ATOM   3371 C  CG    . LEU C 1 120 ? -26.301 8.648  -0.235 1.00 30.07  ? 148 LEU C CG    1 
ATOM   3372 C  CD1   . LEU C 1 120 ? -25.092 9.488  -0.594 1.00 34.10  ? 148 LEU C CD1   1 
ATOM   3373 C  CD2   . LEU C 1 120 ? -27.382 9.498  0.403  1.00 29.87  ? 148 LEU C CD2   1 
ATOM   3374 N  N     . GLU C 1 121 ? -28.235 4.988  -2.662 1.00 32.46  ? 149 GLU C N     1 
ATOM   3375 C  CA    . GLU C 1 121 ? -28.743 4.274  -3.806 1.00 33.64  ? 149 GLU C CA    1 
ATOM   3376 C  C     . GLU C 1 121 ? -30.202 3.947  -3.557 1.00 32.53  ? 149 GLU C C     1 
ATOM   3377 O  O     . GLU C 1 121 ? -31.035 4.068  -4.441 1.00 34.51  ? 149 GLU C O     1 
ATOM   3378 C  CB    . GLU C 1 121 ? -27.974 2.969  -4.001 1.00 38.07  ? 149 GLU C CB    1 
ATOM   3379 C  CG    . GLU C 1 121 ? -26.503 3.095  -4.338 1.00 40.64  ? 149 GLU C CG    1 
ATOM   3380 C  CD    . GLU C 1 121 ? -25.914 1.741  -4.760 1.00 47.21  ? 149 GLU C CD    1 
ATOM   3381 O  OE1   . GLU C 1 121 ? -25.817 0.817  -3.919 1.00 49.10  ? 149 GLU C OE1   1 
ATOM   3382 O  OE2   . GLU C 1 121 ? -25.533 1.594  -5.936 1.00 49.81  ? 149 GLU C OE2   1 
ATOM   3383 N  N     . ASN C 1 122 ? -30.514 3.492  -2.351 1.00 31.84  ? 150 ASN C N     1 
ATOM   3384 C  CA    . ASN C 1 122 ? -31.886 3.103  -2.032 1.00 32.07  ? 150 ASN C CA    1 
ATOM   3385 C  C     . ASN C 1 122 ? -32.648 4.198  -1.319 1.00 29.25  ? 150 ASN C C     1 
ATOM   3386 O  O     . ASN C 1 122 ? -33.856 4.075  -1.104 1.00 28.72  ? 150 ASN C O     1 
ATOM   3387 C  CB    . ASN C 1 122 ? -31.902 1.809  -1.219 1.00 34.55  ? 150 ASN C CB    1 
ATOM   3388 C  CG    . ASN C 1 122 ? -31.423 0.637  -2.027 1.00 36.49  ? 150 ASN C CG    1 
ATOM   3389 O  OD1   . ASN C 1 122 ? -32.059 0.256  -3.016 1.00 38.62  ? 150 ASN C OD1   1 
ATOM   3390 N  ND2   . ASN C 1 122 ? -30.288 0.064  -1.634 1.00 37.35  ? 150 ASN C ND2   1 
ATOM   3391 N  N     . MET C 1 123 ? -31.944 5.280  -0.989 1.00 27.11  ? 151 MET C N     1 
ATOM   3392 C  CA    . MET C 1 123 ? -32.521 6.430  -0.292 1.00 25.39  ? 151 MET C CA    1 
ATOM   3393 C  C     . MET C 1 123 ? -33.208 6.055  1.023  1.00 23.38  ? 151 MET C C     1 
ATOM   3394 O  O     . MET C 1 123 ? -34.399 6.244  1.215  1.00 23.17  ? 151 MET C O     1 
ATOM   3395 C  CB    . MET C 1 123 ? -33.418 7.231  -1.251 1.00 28.01  ? 151 MET C CB    1 
ATOM   3396 C  CG    . MET C 1 123 ? -32.609 7.818  -2.425 1.00 30.53  ? 151 MET C CG    1 
ATOM   3397 S  SD    . MET C 1 123 ? -31.287 8.982  -1.979 1.00 36.55  ? 151 MET C SD    1 
ATOM   3398 C  CE    . MET C 1 123 ? -32.187 10.467 -1.589 1.00 38.80  ? 151 MET C CE    1 
ATOM   3399 N  N     . VAL C 1 124 ? -32.405 5.560  1.930  1.00 23.31  ? 152 VAL C N     1 
ATOM   3400 C  CA    . VAL C 1 124 ? -32.873 5.198  3.226  1.00 24.10  ? 152 VAL C CA    1 
ATOM   3401 C  C     . VAL C 1 124 ? -31.746 5.340  4.219  1.00 23.27  ? 152 VAL C C     1 
ATOM   3402 O  O     . VAL C 1 124 ? -30.619 5.268  3.848  1.00 23.78  ? 152 VAL C O     1 
ATOM   3403 C  CB    . VAL C 1 124 ? -33.395 3.732  3.190  1.00 26.91  ? 152 VAL C CB    1 
ATOM   3404 C  CG1   . VAL C 1 124 ? -32.255 2.841  2.865  1.00 27.85  ? 152 VAL C CG1   1 
ATOM   3405 C  CG2   . VAL C 1 124 ? -33.979 3.309  4.495  1.00 30.23  ? 152 VAL C CG2   1 
ATOM   3406 N  N     . GLN C 1 125 ? -32.086 5.544  5.472  1.00 22.35  ? 153 GLN C N     1 
ATOM   3407 C  CA    . GLN C 1 125 ? -31.123 5.530  6.542  1.00 23.20  ? 153 GLN C CA    1 
ATOM   3408 C  C     . GLN C 1 125 ? -31.533 4.494  7.582  1.00 23.78  ? 153 GLN C C     1 
ATOM   3409 O  O     . GLN C 1 125 ? -32.680 4.273  7.778  1.00 23.43  ? 153 GLN C O     1 
ATOM   3410 C  CB    . GLN C 1 125 ? -31.009 6.880  7.257  1.00 22.59  ? 153 GLN C CB    1 
ATOM   3411 C  CG    . GLN C 1 125 ? -32.272 7.343  7.956  1.00 22.37  ? 153 GLN C CG    1 
ATOM   3412 C  CD    . GLN C 1 125 ? -32.033 8.251  9.148  1.00 23.58  ? 153 GLN C CD    1 
ATOM   3413 O  OE1   . GLN C 1 125 ? -31.519 9.349  9.006  1.00 24.99  ? 153 GLN C OE1   1 
ATOM   3414 N  NE2   . GLN C 1 125 ? -32.439 7.822  10.290 1.00 21.40  ? 153 GLN C NE2   1 
ATOM   3415 N  N     . TYR C 1 126 ? -30.546 3.971  8.281  1.00 25.82  ? 154 TYR C N     1 
ATOM   3416 C  CA    . TYR C 1 126 ? -30.758 3.042  9.368  1.00 27.67  ? 154 TYR C CA    1 
ATOM   3417 C  C     . TYR C 1 126 ? -29.515 2.916  10.231 1.00 28.67  ? 154 TYR C C     1 
ATOM   3418 O  O     . TYR C 1 126 ? -28.451 3.197  9.777  1.00 27.33  ? 154 TYR C O     1 
ATOM   3419 C  CB    . TYR C 1 126 ? -31.130 1.677  8.797  1.00 29.63  ? 154 TYR C CB    1 
ATOM   3420 C  CG    . TYR C 1 126 ? -30.151 1.176  7.805  1.00 30.70  ? 154 TYR C CG    1 
ATOM   3421 C  CD1   . TYR C 1 126 ? -30.354 1.335  6.473  1.00 30.48  ? 154 TYR C CD1   1 
ATOM   3422 C  CD2   . TYR C 1 126 ? -29.022 0.528  8.200  1.00 33.53  ? 154 TYR C CD2   1 
ATOM   3423 C  CE1   . TYR C 1 126 ? -29.450 0.903  5.563  1.00 32.26  ? 154 TYR C CE1   1 
ATOM   3424 C  CE2   . TYR C 1 126 ? -28.121 0.057  7.285  1.00 34.05  ? 154 TYR C CE2   1 
ATOM   3425 C  CZ    . TYR C 1 126 ? -28.347 0.252  5.968  1.00 33.28  ? 154 TYR C CZ    1 
ATOM   3426 O  OH    . TYR C 1 126 ? -27.460 -0.179 5.057  1.00 36.04  ? 154 TYR C OH    1 
ATOM   3427 N  N     . ARG C 1 127 ? -29.670 2.447  11.468 1.00 30.61  ? 155 ARG C N     1 
ATOM   3428 C  CA    . ARG C 1 127 ? -28.519 2.273  12.366 1.00 31.05  ? 155 ARG C CA    1 
ATOM   3429 C  C     . ARG C 1 127 ? -27.634 1.160  11.866 1.00 32.48  ? 155 ARG C C     1 
ATOM   3430 O  O     . ARG C 1 127 ? -28.101 0.048  11.595 1.00 31.73  ? 155 ARG C O     1 
ATOM   3431 C  CB    . ARG C 1 127 ? -28.942 1.923  13.799 1.00 33.10  ? 155 ARG C CB    1 
ATOM   3432 C  CG    . ARG C 1 127 ? -29.486 3.076  14.568 1.00 32.54  ? 155 ARG C CG    1 
ATOM   3433 C  CD    . ARG C 1 127 ? -29.540 2.805  16.062 1.00 33.63  ? 155 ARG C CD    1 
ATOM   3434 N  NE    . ARG C 1 127 ? -30.051 3.996  16.736 1.00 36.48  ? 155 ARG C NE    1 
ATOM   3435 C  CZ    . ARG C 1 127 ? -30.463 4.059  17.999 1.00 36.46  ? 155 ARG C CZ    1 
ATOM   3436 N  NH1   . ARG C 1 127 ? -30.416 2.997  18.787 1.00 37.33  ? 155 ARG C NH1   1 
ATOM   3437 N  NH2   . ARG C 1 127 ? -30.917 5.213  18.475 1.00 38.07  ? 155 ARG C NH2   1 
ATOM   3438 N  N     . ARG C 1 128 ? -26.337 1.440  11.794 1.00 34.08  ? 156 ARG C N     1 
ATOM   3439 C  CA    . ARG C 1 128 ? -25.396 0.418  11.366 1.00 38.57  ? 156 ARG C CA    1 
ATOM   3440 C  C     . ARG C 1 128 ? -25.360 -0.758 12.365 1.00 38.45  ? 156 ARG C C     1 
ATOM   3441 O  O     . ARG C 1 128 ? -25.279 -0.549 13.581 1.00 38.06  ? 156 ARG C O     1 
ATOM   3442 C  CB    . ARG C 1 128 ? -23.996 1.011  11.181 1.00 41.12  ? 156 ARG C CB    1 
ATOM   3443 C  CG    . ARG C 1 128 ? -23.055 0.022  10.494 1.00 50.92  ? 156 ARG C CG    1 
ATOM   3444 C  CD    . ARG C 1 128 ? -21.829 0.679  9.879  1.00 62.03  ? 156 ARG C CD    1 
ATOM   3445 N  NE    . ARG C 1 128 ? -20.964 -0.300 9.204  1.00 68.26  ? 156 ARG C NE    1 
ATOM   3446 C  CZ    . ARG C 1 128 ? -19.924 -0.931 9.757  1.00 78.96  ? 156 ARG C CZ    1 
ATOM   3447 N  NH1   . ARG C 1 128 ? -19.572 -0.705 11.024 1.00 84.13  ? 156 ARG C NH1   1 
ATOM   3448 N  NH2   . ARG C 1 128 ? -19.226 -1.806 9.035  1.00 75.93  ? 156 ARG C NH2   1 
ATOM   3449 N  N     . ASN C 1 129 ? -25.421 -1.978 11.836 1.00 39.86  ? 157 ASN C N     1 
ATOM   3450 C  CA    . ASN C 1 129 ? -25.320 -3.214 12.627 1.00 46.06  ? 157 ASN C CA    1 
ATOM   3451 C  C     . ASN C 1 129 ? -26.347 -3.373 13.766 1.00 45.13  ? 157 ASN C C     1 
ATOM   3452 O  O     . ASN C 1 129 ? -26.032 -3.910 14.833 1.00 49.02  ? 157 ASN C O     1 
ATOM   3453 C  CB    . ASN C 1 129 ? -23.883 -3.401 13.156 1.00 49.38  ? 157 ASN C CB    1 
ATOM   3454 C  CG    . ASN C 1 129 ? -22.893 -3.752 12.053 1.00 51.59  ? 157 ASN C CG    1 
ATOM   3455 O  OD1   . ASN C 1 129 ? -23.179 -4.562 11.160 1.00 59.23  ? 157 ASN C OD1   1 
ATOM   3456 N  ND2   . ASN C 1 129 ? -21.712 -3.160 12.123 1.00 53.96  ? 157 ASN C ND2   1 
ATOM   3457 N  N     . GLU C 1 130 ? -27.574 -2.920 13.514 1.00 42.97  ? 158 GLU C N     1 
ATOM   3458 C  CA    . GLU C 1 130 ? -28.711 -3.132 14.413 1.00 43.86  ? 158 GLU C CA    1 
ATOM   3459 C  C     . GLU C 1 130 ? -29.977 -3.499 13.625 1.00 43.49  ? 158 GLU C C     1 
ATOM   3460 O  O     . GLU C 1 130 ? -30.063 -3.286 12.407 1.00 39.17  ? 158 GLU C O     1 
ATOM   3461 C  CB    . GLU C 1 130 ? -28.985 -1.867 15.228 1.00 45.67  ? 158 GLU C CB    1 
ATOM   3462 C  CG    . GLU C 1 130 ? -27.776 -1.310 15.960 1.00 52.78  ? 158 GLU C CG    1 
ATOM   3463 C  CD    . GLU C 1 130 ? -28.136 -0.558 17.238 1.00 57.88  ? 158 GLU C CD    1 
ATOM   3464 O  OE1   . GLU C 1 130 ? -29.274 -0.046 17.361 1.00 61.11  ? 158 GLU C OE1   1 
ATOM   3465 O  OE2   . GLU C 1 130 ? -27.275 -0.498 18.140 1.00 54.92  ? 158 GLU C OE2   1 
ATOM   3466 N  N     . HIS C 1 131 ? -30.918 -4.148 14.307 1.00 44.94  ? 159 HIS C N     1 
ATOM   3467 C  CA    . HIS C 1 131 ? -32.342 -4.057 13.980 1.00 43.51  ? 159 HIS C CA    1 
ATOM   3468 C  C     . HIS C 1 131 ? -32.807 -2.675 14.332 1.00 44.53  ? 159 HIS C C     1 
ATOM   3469 O  O     . HIS C 1 131 ? -32.540 -2.183 15.421 1.00 50.90  ? 159 HIS C O     1 
ATOM   3470 C  CB    . HIS C 1 131 ? -33.167 -5.006 14.819 1.00 46.16  ? 159 HIS C CB    1 
ATOM   3471 C  CG    . HIS C 1 131 ? -32.906 -6.432 14.521 1.00 46.64  ? 159 HIS C CG    1 
ATOM   3472 N  ND1   . HIS C 1 131 ? -32.064 -7.200 15.288 1.00 50.41  ? 159 HIS C ND1   1 
ATOM   3473 C  CD2   . HIS C 1 131 ? -33.350 -7.228 13.525 1.00 47.73  ? 159 HIS C CD2   1 
ATOM   3474 C  CE1   . HIS C 1 131 ? -32.024 -8.426 14.797 1.00 51.09  ? 159 HIS C CE1   1 
ATOM   3475 N  NE2   . HIS C 1 131 ? -32.794 -8.471 13.726 1.00 51.09  ? 159 HIS C NE2   1 
ATOM   3476 N  N     . GLY C 1 132 ? -33.538 -2.072 13.421 1.00 40.75  ? 160 GLY C N     1 
ATOM   3477 C  CA    . GLY C 1 132 ? -33.994 -0.713 13.603 1.00 40.88  ? 160 GLY C CA    1 
ATOM   3478 C  C     . GLY C 1 132 ? -34.851 -0.326 12.439 1.00 36.79  ? 160 GLY C C     1 
ATOM   3479 O  O     . GLY C 1 132 ? -34.936 -1.047 11.438 1.00 37.19  ? 160 GLY C O     1 
ATOM   3480 N  N     . ARG C 1 133 ? -35.492 0.819  12.587 1.00 37.59  ? 161 ARG C N     1 
ATOM   3481 C  CA    . ARG C 1 133 ? -36.300 1.394  11.535 1.00 38.53  ? 161 ARG C CA    1 
ATOM   3482 C  C     . ARG C 1 133 ? -35.408 1.794  10.374 1.00 33.34  ? 161 ARG C C     1 
ATOM   3483 O  O     . ARG C 1 133 ? -34.310 2.299  10.554 1.00 30.69  ? 161 ARG C O     1 
ATOM   3484 C  CB    . ARG C 1 133 ? -37.073 2.632  12.056 1.00 43.97  ? 161 ARG C CB    1 
ATOM   3485 C  CG    . ARG C 1 133 ? -38.319 2.945  11.234 1.00 54.64  ? 161 ARG C CG    1 
ATOM   3486 C  CD    . ARG C 1 133 ? -39.118 4.128  11.770 1.00 63.00  ? 161 ARG C CD    1 
ATOM   3487 N  NE    . ARG C 1 133 ? -40.112 4.589  10.792 1.00 69.45  ? 161 ARG C NE    1 
ATOM   3488 C  CZ    . ARG C 1 133 ? -40.892 5.666  10.931 1.00 78.61  ? 161 ARG C CZ    1 
ATOM   3489 N  NH1   . ARG C 1 133 ? -40.826 6.433  12.019 1.00 72.37  ? 161 ARG C NH1   1 
ATOM   3490 N  NH2   . ARG C 1 133 ? -41.754 5.983  9.969  1.00 80.09  ? 161 ARG C NH2   1 
ATOM   3491 N  N     . ARG C 1 134 ? -35.904 1.559  9.179  1.00 32.86  ? 162 ARG C N     1 
ATOM   3492 C  CA    . ARG C 1 134 ? -35.306 2.075  7.985  1.00 31.11  ? 162 ARG C CA    1 
ATOM   3493 C  C     . ARG C 1 134 ? -36.190 3.251  7.589  1.00 30.02  ? 162 ARG C C     1 
ATOM   3494 O  O     . ARG C 1 134 ? -37.361 3.073  7.262  1.00 34.96  ? 162 ARG C O     1 
ATOM   3495 C  CB    . ARG C 1 134 ? -35.282 0.982  6.918  1.00 33.13  ? 162 ARG C CB    1 
ATOM   3496 C  CG    . ARG C 1 134 ? -34.322 -0.150 7.246  1.00 36.36  ? 162 ARG C CG    1 
ATOM   3497 C  CD    . ARG C 1 134 ? -34.572 -1.386 6.395  1.00 39.24  ? 162 ARG C CD    1 
ATOM   3498 N  NE    . ARG C 1 134 ? -34.372 -1.141 4.964  1.00 40.83  ? 162 ARG C NE    1 
ATOM   3499 C  CZ    . ARG C 1 134 ? -33.194 -1.133 4.330  1.00 41.56  ? 162 ARG C CZ    1 
ATOM   3500 N  NH1   . ARG C 1 134 ? -32.056 -1.352 4.982  1.00 46.18  ? 162 ARG C NH1   1 
ATOM   3501 N  NH2   . ARG C 1 134 ? -33.159 -0.908 3.016  1.00 43.25  ? 162 ARG C NH2   1 
ATOM   3502 N  N     . ARG C 1 135 ? -35.662 4.459  7.674  1.00 26.38  ? 163 ARG C N     1 
ATOM   3503 C  CA    . ARG C 1 135 ? -36.434 5.633  7.287  1.00 25.04  ? 163 ARG C CA    1 
ATOM   3504 C  C     . ARG C 1 135 ? -36.062 6.054  5.879  1.00 24.77  ? 163 ARG C C     1 
ATOM   3505 O  O     . ARG C 1 135 ? -34.888 6.059  5.512  1.00 24.22  ? 163 ARG C O     1 
ATOM   3506 C  CB    . ARG C 1 135 ? -36.181 6.773  8.264  1.00 24.49  ? 163 ARG C CB    1 
ATOM   3507 C  CG    . ARG C 1 135 ? -36.658 6.485  9.686  1.00 25.09  ? 163 ARG C CG    1 
ATOM   3508 C  CD    . ARG C 1 135 ? -36.269 7.619  10.618 1.00 23.96  ? 163 ARG C CD    1 
ATOM   3509 N  NE    . ARG C 1 135 ? -36.578 7.322  12.006 1.00 23.99  ? 163 ARG C NE    1 
ATOM   3510 C  CZ    . ARG C 1 135 ? -37.633 7.764  12.693 1.00 24.41  ? 163 ARG C CZ    1 
ATOM   3511 N  NH1   . ARG C 1 135 ? -38.536 8.554  12.129 1.00 24.58  ? 163 ARG C NH1   1 
ATOM   3512 N  NH2   . ARG C 1 135 ? -37.791 7.416  13.978 1.00 24.32  ? 163 ARG C NH2   1 
ATOM   3513 N  N     . LYS C 1 136 ? -37.069 6.388  5.089  1.00 24.72  ? 164 LYS C N     1 
ATOM   3514 C  CA    . LYS C 1 136 ? -36.838 6.877  3.748  1.00 25.96  ? 164 LYS C CA    1 
ATOM   3515 C  C     . LYS C 1 136 ? -36.182 8.244  3.873  1.00 23.67  ? 164 LYS C C     1 
ATOM   3516 O  O     . LYS C 1 136 ? -36.405 8.960  4.856  1.00 22.28  ? 164 LYS C O     1 
ATOM   3517 C  CB    . LYS C 1 136 ? -38.142 6.967  2.961  1.00 28.25  ? 164 LYS C CB    1 
ATOM   3518 C  CG    . LYS C 1 136 ? -38.670 5.612  2.509  1.00 38.67  ? 164 LYS C CG    1 
ATOM   3519 C  CD    . LYS C 1 136 ? -39.919 5.769  1.647  1.00 48.58  ? 164 LYS C CD    1 
ATOM   3520 C  CE    . LYS C 1 136 ? -40.296 4.479  0.921  1.00 62.96  ? 164 LYS C CE    1 
ATOM   3521 N  NZ    . LYS C 1 136 ? -40.347 3.285  1.818  1.00 61.08  ? 164 LYS C NZ    1 
ATOM   3522 N  N     . ILE C 1 137 ? -35.313 8.549  2.926  1.00 23.97  ? 165 ILE C N     1 
ATOM   3523 C  CA    . ILE C 1 137 ? -34.741 9.884  2.834  1.00 26.05  ? 165 ILE C CA    1 
ATOM   3524 C  C     . ILE C 1 137 ? -34.972 10.457 1.444  1.00 24.27  ? 165 ILE C C     1 
ATOM   3525 O  O     . ILE C 1 137 ? -35.180 9.711  0.474  1.00 23.91  ? 165 ILE C O     1 
ATOM   3526 C  CB    . ILE C 1 137 ? -33.245 9.917  3.226  1.00 29.03  ? 165 ILE C CB    1 
ATOM   3527 C  CG1   . ILE C 1 137 ? -32.349 9.340  2.147  1.00 34.06  ? 165 ILE C CG1   1 
ATOM   3528 C  CG2   . ILE C 1 137 ? -33.028 9.210  4.563  1.00 32.05  ? 165 ILE C CG2   1 
ATOM   3529 C  CD1   . ILE C 1 137 ? -30.959 8.975  2.648  1.00 37.72  ? 165 ILE C CD1   1 
ATOM   3530 N  N     . LYS C 1 138 ? -34.895 11.780 1.348  1.00 22.23  ? 166 LYS C N     1 
ATOM   3531 C  CA    . LYS C 1 138 ? -34.979 12.461 0.064  1.00 22.88  ? 166 LYS C CA    1 
ATOM   3532 C  C     . LYS C 1 138 ? -34.282 13.820 0.128  1.00 23.75  ? 166 LYS C C     1 
ATOM   3533 O  O     . LYS C 1 138 ? -34.041 14.372 1.197  1.00 22.38  ? 166 LYS C O     1 
ATOM   3534 C  CB    . LYS C 1 138 ? -36.435 12.688 -0.381 1.00 23.48  ? 166 LYS C CB    1 
ATOM   3535 C  CG    . LYS C 1 138 ? -37.255 13.682 0.460  1.00 24.05  ? 166 LYS C CG    1 
ATOM   3536 C  CD    . LYS C 1 138 ? -38.568 13.993 -0.245 1.00 25.22  ? 166 LYS C CD    1 
ATOM   3537 C  CE    . LYS C 1 138 ? -39.311 15.157 0.391  1.00 25.11  ? 166 LYS C CE    1 
ATOM   3538 N  NZ    . LYS C 1 138 ? -40.646 15.434 -0.218 1.00 26.02  ? 166 LYS C NZ    1 
ATOM   3539 N  N     . ARG C 1 139 ? -33.968 14.312 -1.052 1.00 24.16  ? 167 ARG C N     1 
ATOM   3540 C  CA    . ARG C 1 139 ? -33.412 15.639 -1.260 1.00 26.62  ? 167 ARG C CA    1 
ATOM   3541 C  C     . ARG C 1 139 ? -34.464 16.393 -2.059 1.00 28.64  ? 167 ARG C C     1 
ATOM   3542 O  O     . ARG C 1 139 ? -34.807 16.013 -3.186 1.00 32.20  ? 167 ARG C O     1 
ATOM   3543 C  CB    . ARG C 1 139 ? -32.065 15.535 -1.986 1.00 27.68  ? 167 ARG C CB    1 
ATOM   3544 C  CG    . ARG C 1 139 ? -31.301 16.852 -2.160 1.00 29.20  ? 167 ARG C CG    1 
ATOM   3545 C  CD    . ARG C 1 139 ? -30.246 16.677 -3.229 1.00 32.48  ? 167 ARG C CD    1 
ATOM   3546 N  NE    . ARG C 1 139 ? -29.372 17.822 -3.446 1.00 34.29  ? 167 ARG C NE    1 
ATOM   3547 C  CZ    . ARG C 1 139 ? -29.614 18.817 -4.294 1.00 37.86  ? 167 ARG C CZ    1 
ATOM   3548 N  NH1   . ARG C 1 139 ? -30.744 18.860 -4.992 1.00 38.57  ? 167 ARG C NH1   1 
ATOM   3549 N  NH2   . ARG C 1 139 ? -28.736 19.814 -4.409 1.00 39.21  ? 167 ARG C NH2   1 
ATOM   3550 N  N     . ASP C 1 140 ? -35.035 17.424 -1.440 1.00 27.94  ? 168 ASP C N     1 
ATOM   3551 C  CA    . ASP C 1 140 ? -36.123 18.185 -2.047 1.00 29.95  ? 168 ASP C CA    1 
ATOM   3552 C  C     . ASP C 1 140 ? -35.953 19.678 -1.759 1.00 31.63  ? 168 ASP C C     1 
ATOM   3553 O  O     . ASP C 1 140 ? -35.087 20.080 -0.990 1.00 32.33  ? 168 ASP C O     1 
ATOM   3554 C  CB    . ASP C 1 140 ? -37.481 17.693 -1.517 1.00 29.81  ? 168 ASP C CB    1 
ATOM   3555 C  CG    . ASP C 1 140 ? -38.620 17.826 -2.537 1.00 33.89  ? 168 ASP C CG    1 
ATOM   3556 O  OD1   . ASP C 1 140 ? -38.589 18.757 -3.381 1.00 35.79  ? 168 ASP C OD1   1 
ATOM   3557 O  OD2   . ASP C 1 140 ? -39.553 16.973 -2.506 1.00 35.35  ? 168 ASP C OD2   1 
ATOM   3558 N  N     . ILE C 1 141 ? -36.805 20.486 -2.357 1.00 34.40  ? 169 ILE C N     1 
ATOM   3559 C  CA    . ILE C 1 141 ? -36.775 21.925 -2.108 1.00 39.75  ? 169 ILE C CA    1 
ATOM   3560 C  C     . ILE C 1 141 ? -37.068 22.244 -0.629 1.00 40.22  ? 169 ILE C C     1 
ATOM   3561 O  O     . ILE C 1 141 ? -37.551 21.410 0.139  1.00 32.66  ? 169 ILE C O     1 
ATOM   3562 C  CB    . ILE C 1 141 ? -37.762 22.682 -3.019 1.00 42.28  ? 169 ILE C CB    1 
ATOM   3563 C  CG1   . ILE C 1 141 ? -39.216 22.267 -2.727 1.00 46.58  ? 169 ILE C CG1   1 
ATOM   3564 C  CG2   . ILE C 1 141 ? -37.419 22.466 -4.494 1.00 44.66  ? 169 ILE C CG2   1 
ATOM   3565 C  CD1   . ILE C 1 141 ? -40.257 23.190 -3.332 1.00 52.03  ? 169 ILE C CD1   1 
ATOM   3566 N  N     . ILE C 1 142 ? -36.765 23.467 -0.237 1.00 43.90  ? 170 ILE C N     1 
ATOM   3567 C  CA    . ILE C 1 142 ? -37.090 23.933 1.102  1.00 42.64  ? 170 ILE C CA    1 
ATOM   3568 C  C     . ILE C 1 142 ? -38.602 24.091 1.336  1.00 42.19  ? 170 ILE C C     1 
ATOM   3569 O  O     . ILE C 1 142 ? -39.112 23.725 2.390  1.00 41.43  ? 170 ILE C O     1 
ATOM   3570 C  CB    . ILE C 1 142 ? -36.351 25.244 1.374  1.00 48.87  ? 170 ILE C CB    1 
ATOM   3571 C  CG1   . ILE C 1 142 ? -34.880 24.934 1.686  1.00 47.71  ? 170 ILE C CG1   1 
ATOM   3572 C  CG2   . ILE C 1 142 ? -37.041 26.050 2.470  1.00 52.03  ? 170 ILE C CG2   1 
ATOM   3573 C  CD1   . ILE C 1 142 ? -34.651 24.163 2.973  1.00 44.63  ? 170 ILE C CD1   1 
ATOM   3574 N  N     . ASP C 1 143 ? -39.324 24.622 0.362  1.00 45.49  ? 171 ASP C N     1 
ATOM   3575 C  CA    . ASP C 1 143 ? -40.712 25.052 0.598  1.00 50.29  ? 171 ASP C CA    1 
ATOM   3576 C  C     . ASP C 1 143 ? -41.707 23.881 0.512  1.00 45.24  ? 171 ASP C C     1 
ATOM   3577 O  O     . ASP C 1 143 ? -42.585 23.853 -0.347 1.00 48.38  ? 171 ASP C O     1 
ATOM   3578 C  CB    . ASP C 1 143 ? -41.070 26.191 -0.371 1.00 54.25  ? 171 ASP C CB    1 
ATOM   3579 C  CG    . ASP C 1 143 ? -42.222 27.057 0.121  1.00 66.99  ? 171 ASP C CG    1 
ATOM   3580 O  OD1   . ASP C 1 143 ? -42.450 27.129 1.346  1.00 74.09  ? 171 ASP C OD1   1 
ATOM   3581 O  OD2   . ASP C 1 143 ? -42.891 27.695 -0.727 1.00 76.97  ? 171 ASP C OD2   1 
ATOM   3582 N  N     . ILE C 1 144 ? -41.540 22.906 1.410  1.00 44.08  ? 172 ILE C N     1 
ATOM   3583 C  CA    . ILE C 1 144 ? -42.490 21.817 1.566  1.00 39.64  ? 172 ILE C CA    1 
ATOM   3584 C  C     . ILE C 1 144 ? -42.948 21.715 3.015  1.00 36.78  ? 172 ILE C C     1 
ATOM   3585 O  O     . ILE C 1 144 ? -42.204 22.054 3.928  1.00 35.50  ? 172 ILE C O     1 
ATOM   3586 C  CB    . ILE C 1 144 ? -41.919 20.448 1.124  1.00 37.57  ? 172 ILE C CB    1 
ATOM   3587 C  CG1   . ILE C 1 144 ? -40.697 20.027 1.964  1.00 34.77  ? 172 ILE C CG1   1 
ATOM   3588 C  CG2   . ILE C 1 144 ? -41.598 20.494 -0.365 1.00 41.27  ? 172 ILE C CG2   1 
ATOM   3589 C  CD1   . ILE C 1 144 ? -40.377 18.540 1.911  1.00 32.56  ? 172 ILE C CD1   1 
ATOM   3590 N  N     . PRO C 1 145 ? -44.168 21.207 3.232  1.00 37.00  ? 173 PRO C N     1 
ATOM   3591 C  CA    . PRO C 1 145 ? -44.580 21.002 4.609  1.00 36.41  ? 173 PRO C CA    1 
ATOM   3592 C  C     . PRO C 1 145 ? -43.657 20.003 5.277  1.00 32.83  ? 173 PRO C C     1 
ATOM   3593 O  O     . PRO C 1 145 ? -43.215 19.057 4.641  1.00 31.83  ? 173 PRO C O     1 
ATOM   3594 C  CB    . PRO C 1 145 ? -46.001 20.443 4.481  1.00 37.73  ? 173 PRO C CB    1 
ATOM   3595 C  CG    . PRO C 1 145 ? -46.460 20.872 3.128  1.00 39.50  ? 173 PRO C CG    1 
ATOM   3596 C  CD    . PRO C 1 145 ? -45.230 20.852 2.279  1.00 38.30  ? 173 PRO C CD    1 
ATOM   3597 N  N     . LYS C 1 146 ? -43.318 20.259 6.529  1.00 31.89  ? 174 LYS C N     1 
ATOM   3598 C  CA    . LYS C 1 146 ? -42.419 19.400 7.252  1.00 29.46  ? 174 LYS C CA    1 
ATOM   3599 C  C     . LYS C 1 146 ? -42.805 19.440 8.714  1.00 30.25  ? 174 LYS C C     1 
ATOM   3600 O  O     . LYS C 1 146 ? -43.378 20.434 9.196  1.00 31.43  ? 174 LYS C O     1 
ATOM   3601 C  CB    . LYS C 1 146 ? -40.951 19.840 7.077  1.00 29.11  ? 174 LYS C CB    1 
ATOM   3602 C  CG    . LYS C 1 146 ? -40.682 21.257 7.569  1.00 30.92  ? 174 LYS C CG    1 
ATOM   3603 C  CD    . LYS C 1 146 ? -39.380 21.845 7.059  1.00 31.91  ? 174 LYS C CD    1 
ATOM   3604 C  CE    . LYS C 1 146 ? -39.521 22.248 5.603  1.00 33.98  ? 174 LYS C CE    1 
ATOM   3605 N  NZ    . LYS C 1 146 ? -38.270 22.799 5.062  1.00 34.65  ? 174 LYS C NZ    1 
ATOM   3606 N  N     . LYS C 1 147 ? -42.467 18.368 9.410  1.00 28.22  ? 175 LYS C N     1 
ATOM   3607 C  CA    . LYS C 1 147 ? -42.762 18.223 10.833 1.00 30.15  ? 175 LYS C CA    1 
ATOM   3608 C  C     . LYS C 1 147 ? -41.873 19.098 11.694 1.00 30.22  ? 175 LYS C C     1 
ATOM   3609 O  O     . LYS C 1 147 ? -42.249 19.477 12.792 1.00 33.30  ? 175 LYS C O     1 
ATOM   3610 C  CB    . LYS C 1 147 ? -42.548 16.769 11.279 1.00 29.17  ? 175 LYS C CB    1 
ATOM   3611 C  CG    . LYS C 1 147 ? -43.451 15.764 10.586 1.00 32.15  ? 175 LYS C CG    1 
ATOM   3612 C  CD    . LYS C 1 147 ? -43.321 14.388 11.215 1.00 31.98  ? 175 LYS C CD    1 
ATOM   3613 C  CE    . LYS C 1 147 ? -43.924 14.393 12.619 1.00 34.48  ? 175 LYS C CE    1 
ATOM   3614 N  NZ    . LYS C 1 147 ? -44.343 13.039 13.078 1.00 36.84  ? 175 LYS C NZ    1 
ATOM   3615 N  N     . GLY C 1 148 ? -40.670 19.364 11.215 1.00 28.43  ? 176 GLY C N     1 
ATOM   3616 C  CA    . GLY C 1 148 ? -39.685 20.063 11.993 1.00 27.34  ? 176 GLY C CA    1 
ATOM   3617 C  C     . GLY C 1 148 ? -38.292 19.775 11.470 1.00 24.97  ? 176 GLY C C     1 
ATOM   3618 O  O     . GLY C 1 148 ? -38.122 19.392 10.302 1.00 23.69  ? 176 GLY C O     1 
ATOM   3619 N  N     . VAL C 1 149 ? -37.299 20.017 12.318 1.00 23.08  ? 177 VAL C N     1 
ATOM   3620 C  CA    . VAL C 1 149 ? -35.895 19.859 11.958 1.00 22.45  ? 177 VAL C CA    1 
ATOM   3621 C  C     . VAL C 1 149 ? -35.271 19.043 13.047 1.00 21.73  ? 177 VAL C C     1 
ATOM   3622 O  O     . VAL C 1 149 ? -35.270 19.433 14.206 1.00 22.47  ? 177 VAL C O     1 
ATOM   3623 C  CB    . VAL C 1 149 ? -35.111 21.209 11.855 1.00 23.50  ? 177 VAL C CB    1 
ATOM   3624 C  CG1   . VAL C 1 149 ? -33.685 20.956 11.392 1.00 22.44  ? 177 VAL C CG1   1 
ATOM   3625 C  CG2   . VAL C 1 149 ? -35.804 22.182 10.931 1.00 26.02  ? 177 VAL C CG2   1 
ATOM   3626 N  N     . ALA C 1 150 ? -34.798 17.863 12.677 1.00 23.43  ? 178 ALA C N     1 
ATOM   3627 C  CA    . ALA C 1 150 ? -34.047 16.991 13.560 1.00 22.71  ? 178 ALA C CA    1 
ATOM   3628 C  C     . ALA C 1 150 ? -34.753 16.570 14.855 1.00 21.73  ? 178 ALA C C     1 
ATOM   3629 O  O     . ALA C 1 150 ? -34.118 16.361 15.874 1.00 22.15  ? 178 ALA C O     1 
ATOM   3630 C  CB    . ALA C 1 150 ? -32.677 17.599 13.851 1.00 22.02  ? 178 ALA C CB    1 
ATOM   3631 N  N     . GLY C 1 151 ? -36.059 16.379 14.792 1.00 22.70  ? 179 GLY C N     1 
ATOM   3632 C  CA    . GLY C 1 151 ? -36.865 16.107 15.975 1.00 24.21  ? 179 GLY C CA    1 
ATOM   3633 C  C     . GLY C 1 151 ? -37.436 17.334 16.691 1.00 25.36  ? 179 GLY C C     1 
ATOM   3634 O  O     . GLY C 1 151 ? -38.237 17.189 17.619 1.00 26.29  ? 179 GLY C O     1 
ATOM   3635 N  N     . LEU C 1 152 ? -37.031 18.534 16.278 1.00 24.87  ? 180 LEU C N     1 
ATOM   3636 C  CA    . LEU C 1 152 ? -37.577 19.794 16.843 1.00 25.59  ? 180 LEU C CA    1 
ATOM   3637 C  C     . LEU C 1 152 ? -38.780 20.274 16.061 1.00 27.94  ? 180 LEU C C     1 
ATOM   3638 O  O     . LEU C 1 152 ? -38.663 20.580 14.879 1.00 26.10  ? 180 LEU C O     1 
ATOM   3639 C  CB    . LEU C 1 152 ? -36.514 20.874 16.823 1.00 26.06  ? 180 LEU C CB    1 
ATOM   3640 C  CG    . LEU C 1 152 ? -35.285 20.507 17.655 1.00 26.61  ? 180 LEU C CG    1 
ATOM   3641 C  CD1   . LEU C 1 152 ? -34.166 21.461 17.316 1.00 29.36  ? 180 LEU C CD1   1 
ATOM   3642 C  CD2   . LEU C 1 152 ? -35.569 20.507 19.161 1.00 28.48  ? 180 LEU C CD2   1 
ATOM   3643 N  N     . ARG C 1 153 ? -39.939 20.322 16.715 1.00 29.53  ? 181 ARG C N     1 
ATOM   3644 C  CA    . ARG C 1 153 ? -41.194 20.637 16.039 1.00 36.13  ? 181 ARG C CA    1 
ATOM   3645 C  C     . ARG C 1 153 ? -41.338 22.142 15.855 1.00 38.69  ? 181 ARG C C     1 
ATOM   3646 O  O     . ARG C 1 153 ? -40.958 22.901 16.731 1.00 36.87  ? 181 ARG C O     1 
ATOM   3647 C  CB    . ARG C 1 153 ? -42.399 20.086 16.825 1.00 39.85  ? 181 ARG C CB    1 
ATOM   3648 C  CG    . ARG C 1 153 ? -42.491 18.581 16.728 1.00 44.60  ? 181 ARG C CG    1 
ATOM   3649 C  CD    . ARG C 1 153 ? -43.573 17.949 17.592 1.00 52.20  ? 181 ARG C CD    1 
ATOM   3650 N  NE    . ARG C 1 153 ? -43.248 16.521 17.748 1.00 64.60  ? 181 ARG C NE    1 
ATOM   3651 C  CZ    . ARG C 1 153 ? -43.560 15.541 16.887 1.00 64.13  ? 181 ARG C CZ    1 
ATOM   3652 N  NH1   . ARG C 1 153 ? -44.264 15.782 15.775 1.00 55.11  ? 181 ARG C NH1   1 
ATOM   3653 N  NH2   . ARG C 1 153 ? -43.171 14.290 17.152 1.00 62.09  ? 181 ARG C NH2   1 
ATOM   3654 N  N     . LEU C 1 154 ? -41.858 22.546 14.696 1.00 45.92  ? 182 LEU C N     1 
ATOM   3655 C  CA    . LEU C 1 154 ? -42.215 23.940 14.448 1.00 58.36  ? 182 LEU C CA    1 
ATOM   3656 C  C     . LEU C 1 154 ? -43.652 24.205 14.903 1.00 64.30  ? 182 LEU C C     1 
ATOM   3657 O  O     . LEU C 1 154 ? -44.544 23.391 14.659 1.00 64.87  ? 182 LEU C O     1 
ATOM   3658 C  CB    . LEU C 1 154 ? -42.050 24.285 12.960 1.00 63.65  ? 182 LEU C CB    1 
ATOM   3659 C  CG    . LEU C 1 154 ? -40.698 24.875 12.532 1.00 62.58  ? 182 LEU C CG    1 
ATOM   3660 C  CD1   . LEU C 1 154 ? -40.390 26.156 13.299 1.00 66.95  ? 182 LEU C CD1   1 
ATOM   3661 C  CD2   . LEU C 1 154 ? -39.565 23.878 12.694 1.00 59.38  ? 182 LEU C CD2   1 
ATOM   3662 N  N     . HIS D 2 2   ? -16.126 -2.128 21.360 1.00 76.33  ? -5  HIS D N     1 
ATOM   3663 C  CA    . HIS D 2 2   ? -16.313 -0.831 22.092 1.00 79.25  ? -5  HIS D CA    1 
ATOM   3664 C  C     . HIS D 2 2   ? -16.351 0.401  21.162 1.00 72.58  ? -5  HIS D C     1 
ATOM   3665 O  O     . HIS D 2 2   ? -17.120 1.336  21.409 1.00 64.17  ? -5  HIS D O     1 
ATOM   3666 C  CB    . HIS D 2 2   ? -15.297 -0.679 23.254 1.00 76.37  ? -5  HIS D CB    1 
ATOM   3667 C  CG    . HIS D 2 2   ? -13.876 -0.457 22.830 1.00 77.56  ? -5  HIS D CG    1 
ATOM   3668 N  ND1   . HIS D 2 2   ? -13.127 -1.414 22.177 1.00 82.92  ? -5  HIS D ND1   1 
ATOM   3669 C  CD2   . HIS D 2 2   ? -13.046 0.597  23.027 1.00 75.55  ? -5  HIS D CD2   1 
ATOM   3670 C  CE1   . HIS D 2 2   ? -11.908 -0.947 21.962 1.00 88.39  ? -5  HIS D CE1   1 
ATOM   3671 N  NE2   . HIS D 2 2   ? -11.833 0.271  22.470 1.00 75.53  ? -5  HIS D NE2   1 
ATOM   3672 N  N     . HIS D 2 3   ? -15.541 0.388  20.100 1.00 71.92  ? -4  HIS D N     1 
ATOM   3673 C  CA    . HIS D 2 3   ? -15.626 1.382  19.015 1.00 67.67  ? -4  HIS D CA    1 
ATOM   3674 C  C     . HIS D 2 3   ? -17.059 1.552  18.473 1.00 64.84  ? -4  HIS D C     1 
ATOM   3675 O  O     . HIS D 2 3   ? -17.532 2.683  18.314 1.00 56.86  ? -4  HIS D O     1 
ATOM   3676 C  CB    . HIS D 2 3   ? -14.673 1.005  17.861 1.00 74.97  ? -4  HIS D CB    1 
ATOM   3677 C  CG    . HIS D 2 3   ? -13.230 1.317  18.133 1.00 76.73  ? -4  HIS D CG    1 
ATOM   3678 N  ND1   . HIS D 2 3   ? -12.349 1.695  17.141 1.00 81.61  ? -4  HIS D ND1   1 
ATOM   3679 C  CD2   . HIS D 2 3   ? -12.519 1.322  19.287 1.00 76.02  ? -4  HIS D CD2   1 
ATOM   3680 C  CE1   . HIS D 2 3   ? -11.157 1.914  17.671 1.00 78.93  ? -4  HIS D CE1   1 
ATOM   3681 N  NE2   . HIS D 2 3   ? -11.233 1.692  18.971 1.00 76.41  ? -4  HIS D NE2   1 
ATOM   3682 N  N     . HIS D 2 4   ? -17.746 0.436  18.205 1.00 56.49  ? -3  HIS D N     1 
ATOM   3683 C  CA    . HIS D 2 4   ? -19.093 0.478  17.632 1.00 58.90  ? -3  HIS D CA    1 
ATOM   3684 C  C     . HIS D 2 4   ? -20.162 0.907  18.645 1.00 57.30  ? -3  HIS D C     1 
ATOM   3685 O  O     . HIS D 2 4   ? -21.072 1.681  18.315 1.00 61.39  ? -3  HIS D O     1 
ATOM   3686 C  CB    . HIS D 2 4   ? -19.472 -0.888 17.029 1.00 60.09  ? -3  HIS D CB    1 
ATOM   3687 C  CG    . HIS D 2 4   ? -20.911 -0.985 16.620 1.00 65.28  ? -3  HIS D CG    1 
ATOM   3688 N  ND1   . HIS D 2 4   ? -21.465 -0.177 15.651 1.00 65.73  ? -3  HIS D ND1   1 
ATOM   3689 C  CD2   . HIS D 2 4   ? -21.912 -1.785 17.059 1.00 67.71  ? -3  HIS D CD2   1 
ATOM   3690 C  CE1   . HIS D 2 4   ? -22.744 -0.473 15.512 1.00 66.03  ? -3  HIS D CE1   1 
ATOM   3691 N  NE2   . HIS D 2 4   ? -23.041 -1.447 16.352 1.00 68.32  ? -3  HIS D NE2   1 
ATOM   3692 N  N     . HIS D 2 5   ? -20.050 0.398  19.870 1.00 55.41  ? -2  HIS D N     1 
ATOM   3693 C  CA    . HIS D 2 5   ? -21.071 0.622  20.901 1.00 56.19  ? -2  HIS D CA    1 
ATOM   3694 C  C     . HIS D 2 5   ? -20.999 2.011  21.551 1.00 49.88  ? -2  HIS D C     1 
ATOM   3695 O  O     . HIS D 2 5   ? -21.948 2.425  22.221 1.00 55.20  ? -2  HIS D O     1 
ATOM   3696 C  CB    . HIS D 2 5   ? -20.953 -0.431 22.006 1.00 55.46  ? -2  HIS D CB    1 
ATOM   3697 C  CG    . HIS D 2 5   ? -21.325 -1.811 21.572 1.00 59.21  ? -2  HIS D CG    1 
ATOM   3698 N  ND1   . HIS D 2 5   ? -22.587 -2.136 21.118 1.00 58.56  ? -2  HIS D ND1   1 
ATOM   3699 C  CD2   . HIS D 2 5   ? -20.610 -2.960 21.557 1.00 59.72  ? -2  HIS D CD2   1 
ATOM   3700 C  CE1   . HIS D 2 5   ? -22.628 -3.422 20.826 1.00 63.13  ? -2  HIS D CE1   1 
ATOM   3701 N  NE2   . HIS D 2 5   ? -21.443 -3.945 21.085 1.00 62.81  ? -2  HIS D NE2   1 
ATOM   3702 N  N     . HIS D 2 6   ? -19.890 2.716  21.358 1.00 44.44  ? -1  HIS D N     1 
ATOM   3703 C  CA    . HIS D 2 6   ? -19.620 3.956  22.099 1.00 40.69  ? -1  HIS D CA    1 
ATOM   3704 C  C     . HIS D 2 6   ? -19.261 5.076  21.127 1.00 35.42  ? -1  HIS D C     1 
ATOM   3705 O  O     . HIS D 2 6   ? -18.213 5.716  21.246 1.00 32.58  ? -1  HIS D O     1 
ATOM   3706 C  CB    . HIS D 2 6   ? -18.505 3.701  23.124 1.00 39.76  ? -1  HIS D CB    1 
ATOM   3707 C  CG    . HIS D 2 6   ? -18.811 2.575  24.068 1.00 41.61  ? -1  HIS D CG    1 
ATOM   3708 N  ND1   . HIS D 2 6   ? -19.910 2.582  24.899 1.00 44.75  ? -1  HIS D ND1   1 
ATOM   3709 C  CD2   . HIS D 2 6   ? -18.170 1.407  24.308 1.00 44.05  ? -1  HIS D CD2   1 
ATOM   3710 C  CE1   . HIS D 2 6   ? -19.938 1.464  25.607 1.00 45.48  ? -1  HIS D CE1   1 
ATOM   3711 N  NE2   . HIS D 2 6   ? -18.888 0.736  25.270 1.00 45.62  ? -1  HIS D NE2   1 
ATOM   3712 N  N     . ALA D 2 7   ? -20.157 5.304  20.169 1.00 35.46  ? 0   ALA D N     1 
ATOM   3713 C  CA    . ALA D 2 7   ? -19.850 6.135  18.990 1.00 33.88  ? 0   ALA D CA    1 
ATOM   3714 C  C     . ALA D 2 7   ? -19.712 7.621  19.286 1.00 32.01  ? 0   ALA D C     1 
ATOM   3715 O  O     . ALA D 2 7   ? -18.899 8.283  18.642 1.00 30.04  ? 0   ALA D O     1 
ATOM   3716 C  CB    . ALA D 2 7   ? -20.878 5.916  17.900 1.00 35.75  ? 0   ALA D CB    1 
ATOM   3717 N  N     . MET D 2 8   ? -20.485 8.137  20.240 1.00 31.80  ? 1   MET D N     1 
ATOM   3718 C  CA    . MET D 2 8   ? -20.312 9.536  20.687 1.00 33.48  ? 1   MET D CA    1 
ATOM   3719 C  C     . MET D 2 8   ? -18.914 9.752  21.242 1.00 29.97  ? 1   MET D C     1 
ATOM   3720 O  O     . MET D 2 8   ? -18.253 10.740 20.899 1.00 27.80  ? 1   MET D O     1 
ATOM   3721 C  CB    . MET D 2 8   ? -21.331 9.932  21.758 1.00 37.37  ? 1   MET D CB    1 
ATOM   3722 C  CG    . MET D 2 8   ? -22.397 10.887 21.278 1.00 45.44  ? 1   MET D CG    1 
ATOM   3723 S  SD    . MET D 2 8   ? -23.667 11.215 22.523 1.00 52.16  ? 1   MET D SD    1 
ATOM   3724 C  CE    . MET D 2 8   ? -22.617 11.888 23.826 1.00 49.39  ? 1   MET D CE    1 
ATOM   3725 N  N     . ALA D 2 9   ? -18.465 8.819  22.091 1.00 28.38  ? 2   ALA D N     1 
ATOM   3726 C  CA    . ALA D 2 9   ? -17.119 8.869  22.639 1.00 26.74  ? 2   ALA D CA    1 
ATOM   3727 C  C     . ALA D 2 9   ? -16.072 8.794  21.535 1.00 26.20  ? 2   ALA D C     1 
ATOM   3728 O  O     . ALA D 2 9   ? -15.149 9.603  21.514 1.00 25.36  ? 2   ALA D O     1 
ATOM   3729 C  CB    . ALA D 2 9   ? -16.900 7.774  23.671 1.00 27.39  ? 2   ALA D CB    1 
ATOM   3730 N  N     . LEU D 2 10  ? -16.228 7.863  20.602 1.00 27.65  ? 3   LEU D N     1 
ATOM   3731 C  CA    . LEU D 2 10  ? -15.230 7.681  19.553 1.00 29.32  ? 3   LEU D CA    1 
ATOM   3732 C  C     . LEU D 2 10  ? -15.086 8.962  18.728 1.00 28.02  ? 3   LEU D C     1 
ATOM   3733 O  O     . LEU D 2 10  ? -13.966 9.399  18.459 1.00 26.33  ? 3   LEU D O     1 
ATOM   3734 C  CB    . LEU D 2 10  ? -15.573 6.524  18.626 1.00 31.53  ? 3   LEU D CB    1 
ATOM   3735 C  CG    . LEU D 2 10  ? -14.595 6.297  17.476 1.00 32.95  ? 3   LEU D CG    1 
ATOM   3736 C  CD1   . LEU D 2 10  ? -13.190 6.074  18.005 1.00 33.08  ? 3   LEU D CD1   1 
ATOM   3737 C  CD2   . LEU D 2 10  ? -15.036 5.113  16.628 1.00 37.52  ? 3   LEU D CD2   1 
ATOM   3738 N  N     . LYS D 2 11  ? -16.214 9.539  18.335 1.00 28.66  ? 4   LYS D N     1 
ATOM   3739 C  CA    . LYS D 2 11  ? -16.190 10.752 17.522 1.00 30.09  ? 4   LYS D CA    1 
ATOM   3740 C  C     . LYS D 2 11  ? -15.563 11.928 18.257 1.00 27.01  ? 4   LYS D C     1 
ATOM   3741 O  O     . LYS D 2 11  ? -14.789 12.657 17.662 1.00 26.86  ? 4   LYS D O     1 
ATOM   3742 C  CB    . LYS D 2 11  ? -17.565 11.110 16.963 1.00 34.12  ? 4   LYS D CB    1 
ATOM   3743 C  CG    . LYS D 2 11  ? -17.685 10.789 15.483 1.00 43.99  ? 4   LYS D CG    1 
ATOM   3744 C  CD    . LYS D 2 11  ? -17.626 9.284  15.218 1.00 47.79  ? 4   LYS D CD    1 
ATOM   3745 C  CE    . LYS D 2 11  ? -17.305 8.968  13.762 1.00 51.94  ? 4   LYS D CE    1 
ATOM   3746 N  NZ    . LYS D 2 11  ? -18.279 9.592  12.821 1.00 54.26  ? 4   LYS D NZ    1 
ATOM   3747 N  N     . ARG D 2 12  ? -15.873 12.091 19.539 1.00 26.00  ? 5   ARG D N     1 
ATOM   3748 C  CA    . ARG D 2 12  ? -15.228 13.116 20.370 1.00 26.06  ? 5   ARG D CA    1 
ATOM   3749 C  C     . ARG D 2 12  ? -13.701 12.954 20.456 1.00 24.77  ? 5   ARG D C     1 
ATOM   3750 O  O     . ARG D 2 12  ? -12.947 13.929 20.402 1.00 21.52  ? 5   ARG D O     1 
ATOM   3751 C  CB    . ARG D 2 12  ? -15.886 13.130 21.755 1.00 25.50  ? 5   ARG D CB    1 
ATOM   3752 C  CG    . ARG D 2 12  ? -15.113 13.775 22.889 1.00 25.25  ? 5   ARG D CG    1 
ATOM   3753 C  CD    . ARG D 2 12  ? -15.041 15.274 22.752 1.00 24.42  ? 5   ARG D CD    1 
ATOM   3754 N  NE    . ARG D 2 12  ? -14.258 15.831 23.838 1.00 23.59  ? 5   ARG D NE    1 
ATOM   3755 C  CZ    . ARG D 2 12  ? -14.710 16.569 24.854 1.00 24.00  ? 5   ARG D CZ    1 
ATOM   3756 N  NH1   . ARG D 2 12  ? -15.999 16.926 24.984 1.00 25.14  ? 5   ARG D NH1   1 
ATOM   3757 N  NH2   . ARG D 2 12  ? -13.840 16.985 25.744 1.00 23.44  ? 5   ARG D NH2   1 
ATOM   3758 N  N     . ILE D 2 13  ? -13.249 11.713 20.600 1.00 23.16  ? 6   ILE D N     1 
ATOM   3759 C  CA    . ILE D 2 13  ? -11.842 11.424 20.758 1.00 23.32  ? 6   ILE D CA    1 
ATOM   3760 C  C     . ILE D 2 13  ? -11.106 11.680 19.448 1.00 23.52  ? 6   ILE D C     1 
ATOM   3761 O  O     . ILE D 2 13  ? -9.982  12.195 19.476 1.00 23.30  ? 6   ILE D O     1 
ATOM   3762 C  CB    . ILE D 2 13  ? -11.625 9.952  21.245 1.00 24.01  ? 6   ILE D CB    1 
ATOM   3763 C  CG1   . ILE D 2 13  ? -12.160 9.789  22.669 1.00 24.47  ? 6   ILE D CG1   1 
ATOM   3764 C  CG2   . ILE D 2 13  ? -10.152 9.524  21.170 1.00 24.32  ? 6   ILE D CG2   1 
ATOM   3765 C  CD1   . ILE D 2 13  ? -12.414 8.348  23.065 1.00 27.15  ? 6   ILE D CD1   1 
ATOM   3766 N  N     . GLN D 2 14  ? -11.735 11.309 18.320 1.00 25.20  ? 7   GLN D N     1 
ATOM   3767 C  CA    . GLN D 2 14  ? -11.198 11.563 16.984 1.00 27.86  ? 7   GLN D CA    1 
ATOM   3768 C  C     . GLN D 2 14  ? -11.026 13.075 16.743 1.00 27.11  ? 7   GLN D C     1 
ATOM   3769 O  O     . GLN D 2 14  ? -10.041 13.507 16.177 1.00 26.60  ? 7   GLN D O     1 
ATOM   3770 C  CB    . GLN D 2 14  ? -12.089 10.968 15.894 1.00 31.20  ? 7   GLN D CB    1 
ATOM   3771 C  CG    . GLN D 2 14  ? -12.058 9.439  15.791 1.00 37.72  ? 7   GLN D CG    1 
ATOM   3772 C  CD    . GLN D 2 14  ? -13.107 8.864  14.840 1.00 42.43  ? 7   GLN D CD    1 
ATOM   3773 O  OE1   . GLN D 2 14  ? -14.217 9.390  14.709 1.00 49.99  ? 7   GLN D OE1   1 
ATOM   3774 N  NE2   . GLN D 2 14  ? -12.768 7.768  14.190 1.00 48.30  ? 7   GLN D NE2   1 
ATOM   3775 N  N     . LYS D 2 15  ? -12.018 13.847 17.146 1.00 27.00  ? 8   LYS D N     1 
ATOM   3776 C  CA    . LYS D 2 15  ? -11.964 15.306 17.070 1.00 27.59  ? 8   LYS D CA    1 
ATOM   3777 C  C     . LYS D 2 15  ? -10.783 15.887 17.889 1.00 25.72  ? 8   LYS D C     1 
ATOM   3778 O  O     . LYS D 2 15  ? -9.982  16.671 17.365 1.00 26.34  ? 8   LYS D O     1 
ATOM   3779 C  CB    . LYS D 2 15  ? -13.316 15.854 17.530 1.00 28.86  ? 8   LYS D CB    1 
ATOM   3780 C  CG    . LYS D 2 15  ? -13.380 17.335 17.877 1.00 30.29  ? 8   LYS D CG    1 
ATOM   3781 C  CD    . LYS D 2 15  ? -12.984 18.241 16.761 1.00 33.60  ? 8   LYS D CD    1 
ATOM   3782 C  CE    . LYS D 2 15  ? -13.482 19.634 17.112 1.00 35.69  ? 8   LYS D CE    1 
ATOM   3783 N  NZ    . LYS D 2 15  ? -12.881 20.625 16.221 1.00 37.77  ? 8   LYS D NZ    1 
ATOM   3784 N  N     . GLU D 2 16  ? -10.655 15.469 19.148 1.00 24.81  ? 9   GLU D N     1 
ATOM   3785 C  CA    . GLU D 2 16  ? -9.536  15.896 19.978 1.00 25.19  ? 9   GLU D CA    1 
ATOM   3786 C  C     . GLU D 2 16  ? -8.188  15.524 19.386 1.00 24.14  ? 9   GLU D C     1 
ATOM   3787 O  O     . GLU D 2 16  ? -7.262  16.316 19.453 1.00 24.89  ? 9   GLU D O     1 
ATOM   3788 C  CB    . GLU D 2 16  ? -9.603  15.328 21.383 1.00 23.79  ? 9   GLU D CB    1 
ATOM   3789 C  CG    . GLU D 2 16  ? -10.671 15.942 22.268 1.00 22.14  ? 9   GLU D CG    1 
ATOM   3790 C  CD    . GLU D 2 16  ? -10.473 15.639 23.745 1.00 23.14  ? 9   GLU D CD    1 
ATOM   3791 O  OE1   . GLU D 2 16  ? -9.306  15.589 24.204 1.00 23.54  ? 9   GLU D OE1   1 
ATOM   3792 O  OE2   . GLU D 2 16  ? -11.477 15.456 24.469 1.00 25.98  ? 9   GLU D OE2   1 
ATOM   3793 N  N     . LEU D 2 17  ? -8.073  14.301 18.869 1.00 24.81  ? 10  LEU D N     1 
ATOM   3794 C  CA    . LEU D 2 17  ? -6.834  13.853 18.286 1.00 25.59  ? 10  LEU D CA    1 
ATOM   3795 C  C     . LEU D 2 17  ? -6.437  14.694 17.099 1.00 24.96  ? 10  LEU D C     1 
ATOM   3796 O  O     . LEU D 2 17  ? -5.268  15.010 16.938 1.00 25.49  ? 10  LEU D O     1 
ATOM   3797 C  CB    . LEU D 2 17  ? -6.898  12.380 17.859 1.00 25.41  ? 10  LEU D CB    1 
ATOM   3798 C  CG    . LEU D 2 17  ? -5.575  11.871 17.308 1.00 26.84  ? 10  LEU D CG    1 
ATOM   3799 C  CD1   . LEU D 2 17  ? -4.567  11.763 18.443 1.00 26.29  ? 10  LEU D CD1   1 
ATOM   3800 C  CD2   . LEU D 2 17  ? -5.791  10.530 16.601 1.00 31.02  ? 10  LEU D CD2   1 
ATOM   3801 N  N     . SER D 2 18  ? -7.394  15.041 16.249 1.00 26.41  ? 11  SER D N     1 
ATOM   3802 C  CA    . SER D 2 18  ? -7.033  15.734 15.049 1.00 29.99  ? 11  SER D CA    1 
ATOM   3803 C  C     . SER D 2 18  ? -6.718  17.212 15.379 1.00 29.84  ? 11  SER D C     1 
ATOM   3804 O  O     . SER D 2 18  ? -5.814  17.787 14.774 1.00 31.51  ? 11  SER D O     1 
ATOM   3805 C  CB    . SER D 2 18  ? -8.087  15.531 13.948 1.00 35.87  ? 11  SER D CB    1 
ATOM   3806 O  OG    . SER D 2 18  ? -8.951  16.632 13.840 1.00 44.46  ? 11  SER D OG    1 
ATOM   3807 N  N     . ASP D 2 19  ? -7.407  17.791 16.363 1.00 27.07  ? 12  ASP D N     1 
ATOM   3808 C  CA    . ASP D 2 19  ? -7.058  19.147 16.865 1.00 29.63  ? 12  ASP D CA    1 
ATOM   3809 C  C     . ASP D 2 19  ? -5.691  19.164 17.544 1.00 26.76  ? 12  ASP D C     1 
ATOM   3810 O  O     . ASP D 2 19  ? -4.920  20.087 17.326 1.00 29.91  ? 12  ASP D O     1 
ATOM   3811 C  CB    . ASP D 2 19  ? -8.083  19.681 17.860 1.00 28.66  ? 12  ASP D CB    1 
ATOM   3812 C  CG    . ASP D 2 19  ? -9.421  20.044 17.211 1.00 34.83  ? 12  ASP D CG    1 
ATOM   3813 O  OD1   . ASP D 2 19  ? -9.527  20.064 15.966 1.00 36.53  ? 12  ASP D OD1   1 
ATOM   3814 O  OD2   . ASP D 2 19  ? -10.371 20.310 17.969 1.00 35.99  ? 12  ASP D OD2   1 
ATOM   3815 N  N     . LEU D 2 20  ? -5.391  18.133 18.338 1.00 27.99  ? 13  LEU D N     1 
ATOM   3816 C  CA    . LEU D 2 20  ? -4.128  18.064 19.070 1.00 27.73  ? 13  LEU D CA    1 
ATOM   3817 C  C     . LEU D 2 20  ? -2.949  17.926 18.115 1.00 29.48  ? 13  LEU D C     1 
ATOM   3818 O  O     . LEU D 2 20  ? -1.969  18.637 18.237 1.00 28.48  ? 13  LEU D O     1 
ATOM   3819 C  CB    . LEU D 2 20  ? -4.124  16.913 20.076 1.00 27.34  ? 13  LEU D CB    1 
ATOM   3820 C  CG    . LEU D 2 20  ? -2.937  16.754 21.041 1.00 27.80  ? 13  LEU D CG    1 
ATOM   3821 C  CD1   . LEU D 2 20  ? -3.372  16.040 22.308 1.00 28.32  ? 13  LEU D CD1   1 
ATOM   3822 C  CD2   . LEU D 2 20  ? -1.745  16.038 20.402 1.00 27.11  ? 13  LEU D CD2   1 
ATOM   3823 N  N     . GLN D 2 21  ? -3.048  17.001 17.174 1.00 29.07  ? 14  GLN D N     1 
ATOM   3824 C  CA    . GLN D 2 21  ? -1.938  16.716 16.298 1.00 29.78  ? 14  GLN D CA    1 
ATOM   3825 C  C     . GLN D 2 21  ? -1.712  17.864 15.317 1.00 32.92  ? 14  GLN D C     1 
ATOM   3826 O  O     . GLN D 2 21  ? -0.590  18.087 14.903 1.00 32.72  ? 14  GLN D O     1 
ATOM   3827 C  CB    . GLN D 2 21  ? -2.123  15.364 15.599 1.00 28.99  ? 14  GLN D CB    1 
ATOM   3828 C  CG    . GLN D 2 21  ? -2.087  14.194 16.571 1.00 26.19  ? 14  GLN D CG    1 
ATOM   3829 C  CD    . GLN D 2 21  ? -2.019  12.873 15.872 1.00 27.84  ? 14  GLN D CD    1 
ATOM   3830 O  OE1   . GLN D 2 21  ? -2.502  12.739 14.764 1.00 30.28  ? 14  GLN D OE1   1 
ATOM   3831 N  NE2   . GLN D 2 21  ? -1.385  11.890 16.505 1.00 28.43  ? 14  GLN D NE2   1 
ATOM   3832 N  N     . ARG D 2 22  ? -2.755  18.618 14.994 1.00 34.35  ? 15  ARG D N     1 
ATOM   3833 C  CA    . ARG D 2 22  ? -2.592  19.842 14.202 1.00 39.95  ? 15  ARG D CA    1 
ATOM   3834 C  C     . ARG D 2 22  ? -1.929  20.990 14.975 1.00 39.46  ? 15  ARG D C     1 
ATOM   3835 O  O     . ARG D 2 22  ? -1.156  21.750 14.394 1.00 40.97  ? 15  ARG D O     1 
ATOM   3836 C  CB    . ARG D 2 22  ? -3.936  20.319 13.626 1.00 43.83  ? 15  ARG D CB    1 
ATOM   3837 C  CG    . ARG D 2 22  ? -3.853  21.629 12.849 1.00 55.93  ? 15  ARG D CG    1 
ATOM   3838 C  CD    . ARG D 2 22  ? -5.166  22.032 12.182 1.00 65.41  ? 15  ARG D CD    1 
ATOM   3839 N  NE    . ARG D 2 22  ? -6.213  22.382 13.146 1.00 70.50  ? 15  ARG D NE    1 
ATOM   3840 C  CZ    . ARG D 2 22  ? -7.152  21.548 13.610 1.00 76.21  ? 15  ARG D CZ    1 
ATOM   3841 N  NH1   . ARG D 2 22  ? -7.210  20.275 13.213 1.00 77.78  ? 15  ARG D NH1   1 
ATOM   3842 N  NH2   . ARG D 2 22  ? -8.047  21.993 14.489 1.00 71.32  ? 15  ARG D NH2   1 
ATOM   3843 N  N     . ASP D 2 23  ? -2.260  21.155 16.252 1.00 37.29  ? 16  ASP D N     1 
ATOM   3844 C  CA    . ASP D 2 23  ? -1.712  22.259 17.059 1.00 38.70  ? 16  ASP D CA    1 
ATOM   3845 C  C     . ASP D 2 23  ? -1.321  21.754 18.446 1.00 32.94  ? 16  ASP D C     1 
ATOM   3846 O  O     . ASP D 2 23  ? -2.002  22.017 19.431 1.00 32.27  ? 16  ASP D O     1 
ATOM   3847 C  CB    . ASP D 2 23  ? -2.715  23.419 17.175 1.00 42.55  ? 16  ASP D CB    1 
ATOM   3848 C  CG    . ASP D 2 23  ? -2.928  24.159 15.858 1.00 52.19  ? 16  ASP D CG    1 
ATOM   3849 O  OD1   . ASP D 2 23  ? -2.015  24.884 15.403 1.00 54.57  ? 16  ASP D OD1   1 
ATOM   3850 O  OD2   . ASP D 2 23  ? -4.028  24.042 15.284 1.00 54.53  ? 16  ASP D OD2   1 
ATOM   3851 N  N     . PRO D 2 24  ? -0.214  21.008 18.528 1.00 31.83  ? 17  PRO D N     1 
ATOM   3852 C  CA    . PRO D 2 24  ? 0.127   20.377 19.792 1.00 33.91  ? 17  PRO D CA    1 
ATOM   3853 C  C     . PRO D 2 24  ? 0.547   21.384 20.865 1.00 31.16  ? 17  PRO D C     1 
ATOM   3854 O  O     . PRO D 2 24  ? 1.193   22.386 20.545 1.00 31.64  ? 17  PRO D O     1 
ATOM   3855 C  CB    . PRO D 2 24  ? 1.278   19.418 19.421 1.00 31.93  ? 17  PRO D CB    1 
ATOM   3856 C  CG    . PRO D 2 24  ? 1.808   19.925 18.138 1.00 35.83  ? 17  PRO D CG    1 
ATOM   3857 C  CD    . PRO D 2 24  ? 0.689   20.618 17.433 1.00 34.96  ? 17  PRO D CD    1 
ATOM   3858 N  N     . PRO D 2 25  ? 0.178   21.128 22.122 1.00 31.05  ? 18  PRO D N     1 
ATOM   3859 C  CA    . PRO D 2 25  ? 0.688   21.991 23.188 1.00 34.69  ? 18  PRO D CA    1 
ATOM   3860 C  C     . PRO D 2 25  ? 2.219   21.976 23.248 1.00 35.79  ? 18  PRO D C     1 
ATOM   3861 O  O     . PRO D 2 25  ? 2.851   20.952 22.937 1.00 28.62  ? 18  PRO D O     1 
ATOM   3862 C  CB    . PRO D 2 25  ? 0.137   21.381 24.472 1.00 33.60  ? 18  PRO D CB    1 
ATOM   3863 C  CG    . PRO D 2 25  ? -0.528  20.112 24.107 1.00 30.67  ? 18  PRO D CG    1 
ATOM   3864 C  CD    . PRO D 2 25  ? -0.442  19.893 22.634 1.00 30.22  ? 18  PRO D CD    1 
ATOM   3865 N  N     . ALA D 2 26  ? 2.796   23.106 23.639 1.00 32.65  ? 19  ALA D N     1 
ATOM   3866 C  CA    . ALA D 2 26  ? 4.238   23.186 23.853 1.00 34.38  ? 19  ALA D CA    1 
ATOM   3867 C  C     . ALA D 2 26  ? 4.767   22.045 24.726 1.00 28.11  ? 19  ALA D C     1 
ATOM   3868 O  O     . ALA D 2 26  ? 4.168   21.651 25.722 1.00 27.06  ? 19  ALA D O     1 
ATOM   3869 C  CB    . ALA D 2 26  ? 4.606   24.541 24.449 1.00 38.85  ? 19  ALA D CB    1 
ATOM   3870 N  N     . HIS D 2 27  ? 5.902   21.502 24.310 1.00 28.45  ? 20  HIS D N     1 
ATOM   3871 C  CA    . HIS D 2 27  ? 6.607   20.456 25.019 1.00 27.26  ? 20  HIS D CA    1 
ATOM   3872 C  C     . HIS D 2 27  ? 5.952   19.075 24.973 1.00 27.32  ? 20  HIS D C     1 
ATOM   3873 O  O     . HIS D 2 27  ? 6.459   18.153 25.613 1.00 24.72  ? 20  HIS D O     1 
ATOM   3874 C  CB    . HIS D 2 27  ? 6.872   20.876 26.482 1.00 28.60  ? 20  HIS D CB    1 
ATOM   3875 C  CG    . HIS D 2 27  ? 7.487   22.233 26.601 1.00 31.50  ? 20  HIS D CG    1 
ATOM   3876 N  ND1   . HIS D 2 27  ? 8.643   22.574 25.942 1.00 36.71  ? 20  HIS D ND1   1 
ATOM   3877 C  CD2   . HIS D 2 27  ? 7.084   23.347 27.258 1.00 34.63  ? 20  HIS D CD2   1 
ATOM   3878 C  CE1   . HIS D 2 27  ? 8.931   23.842 26.185 1.00 38.60  ? 20  HIS D CE1   1 
ATOM   3879 N  NE2   . HIS D 2 27  ? 8.015   24.325 27.004 1.00 37.23  ? 20  HIS D NE2   1 
ATOM   3880 N  N     . CYS D 2 28  ? 4.849   18.929 24.233 1.00 25.98  ? 21  CYS D N     1 
ATOM   3881 C  CA    . CYS D 2 28  ? 4.038   17.710 24.299 1.00 26.70  ? 21  CYS D CA    1 
ATOM   3882 C  C     . CYS D 2 28  ? 3.802   17.055 22.948 1.00 27.77  ? 21  CYS D C     1 
ATOM   3883 O  O     . CYS D 2 28  ? 3.765   17.714 21.935 1.00 28.41  ? 21  CYS D O     1 
ATOM   3884 C  CB    . CYS D 2 28  ? 2.676   18.018 24.894 1.00 26.96  ? 21  CYS D CB    1 
ATOM   3885 S  SG    . CYS D 2 28  ? 2.715   18.597 26.599 1.00 30.81  ? 21  CYS D SG    1 
ATOM   3886 N  N     . SER D 2 29  ? 3.586   15.740 22.973 1.00 27.32  ? 22  SER D N     1 
ATOM   3887 C  CA    . SER D 2 29  ? 3.182   14.978 21.801 1.00 28.45  ? 22  SER D CA    1 
ATOM   3888 C  C     . SER D 2 29  ? 2.166   13.930 22.258 1.00 27.14  ? 22  SER D C     1 
ATOM   3889 O  O     . SER D 2 29  ? 2.244   13.457 23.384 1.00 25.21  ? 22  SER D O     1 
ATOM   3890 C  CB    . SER D 2 29  ? 4.398   14.277 21.223 1.00 28.88  ? 22  SER D CB    1 
ATOM   3891 O  OG    . SER D 2 29  ? 4.130   13.559 20.034 1.00 30.23  ? 22  SER D OG    1 
ATOM   3892 N  N     . ALA D 2 30  ? 1.230   13.566 21.386 1.00 26.62  ? 23  ALA D N     1 
ATOM   3893 C  CA    . ALA D 2 30  ? 0.351   12.414 21.662 1.00 26.08  ? 23  ALA D CA    1 
ATOM   3894 C  C     . ALA D 2 30  ? -0.191  11.780 20.388 1.00 26.08  ? 23  ALA D C     1 
ATOM   3895 O  O     . ALA D 2 30  ? -0.252  12.407 19.325 1.00 25.15  ? 23  ALA D O     1 
ATOM   3896 C  CB    . ALA D 2 30  ? -0.793  12.813 22.573 1.00 24.74  ? 23  ALA D CB    1 
ATOM   3897 N  N     . GLY D 2 31  ? -0.532  10.501 20.501 1.00 27.08  ? 24  GLY D N     1 
ATOM   3898 C  CA    . GLY D 2 31  ? -1.228  9.776  19.448 1.00 28.76  ? 24  GLY D CA    1 
ATOM   3899 C  C     . GLY D 2 31  ? -1.678  8.410  19.954 1.00 29.01  ? 24  GLY D C     1 
ATOM   3900 O  O     . GLY D 2 31  ? -1.210  7.959  20.988 1.00 26.72  ? 24  GLY D O     1 
ATOM   3901 N  N     . PRO D 2 32  ? -2.566  7.742  19.209 1.00 31.77  ? 25  PRO D N     1 
ATOM   3902 C  CA    . PRO D 2 32  ? -3.032  6.404  19.551 1.00 34.80  ? 25  PRO D CA    1 
ATOM   3903 C  C     . PRO D 2 32  ? -1.956  5.337  19.624 1.00 35.17  ? 25  PRO D C     1 
ATOM   3904 O  O     . PRO D 2 32  ? -0.991  5.349  18.869 1.00 34.79  ? 25  PRO D O     1 
ATOM   3905 C  CB    . PRO D 2 32  ? -3.968  6.047  18.396 1.00 35.09  ? 25  PRO D CB    1 
ATOM   3906 C  CG    . PRO D 2 32  ? -4.293  7.339  17.746 1.00 34.34  ? 25  PRO D CG    1 
ATOM   3907 C  CD    . PRO D 2 32  ? -3.032  8.126  17.870 1.00 33.86  ? 25  PRO D CD    1 
ATOM   3908 N  N     . VAL D 2 33  ? -2.157  4.415  20.551 1.00 38.87  ? 26  VAL D N     1 
ATOM   3909 C  CA    . VAL D 2 33  ? -1.361  3.222  20.649 1.00 47.04  ? 26  VAL D CA    1 
ATOM   3910 C  C     . VAL D 2 33  ? -2.063  2.247  19.733 1.00 49.68  ? 26  VAL D C     1 
ATOM   3911 O  O     . VAL D 2 33  ? -3.273  1.959  19.897 1.00 48.20  ? 26  VAL D O     1 
ATOM   3912 C  CB    . VAL D 2 33  ? -1.316  2.695  22.087 1.00 48.10  ? 26  VAL D CB    1 
ATOM   3913 C  CG1   . VAL D 2 33  ? -0.612  1.360  22.132 1.00 51.82  ? 26  VAL D CG1   1 
ATOM   3914 C  CG2   . VAL D 2 33  ? -0.629  3.707  22.985 1.00 45.22  ? 26  VAL D CG2   1 
ATOM   3915 N  N     . GLY D 2 34  ? -1.320  1.795  18.735 1.00 51.43  ? 27  GLY D N     1 
ATOM   3916 C  CA    . GLY D 2 34  ? -1.865  0.954  17.696 1.00 55.57  ? 27  GLY D CA    1 
ATOM   3917 C  C     . GLY D 2 34  ? -3.066  1.602  17.048 1.00 58.87  ? 27  GLY D C     1 
ATOM   3918 O  O     . GLY D 2 34  ? -3.127  2.820  16.889 1.00 60.17  ? 27  GLY D O     1 
ATOM   3919 N  N     . ASP D 2 35  ? -4.039  0.776  16.707 1.00 61.51  ? 28  ASP D N     1 
ATOM   3920 C  CA    . ASP D 2 35  ? -5.242  1.231  16.014 1.00 64.55  ? 28  ASP D CA    1 
ATOM   3921 C  C     . ASP D 2 35  ? -6.381  1.646  16.960 1.00 58.25  ? 28  ASP D C     1 
ATOM   3922 O  O     . ASP D 2 35  ? -7.468  1.998  16.494 1.00 58.06  ? 28  ASP D O     1 
ATOM   3923 C  CB    . ASP D 2 35  ? -5.727  0.116  15.082 1.00 74.31  ? 28  ASP D CB    1 
ATOM   3924 C  CG    . ASP D 2 35  ? -5.768  -1.249 15.772 1.00 85.62  ? 28  ASP D CG    1 
ATOM   3925 O  OD1   . ASP D 2 35  ? -6.664  -1.468 16.618 1.00 86.40  ? 28  ASP D OD1   1 
ATOM   3926 O  OD2   . ASP D 2 35  ? -4.889  -2.092 15.479 1.00 85.94  ? 28  ASP D OD2   1 
ATOM   3927 N  N     . ASP D 2 36  ? -6.145  1.606  18.272 1.00 49.89  ? 29  ASP D N     1 
ATOM   3928 C  CA    . ASP D 2 36  ? -7.213  1.808  19.253 1.00 46.40  ? 29  ASP D CA    1 
ATOM   3929 C  C     . ASP D 2 36  ? -7.262  3.265  19.674 1.00 39.71  ? 29  ASP D C     1 
ATOM   3930 O  O     . ASP D 2 36  ? -6.369  3.744  20.363 1.00 34.14  ? 29  ASP D O     1 
ATOM   3931 C  CB    . ASP D 2 36  ? -6.987  0.918  20.477 1.00 52.40  ? 29  ASP D CB    1 
ATOM   3932 C  CG    . ASP D 2 36  ? -8.162  0.933  21.448 1.00 55.82  ? 29  ASP D CG    1 
ATOM   3933 O  OD1   . ASP D 2 36  ? -8.929  1.926  21.490 1.00 46.56  ? 29  ASP D OD1   1 
ATOM   3934 O  OD2   . ASP D 2 36  ? -8.316  -0.062 22.184 1.00 56.56  ? 29  ASP D OD2   1 
ATOM   3935 N  N     . LEU D 2 37  ? -8.319  3.964  19.275 1.00 35.03  ? 30  LEU D N     1 
ATOM   3936 C  CA    . LEU D 2 37  ? -8.444  5.387  19.622 1.00 34.07  ? 30  LEU D CA    1 
ATOM   3937 C  C     . LEU D 2 37  ? -8.694  5.632  21.118 1.00 28.94  ? 30  LEU D C     1 
ATOM   3938 O  O     . LEU D 2 37  ? -8.533  6.762  21.593 1.00 25.25  ? 30  LEU D O     1 
ATOM   3939 C  CB    . LEU D 2 37  ? -9.513  6.060  18.746 1.00 34.92  ? 30  LEU D CB    1 
ATOM   3940 C  CG    . LEU D 2 37  ? -9.021  6.663  17.417 1.00 39.57  ? 30  LEU D CG    1 
ATOM   3941 C  CD1   . LEU D 2 37  ? -8.417  8.034  17.654 1.00 38.93  ? 30  LEU D CD1   1 
ATOM   3942 C  CD2   . LEU D 2 37  ? -8.005  5.808  16.679 1.00 45.43  ? 30  LEU D CD2   1 
ATOM   3943 N  N     . PHE D 2 38  ? -9.083  4.593  21.859 1.00 27.92  ? 31  PHE D N     1 
ATOM   3944 C  CA    . PHE D 2 38  ? -9.312  4.716  23.306 1.00 28.10  ? 31  PHE D CA    1 
ATOM   3945 C  C     . PHE D 2 38  ? -8.019  4.616  24.146 1.00 27.54  ? 31  PHE D C     1 
ATOM   3946 O  O     . PHE D 2 38  ? -8.053  4.764  25.371 1.00 26.43  ? 31  PHE D O     1 
ATOM   3947 C  CB    . PHE D 2 38  ? -10.363 3.707  23.794 1.00 31.48  ? 31  PHE D CB    1 
ATOM   3948 C  CG    . PHE D 2 38  ? -11.781 4.094  23.443 1.00 32.52  ? 31  PHE D CG    1 
ATOM   3949 C  CD1   . PHE D 2 38  ? -12.272 3.898  22.161 1.00 33.84  ? 31  PHE D CD1   1 
ATOM   3950 C  CD2   . PHE D 2 38  ? -12.609 4.697  24.385 1.00 31.74  ? 31  PHE D CD2   1 
ATOM   3951 C  CE1   . PHE D 2 38  ? -13.570 4.274  21.827 1.00 34.16  ? 31  PHE D CE1   1 
ATOM   3952 C  CE2   . PHE D 2 38  ? -13.899 5.071  24.061 1.00 32.31  ? 31  PHE D CE2   1 
ATOM   3953 C  CZ    . PHE D 2 38  ? -14.386 4.851  22.778 1.00 33.26  ? 31  PHE D CZ    1 
ATOM   3954 N  N     . HIS D 2 39  ? -6.884  4.388  23.489 1.00 27.74  ? 32  HIS D N     1 
ATOM   3955 C  CA    . HIS D 2 39  ? -5.607  4.237  24.174 1.00 28.49  ? 32  HIS D CA    1 
ATOM   3956 C  C     . HIS D 2 39  ? -4.568  5.038  23.420 1.00 26.69  ? 32  HIS D C     1 
ATOM   3957 O  O     . HIS D 2 39  ? -4.271  4.757  22.255 1.00 27.46  ? 32  HIS D O     1 
ATOM   3958 C  CB    . HIS D 2 39  ? -5.235  2.738  24.251 1.00 32.78  ? 32  HIS D CB    1 
ATOM   3959 C  CG    . HIS D 2 39  ? -3.910  2.447  24.898 1.00 38.24  ? 32  HIS D CG    1 
ATOM   3960 N  ND1   . HIS D 2 39  ? -3.310  1.203  24.822 1.00 43.70  ? 32  HIS D ND1   1 
ATOM   3961 C  CD2   . HIS D 2 39  ? -3.084  3.216  25.649 1.00 38.01  ? 32  HIS D CD2   1 
ATOM   3962 C  CE1   . HIS D 2 39  ? -2.171  1.222  25.495 1.00 47.29  ? 32  HIS D CE1   1 
ATOM   3963 N  NE2   . HIS D 2 39  ? -2.004  2.434  25.996 1.00 42.93  ? 32  HIS D NE2   1 
ATOM   3964 N  N     . TRP D 2 40  ? -4.051  6.074  24.071 1.00 26.02  ? 33  TRP D N     1 
ATOM   3965 C  CA    . TRP D 2 40  ? -3.019  6.916  23.477 1.00 25.28  ? 33  TRP D CA    1 
ATOM   3966 C  C     . TRP D 2 40  ? -1.753  6.804  24.309 1.00 25.04  ? 33  TRP D C     1 
ATOM   3967 O  O     . TRP D 2 40  ? -1.809  6.505  25.517 1.00 26.85  ? 33  TRP D O     1 
ATOM   3968 C  CB    . TRP D 2 40  ? -3.444  8.390  23.493 1.00 24.00  ? 33  TRP D CB    1 
ATOM   3969 C  CG    . TRP D 2 40  ? -4.611  8.786  22.635 1.00 24.49  ? 33  TRP D CG    1 
ATOM   3970 C  CD1   . TRP D 2 40  ? -5.420  7.990  21.910 1.00 25.94  ? 33  TRP D CD1   1 
ATOM   3971 C  CD2   . TRP D 2 40  ? -5.089  10.107 22.465 1.00 22.73  ? 33  TRP D CD2   1 
ATOM   3972 N  NE1   . TRP D 2 40  ? -6.383  8.729  21.281 1.00 24.12  ? 33  TRP D NE1   1 
ATOM   3973 C  CE2   . TRP D 2 40  ? -6.211  10.039 21.615 1.00 24.16  ? 33  TRP D CE2   1 
ATOM   3974 C  CE3   . TRP D 2 40  ? -4.674  11.350 22.953 1.00 24.43  ? 33  TRP D CE3   1 
ATOM   3975 C  CZ2   . TRP D 2 40  ? -6.911  11.153 21.222 1.00 23.07  ? 33  TRP D CZ2   1 
ATOM   3976 C  CZ3   . TRP D 2 40  ? -5.399  12.477 22.591 1.00 23.27  ? 33  TRP D CZ3   1 
ATOM   3977 C  CH2   . TRP D 2 40  ? -6.501  12.371 21.730 1.00 24.38  ? 33  TRP D CH2   1 
ATOM   3978 N  N     . GLN D 2 41  ? -0.623  7.099  23.676 1.00 25.52  ? 34  GLN D N     1 
ATOM   3979 C  CA    . GLN D 2 41  ? 0.612   7.354  24.388 1.00 28.40  ? 34  GLN D CA    1 
ATOM   3980 C  C     . GLN D 2 41  ? 0.880   8.866  24.277 1.00 25.50  ? 34  GLN D C     1 
ATOM   3981 O  O     . GLN D 2 41  ? 0.602   9.474  23.256 1.00 27.20  ? 34  GLN D O     1 
ATOM   3982 C  CB    . GLN D 2 41  ? 1.769   6.529  23.818 1.00 34.41  ? 34  GLN D CB    1 
ATOM   3983 C  CG    . GLN D 2 41  ? 3.098   6.779  24.522 1.00 44.52  ? 34  GLN D CG    1 
ATOM   3984 C  CD    . GLN D 2 41  ? 3.838   5.501  24.873 1.00 66.65  ? 34  GLN D CD    1 
ATOM   3985 O  OE1   . GLN D 2 41  ? 4.032   4.621  24.021 1.00 73.49  ? 34  GLN D OE1   1 
ATOM   3986 N  NE2   . GLN D 2 41  ? 4.244   5.380  26.143 1.00 66.82  ? 34  GLN D NE2   1 
ATOM   3987 N  N     . ALA D 2 42  ? 1.385   9.469  25.344 1.00 24.94  ? 35  ALA D N     1 
ATOM   3988 C  CA    . ALA D 2 42  ? 1.816   10.867 25.317 1.00 24.75  ? 35  ALA D CA    1 
ATOM   3989 C  C     . ALA D 2 42  ? 3.279   11.024 25.757 1.00 26.95  ? 35  ALA D C     1 
ATOM   3990 O  O     . ALA D 2 42  ? 3.849   10.128 26.410 1.00 24.52  ? 35  ALA D O     1 
ATOM   3991 C  CB    . ALA D 2 42  ? 0.890   11.717 26.152 1.00 24.44  ? 35  ALA D CB    1 
ATOM   3992 N  N     . THR D 2 43  ? 3.892   12.141 25.331 1.00 24.25  ? 36  THR D N     1 
ATOM   3993 C  CA    . THR D 2 43  ? 5.291   12.449 25.631 1.00 24.30  ? 36  THR D CA    1 
ATOM   3994 C  C     . THR D 2 43  ? 5.377   13.901 26.099 1.00 25.49  ? 36  THR D C     1 
ATOM   3995 O  O     . THR D 2 43  ? 4.816   14.807 25.463 1.00 23.53  ? 36  THR D O     1 
ATOM   3996 C  CB    . THR D 2 43  ? 6.223   12.242 24.422 1.00 26.26  ? 36  THR D CB    1 
ATOM   3997 O  OG1   . THR D 2 43  ? 6.116   10.898 23.919 1.00 28.23  ? 36  THR D OG1   1 
ATOM   3998 C  CG2   . THR D 2 43  ? 7.672   12.504 24.800 1.00 26.72  ? 36  THR D CG2   1 
ATOM   3999 N  N     . ILE D 2 44  ? 6.032   14.107 27.238 1.00 24.89  ? 37  ILE D N     1 
ATOM   4000 C  CA    . ILE D 2 44  ? 6.339   15.436 27.737 1.00 24.21  ? 37  ILE D CA    1 
ATOM   4001 C  C     . ILE D 2 44  ? 7.846   15.612 27.837 1.00 26.50  ? 37  ILE D C     1 
ATOM   4002 O  O     . ILE D 2 44  ? 8.557   14.785 28.424 1.00 28.06  ? 37  ILE D O     1 
ATOM   4003 C  CB    . ILE D 2 44  ? 5.664   15.721 29.096 1.00 25.25  ? 37  ILE D CB    1 
ATOM   4004 C  CG1   . ILE D 2 44  ? 4.149   15.682 28.941 1.00 25.32  ? 37  ILE D CG1   1 
ATOM   4005 C  CG2   . ILE D 2 44  ? 6.081   17.103 29.644 1.00 26.59  ? 37  ILE D CG2   1 
ATOM   4006 C  CD1   . ILE D 2 44  ? 3.392   15.956 30.219 1.00 28.15  ? 37  ILE D CD1   1 
ATOM   4007 N  N     . MET D 2 45  ? 8.333   16.686 27.229 1.00 26.74  ? 38  MET D N     1 
ATOM   4008 C  CA    . MET D 2 45  ? 9.715   17.065 27.340 1.00 31.55  ? 38  MET D CA    1 
ATOM   4009 C  C     . MET D 2 45  ? 9.773   18.024 28.515 1.00 32.60  ? 38  MET D C     1 
ATOM   4010 O  O     . MET D 2 45  ? 9.009   18.999 28.563 1.00 34.15  ? 38  MET D O     1 
ATOM   4011 C  CB    . MET D 2 45  ? 10.200  17.683 26.025 1.00 35.25  ? 38  MET D CB    1 
ATOM   4012 C  CG    . MET D 2 45  ? 10.816  16.648 25.073 1.00 39.41  ? 38  MET D CG    1 
ATOM   4013 S  SD    . MET D 2 45  ? 12.605  16.892 24.840 1.00 65.11  ? 38  MET D SD    1 
ATOM   4014 C  CE    . MET D 2 45  ? 13.275  17.003 26.488 1.00 45.53  ? 38  MET D CE    1 
ATOM   4015 N  N     . GLY D 2 46  ? 10.631  17.723 29.489 1.00 31.11  ? 39  GLY D N     1 
ATOM   4016 C  CA    . GLY D 2 46  ? 10.664  18.495 30.737 1.00 31.04  ? 39  GLY D CA    1 
ATOM   4017 C  C     . GLY D 2 46  ? 10.743  19.991 30.459 1.00 30.42  ? 39  GLY D C     1 
ATOM   4018 O  O     . GLY D 2 46  ? 11.634  20.422 29.765 1.00 32.93  ? 39  GLY D O     1 
ATOM   4019 N  N     . PRO D 2 47  ? 9.796   20.788 30.989 1.00 32.23  ? 40  PRO D N     1 
ATOM   4020 C  CA    . PRO D 2 47  ? 9.792   22.211 30.623 1.00 34.83  ? 40  PRO D CA    1 
ATOM   4021 C  C     . PRO D 2 47  ? 11.093  22.934 30.983 1.00 36.57  ? 40  PRO D C     1 
ATOM   4022 O  O     . PRO D 2 47  ? 11.685  22.649 32.028 1.00 35.12  ? 40  PRO D O     1 
ATOM   4023 C  CB    . PRO D 2 47  ? 8.615   22.793 31.422 1.00 35.32  ? 40  PRO D CB    1 
ATOM   4024 C  CG    . PRO D 2 47  ? 7.778   21.619 31.817 1.00 36.46  ? 40  PRO D CG    1 
ATOM   4025 C  CD    . PRO D 2 47  ? 8.696   20.438 31.910 1.00 32.33  ? 40  PRO D CD    1 
ATOM   4026 N  N     . PRO D 2 48  ? 11.545  23.858 30.118 1.00 39.90  ? 41  PRO D N     1 
ATOM   4027 C  CA    . PRO D 2 48  ? 12.744  24.621 30.413 1.00 44.94  ? 41  PRO D CA    1 
ATOM   4028 C  C     . PRO D 2 48  ? 12.618  25.340 31.747 1.00 46.78  ? 41  PRO D C     1 
ATOM   4029 O  O     . PRO D 2 48  ? 11.515  25.716 32.141 1.00 47.00  ? 41  PRO D O     1 
ATOM   4030 C  CB    . PRO D 2 48  ? 12.830  25.641 29.267 1.00 47.23  ? 41  PRO D CB    1 
ATOM   4031 C  CG    . PRO D 2 48  ? 11.967  25.109 28.187 1.00 44.74  ? 41  PRO D CG    1 
ATOM   4032 C  CD    . PRO D 2 48  ? 10.940  24.232 28.829 1.00 40.64  ? 41  PRO D CD    1 
ATOM   4033 N  N     . ASP D 2 49  ? 13.732  25.481 32.447 1.00 50.21  ? 42  ASP D N     1 
ATOM   4034 C  CA    . ASP D 2 49  ? 13.758  26.136 33.758 1.00 60.43  ? 42  ASP D CA    1 
ATOM   4035 C  C     . ASP D 2 49  ? 13.093  25.356 34.898 1.00 54.68  ? 42  ASP D C     1 
ATOM   4036 O  O     . ASP D 2 49  ? 13.292  25.720 36.062 1.00 60.79  ? 42  ASP D O     1 
ATOM   4037 C  CB    . ASP D 2 49  ? 13.150  27.548 33.693 1.00 67.39  ? 42  ASP D CB    1 
ATOM   4038 C  CG    . ASP D 2 49  ? 13.827  28.432 32.659 1.00 74.40  ? 42  ASP D CG    1 
ATOM   4039 O  OD1   . ASP D 2 49  ? 15.062  28.609 32.739 1.00 79.14  ? 42  ASP D OD1   1 
ATOM   4040 O  OD2   . ASP D 2 49  ? 13.117  28.955 31.773 1.00 80.53  ? 42  ASP D OD2   1 
ATOM   4041 N  N     . SER D 2 50  ? 12.300  24.320 34.591 1.00 48.18  ? 43  SER D N     1 
ATOM   4042 C  CA    . SER D 2 50  ? 11.854  23.368 35.616 1.00 42.39  ? 43  SER D CA    1 
ATOM   4043 C  C     . SER D 2 50  ? 13.039  22.487 35.979 1.00 40.23  ? 43  SER D C     1 
ATOM   4044 O  O     . SER D 2 50  ? 13.995  22.385 35.219 1.00 36.91  ? 43  SER D O     1 
ATOM   4045 C  CB    . SER D 2 50  ? 10.664  22.523 35.151 1.00 40.02  ? 43  SER D CB    1 
ATOM   4046 O  OG    . SER D 2 50  ? 11.042  21.330 34.455 1.00 36.11  ? 43  SER D OG    1 
ATOM   4047 N  N     . ALA D 2 51  ? 12.978  21.844 37.142 1.00 38.61  ? 44  ALA D N     1 
ATOM   4048 C  CA    . ALA D 2 51  ? 14.025  20.903 37.531 1.00 38.05  ? 44  ALA D CA    1 
ATOM   4049 C  C     . ALA D 2 51  ? 14.012  19.628 36.646 1.00 35.31  ? 44  ALA D C     1 
ATOM   4050 O  O     . ALA D 2 51  ? 14.909  18.787 36.744 1.00 35.52  ? 44  ALA D O     1 
ATOM   4051 C  CB    . ALA D 2 51  ? 13.887  20.541 39.001 1.00 37.84  ? 44  ALA D CB    1 
ATOM   4052 N  N     . TYR D 2 52  ? 13.014  19.505 35.768 1.00 32.92  ? 45  TYR D N     1 
ATOM   4053 C  CA    . TYR D 2 52  ? 12.871  18.337 34.895 1.00 30.26  ? 45  TYR D CA    1 
ATOM   4054 C  C     . TYR D 2 52  ? 13.396  18.614 33.489 1.00 29.45  ? 45  TYR D C     1 
ATOM   4055 O  O     . TYR D 2 52  ? 13.264  17.759 32.598 1.00 28.74  ? 45  TYR D O     1 
ATOM   4056 C  CB    . TYR D 2 52  ? 11.400  17.906 34.855 1.00 28.36  ? 45  TYR D CB    1 
ATOM   4057 C  CG    . TYR D 2 52  ? 10.852  17.755 36.256 1.00 28.81  ? 45  TYR D CG    1 
ATOM   4058 C  CD1   . TYR D 2 52  ? 11.112  16.610 37.003 1.00 28.49  ? 45  TYR D CD1   1 
ATOM   4059 C  CD2   . TYR D 2 52  ? 10.130  18.785 36.862 1.00 29.15  ? 45  TYR D CD2   1 
ATOM   4060 C  CE1   . TYR D 2 52  ? 10.653  16.486 38.292 1.00 29.05  ? 45  TYR D CE1   1 
ATOM   4061 C  CE2   . TYR D 2 52  ? 9.667   18.668 38.153 1.00 29.18  ? 45  TYR D CE2   1 
ATOM   4062 C  CZ    . TYR D 2 52  ? 9.933   17.528 38.864 1.00 29.72  ? 45  TYR D CZ    1 
ATOM   4063 O  OH    . TYR D 2 52  ? 9.474   17.418 40.145 1.00 29.39  ? 45  TYR D OH    1 
ATOM   4064 N  N     . GLN D 2 53  ? 13.985  19.791 33.279 1.00 30.35  ? 46  GLN D N     1 
ATOM   4065 C  CA    . GLN D 2 53  ? 14.446  20.188 31.948 1.00 32.88  ? 46  GLN D CA    1 
ATOM   4066 C  C     . GLN D 2 53  ? 15.415  19.174 31.341 1.00 32.21  ? 46  GLN D C     1 
ATOM   4067 O  O     . GLN D 2 53  ? 16.342  18.734 31.995 1.00 33.04  ? 46  GLN D O     1 
ATOM   4068 C  CB    . GLN D 2 53  ? 15.146  21.581 31.942 1.00 37.00  ? 46  GLN D CB    1 
ATOM   4069 C  CG    . GLN D 2 53  ? 16.488  21.636 32.654 1.00 40.13  ? 46  GLN D CG    1 
ATOM   4070 C  CD    . GLN D 2 53  ? 17.183  22.998 32.567 1.00 47.64  ? 46  GLN D CD    1 
ATOM   4071 O  OE1   . GLN D 2 53  ? 16.744  23.909 31.858 1.00 53.40  ? 46  GLN D OE1   1 
ATOM   4072 N  NE2   . GLN D 2 53  ? 18.280  23.124 33.277 1.00 49.44  ? 46  GLN D NE2   1 
ATOM   4073 N  N     . GLY D 2 54  ? 15.180  18.823 30.085 1.00 32.78  ? 47  GLY D N     1 
ATOM   4074 C  CA    . GLY D 2 54  ? 16.042  17.878 29.373 1.00 33.30  ? 47  GLY D CA    1 
ATOM   4075 C  C     . GLY D 2 54  ? 15.612  16.427 29.573 1.00 31.90  ? 47  GLY D C     1 
ATOM   4076 O  O     . GLY D 2 54  ? 16.210  15.527 28.986 1.00 33.04  ? 47  GLY D O     1 
ATOM   4077 N  N     . GLY D 2 55  ? 14.634  16.204 30.444 1.00 29.16  ? 48  GLY D N     1 
ATOM   4078 C  CA    . GLY D 2 55  ? 14.043  14.876 30.637 1.00 28.08  ? 48  GLY D CA    1 
ATOM   4079 C  C     . GLY D 2 55  ? 12.966  14.599 29.607 1.00 27.94  ? 48  GLY D C     1 
ATOM   4080 O  O     . GLY D 2 55  ? 12.317  15.527 29.113 1.00 28.24  ? 48  GLY D O     1 
ATOM   4081 N  N     . VAL D 2 56  ? 12.795  13.324 29.262 1.00 27.45  ? 49  VAL D N     1 
ATOM   4082 C  CA    . VAL D 2 56  ? 11.696  12.872 28.419 1.00 27.70  ? 49  VAL D CA    1 
ATOM   4083 C  C     . VAL D 2 56  ? 10.820  11.932 29.215 1.00 27.05  ? 49  VAL D C     1 
ATOM   4084 O  O     . VAL D 2 56  ? 11.289  10.901 29.708 1.00 27.61  ? 49  VAL D O     1 
ATOM   4085 C  CB    . VAL D 2 56  ? 12.181  12.121 27.170 1.00 30.66  ? 49  VAL D CB    1 
ATOM   4086 C  CG1   . VAL D 2 56  ? 11.007  11.799 26.248 1.00 31.71  ? 49  VAL D CG1   1 
ATOM   4087 C  CG2   . VAL D 2 56  ? 13.175  12.955 26.435 1.00 32.62  ? 49  VAL D CG2   1 
ATOM   4088 N  N     . PHE D 2 57  ? 9.549   12.278 29.309 1.00 25.77  ? 50  PHE D N     1 
ATOM   4089 C  CA    . PHE D 2 57  ? 8.598   11.559 30.142 1.00 28.36  ? 50  PHE D CA    1 
ATOM   4090 C  C     . PHE D 2 57  ? 7.452   11.010 29.271 1.00 26.85  ? 50  PHE D C     1 
ATOM   4091 O  O     . PHE D 2 57  ? 6.843   11.750 28.490 1.00 25.08  ? 50  PHE D O     1 
ATOM   4092 C  CB    . PHE D 2 57  ? 8.068   12.498 31.226 1.00 27.43  ? 50  PHE D CB    1 
ATOM   4093 C  CG    . PHE D 2 57  ? 9.149   13.072 32.112 1.00 27.87  ? 50  PHE D CG    1 
ATOM   4094 C  CD1   . PHE D 2 57  ? 9.527   12.426 33.278 1.00 30.15  ? 50  PHE D CD1   1 
ATOM   4095 C  CD2   . PHE D 2 57  ? 9.785   14.255 31.779 1.00 27.68  ? 50  PHE D CD2   1 
ATOM   4096 C  CE1   . PHE D 2 57  ? 10.526  12.943 34.094 1.00 28.88  ? 50  PHE D CE1   1 
ATOM   4097 C  CE2   . PHE D 2 57  ? 10.797  14.775 32.590 1.00 30.29  ? 50  PHE D CE2   1 
ATOM   4098 C  CZ    . PHE D 2 57  ? 11.146  14.127 33.760 1.00 28.53  ? 50  PHE D CZ    1 
ATOM   4099 N  N     . PHE D 2 58  ? 7.204   9.709  29.396 1.00 25.46  ? 51  PHE D N     1 
ATOM   4100 C  CA    . PHE D 2 58  ? 6.169   9.031  28.663 1.00 25.76  ? 51  PHE D CA    1 
ATOM   4101 C  C     . PHE D 2 58  ? 4.972   8.760  29.569 1.00 24.97  ? 51  PHE D C     1 
ATOM   4102 O  O     . PHE D 2 58  ? 5.114   8.466  30.760 1.00 24.87  ? 51  PHE D O     1 
ATOM   4103 C  CB    . PHE D 2 58  ? 6.715   7.725  28.093 1.00 28.81  ? 51  PHE D CB    1 
ATOM   4104 C  CG    . PHE D 2 58  ? 7.866   7.921  27.164 1.00 30.76  ? 51  PHE D CG    1 
ATOM   4105 C  CD1   . PHE D 2 58  ? 7.679   8.551  25.939 1.00 30.86  ? 51  PHE D CD1   1 
ATOM   4106 C  CD2   . PHE D 2 58  ? 9.144   7.499  27.507 1.00 33.55  ? 51  PHE D CD2   1 
ATOM   4107 C  CE1   . PHE D 2 58  ? 8.740   8.735  25.065 1.00 31.13  ? 51  PHE D CE1   1 
ATOM   4108 C  CE2   . PHE D 2 58  ? 10.209  7.698  26.639 1.00 35.81  ? 51  PHE D CE2   1 
ATOM   4109 C  CZ    . PHE D 2 58  ? 10.003  8.315  25.416 1.00 33.25  ? 51  PHE D CZ    1 
ATOM   4110 N  N     . LEU D 2 59  ? 3.797   8.871  28.980 1.00 23.18  ? 52  LEU D N     1 
ATOM   4111 C  CA    . LEU D 2 59  ? 2.534   8.762  29.707 1.00 24.60  ? 52  LEU D CA    1 
ATOM   4112 C  C     . LEU D 2 59  ? 1.603   7.909  28.877 1.00 24.93  ? 52  LEU D C     1 
ATOM   4113 O  O     . LEU D 2 59  ? 1.757   7.827  27.654 1.00 26.33  ? 52  LEU D O     1 
ATOM   4114 C  CB    . LEU D 2 59  ? 1.868   10.120 29.898 1.00 25.23  ? 52  LEU D CB    1 
ATOM   4115 C  CG    . LEU D 2 59  ? 2.462   11.195 30.823 1.00 27.44  ? 52  LEU D CG    1 
ATOM   4116 C  CD1   . LEU D 2 59  ? 3.730   11.788 30.223 1.00 33.02  ? 52  LEU D CD1   1 
ATOM   4117 C  CD2   . LEU D 2 59  ? 1.443   12.287 31.049 1.00 29.21  ? 52  LEU D CD2   1 
ATOM   4118 N  N     . THR D 2 60  ? 0.622   7.303  29.535 1.00 25.03  ? 53  THR D N     1 
ATOM   4119 C  CA    . THR D 2 60  ? -0.433  6.581  28.853 1.00 26.92  ? 53  THR D CA    1 
ATOM   4120 C  C     . THR D 2 60  ? -1.728  7.293  29.110 1.00 24.70  ? 53  THR D C     1 
ATOM   4121 O  O     . THR D 2 60  ? -1.914  7.854  30.174 1.00 27.97  ? 53  THR D O     1 
ATOM   4122 C  CB    . THR D 2 60  ? -0.569  5.143  29.396 1.00 28.11  ? 53  THR D CB    1 
ATOM   4123 O  OG1   . THR D 2 60  ? -0.782  5.194  30.815 1.00 29.38  ? 53  THR D OG1   1 
ATOM   4124 C  CG2   . THR D 2 60  ? 0.670   4.355  29.125 1.00 32.91  ? 53  THR D CG2   1 
ATOM   4125 N  N     . VAL D 2 61  ? -2.628  7.235  28.139 1.00 24.64  ? 54  VAL D N     1 
ATOM   4126 C  CA    . VAL D 2 61  ? -3.955  7.835  28.243 1.00 26.02  ? 54  VAL D CA    1 
ATOM   4127 C  C     . VAL D 2 61  ? -4.969  6.753  27.889 1.00 28.15  ? 54  VAL D C     1 
ATOM   4128 O  O     . VAL D 2 61  ? -4.911  6.192  26.793 1.00 31.00  ? 54  VAL D O     1 
ATOM   4129 C  CB    . VAL D 2 61  ? -4.125  9.010  27.262 1.00 26.09  ? 54  VAL D CB    1 
ATOM   4130 C  CG1   . VAL D 2 61  ? -5.511  9.642  27.399 1.00 25.01  ? 54  VAL D CG1   1 
ATOM   4131 C  CG2   . VAL D 2 61  ? -3.015  10.035 27.468 1.00 25.69  ? 54  VAL D CG2   1 
ATOM   4132 N  N     . HIS D 2 62  ? -5.880  6.452  28.813 1.00 28.63  ? 55  HIS D N     1 
ATOM   4133 C  CA    . HIS D 2 62  ? -6.979  5.538  28.528 1.00 31.63  ? 55  HIS D CA    1 
ATOM   4134 C  C     . HIS D 2 62  ? -8.299  6.294  28.684 1.00 29.37  ? 55  HIS D C     1 
ATOM   4135 O  O     . HIS D 2 62  ? -8.569  6.913  29.710 1.00 30.08  ? 55  HIS D O     1 
ATOM   4136 C  CB    . HIS D 2 62  ? -6.924  4.305  29.428 1.00 36.88  ? 55  HIS D CB    1 
ATOM   4137 C  CG    . HIS D 2 62  ? -5.807  3.360  29.105 1.00 42.92  ? 55  HIS D CG    1 
ATOM   4138 N  ND1   . HIS D 2 62  ? -4.582  3.408  29.736 1.00 46.66  ? 55  HIS D ND1   1 
ATOM   4139 C  CD2   . HIS D 2 62  ? -5.733  2.331  28.227 1.00 49.36  ? 55  HIS D CD2   1 
ATOM   4140 C  CE1   . HIS D 2 62  ? -3.799  2.460  29.256 1.00 47.79  ? 55  HIS D CE1   1 
ATOM   4141 N  NE2   . HIS D 2 62  ? -4.473  1.792  28.338 1.00 54.22  ? 55  HIS D NE2   1 
ATOM   4142 N  N     . PHE D 2 63  ? -9.111  6.260  27.637 1.00 27.10  ? 56  PHE D N     1 
ATOM   4143 C  CA    . PHE D 2 63  ? -10.371 6.976  27.616 1.00 26.03  ? 56  PHE D CA    1 
ATOM   4144 C  C     . PHE D 2 63  ? -11.459 6.035  28.078 1.00 29.11  ? 56  PHE D C     1 
ATOM   4145 O  O     . PHE D 2 63  ? -11.506 4.899  27.633 1.00 27.03  ? 56  PHE D O     1 
ATOM   4146 C  CB    . PHE D 2 63  ? -10.692 7.445  26.198 1.00 25.67  ? 56  PHE D CB    1 
ATOM   4147 C  CG    . PHE D 2 63  ? -9.818  8.576  25.699 1.00 23.41  ? 56  PHE D CG    1 
ATOM   4148 C  CD1   . PHE D 2 63  ? -10.167 9.894  25.938 1.00 23.38  ? 56  PHE D CD1   1 
ATOM   4149 C  CD2   . PHE D 2 63  ? -8.694  8.323  24.950 1.00 23.36  ? 56  PHE D CD2   1 
ATOM   4150 C  CE1   . PHE D 2 63  ? -9.378  10.932 25.470 1.00 20.39  ? 56  PHE D CE1   1 
ATOM   4151 C  CE2   . PHE D 2 63  ? -7.907  9.346  24.454 1.00 21.63  ? 56  PHE D CE2   1 
ATOM   4152 C  CZ    . PHE D 2 63  ? -8.245  10.663 24.715 1.00 20.30  ? 56  PHE D CZ    1 
ATOM   4153 N  N     . PRO D 2 64  ? -12.341 6.495  28.969 1.00 30.45  ? 57  PRO D N     1 
ATOM   4154 C  CA    . PRO D 2 64  ? -13.443 5.637  29.352 1.00 31.41  ? 57  PRO D CA    1 
ATOM   4155 C  C     . PRO D 2 64  ? -14.523 5.587  28.260 1.00 31.87  ? 57  PRO D C     1 
ATOM   4156 O  O     . PRO D 2 64  ? -14.616 6.501  27.419 1.00 27.62  ? 57  PRO D O     1 
ATOM   4157 C  CB    . PRO D 2 64  ? -13.967 6.303  30.612 1.00 32.86  ? 57  PRO D CB    1 
ATOM   4158 C  CG    . PRO D 2 64  ? -13.723 7.752  30.367 1.00 31.26  ? 57  PRO D CG    1 
ATOM   4159 C  CD    . PRO D 2 64  ? -12.471 7.852  29.536 1.00 29.60  ? 57  PRO D CD    1 
ATOM   4160 N  N     . THR D 2 65  ? -15.314 4.516  28.269 1.00 32.71  ? 58  THR D N     1 
ATOM   4161 C  CA    . THR D 2 65  ? -16.383 4.321  27.284 1.00 35.16  ? 58  THR D CA    1 
ATOM   4162 C  C     . THR D 2 65  ? -17.434 5.447  27.242 1.00 34.32  ? 58  THR D C     1 
ATOM   4163 O  O     . THR D 2 65  ? -18.014 5.702  26.200 1.00 34.11  ? 58  THR D O     1 
ATOM   4164 C  CB    . THR D 2 65  ? -17.109 2.965  27.464 1.00 37.39  ? 58  THR D CB    1 
ATOM   4165 O  OG1   . THR D 2 65  ? -17.746 2.881  28.754 1.00 39.29  ? 58  THR D OG1   1 
ATOM   4166 C  CG2   . THR D 2 65  ? -16.127 1.804  27.306 1.00 38.53  ? 58  THR D CG2   1 
ATOM   4167 N  N     . ASP D 2 66  ? -17.708 6.084  28.372 1.00 34.82  ? 59  ASP D N     1 
ATOM   4168 C  CA    . ASP D 2 66  ? -18.636 7.208  28.385 1.00 36.14  ? 59  ASP D CA    1 
ATOM   4169 C  C     . ASP D 2 66  ? -17.920 8.567  28.380 1.00 32.91  ? 59  ASP D C     1 
ATOM   4170 O  O     . ASP D 2 66  ? -18.460 9.568  28.856 1.00 33.06  ? 59  ASP D O     1 
ATOM   4171 C  CB    . ASP D 2 66  ? -19.605 7.098  29.565 1.00 39.67  ? 59  ASP D CB    1 
ATOM   4172 C  CG    . ASP D 2 66  ? -18.905 7.020  30.903 1.00 40.40  ? 59  ASP D CG    1 
ATOM   4173 O  OD1   . ASP D 2 66  ? -17.673 6.881  30.944 1.00 43.44  ? 59  ASP D OD1   1 
ATOM   4174 O  OD2   . ASP D 2 66  ? -19.602 7.076  31.930 1.00 45.41  ? 59  ASP D OD2   1 
ATOM   4175 N  N     . TYR D 2 67  ? -16.726 8.603  27.808 1.00 31.46  ? 60  TYR D N     1 
ATOM   4176 C  CA    . TYR D 2 67  ? -16.023 9.865  27.580 1.00 29.81  ? 60  TYR D CA    1 
ATOM   4177 C  C     . TYR D 2 67  ? -16.924 10.738 26.701 1.00 28.93  ? 60  TYR D C     1 
ATOM   4178 O  O     . TYR D 2 67  ? -17.584 10.224 25.802 1.00 31.36  ? 60  TYR D O     1 
ATOM   4179 C  CB    . TYR D 2 67  ? -14.661 9.612  26.900 1.00 28.86  ? 60  TYR D CB    1 
ATOM   4180 C  CG    . TYR D 2 67  ? -13.754 10.814 26.838 1.00 26.49  ? 60  TYR D CG    1 
ATOM   4181 C  CD1   . TYR D 2 67  ? -13.089 11.257 27.981 1.00 28.97  ? 60  TYR D CD1   1 
ATOM   4182 C  CD2   . TYR D 2 67  ? -13.538 11.495 25.655 1.00 25.03  ? 60  TYR D CD2   1 
ATOM   4183 C  CE1   . TYR D 2 67  ? -12.255 12.358 27.947 1.00 28.49  ? 60  TYR D CE1   1 
ATOM   4184 C  CE2   . TYR D 2 67  ? -12.685 12.600 25.608 1.00 24.89  ? 60  TYR D CE2   1 
ATOM   4185 C  CZ    . TYR D 2 67  ? -12.044 13.021 26.760 1.00 26.95  ? 60  TYR D CZ    1 
ATOM   4186 O  OH    . TYR D 2 67  ? -11.201 14.115 26.768 1.00 25.95  ? 60  TYR D OH    1 
ATOM   4187 N  N     . PRO D 2 68  ? -16.982 12.059 26.952 1.00 28.14  ? 61  PRO D N     1 
ATOM   4188 C  CA    . PRO D 2 68  ? -16.280 12.914 27.892 1.00 27.47  ? 61  PRO D CA    1 
ATOM   4189 C  C     . PRO D 2 68  ? -17.000 13.201 29.204 1.00 29.77  ? 61  PRO D C     1 
ATOM   4190 O  O     . PRO D 2 68  ? -16.673 14.176 29.853 1.00 28.76  ? 61  PRO D O     1 
ATOM   4191 C  CB    . PRO D 2 68  ? -16.169 14.217 27.099 1.00 27.79  ? 61  PRO D CB    1 
ATOM   4192 C  CG    . PRO D 2 68  ? -17.477 14.293 26.405 1.00 28.87  ? 61  PRO D CG    1 
ATOM   4193 C  CD    . PRO D 2 68  ? -17.821 12.860 26.041 1.00 29.13  ? 61  PRO D CD    1 
ATOM   4194 N  N     . PHE D 2 69  ? -17.958 12.364 29.604 1.00 31.45  ? 62  PHE D N     1 
ATOM   4195 C  CA    . PHE D 2 69  ? -18.678 12.601 30.845 1.00 33.73  ? 62  PHE D CA    1 
ATOM   4196 C  C     . PHE D 2 69  ? -17.841 12.167 32.059 1.00 36.17  ? 62  PHE D C     1 
ATOM   4197 O  O     . PHE D 2 69  ? -18.128 12.561 33.198 1.00 37.25  ? 62  PHE D O     1 
ATOM   4198 C  CB    . PHE D 2 69  ? -20.017 11.886 30.816 1.00 36.56  ? 62  PHE D CB    1 
ATOM   4199 C  CG    . PHE D 2 69  ? -20.955 12.426 29.774 1.00 42.17  ? 62  PHE D CG    1 
ATOM   4200 C  CD1   . PHE D 2 69  ? -20.845 12.029 28.452 1.00 43.89  ? 62  PHE D CD1   1 
ATOM   4201 C  CD2   . PHE D 2 69  ? -21.947 13.337 30.119 1.00 49.95  ? 62  PHE D CD2   1 
ATOM   4202 C  CE1   . PHE D 2 69  ? -21.697 12.530 27.486 1.00 47.69  ? 62  PHE D CE1   1 
ATOM   4203 C  CE2   . PHE D 2 69  ? -22.815 13.831 29.152 1.00 52.09  ? 62  PHE D CE2   1 
ATOM   4204 C  CZ    . PHE D 2 69  ? -22.677 13.432 27.836 1.00 48.48  ? 62  PHE D CZ    1 
ATOM   4205 N  N     . LYS D 2 70  ? -16.818 11.349 31.811 1.00 33.33  ? 63  LYS D N     1 
ATOM   4206 C  CA    . LYS D 2 70  ? -15.812 10.990 32.815 1.00 34.81  ? 63  LYS D CA    1 
ATOM   4207 C  C     . LYS D 2 70  ? -14.442 11.430 32.281 1.00 30.99  ? 63  LYS D C     1 
ATOM   4208 O  O     . LYS D 2 70  ? -14.273 11.602 31.077 1.00 28.83  ? 63  LYS D O     1 
ATOM   4209 C  CB    . LYS D 2 70  ? -15.811 9.463  33.055 1.00 36.21  ? 63  LYS D CB    1 
ATOM   4210 C  CG    . LYS D 2 70  ? -17.039 8.894  33.754 1.00 44.30  ? 63  LYS D CG    1 
ATOM   4211 C  CD    . LYS D 2 70  ? -17.372 9.669  35.017 1.00 50.41  ? 63  LYS D CD    1 
ATOM   4212 C  CE    . LYS D 2 70  ? -18.154 8.833  36.022 1.00 57.56  ? 63  LYS D CE    1 
ATOM   4213 N  NZ    . LYS D 2 70  ? -19.404 8.267  35.445 1.00 57.94  ? 63  LYS D NZ    1 
ATOM   4214 N  N     . PRO D 2 71  ? -13.454 11.604 33.169 1.00 30.54  ? 64  PRO D N     1 
ATOM   4215 C  CA    . PRO D 2 71  ? -12.129 12.001 32.680 1.00 29.42  ? 64  PRO D CA    1 
ATOM   4216 C  C     . PRO D 2 71  ? -11.320 10.877 32.028 1.00 29.63  ? 64  PRO D C     1 
ATOM   4217 O  O     . PRO D 2 71  ? -11.545 9.699  32.320 1.00 27.87  ? 64  PRO D O     1 
ATOM   4218 C  CB    . PRO D 2 71  ? -11.404 12.481 33.949 1.00 30.64  ? 64  PRO D CB    1 
ATOM   4219 C  CG    . PRO D 2 71  ? -12.161 11.922 35.095 1.00 34.98  ? 64  PRO D CG    1 
ATOM   4220 C  CD    . PRO D 2 71  ? -13.570 11.665 34.640 1.00 34.30  ? 64  PRO D CD    1 
ATOM   4221 N  N     . PRO D 2 72  ? -10.331 11.248 31.202 1.00 27.20  ? 65  PRO D N     1 
ATOM   4222 C  CA    . PRO D 2 72  ? -9.373  10.250 30.797 1.00 26.77  ? 65  PRO D CA    1 
ATOM   4223 C  C     . PRO D 2 72  ? -8.530  9.815  31.993 1.00 27.81  ? 65  PRO D C     1 
ATOM   4224 O  O     . PRO D 2 72  ? -8.352  10.589 32.935 1.00 26.87  ? 65  PRO D O     1 
ATOM   4225 C  CB    . PRO D 2 72  ? -8.525  10.986 29.769 1.00 27.82  ? 65  PRO D CB    1 
ATOM   4226 C  CG    . PRO D 2 72  ? -8.580  12.421 30.189 1.00 26.93  ? 65  PRO D CG    1 
ATOM   4227 C  CD    . PRO D 2 72  ? -9.812  12.613 31.013 1.00 25.84  ? 65  PRO D CD    1 
ATOM   4228 N  N     . LYS D 2 73  ? -8.089  8.560  31.981 1.00 28.02  ? 66  LYS D N     1 
ATOM   4229 C  CA    . LYS D 2 73  ? -7.117  8.062  32.941 1.00 29.25  ? 66  LYS D CA    1 
ATOM   4230 C  C     . LYS D 2 73  ? -5.742  8.291  32.346 1.00 26.42  ? 66  LYS D C     1 
ATOM   4231 O  O     . LYS D 2 73  ? -5.427  7.790  31.276 1.00 28.14  ? 66  LYS D O     1 
ATOM   4232 C  CB    . LYS D 2 73  ? -7.337  6.566  33.219 1.00 35.66  ? 66  LYS D CB    1 
ATOM   4233 C  CG    . LYS D 2 73  ? -8.642  6.263  33.931 1.00 45.93  ? 66  LYS D CG    1 
ATOM   4234 C  CD    . LYS D 2 73  ? -8.467  6.202  35.448 1.00 63.98  ? 66  LYS D CD    1 
ATOM   4235 C  CE    . LYS D 2 73  ? -9.787  6.414  36.191 1.00 67.96  ? 66  LYS D CE    1 
ATOM   4236 N  NZ    . LYS D 2 73  ? -10.279 7.827  36.091 1.00 60.40  ? 66  LYS D NZ    1 
ATOM   4237 N  N     . ILE D 2 74  ? -4.936  9.097  33.016 1.00 28.77  ? 67  ILE D N     1 
ATOM   4238 C  CA    . ILE D 2 74  ? -3.619  9.469  32.509 1.00 26.49  ? 67  ILE D CA    1 
ATOM   4239 C  C     . ILE D 2 74  ? -2.604  9.151  33.602 1.00 27.80  ? 67  ILE D C     1 
ATOM   4240 O  O     . ILE D 2 74  ? -2.814  9.515  34.760 1.00 29.36  ? 67  ILE D O     1 
ATOM   4241 C  CB    . ILE D 2 74  ? -3.554  10.969 32.119 1.00 26.72  ? 67  ILE D CB    1 
ATOM   4242 C  CG1   . ILE D 2 74  ? -4.538  11.262 30.973 1.00 26.13  ? 67  ILE D CG1   1 
ATOM   4243 C  CG2   . ILE D 2 74  ? -2.140  11.315 31.672 1.00 24.79  ? 67  ILE D CG2   1 
ATOM   4244 C  CD1   . ILE D 2 74  ? -4.589  12.721 30.518 1.00 27.29  ? 67  ILE D CD1   1 
ATOM   4245 N  N     . ALA D 2 75  ? -1.517  8.463  33.244 1.00 27.53  ? 68  ALA D N     1 
ATOM   4246 C  CA    . ALA D 2 75  ? -0.463  8.135  34.205 1.00 26.94  ? 68  ALA D CA    1 
ATOM   4247 C  C     . ALA D 2 75  ? 0.921   8.186  33.568 1.00 26.15  ? 68  ALA D C     1 
ATOM   4248 O  O     . ALA D 2 75  ? 1.062   8.000  32.361 1.00 26.26  ? 68  ALA D O     1 
ATOM   4249 C  CB    . ALA D 2 75  ? -0.707  6.750  34.797 1.00 31.67  ? 68  ALA D CB    1 
ATOM   4250 N  N     . PHE D 2 76  ? 1.930   8.412  34.398 1.00 26.96  ? 69  PHE D N     1 
ATOM   4251 C  CA    . PHE D 2 76  ? 3.328   8.346  33.975 1.00 27.33  ? 69  PHE D CA    1 
ATOM   4252 C  C     . PHE D 2 76  ? 3.827   6.930  33.864 1.00 29.42  ? 69  PHE D C     1 
ATOM   4253 O  O     . PHE D 2 76  ? 3.624   6.098  34.755 1.00 30.86  ? 69  PHE D O     1 
ATOM   4254 C  CB    . PHE D 2 76  ? 4.229   9.100  34.956 1.00 28.25  ? 69  PHE D CB    1 
ATOM   4255 C  CG    . PHE D 2 76  ? 4.265   10.580 34.710 1.00 27.72  ? 69  PHE D CG    1 
ATOM   4256 C  CD1   . PHE D 2 76  ? 3.177   11.374 35.038 1.00 28.24  ? 69  PHE D CD1   1 
ATOM   4257 C  CD2   . PHE D 2 76  ? 5.380   11.178 34.151 1.00 27.79  ? 69  PHE D CD2   1 
ATOM   4258 C  CE1   . PHE D 2 76  ? 3.197   12.749 34.787 1.00 26.32  ? 69  PHE D CE1   1 
ATOM   4259 C  CE2   . PHE D 2 76  ? 5.410   12.550 33.919 1.00 28.72  ? 69  PHE D CE2   1 
ATOM   4260 C  CZ    . PHE D 2 76  ? 4.310   13.330 34.222 1.00 26.73  ? 69  PHE D CZ    1 
ATOM   4261 N  N     . THR D 2 77  ? 4.516   6.657  32.774 1.00 29.75  ? 70  THR D N     1 
ATOM   4262 C  CA    . THR D 2 77  ? 5.262   5.425  32.677 1.00 31.50  ? 70  THR D CA    1 
ATOM   4263 C  C     . THR D 2 77  ? 6.722   5.695  33.049 1.00 30.99  ? 70  THR D C     1 
ATOM   4264 O  O     . THR D 2 77  ? 7.396   4.805  33.489 1.00 33.84  ? 70  THR D O     1 
ATOM   4265 C  CB    . THR D 2 77  ? 5.096   4.796  31.286 1.00 34.46  ? 70  THR D CB    1 
ATOM   4266 O  OG1   . THR D 2 77  ? 5.488   5.732  30.288 1.00 40.33  ? 70  THR D OG1   1 
ATOM   4267 C  CG2   . THR D 2 77  ? 3.642   4.473  31.045 1.00 35.53  ? 70  THR D CG2   1 
ATOM   4268 N  N     . THR D 2 78  ? 7.190   6.936  32.945 1.00 28.84  ? 71  THR D N     1 
ATOM   4269 C  CA    . THR D 2 78  ? 8.565   7.281  33.323 1.00 28.50  ? 71  THR D CA    1 
ATOM   4270 C  C     . THR D 2 78  ? 8.608   7.643  34.806 1.00 28.74  ? 71  THR D C     1 
ATOM   4271 O  O     . THR D 2 78  ? 7.763   8.402  35.279 1.00 27.87  ? 71  THR D O     1 
ATOM   4272 C  CB    . THR D 2 78  ? 9.082   8.489  32.491 1.00 26.25  ? 71  THR D CB    1 
ATOM   4273 O  OG1   . THR D 2 78  ? 8.941   8.219  31.093 1.00 26.26  ? 71  THR D OG1   1 
ATOM   4274 C  CG2   . THR D 2 78  ? 10.550  8.784  32.779 1.00 26.55  ? 71  THR D CG2   1 
ATOM   4275 N  N     . LYS D 2 79  ? 9.584   7.096  35.537 1.00 29.88  ? 72  LYS D N     1 
ATOM   4276 C  CA    . LYS D 2 79  ? 9.808   7.423  36.949 1.00 30.97  ? 72  LYS D CA    1 
ATOM   4277 C  C     . LYS D 2 79  ? 10.134  8.927  37.111 1.00 31.22  ? 72  LYS D C     1 
ATOM   4278 O  O     . LYS D 2 79  ? 10.864  9.496  36.305 1.00 31.95  ? 72  LYS D O     1 
ATOM   4279 C  CB    . LYS D 2 79  ? 10.934  6.530  37.512 1.00 34.38  ? 72  LYS D CB    1 
ATOM   4280 C  CG    . LYS D 2 79  ? 11.197  6.672  39.002 1.00 37.07  ? 72  LYS D CG    1 
ATOM   4281 C  CD    . LYS D 2 79  ? 11.924  5.461  39.579 1.00 39.40  ? 72  LYS D CD    1 
ATOM   4282 C  CE    . LYS D 2 79  ? 12.255  5.655  41.052 1.00 42.16  ? 72  LYS D CE    1 
ATOM   4283 N  NZ    . LYS D 2 79  ? 11.088  5.438  41.957 1.00 41.45  ? 72  LYS D NZ    1 
ATOM   4284 N  N     . ILE D 2 80  ? 9.529   9.579  38.103 1.00 30.81  ? 73  ILE D N     1 
ATOM   4285 C  CA    . ILE D 2 80  ? 9.727   11.020 38.335 1.00 29.49  ? 73  ILE D CA    1 
ATOM   4286 C  C     . ILE D 2 80  ? 9.623   11.358 39.835 1.00 31.16  ? 73  ILE D C     1 
ATOM   4287 O  O     . ILE D 2 80  ? 8.845   10.735 40.568 1.00 33.11  ? 73  ILE D O     1 
ATOM   4288 C  CB    . ILE D 2 80  ? 8.738   11.878 37.494 1.00 29.07  ? 73  ILE D CB    1 
ATOM   4289 C  CG1   . ILE D 2 80  ? 9.001   13.386 37.664 1.00 29.36  ? 73  ILE D CG1   1 
ATOM   4290 C  CG2   . ILE D 2 80  ? 7.281   11.586 37.851 1.00 27.45  ? 73  ILE D CG2   1 
ATOM   4291 C  CD1   . ILE D 2 80  ? 8.220   14.245 36.678 1.00 29.27  ? 73  ILE D CD1   1 
ATOM   4292 N  N     . TYR D 2 81  ? 10.440  12.308 40.275 1.00 30.44  ? 74  TYR D N     1 
ATOM   4293 C  CA    . TYR D 2 81  ? 10.471  12.790 41.655 1.00 31.71  ? 74  TYR D CA    1 
ATOM   4294 C  C     . TYR D 2 81  ? 9.610   14.033 41.706 1.00 31.62  ? 74  TYR D C     1 
ATOM   4295 O  O     . TYR D 2 81  ? 10.001  15.085 41.159 1.00 31.00  ? 74  TYR D O     1 
ATOM   4296 C  CB    . TYR D 2 81  ? 11.908  13.132 42.057 1.00 33.82  ? 74  TYR D CB    1 
ATOM   4297 C  CG    . TYR D 2 81  ? 12.127  13.431 43.524 1.00 34.79  ? 74  TYR D CG    1 
ATOM   4298 C  CD1   . TYR D 2 81  ? 12.109  14.742 43.998 1.00 35.11  ? 74  TYR D CD1   1 
ATOM   4299 C  CD2   . TYR D 2 81  ? 12.365  12.406 44.437 1.00 36.16  ? 74  TYR D CD2   1 
ATOM   4300 C  CE1   . TYR D 2 81  ? 12.306  15.018 45.338 1.00 37.13  ? 74  TYR D CE1   1 
ATOM   4301 C  CE2   . TYR D 2 81  ? 12.582  12.678 45.776 1.00 37.96  ? 74  TYR D CE2   1 
ATOM   4302 C  CZ    . TYR D 2 81  ? 12.546  13.985 46.216 1.00 38.23  ? 74  TYR D CZ    1 
ATOM   4303 O  OH    . TYR D 2 81  ? 12.749  14.262 47.531 1.00 40.78  ? 74  TYR D OH    1 
ATOM   4304 N  N     . HIS D 2 82  ? 8.441   13.887 42.340 1.00 31.71  ? 75  HIS D N     1 
ATOM   4305 C  CA    . HIS D 2 82  ? 7.392   14.896 42.363 1.00 31.31  ? 75  HIS D CA    1 
ATOM   4306 C  C     . HIS D 2 82  ? 6.364   14.589 43.479 1.00 32.21  ? 75  HIS D C     1 
ATOM   4307 O  O     . HIS D 2 82  ? 5.944   13.447 43.652 1.00 33.12  ? 75  HIS D O     1 
ATOM   4308 C  CB    . HIS D 2 82  ? 6.690   14.935 40.991 1.00 30.63  ? 75  HIS D CB    1 
ATOM   4309 C  CG    . HIS D 2 82  ? 5.990   16.230 40.693 1.00 31.77  ? 75  HIS D CG    1 
ATOM   4310 N  ND1   . HIS D 2 82  ? 4.765   16.552 41.219 1.00 32.85  ? 75  HIS D ND1   1 
ATOM   4311 C  CD2   . HIS D 2 82  ? 6.341   17.274 39.910 1.00 33.29  ? 75  HIS D CD2   1 
ATOM   4312 C  CE1   . HIS D 2 82  ? 4.397   17.746 40.796 1.00 33.95  ? 75  HIS D CE1   1 
ATOM   4313 N  NE2   . HIS D 2 82  ? 5.335   18.202 39.991 1.00 32.58  ? 75  HIS D NE2   1 
ATOM   4314 N  N     . PRO D 2 83  ? 5.928   15.608 44.220 1.00 32.92  ? 76  PRO D N     1 
ATOM   4315 C  CA    . PRO D 2 83  ? 4.961   15.362 45.306 1.00 35.30  ? 76  PRO D CA    1 
ATOM   4316 C  C     . PRO D 2 83  ? 3.559   14.952 44.870 1.00 33.82  ? 76  PRO D C     1 
ATOM   4317 O  O     . PRO D 2 83  ? 2.801   14.449 45.690 1.00 35.84  ? 76  PRO D O     1 
ATOM   4318 C  CB    . PRO D 2 83  ? 4.899   16.703 46.044 1.00 36.72  ? 76  PRO D CB    1 
ATOM   4319 C  CG    . PRO D 2 83  ? 5.366   17.704 45.060 1.00 36.21  ? 76  PRO D CG    1 
ATOM   4320 C  CD    . PRO D 2 83  ? 6.337   17.018 44.150 1.00 33.90  ? 76  PRO D CD    1 
ATOM   4321 N  N     . ASN D 2 84  ? 3.233   15.162 43.597 1.00 32.07  ? 77  ASN D N     1 
ATOM   4322 C  CA    . ASN D 2 84  ? 1.912   14.885 43.037 1.00 31.72  ? 77  ASN D CA    1 
ATOM   4323 C  C     . ASN D 2 84  ? 1.878   13.701 42.084 1.00 30.35  ? 77  ASN D C     1 
ATOM   4324 O  O     . ASN D 2 84  ? 0.869   13.488 41.400 1.00 29.89  ? 77  ASN D O     1 
ATOM   4325 C  CB    . ASN D 2 84  ? 1.402   16.111 42.281 1.00 30.30  ? 77  ASN D CB    1 
ATOM   4326 C  CG    . ASN D 2 84  ? 1.401   17.351 43.130 1.00 32.87  ? 77  ASN D CG    1 
ATOM   4327 O  OD1   . ASN D 2 84  ? 1.988   18.364 42.763 1.00 33.64  ? 77  ASN D OD1   1 
ATOM   4328 N  ND2   . ASN D 2 84  ? 0.743   17.282 44.285 1.00 35.72  ? 77  ASN D ND2   1 
ATOM   4329 N  N     . ILE D 2 85  ? 2.992   12.973 41.996 1.00 31.88  ? 78  ILE D N     1 
ATOM   4330 C  CA    . ILE D 2 85  ? 3.142   11.832 41.100 1.00 31.11  ? 78  ILE D CA    1 
ATOM   4331 C  C     . ILE D 2 85  ? 3.910   10.721 41.823 1.00 34.16  ? 78  ILE D C     1 
ATOM   4332 O  O     . ILE D 2 85  ? 5.063   10.908 42.207 1.00 34.02  ? 78  ILE D O     1 
ATOM   4333 C  CB    . ILE D 2 85  ? 3.890   12.219 39.791 1.00 30.32  ? 78  ILE D CB    1 
ATOM   4334 C  CG1   . ILE D 2 85  ? 3.295   13.474 39.128 1.00 29.68  ? 78  ILE D CG1   1 
ATOM   4335 C  CG2   . ILE D 2 85  ? 3.838   11.077 38.787 1.00 29.92  ? 78  ILE D CG2   1 
ATOM   4336 C  CD1   . ILE D 2 85  ? 4.211   14.131 38.112 1.00 31.69  ? 78  ILE D CD1   1 
ATOM   4337 N  N     . ASN D 2 86  ? 3.296   9.551  41.980 1.00 35.58  ? 79  ASN D N     1 
ATOM   4338 C  CA    . ASN D 2 86  ? 3.916   8.477  42.767 1.00 39.47  ? 79  ASN D CA    1 
ATOM   4339 C  C     . ASN D 2 86  ? 4.645   7.435  41.914 1.00 38.86  ? 79  ASN D C     1 
ATOM   4340 O  O     . ASN D 2 86  ? 4.718   7.585  40.688 1.00 36.30  ? 79  ASN D O     1 
ATOM   4341 C  CB    . ASN D 2 86  ? 2.892   7.834  43.715 1.00 39.79  ? 79  ASN D CB    1 
ATOM   4342 C  CG    . ASN D 2 86  ? 1.746   7.145  42.998 1.00 38.92  ? 79  ASN D CG    1 
ATOM   4343 O  OD1   . ASN D 2 86  ? 1.833   6.759  41.834 1.00 35.72  ? 79  ASN D OD1   1 
ATOM   4344 N  ND2   . ASN D 2 86  ? 0.669   6.948  43.723 1.00 40.90  ? 79  ASN D ND2   1 
ATOM   4345 N  N     . SER D 2 87  ? 5.170   6.395  42.561 1.00 41.24  ? 80  SER D N     1 
ATOM   4346 C  CA    . SER D 2 87  ? 5.964   5.361  41.887 1.00 42.18  ? 80  SER D CA    1 
ATOM   4347 C  C     . SER D 2 87  ? 5.170   4.498  40.902 1.00 43.19  ? 80  SER D C     1 
ATOM   4348 O  O     . SER D 2 87  ? 5.752   3.860  40.033 1.00 41.55  ? 80  SER D O     1 
ATOM   4349 C  CB    . SER D 2 87  ? 6.677   4.471  42.912 1.00 46.44  ? 80  SER D CB    1 
ATOM   4350 O  OG    . SER D 2 87  ? 5.776   3.830  43.800 1.00 46.65  ? 80  SER D OG    1 
ATOM   4351 N  N     . ASN D 2 88  ? 3.848   4.494  41.012 1.00 44.11  ? 81  ASN D N     1 
ATOM   4352 C  CA    . ASN D 2 88  ? 3.007   3.862  39.996 1.00 43.79  ? 81  ASN D CA    1 
ATOM   4353 C  C     . ASN D 2 88  ? 2.708   4.786  38.811 1.00 40.20  ? 81  ASN D C     1 
ATOM   4354 O  O     . ASN D 2 88  ? 2.064   4.374  37.852 1.00 39.71  ? 81  ASN D O     1 
ATOM   4355 C  CB    . ASN D 2 88  ? 1.699   3.371  40.619 1.00 46.93  ? 81  ASN D CB    1 
ATOM   4356 C  CG    . ASN D 2 88  ? 1.911   2.215  41.580 1.00 56.44  ? 81  ASN D CG    1 
ATOM   4357 O  OD1   . ASN D 2 88  ? 2.850   1.430  41.436 1.00 59.01  ? 81  ASN D OD1   1 
ATOM   4358 N  ND2   . ASN D 2 88  ? 1.040   2.107  42.570 1.00 59.25  ? 81  ASN D ND2   1 
ATOM   4359 N  N     . GLY D 2 89  ? 3.160   6.034  38.883 1.00 37.53  ? 82  GLY D N     1 
ATOM   4360 C  CA    . GLY D 2 89  ? 2.882   7.006  37.847 1.00 31.97  ? 82  GLY D CA    1 
ATOM   4361 C  C     . GLY D 2 89  ? 1.513   7.642  37.984 1.00 31.27  ? 82  GLY D C     1 
ATOM   4362 O  O     . GLY D 2 89  ? 1.090   8.364  37.096 1.00 30.76  ? 82  GLY D O     1 
ATOM   4363 N  N     . SER D 2 90  ? 0.819   7.402  39.094 1.00 30.77  ? 83  SER D N     1 
ATOM   4364 C  CA    . SER D 2 90  ? -0.464  8.054  39.310 1.00 31.80  ? 83  SER D CA    1 
ATOM   4365 C  C     . SER D 2 90  ? -0.288  9.579  39.486 1.00 28.47  ? 83  SER D C     1 
ATOM   4366 O  O     . SER D 2 90  ? 0.644   10.018 40.120 1.00 28.24  ? 83  SER D O     1 
ATOM   4367 C  CB    . SER D 2 90  ? -1.176  7.461  40.507 1.00 34.44  ? 83  SER D CB    1 
ATOM   4368 O  OG    . SER D 2 90  ? -1.454  6.082  40.282 1.00 39.44  ? 83  SER D OG    1 
ATOM   4369 N  N     . ILE D 2 91  ? -1.199  10.362 38.930 1.00 28.82  ? 84  ILE D N     1 
ATOM   4370 C  CA    . ILE D 2 91  ? -1.079  11.830 38.921 1.00 29.04  ? 84  ILE D CA    1 
ATOM   4371 C  C     . ILE D 2 91  ? -2.171  12.455 39.771 1.00 31.76  ? 84  ILE D C     1 
ATOM   4372 O  O     . ILE D 2 91  ? -3.364  12.253 39.511 1.00 34.30  ? 84  ILE D O     1 
ATOM   4373 C  CB    . ILE D 2 91  ? -1.205  12.412 37.509 1.00 28.31  ? 84  ILE D CB    1 
ATOM   4374 C  CG1   . ILE D 2 91  ? -0.216  11.758 36.561 1.00 30.48  ? 84  ILE D CG1   1 
ATOM   4375 C  CG2   . ILE D 2 91  ? -1.019  13.933 37.523 1.00 29.05  ? 84  ILE D CG2   1 
ATOM   4376 C  CD1   . ILE D 2 91  ? -0.485  12.074 35.107 1.00 29.83  ? 84  ILE D CD1   1 
ATOM   4377 N  N     . CYS D 2 92  ? -1.763  13.224 40.773 1.00 32.48  ? 85  CYS D N     1 
ATOM   4378 C  CA    . CYS D 2 92  ? -2.684  13.893 41.662 1.00 35.48  ? 85  CYS D CA    1 
ATOM   4379 C  C     . CYS D 2 92  ? -2.976  15.274 41.108 1.00 33.55  ? 85  CYS D C     1 
ATOM   4380 O  O     . CYS D 2 92  ? -2.199  16.194 41.321 1.00 34.33  ? 85  CYS D O     1 
ATOM   4381 C  CB    . CYS D 2 92  ? -2.060  13.993 43.039 1.00 41.05  ? 85  CYS D CB    1 
ATOM   4382 S  SG    . CYS D 2 92  ? -3.252  14.288 44.343 1.00 43.24  ? 85  CYS D SG    1 
ATOM   4383 N  N     . LEU D 2 93  ? -4.098  15.387 40.398 1.00 31.61  ? 86  LEU D N     1 
ATOM   4384 C  CA    . LEU D 2 93  ? -4.524  16.606 39.682 1.00 32.45  ? 86  LEU D CA    1 
ATOM   4385 C  C     . LEU D 2 93  ? -6.046  16.695 39.728 1.00 31.22  ? 86  LEU D C     1 
ATOM   4386 O  O     . LEU D 2 93  ? -6.733  15.736 39.353 1.00 31.66  ? 86  LEU D O     1 
ATOM   4387 C  CB    . LEU D 2 93  ? -4.102  16.537 38.206 1.00 32.04  ? 86  LEU D CB    1 
ATOM   4388 C  CG    . LEU D 2 93  ? -3.538  17.765 37.487 1.00 35.64  ? 86  LEU D CG    1 
ATOM   4389 C  CD1   . LEU D 2 93  ? -3.664  17.601 35.982 1.00 34.93  ? 86  LEU D CD1   1 
ATOM   4390 C  CD2   . LEU D 2 93  ? -4.094  19.095 37.960 1.00 35.90  ? 86  LEU D CD2   1 
ATOM   4391 N  N     . ASP D 2 94  ? -6.581  17.831 40.165 1.00 30.83  ? 87  ASP D N     1 
ATOM   4392 C  CA    . ASP D 2 94  ? -8.029  17.936 40.382 1.00 32.55  ? 87  ASP D CA    1 
ATOM   4393 C  C     . ASP D 2 94  ? -8.867  17.734 39.111 1.00 31.00  ? 87  ASP D C     1 
ATOM   4394 O  O     . ASP D 2 94  ? -9.973  17.183 39.172 1.00 30.92  ? 87  ASP D O     1 
ATOM   4395 C  CB    . ASP D 2 94  ? -8.409  19.232 41.109 1.00 34.96  ? 87  ASP D CB    1 
ATOM   4396 C  CG    . ASP D 2 94  ? -8.075  20.499 40.328 1.00 36.45  ? 87  ASP D CG    1 
ATOM   4397 O  OD1   . ASP D 2 94  ? -7.387  20.454 39.291 1.00 39.18  ? 87  ASP D OD1   1 
ATOM   4398 O  OD2   . ASP D 2 94  ? -8.507  21.571 40.794 1.00 42.08  ? 87  ASP D OD2   1 
ATOM   4399 N  N     . ILE D 2 95  ? -8.335  18.131 37.961 1.00 29.64  ? 88  ILE D N     1 
ATOM   4400 C  CA    . ILE D 2 95  ? -9.078  17.957 36.707 1.00 28.95  ? 88  ILE D CA    1 
ATOM   4401 C  C     . ILE D 2 95  ? -9.017  16.507 36.193 1.00 27.62  ? 88  ILE D C     1 
ATOM   4402 O  O     . ILE D 2 95  ? -9.703  16.163 35.240 1.00 28.49  ? 88  ILE D O     1 
ATOM   4403 C  CB    . ILE D 2 95  ? -8.673  18.984 35.638 1.00 28.54  ? 88  ILE D CB    1 
ATOM   4404 C  CG1   . ILE D 2 95  ? -7.177  18.881 35.286 1.00 29.50  ? 88  ILE D CG1   1 
ATOM   4405 C  CG2   . ILE D 2 95  ? -8.983  20.394 36.104 1.00 30.55  ? 88  ILE D CG2   1 
ATOM   4406 C  CD1   . ILE D 2 95  ? -6.859  19.512 33.950 1.00 30.23  ? 88  ILE D CD1   1 
ATOM   4407 N  N     . LEU D 2 96  ? -8.242  15.641 36.843 1.00 28.11  ? 89  LEU D N     1 
ATOM   4408 C  CA    . LEU D 2 96  ? -8.310  14.199 36.552 1.00 27.86  ? 89  LEU D CA    1 
ATOM   4409 C  C     . LEU D 2 96  ? -9.215  13.429 37.485 1.00 29.68  ? 89  LEU D C     1 
ATOM   4410 O  O     . LEU D 2 96  ? -9.390  12.213 37.329 1.00 31.36  ? 89  LEU D O     1 
ATOM   4411 C  CB    . LEU D 2 96  ? -6.923  13.566 36.493 1.00 27.81  ? 89  LEU D CB    1 
ATOM   4412 C  CG    . LEU D 2 96  ? -6.135  14.001 35.249 1.00 27.55  ? 89  LEU D CG    1 
ATOM   4413 C  CD1   . LEU D 2 96  ? -4.707  13.532 35.361 1.00 27.85  ? 89  LEU D CD1   1 
ATOM   4414 C  CD2   . LEU D 2 96  ? -6.766  13.493 33.965 1.00 26.50  ? 89  LEU D CD2   1 
ATOM   4415 N  N     . ARG D 2 97  ? -9.806  14.126 38.437 1.00 32.53  ? 90  ARG D N     1 
ATOM   4416 C  CA    . ARG D 2 97  ? -10.790 13.531 39.329 1.00 36.24  ? 90  ARG D CA    1 
ATOM   4417 C  C     . ARG D 2 97  ? -12.041 14.393 39.224 1.00 37.61  ? 90  ARG D C     1 
ATOM   4418 O  O     . ARG D 2 97  ? -12.503 14.611 38.105 1.00 36.96  ? 90  ARG D O     1 
ATOM   4419 C  CB    . ARG D 2 97  ? -10.235 13.350 40.749 1.00 37.99  ? 90  ARG D CB    1 
ATOM   4420 C  CG    . ARG D 2 97  ? -9.324  14.455 41.224 1.00 36.88  ? 90  ARG D CG    1 
ATOM   4421 C  CD    . ARG D 2 97  ? -8.908  14.274 42.673 1.00 36.82  ? 90  ARG D CD    1 
ATOM   4422 N  NE    . ARG D 2 97  ? -8.704  15.589 43.254 1.00 37.16  ? 90  ARG D NE    1 
ATOM   4423 C  CZ    . ARG D 2 97  ? -7.535  16.166 43.500 1.00 36.86  ? 90  ARG D CZ    1 
ATOM   4424 N  NH1   . ARG D 2 97  ? -6.386  15.542 43.253 1.00 36.85  ? 90  ARG D NH1   1 
ATOM   4425 N  NH2   . ARG D 2 97  ? -7.524  17.386 44.026 1.00 39.50  ? 90  ARG D NH2   1 
ATOM   4426 N  N     . SER D 2 98  ? -12.557 14.923 40.329 1.00 38.27  ? 91  SER D N     1 
ATOM   4427 C  CA    . SER D 2 98  ? -13.902 15.500 40.335 1.00 40.83  ? 91  SER D CA    1 
ATOM   4428 C  C     . SER D 2 98  ? -14.069 16.873 39.701 1.00 39.20  ? 91  SER D C     1 
ATOM   4429 O  O     . SER D 2 98  ? -15.203 17.284 39.472 1.00 37.77  ? 91  SER D O     1 
ATOM   4430 C  CB    . SER D 2 98  ? -14.445 15.522 41.747 1.00 44.15  ? 91  SER D CB    1 
ATOM   4431 O  OG    . SER D 2 98  ? -14.452 14.189 42.228 1.00 52.81  ? 91  SER D OG    1 
ATOM   4432 N  N     . GLN D 2 99  ? -12.965 17.564 39.410 1.00 37.54  ? 92  GLN D N     1 
ATOM   4433 C  CA    . GLN D 2 99  ? -13.026 18.842 38.690 1.00 35.89  ? 92  GLN D CA    1 
ATOM   4434 C  C     . GLN D 2 99  ? -12.863 18.670 37.179 1.00 34.49  ? 92  GLN D C     1 
ATOM   4435 O  O     . GLN D 2 99  ? -12.722 19.651 36.465 1.00 34.25  ? 92  GLN D O     1 
ATOM   4436 C  CB    . GLN D 2 99  ? -11.984 19.814 39.241 1.00 35.87  ? 92  GLN D CB    1 
ATOM   4437 C  CG    . GLN D 2 99  ? -12.089 19.967 40.752 1.00 39.65  ? 92  GLN D CG    1 
ATOM   4438 C  CD    . GLN D 2 99  ? -13.515 20.217 41.207 1.00 44.48  ? 92  GLN D CD    1 
ATOM   4439 O  OE1   . GLN D 2 99  ? -14.113 21.224 40.838 1.00 43.69  ? 92  GLN D OE1   1 
ATOM   4440 N  NE2   . GLN D 2 99  ? -14.070 19.298 42.026 1.00 47.59  ? 92  GLN D NE2   1 
ATOM   4441 N  N     . TRP D 2 100 ? -12.890 17.427 36.695 1.00 31.26  ? 93  TRP D N     1 
ATOM   4442 C  CA    . TRP D 2 100 ? -13.034 17.185 35.272 1.00 30.35  ? 93  TRP D CA    1 
ATOM   4443 C  C     . TRP D 2 100 ? -14.273 17.855 34.728 1.00 30.78  ? 93  TRP D C     1 
ATOM   4444 O  O     . TRP D 2 100 ? -15.306 17.941 35.400 1.00 32.45  ? 93  TRP D O     1 
ATOM   4445 C  CB    . TRP D 2 100 ? -13.093 15.683 34.941 1.00 30.04  ? 93  TRP D CB    1 
ATOM   4446 C  CG    . TRP D 2 100 ? -13.414 15.423 33.494 1.00 27.88  ? 93  TRP D CG    1 
ATOM   4447 C  CD1   . TRP D 2 100 ? -14.607 14.987 32.989 1.00 29.12  ? 93  TRP D CD1   1 
ATOM   4448 C  CD2   . TRP D 2 100 ? -12.554 15.612 32.374 1.00 27.06  ? 93  TRP D CD2   1 
ATOM   4449 N  NE1   . TRP D 2 100 ? -14.532 14.878 31.627 1.00 29.08  ? 93  TRP D NE1   1 
ATOM   4450 C  CE2   . TRP D 2 100 ? -13.284 15.256 31.220 1.00 27.64  ? 93  TRP D CE2   1 
ATOM   4451 C  CE3   . TRP D 2 100 ? -11.233 16.043 32.226 1.00 25.21  ? 93  TRP D CE3   1 
ATOM   4452 C  CZ2   . TRP D 2 100 ? -12.740 15.331 29.940 1.00 26.58  ? 93  TRP D CZ2   1 
ATOM   4453 C  CZ3   . TRP D 2 100 ? -10.691 16.096 30.976 1.00 26.35  ? 93  TRP D CZ3   1 
ATOM   4454 C  CH2   . TRP D 2 100 ? -11.449 15.758 29.833 1.00 25.44  ? 93  TRP D CH2   1 
ATOM   4455 N  N     . SER D 2 101 ? -14.158 18.331 33.493 1.00 29.91  ? 94  SER D N     1 
ATOM   4456 C  CA    . SER D 2 101 ? -15.273 18.921 32.778 1.00 32.31  ? 94  SER D CA    1 
ATOM   4457 C  C     . SER D 2 101 ? -15.175 18.467 31.336 1.00 29.04  ? 94  SER D C     1 
ATOM   4458 O  O     . SER D 2 101 ? -14.083 18.436 30.801 1.00 27.33  ? 94  SER D O     1 
ATOM   4459 C  CB    . SER D 2 101 ? -15.151 20.440 32.839 1.00 35.03  ? 94  SER D CB    1 
ATOM   4460 O  OG    . SER D 2 101 ? -16.054 21.045 31.949 1.00 38.45  ? 94  SER D OG    1 
ATOM   4461 N  N     . PRO D 2 102 ? -16.313 18.138 30.691 1.00 29.20  ? 95  PRO D N     1 
ATOM   4462 C  CA    . PRO D 2 102 ? -16.222 17.821 29.270 1.00 28.34  ? 95  PRO D CA    1 
ATOM   4463 C  C     . PRO D 2 102 ? -15.730 18.986 28.395 1.00 27.45  ? 95  PRO D C     1 
ATOM   4464 O  O     . PRO D 2 102 ? -15.332 18.752 27.265 1.00 25.54  ? 95  PRO D O     1 
ATOM   4465 C  CB    . PRO D 2 102 ? -17.643 17.385 28.898 1.00 29.34  ? 95  PRO D CB    1 
ATOM   4466 C  CG    . PRO D 2 102 ? -18.502 17.814 29.999 1.00 33.20  ? 95  PRO D CG    1 
ATOM   4467 C  CD    . PRO D 2 102 ? -17.665 17.935 31.228 1.00 31.65  ? 95  PRO D CD    1 
ATOM   4468 N  N     . ALA D 2 103 ? -15.761 20.219 28.904 1.00 28.27  ? 96  ALA D N     1 
ATOM   4469 C  CA    . ALA D 2 103 ? -15.165 21.351 28.203 1.00 29.42  ? 96  ALA D CA    1 
ATOM   4470 C  C     . ALA D 2 103 ? -13.646 21.285 28.118 1.00 29.85  ? 96  ALA D C     1 
ATOM   4471 O  O     . ALA D 2 103 ? -13.041 21.989 27.300 1.00 30.57  ? 96  ALA D O     1 
ATOM   4472 C  CB    . ALA D 2 103 ? -15.578 22.664 28.864 1.00 31.80  ? 96  ALA D CB    1 
ATOM   4473 N  N     . LEU D 2 104 ? -13.025 20.473 28.967 1.00 28.92  ? 97  LEU D N     1 
ATOM   4474 C  CA    . LEU D 2 104 ? -11.590 20.232 28.870 1.00 30.31  ? 97  LEU D CA    1 
ATOM   4475 C  C     . LEU D 2 104 ? -11.256 19.140 27.845 1.00 30.70  ? 97  LEU D C     1 
ATOM   4476 O  O     . LEU D 2 104 ? -12.093 18.312 27.480 1.00 30.43  ? 97  LEU D O     1 
ATOM   4477 C  CB    . LEU D 2 104 ? -11.014 19.839 30.227 1.00 30.67  ? 97  LEU D CB    1 
ATOM   4478 C  CG    . LEU D 2 104 ? -11.173 20.891 31.321 1.00 32.89  ? 97  LEU D CG    1 
ATOM   4479 C  CD1   . LEU D 2 104 ? -10.790 20.304 32.676 1.00 35.24  ? 97  LEU D CD1   1 
ATOM   4480 C  CD2   . LEU D 2 104 ? -10.347 22.132 31.015 1.00 35.22  ? 97  LEU D CD2   1 
ATOM   4481 N  N     . THR D 2 105 ? -10.007 19.165 27.419 1.00 30.46  ? 98  THR D N     1 
ATOM   4482 C  CA    . THR D 2 105 ? -9.422  18.201 26.481 1.00 30.82  ? 98  THR D CA    1 
ATOM   4483 C  C     . THR D 2 105 ? -8.142  17.599 27.059 1.00 30.82  ? 98  THR D C     1 
ATOM   4484 O  O     . THR D 2 105 ? -7.550  18.151 27.999 1.00 28.41  ? 98  THR D O     1 
ATOM   4485 C  CB    . THR D 2 105 ? -9.061  18.911 25.164 1.00 28.99  ? 98  THR D CB    1 
ATOM   4486 O  OG1   . THR D 2 105 ? -8.116  19.951 25.421 1.00 27.44  ? 98  THR D OG1   1 
ATOM   4487 C  CG2   . THR D 2 105 ? -10.289 19.551 24.528 1.00 33.10  ? 98  THR D CG2   1 
ATOM   4488 N  N     . VAL D 2 106 ? -7.719  16.462 26.502 1.00 28.34  ? 99  VAL D N     1 
ATOM   4489 C  CA    . VAL D 2 106 ? -6.401  15.895 26.805 1.00 26.36  ? 99  VAL D CA    1 
ATOM   4490 C  C     . VAL D 2 106 ? -5.268  16.935 26.621 1.00 27.08  ? 99  VAL D C     1 
ATOM   4491 O  O     . VAL D 2 106 ? -4.365  17.037 27.451 1.00 28.08  ? 99  VAL D O     1 
ATOM   4492 C  CB    . VAL D 2 106 ? -6.152  14.626 25.996 1.00 26.64  ? 99  VAL D CB    1 
ATOM   4493 C  CG1   . VAL D 2 106 ? -4.734  14.091 26.202 1.00 28.31  ? 99  VAL D CG1   1 
ATOM   4494 C  CG2   . VAL D 2 106 ? -7.168  13.565 26.376 1.00 28.23  ? 99  VAL D CG2   1 
ATOM   4495 N  N     . SER D 2 107 ? -5.342  17.721 25.559 1.00 25.36  ? 100 SER D N     1 
ATOM   4496 C  CA    . SER D 2 107 ? -4.393  18.799 25.334 1.00 28.27  ? 100 SER D CA    1 
ATOM   4497 C  C     . SER D 2 107 ? -4.316  19.716 26.555 1.00 26.40  ? 100 SER D C     1 
ATOM   4498 O  O     . SER D 2 107 ? -3.238  19.964 27.057 1.00 24.73  ? 100 SER D O     1 
ATOM   4499 C  CB    . SER D 2 107 ? -4.772  19.581 24.082 1.00 29.56  ? 100 SER D CB    1 
ATOM   4500 O  OG    . SER D 2 107 ? -3.910  20.672 23.903 1.00 33.43  ? 100 SER D OG    1 
ATOM   4501 N  N     . LYS D 2 108 ? -5.458  20.163 27.056 1.00 26.48  ? 101 LYS D N     1 
ATOM   4502 C  CA    . LYS D 2 108 ? -5.497  21.016 28.245 1.00 30.48  ? 101 LYS D CA    1 
ATOM   4503 C  C     . LYS D 2 108 ? -4.956  20.310 29.467 1.00 26.40  ? 101 LYS D C     1 
ATOM   4504 O  O     . LYS D 2 108 ? -4.277  20.921 30.285 1.00 26.58  ? 101 LYS D O     1 
ATOM   4505 C  CB    . LYS D 2 108 ? -6.921  21.513 28.531 1.00 34.32  ? 101 LYS D CB    1 
ATOM   4506 C  CG    . LYS D 2 108 ? -7.561  22.320 27.412 1.00 39.07  ? 101 LYS D CG    1 
ATOM   4507 C  CD    . LYS D 2 108 ? -7.475  23.816 27.616 1.00 51.92  ? 101 LYS D CD    1 
ATOM   4508 C  CE    . LYS D 2 108 ? -8.482  24.533 26.733 1.00 56.26  ? 101 LYS D CE    1 
ATOM   4509 N  NZ    . LYS D 2 108 ? -9.881  24.105 27.021 1.00 64.77  ? 101 LYS D NZ    1 
ATOM   4510 N  N     . VAL D 2 109 ? -5.224  19.008 29.598 1.00 24.53  ? 102 VAL D N     1 
ATOM   4511 C  CA    . VAL D 2 109 ? -4.694  18.254 30.713 1.00 23.96  ? 102 VAL D CA    1 
ATOM   4512 C  C     . VAL D 2 109 ? -3.174  18.174 30.635 1.00 24.62  ? 102 VAL D C     1 
ATOM   4513 O  O     . VAL D 2 109 ? -2.519  18.294 31.646 1.00 26.07  ? 102 VAL D O     1 
ATOM   4514 C  CB    . VAL D 2 109 ? -5.301  16.830 30.809 1.00 24.95  ? 102 VAL D CB    1 
ATOM   4515 C  CG1   . VAL D 2 109 ? -4.645  16.025 31.931 1.00 27.96  ? 102 VAL D CG1   1 
ATOM   4516 C  CG2   . VAL D 2 109 ? -6.795  16.913 31.040 1.00 27.44  ? 102 VAL D CG2   1 
ATOM   4517 N  N     . LEU D 2 110 ? -2.629  17.950 29.440 1.00 23.84  ? 103 LEU D N     1 
ATOM   4518 C  CA    . LEU D 2 110 ? -1.170  17.933 29.241 1.00 26.00  ? 103 LEU D CA    1 
ATOM   4519 C  C     . LEU D 2 110 ? -0.529  19.270 29.595 1.00 26.46  ? 103 LEU D C     1 
ATOM   4520 O  O     . LEU D 2 110 ? 0.502   19.296 30.256 1.00 24.53  ? 103 LEU D O     1 
ATOM   4521 C  CB    . LEU D 2 110 ? -0.818  17.542 27.800 1.00 25.74  ? 103 LEU D CB    1 
ATOM   4522 C  CG    . LEU D 2 110 ? -1.127  16.072 27.438 1.00 27.93  ? 103 LEU D CG    1 
ATOM   4523 C  CD1   . LEU D 2 110 ? -0.977  15.898 25.941 1.00 30.38  ? 103 LEU D CD1   1 
ATOM   4524 C  CD2   . LEU D 2 110 ? -0.230  15.082 28.160 1.00 32.07  ? 103 LEU D CD2   1 
ATOM   4525 N  N     . LEU D 2 111 ? -1.158  20.374 29.198 1.00 27.11  ? 104 LEU D N     1 
ATOM   4526 C  CA    . LEU D 2 111 ? -0.700  21.723 29.612 1.00 30.39  ? 104 LEU D CA    1 
ATOM   4527 C  C     . LEU D 2 111 ? -0.691  21.905 31.130 1.00 30.50  ? 104 LEU D C     1 
ATOM   4528 O  O     . LEU D 2 111 ? 0.238   22.485 31.694 1.00 29.61  ? 104 LEU D O     1 
ATOM   4529 C  CB    . LEU D 2 111 ? -1.578  22.810 29.006 1.00 33.20  ? 104 LEU D CB    1 
ATOM   4530 C  CG    . LEU D 2 111 ? -1.391  23.087 27.522 1.00 40.91  ? 104 LEU D CG    1 
ATOM   4531 C  CD1   . LEU D 2 111 ? -2.578  23.856 26.960 1.00 43.75  ? 104 LEU D CD1   1 
ATOM   4532 C  CD2   . LEU D 2 111 ? -0.102  23.862 27.296 1.00 45.07  ? 104 LEU D CD2   1 
ATOM   4533 N  N     . SER D 2 112 ? -1.730  21.395 31.780 1.00 30.60  ? 105 SER D N     1 
ATOM   4534 C  CA    . SER D 2 112 ? -1.863  21.502 33.212 1.00 30.25  ? 105 SER D CA    1 
ATOM   4535 C  C     . SER D 2 112 ? -0.817  20.620 33.932 1.00 29.37  ? 105 SER D C     1 
ATOM   4536 O  O     . SER D 2 112 ? -0.270  21.008 34.965 1.00 27.40  ? 105 SER D O     1 
ATOM   4537 C  CB    . SER D 2 112 ? -3.304  21.160 33.615 1.00 30.20  ? 105 SER D CB    1 
ATOM   4538 O  OG    . SER D 2 112 ? -3.422  21.100 35.022 1.00 36.52  ? 105 SER D OG    1 
ATOM   4539 N  N     . ILE D 2 113 ? -0.508  19.455 33.364 1.00 25.97  ? 106 ILE D N     1 
ATOM   4540 C  CA    . ILE D 2 113 ? 0.570   18.618 33.878 1.00 27.05  ? 106 ILE D CA    1 
ATOM   4541 C  C     . ILE D 2 113 ? 1.940   19.305 33.748 1.00 27.30  ? 106 ILE D C     1 
ATOM   4542 O  O     . ILE D 2 113 ? 2.755   19.248 34.676 1.00 27.32  ? 106 ILE D O     1 
ATOM   4543 C  CB    . ILE D 2 113 ? 0.580   17.229 33.210 1.00 23.98  ? 106 ILE D CB    1 
ATOM   4544 C  CG1   . ILE D 2 113 ? -0.637  16.415 33.646 1.00 25.63  ? 106 ILE D CG1   1 
ATOM   4545 C  CG2   . ILE D 2 113 ? 1.857   16.474 33.554 1.00 25.98  ? 106 ILE D CG2   1 
ATOM   4546 C  CD1   . ILE D 2 113 ? -0.911  15.184 32.812 1.00 21.14  ? 106 ILE D CD1   1 
ATOM   4547 N  N     . CYS D 2 114 ? 2.181   19.976 32.623 1.00 27.98  ? 107 CYS D N     1 
ATOM   4548 C  CA    . CYS D 2 114 ? 3.417   20.754 32.428 1.00 30.15  ? 107 CYS D CA    1 
ATOM   4549 C  C     . CYS D 2 114 ? 3.522   21.857 33.455 1.00 29.54  ? 107 CYS D C     1 
ATOM   4550 O  O     . CYS D 2 114 ? 4.597   22.142 33.980 1.00 29.06  ? 107 CYS D O     1 
ATOM   4551 C  CB    . CYS D 2 114 ? 3.514   21.339 31.011 1.00 31.80  ? 107 CYS D CB    1 
ATOM   4552 S  SG    . CYS D 2 114 ? 3.794   20.071 29.737 1.00 35.83  ? 107 CYS D SG    1 
ATOM   4553 N  N     . SER D 2 115 ? 2.391   22.461 33.773 1.00 30.97  ? 108 SER D N     1 
ATOM   4554 C  CA    . SER D 2 115 ? 2.366   23.492 34.781 1.00 32.44  ? 108 SER D CA    1 
ATOM   4555 C  C     . SER D 2 115 ? 2.663   22.929 36.178 1.00 31.84  ? 108 SER D C     1 
ATOM   4556 O  O     . SER D 2 115 ? 3.347   23.563 36.973 1.00 33.55  ? 108 SER D O     1 
ATOM   4557 C  CB    . SER D 2 115 ? 1.028   24.242 34.741 1.00 33.85  ? 108 SER D CB    1 
ATOM   4558 O  OG    . SER D 2 115 ? 0.892   25.011 35.903 1.00 39.66  ? 108 SER D OG    1 
ATOM   4559 N  N     . LEU D 2 116 ? 2.189   21.717 36.447 1.00 32.00  ? 109 LEU D N     1 
ATOM   4560 C  CA    . LEU D 2 116 ? 2.433   21.045 37.717 1.00 31.44  ? 109 LEU D CA    1 
ATOM   4561 C  C     . LEU D 2 116 ? 3.906   20.672 37.861 1.00 30.30  ? 109 LEU D C     1 
ATOM   4562 O  O     . LEU D 2 116 ? 4.476   20.728 38.949 1.00 30.01  ? 109 LEU D O     1 
ATOM   4563 C  CB    . LEU D 2 116 ? 1.564   19.788 37.791 1.00 33.71  ? 109 LEU D CB    1 
ATOM   4564 C  CG    . LEU D 2 116 ? 1.181   19.177 39.125 1.00 36.08  ? 109 LEU D CG    1 
ATOM   4565 C  CD1   . LEU D 2 116 ? 0.368   20.158 39.945 1.00 37.79  ? 109 LEU D CD1   1 
ATOM   4566 C  CD2   . LEU D 2 116 ? 0.410   17.876 38.883 1.00 35.65  ? 109 LEU D CD2   1 
ATOM   4567 N  N     . LEU D 2 117 ? 4.526   20.259 36.760 1.00 28.97  ? 110 LEU D N     1 
ATOM   4568 C  CA    . LEU D 2 117 ? 5.961   20.008 36.757 1.00 30.42  ? 110 LEU D CA    1 
ATOM   4569 C  C     . LEU D 2 117 ? 6.751   21.282 37.080 1.00 31.19  ? 110 LEU D C     1 
ATOM   4570 O  O     . LEU D 2 117 ? 7.747   21.236 37.793 1.00 32.03  ? 110 LEU D O     1 
ATOM   4571 C  CB    . LEU D 2 117 ? 6.402   19.455 35.411 1.00 31.31  ? 110 LEU D CB    1 
ATOM   4572 C  CG    . LEU D 2 117 ? 6.469   17.948 35.170 1.00 32.34  ? 110 LEU D CG    1 
ATOM   4573 C  CD1   . LEU D 2 117 ? 5.532   17.103 35.995 1.00 34.41  ? 110 LEU D CD1   1 
ATOM   4574 C  CD2   . LEU D 2 117 ? 6.243   17.730 33.692 1.00 32.48  ? 110 LEU D CD2   1 
ATOM   4575 N  N     . CYS D 2 118 ? 6.300   22.415 36.558 1.00 32.45  ? 111 CYS D N     1 
ATOM   4576 C  CA    . CYS D 2 118 ? 6.929   23.709 36.846 1.00 34.87  ? 111 CYS D CA    1 
ATOM   4577 C  C     . CYS D 2 118 ? 6.668   24.210 38.278 1.00 37.25  ? 111 CYS D C     1 
ATOM   4578 O  O     . CYS D 2 118 ? 7.549   24.781 38.916 1.00 38.05  ? 111 CYS D O     1 
ATOM   4579 C  CB    . CYS D 2 118 ? 6.414   24.760 35.868 1.00 37.75  ? 111 CYS D CB    1 
ATOM   4580 S  SG    . CYS D 2 118 ? 7.038   24.625 34.176 1.00 42.50  ? 111 CYS D SG    1 
ATOM   4581 N  N     . ASP D 2 119 ? 5.447   23.993 38.774 1.00 38.84  ? 112 ASP D N     1 
ATOM   4582 C  CA    . ASP D 2 119 ? 5.023   24.534 40.065 1.00 40.91  ? 112 ASP D CA    1 
ATOM   4583 C  C     . ASP D 2 119 ? 4.216   23.448 40.758 1.00 40.37  ? 112 ASP D C     1 
ATOM   4584 O  O     . ASP D 2 119 ? 2.997   23.370 40.578 1.00 38.34  ? 112 ASP D O     1 
ATOM   4585 C  CB    . ASP D 2 119 ? 4.207   25.805 39.855 1.00 43.36  ? 112 ASP D CB    1 
ATOM   4586 C  CG    . ASP D 2 119 ? 5.091   27.027 39.570 1.00 47.65  ? 112 ASP D CG    1 
ATOM   4587 O  OD1   . ASP D 2 119 ? 5.755   27.514 40.507 1.00 50.42  ? 112 ASP D OD1   1 
ATOM   4588 O  OD2   . ASP D 2 119 ? 5.131   27.504 38.414 1.00 48.92  ? 112 ASP D OD2   1 
ATOM   4589 N  N     . PRO D 2 120 ? 4.907   22.564 41.504 1.00 40.73  ? 113 PRO D N     1 
ATOM   4590 C  CA    . PRO D 2 120 ? 4.217   21.461 42.171 1.00 41.09  ? 113 PRO D CA    1 
ATOM   4591 C  C     . PRO D 2 120 ? 3.224   21.941 43.219 1.00 42.58  ? 113 PRO D C     1 
ATOM   4592 O  O     . PRO D 2 120 ? 3.332   23.058 43.702 1.00 44.76  ? 113 PRO D O     1 
ATOM   4593 C  CB    . PRO D 2 120 ? 5.362   20.652 42.803 1.00 41.35  ? 113 PRO D CB    1 
ATOM   4594 C  CG    . PRO D 2 120 ? 6.564   20.987 41.988 1.00 39.95  ? 113 PRO D CG    1 
ATOM   4595 C  CD    . PRO D 2 120 ? 6.374   22.429 41.602 1.00 39.61  ? 113 PRO D CD    1 
ATOM   4596 N  N     . ASN D 2 121 ? 2.247   21.097 43.533 1.00 45.32  ? 114 ASN D N     1 
ATOM   4597 C  CA    . ASN D 2 121 ? 1.191   21.438 44.480 1.00 47.89  ? 114 ASN D CA    1 
ATOM   4598 C  C     . ASN D 2 121 ? 1.352   20.686 45.816 1.00 47.96  ? 114 ASN D C     1 
ATOM   4599 O  O     . ASN D 2 121 ? 0.782   19.614 46.006 1.00 46.11  ? 114 ASN D O     1 
ATOM   4600 C  CB    . ASN D 2 121 ? -0.166  21.135 43.840 1.00 50.06  ? 114 ASN D CB    1 
ATOM   4601 C  CG    . ASN D 2 121 ? -1.320  21.661 44.656 1.00 55.94  ? 114 ASN D CG    1 
ATOM   4602 O  OD1   . ASN D 2 121 ? -1.136  22.458 45.577 1.00 68.14  ? 114 ASN D OD1   1 
ATOM   4603 N  ND2   . ASN D 2 121 ? -2.524  21.220 44.323 1.00 63.43  ? 114 ASN D ND2   1 
ATOM   4604 N  N     . PRO D 2 122 ? 2.120   21.253 46.757 1.00 52.85  ? 115 PRO D N     1 
ATOM   4605 C  CA    . PRO D 2 122 ? 2.453   20.504 47.973 1.00 55.41  ? 115 PRO D CA    1 
ATOM   4606 C  C     . PRO D 2 122 ? 1.256   20.262 48.918 1.00 57.09  ? 115 PRO D C     1 
ATOM   4607 O  O     . PRO D 2 122 ? 1.309   19.348 49.748 1.00 53.64  ? 115 PRO D O     1 
ATOM   4608 C  CB    . PRO D 2 122 ? 3.494   21.396 48.638 1.00 57.82  ? 115 PRO D CB    1 
ATOM   4609 C  CG    . PRO D 2 122 ? 3.040   22.771 48.282 1.00 59.26  ? 115 PRO D CG    1 
ATOM   4610 C  CD    . PRO D 2 122 ? 2.504   22.670 46.877 1.00 55.92  ? 115 PRO D CD    1 
ATOM   4611 N  N     . ASP D 2 123 ? 0.190   21.051 48.777 1.00 58.45  ? 116 ASP D N     1 
ATOM   4612 C  CA    . ASP D 2 123 ? -1.018  20.877 49.585 1.00 60.81  ? 116 ASP D CA    1 
ATOM   4613 C  C     . ASP D 2 123 ? -1.948  19.765 49.067 1.00 55.47  ? 116 ASP D C     1 
ATOM   4614 O  O     . ASP D 2 123 ? -3.029  19.572 49.609 1.00 57.21  ? 116 ASP D O     1 
ATOM   4615 C  CB    . ASP D 2 123 ? -1.785  22.200 49.673 1.00 66.91  ? 116 ASP D CB    1 
ATOM   4616 C  CG    . ASP D 2 123 ? -0.990  23.303 50.371 1.00 79.83  ? 116 ASP D CG    1 
ATOM   4617 O  OD1   . ASP D 2 123 ? -0.044  23.001 51.144 1.00 81.91  ? 116 ASP D OD1   1 
ATOM   4618 O  OD2   . ASP D 2 123 ? -1.326  24.487 50.148 1.00 93.45  ? 116 ASP D OD2   1 
ATOM   4619 N  N     . ASP D 2 124 ? -1.527  19.023 48.045 1.00 50.89  ? 117 ASP D N     1 
ATOM   4620 C  CA    . ASP D 2 124 ? -2.277  17.858 47.545 1.00 49.49  ? 117 ASP D CA    1 
ATOM   4621 C  C     . ASP D 2 124 ? -1.294  16.670 47.485 1.00 48.75  ? 117 ASP D C     1 
ATOM   4622 O  O     . ASP D 2 124 ? -1.076  16.086 46.429 1.00 47.37  ? 117 ASP D O     1 
ATOM   4623 C  CB    . ASP D 2 124 ? -2.894  18.196 46.176 1.00 48.91  ? 117 ASP D CB    1 
ATOM   4624 C  CG    . ASP D 2 124 ? -4.046  17.252 45.763 1.00 46.82  ? 117 ASP D CG    1 
ATOM   4625 O  OD1   . ASP D 2 124 ? -4.437  16.357 46.540 1.00 45.10  ? 117 ASP D OD1   1 
ATOM   4626 O  OD2   . ASP D 2 124 ? -4.567  17.417 44.638 1.00 47.19  ? 117 ASP D OD2   1 
ATOM   4627 N  N     . PRO D 2 125 ? -0.697  16.312 48.645 1.00 52.00  ? 118 PRO D N     1 
ATOM   4628 C  CA    . PRO D 2 125 ? 0.528   15.506 48.698 1.00 52.00  ? 118 PRO D CA    1 
ATOM   4629 C  C     . PRO D 2 125 ? 0.352   14.000 48.503 1.00 50.35  ? 118 PRO D C     1 
ATOM   4630 O  O     . PRO D 2 125 ? 0.259   13.243 49.473 1.00 55.67  ? 118 PRO D O     1 
ATOM   4631 C  CB    . PRO D 2 125 ? 1.056   15.800 50.095 1.00 52.99  ? 118 PRO D CB    1 
ATOM   4632 C  CG    . PRO D 2 125 ? -0.185  15.973 50.908 1.00 56.69  ? 118 PRO D CG    1 
ATOM   4633 C  CD    . PRO D 2 125 ? -1.153  16.674 49.998 1.00 54.07  ? 118 PRO D CD    1 
ATOM   4634 N  N     . LEU D 2 126 ? 0.359   13.579 47.244 1.00 44.24  ? 119 LEU D N     1 
ATOM   4635 C  CA    . LEU D 2 126 ? 0.327   12.163 46.892 1.00 42.40  ? 119 LEU D CA    1 
ATOM   4636 C  C     . LEU D 2 126 ? 1.547   11.398 47.428 1.00 42.79  ? 119 LEU D C     1 
ATOM   4637 O  O     . LEU D 2 126 ? 1.433   10.221 47.778 1.00 42.64  ? 119 LEU D O     1 
ATOM   4638 C  CB    . LEU D 2 126 ? 0.225   12.003 45.372 1.00 39.95  ? 119 LEU D CB    1 
ATOM   4639 C  CG    . LEU D 2 126 ? -0.000  10.576 44.862 1.00 40.20  ? 119 LEU D CG    1 
ATOM   4640 C  CD1   . LEU D 2 126 ? -1.296  10.019 45.423 1.00 42.26  ? 119 LEU D CD1   1 
ATOM   4641 C  CD2   . LEU D 2 126 ? -0.006  10.535 43.342 1.00 38.36  ? 119 LEU D CD2   1 
ATOM   4642 N  N     . VAL D 2 127 ? 2.700   12.070 47.479 1.00 41.59  ? 120 VAL D N     1 
ATOM   4643 C  CA    . VAL D 2 127 ? 3.929   11.517 48.051 1.00 43.44  ? 120 VAL D CA    1 
ATOM   4644 C  C     . VAL D 2 127 ? 4.355   12.425 49.214 1.00 45.99  ? 120 VAL D C     1 
ATOM   4645 O  O     . VAL D 2 127 ? 5.120   13.375 49.027 1.00 43.46  ? 120 VAL D O     1 
ATOM   4646 C  CB    . VAL D 2 127 ? 5.064   11.391 46.999 1.00 42.36  ? 120 VAL D CB    1 
ATOM   4647 C  CG1   . VAL D 2 127 ? 6.215   10.573 47.554 1.00 44.21  ? 120 VAL D CG1   1 
ATOM   4648 C  CG2   . VAL D 2 127 ? 4.564   10.721 45.732 1.00 40.96  ? 120 VAL D CG2   1 
ATOM   4649 N  N     . PRO D 2 128 ? 3.852   12.137 50.433 1.00 48.71  ? 121 PRO D N     1 
ATOM   4650 C  CA    . PRO D 2 128 ? 4.090   13.009 51.585 1.00 51.43  ? 121 PRO D CA    1 
ATOM   4651 C  C     . PRO D 2 128 ? 5.555   13.356 51.853 1.00 50.57  ? 121 PRO D C     1 
ATOM   4652 O  O     . PRO D 2 128 ? 5.879   14.524 52.069 1.00 50.15  ? 121 PRO D O     1 
ATOM   4653 C  CB    . PRO D 2 128 ? 3.499   12.207 52.746 1.00 55.76  ? 121 PRO D CB    1 
ATOM   4654 C  CG    . PRO D 2 128 ? 2.386   11.447 52.117 1.00 53.75  ? 121 PRO D CG    1 
ATOM   4655 C  CD    . PRO D 2 128 ? 2.915   11.048 50.768 1.00 51.12  ? 121 PRO D CD    1 
ATOM   4656 N  N     . ASP D 2 129 ? 6.430   12.358 51.839 1.00 52.06  ? 122 ASP D N     1 
ATOM   4657 C  CA    . ASP D 2 129 ? 7.845   12.593 52.125 1.00 54.18  ? 122 ASP D CA    1 
ATOM   4658 C  C     . ASP D 2 129 ? 8.446   13.617 51.148 1.00 49.77  ? 122 ASP D C     1 
ATOM   4659 O  O     . ASP D 2 129 ? 9.200   14.509 51.551 1.00 49.45  ? 122 ASP D O     1 
ATOM   4660 C  CB    . ASP D 2 129 ? 8.635   11.279 52.081 1.00 57.66  ? 122 ASP D CB    1 
ATOM   4661 C  CG    . ASP D 2 129 ? 8.393   10.395 53.311 1.00 65.85  ? 122 ASP D CG    1 
ATOM   4662 O  OD1   . ASP D 2 129 ? 9.077   9.355  53.434 1.00 73.10  ? 122 ASP D OD1   1 
ATOM   4663 O  OD2   . ASP D 2 129 ? 7.531   10.723 54.158 1.00 70.06  ? 122 ASP D OD2   1 
ATOM   4664 N  N     . ILE D 2 130 ? 8.090   13.503 49.872 1.00 46.28  ? 123 ILE D N     1 
ATOM   4665 C  CA    . ILE D 2 130 ? 8.551   14.460 48.852 1.00 44.64  ? 123 ILE D CA    1 
ATOM   4666 C  C     . ILE D 2 130 ? 7.915   15.840 49.060 1.00 45.55  ? 123 ILE D C     1 
ATOM   4667 O  O     . ILE D 2 130 ? 8.599   16.865 48.991 1.00 45.61  ? 123 ILE D O     1 
ATOM   4668 C  CB    . ILE D 2 130 ? 8.280   13.942 47.429 1.00 41.64  ? 123 ILE D CB    1 
ATOM   4669 C  CG1   . ILE D 2 130 ? 9.121   12.684 47.183 1.00 41.19  ? 123 ILE D CG1   1 
ATOM   4670 C  CG2   . ILE D 2 130 ? 8.605   15.009 46.386 1.00 40.97  ? 123 ILE D CG2   1 
ATOM   4671 C  CD1   . ILE D 2 130 ? 8.993   12.122 45.781 1.00 39.21  ? 123 ILE D CD1   1 
ATOM   4672 N  N     . ALA D 2 131 ? 6.614   15.855 49.339 1.00 45.88  ? 124 ALA D N     1 
ATOM   4673 C  CA    . ALA D 2 131 ? 5.899   17.102 49.590 1.00 46.06  ? 124 ALA D CA    1 
ATOM   4674 C  C     . ALA D 2 131 ? 6.521   17.880 50.746 1.00 50.30  ? 124 ALA D C     1 
ATOM   4675 O  O     . ALA D 2 131 ? 6.663   19.099 50.674 1.00 50.02  ? 124 ALA D O     1 
ATOM   4676 C  CB    . ALA D 2 131 ? 4.437   16.820 49.863 1.00 46.40  ? 124 ALA D CB    1 
ATOM   4677 N  N     . GLN D 2 132 ? 6.905   17.169 51.801 1.00 53.68  ? 125 GLN D N     1 
ATOM   4678 C  CA    . GLN D 2 132 ? 7.500   17.807 52.966 1.00 60.37  ? 125 GLN D CA    1 
ATOM   4679 C  C     . GLN D 2 132 ? 8.831   18.456 52.611 1.00 57.82  ? 125 GLN D C     1 
ATOM   4680 O  O     . GLN D 2 132 ? 9.109   19.576 53.043 1.00 59.17  ? 125 GLN D O     1 
ATOM   4681 C  CB    . GLN D 2 132 ? 7.683   16.805 54.111 1.00 67.19  ? 125 GLN D CB    1 
ATOM   4682 C  CG    . GLN D 2 132 ? 7.917   17.464 55.461 1.00 78.88  ? 125 GLN D CG    1 
ATOM   4683 C  CD    . GLN D 2 132 ? 6.746   18.335 55.876 1.00 84.44  ? 125 GLN D CD    1 
ATOM   4684 O  OE1   . GLN D 2 132 ? 5.599   17.893 55.861 1.00 88.93  ? 125 GLN D OE1   1 
ATOM   4685 N  NE2   . GLN D 2 132 ? 7.028   19.582 56.233 1.00 88.74  ? 125 GLN D NE2   1 
ATOM   4686 N  N     . ILE D 2 133 ? 9.636   17.760 51.812 1.00 55.47  ? 126 ILE D N     1 
ATOM   4687 C  CA    . ILE D 2 133 ? 10.921  18.303 51.344 1.00 54.84  ? 126 ILE D CA    1 
ATOM   4688 C  C     . ILE D 2 133 ? 10.712  19.553 50.487 1.00 53.21  ? 126 ILE D C     1 
ATOM   4689 O  O     . ILE D 2 133 ? 11.433  20.540 50.655 1.00 53.34  ? 126 ILE D O     1 
ATOM   4690 C  CB    . ILE D 2 133 ? 11.746  17.251 50.571 1.00 52.49  ? 126 ILE D CB    1 
ATOM   4691 C  CG1   . ILE D 2 133 ? 12.222  16.162 51.538 1.00 55.82  ? 126 ILE D CG1   1 
ATOM   4692 C  CG2   . ILE D 2 133 ? 12.946  17.897 49.877 1.00 52.40  ? 126 ILE D CG2   1 
ATOM   4693 C  CD1   . ILE D 2 133 ? 12.820  14.942 50.870 1.00 56.75  ? 126 ILE D CD1   1 
ATOM   4694 N  N     . TYR D 2 134 ? 9.727   19.507 49.589 1.00 49.80  ? 127 TYR D N     1 
ATOM   4695 C  CA    . TYR D 2 134 ? 9.401   20.649 48.732 1.00 49.26  ? 127 TYR D CA    1 
ATOM   4696 C  C     . TYR D 2 134 ? 9.160   21.902 49.566 1.00 53.83  ? 127 TYR D C     1 
ATOM   4697 O  O     . TYR D 2 134 ? 9.701   22.963 49.256 1.00 53.16  ? 127 TYR D O     1 
ATOM   4698 C  CB    . TYR D 2 134 ? 8.177   20.362 47.855 1.00 47.08  ? 127 TYR D CB    1 
ATOM   4699 C  CG    . TYR D 2 134 ? 7.860   21.498 46.908 1.00 46.97  ? 127 TYR D CG    1 
ATOM   4700 C  CD1   . TYR D 2 134 ? 8.527   21.622 45.698 1.00 45.65  ? 127 TYR D CD1   1 
ATOM   4701 C  CD2   . TYR D 2 134 ? 6.921   22.469 47.239 1.00 50.61  ? 127 TYR D CD2   1 
ATOM   4702 C  CE1   . TYR D 2 134 ? 8.265   22.671 44.837 1.00 47.02  ? 127 TYR D CE1   1 
ATOM   4703 C  CE2   . TYR D 2 134 ? 6.649   23.525 46.383 1.00 51.41  ? 127 TYR D CE2   1 
ATOM   4704 C  CZ    . TYR D 2 134 ? 7.326   23.619 45.185 1.00 50.39  ? 127 TYR D CZ    1 
ATOM   4705 O  OH    . TYR D 2 134 ? 7.063   24.661 44.330 1.00 54.63  ? 127 TYR D OH    1 
ATOM   4706 N  N     . LYS D 2 135 ? 8.353   21.760 50.621 1.00 56.55  ? 128 LYS D N     1 
ATOM   4707 C  CA    . LYS D 2 135 ? 8.034   22.864 51.531 1.00 61.51  ? 128 LYS D CA    1 
ATOM   4708 C  C     . LYS D 2 135 ? 9.225   23.303 52.389 1.00 64.19  ? 128 LYS D C     1 
ATOM   4709 O  O     . LYS D 2 135 ? 9.415   24.496 52.615 1.00 65.76  ? 128 LYS D O     1 
ATOM   4710 C  CB    . LYS D 2 135 ? 6.894   22.477 52.478 1.00 63.63  ? 128 LYS D CB    1 
ATOM   4711 C  CG    . LYS D 2 135 ? 5.547   22.216 51.830 1.00 64.18  ? 128 LYS D CG    1 
ATOM   4712 C  CD    . LYS D 2 135 ? 4.503   21.954 52.909 1.00 71.84  ? 128 LYS D CD    1 
ATOM   4713 C  CE    . LYS D 2 135 ? 3.282   21.230 52.370 1.00 75.01  ? 128 LYS D CE    1 
ATOM   4714 N  NZ    . LYS D 2 135 ? 2.341   20.882 53.468 1.00 86.67  ? 128 LYS D NZ    1 
ATOM   4715 N  N     . SER D 2 136 ? 10.005  22.340 52.880 1.00 64.57  ? 129 SER D N     1 
ATOM   4716 C  CA    . SER D 2 136 ? 11.080  22.621 53.846 1.00 68.18  ? 129 SER D CA    1 
ATOM   4717 C  C     . SER D 2 136 ? 12.396  23.039 53.201 1.00 65.84  ? 129 SER D C     1 
ATOM   4718 O  O     . SER D 2 136 ? 13.071  23.940 53.692 1.00 66.40  ? 129 SER D O     1 
ATOM   4719 C  CB    . SER D 2 136 ? 11.339  21.390 54.719 1.00 71.12  ? 129 SER D CB    1 
ATOM   4720 O  OG    . SER D 2 136 ? 10.168  21.011 55.422 1.00 76.61  ? 129 SER D OG    1 
ATOM   4721 N  N     . ASP D 2 137 ? 12.755  22.368 52.109 1.00 61.91  ? 130 ASP D N     1 
ATOM   4722 C  CA    . ASP D 2 137 ? 14.084  22.484 51.525 1.00 61.29  ? 130 ASP D CA    1 
ATOM   4723 C  C     . ASP D 2 137 ? 13.997  22.382 50.003 1.00 58.71  ? 130 ASP D C     1 
ATOM   4724 O  O     . ASP D 2 137 ? 14.252  21.326 49.416 1.00 54.43  ? 130 ASP D O     1 
ATOM   4725 C  CB    . ASP D 2 137 ? 14.975  21.379 52.094 1.00 61.94  ? 130 ASP D CB    1 
ATOM   4726 C  CG    . ASP D 2 137 ? 16.467  21.656 51.908 1.00 64.33  ? 130 ASP D CG    1 
ATOM   4727 O  OD1   . ASP D 2 137 ? 16.846  22.616 51.194 1.00 64.89  ? 130 ASP D OD1   1 
ATOM   4728 O  OD2   . ASP D 2 137 ? 17.263  20.887 52.489 1.00 63.73  ? 130 ASP D OD2   1 
ATOM   4729 N  N     . LYS D 2 138 ? 13.644  23.501 49.379 1.00 59.59  ? 131 LYS D N     1 
ATOM   4730 C  CA    . LYS D 2 138 ? 13.396  23.550 47.942 1.00 59.53  ? 131 LYS D CA    1 
ATOM   4731 C  C     . LYS D 2 138 ? 14.665  23.283 47.127 1.00 58.67  ? 131 LYS D C     1 
ATOM   4732 O  O     . LYS D 2 138 ? 14.591  22.695 46.050 1.00 54.43  ? 131 LYS D O     1 
ATOM   4733 C  CB    . LYS D 2 138 ? 12.766  24.894 47.555 1.00 62.56  ? 131 LYS D CB    1 
ATOM   4734 C  CG    . LYS D 2 138 ? 11.816  24.816 46.368 1.00 65.67  ? 131 LYS D CG    1 
ATOM   4735 C  CD    . LYS D 2 138 ? 10.682  25.824 46.503 1.00 74.62  ? 131 LYS D CD    1 
ATOM   4736 C  CE    . LYS D 2 138 ? 9.775   25.836 45.281 1.00 75.16  ? 131 LYS D CE    1 
ATOM   4737 N  NZ    . LYS D 2 138 ? 10.236  26.763 44.212 1.00 77.65  ? 131 LYS D NZ    1 
ATOM   4738 N  N     . GLU D 2 139 ? 15.818  23.699 47.648 1.00 62.35  ? 132 GLU D N     1 
ATOM   4739 C  CA    . GLU D 2 139 ? 17.104  23.444 46.993 1.00 64.07  ? 132 GLU D CA    1 
ATOM   4740 C  C     . GLU D 2 139 ? 17.356  21.946 46.918 1.00 59.04  ? 132 GLU D C     1 
ATOM   4741 O  O     . GLU D 2 139 ? 17.759  21.431 45.874 1.00 56.58  ? 132 GLU D O     1 
ATOM   4742 C  CB    . GLU D 2 139 ? 18.251  24.135 47.748 1.00 70.41  ? 132 GLU D CB    1 
ATOM   4743 C  CG    . GLU D 2 139 ? 19.587  24.197 46.998 1.00 78.45  ? 132 GLU D CG    1 
ATOM   4744 C  CD    . GLU D 2 139 ? 20.482  22.966 47.177 1.00 82.46  ? 132 GLU D CD    1 
ATOM   4745 O  OE1   . GLU D 2 139 ? 20.539  22.408 48.293 1.00 90.41  ? 132 GLU D OE1   1 
ATOM   4746 O  OE2   . GLU D 2 139 ? 21.152  22.558 46.200 1.00 78.14  ? 132 GLU D OE2   1 
ATOM   4747 N  N     . LYS D 2 140 ? 17.120  21.259 48.036 1.00 57.33  ? 133 LYS D N     1 
ATOM   4748 C  CA    . LYS D 2 140 ? 17.259  19.808 48.111 1.00 55.95  ? 133 LYS D CA    1 
ATOM   4749 C  C     . LYS D 2 140 ? 16.224  19.121 47.222 1.00 52.31  ? 133 LYS D C     1 
ATOM   4750 O  O     . LYS D 2 140 ? 16.537  18.143 46.546 1.00 50.44  ? 133 LYS D O     1 
ATOM   4751 C  CB    . LYS D 2 140 ? 17.103  19.340 49.553 1.00 58.70  ? 133 LYS D CB    1 
ATOM   4752 C  CG    . LYS D 2 140 ? 17.191  17.838 49.768 1.00 61.58  ? 133 LYS D CG    1 
ATOM   4753 C  CD    . LYS D 2 140 ? 17.084  17.528 51.258 1.00 69.56  ? 133 LYS D CD    1 
ATOM   4754 C  CE    . LYS D 2 140 ? 16.493  16.155 51.556 1.00 72.29  ? 133 LYS D CE    1 
ATOM   4755 N  NZ    . LYS D 2 140 ? 17.530  15.090 51.659 1.00 75.64  ? 133 LYS D NZ    1 
ATOM   4756 N  N     . TYR D 2 141 ? 14.992  19.623 47.232 1.00 50.14  ? 134 TYR D N     1 
ATOM   4757 C  CA    . TYR D 2 141 ? 13.964  19.103 46.338 1.00 47.27  ? 134 TYR D CA    1 
ATOM   4758 C  C     . TYR D 2 141 ? 14.422  19.181 44.883 1.00 45.73  ? 134 TYR D C     1 
ATOM   4759 O  O     . TYR D 2 141 ? 14.424  18.170 44.167 1.00 41.17  ? 134 TYR D O     1 
ATOM   4760 C  CB    . TYR D 2 141 ? 12.658  19.879 46.487 1.00 47.51  ? 134 TYR D CB    1 
ATOM   4761 C  CG    . TYR D 2 141 ? 11.677  19.515 45.419 1.00 44.93  ? 134 TYR D CG    1 
ATOM   4762 C  CD1   . TYR D 2 141 ? 11.520  20.300 44.283 1.00 44.65  ? 134 TYR D CD1   1 
ATOM   4763 C  CD2   . TYR D 2 141 ? 10.938  18.359 45.523 1.00 45.68  ? 134 TYR D CD2   1 
ATOM   4764 C  CE1   . TYR D 2 141 ? 10.622  19.938 43.285 1.00 44.32  ? 134 TYR D CE1   1 
ATOM   4765 C  CE2   . TYR D 2 141 ? 10.045  17.994 44.544 1.00 45.87  ? 134 TYR D CE2   1 
ATOM   4766 C  CZ    . TYR D 2 141 ? 9.894   18.785 43.431 1.00 43.25  ? 134 TYR D CZ    1 
ATOM   4767 O  OH    . TYR D 2 141 ? 8.991   18.390 42.488 1.00 48.40  ? 134 TYR D OH    1 
ATOM   4768 N  N     . ASN D 2 142 ? 14.783  20.388 44.451 1.00 46.17  ? 135 ASN D N     1 
ATOM   4769 C  CA    . ASN D 2 142 ? 15.261  20.611 43.088 1.00 45.75  ? 135 ASN D CA    1 
ATOM   4770 C  C     . ASN D 2 142 ? 16.444  19.706 42.759 1.00 44.58  ? 135 ASN D C     1 
ATOM   4771 O  O     . ASN D 2 142 ? 16.529  19.147 41.666 1.00 42.37  ? 135 ASN D O     1 
ATOM   4772 C  CB    . ASN D 2 142 ? 15.649  22.081 42.864 1.00 49.05  ? 135 ASN D CB    1 
ATOM   4773 C  CG    . ASN D 2 142 ? 14.452  22.979 42.553 1.00 51.62  ? 135 ASN D CG    1 
ATOM   4774 O  OD1   . ASN D 2 142 ? 13.402  22.523 42.122 1.00 51.09  ? 135 ASN D OD1   1 
ATOM   4775 N  ND2   . ASN D 2 142 ? 14.622  24.276 42.770 1.00 55.27  ? 135 ASN D ND2   1 
ATOM   4776 N  N     . ARG D 2 143 ? 17.347  19.550 43.715 1.00 45.99  ? 136 ARG D N     1 
ATOM   4777 C  CA    . ARG D 2 143 ? 18.501  18.686 43.517 1.00 47.86  ? 136 ARG D CA    1 
ATOM   4778 C  C     . ARG D 2 143 ? 18.065  17.241 43.230 1.00 43.34  ? 136 ARG D C     1 
ATOM   4779 O  O     . ARG D 2 143 ? 18.521  16.615 42.260 1.00 41.35  ? 136 ARG D O     1 
ATOM   4780 C  CB    . ARG D 2 143 ? 19.434  18.754 44.729 1.00 51.38  ? 136 ARG D CB    1 
ATOM   4781 C  CG    . ARG D 2 143 ? 20.778  18.097 44.503 1.00 56.01  ? 136 ARG D CG    1 
ATOM   4782 C  CD    . ARG D 2 143 ? 21.808  18.519 45.545 1.00 60.71  ? 136 ARG D CD    1 
ATOM   4783 N  NE    . ARG D 2 143 ? 21.344  18.326 46.922 1.00 64.12  ? 136 ARG D NE    1 
ATOM   4784 C  CZ    . ARG D 2 143 ? 21.201  17.143 47.528 1.00 68.43  ? 136 ARG D CZ    1 
ATOM   4785 N  NH1   . ARG D 2 143 ? 21.466  16.001 46.891 1.00 66.19  ? 136 ARG D NH1   1 
ATOM   4786 N  NH2   . ARG D 2 143 ? 20.778  17.097 48.790 1.00 72.77  ? 136 ARG D NH2   1 
ATOM   4787 N  N     . HIS D 2 144 ? 17.172  16.721 44.065 1.00 43.42  ? 137 HIS D N     1 
ATOM   4788 C  CA    . HIS D 2 144 ? 16.644  15.372 43.859 1.00 42.16  ? 137 HIS D CA    1 
ATOM   4789 C  C     . HIS D 2 144 ? 15.873  15.234 42.562 1.00 38.01  ? 137 HIS D C     1 
ATOM   4790 O  O     . HIS D 2 144 ? 15.985  14.206 41.904 1.00 38.00  ? 137 HIS D O     1 
ATOM   4791 C  CB    . HIS D 2 144 ? 15.739  14.948 45.009 1.00 43.13  ? 137 HIS D CB    1 
ATOM   4792 C  CG    . HIS D 2 144 ? 16.479  14.611 46.262 1.00 48.77  ? 137 HIS D CG    1 
ATOM   4793 N  ND1   . HIS D 2 144 ? 15.945  14.818 47.513 1.00 51.65  ? 137 HIS D ND1   1 
ATOM   4794 C  CD2   . HIS D 2 144 ? 17.711  14.085 46.458 1.00 51.48  ? 137 HIS D CD2   1 
ATOM   4795 C  CE1   . HIS D 2 144 ? 16.815  14.428 48.429 1.00 58.34  ? 137 HIS D CE1   1 
ATOM   4796 N  NE2   . HIS D 2 144 ? 17.895  13.980 47.815 1.00 55.89  ? 137 HIS D NE2   1 
ATOM   4797 N  N     . ALA D 2 145 ? 15.082  16.250 42.211 1.00 36.55  ? 138 ALA D N     1 
ATOM   4798 C  CA    . ALA D 2 145 ? 14.302  16.230 40.967 1.00 34.77  ? 138 ALA D CA    1 
ATOM   4799 C  C     . ALA D 2 145 ? 15.211  16.169 39.732 1.00 33.92  ? 138 ALA D C     1 
ATOM   4800 O  O     . ALA D 2 145 ? 14.953  15.400 38.826 1.00 32.51  ? 138 ALA D O     1 
ATOM   4801 C  CB    . ALA D 2 145 ? 13.354  17.423 40.883 1.00 33.93  ? 138 ALA D CB    1 
ATOM   4802 N  N     . ARG D 2 146 ? 16.266  16.978 39.704 1.00 37.01  ? 139 ARG D N     1 
ATOM   4803 C  CA    . ARG D 2 146 ? 17.286  16.899 38.635 1.00 37.68  ? 139 ARG D CA    1 
ATOM   4804 C  C     . ARG D 2 146 ? 18.007  15.541 38.550 1.00 37.15  ? 139 ARG D C     1 
ATOM   4805 O  O     . ARG D 2 146 ? 18.188  14.995 37.449 1.00 35.38  ? 139 ARG D O     1 
ATOM   4806 C  CB    . ARG D 2 146 ? 18.328  18.011 38.789 1.00 41.78  ? 139 ARG D CB    1 
ATOM   4807 C  CG    . ARG D 2 146 ? 17.863  19.364 38.273 1.00 46.98  ? 139 ARG D CG    1 
ATOM   4808 C  CD    . ARG D 2 146 ? 18.959  20.424 38.300 1.00 53.81  ? 139 ARG D CD    1 
ATOM   4809 N  NE    . ARG D 2 146 ? 19.135  20.985 39.642 1.00 59.70  ? 139 ARG D NE    1 
ATOM   4810 C  CZ    . ARG D 2 146 ? 20.128  20.696 40.488 1.00 67.13  ? 139 ARG D CZ    1 
ATOM   4811 N  NH1   . ARG D 2 146 ? 21.101  19.841 40.163 1.00 70.67  ? 139 ARG D NH1   1 
ATOM   4812 N  NH2   . ARG D 2 146 ? 20.153  21.285 41.681 1.00 65.80  ? 139 ARG D NH2   1 
ATOM   4813 N  N     . GLU D 2 147 ? 18.428  15.019 39.700 1.00 39.66  ? 140 GLU D N     1 
ATOM   4814 C  CA    . GLU D 2 147 ? 19.096  13.710 39.778 1.00 41.50  ? 140 GLU D CA    1 
ATOM   4815 C  C     . GLU D 2 147 ? 18.253  12.566 39.224 1.00 37.58  ? 140 GLU D C     1 
ATOM   4816 O  O     . GLU D 2 147 ? 18.756  11.743 38.460 1.00 36.60  ? 140 GLU D O     1 
ATOM   4817 C  CB    . GLU D 2 147 ? 19.511  13.388 41.217 1.00 44.57  ? 140 GLU D CB    1 
ATOM   4818 C  CG    . GLU D 2 147 ? 20.662  14.245 41.718 1.00 51.58  ? 140 GLU D CG    1 
ATOM   4819 C  CD    . GLU D 2 147 ? 20.882  14.156 43.230 1.00 59.38  ? 140 GLU D CD    1 
ATOM   4820 O  OE1   . GLU D 2 147 ? 20.168  13.393 43.926 1.00 57.71  ? 140 GLU D OE1   1 
ATOM   4821 O  OE2   . GLU D 2 147 ? 21.786  14.869 43.723 1.00 62.94  ? 140 GLU D OE2   1 
ATOM   4822 N  N     . TRP D 2 148 ? 16.983  12.512 39.621 1.00 35.72  ? 141 TRP D N     1 
ATOM   4823 C  CA    . TRP D 2 148 ? 16.064  11.520 39.082 1.00 35.19  ? 141 TRP D CA    1 
ATOM   4824 C  C     . TRP D 2 148 ? 15.769  11.764 37.601 1.00 32.22  ? 141 TRP D C     1 
ATOM   4825 O  O     . TRP D 2 148 ? 15.590  10.817 36.845 1.00 32.28  ? 141 TRP D O     1 
ATOM   4826 C  CB    . TRP D 2 148 ? 14.742  11.482 39.872 1.00 35.07  ? 141 TRP D CB    1 
ATOM   4827 C  CG    . TRP D 2 148 ? 14.798  10.767 41.185 1.00 38.18  ? 141 TRP D CG    1 
ATOM   4828 C  CD1   . TRP D 2 148 ? 15.837  10.744 42.074 1.00 41.07  ? 141 TRP D CD1   1 
ATOM   4829 C  CD2   . TRP D 2 148 ? 13.748  10.004 41.783 1.00 39.38  ? 141 TRP D CD2   1 
ATOM   4830 N  NE1   . TRP D 2 148 ? 15.508  9.997  43.173 1.00 40.97  ? 141 TRP D NE1   1 
ATOM   4831 C  CE2   . TRP D 2 148 ? 14.227  9.535  43.027 1.00 43.06  ? 141 TRP D CE2   1 
ATOM   4832 C  CE3   . TRP D 2 148 ? 12.447  9.667  41.390 1.00 37.74  ? 141 TRP D CE3   1 
ATOM   4833 C  CZ2   . TRP D 2 148 ? 13.445  8.753  43.884 1.00 42.19  ? 141 TRP D CZ2   1 
ATOM   4834 C  CZ3   . TRP D 2 148 ? 11.672  8.882  42.243 1.00 39.22  ? 141 TRP D CZ3   1 
ATOM   4835 C  CH2   . TRP D 2 148 ? 12.179  8.433  43.469 1.00 41.61  ? 141 TRP D CH2   1 
ATOM   4836 N  N     . THR D 2 149 ? 15.704  13.024 37.174 1.00 31.23  ? 142 THR D N     1 
ATOM   4837 C  CA    . THR D 2 149 ? 15.533  13.312 35.742 1.00 30.91  ? 142 THR D CA    1 
ATOM   4838 C  C     . THR D 2 149 ? 16.699  12.705 34.957 1.00 31.92  ? 142 THR D C     1 
ATOM   4839 O  O     . THR D 2 149 ? 16.484  12.043 33.952 1.00 32.06  ? 142 THR D O     1 
ATOM   4840 C  CB    . THR D 2 149 ? 15.438  14.823 35.450 1.00 30.58  ? 142 THR D CB    1 
ATOM   4841 O  OG1   . THR D 2 149 ? 14.295  15.354 36.120 1.00 29.71  ? 142 THR D OG1   1 
ATOM   4842 C  CG2   . THR D 2 149 ? 15.314  15.083 33.953 1.00 30.51  ? 142 THR D CG2   1 
ATOM   4843 N  N     . GLN D 2 150 ? 17.918  12.895 35.454 1.00 34.07  ? 143 GLN D N     1 
ATOM   4844 C  CA    . GLN D 2 150 ? 19.101  12.379 34.785 1.00 36.92  ? 143 GLN D CA    1 
ATOM   4845 C  C     . GLN D 2 150 ? 19.122  10.853 34.797 1.00 37.49  ? 143 GLN D C     1 
ATOM   4846 O  O     . GLN D 2 150 ? 19.443  10.225 33.785 1.00 37.56  ? 143 GLN D O     1 
ATOM   4847 C  CB    . GLN D 2 150 ? 20.368  12.947 35.422 1.00 40.40  ? 143 GLN D CB    1 
ATOM   4848 C  CG    . GLN D 2 150 ? 20.502  14.445 35.202 1.00 43.06  ? 143 GLN D CG    1 
ATOM   4849 C  CD    . GLN D 2 150 ? 21.541  15.069 36.099 1.00 49.41  ? 143 GLN D CD    1 
ATOM   4850 O  OE1   . GLN D 2 150 ? 22.325  14.366 36.729 1.00 54.33  ? 143 GLN D OE1   1 
ATOM   4851 N  NE2   . GLN D 2 150 ? 21.569  16.395 36.144 1.00 49.00  ? 143 GLN D NE2   1 
ATOM   4852 N  N     . LYS D 2 151 ? 18.741  10.269 35.930 1.00 37.69  ? 144 LYS D N     1 
ATOM   4853 C  CA    . LYS D 2 151 ? 18.784  8.819  36.104 1.00 41.39  ? 144 LYS D CA    1 
ATOM   4854 C  C     . LYS D 2 151 ? 17.744  8.082  35.273 1.00 38.12  ? 144 LYS D C     1 
ATOM   4855 O  O     . LYS D 2 151 ? 18.064  7.102  34.606 1.00 38.24  ? 144 LYS D O     1 
ATOM   4856 C  CB    . LYS D 2 151 ? 18.610  8.452  37.585 1.00 45.42  ? 144 LYS D CB    1 
ATOM   4857 C  CG    . LYS D 2 151 ? 18.948  7.006  37.905 1.00 52.59  ? 144 LYS D CG    1 
ATOM   4858 C  CD    . LYS D 2 151 ? 19.093  6.766  39.402 1.00 59.48  ? 144 LYS D CD    1 
ATOM   4859 C  CE    . LYS D 2 151 ? 19.527  5.334  39.688 1.00 64.57  ? 144 LYS D CE    1 
ATOM   4860 N  NZ    . LYS D 2 151 ? 19.649  5.048  41.145 1.00 70.95  ? 144 LYS D NZ    1 
ATOM   4861 N  N     . TYR D 2 152 ? 16.508  8.565  35.303 1.00 36.27  ? 145 TYR D N     1 
ATOM   4862 C  CA    . TYR D 2 152 ? 15.373  7.807  34.782 1.00 37.84  ? 145 TYR D CA    1 
ATOM   4863 C  C     . TYR D 2 152 ? 14.752  8.352  33.488 1.00 36.07  ? 145 TYR D C     1 
ATOM   4864 O  O     . TYR D 2 152 ? 14.047  7.615  32.794 1.00 36.28  ? 145 TYR D O     1 
ATOM   4865 C  CB    . TYR D 2 152 ? 14.294  7.717  35.862 1.00 36.84  ? 145 TYR D CB    1 
ATOM   4866 C  CG    . TYR D 2 152 ? 14.760  7.033  37.120 1.00 39.14  ? 145 TYR D CG    1 
ATOM   4867 C  CD1   . TYR D 2 152 ? 15.082  5.677  37.116 1.00 41.78  ? 145 TYR D CD1   1 
ATOM   4868 C  CD2   . TYR D 2 152 ? 14.880  7.732  38.319 1.00 40.18  ? 145 TYR D CD2   1 
ATOM   4869 C  CE1   . TYR D 2 152 ? 15.507  5.035  38.273 1.00 44.23  ? 145 TYR D CE1   1 
ATOM   4870 C  CE2   . TYR D 2 152 ? 15.308  7.104  39.473 1.00 41.94  ? 145 TYR D CE2   1 
ATOM   4871 C  CZ    . TYR D 2 152 ? 15.622  5.755  39.447 1.00 45.22  ? 145 TYR D CZ    1 
ATOM   4872 O  OH    . TYR D 2 152 ? 16.049  5.133  40.591 1.00 50.06  ? 145 TYR D OH    1 
ATOM   4873 N  N     . ALA D 2 153 ? 15.025  9.624  33.161 1.00 34.20  ? 146 ALA D N     1 
ATOM   4874 C  CA    . ALA D 2 153 ? 14.349  10.312 32.069 1.00 31.82  ? 146 ALA D CA    1 
ATOM   4875 C  C     . ALA D 2 153 ? 15.288  10.874 30.998 1.00 32.13  ? 146 ALA D C     1 
ATOM   4876 O  O     . ALA D 2 153 ? 14.844  11.575 30.100 1.00 30.61  ? 146 ALA D O     1 
ATOM   4877 C  CB    . ALA D 2 153 ? 13.461  11.421 32.639 1.00 30.38  ? 146 ALA D CB    1 
ATOM   4878 N  N     . MET D 2 154 ? 16.579  10.559 31.070 1.00 32.26  ? 147 MET D N     1 
ATOM   4879 C  CA    . MET D 2 154 ? 17.537  11.003 30.066 1.00 34.88  ? 147 MET D CA    1 
ATOM   4880 C  C     . MET D 2 154 ? 18.267  9.803  29.468 1.00 38.11  ? 147 MET D C     1 
ATOM   4881 O  O     . MET D 2 154 ? 18.379  8.752  30.110 1.00 40.55  ? 147 MET D O     1 
ATOM   4882 C  CB    . MET D 2 154 ? 18.555  11.960 30.669 1.00 35.32  ? 147 MET D CB    1 
ATOM   4883 C  CG    . MET D 2 154 ? 17.987  13.310 31.077 1.00 34.93  ? 147 MET D CG    1 
ATOM   4884 S  SD    . MET D 2 154 ? 19.329  14.437 31.475 1.00 38.44  ? 147 MET D SD    1 
ATOM   4885 C  CE    . MET D 2 154 ? 18.406  15.787 32.200 1.00 37.45  ? 147 MET D CE    1 
ATOM   4886 O  OXT   . MET D 2 154 ? 18.788  9.842  28.355 1.00 40.73  ? 147 MET D OXT   1 
HETATM 4887 N  N1    . V3L E 3 .   ? 52.529  14.871 34.463 1.00 27.27  ? 201 V3L A N1    1 
HETATM 4888 C  C2    . V3L E 3 .   ? 52.904  15.080 33.184 1.00 26.20  ? 201 V3L A C2    1 
HETATM 4889 N  N3    . V3L E 3 .   ? 53.317  14.075 32.395 1.00 30.46  ? 201 V3L A N3    1 
HETATM 4890 C  C4    . V3L E 3 .   ? 53.385  12.801 32.871 1.00 26.53  ? 201 V3L A C4    1 
HETATM 4891 C  C5    . V3L E 3 .   ? 53.031  12.513 34.173 1.00 24.70  ? 201 V3L A C5    1 
HETATM 4892 C  C6    . V3L E 3 .   ? 52.587  13.629 35.007 1.00 24.47  ? 201 V3L A C6    1 
HETATM 4893 N  N6    . V3L E 3 .   ? 52.221  13.393 36.272 1.00 26.62  ? 201 V3L A N6    1 
HETATM 4894 N  N7    . V3L E 3 .   ? 53.175  11.186 34.381 1.00 32.82  ? 201 V3L A N7    1 
HETATM 4895 C  C8    . V3L E 3 .   ? 53.624  10.658 33.224 1.00 32.77  ? 201 V3L A C8    1 
HETATM 4896 N  N9    . V3L E 3 .   ? 53.721  11.647 32.307 1.00 29.72  ? 201 V3L A N9    1 
HETATM 4897 P  P     . V3L E 3 .   ? 55.123  6.931  32.335 1.00 41.42  ? 201 V3L A P     1 
HETATM 4898 P  PB    . V3L E 3 .   ? 62.485  12.439 32.696 0.90 45.71  ? 201 V3L A PB    1 
HETATM 4899 C  C10   . V3L E 3 .   ? 57.484  12.720 32.067 1.00 28.71  ? 201 V3L A C10   1 
HETATM 4900 C  "C1'" . V3L E 3 .   ? 54.231  11.525 30.930 1.00 27.70  ? 201 V3L A "C1'" 1 
HETATM 4901 O  OP3   . V3L E 3 .   ? 55.539  7.287  33.728 1.00 44.51  ? 201 V3L A OP3   1 
HETATM 4902 O  O1B   . V3L E 3 .   ? 61.950  11.068 33.057 1.00 44.95  ? 201 V3L A O1B   1 
HETATM 4903 C  C12   . V3L E 3 .   ? 57.984  14.164 32.149 1.00 26.76  ? 201 V3L A C12   1 
HETATM 4904 O  O12   . V3L E 3 .   ? 56.925  15.125 32.288 1.00 32.11  ? 201 V3L A O12   1 
HETATM 4905 C  "C2'" . V3L E 3 .   ? 55.747  11.350 31.042 1.00 29.60  ? 201 V3L A "C2'" 1 
HETATM 4906 O  "O2'" . V3L E 3 .   ? 56.424  12.605 31.126 1.00 31.75  ? 201 V3L A "O2'" 1 
HETATM 4907 O  OP1   . V3L E 3 .   ? 53.655  6.642  32.215 1.00 38.94  ? 201 V3L A OP1   1 
HETATM 4908 O  O2B   . V3L E 3 .   ? 63.601  12.452 31.696 1.00 48.15  ? 201 V3L A O2B   1 
HETATM 4909 C  C13   . V3L E 3 .   ? 58.822  14.289 30.878 1.00 27.94  ? 201 V3L A C13   1 
HETATM 4910 O  O13   . V3L E 3 .   ? 58.074  14.778 29.746 1.00 31.00  ? 201 V3L A O13   1 
HETATM 4911 C  "C3'" . V3L E 3 .   ? 56.084  10.543 29.814 1.00 40.21  ? 201 V3L A "C3'" 1 
HETATM 4912 O  "O3'" . V3L E 3 .   ? 56.374  11.414 28.714 1.00 32.87  ? 201 V3L A "O3'" 1 
HETATM 4913 O  OP2   . V3L E 3 .   ? 56.024  5.927  31.670 1.00 43.93  ? 201 V3L A OP2   1 
HETATM 4914 O  O3B   . V3L E 3 .   ? 62.738  13.352 33.868 1.00 35.77  ? 201 V3L A O3B   1 
HETATM 4915 C  C14   . V3L E 3 .   ? 59.272  12.850 30.591 1.00 31.20  ? 201 V3L A C14   1 
HETATM 4916 O  O14   . V3L E 3 .   ? 58.628  12.023 31.566 1.00 29.28  ? 201 V3L A O14   1 
HETATM 4917 C  "C4'" . V3L E 3 .   ? 54.826  9.730  29.566 1.00 40.95  ? 201 V3L A "C4'" 1 
HETATM 4918 O  "O4'" . V3L E 3 .   ? 53.744  10.385 30.240 1.00 34.87  ? 201 V3L A "O4'" 1 
HETATM 4919 C  C15   . V3L E 3 .   ? 60.797  12.692 30.652 1.00 37.88  ? 201 V3L A C15   1 
HETATM 4920 O  O15   . V3L E 3 .   ? 61.295  13.185 31.903 1.00 39.13  ? 201 V3L A O15   1 
HETATM 4921 C  "C5'" . V3L E 3 .   ? 54.942  8.298  30.084 1.00 42.15  ? 201 V3L A "C5'" 1 
HETATM 4922 O  "O5'" . V3L E 3 .   ? 55.314  8.273  31.466 1.00 41.83  ? 201 V3L A "O5'" 1 
HETATM 4923 ZN ZN    . ZN  F 4 .   ? 43.047  20.648 26.934 1.00 30.96  ? 202 ZN  A ZN    1 
HETATM 4924 ZN ZN    . ZN  G 4 .   ? 45.514  24.697 13.627 1.00 33.94  ? 203 ZN  A ZN    1 
HETATM 4925 N  N1    . V3L H 3 .   ? -31.993 13.196 12.709 1.00 20.99  ? 201 V3L C N1    1 
HETATM 4926 C  C2    . V3L H 3 .   ? -32.310 13.356 13.983 1.00 18.55  ? 201 V3L C C2    1 
HETATM 4927 N  N3    . V3L H 3 .   ? -32.715 12.344 14.760 1.00 22.72  ? 201 V3L C N3    1 
HETATM 4928 C  C4    . V3L H 3 .   ? -32.811 11.081 14.232 1.00 24.12  ? 201 V3L C C4    1 
HETATM 4929 C  C5    . V3L H 3 .   ? -32.473 10.832 12.929 1.00 24.56  ? 201 V3L C C5    1 
HETATM 4930 C  C6    . V3L H 3 .   ? -32.049 11.996 12.119 1.00 20.74  ? 201 V3L C C6    1 
HETATM 4931 N  N6    . V3L H 3 .   ? -31.708 11.846 10.857 1.00 21.72  ? 201 V3L C N6    1 
HETATM 4932 N  N7    . V3L H 3 .   ? -32.636 9.515  12.674 1.00 28.29  ? 201 V3L C N7    1 
HETATM 4933 C  C8    . V3L H 3 .   ? -33.059 8.958  13.818 1.00 26.43  ? 201 V3L C C8    1 
HETATM 4934 N  N9    . V3L H 3 .   ? -33.140 9.913  14.764 1.00 23.52  ? 201 V3L C N9    1 
HETATM 4935 P  P     . V3L H 3 .   ? -34.671 5.167  14.579 0.99 34.57  ? 201 V3L C P     1 
HETATM 4936 P  PB    . V3L H 3 .   ? -41.795 10.396 14.355 0.95 35.66  ? 201 V3L C PB    1 
HETATM 4937 C  C10   . V3L H 3 .   ? -36.980 10.722 15.117 1.00 26.72  ? 201 V3L C C10   1 
HETATM 4938 C  "C1'" . V3L H 3 .   ? -33.620 9.750  16.146 1.00 23.45  ? 201 V3L C "C1'" 1 
HETATM 4939 O  OP3   . V3L H 3 .   ? -35.652 4.405  15.407 1.00 41.38  ? 201 V3L C OP3   1 
HETATM 4940 O  O1B   . V3L H 3 .   ? -42.209 11.344 13.249 1.00 29.84  ? 201 V3L C O1B   1 
HETATM 4941 C  C12   . V3L H 3 .   ? -37.501 12.162 15.021 1.00 22.79  ? 201 V3L C C12   1 
HETATM 4942 O  O12   . V3L H 3 .   ? -36.442 13.106 14.906 1.00 26.73  ? 201 V3L C O12   1 
HETATM 4943 C  "C2'" . V3L H 3 .   ? -35.123 9.528  16.037 1.00 27.19  ? 201 V3L C "C2'" 1 
HETATM 4944 O  "O2'" . V3L H 3 .   ? -35.859 10.732 15.993 1.00 28.05  ? 201 V3L C "O2'" 1 
HETATM 4945 O  OP1   . V3L H 3 .   ? -35.137 5.580  13.220 1.00 38.44  ? 201 V3L C OP1   1 
HETATM 4946 O  O2B   . V3L H 3 .   ? -41.083 9.181  13.820 1.00 37.54  ? 201 V3L C O2B   1 
HETATM 4947 C  C13   . V3L H 3 .   ? -38.314 12.293 16.293 1.00 23.34  ? 201 V3L C C13   1 
HETATM 4948 O  O13   . V3L H 3 .   ? -37.577 12.876 17.371 1.00 26.60  ? 201 V3L C O13   1 
HETATM 4949 C  "C3'" . V3L H 3 .   ? -35.438 8.696  17.264 1.00 26.13  ? 201 V3L C "C3'" 1 
HETATM 4950 O  "O3'" . V3L H 3 .   ? -35.651 9.475  18.433 1.00 28.29  ? 201 V3L C "O3'" 1 
HETATM 4951 O  OP2   . V3L H 3 .   ? -33.265 4.639  14.579 1.00 31.15  ? 201 V3L C OP2   1 
HETATM 4952 O  O3B   . V3L H 3 .   ? -42.896 10.179 15.313 1.00 31.18  ? 201 V3L C O3B   1 
HETATM 4953 C  C14   . V3L H 3 .   ? -38.744 10.852 16.613 1.00 26.93  ? 201 V3L C C14   1 
HETATM 4954 O  O14   . V3L H 3 .   ? -38.073 9.997  15.674 1.00 25.28  ? 201 V3L C O14   1 
HETATM 4955 C  "C4'" . V3L H 3 .   ? -34.171 7.878  17.453 1.00 32.11  ? 201 V3L C "C4'" 1 
HETATM 4956 O  "O4'" . V3L H 3 .   ? -33.113 8.594  16.820 1.00 29.24  ? 201 V3L C "O4'" 1 
HETATM 4957 C  C15   . V3L H 3 .   ? -40.259 10.674 16.504 1.00 29.55  ? 201 V3L C C15   1 
HETATM 4958 O  O15   . V3L H 3 .   ? -40.711 11.176 15.238 1.00 31.98  ? 201 V3L C O15   1 
HETATM 4959 C  "C5'" . V3L H 3 .   ? -34.302 6.489  16.835 1.00 29.56  ? 201 V3L C "C5'" 1 
HETATM 4960 O  "O5'" . V3L H 3 .   ? -34.590 6.556  15.433 1.00 30.83  ? 201 V3L C "O5'" 1 
HETATM 4961 ZN ZN    . ZN  I 4 .   ? -22.708 18.914 20.408 1.00 28.27  ? 202 ZN  C ZN    1 
HETATM 4962 ZN ZN    . ZN  J 4 .   ? -25.514 22.557 33.793 1.00 32.89  ? 203 ZN  C ZN    1 
HETATM 4963 O  O     . HOH K 5 .   ? 45.869  19.916 18.257 1.00 32.70  ? 301 HOH A O     1 
HETATM 4964 O  O     . HOH K 5 .   ? 54.849  15.546 30.513 1.00 29.71  ? 302 HOH A O     1 
HETATM 4965 O  O     . HOH K 5 .   ? 51.414  16.435 13.088 1.00 40.65  ? 303 HOH A O     1 
HETATM 4966 O  O     . HOH K 5 .   ? 48.675  21.036 29.959 1.00 25.87  ? 304 HOH A O     1 
HETATM 4967 O  O     . HOH K 5 .   ? 53.978  6.790  36.171 1.00 40.37  ? 305 HOH A O     1 
HETATM 4968 O  O     . HOH K 5 .   ? 51.168  17.048 35.522 1.00 32.34  ? 306 HOH A O     1 
HETATM 4969 O  O     . HOH K 5 .   ? 42.598  18.285 55.403 1.00 38.15  ? 307 HOH A O     1 
HETATM 4970 O  O     . HOH K 5 .   ? 46.276  15.606 30.344 1.00 35.71  ? 308 HOH A O     1 
HETATM 4971 O  O     . HOH K 5 .   ? 49.278  16.215 19.127 1.00 32.14  ? 309 HOH A O     1 
HETATM 4972 O  O     . HOH K 5 .   ? 41.588  25.432 21.356 1.00 31.20  ? 310 HOH A O     1 
HETATM 4973 O  O     . HOH K 5 .   ? 45.425  18.085 29.579 1.00 35.65  ? 311 HOH A O     1 
HETATM 4974 O  O     . HOH K 5 .   ? 50.393  24.014 12.728 1.00 34.57  ? 312 HOH A O     1 
HETATM 4975 O  O     . HOH K 5 .   ? 44.101  4.891  30.147 1.00 33.59  ? 313 HOH A O     1 
HETATM 4976 O  O     . HOH K 5 .   ? 56.932  7.317  47.586 1.00 44.64  ? 314 HOH A O     1 
HETATM 4977 O  O     . HOH K 5 .   ? 59.291  20.206 26.927 1.00 36.41  ? 315 HOH A O     1 
HETATM 4978 O  O     . HOH K 5 .   ? 45.105  14.205 28.061 1.00 36.37  ? 316 HOH A O     1 
HETATM 4979 O  O     . HOH K 5 .   ? 43.140  16.996 13.109 1.00 30.89  ? 317 HOH A O     1 
HETATM 4980 O  O     . HOH K 5 .   ? 59.534  16.746 28.863 1.00 39.21  ? 318 HOH A O     1 
HETATM 4981 O  O     . HOH K 5 .   ? 41.979  21.413 45.335 1.00 40.36  ? 319 HOH A O     1 
HETATM 4982 O  O     . HOH K 5 .   ? 42.757  28.106 19.505 1.00 38.49  ? 320 HOH A O     1 
HETATM 4983 O  O     . HOH K 5 .   ? 46.870  17.376 18.112 1.00 33.01  ? 321 HOH A O     1 
HETATM 4984 O  O     . HOH K 5 .   ? 60.177  22.479 27.592 1.00 39.64  ? 322 HOH A O     1 
HETATM 4985 O  O     . HOH K 5 .   ? 50.635  24.411 36.004 1.00 40.12  ? 323 HOH A O     1 
HETATM 4986 O  O     . HOH K 5 .   ? 48.386  31.750 19.221 1.00 41.99  ? 324 HOH A O     1 
HETATM 4987 O  O     . HOH K 5 .   ? 51.692  21.464 42.197 1.00 38.55  ? 325 HOH A O     1 
HETATM 4988 O  O     . HOH K 5 .   ? 64.464  18.484 41.493 1.00 38.28  ? 326 HOH A O     1 
HETATM 4989 O  O     . HOH K 5 .   ? 46.084  3.668  31.854 1.00 39.47  ? 327 HOH A O     1 
HETATM 4990 O  O     . HOH K 5 .   ? 50.170  8.563  53.145 1.00 56.53  ? 328 HOH A O     1 
HETATM 4991 O  O     . HOH K 5 .   ? 48.907  6.377  54.654 1.00 56.59  ? 329 HOH A O     1 
HETATM 4992 O  O     . HOH K 5 .   ? 65.551  14.395 31.615 1.00 55.66  ? 330 HOH A O     1 
HETATM 4993 O  O     . HOH K 5 .   ? 37.761  24.668 32.833 1.00 45.39  ? 331 HOH A O     1 
HETATM 4994 O  O     . HOH K 5 .   ? 51.581  29.251 28.204 1.00 39.52  ? 332 HOH A O     1 
HETATM 4995 O  O     . HOH K 5 .   ? 57.314  16.096 26.732 1.00 35.59  ? 333 HOH A O     1 
HETATM 4996 O  O     . HOH K 5 .   ? 42.481  12.586 12.838 1.00 43.40  ? 334 HOH A O     1 
HETATM 4997 O  O     . HOH K 5 .   ? 44.752  15.168 12.797 1.00 42.96  ? 335 HOH A O     1 
HETATM 4998 O  O     . HOH K 5 .   ? 66.785  9.488  38.655 1.00 48.60  ? 336 HOH A O     1 
HETATM 4999 O  O     . HOH K 5 .   ? 67.451  18.704 37.534 1.00 63.79  ? 337 HOH A O     1 
HETATM 5000 O  O     . HOH K 5 .   ? 51.646  23.425 38.895 1.00 39.59  ? 338 HOH A O     1 
HETATM 5001 O  O     . HOH K 5 .   ? 45.487  18.836 33.574 1.00 46.51  ? 339 HOH A O     1 
HETATM 5002 O  O     . HOH K 5 .   ? 46.390  19.901 31.208 1.00 38.60  ? 340 HOH A O     1 
HETATM 5003 O  O     . HOH K 5 .   ? 42.738  19.774 30.773 1.00 48.07  ? 341 HOH A O     1 
HETATM 5004 O  O     . HOH K 5 .   ? 48.473  27.008 32.984 1.00 49.30  ? 342 HOH A O     1 
HETATM 5005 O  O     . HOH K 5 .   ? 41.349  19.660 39.070 1.00 47.85  ? 343 HOH A O     1 
HETATM 5006 O  O     . HOH K 5 .   ? 44.779  11.024 51.649 1.00 45.08  ? 344 HOH A O     1 
HETATM 5007 O  O     . HOH K 5 .   ? 45.142  18.855 54.211 1.00 48.32  ? 345 HOH A O     1 
HETATM 5008 O  O     . HOH K 5 .   ? 42.802  15.460 26.831 1.00 37.89  ? 346 HOH A O     1 
HETATM 5009 O  O     . HOH K 5 .   ? 37.695  16.643 28.937 1.00 40.03  ? 347 HOH A O     1 
HETATM 5010 O  O     . HOH K 5 .   ? 38.100  38.670 33.087 1.00 44.41  ? 348 HOH A O     1 
HETATM 5011 O  O     . HOH K 5 .   ? 38.775  20.464 35.398 1.00 52.12  ? 349 HOH A O     1 
HETATM 5012 O  O     . HOH K 5 .   ? 58.741  19.129 11.839 1.00 48.89  ? 350 HOH A O     1 
HETATM 5013 O  O     . HOH K 5 .   ? 49.647  26.959 35.578 1.00 53.86  ? 351 HOH A O     1 
HETATM 5014 O  O     . HOH K 5 .   ? 60.897  6.894  37.092 1.00 59.45  ? 352 HOH A O     1 
HETATM 5015 O  O     . HOH K 5 .   ? 62.098  8.598  34.947 1.00 54.83  ? 353 HOH A O     1 
HETATM 5016 O  O     . HOH K 5 .   ? 44.619  15.774 35.254 1.00 46.65  ? 354 HOH A O     1 
HETATM 5017 O  O     . HOH K 5 .   ? 57.746  5.306  34.769 1.00 55.62  ? 355 HOH A O     1 
HETATM 5018 O  O     . HOH K 5 .   ? 54.621  27.363 17.199 1.00 48.74  ? 356 HOH A O     1 
HETATM 5019 O  O     . HOH K 5 .   ? 64.604  19.404 44.817 1.00 38.61  ? 357 HOH A O     1 
HETATM 5020 O  O     . HOH K 5 .   ? 52.190  18.600 5.843  1.00 51.55  ? 358 HOH A O     1 
HETATM 5021 O  O     . HOH K 5 .   ? 63.459  18.046 46.815 1.00 37.52  ? 359 HOH A O     1 
HETATM 5022 O  O     . HOH K 5 .   ? 57.948  27.688 49.331 1.00 42.51  ? 360 HOH A O     1 
HETATM 5023 O  O     . HOH K 5 .   ? 39.230  14.136 45.162 1.00 43.61  ? 361 HOH A O     1 
HETATM 5024 O  O     . HOH K 5 .   ? 50.744  25.326 10.287 1.00 42.59  ? 362 HOH A O     1 
HETATM 5025 O  O     . HOH K 5 .   ? 51.133  21.727 7.656  1.00 38.29  ? 363 HOH A O     1 
HETATM 5026 O  O     . HOH K 5 .   ? 41.414  13.944 35.159 1.00 44.90  ? 364 HOH A O     1 
HETATM 5027 O  O     . HOH K 5 .   ? 39.842  6.320  49.797 1.00 46.80  ? 365 HOH A O     1 
HETATM 5028 O  O     . HOH K 5 .   ? 38.399  32.108 27.871 1.00 41.76  ? 366 HOH A O     1 
HETATM 5029 O  O     . HOH K 5 .   ? 36.799  25.223 22.780 1.00 48.07  ? 367 HOH A O     1 
HETATM 5030 O  O     . HOH K 5 .   ? 51.620  28.800 31.301 1.00 53.09  ? 368 HOH A O     1 
HETATM 5031 O  O     . HOH K 5 .   ? 46.429  28.695 32.332 1.00 49.65  ? 369 HOH A O     1 
HETATM 5032 O  O     . HOH K 5 .   ? 44.512  27.266 10.273 1.00 44.19  ? 370 HOH A O     1 
HETATM 5033 O  O     . HOH K 5 .   ? 53.308  29.635 16.851 1.00 59.20  ? 371 HOH A O     1 
HETATM 5034 O  O     . HOH K 5 .   ? 69.822  13.901 41.211 1.00 49.64  ? 372 HOH A O     1 
HETATM 5035 O  O     . HOH K 5 .   ? 41.023  17.580 37.387 1.00 53.44  ? 373 HOH A O     1 
HETATM 5036 O  O     . HOH K 5 .   ? 39.381  20.781 42.647 1.00 51.08  ? 374 HOH A O     1 
HETATM 5037 O  O     . HOH K 5 .   ? 39.030  8.591  36.152 1.00 54.28  ? 375 HOH A O     1 
HETATM 5038 O  O     . HOH K 5 .   ? 43.825  8.762  24.093 1.00 43.33  ? 376 HOH A O     1 
HETATM 5039 O  O     . HOH K 5 .   ? 52.086  21.179 51.730 1.00 47.21  ? 377 HOH A O     1 
HETATM 5040 O  O     . HOH K 5 .   ? 54.342  21.094 53.511 1.00 55.28  ? 378 HOH A O     1 
HETATM 5041 O  O     . HOH K 5 .   ? 62.080  20.567 51.285 1.00 53.56  ? 379 HOH A O     1 
HETATM 5042 O  O     . HOH K 5 .   ? 62.347  26.495 42.662 1.00 46.57  ? 380 HOH A O     1 
HETATM 5043 O  O     . HOH K 5 .   ? 64.669  24.615 39.966 1.00 41.85  ? 381 HOH A O     1 
HETATM 5044 O  O     . HOH K 5 .   ? 44.786  13.808 24.523 1.00 37.45  ? 382 HOH A O     1 
HETATM 5045 O  O     . HOH L 5 .   ? 7.902   11.810 10.618 1.00 27.69  ? 201 HOH B O     1 
HETATM 5046 O  O     . HOH L 5 .   ? 12.959  11.673 4.176  1.00 27.64  ? 202 HOH B O     1 
HETATM 5047 O  O     . HOH L 5 .   ? 8.098   13.901 8.753  1.00 27.81  ? 203 HOH B O     1 
HETATM 5048 O  O     . HOH L 5 .   ? 27.257  17.910 24.125 1.00 32.32  ? 204 HOH B O     1 
HETATM 5049 O  O     . HOH L 5 .   ? 14.744  8.153  9.602  1.00 43.11  ? 205 HOH B O     1 
HETATM 5050 O  O     . HOH L 5 .   ? 12.640  22.175 25.533 1.00 34.58  ? 206 HOH B O     1 
HETATM 5051 O  O     . HOH L 5 .   ? 39.950  14.892 27.100 1.00 28.31  ? 207 HOH B O     1 
HETATM 5052 O  O     . HOH L 5 .   ? 24.661  6.496  15.648 1.00 30.23  ? 208 HOH B O     1 
HETATM 5053 O  O     . HOH L 5 .   ? 26.720  11.097 11.532 1.00 27.36  ? 209 HOH B O     1 
HETATM 5054 O  O     . HOH L 5 .   ? 13.525  8.941  7.183  1.00 36.73  ? 210 HOH B O     1 
HETATM 5055 O  O     . HOH L 5 .   ? 8.082   8.697  17.758 1.00 36.86  ? 211 HOH B O     1 
HETATM 5056 O  O     . HOH L 5 .   ? 29.509  11.563 11.534 1.00 31.06  ? 212 HOH B O     1 
HETATM 5057 O  O     . HOH L 5 .   ? 3.544   18.174 12.690 1.00 32.52  ? 213 HOH B O     1 
HETATM 5058 O  O     . HOH L 5 .   ? 27.878  19.545 26.303 1.00 29.92  ? 214 HOH B O     1 
HETATM 5059 O  O     . HOH L 5 .   ? 15.452  20.177 26.695 1.00 37.41  ? 215 HOH B O     1 
HETATM 5060 O  O     . HOH L 5 .   ? 22.877  19.607 4.807  1.00 36.77  ? 216 HOH B O     1 
HETATM 5061 O  O     . HOH L 5 .   ? 35.591  14.726 32.194 1.00 36.16  ? 217 HOH B O     1 
HETATM 5062 O  O     . HOH L 5 .   ? 23.984  10.116 9.813  1.00 36.38  ? 218 HOH B O     1 
HETATM 5063 O  O     . HOH L 5 .   ? 12.667  9.507  2.635  1.00 34.96  ? 219 HOH B O     1 
HETATM 5064 O  O     . HOH L 5 .   ? 27.768  22.842 24.062 1.00 39.91  ? 220 HOH B O     1 
HETATM 5065 O  O     . HOH L 5 .   ? 16.898  9.917  24.242 1.00 36.90  ? 221 HOH B O     1 
HETATM 5066 O  O     . HOH L 5 .   ? 23.573  14.783 -0.393 1.00 32.24  ? 222 HOH B O     1 
HETATM 5067 O  O     . HOH L 5 .   ? -0.587  9.330  15.315 1.00 33.42  ? 223 HOH B O     1 
HETATM 5068 O  O     . HOH L 5 .   ? 30.384  20.693 26.642 1.00 37.14  ? 224 HOH B O     1 
HETATM 5069 O  O     . HOH L 5 .   ? 36.547  4.856  16.339 1.00 36.46  ? 225 HOH B O     1 
HETATM 5070 O  O     . HOH L 5 .   ? 25.178  16.965 34.973 1.00 39.80  ? 226 HOH B O     1 
HETATM 5071 O  O     . HOH L 5 .   ? 25.042  21.357 6.005  1.00 34.54  ? 227 HOH B O     1 
HETATM 5072 O  O     . HOH L 5 .   ? 36.974  23.412 5.754  1.00 39.63  ? 228 HOH B O     1 
HETATM 5073 O  O     . HOH L 5 .   ? 22.643  13.245 -2.438 1.00 34.77  ? 229 HOH B O     1 
HETATM 5074 O  O     . HOH L 5 .   ? 23.814  21.663 26.324 1.00 36.74  ? 230 HOH B O     1 
HETATM 5075 O  O     . HOH L 5 .   ? 26.384  21.710 26.634 1.00 34.75  ? 231 HOH B O     1 
HETATM 5076 O  O     . HOH L 5 .   ? 25.827  11.876 9.124  1.00 38.08  ? 232 HOH B O     1 
HETATM 5077 O  O     . HOH L 5 .   ? 24.972  14.395 34.213 1.00 36.46  ? 233 HOH B O     1 
HETATM 5078 O  O     . HOH L 5 .   ? 17.284  11.171 26.495 1.00 40.75  ? 234 HOH B O     1 
HETATM 5079 O  O     . HOH L 5 .   ? 6.639   21.564 19.408 1.00 46.41  ? 235 HOH B O     1 
HETATM 5080 O  O     . HOH L 5 .   ? 33.955  3.941  19.773 1.00 41.92  ? 236 HOH B O     1 
HETATM 5081 O  O     . HOH L 5 .   ? 32.232  1.947  21.547 1.00 40.46  ? 237 HOH B O     1 
HETATM 5082 O  O     . HOH L 5 .   ? 12.156  7.739  4.982  1.00 38.53  ? 238 HOH B O     1 
HETATM 5083 O  O     . HOH L 5 .   ? 10.849  3.744  5.562  1.00 51.55  ? 239 HOH B O     1 
HETATM 5084 O  O     . HOH L 5 .   ? 14.766  8.005  1.849  1.00 38.98  ? 240 HOH B O     1 
HETATM 5085 O  O     . HOH L 5 .   ? 19.336  8.635  0.207  1.00 36.29  ? 241 HOH B O     1 
HETATM 5086 O  O     . HOH L 5 .   ? 15.458  5.382  10.238 1.00 48.45  ? 242 HOH B O     1 
HETATM 5087 O  O     . HOH L 5 .   ? 30.325  20.943 2.807  1.00 40.21  ? 243 HOH B O     1 
HETATM 5088 O  O     . HOH L 5 .   ? 19.412  18.170 34.958 1.00 43.28  ? 244 HOH B O     1 
HETATM 5089 O  O     . HOH L 5 .   ? 16.378  22.967 27.533 1.00 37.15  ? 245 HOH B O     1 
HETATM 5090 O  O     . HOH L 5 .   ? 29.617  12.775 33.048 1.00 37.01  ? 246 HOH B O     1 
HETATM 5091 O  O     . HOH L 5 .   ? 27.284  12.928 34.303 1.00 41.00  ? 247 HOH B O     1 
HETATM 5092 O  O     . HOH L 5 .   ? 32.887  16.096 33.829 1.00 45.42  ? 248 HOH B O     1 
HETATM 5093 O  O     . HOH L 5 .   ? 26.339  23.364 31.046 1.00 43.36  ? 249 HOH B O     1 
HETATM 5094 O  O     . HOH L 5 .   ? 19.181  25.544 23.642 1.00 30.68  ? 250 HOH B O     1 
HETATM 5095 O  O     . HOH L 5 .   ? 11.003  26.936 16.461 1.00 55.95  ? 251 HOH B O     1 
HETATM 5096 O  O     . HOH L 5 .   ? 9.630   23.084 8.975  1.00 42.24  ? 252 HOH B O     1 
HETATM 5097 O  O     . HOH L 5 .   ? 24.827  4.235  17.914 1.00 50.71  ? 253 HOH B O     1 
HETATM 5098 O  O     . HOH L 5 .   ? 38.106  6.820  14.430 1.00 44.96  ? 254 HOH B O     1 
HETATM 5099 O  O     . HOH L 5 .   ? 31.269  9.745  10.742 1.00 40.86  ? 255 HOH B O     1 
HETATM 5100 O  O     . HOH L 5 .   ? 9.245   5.772  12.419 1.00 41.62  ? 256 HOH B O     1 
HETATM 5101 O  O     . HOH L 5 .   ? 11.057  9.107  0.386  1.00 45.02  ? 257 HOH B O     1 
HETATM 5102 O  O     . HOH L 5 .   ? 30.246  23.280 4.121  1.00 40.95  ? 258 HOH B O     1 
HETATM 5103 O  O     . HOH L 5 .   ? 30.806  25.794 3.649  1.00 40.88  ? 259 HOH B O     1 
HETATM 5104 O  O     . HOH L 5 .   ? 24.836  24.467 16.778 1.00 40.85  ? 260 HOH B O     1 
HETATM 5105 O  O     . HOH L 5 .   ? 21.751  23.255 10.436 1.00 43.57  ? 261 HOH B O     1 
HETATM 5106 O  O     . HOH L 5 .   ? 9.891   26.217 9.818  1.00 49.68  ? 262 HOH B O     1 
HETATM 5107 O  O     . HOH L 5 .   ? 17.154  17.424 -5.883 1.00 44.95  ? 263 HOH B O     1 
HETATM 5108 O  O     . HOH L 5 .   ? 18.512  20.038 -5.174 1.00 46.55  ? 264 HOH B O     1 
HETATM 5109 O  O     . HOH L 5 .   ? 3.269   25.818 -2.383 1.00 50.25  ? 265 HOH B O     1 
HETATM 5110 O  O     . HOH L 5 .   ? 0.335   7.225  17.065 1.00 49.57  ? 266 HOH B O     1 
HETATM 5111 O  O     . HOH L 5 .   ? 3.721   6.276  15.202 1.00 57.91  ? 267 HOH B O     1 
HETATM 5112 O  O     . HOH L 5 .   ? 31.750  18.330 3.726  1.00 17.92  ? 268 HOH B O     1 
HETATM 5113 O  O     . HOH L 5 .   ? 12.426  25.244 24.669 1.00 54.39  ? 269 HOH B O     1 
HETATM 5114 O  O     . HOH L 5 .   ? 35.357  15.007 9.672  1.00 40.58  ? 270 HOH B O     1 
HETATM 5115 O  O     . HOH L 5 .   ? 35.986  24.132 10.717 1.00 57.41  ? 271 HOH B O     1 
HETATM 5116 O  O     . HOH L 5 .   ? 36.156  25.647 7.077  1.00 44.00  ? 272 HOH B O     1 
HETATM 5117 O  O     . HOH L 5 .   ? 24.732  26.280 21.386 1.00 44.25  ? 273 HOH B O     1 
HETATM 5118 O  O     . HOH L 5 .   ? 5.634   6.733  17.649 1.00 58.45  ? 274 HOH B O     1 
HETATM 5119 O  O     . HOH L 5 .   ? 3.798   10.346 1.109  1.00 47.78  ? 275 HOH B O     1 
HETATM 5120 O  O     . HOH L 5 .   ? 40.884  8.799  23.088 1.00 36.32  ? 276 HOH B O     1 
HETATM 5121 O  O     . HOH L 5 .   ? 10.547  6.158  16.233 1.00 43.89  ? 277 HOH B O     1 
HETATM 5122 O  O     . HOH L 5 .   ? 31.882  3.937  29.405 1.00 40.85  ? 278 HOH B O     1 
HETATM 5123 O  O     . HOH L 5 .   ? 24.962  -0.174 28.008 1.00 53.21  ? 279 HOH B O     1 
HETATM 5124 O  O     . HOH L 5 .   ? 33.958  24.744 22.268 1.00 45.40  ? 280 HOH B O     1 
HETATM 5125 O  O     . HOH L 5 .   ? 36.771  17.807 9.999  1.00 41.75  ? 281 HOH B O     1 
HETATM 5126 O  O     . HOH L 5 .   ? 32.475  24.628 31.437 1.00 57.02  ? 282 HOH B O     1 
HETATM 5127 O  O     . HOH L 5 .   ? 26.024  24.137 9.295  1.00 49.37  ? 283 HOH B O     1 
HETATM 5128 O  O     . HOH L 5 .   ? 22.275  5.772  4.074  1.00 50.02  ? 284 HOH B O     1 
HETATM 5129 O  O     . HOH L 5 .   ? 18.935  4.198  11.799 1.00 43.31  ? 285 HOH B O     1 
HETATM 5130 O  O     . HOH L 5 .   ? 37.804  24.261 13.566 1.00 42.84  ? 286 HOH B O     1 
HETATM 5131 O  O     . HOH L 5 .   ? 37.266  6.930  34.425 1.00 49.12  ? 287 HOH B O     1 
HETATM 5132 O  O     . HOH L 5 .   ? 43.903  4.997  27.218 1.00 46.43  ? 288 HOH B O     1 
HETATM 5133 O  O     . HOH L 5 .   ? 30.899  0.757  23.887 1.00 51.00  ? 289 HOH B O     1 
HETATM 5134 O  O     . HOH L 5 .   ? 11.032  25.515 5.550  1.00 44.07  ? 290 HOH B O     1 
HETATM 5135 O  O     . HOH L 5 .   ? 8.179   5.642  2.037  1.00 58.66  ? 291 HOH B O     1 
HETATM 5136 O  O     . HOH L 5 .   ? 33.066  26.971 16.657 1.00 54.43  ? 292 HOH B O     1 
HETATM 5137 O  O     . HOH L 5 .   ? 24.869  23.867 22.838 1.00 47.22  ? 293 HOH B O     1 
HETATM 5138 O  O     . HOH L 5 .   ? 16.465  27.114 11.427 1.00 47.48  ? 294 HOH B O     1 
HETATM 5139 O  O     . HOH L 5 .   ? 19.357  25.116 6.892  1.00 59.85  ? 295 HOH B O     1 
HETATM 5140 O  O     . HOH L 5 .   ? 26.834  21.277 1.194  1.00 42.34  ? 296 HOH B O     1 
HETATM 5141 O  O     . HOH L 5 .   ? 9.618   15.186 -6.713 1.00 45.46  ? 297 HOH B O     1 
HETATM 5142 O  O     . HOH L 5 .   ? 2.017   25.402 3.844  1.00 57.27  ? 298 HOH B O     1 
HETATM 5143 O  O     . HOH L 5 .   ? 0.300   14.331 -2.647 1.00 59.90  ? 299 HOH B O     1 
HETATM 5144 O  O     . HOH L 5 .   ? 1.997   11.971 2.942  1.00 48.18  ? 300 HOH B O     1 
HETATM 5145 O  O     . HOH L 5 .   ? 1.155   9.781  4.411  1.00 48.56  ? 301 HOH B O     1 
HETATM 5146 O  O     . HOH L 5 .   ? 1.673   7.382  20.241 1.00 43.27  ? 302 HOH B O     1 
HETATM 5147 O  O     . HOH M 5 .   ? -34.270 13.686 16.689 1.00 22.89  ? 301 HOH C O     1 
HETATM 5148 O  O     . HOH M 5 .   ? -28.302 19.033 17.314 1.00 23.38  ? 302 HOH C O     1 
HETATM 5149 O  O     . HOH M 5 .   ? -33.792 5.244  10.816 1.00 28.56  ? 303 HOH C O     1 
HETATM 5150 O  O     . HOH M 5 .   ? -30.785 15.286 11.531 1.00 26.47  ? 304 HOH C O     1 
HETATM 5151 O  O     . HOH M 5 .   ? -40.016 20.133 19.584 1.00 29.28  ? 305 HOH C O     1 
HETATM 5152 O  O     . HOH M 5 .   ? -21.563 23.363 26.324 1.00 27.15  ? 306 HOH C O     1 
HETATM 5153 O  O     . HOH M 5 .   ? -34.663 24.654 30.139 1.00 33.45  ? 307 HOH C O     1 
HETATM 5154 O  O     . HOH M 5 .   ? -44.565 18.402 14.042 1.00 38.47  ? 308 HOH C O     1 
HETATM 5155 O  O     . HOH M 5 .   ? -28.403 25.552 14.527 1.00 33.85  ? 309 HOH C O     1 
HETATM 5156 O  O     . HOH M 5 .   ? -40.677 19.391 -5.489 1.00 58.36  ? 310 HOH C O     1 
HETATM 5157 O  O     . HOH M 5 .   ? -36.671 5.731  -0.544 1.00 35.73  ? 311 HOH C O     1 
HETATM 5158 O  O     . HOH M 5 .   ? -17.081 15.217 18.329 1.00 31.89  ? 312 HOH C O     1 
HETATM 5159 O  O     . HOH M 5 .   ? -30.113 22.626 11.240 1.00 33.81  ? 313 HOH C O     1 
HETATM 5160 O  O     . HOH M 5 .   ? -25.193 17.038 13.711 1.00 38.96  ? 314 HOH C O     1 
HETATM 5161 O  O     . HOH M 5 .   ? -30.386 23.638 3.245  1.00 43.79  ? 315 HOH C O     1 
HETATM 5162 O  O     . HOH M 5 .   ? -44.084 16.606 5.838  1.00 32.00  ? 316 HOH C O     1 
HETATM 5163 O  O     . HOH M 5 .   ? -30.480 21.372 34.456 1.00 35.97  ? 317 HOH C O     1 
HETATM 5164 O  O     . HOH M 5 .   ? -21.843 17.792 16.616 1.00 38.90  ? 318 HOH C O     1 
HETATM 5165 O  O     . HOH M 5 .   ? -39.193 14.833 18.475 1.00 31.59  ? 319 HOH C O     1 
HETATM 5166 O  O     . HOH M 5 .   ? -30.352 7.762  17.541 1.00 32.36  ? 320 HOH C O     1 
HETATM 5167 O  O     . HOH M 5 .   ? -37.102 13.469 20.665 1.00 40.31  ? 321 HOH C O     1 
HETATM 5168 O  O     . HOH M 5 .   ? -23.487 3.225  16.739 1.00 33.51  ? 322 HOH C O     1 
HETATM 5169 O  O     . HOH M 5 .   ? -24.394 12.287 18.853 1.00 37.82  ? 323 HOH C O     1 
HETATM 5170 O  O     . HOH M 5 .   ? -28.827 14.014 28.048 1.00 35.91  ? 324 HOH C O     1 
HETATM 5171 O  O     . HOH M 5 .   ? -38.723 17.855 20.329 1.00 30.45  ? 325 HOH C O     1 
HETATM 5172 O  O     . HOH M 5 .   ? -31.517 27.426 19.432 1.00 33.68  ? 326 HOH C O     1 
HETATM 5173 O  O     . HOH M 5 .   ? -32.444 26.157 16.456 1.00 48.18  ? 327 HOH C O     1 
HETATM 5174 O  O     . HOH M 5 .   ? -17.508 8.601  -5.367 1.00 35.29  ? 328 HOH C O     1 
HETATM 5175 O  O     . HOH M 5 .   ? -28.808 29.446 28.366 1.00 40.56  ? 329 HOH C O     1 
HETATM 5176 O  O     . HOH M 5 .   ? -26.526 15.204 29.144 1.00 36.37  ? 330 HOH C O     1 
HETATM 5177 O  O     . HOH M 5 .   ? -22.163 13.907 19.729 1.00 36.92  ? 331 HOH C O     1 
HETATM 5178 O  O     . HOH M 5 .   ? -25.682 13.723 16.771 1.00 30.63  ? 332 HOH C O     1 
HETATM 5179 O  O     . HOH M 5 .   ? -24.942 16.231 17.709 1.00 27.93  ? 333 HOH C O     1 
HETATM 5180 O  O     . HOH M 5 .   ? -25.752 17.709 29.153 1.00 30.56  ? 334 HOH C O     1 
HETATM 5181 O  O     . HOH M 5 .   ? -36.843 22.689 30.713 1.00 38.52  ? 335 HOH C O     1 
HETATM 5182 O  O     . HOH M 5 .   ? -34.797 33.528 18.923 1.00 43.03  ? 336 HOH C O     1 
HETATM 5183 O  O     . HOH M 5 .   ? -30.833 23.689 8.914  1.00 48.56  ? 337 HOH C O     1 
HETATM 5184 O  O     . HOH M 5 .   ? -31.116 19.833 4.911  1.00 34.35  ? 338 HOH C O     1 
HETATM 5185 O  O     . HOH M 5 .   ? -21.818 20.014 1.523  1.00 40.75  ? 339 HOH C O     1 
HETATM 5186 O  O     . HOH M 5 .   ? -18.886 12.716 1.577  1.00 42.48  ? 340 HOH C O     1 
HETATM 5187 O  O     . HOH M 5 .   ? -23.301 6.383  -7.563 1.00 40.79  ? 341 HOH C O     1 
HETATM 5188 O  O     . HOH M 5 .   ? -24.794 9.008  -4.691 1.00 49.13  ? 342 HOH C O     1 
HETATM 5189 O  O     . HOH M 5 .   ? -23.139 4.297  20.277 1.00 49.11  ? 343 HOH C O     1 
HETATM 5190 O  O     . HOH M 5 .   ? -30.937 -0.722 11.478 1.00 40.32  ? 344 HOH C O     1 
HETATM 5191 O  O     . HOH M 5 .   ? -32.485 2.459  12.688 1.00 37.76  ? 345 HOH C O     1 
HETATM 5192 O  O     . HOH M 5 .   ? -25.632 -2.213 9.052  1.00 44.94  ? 346 HOH C O     1 
HETATM 5193 O  O     . HOH M 5 .   ? -32.165 -1.885 9.546  1.00 51.46  ? 347 HOH C O     1 
HETATM 5194 O  O     . HOH M 5 .   ? -25.125 33.241 14.211 1.00 46.34  ? 348 HOH C O     1 
HETATM 5195 O  O     . HOH M 5 .   ? -17.668 23.446 14.714 1.00 33.91  ? 349 HOH C O     1 
HETATM 5196 O  O     . HOH M 5 .   ? -17.067 15.877 15.815 1.00 45.89  ? 350 HOH C O     1 
HETATM 5197 O  O     . HOH M 5 .   ? -31.030 22.848 36.938 1.00 44.29  ? 351 HOH C O     1 
HETATM 5198 O  O     . HOH M 5 .   ? -25.886 18.098 16.078 1.00 35.73  ? 352 HOH C O     1 
HETATM 5199 O  O     . HOH M 5 .   ? -38.193 22.870 28.267 1.00 37.56  ? 353 HOH C O     1 
HETATM 5200 O  O     . HOH M 5 .   ? -30.157 28.405 17.211 1.00 44.16  ? 354 HOH C O     1 
HETATM 5201 O  O     . HOH M 5 .   ? -28.324 30.547 18.755 1.00 46.01  ? 355 HOH C O     1 
HETATM 5202 O  O     . HOH M 5 .   ? -38.838 22.988 19.377 1.00 49.88  ? 356 HOH C O     1 
HETATM 5203 O  O     . HOH M 5 .   ? -30.007 28.285 11.923 1.00 57.53  ? 357 HOH C O     1 
HETATM 5204 O  O     . HOH M 5 .   ? -28.865 24.789 12.170 1.00 42.26  ? 358 HOH C O     1 
HETATM 5205 O  O     . HOH M 5 .   ? -31.368 21.362 7.972  1.00 41.22  ? 359 HOH C O     1 
HETATM 5206 O  O     . HOH M 5 .   ? -46.281 7.761  8.394  1.00 38.40  ? 360 HOH C O     1 
HETATM 5207 O  O     . HOH M 5 .   ? -21.045 18.641 7.772  1.00 48.02  ? 361 HOH C O     1 
HETATM 5208 O  O     . HOH M 5 .   ? -22.310 16.244 -8.608 1.00 39.27  ? 362 HOH C O     1 
HETATM 5209 O  O     . HOH M 5 .   ? -19.329 4.550  -3.319 1.00 35.00  ? 363 HOH C O     1 
HETATM 5210 O  O     . HOH M 5 .   ? -25.384 1.769  15.072 1.00 35.63  ? 364 HOH C O     1 
HETATM 5211 O  O     . HOH M 5 .   ? -38.323 -0.149 9.054  1.00 37.69  ? 365 HOH C O     1 
HETATM 5212 O  O     . HOH M 5 .   ? -38.180 25.931 -1.917 1.00 42.65  ? 366 HOH C O     1 
HETATM 5213 O  O     . HOH M 5 .   ? -33.739 21.658 -5.647 1.00 61.99  ? 367 HOH C O     1 
HETATM 5214 O  O     . HOH M 5 .   ? -40.576 35.128 11.462 1.00 56.28  ? 368 HOH C O     1 
HETATM 5215 O  O     . HOH M 5 .   ? -44.217 23.085 7.404  1.00 38.78  ? 369 HOH C O     1 
HETATM 5216 O  O     . HOH M 5 .   ? -20.370 11.695 11.681 1.00 47.64  ? 370 HOH C O     1 
HETATM 5217 O  O     . HOH M 5 .   ? -23.035 26.047 28.254 1.00 38.75  ? 371 HOH C O     1 
HETATM 5218 O  O     . HOH M 5 .   ? -33.256 17.228 -5.164 1.00 39.54  ? 372 HOH C O     1 
HETATM 5219 O  O     . HOH M 5 .   ? -41.932 20.506 21.444 1.00 48.04  ? 373 HOH C O     1 
HETATM 5220 O  O     . HOH M 5 .   ? -18.463 28.675 23.380 1.00 44.41  ? 374 HOH C O     1 
HETATM 5221 O  O     . HOH M 5 .   ? -37.440 8.564  -0.456 1.00 40.18  ? 375 HOH C O     1 
HETATM 5222 O  O     . HOH M 5 .   ? -20.297 25.769 27.634 1.00 45.41  ? 376 HOH C O     1 
HETATM 5223 O  O     . HOH M 5 .   ? -36.375 14.080 27.804 1.00 46.07  ? 377 HOH C O     1 
HETATM 5224 O  O     . HOH M 5 .   ? -25.969 31.935 20.028 1.00 44.28  ? 378 HOH C O     1 
HETATM 5225 O  O     . HOH M 5 .   ? -44.444 10.087 6.253  1.00 44.72  ? 379 HOH C O     1 
HETATM 5226 O  O     . HOH M 5 .   ? -30.296 33.737 22.139 1.00 53.27  ? 380 HOH C O     1 
HETATM 5227 O  O     . HOH M 5 .   ? -22.937 7.035  22.124 1.00 47.92  ? 381 HOH C O     1 
HETATM 5228 O  O     . HOH M 5 .   ? -18.122 28.958 19.316 1.00 50.51  ? 382 HOH C O     1 
HETATM 5229 O  O     . HOH M 5 .   ? -21.548 32.975 21.452 1.00 55.24  ? 383 HOH C O     1 
HETATM 5230 O  O     . HOH M 5 .   ? -19.246 31.544 21.585 1.00 51.40  ? 384 HOH C O     1 
HETATM 5231 O  O     . HOH M 5 .   ? -30.804 14.062 33.920 1.00 32.43  ? 385 HOH C O     1 
HETATM 5232 O  O     . HOH M 5 .   ? -22.966 14.833 34.354 1.00 41.63  ? 386 HOH C O     1 
HETATM 5233 O  O     . HOH M 5 .   ? -21.759 10.992 34.190 1.00 46.93  ? 387 HOH C O     1 
HETATM 5234 O  O     . HOH M 5 .   ? -30.770 26.882 14.844 1.00 54.16  ? 388 HOH C O     1 
HETATM 5235 O  O     . HOH M 5 .   ? -27.086 20.951 2.854  1.00 50.55  ? 389 HOH C O     1 
HETATM 5236 O  O     . HOH M 5 .   ? -30.086 -0.926 2.382  1.00 45.71  ? 390 HOH C O     1 
HETATM 5237 O  O     . HOH M 5 .   ? -31.275 -2.133 7.039  1.00 53.59  ? 391 HOH C O     1 
HETATM 5238 O  O     . HOH M 5 .   ? -28.284 -1.971 -2.237 1.00 44.59  ? 392 HOH C O     1 
HETATM 5239 O  O     . HOH M 5 .   ? -28.699 -3.360 9.316  1.00 58.86  ? 393 HOH C O     1 
HETATM 5240 O  O     . HOH M 5 .   ? -36.582 -0.008 3.570  1.00 52.52  ? 394 HOH C O     1 
HETATM 5241 O  O     . HOH M 5 .   ? -40.148 3.436  5.661  1.00 52.55  ? 395 HOH C O     1 
HETATM 5242 O  O     . HOH M 5 .   ? -42.514 24.491 4.972  1.00 50.40  ? 396 HOH C O     1 
HETATM 5243 O  O     . HOH M 5 .   ? -45.386 21.564 11.161 1.00 49.67  ? 397 HOH C O     1 
HETATM 5244 O  O     . HOH M 5 .   ? -46.374 17.812 7.900  1.00 56.89  ? 398 HOH C O     1 
HETATM 5245 O  O     . HOH N 5 .   ? 6.087   7.595  37.267 1.00 38.41  ? 201 HOH D O     1 
HETATM 5246 O  O     . HOH N 5 .   ? -5.924  9.830  35.690 1.00 27.59  ? 202 HOH D O     1 
HETATM 5247 O  O     . HOH N 5 .   ? -7.541  18.462 21.211 1.00 31.39  ? 203 HOH D O     1 
HETATM 5248 O  O     . HOH N 5 .   ? 12.802  11.500 36.598 1.00 28.71  ? 204 HOH D O     1 
HETATM 5249 O  O     . HOH N 5 .   ? -7.741  21.801 23.420 1.00 43.44  ? 205 HOH D O     1 
HETATM 5250 O  O     . HOH N 5 .   ? 16.865  18.468 34.779 1.00 32.58  ? 206 HOH D O     1 
HETATM 5251 O  O     . HOH N 5 .   ? -6.935  16.882 23.320 1.00 30.19  ? 207 HOH D O     1 
HETATM 5252 O  O     . HOH N 5 .   ? 7.664   10.841 42.957 1.00 33.14  ? 208 HOH D O     1 
HETATM 5253 O  O     . HOH N 5 .   ? -8.736  10.204 35.604 1.00 31.80  ? 209 HOH D O     1 
HETATM 5254 O  O     . HOH N 5 .   ? -3.132  8.760  37.254 1.00 31.90  ? 210 HOH D O     1 
HETATM 5255 O  O     . HOH N 5 .   ? 4.895   20.024 20.830 1.00 34.03  ? 211 HOH D O     1 
HETATM 5256 O  O     . HOH N 5 .   ? 21.544  9.951  31.922 1.00 32.91  ? 212 HOH D O     1 
HETATM 5257 O  O     . HOH N 5 .   ? 12.533  13.437 38.353 1.00 28.19  ? 213 HOH D O     1 
HETATM 5258 O  O     . HOH N 5 .   ? -19.255 13.306 20.098 1.00 30.31  ? 214 HOH D O     1 
HETATM 5259 O  O     . HOH N 5 .   ? 12.746  8.752  29.434 1.00 38.87  ? 215 HOH D O     1 
HETATM 5260 O  O     . HOH N 5 .   ? -10.296 19.497 20.506 1.00 38.33  ? 216 HOH D O     1 
HETATM 5261 O  O     . HOH N 5 .   ? -4.232  13.744 13.166 1.00 38.31  ? 217 HOH D O     1 
HETATM 5262 O  O     . HOH N 5 .   ? 19.142  15.695 28.441 1.00 32.21  ? 218 HOH D O     1 
HETATM 5263 O  O     . HOH N 5 .   ? 7.242   8.462  39.815 1.00 36.19  ? 219 HOH D O     1 
HETATM 5264 O  O     . HOH N 5 .   ? -2.712  18.515 42.587 1.00 41.85  ? 220 HOH D O     1 
HETATM 5265 O  O     . HOH N 5 .   ? 1.461   15.225 18.867 1.00 31.94  ? 221 HOH D O     1 
HETATM 5266 O  O     . HOH N 5 .   ? -8.798  12.011 14.271 1.00 38.52  ? 222 HOH D O     1 
HETATM 5267 O  O     . HOH N 5 .   ? -4.902  19.712 41.492 1.00 36.12  ? 223 HOH D O     1 
HETATM 5268 O  O     . HOH N 5 .   ? 8.040   8.542  44.356 1.00 38.08  ? 224 HOH D O     1 
HETATM 5269 O  O     . HOH N 5 .   ? 7.678   22.079 21.983 1.00 34.98  ? 225 HOH D O     1 
HETATM 5270 O  O     . HOH N 5 .   ? -12.225 7.739  34.013 1.00 44.96  ? 226 HOH D O     1 
HETATM 5271 O  O     . HOH N 5 .   ? 5.821   5.182  36.735 1.00 49.14  ? 227 HOH D O     1 
HETATM 5272 O  O     . HOH N 5 .   ? 5.831   6.956  45.226 1.00 40.88  ? 228 HOH D O     1 
HETATM 5273 O  O     . HOH N 5 .   ? -3.522  20.847 21.326 1.00 38.57  ? 229 HOH D O     1 
HETATM 5274 O  O     . HOH N 5 .   ? -6.257  21.041 20.857 1.00 36.07  ? 230 HOH D O     1 
HETATM 5275 O  O     . HOH N 5 .   ? -4.693  16.108 12.303 1.00 38.60  ? 231 HOH D O     1 
HETATM 5276 O  O     . HOH N 5 .   ? 3.346   11.126 20.546 1.00 41.31  ? 232 HOH D O     1 
HETATM 5277 O  O     . HOH N 5 .   ? -3.428  5.748  31.559 1.00 39.75  ? 233 HOH D O     1 
HETATM 5278 O  O     . HOH N 5 .   ? -10.477 5.102  31.419 1.00 36.27  ? 234 HOH D O     1 
HETATM 5279 O  O     . HOH N 5 .   ? 8.920   7.092  42.114 1.00 44.72  ? 235 HOH D O     1 
HETATM 5280 O  O     . HOH N 5 .   ? 9.761   8.586  46.603 1.00 46.07  ? 236 HOH D O     1 
HETATM 5281 O  O     . HOH N 5 .   ? 9.957   25.823 38.266 1.00 47.02  ? 237 HOH D O     1 
HETATM 5282 O  O     . HOH N 5 .   ? 19.206  21.045 35.206 1.00 61.71  ? 238 HOH D O     1 
HETATM 5283 O  O     . HOH N 5 .   ? -6.070  22.533 16.538 1.00 44.99  ? 239 HOH D O     1 
HETATM 5284 O  O     . HOH N 5 .   ? 3.868   9.941  22.732 1.00 39.50  ? 240 HOH D O     1 
HETATM 5285 O  O     . HOH N 5 .   ? -5.078  10.546 37.884 1.00 35.00  ? 241 HOH D O     1 
HETATM 5286 O  O     . HOH N 5 .   ? 11.225  4.753  34.472 1.00 43.49  ? 242 HOH D O     1 
HETATM 5287 O  O     . HOH N 5 .   ? 12.899  5.193  32.136 1.00 45.97  ? 243 HOH D O     1 
HETATM 5288 O  O     . HOH N 5 .   ? -12.854 22.026 35.966 1.00 50.12  ? 244 HOH D O     1 
HETATM 5289 O  O     . HOH N 5 .   ? 1.209   24.857 30.921 1.00 42.28  ? 245 HOH D O     1 
HETATM 5290 O  O     . HOH N 5 .   ? 1.187   7.471  46.721 1.00 39.98  ? 246 HOH D O     1 
HETATM 5291 O  O     . HOH N 5 .   ? -11.616 16.915 43.533 1.00 18.93  ? 247 HOH D O     1 
HETATM 5292 O  O     . HOH N 5 .   ? -6.572  20.033 46.316 1.00 45.60  ? 248 HOH D O     1 
HETATM 5293 O  O     . HOH N 5 .   ? -5.986  21.170 43.842 1.00 48.36  ? 249 HOH D O     1 
HETATM 5294 O  O     . HOH N 5 .   ? -6.102  22.742 38.516 1.00 60.59  ? 250 HOH D O     1 
HETATM 5295 O  O     . HOH N 5 .   ? -20.356 6.839  23.691 1.00 35.26  ? 251 HOH D O     1 
HETATM 5296 O  O     . HOH N 5 .   ? 20.964  7.743  30.331 1.00 37.61  ? 252 HOH D O     1 
HETATM 5297 O  O     . HOH N 5 .   ? 11.054  6.266  30.190 1.00 40.06  ? 253 HOH D O     1 
HETATM 5298 O  O     . HOH N 5 .   ? 4.002   22.994 19.881 1.00 40.51  ? 254 HOH D O     1 
HETATM 5299 O  O     . HOH N 5 .   ? 17.126  6.654  31.903 1.00 50.83  ? 255 HOH D O     1 
HETATM 5300 O  O     . HOH N 5 .   ? 13.535  21.220 28.249 1.00 49.52  ? 256 HOH D O     1 
HETATM 5301 O  O     . HOH N 5 .   ? -9.989  19.459 44.358 1.00 42.86  ? 257 HOH D O     1 
HETATM 5302 O  O     . HOH N 5 .   ? 1.236   25.596 24.196 1.00 43.26  ? 258 HOH D O     1 
HETATM 5303 O  O     . HOH N 5 .   ? -4.863  23.046 24.609 1.00 54.35  ? 259 HOH D O     1 
HETATM 5304 O  O     . HOH N 5 .   ? 15.393  6.785  29.537 1.00 56.84  ? 260 HOH D O     1 
HETATM 5305 O  O     . HOH N 5 .   ? -5.267  22.481 36.042 1.00 43.88  ? 261 HOH D O     1 
HETATM 5306 O  O     . HOH N 5 .   ? -14.293 23.316 16.615 1.00 46.93  ? 262 HOH D O     1 
HETATM 5307 O  O     . HOH N 5 .   ? 0.847   17.885 12.636 1.00 41.74  ? 263 HOH D O     1 
HETATM 5308 O  O     . HOH N 5 .   ? -4.613  23.583 30.721 1.00 40.90  ? 264 HOH D O     1 
HETATM 5309 O  O     . HOH N 5 .   ? 14.945  8.569  27.375 1.00 52.42  ? 265 HOH D O     1 
HETATM 5310 O  O     . HOH N 5 .   ? -1.526  22.086 37.231 1.00 39.64  ? 266 HOH D O     1 
HETATM 5311 O  O     . HOH N 5 .   ? -1.198  4.659  42.842 1.00 41.87  ? 267 HOH D O     1 
HETATM 5312 O  O     . HOH N 5 .   ? -14.629 13.556 14.969 1.00 38.05  ? 268 HOH D O     1 
HETATM 5313 O  O     . HOH N 5 .   ? -15.214 2.934  30.822 1.00 40.69  ? 269 HOH D O     1 
HETATM 5314 O  O     . HOH N 5 .   ? 19.266  7.305  27.053 1.00 46.16  ? 270 HOH D O     1 
HETATM 5315 O  O     . HOH N 5 .   ? -0.881  4.411  37.548 1.00 45.20  ? 271 HOH D O     1 
HETATM 5316 O  O     . HOH N 5 .   ? -2.889  24.576 32.538 1.00 41.97  ? 272 HOH D O     1 
HETATM 5317 O  O     . HOH N 5 .   ? -1.845  24.749 23.279 1.00 42.50  ? 273 HOH D O     1 
HETATM 5318 O  O     . HOH N 5 .   ? 10.212  20.888 23.747 1.00 29.77  ? 274 HOH D O     1 
HETATM 5319 O  O     . HOH N 5 .   ? 7.861   24.639 22.688 1.00 55.64  ? 275 HOH D O     1 
HETATM 5320 O  O     . HOH N 5 .   ? 5.678   9.362  19.720 1.00 47.20  ? 276 HOH D O     1 
HETATM 5321 O  O     . HOH N 5 .   ? -24.838 0.300  22.658 1.00 52.66  ? 277 HOH D O     1 
HETATM 5322 O  O     . HOH N 5 .   ? -23.535 4.932  23.440 1.00 50.55  ? 278 HOH D O     1 
HETATM 5323 O  O     . HOH N 5 .   ? -20.271 9.401  25.736 1.00 50.53  ? 279 HOH D O     1 
HETATM 5324 O  O     . HOH N 5 .   ? -9.438  9.570  13.991 1.00 48.52  ? 280 HOH D O     1 
HETATM 5325 O  O     . HOH N 5 .   ? -12.549 15.341 13.505 1.00 57.55  ? 281 HOH D O     1 
HETATM 5326 O  O     . HOH N 5 .   ? -11.280 22.004 21.673 1.00 46.35  ? 282 HOH D O     1 
HETATM 5327 O  O     . HOH N 5 .   ? -7.389  22.961 19.400 1.00 60.52  ? 283 HOH D O     1 
HETATM 5328 O  O     . HOH N 5 .   ? 10.033  26.117 35.358 1.00 54.41  ? 284 HOH D O     1 
HETATM 5329 O  O     . HOH N 5 .   ? -20.498 3.864  28.664 1.00 43.99  ? 285 HOH D O     1 
HETATM 5330 O  O     . HOH N 5 .   ? -6.699  10.353 41.311 1.00 52.49  ? 286 HOH D O     1 
HETATM 5331 O  O     . HOH N 5 .   ? -16.462 21.399 37.962 1.00 52.49  ? 287 HOH D O     1 
HETATM 5332 O  O     . HOH N 5 .   ? 3.308   26.352 36.629 1.00 43.99  ? 288 HOH D O     1 
HETATM 5333 O  O     . HOH N 5 .   ? 16.516  10.705 46.478 1.00 53.54  ? 289 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 2   ? 1.2559 0.4307 0.8347 0.1221  -0.1662 0.0338  30  SER A N   
2    C CA  . SER A 2   ? 1.2242 0.4428 0.8146 0.1630  -0.1497 0.0162  30  SER A CA  
3    C C   . SER A 2   ? 1.2622 0.4415 0.8265 0.1573  -0.1581 0.0007  30  SER A C   
4    O O   . SER A 2   ? 1.1927 0.3903 0.7819 0.1136  -0.1588 0.0036  30  SER A O   
5    C CB  . SER A 2   ? 1.1241 0.4599 0.7895 0.1552  -0.1233 0.0203  30  SER A CB  
6    O OG  . SER A 2   ? 1.1067 0.4878 0.7824 0.1909  -0.1090 0.0077  30  SER A OG  
7    N N   . LEU A 3   ? 1.3302 0.4588 0.8425 0.2041  -0.1642 -0.0154 31  LEU A N   
8    C CA  . LEU A 3   ? 1.3482 0.4442 0.8326 0.2072  -0.1706 -0.0326 31  LEU A CA  
9    C C   . LEU A 3   ? 1.2996 0.4984 0.8470 0.2013  -0.1467 -0.0369 31  LEU A C   
10   O O   . LEU A 3   ? 1.3031 0.4945 0.8482 0.1821  -0.1503 -0.0451 31  LEU A O   
11   C CB  . LEU A 3   ? 1.4427 0.4713 0.8563 0.2688  -0.1796 -0.0501 31  LEU A CB  
12   C CG  . LEU A 3   ? 1.5702 0.4572 0.8909 0.2799  -0.2115 -0.0550 31  LEU A CG  
13   C CD1 . LEU A 3   ? 1.5861 0.4156 0.8976 0.2180  -0.2330 -0.0377 31  LEU A CD1 
14   C CD2 . LEU A 3   ? 1.6026 0.4664 0.8853 0.3443  -0.2108 -0.0571 31  LEU A CD2 
15   N N   . THR A 4   ? 1.1847 0.4763 0.7850 0.2166  -0.1242 -0.0302 32  THR A N   
16   C CA  . THR A 4   ? 1.0883 0.4733 0.7446 0.2107  -0.1033 -0.0319 32  THR A CA  
17   C C   . THR A 4   ? 1.0010 0.4331 0.7119 0.1588  -0.0967 -0.0195 32  THR A C   
18   O O   . THR A 4   ? 1.0032 0.4194 0.7184 0.1346  -0.1031 -0.0074 32  THR A O   
19   C CB  . THR A 4   ? 1.0912 0.5540 0.7725 0.2508  -0.0845 -0.0294 32  THR A CB  
20   O OG1 . THR A 4   ? 1.0594 0.5436 0.7595 0.2475  -0.0815 -0.0149 32  THR A OG1 
21   C CG2 . THR A 4   ? 1.1635 0.5955 0.7917 0.3098  -0.0882 -0.0422 32  THR A CG2 
22   N N   . VAL A 5   ? 0.8783 0.3680 0.6276 0.1444  -0.0843 -0.0222 33  VAL A N   
23   C CA  . VAL A 5   ? 0.8562 0.3958 0.6552 0.1037  -0.0763 -0.0122 33  VAL A CA  
24   C C   . VAL A 5   ? 0.7894 0.3930 0.6269 0.1088  -0.0616 -0.0023 33  VAL A C   
25   O O   . VAL A 5   ? 0.7313 0.3757 0.5771 0.1374  -0.0513 -0.0041 33  VAL A O   
26   C CB  . VAL A 5   ? 0.8281 0.4045 0.6503 0.0925  -0.0684 -0.0186 33  VAL A CB  
27   C CG1 . VAL A 5   ? 0.7723 0.3991 0.6409 0.0582  -0.0598 -0.0093 33  VAL A CG1 
28   C CG2 . VAL A 5   ? 0.8714 0.3870 0.6539 0.0863  -0.0840 -0.0283 33  VAL A CG2 
29   N N   . PRO A 6   ? 0.7867 0.4025 0.6458 0.0806  -0.0614 0.0090  34  PRO A N   
30   C CA  . PRO A 6   ? 0.7885 0.4575 0.6775 0.0845  -0.0501 0.0177  34  PRO A CA  
31   C C   . PRO A 6   ? 0.7099 0.4464 0.6354 0.0842  -0.0350 0.0162  34  PRO A C   
32   O O   . PRO A 6   ? 0.5935 0.3400 0.5303 0.0713  -0.0322 0.0109  34  PRO A O   
33   C CB  . PRO A 6   ? 0.7995 0.4667 0.7014 0.0515  -0.0535 0.0285  34  PRO A CB  
34   C CG  . PRO A 6   ? 0.8546 0.4969 0.7504 0.0259  -0.0613 0.0263  34  PRO A CG  
35   C CD  . PRO A 6   ? 0.8535 0.4417 0.7100 0.0439  -0.0718 0.0158  34  PRO A CD  
36   N N   . GLU A 7   ? 0.6419 0.4225 0.5825 0.0971  -0.0272 0.0222  35  GLU A N   
37   C CA  . GLU A 7   ? 0.5848 0.4262 0.5553 0.0924  -0.0161 0.0242  35  GLU A CA  
38   C C   . GLU A 7   ? 0.5004 0.3591 0.4951 0.0619  -0.0132 0.0291  35  GLU A C   
39   O O   . GLU A 7   ? 0.4964 0.3444 0.4901 0.0532  -0.0163 0.0349  35  GLU A O   
40   C CB  . GLU A 7   ? 0.6840 0.5691 0.6574 0.1165  -0.0113 0.0311  35  GLU A CB  
41   C CG  . GLU A 7   ? 0.7299 0.6794 0.7298 0.1082  -0.0029 0.0366  35  GLU A CG  
42   C CD  . GLU A 7   ? 0.8112 0.8144 0.8140 0.1303  0.0006  0.0470  35  GLU A CD  
43   O OE1 . GLU A 7   ? 0.8104 0.8050 0.7909 0.1652  -0.0008 0.0454  35  GLU A OE1 
44   O OE2 . GLU A 7   ? 0.7889 0.8428 0.8134 0.1132  0.0038  0.0573  35  GLU A OE2 
45   N N   . CYS A 8   ? 0.4308 0.3142 0.4434 0.0479  -0.0078 0.0269  36  CYS A N   
46   C CA  . CYS A 8   ? 0.4125 0.3092 0.4416 0.0246  -0.0052 0.0293  36  CYS A CA  
47   C C   . CYS A 8   ? 0.3636 0.2985 0.4040 0.0214  -0.0019 0.0364  36  CYS A C   
48   O O   . CYS A 8   ? 0.3716 0.3366 0.4172 0.0259  0.0004  0.0391  36  CYS A O   
49   C CB  . CYS A 8   ? 0.4059 0.3035 0.4421 0.0142  -0.0029 0.0234  36  CYS A CB  
50   S SG  . CYS A 8   ? 0.3634 0.2734 0.4115 -0.0054 0.0001  0.0235  36  CYS A SG  
51   N N   . ALA A 9   ? 0.3498 0.2864 0.3928 0.0109  -0.0027 0.0407  37  ALA A N   
52   C CA  . ALA A 9   ? 0.3381 0.3077 0.3879 0.0045  -0.0020 0.0478  37  ALA A CA  
53   C C   . ALA A 9   ? 0.3194 0.2993 0.3735 -0.0130 -0.0015 0.0458  37  ALA A C   
54   O O   . ALA A 9   ? 0.3257 0.3304 0.3813 -0.0225 -0.0035 0.0522  37  ALA A O   
55   C CB  . ALA A 9   ? 0.3464 0.3132 0.3940 -0.0001 -0.0038 0.0526  37  ALA A CB  
56   N N   . ILE A 10  ? 0.3118 0.2708 0.3647 -0.0180 -0.0005 0.0380  38  ILE A N   
57   C CA  . ILE A 10  ? 0.3155 0.2741 0.3659 -0.0308 -0.0017 0.0358  38  ILE A CA  
58   C C   . ILE A 10  ? 0.3209 0.2983 0.3747 -0.0303 -0.0021 0.0397  38  ILE A C   
59   O O   . ILE A 10  ? 0.3206 0.3189 0.3732 -0.0426 -0.0059 0.0475  38  ILE A O   
60   C CB  . ILE A 10  ? 0.3153 0.2488 0.3612 -0.0328 -0.0004 0.0273  38  ILE A CB  
61   C CG1 . ILE A 10  ? 0.3254 0.2527 0.3668 -0.0350 0.0000  0.0259  38  ILE A CG1 
62   C CG2 . ILE A 10  ? 0.3327 0.2567 0.3696 -0.0416 -0.0032 0.0248  38  ILE A CG2 
63   C CD1 . ILE A 10  ? 0.3300 0.2466 0.3696 -0.0321 0.0026  0.0204  38  ILE A CD1 
64   N N   . CYS A 11  ? 0.3395 0.3123 0.3959 -0.0182 0.0006  0.0359  39  CYS A N   
65   C CA  . CYS A 11  ? 0.3467 0.3403 0.4056 -0.0170 0.0009  0.0395  39  CYS A CA  
66   C C   . CYS A 11  ? 0.3238 0.3538 0.3860 -0.0008 0.0028  0.0467  39  CYS A C   
67   O O   . CYS A 11  ? 0.3412 0.4028 0.4065 -0.0002 0.0033  0.0532  39  CYS A O   
68   C CB  . CYS A 11  ? 0.3513 0.3238 0.4087 -0.0124 0.0026  0.0313  39  CYS A CB  
69   S SG  . CYS A 11  ? 0.3920 0.3435 0.4447 0.0070  0.0040  0.0234  39  CYS A SG  
70   N N   . LEU A 12  ? 0.3255 0.3521 0.3849 0.0139  0.0035  0.0464  40  LEU A N   
71   C CA  . LEU A 12  ? 0.3378 0.3934 0.3946 0.0380  0.0052  0.0518  40  LEU A CA  
72   C C   . LEU A 12  ? 0.3679 0.4137 0.4145 0.0614  0.0072  0.0445  40  LEU A C   
73   O O   . LEU A 12  ? 0.3902 0.4659 0.4312 0.0860  0.0093  0.0484  40  LEU A O   
74   C CB  . LEU A 12  ? 0.3243 0.4418 0.3905 0.0322  0.0052  0.0672  40  LEU A CB  
75   C CG  . LEU A 12  ? 0.3196 0.4494 0.3904 0.0126  0.0014  0.0754  40  LEU A CG  
76   C CD1 . LEU A 12  ? 0.3145 0.5125 0.3935 0.0052  -0.0003 0.0933  40  LEU A CD1 
77   C CD2 . LEU A 12  ? 0.3253 0.4339 0.3908 0.0267  0.0014  0.0727  40  LEU A CD2 
78   N N   . GLN A 13  ? 0.3909 0.3970 0.4326 0.0560  0.0061  0.0339  41  GLN A N   
79   C CA  . GLN A 13  ? 0.4309 0.4199 0.4581 0.0759  0.0061  0.0254  41  GLN A CA  
80   C C   . GLN A 13  ? 0.4664 0.3993 0.4747 0.0829  0.0004  0.0167  41  GLN A C   
81   O O   . GLN A 13  ? 0.4514 0.3646 0.4620 0.0698  -0.0022 0.0186  41  GLN A O   
82   C CB  . GLN A 13  ? 0.4355 0.4225 0.4679 0.0634  0.0070  0.0213  41  GLN A CB  
83   C CG  . GLN A 13  ? 0.4651 0.4921 0.5131 0.0456  0.0092  0.0311  41  GLN A CG  
84   C CD  . GLN A 13  ? 0.5509 0.6296 0.6003 0.0586  0.0123  0.0392  41  GLN A CD  
85   O OE1 . GLN A 13  ? 0.5651 0.6561 0.6033 0.0872  0.0144  0.0370  41  GLN A OE1 
86   N NE2 . GLN A 13  ? 0.5999 0.7098 0.6597 0.0383  0.0118  0.0498  41  GLN A NE2 
87   N N   . THR A 14  ? 0.4848 0.3913 0.4708 0.1027  -0.0026 0.0080  42  THR A N   
88   C CA  . THR A 14  ? 0.5410 0.3858 0.5036 0.1018  -0.0117 0.0003  42  THR A CA  
89   C C   . THR A 14  ? 0.4917 0.3243 0.4688 0.0701  -0.0132 0.0000  42  THR A C   
90   O O   . THR A 14  ? 0.4513 0.3058 0.4433 0.0600  -0.0088 -0.0010 42  THR A O   
91   C CB  . THR A 14  ? 0.6152 0.4295 0.5456 0.1264  -0.0167 -0.0105 42  THR A CB  
92   O OG1 . THR A 14  ? 0.6601 0.4975 0.5774 0.1619  -0.0134 -0.0094 42  THR A OG1 
93   C CG2 . THR A 14  ? 0.6605 0.4030 0.5590 0.1223  -0.0301 -0.0167 42  THR A CG2 
94   N N   . CYS A 15  ? 0.4841 0.2877 0.4572 0.0553  -0.0191 0.0026  43  CYS A N   
95   C CA  . CYS A 15  ? 0.4761 0.2787 0.4627 0.0287  -0.0199 0.0042  43  CYS A CA  
96   C C   . CYS A 15  ? 0.4845 0.2714 0.4627 0.0235  -0.0240 -0.0024 43  CYS A C   
97   O O   . CYS A 15  ? 0.5065 0.2566 0.4575 0.0328  -0.0324 -0.0084 43  CYS A O   
98   C CB  . CYS A 15  ? 0.5049 0.2836 0.4851 0.0136  -0.0269 0.0104  43  CYS A CB  
99   S SG  . CYS A 15  ? 0.5450 0.3478 0.5399 0.0104  -0.0221 0.0199  43  CYS A SG  
100  N N   . VAL A 16  ? 0.4456 0.2580 0.4436 0.0104  -0.0189 -0.0016 44  VAL A N   
101  C CA  . VAL A 16  ? 0.5027 0.3073 0.4967 0.0014  -0.0229 -0.0054 44  VAL A CA  
102  C C   . VAL A 16  ? 0.4835 0.2955 0.4880 -0.0204 -0.0250 0.0014  44  VAL A C   
103  O O   . VAL A 16  ? 0.4523 0.2918 0.4754 -0.0241 -0.0178 0.0057  44  VAL A O   
104  C CB  . VAL A 16  ? 0.5302 0.3630 0.5369 0.0067  -0.0156 -0.0082 44  VAL A CB  
105  C CG1 . VAL A 16  ? 0.5778 0.4076 0.5826 -0.0036 -0.0197 -0.0105 44  VAL A CG1 
106  C CG2 . VAL A 16  ? 0.5808 0.4174 0.5773 0.0281  -0.0134 -0.0126 44  VAL A CG2 
107  N N   . HIS A 17  ? 0.4844 0.2730 0.4737 -0.0346 -0.0360 0.0029  45  HIS A N   
108  C CA  . HIS A 17  ? 0.5156 0.3172 0.5120 -0.0575 -0.0402 0.0134  45  HIS A CA  
109  C C   . HIS A 17  ? 0.4751 0.2856 0.4793 -0.0589 -0.0366 0.0204  45  HIS A C   
110  O O   . HIS A 17  ? 0.4619 0.3090 0.4860 -0.0605 -0.0281 0.0245  45  HIS A O   
111  C CB  . HIS A 17  ? 0.5416 0.3852 0.5587 -0.0630 -0.0338 0.0158  45  HIS A CB  
112  C CG  . HIS A 17  ? 0.5959 0.4344 0.6063 -0.0618 -0.0371 0.0098  45  HIS A CG  
113  N ND1 . HIS A 17  ? 0.6733 0.4829 0.6614 -0.0758 -0.0511 0.0097  45  HIS A ND1 
114  C CD2 . HIS A 17  ? 0.6280 0.4829 0.6474 -0.0492 -0.0298 0.0040  45  HIS A CD2 
115  C CE1 . HIS A 17  ? 0.6702 0.4821 0.6552 -0.0704 -0.0512 0.0030  45  HIS A CE1 
116  N NE2 . HIS A 17  ? 0.7115 0.5525 0.7166 -0.0541 -0.0379 0.0001  45  HIS A NE2 
117  N N   . PRO A 18  ? 0.4916 0.2663 0.4767 -0.0547 -0.0434 0.0209  46  PRO A N   
118  C CA  . PRO A 18  ? 0.4854 0.2677 0.4764 -0.0555 -0.0408 0.0282  46  PRO A CA  
119  C C   . PRO A 18  ? 0.5069 0.3098 0.5051 -0.0797 -0.0444 0.0411  46  PRO A C   
120  O O   . PRO A 18  ? 0.5298 0.3162 0.5141 -0.1001 -0.0568 0.0481  46  PRO A O   
121  C CB  . PRO A 18  ? 0.5237 0.2553 0.4852 -0.0466 -0.0511 0.0273  46  PRO A CB  
122  C CG  . PRO A 18  ? 0.5551 0.2455 0.4898 -0.0500 -0.0633 0.0217  46  PRO A CG  
123  C CD  . PRO A 18  ? 0.5349 0.2576 0.4877 -0.0456 -0.0544 0.0142  46  PRO A CD  
124  N N   . VAL A 19  ? 0.4666 0.3063 0.4835 -0.0782 -0.0347 0.0453  47  VAL A N   
125  C CA  . VAL A 19  ? 0.4779 0.3480 0.5022 -0.0965 -0.0360 0.0587  47  VAL A CA  
126  C C   . VAL A 19  ? 0.4903 0.3583 0.5124 -0.0962 -0.0356 0.0652  47  VAL A C   
127  O O   . VAL A 19  ? 0.4843 0.3452 0.5078 -0.0789 -0.0297 0.0582  47  VAL A O   
128  C CB  . VAL A 19  ? 0.4734 0.3954 0.5178 -0.0923 -0.0250 0.0580  47  VAL A CB  
129  C CG1 . VAL A 19  ? 0.4901 0.4164 0.5361 -0.0942 -0.0268 0.0543  47  VAL A CG1 
130  C CG2 . VAL A 19  ? 0.4396 0.3708 0.4920 -0.0714 -0.0133 0.0481  47  VAL A CG2 
131  N N   . SER A 20  ? 0.5267 0.4040 0.5448 -0.1176 -0.0432 0.0808  48  SER A N   
132  C CA  . SER A 20  ? 0.5300 0.4038 0.5433 -0.1213 -0.0453 0.0902  48  SER A CA  
133  C C   . SER A 20  ? 0.4869 0.4210 0.5183 -0.1245 -0.0357 0.0978  48  SER A C   
134  O O   . SER A 20  ? 0.4819 0.4551 0.5209 -0.1382 -0.0359 0.1072  48  SER A O   
135  C CB  . SER A 20  ? 0.5874 0.4206 0.5764 -0.1447 -0.0637 0.1043  48  SER A CB  
136  O OG  . SER A 20  ? 0.7048 0.5207 0.6841 -0.1435 -0.0672 0.1119  48  SER A OG  
137  N N   . LEU A 21  ? 0.4954 0.4405 0.5320 -0.1095 -0.0269 0.0930  49  LEU A N   
138  C CA  . LEU A 21  ? 0.4746 0.4710 0.5213 -0.1081 -0.0182 0.0979  49  LEU A CA  
139  C C   . LEU A 21  ? 0.5044 0.5116 0.5458 -0.1284 -0.0259 0.1177  49  LEU A C   
140  O O   . LEU A 21  ? 0.5005 0.4643 0.5276 -0.1396 -0.0378 0.1248  49  LEU A O   
141  C CB  . LEU A 21  ? 0.4540 0.4507 0.5024 -0.0871 -0.0088 0.0847  49  LEU A CB  
142  C CG  . LEU A 21  ? 0.4502 0.4341 0.5008 -0.0703 -0.0030 0.0677  49  LEU A CG  
143  C CD1 . LEU A 21  ? 0.4553 0.4372 0.5027 -0.0573 0.0022  0.0585  49  LEU A CD1 
144  C CD2 . LEU A 21  ? 0.4490 0.4609 0.5052 -0.0661 0.0019  0.0647  49  LEU A CD2 
145  N N   . PRO A 22  ? 0.5092 0.5727 0.5583 -0.1315 -0.0198 0.1272  50  PRO A N   
146  C CA  . PRO A 22  ? 0.5204 0.6024 0.5651 -0.1522 -0.0266 0.1486  50  PRO A CA  
147  C C   . PRO A 22  ? 0.5205 0.5625 0.5543 -0.1494 -0.0311 0.1493  50  PRO A C   
148  O O   . PRO A 22  ? 0.5128 0.5364 0.5351 -0.1695 -0.0432 0.1668  50  PRO A O   
149  C CB  . PRO A 22  ? 0.5179 0.6716 0.5723 -0.1429 -0.0145 0.1518  50  PRO A CB  
150  C CG  . PRO A 22  ? 0.4936 0.6683 0.5557 -0.1267 -0.0062 0.1391  50  PRO A CG  
151  C CD  . PRO A 22  ? 0.4950 0.6087 0.5536 -0.1144 -0.0070 0.1196  50  PRO A CD  
152  N N   . CYS A 23  ? 0.4515 0.4805 0.4869 -0.1256 -0.0226 0.1318  51  CYS A N   
153  C CA  . CYS A 23  ? 0.4779 0.4754 0.5048 -0.1192 -0.0260 0.1317  51  CYS A CA  
154  C C   . CYS A 23  ? 0.5099 0.4465 0.5235 -0.1176 -0.0366 0.1300  51  CYS A C   
155  O O   . CYS A 23  ? 0.5057 0.4156 0.5095 -0.1095 -0.0406 0.1320  51  CYS A O   
156  C CB  . CYS A 23  ? 0.4688 0.4764 0.5006 -0.0977 -0.0153 0.1150  51  CYS A CB  
157  S SG  . CYS A 23  ? 0.4454 0.4344 0.4820 -0.0821 -0.0101 0.0943  51  CYS A SG  
158  N N   . LYS A 24  ? 0.5181 0.4351 0.5294 -0.1219 -0.0406 0.1253  52  LYS A N   
159  C CA  . LYS A 24  ? 0.5823 0.4389 0.5743 -0.1204 -0.0523 0.1229  52  LYS A CA  
160  C C   . LYS A 24  ? 0.5374 0.3741 0.5299 -0.0932 -0.0463 0.1050  52  LYS A C   
161  O O   . LYS A 24  ? 0.5594 0.3483 0.5330 -0.0835 -0.0544 0.1011  52  LYS A O   
162  C CB  . LYS A 24  ? 0.6336 0.4481 0.6011 -0.1317 -0.0676 0.1390  52  LYS A CB  
163  C CG  . LYS A 24  ? 0.7453 0.5752 0.7082 -0.1655 -0.0776 0.1607  52  LYS A CG  
164  C CD  . LYS A 24  ? 0.8651 0.6392 0.7969 -0.1776 -0.0959 0.1768  52  LYS A CD  
165  C CE  . LYS A 24  ? 0.9822 0.7648 0.9043 -0.2187 -0.1105 0.2022  52  LYS A CE  
166  N NZ  . LYS A 24  ? 1.0180 0.7562 0.9118 -0.2306 -0.1265 0.2211  52  LYS A NZ  
167  N N   . HIS A 25  ? 0.4713 0.3441 0.4821 -0.0807 -0.0332 0.0946  53  HIS A N   
168  C CA  . HIS A 25  ? 0.4557 0.3201 0.4694 -0.0612 -0.0280 0.0804  53  HIS A CA  
169  C C   . HIS A 25  ? 0.4280 0.2851 0.4436 -0.0625 -0.0277 0.0721  53  HIS A C   
170  O O   . HIS A 25  ? 0.4076 0.2841 0.4299 -0.0758 -0.0268 0.0748  53  HIS A O   
171  C CB  . HIS A 25  ? 0.4207 0.3194 0.4475 -0.0530 -0.0178 0.0743  53  HIS A CB  
172  C CG  . HIS A 25  ? 0.4554 0.3593 0.4788 -0.0488 -0.0191 0.0814  53  HIS A CG  
173  N ND1 . HIS A 25  ? 0.4933 0.4235 0.5196 -0.0569 -0.0167 0.0877  53  HIS A ND1 
174  C CD2 . HIS A 25  ? 0.5024 0.3904 0.5177 -0.0356 -0.0229 0.0844  53  HIS A CD2 
175  C CE1 . HIS A 25  ? 0.5106 0.4403 0.5324 -0.0514 -0.0193 0.0944  53  HIS A CE1 
176  N NE2 . HIS A 25  ? 0.5089 0.4147 0.5244 -0.0375 -0.0229 0.0929  53  HIS A NE2 
177  N N   . VAL A 26  ? 0.4355 0.2698 0.4447 -0.0472 -0.0285 0.0632  54  VAL A N   
178  C CA  . VAL A 26  ? 0.4417 0.2649 0.4495 -0.0470 -0.0294 0.0552  54  VAL A CA  
179  C C   . VAL A 26  ? 0.4215 0.2653 0.4419 -0.0330 -0.0198 0.0443  54  VAL A C   
180  O O   . VAL A 26  ? 0.4462 0.2960 0.4673 -0.0191 -0.0168 0.0426  54  VAL A O   
181  C CB  . VAL A 26  ? 0.4793 0.2517 0.4610 -0.0414 -0.0411 0.0541  54  VAL A CB  
182  C CG1 . VAL A 26  ? 0.4736 0.2357 0.4521 -0.0419 -0.0426 0.0453  54  VAL A CG1 
183  C CG2 . VAL A 26  ? 0.5377 0.2800 0.5005 -0.0600 -0.0544 0.0672  54  VAL A CG2 
184  N N   . PHE A 27  ? 0.3972 0.2541 0.4264 -0.0377 -0.0161 0.0392  55  PHE A N   
185  C CA  . PHE A 27  ? 0.3897 0.2600 0.4271 -0.0280 -0.0095 0.0306  55  PHE A CA  
186  C C   . PHE A 27  ? 0.3849 0.2495 0.4221 -0.0298 -0.0105 0.0255  55  PHE A C   
187  O O   . PHE A 27  ? 0.3857 0.2462 0.4203 -0.0415 -0.0151 0.0292  55  PHE A O   
188  C CB  . PHE A 27  ? 0.3742 0.2700 0.4212 -0.0307 -0.0029 0.0297  55  PHE A CB  
189  C CG  . PHE A 27  ? 0.3569 0.2617 0.4032 -0.0316 -0.0024 0.0347  55  PHE A CG  
190  C CD1 . PHE A 27  ? 0.3772 0.2919 0.4233 -0.0396 -0.0025 0.0404  55  PHE A CD1 
191  C CD2 . PHE A 27  ? 0.3744 0.2843 0.4204 -0.0252 -0.0020 0.0352  55  PHE A CD2 
192  C CE1 . PHE A 27  ? 0.3828 0.3066 0.4272 -0.0406 -0.0023 0.0451  55  PHE A CE1 
193  C CE2 . PHE A 27  ? 0.3695 0.2905 0.4146 -0.0272 -0.0023 0.0405  55  PHE A CE2 
194  C CZ  . PHE A 27  ? 0.3786 0.3039 0.4222 -0.0346 -0.0024 0.0446  55  PHE A CZ  
195  N N   . CYS A 28  ? 0.3773 0.2470 0.4176 -0.0207 -0.0068 0.0192  56  CYS A N   
196  C CA  . CYS A 28  ? 0.3922 0.2631 0.4345 -0.0227 -0.0066 0.0149  56  CYS A CA  
197  C C   . CYS A 28  ? 0.3682 0.2584 0.4189 -0.0313 -0.0038 0.0175  56  CYS A C   
198  O O   . CYS A 28  ? 0.3678 0.2711 0.4220 -0.0304 0.0003  0.0186  56  CYS A O   
199  C CB  . CYS A 28  ? 0.3918 0.2722 0.4378 -0.0139 -0.0023 0.0103  56  CYS A CB  
200  S SG  . CYS A 28  ? 0.4286 0.3101 0.4686 0.0010  -0.0022 0.0096  56  CYS A SG  
201  N N   . TYR A 29  ? 0.3576 0.2519 0.4088 -0.0381 -0.0066 0.0188  57  TYR A N   
202  C CA  . TYR A 29  ? 0.3442 0.2668 0.4032 -0.0405 -0.0029 0.0220  57  TYR A CA  
203  C C   . TYR A 29  ? 0.3266 0.2553 0.3872 -0.0273 0.0038  0.0159  57  TYR A C   
204  O O   . TYR A 29  ? 0.3223 0.2642 0.3817 -0.0219 0.0077  0.0162  57  TYR A O   
205  C CB  . TYR A 29  ? 0.3506 0.2829 0.4107 -0.0491 -0.0074 0.0252  57  TYR A CB  
206  C CG  . TYR A 29  ? 0.3470 0.3183 0.4156 -0.0462 -0.0027 0.0296  57  TYR A CG  
207  C CD1 . TYR A 29  ? 0.3543 0.3562 0.4268 -0.0505 -0.0009 0.0385  57  TYR A CD1 
208  C CD2 . TYR A 29  ? 0.3432 0.3242 0.4143 -0.0363 0.0002  0.0258  57  TYR A CD2 
209  C CE1 . TYR A 29  ? 0.3569 0.4019 0.4350 -0.0420 0.0041  0.0430  57  TYR A CE1 
210  C CE2 . TYR A 29  ? 0.3503 0.3687 0.4261 -0.0276 0.0047  0.0301  57  TYR A CE2 
211  C CZ  . TYR A 29  ? 0.3703 0.4224 0.4494 -0.0288 0.0070  0.0384  57  TYR A CZ  
212  O OH  . TYR A 29  ? 0.3667 0.4631 0.4484 -0.0150 0.0122  0.0432  57  TYR A OH  
213  N N   . LEU A 30  ? 0.3244 0.2408 0.3834 -0.0222 0.0038  0.0108  58  LEU A N   
214  C CA  . LEU A 30  ? 0.3376 0.2520 0.3930 -0.0139 0.0068  0.0071  58  LEU A CA  
215  C C   . LEU A 30  ? 0.3259 0.2303 0.3746 -0.0134 0.0073  0.0061  58  LEU A C   
216  O O   . LEU A 30  ? 0.3622 0.2578 0.4005 -0.0089 0.0073  0.0037  58  LEU A O   
217  C CB  . LEU A 30  ? 0.3565 0.2649 0.4120 -0.0120 0.0056  0.0050  58  LEU A CB  
218  C CG  . LEU A 30  ? 0.3637 0.2825 0.4226 -0.0120 0.0045  0.0055  58  LEU A CG  
219  C CD1 . LEU A 30  ? 0.3475 0.2609 0.4050 -0.0098 0.0034  0.0032  58  LEU A CD1 
220  C CD2 . LEU A 30  ? 0.3560 0.2908 0.4148 -0.0046 0.0072  0.0071  58  LEU A CD2 
221  N N   . CYS A 31  ? 0.3295 0.2324 0.3804 -0.0179 0.0061  0.0083  59  CYS A N   
222  C CA  . CYS A 31  ? 0.3301 0.2302 0.3754 -0.0203 0.0056  0.0092  59  CYS A CA  
223  C C   . CYS A 31  ? 0.3319 0.2360 0.3720 -0.0191 0.0071  0.0088  59  CYS A C   
224  O O   . CYS A 31  ? 0.3479 0.2433 0.3752 -0.0178 0.0062  0.0060  59  CYS A O   
225  C CB  . CYS A 31  ? 0.3460 0.2506 0.3955 -0.0222 0.0043  0.0132  59  CYS A CB  
226  S SG  . CYS A 31  ? 0.3632 0.2750 0.4150 -0.0191 0.0034  0.0149  59  CYS A SG  
227  N N   . VAL A 32  ? 0.3227 0.2398 0.3695 -0.0202 0.0084  0.0122  60  VAL A N   
228  C CA  . VAL A 32  ? 0.3548 0.2874 0.3978 -0.0174 0.0109  0.0136  60  VAL A CA  
229  C C   . VAL A 32  ? 0.3550 0.2903 0.3879 -0.0042 0.0136  0.0083  60  VAL A C   
230  O O   . VAL A 32  ? 0.3664 0.2988 0.3843 0.0046  0.0148  0.0043  60  VAL A O   
231  C CB  . VAL A 32  ? 0.3532 0.3053 0.4055 -0.0257 0.0101  0.0223  60  VAL A CB  
232  C CG1 . VAL A 32  ? 0.3786 0.3605 0.4286 -0.0216 0.0138  0.0262  60  VAL A CG1 
233  C CG2 . VAL A 32  ? 0.3790 0.3189 0.4326 -0.0345 0.0060  0.0272  60  VAL A CG2 
234  N N   . LYS A 33  ? 0.3612 0.2990 0.3986 -0.0008 0.0139  0.0079  61  LYS A N   
235  C CA  . LYS A 33  ? 0.3630 0.3014 0.3887 0.0155  0.0159  0.0036  61  LYS A CA  
236  C C   . LYS A 33  ? 0.3865 0.2868 0.3892 0.0218  0.0124  -0.0039 61  LYS A C   
237  O O   . LYS A 33  ? 0.4106 0.2998 0.3909 0.0380  0.0125  -0.0094 61  LYS A O   
238  C CB  . LYS A 33  ? 0.3651 0.3137 0.4011 0.0157  0.0157  0.0060  61  LYS A CB  
239  C CG  . LYS A 33  ? 0.3921 0.3456 0.4162 0.0359  0.0178  0.0033  61  LYS A CG  
240  C CD  . LYS A 33  ? 0.3839 0.3657 0.4225 0.0347  0.0183  0.0091  61  LYS A CD  
241  C CE  . LYS A 33  ? 0.3986 0.3868 0.4246 0.0585  0.0203  0.0074  61  LYS A CE  
242  N NZ  . LYS A 33  ? 0.3890 0.4212 0.4304 0.0588  0.0214  0.0157  61  LYS A NZ  
243  N N   . GLY A 34  ? 0.3843 0.2645 0.3887 0.0090  0.0081  -0.0035 62  GLY A N   
244  C CA  . GLY A 34  ? 0.4238 0.2693 0.4058 0.0064  0.0018  -0.0068 62  GLY A CA  
245  C C   . GLY A 34  ? 0.4495 0.2817 0.4132 0.0051  -0.0010 -0.0100 62  GLY A C   
246  O O   . GLY A 34  ? 0.4876 0.2848 0.4200 0.0103  -0.0072 -0.0157 62  GLY A O   
247  N N   . ALA A 35  ? 0.4291 0.2844 0.4079 -0.0018 0.0020  -0.0065 63  ALA A N   
248  C CA  . ALA A 35  ? 0.4729 0.3216 0.4356 -0.0031 -0.0002 -0.0090 63  ALA A CA  
249  C C   . ALA A 35  ? 0.4972 0.3494 0.4421 0.0171  0.0034  -0.0154 63  ALA A C   
250  O O   . ALA A 35  ? 0.5445 0.3808 0.4645 0.0211  0.0002  -0.0210 63  ALA A O   
251  C CB  . ALA A 35  ? 0.4407 0.3142 0.4237 -0.0145 0.0017  -0.0020 63  ALA A CB  
252  N N   . SER A 36  ? 0.4753 0.3530 0.4315 0.0303  0.0098  -0.0139 64  SER A N   
253  C CA  . SER A 36  ? 0.4940 0.3892 0.4353 0.0535  0.0147  -0.0176 64  SER A CA  
254  C C   . SER A 36  ? 0.5589 0.4102 0.4591 0.0745  0.0097  -0.0291 64  SER A C   
255  O O   . SER A 36  ? 0.5671 0.4184 0.4413 0.0964  0.0113  -0.0358 64  SER A O   
256  C CB  . SER A 36  ? 0.5022 0.4441 0.4669 0.0602  0.0215  -0.0099 64  SER A CB  
257  O OG  . SER A 36  ? 0.5192 0.4474 0.4803 0.0694  0.0204  -0.0121 64  SER A OG  
258  N N   . TRP A 37  ? 0.5815 0.3933 0.4719 0.0689  0.0028  -0.0310 65  TRP A N   
259  C CA  . TRP A 37  ? 0.7086 0.4656 0.5527 0.0869  -0.0052 -0.0410 65  TRP A CA  
260  C C   . TRP A 37  ? 0.7377 0.4534 0.5450 0.0823  -0.0141 -0.0488 65  TRP A C   
261  O O   . TRP A 37  ? 0.7748 0.4490 0.5352 0.1051  -0.0197 -0.0599 65  TRP A O   
262  C CB  . TRP A 37  ? 0.7565 0.4771 0.5957 0.0759  -0.0131 -0.0384 65  TRP A CB  
263  C CG  . TRP A 37  ? 0.8312 0.5892 0.7062 0.0755  -0.0060 -0.0305 65  TRP A CG  
264  C CD1 . TRP A 37  ? 0.8426 0.6041 0.7408 0.0532  -0.0081 -0.0231 65  TRP A CD1 
265  C CD2 . TRP A 37  ? 0.8539 0.6534 0.7426 0.0980  0.0030  -0.0288 65  TRP A CD2 
266  N NE1 . TRP A 37  ? 0.8405 0.6356 0.7630 0.0601  -0.0015 -0.0187 65  TRP A NE1 
267  C CE2 . TRP A 37  ? 0.8806 0.7009 0.7991 0.0853  0.0048  -0.0212 65  TRP A CE2 
268  C CE3 . TRP A 37  ? 0.9256 0.7530 0.8037 0.1278  0.0096  -0.0318 65  TRP A CE3 
269  C CZ2 . TRP A 37  ? 0.8205 0.6847 0.7581 0.0976  0.0115  -0.0162 65  TRP A CZ2 
270  C CZ3 . TRP A 37  ? 1.0477 0.9272 0.9479 0.1408  0.0172  -0.0249 65  TRP A CZ3 
271  C CH2 . TRP A 37  ? 0.9277 0.8232 0.8572 0.1237  0.0174  -0.0171 65  TRP A CH2 
272  N N   . LEU A 38  ? 0.7272 0.4542 0.5530 0.0547  -0.0160 -0.0432 66  LEU A N   
273  C CA  . LEU A 38  ? 0.7656 0.4610 0.5601 0.0451  -0.0253 -0.0486 66  LEU A CA  
274  C C   . LEU A 38  ? 0.7432 0.4743 0.5404 0.0576  -0.0172 -0.0513 66  LEU A C   
275  O O   . LEU A 38  ? 0.7920 0.5024 0.5632 0.0518  -0.0240 -0.0563 66  LEU A O   
276  C CB  . LEU A 38  ? 0.7624 0.4585 0.5751 0.0087  -0.0323 -0.0388 66  LEU A CB  
277  C CG  . LEU A 38  ? 0.8057 0.4769 0.6183 -0.0079 -0.0404 -0.0326 66  LEU A CG  
278  C CD1 . LEU A 38  ? 0.7787 0.4783 0.6212 -0.0385 -0.0426 -0.0196 66  LEU A CD1 
279  C CD2 . LEU A 38  ? 0.8561 0.4534 0.6111 -0.0083 -0.0571 -0.0400 66  LEU A CD2 
280  N N   . GLY A 39  ? 0.6983 0.4855 0.5262 0.0717  -0.0040 -0.0461 67  GLY A N   
281  C CA  . GLY A 39  ? 0.6832 0.5123 0.5133 0.0846  0.0039  -0.0459 67  GLY A CA  
282  C C   . GLY A 39  ? 0.6387 0.4966 0.4970 0.0590  0.0051  -0.0361 67  GLY A C   
283  O O   . GLY A 39  ? 0.6139 0.4876 0.4621 0.0629  0.0067  -0.0373 67  GLY A O   
284  N N   . LYS A 40  ? 0.5815 0.4469 0.4729 0.0356  0.0043  -0.0264 68  LYS A N   
285  C CA  . LYS A 40  ? 0.5826 0.4657 0.4953 0.0139  0.0035  -0.0174 68  LYS A CA  
286  C C   . LYS A 40  ? 0.5393 0.4727 0.4795 0.0137  0.0118  -0.0068 68  LYS A C   
287  O O   . LYS A 40  ? 0.4906 0.4512 0.4444 0.0221  0.0178  -0.0026 68  LYS A O   
288  C CB  . LYS A 40  ? 0.5492 0.4222 0.4819 -0.0059 -0.0007 -0.0111 68  LYS A CB  
289  C CG  . LYS A 40  ? 0.5795 0.4092 0.4868 -0.0151 -0.0114 -0.0162 68  LYS A CG  
290  C CD  . LYS A 40  ? 0.6039 0.4150 0.4834 -0.0244 -0.0200 -0.0195 68  LYS A CD  
291  C CE  . LYS A 40  ? 0.6446 0.4161 0.5004 -0.0434 -0.0339 -0.0197 68  LYS A CE  
292  N NZ  . LYS A 40  ? 0.6698 0.4140 0.4884 -0.0539 -0.0455 -0.0244 68  LYS A NZ  
293  N N   . ARG A 41  ? 0.4987 0.4444 0.4449 0.0016  0.0105  -0.0006 69  ARG A N   
294  C CA  . ARG A 41  ? 0.4714 0.4559 0.4413 -0.0052 0.0149  0.0124  69  ARG A CA  
295  C C   . ARG A 41  ? 0.4073 0.3840 0.4002 -0.0209 0.0118  0.0206  69  ARG A C   
296  O O   . ARG A 41  ? 0.4003 0.3530 0.3933 -0.0234 0.0087  0.0160  69  ARG A O   
297  C CB  . ARG A 41  ? 0.4633 0.4623 0.4211 -0.0060 0.0146  0.0141  69  ARG A CB  
298  C CG  . ARG A 41  ? 0.5104 0.5193 0.4406 0.0156  0.0183  0.0048  69  ARG A CG  
299  C CD  . ARG A 41  ? 0.5381 0.5574 0.4500 0.0165  0.0173  0.0038  69  ARG A CD  
300  N NE  . ARG A 41  ? 0.5377 0.6072 0.4705 0.0095  0.0222  0.0201  69  ARG A NE  
301  C CZ  . ARG A 41  ? 0.5337 0.6490 0.4623 0.0226  0.0290  0.0247  69  ARG A CZ  
302  N NH1 . ARG A 41  ? 0.5780 0.6974 0.4806 0.0499  0.0332  0.0124  69  ARG A NH1 
303  N NH2 . ARG A 41  ? 0.5167 0.6759 0.4647 0.0093  0.0311  0.0433  69  ARG A NH2 
304  N N   . CYS A 42  ? 0.3925 0.3877 0.4012 -0.0304 0.0118  0.0330  70  CYS A N   
305  C CA  . CYS A 42  ? 0.3719 0.3539 0.3943 -0.0393 0.0080  0.0392  70  CYS A CA  
306  C C   . CYS A 42  ? 0.3829 0.3504 0.3998 -0.0414 0.0043  0.0356  70  CYS A C   
307  O O   . CYS A 42  ? 0.4102 0.3836 0.4178 -0.0441 0.0024  0.0362  70  CYS A O   
308  C CB  . CYS A 42  ? 0.3807 0.3742 0.4113 -0.0480 0.0058  0.0533  70  CYS A CB  
309  S SG  . CYS A 42  ? 0.3814 0.3502 0.4181 -0.0504 -0.0001 0.0590  70  CYS A SG  
310  N N   . ALA A 43  ? 0.3608 0.3145 0.3832 -0.0414 0.0026  0.0333  71  ALA A N   
311  C CA  . ALA A 43  ? 0.3585 0.3092 0.3779 -0.0460 -0.0014 0.0334  71  ALA A CA  
312  C C   . ALA A 43  ? 0.3544 0.3204 0.3795 -0.0483 -0.0036 0.0436  71  ALA A C   
313  O O   . ALA A 43  ? 0.3450 0.3204 0.3650 -0.0544 -0.0073 0.0459  71  ALA A O   
314  C CB  . ALA A 43  ? 0.3737 0.3167 0.3999 -0.0446 -0.0019 0.0320  71  ALA A CB  
315  N N   . LEU A 44  ? 0.3495 0.3168 0.3823 -0.0444 -0.0027 0.0507  72  LEU A N   
316  C CA  . LEU A 44  ? 0.3645 0.3412 0.3994 -0.0423 -0.0055 0.0612  72  LEU A CA  
317  C C   . LEU A 44  ? 0.3780 0.3679 0.4076 -0.0477 -0.0062 0.0670  72  LEU A C   
318  O O   . LEU A 44  ? 0.3996 0.4038 0.4283 -0.0480 -0.0088 0.0737  72  LEU A O   
319  C CB  . LEU A 44  ? 0.3800 0.3400 0.4174 -0.0340 -0.0074 0.0664  72  LEU A CB  
320  C CG  . LEU A 44  ? 0.3882 0.3417 0.4280 -0.0233 -0.0075 0.0628  72  LEU A CG  
321  C CD1 . LEU A 44  ? 0.4025 0.3266 0.4359 -0.0149 -0.0108 0.0639  72  LEU A CD1 
322  C CD2 . LEU A 44  ? 0.3946 0.3721 0.4365 -0.0155 -0.0084 0.0686  72  LEU A CD2 
323  N N   . CYS A 45  ? 0.3643 0.3561 0.3908 -0.0513 -0.0038 0.0661  73  CYS A N   
324  C CA  . CYS A 45  ? 0.3944 0.4038 0.4157 -0.0557 -0.0040 0.0735  73  CYS A CA  
325  C C   . CYS A 45  ? 0.3861 0.4090 0.3959 -0.0559 -0.0003 0.0655  73  CYS A C   
326  O O   . CYS A 45  ? 0.3888 0.4310 0.3926 -0.0581 0.0001  0.0708  73  CYS A O   
327  C CB  . CYS A 45  ? 0.4117 0.4180 0.4370 -0.0594 -0.0065 0.0869  73  CYS A CB  
328  S SG  . CYS A 45  ? 0.4113 0.4234 0.4392 -0.0657 -0.0040 0.0880  73  CYS A SG  
329  N N   . ARG A 46  ? 0.4081 0.4200 0.4117 -0.0509 0.0019  0.0528  74  ARG A N   
330  C CA  . ARG A 46  ? 0.4067 0.4229 0.3915 -0.0437 0.0047  0.0423  74  ARG A CA  
331  C C   . ARG A 46  ? 0.4053 0.4502 0.3917 -0.0384 0.0104  0.0474  74  ARG A C   
332  O O   . ARG A 46  ? 0.4262 0.4823 0.3946 -0.0273 0.0136  0.0397  74  ARG A O   
333  C CB  . ARG A 46  ? 0.4455 0.4596 0.4099 -0.0463 0.0004  0.0375  74  ARG A CB  
334  C CG  . ARG A 46  ? 0.4782 0.4688 0.4350 -0.0543 -0.0067 0.0322  74  ARG A CG  
335  C CD  . ARG A 46  ? 0.5274 0.5187 0.4635 -0.0629 -0.0137 0.0308  74  ARG A CD  
336  N NE  . ARG A 46  ? 0.5806 0.6018 0.5266 -0.0644 -0.0116 0.0425  74  ARG A NE  
337  C CZ  . ARG A 46  ? 0.5668 0.6046 0.5340 -0.0692 -0.0124 0.0568  74  ARG A CZ  
338  N NH1 . ARG A 46  ? 0.5410 0.5737 0.5220 -0.0716 -0.0146 0.0605  74  ARG A NH1 
339  N NH2 . ARG A 46  ? 0.5523 0.6125 0.5242 -0.0696 -0.0113 0.0679  74  ARG A NH2 
340  N N   . GLN A 47  ? 0.3992 0.4569 0.4037 -0.0461 0.0107  0.0608  75  GLN A N   
341  C CA  . GLN A 47  ? 0.4096 0.5039 0.4173 -0.0462 0.0147  0.0699  75  GLN A CA  
342  C C   . GLN A 47  ? 0.4006 0.5007 0.4093 -0.0360 0.0191  0.0627  75  GLN A C   
343  O O   . GLN A 47  ? 0.3993 0.4699 0.4097 -0.0328 0.0179  0.0534  75  GLN A O   
344  C CB  . GLN A 47  ? 0.4171 0.5195 0.4380 -0.0640 0.0098  0.0901  75  GLN A CB  
345  C CG  . GLN A 47  ? 0.4426 0.5531 0.4593 -0.0705 0.0068  0.1002  75  GLN A CG  
346  C CD  . GLN A 47  ? 0.5099 0.6214 0.5328 -0.0885 -0.0003 0.1219  75  GLN A CD  
347  O OE1 . GLN A 47  ? 0.5203 0.6252 0.5489 -0.0991 -0.0043 0.1299  75  GLN A OE1 
348  N NE2 . GLN A 47  ? 0.5280 0.6453 0.5464 -0.0935 -0.0036 0.1324  75  GLN A NE2 
349  N N   . GLU A 48  ? 0.4353 0.5792 0.4426 -0.0297 0.0244  0.0683  76  GLU A N   
350  C CA  . GLU A 48  ? 0.4918 0.6490 0.4958 -0.0134 0.0295  0.0607  76  GLU A CA  
351  C C   . GLU A 48  ? 0.4724 0.6239 0.4949 -0.0249 0.0268  0.0670  76  GLU A C   
352  O O   . GLU A 48  ? 0.4226 0.5771 0.4590 -0.0467 0.0212  0.0823  76  GLU A O   
353  C CB  . GLU A 48  ? 0.5456 0.7638 0.5430 0.0004  0.0367  0.0669  76  GLU A CB  
354  C CG  . GLU A 48  ? 0.6393 0.8652 0.6228 0.0290  0.0427  0.0539  76  GLU A CG  
355  C CD  . GLU A 48  ? 0.7923 1.0843 0.7648 0.0515  0.0511  0.0584  76  GLU A CD  
356  O OE1 . GLU A 48  ? 0.6488 0.9923 0.6304 0.0396  0.0526  0.0757  76  GLU A OE1 
357  O OE2 . GLU A 48  ? 0.8555 1.1489 0.8080 0.0831  0.0560  0.0452  76  GLU A OE2 
358  N N   . ILE A 49  ? 0.4538 0.5906 0.4718 -0.0100 0.0292  0.0547  77  ILE A N   
359  C CA  . ILE A 49  ? 0.4577 0.5985 0.4905 -0.0170 0.0276  0.0597  77  ILE A CA  
360  C C   . ILE A 49  ? 0.4596 0.6594 0.4932 -0.0037 0.0340  0.0659  77  ILE A C   
361  O O   . ILE A 49  ? 0.4891 0.6950 0.5050 0.0240  0.0400  0.0540  77  ILE A O   
362  C CB  . ILE A 49  ? 0.4404 0.5332 0.4689 -0.0094 0.0260  0.0446  77  ILE A CB  
363  C CG1 . ILE A 49  ? 0.4439 0.4935 0.4736 -0.0218 0.0202  0.0419  77  ILE A CG1 
364  C CG2 . ILE A 49  ? 0.4461 0.5459 0.4878 -0.0146 0.0247  0.0488  77  ILE A CG2 
365  C CD1 . ILE A 49  ? 0.4516 0.4613 0.4735 -0.0149 0.0186  0.0284  77  ILE A CD1 
366  N N   . PRO A 50  ? 0.4582 0.7018 0.5088 -0.0230 0.0316  0.0856  78  PRO A N   
367  C CA  . PRO A 50  ? 0.4714 0.7864 0.5258 -0.0112 0.0377  0.0953  78  PRO A CA  
368  C C   . PRO A 50  ? 0.4474 0.7588 0.4925 0.0197  0.0436  0.0803  78  PRO A C   
369  O O   . PRO A 50  ? 0.4279 0.6917 0.4744 0.0180  0.0400  0.0704  78  PRO A O   
370  C CB  . PRO A 50  ? 0.4880 0.8302 0.5618 -0.0453 0.0294  0.1177  78  PRO A CB  
371  C CG  . PRO A 50  ? 0.5001 0.7926 0.5743 -0.0729 0.0194  0.1225  78  PRO A CG  
372  C CD  . PRO A 50  ? 0.4748 0.7024 0.5378 -0.0565 0.0213  0.1004  78  PRO A CD  
373  N N   . GLU A 51  ? 0.4915 0.8536 0.5246 0.0499  0.0523  0.0793  79  GLU A N   
374  C CA  . GLU A 51  ? 0.5759 0.9418 0.5945 0.0858  0.0579  0.0673  79  GLU A CA  
375  C C   . GLU A 51  ? 0.5130 0.8868 0.5502 0.0755  0.0549  0.0738  79  GLU A C   
376  O O   . GLU A 51  ? 0.5326 0.8665 0.5583 0.0946  0.0550  0.0594  79  GLU A O   
377  C CB  . GLU A 51  ? 0.7084 1.1535 0.7155 0.1180  0.0677  0.0734  79  GLU A CB  
378  C CG  . GLU A 51  ? 0.9154 1.3691 0.9002 0.1648  0.0741  0.0612  79  GLU A CG  
379  C CD  . GLU A 51  ? 1.1039 1.4804 1.0449 0.1983  0.0737  0.0339  79  GLU A CD  
380  O OE1 . GLU A 51  ? 1.0935 1.3865 1.0286 0.1812  0.0658  0.0212  79  GLU A OE1 
381  O OE2 . GLU A 51  ? 1.1885 1.5882 1.0977 0.2420  0.0803  0.0257  79  GLU A OE2 
382  N N   . ASP A 52  ? 0.4700 0.8922 0.5326 0.0434  0.0505  0.0961  80  ASP A N   
383  C CA  . ASP A 52  ? 0.4767 0.9139 0.5553 0.0303  0.0461  0.1043  80  ASP A CA  
384  C C   . ASP A 52  ? 0.4415 0.8125 0.5286 -0.0035 0.0349  0.1021  80  ASP A C   
385  O O   . ASP A 52  ? 0.4202 0.8043 0.5200 -0.0249 0.0281  0.1126  80  ASP A O   
386  C CB  . ASP A 52  ? 0.5200 1.0572 0.6166 0.0150  0.0459  0.1321  80  ASP A CB  
387  C CG  . ASP A 52  ? 0.5540 1.1035 0.6624 -0.0308 0.0361  0.1530  80  ASP A CG  
388  O OD1 . ASP A 52  ? 0.5992 1.0876 0.7005 -0.0425 0.0322  0.1453  80  ASP A OD1 
389  O OD2 . ASP A 52  ? 0.6179 1.2400 0.7410 -0.0561 0.0312  0.1791  80  ASP A OD2 
390  N N   . PHE A 53  ? 0.3852 0.6876 0.4629 -0.0065 0.0326  0.0884  81  PHE A N   
391  C CA  . PHE A 53  ? 0.4060 0.6525 0.4887 -0.0347 0.0225  0.0878  81  PHE A CA  
392  C C   . PHE A 53  ? 0.4013 0.6172 0.4859 -0.0326 0.0198  0.0791  81  PHE A C   
393  O O   . PHE A 53  ? 0.3878 0.5896 0.4785 -0.0571 0.0107  0.0857  81  PHE A O   
394  C CB  . PHE A 53  ? 0.4180 0.6082 0.4909 -0.0344 0.0216  0.0765  81  PHE A CB  
395  C CG  . PHE A 53  ? 0.4394 0.5852 0.5151 -0.0606 0.0113  0.0802  81  PHE A CG  
396  C CD1 . PHE A 53  ? 0.4859 0.6437 0.5640 -0.0867 0.0035  0.0976  81  PHE A CD1 
397  C CD2 . PHE A 53  ? 0.4513 0.5441 0.5238 -0.0581 0.0084  0.0675  81  PHE A CD2 
398  C CE1 . PHE A 53  ? 0.4956 0.6032 0.5682 -0.1063 -0.0076 0.1000  81  PHE A CE1 
399  C CE2 . PHE A 53  ? 0.4606 0.5128 0.5304 -0.0755 -0.0008 0.0698  81  PHE A CE2 
400  C CZ  . PHE A 53  ? 0.5120 0.5670 0.5796 -0.0979 -0.0092 0.0850  81  PHE A CZ  
401  N N   . LEU A 54  ? 0.4091 0.6127 0.4847 -0.0036 0.0264  0.0648  82  LEU A N   
402  C CA  . LEU A 54  ? 0.4644 0.6399 0.5412 -0.0011 0.0239  0.0573  82  LEU A CA  
403  C C   . LEU A 54  ? 0.4700 0.6954 0.5597 -0.0105 0.0213  0.0708  82  LEU A C   
404  O O   . LEU A 54  ? 0.4521 0.6561 0.5460 -0.0240 0.0150  0.0699  82  LEU A O   
405  C CB  . LEU A 54  ? 0.5120 0.6588 0.5717 0.0300  0.0293  0.0413  82  LEU A CB  
406  C CG  . LEU A 54  ? 0.5518 0.6451 0.5967 0.0331  0.0288  0.0290  82  LEU A CG  
407  C CD1 . LEU A 54  ? 0.5724 0.6307 0.5939 0.0589  0.0303  0.0152  82  LEU A CD1 
408  C CD2 . LEU A 54  ? 0.5156 0.5697 0.5687 0.0095  0.0225  0.0280  82  LEU A CD2 
409  N N   . ASP A 55  ? 0.4740 0.7703 0.5691 -0.0041 0.0256  0.0842  83  ASP A N   
410  C CA  . ASP A 55  ? 0.5078 0.8663 0.6166 -0.0163 0.0223  0.1013  83  ASP A CA  
411  C C   . ASP A 55  ? 0.5053 0.8741 0.6234 -0.0617 0.0097  0.1193  83  ASP A C   
412  O O   . ASP A 55  ? 0.5295 0.9118 0.6537 -0.0834 0.0009  0.1287  83  ASP A O   
413  C CB  . ASP A 55  ? 0.5593 1.0007 0.6694 0.0111  0.0320  0.1109  83  ASP A CB  
414  C CG  . ASP A 55  ? 0.6272 1.0515 0.7202 0.0584  0.0413  0.0934  83  ASP A CG  
415  O OD1 . ASP A 55  ? 0.7504 1.0994 0.8318 0.0652  0.0397  0.0756  83  ASP A OD1 
416  O OD2 . ASP A 55  ? 0.7444 1.2310 0.8325 0.0897  0.0495  0.0986  83  ASP A OD2 
417  N N   . LYS A 56  ? 0.4813 0.8399 0.5966 -0.0772 0.0071  0.1247  84  LYS A N   
418  C CA  . LYS A 56  ? 0.4890 0.8429 0.6053 -0.1212 -0.0075 0.1423  84  LYS A CA  
419  C C   . LYS A 56  ? 0.4549 0.7324 0.5591 -0.1300 -0.0126 0.1328  84  LYS A C   
420  O O   . LYS A 56  ? 0.4476 0.7346 0.5499 -0.1419 -0.0145 0.1432  84  LYS A O   
421  C CB  . LYS A 56  ? 0.5871 1.0268 0.7125 -0.1371 -0.0082 0.1685  84  LYS A CB  
422  C CG  . LYS A 56  ? 0.6492 1.1819 0.7878 -0.1283 -0.0033 0.1827  84  LYS A CG  
423  C CD  . LYS A 56  ? 0.7872 1.4052 0.9357 -0.1633 -0.0112 0.2162  84  LYS A CD  
424  C CE  . LYS A 56  ? 0.8845 1.5248 1.0311 -0.1630 -0.0066 0.2243  84  LYS A CE  
425  N NZ  . LYS A 56  ? 1.0412 1.7886 1.1997 -0.1901 -0.0110 0.2596  84  LYS A NZ  
426  N N   . PRO A 57  ? 0.4371 0.6439 0.5330 -0.1226 -0.0145 0.1142  85  PRO A N   
427  C CA  . PRO A 57  ? 0.4402 0.5815 0.5244 -0.1264 -0.0188 0.1059  85  PRO A CA  
428  C C   . PRO A 57  ? 0.4749 0.5889 0.5475 -0.1619 -0.0359 0.1201  85  PRO A C   
429  O O   . PRO A 57  ? 0.5005 0.6269 0.5707 -0.1860 -0.0469 0.1317  85  PRO A O   
430  C CB  . PRO A 57  ? 0.4707 0.5601 0.5499 -0.1094 -0.0168 0.0859  85  PRO A CB  
431  C CG  . PRO A 57  ? 0.4683 0.5806 0.5525 -0.1132 -0.0192 0.0882  85  PRO A CG  
432  C CD  . PRO A 57  ? 0.4652 0.6555 0.5617 -0.1129 -0.0143 0.1032  85  PRO A CD  
433  N N   . THR A 58  ? 0.4759 0.5511 0.5380 -0.1657 -0.0397 0.1202  86  THR A N   
434  C CA  . THR A 58  ? 0.5274 0.5545 0.5691 -0.1943 -0.0579 0.1305  86  THR A CA  
435  C C   . THR A 58  ? 0.5498 0.5024 0.5744 -0.1811 -0.0622 0.1117  86  THR A C   
436  O O   . THR A 58  ? 0.5132 0.4399 0.5371 -0.1576 -0.0544 0.0987  86  THR A O   
437  C CB  . THR A 58  ? 0.5740 0.5987 0.6107 -0.2019 -0.0600 0.1417  86  THR A CB  
438  O OG1 . THR A 58  ? 0.5934 0.6968 0.6461 -0.2110 -0.0544 0.1593  86  THR A OG1 
439  C CG2 . THR A 58  ? 0.6275 0.5903 0.6357 -0.2305 -0.0815 0.1530  86  THR A CG2 
440  N N   . LEU A 59  ? 0.5632 0.4864 0.5730 -0.1956 -0.0748 0.1110  87  LEU A N   
441  C CA  . LEU A 59  ? 0.6060 0.4639 0.5966 -0.1799 -0.0786 0.0929  87  LEU A CA  
442  C C   . LEU A 59  ? 0.6515 0.4406 0.6104 -0.1857 -0.0930 0.0948  87  LEU A C   
443  O O   . LEU A 59  ? 0.6607 0.4357 0.6027 -0.2155 -0.1087 0.1117  87  LEU A O   
444  C CB  . LEU A 59  ? 0.6529 0.5023 0.6340 -0.1927 -0.0882 0.0909  87  LEU A CB  
445  C CG  . LEU A 59  ? 0.6738 0.5714 0.6788 -0.1778 -0.0750 0.0833  87  LEU A CG  
446  C CD1 . LEU A 59  ? 0.6919 0.6524 0.7266 -0.1600 -0.0566 0.0848  87  LEU A CD1 
447  C CD2 . LEU A 59  ? 0.7059 0.6269 0.7077 -0.2061 -0.0871 0.0950  87  LEU A CD2 
448  N N   . LEU A 60  ? 0.6663 0.4144 0.6151 -0.1569 -0.0884 0.0790  88  LEU A N   
449  C CA  . LEU A 60  ? 0.7529 0.4326 0.6671 -0.1540 -0.1017 0.0791  88  LEU A CA  
450  C C   . LEU A 60  ? 0.8488 0.4642 0.7219 -0.1725 -0.1242 0.0795  88  LEU A C   
451  O O   . LEU A 60  ? 0.8800 0.4423 0.7194 -0.1902 -0.1429 0.0898  88  LEU A O   
452  C CB  . LEU A 60  ? 0.7402 0.4022 0.6534 -0.1152 -0.0909 0.0628  88  LEU A CB  
453  C CG  . LEU A 60  ? 0.8376 0.4353 0.7151 -0.1028 -0.1024 0.0629  88  LEU A CG  
454  C CD1 . LEU A 60  ? 0.8390 0.4482 0.7217 -0.1151 -0.1038 0.0790  88  LEU A CD1 
455  C CD2 . LEU A 60  ? 0.8327 0.4234 0.7084 -0.0624 -0.0921 0.0472  88  LEU A CD2 
456  N N   . SER A 61  ? 0.8714 0.4882 0.7440 -0.1693 -0.1238 0.0687  89  SER A N   
457  C CA  . SER A 61  ? 1.0246 0.5831 0.8564 -0.1891 -0.1460 0.0678  89  SER A CA  
458  C C   . SER A 61  ? 0.9599 0.5674 0.8117 -0.2066 -0.1440 0.0695  89  SER A C   
459  O O   . SER A 61  ? 0.8798 0.4957 0.7391 -0.1846 -0.1346 0.0538  89  SER A O   
460  C CB  . SER A 61  ? 1.0628 0.5478 0.8554 -0.1562 -0.1511 0.0476  89  SER A CB  
461  O OG  . SER A 61  ? 0.9788 0.4985 0.7983 -0.1168 -0.1289 0.0336  89  SER A OG  
462  N N   . PRO A 62  ? 0.9846 0.6314 0.8460 -0.2460 -0.1528 0.0907  90  PRO A N   
463  C CA  . PRO A 62  ? 1.0101 0.7126 0.8909 -0.2634 -0.1518 0.0959  90  PRO A CA  
464  C C   . PRO A 62  ? 1.0779 0.7252 0.9227 -0.2706 -0.1684 0.0851  90  PRO A C   
465  O O   . PRO A 62  ? 1.0396 0.7214 0.9011 -0.2616 -0.1601 0.0772  90  PRO A O   
466  C CB  . PRO A 62  ? 1.0073 0.7546 0.8949 -0.3076 -0.1632 0.1246  90  PRO A CB  
467  C CG  . PRO A 62  ? 0.9425 0.6811 0.8306 -0.3050 -0.1608 0.1329  90  PRO A CG  
468  C CD  . PRO A 62  ? 0.9835 0.6338 0.8396 -0.2760 -0.1635 0.1133  90  PRO A CD  
469  N N   . GLU A 63  ? 1.1115 0.6698 0.9032 -0.2858 -0.1927 0.0846  91  GLU A N   
470  C CA  . GLU A 63  ? 1.2478 0.7348 0.9926 -0.2874 -0.2107 0.0704  91  GLU A CA  
471  C C   . GLU A 63  ? 1.2495 0.7327 1.0004 -0.2396 -0.1931 0.0441  91  GLU A C   
472  O O   . GLU A 63  ? 1.1955 0.6664 0.9307 -0.2400 -0.1992 0.0341  91  GLU A O   
473  C CB  . GLU A 63  ? 1.4942 0.8694 1.1719 -0.2995 -0.2388 0.0702  91  GLU A CB  
474  C CG  . GLU A 63  ? 1.5826 0.9064 1.2441 -0.2566 -0.2311 0.0569  91  GLU A CG  
475  C CD  . GLU A 63  ? 1.5893 0.9518 1.2813 -0.2601 -0.2210 0.0735  91  GLU A CD  
476  O OE1 . GLU A 63  ? 1.5248 0.9526 1.2483 -0.2955 -0.2203 0.0958  91  GLU A OE1 
477  O OE2 . GLU A 63  ? 1.5540 0.8861 1.2379 -0.2257 -0.2136 0.0649  91  GLU A OE2 
478  N N   . GLU A 64  ? 1.1629 0.6609 0.9361 -0.2008 -0.1724 0.0349  92  GLU A N   
479  C CA  . GLU A 64  ? 1.2547 0.7567 1.0348 -0.1575 -0.1559 0.0138  92  GLU A CA  
480  C C   . GLU A 64  ? 1.1125 0.6970 0.9413 -0.1533 -0.1367 0.0138  92  GLU A C   
481  O O   . GLU A 64  ? 1.1460 0.7356 0.9767 -0.1284 -0.1279 -0.0005 92  GLU A O   
482  C CB  . GLU A 64  ? 1.3051 0.7999 1.0913 -0.1216 -0.1423 0.0074  92  GLU A CB  
483  C CG  . GLU A 64  ? 1.3646 0.8219 1.1243 -0.0797 -0.1388 -0.0129 92  GLU A CG  
484  C CD  . GLU A 64  ? 1.5641 0.9246 1.2550 -0.0781 -0.1635 -0.0221 92  GLU A CD  
485  O OE1 . GLU A 64  ? 1.5865 0.8953 1.2463 -0.1071 -0.1844 -0.0114 92  GLU A OE1 
486  O OE2 . GLU A 64  ? 1.6943 1.0284 1.3583 -0.0477 -0.1633 -0.0397 92  GLU A OE2 
487  N N   . LEU A 65  ? 1.0060 0.6552 0.8715 -0.1751 -0.1305 0.0305  93  LEU A N   
488  C CA  . LEU A 65  ? 0.9228 0.6441 0.8268 -0.1722 -0.1160 0.0323  93  LEU A CA  
489  C C   . LEU A 65  ? 0.9111 0.6275 0.7979 -0.1932 -0.1303 0.0327  93  LEU A C   
490  O O   . LEU A 65  ? 0.8172 0.5486 0.7110 -0.1771 -0.1230 0.0224  93  LEU A O   
491  C CB  . LEU A 65  ? 0.8805 0.6711 0.8209 -0.1858 -0.1071 0.0501  93  LEU A CB  
492  C CG  . LEU A 65  ? 0.8627 0.7267 0.8375 -0.1805 -0.0939 0.0538  93  LEU A CG  
493  C CD1 . LEU A 65  ? 0.8103 0.6754 0.7969 -0.1453 -0.0779 0.0371  93  LEU A CD1 
494  C CD2 . LEU A 65  ? 0.9023 0.8313 0.9065 -0.1851 -0.0843 0.0694  93  LEU A CD2 
495  N N   . LYS A 66  ? 0.9657 0.6612 0.8283 -0.2320 -0.1521 0.0464  94  LYS A N   
496  C CA  . LYS A 66  ? 1.0031 0.6857 0.8414 -0.2585 -0.1706 0.0482  94  LYS A CA  
497  C C   . LYS A 66  ? 1.0130 0.6288 0.8136 -0.2345 -0.1757 0.0244  94  LYS A C   
498  O O   . LYS A 66  ? 0.9839 0.6137 0.7823 -0.2360 -0.1777 0.0190  94  LYS A O   
499  C CB  . LYS A 66  ? 1.1000 0.7500 0.9059 -0.3070 -0.1982 0.0666  94  LYS A CB  
500  C CG  . LYS A 66  ? 1.2220 0.8758 1.0077 -0.3454 -0.2193 0.0751  94  LYS A CG  
501  C CD  . LYS A 66  ? 1.3446 0.9817 1.1044 -0.4007 -0.2467 0.1000  94  LYS A CD  
502  C CE  . LYS A 66  ? 1.4433 1.0577 1.1661 -0.4438 -0.2751 0.1067  94  LYS A CE  
503  N NZ  . LYS A 66  ? 1.3598 1.0825 1.1268 -0.4562 -0.2660 0.1204  94  LYS A NZ  
504  N N   . ALA A 67  ? 1.0911 0.6400 0.8621 -0.2094 -0.1770 0.0109  95  ALA A N   
505  C CA  . ALA A 67  ? 1.1613 0.6522 0.8945 -0.1782 -0.1796 -0.0121 95  ALA A CA  
506  C C   . ALA A 67  ? 1.1001 0.6456 0.8698 -0.1415 -0.1543 -0.0231 95  ALA A C   
507  O O   . ALA A 67  ? 1.1105 0.6434 0.8619 -0.1280 -0.1560 -0.0363 95  ALA A O   
508  C CB  . ALA A 67  ? 1.2823 0.6947 0.9736 -0.1567 -0.1871 -0.0214 95  ALA A CB  
509  N N   . ALA A 68  ? 1.0510 0.6540 0.8681 -0.1272 -0.1327 -0.0172 96  ALA A N   
510  C CA  . ALA A 68  ? 1.0067 0.6630 0.8589 -0.0997 -0.1109 -0.0233 96  ALA A CA  
511  C C   . ALA A 68  ? 1.0211 0.7235 0.8915 -0.1128 -0.1096 -0.0193 96  ALA A C   
512  O O   . ALA A 68  ? 0.9791 0.6951 0.8526 -0.0936 -0.1019 -0.0286 96  ALA A O   
513  C CB  . ALA A 68  ? 0.9373 0.6387 0.8303 -0.0899 -0.0927 -0.0156 96  ALA A CB  
514  N N   . SER A 69  ? 0.9742 0.7052 0.8561 -0.1454 -0.1175 -0.0037 97  SER A N   
515  C CA  . SER A 69  ? 0.9243 0.7059 0.8236 -0.1588 -0.1176 0.0032  97  SER A CA  
516  C C   . SER A 69  ? 1.0887 0.8321 0.9488 -0.1744 -0.1370 -0.0035 97  SER A C   
517  O O   . SER A 69  ? 0.9893 0.7733 0.8596 -0.1901 -0.1405 0.0036  97  SER A O   
518  C CB  . SER A 69  ? 0.9007 0.7385 0.8264 -0.1862 -0.1189 0.0247  97  SER A CB  
519  O OG  . SER A 69  ? 0.9370 0.7473 0.8342 -0.2247 -0.1421 0.0350  97  SER A OG  
520  N N   . ARG A 70  ? 1.2638 0.9283 1.0757 -0.1691 -0.1507 -0.0172 98  ARG A N   
521  C CA  . ARG A 70  ? 1.3279 0.9428 1.0929 -0.1735 -0.1682 -0.0298 98  ARG A CA  
522  C C   . ARG A 70  ? 1.3916 0.9405 1.1161 -0.1358 -0.1679 -0.0521 98  ARG A C   
523  O O   . ARG A 70  ? 1.4766 0.9638 1.1475 -0.1360 -0.1859 -0.0652 98  ARG A O   
524  C CB  . ARG A 70  ? 1.4351 1.0087 1.1622 -0.2200 -0.1976 -0.0197 98  ARG A CB  
525  C CG  . ARG A 70  ? 1.5781 1.0710 1.2629 -0.2269 -0.2136 -0.0210 98  ARG A CG  
526  C CD  . ARG A 70  ? 1.7304 1.1695 1.3663 -0.2766 -0.2475 -0.0114 98  ARG A CD  
527  N NE  . ARG A 70  ? 1.7153 1.2202 1.3863 -0.3209 -0.2515 0.0170  98  ARG A NE  
528  C CZ  . ARG A 70  ? 1.7802 1.2704 1.4232 -0.3743 -0.2797 0.0338  98  ARG A CZ  
529  N NH1 . ARG A 70  ? 1.7896 1.1896 1.3640 -0.3925 -0.3089 0.0234  98  ARG A NH1 
530  N NH2 . ARG A 70  ? 1.7006 1.2686 1.3818 -0.4101 -0.2797 0.0621  98  ARG A NH2 
531  N N   . GLY A 71  ? 1.4231 0.9887 1.1710 -0.1024 -0.1480 -0.0561 99  GLY A N   
532  C CA  . GLY A 71  ? 1.5443 1.0524 1.2550 -0.0677 -0.1485 -0.0718 99  GLY A CA  
533  C C   . GLY A 71  ? 1.6384 1.1568 1.3416 -0.0270 -0.1365 -0.0875 99  GLY A C   
534  O O   . GLY A 71  ? 1.7776 1.2378 1.4300 -0.0014 -0.1451 -0.1033 99  GLY A O   
535  N N   . ASN A 72  ? 1.5465 1.1381 1.2967 -0.0196 -0.1173 -0.0824 100 ASN A N   
536  C CA  . ASN A 72  ? 1.5553 1.1708 1.3042 0.0155  -0.1046 -0.0927 100 ASN A CA  
537  C C   . ASN A 72  ? 1.6645 1.2676 1.3820 0.0166  -0.1142 -0.1036 100 ASN A C   
538  O O   . ASN A 72  ? 1.6094 1.2532 1.3379 0.0374  -0.1022 -0.1070 100 ASN A O   
539  C CB  . ASN A 72  ? 1.4876 1.1798 1.2941 0.0232  -0.0818 -0.0814 100 ASN A CB  
540  C CG  . ASN A 72  ? 1.4013 1.1314 1.2503 -0.0065 -0.0781 -0.0653 100 ASN A CG  
541  O OD1 . ASN A 72  ? 1.4760 1.1857 1.3214 -0.0310 -0.0886 -0.0591 100 ASN A OD1 
542  N ND2 . ASN A 72  ? 1.1556 0.9416 1.0423 -0.0031 -0.0637 -0.0574 100 ASN A ND2 
543  N N   . GLY A 73  ? 1.6553 1.2029 1.3322 -0.0082 -0.1370 -0.1077 101 GLY A N   
544  C CA  . GLY A 73  ? 1.6019 1.1171 1.2324 -0.0058 -0.1511 -0.1217 101 GLY A CA  
545  C C   . GLY A 73  ? 1.5744 1.1495 1.2338 -0.0208 -0.1462 -0.1153 101 GLY A C   
546  O O   . GLY A 73  ? 1.7008 1.2782 1.3610 -0.0579 -0.1598 -0.1068 101 GLY A O   
547  N N   . GLU A 74  ? 1.3966 1.0238 1.0791 0.0074  -0.1275 -0.1172 102 GLU A N   
548  C CA  . GLU A 74  ? 1.3222 0.9987 1.0216 0.0013  -0.1236 -0.1137 102 GLU A CA  
549  C C   . GLU A 74  ? 1.1134 0.8630 0.8774 -0.0143 -0.1086 -0.0932 102 GLU A C   
550  O O   . GLU A 74  ? 1.1396 0.9173 0.9177 -0.0377 -0.1136 -0.0843 102 GLU A O   
551  C CB  . GLU A 74  ? 1.3912 1.0849 1.0758 0.0405  -0.1128 -0.1253 102 GLU A CB  
552  C CG  . GLU A 74  ? 1.4521 1.1656 1.1232 0.0379  -0.1173 -0.1295 102 GLU A CG  
553  C CD  . GLU A 74  ? 1.6214 1.2661 1.2192 0.0498  -0.1365 -0.1517 102 GLU A CD  
554  O OE1 . GLU A 74  ? 1.6551 1.2715 1.2266 0.0214  -0.1557 -0.1544 102 GLU A OE1 
555  O OE2 . GLU A 74  ? 1.7066 1.3257 1.2699 0.0886  -0.1332 -0.1664 102 GLU A OE2 
556  N N   . TYR A 75  ? 0.9203 0.6985 0.7194 0.0000  -0.0915 -0.0858 103 TYR A N   
557  C CA  . TYR A 75  ? 0.8499 0.6897 0.7013 -0.0050 -0.0764 -0.0694 103 TYR A CA  
558  C C   . TYR A 75  ? 0.7469 0.5924 0.6271 -0.0082 -0.0682 -0.0602 103 TYR A C   
559  O O   . TYR A 75  ? 0.8110 0.6217 0.6758 -0.0005 -0.0700 -0.0661 103 TYR A O   
560  C CB  . TYR A 75  ? 0.8118 0.6888 0.6740 0.0194  -0.0625 -0.0691 103 TYR A CB  
561  C CG  . TYR A 75  ? 0.9490 0.8177 0.8034 0.0452  -0.0543 -0.0748 103 TYR A CG  
562  C CD1 . TYR A 75  ? 0.9051 0.7956 0.7915 0.0474  -0.0425 -0.0643 103 TYR A CD1 
563  C CD2 . TYR A 75  ? 1.0032 0.8421 0.8146 0.0690  -0.0593 -0.0907 103 TYR A CD2 
564  C CE1 . TYR A 75  ? 0.9277 0.8186 0.8081 0.0696  -0.0357 -0.0673 103 TYR A CE1 
565  C CE2 . TYR A 75  ? 0.9932 0.8330 0.7973 0.0964  -0.0514 -0.0943 103 TYR A CE2 
566  C CZ  . TYR A 75  ? 0.9247 0.7942 0.7656 0.0951  -0.0396 -0.0815 103 TYR A CZ  
567  O OH  . TYR A 75  ? 1.0572 0.9356 0.8918 0.1212  -0.0323 -0.0832 103 TYR A OH  
568  N N   . ALA A 76  ? 0.6114 0.4994 0.5300 -0.0169 -0.0594 -0.0462 104 ALA A N   
569  C CA  . ALA A 76  ? 0.5128 0.4108 0.4584 -0.0185 -0.0509 -0.0374 104 ALA A CA  
570  C C   . ALA A 76  ? 0.4414 0.3824 0.4188 -0.0149 -0.0396 -0.0257 104 ALA A C   
571  O O   . ALA A 76  ? 0.4334 0.3975 0.4143 -0.0151 -0.0397 -0.0222 104 ALA A O   
572  C CB  . ALA A 76  ? 0.5277 0.4142 0.4737 -0.0413 -0.0603 -0.0322 104 ALA A CB  
573  N N   . TRP A 77  ? 0.3884 0.3349 0.3847 -0.0117 -0.0315 -0.0198 105 TRP A N   
574  C CA  . TRP A 77  ? 0.3679 0.3404 0.3860 -0.0071 -0.0231 -0.0096 105 TRP A CA  
575  C C   . TRP A 77  ? 0.3660 0.3490 0.3984 -0.0145 -0.0228 -0.0023 105 TRP A C   
576  O O   . TRP A 77  ? 0.3875 0.3584 0.4190 -0.0221 -0.0252 -0.0035 105 TRP A O   
577  C CB  . TRP A 77  ? 0.3601 0.3287 0.3821 0.0030  -0.0155 -0.0087 105 TRP A CB  
578  C CG  . TRP A 77  ? 0.3773 0.3545 0.3900 0.0123  -0.0137 -0.0107 105 TRP A CG  
579  C CD1 . TRP A 77  ? 0.3965 0.3646 0.3911 0.0217  -0.0152 -0.0200 105 TRP A CD1 
580  C CD2 . TRP A 77  ? 0.3793 0.3783 0.3977 0.0151  -0.0103 -0.0019 105 TRP A CD2 
581  N NE1 . TRP A 77  ? 0.4019 0.3936 0.3931 0.0309  -0.0117 -0.0174 105 TRP A NE1 
582  C CE2 . TRP A 77  ? 0.4144 0.4254 0.4211 0.0243  -0.0090 -0.0051 105 TRP A CE2 
583  C CE3 . TRP A 77  ? 0.3998 0.4075 0.4285 0.0123  -0.0090 0.0089  105 TRP A CE3 
584  C CZ2 . TRP A 77  ? 0.4138 0.4514 0.4227 0.0263  -0.0063 0.0042  105 TRP A CZ2 
585  C CZ3 . TRP A 77  ? 0.4313 0.4550 0.4587 0.0139  -0.0080 0.0176  105 TRP A CZ3 
586  C CH2 . TRP A 77  ? 0.4071 0.4487 0.4265 0.0187  -0.0065 0.0162  105 TRP A CH2 
587  N N   . TYR A 78  ? 0.3459 0.3530 0.3895 -0.0100 -0.0198 0.0061  106 TYR A N   
588  C CA  . TYR A 78  ? 0.3338 0.3619 0.3887 -0.0112 -0.0190 0.0137  106 TYR A CA  
589  C C   . TYR A 78  ? 0.3193 0.3512 0.3794 0.0052  -0.0123 0.0195  106 TYR A C   
590  O O   . TYR A 78  ? 0.3219 0.3484 0.3777 0.0127  -0.0111 0.0212  106 TYR A O   
591  C CB  . TYR A 78  ? 0.3323 0.3924 0.3891 -0.0206 -0.0257 0.0195  106 TYR A CB  
592  C CG  . TYR A 78  ? 0.3548 0.4038 0.3988 -0.0414 -0.0367 0.0148  106 TYR A CG  
593  C CD1 . TYR A 78  ? 0.3723 0.4031 0.3989 -0.0442 -0.0426 0.0065  106 TYR A CD1 
594  C CD2 . TYR A 78  ? 0.3557 0.4094 0.4003 -0.0586 -0.0427 0.0191  106 TYR A CD2 
595  C CE1 . TYR A 78  ? 0.4097 0.4172 0.4147 -0.0621 -0.0554 0.0004  106 TYR A CE1 
596  C CE2 . TYR A 78  ? 0.3961 0.4280 0.4215 -0.0807 -0.0563 0.0157  106 TYR A CE2 
597  C CZ  . TYR A 78  ? 0.4287 0.4325 0.4318 -0.0816 -0.0633 0.0052  106 TYR A CZ  
598  O OH  . TYR A 78  ? 0.4872 0.4575 0.4619 -0.1027 -0.0795 0.0003  106 TYR A OH  
599  N N   . TYR A 79  ? 0.3140 0.3529 0.3792 0.0110  -0.0091 0.0228  107 TYR A N   
600  C CA  . TYR A 79  ? 0.3372 0.3725 0.3990 0.0303  -0.0048 0.0270  107 TYR A CA  
601  C C   . TYR A 79  ? 0.3405 0.4151 0.4081 0.0409  -0.0036 0.0345  107 TYR A C   
602  O O   . TYR A 79  ? 0.3441 0.4478 0.4210 0.0297  -0.0050 0.0374  107 TYR A O   
603  C CB  . TYR A 79  ? 0.3508 0.3528 0.4058 0.0338  -0.0017 0.0228  107 TYR A CB  
604  C CG  . TYR A 79  ? 0.3494 0.3563 0.4102 0.0276  -0.0001 0.0204  107 TYR A CG  
605  C CD1 . TYR A 79  ? 0.3398 0.3384 0.4042 0.0111  -0.0022 0.0159  107 TYR A CD1 
606  C CD2 . TYR A 79  ? 0.3570 0.3760 0.4164 0.0406  0.0032  0.0229  107 TYR A CD2 
607  C CE1 . TYR A 79  ? 0.3445 0.3456 0.4125 0.0043  -0.0019 0.0156  107 TYR A CE1 
608  C CE2 . TYR A 79  ? 0.3526 0.3802 0.4174 0.0340  0.0047  0.0223  107 TYR A CE2 
609  C CZ  . TYR A 79  ? 0.3395 0.3575 0.4094 0.0140  0.0018  0.0195  107 TYR A CZ  
610  O OH  . TYR A 79  ? 0.3275 0.3523 0.4013 0.0058  0.0020  0.0208  107 TYR A OH  
611  N N   . GLU A 80  ? 0.3556 0.4319 0.4150 0.0633  -0.0018 0.0390  108 GLU A N   
612  C CA  . GLU A 80  ? 0.3764 0.4983 0.4394 0.0808  -0.0001 0.0475  108 GLU A CA  
613  C C   . GLU A 80  ? 0.3816 0.5212 0.4461 0.0901  0.0044  0.0481  108 GLU A C   
614  O O   . GLU A 80  ? 0.3858 0.4877 0.4370 0.1006  0.0069  0.0417  108 GLU A O   
615  C CB  . GLU A 80  ? 0.4430 0.5473 0.4887 0.1081  0.0000  0.0507  108 GLU A CB  
616  C CG  . GLU A 80  ? 0.4751 0.6275 0.5204 0.1349  0.0020  0.0602  108 GLU A CG  
617  C CD  . GLU A 80  ? 0.5340 0.6508 0.5526 0.1671  0.0007  0.0618  108 GLU A CD  
618  O OE1 . GLU A 80  ? 0.5278 0.5835 0.5293 0.1621  -0.0031 0.0572  108 GLU A OE1 
619  O OE2 . GLU A 80  ? 0.5319 0.6826 0.5442 0.1976  0.0027  0.0690  108 GLU A OE2 
620  N N   . GLY A 81  ? 0.3848 0.5850 0.4643 0.0842  0.0045  0.0572  109 GLY A N   
621  C CA  . GLY A 81  ? 0.4046 0.6404 0.4863 0.0975  0.0096  0.0618  109 GLY A CA  
622  C C   . GLY A 81  ? 0.4225 0.7241 0.5065 0.1241  0.0127  0.0741  109 GLY A C   
623  O O   . GLY A 81  ? 0.4027 0.7162 0.4860 0.1325  0.0104  0.0787  109 GLY A O   
624  N N   . ARG A 82  ? 0.4477 0.7976 0.5343 0.1394  0.0180  0.0807  110 ARG A N   
625  C CA  . ARG A 82  ? 0.4996 0.9288 0.5902 0.1671  0.0218  0.0950  110 ARG A CA  
626  C C   . ARG A 82  ? 0.4575 0.9587 0.5741 0.1326  0.0154  0.1115  110 ARG A C   
627  O O   . ARG A 82  ? 0.4199 0.9426 0.5503 0.0972  0.0113  0.1173  110 ARG A O   
628  C CB  . ARG A 82  ? 0.5844 1.0517 0.6682 0.1964  0.0300  0.0978  110 ARG A CB  
629  C CG  . ARG A 82  ? 0.7270 1.1328 0.7752 0.2430  0.0347  0.0836  110 ARG A CG  
630  C CD  . ARG A 82  ? 0.8288 1.2791 0.8645 0.2804  0.0431  0.0859  110 ARG A CD  
631  N NE  . ARG A 82  ? 0.8806 1.3255 0.9228 0.2582  0.0449  0.0822  110 ARG A NE  
632  C CZ  . ARG A 82  ? 0.9969 1.3581 1.0203 0.2531  0.0434  0.0655  110 ARG A CZ  
633  N NH1 . ARG A 82  ? 1.0633 1.3360 1.0594 0.2647  0.0390  0.0516  110 ARG A NH1 
634  N NH2 . ARG A 82  ? 0.9576 1.3259 0.9894 0.2334  0.0452  0.0648  110 ARG A NH2 
635  N N   . ASN A 83  ? 0.4315 0.9636 0.5513 0.1405  0.0127  0.1194  111 ASN A N   
636  C CA  . ASN A 83  ? 0.4397 1.0376 0.5797 0.1066  0.0042  0.1354  111 ASN A CA  
637  C C   . ASN A 83  ? 0.4334 0.9915 0.5784 0.0534  -0.0067 0.1304  111 ASN A C   
638  O O   . ASN A 83  ? 0.4613 1.0684 0.6185 0.0176  -0.0151 0.1440  111 ASN A O   
639  C CB  . ASN A 83  ? 0.4713 1.1777 0.6271 0.1104  0.0068  0.1570  111 ASN A CB  
640  C CG  . ASN A 83  ? 0.5052 1.2545 0.6512 0.1709  0.0183  0.1613  111 ASN A CG  
641  O OD1 . ASN A 83  ? 0.5364 1.2984 0.6761 0.1993  0.0193  0.1642  111 ASN A OD1 
642  N ND2 . ASN A 83  ? 0.5531 1.3238 0.6942 0.1930  0.0266  0.1615  111 ASN A ND2 
643  N N   . GLY A 84  ? 0.3853 0.8553 0.5175 0.0489  -0.0078 0.1120  112 GLY A N   
644  C CA  . GLY A 84  ? 0.3676 0.7925 0.4977 0.0076  -0.0181 0.1047  112 GLY A CA  
645  C C   . GLY A 84  ? 0.3603 0.6968 0.4767 0.0118  -0.0153 0.0850  112 GLY A C   
646  O O   . GLY A 84  ? 0.3648 0.6707 0.4732 0.0411  -0.0068 0.0777  112 GLY A O   
647  N N   . TRP A 85  ? 0.3375 0.6337 0.4478 -0.0174 -0.0239 0.0774  113 TRP A N   
648  C CA  . TRP A 85  ? 0.3356 0.5605 0.4343 -0.0156 -0.0220 0.0612  113 TRP A CA  
649  C C   . TRP A 85  ? 0.3336 0.5302 0.4296 -0.0313 -0.0235 0.0565  113 TRP A C   
650  O O   . TRP A 85  ? 0.3546 0.5661 0.4510 -0.0579 -0.0324 0.0629  113 TRP A O   
651  C CB  . TRP A 85  ? 0.3456 0.5438 0.4344 -0.0306 -0.0300 0.0543  113 TRP A CB  
652  C CG  . TRP A 85  ? 0.3397 0.5540 0.4285 -0.0162 -0.0288 0.0571  113 TRP A CG  
653  C CD1 . TRP A 85  ? 0.3550 0.6141 0.4473 -0.0253 -0.0356 0.0666  113 TRP A CD1 
654  C CD2 . TRP A 85  ? 0.3454 0.5317 0.4287 0.0068  -0.0221 0.0522  113 TRP A CD2 
655  N NE1 . TRP A 85  ? 0.3490 0.6091 0.4392 -0.0060 -0.0323 0.0671  113 TRP A NE1 
656  C CE2 . TRP A 85  ? 0.3580 0.5721 0.4418 0.0129  -0.0246 0.0589  113 TRP A CE2 
657  C CE3 . TRP A 85  ? 0.3520 0.4932 0.4286 0.0201  -0.0159 0.0446  113 TRP A CE3 
658  C CZ2 . TRP A 85  ? 0.3531 0.5479 0.4298 0.0322  -0.0210 0.0586  113 TRP A CZ2 
659  C CZ3 . TRP A 85  ? 0.3560 0.4787 0.4248 0.0361  -0.0135 0.0451  113 TRP A CZ3 
660  C CH2 . TRP A 85  ? 0.3672 0.5149 0.4357 0.0422  -0.0161 0.0522  113 TRP A CH2 
661  N N   . TRP A 86  ? 0.3282 0.4821 0.4192 -0.0169 -0.0165 0.0465  114 TRP A N   
662  C CA  . TRP A 86  ? 0.3316 0.4490 0.4177 -0.0290 -0.0178 0.0399  114 TRP A CA  
663  C C   . TRP A 86  ? 0.3294 0.3991 0.4034 -0.0339 -0.0212 0.0283  114 TRP A C   
664  O O   . TRP A 86  ? 0.3263 0.3841 0.3975 -0.0204 -0.0176 0.0241  114 TRP A O   
665  C CB  . TRP A 86  ? 0.3230 0.4257 0.4093 -0.0098 -0.0085 0.0364  114 TRP A CB  
666  C CG  . TRP A 86  ? 0.3300 0.4749 0.4231 0.0014  -0.0036 0.0451  114 TRP A CG  
667  C CD1 . TRP A 86  ? 0.3433 0.5086 0.4344 0.0297  0.0028  0.0477  114 TRP A CD1 
668  C CD2 . TRP A 86  ? 0.3305 0.5025 0.4299 -0.0119 -0.0049 0.0529  114 TRP A CD2 
669  N NE1 . TRP A 86  ? 0.3503 0.5592 0.4463 0.0379  0.0068  0.0556  114 TRP A NE1 
670  C CE2 . TRP A 86  ? 0.3505 0.5681 0.4538 0.0103  0.0023  0.0601  114 TRP A CE2 
671  C CE3 . TRP A 86  ? 0.3476 0.5089 0.4465 -0.0402 -0.0126 0.0554  114 TRP A CE3 
672  C CZ2 . TRP A 86  ? 0.3522 0.6141 0.4627 0.0042  0.0035  0.0706  114 TRP A CZ2 
673  C CZ3 . TRP A 86  ? 0.3441 0.5433 0.4496 -0.0499 -0.0129 0.0670  114 TRP A CZ3 
674  C CH2 . TRP A 86  ? 0.3582 0.6115 0.4713 -0.0285 -0.0042 0.0749  114 TRP A CH2 
675  N N   . GLN A 87  ? 0.3328 0.3756 0.3969 -0.0514 -0.0286 0.0242  115 GLN A N   
676  C CA  . GLN A 87  ? 0.3497 0.3490 0.3990 -0.0492 -0.0305 0.0125  115 GLN A CA  
677  C C   . GLN A 87  ? 0.3397 0.3176 0.3913 -0.0358 -0.0222 0.0077  115 GLN A C   
678  O O   . GLN A 87  ? 0.3296 0.3091 0.3866 -0.0377 -0.0198 0.0109  115 GLN A O   
679  C CB  . GLN A 87  ? 0.3980 0.3691 0.4278 -0.0693 -0.0437 0.0092  115 GLN A CB  
680  C CG  . GLN A 87  ? 0.4278 0.3577 0.4358 -0.0616 -0.0470 -0.0038 115 GLN A CG  
681  C CD  . GLN A 87  ? 0.5034 0.3939 0.4818 -0.0790 -0.0630 -0.0083 115 GLN A CD  
682  O OE1 . GLN A 87  ? 0.5302 0.4297 0.5027 -0.1020 -0.0745 -0.0013 115 GLN A OE1 
683  N NE2 . GLN A 87  ? 0.5668 0.4128 0.5233 -0.0680 -0.0650 -0.0190 115 GLN A NE2 
684  N N   . TYR A 88  ? 0.3329 0.2958 0.3803 -0.0240 -0.0182 0.0017  116 TYR A N   
685  C CA  . TYR A 88  ? 0.3210 0.2664 0.3682 -0.0155 -0.0126 -0.0013 116 TYR A CA  
686  C C   . TYR A 88  ? 0.3582 0.2790 0.3948 -0.0208 -0.0171 -0.0062 116 TYR A C   
687  O O   . TYR A 88  ? 0.3639 0.2677 0.3847 -0.0265 -0.0253 -0.0108 116 TYR A O   
688  C CB  . TYR A 88  ? 0.3253 0.2687 0.3691 -0.0058 -0.0094 -0.0035 116 TYR A CB  
689  C CG  . TYR A 88  ? 0.3149 0.2693 0.3650 0.0002  -0.0052 0.0028  116 TYR A CG  
690  C CD1 . TYR A 88  ? 0.3119 0.2574 0.3631 0.0032  -0.0018 0.0058  116 TYR A CD1 
691  C CD2 . TYR A 88  ? 0.3125 0.2814 0.3629 0.0024  -0.0066 0.0061  116 TYR A CD2 
692  C CE1 . TYR A 88  ? 0.3318 0.2743 0.3797 0.0080  -0.0014 0.0117  116 TYR A CE1 
693  C CE2 . TYR A 88  ? 0.3198 0.2902 0.3699 0.0096  -0.0047 0.0125  116 TYR A CE2 
694  C CZ  . TYR A 88  ? 0.3236 0.2767 0.3703 0.0122  -0.0028 0.0151  116 TYR A CZ  
695  O OH  . TYR A 88  ? 0.3474 0.2890 0.3853 0.0183  -0.0042 0.0216  116 TYR A OH  
696  N N   . ASP A 89  ? 0.3600 0.2746 0.4012 -0.0176 -0.0128 -0.0052 117 ASP A N   
697  C CA  . ASP A 89  ? 0.4063 0.2971 0.4368 -0.0169 -0.0155 -0.0090 117 ASP A CA  
698  C C   . ASP A 89  ? 0.4152 0.2944 0.4316 -0.0046 -0.0163 -0.0160 117 ASP A C   
699  O O   . ASP A 89  ? 0.3751 0.2706 0.3954 0.0024  -0.0121 -0.0158 117 ASP A O   
700  C CB  . ASP A 89  ? 0.3877 0.2816 0.4275 -0.0140 -0.0096 -0.0057 117 ASP A CB  
701  C CG  . ASP A 89  ? 0.4023 0.3040 0.4457 -0.0043 -0.0037 -0.0055 117 ASP A CG  
702  O OD1 . ASP A 89  ? 0.4341 0.3465 0.4845 -0.0043 -0.0003 -0.0018 117 ASP A OD1 
703  O OD2 . ASP A 89  ? 0.4360 0.3331 0.4724 0.0033  -0.0036 -0.0078 117 ASP A OD2 
704  N N   . GLU A 90  ? 0.4358 0.2866 0.4327 -0.0007 -0.0223 -0.0214 118 GLU A N   
705  C CA  . GLU A 90  ? 0.4984 0.3363 0.4742 0.0160  -0.0243 -0.0298 118 GLU A CA  
706  C C   . GLU A 90  ? 0.4639 0.3293 0.4484 0.0329  -0.0147 -0.0278 118 GLU A C   
707  O O   . GLU A 90  ? 0.4633 0.3406 0.4388 0.0461  -0.0131 -0.0313 118 GLU A O   
708  C CB  . GLU A 90  ? 0.5965 0.3878 0.5410 0.0205  -0.0349 -0.0367 118 GLU A CB  
709  C CG  . GLU A 90  ? 0.6647 0.4465 0.6103 0.0259  -0.0331 -0.0333 118 GLU A CG  
710  C CD  . GLU A 90  ? 0.8598 0.5936 0.7676 0.0421  -0.0426 -0.0412 118 GLU A CD  
711  O OE1 . GLU A 90  ? 0.9035 0.5911 0.7853 0.0291  -0.0567 -0.0437 118 GLU A OE1 
712  O OE2 . GLU A 90  ? 0.9086 0.6507 0.8100 0.0680  -0.0371 -0.0437 118 GLU A OE2 
713  N N   . ARG A 91  ? 0.4410 0.3205 0.4416 0.0308  -0.0092 -0.0209 119 ARG A N   
714  C CA  . ARG A 91  ? 0.4319 0.3428 0.4411 0.0406  -0.0021 -0.0154 119 ARG A CA  
715  C C   . ARG A 91  ? 0.4029 0.3414 0.4258 0.0328  0.0016  -0.0087 119 ARG A C   
716  O O   . ARG A 91  ? 0.3786 0.3438 0.4000 0.0413  0.0044  -0.0055 119 ARG A O   
717  C CB  . ARG A 91  ? 0.4373 0.3524 0.4563 0.0369  0.0002  -0.0094 119 ARG A CB  
718  C CG  . ARG A 91  ? 0.4674 0.4199 0.4965 0.0395  0.0053  -0.0002 119 ARG A CG  
719  C CD  . ARG A 91  ? 0.5270 0.4809 0.5615 0.0367  0.0059  0.0045  119 ARG A CD  
720  N NE  . ARG A 91  ? 0.5271 0.4687 0.5465 0.0558  0.0043  -0.0002 119 ARG A NE  
721  C CZ  . ARG A 91  ? 0.5165 0.4346 0.5314 0.0556  0.0014  -0.0012 119 ARG A CZ  
722  N NH1 . ARG A 91  ? 0.5909 0.5009 0.6171 0.0372  0.0010  0.0019  119 ARG A NH1 
723  N NH2 . ARG A 91  ? 0.5255 0.4261 0.5204 0.0762  -0.0015 -0.0053 119 ARG A NH2 
724  N N   . THR A 92  ? 0.3709 0.3039 0.4042 0.0187  0.0011  -0.0057 120 THR A N   
725  C CA  . THR A 92  ? 0.3816 0.3296 0.4213 0.0130  0.0024  0.0003  120 THR A CA  
726  C C   . THR A 92  ? 0.3857 0.3399 0.4177 0.0189  0.0008  -0.0036 120 THR A C   
727  O O   . THR A 92  ? 0.3732 0.3486 0.4063 0.0200  0.0025  0.0020  120 THR A O   
728  C CB  . THR A 92  ? 0.3773 0.3143 0.4235 0.0038  0.0016  0.0027  120 THR A CB  
729  O OG1 . THR A 92  ? 0.4131 0.3419 0.4622 0.0000  0.0025  0.0044  120 THR A OG1 
730  C CG2 . THR A 92  ? 0.3873 0.3309 0.4339 0.0004  0.0014  0.0101  120 THR A CG2 
731  N N   . SER A 93  ? 0.4003 0.3359 0.4221 0.0204  -0.0036 -0.0123 121 SER A N   
732  C CA  . SER A 93  ? 0.4631 0.4005 0.4727 0.0252  -0.0068 -0.0177 121 SER A CA  
733  C C   . SER A 93  ? 0.4542 0.4079 0.4520 0.0421  -0.0041 -0.0200 121 SER A C   
734  O O   . SER A 93  ? 0.4385 0.4114 0.4333 0.0457  -0.0033 -0.0188 121 SER A O   
735  C CB  . SER A 93  ? 0.5108 0.4189 0.5044 0.0205  -0.0155 -0.0263 121 SER A CB  
736  O OG  . SER A 93  ? 0.5843 0.4926 0.5907 0.0048  -0.0175 -0.0212 121 SER A OG  
737  N N   . ARG A 94  ? 0.4517 0.4035 0.4428 0.0543  -0.0024 -0.0221 122 ARG A N   
738  C CA  . ARG A 94  ? 0.4569 0.4356 0.4368 0.0754  0.0014  -0.0226 122 ARG A CA  
739  C C   . ARG A 94  ? 0.4358 0.4637 0.4342 0.0695  0.0075  -0.0074 122 ARG A C   
740  O O   . ARG A 94  ? 0.4194 0.4798 0.4117 0.0801  0.0101  -0.0049 122 ARG A O   
741  C CB  . ARG A 94  ? 0.5145 0.4840 0.4823 0.0931  0.0018  -0.0265 122 ARG A CB  
742  C CG  . ARG A 94  ? 0.5629 0.4786 0.4992 0.1040  -0.0070 -0.0417 122 ARG A CG  
743  C CD  . ARG A 94  ? 0.6766 0.5826 0.5928 0.1303  -0.0070 -0.0460 122 ARG A CD  
744  N NE  . ARG A 94  ? 0.6848 0.5927 0.6191 0.1213  -0.0047 -0.0377 122 ARG A NE  
745  C CZ  . ARG A 94  ? 0.6956 0.5604 0.6265 0.1078  -0.0114 -0.0398 122 ARG A CZ  
746  N NH1 . ARG A 94  ? 0.7495 0.5657 0.6599 0.0980  -0.0220 -0.0484 122 ARG A NH1 
747  N NH2 . ARG A 94  ? 0.6709 0.5443 0.6182 0.1016  -0.0084 -0.0318 122 ARG A NH2 
748  N N   . GLU A 95  ? 0.3927 0.4241 0.4097 0.0514  0.0085  0.0031  123 GLU A N   
749  C CA  . GLU A 95  ? 0.4162 0.4818 0.4454 0.0384  0.0102  0.0192  123 GLU A CA  
750  C C   . GLU A 95  ? 0.3773 0.4454 0.4062 0.0314  0.0084  0.0222  123 GLU A C   
751  O O   . GLU A 95  ? 0.3723 0.4772 0.4012 0.0312  0.0098  0.0324  123 GLU A O   
752  C CB  . GLU A 95  ? 0.4191 0.4724 0.4593 0.0197  0.0084  0.0275  123 GLU A CB  
753  C CG  . GLU A 95  ? 0.4642 0.5370 0.5092 0.0006  0.0058  0.0449  123 GLU A CG  
754  C CD  . GLU A 95  ? 0.5292 0.6587 0.5759 0.0017  0.0078  0.0587  123 GLU A CD  
755  O OE1 . GLU A 95  ? 0.6490 0.8046 0.6964 0.0157  0.0118  0.0576  123 GLU A OE1 
756  O OE2 . GLU A 95  ? 0.5227 0.6746 0.5692 -0.0106 0.0052  0.0724  123 GLU A OE2 
757  N N   . LEU A 96  ? 0.3575 0.3926 0.3862 0.0260  0.0053  0.0152  124 LEU A N   
758  C CA  . LEU A 96  ? 0.3533 0.3911 0.3811 0.0218  0.0032  0.0179  124 LEU A CA  
759  C C   . LEU A 96  ? 0.3651 0.4245 0.3812 0.0351  0.0040  0.0128  124 LEU A C   
760  O O   . LEU A 96  ? 0.3411 0.4267 0.3574 0.0328  0.0045  0.0219  124 LEU A O   
761  C CB  . LEU A 96  ? 0.3655 0.3738 0.3951 0.0171  0.0000  0.0114  124 LEU A CB  
762  C CG  . LEU A 96  ? 0.3634 0.3524 0.4008 0.0083  -0.0006 0.0162  124 LEU A CG  
763  C CD1 . LEU A 96  ? 0.3720 0.3448 0.4117 0.0079  -0.0024 0.0098  124 LEU A CD1 
764  C CD2 . LEU A 96  ? 0.3767 0.3664 0.4135 0.0007  -0.0025 0.0292  124 LEU A CD2 
765  N N   . GLU A 97  ? 0.3686 0.4135 0.3703 0.0493  0.0031  -0.0016 125 GLU A N   
766  C CA  . GLU A 97  ? 0.4068 0.4631 0.3888 0.0660  0.0026  -0.0100 125 GLU A CA  
767  C C   . GLU A 97  ? 0.3980 0.5052 0.3799 0.0781  0.0088  -0.0003 125 GLU A C   
768  O O   . GLU A 97  ? 0.4050 0.5404 0.3792 0.0851  0.0099  0.0015  125 GLU A O   
769  C CB  . GLU A 97  ? 0.4415 0.4593 0.3994 0.0798  -0.0022 -0.0277 125 GLU A CB  
770  C CG  . GLU A 97  ? 0.4822 0.4936 0.4093 0.0974  -0.0063 -0.0408 125 GLU A CG  
771  C CD  . GLU A 97  ? 0.4917 0.5038 0.4184 0.0846  -0.0109 -0.0409 125 GLU A CD  
772  O OE1 . GLU A 97  ? 0.4855 0.4920 0.4318 0.0635  -0.0129 -0.0338 125 GLU A OE1 
773  O OE2 . GLU A 97  ? 0.5104 0.5320 0.4152 0.0986  -0.0125 -0.0480 125 GLU A OE2 
774  N N   . ASP A 98  ? 0.4004 0.5250 0.3909 0.0799  0.0126  0.0069  126 ASP A N   
775  C CA  . ASP A 98  ? 0.4295 0.6155 0.4228 0.0889  0.0183  0.0204  126 ASP A CA  
776  C C   . ASP A 98  ? 0.3874 0.6083 0.3944 0.0675  0.0179  0.0403  126 ASP A C   
777  O O   . ASP A 98  ? 0.4236 0.6932 0.4260 0.0754  0.0208  0.0482  126 ASP A O   
778  C CB  . ASP A 98  ? 0.4292 0.6292 0.4326 0.0879  0.0208  0.0280  126 ASP A CB  
779  C CG  . ASP A 98  ? 0.4937 0.7696 0.5017 0.0956  0.0262  0.0453  126 ASP A CG  
780  O OD1 . ASP A 98  ? 0.4922 0.7976 0.4837 0.1278  0.0309  0.0385  126 ASP A OD1 
781  O OD2 . ASP A 98  ? 0.4715 0.7784 0.4968 0.0696  0.0248  0.0665  126 ASP A OD2 
782  N N   . ALA A 99  ? 0.3569 0.5506 0.3769 0.0419  0.0135  0.0486  127 ALA A N   
783  C CA  . ALA A 99  ? 0.3609 0.5708 0.3878 0.0194  0.0099  0.0681  127 ALA A CA  
784  C C   . ALA A 99  ? 0.3578 0.5704 0.3776 0.0236  0.0090  0.0657  127 ALA A C   
785  O O   . ALA A 99  ? 0.3516 0.6061 0.3710 0.0183  0.0091  0.0809  127 ALA A O   
786  C CB  . ALA A 99  ? 0.3630 0.5272 0.3956 -0.0019 0.0040  0.0726  127 ALA A CB  
787  N N   . PHE A 100 ? 0.3495 0.5214 0.3639 0.0310  0.0074  0.0484  128 PHE A N   
788  C CA  . PHE A 100 ? 0.3580 0.5314 0.3650 0.0346  0.0055  0.0448  128 PHE A CA  
789  C C   . PHE A 100 ? 0.3660 0.5828 0.3595 0.0531  0.0093  0.0420  128 PHE A C   
790  O O   . PHE A 100 ? 0.3528 0.6007 0.3448 0.0498  0.0091  0.0526  128 PHE A O   
791  C CB  . PHE A 100 ? 0.3616 0.4905 0.3639 0.0378  0.0020  0.0273  128 PHE A CB  
792  C CG  . PHE A 100 ? 0.3739 0.5062 0.3685 0.0393  -0.0012 0.0242  128 PHE A CG  
793  C CD1 . PHE A 100 ? 0.3739 0.5053 0.3765 0.0273  -0.0041 0.0365  128 PHE A CD1 
794  C CD2 . PHE A 100 ? 0.3989 0.5335 0.3739 0.0541  -0.0024 0.0092  128 PHE A CD2 
795  C CE1 . PHE A 100 ? 0.3792 0.5192 0.3755 0.0291  -0.0072 0.0351  128 PHE A CE1 
796  C CE2 . PHE A 100 ? 0.4148 0.5545 0.3810 0.0536  -0.0065 0.0067  128 PHE A CE2 
797  C CZ  . PHE A 100 ? 0.3972 0.5438 0.3767 0.0405  -0.0084 0.0204  128 PHE A CZ  
798  N N   . SER A 101 ? 0.3812 0.5995 0.3624 0.0746  0.0126  0.0281  129 SER A N   
799  C CA  . SER A 101 ? 0.4170 0.6698 0.3777 0.1005  0.0162  0.0209  129 SER A CA  
800  C C   . SER A 101 ? 0.4076 0.7352 0.3765 0.1010  0.0220  0.0427  129 SER A C   
801  O O   . SER A 101 ? 0.4322 0.8017 0.3879 0.1167  0.0250  0.0434  129 SER A O   
802  C CB  . SER A 101 ? 0.4490 0.6749 0.3876 0.1274  0.0166  0.0002  129 SER A CB  
803  O OG  . SER A 101 ? 0.4549 0.7076 0.4021 0.1347  0.0219  0.0082  129 SER A OG  
804  N N   . LYS A 102 ? 0.3850 0.7310 0.3741 0.0814  0.0225  0.0616  130 LYS A N   
805  C CA  . LYS A 102 ? 0.3984 0.8181 0.3972 0.0713  0.0252  0.0881  130 LYS A CA  
806  C C   . LYS A 102 ? 0.3914 0.8176 0.3989 0.0405  0.0192  0.1095  130 LYS A C   
807  O O   . LYS A 102 ? 0.4058 0.8917 0.4191 0.0264  0.0190  0.1346  130 LYS A O   
808  C CB  . LYS A 102 ? 0.4020 0.8401 0.4147 0.0602  0.0258  0.1011  130 LYS A CB  
809  C CG  . LYS A 102 ? 0.4533 0.9073 0.4576 0.0926  0.0324  0.0879  130 LYS A CG  
810  C CD  . LYS A 102 ? 0.4671 0.9467 0.4881 0.0760  0.0319  0.1052  130 LYS A CD  
811  C CE  . LYS A 102 ? 0.5568 1.0346 0.5709 0.1061  0.0369  0.0912  130 LYS A CE  
812  N NZ  . LYS A 102 ? 0.6076 1.1100 0.5974 0.1524  0.0437  0.0755  130 LYS A NZ  
813  N N   . GLY A 103 ? 0.3788 0.7462 0.3854 0.0302  0.0135  0.1015  131 GLY A N   
814  C CA  . GLY A 103 ? 0.3903 0.7524 0.4003 0.0049  0.0066  0.1207  131 GLY A CA  
815  C C   . GLY A 103 ? 0.3984 0.7379 0.4156 -0.0260 -0.0013 0.1404  131 GLY A C   
816  O O   . GLY A 103 ? 0.4036 0.7472 0.4181 -0.0489 -0.0088 0.1624  131 GLY A O   
817  N N   . LYS A 104 ? 0.3913 0.7014 0.4134 -0.0277 -0.0013 0.1328  132 LYS A N   
818  C CA  . LYS A 104 ? 0.4152 0.6925 0.4377 -0.0563 -0.0106 0.1481  132 LYS A CA  
819  C C   . LYS A 104 ? 0.4269 0.6372 0.4409 -0.0636 -0.0183 0.1451  132 LYS A C   
820  O O   . LYS A 104 ? 0.4114 0.5908 0.4260 -0.0455 -0.0149 0.1251  132 LYS A O   
821  C CB  . LYS A 104 ? 0.4204 0.6818 0.4486 -0.0535 -0.0084 0.1384  132 LYS A CB  
822  C CG  . LYS A 104 ? 0.4348 0.7643 0.4701 -0.0462 -0.0020 0.1452  132 LYS A CG  
823  C CD  . LYS A 104 ? 0.4595 0.7718 0.4999 -0.0486 -0.0020 0.1403  132 LYS A CD  
824  C CE  . LYS A 104 ? 0.4843 0.8703 0.5315 -0.0378 0.0044  0.1485  132 LYS A CE  
825  N NZ  . LYS A 104 ? 0.5087 0.8738 0.5602 -0.0323 0.0059  0.1385  132 LYS A NZ  
826  N N   . LYS A 105 ? 0.4556 0.6431 0.4588 -0.0899 -0.0300 0.1660  133 LYS A N   
827  C CA  . LYS A 105 ? 0.4871 0.6081 0.4763 -0.0917 -0.0382 0.1641  133 LYS A CA  
828  C C   . LYS A 105 ? 0.4819 0.5465 0.4690 -0.0839 -0.0384 0.1467  133 LYS A C   
829  O O   . LYS A 105 ? 0.4811 0.5036 0.4622 -0.0707 -0.0393 0.1360  133 LYS A O   
830  C CB  . LYS A 105 ? 0.5497 0.6514 0.5190 -0.1210 -0.0534 0.1917  133 LYS A CB  
831  C CG  . LYS A 105 ? 0.6048 0.7550 0.5740 -0.1268 -0.0541 0.2094  133 LYS A CG  
832  C CD  . LYS A 105 ? 0.6977 0.8730 0.6562 -0.1638 -0.0663 0.2426  133 LYS A CD  
833  C CE  . LYS A 105 ? 0.7541 1.0039 0.7187 -0.1682 -0.0633 0.2609  133 LYS A CE  
834  N NZ  . LYS A 105 ? 0.8174 1.0360 0.7602 -0.1876 -0.0777 0.2832  133 LYS A NZ  
835  N N   . ASN A 106 ? 0.4841 0.5549 0.4763 -0.0911 -0.0373 0.1453  134 ASN A N   
836  C CA  . ASN A 106 ? 0.5002 0.5253 0.4910 -0.0839 -0.0367 0.1295  134 ASN A CA  
837  C C   . ASN A 106 ? 0.4784 0.5319 0.4811 -0.0862 -0.0317 0.1262  134 ASN A C   
838  O O   . ASN A 106 ? 0.4877 0.5975 0.4985 -0.0931 -0.0292 0.1379  134 ASN A O   
839  C CB  . ASN A 106 ? 0.5700 0.5291 0.5348 -0.0983 -0.0505 0.1375  134 ASN A CB  
840  C CG  . ASN A 106 ? 0.6406 0.6015 0.5893 -0.1320 -0.0641 0.1632  134 ASN A CG  
841  O OD1 . ASN A 106 ? 0.6870 0.6772 0.6418 -0.1487 -0.0650 0.1710  134 ASN A OD1 
842  N ND2 . ASN A 106 ? 0.6917 0.6226 0.6181 -0.1437 -0.0758 0.1784  134 ASN A ND2 
843  N N   . THR A 107 ? 0.4516 0.4712 0.4552 -0.0781 -0.0297 0.1113  135 THR A N   
844  C CA  . THR A 107 ? 0.4602 0.4986 0.4729 -0.0799 -0.0261 0.1082  135 THR A CA  
845  C C   . THR A 107 ? 0.4712 0.4554 0.4756 -0.0789 -0.0292 0.0973  135 THR A C   
846  O O   . THR A 107 ? 0.5064 0.4491 0.5020 -0.0689 -0.0305 0.0885  135 THR A O   
847  C CB  . THR A 107 ? 0.4436 0.5233 0.4726 -0.0565 -0.0139 0.0949  135 THR A CB  
848  O OG1 . THR A 107 ? 0.4837 0.5857 0.5198 -0.0564 -0.0110 0.0949  135 THR A OG1 
849  C CG2 . THR A 107 ? 0.4253 0.4745 0.4566 -0.0363 -0.0090 0.0741  135 THR A CG2 
850  N N   . GLU A 108 ? 0.4830 0.4730 0.4897 -0.0874 -0.0300 0.0986  136 GLU A N   
851  C CA  . GLU A 108 ? 0.4899 0.4329 0.4869 -0.0870 -0.0330 0.0889  136 GLU A CA  
852  C C   . GLU A 108 ? 0.4864 0.4445 0.5006 -0.0689 -0.0225 0.0735  136 GLU A C   
853  O O   . GLU A 108 ? 0.5310 0.5331 0.5594 -0.0627 -0.0161 0.0741  136 GLU A O   
854  C CB  . GLU A 108 ? 0.5639 0.4938 0.5446 -0.1148 -0.0452 0.1032  136 GLU A CB  
855  C CG  . GLU A 108 ? 0.6626 0.5538 0.6151 -0.1358 -0.0603 0.1180  136 GLU A CG  
856  C CD  . GLU A 108 ? 0.7965 0.6577 0.7234 -0.1671 -0.0767 0.1309  136 GLU A CD  
857  O OE1 . GLU A 108 ? 0.8506 0.7220 0.7832 -0.1711 -0.0753 0.1271  136 GLU A OE1 
858  O OE2 . GLU A 108 ? 0.8784 0.7021 0.7761 -0.1892 -0.0926 0.1456  136 GLU A OE2 
859  N N   . MET A 109 ? 0.4588 0.3803 0.4688 -0.0587 -0.0212 0.0604  137 MET A N   
860  C CA  . MET A 109 ? 0.4621 0.3919 0.4856 -0.0442 -0.0131 0.0474  137 MET A CA  
861  C C   . MET A 109 ? 0.4607 0.3584 0.4747 -0.0469 -0.0160 0.0426  137 MET A C   
862  O O   . MET A 109 ? 0.4538 0.3139 0.4494 -0.0477 -0.0217 0.0418  137 MET A O   
863  C CB  . MET A 109 ? 0.4736 0.4015 0.5038 -0.0273 -0.0076 0.0364  137 MET A CB  
864  C CG  . MET A 109 ? 0.5651 0.4906 0.5901 -0.0257 -0.0099 0.0404  137 MET A CG  
865  S SD  . MET A 109 ? 0.6112 0.5361 0.6425 -0.0096 -0.0057 0.0294  137 MET A SD  
866  C CE  . MET A 109 ? 0.5672 0.4609 0.5824 -0.0051 -0.0109 0.0334  137 MET A CE  
867  N N   . LEU A 110 ? 0.4314 0.3426 0.4543 -0.0458 -0.0124 0.0393  138 LEU A N   
868  C CA  . LEU A 110 ? 0.4426 0.3292 0.4581 -0.0457 -0.0137 0.0334  138 LEU A CA  
869  C C   . LEU A 110 ? 0.4232 0.3059 0.4468 -0.0292 -0.0071 0.0221  138 LEU A C   
870  O O   . LEU A 110 ? 0.4092 0.3114 0.4463 -0.0226 -0.0021 0.0186  138 LEU A O   
871  C CB  . LEU A 110 ? 0.4263 0.3324 0.4477 -0.0534 -0.0137 0.0373  138 LEU A CB  
872  C CG  . LEU A 110 ? 0.4504 0.3338 0.4640 -0.0529 -0.0146 0.0308  138 LEU A CG  
873  C CD1 . LEU A 110 ? 0.4837 0.3270 0.4700 -0.0637 -0.0245 0.0321  138 LEU A CD1 
874  C CD2 . LEU A 110 ? 0.4723 0.3816 0.4958 -0.0563 -0.0128 0.0342  138 LEU A CD2 
875  N N   . ILE A 111 ? 0.4299 0.2875 0.4417 -0.0224 -0.0083 0.0173  139 ILE A N   
876  C CA  . ILE A 111 ? 0.4359 0.3008 0.4562 -0.0094 -0.0028 0.0102  139 ILE A CA  
877  C C   . ILE A 111 ? 0.4333 0.2817 0.4412 -0.0033 -0.0030 0.0059  139 ILE A C   
878  O O   . ILE A 111 ? 0.4546 0.2754 0.4404 0.0028  -0.0073 0.0046  139 ILE A O   
879  C CB  . ILE A 111 ? 0.4811 0.3504 0.5026 -0.0004 -0.0018 0.0099  139 ILE A CB  
880  C CG1 . ILE A 111 ? 0.4845 0.3688 0.5138 -0.0058 -0.0022 0.0138  139 ILE A CG1 
881  C CG2 . ILE A 111 ? 0.5122 0.4005 0.5449 0.0073  0.0025  0.0061  139 ILE A CG2 
882  C CD1 . ILE A 111 ? 0.5721 0.4655 0.6044 0.0015  -0.0015 0.0135  139 ILE A CD1 
883  N N   . ALA A 112 ? 0.4577 0.3206 0.4760 -0.0036 0.0007  0.0038  140 ALA A N   
884  C CA  . ALA A 112 ? 0.4771 0.3340 0.4859 0.0025  0.0017  0.0002  140 ALA A CA  
885  C C   . ALA A 112 ? 0.5303 0.3529 0.5121 0.0014  -0.0047 -0.0015 140 ALA A C   
886  O O   . ALA A 112 ? 0.6299 0.4324 0.5901 0.0158  -0.0061 -0.0062 140 ALA A O   
887  C CB  . ALA A 112 ? 0.5457 0.4185 0.5564 0.0176  0.0059  -0.0015 140 ALA A CB  
888  N N   . GLY A 113 ? 0.5477 0.3632 0.5270 -0.0152 -0.0098 0.0028  141 GLY A N   
889  C CA  . GLY A 113 ? 0.5971 0.3773 0.5472 -0.0235 -0.0192 0.0026  141 GLY A CA  
890  C C   . GLY A 113 ? 0.5770 0.3187 0.5001 -0.0283 -0.0294 0.0054  141 GLY A C   
891  O O   . GLY A 113 ? 0.6445 0.3484 0.5369 -0.0398 -0.0407 0.0061  141 GLY A O   
892  N N   . PHE A 114 ? 0.5398 0.2869 0.4703 -0.0219 -0.0273 0.0077  142 PHE A N   
893  C CA  . PHE A 114 ? 0.5704 0.2815 0.4756 -0.0293 -0.0381 0.0134  142 PHE A CA  
894  C C   . PHE A 114 ? 0.5204 0.2604 0.4466 -0.0402 -0.0368 0.0236  142 PHE A C   
895  O O   . PHE A 114 ? 0.4896 0.2697 0.4453 -0.0325 -0.0266 0.0222  142 PHE A O   
896  C CB  . PHE A 114 ? 0.6263 0.3035 0.5063 -0.0042 -0.0393 0.0061  142 PHE A CB  
897  C CG  . PHE A 114 ? 0.7140 0.3547 0.5614 0.0100  -0.0429 -0.0039 142 PHE A CG  
898  C CD1 . PHE A 114 ? 0.6931 0.3637 0.5543 0.0298  -0.0318 -0.0119 142 PHE A CD1 
899  C CD2 . PHE A 114 ? 0.7540 0.3298 0.5535 0.0025  -0.0588 -0.0047 142 PHE A CD2 
900  C CE1 . PHE A 114 ? 0.7381 0.3808 0.5677 0.0461  -0.0343 -0.0215 142 PHE A CE1 
901  C CE2 . PHE A 114 ? 0.8364 0.3742 0.5997 0.0186  -0.0629 -0.0162 142 PHE A CE2 
902  C CZ  . PHE A 114 ? 0.8037 0.3782 0.5830 0.0426  -0.0496 -0.0250 142 PHE A CZ  
903  N N   . LEU A 115 ? 0.5630 0.2803 0.4696 -0.0592 -0.0486 0.0343  143 LEU A N   
904  C CA  . LEU A 115 ? 0.5645 0.3103 0.4862 -0.0698 -0.0484 0.0459  143 LEU A CA  
905  C C   . LEU A 115 ? 0.5613 0.2890 0.4745 -0.0533 -0.0482 0.0440  143 LEU A C   
906  O O   . LEU A 115 ? 0.6286 0.3032 0.5076 -0.0465 -0.0572 0.0420  143 LEU A O   
907  C CB  . LEU A 115 ? 0.6506 0.3878 0.5550 -0.1019 -0.0626 0.0626  143 LEU A CB  
908  C CG  . LEU A 115 ? 0.6883 0.4713 0.6121 -0.1193 -0.0609 0.0698  143 LEU A CG  
909  C CD1 . LEU A 115 ? 0.7501 0.5298 0.6548 -0.1554 -0.0770 0.0895  143 LEU A CD1 
910  C CD2 . LEU A 115 ? 0.6423 0.4905 0.6048 -0.1076 -0.0464 0.0701  143 LEU A CD2 
911  N N   . TYR A 116 ? 0.5027 0.2727 0.4438 -0.0457 -0.0387 0.0446  144 TYR A N   
912  C CA  . TYR A 116 ? 0.5169 0.2830 0.4558 -0.0318 -0.0377 0.0448  144 TYR A CA  
913  C C   . TYR A 116 ? 0.5130 0.3022 0.4583 -0.0477 -0.0407 0.0585  144 TYR A C   
914  O O   . TYR A 116 ? 0.5072 0.3354 0.4703 -0.0606 -0.0378 0.0641  144 TYR A O   
915  C CB  . TYR A 116 ? 0.4728 0.2722 0.4368 -0.0115 -0.0253 0.0344  144 TYR A CB  
916  C CG  . TYR A 116 ? 0.4741 0.2571 0.4295 0.0069  -0.0226 0.0243  144 TYR A CG  
917  C CD1 . TYR A 116 ? 0.4748 0.2601 0.4340 0.0049  -0.0198 0.0185  144 TYR A CD1 
918  C CD2 . TYR A 116 ? 0.5030 0.2727 0.4449 0.0285  -0.0228 0.0219  144 TYR A CD2 
919  C CE1 . TYR A 116 ? 0.4933 0.2699 0.4435 0.0226  -0.0170 0.0105  144 TYR A CE1 
920  C CE2 . TYR A 116 ? 0.5378 0.3021 0.4707 0.0491  -0.0195 0.0140  144 TYR A CE2 
921  C CZ  . TYR A 116 ? 0.5397 0.3083 0.4768 0.0454  -0.0165 0.0084  144 TYR A CZ  
922  O OH  . TYR A 116 ? 0.5852 0.3553 0.5129 0.0665  -0.0127 0.0017  144 TYR A OH  
923  N N   . VAL A 117 ? 0.5336 0.3002 0.4620 -0.0452 -0.0471 0.0650  145 VAL A N   
924  C CA  . VAL A 117 ? 0.5360 0.3317 0.4728 -0.0558 -0.0481 0.0775  145 VAL A CA  
925  C C   . VAL A 117 ? 0.4959 0.3226 0.4537 -0.0343 -0.0373 0.0690  145 VAL A C   
926  O O   . VAL A 117 ? 0.5121 0.3212 0.4644 -0.0144 -0.0354 0.0609  145 VAL A O   
927  C CB  . VAL A 117 ? 0.6075 0.3583 0.5108 -0.0682 -0.0633 0.0921  145 VAL A CB  
928  C CG1 . VAL A 117 ? 0.6219 0.4096 0.5356 -0.0776 -0.0633 0.1061  145 VAL A CG1 
929  C CG2 . VAL A 117 ? 0.6525 0.3678 0.5292 -0.0961 -0.0779 0.1025  145 VAL A CG2 
930  N N   . ALA A 118 ? 0.4575 0.3331 0.4375 -0.0375 -0.0307 0.0707  146 ALA A N   
931  C CA  . ALA A 118 ? 0.4341 0.3352 0.4269 -0.0233 -0.0245 0.0656  146 ALA A CA  
932  C C   . ALA A 118 ? 0.4476 0.3572 0.4324 -0.0322 -0.0300 0.0803  146 ALA A C   
933  O O   . ALA A 118 ? 0.4446 0.3831 0.4333 -0.0468 -0.0309 0.0908  146 ALA A O   
934  C CB  . ALA A 118 ? 0.4042 0.3446 0.4180 -0.0186 -0.0156 0.0561  146 ALA A CB  
935  N N   . ASP A 119 ? 0.4763 0.3648 0.4493 -0.0224 -0.0338 0.0828  147 ASP A N   
936  C CA  . ASP A 119 ? 0.5159 0.4063 0.4780 -0.0300 -0.0404 0.0982  147 ASP A CA  
937  C C   . ASP A 119 ? 0.4731 0.4083 0.4534 -0.0192 -0.0326 0.0933  147 ASP A C   
938  O O   . ASP A 119 ? 0.4482 0.3813 0.4304 -0.0027 -0.0306 0.0867  147 ASP A O   
939  C CB  . ASP A 119 ? 0.5653 0.3997 0.4979 -0.0223 -0.0506 0.1038  147 ASP A CB  
940  C CG  . ASP A 119 ? 0.6195 0.4512 0.5385 -0.0282 -0.0584 0.1207  147 ASP A CG  
941  O OD1 . ASP A 119 ? 0.5748 0.4557 0.5110 -0.0331 -0.0536 0.1257  147 ASP A OD1 
942  O OD2 . ASP A 119 ? 0.7030 0.4785 0.5893 -0.0265 -0.0705 0.1291  147 ASP A OD2 
943  N N   . LEU A 120 ? 0.4668 0.4450 0.4582 -0.0279 -0.0290 0.0971  148 LEU A N   
944  C CA  . LEU A 120 ? 0.4698 0.4877 0.4732 -0.0177 -0.0225 0.0897  148 LEU A CA  
945  C C   . LEU A 120 ? 0.5219 0.5510 0.5186 -0.0172 -0.0264 0.1010  148 LEU A C   
946  O O   . LEU A 120 ? 0.5011 0.5571 0.5039 -0.0079 -0.0227 0.0942  148 LEU A O   
947  C CB  . LEU A 120 ? 0.4435 0.5020 0.4559 -0.0201 -0.0167 0.0870  148 LEU A CB  
948  C CG  . LEU A 120 ? 0.4401 0.4913 0.4594 -0.0167 -0.0123 0.0746  148 LEU A CG  
949  C CD1 . LEU A 120 ? 0.4643 0.5574 0.4879 -0.0127 -0.0069 0.0729  148 LEU A CD1 
950  C CD2 . LEU A 120 ? 0.4320 0.4635 0.4557 -0.0042 -0.0098 0.0573  148 LEU A CD2 
951  N N   . GLU A 121 ? 0.5659 0.5703 0.5464 -0.0282 -0.0354 0.1186  149 GLU A N   
952  C CA  . GLU A 121 ? 0.5939 0.6020 0.5652 -0.0268 -0.0404 0.1309  149 GLU A CA  
953  C C   . GLU A 121 ? 0.6329 0.6163 0.6002 -0.0066 -0.0410 0.1234  149 GLU A C   
954  O O   . GLU A 121 ? 0.6410 0.6499 0.6135 0.0030  -0.0392 0.1226  149 GLU A O   
955  C CB  . GLU A 121 ? 0.6607 0.6427 0.6100 -0.0472 -0.0528 0.1546  149 GLU A CB  
956  C CG  . GLU A 121 ? 0.6943 0.7216 0.6484 -0.0697 -0.0533 0.1701  149 GLU A CG  
957  C CD  . GLU A 121 ? 0.7740 0.7781 0.7039 -0.0950 -0.0685 0.1980  149 GLU A CD  
958  O OE1 . GLU A 121 ? 0.7744 0.7305 0.6850 -0.1118 -0.0795 0.2059  149 GLU A OE1 
959  O OE2 . GLU A 121 ? 0.8633 0.8946 0.7904 -0.0998 -0.0710 0.2128  149 GLU A OE2 
960  N N   . ASN A 122 ? 0.5952 0.5331 0.5517 0.0005  -0.0440 0.1188  150 ASN A N   
961  C CA  . ASN A 122 ? 0.6070 0.5259 0.5574 0.0241  -0.0443 0.1132  150 ASN A CA  
962  C C   . ASN A 122 ? 0.5543 0.4933 0.5240 0.0360  -0.0353 0.0954  150 ASN A C   
963  O O   . ASN A 122 ? 0.5935 0.5311 0.5618 0.0556  -0.0343 0.0919  150 ASN A O   
964  C CB  . ASN A 122 ? 0.6468 0.5006 0.5655 0.0297  -0.0542 0.1195  150 ASN A CB  
965  C CG  . ASN A 122 ? 0.7114 0.5346 0.6036 0.0167  -0.0670 0.1398  150 ASN A CG  
966  O OD1 . ASN A 122 ? 0.7788 0.6100 0.6655 0.0256  -0.0698 0.1488  150 ASN A OD1 
967  N ND2 . ASN A 122 ? 0.7222 0.5121 0.5969 -0.0069 -0.0760 0.1490  150 ASN A ND2 
968  N N   . MET A 123 ? 0.5080 0.4674 0.4939 0.0247  -0.0294 0.0860  151 MET A N   
969  C CA  . MET A 123 ? 0.4700 0.4459 0.4721 0.0307  -0.0228 0.0709  151 MET A CA  
970  C C   . MET A 123 ? 0.4624 0.4133 0.4586 0.0444  -0.0226 0.0667  151 MET A C   
971  O O   . MET A 123 ? 0.4331 0.4030 0.4362 0.0580  -0.0202 0.0631  151 MET A O   
972  C CB  . MET A 123 ? 0.4996 0.5151 0.5136 0.0341  -0.0207 0.0666  151 MET A CB  
973  C CG  . MET A 123 ? 0.4951 0.5350 0.5112 0.0237  -0.0201 0.0668  151 MET A CG  
974  S SD  . MET A 123 ? 0.5400 0.5823 0.5609 0.0149  -0.0157 0.0563  151 MET A SD  
975  C CE  . MET A 123 ? 0.4648 0.5130 0.4928 0.0176  -0.0145 0.0400  151 MET A CE  
976  N N   . VAL A 124 ? 0.4788 0.3913 0.4611 0.0400  -0.0257 0.0681  152 VAL A N   
977  C CA  . VAL A 124 ? 0.4938 0.3767 0.4643 0.0536  -0.0260 0.0629  152 VAL A CA  
978  C C   . VAL A 124 ? 0.4910 0.3544 0.4603 0.0387  -0.0262 0.0587  152 VAL A C   
979  O O   . VAL A 124 ? 0.4998 0.3617 0.4685 0.0195  -0.0291 0.0648  152 VAL A O   
980  C CB  . VAL A 124 ? 0.5710 0.4089 0.5093 0.0702  -0.0344 0.0709  152 VAL A CB  
981  C CG1 . VAL A 124 ? 0.6187 0.4129 0.5331 0.0515  -0.0451 0.0819  152 VAL A CG1 
982  C CG2 . VAL A 124 ? 0.6048 0.4172 0.5273 0.0925  -0.0338 0.0632  152 VAL A CG2 
983  N N   . GLN A 125 ? 0.4690 0.3249 0.4388 0.0475  -0.0228 0.0497  153 GLN A N   
984  C CA  . GLN A 125 ? 0.4817 0.3144 0.4458 0.0359  -0.0241 0.0464  153 GLN A CA  
985  C C   . GLN A 125 ? 0.5218 0.3067 0.4558 0.0506  -0.0296 0.0443  153 GLN A C   
986  O O   . GLN A 125 ? 0.5296 0.3154 0.4563 0.0757  -0.0276 0.0413  153 GLN A O   
987  C CB  . GLN A 125 ? 0.4362 0.2987 0.4239 0.0324  -0.0160 0.0368  153 GLN A CB  
988  C CG  . GLN A 125 ? 0.4438 0.3193 0.4360 0.0503  -0.0112 0.0302  153 GLN A CG  
989  C CD  . GLN A 125 ? 0.4400 0.3231 0.4428 0.0451  -0.0069 0.0231  153 GLN A CD  
990  O OE1 . GLN A 125 ? 0.4857 0.3564 0.4780 0.0567  -0.0060 0.0196  153 GLN A OE1 
991  N NE2 . GLN A 125 ? 0.3964 0.2993 0.4167 0.0305  -0.0044 0.0209  153 GLN A NE2 
992  N N   . TYR A 126 ? 0.5465 0.2929 0.4614 0.0362  -0.0368 0.0459  154 TYR A N   
993  C CA  . TYR A 126 ? 0.6099 0.3009 0.4883 0.0492  -0.0441 0.0417  154 TYR A CA  
994  C C   . TYR A 126 ? 0.6205 0.2860 0.4881 0.0279  -0.0498 0.0406  154 TYR A C   
995  O O   . TYR A 126 ? 0.5732 0.2545 0.4532 0.0005  -0.0520 0.0487  154 TYR A O   
996  C CB  . TYR A 126 ? 0.6682 0.3065 0.5077 0.0578  -0.0566 0.0497  154 TYR A CB  
997  C CG  . TYR A 126 ? 0.7021 0.3238 0.5328 0.0268  -0.0676 0.0649  154 TYR A CG  
998  C CD1 . TYR A 126 ? 0.6960 0.3514 0.5441 0.0215  -0.0656 0.0749  154 TYR A CD1 
999  C CD2 . TYR A 126 ? 0.7587 0.3349 0.5621 0.0009  -0.0810 0.0710  154 TYR A CD2 
1000 C CE1 . TYR A 126 ? 0.7242 0.3733 0.5647 -0.0072 -0.0753 0.0913  154 TYR A CE1 
1001 C CE2 . TYR A 126 ? 0.7742 0.3449 0.5703 -0.0312 -0.0920 0.0890  154 TYR A CE2 
1002 C CZ  . TYR A 126 ? 0.7612 0.3710 0.5769 -0.0342 -0.0884 0.0993  154 TYR A CZ  
1003 O OH  . TYR A 126 ? 0.8001 0.4140 0.6097 -0.0661 -0.0988 0.1194  154 TYR A OH  
1004 N N   . ARG A 127 ? 0.6587 0.2891 0.5016 0.0426  -0.0521 0.0313  155 ARG A N   
1005 C CA  . ARG A 127 ? 0.7428 0.3459 0.5708 0.0243  -0.0586 0.0293  155 ARG A CA  
1006 C C   . ARG A 127 ? 0.8090 0.3563 0.6003 -0.0007 -0.0771 0.0413  155 ARG A C   
1007 O O   . ARG A 127 ? 0.8426 0.3346 0.5945 0.0097  -0.0885 0.0441  155 ARG A O   
1008 C CB  . ARG A 127 ? 0.8178 0.3951 0.6225 0.0502  -0.0571 0.0157  155 ARG A CB  
1009 C CG  . ARG A 127 ? 0.8857 0.4526 0.6851 0.0340  -0.0597 0.0112  155 ARG A CG  
1010 C CD  . ARG A 127 ? 0.9420 0.4984 0.7241 0.0627  -0.0552 -0.0026 155 ARG A CD  
1011 N NE  . ARG A 127 ? 0.9518 0.5776 0.7785 0.0697  -0.0387 -0.0063 155 ARG A NE  
1012 C CZ  . ARG A 127 ? 1.0031 0.6411 0.8272 0.0864  -0.0325 -0.0151 155 ARG A CZ  
1013 N NH1 . ARG A 127 ? 1.0099 0.5956 0.7877 0.1021  -0.0404 -0.0237 155 ARG A NH1 
1014 N NH2 . ARG A 127 ? 0.9635 0.6641 0.8277 0.0868  -0.0197 -0.0149 155 ARG A NH2 
1015 N N   . ARG A 128 ? 0.8310 0.3968 0.6351 -0.0347 -0.0809 0.0505  156 ARG A N   
1016 C CA  . ARG A 128 ? 0.9191 0.4524 0.6973 -0.0672 -0.0984 0.0677  156 ARG A CA  
1017 C C   . ARG A 128 ? 1.0278 0.4674 0.7425 -0.0694 -0.1187 0.0661  156 ARG A C   
1018 O O   . ARG A 128 ? 1.0705 0.4586 0.7484 -0.0842 -0.1360 0.0787  156 ARG A O   
1019 C CB  . ARG A 128 ? 0.8824 0.4652 0.6871 -0.1007 -0.0976 0.0783  156 ARG A CB  
1020 C CG  . ARG A 128 ? 0.9623 0.5454 0.7555 -0.1380 -0.1123 0.1016  156 ARG A CG  
1021 C CD  . ARG A 128 ? 1.0345 0.6704 0.8499 -0.1675 -0.1120 0.1122  156 ARG A CD  
1022 N NE  . ARG A 128 ? 1.1277 0.7506 0.9181 -0.2103 -0.1322 0.1364  156 ARG A NE  
1023 C CZ  . ARG A 128 ? 1.2353 0.8812 1.0254 -0.2431 -0.1407 0.1490  156 ARG A CZ  
1024 N NH1 . ARG A 128 ? 1.1601 0.8405 0.9734 -0.2353 -0.1300 0.1385  156 ARG A NH1 
1025 N NH2 . ARG A 128 ? 1.2909 0.9275 1.0564 -0.2862 -0.1611 0.1744  156 ARG A NH2 
1026 N N   . ASN A 129 ? 1.0957 0.5100 0.7940 -0.0546 -0.1177 0.0508  157 ASN A N   
1027 C CA  . ASN A 129 ? 1.3398 0.6582 0.9704 -0.0517 -0.1374 0.0452  157 ASN A CA  
1028 C C   . ASN A 129 ? 1.3905 0.6489 0.9790 -0.0126 -0.1422 0.0378  157 ASN A C   
1029 O O   . ASN A 129 ? 1.5655 0.7327 1.0902 -0.0169 -0.1644 0.0409  157 ASN A O   
1030 C CB  . ASN A 129 ? 1.3654 0.6794 0.9896 -0.0448 -0.1341 0.0301  157 ASN A CB  
1031 C CG  . ASN A 129 ? 1.3669 0.7116 1.0093 0.0020  -0.1147 0.0120  157 ASN A CG  
1032 O OD1 . ASN A 129 ? 1.4582 0.7763 1.0778 0.0385  -0.1133 0.0049  157 ASN A OD1 
1033 N ND2 . ASN A 129 ? 1.2818 0.6848 0.9633 0.0009  -0.1005 0.0061  157 ASN A ND2 
1034 N N   . GLU A 130 ? 1.3727 0.6820 0.9944 0.0247  -0.1228 0.0294  158 GLU A N   
1035 C CA  . GLU A 130 ? 1.5093 0.7802 1.0978 0.0685  -0.1239 0.0229  158 GLU A CA  
1036 C C   . GLU A 130 ? 1.4471 0.7873 1.0827 0.0805  -0.1091 0.0297  158 GLU A C   
1037 O O   . GLU A 130 ? 1.3651 0.7838 1.0517 0.0918  -0.0896 0.0244  158 GLU A O   
1038 C CB  . GLU A 130 ? 1.5804 0.8472 1.1533 0.1109  -0.1152 0.0035  158 GLU A CB  
1039 C CG  . GLU A 130 ? 1.6827 0.9206 1.2204 0.1640  -0.1147 -0.0034 158 GLU A CG  
1040 C CD  . GLU A 130 ? 1.7234 1.0022 1.2688 0.2070  -0.0987 -0.0188 158 GLU A CD  
1041 O OE1 . GLU A 130 ? 1.5536 0.8700 1.1250 0.1939  -0.0903 -0.0248 158 GLU A OE1 
1042 O OE2 . GLU A 130 ? 1.7586 1.0370 1.2840 0.2547  -0.0946 -0.0233 158 GLU A OE2 
1043 N N   . HIS A 131 ? 1.4641 0.7708 1.0781 0.0768  -0.1202 0.0420  159 HIS A N   
1044 C CA  . HIS A 131 ? 1.4628 0.8321 1.1184 0.0805  -0.1093 0.0511  159 HIS A CA  
1045 C C   . HIS A 131 ? 1.3899 0.7926 1.0556 0.1292  -0.0957 0.0421  159 HIS A C   
1046 O O   . HIS A 131 ? 1.3015 0.7683 1.0075 0.1326  -0.0846 0.0476  159 HIS A O   
1047 C CB  . HIS A 131 ? 1.6214 0.9438 1.2476 0.0605  -0.1267 0.0692  159 HIS A CB  
1048 C CG  . HIS A 131 ? 1.6738 0.9919 1.3024 0.0073  -0.1382 0.0841  159 HIS A CG  
1049 N ND1 . HIS A 131 ? 1.7054 1.0473 1.3480 -0.0213 -0.1430 0.1041  159 HIS A ND1 
1050 C CD2 . HIS A 131 ? 1.6839 0.9859 1.3040 -0.0222 -0.1456 0.0839  159 HIS A CD2 
1051 C CE1 . HIS A 131 ? 1.7278 1.0722 1.3707 -0.0659 -0.1527 0.1165  159 HIS A CE1 
1052 N NE2 . HIS A 131 ? 1.7336 1.0539 1.3634 -0.0679 -0.1547 0.1048  159 HIS A NE2 
1053 N N   . GLY A 132 ? 1.4227 0.7853 1.0496 0.1669  -0.0974 0.0293  160 GLY A N   
1054 C CA  . GLY A 132 ? 1.3616 0.7648 0.9956 0.2160  -0.0846 0.0225  160 GLY A CA  
1055 C C   . GLY A 132 ? 1.1688 0.6749 0.8660 0.2171  -0.0634 0.0185  160 GLY A C   
1056 O O   . GLY A 132 ? 1.1667 0.7328 0.8890 0.2398  -0.0528 0.0214  160 GLY A O   
1057 N N   . ARG A 133 ? 1.0786 0.6045 0.7988 0.1920  -0.0586 0.0131  161 ARG A N   
1058 C CA  . ARG A 133 ? 1.0375 0.6525 0.8150 0.1852  -0.0415 0.0114  161 ARG A CA  
1059 C C   . ARG A 133 ? 0.8892 0.5534 0.7101 0.1588  -0.0372 0.0216  161 ARG A C   
1060 O O   . ARG A 133 ? 0.8135 0.4808 0.6525 0.1241  -0.0388 0.0248  161 ARG A O   
1061 C CB  . ARG A 133 ? 1.1352 0.7508 0.9230 0.1619  -0.0397 0.0049  161 ARG A CB  
1062 C CG  . ARG A 133 ? 1.2575 0.8482 1.0138 0.1876  -0.0396 -0.0069 161 ARG A CG  
1063 C CD  . ARG A 133 ? 1.3354 0.9161 1.0976 0.1577  -0.0414 -0.0110 161 ARG A CD  
1064 N NE  . ARG A 133 ? 1.3028 0.9254 1.0795 0.1714  -0.0303 -0.0187 161 ARG A NE  
1065 C CZ  . ARG A 133 ? 1.4828 1.0778 1.2215 0.2006  -0.0318 -0.0290 161 ARG A CZ  
1066 N NH1 . ARG A 133 ? 1.5921 1.1070 1.2699 0.2216  -0.0452 -0.0350 161 ARG A NH1 
1067 N NH2 . ARG A 133 ? 1.4785 1.1237 1.2362 0.2094  -0.0208 -0.0332 161 ARG A NH2 
1068 N N   . ARG A 134 ? 0.8599 0.5642 0.6948 0.1769  -0.0323 0.0269  162 ARG A N   
1069 C CA  . ARG A 134 ? 0.8062 0.5501 0.6738 0.1553  -0.0301 0.0359  162 ARG A CA  
1070 C C   . ARG A 134 ? 0.7267 0.5508 0.6362 0.1573  -0.0184 0.0360  162 ARG A C   
1071 O O   . ARG A 134 ? 0.8107 0.6675 0.7206 0.1850  -0.0131 0.0355  162 ARG A O   
1072 C CB  . ARG A 134 ? 0.8629 0.5776 0.7059 0.1675  -0.0386 0.0452  162 ARG A CB  
1073 C CG  . ARG A 134 ? 0.9245 0.5838 0.7463 0.1396  -0.0513 0.0529  162 ARG A CG  
1074 C CD  . ARG A 134 ? 1.0259 0.6276 0.8040 0.1559  -0.0643 0.0617  162 ARG A CD  
1075 N NE  . ARG A 134 ? 1.1401 0.6816 0.8911 0.1238  -0.0794 0.0704  162 ARG A NE  
1076 C CZ  . ARG A 134 ? 1.1675 0.7217 0.9308 0.0939  -0.0839 0.0843  162 ARG A CZ  
1077 N NH1 . ARG A 134 ? 1.1130 0.7309 0.9123 0.0939  -0.0746 0.0892  162 ARG A NH1 
1078 N NH2 . ARG A 134 ? 1.2786 0.7831 1.0154 0.0626  -0.0988 0.0947  162 ARG A NH2 
1079 N N   . ARG A 135 ? 0.5839 0.4396 0.5249 0.1280  -0.0155 0.0377  163 ARG A N   
1080 C CA  . ARG A 135 ? 0.5170 0.4383 0.4919 0.1224  -0.0086 0.0388  163 ARG A CA  
1081 C C   . ARG A 135 ? 0.4849 0.4202 0.4734 0.1033  -0.0108 0.0438  163 ARG A C   
1082 O O   . ARG A 135 ? 0.4718 0.3836 0.4583 0.0839  -0.0139 0.0440  163 ARG A O   
1083 C CB  . ARG A 135 ? 0.4882 0.4300 0.4828 0.1068  -0.0035 0.0325  163 ARG A CB  
1084 C CG  . ARG A 135 ? 0.4896 0.4316 0.4744 0.1255  -0.0001 0.0283  163 ARG A CG  
1085 C CD  . ARG A 135 ? 0.4515 0.4123 0.4555 0.1069  0.0038  0.0240  163 ARG A CD  
1086 N NE  . ARG A 135 ? 0.4676 0.4253 0.4590 0.1241  0.0069  0.0201  163 ARG A NE  
1087 C CZ  . ARG A 135 ? 0.4577 0.4657 0.4588 0.1369  0.0123  0.0233  163 ARG A CZ  
1088 N NH1 . ARG A 135 ? 0.4291 0.4949 0.4536 0.1300  0.0139  0.0317  163 ARG A NH1 
1089 N NH2 . ARG A 135 ? 0.4736 0.4773 0.4595 0.1551  0.0153  0.0191  163 ARG A NH2 
1090 N N   . LYS A 136 ? 0.4663 0.4448 0.4673 0.1094  -0.0095 0.0489  164 LYS A N   
1091 C CA  . LYS A 136 ? 0.4698 0.4671 0.4827 0.0925  -0.0115 0.0521  164 LYS A CA  
1092 C C   . LYS A 136 ? 0.4082 0.4191 0.4388 0.0683  -0.0095 0.0448  164 LYS A C   
1093 O O   . LYS A 136 ? 0.3865 0.4103 0.4264 0.0648  -0.0067 0.0402  164 LYS A O   
1094 C CB  . LYS A 136 ? 0.5186 0.5627 0.5398 0.1034  -0.0116 0.0593  164 LYS A CB  
1095 C CG  . LYS A 136 ? 0.6222 0.6500 0.6238 0.1246  -0.0155 0.0684  164 LYS A CG  
1096 C CD  . LYS A 136 ? 0.7793 0.7762 0.7563 0.1551  -0.0158 0.0687  164 LYS A CD  
1097 C CE  . LYS A 136 ? 0.9244 0.8720 0.8691 0.1719  -0.0235 0.0762  164 LYS A CE  
1098 N NZ  . LYS A 136 ? 0.9836 0.8688 0.8929 0.1915  -0.0274 0.0718  164 LYS A NZ  
1099 N N   . ILE A 137 ? 0.3906 0.3971 0.4225 0.0536  -0.0114 0.0444  165 ILE A N   
1100 C CA  . ILE A 137 ? 0.3799 0.3966 0.4220 0.0367  -0.0106 0.0366  165 ILE A CA  
1101 C C   . ILE A 137 ? 0.3673 0.4077 0.4116 0.0303  -0.0134 0.0371  165 ILE A C   
1102 O O   . ILE A 137 ? 0.3606 0.4082 0.4004 0.0364  -0.0152 0.0445  165 ILE A O   
1103 C CB  . ILE A 137 ? 0.4109 0.4016 0.4491 0.0280  -0.0094 0.0330  165 ILE A CB  
1104 C CG1 . ILE A 137 ? 0.4452 0.4286 0.4749 0.0247  -0.0115 0.0403  165 ILE A CG1 
1105 C CG2 . ILE A 137 ? 0.4364 0.4024 0.4697 0.0326  -0.0080 0.0321  165 ILE A CG2 
1106 C CD1 . ILE A 137 ? 0.4581 0.4269 0.4845 0.0151  -0.0111 0.0411  165 ILE A CD1 
1107 N N   . LYS A 138 ? 0.3381 0.3867 0.3854 0.0185  -0.0152 0.0291  166 LYS A N   
1108 C CA  . LYS A 138 ? 0.3557 0.4185 0.3981 0.0119  -0.0194 0.0263  166 LYS A CA  
1109 C C   . LYS A 138 ? 0.3564 0.4032 0.3906 0.0031  -0.0215 0.0144  166 LYS A C   
1110 O O   . LYS A 138 ? 0.3457 0.3763 0.3814 0.0000  -0.0205 0.0099  166 LYS A O   
1111 C CB  . LYS A 138 ? 0.3577 0.4522 0.4042 0.0086  -0.0243 0.0309  166 LYS A CB  
1112 C CG  . LYS A 138 ? 0.3489 0.4535 0.3993 -0.0045 -0.0288 0.0287  166 LYS A CG  
1113 C CD  . LYS A 138 ? 0.3456 0.4903 0.3992 -0.0128 -0.0357 0.0361  166 LYS A CD  
1114 C CE  . LYS A 138 ? 0.3562 0.5129 0.4110 -0.0334 -0.0431 0.0371  166 LYS A CE  
1115 N NZ  . LYS A 138 ? 0.3741 0.5698 0.4277 -0.0501 -0.0536 0.0447  166 LYS A NZ  
1116 N N   . ARG A 139 ? 0.3896 0.4398 0.4119 0.0019  -0.0248 0.0093  167 ARG A N   
1117 C CA  . ARG A 139 ? 0.4231 0.4540 0.4283 -0.0002 -0.0284 -0.0034 167 ARG A CA  
1118 C C   . ARG A 139 ? 0.4638 0.4985 0.4546 -0.0102 -0.0387 -0.0082 167 ARG A C   
1119 O O   . ARG A 139 ? 0.5054 0.5570 0.4896 -0.0077 -0.0406 -0.0073 167 ARG A O   
1120 C CB  . ARG A 139 ? 0.4230 0.4564 0.4210 0.0113  -0.0232 -0.0050 167 ARG A CB  
1121 C CG  . ARG A 139 ? 0.4770 0.4923 0.4515 0.0182  -0.0261 -0.0192 167 ARG A CG  
1122 C CD  . ARG A 139 ? 0.4947 0.5306 0.4633 0.0324  -0.0202 -0.0179 167 ARG A CD  
1123 N NE  . ARG A 139 ? 0.5376 0.5584 0.4799 0.0470  -0.0219 -0.0320 167 ARG A NE  
1124 C CZ  . ARG A 139 ? 0.6001 0.6172 0.5147 0.0562  -0.0273 -0.0431 167 ARG A CZ  
1125 N NH1 . ARG A 139 ? 0.6540 0.6854 0.5665 0.0488  -0.0315 -0.0408 167 ARG A NH1 
1126 N NH2 . ARG A 139 ? 0.6513 0.6483 0.5364 0.0753  -0.0291 -0.0570 167 ARG A NH2 
1127 N N   . ASP A 140 ? 0.4703 0.4903 0.4549 -0.0243 -0.0469 -0.0118 168 ASP A N   
1128 C CA  . ASP A 140 ? 0.5046 0.5274 0.4739 -0.0412 -0.0600 -0.0135 168 ASP A CA  
1129 C C   . ASP A 140 ? 0.5519 0.5280 0.4912 -0.0517 -0.0717 -0.0259 168 ASP A C   
1130 O O   . ASP A 140 ? 0.5748 0.5216 0.5080 -0.0417 -0.0677 -0.0328 168 ASP A O   
1131 C CB  . ASP A 140 ? 0.4844 0.5444 0.4756 -0.0537 -0.0616 0.0010  168 ASP A CB  
1132 C CG  . ASP A 140 ? 0.5221 0.6085 0.5059 -0.0694 -0.0730 0.0057  168 ASP A CG  
1133 O OD1 . ASP A 140 ? 0.5569 0.6186 0.5118 -0.0783 -0.0842 -0.0048 168 ASP A OD1 
1134 O OD2 . ASP A 140 ? 0.4809 0.6136 0.4854 -0.0718 -0.0716 0.0201  168 ASP A OD2 
1135 N N   . ILE A 141 ? 0.6054 0.5716 0.5224 -0.0722 -0.0877 -0.0282 169 ILE A N   
1136 C CA  . ILE A 141 ? 0.6543 0.5649 0.5350 -0.0861 -0.1031 -0.0385 169 ILE A CA  
1137 C C   . ILE A 141 ? 0.6605 0.5657 0.5549 -0.1011 -0.1044 -0.0298 169 ILE A C   
1138 O O   . ILE A 141 ? 0.5955 0.5463 0.5255 -0.1047 -0.0958 -0.0153 169 ILE A O   
1139 C CB  . ILE A 141 ? 0.7142 0.6084 0.5605 -0.1106 -0.1243 -0.0420 169 ILE A CB  
1140 C CG1 . ILE A 141 ? 0.6827 0.6283 0.5525 -0.1400 -0.1308 -0.0228 169 ILE A CG1 
1141 C CG2 . ILE A 141 ? 0.7290 0.6240 0.5558 -0.0935 -0.1236 -0.0530 169 ILE A CG2 
1142 C CD1 . ILE A 141 ? 0.7667 0.6952 0.6009 -0.1727 -0.1553 -0.0232 169 ILE A CD1 
1143 N N   . ILE A 142 ? 0.7529 0.5999 0.6147 -0.1074 -0.1158 -0.0390 170 ILE A N   
1144 C CA  . ILE A 142 ? 0.7657 0.6008 0.6335 -0.1242 -0.1197 -0.0306 170 ILE A CA  
1145 C C   . ILE A 142 ? 0.7258 0.5879 0.5981 -0.1627 -0.1342 -0.0142 170 ILE A C   
1146 O O   . ILE A 142 ? 0.6955 0.5911 0.5948 -0.1740 -0.1301 0.0004  170 ILE A O   
1147 C CB  . ILE A 142 ? 0.9000 0.6589 0.7252 -0.1188 -0.1300 -0.0445 170 ILE A CB  
1148 C CG1 . ILE A 142 ? 0.9133 0.6689 0.7483 -0.0810 -0.1118 -0.0536 170 ILE A CG1 
1149 C CG2 . ILE A 142 ? 0.9326 0.6704 0.7530 -0.1459 -0.1414 -0.0342 170 ILE A CG2 
1150 C CD1 . ILE A 142 ? 1.0402 0.7299 0.8375 -0.0677 -0.1187 -0.0656 170 ILE A CD1 
1151 N N   . ASP A 143 ? 0.7865 0.6397 0.6318 -0.1834 -0.1515 -0.0156 171 ASP A N   
1152 C CA  . ASP A 143 ? 0.7990 0.6827 0.6454 -0.2254 -0.1683 0.0025  171 ASP A CA  
1153 C C   . ASP A 143 ? 0.7021 0.6797 0.5946 -0.2250 -0.1567 0.0202  171 ASP A C   
1154 O O   . ASP A 143 ? 0.7063 0.7123 0.5934 -0.2414 -0.1667 0.0258  171 ASP A O   
1155 C CB  . ASP A 143 ? 0.9129 0.7427 0.7047 -0.2521 -0.1954 -0.0054 171 ASP A CB  
1156 C CG  . ASP A 143 ? 0.9743 0.8201 0.7566 -0.3044 -0.2188 0.0147  171 ASP A CG  
1157 O OD1 . ASP A 143 ? 1.1460 0.9641 0.8884 -0.3323 -0.2421 0.0125  171 ASP A OD1 
1158 O OD2 . ASP A 143 ? 0.9779 0.8656 0.7901 -0.3194 -0.2149 0.0337  171 ASP A OD2 
1159 N N   . ILE A 144 ? 0.6304 0.6533 0.5644 -0.2042 -0.1364 0.0285  172 ILE A N   
1160 C CA  . ILE A 144 ? 0.5583 0.6677 0.5308 -0.2024 -0.1274 0.0474  172 ILE A CA  
1161 C C   . ILE A 144 ? 0.5335 0.6801 0.5288 -0.2115 -0.1235 0.0636  172 ILE A C   
1162 O O   . ILE A 144 ? 0.5516 0.6568 0.5399 -0.2112 -0.1223 0.0584  172 ILE A O   
1163 C CB  . ILE A 144 ? 0.5016 0.6365 0.4988 -0.1626 -0.1064 0.0432  172 ILE A CB  
1164 C CG1 . ILE A 144 ? 0.4812 0.5809 0.4854 -0.1351 -0.0908 0.0326  172 ILE A CG1 
1165 C CG2 . ILE A 144 ? 0.5333 0.6531 0.5126 -0.1561 -0.1102 0.0327  172 ILE A CG2 
1166 C CD1 . ILE A 144 ? 0.4312 0.5615 0.4611 -0.1028 -0.0725 0.0352  172 ILE A CD1 
1167 N N   . PRO A 145 ? 0.5027 0.7323 0.5250 -0.2172 -0.1210 0.0841  173 PRO A N   
1168 C CA  . PRO A 145 ? 0.4912 0.7637 0.5361 -0.2180 -0.1139 0.0989  173 PRO A CA  
1169 C C   . PRO A 145 ? 0.4456 0.7076 0.5081 -0.1754 -0.0915 0.0891  173 PRO A C   
1170 O O   . PRO A 145 ? 0.4190 0.6765 0.4875 -0.1449 -0.0799 0.0800  173 PRO A O   
1171 C CB  . PRO A 145 ? 0.4795 0.8523 0.5474 -0.2268 -0.1153 0.1230  173 PRO A CB  
1172 C CG  . PRO A 145 ? 0.5066 0.8778 0.5568 -0.2490 -0.1312 0.1229  173 PRO A CG  
1173 C CD  . PRO A 145 ? 0.5070 0.7980 0.5364 -0.2275 -0.1273 0.0967  173 PRO A CD  
1174 N N   . LYS A 146 ? 0.4284 0.6837 0.4961 -0.1762 -0.0873 0.0918  174 LYS A N   
1175 C CA  . LYS A 146 ? 0.4137 0.6515 0.4925 -0.1414 -0.0692 0.0822  174 LYS A CA  
1176 C C   . LYS A 146 ? 0.4046 0.6775 0.4970 -0.1434 -0.0644 0.0943  174 LYS A C   
1177 O O   . LYS A 146 ? 0.4197 0.7104 0.5086 -0.1762 -0.0765 0.1078  174 LYS A O   
1178 C CB  . LYS A 146 ? 0.4183 0.5730 0.4774 -0.1344 -0.0689 0.0617  174 LYS A CB  
1179 C CG  . LYS A 146 ? 0.4572 0.5644 0.4942 -0.1624 -0.0831 0.0600  174 LYS A CG  
1180 C CD  . LYS A 146 ? 0.4766 0.5077 0.4889 -0.1521 -0.0848 0.0399  174 LYS A CD  
1181 C CE  . LYS A 146 ? 0.5056 0.5114 0.4931 -0.1615 -0.0973 0.0320  174 LYS A CE  
1182 N NZ  . LYS A 146 ? 0.5528 0.4838 0.5079 -0.1537 -0.1026 0.0140  174 LYS A NZ  
1183 N N   . LYS A 147 ? 0.3964 0.6769 0.5007 -0.1092 -0.0479 0.0899  175 LYS A N   
1184 C CA  . LYS A 147 ? 0.3893 0.7030 0.5045 -0.1030 -0.0407 0.0988  175 LYS A CA  
1185 C C   . LYS A 147 ? 0.3921 0.6532 0.4965 -0.1196 -0.0450 0.0931  175 LYS A C   
1186 O O   . LYS A 147 ? 0.3761 0.6667 0.4861 -0.1317 -0.0460 0.1052  175 LYS A O   
1187 C CB  . LYS A 147 ? 0.3687 0.6902 0.4903 -0.0589 -0.0238 0.0922  175 LYS A CB  
1188 C CG  . LYS A 147 ? 0.3664 0.7385 0.4951 -0.0363 -0.0194 0.0989  175 LYS A CG  
1189 C CD  . LYS A 147 ? 0.3581 0.7426 0.4861 0.0079  -0.0054 0.0960  175 LYS A CD  
1190 C CE  . LYS A 147 ? 0.3710 0.8067 0.5058 0.0131  -0.0003 0.1067  175 LYS A CE  
1191 N NZ  . LYS A 147 ? 0.4007 0.8739 0.5316 0.0595  0.0110  0.1086  175 LYS A NZ  
1192 N N   . GLY A 148 ? 0.3964 0.5845 0.4850 -0.1186 -0.0475 0.0760  176 GLY A N   
1193 C CA  . GLY A 148 ? 0.4060 0.5401 0.4824 -0.1267 -0.0505 0.0690  176 GLY A CA  
1194 C C   . GLY A 148 ? 0.4024 0.4762 0.4682 -0.1070 -0.0454 0.0497  176 GLY A C   
1195 O O   . GLY A 148 ? 0.3995 0.4658 0.4624 -0.0968 -0.0443 0.0425  176 GLY A O   
1196 N N   . VAL A 149 ? 0.3867 0.4241 0.4471 -0.1019 -0.0424 0.0433  177 VAL A N   
1197 C CA  . VAL A 149 ? 0.4003 0.3915 0.4526 -0.0835 -0.0371 0.0282  177 VAL A CA  
1198 C C   . VAL A 149 ? 0.3770 0.3724 0.4401 -0.0654 -0.0250 0.0265  177 VAL A C   
1199 O O   . VAL A 149 ? 0.3826 0.3798 0.4471 -0.0720 -0.0251 0.0315  177 VAL A O   
1200 C CB  . VAL A 149 ? 0.4277 0.3645 0.4559 -0.0945 -0.0481 0.0214  177 VAL A CB  
1201 C CG1 . VAL A 149 ? 0.4399 0.3433 0.4610 -0.0725 -0.0417 0.0080  177 VAL A CG1 
1202 C CG2 . VAL A 149 ? 0.4673 0.3905 0.4761 -0.1150 -0.0635 0.0223  177 VAL A CG2 
1203 N N   . ALA A 150 ? 0.3736 0.3699 0.4416 -0.0448 -0.0160 0.0209  178 ALA A N   
1204 C CA  . ALA A 150 ? 0.3620 0.3499 0.4326 -0.0296 -0.0074 0.0176  178 ALA A CA  
1205 C C   . ALA A 150 ? 0.3395 0.3561 0.4166 -0.0256 -0.0029 0.0243  178 ALA A C   
1206 O O   . ALA A 150 ? 0.3531 0.3575 0.4282 -0.0198 0.0010  0.0218  178 ALA A O   
1207 C CB  . ALA A 150 ? 0.3823 0.3347 0.4453 -0.0317 -0.0086 0.0114  178 ALA A CB  
1208 N N   . GLY A 151 ? 0.3201 0.3796 0.4042 -0.0278 -0.0036 0.0336  179 GLY A N   
1209 C CA  . GLY A 151 ? 0.3346 0.4349 0.4245 -0.0219 0.0009  0.0420  179 GLY A CA  
1210 C C   . GLY A 151 ? 0.3479 0.4718 0.4424 -0.0469 -0.0055 0.0539  179 GLY A C   
1211 O O   . GLY A 151 ? 0.3725 0.5432 0.4734 -0.0446 -0.0022 0.0642  179 GLY A O   
1212 N N   . LEU A 152 ? 0.3766 0.4677 0.4643 -0.0701 -0.0158 0.0534  180 LEU A N   
1213 C CA  . LEU A 152 ? 0.3945 0.4949 0.4796 -0.0991 -0.0262 0.0661  180 LEU A CA  
1214 C C   . LEU A 152 ? 0.4361 0.5699 0.5224 -0.1214 -0.0365 0.0783  180 LEU A C   
1215 O O   . LEU A 152 ? 0.4110 0.5188 0.4885 -0.1263 -0.0431 0.0717  180 LEU A O   
1216 C CB  . LEU A 152 ? 0.4155 0.4514 0.4837 -0.1100 -0.0344 0.0585  180 LEU A CB  
1217 C CG  . LEU A 152 ? 0.4120 0.4204 0.4797 -0.0908 -0.0254 0.0486  180 LEU A CG  
1218 C CD1 . LEU A 152 ? 0.4290 0.3783 0.4795 -0.0921 -0.0318 0.0391  180 LEU A CD1 
1219 C CD2 . LEU A 152 ? 0.4145 0.4498 0.4881 -0.0956 -0.0226 0.0589  180 LEU A CD2 
1220 N N   . ARG A 153 ? 0.4564 0.6526 0.5530 -0.1357 -0.0385 0.0971  181 ARG A N   
1221 C CA  . ARG A 153 ? 0.5513 0.7991 0.6527 -0.1581 -0.0480 0.1132  181 ARG A CA  
1222 C C   . ARG A 153 ? 0.6210 0.8270 0.7020 -0.1986 -0.0691 0.1180  181 ARG A C   
1223 O O   . ARG A 153 ? 0.6278 0.7899 0.6934 -0.2169 -0.0781 0.1194  181 ARG A O   
1224 C CB  . ARG A 153 ? 0.5832 0.9194 0.7007 -0.1645 -0.0450 0.1358  181 ARG A CB  
1225 C CG  . ARG A 153 ? 0.6442 1.0296 0.7753 -0.1219 -0.0259 0.1330  181 ARG A CG  
1226 C CD  . ARG A 153 ? 0.7075 1.1031 0.8420 -0.0911 -0.0180 0.1239  181 ARG A CD  
1227 N NE  . ARG A 153 ? 0.9209 1.3681 1.0624 -0.1088 -0.0265 0.1384  181 ARG A NE  
1228 C CZ  . ARG A 153 ? 0.8331 1.3298 0.9827 -0.0832 -0.0197 0.1414  181 ARG A CZ  
1229 N NH1 . ARG A 153 ? 0.8052 1.3015 0.9529 -0.0370 -0.0049 0.1305  181 ARG A NH1 
1230 N NH2 . ARG A 153 ? 0.8483 1.3935 1.0043 -0.1046 -0.0292 0.1562  181 ARG A NH2 
1231 N N   . LEU A 154 ? 0.7029 0.9198 0.7800 -0.2113 -0.0779 0.1205  182 LEU A N   
1232 C CA  . LEU A 154 ? 0.9325 1.1156 0.9848 -0.2529 -0.1013 0.1271  182 LEU A CA  
1233 C C   . LEU A 154 ? 0.8664 1.1251 0.9291 -0.2759 -0.1094 0.1469  182 LEU A C   
1234 O O   . LEU A 154 ? 0.8023 1.1435 0.8849 -0.2853 -0.1069 0.1690  182 LEU A O   
1235 C CB  . LEU A 154 ? 1.0306 1.1284 1.0572 -0.2436 -0.1065 0.1039  182 LEU A CB  
1236 C CG  . LEU A 154 ? 1.1876 1.1949 1.1786 -0.2574 -0.1210 0.0951  182 LEU A CG  
1237 C CD1 . LEU A 154 ? 1.2097 1.2086 1.2055 -0.2536 -0.1154 0.0993  182 LEU A CD1 
1238 C CD2 . LEU A 154 ? 1.2112 1.1542 1.1848 -0.2293 -0.1169 0.0698  182 LEU A CD2 
1239 N N   . HIS B 6   ? 0.6286 0.5971 0.7906 0.1504  -0.0553 0.0169  -1  HIS B N   
1240 C CA  . HIS B 6   ? 0.6052 0.5836 0.7485 0.1304  -0.0399 0.0001  -1  HIS B CA  
1241 C C   . HIS B 6   ? 0.5235 0.5107 0.6404 0.1103  -0.0349 0.0132  -1  HIS B C   
1242 O O   . HIS B 6   ? 0.4321 0.3962 0.5322 0.0950  -0.0278 0.0165  -1  HIS B O   
1243 C CB  . HIS B 6   ? 0.6908 0.6306 0.8355 0.1269  -0.0349 -0.0086 -1  HIS B CB  
1244 C CG  . HIS B 6   ? 0.8091 0.7338 0.9824 0.1489  -0.0432 -0.0221 -1  HIS B CG  
1245 N ND1 . HIS B 6   ? 0.7974 0.6761 0.9853 0.1573  -0.0535 -0.0110 -1  HIS B ND1 
1246 C CD2 . HIS B 6   ? 0.8258 0.7777 1.0183 0.1647  -0.0439 -0.0475 -1  HIS B CD2 
1247 C CE1 . HIS B 6   ? 0.8834 0.7562 1.0996 0.1784  -0.0611 -0.0313 -1  HIS B CE1 
1248 N NE2 . HIS B 6   ? 0.9206 0.8405 1.1394 0.1843  -0.0549 -0.0550 -1  HIS B NE2 
1249 N N   . ALA B 7   ? 0.4598 0.4844 0.5748 0.1117  -0.0395 0.0179  0   ALA B N   
1250 C CA  . ALA B 7   ? 0.4212 0.4590 0.5145 0.0972  -0.0384 0.0287  0   ALA B CA  
1251 C C   . ALA B 7   ? 0.3892 0.4348 0.4665 0.0760  -0.0277 0.0133  0   ALA B C   
1252 O O   . ALA B 7   ? 0.3598 0.3980 0.4195 0.0640  -0.0249 0.0182  0   ALA B O   
1253 C CB  . ALA B 7   ? 0.4348 0.5130 0.5322 0.1059  -0.0484 0.0375  0   ALA B CB  
1254 N N   . MET B 8   ? 0.3696 0.4312 0.4544 0.0713  -0.0225 -0.0043 1   MET B N   
1255 C CA  . MET B 8   ? 0.3711 0.4324 0.4441 0.0497  -0.0139 -0.0153 1   MET B CA  
1256 C C   . MET B 8   ? 0.3433 0.3623 0.4043 0.0425  -0.0077 -0.0123 1   MET B C   
1257 O O   . MET B 8   ? 0.3292 0.3391 0.3758 0.0294  -0.0053 -0.0125 1   MET B O   
1258 C CB  . MET B 8   ? 0.4211 0.5080 0.5060 0.0448  -0.0094 -0.0296 1   MET B CB  
1259 C CG  . MET B 8   ? 0.4995 0.5817 0.5759 0.0216  -0.0020 -0.0360 1   MET B CG  
1260 S SD  . MET B 8   ? 0.5711 0.6827 0.6592 0.0130  0.0049  -0.0461 1   MET B SD  
1261 C CE  . MET B 8   ? 0.5523 0.6403 0.6440 0.0301  0.0089  -0.0495 1   MET B CE  
1262 N N   . ALA B 9   ? 0.3258 0.3215 0.3944 0.0519  -0.0061 -0.0120 2   ALA B N   
1263 C CA  . ALA B 9   ? 0.3282 0.2877 0.3879 0.0459  -0.0009 -0.0096 2   ALA B CA  
1264 C C   . ALA B 9   ? 0.3413 0.2852 0.3889 0.0440  -0.0033 0.0052  2   ALA B C   
1265 O O   . ALA B 9   ? 0.3489 0.2822 0.3828 0.0323  0.0013  0.0041  2   ALA B O   
1266 C CB  . ALA B 9   ? 0.3403 0.2815 0.4131 0.0572  -0.0008 -0.0141 2   ALA B CB  
1267 N N   . LEU B 10  ? 0.3619 0.3087 0.4156 0.0558  -0.0112 0.0195  3   LEU B N   
1268 C CA  . LEU B 10  ? 0.3918 0.3327 0.4350 0.0538  -0.0140 0.0380  3   LEU B CA  
1269 C C   . LEU B 10  ? 0.3766 0.3395 0.4013 0.0419  -0.0109 0.0338  3   LEU B C   
1270 O O   . LEU B 10  ? 0.3622 0.3162 0.3749 0.0346  -0.0070 0.0370  3   LEU B O   
1271 C CB  . LEU B 10  ? 0.4283 0.3781 0.4818 0.0673  -0.0251 0.0574  3   LEU B CB  
1272 C CG  . LEU B 10  ? 0.4588 0.4128 0.5010 0.0636  -0.0287 0.0821  3   LEU B CG  
1273 C CD1 . LEU B 10  ? 0.4887 0.4104 0.5272 0.0552  -0.0235 0.0886  3   LEU B CD1 
1274 C CD2 . LEU B 10  ? 0.5493 0.5089 0.6049 0.0772  -0.0417 0.1059  3   LEU B CD2 
1275 N N   . LYS B 11  ? 0.3806 0.3749 0.4053 0.0409  -0.0137 0.0247  4   LYS B N   
1276 C CA  . LYS B 11  ? 0.4096 0.4261 0.4203 0.0305  -0.0130 0.0153  4   LYS B CA  
1277 C C   . LYS B 11  ? 0.3643 0.3613 0.3699 0.0179  -0.0061 -0.0011 4   LYS B C   
1278 O O   . LYS B 11  ? 0.3678 0.3666 0.3619 0.0123  -0.0049 -0.0065 4   LYS B O   
1279 C CB  . LYS B 11  ? 0.4201 0.4757 0.4353 0.0311  -0.0191 0.0080  4   LYS B CB  
1280 C CG  . LYS B 11  ? 0.5102 0.5930 0.5264 0.0433  -0.0278 0.0262  4   LYS B CG  
1281 C CD  . LYS B 11  ? 0.5998 0.7044 0.5977 0.0394  -0.0294 0.0329  4   LYS B CD  
1282 C CE  . LYS B 11  ? 0.7143 0.8429 0.7117 0.0506  -0.0383 0.0599  4   LYS B CE  
1283 N NZ  . LYS B 11  ? 0.7126 0.8049 0.7219 0.0598  -0.0401 0.0824  4   LYS B NZ  
1284 N N   . ARG B 12  ? 0.3387 0.3199 0.3535 0.0145  -0.0024 -0.0085 5   ARG B N   
1285 C CA  . ARG B 12  ? 0.3311 0.2898 0.3425 0.0033  0.0027  -0.0183 5   ARG B CA  
1286 C C   . ARG B 12  ? 0.3417 0.2746 0.3451 0.0049  0.0067  -0.0122 5   ARG B C   
1287 O O   . ARG B 12  ? 0.3230 0.2470 0.3194 -0.0013 0.0083  -0.0197 5   ARG B O   
1288 C CB  . ARG B 12  ? 0.3216 0.2762 0.3435 -0.0007 0.0058  -0.0227 5   ARG B CB  
1289 C CG  . ARG B 12  ? 0.3208 0.2497 0.3402 -0.0099 0.0109  -0.0257 5   ARG B CG  
1290 C CD  . ARG B 12  ? 0.3268 0.2497 0.3435 -0.0236 0.0087  -0.0338 5   ARG B CD  
1291 N NE  . ARG B 12  ? 0.3476 0.2456 0.3636 -0.0305 0.0119  -0.0326 5   ARG B NE  
1292 C CZ  . ARG B 12  ? 0.3454 0.2427 0.3677 -0.0431 0.0119  -0.0317 5   ARG B CZ  
1293 N NH1 . ARG B 12  ? 0.3312 0.2520 0.3621 -0.0525 0.0095  -0.0331 5   ARG B NH1 
1294 N NH2 . ARG B 12  ? 0.3711 0.2465 0.3915 -0.0476 0.0137  -0.0274 5   ARG B NH2 
1295 N N   . ILE B 13  ? 0.3313 0.2529 0.3380 0.0134  0.0073  0.0004  6   ILE B N   
1296 C CA  . ILE B 13  ? 0.3393 0.2397 0.3410 0.0130  0.0107  0.0073  6   ILE B CA  
1297 C C   . ILE B 13  ? 0.3383 0.2550 0.3281 0.0117  0.0100  0.0125  6   ILE B C   
1298 O O   . ILE B 13  ? 0.3349 0.2449 0.3179 0.0075  0.0138  0.0082  6   ILE B O   
1299 C CB  . ILE B 13  ? 0.3445 0.2278 0.3567 0.0208  0.0093  0.0193  6   ILE B CB  
1300 C CG1 . ILE B 13  ? 0.3432 0.2153 0.3663 0.0228  0.0113  0.0087  6   ILE B CG1 
1301 C CG2 . ILE B 13  ? 0.3579 0.2239 0.3662 0.0176  0.0119  0.0288  6   ILE B CG2 
1302 C CD1 . ILE B 13  ? 0.3537 0.2159 0.3927 0.0346  0.0065  0.0135  6   ILE B CD1 
1303 N N   . GLN B 14  ? 0.3536 0.2970 0.3413 0.0161  0.0047  0.0214  7   GLN B N   
1304 C CA  . GLN B 14  ? 0.3790 0.3515 0.3538 0.0149  0.0036  0.0256  7   GLN B CA  
1305 C C   . GLN B 14  ? 0.3884 0.3718 0.3555 0.0093  0.0054  0.0017  7   GLN B C   
1306 O O   . GLN B 14  ? 0.3725 0.3675 0.3307 0.0081  0.0081  -0.0023 7   GLN B O   
1307 C CB  . GLN B 14  ? 0.4198 0.4253 0.3937 0.0206  -0.0036 0.0387  7   GLN B CB  
1308 C CG  . GLN B 14  ? 0.4972 0.4951 0.4782 0.0267  -0.0080 0.0678  7   GLN B CG  
1309 C CD  . GLN B 14  ? 0.5596 0.5858 0.5442 0.0349  -0.0176 0.0824  7   GLN B CD  
1310 O OE1 . GLN B 14  ? 0.6105 0.6598 0.5954 0.0369  -0.0205 0.0685  7   GLN B OE1 
1311 N NE2 . GLN B 14  ? 0.6031 0.6274 0.5924 0.0390  -0.0236 0.1119  7   GLN B NE2 
1312 N N   . LYS B 15  ? 0.3849 0.3660 0.3581 0.0060  0.0030  -0.0144 8   LYS B N   
1313 C CA  . LYS B 15  ? 0.3787 0.3603 0.3505 0.0000  0.0018  -0.0380 8   LYS B CA  
1314 C C   . LYS B 15  ? 0.3699 0.3199 0.3427 -0.0022 0.0064  -0.0439 8   LYS B C   
1315 O O   . LYS B 15  ? 0.3804 0.3359 0.3490 -0.0015 0.0060  -0.0583 8   LYS B O   
1316 C CB  . LYS B 15  ? 0.3992 0.3819 0.3810 -0.0064 -0.0026 -0.0487 8   LYS B CB  
1317 C CG  . LYS B 15  ? 0.4178 0.3847 0.4058 -0.0160 -0.0056 -0.0696 8   LYS B CG  
1318 C CD  . LYS B 15  ? 0.4855 0.4717 0.4689 -0.0154 -0.0106 -0.0906 8   LYS B CD  
1319 C CE  . LYS B 15  ? 0.5113 0.4759 0.5076 -0.0258 -0.0172 -0.1112 8   LYS B CE  
1320 N NZ  . LYS B 15  ? 0.5502 0.5235 0.5453 -0.0223 -0.0225 -0.1372 8   LYS B NZ  
1321 N N   . GLU B 16  ? 0.3568 0.2781 0.3357 -0.0035 0.0101  -0.0346 9   GLU B N   
1322 C CA  . GLU B 16  ? 0.3706 0.2657 0.3503 -0.0049 0.0137  -0.0375 9   GLU B CA  
1323 C C   . GLU B 16  ? 0.3648 0.2695 0.3367 -0.0002 0.0172  -0.0328 9   GLU B C   
1324 O O   . GLU B 16  ? 0.3618 0.2626 0.3328 0.0007  0.0180  -0.0439 9   GLU B O   
1325 C CB  . GLU B 16  ? 0.3659 0.2373 0.3519 -0.0067 0.0170  -0.0280 9   GLU B CB  
1326 C CG  . GLU B 16  ? 0.3861 0.2501 0.3800 -0.0142 0.0150  -0.0331 9   GLU B CG  
1327 C CD  . GLU B 16  ? 0.3859 0.2329 0.3839 -0.0164 0.0188  -0.0268 9   GLU B CD  
1328 O OE1 . GLU B 16  ? 0.3994 0.2313 0.3948 -0.0147 0.0215  -0.0245 9   GLU B OE1 
1329 O OE2 . GLU B 16  ? 0.4025 0.2565 0.4064 -0.0202 0.0189  -0.0254 9   GLU B OE2 
1330 N N   . LEU B 17  ? 0.3633 0.2816 0.3319 0.0025  0.0185  -0.0150 10  LEU B N   
1331 C CA  . LEU B 17  ? 0.3848 0.3175 0.3471 0.0036  0.0220  -0.0058 10  LEU B CA  
1332 C C   . LEU B 17  ? 0.3997 0.3673 0.3531 0.0057  0.0215  -0.0206 10  LEU B C   
1333 O O   . LEU B 17  ? 0.4029 0.3773 0.3543 0.0071  0.0249  -0.0278 10  LEU B O   
1334 C CB  . LEU B 17  ? 0.3823 0.3237 0.3449 0.0039  0.0210  0.0197  10  LEU B CB  
1335 C CG  . LEU B 17  ? 0.4017 0.3581 0.3602 0.0008  0.0245  0.0347  10  LEU B CG  
1336 C CD1 . LEU B 17  ? 0.3946 0.3223 0.3597 -0.0020 0.0289  0.0324  10  LEU B CD1 
1337 C CD2 . LEU B 17  ? 0.4229 0.3856 0.3843 -0.0003 0.0206  0.0636  10  LEU B CD2 
1338 N N   . SER B 18  ? 0.3830 0.3774 0.3321 0.0069  0.0168  -0.0271 11  SER B N   
1339 C CA  . SER B 18  ? 0.4150 0.4488 0.3560 0.0098  0.0152  -0.0455 11  SER B CA  
1340 C C   . SER B 18  ? 0.4132 0.4300 0.3605 0.0120  0.0138  -0.0748 11  SER B C   
1341 O O   . SER B 18  ? 0.4216 0.4628 0.3653 0.0172  0.0154  -0.0895 11  SER B O   
1342 C CB  . SER B 18  ? 0.4423 0.5050 0.3799 0.0099  0.0088  -0.0500 11  SER B CB  
1343 O OG  . SER B 18  ? 0.5445 0.6481 0.4750 0.0130  0.0063  -0.0742 11  SER B OG  
1344 N N   . ASP B 19  ? 0.4040 0.3818 0.3622 0.0083  0.0102  -0.0821 12  ASP B N   
1345 C CA  . ASP B 19  ? 0.4411 0.3940 0.4093 0.0094  0.0060  -0.1054 12  ASP B CA  
1346 C C   . ASP B 19  ? 0.4127 0.3488 0.3828 0.0135  0.0109  -0.1015 12  ASP B C   
1347 O O   . ASP B 19  ? 0.4313 0.3690 0.4062 0.0204  0.0082  -0.1224 12  ASP B O   
1348 C CB  . ASP B 19  ? 0.4396 0.3560 0.4195 0.0009  0.0009  -0.1061 12  ASP B CB  
1349 C CG  . ASP B 19  ? 0.5087 0.4423 0.4909 -0.0044 -0.0056 -0.1156 12  ASP B CG  
1350 O OD1 . ASP B 19  ? 0.5002 0.4703 0.4766 -0.0004 -0.0085 -0.1301 12  ASP B OD1 
1351 O OD2 . ASP B 19  ? 0.5659 0.4811 0.5563 -0.0133 -0.0078 -0.1087 12  ASP B OD2 
1352 N N   . LEU B 20  ? 0.3892 0.3115 0.3574 0.0104  0.0169  -0.0775 13  LEU B N   
1353 C CA  . LEU B 20  ? 0.3946 0.3034 0.3655 0.0128  0.0212  -0.0729 13  LEU B CA  
1354 C C   . LEU B 20  ? 0.4276 0.3764 0.3920 0.0186  0.0254  -0.0768 13  LEU B C   
1355 O O   . LEU B 20  ? 0.4309 0.3836 0.4000 0.0257  0.0251  -0.0923 13  LEU B O   
1356 C CB  . LEU B 20  ? 0.3990 0.2861 0.3710 0.0072  0.0255  -0.0496 13  LEU B CB  
1357 C CG  . LEU B 20  ? 0.4119 0.2859 0.3874 0.0076  0.0293  -0.0438 13  LEU B CG  
1358 C CD1 . LEU B 20  ? 0.4338 0.2802 0.4135 0.0023  0.0303  -0.0310 13  LEU B CD1 
1359 C CD2 . LEU B 20  ? 0.4356 0.3387 0.4065 0.0078  0.0346  -0.0341 13  LEU B CD2 
1360 N N   . GLN B 21  ? 0.4082 0.3912 0.3628 0.0161  0.0285  -0.0626 14  GLN B N   
1361 C CA  . GLN B 21  ? 0.4491 0.4782 0.3968 0.0182  0.0336  -0.0601 14  GLN B CA  
1362 C C   . GLN B 21  ? 0.4870 0.5534 0.4326 0.0277  0.0310  -0.0913 14  GLN B C   
1363 O O   . GLN B 21  ? 0.5267 0.6272 0.4714 0.0333  0.0348  -0.1006 14  GLN B O   
1364 C CB  . GLN B 21  ? 0.4122 0.4664 0.3515 0.0107  0.0361  -0.0304 14  GLN B CB  
1365 C CG  . GLN B 21  ? 0.3837 0.3979 0.3302 0.0036  0.0373  -0.0052 14  GLN B CG  
1366 C CD  . GLN B 21  ? 0.3992 0.4316 0.3429 -0.0039 0.0382  0.0267  14  GLN B CD  
1367 O OE1 . GLN B 21  ? 0.4215 0.4885 0.3567 -0.0043 0.0361  0.0359  14  GLN B OE1 
1368 N NE2 . GLN B 21  ? 0.3903 0.3992 0.3424 -0.0107 0.0401  0.0446  14  GLN B NE2 
1369 N N   . ARG B 22  ? 0.4925 0.5522 0.4399 0.0300  0.0238  -0.1105 15  ARG B N   
1370 C CA  . ARG B 22  ? 0.5096 0.5936 0.4601 0.0400  0.0184  -0.1475 15  ARG B CA  
1371 C C   . ARG B 22  ? 0.5205 0.5720 0.4871 0.0494  0.0139  -0.1717 15  ARG B C   
1372 O O   . ARG B 22  ? 0.5162 0.5989 0.4865 0.0616  0.0125  -0.1993 15  ARG B O   
1373 C CB  . ARG B 22  ? 0.5659 0.6464 0.5172 0.0372  0.0102  -0.1607 15  ARG B CB  
1374 C CG  . ARG B 22  ? 0.7100 0.8124 0.6675 0.0466  0.0020  -0.2033 15  ARG B CG  
1375 C CD  . ARG B 22  ? 0.7953 0.8887 0.7569 0.0407  -0.0072 -0.2158 15  ARG B CD  
1376 N NE  . ARG B 22  ? 0.8917 1.0311 0.8371 0.0355  -0.0048 -0.1997 15  ARG B NE  
1377 C CZ  . ARG B 22  ? 0.9597 1.0838 0.9019 0.0260  -0.0040 -0.1713 15  ARG B CZ  
1378 N NH1 . ARG B 22  ? 0.9049 0.9729 0.8576 0.0194  -0.0041 -0.1564 15  ARG B NH1 
1379 N NH2 . ARG B 22  ? 0.9974 1.1679 0.9264 0.0241  -0.0035 -0.1577 15  ARG B NH2 
1380 N N   . ASP B 23  ? 0.5181 0.5111 0.4952 0.0447  0.0104  -0.1627 16  ASP B N   
1381 C CA  . ASP B 23  ? 0.5355 0.4922 0.5294 0.0527  0.0040  -0.1789 16  ASP B CA  
1382 C C   . ASP B 23  ? 0.4613 0.3826 0.4570 0.0465  0.0083  -0.1515 16  ASP B C   
1383 O O   . ASP B 23  ? 0.4549 0.3340 0.4565 0.0389  0.0042  -0.1411 16  ASP B O   
1384 C CB  . ASP B 23  ? 0.5538 0.4740 0.5621 0.0515  -0.0088 -0.1987 16  ASP B CB  
1385 C CG  . ASP B 23  ? 0.6574 0.6116 0.6673 0.0589  -0.0154 -0.2334 16  ASP B CG  
1386 O OD1 . ASP B 23  ? 0.6419 0.6278 0.6554 0.0738  -0.0162 -0.2597 16  ASP B OD1 
1387 O OD2 . ASP B 23  ? 0.6866 0.6401 0.6955 0.0503  -0.0202 -0.2371 16  ASP B OD2 
1388 N N   . PRO B 24  ? 0.4495 0.3934 0.4400 0.0484  0.0167  -0.1394 17  PRO B N   
1389 C CA  . PRO B 24  ? 0.4388 0.3552 0.4298 0.0410  0.0210  -0.1141 17  PRO B CA  
1390 C C   . PRO B 24  ? 0.4358 0.3142 0.4407 0.0462  0.0142  -0.1199 17  PRO B C   
1391 O O   . PRO B 24  ? 0.4311 0.3109 0.4467 0.0588  0.0077  -0.1426 17  PRO B O   
1392 C CB  . PRO B 24  ? 0.4473 0.4024 0.4323 0.0407  0.0300  -0.1032 17  PRO B CB  
1393 C CG  . PRO B 24  ? 0.4500 0.4566 0.4311 0.0490  0.0312  -0.1223 17  PRO B CG  
1394 C CD  . PRO B 24  ? 0.4694 0.4709 0.4533 0.0552  0.0228  -0.1479 17  PRO B CD  
1395 N N   . PRO B 25  ? 0.4265 0.2727 0.4320 0.0374  0.0145  -0.1002 18  PRO B N   
1396 C CA  . PRO B 25  ? 0.4347 0.2495 0.4521 0.0413  0.0075  -0.1007 18  PRO B CA  
1397 C C   . PRO B 25  ? 0.4360 0.2680 0.4584 0.0517  0.0094  -0.1045 18  PRO B C   
1398 O O   . PRO B 25  ? 0.3910 0.2521 0.4062 0.0490  0.0185  -0.0961 18  PRO B O   
1399 C CB  . PRO B 25  ? 0.4778 0.2692 0.4912 0.0283  0.0095  -0.0777 18  PRO B CB  
1400 C CG  . PRO B 25  ? 0.4304 0.2414 0.4320 0.0207  0.0186  -0.0661 18  PRO B CG  
1401 C CD  . PRO B 25  ? 0.4152 0.2595 0.4115 0.0255  0.0214  -0.0770 18  PRO B CD  
1402 N N   . ALA B 26  ? 0.4179 0.2320 0.4548 0.0632  -0.0001 -0.1162 19  ALA B N   
1403 C CA  . ALA B 26  ? 0.4360 0.2671 0.4805 0.0749  0.0001  -0.1203 19  ALA B CA  
1404 C C   . ALA B 26  ? 0.3776 0.2156 0.4146 0.0649  0.0082  -0.0972 19  ALA B C   
1405 O O   . ALA B 26  ? 0.3805 0.1950 0.4125 0.0531  0.0085  -0.0791 19  ALA B O   
1406 C CB  . ALA B 26  ? 0.4669 0.2667 0.5307 0.0881  -0.0142 -0.1301 19  ALA B CB  
1407 N N   . HIS B 27  ? 0.3792 0.2549 0.4164 0.0692  0.0146  -0.0999 20  HIS B N   
1408 C CA  . HIS B 27  ? 0.3786 0.2653 0.4125 0.0599  0.0210  -0.0823 20  HIS B CA  
1409 C C   . HIS B 27  ? 0.3697 0.2585 0.3913 0.0423  0.0295  -0.0651 20  HIS B C   
1410 O O   . HIS B 27  ? 0.3437 0.2380 0.3649 0.0335  0.0334  -0.0527 20  HIS B O   
1411 C CB  . HIS B 27  ? 0.4074 0.2658 0.4476 0.0609  0.0138  -0.0726 20  HIS B CB  
1412 C CG  . HIS B 27  ? 0.4423 0.2903 0.4979 0.0789  0.0023  -0.0855 20  HIS B CG  
1413 N ND1 . HIS B 27  ? 0.4979 0.3775 0.5645 0.0952  0.0013  -0.1033 20  HIS B ND1 
1414 C CD2 . HIS B 27  ? 0.4757 0.2851 0.5399 0.0837  -0.0097 -0.0836 20  HIS B CD2 
1415 C CE1 . HIS B 27  ? 0.4730 0.3306 0.5557 0.1117  -0.0118 -0.1137 20  HIS B CE1 
1416 N NE2 . HIS B 27  ? 0.4763 0.2886 0.5581 0.1039  -0.0193 -0.1000 20  HIS B NE2 
1417 N N   . CYS B 28  ? 0.3660 0.2506 0.3797 0.0379  0.0309  -0.0654 21  CYS B N   
1418 C CA  . CYS B 28  ? 0.3927 0.2701 0.3979 0.0238  0.0358  -0.0488 21  CYS B CA  
1419 C C   . CYS B 28  ? 0.4022 0.3085 0.4002 0.0199  0.0410  -0.0460 21  CYS B C   
1420 O O   . CYS B 28  ? 0.3969 0.3267 0.3933 0.0277  0.0405  -0.0599 21  CYS B O   
1421 C CB  . CYS B 28  ? 0.4009 0.2430 0.4038 0.0200  0.0314  -0.0454 21  CYS B CB  
1422 S SG  . CYS B 28  ? 0.4472 0.2606 0.4565 0.0212  0.0248  -0.0419 21  CYS B SG  
1423 N N   . SER B 29  ? 0.4080 0.3136 0.4029 0.0081  0.0449  -0.0280 22  SER B N   
1424 C CA  . SER B 29  ? 0.3994 0.3280 0.3879 0.0020  0.0482  -0.0172 22  SER B CA  
1425 C C   . SER B 29  ? 0.4018 0.3010 0.3902 -0.0060 0.0467  -0.0024 22  SER B C   
1426 O O   . SER B 29  ? 0.3568 0.2313 0.3509 -0.0095 0.0456  0.0006  22  SER B O   
1427 C CB  . SER B 29  ? 0.4141 0.3795 0.4049 -0.0049 0.0534  -0.0062 22  SER B CB  
1428 O OG  . SER B 29  ? 0.4174 0.4071 0.4024 -0.0130 0.0556  0.0105  22  SER B OG  
1429 N N   . ALA B 30  ? 0.3698 0.2744 0.3525 -0.0070 0.0457  0.0036  23  ALA B N   
1430 C CA  . ALA B 30  ? 0.3842 0.2653 0.3695 -0.0119 0.0433  0.0168  23  ALA B CA  
1431 C C   . ALA B 30  ? 0.3960 0.2977 0.3762 -0.0140 0.0423  0.0305  23  ALA B C   
1432 O O   . ALA B 30  ? 0.3731 0.3068 0.3446 -0.0105 0.0433  0.0249  23  ALA B O   
1433 C CB  . ALA B 30  ? 0.3917 0.2452 0.3778 -0.0078 0.0402  0.0063  23  ALA B CB  
1434 N N   . GLY B 31  ? 0.3768 0.2618 0.3636 -0.0189 0.0394  0.0479  24  GLY B N   
1435 C CA  . GLY B 31  ? 0.3910 0.2916 0.3755 -0.0207 0.0363  0.0663  24  GLY B CA  
1436 C C   . GLY B 31  ? 0.3951 0.2644 0.3929 -0.0230 0.0303  0.0820  24  GLY B C   
1437 O O   . GLY B 31  ? 0.3654 0.2069 0.3745 -0.0255 0.0295  0.0790  24  GLY B O   
1438 N N   . PRO B 32  ? 0.4240 0.2995 0.4219 -0.0207 0.0249  0.0972  25  PRO B N   
1439 C CA  . PRO B 32  ? 0.4516 0.2967 0.4658 -0.0197 0.0169  0.1113  25  PRO B CA  
1440 C C   . PRO B 32  ? 0.4764 0.3099 0.5041 -0.0314 0.0135  0.1343  25  PRO B C   
1441 O O   . PRO B 32  ? 0.4840 0.3454 0.5058 -0.0420 0.0174  0.1478  25  PRO B O   
1442 C CB  . PRO B 32  ? 0.4497 0.3136 0.4593 -0.0139 0.0115  0.1241  25  PRO B CB  
1443 C CG  . PRO B 32  ? 0.4570 0.3683 0.4486 -0.0183 0.0165  0.1281  25  PRO B CG  
1444 C CD  . PRO B 32  ? 0.4316 0.3454 0.4158 -0.0178 0.0247  0.1009  25  PRO B CD  
1445 N N   . VAL B 33  ? 0.5174 0.3121 0.5651 -0.0298 0.0056  0.1375  26  VAL B N   
1446 C CA  . VAL B 33  ? 0.5526 0.3280 0.6188 -0.0417 -0.0012 0.1603  26  VAL B CA  
1447 C C   . VAL B 33  ? 0.6347 0.4150 0.7063 -0.0421 -0.0107 0.1927  26  VAL B C   
1448 O O   . VAL B 33  ? 0.6687 0.4255 0.7525 -0.0301 -0.0200 0.1933  26  VAL B O   
1449 C CB  . VAL B 33  ? 0.5750 0.3044 0.6639 -0.0380 -0.0078 0.1446  26  VAL B CB  
1450 C CG1 . VAL B 33  ? 0.6395 0.3428 0.7525 -0.0518 -0.0177 0.1678  26  VAL B CG1 
1451 C CG2 . VAL B 33  ? 0.5342 0.2645 0.6160 -0.0370 0.0009  0.1143  26  VAL B CG2 
1452 N N   . GLY B 34  ? 0.6583 0.4745 0.7207 -0.0550 -0.0087 0.2201  27  GLY B N   
1453 C CA  . GLY B 34  ? 0.7254 0.5564 0.7891 -0.0566 -0.0176 0.2552  27  GLY B CA  
1454 C C   . GLY B 34  ? 0.7206 0.5716 0.7699 -0.0398 -0.0178 0.2447  27  GLY B C   
1455 O O   . GLY B 34  ? 0.6954 0.5761 0.7244 -0.0345 -0.0078 0.2199  27  GLY B O   
1456 N N   . ASP B 35  ? 0.7063 0.5399 0.7690 -0.0312 -0.0307 0.2629  28  ASP B N   
1457 C CA  . ASP B 35  ? 0.7136 0.5698 0.7656 -0.0159 -0.0328 0.2558  28  ASP B CA  
1458 C C   . ASP B 35  ? 0.6517 0.4789 0.7122 0.0010  -0.0331 0.2209  28  ASP B C   
1459 O O   . ASP B 35  ? 0.6504 0.4928 0.7074 0.0138  -0.0363 0.2143  28  ASP B O   
1460 C CB  . ASP B 35  ? 0.7584 0.6191 0.8206 -0.0137 -0.0477 0.2961  28  ASP B CB  
1461 C CG  . ASP B 35  ? 0.8979 0.8051 0.9467 -0.0312 -0.0469 0.3345  28  ASP B CG  
1462 O OD1 . ASP B 35  ? 0.9600 0.9023 0.9903 -0.0426 -0.0338 0.3252  28  ASP B OD1 
1463 O OD2 . ASP B 35  ? 0.9561 0.8683 1.0137 -0.0330 -0.0600 0.3749  28  ASP B OD2 
1464 N N   . ASP B 36  ? 0.6331 0.4250 0.7046 0.0005  -0.0298 0.1984  29  ASP B N   
1465 C CA  . ASP B 36  ? 0.6260 0.3948 0.7080 0.0156  -0.0309 0.1681  29  ASP B CA  
1466 C C   . ASP B 36  ? 0.5630 0.3513 0.6256 0.0159  -0.0177 0.1365  29  ASP B C   
1467 O O   . ASP B 36  ? 0.5497 0.3294 0.6088 0.0085  -0.0101 0.1223  29  ASP B O   
1468 C CB  . ASP B 36  ? 0.6621 0.3839 0.7699 0.0160  -0.0372 0.1612  29  ASP B CB  
1469 C CG  . ASP B 36  ? 0.7073 0.4140 0.8261 0.0318  -0.0376 0.1277  29  ASP B CG  
1470 O OD1 . ASP B 36  ? 0.6437 0.3723 0.7554 0.0433  -0.0358 0.1155  29  ASP B OD1 
1471 O OD2 . ASP B 36  ? 0.7621 0.4386 0.8978 0.0318  -0.0401 0.1130  29  ASP B OD2 
1472 N N   . LEU B 37  ? 0.5056 0.3194 0.5579 0.0240  -0.0163 0.1264  30  LEU B N   
1473 C CA  . LEU B 37  ? 0.5140 0.3446 0.5498 0.0218  -0.0057 0.1002  30  LEU B CA  
1474 C C   . LEU B 37  ? 0.4448 0.2536 0.4889 0.0255  -0.0023 0.0753  30  LEU B C   
1475 O O   . LEU B 37  ? 0.4043 0.2200 0.4373 0.0209  0.0054  0.0584  30  LEU B O   
1476 C CB  . LEU B 37  ? 0.5410 0.4054 0.5657 0.0267  -0.0062 0.0953  30  LEU B CB  
1477 C CG  . LEU B 37  ? 0.6134 0.5153 0.6207 0.0208  -0.0053 0.1085  30  LEU B CG  
1478 C CD1 . LEU B 37  ? 0.6287 0.5409 0.6213 0.0118  0.0042  0.0946  30  LEU B CD1 
1479 C CD2 . LEU B 37  ? 0.7138 0.6189 0.7259 0.0182  -0.0124 0.1426  30  LEU B CD2 
1480 N N   . PHE B 38  ? 0.4372 0.2223 0.5016 0.0342  -0.0090 0.0723  31  PHE B N   
1481 C CA  . PHE B 38  ? 0.4151 0.1901 0.4863 0.0381  -0.0054 0.0468  31  PHE B CA  
1482 C C   . PHE B 38  ? 0.4161 0.1708 0.4890 0.0295  -0.0016 0.0405  31  PHE B C   
1483 O O   . PHE B 38  ? 0.3923 0.1464 0.4658 0.0303  0.0026  0.0200  31  PHE B O   
1484 C CB  . PHE B 38  ? 0.4575 0.2250 0.5504 0.0541  -0.0139 0.0383  31  PHE B CB  
1485 C CG  . PHE B 38  ? 0.4582 0.2552 0.5488 0.0627  -0.0149 0.0342  31  PHE B CG  
1486 C CD1 . PHE B 38  ? 0.5082 0.3185 0.5970 0.0661  -0.0213 0.0543  31  PHE B CD1 
1487 C CD2 . PHE B 38  ? 0.4494 0.2658 0.5401 0.0663  -0.0098 0.0116  31  PHE B CD2 
1488 C CE1 . PHE B 38  ? 0.5217 0.3630 0.6094 0.0735  -0.0229 0.0494  31  PHE B CE1 
1489 C CE2 . PHE B 38  ? 0.4727 0.3199 0.5633 0.0721  -0.0110 0.0081  31  PHE B CE2 
1490 C CZ  . PHE B 38  ? 0.4873 0.3462 0.5768 0.0761  -0.0177 0.0258  31  PHE B CZ  
1491 N N   . HIS B 39  ? 0.4156 0.1597 0.4888 0.0201  -0.0030 0.0588  32  HIS B N   
1492 C CA  . HIS B 39  ? 0.4243 0.1545 0.4993 0.0101  0.0003  0.0542  32  HIS B CA  
1493 C C   . HIS B 39  ? 0.4099 0.1602 0.4667 -0.0012 0.0076  0.0647  32  HIS B C   
1494 O O   . HIS B 39  ? 0.4572 0.2192 0.5105 -0.0055 0.0056  0.0863  32  HIS B O   
1495 C CB  . HIS B 39  ? 0.4855 0.1856 0.5837 0.0076  -0.0096 0.0662  32  HIS B CB  
1496 C CG  . HIS B 39  ? 0.5190 0.1962 0.6401 0.0208  -0.0183 0.0495  32  HIS B CG  
1497 N ND1 . HIS B 39  ? 0.5907 0.2594 0.7269 0.0338  -0.0286 0.0571  32  HIS B ND1 
1498 C CD2 . HIS B 39  ? 0.5438 0.2085 0.6768 0.0246  -0.0192 0.0237  32  HIS B CD2 
1499 C CE1 . HIS B 39  ? 0.6116 0.2623 0.7696 0.0463  -0.0355 0.0348  32  HIS B CE1 
1500 N NE2 . HIS B 39  ? 0.5832 0.2331 0.7389 0.0406  -0.0295 0.0133  32  HIS B NE2 
1501 N N   . TRP B 40  ? 0.4063 0.1650 0.4518 -0.0049 0.0155  0.0495  33  TRP B N   
1502 C CA  . TRP B 40  ? 0.3729 0.1513 0.4046 -0.0128 0.0217  0.0542  33  TRP B CA  
1503 C C   . TRP B 40  ? 0.3619 0.1322 0.3988 -0.0204 0.0241  0.0496  33  TRP B C   
1504 O O   . TRP B 40  ? 0.3621 0.1158 0.4077 -0.0187 0.0226  0.0363  33  TRP B O   
1505 C CB  . TRP B 40  ? 0.3598 0.1553 0.3762 -0.0091 0.0269  0.0399  33  TRP B CB  
1506 C CG  . TRP B 40  ? 0.3724 0.1837 0.3816 -0.0038 0.0253  0.0410  33  TRP B CG  
1507 C CD1 . TRP B 40  ? 0.4001 0.2140 0.4143 0.0005  0.0197  0.0529  33  TRP B CD1 
1508 C CD2 . TRP B 40  ? 0.3858 0.2111 0.3842 -0.0022 0.0277  0.0282  33  TRP B CD2 
1509 N NE1 . TRP B 40  ? 0.3847 0.2187 0.3901 0.0042  0.0194  0.0476  33  TRP B NE1 
1510 C CE2 . TRP B 40  ? 0.3820 0.2215 0.3784 0.0018  0.0241  0.0314  33  TRP B CE2 
1511 C CE3 . TRP B 40  ? 0.3892 0.2149 0.3817 -0.0037 0.0311  0.0146  33  TRP B CE3 
1512 C CZ2 . TRP B 40  ? 0.3724 0.2274 0.3611 0.0025  0.0241  0.0196  33  TRP B CZ2 
1513 C CZ3 . TRP B 40  ? 0.4210 0.2565 0.4078 -0.0024 0.0301  0.0040  33  TRP B CZ3 
1514 C CH2 . TRP B 40  ? 0.4217 0.2722 0.4065 -0.0001 0.0269  0.0056  33  TRP B CH2 
1515 N N   . GLN B 41  ? 0.3740 0.1619 0.4062 -0.0287 0.0275  0.0598  34  GLN B N   
1516 C CA  . GLN B 41  ? 0.4116 0.2026 0.4457 -0.0350 0.0309  0.0532  34  GLN B CA  
1517 C C   . GLN B 41  ? 0.3839 0.1963 0.4032 -0.0301 0.0369  0.0411  34  GLN B C   
1518 O O   . GLN B 41  ? 0.3761 0.2070 0.3850 -0.0261 0.0385  0.0423  34  GLN B O   
1519 C CB  . GLN B 41  ? 0.5032 0.3027 0.5461 -0.0483 0.0300  0.0720  34  GLN B CB  
1520 C CG  . GLN B 41  ? 0.7270 0.5006 0.7896 -0.0563 0.0245  0.0712  34  GLN B CG  
1521 C CD  . GLN B 41  ? 0.9276 0.7104 0.9918 -0.0615 0.0281  0.0582  34  GLN B CD  
1522 O OE1 . GLN B 41  ? 0.8566 0.6208 0.9312 -0.0619 0.0246  0.0441  34  GLN B OE1 
1523 N NE2 . GLN B 41  ? 0.8772 0.6930 0.9321 -0.0646 0.0345  0.0614  34  GLN B NE2 
1524 N N   . ALA B 42  ? 0.3755 0.1848 0.3953 -0.0294 0.0386  0.0281  35  ALA B N   
1525 C CA  . ALA B 42  ? 0.3900 0.2147 0.4005 -0.0239 0.0418  0.0175  35  ALA B CA  
1526 C C   . ALA B 42  ? 0.3708 0.2074 0.3862 -0.0277 0.0435  0.0151  35  ALA B C   
1527 O O   . ALA B 42  ? 0.3734 0.2017 0.3984 -0.0349 0.0420  0.0172  35  ALA B O   
1528 C CB  . ALA B 42  ? 0.3768 0.1874 0.3829 -0.0172 0.0403  0.0057  35  ALA B CB  
1529 N N   . THR B 43  ? 0.3680 0.2258 0.3787 -0.0221 0.0458  0.0085  36  THR B N   
1530 C CA  . THR B 43  ? 0.3489 0.2246 0.3648 -0.0226 0.0471  0.0045  36  THR B CA  
1531 C C   . THR B 43  ? 0.3808 0.2558 0.3934 -0.0098 0.0450  -0.0095 36  THR B C   
1532 O O   . THR B 43  ? 0.3467 0.2236 0.3541 -0.0018 0.0442  -0.0164 36  THR B O   
1533 C CB  . THR B 43  ? 0.3741 0.2873 0.3918 -0.0274 0.0512  0.0118  36  THR B CB  
1534 O OG1 . THR B 43  ? 0.3849 0.2959 0.4077 -0.0413 0.0513  0.0300  36  THR B OG1 
1535 C CG2 . THR B 43  ? 0.3846 0.3226 0.4098 -0.0273 0.0526  0.0063  36  THR B CG2 
1536 N N   . ILE B 44  ? 0.3559 0.2278 0.3733 -0.0084 0.0427  -0.0134 37  ILE B N   
1537 C CA  . ILE B 44  ? 0.3543 0.2253 0.3726 0.0034  0.0386  -0.0226 37  ILE B CA  
1538 C C   . ILE B 44  ? 0.3540 0.2535 0.3807 0.0063  0.0390  -0.0259 37  ILE B C   
1539 O O   . ILE B 44  ? 0.3525 0.2604 0.3841 -0.0027 0.0400  -0.0212 37  ILE B O   
1540 C CB  . ILE B 44  ? 0.3545 0.2007 0.3707 0.0034  0.0338  -0.0210 37  ILE B CB  
1541 C CG1 . ILE B 44  ? 0.3556 0.1810 0.3651 0.0006  0.0338  -0.0187 37  ILE B CG1 
1542 C CG2 . ILE B 44  ? 0.3675 0.2114 0.3876 0.0148  0.0272  -0.0252 37  ILE B CG2 
1543 C CD1 . ILE B 44  ? 0.4107 0.2222 0.4178 -0.0035 0.0316  -0.0152 37  ILE B CD1 
1544 N N   . MET B 45  ? 0.3393 0.2565 0.3694 0.0191  0.0377  -0.0362 38  MET B N   
1545 C CA  . MET B 45  ? 0.4015 0.3483 0.4417 0.0265  0.0366  -0.0423 38  MET B CA  
1546 C C   . MET B 45  ? 0.4185 0.3434 0.4627 0.0376  0.0274  -0.0450 38  MET B C   
1547 O O   . MET B 45  ? 0.4221 0.3217 0.4655 0.0468  0.0215  -0.0494 38  MET B O   
1548 C CB  . MET B 45  ? 0.4333 0.4159 0.4772 0.0372  0.0392  -0.0549 38  MET B CB  
1549 C CG  . MET B 45  ? 0.5511 0.5705 0.6080 0.0496  0.0375  -0.0657 38  MET B CG  
1550 S SD  . MET B 45  ? 0.6680 0.7387 0.7313 0.0336  0.0457  -0.0562 38  MET B SD  
1551 C CE  . MET B 45  ? 0.4864 0.5970 0.5434 0.0266  0.0550  -0.0547 38  MET B CE  
1552 N N   . GLY B 46  ? 0.3636 0.2989 0.4131 0.0354  0.0252  -0.0407 39  GLY B N   
1553 C CA  . GLY B 46  ? 0.3626 0.2814 0.4148 0.0435  0.0158  -0.0374 39  GLY B CA  
1554 C C   . GLY B 46  ? 0.3754 0.2879 0.4370 0.0638  0.0075  -0.0467 39  GLY B C   
1555 O O   . GLY B 46  ? 0.3806 0.3215 0.4520 0.0754  0.0079  -0.0590 39  GLY B O   
1556 N N   . PRO B 47  ? 0.4029 0.2790 0.4635 0.0679  -0.0009 -0.0415 40  PRO B N   
1557 C CA  . PRO B 47  ? 0.4457 0.3062 0.5191 0.0866  -0.0115 -0.0513 40  PRO B CA  
1558 C C   . PRO B 47  ? 0.4418 0.3224 0.5317 0.1049  -0.0197 -0.0572 40  PRO B C   
1559 O O   . PRO B 47  ? 0.4190 0.3118 0.5094 0.1024  -0.0221 -0.0454 40  PRO B O   
1560 C CB  . PRO B 47  ? 0.4779 0.2966 0.5486 0.0813  -0.0202 -0.0362 40  PRO B CB  
1561 C CG  . PRO B 47  ? 0.4745 0.2905 0.5283 0.0613  -0.0105 -0.0263 40  PRO B CG  
1562 C CD  . PRO B 47  ? 0.4283 0.2776 0.4775 0.0542  -0.0009 -0.0273 40  PRO B CD  
1563 N N   . PRO B 48  ? 0.4975 0.3848 0.6020 0.1246  -0.0248 -0.0773 41  PRO B N   
1564 C CA  . PRO B 48  ? 0.5412 0.4462 0.6651 0.1459  -0.0348 -0.0845 41  PRO B CA  
1565 C C   . PRO B 48  ? 0.5547 0.4269 0.6847 0.1494  -0.0497 -0.0638 41  PRO B C   
1566 O O   . PRO B 48  ? 0.5652 0.3949 0.6903 0.1409  -0.0555 -0.0500 41  PRO B O   
1567 C CB  . PRO B 48  ? 0.5855 0.4896 0.7252 0.1677  -0.0409 -0.1121 41  PRO B CB  
1568 C CG  . PRO B 48  ? 0.5698 0.4788 0.6948 0.1551  -0.0288 -0.1209 41  PRO B CG  
1569 C CD  . PRO B 48  ? 0.5234 0.4030 0.6290 0.1302  -0.0236 -0.0963 41  PRO B CD  
1570 N N   . ASP B 49  ? 0.5759 0.4728 0.7159 0.1595  -0.0556 -0.0589 42  ASP B N   
1571 C CA  . ASP B 49  ? 0.6974 0.5702 0.8431 0.1633  -0.0710 -0.0358 42  ASP B CA  
1572 C C   . ASP B 49  ? 0.6070 0.4742 0.7312 0.1382  -0.0660 -0.0099 42  ASP B C   
1573 O O   . ASP B 49  ? 0.6782 0.5414 0.8039 0.1390  -0.0769 0.0114  42  ASP B O   
1574 C CB  . ASP B 49  ? 0.7603 0.5803 0.9224 0.1769  -0.0884 -0.0344 42  ASP B CB  
1575 C CG  . ASP B 49  ? 0.8208 0.6439 1.0069 0.2044  -0.0954 -0.0658 42  ASP B CG  
1576 O OD1 . ASP B 49  ? 0.7824 0.6433 0.9833 0.2237  -0.0981 -0.0782 42  ASP B OD1 
1577 O OD2 . ASP B 49  ? 0.9475 0.7384 1.1391 0.2073  -0.0988 -0.0801 42  ASP B OD2 
1578 N N   . SER B 50  ? 0.5364 0.4062 0.6418 0.1176  -0.0509 -0.0118 43  SER B N   
1579 C CA  . SER B 50  ? 0.4909 0.3682 0.5781 0.0966  -0.0450 0.0052  43  SER B CA  
1580 C C   . SER B 50  ? 0.4781 0.4019 0.5657 0.0948  -0.0406 0.0015  43  SER B C   
1581 O O   . SER B 50  ? 0.4555 0.4070 0.5550 0.1056  -0.0383 -0.0139 43  SER B O   
1582 C CB  . SER B 50  ? 0.4624 0.3268 0.5331 0.0777  -0.0322 0.0027  43  SER B CB  
1583 O OG  . SER B 50  ? 0.4293 0.3198 0.4954 0.0698  -0.0190 -0.0107 43  SER B OG  
1584 N N   . ALA B 51  ? 0.4517 0.3891 0.5276 0.0809  -0.0396 0.0142  44  ALA B N   
1585 C CA  . ALA B 51  ? 0.4429 0.4238 0.5189 0.0748  -0.0354 0.0086  44  ALA B CA  
1586 C C   . ALA B 51  ? 0.4141 0.4058 0.4863 0.0606  -0.0208 -0.0066 44  ALA B C   
1587 O O   . ALA B 51  ? 0.4232 0.4498 0.5002 0.0540  -0.0169 -0.0140 44  ALA B O   
1588 C CB  . ALA B 51  ? 0.4635 0.4582 0.5278 0.0637  -0.0390 0.0228  44  ALA B CB  
1589 N N   . TYR B 52  ? 0.3654 0.3280 0.4308 0.0551  -0.0139 -0.0096 45  TYR B N   
1590 C CA  . TYR B 52  ? 0.3405 0.3078 0.4024 0.0415  -0.0018 -0.0191 45  TYR B CA  
1591 C C   . TYR B 52  ? 0.3330 0.3106 0.4036 0.0498  0.0026  -0.0300 45  TYR B C   
1592 O O   . TYR B 52  ? 0.3238 0.3054 0.3915 0.0389  0.0118  -0.0339 45  TYR B O   
1593 C CB  . TYR B 52  ? 0.3569 0.2927 0.4056 0.0304  0.0024  -0.0147 45  TYR B CB  
1594 C CG  . TYR B 52  ? 0.3672 0.3020 0.4072 0.0237  -0.0017 -0.0055 45  TYR B CG  
1595 C CD1 . TYR B 52  ? 0.3338 0.2901 0.3715 0.0115  0.0008  -0.0102 45  TYR B CD1 
1596 C CD2 . TYR B 52  ? 0.3691 0.2852 0.4044 0.0288  -0.0092 0.0076  45  TYR B CD2 
1597 C CE1 . TYR B 52  ? 0.3524 0.3178 0.3815 0.0065  -0.0028 -0.0050 45  TYR B CE1 
1598 C CE2 . TYR B 52  ? 0.3723 0.2978 0.3983 0.0216  -0.0126 0.0180  45  TYR B CE2 
1599 C CZ  . TYR B 52  ? 0.3685 0.3215 0.3903 0.0114  -0.0089 0.0103  45  TYR B CZ  
1600 O OH  . TYR B 52  ? 0.3899 0.3610 0.4018 0.0053  -0.0121 0.0177  45  TYR B OH  
1601 N N   . GLN B 53  ? 0.3472 0.3322 0.4294 0.0697  -0.0046 -0.0351 46  GLN B N   
1602 C CA  . GLN B 53  ? 0.3598 0.3621 0.4508 0.0808  -0.0009 -0.0499 46  GLN B CA  
1603 C C   . GLN B 53  ? 0.3314 0.3792 0.4264 0.0697  0.0091  -0.0550 46  GLN B C   
1604 O O   . GLN B 53  ? 0.3192 0.3961 0.4206 0.0649  0.0083  -0.0529 46  GLN B O   
1605 C CB  . GLN B 53  ? 0.4007 0.4090 0.5086 0.1071  -0.0124 -0.0587 46  GLN B CB  
1606 C CG  . GLN B 53  ? 0.4166 0.4598 0.5370 0.1157  -0.0186 -0.0574 46  GLN B CG  
1607 C CD  . GLN B 53  ? 0.5004 0.5499 0.6412 0.1454  -0.0308 -0.0689 46  GLN B CD  
1608 O OE1 . GLN B 53  ? 0.5890 0.6068 0.7351 0.1594  -0.0372 -0.0767 46  GLN B OE1 
1609 N NE2 . GLN B 53  ? 0.5075 0.5990 0.6624 0.1558  -0.0352 -0.0719 46  GLN B NE2 
1610 N N   . GLY B 54  ? 0.3344 0.3902 0.4258 0.0647  0.0179  -0.0604 47  GLY B N   
1611 C CA  . GLY B 54  ? 0.3360 0.4361 0.4313 0.0509  0.0276  -0.0606 47  GLY B CA  
1612 C C   . GLY B 54  ? 0.3178 0.4031 0.4050 0.0246  0.0333  -0.0471 47  GLY B C   
1613 O O   . GLY B 54  ? 0.3332 0.4476 0.4248 0.0089  0.0401  -0.0424 47  GLY B O   
1614 N N   . GLY B 55  ? 0.3291 0.3716 0.4069 0.0199  0.0295  -0.0407 48  GLY B N   
1615 C CA  . GLY B 55  ? 0.3282 0.3521 0.4007 -0.0009 0.0329  -0.0324 48  GLY B CA  
1616 C C   . GLY B 55  ? 0.3361 0.3390 0.3998 -0.0057 0.0381  -0.0281 48  GLY B C   
1617 O O   . GLY B 55  ? 0.3270 0.3160 0.3844 0.0071  0.0372  -0.0321 48  GLY B O   
1618 N N   . VAL B 56  ? 0.3398 0.3422 0.4053 -0.0241 0.0424  -0.0197 49  VAL B N   
1619 C CA  . VAL B 56  ? 0.3456 0.3267 0.4034 -0.0296 0.0458  -0.0124 49  VAL B CA  
1620 C C   . VAL B 56  ? 0.3652 0.3093 0.4212 -0.0385 0.0427  -0.0096 49  VAL B C   
1621 O O   . VAL B 56  ? 0.3468 0.2915 0.4123 -0.0517 0.0410  -0.0081 49  VAL B O   
1622 C CB  . VAL B 56  ? 0.3708 0.3794 0.4341 -0.0440 0.0512  -0.0010 49  VAL B CB  
1623 C CG1 . VAL B 56  ? 0.3857 0.3751 0.4404 -0.0473 0.0533  0.0085  49  VAL B CG1 
1624 C CG2 . VAL B 56  ? 0.3546 0.4146 0.4221 -0.0364 0.0552  -0.0063 49  VAL B CG2 
1625 N N   . PHE B 57  ? 0.3272 0.2422 0.3728 -0.0311 0.0415  -0.0109 50  PHE B N   
1626 C CA  . PHE B 57  ? 0.3558 0.2418 0.3997 -0.0360 0.0389  -0.0116 50  PHE B CA  
1627 C C   . PHE B 57  ? 0.3420 0.2080 0.3825 -0.0390 0.0405  -0.0047 50  PHE B C   
1628 O O   . PHE B 57  ? 0.3592 0.2238 0.3914 -0.0316 0.0423  -0.0031 50  PHE B O   
1629 C CB  . PHE B 57  ? 0.3376 0.2136 0.3736 -0.0258 0.0354  -0.0177 50  PHE B CB  
1630 C CG  . PHE B 57  ? 0.3418 0.2384 0.3814 -0.0217 0.0320  -0.0216 50  PHE B CG  
1631 C CD1 . PHE B 57  ? 0.3399 0.2445 0.3842 -0.0288 0.0291  -0.0261 50  PHE B CD1 
1632 C CD2 . PHE B 57  ? 0.3525 0.2617 0.3923 -0.0091 0.0303  -0.0223 50  PHE B CD2 
1633 C CE1 . PHE B 57  ? 0.3448 0.2730 0.3922 -0.0248 0.0251  -0.0286 50  PHE B CE1 
1634 C CE2 . PHE B 57  ? 0.3507 0.2796 0.3956 -0.0033 0.0255  -0.0244 50  PHE B CE2 
1635 C CZ  . PHE B 57  ? 0.3508 0.2905 0.3984 -0.0116 0.0231  -0.0261 50  PHE B CZ  
1636 N N   . PHE B 58  ? 0.3549 0.2059 0.4041 -0.0495 0.0385  -0.0016 51  PHE B N   
1637 C CA  . PHE B 58  ? 0.3499 0.1817 0.3995 -0.0515 0.0380  0.0063  51  PHE B CA  
1638 C C   . PHE B 58  ? 0.3447 0.1528 0.3925 -0.0458 0.0348  -0.0032 51  PHE B C   
1639 O O   . PHE B 58  ? 0.3602 0.1648 0.4134 -0.0472 0.0318  -0.0146 51  PHE B O   
1640 C CB  . PHE B 58  ? 0.3907 0.2206 0.4556 -0.0668 0.0357  0.0187  51  PHE B CB  
1641 C CG  . PHE B 58  ? 0.3963 0.2597 0.4631 -0.0746 0.0398  0.0302  51  PHE B CG  
1642 C CD1 . PHE B 58  ? 0.4029 0.2876 0.4588 -0.0696 0.0446  0.0381  51  PHE B CD1 
1643 C CD2 . PHE B 58  ? 0.4350 0.3144 0.5154 -0.0876 0.0387  0.0314  51  PHE B CD2 
1644 C CE1 . PHE B 58  ? 0.4084 0.3337 0.4660 -0.0760 0.0491  0.0468  51  PHE B CE1 
1645 C CE2 . PHE B 58  ? 0.4717 0.3904 0.5549 -0.0955 0.0431  0.0420  51  PHE B CE2 
1646 C CZ  . PHE B 58  ? 0.4399 0.3836 0.5113 -0.0892 0.0488  0.0496  51  PHE B CZ  
1647 N N   . LEU B 59  ? 0.3338 0.1320 0.3742 -0.0393 0.0356  0.0000  52  LEU B N   
1648 C CA  . LEU B 59  ? 0.3386 0.1226 0.3767 -0.0330 0.0337  -0.0081 52  LEU B CA  
1649 C C   . LEU B 59  ? 0.3525 0.1215 0.3961 -0.0320 0.0313  -0.0007 52  LEU B C   
1650 O O   . LEU B 59  ? 0.3590 0.1316 0.4021 -0.0350 0.0320  0.0134  52  LEU B O   
1651 C CB  . LEU B 59  ? 0.3365 0.1268 0.3608 -0.0252 0.0361  -0.0110 52  LEU B CB  
1652 C CG  . LEU B 59  ? 0.3646 0.1656 0.3836 -0.0232 0.0360  -0.0165 52  LEU B CG  
1653 C CD1 . LEU B 59  ? 0.4109 0.2252 0.4300 -0.0229 0.0371  -0.0130 52  LEU B CD1 
1654 C CD2 . LEU B 59  ? 0.4011 0.2004 0.4111 -0.0183 0.0357  -0.0167 52  LEU B CD2 
1655 N N   . THR B 60  ? 0.3756 0.1329 0.4245 -0.0269 0.0282  -0.0105 53  THR B N   
1656 C CA  . THR B 60  ? 0.3994 0.1434 0.4550 -0.0220 0.0245  -0.0056 53  THR B CA  
1657 C C   . THR B 60  ? 0.3589 0.1111 0.4048 -0.0133 0.0267  -0.0127 53  THR B C   
1658 O O   . THR B 60  ? 0.3651 0.1275 0.4057 -0.0117 0.0288  -0.0245 53  THR B O   
1659 C CB  . THR B 60  ? 0.4106 0.1339 0.4875 -0.0215 0.0167  -0.0137 53  THR B CB  
1660 O OG1 . THR B 60  ? 0.3993 0.1288 0.4783 -0.0171 0.0164  -0.0365 53  THR B OG1 
1661 C CG2 . THR B 60  ? 0.4852 0.1985 0.5748 -0.0334 0.0132  -0.0042 53  THR B CG2 
1662 N N   . VAL B 61  ? 0.3579 0.1095 0.4018 -0.0093 0.0257  -0.0035 54  VAL B N   
1663 C CA  . VAL B 61  ? 0.3560 0.1170 0.3941 -0.0026 0.0266  -0.0086 54  VAL B CA  
1664 C C   . VAL B 61  ? 0.3488 0.1023 0.3997 0.0054  0.0208  -0.0072 54  VAL B C   
1665 O O   . VAL B 61  ? 0.3413 0.0874 0.3966 0.0052  0.0170  0.0081  54  VAL B O   
1666 C CB  . VAL B 61  ? 0.3502 0.1233 0.3742 -0.0042 0.0298  -0.0010 54  VAL B CB  
1667 C CG1 . VAL B 61  ? 0.3727 0.1564 0.3926 -0.0006 0.0301  -0.0070 54  VAL B CG1 
1668 C CG2 . VAL B 61  ? 0.3306 0.1086 0.3459 -0.0092 0.0334  -0.0023 54  VAL B CG2 
1669 N N   . HIS B 62  ? 0.3476 0.1077 0.4045 0.0128  0.0199  -0.0222 55  HIS B N   
1670 C CA  . HIS B 62  ? 0.3868 0.1452 0.4568 0.0239  0.0141  -0.0240 55  HIS B CA  
1671 C C   . HIS B 62  ? 0.3574 0.1420 0.4210 0.0282  0.0172  -0.0309 55  HIS B C   
1672 O O   . HIS B 62  ? 0.3489 0.1516 0.4069 0.0257  0.0220  -0.0425 55  HIS B O   
1673 C CB  . HIS B 62  ? 0.4023 0.1453 0.4940 0.0318  0.0072  -0.0386 55  HIS B CB  
1674 C CG  . HIS B 62  ? 0.4512 0.1911 0.5606 0.0466  -0.0006 -0.0422 55  HIS B CG  
1675 N ND1 . HIS B 62  ? 0.4893 0.2140 0.6062 0.0499  -0.0079 -0.0218 55  HIS B ND1 
1676 C CD2 . HIS B 62  ? 0.4591 0.2138 0.5810 0.0603  -0.0030 -0.0638 55  HIS B CD2 
1677 C CE1 . HIS B 62  ? 0.4729 0.1989 0.6074 0.0660  -0.0154 -0.0302 55  HIS B CE1 
1678 N NE2 . HIS B 62  ? 0.4846 0.2293 0.6232 0.0732  -0.0123 -0.0574 55  HIS B NE2 
1679 N N   . PHE B 63  ? 0.3709 0.1606 0.4359 0.0332  0.0140  -0.0215 56  PHE B N   
1680 C CA  . PHE B 63  ? 0.3501 0.1665 0.4111 0.0355  0.0160  -0.0261 56  PHE B CA  
1681 C C   . PHE B 63  ? 0.3866 0.2134 0.4660 0.0501  0.0111  -0.0388 56  PHE B C   
1682 O O   . PHE B 63  ? 0.3783 0.1861 0.4741 0.0608  0.0029  -0.0364 56  PHE B O   
1683 C CB  . PHE B 63  ? 0.3558 0.1782 0.4081 0.0329  0.0145  -0.0110 56  PHE B CB  
1684 C CG  . PHE B 63  ? 0.3392 0.1583 0.3747 0.0210  0.0190  -0.0041 56  PHE B CG  
1685 C CD1 . PHE B 63  ? 0.3619 0.1933 0.3875 0.0129  0.0231  -0.0099 56  PHE B CD1 
1686 C CD2 . PHE B 63  ? 0.3656 0.1717 0.3978 0.0180  0.0182  0.0080  56  PHE B CD2 
1687 C CE1 . PHE B 63  ? 0.3282 0.1550 0.3423 0.0053  0.0253  -0.0070 56  PHE B CE1 
1688 C CE2 . PHE B 63  ? 0.3499 0.1591 0.3689 0.0099  0.0221  0.0107  56  PHE B CE2 
1689 C CZ  . PHE B 63  ? 0.3496 0.1675 0.3600 0.0051  0.0252  0.0014  56  PHE B CZ  
1690 N N   . PRO B 64  ? 0.3745 0.2327 0.4534 0.0507  0.0152  -0.0521 57  PRO B N   
1691 C CA  . PRO B 64  ? 0.3914 0.2719 0.4874 0.0656  0.0117  -0.0668 57  PRO B CA  
1692 C C   . PRO B 64  ? 0.3931 0.2855 0.4935 0.0722  0.0068  -0.0570 57  PRO B C   
1693 O O   . PRO B 64  ? 0.3776 0.2730 0.4639 0.0616  0.0085  -0.0426 57  PRO B O   
1694 C CB  . PRO B 64  ? 0.3795 0.2978 0.4687 0.0582  0.0198  -0.0794 57  PRO B CB  
1695 C CG  . PRO B 64  ? 0.3503 0.2677 0.4198 0.0395  0.0249  -0.0633 57  PRO B CG  
1696 C CD  . PRO B 64  ? 0.3654 0.2428 0.4279 0.0359  0.0230  -0.0510 57  PRO B CD  
1697 N N   . THR B 65  ? 0.3992 0.3004 0.5206 0.0909  -0.0003 -0.0669 58  THR B N   
1698 C CA  . THR B 65  ? 0.4186 0.3344 0.5478 0.1005  -0.0070 -0.0583 58  THR B CA  
1699 C C   . THR B 65  ? 0.4086 0.3689 0.5289 0.0918  -0.0011 -0.0603 58  THR B C   
1700 O O   . THR B 65  ? 0.4150 0.3884 0.5349 0.0933  -0.0054 -0.0499 58  THR B O   
1701 C CB  . THR B 65  ? 0.4455 0.3623 0.6035 0.1257  -0.0175 -0.0711 58  THR B CB  
1702 O OG1 . THR B 65  ? 0.4707 0.4235 0.6382 0.1330  -0.0130 -0.0986 58  THR B OG1 
1703 C CG2 . THR B 65  ? 0.4585 0.3252 0.6302 0.1331  -0.0267 -0.0666 58  THR B CG2 
1704 N N   . ASP B 66  ? 0.4058 0.3922 0.5203 0.0817  0.0076  -0.0728 59  ASP B N   
1705 C CA  . ASP B 66  ? 0.3899 0.4158 0.4968 0.0675  0.0130  -0.0715 59  ASP B CA  
1706 C C   . ASP B 66  ? 0.3845 0.3961 0.4705 0.0437  0.0189  -0.0600 59  ASP B C   
1707 O O   . ASP B 66  ? 0.3804 0.4190 0.4618 0.0284  0.0236  -0.0599 59  ASP B O   
1708 C CB  . ASP B 66  ? 0.3961 0.4723 0.5144 0.0715  0.0174  -0.0902 59  ASP B CB  
1709 C CG  . ASP B 66  ? 0.3988 0.4749 0.5125 0.0675  0.0237  -0.1009 59  ASP B CG  
1710 O OD1 . ASP B 66  ? 0.4073 0.4412 0.5139 0.0662  0.0231  -0.0971 59  ASP B OD1 
1711 O OD2 . ASP B 66  ? 0.3992 0.5236 0.5166 0.0651  0.0293  -0.1130 59  ASP B OD2 
1712 N N   . TYR B 67  ? 0.4014 0.3718 0.4769 0.0406  0.0177  -0.0495 60  TYR B N   
1713 C CA  . TYR B 67  ? 0.3732 0.3286 0.4320 0.0224  0.0211  -0.0404 60  TYR B CA  
1714 C C   . TYR B 67  ? 0.3732 0.3484 0.4295 0.0132  0.0189  -0.0365 60  TYR B C   
1715 O O   . TYR B 67  ? 0.3675 0.3535 0.4290 0.0219  0.0135  -0.0345 60  TYR B O   
1716 C CB  . TYR B 67  ? 0.3971 0.3138 0.4480 0.0242  0.0195  -0.0315 60  TYR B CB  
1717 C CG  . TYR B 67  ? 0.3486 0.2477 0.3850 0.0099  0.0228  -0.0263 60  TYR B CG  
1718 C CD1 . TYR B 67  ? 0.3597 0.2519 0.3876 0.0054  0.0205  -0.0202 60  TYR B CD1 
1719 C CD2 . TYR B 67  ? 0.3593 0.2522 0.3916 0.0024  0.0272  -0.0289 60  TYR B CD2 
1720 C CE1 . TYR B 67  ? 0.3635 0.2406 0.3816 -0.0044 0.0222  -0.0194 60  TYR B CE1 
1721 C CE2 . TYR B 67  ? 0.3759 0.2515 0.3980 -0.0078 0.0284  -0.0240 60  TYR B CE2 
1722 C CZ  . TYR B 67  ? 0.3676 0.2341 0.3839 -0.0104 0.0257  -0.0205 60  TYR B CZ  
1723 O OH  . TYR B 67  ? 0.3786 0.2287 0.3882 -0.0177 0.0258  -0.0193 60  TYR B OH  
1724 N N   . PRO B 68  ? 0.3566 0.3358 0.4064 -0.0051 0.0215  -0.0348 61  PRO B N   
1725 C CA  . PRO B 68  ? 0.3539 0.3175 0.3961 -0.0178 0.0256  -0.0318 61  PRO B CA  
1726 C C   . PRO B 68  ? 0.3565 0.3512 0.4033 -0.0265 0.0301  -0.0335 61  PRO B C   
1727 O O   . PRO B 68  ? 0.3584 0.3478 0.3999 -0.0420 0.0316  -0.0261 61  PRO B O   
1728 C CB  . PRO B 68  ? 0.3638 0.3151 0.4005 -0.0320 0.0221  -0.0276 61  PRO B CB  
1729 C CG  . PRO B 68  ? 0.3842 0.3672 0.4293 -0.0348 0.0187  -0.0309 61  PRO B CG  
1730 C CD  . PRO B 68  ? 0.3637 0.3601 0.4144 -0.0150 0.0176  -0.0341 61  PRO B CD  
1731 N N   . PHE B 69  ? 0.3291 0.3595 0.3869 -0.0165 0.0314  -0.0424 62  PHE B N   
1732 C CA  . PHE B 69  ? 0.3378 0.4118 0.4002 -0.0244 0.0365  -0.0454 62  PHE B CA  
1733 C C   . PHE B 69  ? 0.3400 0.4110 0.3972 -0.0211 0.0409  -0.0493 62  PHE B C   
1734 O O   . PHE B 69  ? 0.3397 0.4449 0.3954 -0.0320 0.0455  -0.0474 62  PHE B O   
1735 C CB  . PHE B 69  ? 0.3386 0.4599 0.4163 -0.0124 0.0364  -0.0575 62  PHE B CB  
1736 C CG  . PHE B 69  ? 0.3492 0.4942 0.4329 -0.0229 0.0332  -0.0528 62  PHE B CG  
1737 C CD1 . PHE B 69  ? 0.3417 0.4665 0.4261 -0.0158 0.0267  -0.0515 62  PHE B CD1 
1738 C CD2 . PHE B 69  ? 0.3632 0.5555 0.4523 -0.0416 0.0364  -0.0490 62  PHE B CD2 
1739 C CE1 . PHE B 69  ? 0.3382 0.4881 0.4285 -0.0260 0.0229  -0.0496 62  PHE B CE1 
1740 C CE2 . PHE B 69  ? 0.3667 0.5822 0.4637 -0.0536 0.0327  -0.0456 62  PHE B CE2 
1741 C CZ  . PHE B 69  ? 0.3666 0.5602 0.4643 -0.0450 0.0256  -0.0476 62  PHE B CZ  
1742 N N   . LYS B 70  ? 0.3592 0.3936 0.4141 -0.0073 0.0392  -0.0542 63  LYS B N   
1743 C CA  . LYS B 70  ? 0.3769 0.4034 0.4266 -0.0053 0.0421  -0.0588 63  LYS B CA  
1744 C C   . LYS B 70  ? 0.3668 0.3434 0.4065 -0.0084 0.0399  -0.0488 63  LYS B C   
1745 O O   . LYS B 70  ? 0.3559 0.3067 0.3950 -0.0057 0.0361  -0.0435 63  LYS B O   
1746 C CB  . LYS B 70  ? 0.4041 0.4403 0.4665 0.0157  0.0410  -0.0795 63  LYS B CB  
1747 C CG  . LYS B 70  ? 0.4643 0.5603 0.5368 0.0205  0.0444  -0.0945 63  LYS B CG  
1748 C CD  . LYS B 70  ? 0.5705 0.6726 0.6588 0.0441  0.0414  -0.1202 63  LYS B CD  
1749 C CE  . LYS B 70  ? 0.6353 0.8052 0.7357 0.0521  0.0448  -0.1395 63  LYS B CE  
1750 N NZ  . LYS B 70  ? 0.6198 0.8114 0.7328 0.0589  0.0421  -0.1390 63  LYS B NZ  
1751 N N   . PRO B 71  ? 0.3565 0.3251 0.3879 -0.0142 0.0420  -0.0462 64  PRO B N   
1752 C CA  . PRO B 71  ? 0.3546 0.2817 0.3783 -0.0160 0.0401  -0.0383 64  PRO B CA  
1753 C C   . PRO B 71  ? 0.3560 0.2573 0.3851 -0.0021 0.0377  -0.0457 64  PRO B C   
1754 O O   . PRO B 71  ? 0.3733 0.2843 0.4128 0.0093  0.0369  -0.0591 64  PRO B O   
1755 C CB  . PRO B 71  ? 0.3573 0.2922 0.3731 -0.0246 0.0423  -0.0341 64  PRO B CB  
1756 C CG  . PRO B 71  ? 0.3814 0.3588 0.4015 -0.0211 0.0457  -0.0463 64  PRO B CG  
1757 C CD  . PRO B 71  ? 0.3849 0.3889 0.4140 -0.0187 0.0462  -0.0508 64  PRO B CD  
1758 N N   . PRO B 72  ? 0.3668 0.2366 0.3904 -0.0036 0.0359  -0.0373 65  PRO B N   
1759 C CA  . PRO B 72  ? 0.3677 0.2151 0.3965 0.0046  0.0337  -0.0400 65  PRO B CA  
1760 C C   . PRO B 72  ? 0.3786 0.2270 0.4081 0.0042  0.0351  -0.0485 65  PRO B C   
1761 O O   . PRO B 72  ? 0.3800 0.2431 0.4015 -0.0035 0.0378  -0.0471 65  PRO B O   
1762 C CB  . PRO B 72  ? 0.3990 0.2251 0.4200 0.0001  0.0330  -0.0282 65  PRO B CB  
1763 C CG  . PRO B 72  ? 0.3941 0.2249 0.4058 -0.0098 0.0345  -0.0235 65  PRO B CG  
1764 C CD  . PRO B 72  ? 0.3625 0.2191 0.3763 -0.0140 0.0357  -0.0263 65  PRO B CD  
1765 N N   . LYS B 73  ? 0.3857 0.2199 0.4264 0.0120  0.0318  -0.0566 66  LYS B N   
1766 C CA  . LYS B 73  ? 0.4155 0.2478 0.4590 0.0113  0.0314  -0.0668 66  LYS B CA  
1767 C C   . LYS B 73  ? 0.3822 0.1903 0.4210 0.0046  0.0310  -0.0549 66  LYS B C   
1768 O O   . LYS B 73  ? 0.3914 0.1786 0.4361 0.0059  0.0280  -0.0467 66  LYS B O   
1769 C CB  . LYS B 73  ? 0.4529 0.2788 0.5157 0.0228  0.0259  -0.0839 66  LYS B CB  
1770 C CG  . LYS B 73  ? 0.5531 0.3857 0.6219 0.0233  0.0245  -0.1028 66  LYS B CG  
1771 C CD  . LYS B 73  ? 0.6595 0.5353 0.7278 0.0284  0.0275  -0.1221 66  LYS B CD  
1772 C CE  . LYS B 73  ? 0.6325 0.5165 0.7196 0.0445  0.0231  -0.1402 66  LYS B CE  
1773 N NZ  . LYS B 73  ? 0.5137 0.4508 0.5962 0.0473  0.0286  -0.1516 66  LYS B NZ  
1774 N N   . ILE B 74  ? 0.3625 0.1779 0.3915 -0.0025 0.0336  -0.0526 67  ILE B N   
1775 C CA  . ILE B 74  ? 0.3701 0.1707 0.3951 -0.0078 0.0336  -0.0429 67  ILE B CA  
1776 C C   . ILE B 74  ? 0.3793 0.1863 0.4068 -0.0106 0.0328  -0.0519 67  ILE B C   
1777 O O   . ILE B 74  ? 0.3997 0.2288 0.4217 -0.0116 0.0339  -0.0582 67  ILE B O   
1778 C CB  . ILE B 74  ? 0.3693 0.1719 0.3819 -0.0121 0.0357  -0.0310 67  ILE B CB  
1779 C CG1 . ILE B 74  ? 0.3863 0.1862 0.3970 -0.0104 0.0357  -0.0253 67  ILE B CG1 
1780 C CG2 . ILE B 74  ? 0.3849 0.1785 0.3961 -0.0146 0.0355  -0.0249 67  ILE B CG2 
1781 C CD1 . ILE B 74  ? 0.3892 0.1870 0.3918 -0.0140 0.0356  -0.0177 67  ILE B CD1 
1782 N N   . ALA B 75  ? 0.3861 0.1780 0.4222 -0.0131 0.0304  -0.0513 68  ALA B N   
1783 C CA  . ALA B 75  ? 0.4017 0.2008 0.4424 -0.0170 0.0285  -0.0614 68  ALA B CA  
1784 C C   . ALA B 75  ? 0.3661 0.1590 0.4071 -0.0238 0.0287  -0.0507 68  ALA B C   
1785 O O   . ALA B 75  ? 0.3545 0.1343 0.3978 -0.0256 0.0291  -0.0386 68  ALA B O   
1786 C CB  . ALA B 75  ? 0.4022 0.1928 0.4609 -0.0141 0.0232  -0.0790 68  ALA B CB  
1787 N N   . PHE B 76  ? 0.3617 0.1703 0.4002 -0.0273 0.0284  -0.0550 69  PHE B N   
1788 C CA  . PHE B 76  ? 0.3665 0.1756 0.4102 -0.0339 0.0277  -0.0493 69  PHE B CA  
1789 C C   . PHE B 76  ? 0.4082 0.2053 0.4704 -0.0409 0.0231  -0.0569 69  PHE B C   
1790 O O   . PHE B 76  ? 0.4337 0.2315 0.5043 -0.0401 0.0191  -0.0744 69  PHE B O   
1791 C CB  . PHE B 76  ? 0.3837 0.2161 0.4212 -0.0348 0.0273  -0.0522 69  PHE B CB  
1792 C CG  . PHE B 76  ? 0.3649 0.2035 0.3905 -0.0300 0.0294  -0.0395 69  PHE B CG  
1793 C CD1 . PHE B 76  ? 0.3524 0.1892 0.3677 -0.0252 0.0303  -0.0349 69  PHE B CD1 
1794 C CD2 . PHE B 76  ? 0.3712 0.2183 0.3984 -0.0302 0.0294  -0.0335 69  PHE B CD2 
1795 C CE1 . PHE B 76  ? 0.3475 0.1840 0.3560 -0.0211 0.0296  -0.0242 69  PHE B CE1 
1796 C CE2 . PHE B 76  ? 0.3758 0.2259 0.3960 -0.0231 0.0292  -0.0254 69  PHE B CE2 
1797 C CZ  . PHE B 76  ? 0.3317 0.1726 0.3433 -0.0187 0.0286  -0.0208 69  PHE B CZ  
1798 N N   . THR B 77  ? 0.4012 0.1897 0.4711 -0.0483 0.0229  -0.0440 70  THR B N   
1799 C CA  . THR B 77  ? 0.4248 0.2025 0.5149 -0.0593 0.0173  -0.0467 70  THR B CA  
1800 C C   . THR B 77  ? 0.4318 0.2319 0.5249 -0.0687 0.0176  -0.0466 70  THR B C   
1801 O O   . THR B 77  ? 0.4069 0.2038 0.5178 -0.0799 0.0120  -0.0533 70  THR B O   
1802 C CB  . THR B 77  ? 0.4729 0.2299 0.5722 -0.0646 0.0157  -0.0281 70  THR B CB  
1803 O OG1 . THR B 77  ? 0.5038 0.2776 0.5905 -0.0656 0.0222  -0.0102 70  THR B OG1 
1804 C CG2 . THR B 77  ? 0.4885 0.2255 0.5879 -0.0539 0.0135  -0.0301 70  THR B CG2 
1805 N N   . THR B 78  ? 0.3864 0.2093 0.4647 -0.0638 0.0229  -0.0406 71  THR B N   
1806 C CA  . THR B 78  ? 0.3685 0.2181 0.4501 -0.0696 0.0229  -0.0414 71  THR B CA  
1807 C C   . THR B 78  ? 0.3822 0.2496 0.4578 -0.0643 0.0203  -0.0564 71  THR B C   
1808 O O   . THR B 78  ? 0.3729 0.2418 0.4339 -0.0537 0.0218  -0.0574 71  THR B O   
1809 C CB  . THR B 78  ? 0.3494 0.2175 0.4218 -0.0646 0.0284  -0.0281 71  THR B CB  
1810 O OG1 . THR B 78  ? 0.3380 0.1987 0.4133 -0.0696 0.0312  -0.0137 71  THR B OG1 
1811 C CG2 . THR B 78  ? 0.3451 0.2451 0.4244 -0.0693 0.0278  -0.0296 71  THR B CG2 
1812 N N   . LYS B 79  ? 0.3833 0.2673 0.4706 -0.0732 0.0159  -0.0668 72  LYS B N   
1813 C CA  . LYS B 79  ? 0.4030 0.3134 0.4841 -0.0691 0.0128  -0.0801 72  LYS B CA  
1814 C C   . LYS B 79  ? 0.3879 0.3200 0.4540 -0.0584 0.0151  -0.0683 72  LYS B C   
1815 O O   . LYS B 79  ? 0.3682 0.3077 0.4364 -0.0574 0.0175  -0.0571 72  LYS B O   
1816 C CB  . LYS B 79  ? 0.4469 0.3742 0.5453 -0.0820 0.0068  -0.0938 72  LYS B CB  
1817 C CG  . LYS B 79  ? 0.4660 0.4251 0.5595 -0.0793 0.0021  -0.1112 72  LYS B CG  
1818 C CD  . LYS B 79  ? 0.4888 0.4586 0.6035 -0.0938 -0.0052 -0.1306 72  LYS B CD  
1819 C CE  . LYS B 79  ? 0.5071 0.5183 0.6161 -0.0914 -0.0103 -0.1491 72  LYS B CE  
1820 N NZ  . LYS B 79  ? 0.5282 0.5426 0.6247 -0.0816 -0.0106 -0.1636 72  LYS B NZ  
1821 N N   . ILE B 80  ? 0.3542 0.2973 0.4068 -0.0502 0.0138  -0.0704 73  ILE B N   
1822 C CA  . ILE B 80  ? 0.3459 0.3025 0.3870 -0.0399 0.0132  -0.0570 73  ILE B CA  
1823 C C   . ILE B 80  ? 0.3554 0.3410 0.3874 -0.0375 0.0084  -0.0606 73  ILE B C   
1824 O O   . ILE B 80  ? 0.3827 0.3744 0.4114 -0.0407 0.0080  -0.0731 73  ILE B O   
1825 C CB  . ILE B 80  ? 0.3548 0.2848 0.3867 -0.0321 0.0170  -0.0443 73  ILE B CB  
1826 C CG1 . ILE B 80  ? 0.3536 0.2900 0.3790 -0.0213 0.0140  -0.0308 73  ILE B CG1 
1827 C CG2 . ILE B 80  ? 0.3537 0.2718 0.3781 -0.0326 0.0185  -0.0486 73  ILE B CG2 
1828 C CD1 . ILE B 80  ? 0.3693 0.2788 0.3902 -0.0149 0.0163  -0.0217 73  ILE B CD1 
1829 N N   . TYR B 81  ? 0.3483 0.3563 0.3774 -0.0313 0.0040  -0.0504 74  TYR B N   
1830 C CA  . TYR B 81  ? 0.3628 0.4041 0.3823 -0.0290 -0.0017 -0.0476 74  TYR B CA  
1831 C C   . TYR B 81  ? 0.3587 0.3879 0.3660 -0.0212 -0.0028 -0.0266 74  TYR B C   
1832 O O   . TYR B 81  ? 0.3643 0.3811 0.3742 -0.0124 -0.0057 -0.0118 74  TYR B O   
1833 C CB  . TYR B 81  ? 0.3715 0.4451 0.3979 -0.0265 -0.0079 -0.0459 74  TYR B CB  
1834 C CG  . TYR B 81  ? 0.3762 0.4922 0.3936 -0.0251 -0.0152 -0.0427 74  TYR B CG  
1835 C CD1 . TYR B 81  ? 0.3874 0.5108 0.3966 -0.0150 -0.0213 -0.0187 74  TYR B CD1 
1836 C CD2 . TYR B 81  ? 0.3734 0.5237 0.3919 -0.0339 -0.0175 -0.0634 74  TYR B CD2 
1837 C CE1 . TYR B 81  ? 0.3954 0.5621 0.3955 -0.0145 -0.0289 -0.0112 74  TYR B CE1 
1838 C CE2 . TYR B 81  ? 0.3857 0.5834 0.3942 -0.0326 -0.0243 -0.0605 74  TYR B CE2 
1839 C CZ  . TYR B 81  ? 0.3940 0.6011 0.3923 -0.0232 -0.0297 -0.0322 74  TYR B CZ  
1840 O OH  . TYR B 81  ? 0.4051 0.6625 0.3927 -0.0225 -0.0374 -0.0242 74  TYR B OH  
1841 N N   . HIS B 82  ? 0.3486 0.3826 0.3448 -0.0246 -0.0011 -0.0267 75  HIS B N   
1842 C CA  . HIS B 82  ? 0.3619 0.3808 0.3487 -0.0217 -0.0014 -0.0064 75  HIS B CA  
1843 C C   . HIS B 82  ? 0.3682 0.4152 0.3427 -0.0278 -0.0001 -0.0078 75  HIS B C   
1844 O O   . HIS B 82  ? 0.3641 0.4205 0.3399 -0.0318 0.0043  -0.0302 75  HIS B O   
1845 C CB  . HIS B 82  ? 0.3575 0.3326 0.3490 -0.0202 0.0042  -0.0070 75  HIS B CB  
1846 C CG  . HIS B 82  ? 0.3713 0.3246 0.3589 -0.0167 0.0018  0.0134  75  HIS B CG  
1847 N ND1 . HIS B 82  ? 0.3883 0.3455 0.3668 -0.0222 0.0026  0.0227  75  HIS B ND1 
1848 C CD2 . HIS B 82  ? 0.3840 0.3128 0.3778 -0.0087 -0.0024 0.0247  75  HIS B CD2 
1849 C CE1 . HIS B 82  ? 0.3953 0.3278 0.3752 -0.0200 -0.0015 0.0410  75  HIS B CE1 
1850 N NE2 . HIS B 82  ? 0.3965 0.3090 0.3861 -0.0107 -0.0050 0.0406  75  HIS B NE2 
1851 N N   . PRO B 83  ? 0.3818 0.4439 0.3462 -0.0286 -0.0045 0.0162  76  PRO B N   
1852 C CA  . PRO B 83  ? 0.3794 0.4810 0.3313 -0.0357 -0.0026 0.0164  76  PRO B CA  
1853 C C   . PRO B 83  ? 0.3738 0.4617 0.3247 -0.0391 0.0053  0.0071  76  PRO B C   
1854 O O   . PRO B 83  ? 0.3804 0.5071 0.3242 -0.0432 0.0087  -0.0044 76  PRO B O   
1855 C CB  . PRO B 83  ? 0.3977 0.5152 0.3414 -0.0376 -0.0107 0.0518  76  PRO B CB  
1856 C CG  . PRO B 83  ? 0.4105 0.4767 0.3648 -0.0307 -0.0154 0.0679  76  PRO B CG  
1857 C CD  . PRO B 83  ? 0.3914 0.4366 0.3575 -0.0234 -0.0126 0.0449  76  PRO B CD  
1858 N N   . ASN B 84  ? 0.3674 0.4063 0.3256 -0.0365 0.0079  0.0107  77  ASN B N   
1859 C CA  . ASN B 84  ? 0.3724 0.3962 0.3312 -0.0388 0.0144  0.0048  77  ASN B CA  
1860 C C   . ASN B 84  ? 0.3661 0.3642 0.3353 -0.0347 0.0194  -0.0202 77  ASN B C   
1861 O O   . ASN B 84  ? 0.3572 0.3382 0.3289 -0.0345 0.0237  -0.0243 77  ASN B O   
1862 C CB  . ASN B 84  ? 0.3681 0.3580 0.3279 -0.0400 0.0123  0.0283  77  ASN B CB  
1863 C CG  . ASN B 84  ? 0.3866 0.3910 0.3407 -0.0448 0.0045  0.0583  77  ASN B CG  
1864 O OD1 . ASN B 84  ? 0.3958 0.3722 0.3560 -0.0405 -0.0027 0.0740  77  ASN B OD1 
1865 N ND2 . ASN B 84  ? 0.4110 0.4621 0.3547 -0.0532 0.0050  0.0666  77  ASN B ND2 
1866 N N   . ILE B 85  ? 0.3786 0.3743 0.3554 -0.0325 0.0178  -0.0346 78  ILE B N   
1867 C CA  . ILE B 85  ? 0.3666 0.3365 0.3559 -0.0310 0.0206  -0.0538 78  ILE B CA  
1868 C C   . ILE B 85  ? 0.3659 0.3569 0.3627 -0.0330 0.0180  -0.0770 78  ILE B C   
1869 O O   . ILE B 85  ? 0.3946 0.3983 0.3932 -0.0345 0.0141  -0.0755 78  ILE B O   
1870 C CB  . ILE B 85  ? 0.3705 0.3049 0.3668 -0.0289 0.0206  -0.0441 78  ILE B CB  
1871 C CG1 . ILE B 85  ? 0.3907 0.3051 0.3815 -0.0262 0.0210  -0.0241 78  ILE B CG1 
1872 C CG2 . ILE B 85  ? 0.3671 0.2764 0.3754 -0.0298 0.0232  -0.0572 78  ILE B CG2 
1873 C CD1 . ILE B 85  ? 0.3857 0.2777 0.3823 -0.0220 0.0201  -0.0175 78  ILE B CD1 
1874 N N   . ASN B 86  ? 0.3662 0.3604 0.3705 -0.0323 0.0189  -0.1005 79  ASN B N   
1875 C CA  . ASN B 86  ? 0.3920 0.4075 0.4057 -0.0343 0.0146  -0.1274 79  ASN B CA  
1876 C C   . ASN B 86  ? 0.4109 0.3899 0.4452 -0.0374 0.0119  -0.1392 79  ASN B C   
1877 O O   . ASN B 86  ? 0.4047 0.3467 0.4436 -0.0378 0.0142  -0.1241 79  ASN B O   
1878 C CB  . ASN B 86  ? 0.3841 0.4349 0.3958 -0.0306 0.0150  -0.1512 79  ASN B CB  
1879 C CG  . ASN B 86  ? 0.3821 0.4071 0.4046 -0.0245 0.0171  -0.1635 79  ASN B CG  
1880 O OD1 . ASN B 86  ? 0.3660 0.3445 0.3999 -0.0240 0.0171  -0.1574 79  ASN B OD1 
1881 N ND2 . ASN B 86  ? 0.3894 0.4505 0.4088 -0.0193 0.0187  -0.1810 79  ASN B ND2 
1882 N N   . SER B 87  ? 0.4367 0.4289 0.4843 -0.0406 0.0063  -0.1662 80  SER B N   
1883 C CA  . SER B 87  ? 0.5158 0.4755 0.5864 -0.0474 0.0014  -0.1759 80  SER B CA  
1884 C C   . SER B 87  ? 0.5470 0.4635 0.6328 -0.0443 0.0007  -0.1802 80  SER B C   
1885 O O   . SER B 87  ? 0.5570 0.4398 0.6608 -0.0516 -0.0028 -0.1763 80  SER B O   
1886 C CB  . SER B 87  ? 0.5158 0.5010 0.5991 -0.0528 -0.0063 -0.2061 80  SER B CB  
1887 O OG  . SER B 87  ? 0.5238 0.5372 0.6060 -0.0452 -0.0082 -0.2348 80  SER B OG  
1888 N N   . ASN B 88  ? 0.5070 0.4277 0.5870 -0.0342 0.0034  -0.1866 81  ASN B N   
1889 C CA  . ASN B 88  ? 0.5666 0.4487 0.6592 -0.0286 0.0026  -0.1858 81  ASN B CA  
1890 C C   . ASN B 88  ? 0.5052 0.3658 0.5857 -0.0286 0.0092  -0.1528 81  ASN B C   
1891 O O   . ASN B 88  ? 0.5555 0.3860 0.6446 -0.0250 0.0085  -0.1464 81  ASN B O   
1892 C CB  . ASN B 88  ? 0.5842 0.4855 0.6789 -0.0162 0.0022  -0.2103 81  ASN B CB  
1893 C CG  . ASN B 88  ? 0.6480 0.5660 0.7605 -0.0137 -0.0061 -0.2502 81  ASN B CG  
1894 O OD1 . ASN B 88  ? 0.6307 0.5281 0.7619 -0.0217 -0.0140 -0.2604 81  ASN B OD1 
1895 N ND2 . ASN B 88  ? 0.6907 0.6503 0.7983 -0.0032 -0.0048 -0.2744 81  ASN B ND2 
1896 N N   . GLY B 89  ? 0.4645 0.3418 0.5264 -0.0316 0.0143  -0.1329 82  GLY B N   
1897 C CA  . GLY B 89  ? 0.4408 0.3009 0.4925 -0.0306 0.0194  -0.1069 82  GLY B CA  
1898 C C   . GLY B 89  ? 0.4117 0.2819 0.4502 -0.0241 0.0237  -0.1013 82  GLY B C   
1899 O O   . GLY B 89  ? 0.3936 0.2484 0.4256 -0.0230 0.0268  -0.0834 82  GLY B O   
1900 N N   . SER B 90  ? 0.4183 0.3191 0.4534 -0.0205 0.0236  -0.1171 83  SER B N   
1901 C CA  . SER B 90  ? 0.4351 0.3536 0.4588 -0.0170 0.0279  -0.1108 83  SER B CA  
1902 C C   . SER B 90  ? 0.3899 0.3193 0.3969 -0.0222 0.0301  -0.0864 83  SER B C   
1903 O O   . SER B 90  ? 0.3703 0.3144 0.3722 -0.0257 0.0279  -0.0822 83  SER B O   
1904 C CB  . SER B 90  ? 0.4986 0.4577 0.5231 -0.0126 0.0277  -0.1345 83  SER B CB  
1905 O OG  . SER B 90  ? 0.5777 0.5225 0.6222 -0.0052 0.0234  -0.1606 83  SER B OG  
1906 N N   . ILE B 91  ? 0.3860 0.3060 0.3870 -0.0222 0.0328  -0.0705 84  ILE B N   
1907 C CA  . ILE B 91  ? 0.3892 0.3077 0.3793 -0.0268 0.0325  -0.0467 84  ILE B CA  
1908 C C   . ILE B 91  ? 0.3663 0.3167 0.3474 -0.0311 0.0340  -0.0387 84  ILE B C   
1909 O O   . ILE B 91  ? 0.3905 0.3444 0.3734 -0.0306 0.0368  -0.0414 84  ILE B O   
1910 C CB  . ILE B 91  ? 0.3754 0.2584 0.3674 -0.0256 0.0330  -0.0344 84  ILE B CB  
1911 C CG1 . ILE B 91  ? 0.4274 0.2861 0.4278 -0.0231 0.0324  -0.0391 84  ILE B CG1 
1912 C CG2 . ILE B 91  ? 0.4131 0.2920 0.3982 -0.0289 0.0302  -0.0141 84  ILE B CG2 
1913 C CD1 . ILE B 91  ? 0.3778 0.2111 0.3794 -0.0212 0.0334  -0.0305 84  ILE B CD1 
1914 N N   . CYS B 92  ? 0.3773 0.3544 0.3494 -0.0362 0.0316  -0.0269 85  CYS B N   
1915 C CA  . CYS B 92  ? 0.4057 0.4195 0.3690 -0.0437 0.0324  -0.0137 85  CYS B CA  
1916 C C   . CYS B 92  ? 0.4241 0.4134 0.3857 -0.0503 0.0291  0.0143  85  CYS B C   
1917 O O   . CYS B 92  ? 0.4096 0.3914 0.3687 -0.0527 0.0232  0.0328  85  CYS B O   
1918 C CB  . CYS B 92  ? 0.4700 0.5273 0.4245 -0.0470 0.0298  -0.0113 85  CYS B CB  
1919 S SG  . CYS B 92  ? 0.5222 0.6475 0.4657 -0.0560 0.0328  -0.0047 85  CYS B SG  
1920 N N   . LEU B 93  ? 0.4002 0.3767 0.3657 -0.0525 0.0317  0.0157  86  LEU B N   
1921 C CA  . LEU B 93  ? 0.3878 0.3348 0.3559 -0.0587 0.0277  0.0363  86  LEU B CA  
1922 C C   . LEU B 93  ? 0.3782 0.3452 0.3473 -0.0675 0.0309  0.0405  86  LEU B C   
1923 O O   . LEU B 93  ? 0.3732 0.3476 0.3461 -0.0619 0.0362  0.0221  86  LEU B O   
1924 C CB  . LEU B 93  ? 0.3741 0.2742 0.3494 -0.0498 0.0266  0.0280  86  LEU B CB  
1925 C CG  . LEU B 93  ? 0.3890 0.2561 0.3694 -0.0529 0.0216  0.0402  86  LEU B CG  
1926 C CD1 . LEU B 93  ? 0.4151 0.2747 0.3963 -0.0583 0.0127  0.0626  86  LEU B CD1 
1927 C CD2 . LEU B 93  ? 0.4231 0.2583 0.4085 -0.0426 0.0219  0.0277  86  LEU B CD2 
1928 N N   . ASP B 94  ? 0.3753 0.3520 0.3432 -0.0816 0.0267  0.0659  87  ASP B N   
1929 C CA  . ASP B 94  ? 0.3831 0.3897 0.3526 -0.0933 0.0300  0.0719  87  ASP B CA  
1930 C C   . ASP B 94  ? 0.3681 0.3503 0.3465 -0.0900 0.0319  0.0597  87  ASP B C   
1931 O O   . ASP B 94  ? 0.3663 0.3811 0.3468 -0.0915 0.0374  0.0506  87  ASP B O   
1932 C CB  . ASP B 94  ? 0.4112 0.4304 0.3804 -0.1129 0.0236  0.1063  87  ASP B CB  
1933 C CG  . ASP B 94  ? 0.4628 0.4234 0.4417 -0.1167 0.0128  0.1232  87  ASP B CG  
1934 O OD1 . ASP B 94  ? 0.4890 0.4055 0.4722 -0.1029 0.0109  0.1079  87  ASP B OD1 
1935 O OD2 . ASP B 94  ? 0.6094 0.5705 0.5931 -0.1340 0.0053  0.1520  87  ASP B OD2 
1936 N N   . ILE B 95  ? 0.3567 0.2883 0.3404 -0.0843 0.0273  0.0578  88  ILE B N   
1937 C CA  . ILE B 95  ? 0.3658 0.2796 0.3566 -0.0814 0.0283  0.0469  88  ILE B CA  
1938 C C   . ILE B 95  ? 0.3426 0.2597 0.3337 -0.0657 0.0345  0.0226  88  ILE B C   
1939 O O   . ILE B 95  ? 0.3831 0.2931 0.3794 -0.0618 0.0354  0.0142  88  ILE B O   
1940 C CB  . ILE B 95  ? 0.3798 0.2462 0.3767 -0.0814 0.0207  0.0514  88  ILE B CB  
1941 C CG1 . ILE B 95  ? 0.4080 0.2467 0.4026 -0.0678 0.0191  0.0439  88  ILE B CG1 
1942 C CG2 . ILE B 95  ? 0.4108 0.2686 0.4133 -0.0979 0.0119  0.0753  88  ILE B CG2 
1943 C CD1 . ILE B 95  ? 0.4284 0.2294 0.4294 -0.0631 0.0132  0.0395  88  ILE B CD1 
1944 N N   . LEU B 96  ? 0.3530 0.2803 0.3403 -0.0571 0.0373  0.0121  89  LEU B N   
1945 C CA  . LEU B 96  ? 0.3608 0.2945 0.3526 -0.0441 0.0413  -0.0099 89  LEU B CA  
1946 C C   . LEU B 96  ? 0.3604 0.3434 0.3535 -0.0434 0.0456  -0.0210 89  LEU B C   
1947 O O   . LEU B 96  ? 0.3858 0.3750 0.3861 -0.0311 0.0471  -0.0416 89  LEU B O   
1948 C CB  . LEU B 96  ? 0.3872 0.3005 0.3789 -0.0351 0.0404  -0.0192 89  LEU B CB  
1949 C CG  . LEU B 96  ? 0.3703 0.2427 0.3626 -0.0324 0.0375  -0.0137 89  LEU B CG  
1950 C CD1 . LEU B 96  ? 0.3748 0.2363 0.3674 -0.0274 0.0368  -0.0197 89  LEU B CD1 
1951 C CD2 . LEU B 96  ? 0.3715 0.2275 0.3692 -0.0274 0.0377  -0.0179 89  LEU B CD2 
1952 N N   . ARG B 97  ? 0.3840 0.4036 0.3720 -0.0565 0.0467  -0.0071 90  ARG B N   
1953 C CA  . ARG B 97  ? 0.4151 0.4951 0.4034 -0.0576 0.0516  -0.0166 90  ARG B CA  
1954 C C   . ARG B 97  ? 0.4311 0.5336 0.4225 -0.0715 0.0526  -0.0014 90  ARG B C   
1955 O O   . ARG B 97  ? 0.4447 0.5204 0.4432 -0.0704 0.0508  -0.0011 90  ARG B O   
1956 C CB  . ARG B 97  ? 0.3954 0.5145 0.3733 -0.0640 0.0525  -0.0109 90  ARG B CB  
1957 C CG  . ARG B 97  ? 0.4190 0.5154 0.3930 -0.0563 0.0497  -0.0183 90  ARG B CG  
1958 C CD  . ARG B 97  ? 0.4148 0.5637 0.3783 -0.0621 0.0505  -0.0152 90  ARG B CD  
1959 N NE  . ARG B 97  ? 0.4162 0.5787 0.3710 -0.0803 0.0475  0.0205  90  ARG B NE  
1960 C CZ  . ARG B 97  ? 0.4028 0.5485 0.3511 -0.0851 0.0415  0.0406  90  ARG B CZ  
1961 N NH1 . ARG B 97  ? 0.4123 0.5329 0.3606 -0.0741 0.0390  0.0276  90  ARG B NH1 
1962 N NH2 . ARG B 97  ? 0.4153 0.5706 0.3592 -0.1015 0.0369  0.0752  90  ARG B NH2 
1963 N N   . SER B 98  ? 0.4122 0.5668 0.3983 -0.0862 0.0549  0.0128  91  SER B N   
1964 C CA  . SER B 98  ? 0.4272 0.6155 0.4180 -0.1026 0.0563  0.0277  91  SER B CA  
1965 C C   . SER B 98  ? 0.4273 0.5693 0.4221 -0.1180 0.0492  0.0526  91  SER B C   
1966 O O   . SER B 98  ? 0.3850 0.5425 0.3878 -0.1301 0.0490  0.0602  91  SER B O   
1967 C CB  . SER B 98  ? 0.4538 0.7131 0.4371 -0.1182 0.0599  0.0427  91  SER B CB  
1968 O OG  . SER B 98  ? 0.4882 0.7324 0.4661 -0.1391 0.0536  0.0795  91  SER B OG  
1969 N N   . GLN B 99  ? 0.4003 0.4890 0.3916 -0.1178 0.0426  0.0636  92  GLN B N   
1970 C CA  . GLN B 99  ? 0.4193 0.4644 0.4174 -0.1308 0.0341  0.0832  92  GLN B CA  
1971 C C   . GLN B 99  ? 0.4018 0.3994 0.4061 -0.1179 0.0320  0.0656  92  GLN B C   
1972 O O   . GLN B 99  ? 0.4135 0.3721 0.4243 -0.1249 0.0243  0.0744  92  GLN B O   
1973 C CB  . GLN B 99  ? 0.4569 0.4742 0.4512 -0.1376 0.0261  0.1062  92  GLN B CB  
1974 C CG  . GLN B 99  ? 0.5128 0.5813 0.5004 -0.1534 0.0266  0.1301  92  GLN B CG  
1975 C CD  . GLN B 99  ? 0.5402 0.6444 0.5352 -0.1775 0.0262  0.1507  92  GLN B CD  
1976 O OE1 . GLN B 99  ? 0.5917 0.6632 0.5972 -0.1943 0.0164  0.1740  92  GLN B OE1 
1977 N NE2 . GLN B 99  ? 0.5114 0.6839 0.5033 -0.1794 0.0362  0.1408  92  GLN B NE2 
1978 N N   . TRP B 100 ? 0.3571 0.3596 0.3607 -0.0994 0.0377  0.0410  93  TRP B N   
1979 C CA  . TRP B 100 ? 0.3563 0.3285 0.3656 -0.0893 0.0361  0.0276  93  TRP B CA  
1980 C C   . TRP B 100 ? 0.3745 0.3562 0.3928 -0.1029 0.0333  0.0339  93  TRP B C   
1981 O O   . TRP B 100 ? 0.4014 0.4276 0.4234 -0.1150 0.0361  0.0404  93  TRP B O   
1982 C CB  . TRP B 100 ? 0.3413 0.3259 0.3522 -0.0700 0.0413  0.0049  93  TRP B CB  
1983 C CG  . TRP B 100 ? 0.3282 0.2911 0.3449 -0.0615 0.0390  -0.0037 93  TRP B CG  
1984 C CD1 . TRP B 100 ? 0.3379 0.3255 0.3628 -0.0590 0.0397  -0.0108 93  TRP B CD1 
1985 C CD2 . TRP B 100 ? 0.3290 0.2489 0.3436 -0.0551 0.0351  -0.0049 93  TRP B CD2 
1986 N NE1 . TRP B 100 ? 0.3190 0.2807 0.3458 -0.0516 0.0361  -0.0150 93  TRP B NE1 
1987 C CE2 . TRP B 100 ? 0.3221 0.2440 0.3421 -0.0494 0.0337  -0.0118 93  TRP B CE2 
1988 C CE3 . TRP B 100 ? 0.3266 0.2126 0.3354 -0.0529 0.0328  -0.0014 93  TRP B CE3 
1989 C CZ2 . TRP B 100 ? 0.3239 0.2180 0.3421 -0.0429 0.0303  -0.0142 93  TRP B CZ2 
1990 C CZ3 . TRP B 100 ? 0.3515 0.2106 0.3597 -0.0459 0.0302  -0.0057 93  TRP B CZ3 
1991 C CH2 . TRP B 100 ? 0.3280 0.1925 0.3400 -0.0415 0.0291  -0.0116 93  TRP B CH2 
1992 N N   . SER B 101 ? 0.3643 0.3086 0.3866 -0.1017 0.0276  0.0309  94  SER B N   
1993 C CA  . SER B 101 ? 0.3728 0.3238 0.4049 -0.1128 0.0238  0.0315  94  SER B CA  
1994 C C   . SER B 101 ? 0.3537 0.2819 0.3861 -0.0978 0.0220  0.0148  94  SER B C   
1995 O O   . SER B 101 ? 0.3457 0.2407 0.3726 -0.0872 0.0204  0.0103  94  SER B O   
1996 C CB  . SER B 101 ? 0.4035 0.3295 0.4425 -0.1333 0.0144  0.0493  94  SER B CB  
1997 O OG  . SER B 101 ? 0.4049 0.3197 0.4543 -0.1406 0.0079  0.0435  94  SER B OG  
1998 N N   . PRO B 102 ? 0.3614 0.3128 0.4006 -0.0975 0.0220  0.0070  95  PRO B N   
1999 C CA  . PRO B 102 ? 0.3609 0.2967 0.3996 -0.0852 0.0190  -0.0055 95  PRO B CA  
2000 C C   . PRO B 102 ? 0.3800 0.2806 0.4199 -0.0915 0.0109  -0.0070 95  PRO B C   
2001 O O   . PRO B 102 ? 0.3674 0.2557 0.4035 -0.0802 0.0090  -0.0174 95  PRO B O   
2002 C CB  . PRO B 102 ? 0.3662 0.3415 0.4139 -0.0872 0.0192  -0.0105 95  PRO B CB  
2003 C CG  . PRO B 102 ? 0.3778 0.3818 0.4330 -0.1078 0.0199  0.0004  95  PRO B CG  
2004 C CD  . PRO B 102 ? 0.3706 0.3688 0.4187 -0.1101 0.0239  0.0108  95  PRO B CD  
2005 N N   . ALA B 103 ? 0.4005 0.2873 0.4472 -0.1095 0.0051  0.0029  96  ALA B N   
2006 C CA  . ALA B 103 ? 0.4341 0.2812 0.4847 -0.1122 -0.0040 -0.0013 96  ALA B CA  
2007 C C   . ALA B 103 ? 0.4553 0.2735 0.4965 -0.0962 -0.0027 -0.0050 96  ALA B C   
2008 O O   . ALA B 103 ? 0.4418 0.2346 0.4854 -0.0913 -0.0092 -0.0158 96  ALA B O   
2009 C CB  . ALA B 103 ? 0.4722 0.3057 0.5359 -0.1348 -0.0126 0.0133  96  ALA B CB  
2010 N N   . LEU B 104 ? 0.4383 0.2641 0.4703 -0.0878 0.0050  0.0012  97  LEU B N   
2011 C CA  . LEU B 104 ? 0.4472 0.2515 0.4715 -0.0737 0.0067  -0.0020 97  LEU B CA  
2012 C C   . LEU B 104 ? 0.4499 0.2610 0.4670 -0.0580 0.0114  -0.0138 97  LEU B C   
2013 O O   . LEU B 104 ? 0.4308 0.2640 0.4477 -0.0551 0.0145  -0.0169 97  LEU B O   
2014 C CB  . LEU B 104 ? 0.4304 0.2405 0.4493 -0.0734 0.0115  0.0093  97  LEU B CB  
2015 C CG  . LEU B 104 ? 0.5106 0.3185 0.5344 -0.0891 0.0068  0.0272  97  LEU B CG  
2016 C CD1 . LEU B 104 ? 0.5172 0.3448 0.5331 -0.0876 0.0127  0.0362  97  LEU B CD1 
2017 C CD2 . LEU B 104 ? 0.5742 0.3433 0.6053 -0.0900 -0.0036 0.0294  97  LEU B CD2 
2018 N N   . THR B 105 ? 0.4499 0.2438 0.4625 -0.0481 0.0113  -0.0185 98  THR B N   
2019 C CA  . THR B 105 ? 0.4199 0.2205 0.4257 -0.0355 0.0154  -0.0249 98  THR B CA  
2020 C C   . THR B 105 ? 0.4137 0.2067 0.4149 -0.0288 0.0197  -0.0208 98  THR B C   
2021 O O   . THR B 105 ? 0.3894 0.1708 0.3920 -0.0319 0.0184  -0.0160 98  THR B O   
2022 C CB  . THR B 105 ? 0.4264 0.2234 0.4318 -0.0311 0.0108  -0.0371 98  THR B CB  
2023 O OG1 . THR B 105 ? 0.4143 0.1904 0.4233 -0.0297 0.0065  -0.0411 98  THR B OG1 
2024 C CG2 . THR B 105 ? 0.4439 0.2501 0.4551 -0.0383 0.0052  -0.0444 98  THR B CG2 
2025 N N   . VAL B 106 ? 0.3871 0.1874 0.3843 -0.0207 0.0238  -0.0209 99  VAL B N   
2026 C CA  . VAL B 106 ? 0.3734 0.1677 0.3682 -0.0159 0.0271  -0.0182 99  VAL B CA  
2027 C C   . VAL B 106 ? 0.3851 0.1696 0.3794 -0.0138 0.0247  -0.0225 99  VAL B C   
2028 O O   . VAL B 106 ? 0.3784 0.1562 0.3735 -0.0133 0.0252  -0.0196 99  VAL B O   
2029 C CB  . VAL B 106 ? 0.4030 0.2049 0.3964 -0.0103 0.0297  -0.0151 99  VAL B CB  
2030 C CG1 . VAL B 106 ? 0.3877 0.1850 0.3805 -0.0085 0.0322  -0.0122 99  VAL B CG1 
2031 C CG2 . VAL B 106 ? 0.4193 0.2260 0.4176 -0.0091 0.0304  -0.0123 99  VAL B CG2 
2032 N N   . SER B 107 ? 0.4021 0.1891 0.3965 -0.0114 0.0212  -0.0314 100 SER B N   
2033 C CA  . SER B 107 ? 0.4511 0.2305 0.4487 -0.0064 0.0173  -0.0403 100 SER B CA  
2034 C C   . SER B 107 ? 0.4159 0.1740 0.4203 -0.0102 0.0121  -0.0358 100 SER B C   
2035 O O   . SER B 107 ? 0.3834 0.1358 0.3898 -0.0051 0.0113  -0.0348 100 SER B O   
2036 C CB  . SER B 107 ? 0.4501 0.2361 0.4495 -0.0036 0.0123  -0.0554 100 SER B CB  
2037 O OG  . SER B 107 ? 0.5067 0.2848 0.5125 0.0038  0.0072  -0.0680 100 SER B OG  
2038 N N   . LYS B 108 ? 0.4288 0.1791 0.4372 -0.0199 0.0083  -0.0309 101 LYS B N   
2039 C CA  . LYS B 108 ? 0.4440 0.1774 0.4590 -0.0269 0.0025  -0.0201 101 LYS B CA  
2040 C C   . LYS B 108 ? 0.4042 0.1455 0.4137 -0.0281 0.0077  -0.0076 101 LYS B C   
2041 O O   . LYS B 108 ? 0.3824 0.1140 0.3951 -0.0277 0.0034  0.0000  101 LYS B O   
2042 C CB  . LYS B 108 ? 0.4817 0.2116 0.5029 -0.0406 -0.0022 -0.0145 101 LYS B CB  
2043 C CG  . LYS B 108 ? 0.5246 0.2412 0.5558 -0.0418 -0.0112 -0.0282 101 LYS B CG  
2044 C CD  . LYS B 108 ? 0.5844 0.3080 0.6207 -0.0571 -0.0136 -0.0237 101 LYS B CD  
2045 C CE  . LYS B 108 ? 0.6971 0.4042 0.7470 -0.0610 -0.0250 -0.0384 101 LYS B CE  
2046 N NZ  . LYS B 108 ? 0.8186 0.5345 0.8758 -0.0791 -0.0281 -0.0324 101 LYS B NZ  
2047 N N   . VAL B 109 ? 0.3824 0.1419 0.3851 -0.0283 0.0157  -0.0067 102 VAL B N   
2048 C CA  . VAL B 109 ? 0.3563 0.1257 0.3552 -0.0285 0.0198  -0.0004 102 VAL B CA  
2049 C C   . VAL B 109 ? 0.3481 0.1132 0.3466 -0.0203 0.0201  -0.0033 102 VAL B C   
2050 O O   . VAL B 109 ? 0.3337 0.1004 0.3321 -0.0207 0.0184  0.0028  102 VAL B O   
2051 C CB  . VAL B 109 ? 0.3668 0.1538 0.3628 -0.0283 0.0264  -0.0033 102 VAL B CB  
2052 C CG1 . VAL B 109 ? 0.3962 0.1941 0.3902 -0.0277 0.0292  -0.0022 102 VAL B CG1 
2053 C CG2 . VAL B 109 ? 0.3966 0.1961 0.3946 -0.0359 0.0263  -0.0008 102 VAL B CG2 
2054 N N   . LEU B 110 ? 0.3279 0.0934 0.3261 -0.0134 0.0221  -0.0118 103 LEU B N   
2055 C CA  . LEU B 110 ? 0.3523 0.1208 0.3516 -0.0065 0.0227  -0.0150 103 LEU B CA  
2056 C C   . LEU B 110 ? 0.3550 0.1130 0.3603 -0.0017 0.0156  -0.0152 103 LEU B C   
2057 O O   . LEU B 110 ? 0.3757 0.1387 0.3825 0.0015  0.0151  -0.0125 103 LEU B O   
2058 C CB  . LEU B 110 ? 0.3693 0.1480 0.3673 -0.0016 0.0260  -0.0223 103 LEU B CB  
2059 C CG  . LEU B 110 ? 0.3653 0.1532 0.3603 -0.0051 0.0316  -0.0178 103 LEU B CG  
2060 C CD1 . LEU B 110 ? 0.3881 0.1903 0.3807 -0.0023 0.0335  -0.0198 103 LEU B CD1 
2061 C CD2 . LEU B 110 ? 0.4145 0.2054 0.4116 -0.0073 0.0341  -0.0139 103 LEU B CD2 
2062 N N   . LEU B 111 ? 0.3647 0.1074 0.3757 -0.0010 0.0085  -0.0187 104 LEU B N   
2063 C CA  . LEU B 111 ? 0.3807 0.1065 0.4017 0.0041  -0.0013 -0.0174 104 LEU B CA  
2064 C C   . LEU B 111 ? 0.3832 0.1047 0.4042 -0.0031 -0.0048 0.0010  104 LEU B C   
2065 O O   . LEU B 111 ? 0.3806 0.0982 0.4071 0.0032  -0.0107 0.0059  104 LEU B O   
2066 C CB  . LEU B 111 ? 0.4096 0.1151 0.4406 0.0049  -0.0104 -0.0264 104 LEU B CB  
2067 C CG  . LEU B 111 ? 0.4198 0.1372 0.4513 0.0152  -0.0084 -0.0482 104 LEU B CG  
2068 C CD1 . LEU B 111 ? 0.4829 0.1837 0.5238 0.0140  -0.0173 -0.0607 104 LEU B CD1 
2069 C CD2 . LEU B 111 ? 0.4190 0.1464 0.4559 0.0306  -0.0094 -0.0590 104 LEU B CD2 
2070 N N   . SER B 112 ? 0.3749 0.1031 0.3898 -0.0156 -0.0014 0.0112  105 SER B N   
2071 C CA  . SER B 112 ? 0.3947 0.1311 0.4069 -0.0236 -0.0034 0.0292  105 SER B CA  
2072 C C   . SER B 112 ? 0.3753 0.1324 0.3811 -0.0193 0.0017  0.0287  105 SER B C   
2073 O O   . SER B 112 ? 0.3761 0.1400 0.3817 -0.0204 -0.0028 0.0411  105 SER B O   
2074 C CB  . SER B 112 ? 0.4091 0.1591 0.4164 -0.0374 0.0003  0.0374  105 SER B CB  
2075 O OG  . SER B 112 ? 0.4952 0.2273 0.5104 -0.0439 -0.0056 0.0387  105 SER B OG  
2076 N N   . ILE B 113 ? 0.3593 0.1274 0.3609 -0.0155 0.0101  0.0157  106 ILE B N   
2077 C CA  . ILE B 113 ? 0.3519 0.1372 0.3510 -0.0126 0.0136  0.0127  106 ILE B CA  
2078 C C   . ILE B 113 ? 0.3633 0.1453 0.3690 -0.0029 0.0083  0.0118  106 ILE B C   
2079 O O   . ILE B 113 ? 0.3707 0.1661 0.3763 -0.0018 0.0059  0.0170  106 ILE B O   
2080 C CB  . ILE B 113 ? 0.3396 0.1327 0.3367 -0.0129 0.0218  0.0014  106 ILE B CB  
2081 C CG1 . ILE B 113 ? 0.3425 0.1419 0.3358 -0.0194 0.0254  0.0009  106 ILE B CG1 
2082 C CG2 . ILE B 113 ? 0.3555 0.1630 0.3541 -0.0115 0.0236  -0.0027 106 ILE B CG2 
2083 C CD1 . ILE B 113 ? 0.3513 0.1512 0.3463 -0.0183 0.0305  -0.0081 106 ILE B CD1 
2084 N N   . CYS B 114 ? 0.3872 0.1569 0.3992 0.0052  0.0062  0.0033  107 CYS B N   
2085 C CA  . CYS B 114 ? 0.4195 0.1887 0.4410 0.0176  0.0000  -0.0006 107 CYS B CA  
2086 C C   . CYS B 114 ? 0.4187 0.1755 0.4464 0.0196  -0.0114 0.0135  107 CYS B C   
2087 O O   . CYS B 114 ? 0.4133 0.1796 0.4464 0.0275  -0.0162 0.0165  107 CYS B O   
2088 C CB  . CYS B 114 ? 0.4550 0.2162 0.4835 0.0274  -0.0016 -0.0157 107 CYS B CB  
2089 S SG  . CYS B 114 ? 0.4879 0.2739 0.5101 0.0266  0.0103  -0.0278 107 CYS B SG  
2090 N N   . SER B 115 ? 0.4178 0.1562 0.4457 0.0112  -0.0164 0.0247  108 SER B N   
2091 C CA  . SER B 115 ? 0.4777 0.2028 0.5126 0.0096  -0.0288 0.0447  108 SER B CA  
2092 C C   . SER B 115 ? 0.4609 0.2131 0.4865 0.0031  -0.0276 0.0612  108 SER B C   
2093 O O   . SER B 115 ? 0.4619 0.2145 0.4933 0.0078  -0.0377 0.0758  108 SER B O   
2094 C CB  . SER B 115 ? 0.5116 0.2147 0.5496 -0.0023 -0.0337 0.0547  108 SER B CB  
2095 O OG  . SER B 115 ? 0.5635 0.2597 0.6061 -0.0095 -0.0447 0.0809  108 SER B OG  
2096 N N   . LEU B 116 ? 0.4441 0.2206 0.4565 -0.0061 -0.0163 0.0571  109 LEU B N   
2097 C CA  . LEU B 116 ? 0.4535 0.2635 0.4563 -0.0116 -0.0133 0.0638  109 LEU B CA  
2098 C C   . LEU B 116 ? 0.4227 0.2493 0.4281 -0.0017 -0.0137 0.0557  109 LEU B C   
2099 O O   . LEU B 116 ? 0.4195 0.2696 0.4218 -0.0024 -0.0180 0.0660  109 LEU B O   
2100 C CB  . LEU B 116 ? 0.4702 0.2984 0.4629 -0.0204 -0.0018 0.0528  109 LEU B CB  
2101 C CG  . LEU B 116 ? 0.5070 0.3719 0.4895 -0.0295 0.0010  0.0581  109 LEU B CG  
2102 C CD1 . LEU B 116 ? 0.5802 0.4522 0.5599 -0.0398 -0.0048 0.0828  109 LEU B CD1 
2103 C CD2 . LEU B 116 ? 0.5245 0.4010 0.5029 -0.0326 0.0111  0.0397  109 LEU B CD2 
2104 N N   . LEU B 117 ? 0.4110 0.2312 0.4219 0.0063  -0.0093 0.0380  110 LEU B N   
2105 C CA  . LEU B 117 ? 0.4062 0.2438 0.4231 0.0152  -0.0101 0.0303  110 LEU B CA  
2106 C C   . LEU B 117 ? 0.4390 0.2714 0.4666 0.0274  -0.0228 0.0409  110 LEU B C   
2107 O O   . LEU B 117 ? 0.4217 0.2779 0.4515 0.0318  -0.0268 0.0445  110 LEU B O   
2108 C CB  . LEU B 117 ? 0.4149 0.2506 0.4364 0.0195  -0.0027 0.0124  110 LEU B CB  
2109 C CG  . LEU B 117 ? 0.4405 0.2927 0.4574 0.0101  0.0072  0.0023  110 LEU B CG  
2110 C CD1 . LEU B 117 ? 0.4558 0.3098 0.4634 -0.0009 0.0106  0.0044  110 LEU B CD1 
2111 C CD2 . LEU B 117 ? 0.4550 0.3014 0.4748 0.0111  0.0137  -0.0077 110 LEU B CD2 
2112 N N   . CYS B 118 ? 0.4528 0.2538 0.4891 0.0335  -0.0306 0.0451  111 CYS B N   
2113 C CA  . CYS B 118 ? 0.4761 0.2639 0.5270 0.0465  -0.0458 0.0562  111 CYS B CA  
2114 C C   . CYS B 118 ? 0.4973 0.2894 0.5446 0.0392  -0.0554 0.0850  111 CYS B C   
2115 O O   . CYS B 118 ? 0.5123 0.3103 0.5687 0.0496  -0.0671 0.0970  111 CYS B O   
2116 C CB  . CYS B 118 ? 0.5033 0.2523 0.5682 0.0549  -0.0535 0.0493  111 CYS B CB  
2117 S SG  . CYS B 118 ? 0.5711 0.3259 0.6416 0.0674  -0.0448 0.0156  111 CYS B SG  
2118 N N   . ASP B 119 ? 0.5056 0.2995 0.5403 0.0217  -0.0509 0.0971  112 ASP B N   
2119 C CA  . ASP B 119 ? 0.5410 0.3436 0.5713 0.0114  -0.0595 0.1278  112 ASP B CA  
2120 C C   . ASP B 119 ? 0.5049 0.3424 0.5157 -0.0055 -0.0473 0.1284  112 ASP B C   
2121 O O   . ASP B 119 ? 0.4831 0.3133 0.4892 -0.0176 -0.0427 0.1314  112 ASP B O   
2122 C CB  . ASP B 119 ? 0.5901 0.3511 0.6329 0.0073  -0.0718 0.1464  112 ASP B CB  
2123 C CG  . ASP B 119 ? 0.6697 0.3970 0.7357 0.0262  -0.0885 0.1482  112 ASP B CG  
2124 O OD1 . ASP B 119 ? 0.7202 0.4556 0.7921 0.0327  -0.1008 0.1689  112 ASP B OD1 
2125 O OD2 . ASP B 119 ? 0.7234 0.4186 0.8027 0.0360  -0.0903 0.1276  112 ASP B OD2 
2126 N N   . PRO B 120 ? 0.5124 0.3908 0.5135 -0.0055 -0.0425 0.1223  113 PRO B N   
2127 C CA  . PRO B 120 ? 0.5039 0.4188 0.4890 -0.0187 -0.0323 0.1173  113 PRO B CA  
2128 C C   . PRO B 120 ? 0.5380 0.4706 0.5152 -0.0328 -0.0367 0.1458  113 PRO B C   
2129 O O   . PRO B 120 ? 0.5451 0.4668 0.5286 -0.0333 -0.0498 0.1749  113 PRO B O   
2130 C CB  . PRO B 120 ? 0.4867 0.4412 0.4674 -0.0145 -0.0311 0.1066  113 PRO B CB  
2131 C CG  . PRO B 120 ? 0.4888 0.4236 0.4831 0.0002  -0.0348 0.0963  113 PRO B CG  
2132 C CD  . PRO B 120 ? 0.4965 0.3906 0.5034 0.0075  -0.0455 0.1128  113 PRO B CD  
2133 N N   . ASN B 121 ? 0.5255 0.4869 0.4909 -0.0441 -0.0264 0.1378  114 ASN B N   
2134 C CA  . ASN B 121 ? 0.5893 0.5820 0.5455 -0.0595 -0.0276 0.1621  114 ASN B CA  
2135 C C   . ASN B 121 ? 0.5626 0.6222 0.5034 -0.0638 -0.0236 0.1580  114 ASN B C   
2136 O O   . ASN B 121 ? 0.5370 0.6267 0.4701 -0.0675 -0.0129 0.1360  114 ASN B O   
2137 C CB  . ASN B 121 ? 0.6241 0.6061 0.5804 -0.0686 -0.0192 0.1547  114 ASN B CB  
2138 C CG  . ASN B 121 ? 0.6771 0.6893 0.6275 -0.0869 -0.0213 0.1839  114 ASN B CG  
2139 O OD1 . ASN B 121 ? 0.7792 0.8197 0.7247 -0.0937 -0.0295 0.2130  114 ASN B OD1 
2140 N ND2 . ASN B 121 ? 0.7083 0.7188 0.6596 -0.0958 -0.0143 0.1785  114 ASN B ND2 
2141 N N   . PRO B 122 ? 0.6007 0.6862 0.5382 -0.0621 -0.0334 0.1782  115 PRO B N   
2142 C CA  . PRO B 122 ? 0.6071 0.7616 0.5297 -0.0653 -0.0305 0.1710  115 PRO B CA  
2143 C C   . PRO B 122 ? 0.6289 0.8390 0.5373 -0.0815 -0.0255 0.1834  115 PRO B C   
2144 O O   . PRO B 122 ? 0.6341 0.9069 0.5299 -0.0835 -0.0203 0.1672  115 PRO B O   
2145 C CB  . PRO B 122 ? 0.6514 0.8166 0.5756 -0.0597 -0.0447 0.1968  115 PRO B CB  
2146 C CG  . PRO B 122 ? 0.6872 0.8034 0.6235 -0.0618 -0.0562 0.2328  115 PRO B CG  
2147 C CD  . PRO B 122 ? 0.6490 0.7060 0.5969 -0.0582 -0.0493 0.2115  115 PRO B CD  
2148 N N   . ASP B 123 ? 0.6493 0.8402 0.5609 -0.0931 -0.0271 0.2095  116 ASP B N   
2149 C CA  . ASP B 123 ? 0.6993 0.9458 0.5994 -0.1100 -0.0211 0.2216  116 ASP B CA  
2150 C C   . ASP B 123 ? 0.6370 0.8935 0.5363 -0.1091 -0.0062 0.1837  116 ASP B C   
2151 O O   . ASP B 123 ? 0.6235 0.9295 0.5154 -0.1214 0.0000  0.1887  116 ASP B O   
2152 C CB  . ASP B 123 ? 0.8463 1.0704 0.7530 -0.1261 -0.0303 0.2683  116 ASP B CB  
2153 C CG  . ASP B 123 ? 0.9579 1.1736 0.8679 -0.1268 -0.0477 0.3102  116 ASP B CG  
2154 O OD1 . ASP B 123 ? 0.9395 1.1992 0.8393 -0.1208 -0.0510 0.3108  116 ASP B OD1 
2155 O OD2 . ASP B 123 ? 1.1165 1.2810 1.0415 -0.1330 -0.0596 0.3419  116 ASP B OD2 
2156 N N   . ASP B 124 ? 0.5701 0.7834 0.4782 -0.0945 -0.0013 0.1477  117 ASP B N   
2157 C CA  . ASP B 124 ? 0.5397 0.7599 0.4496 -0.0898 0.0105  0.1096  117 ASP B CA  
2158 C C   . ASP B 124 ? 0.5319 0.7547 0.4433 -0.0760 0.0125  0.0730  117 ASP B C   
2159 O O   . ASP B 124 ? 0.5333 0.7063 0.4558 -0.0664 0.0142  0.0525  117 ASP B O   
2160 C CB  . ASP B 124 ? 0.5151 0.6718 0.4377 -0.0885 0.0124  0.1080  117 ASP B CB  
2161 C CG  . ASP B 124 ? 0.4610 0.6318 0.3859 -0.0875 0.0230  0.0812  117 ASP B CG  
2162 O OD1 . ASP B 124 ? 0.4411 0.6673 0.3601 -0.0862 0.0291  0.0605  117 ASP B OD1 
2163 O OD2 . ASP B 124 ? 0.4792 0.6058 0.4136 -0.0861 0.0245  0.0784  117 ASP B OD2 
2164 N N   . PRO B 125 ? 0.5422 0.8266 0.4431 -0.0766 0.0114  0.0657  118 PRO B N   
2165 C CA  . PRO B 125 ? 0.5460 0.8295 0.4506 -0.0665 0.0091  0.0390  118 PRO B CA  
2166 C C   . PRO B 125 ? 0.5125 0.7986 0.4249 -0.0585 0.0159  -0.0086 118 PRO B C   
2167 O O   . PRO B 125 ? 0.5452 0.8893 0.4523 -0.0578 0.0174  -0.0331 118 PRO B O   
2168 C CB  . PRO B 125 ? 0.5521 0.9048 0.4423 -0.0715 0.0036  0.0524  118 PRO B CB  
2169 C CG  . PRO B 125 ? 0.5866 0.9964 0.4649 -0.0824 0.0084  0.0644  118 PRO B CG  
2170 C CD  . PRO B 125 ? 0.5686 0.9280 0.4541 -0.0883 0.0103  0.0870  118 PRO B CD  
2171 N N   . LEU B 126 ? 0.4335 0.6578 0.3598 -0.0524 0.0184  -0.0214 119 LEU B N   
2172 C CA  . LEU B 126 ? 0.4327 0.6461 0.3712 -0.0448 0.0219  -0.0620 119 LEU B CA  
2173 C C   . LEU B 126 ? 0.4332 0.6622 0.3763 -0.0419 0.0172  -0.0856 119 LEU B C   
2174 O O   . LEU B 126 ? 0.4178 0.6631 0.3691 -0.0377 0.0178  -0.1220 119 LEU B O   
2175 C CB  . LEU B 126 ? 0.4306 0.5750 0.3823 -0.0405 0.0240  -0.0624 119 LEU B CB  
2176 C CG  . LEU B 126 ? 0.4392 0.5631 0.4061 -0.0334 0.0263  -0.0968 119 LEU B CG  
2177 C CD1 . LEU B 126 ? 0.4334 0.5949 0.4002 -0.0303 0.0305  -0.1163 119 LEU B CD1 
2178 C CD2 . LEU B 126 ? 0.4230 0.4841 0.4001 -0.0310 0.0273  -0.0886 119 LEU B CD2 
2179 N N   . VAL B 127 ? 0.4296 0.6518 0.3703 -0.0434 0.0114  -0.0664 120 VAL B N   
2180 C CA  . VAL B 127 ? 0.4558 0.7015 0.4002 -0.0427 0.0060  -0.0848 120 VAL B CA  
2181 C C   . VAL B 127 ? 0.4605 0.7590 0.3890 -0.0463 0.0003  -0.0604 120 VAL B C   
2182 O O   . VAL B 127 ? 0.4635 0.7435 0.3917 -0.0455 -0.0051 -0.0325 120 VAL B O   
2183 C CB  . VAL B 127 ? 0.4560 0.6507 0.4154 -0.0405 0.0034  -0.0859 120 VAL B CB  
2184 C CG1 . VAL B 127 ? 0.4677 0.6922 0.4334 -0.0420 -0.0022 -0.1083 120 VAL B CG1 
2185 C CG2 . VAL B 127 ? 0.4481 0.5897 0.4222 -0.0384 0.0082  -0.1010 120 VAL B CG2 
2186 N N   . PRO B 128 ? 0.4874 0.8551 0.4035 -0.0493 0.0008  -0.0710 121 PRO B N   
2187 C CA  . PRO B 128 ? 0.4890 0.9173 0.3874 -0.0544 -0.0046 -0.0433 121 PRO B CA  
2188 C C   . PRO B 128 ? 0.4850 0.9187 0.3847 -0.0524 -0.0142 -0.0321 121 PRO B C   
2189 O O   . PRO B 128 ? 0.4761 0.9134 0.3687 -0.0538 -0.0207 0.0081  121 PRO B O   
2190 C CB  . PRO B 128 ? 0.5175 1.0245 0.4065 -0.0560 -0.0018 -0.0738 121 PRO B CB  
2191 C CG  . PRO B 128 ? 0.5038 0.9859 0.4030 -0.0521 0.0064  -0.1024 121 PRO B CG  
2192 C CD  . PRO B 128 ? 0.4893 0.8859 0.4081 -0.0472 0.0063  -0.1096 121 PRO B CD  
2193 N N   . ASP B 129 ? 0.4908 0.9258 0.4021 -0.0495 -0.0162 -0.0671 122 ASP B N   
2194 C CA  . ASP B 129 ? 0.4975 0.9444 0.4124 -0.0478 -0.0251 -0.0609 122 ASP B CA  
2195 C C   . ASP B 129 ? 0.4716 0.8618 0.3943 -0.0431 -0.0286 -0.0274 122 ASP B C   
2196 O O   . ASP B 129 ? 0.4784 0.8871 0.3976 -0.0402 -0.0374 -0.0009 122 ASP B O   
2197 C CB  . ASP B 129 ? 0.5363 0.9841 0.4673 -0.0481 -0.0264 -0.1058 122 ASP B CB  
2198 C CG  . ASP B 129 ? 0.6135 1.1319 0.5380 -0.0508 -0.0275 -0.1422 122 ASP B CG  
2199 O OD1 . ASP B 129 ? 0.7349 1.2656 0.6726 -0.0525 -0.0320 -0.1778 122 ASP B OD1 
2200 O OD2 . ASP B 129 ? 0.6148 1.1802 0.5222 -0.0519 -0.0243 -0.1365 122 ASP B OD2 
2201 N N   . ILE B 130 ? 0.4529 0.7770 0.3870 -0.0410 -0.0224 -0.0297 123 ILE B N   
2202 C CA  . ILE B 130 ? 0.4395 0.7105 0.3824 -0.0350 -0.0248 -0.0043 123 ILE B CA  
2203 C C   . ILE B 130 ? 0.4411 0.7067 0.3740 -0.0347 -0.0287 0.0366  123 ILE B C   
2204 O O   . ILE B 130 ? 0.4641 0.7167 0.4013 -0.0283 -0.0374 0.0627  123 ILE B O   
2205 C CB  . ILE B 130 ? 0.4079 0.6180 0.3645 -0.0339 -0.0169 -0.0204 123 ILE B CB  
2206 C CG1 . ILE B 130 ? 0.4064 0.6179 0.3771 -0.0362 -0.0162 -0.0534 123 ILE B CG1 
2207 C CG2 . ILE B 130 ? 0.4054 0.5667 0.3691 -0.0270 -0.0187 0.0036  123 ILE B CG2 
2208 C CD1 . ILE B 130 ? 0.3770 0.5337 0.3622 -0.0367 -0.0099 -0.0651 123 ILE B CD1 
2209 N N   . ALA B 131 ? 0.4457 0.7224 0.3679 -0.0415 -0.0235 0.0420  124 ALA B N   
2210 C CA  . ALA B 131 ? 0.4598 0.7345 0.3741 -0.0456 -0.0280 0.0830  124 ALA B CA  
2211 C C   . ALA B 131 ? 0.4858 0.8081 0.3913 -0.0463 -0.0397 0.1130  124 ALA B C   
2212 O O   . ALA B 131 ? 0.5017 0.8008 0.4108 -0.0444 -0.0494 0.1504  124 ALA B O   
2213 C CB  . ALA B 131 ? 0.4460 0.7418 0.3502 -0.0553 -0.0197 0.0812  124 ALA B CB  
2214 N N   . GLN B 132 ? 0.5114 0.9004 0.4068 -0.0486 -0.0404 0.0963  125 GLN B N   
2215 C CA  . GLN B 132 ? 0.5596 1.0038 0.4450 -0.0492 -0.0522 0.1246  125 GLN B CA  
2216 C C   . GLN B 132 ? 0.5591 0.9741 0.4585 -0.0372 -0.0635 0.1383  125 GLN B C   
2217 O O   . GLN B 132 ? 0.5680 0.9903 0.4664 -0.0347 -0.0761 0.1785  125 GLN B O   
2218 C CB  . GLN B 132 ? 0.6057 1.1328 0.4780 -0.0533 -0.0506 0.0966  125 GLN B CB  
2219 C CG  . GLN B 132 ? 0.6732 1.2535 0.5289 -0.0640 -0.0425 0.0916  125 GLN B CG  
2220 C CD  . GLN B 132 ? 0.7514 1.3425 0.5963 -0.0733 -0.0467 0.1451  125 GLN B CD  
2221 O OE1 . GLN B 132 ? 0.8725 1.4323 0.7190 -0.0795 -0.0400 0.1546  125 GLN B OE1 
2222 N NE2 . GLN B 132 ? 0.7471 1.3804 0.5831 -0.0752 -0.0592 0.1828  125 GLN B NE2 
2223 N N   . ILE B 133 ? 0.5241 0.9078 0.4384 -0.0297 -0.0598 0.1061  126 ILE B N   
2224 C CA  . ILE B 133 ? 0.5255 0.8876 0.4553 -0.0172 -0.0691 0.1138  126 ILE B CA  
2225 C C   . ILE B 133 ? 0.5327 0.8297 0.4741 -0.0093 -0.0740 0.1426  126 ILE B C   
2226 O O   . ILE B 133 ? 0.5619 0.8528 0.5122 0.0014  -0.0873 0.1685  126 ILE B O   
2227 C CB  . ILE B 133 ? 0.5177 0.8687 0.4613 -0.0146 -0.0629 0.0727  126 ILE B CB  
2228 C CG1 . ILE B 133 ? 0.5451 0.9626 0.4813 -0.0217 -0.0626 0.0444  126 ILE B CG1 
2229 C CG2 . ILE B 133 ? 0.5387 0.8682 0.5004 -0.0012 -0.0707 0.0797  126 ILE B CG2 
2230 C CD1 . ILE B 133 ? 0.5359 0.9391 0.4854 -0.0258 -0.0548 0.0008  126 ILE B CD1 
2231 N N   . TYR B 134 ? 0.5276 0.7772 0.4706 -0.0137 -0.0646 0.1367  127 TYR B N   
2232 C CA  . TYR B 134 ? 0.5334 0.7222 0.4877 -0.0078 -0.0694 0.1596  127 TYR B CA  
2233 C C   . TYR B 134 ? 0.5729 0.7725 0.5236 -0.0096 -0.0838 0.2059  127 TYR B C   
2234 O O   . TYR B 134 ? 0.5783 0.7435 0.5443 0.0020  -0.0968 0.2278  127 TYR B O   
2235 C CB  . TYR B 134 ? 0.5259 0.6750 0.4792 -0.0155 -0.0574 0.1474  127 TYR B CB  
2236 C CG  . TYR B 134 ? 0.5473 0.6339 0.5141 -0.0094 -0.0628 0.1646  127 TYR B CG  
2237 C CD1 . TYR B 134 ? 0.5192 0.5647 0.5025 0.0037  -0.0624 0.1476  127 TYR B CD1 
2238 C CD2 . TYR B 134 ? 0.5990 0.6719 0.5639 -0.0176 -0.0696 0.1981  127 TYR B CD2 
2239 C CE1 . TYR B 134 ? 0.5594 0.5517 0.5564 0.0109  -0.0685 0.1585  127 TYR B CE1 
2240 C CE2 . TYR B 134 ? 0.6232 0.6368 0.6038 -0.0124 -0.0767 0.2110  127 TYR B CE2 
2241 C CZ  . TYR B 134 ? 0.6094 0.5829 0.6059 0.0029  -0.0763 0.1889  127 TYR B CZ  
2242 O OH  . TYR B 134 ? 0.6369 0.5551 0.6501 0.0094  -0.0841 0.1963  127 TYR B OH  
2243 N N   . LYS B 135 ? 0.6098 0.8604 0.5418 -0.0239 -0.0824 0.2207  128 LYS B N   
2244 C CA  . LYS B 135 ? 0.6687 0.9356 0.5958 -0.0303 -0.0959 0.2704  128 LYS B CA  
2245 C C   . LYS B 135 ? 0.6918 0.9986 0.6195 -0.0215 -0.1116 0.2930  128 LYS B C   
2246 O O   . LYS B 135 ? 0.7614 1.0498 0.6980 -0.0180 -0.1282 0.3355  128 LYS B O   
2247 C CB  . LYS B 135 ? 0.6896 1.0073 0.5958 -0.0503 -0.0880 0.2800  128 LYS B CB  
2248 C CG  . LYS B 135 ? 0.7048 0.9809 0.6134 -0.0594 -0.0768 0.2716  128 LYS B CG  
2249 C CD  . LYS B 135 ? 0.7843 1.1101 0.6763 -0.0796 -0.0726 0.2939  128 LYS B CD  
2250 C CE  . LYS B 135 ? 0.8002 1.1982 0.6742 -0.0844 -0.0589 0.2582  128 LYS B CE  
2251 N NZ  . LYS B 135 ? 0.8733 1.3234 0.7328 -0.1030 -0.0530 0.2761  128 LYS B NZ  
2252 N N   . SER B 136 ? 0.6784 1.0384 0.5988 -0.0179 -0.1081 0.2653  129 SER B N   
2253 C CA  . SER B 136 ? 0.7120 1.1243 0.6303 -0.0109 -0.1229 0.2857  129 SER B CA  
2254 C C   . SER B 136 ? 0.7008 1.0841 0.6415 0.0101  -0.1324 0.2778  129 SER B C   
2255 O O   . SER B 136 ? 0.7119 1.1118 0.6590 0.0203  -0.1498 0.3088  129 SER B O   
2256 C CB  . SER B 136 ? 0.7215 1.2201 0.6196 -0.0195 -0.1162 0.2607  129 SER B CB  
2257 O OG  . SER B 136 ? 0.7061 1.1989 0.6112 -0.0154 -0.1052 0.2084  129 SER B OG  
2258 N N   . ASP B 137 ? 0.6776 1.0224 0.6309 0.0166  -0.1215 0.2379  130 ASP B N   
2259 C CA  . ASP B 137 ? 0.6755 1.0084 0.6494 0.0351  -0.1275 0.2231  130 ASP B CA  
2260 C C   . ASP B 137 ? 0.6454 0.9119 0.6356 0.0414  -0.1176 0.1973  130 ASP B C   
2261 O O   . ASP B 137 ? 0.6035 0.8718 0.5940 0.0366  -0.1040 0.1602  130 ASP B O   
2262 C CB  . ASP B 137 ? 0.6708 1.0696 0.6388 0.0323  -0.1240 0.1934  130 ASP B CB  
2263 C CG  . ASP B 137 ? 0.6834 1.0916 0.6718 0.0501  -0.1335 0.1867  130 ASP B CG  
2264 O OD1 . ASP B 137 ? 0.6627 1.0214 0.6716 0.0662  -0.1386 0.1925  130 ASP B OD1 
2265 O OD2 . ASP B 137 ? 0.7238 1.1942 0.7086 0.0483  -0.1362 0.1732  130 ASP B OD2 
2266 N N   . LYS B 138 ? 0.6676 0.8771 0.6724 0.0519  -0.1258 0.2178  131 LYS B N   
2267 C CA  . LYS B 138 ? 0.7099 0.8592 0.7275 0.0567  -0.1171 0.1966  131 LYS B CA  
2268 C C   . LYS B 138 ? 0.6729 0.8238 0.7079 0.0716  -0.1146 0.1671  131 LYS B C   
2269 O O   . LYS B 138 ? 0.6006 0.7300 0.6389 0.0690  -0.1011 0.1385  131 LYS B O   
2270 C CB  . LYS B 138 ? 0.7866 0.8783 0.8173 0.0641  -0.1292 0.2251  131 LYS B CB  
2271 C CG  . LYS B 138 ? 0.8909 0.9259 0.9268 0.0614  -0.1187 0.2068  131 LYS B CG  
2272 C CD  . LYS B 138 ? 0.9752 0.9762 1.0076 0.0493  -0.1236 0.2359  131 LYS B CD  
2273 C CE  . LYS B 138 ? 1.0459 0.9954 1.0836 0.0463  -0.1138 0.2162  131 LYS B CE  
2274 N NZ  . LYS B 138 ? 1.1373 1.0355 1.2012 0.0664  -0.1250 0.2114  131 LYS B NZ  
2275 N N   . GLU B 139 ? 0.7109 0.8923 0.7573 0.0866  -0.1278 0.1758  132 GLU B N   
2276 C CA  . GLU B 139 ? 0.7144 0.9107 0.7787 0.1003  -0.1262 0.1494  132 GLU B CA  
2277 C C   . GLU B 139 ? 0.6450 0.8785 0.6997 0.0838  -0.1104 0.1171  132 GLU B C   
2278 O O   . GLU B 139 ? 0.6122 0.8357 0.6772 0.0843  -0.1002 0.0906  132 GLU B O   
2279 C CB  . GLU B 139 ? 0.7773 1.0070 0.8557 0.1197  -0.1451 0.1672  132 GLU B CB  
2280 C CG  . GLU B 139 ? 0.8442 1.0946 0.9449 0.1365  -0.1451 0.1420  132 GLU B CG  
2281 C CD  . GLU B 139 ? 0.9254 1.2484 1.0235 0.1322  -0.1467 0.1333  132 GLU B CD  
2282 O OE1 . GLU B 139 ? 0.9487 1.3055 1.0458 0.1397  -0.1627 0.1585  132 GLU B OE1 
2283 O OE2 . GLU B 139 ? 0.8659 1.2130 0.9645 0.1207  -0.1332 0.1025  132 GLU B OE2 
2284 N N   . LYS B 140 ? 0.6066 0.8838 0.6429 0.0686  -0.1093 0.1195  133 LYS B N   
2285 C CA  . LYS B 140 ? 0.5616 0.8682 0.5899 0.0511  -0.0963 0.0877  133 LYS B CA  
2286 C C   . LYS B 140 ? 0.5161 0.7774 0.5397 0.0392  -0.0805 0.0698  133 LYS B C   
2287 O O   . LYS B 140 ? 0.4801 0.7398 0.5106 0.0318  -0.0705 0.0422  133 LYS B O   
2288 C CB  . LYS B 140 ? 0.5736 0.9349 0.5825 0.0391  -0.0996 0.0930  133 LYS B CB  
2289 C CG  . LYS B 140 ? 0.6040 0.9980 0.6073 0.0222  -0.0896 0.0571  133 LYS B CG  
2290 C CD  . LYS B 140 ? 0.6957 1.1612 0.6845 0.0161  -0.0973 0.0595  133 LYS B CD  
2291 C CE  . LYS B 140 ? 0.7398 1.2449 0.7306 0.0024  -0.0921 0.0190  133 LYS B CE  
2292 N NZ  . LYS B 140 ? 0.7367 1.2350 0.7151 -0.0118 -0.0813 -0.0031 133 LYS B NZ  
2293 N N   . TYR B 141 ? 0.4882 0.7150 0.5013 0.0363  -0.0792 0.0873  134 TYR B N   
2294 C CA  . TYR B 141 ? 0.4561 0.6407 0.4655 0.0273  -0.0659 0.0731  134 TYR B CA  
2295 C C   . TYR B 141 ? 0.4438 0.5929 0.4702 0.0354  -0.0605 0.0580  134 TYR B C   
2296 O O   . TYR B 141 ? 0.3956 0.5362 0.4238 0.0263  -0.0490 0.0348  134 TYR B O   
2297 C CB  . TYR B 141 ? 0.4829 0.6371 0.4823 0.0246  -0.0676 0.0979  134 TYR B CB  
2298 C CG  . TYR B 141 ? 0.4632 0.5744 0.4610 0.0176  -0.0552 0.0842  134 TYR B CG  
2299 C CD1 . TYR B 141 ? 0.4523 0.5758 0.4379 0.0035  -0.0447 0.0680  134 TYR B CD1 
2300 C CD2 . TYR B 141 ? 0.4561 0.5179 0.4659 0.0267  -0.0547 0.0848  134 TYR B CD2 
2301 C CE1 . TYR B 141 ? 0.4597 0.5465 0.4451 -0.0014 -0.0345 0.0562  134 TYR B CE1 
2302 C CE2 . TYR B 141 ? 0.4642 0.4921 0.4720 0.0203  -0.0438 0.0724  134 TYR B CE2 
2303 C CZ  . TYR B 141 ? 0.4483 0.4883 0.4437 0.0061  -0.0340 0.0598  134 TYR B CZ  
2304 O OH  . TYR B 141 ? 0.4792 0.4884 0.4733 0.0008  -0.0244 0.0488  134 TYR B OH  
2305 N N   . ASN B 142 ? 0.4471 0.5777 0.4869 0.0530  -0.0698 0.0716  135 ASN B N   
2306 C CA  . ASN B 142 ? 0.4496 0.5537 0.5055 0.0636  -0.0658 0.0575  135 ASN B CA  
2307 C C   . ASN B 142 ? 0.4308 0.5705 0.4969 0.0614  -0.0602 0.0350  135 ASN B C   
2308 O O   . ASN B 142 ? 0.4294 0.5567 0.5015 0.0578  -0.0500 0.0184  135 ASN B O   
2309 C CB  . ASN B 142 ? 0.4963 0.5793 0.5680 0.0861  -0.0798 0.0733  135 ASN B CB  
2310 C CG  . ASN B 142 ? 0.5191 0.5537 0.5866 0.0862  -0.0848 0.0930  135 ASN B CG  
2311 O OD1 . ASN B 142 ? 0.5132 0.5236 0.5694 0.0727  -0.0746 0.0884  135 ASN B OD1 
2312 N ND2 . ASN B 142 ? 0.5924 0.6123 0.6714 0.1012  -0.1019 0.1158  135 ASN B ND2 
2313 N N   . ARG B 143 ? 0.4424 0.6300 0.5108 0.0619  -0.0672 0.0361  136 ARG B N   
2314 C CA  . ARG B 143 ? 0.4382 0.6654 0.5176 0.0558  -0.0629 0.0152  136 ARG B CA  
2315 C C   . ARG B 143 ? 0.4134 0.6354 0.4862 0.0329  -0.0499 -0.0041 136 ARG B C   
2316 O O   . ARG B 143 ? 0.3926 0.6140 0.4763 0.0262  -0.0419 -0.0190 136 ARG B O   
2317 C CB  . ARG B 143 ? 0.4841 0.7665 0.5656 0.0588  -0.0741 0.0201  136 ARG B CB  
2318 C CG  . ARG B 143 ? 0.5053 0.8328 0.5964 0.0456  -0.0700 -0.0026 136 ARG B CG  
2319 C CD  . ARG B 143 ? 0.5462 0.9328 0.6446 0.0536  -0.0829 0.0017  136 ARG B CD  
2320 N NE  . ARG B 143 ? 0.5520 0.9656 0.6326 0.0467  -0.0898 0.0100  136 ARG B NE  
2321 C CZ  . ARG B 143 ? 0.6433 1.0632 0.7147 0.0593  -0.1020 0.0373  136 ARG B CZ  
2322 N NH1 . ARG B 143 ? 0.6536 1.0466 0.7344 0.0810  -0.1105 0.0590  136 ARG B NH1 
2323 N NH2 . ARG B 143 ? 0.6887 1.1444 0.7424 0.0501  -0.1067 0.0433  136 ARG B NH2 
2324 N N   . HIS B 144 ? 0.4106 0.6309 0.4668 0.0212  -0.0488 -0.0032 137 HIS B N   
2325 C CA  . HIS B 144 ? 0.3984 0.6096 0.4506 0.0023  -0.0390 -0.0229 137 HIS B CA  
2326 C C   . HIS B 144 ? 0.3782 0.5396 0.4310 -0.0001 -0.0288 -0.0254 137 HIS B C   
2327 O O   . HIS B 144 ? 0.3684 0.5218 0.4286 -0.0126 -0.0217 -0.0408 137 HIS B O   
2328 C CB  . HIS B 144 ? 0.4027 0.6268 0.4375 -0.0054 -0.0405 -0.0232 137 HIS B CB  
2329 C CG  . HIS B 144 ? 0.4543 0.7358 0.4871 -0.0081 -0.0490 -0.0281 137 HIS B CG  
2330 N ND1 . HIS B 144 ? 0.4504 0.7606 0.4664 -0.0125 -0.0522 -0.0266 137 HIS B ND1 
2331 C CD2 . HIS B 144 ? 0.4669 0.7890 0.5123 -0.0073 -0.0551 -0.0352 137 HIS B CD2 
2332 C CE1 . HIS B 144 ? 0.4998 0.8654 0.5171 -0.0142 -0.0602 -0.0334 137 HIS B CE1 
2333 N NE2 . HIS B 144 ? 0.4874 0.8597 0.5231 -0.0111 -0.0624 -0.0386 137 HIS B NE2 
2334 N N   . ALA B 145 ? 0.3674 0.4958 0.4135 0.0104  -0.0294 -0.0093 138 ALA B N   
2335 C CA  . ALA B 145 ? 0.3644 0.4499 0.4101 0.0090  -0.0209 -0.0114 138 ALA B CA  
2336 C C   . ALA B 145 ? 0.3564 0.4431 0.4174 0.0130  -0.0169 -0.0189 138 ALA B C   
2337 O O   . ALA B 145 ? 0.3661 0.4360 0.4293 0.0039  -0.0083 -0.0269 138 ALA B O   
2338 C CB  . ALA B 145 ? 0.3726 0.4264 0.4104 0.0187  -0.0242 0.0061  138 ALA B CB  
2339 N N   . ARG B 146 ? 0.3752 0.4873 0.4476 0.0264  -0.0235 -0.0159 139 ARG B N   
2340 C CA  . ARG B 146 ? 0.3751 0.5015 0.4631 0.0308  -0.0194 -0.0247 139 ARG B CA  
2341 C C   . ARG B 146 ? 0.3578 0.5135 0.4540 0.0116  -0.0138 -0.0370 139 ARG B C   
2342 O O   . ARG B 146 ? 0.3240 0.4785 0.4272 0.0033  -0.0056 -0.0423 139 ARG B O   
2343 C CB  . ARG B 146 ? 0.4109 0.5607 0.5119 0.0530  -0.0289 -0.0209 139 ARG B CB  
2344 C CG  . ARG B 146 ? 0.4733 0.5866 0.5739 0.0728  -0.0351 -0.0117 139 ARG B CG  
2345 C CD  . ARG B 146 ? 0.5630 0.6953 0.6820 0.0982  -0.0460 -0.0118 139 ARG B CD  
2346 N NE  . ARG B 146 ? 0.6633 0.8434 0.7898 0.1001  -0.0532 -0.0098 139 ARG B NE  
2347 C CZ  . ARG B 146 ? 0.7047 0.8920 0.8292 0.1078  -0.0665 0.0064  139 ARG B CZ  
2348 N NH1 . ARG B 146 ? 0.7148 0.8631 0.8311 0.1137  -0.0749 0.0253  139 ARG B NH1 
2349 N NH2 . ARG B 146 ? 0.6873 0.9253 0.8189 0.1085  -0.0722 0.0054  139 ARG B NH2 
2350 N N   . GLU B 147 ? 0.3488 0.5321 0.4449 0.0034  -0.0191 -0.0407 140 GLU B N   
2351 C CA  . GLU B 147 ? 0.3665 0.5745 0.4732 -0.0171 -0.0164 -0.0540 140 GLU B CA  
2352 C C   . GLU B 147 ? 0.3335 0.5060 0.4376 -0.0348 -0.0085 -0.0598 140 GLU B C   
2353 O O   . GLU B 147 ? 0.3317 0.5084 0.4488 -0.0491 -0.0036 -0.0640 140 GLU B O   
2354 C CB  . GLU B 147 ? 0.3854 0.6292 0.4912 -0.0219 -0.0250 -0.0603 140 GLU B CB  
2355 C CG  . GLU B 147 ? 0.4455 0.7360 0.5608 -0.0076 -0.0336 -0.0558 140 GLU B CG  
2356 C CD  . GLU B 147 ? 0.5127 0.8435 0.6243 -0.0100 -0.0435 -0.0593 140 GLU B CD  
2357 O OE1 . GLU B 147 ? 0.5869 0.9103 0.6858 -0.0204 -0.0439 -0.0655 140 GLU B OE1 
2358 O OE2 . GLU B 147 ? 0.5969 0.9719 0.7186 -0.0002 -0.0514 -0.0567 140 GLU B OE2 
2359 N N   . TRP B 148 ? 0.3229 0.4618 0.4116 -0.0335 -0.0078 -0.0578 141 TRP B N   
2360 C CA  . TRP B 148 ? 0.3355 0.4392 0.4228 -0.0465 -0.0018 -0.0632 141 TRP B CA  
2361 C C   . TRP B 148 ? 0.3233 0.4015 0.4120 -0.0444 0.0056  -0.0546 141 TRP B C   
2362 O O   . TRP B 148 ? 0.3316 0.3934 0.4274 -0.0582 0.0100  -0.0565 141 TRP B O   
2363 C CB  . TRP B 148 ? 0.3368 0.4197 0.4083 -0.0441 -0.0028 -0.0650 141 TRP B CB  
2364 C CG  . TRP B 148 ? 0.3717 0.4785 0.4427 -0.0520 -0.0083 -0.0803 141 TRP B CG  
2365 C CD1 . TRP B 148 ? 0.3797 0.5297 0.4564 -0.0545 -0.0149 -0.0874 141 TRP B CD1 
2366 C CD2 . TRP B 148 ? 0.4007 0.4951 0.4647 -0.0567 -0.0080 -0.0929 141 TRP B CD2 
2367 N NE1 . TRP B 148 ? 0.3946 0.5605 0.4680 -0.0616 -0.0189 -0.1051 141 TRP B NE1 
2368 C CE2 . TRP B 148 ? 0.4295 0.5626 0.4953 -0.0621 -0.0147 -0.1097 141 TRP B CE2 
2369 C CE3 . TRP B 148 ? 0.3874 0.4465 0.4450 -0.0558 -0.0032 -0.0935 141 TRP B CE3 
2370 C CZ2 . TRP B 148 ? 0.4320 0.5707 0.4935 -0.0659 -0.0164 -0.1296 141 TRP B CZ2 
2371 C CZ3 . TRP B 148 ? 0.4253 0.4891 0.4796 -0.0589 -0.0049 -0.1116 141 TRP B CZ3 
2372 C CH2 . TRP B 148 ? 0.4278 0.5317 0.4842 -0.0635 -0.0113 -0.1307 141 TRP B CH2 
2373 N N   . THR B 149 ? 0.3104 0.3846 0.3933 -0.0270 0.0060  -0.0451 142 THR B N   
2374 C CA  . THR B 149 ? 0.3070 0.3685 0.3917 -0.0235 0.0126  -0.0404 142 THR B CA  
2375 C C   . THR B 149 ? 0.3148 0.4084 0.4156 -0.0346 0.0165  -0.0425 142 THR B C   
2376 O O   . THR B 149 ? 0.3394 0.4234 0.4431 -0.0462 0.0225  -0.0389 142 THR B O   
2377 C CB  . THR B 149 ? 0.3082 0.3645 0.3884 -0.0013 0.0098  -0.0352 142 THR B CB  
2378 O OG1 . THR B 149 ? 0.3126 0.3397 0.3796 0.0044  0.0059  -0.0294 142 THR B OG1 
2379 C CG2 . THR B 149 ? 0.3060 0.3536 0.3872 0.0027  0.0164  -0.0351 142 THR B CG2 
2380 N N   . GLN B 150 ? 0.3279 0.4633 0.4398 -0.0320 0.0125  -0.0462 143 GLN B N   
2381 C CA  . GLN B 150 ? 0.3430 0.5182 0.4720 -0.0443 0.0161  -0.0475 143 GLN B CA  
2382 C C   . GLN B 150 ? 0.3558 0.5232 0.4938 -0.0723 0.0171  -0.0484 143 GLN B C   
2383 O O   . GLN B 150 ? 0.3568 0.5318 0.5044 -0.0876 0.0225  -0.0417 143 GLN B O   
2384 C CB  . GLN B 150 ? 0.3602 0.5844 0.5003 -0.0350 0.0101  -0.0526 143 GLN B CB  
2385 C CG  . GLN B 150 ? 0.3916 0.6242 0.5298 -0.0061 0.0073  -0.0521 143 GLN B CG  
2386 C CD  . GLN B 150 ? 0.4715 0.7417 0.6186 0.0075  -0.0022 -0.0552 143 GLN B CD  
2387 O OE1 . GLN B 150 ? 0.4895 0.7908 0.6450 -0.0059 -0.0053 -0.0590 143 GLN B OE1 
2388 N NE2 . GLN B 150 ? 0.5145 0.7819 0.6617 0.0347  -0.0085 -0.0537 143 GLN B NE2 
2389 N N   . LYS B 151 ? 0.3684 0.5213 0.5043 -0.0786 0.0111  -0.0566 144 LYS B N   
2390 C CA  . LYS B 151 ? 0.4045 0.5472 0.5532 -0.1032 0.0087  -0.0629 144 LYS B CA  
2391 C C   . LYS B 151 ? 0.3950 0.4906 0.5416 -0.1120 0.0125  -0.0563 144 LYS B C   
2392 O O   . LYS B 151 ? 0.3778 0.4695 0.5401 -0.1323 0.0132  -0.0502 144 LYS B O   
2393 C CB  . LYS B 151 ? 0.4593 0.6044 0.6054 -0.1035 0.0005  -0.0787 144 LYS B CB  
2394 C CG  . LYS B 151 ? 0.5693 0.7098 0.7337 -0.1275 -0.0049 -0.0923 144 LYS B CG  
2395 C CD  . LYS B 151 ? 0.6329 0.8095 0.8009 -0.1289 -0.0136 -0.1102 144 LYS B CD  
2396 C CE  . LYS B 151 ? 0.7295 0.9062 0.9214 -0.1544 -0.0207 -0.1274 144 LYS B CE  
2397 N NZ  . LYS B 151 ? 0.7156 0.8518 0.9060 -0.1568 -0.0248 -0.1443 144 LYS B NZ  
2398 N N   . TYR B 152 ? 0.3715 0.4332 0.5001 -0.0974 0.0142  -0.0550 145 TYR B N   
2399 C CA  . TYR B 152 ? 0.3912 0.4087 0.5177 -0.1031 0.0159  -0.0514 145 TYR B CA  
2400 C C   . TYR B 152 ? 0.3994 0.4020 0.5156 -0.0948 0.0230  -0.0365 145 TYR B C   
2401 O O   . TYR B 152 ? 0.4189 0.3931 0.5376 -0.1028 0.0243  -0.0291 145 TYR B O   
2402 C CB  . TYR B 152 ? 0.3859 0.3793 0.5019 -0.0954 0.0119  -0.0642 145 TYR B CB  
2403 C CG  . TYR B 152 ? 0.4155 0.4259 0.5399 -0.1027 0.0045  -0.0828 145 TYR B CG  
2404 C CD1 . TYR B 152 ? 0.4781 0.4825 0.6245 -0.1225 -0.0008 -0.0926 145 TYR B CD1 
2405 C CD2 . TYR B 152 ? 0.4270 0.4615 0.5389 -0.0909 0.0014  -0.0904 145 TYR B CD2 
2406 C CE1 . TYR B 152 ? 0.5013 0.5242 0.6570 -0.1293 -0.0087 -0.1142 145 TYR B CE1 
2407 C CE2 . TYR B 152 ? 0.4503 0.5084 0.5686 -0.0975 -0.0057 -0.1092 145 TYR B CE2 
2408 C CZ  . TYR B 152 ? 0.5041 0.5567 0.6443 -0.1162 -0.0106 -0.1236 145 TYR B CZ  
2409 O OH  . TYR B 152 ? 0.5162 0.5946 0.6639 -0.1226 -0.0187 -0.1466 145 TYR B OH  
2410 N N   . ALA B 153 ? 0.3675 0.3897 0.4738 -0.0783 0.0264  -0.0330 146 ALA B N   
2411 C CA  . ALA B 153 ? 0.3382 0.3486 0.4341 -0.0684 0.0320  -0.0242 146 ALA B CA  
2412 C C   . ALA B 153 ? 0.3320 0.3812 0.4323 -0.0648 0.0370  -0.0192 146 ALA B C   
2413 O O   . ALA B 153 ? 0.3435 0.3904 0.4347 -0.0529 0.0407  -0.0170 146 ALA B O   
2414 C CB  . ALA B 153 ? 0.3276 0.3168 0.4074 -0.0495 0.0303  -0.0279 146 ALA B CB  
2415 N N   . MET B 154 ? 0.3320 0.4213 0.4470 -0.0749 0.0369  -0.0195 147 MET B N   
2416 C CA  . MET B 154 ? 0.3449 0.4815 0.4666 -0.0741 0.0426  -0.0154 147 MET B CA  
2417 C C   . MET B 154 ? 0.3834 0.5428 0.5210 -0.1017 0.0449  -0.0034 147 MET B C   
2418 O O   . MET B 154 ? 0.4218 0.5623 0.5698 -0.1201 0.0398  -0.0025 147 MET B O   
2419 C CB  . MET B 154 ? 0.3244 0.5018 0.4521 -0.0579 0.0400  -0.0264 147 MET B CB  
2420 C CG  . MET B 154 ? 0.3261 0.4823 0.4422 -0.0308 0.0356  -0.0347 147 MET B CG  
2421 S SD  . MET B 154 ? 0.3391 0.5441 0.4672 -0.0096 0.0304  -0.0454 147 MET B SD  
2422 C CE  . MET B 154 ? 0.3379 0.4978 0.4533 0.0172  0.0224  -0.0485 147 MET B CE  
2423 O OXT . MET B 154 ? 0.3989 0.5997 0.5411 -0.1067 0.0512  0.0049  147 MET B OXT 
2424 N N   . SER C 2   ? 0.7905 0.4816 0.7069 -0.2265 0.0164  -0.0397 30  SER C N   
2425 C CA  . SER C 2   ? 0.7945 0.4072 0.6757 -0.2195 0.0043  -0.0301 30  SER C CA  
2426 C C   . SER C 2   ? 0.7993 0.3800 0.6699 -0.2228 -0.0063 -0.0402 30  SER C C   
2427 O O   . SER C 2   ? 0.7284 0.3429 0.6240 -0.2071 -0.0080 -0.0528 30  SER C O   
2428 C CB  . SER C 2   ? 0.7735 0.3787 0.6618 -0.1802 -0.0002 -0.0243 30  SER C CB  
2429 O OG  . SER C 2   ? 0.7650 0.3030 0.6223 -0.1693 -0.0129 -0.0184 30  SER C OG  
2430 N N   . LEU C 3   ? 0.8496 0.3617 0.6799 -0.2429 -0.0148 -0.0346 31  LEU C N   
2431 C CA  . LEU C 3   ? 0.8823 0.3504 0.6962 -0.2425 -0.0281 -0.0444 31  LEU C CA  
2432 C C   . LEU C 3   ? 0.8744 0.3009 0.6785 -0.2018 -0.0422 -0.0445 31  LEU C C   
2433 O O   . LEU C 3   ? 0.9032 0.3083 0.7030 -0.1900 -0.0532 -0.0568 31  LEU C O   
2434 C CB  . LEU C 3   ? 0.9758 0.3827 0.7464 -0.2844 -0.0329 -0.0395 31  LEU C CB  
2435 C CG  . LEU C 3   ? 0.9924 0.4481 0.7746 -0.3290 -0.0194 -0.0450 31  LEU C CG  
2436 C CD1 . LEU C 3   ? 1.0334 0.4260 0.7675 -0.3765 -0.0226 -0.0370 31  LEU C CD1 
2437 C CD2 . LEU C 3   ? 0.9904 0.4987 0.8066 -0.3257 -0.0189 -0.0656 31  LEU C CD2 
2438 N N   . THR C 4   ? 0.8115 0.2314 0.6131 -0.1806 -0.0419 -0.0331 32  THR C N   
2439 C CA  . THR C 4   ? 0.8207 0.2023 0.6101 -0.1442 -0.0557 -0.0337 32  THR C CA  
2440 C C   . THR C 4   ? 0.7671 0.2052 0.5938 -0.1090 -0.0509 -0.0386 32  THR C C   
2441 O O   . THR C 4   ? 0.7807 0.2051 0.6055 -0.0791 -0.0609 -0.0451 32  THR C O   
2442 C CB  . THR C 4   ? 0.8507 0.1750 0.6035 -0.1441 -0.0627 -0.0183 32  THR C CB  
2443 O OG1 . THR C 4   ? 0.7961 0.1618 0.5653 -0.1466 -0.0493 -0.0071 32  THR C OG1 
2444 C CG2 . THR C 4   ? 0.9344 0.1921 0.6414 -0.1810 -0.0690 -0.0111 32  THR C CG2 
2445 N N   . VAL C 5   ? 0.7220 0.2225 0.5802 -0.1126 -0.0364 -0.0360 33  VAL C N   
2446 C CA  . VAL C 5   ? 0.6695 0.2189 0.5586 -0.0838 -0.0321 -0.0389 33  VAL C CA  
2447 C C   . VAL C 5   ? 0.6034 0.2088 0.5214 -0.0898 -0.0238 -0.0473 33  VAL C C   
2448 O O   . VAL C 5   ? 0.5777 0.2073 0.5033 -0.1125 -0.0157 -0.0465 33  VAL C O   
2449 C CB  . VAL C 5   ? 0.6792 0.2425 0.5743 -0.0759 -0.0257 -0.0267 33  VAL C CB  
2450 C CG1 . VAL C 5   ? 0.6300 0.2406 0.5539 -0.0523 -0.0209 -0.0287 33  VAL C CG1 
2451 C CG2 . VAL C 5   ? 0.7673 0.2767 0.6330 -0.0661 -0.0362 -0.0197 33  VAL C CG2 
2452 N N   . PRO C 6   ? 0.5805 0.2098 0.5138 -0.0687 -0.0263 -0.0562 34  PRO C N   
2453 C CA  . PRO C 6   ? 0.5407 0.2180 0.4965 -0.0724 -0.0214 -0.0643 34  PRO C CA  
2454 C C   . PRO C 6   ? 0.5154 0.2377 0.4925 -0.0720 -0.0114 -0.0579 34  PRO C C   
2455 O O   . PRO C 6   ? 0.4621 0.1813 0.4392 -0.0648 -0.0081 -0.0477 34  PRO C O   
2456 C CB  . PRO C 6   ? 0.5329 0.2212 0.4945 -0.0475 -0.0266 -0.0724 34  PRO C CB  
2457 C CG  . PRO C 6   ? 0.5523 0.2212 0.5062 -0.0284 -0.0293 -0.0662 34  PRO C CG  
2458 C CD  . PRO C 6   ? 0.5881 0.2079 0.5189 -0.0403 -0.0334 -0.0596 34  PRO C CD  
2459 N N   . GLU C 7   ? 0.4898 0.2523 0.4838 -0.0789 -0.0084 -0.0657 35  GLU C N   
2460 C CA  . GLU C 7   ? 0.4845 0.2900 0.4980 -0.0739 -0.0022 -0.0636 35  GLU C CA  
2461 C C   . GLU C 7   ? 0.4387 0.2601 0.4605 -0.0483 -0.0047 -0.0621 35  GLU C C   
2462 O O   . GLU C 7   ? 0.4715 0.2948 0.4918 -0.0400 -0.0096 -0.0688 35  GLU C O   
2463 C CB  . GLU C 7   ? 0.5305 0.3738 0.5572 -0.0902 -0.0003 -0.0753 35  GLU C CB  
2464 C CG  . GLU C 7   ? 0.5407 0.4295 0.5865 -0.0854 0.0044  -0.0766 35  GLU C CG  
2465 C CD  . GLU C 7   ? 0.6624 0.5962 0.7232 -0.1004 0.0053  -0.0919 35  GLU C CD  
2466 O OE1 . GLU C 7   ? 0.5945 0.5667 0.6710 -0.0843 0.0015  -0.1001 35  GLU C OE1 
2467 O OE2 . GLU C 7   ? 0.6925 0.6227 0.7472 -0.1289 0.0092  -0.0959 35  GLU C OE2 
2468 N N   . CYS C 8   ? 0.4044 0.2344 0.4316 -0.0376 -0.0014 -0.0532 36  CYS C N   
2469 C CA  . CYS C 8   ? 0.3797 0.2247 0.4116 -0.0184 -0.0032 -0.0500 36  CYS C CA  
2470 C C   . CYS C 8   ? 0.3484 0.2283 0.3915 -0.0142 -0.0059 -0.0573 36  CYS C C   
2471 O O   . CYS C 8   ? 0.3565 0.2571 0.4094 -0.0194 -0.0041 -0.0609 36  CYS C O   
2472 C CB  . CYS C 8   ? 0.3624 0.2004 0.3939 -0.0119 0.0001  -0.0387 36  CYS C CB  
2473 S SG  . CYS C 8   ? 0.3401 0.1886 0.3720 0.0053  -0.0016 -0.0314 36  CYS C SG  
2474 N N   . ALA C 9   ? 0.3285 0.2174 0.3692 -0.0036 -0.0108 -0.0607 37  ALA C N   
2475 C CA  . ALA C 9   ? 0.3296 0.2491 0.3776 0.0027  -0.0159 -0.0682 37  ALA C CA  
2476 C C   . ALA C 9   ? 0.3226 0.2482 0.3699 0.0176  -0.0184 -0.0602 37  ALA C C   
2477 O O   . ALA C 9   ? 0.3340 0.2821 0.3857 0.0263  -0.0247 -0.0664 37  ALA C O   
2478 C CB  . ALA C 9   ? 0.3387 0.2644 0.3808 0.0083  -0.0214 -0.0749 37  ALA C CB  
2479 N N   . ILE C 10  ? 0.3184 0.2222 0.3585 0.0208  -0.0150 -0.0476 38  ILE C N   
2480 C CA  . ILE C 10  ? 0.3262 0.2272 0.3626 0.0321  -0.0181 -0.0397 38  ILE C CA  
2481 C C   . ILE C 10  ? 0.3240 0.2361 0.3723 0.0301  -0.0165 -0.0441 38  ILE C C   
2482 O O   . ILE C 10  ? 0.3176 0.2479 0.3705 0.0409  -0.0230 -0.0506 38  ILE C O   
2483 C CB  . ILE C 10  ? 0.3311 0.2077 0.3553 0.0332  -0.0149 -0.0259 38  ILE C CB  
2484 C CG1 . ILE C 10  ? 0.3496 0.2252 0.3615 0.0359  -0.0163 -0.0234 38  ILE C CG1 
2485 C CG2 . ILE C 10  ? 0.3463 0.2126 0.3640 0.0412  -0.0186 -0.0177 38  ILE C CG2 
2486 C CD1 . ILE C 10  ? 0.3616 0.2238 0.3629 0.0340  -0.0119 -0.0126 38  ILE C CD1 
2487 N N   . CYS C 11  ? 0.3146 0.2168 0.3664 0.0180  -0.0088 -0.0416 39  CYS C N   
2488 C CA  . CYS C 11  ? 0.3241 0.2387 0.3850 0.0147  -0.0058 -0.0454 39  CYS C CA  
2489 C C   . CYS C 11  ? 0.3058 0.2483 0.3787 -0.0002 -0.0020 -0.0583 39  CYS C C   
2490 O O   . CYS C 11  ? 0.3053 0.2687 0.3869 -0.0035 0.0008  -0.0643 39  CYS C O   
2491 C CB  . CYS C 11  ? 0.3324 0.2223 0.3875 0.0094  0.0000  -0.0349 39  CYS C CB  
2492 S SG  . CYS C 11  ? 0.3526 0.2211 0.4010 -0.0081 0.0062  -0.0316 39  CYS C SG  
2493 N N   . LEU C 12  ? 0.3314 0.2748 0.4035 -0.0108 -0.0019 -0.0632 40  LEU C N   
2494 C CA  . LEU C 12  ? 0.3391 0.3039 0.4188 -0.0312 0.0019  -0.0746 40  LEU C CA  
2495 C C   . LEU C 12  ? 0.3659 0.3165 0.4399 -0.0523 0.0105  -0.0699 40  LEU C C   
2496 O O   . LEU C 12  ? 0.3743 0.3465 0.4532 -0.0727 0.0151  -0.0785 40  LEU C O   
2497 C CB  . LEU C 12  ? 0.3285 0.3440 0.4256 -0.0269 -0.0011 -0.0905 40  LEU C CB  
2498 C CG  . LEU C 12  ? 0.3299 0.3630 0.4305 -0.0076 -0.0118 -0.0976 40  LEU C CG  
2499 C CD1 . LEU C 12  ? 0.3303 0.4174 0.4492 -0.0014 -0.0160 -0.1159 40  LEU C CD1 
2500 C CD2 . LEU C 12  ? 0.3379 0.3612 0.4328 -0.0164 -0.0136 -0.1002 40  LEU C CD2 
2501 N N   . GLN C 13  ? 0.3750 0.2907 0.4371 -0.0486 0.0125  -0.0566 41  GLN C N   
2502 C CA  . GLN C 13  ? 0.4041 0.2970 0.4542 -0.0669 0.0186  -0.0498 41  GLN C CA  
2503 C C   . GLN C 13  ? 0.4030 0.2532 0.4359 -0.0712 0.0154  -0.0441 41  GLN C C   
2504 O O   . GLN C 13  ? 0.3833 0.2259 0.4161 -0.0576 0.0101  -0.0448 41  GLN C O   
2505 C CB  . GLN C 13  ? 0.4118 0.2941 0.4588 -0.0573 0.0208  -0.0403 41  GLN C CB  
2506 C CG  . GLN C 13  ? 0.4740 0.3901 0.5355 -0.0445 0.0207  -0.0461 41  GLN C CG  
2507 C CD  . GLN C 13  ? 0.5758 0.5272 0.6450 -0.0598 0.0273  -0.0557 41  GLN C CD  
2508 O OE1 . GLN C 13  ? 0.5535 0.5022 0.6150 -0.0844 0.0330  -0.0559 41  GLN C OE1 
2509 N NE2 . GLN C 13  ? 0.5931 0.5777 0.6755 -0.0461 0.0260  -0.0645 41  GLN C NE2 
2510 N N   . THR C 14  ? 0.4221 0.2436 0.4381 -0.0896 0.0179  -0.0389 42  THR C N   
2511 C CA  . THR C 14  ? 0.4461 0.2188 0.4415 -0.0883 0.0123  -0.0329 42  THR C CA  
2512 C C   . THR C 14  ? 0.4180 0.1799 0.4141 -0.0641 0.0093  -0.0260 42  THR C C   
2513 O O   . THR C 14  ? 0.3974 0.1693 0.3987 -0.0580 0.0128  -0.0201 42  THR C O   
2514 C CB  . THR C 14  ? 0.4917 0.2297 0.4632 -0.1097 0.0139  -0.0255 42  THR C CB  
2515 O OG1 . THR C 14  ? 0.4992 0.2494 0.4684 -0.1377 0.0177  -0.0320 42  THR C OG1 
2516 C CG2 . THR C 14  ? 0.5365 0.2195 0.4839 -0.1035 0.0045  -0.0209 42  THR C CG2 
2517 N N   . CYS C 15  ? 0.4163 0.1623 0.4081 -0.0509 0.0030  -0.0283 43  CYS C N   
2518 C CA  . CYS C 15  ? 0.4164 0.1600 0.4101 -0.0305 0.0010  -0.0237 43  CYS C CA  
2519 C C   . CYS C 15  ? 0.4297 0.1506 0.4125 -0.0286 0.0008  -0.0149 43  CYS C C   
2520 O O   . CYS C 15  ? 0.4350 0.1222 0.3989 -0.0367 -0.0026 -0.0126 43  CYS C O   
2521 C CB  . CYS C 15  ? 0.4441 0.1764 0.4325 -0.0181 -0.0055 -0.0300 43  CYS C CB  
2522 S SG  . CYS C 15  ? 0.4621 0.2245 0.4620 -0.0129 -0.0066 -0.0399 43  CYS C SG  
2523 N N   . VAL C 16  ? 0.4064 0.1434 0.3986 -0.0184 0.0036  -0.0099 44  VAL C N   
2524 C CA  . VAL C 16  ? 0.4276 0.1494 0.4123 -0.0119 0.0022  -0.0034 44  VAL C CA  
2525 C C   . VAL C 16  ? 0.4010 0.1287 0.3896 0.0050  -0.0013 -0.0060 44  VAL C C   
2526 O O   . VAL C 16  ? 0.3702 0.1226 0.3707 0.0098  0.0012  -0.0071 44  VAL C O   
2527 C CB  . VAL C 16  ? 0.4632 0.2016 0.4558 -0.0149 0.0079  0.0019  44  VAL C CB  
2528 C CG1 . VAL C 16  ? 0.4923 0.2188 0.4782 -0.0080 0.0060  0.0075  44  VAL C CG1 
2529 C CG2 . VAL C 16  ? 0.5369 0.2779 0.5262 -0.0323 0.0124  0.0017  44  VAL C CG2 
2530 N N   . HIS C 17  ? 0.4205 0.1264 0.3972 0.0140  -0.0081 -0.0077 45  HIS C N   
2531 C CA  . HIS C 17  ? 0.4304 0.1481 0.4111 0.0309  -0.0121 -0.0142 45  HIS C CA  
2532 C C   . HIS C 17  ? 0.4142 0.1496 0.4016 0.0333  -0.0113 -0.0219 45  HIS C C   
2533 O O   . HIS C 17  ? 0.4061 0.1715 0.4047 0.0362  -0.0067 -0.0218 45  HIS C O   
2534 C CB  . HIS C 17  ? 0.4341 0.1770 0.4261 0.0356  -0.0080 -0.0103 45  HIS C CB  
2535 C CG  . HIS C 17  ? 0.4894 0.2178 0.4746 0.0355  -0.0099 -0.0046 45  HIS C CG  
2536 N ND1 . HIS C 17  ? 0.5465 0.2507 0.5170 0.0459  -0.0191 -0.0073 45  HIS C ND1 
2537 C CD2 . HIS C 17  ? 0.5099 0.2427 0.4984 0.0277  -0.0052 0.0028  45  HIS C CD2 
2538 C CE1 . HIS C 17  ? 0.5982 0.2938 0.5630 0.0434  -0.0195 -0.0005 45  HIS C CE1 
2539 N NE2 . HIS C 17  ? 0.5528 0.2669 0.5292 0.0319  -0.0105 0.0051  45  HIS C NE2 
2540 N N   . PRO C 18  ? 0.4081 0.1228 0.3858 0.0304  -0.0162 -0.0283 46  PRO C N   
2541 C CA  . PRO C 18  ? 0.4119 0.1445 0.3954 0.0319  -0.0157 -0.0362 46  PRO C CA  
2542 C C   . PRO C 18  ? 0.4134 0.1660 0.4000 0.0490  -0.0181 -0.0449 46  PRO C C   
2543 O O   . PRO C 18  ? 0.4330 0.1732 0.4124 0.0624  -0.0251 -0.0511 46  PRO C O   
2544 C CB  . PRO C 18  ? 0.4432 0.1437 0.4129 0.0243  -0.0221 -0.0425 46  PRO C CB  
2545 C CG  . PRO C 18  ? 0.4663 0.1267 0.4180 0.0245  -0.0285 -0.0388 46  PRO C CG  
2546 C CD  . PRO C 18  ? 0.4479 0.1207 0.4066 0.0220  -0.0221 -0.0274 46  PRO C CD  
2547 N N   . VAL C 19  ? 0.4015 0.1868 0.3972 0.0491  -0.0129 -0.0458 47  VAL C N   
2548 C CA  . VAL C 19  ? 0.4023 0.2153 0.4005 0.0618  -0.0130 -0.0546 47  VAL C CA  
2549 C C   . VAL C 19  ? 0.4167 0.2395 0.4124 0.0633  -0.0145 -0.0641 47  VAL C C   
2550 O O   . VAL C 19  ? 0.4253 0.2457 0.4217 0.0530  -0.0130 -0.0605 47  VAL C O   
2551 C CB  . VAL C 19  ? 0.4050 0.2509 0.4116 0.0583  -0.0048 -0.0463 47  VAL C CB  
2552 C CG1 . VAL C 19  ? 0.4113 0.2509 0.4207 0.0590  -0.0046 -0.0406 47  VAL C CG1 
2553 C CG2 . VAL C 19  ? 0.4035 0.2561 0.4115 0.0459  0.0005  -0.0354 47  VAL C CG2 
2554 N N   . SER C 20  ? 0.4194 0.2567 0.4128 0.0775  -0.0183 -0.0782 48  SER C N   
2555 C CA  . SER C 20  ? 0.4411 0.2868 0.4303 0.0817  -0.0214 -0.0905 48  SER C CA  
2556 C C   . SER C 20  ? 0.4392 0.3326 0.4320 0.0838  -0.0141 -0.0920 48  SER C C   
2557 O O   . SER C 20  ? 0.4396 0.3596 0.4358 0.0928  -0.0121 -0.0978 48  SER C O   
2558 C CB  . SER C 20  ? 0.4939 0.3159 0.4737 0.0979  -0.0331 -0.1082 48  SER C CB  
2559 O OG  . SER C 20  ? 0.5737 0.3966 0.5480 0.1005  -0.0375 -0.1211 48  SER C OG  
2560 N N   . LEU C 21  ? 0.4288 0.3347 0.4197 0.0744  -0.0103 -0.0863 49  LEU C N   
2561 C CA  . LEU C 21  ? 0.4383 0.3842 0.4257 0.0732  -0.0039 -0.0856 49  LEU C CA  
2562 C C   . LEU C 21  ? 0.4617 0.4285 0.4447 0.0867  -0.0077 -0.1062 49  LEU C C   
2563 O O   . LEU C 21  ? 0.4457 0.3890 0.4269 0.0960  -0.0167 -0.1201 49  LEU C O   
2564 C CB  . LEU C 21  ? 0.4316 0.3778 0.4134 0.0612  -0.0016 -0.0725 49  LEU C CB  
2565 C CG  . LEU C 21  ? 0.4211 0.3482 0.4061 0.0506  0.0006  -0.0547 49  LEU C CG  
2566 C CD1 . LEU C 21  ? 0.4316 0.3577 0.4094 0.0447  -0.0007 -0.0457 49  LEU C CD1 
2567 C CD2 . LEU C 21  ? 0.4361 0.3751 0.4220 0.0458  0.0071  -0.0454 49  LEU C CD2 
2568 N N   . PRO C 22  ? 0.4946 0.5051 0.4736 0.0868  -0.0010 -0.1089 50  PRO C N   
2569 C CA  . PRO C 22  ? 0.4782 0.5144 0.4530 0.1008  -0.0042 -0.1306 50  PRO C CA  
2570 C C   . PRO C 22  ? 0.5033 0.5217 0.4711 0.1029  -0.0116 -0.1385 50  PRO C C   
2571 O O   . PRO C 22  ? 0.4727 0.4900 0.4382 0.1176  -0.0192 -0.1596 50  PRO C O   
2572 C CB  . PRO C 22  ? 0.4939 0.5816 0.4625 0.0928  0.0066  -0.1268 50  PRO C CB  
2573 C CG  . PRO C 22  ? 0.4824 0.5713 0.4559 0.0795  0.0140  -0.1090 50  PRO C CG  
2574 C CD  . PRO C 22  ? 0.4685 0.5069 0.4453 0.0736  0.0093  -0.0943 50  PRO C CD  
2575 N N   . CYS C 23  ? 0.4754 0.4792 0.4397 0.0894  -0.0108 -0.1235 51  CYS C N   
2576 C CA  . CYS C 23  ? 0.4951 0.4841 0.4554 0.0890  -0.0182 -0.1306 51  CYS C CA  
2577 C C   . CYS C 23  ? 0.5204 0.4656 0.4861 0.0893  -0.0270 -0.1373 51  CYS C C   
2578 O O   . CYS C 23  ? 0.5195 0.4523 0.4828 0.0865  -0.0336 -0.1458 51  CYS C O   
2579 C CB  . CYS C 23  ? 0.4990 0.4906 0.4544 0.0767  -0.0158 -0.1133 51  CYS C CB  
2580 S SG  . CYS C 23  ? 0.4648 0.4289 0.4289 0.0650  -0.0129 -0.0915 51  CYS C SG  
2581 N N   . LYS C 24  ? 0.5215 0.4443 0.4926 0.0906  -0.0271 -0.1332 52  LYS C N   
2582 C CA  . LYS C 24  ? 0.5602 0.4368 0.5309 0.0887  -0.0351 -0.1366 52  LYS C CA  
2583 C C   . LYS C 24  ? 0.5090 0.3650 0.4845 0.0706  -0.0331 -0.1218 52  LYS C C   
2584 O O   . LYS C 24  ? 0.5263 0.3451 0.4989 0.0641  -0.0384 -0.1231 52  LYS C O   
2585 C CB  . LYS C 24  ? 0.6311 0.4881 0.5926 0.0972  -0.0464 -0.1581 52  LYS C CB  
2586 C CG  . LYS C 24  ? 0.7471 0.6214 0.7042 0.1194  -0.0504 -0.1766 52  LYS C CG  
2587 C CD  . LYS C 24  ? 0.8876 0.7293 0.8326 0.1299  -0.0648 -0.1990 52  LYS C CD  
2588 C CE  . LYS C 24  ? 1.0382 0.9084 0.9796 0.1554  -0.0694 -0.2221 52  LYS C CE  
2589 N NZ  . LYS C 24  ? 1.0575 0.9468 1.0051 0.1696  -0.0664 -0.2214 52  LYS C NZ  
2590 N N   . HIS C 25  ? 0.4511 0.3295 0.4316 0.0626  -0.0263 -0.1083 53  HIS C N   
2591 C CA  . HIS C 25  ? 0.4315 0.2968 0.4186 0.0493  -0.0242 -0.0957 53  HIS C CA  
2592 C C   . HIS C 25  ? 0.4001 0.2502 0.3907 0.0478  -0.0202 -0.0842 53  HIS C C   
2593 O O   . HIS C 25  ? 0.3943 0.2556 0.3846 0.0554  -0.0168 -0.0812 53  HIS C O   
2594 C CB  . HIS C 25  ? 0.4195 0.3095 0.4085 0.0455  -0.0218 -0.0875 53  HIS C CB  
2595 C CG  . HIS C 25  ? 0.4534 0.3562 0.4397 0.0458  -0.0274 -0.0995 53  HIS C CG  
2596 N ND1 . HIS C 25  ? 0.4749 0.4035 0.4524 0.0531  -0.0280 -0.1020 53  HIS C ND1 
2597 C CD2 . HIS C 25  ? 0.4794 0.3731 0.4689 0.0383  -0.0330 -0.1109 53  HIS C CD2 
2598 C CE1 . HIS C 25  ? 0.5075 0.4432 0.4841 0.0524  -0.0343 -0.1148 53  HIS C CE1 
2599 N NE2 . HIS C 25  ? 0.5132 0.4289 0.4982 0.0428  -0.0374 -0.1209 53  HIS C NE2 
2600 N N   . VAL C 26  ? 0.4014 0.2287 0.3949 0.0367  -0.0208 -0.0795 54  VAL C N   
2601 C CA  . VAL C 26  ? 0.3988 0.2075 0.3934 0.0338  -0.0181 -0.0695 54  VAL C CA  
2602 C C   . VAL C 26  ? 0.3773 0.1940 0.3802 0.0239  -0.0127 -0.0572 54  VAL C C   
2603 O O   . VAL C 26  ? 0.3815 0.2043 0.3888 0.0151  -0.0132 -0.0593 54  VAL C O   
2604 C CB  . VAL C 26  ? 0.4374 0.2069 0.4226 0.0285  -0.0242 -0.0748 54  VAL C CB  
2605 C CG1 . VAL C 26  ? 0.4442 0.1943 0.4273 0.0258  -0.0222 -0.0638 54  VAL C CG1 
2606 C CG2 . VAL C 26  ? 0.4534 0.2098 0.4282 0.0424  -0.0325 -0.0892 54  VAL C CG2 
2607 N N   . PHE C 27  ? 0.3559 0.1742 0.3612 0.0262  -0.0085 -0.0466 55  PHE C N   
2608 C CA  . PHE C 27  ? 0.3523 0.1752 0.3640 0.0199  -0.0046 -0.0362 55  PHE C CA  
2609 C C   . PHE C 27  ? 0.3645 0.1735 0.3758 0.0196  -0.0020 -0.0287 55  PHE C C   
2610 O O   . PHE C 27  ? 0.3556 0.1593 0.3630 0.0268  -0.0031 -0.0302 55  PHE C O   
2611 C CB  . PHE C 27  ? 0.3277 0.1711 0.3394 0.0244  -0.0032 -0.0302 55  PHE C CB  
2612 C CG  . PHE C 27  ? 0.3305 0.1896 0.3391 0.0275  -0.0066 -0.0368 55  PHE C CG  
2613 C CD1 . PHE C 27  ? 0.3421 0.2123 0.3435 0.0335  -0.0068 -0.0406 55  PHE C CD1 
2614 C CD2 . PHE C 27  ? 0.3299 0.1973 0.3429 0.0249  -0.0099 -0.0407 55  PHE C CD2 
2615 C CE1 . PHE C 27  ? 0.3421 0.2273 0.3384 0.0365  -0.0103 -0.0466 55  PHE C CE1 
2616 C CE2 . PHE C 27  ? 0.3352 0.2186 0.3446 0.0290  -0.0143 -0.0473 55  PHE C CE2 
2617 C CZ  . PHE C 27  ? 0.3486 0.2389 0.3485 0.0346  -0.0145 -0.0495 55  PHE C CZ  
2618 N N   . CYS C 28  ? 0.3717 0.1787 0.3872 0.0132  0.0005  -0.0221 56  CYS C N   
2619 C CA  . CYS C 28  ? 0.3839 0.1816 0.3988 0.0136  0.0028  -0.0147 56  CYS C CA  
2620 C C   . CYS C 28  ? 0.3603 0.1704 0.3755 0.0208  0.0041  -0.0107 56  CYS C C   
2621 O O   . CYS C 28  ? 0.3377 0.1618 0.3526 0.0217  0.0047  -0.0085 56  CYS C O   
2622 C CB  . CYS C 28  ? 0.3637 0.1639 0.3835 0.0076  0.0056  -0.0096 56  CYS C CB  
2623 S SG  . CYS C 28  ? 0.3921 0.1959 0.4153 -0.0047 0.0067  -0.0152 56  CYS C SG  
2624 N N   . TYR C 29  ? 0.3340 0.1400 0.3479 0.0247  0.0041  -0.0099 57  TYR C N   
2625 C CA  . TYR C 29  ? 0.3422 0.1659 0.3577 0.0270  0.0067  -0.0069 57  TYR C CA  
2626 C C   . TYR C 29  ? 0.3252 0.1510 0.3409 0.0202  0.0092  0.0025  57  TYR C C   
2627 O O   . TYR C 29  ? 0.3090 0.1460 0.3203 0.0177  0.0105  0.0063  57  TYR C O   
2628 C CB  . TYR C 29  ? 0.3552 0.1774 0.3719 0.0316  0.0057  -0.0081 57  TYR C CB  
2629 C CG  . TYR C 29  ? 0.3494 0.1957 0.3698 0.0300  0.0091  -0.0063 57  TYR C CG  
2630 C CD1 . TYR C 29  ? 0.3498 0.2225 0.3701 0.0313  0.0114  -0.0113 57  TYR C CD1 
2631 C CD2 . TYR C 29  ? 0.3357 0.1809 0.3586 0.0250  0.0105  -0.0004 57  TYR C CD2 
2632 C CE1 . TYR C 29  ? 0.3689 0.2673 0.3912 0.0249  0.0158  -0.0096 57  TYR C CE1 
2633 C CE2 . TYR C 29  ? 0.3550 0.2231 0.3805 0.0195  0.0138  0.0006  57  TYR C CE2 
2634 C CZ  . TYR C 29  ? 0.3580 0.2534 0.3830 0.0179  0.0170  -0.0035 57  TYR C CZ  
2635 O OH  . TYR C 29  ? 0.3631 0.2852 0.3896 0.0077  0.0215  -0.0026 57  TYR C OH  
2636 N N   . LEU C 30  ? 0.3119 0.1249 0.3297 0.0173  0.0090  0.0059  58  LEU C N   
2637 C CA  . LEU C 30  ? 0.3241 0.1345 0.3405 0.0140  0.0090  0.0128  58  LEU C CA  
2638 C C   . LEU C 30  ? 0.3218 0.1332 0.3343 0.0156  0.0060  0.0137  58  LEU C C   
2639 O O   . LEU C 30  ? 0.3497 0.1546 0.3548 0.0151  0.0035  0.0197  58  LEU C O   
2640 C CB  . LEU C 30  ? 0.3241 0.1246 0.3438 0.0125  0.0093  0.0137  58  LEU C CB  
2641 C CG  . LEU C 30  ? 0.3340 0.1326 0.3542 0.0120  0.0104  0.0148  58  LEU C CG  
2642 C CD1 . LEU C 30  ? 0.3274 0.1167 0.3481 0.0103  0.0105  0.0156  58  LEU C CD1 
2643 C CD2 . LEU C 30  ? 0.3539 0.1606 0.3729 0.0088  0.0112  0.0186  58  LEU C CD2 
2644 N N   . CYS C 31  ? 0.3203 0.1375 0.3355 0.0178  0.0048  0.0073  59  CYS C N   
2645 C CA  . CYS C 31  ? 0.3302 0.1534 0.3416 0.0217  0.0006  0.0060  59  CYS C CA  
2646 C C   . CYS C 31  ? 0.3336 0.1621 0.3337 0.0220  0.0001  0.0097  59  CYS C C   
2647 O O   . CYS C 31  ? 0.3546 0.1793 0.3433 0.0240  -0.0041 0.0150  59  CYS C O   
2648 C CB  . CYS C 31  ? 0.3399 0.1722 0.3586 0.0216  -0.0004 -0.0038 59  CYS C CB  
2649 S SG  . CYS C 31  ? 0.3653 0.2008 0.3946 0.0178  0.0006  -0.0089 59  CYS C SG  
2650 N N   . VAL C 32  ? 0.3422 0.1797 0.3433 0.0207  0.0037  0.0063  60  VAL C N   
2651 C CA  . VAL C 32  ? 0.3493 0.1990 0.3396 0.0188  0.0054  0.0092  60  VAL C CA  
2652 C C   . VAL C 32  ? 0.3638 0.2073 0.3446 0.0107  0.0071  0.0205  60  VAL C C   
2653 O O   . VAL C 32  ? 0.3498 0.1915 0.3141 0.0059  0.0059  0.0282  60  VAL C O   
2654 C CB  . VAL C 32  ? 0.3682 0.2338 0.3632 0.0212  0.0086  0.0003  60  VAL C CB  
2655 C CG1 . VAL C 32  ? 0.3834 0.2706 0.3679 0.0175  0.0121  0.0019  60  VAL C CG1 
2656 C CG2 . VAL C 32  ? 0.3706 0.2352 0.3704 0.0274  0.0053  -0.0109 60  VAL C CG2 
2657 N N   . LYS C 33  ? 0.3578 0.1956 0.3463 0.0079  0.0094  0.0217  61  LYS C N   
2658 C CA  . LYS C 33  ? 0.3733 0.2040 0.3531 -0.0019 0.0105  0.0311  61  LYS C CA  
2659 C C   . LYS C 33  ? 0.3879 0.1928 0.3533 -0.0020 0.0037  0.0395  61  LYS C C   
2660 O O   . LYS C 33  ? 0.4158 0.2102 0.3620 -0.0112 0.0022  0.0490  61  LYS C O   
2661 C CB  . LYS C 33  ? 0.3659 0.1962 0.3577 -0.0031 0.0128  0.0289  61  LYS C CB  
2662 C CG  . LYS C 33  ? 0.3959 0.2258 0.3813 -0.0157 0.0148  0.0355  61  LYS C CG  
2663 C CD  . LYS C 33  ? 0.3743 0.2172 0.3736 -0.0154 0.0175  0.0297  61  LYS C CD  
2664 C CE  . LYS C 33  ? 0.4324 0.2748 0.4260 -0.0304 0.0189  0.0355  61  LYS C CE  
2665 N NZ  . LYS C 33  ? 0.4145 0.2798 0.4216 -0.0308 0.0214  0.0282  61  LYS C NZ  
2666 N N   . GLY C 34  ? 0.3750 0.1699 0.3475 0.0079  -0.0010 0.0352  62  GLY C N   
2667 C CA  . GLY C 34  ? 0.4122 0.1850 0.3725 0.0135  -0.0099 0.0392  62  GLY C CA  
2668 C C   . GLY C 34  ? 0.4359 0.2036 0.3773 0.0167  -0.0161 0.0436  62  GLY C C   
2669 O O   . GLY C 34  ? 0.5064 0.2480 0.4265 0.0178  -0.0246 0.0515  62  GLY C O   
2670 N N   . ALA C 35  ? 0.4226 0.2120 0.3690 0.0190  -0.0134 0.0380  63  ALA C N   
2671 C CA  . ALA C 35  ? 0.4769 0.2660 0.4050 0.0222  -0.0190 0.0412  63  ALA C CA  
2672 C C   . ALA C 35  ? 0.4968 0.2846 0.4034 0.0079  -0.0148 0.0523  63  ALA C C   
2673 O O   . ALA C 35  ? 0.5531 0.3308 0.4349 0.0075  -0.0205 0.0597  63  ALA C O   
2674 C CB  . ALA C 35  ? 0.4652 0.2801 0.4071 0.0289  -0.0176 0.0292  63  ALA C CB  
2675 N N   . SER C 36  ? 0.4752 0.2759 0.3901 -0.0039 -0.0051 0.0527  64  SER C N   
2676 C CA  . SER C 36  ? 0.5063 0.3163 0.4039 -0.0207 0.0009  0.0608  64  SER C CA  
2677 C C   . SER C 36  ? 0.6065 0.3804 0.4741 -0.0333 -0.0047 0.0768  64  SER C C   
2678 O O   . SER C 36  ? 0.6201 0.3919 0.4608 -0.0480 -0.0032 0.0871  64  SER C O   
2679 C CB  . SER C 36  ? 0.5184 0.3559 0.4351 -0.0283 0.0112  0.0543  64  SER C CB  
2680 O OG  . SER C 36  ? 0.5610 0.3817 0.4820 -0.0346 0.0109  0.0582  64  SER C OG  
2681 N N   . TRP C 37  ? 0.6234 0.3670 0.4923 -0.0286 -0.0115 0.0787  65  TRP C N   
2682 C CA  . TRP C 37  ? 0.7526 0.4520 0.5892 -0.0388 -0.0200 0.0930  65  TRP C CA  
2683 C C   . TRP C 37  ? 0.8371 0.5118 0.6397 -0.0342 -0.0308 0.1023  65  TRP C C   
2684 O O   . TRP C 37  ? 0.8820 0.5261 0.6477 -0.0505 -0.0348 0.1175  65  TRP C O   
2685 C CB  . TRP C 37  ? 0.7339 0.4033 0.5766 -0.0282 -0.0286 0.0901  65  TRP C CB  
2686 C CG  . TRP C 37  ? 0.7145 0.4048 0.5889 -0.0287 -0.0204 0.0804  65  TRP C CG  
2687 C CD1 . TRP C 37  ? 0.7151 0.4070 0.6110 -0.0123 -0.0232 0.0699  65  TRP C CD1 
2688 C CD2 . TRP C 37  ? 0.7541 0.4689 0.6405 -0.0457 -0.0089 0.0796  65  TRP C CD2 
2689 N NE1 . TRP C 37  ? 0.7336 0.4436 0.6507 -0.0182 -0.0148 0.0646  65  TRP C NE1 
2690 C CE2 . TRP C 37  ? 0.7208 0.4453 0.6335 -0.0369 -0.0068 0.0697  65  TRP C CE2 
2691 C CE3 . TRP C 37  ? 0.8645 0.5982 0.7418 -0.0675 -0.0003 0.0852  65  TRP C CE3 
2692 C CZ2 . TRP C 37  ? 0.7368 0.4855 0.6661 -0.0463 0.0016  0.0654  65  TRP C CZ2 
2693 C CZ3 . TRP C 37  ? 0.8927 0.6569 0.7903 -0.0769 0.0088  0.0788  65  TRP C CZ3 
2694 C CH2 . TRP C 37  ? 0.7876 0.5570 0.7105 -0.0648 0.0087  0.0691  65  TRP C CH2 
2695 N N   . LEU C 38  ? 0.8925 0.5804 0.7057 -0.0134 -0.0359 0.0932  66  LEU C N   
2696 C CA  . LEU C 38  ? 0.9726 0.6428 0.7561 -0.0047 -0.0475 0.0994  66  LEU C CA  
2697 C C   . LEU C 38  ? 0.9887 0.6881 0.7615 -0.0161 -0.0391 0.1024  66  LEU C C   
2698 O O   . LEU C 38  ? 0.9720 0.6600 0.7170 -0.0110 -0.0478 0.1085  66  LEU C O   
2699 C CB  . LEU C 38  ? 1.1070 0.7861 0.9096 0.0226  -0.0571 0.0853  66  LEU C CB  
2700 C CG  . LEU C 38  ? 1.1706 0.8342 0.9892 0.0373  -0.0645 0.0772  66  LEU C CG  
2701 C CD1 . LEU C 38  ? 1.1006 0.7927 0.9457 0.0591  -0.0689 0.0598  66  LEU C CD1 
2702 C CD2 . LEU C 38  ? 1.1759 0.7836 0.9575 0.0415  -0.0810 0.0884  66  LEU C CD2 
2703 N N   . GLY C 39  ? 0.9485 0.6874 0.7426 -0.0290 -0.0233 0.0966  67  GLY C N   
2704 C CA  . GLY C 39  ? 0.9626 0.7372 0.7502 -0.0378 -0.0145 0.0953  67  GLY C CA  
2705 C C   . GLY C 39  ? 0.8322 0.6308 0.6335 -0.0184 -0.0176 0.0820  67  GLY C C   
2706 O O   . GLY C 39  ? 0.7447 0.5622 0.5304 -0.0213 -0.0157 0.0824  67  GLY C O   
2707 N N   . LYS C 40  ? 0.8108 0.6111 0.6407 -0.0004 -0.0219 0.0695  68  LYS C N   
2708 C CA  . LYS C 40  ? 0.8682 0.6927 0.7136 0.0147  -0.0244 0.0550  68  LYS C CA  
2709 C C   . LYS C 40  ? 0.8184 0.6824 0.6766 0.0094  -0.0129 0.0445  68  LYS C C   
2710 O O   . LYS C 40  ? 0.8100 0.6883 0.6773 -0.0012 -0.0026 0.0438  68  LYS C O   
2711 C CB  . LYS C 40  ? 0.8248 0.6488 0.7004 0.0287  -0.0282 0.0427  68  LYS C CB  
2712 C CG  . LYS C 40  ? 0.8555 0.6486 0.7220 0.0392  -0.0409 0.0475  68  LYS C CG  
2713 C CD  . LYS C 40  ? 0.9698 0.7542 0.8130 0.0522  -0.0551 0.0492  68  LYS C CD  
2714 C CE  . LYS C 40  ? 0.9829 0.7300 0.8086 0.0644  -0.0703 0.0554  68  LYS C CE  
2715 N NZ  . LYS C 40  ? 0.9960 0.7317 0.7944 0.0800  -0.0868 0.0573  68  LYS C NZ  
2716 N N   . ARG C 41  ? 0.7839 0.6668 0.6418 0.0185  -0.0160 0.0348  69  ARG C N   
2717 C CA  . ARG C 41  ? 0.6441 0.5626 0.5159 0.0191  -0.0081 0.0200  69  ARG C CA  
2718 C C   . ARG C 41  ? 0.4930 0.4124 0.3959 0.0298  -0.0100 0.0047  69  ARG C C   
2719 O O   . ARG C 41  ? 0.4861 0.3857 0.3989 0.0322  -0.0135 0.0077  69  ARG C O   
2720 C CB  . ARG C 41  ? 0.6060 0.5407 0.4565 0.0219  -0.0116 0.0180  69  ARG C CB  
2721 C CG  . ARG C 41  ? 0.6524 0.5793 0.4645 0.0079  -0.0105 0.0367  69  ARG C CG  
2722 C CD  . ARG C 41  ? 0.6999 0.6402 0.4856 0.0108  -0.0151 0.0366  69  ARG C CD  
2723 N NE  . ARG C 41  ? 0.7133 0.6974 0.5116 0.0119  -0.0063 0.0192  69  ARG C NE  
2724 C CZ  . ARG C 41  ? 0.6877 0.7019 0.4682 0.0000  0.0028  0.0202  69  ARG C CZ  
2725 N NH1 . ARG C 41  ? 0.7698 0.7741 0.5146 -0.0188 0.0057  0.0405  69  ARG C NH1 
2726 N NH2 . ARG C 41  ? 0.6645 0.7191 0.4606 0.0065  0.0087  -0.0003 69  ARG C NH2 
2727 N N   . CYS C 42  ? 0.4917 0.4318 0.4077 0.0352  -0.0081 -0.0117 70  CYS C N   
2728 C CA  . CYS C 42  ? 0.4523 0.3864 0.3912 0.0416  -0.0114 -0.0246 70  CYS C CA  
2729 C C   . CYS C 42  ? 0.4355 0.3615 0.3741 0.0468  -0.0206 -0.0242 70  CYS C C   
2730 O O   . CYS C 42  ? 0.4513 0.3861 0.3756 0.0514  -0.0267 -0.0250 70  CYS C O   
2731 C CB  . CYS C 42  ? 0.4543 0.4048 0.4006 0.0467  -0.0112 -0.0429 70  CYS C CB  
2732 S SG  . CYS C 42  ? 0.4429 0.3800 0.4092 0.0489  -0.0169 -0.0575 70  CYS C SG  
2733 N N   . ALA C 43  ? 0.4256 0.3387 0.3798 0.0467  -0.0220 -0.0246 71  ALA C N   
2734 C CA  . ALA C 43  ? 0.4228 0.3350 0.3808 0.0528  -0.0306 -0.0269 71  ALA C CA  
2735 C C   . ALA C 43  ? 0.4138 0.3456 0.3800 0.0561  -0.0358 -0.0433 71  ALA C C   
2736 O O   . ALA C 43  ? 0.4014 0.3429 0.3656 0.0637  -0.0448 -0.0470 71  ALA C O   
2737 C CB  . ALA C 43  ? 0.4244 0.3255 0.3989 0.0502  -0.0287 -0.0259 71  ALA C CB  
2738 N N   . LEU C 44  ? 0.3984 0.3352 0.3728 0.0512  -0.0317 -0.0544 72  LEU C N   
2739 C CA  . LEU C 44  ? 0.4213 0.3733 0.4021 0.0514  -0.0368 -0.0711 72  LEU C CA  
2740 C C   . LEU C 44  ? 0.4312 0.3993 0.3957 0.0579  -0.0407 -0.0760 72  LEU C C   
2741 O O   . LEU C 44  ? 0.4266 0.4108 0.3902 0.0622  -0.0486 -0.0848 72  LEU C O   
2742 C CB  . LEU C 44  ? 0.4229 0.3640 0.4164 0.0424  -0.0331 -0.0818 72  LEU C CB  
2743 C CG  . LEU C 44  ? 0.4346 0.3659 0.4431 0.0331  -0.0308 -0.0807 72  LEU C CG  
2744 C CD1 . LEU C 44  ? 0.4219 0.3306 0.4334 0.0236  -0.0274 -0.0857 72  LEU C CD1 
2745 C CD2 . LEU C 44  ? 0.4351 0.3879 0.4543 0.0299  -0.0365 -0.0913 72  LEU C CD2 
2746 N N   . CYS C 45  ? 0.4222 0.3910 0.3740 0.0586  -0.0352 -0.0718 73  CYS C N   
2747 C CA  . CYS C 45  ? 0.4480 0.4365 0.3842 0.0637  -0.0379 -0.0789 73  CYS C CA  
2748 C C   . CYS C 45  ? 0.4521 0.4470 0.3626 0.0644  -0.0354 -0.0639 73  CYS C C   
2749 O O   . CYS C 45  ? 0.4411 0.4548 0.3358 0.0675  -0.0367 -0.0689 73  CYS C O   
2750 C CB  . CYS C 45  ? 0.4625 0.4552 0.4047 0.0641  -0.0349 -0.0954 73  CYS C CB  
2751 S SG  . CYS C 45  ? 0.4803 0.4720 0.4205 0.0635  -0.0244 -0.0898 73  CYS C SG  
2752 N N   . ARG C 46  ? 0.4619 0.4402 0.3667 0.0597  -0.0318 -0.0460 74  ARG C N   
2753 C CA  . ARG C 46  ? 0.5011 0.4774 0.3774 0.0548  -0.0296 -0.0285 74  ARG C CA  
2754 C C   . ARG C 46  ? 0.5135 0.5102 0.3815 0.0473  -0.0186 -0.0289 74  ARG C C   
2755 O O   . ARG C 46  ? 0.5479 0.5472 0.3897 0.0388  -0.0154 -0.0149 74  ARG C O   
2756 C CB  . ARG C 46  ? 0.5276 0.5052 0.3784 0.0613  -0.0404 -0.0237 74  ARG C CB  
2757 C CG  . ARG C 46  ? 0.5399 0.4985 0.3938 0.0703  -0.0523 -0.0201 74  ARG C CG  
2758 C CD  . ARG C 46  ? 0.5731 0.5361 0.4032 0.0813  -0.0659 -0.0196 74  ARG C CD  
2759 N NE  . ARG C 46  ? 0.6171 0.6105 0.4509 0.0839  -0.0659 -0.0367 74  ARG C NE  
2760 C CZ  . ARG C 46  ? 0.6190 0.6300 0.4791 0.0886  -0.0693 -0.0573 74  ARG C CZ  
2761 N NH1 . ARG C 46  ? 0.6101 0.6161 0.4962 0.0901  -0.0719 -0.0633 74  ARG C NH1 
2762 N NH2 . ARG C 46  ? 0.6622 0.6971 0.5212 0.0901  -0.0699 -0.0726 74  ARG C NH2 
2763 N N   . GLN C 47  ? 0.4895 0.5007 0.3773 0.0501  -0.0135 -0.0454 75  GLN C N   
2764 C CA  . GLN C 47  ? 0.5062 0.5441 0.3898 0.0463  -0.0038 -0.0499 75  GLN C CA  
2765 C C   . GLN C 47  ? 0.5037 0.5351 0.3902 0.0355  0.0043  -0.0367 75  GLN C C   
2766 O O   . GLN C 47  ? 0.4737 0.4774 0.3707 0.0338  0.0023  -0.0283 75  GLN C O   
2767 C CB  . GLN C 47  ? 0.4897 0.5422 0.3910 0.0572  -0.0043 -0.0744 75  GLN C CB  
2768 C CG  . GLN C 47  ? 0.5174 0.5846 0.4099 0.0650  -0.0110 -0.0884 75  GLN C CG  
2769 C CD  . GLN C 47  ? 0.5507 0.6279 0.4556 0.0765  -0.0136 -0.1142 75  GLN C CD  
2770 O OE1 . GLN C 47  ? 0.5608 0.6381 0.4780 0.0809  -0.0104 -0.1226 75  GLN C OE1 
2771 N NE2 . GLN C 47  ? 0.5743 0.6593 0.4737 0.0828  -0.0210 -0.1281 75  GLN C NE2 
2772 N N   . GLU C 48  ? 0.5386 0.5995 0.4149 0.0271  0.0136  -0.0356 76  GLU C N   
2773 C CA  . GLU C 48  ? 0.5884 0.6466 0.4617 0.0121  0.0212  -0.0211 76  GLU C CA  
2774 C C   . GLU C 48  ? 0.5461 0.6000 0.4482 0.0176  0.0232  -0.0295 76  GLU C C   
2775 O O   . GLU C 48  ? 0.5164 0.5831 0.4362 0.0315  0.0219  -0.0491 76  GLU C O   
2776 C CB  . GLU C 48  ? 0.6965 0.7953 0.5510 -0.0023 0.0319  -0.0189 76  GLU C CB  
2777 C CG  . GLU C 48  ? 0.7574 0.8486 0.5998 -0.0246 0.0388  0.0004  76  GLU C CG  
2778 C CD  . GLU C 48  ? 0.9877 1.1018 0.7951 -0.0467 0.0464  0.0125  76  GLU C CD  
2779 O OE1 . GLU C 48  ? 0.9361 1.0990 0.7401 -0.0463 0.0532  -0.0011 76  GLU C OE1 
2780 O OE2 . GLU C 48  ? 0.9829 1.0646 0.7635 -0.0653 0.0452  0.0356  76  GLU C OE2 
2781 N N   . ILE C 49  ? 0.4923 0.5232 0.3958 0.0078  0.0246  -0.0147 77  ILE C N   
2782 C CA  . ILE C 49  ? 0.5051 0.5353 0.4310 0.0100  0.0274  -0.0198 77  ILE C CA  
2783 C C   . ILE C 49  ? 0.5070 0.5725 0.4291 -0.0040 0.0377  -0.0181 77  ILE C C   
2784 O O   . ILE C 49  ? 0.5106 0.5724 0.4121 -0.0232 0.0416  -0.0012 77  ILE C O   
2785 C CB  . ILE C 49  ? 0.5009 0.4898 0.4320 0.0077  0.0228  -0.0071 77  ILE C CB  
2786 C CG1 . ILE C 49  ? 0.5057 0.4702 0.4430 0.0197  0.0138  -0.0116 77  ILE C CG1 
2787 C CG2 . ILE C 49  ? 0.5131 0.5025 0.4638 0.0088  0.0257  -0.0113 77  ILE C CG2 
2788 C CD1 . ILE C 49  ? 0.4991 0.4296 0.4389 0.0182  0.0089  -0.0004 77  ILE C CD1 
2789 N N   . PRO C 50  ? 0.4957 0.5957 0.4359 0.0050  0.0412  -0.0364 78  PRO C N   
2790 C CA  . PRO C 50  ? 0.5341 0.6796 0.4751 -0.0079 0.0515  -0.0390 78  PRO C CA  
2791 C C   . PRO C 50  ? 0.4823 0.6111 0.4183 -0.0293 0.0553  -0.0202 78  PRO C C   
2792 O O   . PRO C 50  ? 0.4493 0.5380 0.3934 -0.0259 0.0496  -0.0127 78  PRO C O   
2793 C CB  . PRO C 50  ? 0.5362 0.7061 0.5025 0.0132  0.0491  -0.0628 78  PRO C CB  
2794 C CG  . PRO C 50  ? 0.5219 0.6722 0.4905 0.0345  0.0398  -0.0754 78  PRO C CG  
2795 C CD  . PRO C 50  ? 0.5120 0.6120 0.4700 0.0284  0.0346  -0.0574 78  PRO C CD  
2796 N N   . GLU C 51  ? 0.5281 0.6888 0.4494 -0.0529 0.0651  -0.0135 79  GLU C N   
2797 C CA  . GLU C 51  ? 0.5803 0.7231 0.4908 -0.0782 0.0686  0.0049  79  GLU C CA  
2798 C C   . GLU C 51  ? 0.5332 0.6749 0.4705 -0.0720 0.0672  -0.0017 79  GLU C C   
2799 O O   . GLU C 51  ? 0.5303 0.6306 0.4640 -0.0800 0.0634  0.0122  79  GLU C O   
2800 C CB  . GLU C 51  ? 0.6900 0.8756 0.5789 -0.1087 0.0808  0.0106  79  GLU C CB  
2801 C CG  . GLU C 51  ? 0.8230 1.0258 0.7140 -0.1351 0.0884  0.0160  79  GLU C CG  
2802 C CD  . GLU C 51  ? 0.9741 1.1202 0.8334 -0.1621 0.0857  0.0434  79  GLU C CD  
2803 O OE1 . GLU C 51  ? 1.0407 1.1337 0.9054 -0.1527 0.0761  0.0509  79  GLU C OE1 
2804 O OE2 . GLU C 51  ? 0.9746 1.1288 0.8017 -0.1934 0.0927  0.0569  79  GLU C OE2 
2805 N N   . ASP C 52  ? 0.5099 0.6944 0.4722 -0.0549 0.0684  -0.0241 80  ASP C N   
2806 C CA  . ASP C 52  ? 0.5018 0.6891 0.4873 -0.0471 0.0659  -0.0317 80  ASP C CA  
2807 C C   . ASP C 52  ? 0.4423 0.5917 0.4425 -0.0186 0.0545  -0.0388 80  ASP C C   
2808 O O   . ASP C 52  ? 0.4132 0.5672 0.4311 -0.0063 0.0506  -0.0485 80  ASP C O   
2809 C CB  . ASP C 52  ? 0.5742 0.8350 0.5763 -0.0465 0.0728  -0.0525 80  ASP C CB  
2810 C CG  . ASP C 52  ? 0.7072 1.0050 0.6979 -0.0827 0.0851  -0.0438 80  ASP C CG  
2811 O OD1 . ASP C 52  ? 0.7955 1.0558 0.7741 -0.1047 0.0854  -0.0240 80  ASP C OD1 
2812 O OD2 . ASP C 52  ? 0.8749 1.2399 0.8678 -0.0901 0.0943  -0.0576 80  ASP C OD2 
2813 N N   . PHE C 53  ? 0.4220 0.5327 0.4128 -0.0100 0.0487  -0.0332 81  PHE C N   
2814 C CA  . PHE C 53  ? 0.4077 0.4839 0.4091 0.0120  0.0389  -0.0399 81  PHE C CA  
2815 C C   . PHE C 53  ? 0.4095 0.4502 0.4186 0.0121  0.0347  -0.0316 81  PHE C C   
2816 O O   . PHE C 53  ? 0.4015 0.4293 0.4212 0.0288  0.0282  -0.0408 81  PHE C O   
2817 C CB  . PHE C 53  ? 0.4176 0.4653 0.4075 0.0166  0.0344  -0.0358 81  PHE C CB  
2818 C CG  . PHE C 53  ? 0.3900 0.4082 0.3885 0.0354  0.0253  -0.0451 81  PHE C CG  
2819 C CD1 . PHE C 53  ? 0.3992 0.3761 0.4000 0.0345  0.0209  -0.0354 81  PHE C CD1 
2820 C CD2 . PHE C 53  ? 0.4111 0.4434 0.4139 0.0532  0.0209  -0.0645 81  PHE C CD2 
2821 C CE1 . PHE C 53  ? 0.4105 0.3599 0.4159 0.0466  0.0135  -0.0427 81  PHE C CE1 
2822 C CE2 . PHE C 53  ? 0.3890 0.3866 0.3947 0.0669  0.0116  -0.0718 81  PHE C CE2 
2823 C CZ  . PHE C 53  ? 0.3860 0.3424 0.3922 0.0616  0.0085  -0.0600 81  PHE C CZ  
2824 N N   . LEU C 54  ? 0.4018 0.4236 0.4027 -0.0060 0.0373  -0.0146 82  LEU C N   
2825 C CA  . LEU C 54  ? 0.4261 0.4181 0.4336 -0.0059 0.0337  -0.0082 82  LEU C CA  
2826 C C   . LEU C 54  ? 0.4115 0.4297 0.4338 -0.0029 0.0345  -0.0178 82  LEU C C   
2827 O O   . LEU C 54  ? 0.3799 0.3785 0.4104 0.0079  0.0289  -0.0201 82  LEU C O   
2828 C CB  . LEU C 54  ? 0.4821 0.4473 0.4752 -0.0245 0.0347  0.0098  82  LEU C CB  
2829 C CG  . LEU C 54  ? 0.5039 0.4368 0.4832 -0.0223 0.0302  0.0186  82  LEU C CG  
2830 C CD1 . LEU C 54  ? 0.5981 0.5000 0.5613 -0.0364 0.0281  0.0345  82  LEU C CD1 
2831 C CD2 . LEU C 54  ? 0.4708 0.3828 0.4608 -0.0052 0.0243  0.0124  82  LEU C CD2 
2832 N N   . ASP C 55  ? 0.3877 0.4526 0.4120 -0.0133 0.0412  -0.0236 83  ASP C N   
2833 C CA  . ASP C 55  ? 0.4209 0.5218 0.4612 -0.0095 0.0416  -0.0359 83  ASP C CA  
2834 C C   . ASP C 55  ? 0.4211 0.5427 0.4735 0.0188  0.0352  -0.0570 83  ASP C C   
2835 O O   . ASP C 55  ? 0.4231 0.5527 0.4872 0.0328  0.0293  -0.0671 83  ASP C O   
2836 C CB  . ASP C 55  ? 0.4603 0.6102 0.4991 -0.0339 0.0518  -0.0361 83  ASP C CB  
2837 C CG  . ASP C 55  ? 0.5829 0.7708 0.6394 -0.0348 0.0520  -0.0474 83  ASP C CG  
2838 O OD1 . ASP C 55  ? 0.6262 0.7851 0.6865 -0.0343 0.0470  -0.0417 83  ASP C OD1 
2839 O OD2 . ASP C 55  ? 0.6662 0.9175 0.7334 -0.0352 0.0570  -0.0638 83  ASP C OD2 
2840 N N   . LYS C 56  ? 0.4094 0.5354 0.4566 0.0289  0.0345  -0.0640 84  LYS C N   
2841 C CA  . LYS C 56  ? 0.4345 0.5744 0.4890 0.0571  0.0265  -0.0855 84  LYS C CA  
2842 C C   . LYS C 56  ? 0.4003 0.4967 0.4445 0.0688  0.0200  -0.0846 84  LYS C C   
2843 O O   . LYS C 56  ? 0.4102 0.5259 0.4504 0.0746  0.0209  -0.0946 84  LYS C O   
2844 C CB  . LYS C 56  ? 0.4919 0.7015 0.5526 0.0579  0.0329  -0.1032 84  LYS C CB  
2845 C CG  . LYS C 56  ? 0.5531 0.8182 0.6269 0.0465  0.0393  -0.1094 84  LYS C CG  
2846 C CD  . LYS C 56  ? 0.6421 0.9842 0.7218 0.0451  0.0473  -0.1284 84  LYS C CD  
2847 C CE  . LYS C 56  ? 0.7180 1.1256 0.8133 0.0321  0.0541  -0.1380 84  LYS C CE  
2848 N NZ  . LYS C 56  ? 0.7123 1.1256 0.8252 0.0588  0.0419  -0.1540 84  LYS C NZ  
2849 N N   . PRO C 57  ? 0.3826 0.4236 0.4223 0.0705  0.0137  -0.0737 85  PRO C N   
2850 C CA  . PRO C 57  ? 0.3914 0.3936 0.4217 0.0753  0.0088  -0.0716 85  PRO C CA  
2851 C C   . PRO C 57  ? 0.4156 0.4038 0.4440 0.0996  -0.0027 -0.0896 85  PRO C C   
2852 O O   . PRO C 57  ? 0.4450 0.4391 0.4777 0.1155  -0.0095 -0.1004 85  PRO C O   
2853 C CB  . PRO C 57  ? 0.3873 0.3446 0.4144 0.0652  0.0078  -0.0546 85  PRO C CB  
2854 C CG  . PRO C 57  ? 0.3892 0.3512 0.4234 0.0669  0.0065  -0.0540 85  PRO C CG  
2855 C CD  . PRO C 57  ? 0.3846 0.4014 0.4275 0.0670  0.0113  -0.0642 85  PRO C CD  
2856 N N   . THR C 58  ? 0.4091 0.3788 0.4294 0.1032  -0.0061 -0.0937 86  THR C N   
2857 C CA  . THR C 58  ? 0.4343 0.3748 0.4472 0.1229  -0.0189 -0.1085 86  THR C CA  
2858 C C   . THR C 58  ? 0.4436 0.3261 0.4476 0.1151  -0.0239 -0.0959 86  THR C C   
2859 O O   . THR C 58  ? 0.4319 0.2990 0.4329 0.1007  -0.0202 -0.0865 86  THR C O   
2860 C CB  . THR C 58  ? 0.4434 0.3966 0.4514 0.1279  -0.0198 -0.1209 86  THR C CB  
2861 O OG1 . THR C 58  ? 0.4493 0.4629 0.4645 0.1329  -0.0135 -0.1327 86  THR C OG1 
2862 C CG2 . THR C 58  ? 0.4927 0.4062 0.4891 0.1472  -0.0351 -0.1371 86  THR C CG2 
2863 N N   . LEU C 59  ? 0.4588 0.3124 0.4578 0.1240  -0.0323 -0.0959 87  LEU C N   
2864 C CA  . LEU C 59  ? 0.5172 0.3158 0.5036 0.1150  -0.0371 -0.0849 87  LEU C CA  
2865 C C   . LEU C 59  ? 0.5218 0.2832 0.4929 0.1197  -0.0469 -0.0944 87  LEU C C   
2866 O O   . LEU C 59  ? 0.5182 0.2835 0.4848 0.1390  -0.0556 -0.1120 87  LEU C O   
2867 C CB  . LEU C 59  ? 0.5434 0.3196 0.5233 0.1237  -0.0445 -0.0822 87  LEU C CB  
2868 C CG  . LEU C 59  ? 0.5983 0.4048 0.5923 0.1144  -0.0349 -0.0714 87  LEU C CG  
2869 C CD1 . LEU C 59  ? 0.6461 0.4473 0.6365 0.1304  -0.0441 -0.0757 87  LEU C CD1 
2870 C CD2 . LEU C 59  ? 0.6180 0.4063 0.6117 0.0916  -0.0268 -0.0532 87  LEU C CD2 
2871 N N   . LEU C 60  ? 0.5219 0.2501 0.4852 0.1016  -0.0457 -0.0845 88  LEU C N   
2872 C CA  . LEU C 60  ? 0.5436 0.2307 0.4899 0.1010  -0.0556 -0.0926 88  LEU C CA  
2873 C C   . LEU C 60  ? 0.6027 0.2391 0.5263 0.1156  -0.0715 -0.0981 88  LEU C C   
2874 O O   . LEU C 60  ? 0.6234 0.2364 0.5330 0.1313  -0.0844 -0.1140 88  LEU C O   
2875 C CB  . LEU C 60  ? 0.5245 0.1937 0.4688 0.0747  -0.0498 -0.0810 88  LEU C CB  
2876 C CG  . LEU C 60  ? 0.5763 0.2001 0.5015 0.0657  -0.0589 -0.0875 88  LEU C CG  
2877 C CD1 . LEU C 60  ? 0.5909 0.2283 0.5174 0.0758  -0.0634 -0.1049 88  LEU C CD1 
2878 C CD2 . LEU C 60  ? 0.5790 0.1965 0.5055 0.0370  -0.0513 -0.0759 88  LEU C CD2 
2879 N N   . SER C 61  ? 0.6230 0.2399 0.5403 0.1115  -0.0719 -0.0855 89  SER C N   
2880 C CA  . SER C 61  ? 0.7284 0.2916 0.6190 0.1248  -0.0882 -0.0871 89  SER C CA  
2881 C C   . SER C 61  ? 0.6889 0.2750 0.5872 0.1407  -0.0891 -0.0853 89  SER C C   
2882 O O   . SER C 61  ? 0.6655 0.2453 0.5626 0.1280  -0.0839 -0.0699 89  SER C O   
2883 C CB  . SER C 61  ? 0.7957 0.3043 0.6633 0.0994  -0.0892 -0.0717 89  SER C CB  
2884 O OG  . SER C 61  ? 0.8639 0.3577 0.7267 0.0815  -0.0876 -0.0744 89  SER C OG  
2885 N N   . PRO C 62  ? 0.6862 0.3049 0.5938 0.1684  -0.0955 -0.1029 90  PRO C N   
2886 C CA  . PRO C 62  ? 0.7014 0.3554 0.6217 0.1819  -0.0951 -0.1038 90  PRO C CA  
2887 C C   . PRO C 62  ? 0.7408 0.3489 0.6388 0.1879  -0.1069 -0.0949 90  PRO C C   
2888 O O   . PRO C 62  ? 0.6637 0.2958 0.5725 0.1834  -0.1006 -0.0861 90  PRO C O   
2889 C CB  . PRO C 62  ? 0.7324 0.4241 0.6615 0.2124  -0.1034 -0.1289 90  PRO C CB  
2890 C CG  . PRO C 62  ? 0.7266 0.4303 0.6606 0.2062  -0.0979 -0.1367 90  PRO C CG  
2891 C CD  . PRO C 62  ? 0.7094 0.3511 0.6229 0.1848  -0.0995 -0.1236 90  PRO C CD  
2892 N N   . GLU C 63  ? 0.7724 0.3124 0.6365 0.1970  -0.1246 -0.0970 91  GLU C N   
2893 C CA  . GLU C 63  ? 0.8461 0.3318 0.6802 0.2007  -0.1375 -0.0864 91  GLU C CA  
2894 C C   . GLU C 63  ? 0.8608 0.3297 0.6896 0.1664  -0.1243 -0.0621 91  GLU C C   
2895 O O   . GLU C 63  ? 0.8777 0.3317 0.6943 0.1663  -0.1277 -0.0515 91  GLU C O   
2896 C CB  . GLU C 63  ? 0.9672 0.3746 0.7596 0.2158  -0.1609 -0.0934 91  GLU C CB  
2897 C CG  . GLU C 63  ? 1.0302 0.4506 0.8232 0.2588  -0.1793 -0.1198 91  GLU C CG  
2898 C CD  . GLU C 63  ? 1.1299 0.5868 0.9336 0.2830  -0.1849 -0.1250 91  GLU C CD  
2899 O OE1 . GLU C 63  ? 1.1005 0.5046 0.8726 0.2918  -0.2006 -0.1167 91  GLU C OE1 
2900 O OE2 . GLU C 63  ? 1.1312 0.6702 0.9734 0.2905  -0.1734 -0.1366 91  GLU C OE2 
2901 N N   . GLU C 64  ? 0.8043 0.2795 0.6424 0.1385  -0.1098 -0.0547 92  GLU C N   
2902 C CA  . GLU C 64  ? 0.8089 0.2790 0.6459 0.1076  -0.0966 -0.0353 92  GLU C CA  
2903 C C   . GLU C 64  ? 0.7110 0.2359 0.5757 0.1059  -0.0838 -0.0295 92  GLU C C   
2904 O O   . GLU C 64  ? 0.7081 0.2250 0.5669 0.0891  -0.0777 -0.0156 92  GLU C O   
2905 C CB  . GLU C 64  ? 0.8500 0.3226 0.6936 0.0807  -0.0851 -0.0320 92  GLU C CB  
2906 C CG  . GLU C 64  ? 0.9669 0.3765 0.7777 0.0723  -0.0968 -0.0340 92  GLU C CG  
2907 C CD  . GLU C 64  ? 1.0899 0.4356 0.8607 0.0562  -0.1042 -0.0191 92  GLU C CD  
2908 O OE1 . GLU C 64  ? 1.0465 0.4056 0.8199 0.0418  -0.0944 -0.0054 92  GLU C OE1 
2909 O OE2 . GLU C 64  ? 1.1688 0.4482 0.9024 0.0569  -0.1204 -0.0211 92  GLU C OE2 
2910 N N   . LEU C 65  ? 0.6816 0.2604 0.5737 0.1221  -0.0804 -0.0408 93  LEU C N   
2911 C CA  . LEU C 65  ? 0.6960 0.3224 0.6116 0.1184  -0.0697 -0.0360 93  LEU C CA  
2912 C C   . LEU C 65  ? 0.6960 0.3097 0.5987 0.1333  -0.0806 -0.0349 93  LEU C C   
2913 O O   . LEU C 65  ? 0.6416 0.2673 0.5495 0.1229  -0.0740 -0.0251 93  LEU C O   
2914 C CB  . LEU C 65  ? 0.6341 0.3219 0.5795 0.1258  -0.0621 -0.0473 93  LEU C CB  
2915 C CG  . LEU C 65  ? 0.6299 0.3647 0.5962 0.1240  -0.0543 -0.0456 93  LEU C CG  
2916 C CD1 . LEU C 65  ? 0.5936 0.3320 0.5673 0.0988  -0.0407 -0.0301 93  LEU C CD1 
2917 C CD2 . LEU C 65  ? 0.6451 0.4374 0.6337 0.1325  -0.0499 -0.0593 93  LEU C CD2 
2918 N N   . LYS C 66  ? 0.7657 0.3554 0.6508 0.1596  -0.0988 -0.0465 94  LYS C N   
2919 C CA  . LYS C 66  ? 0.8263 0.3939 0.6920 0.1763  -0.1130 -0.0453 94  LYS C CA  
2920 C C   . LYS C 66  ? 0.8219 0.3340 0.6568 0.1554  -0.1132 -0.0253 94  LYS C C   
2921 O O   . LYS C 66  ? 0.7564 0.2737 0.5887 0.1505  -0.1111 -0.0161 94  LYS C O   
2922 C CB  . LYS C 66  ? 0.9686 0.5094 0.8145 0.2109  -0.1361 -0.0619 94  LYS C CB  
2923 C CG  . LYS C 66  ? 1.0525 0.6592 0.9284 0.2367  -0.1381 -0.0850 94  LYS C CG  
2924 C CD  . LYS C 66  ? 1.1499 0.7318 1.0093 0.2684  -0.1581 -0.1051 94  LYS C CD  
2925 C CE  . LYS C 66  ? 1.3417 0.8560 1.1592 0.2938  -0.1848 -0.1059 94  LYS C CE  
2926 N NZ  . LYS C 66  ? 1.3112 0.8637 1.1373 0.3303  -0.1997 -0.1245 94  LYS C NZ  
2927 N N   . ALA C 67  ? 0.8130 0.2756 0.6248 0.1410  -0.1149 -0.0193 95  ALA C N   
2928 C CA  . ALA C 67  ? 0.8892 0.3040 0.6711 0.1146  -0.1123 -0.0006 95  ALA C CA  
2929 C C   . ALA C 67  ? 0.7943 0.2516 0.6002 0.0894  -0.0915 0.0099  95  ALA C C   
2930 O O   . ALA C 67  ? 0.8390 0.2840 0.6297 0.0793  -0.0900 0.0217  95  ALA C O   
2931 C CB  . ALA C 67  ? 0.9274 0.2948 0.6873 0.0980  -0.1146 0.0015  95  ALA C CB  
2932 N N   . ALA C 68  ? 0.7731 0.2790 0.6141 0.0810  -0.0767 0.0050  96  ALA C N   
2933 C CA  . ALA C 68  ? 0.7237 0.2696 0.5879 0.0619  -0.0593 0.0123  96  ALA C CA  
2934 C C   . ALA C 68  ? 0.6834 0.2548 0.5565 0.0713  -0.0594 0.0135  96  ALA C C   
2935 O O   . ALA C 68  ? 0.7053 0.2841 0.5788 0.0565  -0.0511 0.0223  96  ALA C O   
2936 C CB  . ALA C 68  ? 0.6991 0.2881 0.5952 0.0572  -0.0477 0.0058  96  ALA C CB  
2937 N N   . SER C 69  ? 0.6435 0.2299 0.5229 0.0961  -0.0695 0.0028  97  SER C N   
2938 C CA  . SER C 69  ? 0.6402 0.2532 0.5281 0.1055  -0.0713 0.0015  97  SER C CA  
2939 C C   . SER C 69  ? 0.7241 0.2986 0.5804 0.1040  -0.0794 0.0122  97  SER C C   
2940 O O   . SER C 69  ? 0.6516 0.2467 0.5145 0.0986  -0.0744 0.0163  97  SER C O   
2941 C CB  . SER C 69  ? 0.6219 0.2673 0.5248 0.1321  -0.0807 -0.0150 97  SER C CB  
2942 O OG  . SER C 69  ? 0.7740 0.3830 0.6500 0.1561  -0.1006 -0.0205 97  SER C OG  
2943 N N   . ARG C 70  ? 0.7281 0.2443 0.5471 0.1077  -0.0922 0.0169  98  ARG C N   
2944 C CA  . ARG C 70  ? 0.7844 0.2552 0.5647 0.1019  -0.0999 0.0301  98  ARG C CA  
2945 C C   . ARG C 70  ? 0.8090 0.2713 0.5807 0.0677  -0.0843 0.0447  98  ARG C C   
2946 O O   . ARG C 70  ? 0.8024 0.2470 0.5498 0.0584  -0.0850 0.0557  98  ARG C O   
2947 C CB  . ARG C 70  ? 0.8502 0.2536 0.5870 0.1170  -0.1212 0.0309  98  ARG C CB  
2948 C CG  . ARG C 70  ? 0.8704 0.2837 0.6138 0.1553  -0.1390 0.0131  98  ARG C CG  
2949 C CD  . ARG C 70  ? 0.9877 0.3257 0.6811 0.1744  -0.1643 0.0140  98  ARG C CD  
2950 N NE  . ARG C 70  ? 1.0447 0.3305 0.7151 0.1576  -0.1648 0.0192  98  ARG C NE  
2951 C CZ  . ARG C 70  ? 1.1050 0.3895 0.7854 0.1697  -0.1695 0.0049  98  ARG C CZ  
2952 N NH1 . ARG C 70  ? 1.1292 0.4651 0.8425 0.1991  -0.1733 -0.0157 98  ARG C NH1 
2953 N NH2 . ARG C 70  ? 1.1561 0.3900 0.8127 0.1508  -0.1702 0.0104  98  ARG C NH2 
2954 N N   . GLY C 71  ? 0.7888 0.2661 0.5790 0.0500  -0.0712 0.0437  99  GLY C N   
2955 C CA  . GLY C 71  ? 0.7959 0.2862 0.5899 0.0205  -0.0547 0.0521  99  GLY C CA  
2956 C C   . GLY C 71  ? 0.8680 0.3087 0.6176 0.0010  -0.0578 0.0658  99  GLY C C   
2957 O O   . GLY C 71  ? 0.9145 0.3007 0.6309 0.0013  -0.0702 0.0692  99  GLY C O   
2958 N N   . ASN C 72  ? 0.8388 0.2948 0.5836 -0.0162 -0.0478 0.0735  100 ASN C N   
2959 C CA  . ASN C 72  ? 0.9252 0.3361 0.6231 -0.0383 -0.0497 0.0878  100 ASN C CA  
2960 C C   . ASN C 72  ? 0.9507 0.3139 0.6074 -0.0217 -0.0684 0.0956  100 ASN C C   
2961 O O   . ASN C 72  ? 0.9367 0.2586 0.5483 -0.0394 -0.0715 0.1095  100 ASN C O   
2962 C CB  . ASN C 72  ? 0.9542 0.4015 0.6583 -0.0648 -0.0317 0.0919  100 ASN C CB  
2963 C CG  . ASN C 72  ? 0.9204 0.4075 0.6429 -0.0522 -0.0282 0.0885  100 ASN C CG  
2964 O OD1 . ASN C 72  ? 0.8849 0.3558 0.5929 -0.0332 -0.0406 0.0905  100 ASN C OD1 
2965 N ND2 . ASN C 72  ? 0.8926 0.4321 0.6466 -0.0619 -0.0127 0.0818  100 ASN C ND2 
2966 N N   . GLY C 73  ? 0.9402 0.3127 0.6115 0.0115  -0.0808 0.0861  101 GLY C N   
2967 C CA  . GLY C 73  ? 0.9854 0.3180 0.6213 0.0338  -0.1014 0.0898  101 GLY C CA  
2968 C C   . GLY C 73  ? 1.0036 0.3602 0.6371 0.0367  -0.0999 0.0934  101 GLY C C   
2969 O O   . GLY C 73  ? 1.1027 0.4455 0.7204 0.0623  -0.1171 0.0914  101 GLY C O   
2970 N N   . GLU C 74  ? 0.9839 0.3790 0.6337 0.0129  -0.0806 0.0965  102 GLU C N   
2971 C CA  . GLU C 74  ? 0.9239 0.3387 0.5667 0.0122  -0.0785 0.0999  102 GLU C CA  
2972 C C   . GLU C 74  ? 0.8508 0.3335 0.5455 0.0208  -0.0682 0.0862  102 GLU C C   
2973 O O   . GLU C 74  ? 0.8303 0.3294 0.5339 0.0426  -0.0776 0.0793  102 GLU C O   
2974 C CB  . GLU C 74  ? 0.9785 0.3819 0.5915 -0.0214 -0.0665 0.1134  102 GLU C CB  
2975 C CG  . GLU C 74  ? 1.0601 0.4677 0.6495 -0.0209 -0.0689 0.1193  102 GLU C CG  
2976 C CD  . GLU C 74  ? 1.2017 0.6113 0.7653 -0.0558 -0.0541 0.1302  102 GLU C CD  
2977 O OE1 . GLU C 74  ? 1.2119 0.6326 0.7855 -0.0806 -0.0396 0.1304  102 GLU C OE1 
2978 O OE2 . GLU C 74  ? 1.2912 0.6953 0.8245 -0.0586 -0.0570 0.1376  102 GLU C OE2 
2979 N N   . TYR C 75  ? 0.7524 0.2725 0.4788 0.0039  -0.0502 0.0817  103 TYR C N   
2980 C CA  . TYR C 75  ? 0.7461 0.3217 0.5161 0.0097  -0.0413 0.0698  103 TYR C CA  
2981 C C   . TYR C 75  ? 0.6659 0.2655 0.4724 0.0071  -0.0323 0.0620  103 TYR C C   
2982 O O   . TYR C 75  ? 0.6676 0.2506 0.4684 -0.0046 -0.0283 0.0653  103 TYR C O   
2983 C CB  . TYR C 75  ? 0.7214 0.3211 0.4897 -0.0070 -0.0294 0.0713  103 TYR C CB  
2984 C CG  . TYR C 75  ? 0.7495 0.3545 0.5177 -0.0313 -0.0152 0.0741  103 TYR C CG  
2985 C CD1 . TYR C 75  ? 0.7491 0.3916 0.5552 -0.0345 -0.0041 0.0641  103 TYR C CD1 
2986 C CD2 . TYR C 75  ? 0.8258 0.3974 0.5544 -0.0517 -0.0140 0.0864  103 TYR C CD2 
2987 C CE1 . TYR C 75  ? 0.7548 0.4085 0.5634 -0.0546 0.0076  0.0640  103 TYR C CE1 
2988 C CE2 . TYR C 75  ? 0.8350 0.4190 0.5661 -0.0766 -0.0004 0.0870  103 TYR C CE2 
2989 C CZ  . TYR C 75  ? 0.8064 0.4349 0.5799 -0.0762 0.0101  0.0745  103 TYR C CZ  
2990 O OH  . TYR C 75  ? 0.8397 0.4881 0.6191 -0.0981 0.0225  0.0721  103 TYR C OH  
2991 N N   . ALA C 76  ? 0.5859 0.2236 0.4275 0.0165  -0.0292 0.0517  104 ALA C N   
2992 C CA  . ALA C 76  ? 0.5160 0.1757 0.3882 0.0137  -0.0211 0.0454  104 ALA C CA  
2993 C C   . ALA C 76  ? 0.4531 0.1499 0.3534 0.0148  -0.0152 0.0375  104 ALA C C   
2994 O O   . ALA C 76  ? 0.4398 0.1469 0.3389 0.0198  -0.0187 0.0351  104 ALA C O   
2995 C CB  . ALA C 76  ? 0.5425 0.1946 0.4219 0.0281  -0.0292 0.0413  104 ALA C CB  
2996 N N   . TRP C 77  ? 0.4122 0.1255 0.3349 0.0101  -0.0077 0.0335  105 TRP C N   
2997 C CA  . TRP C 77  ? 0.3887 0.1281 0.3349 0.0111  -0.0041 0.0265  105 TRP C CA  
2998 C C   . TRP C 77  ? 0.3686 0.1187 0.3322 0.0190  -0.0076 0.0223  105 TRP C C   
2999 O O   . TRP C 77  ? 0.3854 0.1297 0.3506 0.0220  -0.0087 0.0230  105 TRP C O   
3000 C CB  . TRP C 77  ? 0.3877 0.1370 0.3430 0.0020  0.0045  0.0244  105 TRP C CB  
3001 C CG  . TRP C 77  ? 0.4015 0.1546 0.3440 -0.0059 0.0091  0.0245  105 TRP C CG  
3002 C CD1 . TRP C 77  ? 0.4252 0.1679 0.3477 -0.0169 0.0125  0.0302  105 TRP C CD1 
3003 C CD2 . TRP C 77  ? 0.4153 0.1844 0.3616 -0.0051 0.0105  0.0180  105 TRP C CD2 
3004 N NE1 . TRP C 77  ? 0.4517 0.2088 0.3665 -0.0236 0.0175  0.0275  105 TRP C NE1 
3005 C CE2 . TRP C 77  ? 0.4309 0.2048 0.3609 -0.0146 0.0160  0.0190  105 TRP C CE2 
3006 C CE3 . TRP C 77  ? 0.4351 0.2140 0.3953 0.0013  0.0076  0.0107  105 TRP C CE3 
3007 C CZ2 . TRP C 77  ? 0.4661 0.2588 0.3955 -0.0147 0.0186  0.0113  105 TRP C CZ2 
3008 C CZ3 . TRP C 77  ? 0.4896 0.2804 0.4479 0.0017  0.0086  0.0032  105 TRP C CZ3 
3009 C CH2 . TRP C 77  ? 0.5235 0.3235 0.4675 -0.0048 0.0142  0.0027  105 TRP C CH2 
3010 N N   . TYR C 78  ? 0.3471 0.1144 0.3227 0.0205  -0.0091 0.0172  106 TYR C N   
3011 C CA  . TYR C 78  ? 0.3323 0.1163 0.3227 0.0238  -0.0116 0.0126  106 TYR C CA  
3012 C C   . TYR C 78  ? 0.3240 0.1191 0.3273 0.0150  -0.0081 0.0097  106 TYR C C   
3013 O O   . TYR C 78  ? 0.3185 0.1100 0.3188 0.0114  -0.0075 0.0083  106 TYR C O   
3014 C CB  . TYR C 78  ? 0.3408 0.1354 0.3287 0.0335  -0.0201 0.0081  106 TYR C CB  
3015 C CG  . TYR C 78  ? 0.3648 0.1413 0.3347 0.0458  -0.0277 0.0105  106 TYR C CG  
3016 C CD1 . TYR C 78  ? 0.3816 0.1365 0.3284 0.0469  -0.0313 0.0161  106 TYR C CD1 
3017 C CD2 . TYR C 78  ? 0.3646 0.1428 0.3370 0.0563  -0.0323 0.0071  106 TYR C CD2 
3018 C CE1 . TYR C 78  ? 0.4207 0.1487 0.3438 0.0572  -0.0404 0.0202  106 TYR C CE1 
3019 C CE2 . TYR C 78  ? 0.3954 0.1484 0.3470 0.0695  -0.0421 0.0087  106 TYR C CE2 
3020 C CZ  . TYR C 78  ? 0.4237 0.1484 0.3490 0.0696  -0.0468 0.0161  106 TYR C CZ  
3021 O OH  . TYR C 78  ? 0.4904 0.1808 0.3884 0.0819  -0.0587 0.0193  106 TYR C OH  
3022 N N   . TYR C 79  ? 0.3202 0.1264 0.3345 0.0114  -0.0065 0.0086  107 TYR C N   
3023 C CA  . TYR C 79  ? 0.3217 0.1313 0.3423 0.0006  -0.0050 0.0074  107 TYR C CA  
3024 C C   . TYR C 79  ? 0.3169 0.1515 0.3468 -0.0044 -0.0063 0.0030  107 TYR C C   
3025 O O   . TYR C 79  ? 0.3146 0.1665 0.3495 0.0018  -0.0067 0.0004  107 TYR C O   
3026 C CB  . TYR C 79  ? 0.3213 0.1180 0.3413 -0.0034 -0.0012 0.0117  107 TYR C CB  
3027 C CG  . TYR C 79  ? 0.3422 0.1464 0.3659 -0.0023 0.0013  0.0140  107 TYR C CG  
3028 C CD1 . TYR C 79  ? 0.3216 0.1209 0.3427 0.0057  0.0022  0.0150  107 TYR C CD1 
3029 C CD2 . TYR C 79  ? 0.3348 0.1512 0.3625 -0.0110 0.0029  0.0145  107 TYR C CD2 
3030 C CE1 . TYR C 79  ? 0.3297 0.1353 0.3535 0.0077  0.0037  0.0151  107 TYR C CE1 
3031 C CE2 . TYR C 79  ? 0.3431 0.1699 0.3732 -0.0093 0.0056  0.0151  107 TYR C CE2 
3032 C CZ  . TYR C 79  ? 0.3188 0.1399 0.3477 0.0016  0.0055  0.0146  107 TYR C CZ  
3033 O OH  . TYR C 79  ? 0.3466 0.1778 0.3775 0.0044  0.0072  0.0133  107 TYR C OH  
3034 N N   . GLU C 80  ? 0.3357 0.1729 0.3674 -0.0168 -0.0070 0.0009  108 GLU C N   
3035 C CA  . GLU C 80  ? 0.3382 0.2041 0.3787 -0.0267 -0.0077 -0.0048 108 GLU C CA  
3036 C C   . GLU C 80  ? 0.3306 0.2125 0.3758 -0.0350 -0.0026 -0.0029 108 GLU C C   
3037 O O   . GLU C 80  ? 0.3329 0.1951 0.3711 -0.0420 0.0004  0.0043  108 GLU C O   
3038 C CB  . GLU C 80  ? 0.3846 0.2406 0.4215 -0.0423 -0.0099 -0.0065 108 GLU C CB  
3039 C CG  . GLU C 80  ? 0.4192 0.3068 0.4647 -0.0578 -0.0107 -0.0138 108 GLU C CG  
3040 C CD  . GLU C 80  ? 0.5358 0.4033 0.5731 -0.0774 -0.0135 -0.0144 108 GLU C CD  
3041 O OE1 . GLU C 80  ? 0.4534 0.2821 0.4784 -0.0743 -0.0165 -0.0109 108 GLU C OE1 
3042 O OE2 . GLU C 80  ? 0.5716 0.4636 0.6145 -0.0961 -0.0134 -0.0199 108 GLU C OE2 
3043 N N   . GLY C 81  ? 0.3213 0.2416 0.3776 -0.0330 -0.0025 -0.0107 109 GLY C N   
3044 C CA  . GLY C 81  ? 0.3459 0.2941 0.4079 -0.0445 0.0031  -0.0120 109 GLY C CA  
3045 C C   . GLY C 81  ? 0.3610 0.3513 0.4338 -0.0597 0.0035  -0.0216 109 GLY C C   
3046 O O   . GLY C 81  ? 0.3623 0.3537 0.4369 -0.0622 -0.0011 -0.0261 109 GLY C O   
3047 N N   . ARG C 82  ? 0.3791 0.4077 0.4588 -0.0712 0.0094  -0.0258 110 ARG C N   
3048 C CA  . ARG C 82  ? 0.4337 0.5145 0.5262 -0.0877 0.0112  -0.0373 110 ARG C CA  
3049 C C   . ARG C 82  ? 0.3977 0.5201 0.5071 -0.0621 0.0044  -0.0538 110 ARG C C   
3050 O O   . ARG C 82  ? 0.3707 0.5062 0.4844 -0.0398 0.0027  -0.0592 110 ARG C O   
3051 C CB  . ARG C 82  ? 0.5161 0.6295 0.6089 -0.1095 0.0210  -0.0369 110 ARG C CB  
3052 C CG  . ARG C 82  ? 0.6248 0.7991 0.7305 -0.1339 0.0251  -0.0493 110 ARG C CG  
3053 C CD  . ARG C 82  ? 0.7887 1.0045 0.8942 -0.1556 0.0361  -0.0503 110 ARG C CD  
3054 N NE  . ARG C 82  ? 0.9524 1.1172 1.0313 -0.1780 0.0412  -0.0302 110 ARG C NE  
3055 C CZ  . ARG C 82  ? 1.1109 1.2474 1.1781 -0.1662 0.0429  -0.0203 110 ARG C CZ  
3056 N NH1 . ARG C 82  ? 1.2367 1.3882 1.3159 -0.1340 0.0409  -0.0284 110 ARG C NH1 
3057 N NH2 . ARG C 82  ? 1.2112 1.3015 1.2523 -0.1865 0.0454  -0.0027 110 ARG C NH2 
3058 N N   . ASN C 83  ? 0.3998 0.5383 0.5161 -0.0637 -0.0014 -0.0623 111 ASN C N   
3059 C CA  . ASN C 83  ? 0.4015 0.5799 0.5316 -0.0387 -0.0106 -0.0789 111 ASN C CA  
3060 C C   . ASN C 83  ? 0.4267 0.5730 0.5478 -0.0037 -0.0189 -0.0765 111 ASN C C   
3061 O O   . ASN C 83  ? 0.4760 0.6512 0.6044 0.0199  -0.0250 -0.0887 111 ASN C O   
3062 C CB  . ASN C 83  ? 0.4157 0.6697 0.5658 -0.0426 -0.0070 -0.0964 111 ASN C CB  
3063 C CG  . ASN C 83  ? 0.4385 0.7297 0.5960 -0.0820 0.0013  -0.0998 111 ASN C CG  
3064 O OD1 . ASN C 83  ? 0.4670 0.7416 0.6205 -0.0993 -0.0008 -0.0970 111 ASN C OD1 
3065 N ND2 . ASN C 83  ? 0.4848 0.8274 0.6517 -0.0978 0.0106  -0.1068 111 ASN C ND2 
3066 N N   . GLY C 84  ? 0.4236 0.5098 0.5272 -0.0009 -0.0197 -0.0615 112 GLY C N   
3067 C CA  . GLY C 84  ? 0.4081 0.4586 0.4990 0.0254  -0.0264 -0.0569 112 GLY C CA  
3068 C C   . GLY C 84  ? 0.3948 0.3886 0.4692 0.0199  -0.0221 -0.0402 112 GLY C C   
3069 O O   . GLY C 84  ? 0.4054 0.3856 0.4782 -0.0007 -0.0146 -0.0324 112 GLY C O   
3070 N N   . TRP C 85  ? 0.3683 0.3292 0.4286 0.0385  -0.0279 -0.0355 113 TRP C N   
3071 C CA  . TRP C 85  ? 0.3656 0.2803 0.4113 0.0350  -0.0241 -0.0223 113 TRP C CA  
3072 C C   . TRP C 85  ? 0.3533 0.2548 0.3956 0.0411  -0.0214 -0.0188 113 TRP C C   
3073 O O   . TRP C 85  ? 0.3876 0.2984 0.4297 0.0575  -0.0274 -0.0258 113 TRP C O   
3074 C CB  . TRP C 85  ? 0.3779 0.2646 0.4064 0.0468  -0.0313 -0.0186 113 TRP C CB  
3075 C CG  . TRP C 85  ? 0.3832 0.2763 0.4115 0.0410  -0.0339 -0.0210 113 TRP C CG  
3076 C CD1 . TRP C 85  ? 0.4120 0.3255 0.4409 0.0510  -0.0431 -0.0297 113 TRP C CD1 
3077 C CD2 . TRP C 85  ? 0.3839 0.2625 0.4101 0.0259  -0.0285 -0.0164 113 TRP C CD2 
3078 N NE1 . TRP C 85  ? 0.4213 0.3346 0.4491 0.0407  -0.0429 -0.0303 113 TRP C NE1 
3079 C CE2 . TRP C 85  ? 0.3985 0.2887 0.4240 0.0260  -0.0343 -0.0225 113 TRP C CE2 
3080 C CE3 . TRP C 85  ? 0.3852 0.2419 0.4092 0.0148  -0.0210 -0.0091 113 TRP C CE3 
3081 C CZ2 . TRP C 85  ? 0.4231 0.3025 0.4457 0.0144  -0.0323 -0.0222 113 TRP C CZ2 
3082 C CZ3 . TRP C 85  ? 0.4011 0.2470 0.4220 0.0058  -0.0200 -0.0092 113 TRP C CZ3 
3083 C CH2 . TRP C 85  ? 0.4134 0.2695 0.4333 0.0054  -0.0254 -0.0158 113 TRP C CH2 
3084 N N   . TRP C 86  ? 0.3366 0.2156 0.3752 0.0298  -0.0141 -0.0096 114 TRP C N   
3085 C CA  . TRP C 86  ? 0.3238 0.1835 0.3563 0.0344  -0.0121 -0.0053 114 TRP C CA  
3086 C C   . TRP C 86  ? 0.3382 0.1616 0.3549 0.0372  -0.0136 0.0020  114 TRP C C   
3087 O O   . TRP C 86  ? 0.3470 0.1607 0.3600 0.0299  -0.0118 0.0059  114 TRP C O   
3088 C CB  . TRP C 86  ? 0.3042 0.1648 0.3414 0.0202  -0.0039 -0.0005 114 TRP C CB  
3089 C CG  . TRP C 86  ? 0.3097 0.2034 0.3574 0.0128  -0.0003 -0.0054 114 TRP C CG  
3090 C CD1 . TRP C 86  ? 0.3084 0.2172 0.3605 -0.0044 0.0033  -0.0046 114 TRP C CD1 
3091 C CD2 . TRP C 86  ? 0.3169 0.2325 0.3694 0.0200  0.0003  -0.0119 114 TRP C CD2 
3092 N NE1 . TRP C 86  ? 0.3305 0.2723 0.3895 -0.0109 0.0074  -0.0093 114 TRP C NE1 
3093 C CE2 . TRP C 86  ? 0.3261 0.2757 0.3868 0.0053  0.0058  -0.0148 114 TRP C CE2 
3094 C CE3 . TRP C 86  ? 0.3226 0.2317 0.3717 0.0369  -0.0038 -0.0166 114 TRP C CE3 
3095 C CZ2 . TRP C 86  ? 0.3345 0.3181 0.4015 0.0075  0.0088  -0.0228 114 TRP C CZ2 
3096 C CZ3 . TRP C 86  ? 0.3106 0.2496 0.3663 0.0419  -0.0025 -0.0257 114 TRP C CZ3 
3097 C CH2 . TRP C 86  ? 0.3268 0.3061 0.3924 0.0277  0.0043  -0.0291 114 TRP C CH2 
3098 N N   . GLN C 87  ? 0.3546 0.1584 0.3603 0.0463  -0.0172 0.0030  115 GLN C N   
3099 C CA  . GLN C 87  ? 0.3633 0.1350 0.3529 0.0423  -0.0163 0.0108  115 GLN C CA  
3100 C C   . GLN C 87  ? 0.3486 0.1178 0.3441 0.0307  -0.0077 0.0145  115 GLN C C   
3101 O O   . GLN C 87  ? 0.3511 0.1292 0.3546 0.0311  -0.0056 0.0122  115 GLN C O   
3102 C CB  . GLN C 87  ? 0.3904 0.1355 0.3613 0.0534  -0.0247 0.0111  115 GLN C CB  
3103 C CG  . GLN C 87  ? 0.4118 0.1234 0.3598 0.0460  -0.0250 0.0199  115 GLN C CG  
3104 C CD  . GLN C 87  ? 0.4754 0.1515 0.3970 0.0567  -0.0367 0.0215  115 GLN C CD  
3105 O OE1 . GLN C 87  ? 0.4832 0.1594 0.3994 0.0738  -0.0478 0.0164  115 GLN C OE1 
3106 N NE2 . GLN C 87  ? 0.5012 0.1461 0.4047 0.0463  -0.0355 0.0280  115 GLN C NE2 
3107 N N   . TYR C 88  ? 0.3310 0.0918 0.3226 0.0219  -0.0033 0.0188  116 TYR C N   
3108 C CA  . TYR C 88  ? 0.3249 0.0833 0.3197 0.0143  0.0025  0.0204  116 TYR C CA  
3109 C C   . TYR C 88  ? 0.3757 0.1194 0.3622 0.0142  0.0017  0.0213  116 TYR C C   
3110 O O   . TYR C 88  ? 0.3562 0.0805 0.3268 0.0161  -0.0027 0.0233  116 TYR C O   
3111 C CB  . TYR C 88  ? 0.3248 0.0820 0.3160 0.0075  0.0062  0.0215  116 TYR C CB  
3112 C CG  . TYR C 88  ? 0.3249 0.0933 0.3253 0.0069  0.0069  0.0186  116 TYR C CG  
3113 C CD1 . TYR C 88  ? 0.3120 0.0848 0.3205 0.0057  0.0086  0.0169  116 TYR C CD1 
3114 C CD2 . TYR C 88  ? 0.3237 0.0944 0.3216 0.0081  0.0042  0.0173  116 TYR C CD2 
3115 C CE1 . TYR C 88  ? 0.3284 0.1018 0.3399 0.0057  0.0067  0.0143  116 TYR C CE1 
3116 C CE2 . TYR C 88  ? 0.3396 0.1149 0.3432 0.0066  0.0034  0.0138  116 TYR C CE2 
3117 C CZ  . TYR C 88  ? 0.3254 0.0990 0.3345 0.0053  0.0043  0.0126  116 TYR C CZ  
3118 O OH  . TYR C 88  ? 0.3638 0.1328 0.3735 0.0044  0.0012  0.0093  116 TYR C OH  
3119 N N   . ASP C 89  ? 0.3655 0.1152 0.3599 0.0114  0.0049  0.0197  117 ASP C N   
3120 C CA  . ASP C 89  ? 0.4221 0.1583 0.4089 0.0075  0.0049  0.0194  117 ASP C CA  
3121 C C   . ASP C 89  ? 0.4479 0.1727 0.4225 -0.0039 0.0077  0.0227  117 ASP C C   
3122 O O   . ASP C 89  ? 0.4034 0.1392 0.3806 -0.0082 0.0116  0.0232  117 ASP C O   
3123 C CB  . ASP C 89  ? 0.4207 0.1706 0.4191 0.0058  0.0081  0.0163  117 ASP C CB  
3124 C CG  . ASP C 89  ? 0.4184 0.1805 0.4235 -0.0006 0.0127  0.0157  117 ASP C CG  
3125 O OD1 . ASP C 89  ? 0.4604 0.2332 0.4732 0.0023  0.0132  0.0155  117 ASP C OD1 
3126 O OD2 . ASP C 89  ? 0.4562 0.2173 0.4577 -0.0091 0.0152  0.0143  117 ASP C OD2 
3127 N N   . GLU C 90  ? 0.4548 0.1578 0.4144 -0.0101 0.0056  0.0240  118 GLU C N   
3128 C CA  . GLU C 90  ? 0.5009 0.1905 0.4432 -0.0256 0.0084  0.0283  118 GLU C CA  
3129 C C   . GLU C 90  ? 0.4334 0.1513 0.3876 -0.0377 0.0176  0.0249  118 GLU C C   
3130 O O   . GLU C 90  ? 0.4495 0.1727 0.3956 -0.0475 0.0219  0.0268  118 GLU C O   
3131 C CB  . GLU C 90  ? 0.5825 0.2376 0.5033 -0.0331 0.0033  0.0304  118 GLU C CB  
3132 C CG  . GLU C 90  ? 0.6531 0.3185 0.5843 -0.0414 0.0067  0.0245  118 GLU C CG  
3133 C CD  . GLU C 90  ? 0.8578 0.4847 0.7656 -0.0509 0.0007  0.0255  118 GLU C CD  
3134 O OE1 . GLU C 90  ? 0.8648 0.4737 0.7520 -0.0719 0.0029  0.0306  118 GLU C OE1 
3135 O OE2 . GLU C 90  ? 0.7530 0.3672 0.6613 -0.0386 -0.0065 0.0205  118 GLU C OE2 
3136 N N   . ARG C 91  ? 0.4371 0.1756 0.4094 -0.0357 0.0198  0.0186  119 ARG C N   
3137 C CA  . ARG C 91  ? 0.4575 0.2259 0.4418 -0.0434 0.0261  0.0123  119 ARG C CA  
3138 C C   . ARG C 91  ? 0.4201 0.2071 0.4133 -0.0353 0.0277  0.0101  119 ARG C C   
3139 O O   . ARG C 91  ? 0.4219 0.2261 0.4138 -0.0431 0.0328  0.0067  119 ARG C O   
3140 C CB  . ARG C 91  ? 0.5016 0.2841 0.5004 -0.0393 0.0251  0.0059  119 ARG C CB  
3141 C CG  . ARG C 91  ? 0.5556 0.3730 0.5690 -0.0425 0.0290  -0.0035 119 ARG C CG  
3142 C CD  . ARG C 91  ? 0.5809 0.4066 0.6037 -0.0388 0.0260  -0.0089 119 ARG C CD  
3143 N NE  . ARG C 91  ? 0.6360 0.4528 0.6502 -0.0554 0.0273  -0.0101 119 ARG C NE  
3144 C CZ  . ARG C 91  ? 0.6201 0.4280 0.6340 -0.0545 0.0234  -0.0124 119 ARG C CZ  
3145 N NH1 . ARG C 91  ? 0.6699 0.4802 0.6916 -0.0380 0.0189  -0.0132 119 ARG C NH1 
3146 N NH2 . ARG C 91  ? 0.5347 0.3298 0.5378 -0.0720 0.0239  -0.0141 119 ARG C NH2 
3147 N N   . THR C 92  ? 0.4157 0.1988 0.4157 -0.0213 0.0233  0.0114  120 THR C N   
3148 C CA  . THR C 92  ? 0.3991 0.1922 0.4048 -0.0139 0.0228  0.0089  120 THR C CA  
3149 C C   . THR C 92  ? 0.4203 0.2062 0.4133 -0.0180 0.0239  0.0124  120 THR C C   
3150 O O   . THR C 92  ? 0.3912 0.1906 0.3856 -0.0171 0.0257  0.0078  120 THR C O   
3151 C CB  . THR C 92  ? 0.4139 0.2006 0.4257 -0.0033 0.0179  0.0108  120 THR C CB  
3152 O OG1 . THR C 92  ? 0.4100 0.2018 0.4293 0.0000  0.0165  0.0088  120 THR C OG1 
3153 C CG2 . THR C 92  ? 0.3957 0.1864 0.4107 0.0026  0.0157  0.0075  120 THR C CG2 
3154 N N   . SER C 93  ? 0.4573 0.2211 0.4354 -0.0212 0.0215  0.0195  121 SER C N   
3155 C CA  . SER C 93  ? 0.4596 0.2123 0.4206 -0.0241 0.0206  0.0242  121 SER C CA  
3156 C C   . SER C 93  ? 0.4716 0.2344 0.4215 -0.0396 0.0277  0.0236  121 SER C C   
3157 O O   . SER C 93  ? 0.4659 0.2359 0.4082 -0.0413 0.0295  0.0233  121 SER C O   
3158 C CB  . SER C 93  ? 0.5631 0.2862 0.5076 -0.0208 0.0136  0.0310  121 SER C CB  
3159 O OG  . SER C 93  ? 0.6433 0.3552 0.5713 -0.0185 0.0098  0.0352  121 SER C OG  
3160 N N   . ARG C 94  ? 0.4813 0.2489 0.4307 -0.0521 0.0322  0.0223  122 ARG C N   
3161 C CA  . ARG C 94  ? 0.5203 0.3061 0.4611 -0.0708 0.0405  0.0201  122 ARG C CA  
3162 C C   . ARG C 94  ? 0.4463 0.2745 0.4062 -0.0655 0.0455  0.0076  122 ARG C C   
3163 O O   . ARG C 94  ? 0.4503 0.2988 0.4025 -0.0757 0.0518  0.0044  122 ARG C O   
3164 C CB  . ARG C 94  ? 0.5784 0.3630 0.5162 -0.0875 0.0438  0.0197  122 ARG C CB  
3165 C CG  . ARG C 94  ? 0.6695 0.4074 0.5779 -0.0986 0.0390  0.0315  122 ARG C CG  
3166 C CD  . ARG C 94  ? 0.7217 0.4589 0.6229 -0.1219 0.0433  0.0304  122 ARG C CD  
3167 N NE  . ARG C 94  ? 0.8329 0.5823 0.7573 -0.1136 0.0413  0.0221  122 ARG C NE  
3168 C CZ  . ARG C 94  ? 0.7838 0.5026 0.7057 -0.1033 0.0329  0.0244  122 ARG C CZ  
3169 N NH1 . ARG C 94  ? 0.9265 0.6002 0.8250 -0.0973 0.0243  0.0335  122 ARG C NH1 
3170 N NH2 . ARG C 94  ? 0.7631 0.4985 0.7053 -0.0968 0.0320  0.0163  122 ARG C NH2 
3171 N N   . GLU C 95  ? 0.4236 0.2638 0.4054 -0.0494 0.0418  0.0001  123 GLU C N   
3172 C CA  . GLU C 95  ? 0.4330 0.3059 0.4304 -0.0392 0.0427  -0.0131 123 GLU C CA  
3173 C C   . GLU C 95  ? 0.4035 0.2714 0.3949 -0.0312 0.0404  -0.0132 123 GLU C C   
3174 O O   . GLU C 95  ? 0.3893 0.2838 0.3808 -0.0321 0.0443  -0.0225 123 GLU C O   
3175 C CB  . GLU C 95  ? 0.4220 0.2995 0.4378 -0.0237 0.0368  -0.0194 123 GLU C CB  
3176 C CG  . GLU C 95  ? 0.4769 0.3755 0.5047 -0.0070 0.0327  -0.0330 123 GLU C CG  
3177 C CD  . GLU C 95  ? 0.5926 0.5354 0.6259 -0.0108 0.0389  -0.0479 123 GLU C CD  
3178 O OE1 . GLU C 95  ? 0.6116 0.5765 0.6450 -0.0277 0.0467  -0.0495 123 GLU C OE1 
3179 O OE2 . GLU C 95  ? 0.5524 0.5097 0.5894 0.0023  0.0358  -0.0594 123 GLU C OE2 
3180 N N   . LEU C 96  ? 0.3886 0.2267 0.3747 -0.0242 0.0341  -0.0043 124 LEU C N   
3181 C CA  . LEU C 96  ? 0.3930 0.2252 0.3729 -0.0178 0.0308  -0.0045 124 LEU C CA  
3182 C C   . LEU C 96  ? 0.4086 0.2464 0.3695 -0.0295 0.0360  -0.0019 124 LEU C C   
3183 O O   . LEU C 96  ? 0.3724 0.2265 0.3315 -0.0263 0.0370  -0.0095 124 LEU C O   
3184 C CB  . LEU C 96  ? 0.3890 0.1943 0.3669 -0.0114 0.0237  0.0038  124 LEU C CB  
3185 C CG  . LEU C 96  ? 0.3888 0.1890 0.3817 -0.0021 0.0188  0.0020  124 LEU C CG  
3186 C CD1 . LEU C 96  ? 0.3801 0.1634 0.3715 0.0003  0.0140  0.0092  124 LEU C CD1 
3187 C CD2 . LEU C 96  ? 0.3902 0.1977 0.3899 0.0065  0.0153  -0.0077 124 LEU C CD2 
3188 N N   . GLU C 97  ? 0.4163 0.2379 0.3597 -0.0434 0.0385  0.0085  125 GLU C N   
3189 C CA  . GLU C 97  ? 0.4519 0.2711 0.3698 -0.0574 0.0426  0.0143  125 GLU C CA  
3190 C C   . GLU C 97  ? 0.4326 0.2934 0.3532 -0.0686 0.0528  0.0035  125 GLU C C   
3191 O O   . GLU C 97  ? 0.4410 0.3158 0.3486 -0.0729 0.0563  0.0012  125 GLU C O   
3192 C CB  . GLU C 97  ? 0.5028 0.2874 0.3965 -0.0711 0.0411  0.0283  125 GLU C CB  
3193 C CG  . GLU C 97  ? 0.5810 0.3509 0.4392 -0.0867 0.0430  0.0381  125 GLU C CG  
3194 C CD  . GLU C 97  ? 0.5584 0.3163 0.4048 -0.0737 0.0355  0.0411  125 GLU C CD  
3195 O OE1 . GLU C 97  ? 0.5676 0.3214 0.4310 -0.0542 0.0277  0.0376  125 GLU C OE1 
3196 O OE2 . GLU C 97  ? 0.5807 0.3348 0.3991 -0.0846 0.0375  0.0468  125 GLU C OE2 
3197 N N   . ASP C 98  ? 0.4385 0.3235 0.3768 -0.0720 0.0573  -0.0048 126 ASP C N   
3198 C CA  . ASP C 98  ? 0.4462 0.3802 0.3913 -0.0817 0.0670  -0.0185 126 ASP C CA  
3199 C C   . ASP C 98  ? 0.4160 0.3785 0.3749 -0.0626 0.0650  -0.0344 126 ASP C C   
3200 O O   . ASP C 98  ? 0.4083 0.4014 0.3590 -0.0692 0.0715  -0.0422 126 ASP C O   
3201 C CB  . ASP C 98  ? 0.4898 0.4461 0.4542 -0.0851 0.0696  -0.0265 126 ASP C CB  
3202 C CG  . ASP C 98  ? 0.5426 0.5578 0.5147 -0.0975 0.0802  -0.0424 126 ASP C CG  
3203 O OD1 . ASP C 98  ? 0.5924 0.6166 0.5449 -0.1256 0.0898  -0.0368 126 ASP C OD1 
3204 O OD2 . ASP C 98  ? 0.5406 0.5931 0.5365 -0.0791 0.0781  -0.0611 126 ASP C OD2 
3205 N N   . ALA C 99  ? 0.3850 0.3345 0.3614 -0.0401 0.0553  -0.0392 127 ALA C N   
3206 C CA  . ALA C 99  ? 0.3737 0.3370 0.3603 -0.0200 0.0497  -0.0540 127 ALA C CA  
3207 C C   . ALA C 99  ? 0.3936 0.3484 0.3627 -0.0210 0.0492  -0.0512 127 ALA C C   
3208 O O   . ALA C 99  ? 0.3850 0.3700 0.3536 -0.0165 0.0516  -0.0653 127 ALA C O   
3209 C CB  . ALA C 99  ? 0.3539 0.2904 0.3538 -0.0012 0.0384  -0.0542 127 ALA C CB  
3210 N N   . PHE C 100 ? 0.4115 0.3287 0.3660 -0.0261 0.0458  -0.0342 128 PHE C N   
3211 C CA  . PHE C 100 ? 0.4231 0.3296 0.3605 -0.0256 0.0433  -0.0306 128 PHE C CA  
3212 C C   . PHE C 100 ? 0.4332 0.3636 0.3495 -0.0415 0.0526  -0.0308 128 PHE C C   
3213 O O   . PHE C 100 ? 0.4231 0.3716 0.3336 -0.0368 0.0529  -0.0403 128 PHE C O   
3214 C CB  . PHE C 100 ? 0.4497 0.3150 0.3765 -0.0259 0.0363  -0.0138 128 PHE C CB  
3215 C CG  . PHE C 100 ? 0.4742 0.3300 0.3849 -0.0225 0.0313  -0.0114 128 PHE C CG  
3216 C CD1 . PHE C 100 ? 0.4934 0.3520 0.4149 -0.0089 0.0245  -0.0218 128 PHE C CD1 
3217 C CD2 . PHE C 100 ? 0.5145 0.3573 0.3967 -0.0336 0.0324  0.0006  128 PHE C CD2 
3218 C CE1 . PHE C 100 ? 0.5163 0.3702 0.4239 -0.0061 0.0194  -0.0215 128 PHE C CE1 
3219 C CE2 . PHE C 100 ? 0.5480 0.3843 0.4141 -0.0289 0.0266  0.0021  128 PHE C CE2 
3220 C CZ  . PHE C 100 ? 0.5419 0.3868 0.4227 -0.0150 0.0204  -0.0097 128 PHE C CZ  
3221 N N   . SER C 101 ? 0.4642 0.3941 0.3668 -0.0621 0.0604  -0.0207 129 SER C N   
3222 C CA  . SER C 101 ? 0.5108 0.4586 0.3870 -0.0835 0.0701  -0.0173 129 SER C CA  
3223 C C   . SER C 101 ? 0.5111 0.5208 0.3997 -0.0854 0.0800  -0.0385 129 SER C C   
3224 O O   . SER C 101 ? 0.5418 0.5759 0.4098 -0.0998 0.0882  -0.0400 129 SER C O   
3225 C CB  . SER C 101 ? 0.5378 0.4632 0.3937 -0.1081 0.0748  -0.0008 129 SER C CB  
3226 O OG  . SER C 101 ? 0.5516 0.5025 0.4286 -0.1148 0.0808  -0.0089 129 SER C OG  
3227 N N   . LYS C 102 ? 0.4663 0.5020 0.3864 -0.0701 0.0785  -0.0555 130 LYS C N   
3228 C CA  . LYS C 102 ? 0.4551 0.5522 0.3909 -0.0641 0.0845  -0.0803 130 LYS C CA  
3229 C C   . LYS C 102 ? 0.4383 0.5406 0.3845 -0.0361 0.0751  -0.0972 130 LYS C C   
3230 O O   . LYS C 102 ? 0.4606 0.6112 0.4187 -0.0254 0.0773  -0.1206 130 LYS C O   
3231 C CB  . LYS C 102 ? 0.4471 0.5717 0.4095 -0.0603 0.0858  -0.0919 130 LYS C CB  
3232 C CG  . LYS C 102 ? 0.4732 0.6071 0.4263 -0.0915 0.0969  -0.0813 130 LYS C CG  
3233 C CD  . LYS C 102 ? 0.4855 0.6406 0.4656 -0.0861 0.0957  -0.0915 130 LYS C CD  
3234 C CE  . LYS C 102 ? 0.5402 0.7044 0.5099 -0.1206 0.1067  -0.0821 130 LYS C CE  
3235 N NZ  . LYS C 102 ? 0.5455 0.7256 0.5410 -0.1150 0.1040  -0.0909 130 LYS C NZ  
3236 N N   . GLY C 103 ? 0.4270 0.4812 0.3678 -0.0247 0.0641  -0.0870 131 GLY C N   
3237 C CA  . GLY C 103 ? 0.4305 0.4805 0.3775 -0.0018 0.0539  -0.1013 131 GLY C CA  
3238 C C   . GLY C 103 ? 0.4183 0.4656 0.3898 0.0222  0.0435  -0.1168 131 GLY C C   
3239 O O   . GLY C 103 ? 0.4258 0.4792 0.4022 0.0418  0.0354  -0.1352 131 GLY C O   
3240 N N   . LYS C 104 ? 0.4080 0.4423 0.3918 0.0216  0.0422  -0.1097 132 LYS C N   
3241 C CA  . LYS C 104 ? 0.4207 0.4430 0.4216 0.0444  0.0302  -0.1211 132 LYS C CA  
3242 C C   . LYS C 104 ? 0.4175 0.3891 0.4137 0.0552  0.0171  -0.1153 132 LYS C C   
3243 O O   . LYS C 104 ? 0.4247 0.3660 0.4119 0.0435  0.0175  -0.0969 132 LYS C O   
3244 C CB  . LYS C 104 ? 0.4259 0.4451 0.4379 0.0399  0.0316  -0.1134 132 LYS C CB  
3245 C CG  . LYS C 104 ? 0.4400 0.5132 0.4593 0.0287  0.0433  -0.1227 132 LYS C CG  
3246 C CD  . LYS C 104 ? 0.4806 0.5519 0.5132 0.0286  0.0419  -0.1192 132 LYS C CD  
3247 C CE  . LYS C 104 ? 0.5172 0.6455 0.5578 0.0129  0.0542  -0.1287 132 LYS C CE  
3248 N NZ  . LYS C 104 ? 0.5438 0.6667 0.5943 0.0073  0.0538  -0.1221 132 LYS C NZ  
3249 N N   . LYS C 105 ? 0.4436 0.4067 0.4443 0.0771  0.0048  -0.1322 133 LYS C N   
3250 C CA  . LYS C 105 ? 0.4763 0.3902 0.4706 0.0837  -0.0079 -0.1278 133 LYS C CA  
3251 C C   . LYS C 105 ? 0.4474 0.3236 0.4446 0.0784  -0.0119 -0.1099 133 LYS C C   
3252 O O   . LYS C 105 ? 0.4384 0.2812 0.4298 0.0710  -0.0158 -0.0977 133 LYS C O   
3253 C CB  . LYS C 105 ? 0.5543 0.4610 0.5481 0.1081  -0.0222 -0.1510 133 LYS C CB  
3254 C CG  . LYS C 105 ? 0.6501 0.5901 0.6390 0.1145  -0.0200 -0.1702 133 LYS C CG  
3255 C CD  . LYS C 105 ? 0.7479 0.6912 0.7388 0.1436  -0.0342 -0.1983 133 LYS C CD  
3256 C CE  . LYS C 105 ? 0.8713 0.8510 0.8575 0.1525  -0.0328 -0.2210 133 LYS C CE  
3257 N NZ  . LYS C 105 ? 0.9103 0.8501 0.8825 0.1523  -0.0425 -0.2210 133 LYS C NZ  
3258 N N   . ASN C 106 ? 0.4268 0.3137 0.4334 0.0820  -0.0106 -0.1100 134 ASN C N   
3259 C CA  . ASN C 106 ? 0.4378 0.2953 0.4462 0.0767  -0.0130 -0.0939 134 ASN C CA  
3260 C C   . ASN C 106 ? 0.4106 0.2953 0.4293 0.0731  -0.0056 -0.0925 134 ASN C C   
3261 O O   . ASN C 106 ? 0.4086 0.3357 0.4342 0.0759  0.0000  -0.1061 134 ASN C O   
3262 C CB  . ASN C 106 ? 0.4800 0.2975 0.4831 0.0918  -0.0292 -0.0980 134 ASN C CB  
3263 C CG  . ASN C 106 ? 0.5151 0.3453 0.5202 0.1162  -0.0391 -0.1205 134 ASN C CG  
3264 O OD1 . ASN C 106 ? 0.5330 0.3924 0.5483 0.1244  -0.0374 -0.1282 134 ASN C OD1 
3265 N ND2 . ASN C 106 ? 0.5768 0.3867 0.5724 0.1290  -0.0505 -0.1333 134 ASN C ND2 
3266 N N   . THR C 107 ? 0.3958 0.2594 0.4156 0.0658  -0.0055 -0.0773 135 THR C N   
3267 C CA  . THR C 107 ? 0.4125 0.2952 0.4417 0.0649  -0.0020 -0.0772 135 THR C CA  
3268 C C   . THR C 107 ? 0.4139 0.2620 0.4410 0.0683  -0.0100 -0.0666 135 THR C C   
3269 O O   . THR C 107 ? 0.4098 0.2223 0.4278 0.0656  -0.0152 -0.0568 135 THR C O   
3270 C CB  . THR C 107 ? 0.4123 0.3160 0.4422 0.0436  0.0121  -0.0678 135 THR C CB  
3271 O OG1 . THR C 107 ? 0.4252 0.3535 0.4651 0.0414  0.0155  -0.0716 135 THR C OG1 
3272 C CG2 . THR C 107 ? 0.4223 0.2940 0.4438 0.0307  0.0140  -0.0483 135 THR C CG2 
3273 N N   . GLU C 108 ? 0.4225 0.2844 0.4570 0.0730  -0.0109 -0.0694 136 GLU C N   
3274 C CA  . GLU C 108 ? 0.4524 0.2864 0.4830 0.0748  -0.0173 -0.0588 136 GLU C CA  
3275 C C   . GLU C 108 ? 0.4711 0.3135 0.5065 0.0588  -0.0077 -0.0472 136 GLU C C   
3276 O O   . GLU C 108 ? 0.4855 0.3600 0.5292 0.0506  0.0010  -0.0517 136 GLU C O   
3277 C CB  . GLU C 108 ? 0.5240 0.3620 0.5560 0.0957  -0.0291 -0.0712 136 GLU C CB  
3278 C CG  . GLU C 108 ? 0.6087 0.4189 0.6288 0.1148  -0.0441 -0.0804 136 GLU C CG  
3279 C CD  . GLU C 108 ? 0.7337 0.5302 0.7470 0.1381  -0.0606 -0.0889 136 GLU C CD  
3280 O OE1 . GLU C 108 ? 0.8330 0.6426 0.8516 0.1390  -0.0602 -0.0863 136 GLU C OE1 
3281 O OE2 . GLU C 108 ? 0.7802 0.5495 0.7806 0.1567  -0.0756 -0.0984 136 GLU C OE2 
3282 N N   . MET C 109 ? 0.4311 0.2451 0.4599 0.0535  -0.0097 -0.0334 137 MET C N   
3283 C CA  . MET C 109 ? 0.4653 0.2834 0.4971 0.0416  -0.0029 -0.0241 137 MET C CA  
3284 C C   . MET C 109 ? 0.4513 0.2494 0.4773 0.0459  -0.0097 -0.0172 137 MET C C   
3285 O O   . MET C 109 ? 0.4173 0.1881 0.4325 0.0489  -0.0167 -0.0120 137 MET C O   
3286 C CB  . MET C 109 ? 0.4961 0.3058 0.5242 0.0278  0.0041  -0.0141 137 MET C CB  
3287 C CG  . MET C 109 ? 0.5110 0.2970 0.5315 0.0274  0.0000  -0.0082 137 MET C CG  
3288 S SD  . MET C 109 ? 0.6518 0.4358 0.6685 0.0177  0.0050  -0.0029 137 MET C SD  
3289 C CE  . MET C 109 ? 0.4987 0.2616 0.5098 0.0187  -0.0022 -0.0015 137 MET C CE  
3290 N N   . LEU C 110 ? 0.4531 0.2646 0.4843 0.0445  -0.0078 -0.0174 138 LEU C N   
3291 C CA  . LEU C 110 ? 0.4399 0.2360 0.4639 0.0460  -0.0124 -0.0098 138 LEU C CA  
3292 C C   . LEU C 110 ? 0.4285 0.2165 0.4504 0.0329  -0.0058 0.0009  138 LEU C C   
3293 O O   . LEU C 110 ? 0.4118 0.2123 0.4399 0.0252  0.0010  0.0006  138 LEU C O   
3294 C CB  . LEU C 110 ? 0.4462 0.2635 0.4770 0.0512  -0.0141 -0.0167 138 LEU C CB  
3295 C CG  . LEU C 110 ? 0.4588 0.2620 0.4798 0.0526  -0.0187 -0.0088 138 LEU C CG  
3296 C CD1 . LEU C 110 ? 0.5124 0.2879 0.5164 0.0646  -0.0312 -0.0057 138 LEU C CD1 
3297 C CD2 . LEU C 110 ? 0.4906 0.3186 0.5200 0.0547  -0.0188 -0.0161 138 LEU C CD2 
3298 N N   . ILE C 111 ? 0.4049 0.1722 0.4163 0.0301  -0.0086 0.0096  139 ILE C N   
3299 C CA  . ILE C 111 ? 0.4085 0.1759 0.4198 0.0198  -0.0028 0.0168  139 ILE C CA  
3300 C C   . ILE C 111 ? 0.4042 0.1626 0.4048 0.0174  -0.0056 0.0239  139 ILE C C   
3301 O O   . ILE C 111 ? 0.4172 0.1559 0.4048 0.0157  -0.0110 0.0289  139 ILE C O   
3302 C CB  . ILE C 111 ? 0.4458 0.2073 0.4566 0.0141  -0.0009 0.0191  139 ILE C CB  
3303 C CG1 . ILE C 111 ? 0.4292 0.1984 0.4460 0.0162  0.0013  0.0128  139 ILE C CG1 
3304 C CG2 . ILE C 111 ? 0.4442 0.2130 0.4570 0.0069  0.0037  0.0231  139 ILE C CG2 
3305 C CD1 . ILE C 111 ? 0.4709 0.2360 0.4863 0.0118  0.0023  0.0142  139 ILE C CD1 
3306 N N   . ALA C 112 ? 0.4049 0.1759 0.4083 0.0160  -0.0023 0.0240  140 ALA C N   
3307 C CA  . ALA C 112 ? 0.4159 0.1846 0.4083 0.0126  -0.0035 0.0301  140 ALA C CA  
3308 C C   . ALA C 112 ? 0.4679 0.2160 0.4433 0.0168  -0.0124 0.0346  140 ALA C C   
3309 O O   . ALA C 112 ? 0.5155 0.2470 0.4741 0.0084  -0.0145 0.0435  140 ALA C O   
3310 C CB  . ALA C 112 ? 0.4674 0.2401 0.4575 0.0017  0.0013  0.0349  140 ALA C CB  
3311 N N   . GLY C 113 ? 0.4312 0.1805 0.4094 0.0294  -0.0184 0.0279  141 GLY C N   
3312 C CA  . GLY C 113 ? 0.4841 0.2143 0.4452 0.0393  -0.0300 0.0297  141 GLY C CA  
3313 C C   . GLY C 113 ? 0.5059 0.2094 0.4568 0.0466  -0.0394 0.0288  141 GLY C C   
3314 O O   . GLY C 113 ? 0.5293 0.2141 0.4649 0.0598  -0.0521 0.0278  141 GLY C O   
3315 N N   . PHE C 114 ? 0.4794 0.1798 0.4370 0.0403  -0.0351 0.0279  142 PHE C N   
3316 C CA  . PHE C 114 ? 0.5120 0.1850 0.4588 0.0474  -0.0448 0.0254  142 PHE C CA  
3317 C C   . PHE C 114 ? 0.4626 0.1556 0.4287 0.0533  -0.0409 0.0133  142 PHE C C   
3318 O O   . PHE C 114 ? 0.4172 0.1351 0.3998 0.0449  -0.0296 0.0120  142 PHE C O   
3319 C CB  . PHE C 114 ? 0.5288 0.1719 0.4575 0.0311  -0.0454 0.0368  142 PHE C CB  
3320 C CG  . PHE C 114 ? 0.5891 0.2054 0.4906 0.0237  -0.0513 0.0494  142 PHE C CG  
3321 C CD1 . PHE C 114 ? 0.5851 0.2205 0.4872 0.0099  -0.0419 0.0571  142 PHE C CD1 
3322 C CD2 . PHE C 114 ? 0.6750 0.2459 0.5473 0.0318  -0.0674 0.0530  142 PHE C CD2 
3323 C CE1 . PHE C 114 ? 0.6316 0.2452 0.5058 0.0012  -0.0464 0.0692  142 PHE C CE1 
3324 C CE2 . PHE C 114 ? 0.7500 0.2913 0.5909 0.0230  -0.0736 0.0669  142 PHE C CE2 
3325 C CZ  . PHE C 114 ? 0.7370 0.3019 0.5790 0.0063  -0.0620 0.0754  142 PHE C CZ  
3326 N N   . LEU C 115 ? 0.4802 0.1608 0.4413 0.0688  -0.0515 0.0040  143 LEU C N   
3327 C CA  . LEU C 115 ? 0.4702 0.1717 0.4468 0.0745  -0.0482 -0.0087 143 LEU C CA  
3328 C C   . LEU C 115 ? 0.4651 0.1466 0.4355 0.0640  -0.0468 -0.0045 143 LEU C C   
3329 O O   . LEU C 115 ? 0.4906 0.1327 0.4405 0.0632  -0.0568 0.0004  143 LEU C O   
3330 C CB  . LEU C 115 ? 0.5398 0.2433 0.5150 0.0986  -0.0609 -0.0245 143 LEU C CB  
3331 C CG  . LEU C 115 ? 0.5711 0.3129 0.5611 0.1099  -0.0605 -0.0352 143 LEU C CG  
3332 C CD1 . LEU C 115 ? 0.6497 0.4025 0.6415 0.1359  -0.0733 -0.0549 143 LEU C CD1 
3333 C CD2 . LEU C 115 ? 0.5788 0.3637 0.5914 0.0950  -0.0435 -0.0376 143 LEU C CD2 
3334 N N   . TYR C 116 ? 0.4002 0.1064 0.3858 0.0551  -0.0355 -0.0064 144 TYR C N   
3335 C CA  . TYR C 116 ? 0.4126 0.1083 0.3956 0.0468  -0.0340 -0.0053 144 TYR C CA  
3336 C C   . TYR C 116 ? 0.4165 0.1288 0.4071 0.0567  -0.0341 -0.0195 144 TYR C C   
3337 O O   . TYR C 116 ? 0.4073 0.1508 0.4100 0.0635  -0.0296 -0.0283 144 TYR C O   
3338 C CB  . TYR C 116 ? 0.3809 0.0914 0.3719 0.0304  -0.0226 0.0033  144 TYR C CB  
3339 C CG  . TYR C 116 ? 0.3793 0.0764 0.3617 0.0181  -0.0222 0.0151  144 TYR C CG  
3340 C CD1 . TYR C 116 ? 0.3835 0.0848 0.3646 0.0185  -0.0211 0.0201  144 TYR C CD1 
3341 C CD2 . TYR C 116 ? 0.3904 0.0754 0.3663 0.0048  -0.0224 0.0201  144 TYR C CD2 
3342 C CE1 . TYR C 116 ? 0.3999 0.0941 0.3720 0.0064  -0.0197 0.0301  144 TYR C CE1 
3343 C CE2 . TYR C 116 ? 0.3993 0.0795 0.3675 -0.0091 -0.0206 0.0297  144 TYR C CE2 
3344 C CZ  . TYR C 116 ? 0.4171 0.1024 0.3828 -0.0081 -0.0189 0.0349  144 TYR C CZ  
3345 O OH  . TYR C 116 ? 0.4358 0.1217 0.3928 -0.0228 -0.0160 0.0437  144 TYR C OH  
3346 N N   . VAL C 117 ? 0.4301 0.1240 0.4131 0.0561  -0.0390 -0.0226 145 VAL C N   
3347 C CA  . VAL C 117 ? 0.4278 0.1400 0.4169 0.0625  -0.0374 -0.0354 145 VAL C CA  
3348 C C   . VAL C 117 ? 0.4196 0.1432 0.4134 0.0471  -0.0278 -0.0289 145 VAL C C   
3349 O O   . VAL C 117 ? 0.4152 0.1210 0.4035 0.0350  -0.0284 -0.0198 145 VAL C O   
3350 C CB  . VAL C 117 ? 0.4714 0.1545 0.4472 0.0742  -0.0512 -0.0458 145 VAL C CB  
3351 C CG1 . VAL C 117 ? 0.4900 0.1977 0.4724 0.0805  -0.0484 -0.0604 145 VAL C CG1 
3352 C CG2 . VAL C 117 ? 0.5098 0.1768 0.4772 0.0940  -0.0643 -0.0533 145 VAL C CG2 
3353 N N   . ALA C 118 ? 0.4015 0.1564 0.4040 0.0468  -0.0192 -0.0340 146 ALA C N   
3354 C CA  . ALA C 118 ? 0.4042 0.1675 0.4066 0.0368  -0.0131 -0.0304 146 ALA C CA  
3355 C C   . ALA C 118 ? 0.4054 0.1741 0.4042 0.0443  -0.0165 -0.0436 146 ALA C C   
3356 O O   . ALA C 118 ? 0.4186 0.2115 0.4208 0.0522  -0.0141 -0.0549 146 ALA C O   
3357 C CB  . ALA C 118 ? 0.4131 0.1998 0.4202 0.0293  -0.0025 -0.0250 146 ALA C CB  
3358 N N   . ASP C 119 ? 0.4211 0.1702 0.4132 0.0412  -0.0224 -0.0439 147 ASP C N   
3359 C CA  . ASP C 119 ? 0.4435 0.1943 0.4307 0.0483  -0.0271 -0.0574 147 ASP C CA  
3360 C C   . ASP C 119 ? 0.4086 0.1809 0.3955 0.0396  -0.0192 -0.0544 147 ASP C C   
3361 O O   . ASP C 119 ? 0.4086 0.1735 0.3940 0.0299  -0.0191 -0.0461 147 ASP C O   
3362 C CB  . ASP C 119 ? 0.4780 0.1912 0.4552 0.0478  -0.0394 -0.0597 147 ASP C CB  
3363 C CG  . ASP C 119 ? 0.5430 0.2542 0.5138 0.0545  -0.0457 -0.0749 147 ASP C CG  
3364 O OD1 . ASP C 119 ? 0.4908 0.2337 0.4650 0.0576  -0.0391 -0.0819 147 ASP C OD1 
3365 O OD2 . ASP C 119 ? 0.5957 0.2714 0.5554 0.0553  -0.0579 -0.0798 147 ASP C OD2 
3366 N N   . LEU C 120 ? 0.4275 0.2282 0.4144 0.0431  -0.0128 -0.0615 148 LEU C N   
3367 C CA  . LEU C 120 ? 0.4385 0.2556 0.4192 0.0339  -0.0054 -0.0557 148 LEU C CA  
3368 C C   . LEU C 120 ? 0.4885 0.3091 0.4612 0.0368  -0.0095 -0.0656 148 LEU C C   
3369 O O   . LEU C 120 ? 0.4907 0.3220 0.4543 0.0307  -0.0057 -0.0612 148 LEU C O   
3370 C CB  . LEU C 120 ? 0.4430 0.2884 0.4230 0.0302  0.0048  -0.0556 148 LEU C CB  
3371 C CG  . LEU C 120 ? 0.4368 0.2811 0.4244 0.0261  0.0089  -0.0472 148 LEU C CG  
3372 C CD1 . LEU C 120 ? 0.4779 0.3533 0.4642 0.0193  0.0189  -0.0502 148 LEU C CD1 
3373 C CD2 . LEU C 120 ? 0.4418 0.2657 0.4272 0.0175  0.0090  -0.0308 148 LEU C CD2 
3374 N N   . GLU C 121 ? 0.4838 0.2925 0.4569 0.0470  -0.0187 -0.0794 149 GLU C N   
3375 C CA  . GLU C 121 ? 0.5017 0.3093 0.4672 0.0499  -0.0245 -0.0903 149 GLU C CA  
3376 C C   . GLU C 121 ? 0.4964 0.2786 0.4608 0.0406  -0.0312 -0.0828 149 GLU C C   
3377 O O   . GLU C 121 ? 0.5211 0.3096 0.4805 0.0359  -0.0324 -0.0835 149 GLU C O   
3378 C CB  . GLU C 121 ? 0.5603 0.3615 0.5245 0.0662  -0.0338 -0.1106 149 GLU C CB  
3379 C CG  . GLU C 121 ? 0.5801 0.4162 0.5478 0.0783  -0.0285 -0.1244 149 GLU C CG  
3380 C CD  . GLU C 121 ? 0.6661 0.4969 0.6306 0.0989  -0.0407 -0.1488 149 GLU C CD  
3381 O OE1 . GLU C 121 ? 0.7019 0.4981 0.6654 0.1093  -0.0531 -0.1529 149 GLU C OE1 
3382 O OE2 . GLU C 121 ? 0.6906 0.5504 0.6512 0.1055  -0.0388 -0.1647 149 GLU C OE2 
3383 N N   . ASN C 122 ? 0.4950 0.2512 0.4634 0.0371  -0.0358 -0.0766 150 ASN C N   
3384 C CA  . ASN C 122 ? 0.5043 0.2416 0.4723 0.0245  -0.0412 -0.0707 150 ASN C CA  
3385 C C   . ASN C 122 ? 0.4629 0.2102 0.4381 0.0141  -0.0343 -0.0549 150 ASN C C   
3386 O O   . ASN C 122 ? 0.4564 0.2007 0.4339 0.0030  -0.0369 -0.0511 150 ASN C O   
3387 C CB  . ASN C 122 ? 0.5504 0.2497 0.5127 0.0235  -0.0515 -0.0738 150 ASN C CB  
3388 C CG  . ASN C 122 ? 0.5836 0.2667 0.5359 0.0349  -0.0621 -0.0920 150 ASN C CG  
3389 O OD1 . ASN C 122 ? 0.6114 0.2964 0.5596 0.0316  -0.0662 -0.1005 150 ASN C OD1 
3390 N ND2 . ASN C 122 ? 0.6007 0.2694 0.5488 0.0506  -0.0677 -0.0999 150 ASN C ND2 
3391 N N   . MET C 123 ? 0.4299 0.1916 0.4084 0.0176  -0.0260 -0.0476 151 MET C N   
3392 C CA  . MET C 123 ? 0.4040 0.1731 0.3876 0.0113  -0.0206 -0.0344 151 MET C CA  
3393 C C   . MET C 123 ? 0.3812 0.1366 0.3705 0.0031  -0.0228 -0.0281 151 MET C C   
3394 O O   . MET C 123 ? 0.3751 0.1368 0.3682 -0.0050 -0.0236 -0.0246 151 MET C O   
3395 C CB  . MET C 123 ? 0.4333 0.2179 0.4131 0.0096  -0.0203 -0.0324 151 MET C CB  
3396 C CG  . MET C 123 ? 0.4647 0.2618 0.4334 0.0149  -0.0164 -0.0350 151 MET C CG  
3397 S SD  . MET C 123 ? 0.5399 0.3428 0.5058 0.0149  -0.0066 -0.0272 151 MET C SD  
3398 C CE  . MET C 123 ? 0.5717 0.3695 0.5330 0.0115  -0.0063 -0.0130 151 MET C CE  
3399 N N   . VAL C 124 ? 0.3856 0.1254 0.3744 0.0057  -0.0237 -0.0272 152 VAL C N   
3400 C CA  . VAL C 124 ? 0.4007 0.1249 0.3899 -0.0029 -0.0255 -0.0200 152 VAL C CA  
3401 C C   . VAL C 124 ? 0.3923 0.1101 0.3817 0.0043  -0.0237 -0.0166 152 VAL C C   
3402 O O   . VAL C 124 ? 0.3979 0.1186 0.3867 0.0162  -0.0241 -0.0235 152 VAL C O   
3403 C CB  . VAL C 124 ? 0.4485 0.1456 0.4282 -0.0108 -0.0348 -0.0248 152 VAL C CB  
3404 C CG1 . VAL C 124 ? 0.4708 0.1461 0.4412 0.0024  -0.0424 -0.0347 152 VAL C CG1 
3405 C CG2 . VAL C 124 ? 0.4975 0.1783 0.4728 -0.0257 -0.0361 -0.0156 152 VAL C CG2 
3406 N N   . GLN C 125 ? 0.3816 0.0952 0.3721 -0.0028 -0.0219 -0.0073 153 GLN C N   
3407 C CA  . GLN C 125 ? 0.3958 0.1011 0.3846 0.0030  -0.0221 -0.0039 153 GLN C CA  
3408 C C   . GLN C 125 ? 0.4169 0.0933 0.3933 -0.0057 -0.0285 0.0017  153 GLN C C   
3409 O O   . GLN C 125 ? 0.4141 0.0880 0.3878 -0.0215 -0.0282 0.0061  153 GLN C O   
3410 C CB  . GLN C 125 ? 0.3781 0.1043 0.3759 0.0025  -0.0137 0.0026  153 GLN C CB  
3411 C CG  . GLN C 125 ? 0.3717 0.1057 0.3724 -0.0091 -0.0106 0.0099  153 GLN C CG  
3412 C CD  . GLN C 125 ? 0.3834 0.1250 0.3873 -0.0084 -0.0063 0.0157  153 GLN C CD  
3413 O OE1 . GLN C 125 ? 0.4050 0.1401 0.4040 -0.0159 -0.0069 0.0211  153 GLN C OE1 
3414 N NE2 . GLN C 125 ? 0.3493 0.1045 0.3592 -0.0017 -0.0019 0.0149  153 GLN C NE2 
3415 N N   . TYR C 126 ? 0.4523 0.1087 0.4199 0.0037  -0.0346 0.0013  154 TYR C N   
3416 C CA  . TYR C 126 ? 0.4935 0.1153 0.4425 -0.0036 -0.0422 0.0090  154 TYR C CA  
3417 C C   . TYR C 126 ? 0.5112 0.1234 0.4546 0.0120  -0.0474 0.0088  154 TYR C C   
3418 O O   . TYR C 126 ? 0.4847 0.1150 0.4385 0.0292  -0.0471 -0.0010 154 TYR C O   
3419 C CB  . TYR C 126 ? 0.5370 0.1206 0.4680 -0.0078 -0.0537 0.0050  154 TYR C CB  
3420 C CG  . TYR C 126 ? 0.5531 0.1296 0.4837 0.0128  -0.0618 -0.0101 154 TYR C CG  
3421 C CD1 . TYR C 126 ? 0.5388 0.1380 0.4812 0.0150  -0.0580 -0.0199 154 TYR C CD1 
3422 C CD2 . TYR C 126 ? 0.6023 0.1519 0.5196 0.0318  -0.0741 -0.0159 154 TYR C CD2 
3423 C CE1 . TYR C 126 ? 0.5616 0.1604 0.5034 0.0338  -0.0644 -0.0356 154 TYR C CE1 
3424 C CE2 . TYR C 126 ? 0.6082 0.1586 0.5267 0.0531  -0.0817 -0.0332 154 TYR C CE2 
3425 C CZ  . TYR C 126 ? 0.5853 0.1623 0.5167 0.0531  -0.0758 -0.0431 154 TYR C CZ  
3426 O OH  . TYR C 126 ? 0.6179 0.2010 0.5502 0.0738  -0.0825 -0.0619 154 TYR C OH  
3427 N N   . ARG C 127 ? 0.5508 0.1362 0.4761 0.0053  -0.0526 0.0190  155 ARG C N   
3428 C CA  . ARG C 127 ? 0.5635 0.1365 0.4798 0.0216  -0.0603 0.0189  155 ARG C CA  
3429 C C   . ARG C 127 ? 0.5966 0.1382 0.4991 0.0413  -0.0761 0.0078  155 ARG C C   
3430 O O   . ARG C 127 ? 0.6082 0.1076 0.4895 0.0359  -0.0866 0.0087  155 ARG C O   
3431 C CB  . ARG C 127 ? 0.6052 0.1529 0.4994 0.0090  -0.0633 0.0337  155 ARG C CB  
3432 C CG  . ARG C 127 ? 0.5818 0.1651 0.4894 -0.0030 -0.0495 0.0413  155 ARG C CG  
3433 C CD  . ARG C 127 ? 0.6092 0.1737 0.4947 -0.0102 -0.0529 0.0536  155 ARG C CD  
3434 N NE  . ARG C 127 ? 0.6267 0.2313 0.5278 -0.0192 -0.0394 0.0574  155 ARG C NE  
3435 C CZ  . ARG C 127 ? 0.6312 0.2358 0.5183 -0.0311 -0.0368 0.0677  155 ARG C CZ  
3436 N NH1 . ARG C 127 ? 0.6672 0.2301 0.5209 -0.0378 -0.0468 0.0782  155 ARG C NH1 
3437 N NH2 . ARG C 127 ? 0.6324 0.2774 0.5366 -0.0358 -0.0250 0.0671  155 ARG C NH2 
3438 N N   . ARG C 128 ? 0.6065 0.1684 0.5197 0.0643  -0.0790 -0.0038 156 ARG C N   
3439 C CA  . ARG C 128 ? 0.6748 0.2137 0.5767 0.0886  -0.0956 -0.0182 156 ARG C CA  
3440 C C   . ARG C 128 ? 0.7059 0.1833 0.5716 0.0933  -0.1143 -0.0104 156 ARG C C   
3441 O O   . ARG C 128 ? 0.7065 0.1772 0.5624 0.0900  -0.1150 0.0010  156 ARG C O   
3442 C CB  . ARG C 128 ? 0.6853 0.2689 0.6082 0.1114  -0.0941 -0.0342 156 ARG C CB  
3443 C CG  . ARG C 128 ? 0.8150 0.3880 0.7317 0.1393  -0.1102 -0.0547 156 ARG C CG  
3444 C CD  . ARG C 128 ? 0.9263 0.5605 0.8701 0.1563  -0.1041 -0.0745 156 ARG C CD  
3445 N NE  . ARG C 128 ? 1.0081 0.6385 0.9470 0.1855  -0.1199 -0.0975 156 ARG C NE  
3446 C CZ  . ARG C 128 ? 1.1486 0.7720 1.0794 0.2147  -0.1375 -0.1107 156 ARG C CZ  
3447 N NH1 . ARG C 128 ? 1.2173 0.8361 1.1428 0.2180  -0.1418 -0.1021 156 ARG C NH1 
3448 N NH2 . ARG C 128 ? 1.1118 0.7340 1.0388 0.2430  -0.1524 -0.1343 156 ARG C NH2 
3449 N N   . ASN C 129 ? 0.7470 0.1770 0.5902 0.1008  -0.1303 -0.0166 157 ASN C N   
3450 C CA  . ASN C 129 ? 0.8631 0.2222 0.6644 0.1073  -0.1521 -0.0102 157 ASN C CA  
3451 C C   . ASN C 129 ? 0.8722 0.1957 0.6469 0.0767  -0.1498 0.0147  157 ASN C C   
3452 O O   . ASN C 129 ? 0.9460 0.2273 0.6892 0.0820  -0.1634 0.0242  157 ASN C O   
3453 C CB  . ASN C 129 ? 0.9065 0.2663 0.7034 0.1430  -0.1674 -0.0221 157 ASN C CB  
3454 C CG  . ASN C 129 ? 0.9237 0.3019 0.7343 0.1752  -0.1769 -0.0494 157 ASN C CG  
3455 O OD1 . ASN C 129 ? 1.0345 0.3822 0.8337 0.1783  -0.1858 -0.0583 157 ASN C OD1 
3456 N ND2 . ASN C 129 ? 0.9282 0.3591 0.7627 0.1988  -0.1752 -0.0645 157 ASN C ND2 
3457 N N   . GLU C 130 ? 0.8345 0.1775 0.6207 0.0453  -0.1330 0.0242  158 GLU C N   
3458 C CA  . GLU C 130 ? 0.8619 0.1796 0.6248 0.0117  -0.1288 0.0452  158 GLU C CA  
3459 C C   . GLU C 130 ? 0.8600 0.1701 0.6221 -0.0165 -0.1232 0.0470  158 GLU C C   
3460 O O   . GLU C 130 ? 0.7884 0.1250 0.5746 -0.0107 -0.1186 0.0333  158 GLU C O   
3461 C CB  . GLU C 130 ? 0.8594 0.2312 0.6445 0.0004  -0.1100 0.0541  158 GLU C CB  
3462 C CG  . GLU C 130 ? 0.9405 0.3316 0.7329 0.0258  -0.1128 0.0505  158 GLU C CG  
3463 C CD  . GLU C 130 ? 0.9981 0.4113 0.7897 0.0108  -0.1020 0.0645  158 GLU C CD  
3464 O OE1 . GLU C 130 ? 1.0277 0.4655 0.8285 -0.0155 -0.0868 0.0725  158 GLU C OE1 
3465 O OE2 . GLU C 130 ? 0.9657 0.3736 0.7471 0.0269  -0.1096 0.0659  158 GLU C OE2 
3466 N N   . HIS C 131 ? 0.9018 0.1730 0.6325 -0.0476 -0.1253 0.0633  159 HIS C N   
3467 C CA  . HIS C 131 ? 0.8746 0.1656 0.6129 -0.0834 -0.1122 0.0684  159 HIS C CA  
3468 C C   . HIS C 131 ? 0.8512 0.2157 0.6247 -0.0909 -0.0906 0.0709  159 HIS C C   
3469 O O   . HIS C 131 ? 0.9290 0.3054 0.6993 -0.0894 -0.0864 0.0798  159 HIS C O   
3470 C CB  . HIS C 131 ? 0.9403 0.1785 0.6350 -0.1186 -0.1179 0.0861  159 HIS C CB  
3471 C CG  . HIS C 131 ? 0.9886 0.1426 0.6409 -0.1169 -0.1411 0.0855  159 HIS C CG  
3472 N ND1 . HIS C 131 ? 1.0729 0.1595 0.6828 -0.1015 -0.1612 0.0929  159 HIS C ND1 
3473 C CD2 . HIS C 131 ? 1.0156 0.1384 0.6593 -0.1264 -0.1493 0.0770  159 HIS C CD2 
3474 C CE1 . HIS C 131 ? 1.1179 0.1306 0.6924 -0.1017 -0.1817 0.0895  159 HIS C CE1 
3475 N NE2 . HIS C 131 ? 1.1043 0.1377 0.6991 -0.1176 -0.1745 0.0796  159 HIS C NE2 
3476 N N   . GLY C 132 ? 0.7776 0.1886 0.5818 -0.0985 -0.0786 0.0626  160 GLY C N   
3477 C CA  . GLY C 132 ? 0.7458 0.2240 0.5832 -0.1011 -0.0606 0.0622  160 GLY C CA  
3478 C C   . GLY C 132 ? 0.6731 0.1887 0.5361 -0.1083 -0.0528 0.0522  160 GLY C C   
3479 O O   . GLY C 132 ? 0.6872 0.1804 0.5453 -0.1083 -0.0606 0.0444  160 GLY C O   
3480 N N   . ARG C 133 ? 0.6560 0.2276 0.5446 -0.1127 -0.0387 0.0515  161 ARG C N   
3481 C CA  . ARG C 133 ? 0.6457 0.2586 0.5596 -0.1150 -0.0319 0.0416  161 ARG C CA  
3482 C C   . ARG C 133 ? 0.5738 0.1906 0.5023 -0.0878 -0.0349 0.0307  161 ARG C C   
3483 O O   . ARG C 133 ? 0.5388 0.1558 0.4715 -0.0670 -0.0351 0.0298  161 ARG C O   
3484 C CB  . ARG C 133 ? 0.6882 0.3582 0.6241 -0.1194 -0.0186 0.0419  161 ARG C CB  
3485 C CG  . ARG C 133 ? 0.8034 0.5142 0.7582 -0.1299 -0.0138 0.0331  161 ARG C CG  
3486 C CD  . ARG C 133 ? 0.8839 0.6508 0.8589 -0.1304 -0.0033 0.0306  161 ARG C CD  
3487 N NE  . ARG C 133 ? 0.9453 0.7526 0.9406 -0.1301 -0.0017 0.0191  161 ARG C NE  
3488 C CZ  . ARG C 133 ? 1.0378 0.8961 1.0527 -0.1243 0.0040  0.0122  161 ARG C CZ  
3489 N NH1 . ARG C 133 ? 0.9514 0.8286 0.9697 -0.1194 0.0098  0.0149  161 ARG C NH1 
3490 N NH2 . ARG C 133 ? 1.0405 0.9314 1.0709 -0.1214 0.0026  0.0009  161 ARG C NH2 
3491 N N   . ARG C 134 ? 0.5632 0.1864 0.4986 -0.0901 -0.0368 0.0217  162 ARG C N   
3492 C CA  . ARG C 134 ? 0.5315 0.1693 0.4812 -0.0689 -0.0370 0.0112  162 ARG C CA  
3493 C C   . ARG C 134 ? 0.4938 0.1812 0.4655 -0.0706 -0.0275 0.0087  162 ARG C C   
3494 O O   . ARG C 134 ? 0.5492 0.2536 0.5253 -0.0862 -0.0266 0.0058  162 ARG C O   
3495 C CB  . ARG C 134 ? 0.5700 0.1796 0.5090 -0.0690 -0.0472 0.0020  162 ARG C CB  
3496 C CG  . ARG C 134 ? 0.6368 0.1928 0.5516 -0.0609 -0.0599 0.0019  162 ARG C CG  
3497 C CD  . ARG C 134 ? 0.6907 0.2105 0.5895 -0.0663 -0.0720 -0.0069 162 ARG C CD  
3498 N NE  . ARG C 134 ? 0.6985 0.2410 0.6115 -0.0515 -0.0718 -0.0215 162 ARG C NE  
3499 C CZ  . ARG C 134 ? 0.7073 0.2493 0.6223 -0.0254 -0.0759 -0.0323 162 ARG C CZ  
3500 N NH1 . ARG C 134 ? 0.7755 0.2970 0.6818 -0.0083 -0.0816 -0.0320 162 ARG C NH1 
3501 N NH2 . ARG C 134 ? 0.7171 0.2833 0.6427 -0.0164 -0.0744 -0.0447 162 ARG C NH2 
3502 N N   . ARG C 135 ? 0.4360 0.1461 0.4200 -0.0551 -0.0215 0.0093  163 ARG C N   
3503 C CA  . ARG C 135 ? 0.4007 0.1498 0.4008 -0.0525 -0.0156 0.0066  163 ARG C CA  
3504 C C   . ARG C 135 ? 0.3940 0.1491 0.3980 -0.0385 -0.0172 -0.0004 163 ARG C C   
3505 O O   . ARG C 135 ? 0.3928 0.1345 0.3927 -0.0265 -0.0182 -0.0019 163 ARG C O   
3506 C CB  . ARG C 135 ? 0.3862 0.1513 0.3929 -0.0456 -0.0094 0.0118  163 ARG C CB  
3507 C CG  . ARG C 135 ? 0.3946 0.1617 0.3970 -0.0599 -0.0066 0.0185  163 ARG C CG  
3508 C CD  . ARG C 135 ? 0.3735 0.1549 0.3817 -0.0504 -0.0014 0.0216  163 ARG C CD  
3509 N NE  . ARG C 135 ? 0.3755 0.1589 0.3769 -0.0630 0.0014  0.0279  163 ARG C NE  
3510 C CZ  . ARG C 135 ? 0.3674 0.1842 0.3757 -0.0720 0.0068  0.0265  163 ARG C CZ  
3511 N NH1 . ARG C 135 ? 0.3529 0.2043 0.3767 -0.0670 0.0083  0.0179  163 ARG C NH1 
3512 N NH2 . ARG C 135 ? 0.3693 0.1870 0.3676 -0.0852 0.0100  0.0330  163 ARG C NH2 
3513 N N   . LYS C 136 ? 0.3832 0.1616 0.3943 -0.0406 -0.0177 -0.0056 164 LYS C N   
3514 C CA  . LYS C 136 ? 0.3967 0.1818 0.4077 -0.0284 -0.0195 -0.0110 164 LYS C CA  
3515 C C   . LYS C 136 ? 0.3652 0.1567 0.3773 -0.0155 -0.0150 -0.0062 164 LYS C C   
3516 O O   . LYS C 136 ? 0.3430 0.1431 0.3601 -0.0154 -0.0117 -0.0016 164 LYS C O   
3517 C CB  . LYS C 136 ? 0.4157 0.2252 0.4324 -0.0323 -0.0227 -0.0177 164 LYS C CB  
3518 C CG  . LYS C 136 ? 0.5516 0.3526 0.5651 -0.0463 -0.0281 -0.0245 164 LYS C CG  
3519 C CD  . LYS C 136 ? 0.6645 0.4959 0.6853 -0.0491 -0.0319 -0.0332 164 LYS C CD  
3520 C CE  . LYS C 136 ? 0.8519 0.6727 0.8677 -0.0619 -0.0384 -0.0421 164 LYS C CE  
3521 N NZ  . LYS C 136 ? 0.8390 0.6338 0.8478 -0.0826 -0.0392 -0.0392 164 LYS C NZ  
3522 N N   . ILE C 137 ? 0.3730 0.1591 0.3786 -0.0065 -0.0148 -0.0079 165 ILE C N   
3523 C CA  . ILE C 137 ? 0.3994 0.1886 0.4015 0.0015  -0.0111 -0.0031 165 ILE C CA  
3524 C C   . ILE C 137 ? 0.3780 0.1731 0.3710 0.0069  -0.0136 -0.0051 165 ILE C C   
3525 O O   . ILE C 137 ? 0.3737 0.1712 0.3636 0.0062  -0.0170 -0.0115 165 ILE C O   
3526 C CB  . ILE C 137 ? 0.4413 0.2204 0.4411 0.0040  -0.0068 -0.0012 165 ILE C CB  
3527 C CG1 . ILE C 137 ? 0.5075 0.2853 0.5012 0.0072  -0.0070 -0.0080 165 ILE C CG1 
3528 C CG2 . ILE C 137 ? 0.4808 0.2509 0.4859 0.0003  -0.0067 0.0005  165 ILE C CG2 
3529 C CD1 . ILE C 137 ? 0.5544 0.3288 0.5498 0.0107  -0.0046 -0.0107 165 ILE C CD1 
3530 N N   . LYS C 138 ? 0.3551 0.1489 0.3403 0.0122  -0.0129 0.0004  166 LYS C N   
3531 C CA  . LYS C 138 ? 0.3692 0.1615 0.3383 0.0170  -0.0160 0.0014  166 LYS C CA  
3532 C C   . LYS C 138 ? 0.3901 0.1678 0.3442 0.0183  -0.0136 0.0101  166 LYS C C   
3533 O O   . LYS C 138 ? 0.3731 0.1449 0.3321 0.0179  -0.0113 0.0137  166 LYS C O   
3534 C CB  . LYS C 138 ? 0.3731 0.1767 0.3422 0.0233  -0.0245 -0.0019 166 LYS C CB  
3535 C CG  . LYS C 138 ? 0.3779 0.1851 0.3508 0.0308  -0.0285 -0.0001 166 LYS C CG  
3536 C CD  . LYS C 138 ? 0.3885 0.2108 0.3589 0.0411  -0.0388 -0.0059 166 LYS C CD  
3537 C CE  . LYS C 138 ? 0.3864 0.2113 0.3562 0.0546  -0.0454 -0.0065 166 LYS C CE  
3538 N NZ  . LYS C 138 ? 0.3909 0.2368 0.3608 0.0683  -0.0575 -0.0154 166 LYS C NZ  
3539 N N   . ARG C 139 ? 0.4043 0.1755 0.3381 0.0181  -0.0145 0.0130  167 ARG C N   
3540 C CA  . ARG C 139 ? 0.4496 0.2008 0.3607 0.0157  -0.0138 0.0225  167 ARG C CA  
3541 C C   . ARG C 139 ? 0.4856 0.2256 0.3769 0.0254  -0.0249 0.0257  167 ARG C C   
3542 O O   . ARG C 139 ? 0.5314 0.2785 0.4134 0.0275  -0.0284 0.0231  167 ARG C O   
3543 C CB  . ARG C 139 ? 0.4660 0.2201 0.3654 0.0042  -0.0051 0.0238  167 ARG C CB  
3544 C CG  . ARG C 139 ? 0.5007 0.2340 0.3745 -0.0057 -0.0023 0.0344  167 ARG C CG  
3545 C CD  . ARG C 139 ? 0.5430 0.2886 0.4022 -0.0183 0.0059  0.0339  167 ARG C CD  
3546 N NE  . ARG C 139 ? 0.5801 0.3095 0.4131 -0.0348 0.0108  0.0440  167 ARG C NE  
3547 C CZ  . ARG C 139 ? 0.6469 0.3486 0.4428 -0.0404 0.0059  0.0556  167 ARG C CZ  
3548 N NH1 . ARG C 139 ? 0.6647 0.3539 0.4467 -0.0272 -0.0052 0.0577  167 ARG C NH1 
3549 N NH2 . ARG C 139 ? 0.6785 0.3625 0.4485 -0.0603 0.0111  0.0653  167 ARG C NH2 
3550 N N   . ASP C 140 ? 0.4842 0.2079 0.3695 0.0340  -0.0320 0.0294  168 ASP C N   
3551 C CA  . ASP C 140 ? 0.5196 0.2316 0.3864 0.0488  -0.0459 0.0303  168 ASP C CA  
3552 C C   . ASP C 140 ? 0.5627 0.2360 0.4029 0.0531  -0.0527 0.0393  168 ASP C C   
3553 O O   . ASP C 140 ? 0.5758 0.2358 0.4165 0.0432  -0.0458 0.0437  168 ASP C O   
3554 C CB  . ASP C 140 ? 0.4998 0.2403 0.3923 0.0617  -0.0526 0.0187  168 ASP C CB  
3555 C CG  . ASP C 140 ? 0.5528 0.3007 0.4341 0.0763  -0.0661 0.0139  168 ASP C CG  
3556 O OD1 . ASP C 140 ? 0.5977 0.3167 0.4454 0.0834  -0.0752 0.0215  168 ASP C OD1 
3557 O OD2 . ASP C 140 ? 0.5519 0.3345 0.4565 0.0795  -0.0682 0.0024  168 ASP C OD2 
3558 N N   . ILE C 141 ? 0.6124 0.2660 0.4285 0.0688  -0.0679 0.0410  169 ILE C N   
3559 C CA  . ILE C 141 ? 0.7056 0.3136 0.4912 0.0760  -0.0785 0.0487  169 ILE C CA  
3560 C C   . ILE C 141 ? 0.7021 0.3156 0.5105 0.0850  -0.0794 0.0412  169 ILE C C   
3561 O O   . ILE C 141 ? 0.5803 0.2348 0.4256 0.0881  -0.0741 0.0302  169 ILE C O   
3562 C CB  . ILE C 141 ? 0.7563 0.3402 0.5097 0.0970  -0.0986 0.0501  169 ILE C CB  
3563 C CG1 . ILE C 141 ? 0.7881 0.4116 0.5699 0.1211  -0.1087 0.0334  169 ILE C CG1 
3564 C CG2 . ILE C 141 ? 0.7989 0.3742 0.5237 0.0870  -0.0979 0.0590  169 ILE C CG2 
3565 C CD1 . ILE C 141 ? 0.8743 0.4754 0.6271 0.1489  -0.1322 0.0311  169 ILE C CD1 
3566 N N   . ILE C 142 ? 0.7716 0.3414 0.5547 0.0876  -0.0866 0.0472  170 ILE C N   
3567 C CA  . ILE C 142 ? 0.7498 0.3212 0.5490 0.0991  -0.0900 0.0388  170 ILE C CA  
3568 C C   . ILE C 142 ? 0.7333 0.3257 0.5438 0.1292  -0.1053 0.0243  170 ILE C C   
3569 O O   . ILE C 142 ? 0.7004 0.3302 0.5436 0.1361  -0.1018 0.0120  170 ILE C O   
3570 C CB  . ILE C 142 ? 0.8595 0.3730 0.6242 0.0935  -0.0956 0.0481  170 ILE C CB  
3571 C CG1 . ILE C 142 ? 0.8420 0.3574 0.6133 0.0631  -0.0769 0.0557  170 ILE C CG1 
3572 C CG2 . ILE C 142 ? 0.9014 0.4050 0.6702 0.1160  -0.1079 0.0371  170 ILE C CG2 
3573 C CD1 . ILE C 142 ? 0.7748 0.3321 0.5889 0.0594  -0.0644 0.0462  170 ILE C CD1 
3574 N N   . ASP C 143 ? 0.7909 0.3632 0.5741 0.1472  -0.1224 0.0248  171 ASP C N   
3575 C CA  . ASP C 143 ? 0.8446 0.4327 0.6334 0.1804  -0.1407 0.0089  171 ASP C CA  
3576 C C   . ASP C 143 ? 0.7441 0.4023 0.5724 0.1854  -0.1366 -0.0054 171 ASP C C   
3577 O O   . ASP C 143 ? 0.7821 0.4525 0.6034 0.2022  -0.1496 -0.0114 171 ASP C O   
3578 C CB  . ASP C 143 ? 0.9302 0.4623 0.6687 0.2009  -0.1642 0.0148  171 ASP C CB  
3579 C CG  . ASP C 143 ? 1.0933 0.6234 0.8286 0.2393  -0.1869 -0.0019 171 ASP C CG  
3580 O OD1 . ASP C 143 ? 1.1654 0.7210 0.9283 0.2465  -0.1837 -0.0150 171 ASP C OD1 
3581 O OD2 . ASP C 143 ? 1.2398 0.7422 0.9425 0.2639  -0.2092 -0.0028 171 ASP C OD2 
3582 N N   . ILE C 144 ? 0.7017 0.4038 0.5691 0.1690  -0.1190 -0.0107 172 ILE C N   
3583 C CA  . ILE C 144 ? 0.6116 0.3783 0.5161 0.1691  -0.1144 -0.0248 172 ILE C CA  
3584 C C   . ILE C 144 ? 0.5524 0.3574 0.4876 0.1722  -0.1090 -0.0376 172 ILE C C   
3585 O O   . ILE C 144 ? 0.5430 0.3285 0.4773 0.1649  -0.1020 -0.0327 172 ILE C O   
3586 C CB  . ILE C 144 ? 0.5744 0.3592 0.4937 0.1419  -0.0980 -0.0183 172 ILE C CB  
3587 C CG1 . ILE C 144 ? 0.5395 0.3136 0.4680 0.1189  -0.0805 -0.0092 172 ILE C CG1 
3588 C CG2 . ILE C 144 ? 0.6400 0.3975 0.5304 0.1402  -0.1033 -0.0087 172 ILE C CG2 
3589 C CD1 . ILE C 144 ? 0.4953 0.2961 0.4456 0.0972  -0.0664 -0.0087 172 ILE C CD1 
3590 N N   . PRO C 145 ? 0.5263 0.3903 0.4889 0.1806  -0.1115 -0.0548 173 PRO C N   
3591 C CA  . PRO C 145 ? 0.4952 0.4018 0.4862 0.1786  -0.1037 -0.0665 173 PRO C CA  
3592 C C   . PRO C 145 ? 0.4451 0.3526 0.4497 0.1471  -0.0832 -0.0555 173 PRO C C   
3593 O O   . PRO C 145 ? 0.4333 0.3368 0.4392 0.1278  -0.0752 -0.0467 173 PRO C O   
3594 C CB  . PRO C 145 ? 0.4804 0.4555 0.4975 0.1860  -0.1078 -0.0859 173 PRO C CB  
3595 C CG  . PRO C 145 ? 0.5144 0.4748 0.5115 0.2059  -0.1253 -0.0877 173 PRO C CG  
3596 C CD  . PRO C 145 ? 0.5296 0.4277 0.4977 0.1916  -0.1215 -0.0654 173 PRO C CD  
3597 N N   . LYS C 146 ? 0.4302 0.3390 0.4421 0.1442  -0.0765 -0.0564 174 LYS C N   
3598 C CA  . LYS C 146 ? 0.3972 0.3036 0.4185 0.1180  -0.0597 -0.0463 174 LYS C CA  
3599 C C   . LYS C 146 ? 0.3898 0.3306 0.4287 0.1179  -0.0541 -0.0559 174 LYS C C   
3600 O O   . LYS C 146 ? 0.4018 0.3525 0.4399 0.1401  -0.0634 -0.0683 174 LYS C O   
3601 C CB  . LYS C 146 ? 0.4192 0.2683 0.4184 0.1107  -0.0568 -0.0302 174 LYS C CB  
3602 C CG  . LYS C 146 ? 0.4588 0.2755 0.4405 0.1274  -0.0657 -0.0316 174 LYS C CG  
3603 C CD  . LYS C 146 ? 0.4994 0.2589 0.4541 0.1194  -0.0656 -0.0166 174 LYS C CD  
3604 C CE  . LYS C 146 ? 0.5434 0.2746 0.4729 0.1268  -0.0765 -0.0111 174 LYS C CE  
3605 N NZ  . LYS C 146 ? 0.5786 0.2584 0.4795 0.1142  -0.0749 0.0037  174 LYS C NZ  
3606 N N   . LYS C 147 ? 0.3546 0.3110 0.4063 0.0938  -0.0399 -0.0504 175 LYS C N   
3607 C CA  . LYS C 147 ? 0.3631 0.3534 0.4288 0.0881  -0.0322 -0.0570 175 LYS C CA  
3608 C C   . LYS C 147 ? 0.3778 0.3375 0.4329 0.0950  -0.0320 -0.0533 175 LYS C C   
3609 O O   . LYS C 147 ? 0.4056 0.3913 0.4681 0.1011  -0.0306 -0.0632 175 LYS C O   
3610 C CB  . LYS C 147 ? 0.3432 0.3471 0.4178 0.0582  -0.0186 -0.0487 175 LYS C CB  
3611 C CG  . LYS C 147 ? 0.3668 0.4023 0.4522 0.0455  -0.0177 -0.0531 175 LYS C CG  
3612 C CD  . LYS C 147 ? 0.3609 0.4043 0.4499 0.0151  -0.0060 -0.0454 175 LYS C CD  
3613 C CE  . LYS C 147 ? 0.3752 0.4613 0.4736 0.0074  0.0011  -0.0525 175 LYS C CE  
3614 N NZ  . LYS C 147 ? 0.3972 0.5043 0.4981 -0.0246 0.0105  -0.0486 175 LYS C NZ  
3615 N N   . GLY C 148 ? 0.3780 0.2862 0.4161 0.0918  -0.0325 -0.0400 176 GLY C N   
3616 C CA  . GLY C 148 ? 0.3773 0.2559 0.4056 0.0928  -0.0312 -0.0357 176 GLY C CA  
3617 C C   . GLY C 148 ? 0.3646 0.2028 0.3812 0.0781  -0.0263 -0.0203 176 GLY C C   
3618 O O   . GLY C 148 ? 0.3548 0.1799 0.3654 0.0735  -0.0272 -0.0140 176 GLY C O   
3619 N N   . VAL C 149 ? 0.3472 0.1693 0.3604 0.0720  -0.0217 -0.0162 177 VAL C N   
3620 C CA  . VAL C 149 ? 0.3525 0.1438 0.3566 0.0591  -0.0171 -0.0049 177 VAL C CA  
3621 C C   . VAL C 149 ? 0.3355 0.1402 0.3498 0.0470  -0.0080 -0.0022 177 VAL C C   
3622 O O   . VAL C 149 ? 0.3411 0.1544 0.3581 0.0502  -0.0073 -0.0069 177 VAL C O   
3623 C CB  . VAL C 149 ? 0.3854 0.1372 0.3703 0.0636  -0.0231 -0.0031 177 VAL C CB  
3624 C CG1 . VAL C 149 ? 0.3808 0.1124 0.3590 0.0471  -0.0167 0.0067  177 VAL C CG1 
3625 C CG2 . VAL C 149 ? 0.4304 0.1602 0.3979 0.0786  -0.0355 -0.0056 177 VAL C CG2 
3626 N N   . ALA C 150 ? 0.3551 0.1616 0.3734 0.0346  -0.0023 0.0044  178 ALA C N   
3627 C CA  . ALA C 150 ? 0.3431 0.1537 0.3658 0.0245  0.0037  0.0084  178 ALA C CA  
3628 C C   . ALA C 150 ? 0.3201 0.1561 0.3494 0.0220  0.0066  0.0055  178 ALA C C   
3629 O O   . ALA C 150 ? 0.3259 0.1617 0.3539 0.0180  0.0094  0.0077  178 ALA C O   
3630 C CB  . ALA C 150 ? 0.3426 0.1342 0.3595 0.0232  0.0044  0.0104  178 ALA C CB  
3631 N N   . GLY C 151 ? 0.3219 0.1830 0.3574 0.0229  0.0062  0.0004  179 GLY C N   
3632 C CA  . GLY C 151 ? 0.3287 0.2215 0.3695 0.0185  0.0101  -0.0038 179 GLY C CA  
3633 C C   . GLY C 151 ? 0.3359 0.2477 0.3797 0.0333  0.0072  -0.0157 179 GLY C C   
3634 O O   . GLY C 151 ? 0.3340 0.2813 0.3833 0.0307  0.0109  -0.0222 179 GLY C O   
3635 N N   . LEU C 152 ? 0.3396 0.2275 0.3776 0.0481  0.0002  -0.0193 180 LEU C N   
3636 C CA  . LEU C 152 ? 0.3457 0.2432 0.3831 0.0663  -0.0060 -0.0328 180 LEU C CA  
3637 C C   . LEU C 152 ? 0.3692 0.2821 0.4100 0.0820  -0.0141 -0.0433 180 LEU C C   
3638 O O   . LEU C 152 ? 0.3577 0.2435 0.3904 0.0874  -0.0207 -0.0395 180 LEU C O   
3639 C CB  . LEU C 152 ? 0.3699 0.2258 0.3942 0.0730  -0.0116 -0.0313 180 LEU C CB  
3640 C CG  . LEU C 152 ? 0.3807 0.2269 0.4033 0.0600  -0.0051 -0.0240 180 LEU C CG  
3641 C CD1 . LEU C 152 ? 0.4330 0.2390 0.4433 0.0610  -0.0099 -0.0216 180 LEU C CD1 
3642 C CD2 . LEU C 152 ? 0.3932 0.2685 0.4203 0.0613  -0.0016 -0.0314 180 LEU C CD2 
3643 N N   . ARG C 153 ? 0.3698 0.3298 0.4221 0.0893  -0.0138 -0.0573 181 ARG C N   
3644 C CA  . ARG C 153 ? 0.4420 0.4294 0.5014 0.1053  -0.0218 -0.0705 181 ARG C CA  
3645 C C   . ARG C 153 ? 0.4862 0.4497 0.5341 0.1346  -0.0372 -0.0822 181 ARG C C   
3646 O O   . ARG C 153 ? 0.4690 0.4211 0.5108 0.1430  -0.0396 -0.0878 181 ARG C O   
3647 C CB  . ARG C 153 ? 0.4600 0.5163 0.5375 0.1005  -0.0151 -0.0836 181 ARG C CB  
3648 C CG  . ARG C 153 ? 0.5121 0.5861 0.5962 0.0707  -0.0031 -0.0720 181 ARG C CG  
3649 C CD  . ARG C 153 ? 0.5816 0.7220 0.6795 0.0572  0.0058  -0.0821 181 ARG C CD  
3650 N NE  . ARG C 153 ? 0.7422 0.8763 0.8359 0.0243  0.0169  -0.0654 181 ARG C NE  
3651 C CZ  . ARG C 153 ? 0.7355 0.8695 0.8316 0.0076  0.0185  -0.0593 181 ARG C CZ  
3652 N NH1 . ARG C 153 ? 0.6137 0.7609 0.7190 0.0194  0.0108  -0.0686 181 ARG C NH1 
3653 N NH2 . ARG C 153 ? 0.7180 0.8361 0.8050 -0.0206 0.0264  -0.0442 181 ARG C NH2 
3654 N N   . LEU C 154 ? 0.5838 0.5351 0.6256 0.1498  -0.0489 -0.0854 182 LEU C N   
3655 C CA  . LEU C 154 ? 0.7545 0.6813 0.7813 0.1810  -0.0671 -0.0979 182 LEU C CA  
3656 C C   . LEU C 154 ? 0.8037 0.7920 0.8471 0.2040  -0.0737 -0.1231 182 LEU C C   
3657 O O   . LEU C 154 ? 0.7865 0.8288 0.8493 0.1979  -0.0685 -0.1289 182 LEU C O   
3658 C CB  . LEU C 154 ? 0.8441 0.7237 0.8507 0.1875  -0.0785 -0.0885 182 LEU C CB  
3659 C CG  . LEU C 154 ? 0.8640 0.6707 0.8430 0.1785  -0.0808 -0.0713 182 LEU C CG  
3660 C CD1 . LEU C 154 ? 0.9363 0.7087 0.8986 0.1942  -0.0911 -0.0794 182 LEU C CD1 
3661 C CD2 . LEU C 154 ? 0.8222 0.6255 0.8084 0.1467  -0.0630 -0.0544 182 LEU C CD2 
3662 N N   . HIS D 2   ? 1.0006 0.6367 1.2628 -0.1516 -0.1452 -0.0283 -5  HIS D N   
3663 C CA  . HIS D 2   ? 1.0292 0.7120 1.2696 -0.1456 -0.1215 -0.0031 -5  HIS D CA  
3664 C C   . HIS D 2   ? 0.9434 0.6618 1.1523 -0.1282 -0.1069 -0.0226 -5  HIS D C   
3665 O O   . HIS D 2   ? 0.8261 0.5865 1.0253 -0.1299 -0.0951 -0.0068 -5  HIS D O   
3666 C CB  . HIS D 2   ? 0.9980 0.6693 1.2344 -0.1352 -0.1107 0.0169  -5  HIS D CB  
3667 C CG  . HIS D 2   ? 1.0264 0.6762 1.2441 -0.1096 -0.1044 -0.0070 -5  HIS D CG  
3668 N ND1 . HIS D 2   ? 1.1050 0.7125 1.3330 -0.1018 -0.1191 -0.0335 -5  HIS D ND1 
3669 C CD2 . HIS D 2   ? 1.0040 0.6709 1.1956 -0.0904 -0.0858 -0.0076 -5  HIS D CD2 
3670 C CE1 . HIS D 2   ? 1.1815 0.7874 1.3893 -0.0783 -0.1082 -0.0486 -5  HIS D CE1 
3671 N NE2 . HIS D 2   ? 1.0143 0.6547 1.2004 -0.0728 -0.0884 -0.0319 -5  HIS D NE2 
3672 N N   . HIS D 3   ? 0.9446 0.6489 1.1391 -0.1111 -0.1086 -0.0556 -4  HIS D N   
3673 C CA  . HIS D 3   ? 0.8879 0.6268 1.0562 -0.0978 -0.0991 -0.0736 -4  HIS D CA  
3674 C C   . HIS D 3   ? 0.8390 0.6123 1.0121 -0.1125 -0.1047 -0.0719 -4  HIS D C   
3675 O O   . HIS D 3   ? 0.7305 0.5429 0.8869 -0.1065 -0.0921 -0.0627 -4  HIS D O   
3676 C CB  . HIS D 3   ? 0.9887 0.7127 1.1469 -0.0814 -0.1051 -0.1110 -4  HIS D CB  
3677 C CG  . HIS D 3   ? 1.0198 0.7312 1.1641 -0.0612 -0.0938 -0.1136 -4  HIS D CG  
3678 N ND1 . HIS D 3   ? 1.0837 0.8098 1.2072 -0.0418 -0.0884 -0.1381 -4  HIS D ND1 
3679 C CD2 . HIS D 3   ? 1.0160 0.7079 1.1644 -0.0581 -0.0869 -0.0936 -4  HIS D CD2 
3680 C CE1 . HIS D 3   ? 1.0557 0.7706 1.1725 -0.0284 -0.0789 -0.1329 -4  HIS D CE1 
3681 N NE2 . HIS D 3   ? 1.0263 0.7192 1.1577 -0.0376 -0.0781 -0.1069 -4  HIS D NE2 
3682 N N   . HIS D 4   ? 0.7303 0.4882 0.9279 -0.1318 -0.1248 -0.0803 -3  HIS D N   
3683 C CA  . HIS D 4   ? 0.7469 0.5394 0.9515 -0.1477 -0.1326 -0.0807 -3  HIS D CA  
3684 C C   . HIS D 4   ? 0.7121 0.5374 0.9276 -0.1628 -0.1256 -0.0432 -3  HIS D C   
3685 O O   . HIS D 4   ? 0.7509 0.6227 0.9587 -0.1632 -0.1197 -0.0372 -3  HIS D O   
3686 C CB  . HIS D 4   ? 0.7628 0.5271 0.9931 -0.1656 -0.1590 -0.1035 -3  HIS D CB  
3687 C CG  . HIS D 4   ? 0.8123 0.6119 1.0558 -0.1874 -0.1695 -0.0998 -3  HIS D CG  
3688 N ND1 . HIS D 4   ? 0.8085 0.6568 1.0322 -0.1801 -0.1640 -0.1114 -3  HIS D ND1 
3689 C CD2 . HIS D 4   ? 0.8332 0.6303 1.1091 -0.2174 -0.1856 -0.0832 -3  HIS D CD2 
3690 C CE1 . HIS D 4   ? 0.7969 0.6721 1.0396 -0.2032 -0.1759 -0.1041 -3  HIS D CE1 
3691 N NE2 . HIS D 4   ? 0.8251 0.6706 1.0999 -0.2271 -0.1891 -0.0871 -3  HIS D NE2 
3692 N N   . HIS D 5   ? 0.6884 0.4942 0.9224 -0.1741 -0.1266 -0.0175 -2  HIS D N   
3693 C CA  . HIS D 5   ? 0.6814 0.5243 0.9291 -0.1902 -0.1217 0.0184  -2  HIS D CA  
3694 C C   . HIS D 5   ? 0.5968 0.4769 0.8213 -0.1711 -0.0980 0.0342  -2  HIS D C   
3695 O O   . HIS D 5   ? 0.6472 0.5718 0.8782 -0.1785 -0.0919 0.0580  -2  HIS D O   
3696 C CB  . HIS D 5   ? 0.6720 0.4870 0.9482 -0.2098 -0.1317 0.0437  -2  HIS D CB  
3697 C CG  . HIS D 5   ? 0.7203 0.5008 1.0284 -0.2346 -0.1584 0.0359  -2  HIS D CG  
3698 N ND1 . HIS D 5   ? 0.6969 0.5043 1.0235 -0.2581 -0.1715 0.0380  -2  HIS D ND1 
3699 C CD2 . HIS D 5   ? 0.7405 0.4603 1.0680 -0.2398 -0.1762 0.0262  -2  HIS D CD2 
3700 C CE1 . HIS D 5   ? 0.7601 0.5223 1.1162 -0.2784 -0.1970 0.0287  -2  HIS D CE1 
3701 N NE2 . HIS D 5   ? 0.7740 0.4807 1.1318 -0.2667 -0.2007 0.0210  -2  HIS D NE2 
3702 N N   . HIS D 6   ? 0.5417 0.4057 0.7410 -0.1467 -0.0860 0.0204  -1  HIS D N   
3703 C CA  . HIS D 6   ? 0.4930 0.3798 0.6732 -0.1289 -0.0663 0.0336  -1  HIS D CA  
3704 C C   . HIS D 6   ? 0.4320 0.3278 0.5859 -0.1073 -0.0572 0.0151  -1  HIS D C   
3705 O O   . HIS D 6   ? 0.4069 0.2877 0.5430 -0.0901 -0.0470 0.0104  -1  HIS D O   
3706 C CB  . HIS D 6   ? 0.4912 0.3482 0.6711 -0.1240 -0.0614 0.0432  -1  HIS D CB  
3707 C CG  . HIS D 6   ? 0.5083 0.3568 0.7157 -0.1460 -0.0717 0.0662  -1  HIS D CG  
3708 N ND1 . HIS D 6   ? 0.5290 0.4200 0.7510 -0.1613 -0.0705 0.0937  -1  HIS D ND1 
3709 C CD2 . HIS D 6   ? 0.5479 0.3529 0.7728 -0.1553 -0.0844 0.0682  -1  HIS D CD2 
3710 C CE1 . HIS D 6   ? 0.5349 0.4105 0.7824 -0.1818 -0.0819 0.1146  -1  HIS D CE1 
3711 N NE2 . HIS D 6   ? 0.5544 0.3741 0.8048 -0.1781 -0.0912 0.0998  -1  HIS D NE2 
3712 N N   . ALA D 7   ? 0.4235 0.3472 0.5766 -0.1099 -0.0619 0.0071  0   ALA D N   
3713 C CA  . ALA D 7   ? 0.4077 0.3405 0.5390 -0.0931 -0.0579 -0.0100 0   ALA D CA  
3714 C C   . ALA D 7   ? 0.3838 0.3347 0.4977 -0.0737 -0.0423 0.0007  0   ALA D C   
3715 O O   . ALA D 7   ? 0.3673 0.3105 0.4632 -0.0591 -0.0372 -0.0084 0   ALA D O   
3716 C CB  . ALA D 7   ? 0.4200 0.3817 0.5564 -0.1021 -0.0688 -0.0200 0   ALA D CB  
3717 N N   . MET D 8   ? 0.3703 0.3467 0.4911 -0.0733 -0.0359 0.0196  1   MET D N   
3718 C CA  . MET D 8   ? 0.3925 0.3794 0.4999 -0.0531 -0.0230 0.0271  1   MET D CA  
3719 C C   . MET D 8   ? 0.3638 0.3150 0.4597 -0.0441 -0.0158 0.0244  1   MET D C   
3720 O O   . MET D 8   ? 0.3442 0.2870 0.4250 -0.0289 -0.0099 0.0206  1   MET D O   
3721 C CB  . MET D 8   ? 0.4263 0.4491 0.5443 -0.0522 -0.0179 0.0438  1   MET D CB  
3722 C CG  . MET D 8   ? 0.5155 0.5780 0.6330 -0.0409 -0.0167 0.0468  1   MET D CG  
3723 S SD  . MET D 8   ? 0.5778 0.6937 0.7103 -0.0383 -0.0113 0.0634  1   MET D SD  
3724 C CE  . MET D 8   ? 0.5541 0.6471 0.6752 -0.0222 0.0003  0.0633  1   MET D CE  
3725 N N   . ALA D 9   ? 0.3471 0.2789 0.4524 -0.0546 -0.0176 0.0285  2   ALA D N   
3726 C CA  . ALA D 9   ? 0.3396 0.2403 0.4360 -0.0474 -0.0121 0.0263  2   ALA D CA  
3727 C C   . ALA D 9   ? 0.3449 0.2211 0.4293 -0.0413 -0.0143 0.0088  2   ALA D C   
3728 O O   . ALA D 9   ? 0.3422 0.2088 0.4126 -0.0289 -0.0070 0.0065  2   ALA D O   
3729 C CB  . ALA D 9   ? 0.3473 0.2349 0.4585 -0.0604 -0.0156 0.0365  2   ALA D CB  
3730 N N   . LEU D 10  ? 0.3632 0.2336 0.4535 -0.0500 -0.0249 -0.0040 3   LEU D N   
3731 C CA  . LEU D 10  ? 0.3931 0.2486 0.4723 -0.0428 -0.0273 -0.0233 3   LEU D CA  
3732 C C   . LEU D 10  ? 0.3758 0.2520 0.4366 -0.0299 -0.0203 -0.0238 3   LEU D C   
3733 O O   . LEU D 10  ? 0.3613 0.2292 0.4097 -0.0202 -0.0150 -0.0280 3   LEU D O   
3734 C CB  . LEU D 10  ? 0.4192 0.2708 0.5079 -0.0526 -0.0415 -0.0418 3   LEU D CB  
3735 C CG  . LEU D 10  ? 0.4430 0.2892 0.5194 -0.0426 -0.0443 -0.0661 3   LEU D CG  
3736 C CD1 . LEU D 10  ? 0.4551 0.2732 0.5285 -0.0337 -0.0396 -0.0689 3   LEU D CD1 
3737 C CD2 . LEU D 10  ? 0.4984 0.3408 0.5860 -0.0515 -0.0607 -0.0891 3   LEU D CD2 
3738 N N   . LYS D 11  ? 0.3741 0.2792 0.4356 -0.0305 -0.0212 -0.0174 4   LYS D N   
3739 C CA  . LYS D 11  ? 0.3902 0.3151 0.4376 -0.0189 -0.0169 -0.0135 4   LYS D CA  
3740 C C   . LYS D 11  ? 0.3574 0.2706 0.3979 -0.0078 -0.0070 -0.0008 4   LYS D C   
3741 O O   . LYS D 11  ? 0.3596 0.2722 0.3885 -0.0003 -0.0040 0.0005  4   LYS D O   
3742 C CB  . LYS D 11  ? 0.4284 0.3879 0.4800 -0.0204 -0.0212 -0.0079 4   LYS D CB  
3743 C CG  . LYS D 11  ? 0.5482 0.5301 0.5930 -0.0224 -0.0290 -0.0212 4   LYS D CG  
3744 C CD  . LYS D 11  ? 0.5973 0.5679 0.6504 -0.0350 -0.0393 -0.0422 4   LYS D CD  
3745 C CE  . LYS D 11  ? 0.6471 0.6375 0.6889 -0.0327 -0.0460 -0.0627 4   LYS D CE  
3746 N NZ  . LYS D 11  ? 0.6631 0.6982 0.7001 -0.0314 -0.0492 -0.0571 4   LYS D NZ  
3747 N N   . ARG D 12  ? 0.3442 0.2510 0.3924 -0.0075 -0.0029 0.0080  5   ARG D N   
3748 C CA  . ARG D 12  ? 0.3515 0.2444 0.3943 0.0026  0.0046  0.0152  5   ARG D CA  
3749 C C   . ARG D 12  ? 0.3462 0.2139 0.3811 0.0031  0.0076  0.0099  5   ARG D C   
3750 O O   . ARG D 12  ? 0.3103 0.1698 0.3375 0.0103  0.0112  0.0138  5   ARG D O   
3751 C CB  . ARG D 12  ? 0.3389 0.2385 0.3912 0.0027  0.0077  0.0219  5   ARG D CB  
3752 C CG  . ARG D 12  ? 0.3423 0.2265 0.3906 0.0104  0.0141  0.0238  5   ARG D CG  
3753 C CD  . ARG D 12  ? 0.3348 0.2156 0.3774 0.0247  0.0158  0.0256  5   ARG D CD  
3754 N NE  . ARG D 12  ? 0.3306 0.1954 0.3702 0.0305  0.0199  0.0236  5   ARG D NE  
3755 C CZ  . ARG D 12  ? 0.3320 0.2052 0.3746 0.0412  0.0220  0.0220  5   ARG D CZ  
3756 N NH1 . ARG D 12  ? 0.3352 0.2350 0.3849 0.0496  0.0212  0.0233  5   ARG D NH1 
3757 N NH2 . ARG D 12  ? 0.3312 0.1893 0.3698 0.0448  0.0244  0.0172  5   ARG D NH2 
3758 N N   . ILE D 13  ? 0.3282 0.1839 0.3675 -0.0046 0.0048  0.0019  6   ILE D N   
3759 C CA  . ILE D 13  ? 0.3386 0.1744 0.3729 -0.0027 0.0072  -0.0034 6   ILE D CA  
3760 C C   . ILE D 13  ? 0.3422 0.1859 0.3654 0.0016  0.0068  -0.0109 6   ILE D C   
3761 O O   . ILE D 13  ? 0.3437 0.1817 0.3597 0.0061  0.0114  -0.0089 6   ILE D O   
3762 C CB  . ILE D 13  ? 0.3490 0.1686 0.3946 -0.0105 0.0022  -0.0094 6   ILE D CB  
3763 C CG1 . ILE D 13  ? 0.3517 0.1704 0.4075 -0.0157 0.0039  0.0037  6   ILE D CG1 
3764 C CG2 . ILE D 13  ? 0.3600 0.1626 0.4015 -0.0057 0.0032  -0.0180 6   ILE D CG2 
3765 C CD1 . ILE D 13  ? 0.3839 0.1913 0.4562 -0.0274 -0.0041 0.0050  6   ILE D CD1 
3766 N N   . GLN D 14  ? 0.3577 0.2197 0.3799 -0.0004 0.0010  -0.0189 7   GLN D N   
3767 C CA  . GLN D 14  ? 0.3885 0.2710 0.3991 0.0039  0.0004  -0.0252 7   GLN D CA  
3768 C C   . GLN D 14  ? 0.3779 0.2714 0.3806 0.0088  0.0054  -0.0071 7   GLN D C   
3769 O O   . GLN D 14  ? 0.3711 0.2741 0.3654 0.0116  0.0081  -0.0043 7   GLN D O   
3770 C CB  . GLN D 14  ? 0.4228 0.3289 0.4337 0.0005  -0.0076 -0.0371 7   GLN D CB  
3771 C CG  . GLN D 14  ? 0.5066 0.4003 0.5260 -0.0042 -0.0161 -0.0596 7   GLN D CG  
3772 C CD  . GLN D 14  ? 0.5580 0.4736 0.5805 -0.0100 -0.0265 -0.0729 7   GLN D CD  
3773 O OE1 . GLN D 14  ? 0.6467 0.5815 0.6711 -0.0138 -0.0276 -0.0616 7   GLN D OE1 
3774 N NE2 . GLN D 14  ? 0.6324 0.5460 0.6567 -0.0097 -0.0351 -0.0989 7   GLN D NE2 
3775 N N   . LYS D 15  ? 0.3748 0.2688 0.3823 0.0100  0.0053  0.0053  8   LYS D N   
3776 C CA  . LYS D 15  ? 0.3828 0.2779 0.3877 0.0156  0.0072  0.0227  8   LYS D CA  
3777 C C   . LYS D 15  ? 0.3675 0.2380 0.3715 0.0168  0.0119  0.0277  8   LYS D C   
3778 O O   . LYS D 15  ? 0.3758 0.2498 0.3752 0.0169  0.0124  0.0381  8   LYS D O   
3779 C CB  . LYS D 15  ? 0.3950 0.2932 0.4084 0.0199  0.0052  0.0302  8   LYS D CB  
3780 C CG  . LYS D 15  ? 0.4158 0.3027 0.4322 0.0287  0.0053  0.0449  8   LYS D CG  
3781 C CD  . LYS D 15  ? 0.4560 0.3528 0.4678 0.0301  0.0022  0.0599  8   LYS D CD  
3782 C CE  . LYS D 15  ? 0.4841 0.3669 0.5049 0.0402  -0.0015 0.0739  8   LYS D CE  
3783 N NZ  . LYS D 15  ? 0.5104 0.3943 0.5302 0.0391  -0.0058 0.0939  8   LYS D NZ  
3784 N N   . GLU D 16  ? 0.3611 0.2113 0.3702 0.0161  0.0146  0.0218  9   GLU D N   
3785 C CA  . GLU D 16  ? 0.3728 0.2033 0.3809 0.0165  0.0182  0.0239  9   GLU D CA  
3786 C C   . GLU D 16  ? 0.3599 0.1953 0.3617 0.0134  0.0200  0.0208  9   GLU D C   
3787 O O   . GLU D 16  ? 0.3717 0.2024 0.3717 0.0124  0.0214  0.0289  9   GLU D O   
3788 C CB  . GLU D 16  ? 0.3579 0.1746 0.3714 0.0160  0.0206  0.0180  9   GLU D CB  
3789 C CG  . GLU D 16  ? 0.3350 0.1517 0.3544 0.0212  0.0204  0.0211  9   GLU D CG  
3790 C CD  . GLU D 16  ? 0.3488 0.1589 0.3713 0.0213  0.0236  0.0179  9   GLU D CD  
3791 O OE1 . GLU D 16  ? 0.3589 0.1569 0.3783 0.0194  0.0256  0.0161  9   GLU D OE1 
3792 O OE2 . GLU D 16  ? 0.3787 0.2013 0.4069 0.0231  0.0241  0.0182  9   GLU D OE2 
3793 N N   . LEU D 17  ? 0.3656 0.2109 0.3659 0.0123  0.0191  0.0079  10  LEU D N   
3794 C CA  . LEU D 17  ? 0.3736 0.2299 0.3685 0.0131  0.0207  0.0012  10  LEU D CA  
3795 C C   . LEU D 17  ? 0.3589 0.2431 0.3461 0.0128  0.0211  0.0116  10  LEU D C   
3796 O O   . LEU D 17  ? 0.3635 0.2573 0.3476 0.0118  0.0241  0.0167  10  LEU D O   
3797 C CB  . LEU D 17  ? 0.3693 0.2301 0.3658 0.0149  0.0172  -0.0188 10  LEU D CB  
3798 C CG  . LEU D 17  ? 0.3841 0.2595 0.3761 0.0200  0.0188  -0.0297 10  LEU D CG  
3799 C CD1 . LEU D 17  ? 0.3822 0.2375 0.3791 0.0209  0.0224  -0.0270 10  LEU D CD1 
3800 C CD2 . LEU D 17  ? 0.4342 0.3162 0.4282 0.0245  0.0124  -0.0538 10  LEU D CD2 
3801 N N   . SER D 18  ? 0.3722 0.2743 0.3570 0.0128  0.0177  0.0170  11  SER D N   
3802 C CA  . SER D 18  ? 0.4087 0.3443 0.3863 0.0118  0.0174  0.0298  11  SER D CA  
3803 C C   . SER D 18  ? 0.4097 0.3320 0.3918 0.0079  0.0172  0.0550  11  SER D C   
3804 O O   . SER D 18  ? 0.4249 0.3679 0.4042 0.0035  0.0180  0.0695  11  SER D O   
3805 C CB  . SER D 18  ? 0.4746 0.4402 0.4478 0.0133  0.0128  0.0272  11  SER D CB  
3806 O OG  . SER D 18  ? 0.5826 0.5470 0.5596 0.0130  0.0096  0.0479  11  SER D OG  
3807 N N   . ASP D 19  ? 0.3829 0.2723 0.3732 0.0095  0.0154  0.0593  12  ASP D N   
3808 C CA  . ASP D 19  ? 0.4205 0.2873 0.4180 0.0070  0.0128  0.0773  12  ASP D CA  
3809 C C   . ASP D 19  ? 0.3878 0.2425 0.3861 0.0016  0.0160  0.0755  12  ASP D C   
3810 O O   . ASP D 19  ? 0.4264 0.2815 0.4284 -0.0053 0.0135  0.0927  12  ASP D O   
3811 C CB  . ASP D 19  ? 0.4153 0.2522 0.4213 0.0137  0.0097  0.0752  12  ASP D CB  
3812 C CG  . ASP D 19  ? 0.4885 0.3376 0.4972 0.0198  0.0050  0.0827  12  ASP D CG  
3813 O OD1 . ASP D 19  ? 0.5016 0.3807 0.5056 0.0176  0.0031  0.0933  12  ASP D OD1 
3814 O OD2 . ASP D 19  ? 0.5059 0.3399 0.5216 0.0277  0.0033  0.0779  12  ASP D OD2 
3815 N N   . LEU D 20  ? 0.4067 0.2531 0.4034 0.0038  0.0204  0.0569  13  LEU D N   
3816 C CA  . LEU D 20  ? 0.4059 0.2438 0.4038 0.0000  0.0233  0.0543  13  LEU D CA  
3817 C C   . LEU D 20  ? 0.4185 0.2896 0.4120 -0.0045 0.0257  0.0603  13  LEU D C   
3818 O O   . LEU D 20  ? 0.4039 0.2770 0.4010 -0.0121 0.0252  0.0726  13  LEU D O   
3819 C CB  . LEU D 20  ? 0.4049 0.2304 0.4032 0.0043  0.0266  0.0362  13  LEU D CB  
3820 C CG  . LEU D 20  ? 0.4128 0.2299 0.4133 0.0022  0.0290  0.0329  13  LEU D CG  
3821 C CD1 . LEU D 20  ? 0.4243 0.2236 0.4278 0.0061  0.0300  0.0223  13  LEU D CD1 
3822 C CD2 . LEU D 20  ? 0.3967 0.2392 0.3941 0.0024  0.0323  0.0290  13  LEU D CD2 
3823 N N   . GLN D 21  ? 0.4059 0.3064 0.3922 0.0001  0.0277  0.0503  14  GLN D N   
3824 C CA  . GLN D 21  ? 0.4031 0.3440 0.3843 -0.0005 0.0309  0.0510  14  GLN D CA  
3825 C C   . GLN D 21  ? 0.4334 0.4036 0.4139 -0.0093 0.0289  0.0776  14  GLN D C   
3826 O O   . GLN D 21  ? 0.4203 0.4222 0.4005 -0.0147 0.0313  0.0879  14  GLN D O   
3827 C CB  . GLN D 21  ? 0.3876 0.3518 0.3620 0.0094  0.0321  0.0273  14  GLN D CB  
3828 C CG  . GLN D 21  ? 0.3604 0.2952 0.3396 0.0162  0.0323  0.0055  14  GLN D CG  
3829 C CD  . GLN D 21  ? 0.3760 0.3296 0.3521 0.0265  0.0310  -0.0194 14  GLN D CD  
3830 O OE1 . GLN D 21  ? 0.3996 0.3819 0.3690 0.0289  0.0288  -0.0253 14  GLN D OE1 
3831 N NE2 . GLN D 21  ? 0.3865 0.3252 0.3684 0.0336  0.0310  -0.0350 14  GLN D NE2 
3832 N N   . ARG D 22  ? 0.4538 0.4151 0.4362 -0.0110 0.0239  0.0914  15  ARG D N   
3833 C CA  . ARG D 22  ? 0.5170 0.4979 0.5029 -0.0207 0.0195  0.1230  15  ARG D CA  
3834 C C   . ARG D 22  ? 0.5170 0.4664 0.5159 -0.0320 0.0150  0.1419  15  ARG D C   
3835 O O   . ARG D 22  ? 0.5265 0.4997 0.5303 -0.0441 0.0125  0.1677  15  ARG D O   
3836 C CB  . ARG D 22  ? 0.5664 0.5460 0.5527 -0.0175 0.0138  0.1335  15  ARG D CB  
3837 C CG  . ARG D 22  ? 0.7122 0.7072 0.7055 -0.0273 0.0070  0.1708  15  ARG D CG  
3838 C CD  . ARG D 22  ? 0.8302 0.8310 0.8241 -0.0219 0.0009  0.1823  15  ARG D CD  
3839 N NE  . ARG D 22  ? 0.9091 0.8573 0.9122 -0.0138 -0.0036 0.1742  15  ARG D NE  
3840 C CZ  . ARG D 22  ? 0.9865 0.9236 0.9853 -0.0033 -0.0007 0.1482  15  ARG D CZ  
3841 N NH1 . ARG D 22  ? 1.0007 0.9669 0.9875 -0.0002 0.0049  0.1261  15  ARG D NH1 
3842 N NH2 . ARG D 22  ? 0.9345 0.8323 0.9428 0.0040  -0.0047 0.1438  15  ARG D NH2 
3843 N N   . ASP D 23  ? 0.5040 0.4034 0.5094 -0.0289 0.0129  0.1302  16  ASP D N   
3844 C CA  . ASP D 23  ? 0.5287 0.3941 0.5472 -0.0386 0.0064  0.1424  16  ASP D CA  
3845 C C   . ASP D 23  ? 0.4647 0.3034 0.4834 -0.0350 0.0097  0.1194  16  ASP D C   
3846 O O   . ASP D 23  ? 0.4671 0.2689 0.4899 -0.0289 0.0065  0.1082  16  ASP D O   
3847 C CB  . ASP D 23  ? 0.5858 0.4156 0.6153 -0.0369 -0.0039 0.1552  16  ASP D CB  
3848 C CG  . ASP D 23  ? 0.6982 0.5530 0.7317 -0.0433 -0.0099 0.1866  16  ASP D CG  
3849 O OD1 . ASP D 23  ? 0.7212 0.5891 0.7629 -0.0588 -0.0146 0.2128  16  ASP D OD1 
3850 O OD2 . ASP D 23  ? 0.7261 0.5900 0.7555 -0.0340 -0.0106 0.1875  16  ASP D OD2 
3851 N N   . PRO D 24  ? 0.4441 0.3068 0.4585 -0.0375 0.0161  0.1122  17  PRO D N   
3852 C CA  . PRO D 24  ? 0.4769 0.3205 0.4908 -0.0329 0.0194  0.0918  17  PRO D CA  
3853 C C   . PRO D 24  ? 0.4493 0.2608 0.4736 -0.0411 0.0126  0.0950  17  PRO D C   
3854 O O   . PRO D 24  ? 0.4519 0.2646 0.4854 -0.0547 0.0062  0.1143  17  PRO D O   
3855 C CB  . PRO D 24  ? 0.4405 0.3230 0.4494 -0.0323 0.0265  0.0865  17  PRO D CB  
3856 C CG  . PRO D 24  ? 0.4765 0.3993 0.4856 -0.0411 0.0261  0.1077  17  PRO D CG  
3857 C CD  . PRO D 24  ? 0.4680 0.3829 0.4773 -0.0419 0.0209  0.1212  17  PRO D CD  
3858 N N   . PRO D 25  ? 0.4568 0.2423 0.4806 -0.0337 0.0129  0.0767  18  PRO D N   
3859 C CA  . PRO D 25  ? 0.5083 0.2691 0.5406 -0.0405 0.0060  0.0743  18  PRO D CA  
3860 C C   . PRO D 25  ? 0.5139 0.2959 0.5498 -0.0531 0.0066  0.0810  18  PRO D C   
3861 O O   . PRO D 25  ? 0.4146 0.2285 0.4443 -0.0502 0.0148  0.0785  18  PRO D O   
3862 C CB  . PRO D 25  ? 0.5006 0.2479 0.5281 -0.0289 0.0091  0.0525  18  PRO D CB  
3863 C CG  . PRO D 25  ? 0.4611 0.2243 0.4799 -0.0187 0.0173  0.0462  18  PRO D CG  
3864 C CD  . PRO D 25  ? 0.4485 0.2349 0.4646 -0.0212 0.0195  0.0582  18  PRO D CD  
3865 N N   . ALA D 26  ? 0.4760 0.2406 0.5236 -0.0663 -0.0032 0.0886  19  ALA D N   
3866 C CA  . ALA D 26  ? 0.4890 0.2746 0.5424 -0.0803 -0.0041 0.0948  19  ALA D CA  
3867 C C   . ALA D 26  ? 0.4066 0.2095 0.4519 -0.0716 0.0041  0.0769  19  ALA D C   
3868 O O   . ALA D 26  ? 0.4009 0.1863 0.4409 -0.0602 0.0055  0.0588  19  ALA D O   
3869 C CB  . ALA D 26  ? 0.5509 0.3055 0.6196 -0.0954 -0.0187 0.0990  19  ALA D CB  
3870 N N   . HIS D 27  ? 0.3976 0.2401 0.4432 -0.0763 0.0094  0.0842  20  HIS D N   
3871 C CA  . HIS D 27  ? 0.3771 0.2401 0.4186 -0.0683 0.0158  0.0717  20  HIS D CA  
3872 C C   . HIS D 27  ? 0.3802 0.2465 0.4113 -0.0486 0.0245  0.0582  20  HIS D C   
3873 O O   . HIS D 27  ? 0.3436 0.2219 0.3734 -0.0404 0.0283  0.0492  20  HIS D O   
3874 C CB  . HIS D 27  ? 0.3994 0.2426 0.4447 -0.0724 0.0094  0.0605  20  HIS D CB  
3875 C CG  . HIS D 27  ? 0.4350 0.2682 0.4933 -0.0929 -0.0022 0.0703  20  HIS D CG  
3876 N ND1 . HIS D 27  ? 0.4872 0.3522 0.5551 -0.1095 -0.0039 0.0891  20  HIS D ND1 
3877 C CD2 . HIS D 27  ? 0.4851 0.2801 0.5503 -0.0999 -0.0141 0.0640  20  HIS D CD2 
3878 C CE1 . HIS D 27  ? 0.5137 0.3574 0.5953 -0.1287 -0.0174 0.0966  20  HIS D CE1 
3879 N NE2 . HIS D 27  ? 0.5118 0.3103 0.5922 -0.1221 -0.0243 0.0794  20  HIS D NE2 
3880 N N   . CYS D 28  ? 0.3685 0.2242 0.3942 -0.0418 0.0262  0.0578  21  CYS D N   
3881 C CA  . CYS D 28  ? 0.3818 0.2322 0.4005 -0.0260 0.0314  0.0444  21  CYS D CA  
3882 C C   . CYS D 28  ? 0.3895 0.2619 0.4035 -0.0193 0.0356  0.0446  21  CYS D C   
3883 O O   . CYS D 28  ? 0.3931 0.2795 0.4067 -0.0259 0.0345  0.0567  21  CYS D O   
3884 C CB  . CYS D 28  ? 0.3969 0.2139 0.4136 -0.0223 0.0286  0.0384  21  CYS D CB  
3885 S SG  . CYS D 28  ? 0.4516 0.2479 0.4711 -0.0246 0.0239  0.0303  21  CYS D SG  
3886 N N   . SER D 29  ? 0.3840 0.2587 0.3953 -0.0062 0.0390  0.0310  22  SER D N   
3887 C CA  . SER D 29  ? 0.3944 0.2852 0.4011 0.0024  0.0411  0.0240  22  SER D CA  
3888 C C   . SER D 29  ? 0.3864 0.2515 0.3932 0.0118  0.0399  0.0106  22  SER D C   
3889 O O   . SER D 29  ? 0.3660 0.2145 0.3772 0.0142  0.0392  0.0075  22  SER D O   
3890 C CB  . SER D 29  ? 0.3868 0.3158 0.3945 0.0097  0.0445  0.0185  22  SER D CB  
3891 O OG  . SER D 29  ? 0.3983 0.3492 0.4011 0.0197  0.0457  0.0073  22  SER D OG  
3892 N N   . ALA D 30  ? 0.3808 0.2464 0.3840 0.0156  0.0389  0.0046  23  ALA D N   
3893 C CA  . ALA D 30  ? 0.3797 0.2251 0.3860 0.0226  0.0362  -0.0078 23  ALA D CA  
3894 C C   . ALA D 30  ? 0.3763 0.2352 0.3794 0.0283  0.0341  -0.0199 23  ALA D C   
3895 O O   . ALA D 30  ? 0.3586 0.2421 0.3546 0.0260  0.0353  -0.0158 23  ALA D O   
3896 C CB  . ALA D 30  ? 0.3710 0.1900 0.3790 0.0172  0.0345  -0.0017 23  ALA D CB  
3897 N N   . GLY D 31  ? 0.3918 0.2359 0.4011 0.0353  0.0298  -0.0346 24  GLY D N   
3898 C CA  . GLY D 31  ? 0.4113 0.2616 0.4196 0.0400  0.0250  -0.0505 24  GLY D CA  
3899 C C   . GLY D 31  ? 0.4203 0.2408 0.4412 0.0438  0.0174  -0.0628 24  GLY D C   
3900 O O   . GLY D 31  ? 0.3945 0.1963 0.4242 0.0453  0.0166  -0.0583 24  GLY D O   
3901 N N   . PRO D 32  ? 0.4555 0.2727 0.4786 0.0444  0.0104  -0.0772 25  PRO D N   
3902 C CA  . PRO D 32  ? 0.4990 0.2855 0.5375 0.0456  0.0000  -0.0886 25  PRO D CA  
3903 C C   . PRO D 32  ? 0.5036 0.2804 0.5523 0.0596  -0.0049 -0.1043 25  PRO D C   
3904 O O   . PRO D 32  ? 0.4918 0.2958 0.5341 0.0724  -0.0021 -0.1185 25  PRO D O   
3905 C CB  . PRO D 32  ? 0.5004 0.2957 0.5370 0.0444  -0.0070 -0.1059 25  PRO D CB  
3906 C CG  . PRO D 32  ? 0.4856 0.3131 0.5059 0.0398  0.0008  -0.0950 25  PRO D CG  
3907 C CD  . PRO D 32  ? 0.4759 0.3226 0.4880 0.0446  0.0103  -0.0852 25  PRO D CD  
3908 N N   . VAL D 33  ? 0.5564 0.2976 0.6226 0.0575  -0.0129 -0.1000 26  VAL D N   
3909 C CA  . VAL D 33  ? 0.6612 0.3834 0.7427 0.0714  -0.0218 -0.1148 26  VAL D CA  
3910 C C   . VAL D 33  ? 0.6965 0.4035 0.7872 0.0740  -0.0355 -0.1406 26  VAL D C   
3911 O O   . VAL D 33  ? 0.6819 0.3682 0.7811 0.0591  -0.0430 -0.1347 26  VAL D O   
3912 C CB  . VAL D 33  ? 0.6795 0.3703 0.7778 0.0661  -0.0260 -0.0933 26  VAL D CB  
3913 C CG1 . VAL D 33  ? 0.7285 0.3933 0.8471 0.0814  -0.0386 -0.1078 26  VAL D CG1 
3914 C CG2 . VAL D 33  ? 0.6400 0.3502 0.7277 0.0635  -0.0132 -0.0714 26  VAL D CG2 
3915 N N   . GLY D 34  ? 0.7139 0.4373 0.8026 0.0927  -0.0388 -0.1705 27  GLY D N   
3916 C CA  . GLY D 34  ? 0.7667 0.4833 0.8612 0.0981  -0.0522 -0.2026 27  GLY D CA  
3917 C C   . GLY D 34  ? 0.8064 0.5421 0.8880 0.0825  -0.0501 -0.2000 27  GLY D C   
3918 O O   . GLY D 34  ? 0.8178 0.5878 0.8804 0.0763  -0.0364 -0.1829 27  GLY D O   
3919 N N   . ASP D 35  ? 0.8437 0.5550 0.9381 0.0756  -0.0653 -0.2156 28  ASP D N   
3920 C CA  . ASP D 35  ? 0.8788 0.6101 0.9637 0.0618  -0.0660 -0.2164 28  ASP D CA  
3921 C C   . ASP D 35  ? 0.8025 0.5170 0.8936 0.0386  -0.0640 -0.1827 28  ASP D C   
3922 O O   . ASP D 35  ? 0.7965 0.5269 0.8826 0.0268  -0.0653 -0.1807 28  ASP D O   
3923 C CB  . ASP D 35  ? 1.0025 0.7219 1.0987 0.0655  -0.0850 -0.2543 28  ASP D CB  
3924 C CG  . ASP D 35  ? 1.1557 0.8140 1.2833 0.0640  -0.1038 -0.2610 28  ASP D CG  
3925 O OD1 . ASP D 35  ? 1.1705 0.7978 1.3144 0.0429  -0.1096 -0.2360 28  ASP D OD1 
3926 O OD2 . ASP D 35  ? 1.1614 0.8050 1.2988 0.0845  -0.1131 -0.2899 28  ASP D OD2 
3927 N N   . ASP D 36  ? 0.7017 0.3905 0.8034 0.0333  -0.0609 -0.1568 29  ASP D N   
3928 C CA  . ASP D 36  ? 0.6585 0.3352 0.7690 0.0131  -0.0605 -0.1271 29  ASP D CA  
3929 C C   . ASP D 36  ? 0.5703 0.2766 0.6616 0.0101  -0.0428 -0.1032 29  ASP D C   
3930 O O   . ASP D 36  ? 0.5010 0.2094 0.5866 0.0163  -0.0333 -0.0908 29  ASP D O   
3931 C CB  . ASP D 36  ? 0.7397 0.3776 0.8733 0.0084  -0.0683 -0.1107 29  ASP D CB  
3932 C CG  . ASP D 36  ? 0.7809 0.4134 0.9266 -0.0135 -0.0700 -0.0806 29  ASP D CG  
3933 O OD1 . ASP D 36  ? 0.6582 0.3199 0.7907 -0.0214 -0.0599 -0.0679 29  ASP D OD1 
3934 O OD2 . ASP D 36  ? 0.7925 0.3939 0.9626 -0.0224 -0.0822 -0.0685 29  ASP D OD2 
3935 N N   . LEU D 37  ? 0.5065 0.2348 0.5895 0.0010  -0.0399 -0.0974 30  LEU D N   
3936 C CA  . LEU D 37  ? 0.4916 0.2439 0.5589 0.0000  -0.0256 -0.0769 30  LEU D CA  
3937 C C   . LEU D 37  ? 0.4277 0.1696 0.5023 -0.0078 -0.0208 -0.0510 30  LEU D C   
3938 O O   . LEU D 37  ? 0.3802 0.1358 0.4433 -0.0055 -0.0100 -0.0375 30  LEU D O   
3939 C CB  . LEU D 37  ? 0.4961 0.2759 0.5545 -0.0048 -0.0251 -0.0779 30  LEU D CB  
3940 C CG  . LEU D 37  ? 0.5508 0.3612 0.5911 0.0053  -0.0213 -0.0914 30  LEU D CG  
3941 C CD1 . LEU D 37  ? 0.5423 0.3678 0.5688 0.0099  -0.0084 -0.0732 30  LEU D CD1 
3942 C CD2 . LEU D 37  ? 0.6254 0.4355 0.6651 0.0169  -0.0264 -0.1179 30  LEU D CD2 
3943 N N   . PHE D 38  ? 0.4156 0.1352 0.5099 -0.0171 -0.0300 -0.0439 31  PHE D N   
3944 C CA  . PHE D 38  ? 0.4159 0.1343 0.5174 -0.0247 -0.0259 -0.0180 31  PHE D CA  
3945 C C   . PHE D 38  ? 0.4128 0.1196 0.5139 -0.0162 -0.0218 -0.0118 31  PHE D C   
3946 O O   . PHE D 38  ? 0.3959 0.1075 0.5005 -0.0207 -0.0178 0.0087  31  PHE D O   
3947 C CB  . PHE D 38  ? 0.4544 0.1625 0.5788 -0.0417 -0.0375 -0.0057 31  PHE D CB  
3948 C CG  . PHE D 38  ? 0.4595 0.1919 0.5843 -0.0524 -0.0381 -0.0019 31  PHE D CG  
3949 C CD1 . PHE D 38  ? 0.4757 0.2106 0.5994 -0.0537 -0.0455 -0.0220 31  PHE D CD1 
3950 C CD2 . PHE D 38  ? 0.4406 0.1994 0.5659 -0.0594 -0.0310 0.0203  31  PHE D CD2 
3951 C CE1 . PHE D 38  ? 0.4706 0.2321 0.5952 -0.0630 -0.0463 -0.0177 31  PHE D CE1 
3952 C CE2 . PHE D 38  ? 0.4384 0.2242 0.5651 -0.0670 -0.0314 0.0236  31  PHE D CE2 
3953 C CZ  . PHE D 38  ? 0.4501 0.2365 0.5771 -0.0694 -0.0392 0.0057  31  PHE D CZ  
3954 N N   . HIS D 39  ? 0.4197 0.1180 0.5162 -0.0032 -0.0225 -0.0296 32  HIS D N   
3955 C CA  . HIS D 39  ? 0.4313 0.1221 0.5288 0.0060  -0.0196 -0.0253 32  HIS D CA  
3956 C C   . HIS D 39  ? 0.4084 0.1176 0.4881 0.0189  -0.0109 -0.0389 32  HIS D C   
3957 O O   . HIS D 39  ? 0.4178 0.1311 0.4943 0.0273  -0.0142 -0.0604 32  HIS D O   
3958 C CB  . HIS D 39  ? 0.4890 0.1478 0.6086 0.0090  -0.0338 -0.0312 32  HIS D CB  
3959 C CG  . HIS D 39  ? 0.5592 0.2111 0.6827 0.0208  -0.0326 -0.0270 32  HIS D CG  
3960 N ND1 . HIS D 39  ? 0.6314 0.2546 0.7742 0.0300  -0.0455 -0.0362 32  HIS D ND1 
3961 C CD2 . HIS D 39  ? 0.5538 0.2240 0.6663 0.0252  -0.0217 -0.0149 32  HIS D CD2 
3962 C CE1 . HIS D 39  ? 0.6754 0.3026 0.8185 0.0404  -0.0415 -0.0282 32  HIS D CE1 
3963 N NE2 . HIS D 39  ? 0.6166 0.2735 0.7409 0.0367  -0.0270 -0.0156 32  HIS D NE2 
3964 N N   . TRP D 40  ? 0.3985 0.1230 0.4670 0.0197  -0.0004 -0.0265 33  TRP D N   
3965 C CA  . TRP D 40  ? 0.3873 0.1316 0.4415 0.0281  0.0073  -0.0336 33  TRP D CA  
3966 C C   . TRP D 40  ? 0.3833 0.1277 0.4403 0.0344  0.0098  -0.0276 33  TRP D C   
3967 O O   . TRP D 40  ? 0.4069 0.1414 0.4720 0.0304  0.0085  -0.0133 33  TRP D O   
3968 C CB  . TRP D 40  ? 0.3701 0.1310 0.4105 0.0221  0.0154  -0.0237 33  TRP D CB  
3969 C CG  . TRP D 40  ? 0.3755 0.1438 0.4112 0.0175  0.0143  -0.0266 33  TRP D CG  
3970 C CD1 . TRP D 40  ? 0.3932 0.1576 0.4346 0.0157  0.0069  -0.0372 33  TRP D CD1 
3971 C CD2 . TRP D 40  ? 0.3522 0.1333 0.3780 0.0144  0.0193  -0.0183 33  TRP D CD2 
3972 N NE1 . TRP D 40  ? 0.3676 0.1465 0.4021 0.0116  0.0081  -0.0351 33  TRP D NE1 
3973 C CE2 . TRP D 40  ? 0.3682 0.1562 0.3936 0.0117  0.0156  -0.0226 33  TRP D CE2 
3974 C CE3 . TRP D 40  ? 0.3744 0.1601 0.3935 0.0139  0.0250  -0.0081 33  TRP D CE3 
3975 C CZ2 . TRP D 40  ? 0.3524 0.1530 0.3710 0.0102  0.0180  -0.0153 33  TRP D CZ2 
3976 C CZ3 . TRP D 40  ? 0.3593 0.1518 0.3730 0.0120  0.0262  -0.0019 33  TRP D CZ3 
3977 C CH2 . TRP D 40  ? 0.3707 0.1711 0.3842 0.0111  0.0231  -0.0045 33  TRP D CH2 
3978 N N   . GLN D 41  ? 0.3856 0.1481 0.4357 0.0435  0.0138  -0.0367 34  GLN D N   
3979 C CA  . GLN D 41  ? 0.4187 0.1915 0.4687 0.0477  0.0180  -0.0296 34  GLN D CA  
3980 C C   . GLN D 41  ? 0.3794 0.1738 0.4155 0.0407  0.0263  -0.0218 34  GLN D C   
3981 O O   . GLN D 41  ? 0.3994 0.2069 0.4271 0.0387  0.0284  -0.0258 34  GLN D O   
3982 C CB  . GLN D 41  ? 0.4898 0.2715 0.5459 0.0635  0.0154  -0.0445 34  GLN D CB  
3983 C CG  . GLN D 41  ? 0.6119 0.4105 0.6691 0.0681  0.0195  -0.0365 34  GLN D CG  
3984 C CD  . GLN D 41  ? 0.8902 0.6783 0.9636 0.0832  0.0124  -0.0421 34  GLN D CD  
3985 O OE1 . GLN D 41  ? 0.9756 0.7605 1.0560 0.0974  0.0067  -0.0619 34  GLN D OE1 
3986 N NE2 . GLN D 41  ? 0.8917 0.6750 0.9719 0.0814  0.0117  -0.0255 34  GLN D NE2 
3987 N N   . ALA D 42  ? 0.3716 0.1692 0.4067 0.0362  0.0294  -0.0099 35  ALA D N   
3988 C CA  . ALA D 42  ? 0.3670 0.1801 0.3931 0.0289  0.0343  -0.0034 35  ALA D CA  
3989 C C   . ALA D 42  ? 0.3880 0.2196 0.4161 0.0308  0.0362  -0.0002 35  ALA D C   
3990 O O   . ALA D 42  ? 0.3548 0.1856 0.3908 0.0381  0.0342  -0.0004 35  ALA D O   
3991 C CB  . ALA D 42  ? 0.3682 0.1692 0.3909 0.0203  0.0346  0.0045  35  ALA D CB  
3992 N N   . THR D 43  ? 0.3494 0.1995 0.3724 0.0236  0.0389  0.0044  36  THR D N   
3993 C CA  . THR D 43  ? 0.3411 0.2151 0.3669 0.0220  0.0403  0.0088  36  THR D CA  
3994 C C   . THR D 43  ? 0.3577 0.2298 0.3808 0.0070  0.0394  0.0182  36  THR D C   
3995 O O   . THR D 43  ? 0.3361 0.2022 0.3554 -0.0007 0.0387  0.0225  36  THR D O   
3996 C CB  . THR D 43  ? 0.3543 0.2628 0.3805 0.0279  0.0430  0.0050  36  THR D CB  
3997 O OG1 . THR D 43  ? 0.3783 0.2860 0.4081 0.0445  0.0419  -0.0092 36  THR D OG1 
3998 C CG2 . THR D 43  ? 0.3483 0.2873 0.3797 0.0258  0.0443  0.0110  36  THR D CG2 
3999 N N   . ILE D 44  ? 0.3480 0.2235 0.3741 0.0034  0.0378  0.0209  37  ILE D N   
4000 C CA  . ILE D 44  ? 0.3398 0.2142 0.3658 -0.0107 0.0345  0.0260  37  ILE D CA  
4001 C C   . ILE D 44  ? 0.3563 0.2620 0.3883 -0.0161 0.0341  0.0310  37  ILE D C   
4002 O O   . ILE D 44  ? 0.3695 0.2914 0.4050 -0.0081 0.0351  0.0293  37  ILE D O   
4003 C CB  . ILE D 44  ? 0.3602 0.2151 0.3839 -0.0118 0.0314  0.0216  37  ILE D CB  
4004 C CG1 . ILE D 44  ? 0.3705 0.2015 0.3898 -0.0075 0.0319  0.0182  37  ILE D CG1 
4005 C CG2 . ILE D 44  ? 0.3776 0.2296 0.4030 -0.0252 0.0254  0.0215  37  ILE D CG2 
4006 C CD1 . ILE D 44  ? 0.4107 0.2317 0.4272 -0.0065 0.0297  0.0130  37  ILE D CD1 
4007 N N   . MET D 45  ? 0.3549 0.2711 0.3898 -0.0303 0.0318  0.0396  38  MET D N   
4008 C CA  . MET D 45  ? 0.4026 0.3511 0.4451 -0.0403 0.0301  0.0469  38  MET D CA  
4009 C C   . MET D 45  ? 0.4210 0.3516 0.4660 -0.0531 0.0222  0.0448  38  MET D C   
4010 O O   . MET D 45  ? 0.4509 0.3509 0.4954 -0.0615 0.0166  0.0440  38  MET D O   
4011 C CB  . MET D 45  ? 0.4394 0.4138 0.4858 -0.0511 0.0308  0.0606  38  MET D CB  
4012 C CG  . MET D 45  ? 0.4782 0.4950 0.5241 -0.0372 0.0385  0.0594  38  MET D CG  
4013 S SD  . MET D 45  ? 0.7787 0.8590 0.8360 -0.0469 0.0393  0.0720  38  MET D SD  
4014 C CE  . MET D 45  ? 0.5311 0.6041 0.5946 -0.0524 0.0336  0.0685  38  MET D CE  
4015 N N   . GLY D 46  ? 0.3945 0.3446 0.4427 -0.0527 0.0207  0.0419  39  GLY D N   
4016 C CA  . GLY D 46  ? 0.3975 0.3352 0.4466 -0.0623 0.0126  0.0348  39  GLY D CA  
4017 C C   . GLY D 46  ? 0.3927 0.3140 0.4490 -0.0831 0.0031  0.0386  39  GLY D C   
4018 O O   . GLY D 46  ? 0.4141 0.3574 0.4796 -0.0969 0.0011  0.0518  39  GLY D O   
4019 N N   . PRO D 47  ? 0.4291 0.3125 0.4828 -0.0849 -0.0036 0.0277  40  PRO D N   
4020 C CA  . PRO D 47  ? 0.4667 0.3256 0.5307 -0.1033 -0.0151 0.0319  40  PRO D CA  
4021 C C   . PRO D 47  ? 0.4785 0.3554 0.5556 -0.1245 -0.0252 0.0361  40  PRO D C   
4022 O O   . PRO D 47  ? 0.4540 0.3507 0.5296 -0.1235 -0.0268 0.0255  40  PRO D O   
4023 C CB  . PRO D 47  ? 0.4879 0.3070 0.5472 -0.0958 -0.0214 0.0128  40  PRO D CB  
4024 C CG  . PRO D 47  ? 0.5049 0.3301 0.5503 -0.0745 -0.0103 0.0049  40  PRO D CG  
4025 C CD  . PRO D 47  ? 0.4403 0.3044 0.4836 -0.0700 -0.0020 0.0120  40  PRO D CD  
4026 N N   . PRO D 48  ? 0.5169 0.3908 0.6081 -0.1450 -0.0329 0.0538  41  PRO D N   
4027 C CA  . PRO D 48  ? 0.5701 0.4601 0.6772 -0.1693 -0.0446 0.0601  41  PRO D CA  
4028 C C   . PRO D 48  ? 0.6021 0.4636 0.7116 -0.1735 -0.0585 0.0355  41  PRO D C   
4029 O O   . PRO D 48  ? 0.6208 0.4405 0.7246 -0.1626 -0.0626 0.0182  41  PRO D O   
4030 C CB  . PRO D 48  ? 0.5981 0.4752 0.7211 -0.1907 -0.0530 0.0847  41  PRO D CB  
4031 C CG  . PRO D 48  ? 0.5704 0.4460 0.6832 -0.1754 -0.0411 0.0947  41  PRO D CG  
4032 C CD  . PRO D 48  ? 0.5305 0.3889 0.6246 -0.1478 -0.0318 0.0711  41  PRO D CD  
4033 N N   . ASP D 49  ? 0.6337 0.5233 0.7508 -0.1873 -0.0654 0.0322  42  ASP D N   
4034 C CA  . ASP D 49  ? 0.7683 0.6401 0.8873 -0.1919 -0.0797 0.0056  42  ASP D CA  
4035 C C   . ASP D 49  ? 0.7003 0.5780 0.7993 -0.1664 -0.0722 -0.0191 42  ASP D C   
4036 O O   . ASP D 49  ? 0.7769 0.6579 0.8749 -0.1686 -0.0822 -0.0416 42  ASP D O   
4037 C CB  . ASP D 49  ? 0.8719 0.6842 1.0042 -0.2040 -0.0983 -0.0032 42  ASP D CB  
4038 C CG  . ASP D 49  ? 0.9551 0.7604 1.1111 -0.2335 -0.1093 0.0253  42  ASP D CG  
4039 O OD1 . ASP D 49  ? 0.9994 0.8386 1.1689 -0.2561 -0.1157 0.0363  42  ASP D OD1 
4040 O OD2 . ASP D 49  ? 1.0427 0.8121 1.2050 -0.2348 -0.1122 0.0389  42  ASP D OD2 
4041 N N   . SER D 50  ? 0.6217 0.5030 0.7057 -0.1437 -0.0559 -0.0148 43  SER D N   
4042 C CA  . SER D 50  ? 0.5477 0.4475 0.6151 -0.1223 -0.0475 -0.0290 43  SER D CA  
4043 C C   . SER D 50  ? 0.5027 0.4551 0.5705 -0.1228 -0.0422 -0.0196 43  SER D C   
4044 O O   . SER D 50  ? 0.4496 0.4250 0.5277 -0.1338 -0.0405 -0.0013 43  SER D O   
4045 C CB  . SER D 50  ? 0.5262 0.4126 0.5815 -0.1012 -0.0340 -0.0248 43  SER D CB  
4046 O OG  . SER D 50  ? 0.4684 0.3815 0.5218 -0.0934 -0.0210 -0.0060 43  SER D OG  
4047 N N   . ALA D 51  ? 0.4778 0.4543 0.5349 -0.1101 -0.0398 -0.0306 44  ALA D N   
4048 C CA  . ALA D 51  ? 0.4537 0.4804 0.5116 -0.1067 -0.0350 -0.0199 44  ALA D CA  
4049 C C   . ALA D 51  ? 0.4158 0.4532 0.4727 -0.0912 -0.0205 0.0000  44  ALA D C   
4050 O O   . ALA D 51  ? 0.4041 0.4804 0.4648 -0.0854 -0.0163 0.0107  44  ALA D O   
4051 C CB  . ALA D 51  ? 0.4463 0.4981 0.4934 -0.0967 -0.0369 -0.0335 44  ALA D CB  
4052 N N   . TYR D 52  ? 0.3982 0.4015 0.4511 -0.0837 -0.0141 0.0030  45  TYR D N   
4053 C CA  . TYR D 52  ? 0.3631 0.3713 0.4150 -0.0685 -0.0024 0.0164  45  TYR D CA  
4054 C C   . TYR D 52  ? 0.3485 0.3612 0.4093 -0.0774 -0.0002 0.0287  45  TYR D C   
4055 O O   . TYR D 52  ? 0.3383 0.3554 0.3982 -0.0647 0.0085  0.0360  45  TYR D O   
4056 C CB  . TYR D 52  ? 0.3534 0.3288 0.3951 -0.0544 0.0029  0.0116  45  TYR D CB  
4057 C CG  . TYR D 52  ? 0.3606 0.3403 0.3938 -0.0476 0.0006  0.0014  45  TYR D CG  
4058 C CD1 . TYR D 52  ? 0.3477 0.3553 0.3792 -0.0357 0.0041  0.0088  45  TYR D CD1 
4059 C CD2 . TYR D 52  ? 0.3730 0.3334 0.4009 -0.0526 -0.0061 -0.0155 45  TYR D CD2 
4060 C CE1 . TYR D 52  ? 0.3529 0.3744 0.3764 -0.0308 0.0020  0.0030  45  TYR D CE1 
4061 C CE2 . TYR D 52  ? 0.3713 0.3469 0.3904 -0.0455 -0.0079 -0.0262 45  TYR D CE2 
4062 C CZ  . TYR D 52  ? 0.3679 0.3770 0.3841 -0.0357 -0.0033 -0.0154 45  TYR D CZ  
4063 O OH  . TYR D 52  ? 0.3590 0.3916 0.3660 -0.0297 -0.0049 -0.0228 45  TYR D OH  
4064 N N   . GLN D 53  ? 0.3562 0.3702 0.4265 -0.0994 -0.0090 0.0311  46  GLN D N   
4065 C CA  . GLN D 53  ? 0.3819 0.4058 0.4615 -0.1113 -0.0078 0.0471  46  GLN D CA  
4066 C C   . GLN D 53  ? 0.3553 0.4294 0.4391 -0.1014 0.0013  0.0585  46  GLN D C   
4067 O O   . GLN D 53  ? 0.3523 0.4624 0.4404 -0.0989 0.0008  0.0586  46  GLN D O   
4068 C CB  . GLN D 53  ? 0.4290 0.4533 0.5232 -0.1406 -0.0213 0.0527  46  GLN D CB  
4069 C CG  . GLN D 53  ? 0.4508 0.5191 0.5547 -0.1524 -0.0271 0.0541  46  GLN D CG  
4070 C CD  . GLN D 53  ? 0.5403 0.6079 0.6620 -0.1849 -0.0423 0.0614  46  GLN D CD  
4071 O OE1 . GLN D 53  ? 0.6218 0.6564 0.7507 -0.1993 -0.0489 0.0696  46  GLN D OE1 
4072 N NE2 . GLN D 53  ? 0.5476 0.6523 0.6783 -0.1974 -0.0493 0.0603  46  GLN D NE2 
4073 N N   . GLY D 54  ? 0.3614 0.4402 0.4439 -0.0945 0.0091  0.0668  47  GLY D N   
4074 C CA  . GLY D 54  ? 0.3500 0.4785 0.4366 -0.0817 0.0177  0.0736  47  GLY D CA  
4075 C C   . GLY D 54  ? 0.3369 0.4591 0.4160 -0.0523 0.0250  0.0629  47  GLY D C   
4076 O O   . GLY D 54  ? 0.3385 0.4954 0.4213 -0.0361 0.0312  0.0636  47  GLY D O   
4077 N N   . GLY D 55  ? 0.3186 0.3998 0.3893 -0.0454 0.0232  0.0532  48  GLY D N   
4078 C CA  . GLY D 55  ? 0.3112 0.3783 0.3771 -0.0214 0.0280  0.0467  48  GLY D CA  
4079 C C   . GLY D 55  ? 0.3210 0.3599 0.3805 -0.0137 0.0324  0.0429  48  GLY D C   
4080 O O   . GLY D 55  ? 0.3331 0.3513 0.3884 -0.0266 0.0311  0.0445  48  GLY D O   
4081 N N   . VAL D 56  ? 0.3147 0.3529 0.3751 0.0073  0.0363  0.0378  49  VAL D N   
4082 C CA  . VAL D 56  ? 0.3291 0.3395 0.3838 0.0160  0.0390  0.0313  49  VAL D CA  
4083 C C   . VAL D 56  ? 0.3321 0.3098 0.3859 0.0274  0.0371  0.0275  49  VAL D C   
4084 O O   . VAL D 56  ? 0.3341 0.3193 0.3956 0.0416  0.0356  0.0277  49  VAL D O   
4085 C CB  . VAL D 56  ? 0.3563 0.3938 0.4145 0.0312  0.0432  0.0256  49  VAL D CB  
4086 C CG1 . VAL D 56  ? 0.3808 0.3918 0.4322 0.0371  0.0447  0.0171  49  VAL D CG1 
4087 C CG2 . VAL D 56  ? 0.3652 0.4483 0.4260 0.0197  0.0456  0.0336  49  VAL D CG2 
4088 N N   . PHE D 57  ? 0.3295 0.2735 0.3759 0.0213  0.0365  0.0259  50  PHE D N   
4089 C CA  . PHE D 57  ? 0.3712 0.2889 0.4173 0.0272  0.0344  0.0261  50  PHE D CA  
4090 C C   . PHE D 57  ? 0.3614 0.2530 0.4057 0.0330  0.0351  0.0203  50  PHE D C   
4091 O O   . PHE D 57  ? 0.3438 0.2275 0.3814 0.0258  0.0369  0.0174  50  PHE D O   
4092 C CB  . PHE D 57  ? 0.3645 0.2737 0.4039 0.0148  0.0323  0.0283  50  PHE D CB  
4093 C CG  . PHE D 57  ? 0.3609 0.2961 0.4019 0.0076  0.0297  0.0310  50  PHE D CG  
4094 C CD1 . PHE D 57  ? 0.3837 0.3339 0.4279 0.0133  0.0275  0.0364  50  PHE D CD1 
4095 C CD2 . PHE D 57  ? 0.3548 0.3012 0.3955 -0.0060 0.0282  0.0299  50  PHE D CD2 
4096 C CE1 . PHE D 57  ? 0.3576 0.3364 0.4030 0.0065  0.0243  0.0378  50  PHE D CE1 
4097 C CE2 . PHE D 57  ? 0.3785 0.3499 0.4224 -0.0146 0.0241  0.0313  50  PHE D CE2 
4098 C CZ  . PHE D 57  ? 0.3501 0.3386 0.3953 -0.0079 0.0224  0.0336  50  PHE D CZ  
4099 N N   . PHE D 58  ? 0.3454 0.2244 0.3975 0.0455  0.0324  0.0194  51  PHE D N   
4100 C CA  . PHE D 58  ? 0.3569 0.2112 0.4104 0.0503  0.0308  0.0127  51  PHE D CA  
4101 C C   . PHE D 58  ? 0.3543 0.1856 0.4087 0.0448  0.0279  0.0209  51  PHE D C   
4102 O O   . PHE D 58  ? 0.3503 0.1854 0.4090 0.0442  0.0257  0.0320  51  PHE D O   
4103 C CB  . PHE D 58  ? 0.3918 0.2455 0.4572 0.0679  0.0270  0.0042  51  PHE D CB  
4104 C CG  . PHE D 58  ? 0.4058 0.2924 0.4704 0.0759  0.0305  -0.0049 51  PHE D CG  
4105 C CD1 . PHE D 58  ? 0.4057 0.3055 0.4611 0.0721  0.0347  -0.0129 51  PHE D CD1 
4106 C CD2 . PHE D 58  ? 0.4300 0.3411 0.5036 0.0871  0.0298  -0.0036 51  PHE D CD2 
4107 C CE1 . PHE D 58  ? 0.3958 0.3360 0.4507 0.0785  0.0385  -0.0188 51  PHE D CE1 
4108 C CE2 . PHE D 58  ? 0.4453 0.3962 0.5189 0.0945  0.0337  -0.0114 51  PHE D CE2 
4109 C CZ  . PHE D 58  ? 0.4107 0.3779 0.4748 0.0897  0.0384  -0.0185 51  PHE D CZ  
4110 N N   . LEU D 59  ? 0.3386 0.1526 0.3892 0.0405  0.0280  0.0166  52  LEU D N   
4111 C CA  . LEU D 59  ? 0.3613 0.1610 0.4123 0.0336  0.0263  0.0246  52  LEU D CA  
4112 C C   . LEU D 59  ? 0.3703 0.1491 0.4278 0.0356  0.0221  0.0191  52  LEU D C   
4113 O O   . LEU D 59  ? 0.3890 0.1665 0.4447 0.0407  0.0221  0.0059  52  LEU D O   
4114 C CB  . LEU D 59  ? 0.3718 0.1760 0.4108 0.0241  0.0304  0.0242  52  LEU D CB  
4115 C CG  . LEU D 59  ? 0.3965 0.2171 0.4288 0.0191  0.0324  0.0263  52  LEU D CG  
4116 C CD1 . LEU D 59  ? 0.4636 0.2965 0.4942 0.0185  0.0337  0.0219  52  LEU D CD1 
4117 C CD2 . LEU D 59  ? 0.4228 0.2394 0.4473 0.0132  0.0335  0.0231  52  LEU D CD2 
4118 N N   . THR D 60  ? 0.3730 0.1401 0.4379 0.0305  0.0181  0.0294  53  THR D N   
4119 C CA  . THR D 60  ? 0.4008 0.1485 0.4733 0.0282  0.0126  0.0255  53  THR D CA  
4120 C C   . THR D 60  ? 0.3731 0.1266 0.4389 0.0178  0.0158  0.0310  53  THR D C   
4121 O O   . THR D 60  ? 0.4107 0.1795 0.4721 0.0135  0.0194  0.0416  53  THR D O   
4122 C CB  . THR D 60  ? 0.4154 0.1445 0.5079 0.0287  0.0026  0.0366  53  THR D CB  
4123 O OG1 . THR D 60  ? 0.4262 0.1690 0.5211 0.0216  0.0035  0.0586  53  THR D OG1 
4124 C CG2 . THR D 60  ? 0.4758 0.1968 0.5779 0.0428  -0.0022 0.0292  53  THR D CG2 
4125 N N   . VAL D 61  ? 0.3751 0.1202 0.4408 0.0151  0.0138  0.0225  54  VAL D N   
4126 C CA  . VAL D 61  ? 0.3914 0.1441 0.4529 0.0071  0.0160  0.0269  54  VAL D CA  
4127 C C   . VAL D 61  ? 0.4181 0.1575 0.4937 0.0005  0.0076  0.0288  54  VAL D C   
4128 O O   . VAL D 61  ? 0.4576 0.1831 0.5370 0.0035  0.0022  0.0147  54  VAL D O   
4129 C CB  . VAL D 61  ? 0.3945 0.1541 0.4424 0.0091  0.0210  0.0157  54  VAL D CB  
4130 C CG1 . VAL D 61  ? 0.3786 0.1473 0.4241 0.0039  0.0225  0.0200  54  VAL D CG1 
4131 C CG2 . VAL D 61  ? 0.3899 0.1584 0.4275 0.0130  0.0265  0.0141  54  VAL D CG2 
4132 N N   . HIS D 62  ? 0.4186 0.1662 0.5029 -0.0088 0.0058  0.0458  55  HIS D N   
4133 C CA  . HIS D 62  ? 0.4544 0.1931 0.5542 -0.0193 -0.0030 0.0508  55  HIS D CA  
4134 C C   . HIS D 62  ? 0.4189 0.1830 0.5138 -0.0260 0.0016  0.0564  55  HIS D C   
4135 O O   . HIS D 62  ? 0.4211 0.2108 0.5109 -0.0266 0.0080  0.0679  55  HIS D O   
4136 C CB  . HIS D 62  ? 0.5175 0.2459 0.6379 -0.0269 -0.0120 0.0709  55  HIS D CB  
4137 C CG  . HIS D 62  ? 0.6006 0.2986 0.7314 -0.0185 -0.0201 0.0634  55  HIS D CG  
4138 N ND1 . HIS D 62  ? 0.6481 0.3486 0.7759 -0.0087 -0.0170 0.0677  55  HIS D ND1 
4139 C CD2 . HIS D 62  ? 0.6878 0.3541 0.8333 -0.0167 -0.0324 0.0500  55  HIS D CD2 
4140 C CE1 . HIS D 62  ? 0.6676 0.3402 0.8080 0.0000  -0.0262 0.0583  55  HIS D CE1 
4141 N NE2 . HIS D 62  ? 0.7529 0.4029 0.9042 -0.0038 -0.0360 0.0459  55  HIS D NE2 
4142 N N   . PHE D 63  ? 0.3907 0.1517 0.4870 -0.0294 -0.0019 0.0463  56  PHE D N   
4143 C CA  . PHE D 63  ? 0.3697 0.1564 0.4625 -0.0334 0.0017  0.0499  56  PHE D CA  
4144 C C   . PHE D 63  ? 0.3992 0.1953 0.5116 -0.0493 -0.0058 0.0669  56  PHE D C   
4145 O O   . PHE D 63  ? 0.3754 0.1481 0.5035 -0.0579 -0.0172 0.0662  56  PHE D O   
4146 C CB  . PHE D 63  ? 0.3688 0.1529 0.4534 -0.0294 0.0011  0.0323  56  PHE D CB  
4147 C CG  . PHE D 63  ? 0.3466 0.1298 0.4130 -0.0165 0.0086  0.0210  56  PHE D CG  
4148 C CD1 . PHE D 63  ? 0.3440 0.1441 0.4000 -0.0107 0.0157  0.0231  56  PHE D CD1 
4149 C CD2 . PHE D 63  ? 0.3528 0.1200 0.4145 -0.0104 0.0073  0.0085  56  PHE D CD2 
4150 C CE1 . PHE D 63  ? 0.3118 0.1078 0.3549 -0.0020 0.0202  0.0161  56  PHE D CE1 
4151 C CE2 . PHE D 63  ? 0.3343 0.1058 0.3816 -0.0019 0.0134  0.0022  56  PHE D CE2 
4152 C CZ  . PHE D 63  ? 0.3162 0.0998 0.3550 0.0006  0.0193  0.0076  56  PHE D CZ  
4153 N N   . PRO D 64  ? 0.4039 0.2360 0.5170 -0.0532 -0.0005 0.0820  57  PRO D N   
4154 C CA  . PRO D 64  ? 0.4035 0.2529 0.5368 -0.0709 -0.0077 0.1014  57  PRO D CA  
4155 C C   . PRO D 64  ? 0.4062 0.2595 0.5449 -0.0776 -0.0132 0.0925  57  PRO D C   
4156 O O   . PRO D 64  ? 0.3566 0.2124 0.4804 -0.0661 -0.0082 0.0749  57  PRO D O   
4157 C CB  . PRO D 64  ? 0.4072 0.3049 0.5362 -0.0691 0.0015  0.1172  57  PRO D CB  
4158 C CG  . PRO D 64  ? 0.3922 0.2962 0.4991 -0.0501 0.0118  0.0972  57  PRO D CG  
4159 C CD  . PRO D 64  ? 0.3887 0.2499 0.4857 -0.0414 0.0109  0.0793  57  PRO D CD  
4160 N N   . THR D 65  ? 0.4089 0.2634 0.5704 -0.0971 -0.0246 0.1065  58  THR D N   
4161 C CA  . THR D 65  ? 0.4349 0.2961 0.6047 -0.1069 -0.0321 0.0991  58  THR D CA  
4162 C C   . THR D 65  ? 0.4116 0.3204 0.5717 -0.1006 -0.0226 0.0992  58  THR D C   
4163 O O   . THR D 65  ? 0.4085 0.3215 0.5661 -0.0997 -0.0255 0.0857  58  THR D O   
4164 C CB  . THR D 65  ? 0.4544 0.3113 0.6547 -0.1329 -0.0480 0.1178  58  THR D CB  
4165 O OG1 . THR D 65  ? 0.4605 0.3599 0.6723 -0.1447 -0.0445 0.1500  58  THR D OG1 
4166 C CG2 . THR D 65  ? 0.4829 0.2846 0.6964 -0.1368 -0.0611 0.1135  58  THR D CG2 
4167 N N   . ASP D 66  ? 0.4065 0.3540 0.5623 -0.0953 -0.0123 0.1137  59  ASP D N   
4168 C CA  . ASP D 66  ? 0.4114 0.4030 0.5588 -0.0843 -0.0037 0.1106  59  ASP D CA  
4169 C C   . ASP D 66  ? 0.3808 0.3650 0.5046 -0.0592 0.0070  0.0932  59  ASP D C   
4170 O O   . ASP D 66  ? 0.3731 0.3924 0.4904 -0.0459 0.0149  0.0919  59  ASP D O   
4171 C CB  . ASP D 66  ? 0.4326 0.4822 0.5924 -0.0929 -0.0004 0.1347  59  ASP D CB  
4172 C CG  . ASP D 66  ? 0.4394 0.4993 0.5961 -0.0906 0.0053  0.1482  59  ASP D CG  
4173 O OD1 . ASP D 66  ? 0.4946 0.5127 0.6430 -0.0854 0.0050  0.1412  59  ASP D OD1 
4174 O OD2 . ASP D 66  ? 0.4820 0.5983 0.6449 -0.0941 0.0100  0.1666  59  ASP D OD2 
4175 N N   . TYR D 67  ? 0.3810 0.3205 0.4939 -0.0528 0.0063  0.0791  60  TYR D N   
4176 C CA  . TYR D 67  ? 0.3704 0.2981 0.4640 -0.0330 0.0137  0.0638  60  TYR D CA  
4177 C C   . TYR D 67  ? 0.3550 0.2990 0.4449 -0.0246 0.0142  0.0561  60  TYR D C   
4178 O O   . TYR D 67  ? 0.3821 0.3294 0.4797 -0.0338 0.0074  0.0554  60  TYR D O   
4179 C CB  . TYR D 67  ? 0.3757 0.2594 0.4612 -0.0309 0.0115  0.0522  60  TYR D CB  
4180 C CG  . TYR D 67  ? 0.3554 0.2270 0.4241 -0.0151 0.0181  0.0417  60  TYR D CG  
4181 C CD1 . TYR D 67  ? 0.3878 0.2620 0.4508 -0.0089 0.0237  0.0440  60  TYR D CD1 
4182 C CD2 . TYR D 67  ? 0.3439 0.2036 0.4033 -0.0080 0.0177  0.0309  60  TYR D CD2 
4183 C CE1 . TYR D 67  ? 0.3903 0.2514 0.4407 0.0028  0.0276  0.0343  60  TYR D CE1 
4184 C CE2 . TYR D 67  ? 0.3502 0.1977 0.3977 0.0031  0.0220  0.0251  60  TYR D CE2 
4185 C CZ  . TYR D 67  ? 0.3781 0.2239 0.4219 0.0078  0.0264  0.0261  60  TYR D CZ  
4186 O OH  . TYR D 67  ? 0.3731 0.2052 0.4077 0.0164  0.0286  0.0203  60  TYR D OH  
4187 N N   . PRO D 68  ? 0.3448 0.2994 0.4247 -0.0068 0.0205  0.0501  61  PRO D N   
4188 C CA  . PRO D 68  ? 0.3407 0.2919 0.4109 0.0064  0.0269  0.0453  61  PRO D CA  
4189 C C   . PRO D 68  ? 0.3540 0.3489 0.4281 0.0125  0.0318  0.0504  61  PRO D C   
4190 O O   . PRO D 68  ? 0.3432 0.3406 0.4090 0.0279  0.0358  0.0406  61  PRO D O   
4191 C CB  . PRO D 68  ? 0.3529 0.2890 0.4140 0.0220  0.0270  0.0341  61  PRO D CB  
4192 C CG  . PRO D 68  ? 0.3553 0.3172 0.4241 0.0227  0.0240  0.0372  61  PRO D CG  
4193 C CD  . PRO D 68  ? 0.3535 0.3209 0.4323 0.0022  0.0191  0.0452  61  PRO D CD  
4194 N N   . PHE D 69  ? 0.3585 0.3904 0.4458 0.0002  0.0308  0.0651  62  PHE D N   
4195 C CA  . PHE D 69  ? 0.3682 0.4542 0.4591 0.0061  0.0362  0.0714  62  PHE D CA  
4196 C C   . PHE D 69  ? 0.3985 0.4895 0.4862 0.0015  0.0393  0.0789  62  PHE D C   
4197 O O   . PHE D 69  ? 0.3980 0.5341 0.4833 0.0106  0.0449  0.0795  62  PHE D O   
4198 C CB  . PHE D 69  ? 0.3830 0.5149 0.4910 -0.0075 0.0338  0.0882  62  PHE D CB  
4199 C CG  . PHE D 69  ? 0.4503 0.5904 0.5615 -0.0003 0.0312  0.0809  62  PHE D CG  
4200 C CD1 . PHE D 69  ? 0.4835 0.5875 0.5963 -0.0101 0.0239  0.0781  62  PHE D CD1 
4201 C CD2 . PHE D 69  ? 0.5323 0.7204 0.6452 0.0181  0.0356  0.0759  62  PHE D CD2 
4202 C CE1 . PHE D 69  ? 0.5267 0.6431 0.6420 -0.0035 0.0211  0.0731  62  PHE D CE1 
4203 C CE2 . PHE D 69  ? 0.5547 0.7524 0.6721 0.0259  0.0324  0.0713  62  PHE D CE2 
4204 C CZ  . PHE D 69  ? 0.5206 0.6825 0.6387 0.0142  0.0252  0.0711  62  PHE D CZ  
4205 N N   . LYS D 70  ? 0.3765 0.4255 0.4643 -0.0110 0.0353  0.0841  63  LYS D N   
4206 C CA  . LYS D 70  ? 0.3976 0.4434 0.4814 -0.0136 0.0371  0.0906  63  LYS D CA  
4207 C C   . LYS D 70  ? 0.3710 0.3641 0.4421 -0.0059 0.0366  0.0741  63  LYS D C   
4208 O O   . LYS D 70  ? 0.3557 0.3148 0.4246 -0.0048 0.0335  0.0642  63  LYS D O   
4209 C CB  . LYS D 70  ? 0.4099 0.4554 0.5105 -0.0364 0.0308  0.1160  63  LYS D CB  
4210 C CG  . LYS D 70  ? 0.4879 0.5911 0.6041 -0.0494 0.0304  0.1398  63  LYS D CG  
4211 C CD  . LYS D 70  ? 0.5475 0.7125 0.6553 -0.0360 0.0398  0.1399  63  LYS D CD  
4212 C CE  . LYS D 70  ? 0.6118 0.8399 0.7353 -0.0527 0.0396  0.1720  63  LYS D CE  
4213 N NZ  . LYS D 70  ? 0.6034 0.8519 0.7462 -0.0691 0.0344  0.1869  63  LYS D NZ  
4214 N N   . PRO D 71  ? 0.3683 0.3604 0.4313 -0.0013 0.0394  0.0723  64  PRO D N   
4215 C CA  . PRO D 71  ? 0.3723 0.3202 0.4253 0.0039  0.0386  0.0588  64  PRO D CA  
4216 C C   . PRO D 71  ? 0.3848 0.2966 0.4442 -0.0075 0.0333  0.0660  64  PRO D C   
4217 O O   . PRO D 71  ? 0.3563 0.2738 0.4286 -0.0200 0.0292  0.0835  64  PRO D O   
4218 C CB  . PRO D 71  ? 0.3845 0.3510 0.4285 0.0112  0.0423  0.0550  64  PRO D CB  
4219 C CG  . PRO D 71  ? 0.4200 0.4387 0.4704 0.0063  0.0445  0.0720  64  PRO D CG  
4220 C CD  . PRO D 71  ? 0.4006 0.4407 0.4617 0.0013  0.0438  0.0800  64  PRO D CD  
4221 N N   . PRO D 72  ? 0.3684 0.2451 0.4200 -0.0026 0.0326  0.0530  65  PRO D N   
4222 C CA  . PRO D 72  ? 0.3704 0.2195 0.4270 -0.0086 0.0282  0.0562  65  PRO D CA  
4223 C C   . PRO D 72  ? 0.3803 0.2380 0.4381 -0.0097 0.0289  0.0666  65  PRO D C   
4224 O O   . PRO D 72  ? 0.3639 0.2438 0.4131 -0.0037 0.0335  0.0643  65  PRO D O   
4225 C CB  . PRO D 72  ? 0.3955 0.2198 0.4417 -0.0014 0.0291  0.0404  65  PRO D CB  
4226 C CG  . PRO D 72  ? 0.3840 0.2191 0.4199 0.0075  0.0336  0.0323  65  PRO D CG  
4227 C CD  . PRO D 72  ? 0.3585 0.2255 0.3975 0.0090  0.0355  0.0371  65  PRO D CD  
4228 N N   . LYS D 73  ? 0.3842 0.2262 0.4540 -0.0168 0.0229  0.0777  66  LYS D N   
4229 C CA  . LYS D 73  ? 0.3976 0.2436 0.4701 -0.0167 0.0220  0.0889  66  LYS D CA  
4230 C C   . LYS D 73  ? 0.3724 0.1933 0.4379 -0.0083 0.0224  0.0745  66  LYS D C   
4231 O O   . LYS D 73  ? 0.4017 0.1957 0.4717 -0.0071 0.0183  0.0662  66  LYS D O   
4232 C CB  . LYS D 73  ? 0.4742 0.3132 0.5674 -0.0277 0.0131  0.1108  66  LYS D CB  
4233 C CG  . LYS D 73  ? 0.5898 0.4624 0.6927 -0.0395 0.0123  0.1314  66  LYS D CG  
4234 C CD  . LYS D 73  ? 0.8048 0.7184 0.9075 -0.0413 0.0151  0.1525  66  LYS D CD  
4235 C CE  . LYS D 73  ? 0.8371 0.8031 0.9419 -0.0484 0.0188  0.1670  66  LYS D CE  
4236 N NZ  . LYS D 73  ? 0.7401 0.7280 0.8266 -0.0359 0.0282  0.1432  66  LYS D NZ  
4237 N N   . ILE D 74  ? 0.4015 0.2357 0.4558 -0.0024 0.0271  0.0700  67  ILE D N   
4238 C CA  . ILE D 74  ? 0.3799 0.1987 0.4279 0.0038  0.0279  0.0579  67  ILE D CA  
4239 C C   . ILE D 74  ? 0.3912 0.2244 0.4405 0.0053  0.0273  0.0675  67  ILE D C   
4240 O O   . ILE D 74  ? 0.4029 0.2647 0.4477 0.0043  0.0295  0.0738  67  ILE D O   
4241 C CB  . ILE D 74  ? 0.3870 0.2065 0.4213 0.0075  0.0324  0.0419  67  ILE D CB  
4242 C CG1 . ILE D 74  ? 0.3837 0.1914 0.4174 0.0070  0.0322  0.0351  67  ILE D CG1 
4243 C CG2 . ILE D 74  ? 0.3670 0.1773 0.3973 0.0106  0.0327  0.0342  67  ILE D CG2 
4244 C CD1 . ILE D 74  ? 0.4027 0.2074 0.4267 0.0106  0.0344  0.0236  67  ILE D CD1 
4245 N N   . ALA D 75  ? 0.3906 0.2090 0.4464 0.0093  0.0240  0.0680  68  ALA D N   
4246 C CA  . ALA D 75  ? 0.3772 0.2108 0.4356 0.0121  0.0227  0.0779  68  ALA D CA  
4247 C C   . ALA D 75  ? 0.3702 0.1951 0.4280 0.0195  0.0225  0.0675  68  ALA D C   
4248 O O   . ALA D 75  ? 0.3775 0.1828 0.4374 0.0233  0.0218  0.0562  68  ALA D O   
4249 C CB  . ALA D 75  ? 0.4318 0.2638 0.5074 0.0094  0.0157  0.1005  68  ALA D CB  
4250 N N   . PHE D 76  ? 0.3744 0.2203 0.4297 0.0217  0.0231  0.0714  69  PHE D N   
4251 C CA  . PHE D 76  ? 0.3778 0.2252 0.4353 0.0288  0.0226  0.0654  69  PHE D CA  
4252 C C   . PHE D 76  ? 0.4025 0.2383 0.4770 0.0378  0.0162  0.0746  69  PHE D C   
4253 O O   . PHE D 76  ? 0.4162 0.2552 0.5011 0.0375  0.0111  0.0935  69  PHE D O   
4254 C CB  . PHE D 76  ? 0.3818 0.2594 0.4321 0.0269  0.0241  0.0663  69  PHE D CB  
4255 C CG  . PHE D 76  ? 0.3781 0.2596 0.4154 0.0205  0.0277  0.0509  69  PHE D CG  
4256 C CD1 . PHE D 76  ? 0.3879 0.2684 0.4165 0.0153  0.0293  0.0456  69  PHE D CD1 
4257 C CD2 . PHE D 76  ? 0.3776 0.2646 0.4135 0.0197  0.0284  0.0428  69  PHE D CD2 
4258 C CE1 . PHE D 76  ? 0.3676 0.2448 0.3877 0.0105  0.0301  0.0311  69  PHE D CE1 
4259 C CE2 . PHE D 76  ? 0.3923 0.2785 0.4201 0.0114  0.0291  0.0318  69  PHE D CE2 
4260 C CZ  . PHE D 76  ? 0.3726 0.2497 0.3931 0.0074  0.0293  0.0255  69  PHE D CZ  
4261 N N   . THR D 77  ? 0.4089 0.2338 0.4876 0.0468  0.0155  0.0618  70  THR D N   
4262 C CA  . THR D 77  ? 0.4283 0.2447 0.5239 0.0600  0.0085  0.0656  70  THR D CA  
4263 C C   . THR D 77  ? 0.4120 0.2580 0.5072 0.0672  0.0103  0.0663  70  THR D C   
4264 O O   . THR D 77  ? 0.4425 0.2912 0.5517 0.0778  0.0044  0.0760  70  THR D O   
4265 C CB  . THR D 77  ? 0.4719 0.2629 0.5743 0.0690  0.0053  0.0481  70  THR D CB  
4266 O OG1 . THR D 77  ? 0.5458 0.3515 0.6347 0.0693  0.0127  0.0307  70  THR D OG1 
4267 C CG2 . THR D 77  ? 0.4933 0.2581 0.5983 0.0599  0.0018  0.0496  70  THR D CG2 
4268 N N   . THR D 78  ? 0.3819 0.2508 0.4629 0.0603  0.0172  0.0580  71  THR D N   
4269 C CA  . THR D 78  ? 0.3666 0.2683 0.4478 0.0636  0.0183  0.0593  71  THR D CA  
4270 C C   . THR D 78  ? 0.3638 0.2872 0.4407 0.0555  0.0173  0.0730  71  THR D C   
4271 O O   . THR D 78  ? 0.3569 0.2794 0.4225 0.0438  0.0195  0.0723  71  THR D O   
4272 C CB  . THR D 78  ? 0.3363 0.2538 0.4070 0.0565  0.0243  0.0460  71  THR D CB  
4273 O OG1 . THR D 78  ? 0.3400 0.2456 0.4121 0.0634  0.0259  0.0337  71  THR D OG1 
4274 C CG2 . THR D 78  ? 0.3264 0.2817 0.4004 0.0583  0.0245  0.0479  71  THR D CG2 
4275 N N   . LYS D 79  ? 0.3674 0.3142 0.4534 0.0633  0.0134  0.0843  72  LYS D N   
4276 C CA  . LYS D 79  ? 0.3724 0.3505 0.4537 0.0568  0.0118  0.0967  72  LYS D CA  
4277 C C   . LYS D 79  ? 0.3735 0.3730 0.4397 0.0433  0.0157  0.0829  72  LYS D C   
4278 O O   . LYS D 79  ? 0.3813 0.3857 0.4470 0.0416  0.0179  0.0716  72  LYS D O   
4279 C CB  . LYS D 79  ? 0.4029 0.4044 0.4988 0.0697  0.0062  0.1114  72  LYS D CB  
4280 C CG  . LYS D 79  ? 0.4253 0.4655 0.5176 0.0647  0.0033  0.1273  72  LYS D CG  
4281 C CD  . LYS D 79  ? 0.4440 0.4982 0.5547 0.0792  -0.0042 0.1498  72  LYS D CD  
4282 C CE  . LYS D 79  ? 0.4646 0.5668 0.5702 0.0739  -0.0071 0.1665  72  LYS D CE  
4283 N NZ  . LYS D 79  ? 0.4563 0.5615 0.5571 0.0655  -0.0084 0.1840  72  LYS D NZ  
4284 N N   . ILE D 80  ? 0.3678 0.3798 0.4229 0.0335  0.0156  0.0832  73  ILE D N   
4285 C CA  . ILE D 80  ? 0.3506 0.3761 0.3935 0.0210  0.0162  0.0671  73  ILE D CA  
4286 C C   . ILE D 80  ? 0.3632 0.4229 0.3978 0.0166  0.0131  0.0693  73  ILE D C   
4287 O O   . ILE D 80  ? 0.3857 0.4531 0.4193 0.0200  0.0130  0.0820  73  ILE D O   
4288 C CB  . ILE D 80  ? 0.3589 0.3513 0.3940 0.0140  0.0195  0.0524  73  ILE D CB  
4289 C CG1 . ILE D 80  ? 0.3634 0.3617 0.3904 0.0015  0.0171  0.0358  73  ILE D CG1 
4290 C CG2 . ILE D 80  ? 0.3446 0.3232 0.3751 0.0154  0.0210  0.0560  73  ILE D CG2 
4291 C CD1 . ILE D 80  ? 0.3749 0.3392 0.3981 -0.0041 0.0188  0.0244  73  ILE D CD1 
4292 N N   . TYR D 81  ? 0.3473 0.4318 0.3772 0.0085  0.0098  0.0576  74  TYR D N   
4293 C CA  . TYR D 81  ? 0.3539 0.4765 0.3743 0.0043  0.0057  0.0529  74  TYR D CA  
4294 C C   . TYR D 81  ? 0.3620 0.4685 0.3709 -0.0033 0.0050  0.0295  74  TYR D C   
4295 O O   . TYR D 81  ? 0.3596 0.4493 0.3688 -0.0127 0.0019  0.0126  74  TYR D O   
4296 C CB  . TYR D 81  ? 0.3676 0.5258 0.3915 -0.0007 0.0002  0.0504  74  TYR D CB  
4297 C CG  . TYR D 81  ? 0.3665 0.5736 0.3817 -0.0035 -0.0052 0.0468  74  TYR D CG  
4298 C CD1 . TYR D 81  ? 0.3711 0.5864 0.3764 -0.0144 -0.0108 0.0203  74  TYR D CD1 
4299 C CD2 . TYR D 81  ? 0.3699 0.6162 0.3876 0.0051  -0.0063 0.0696  74  TYR D CD2 
4300 C CE1 . TYR D 81  ? 0.3832 0.6480 0.3793 -0.0158 -0.0167 0.0128  74  TYR D CE1 
4301 C CE2 . TYR D 81  ? 0.3781 0.6778 0.3865 0.0027  -0.0114 0.0669  74  TYR D CE2 
4302 C CZ  . TYR D 81  ? 0.3818 0.6922 0.3783 -0.0074 -0.0163 0.0365  74  TYR D CZ  
4303 O OH  . TYR D 81  ? 0.3986 0.7658 0.3847 -0.0087 -0.0221 0.0296  74  TYR D OH  
4304 N N   . HIS D 82  ? 0.3637 0.4765 0.3646 0.0010  0.0072  0.0302  75  HIS D N   
4305 C CA  . HIS D 82  ? 0.3670 0.4640 0.3584 -0.0008 0.0072  0.0085  75  HIS D CA  
4306 C C   . HIS D 82  ? 0.3698 0.5018 0.3521 0.0055  0.0092  0.0123  75  HIS D C   
4307 O O   . HIS D 82  ? 0.3763 0.5191 0.3630 0.0099  0.0130  0.0376  75  HIS D O   
4308 C CB  . HIS D 82  ? 0.3738 0.4198 0.3700 -0.0005 0.0116  0.0083  75  HIS D CB  
4309 C CG  . HIS D 82  ? 0.3985 0.4193 0.3893 -0.0034 0.0093  -0.0156 75  HIS D CG  
4310 N ND1 . HIS D 82  ? 0.4127 0.4396 0.3957 0.0026  0.0105  -0.0260 75  HIS D ND1 
4311 C CD2 . HIS D 82  ? 0.4268 0.4169 0.4211 -0.0113 0.0049  -0.0294 75  HIS D CD2 
4312 C CE1 . HIS D 82  ? 0.4366 0.4346 0.4186 0.0010  0.0063  -0.0476 75  HIS D CE1 
4313 N NE2 . HIS D 82  ? 0.4250 0.3981 0.4145 -0.0086 0.0024  -0.0483 75  HIS D NE2 
4314 N N   . PRO D 83  ? 0.3762 0.5272 0.3473 0.0062  0.0059  -0.0128 76  PRO D N   
4315 C CA  . PRO D 83  ? 0.3943 0.5910 0.3558 0.0134  0.0085  -0.0103 76  PRO D CA  
4316 C C   . PRO D 83  ? 0.3803 0.5611 0.3434 0.0181  0.0154  -0.0004 76  PRO D C   
4317 O O   . PRO D 83  ? 0.3928 0.6171 0.3516 0.0222  0.0186  0.0121  76  PRO D O   
4318 C CB  . PRO D 83  ? 0.4096 0.6260 0.3595 0.0153  0.0019  -0.0481 76  PRO D CB  
4319 C CG  . PRO D 83  ? 0.4197 0.5802 0.3758 0.0084  -0.0036 -0.0686 76  PRO D CG  
4320 C CD  . PRO D 83  ? 0.3948 0.5301 0.3629 0.0006  -0.0018 -0.0449 76  PRO D CD  
4321 N N   . ASN D 84  ? 0.3746 0.4994 0.3444 0.0165  0.0173  -0.0042 77  ASN D N   
4322 C CA  . ASN D 84  ? 0.3754 0.4818 0.3478 0.0199  0.0228  0.0021  77  ASN D CA  
4323 C C   . ASN D 84  ? 0.3642 0.4396 0.3492 0.0166  0.0260  0.0291  77  ASN D C   
4324 O O   . ASN D 84  ? 0.3645 0.4176 0.3534 0.0174  0.0293  0.0331  77  ASN D O   
4325 C CB  . ASN D 84  ? 0.3710 0.4385 0.3415 0.0221  0.0210  -0.0250 77  ASN D CB  
4326 C CG  . ASN D 84  ? 0.4000 0.4880 0.3609 0.0271  0.0151  -0.0571 77  ASN D CG  
4327 O OD1 . ASN D 84  ? 0.4193 0.4771 0.3818 0.0236  0.0080  -0.0779 77  ASN D OD1 
4328 N ND2 . ASN D 84  ? 0.4210 0.5631 0.3729 0.0352  0.0169  -0.0617 77  ASN D ND2 
4329 N N   . ILE D 85  ? 0.3818 0.4554 0.3741 0.0141  0.0239  0.0446  78  ILE D N   
4330 C CA  . ILE D 85  ? 0.3777 0.4207 0.3836 0.0136  0.0248  0.0653  78  ILE D CA  
4331 C C   . ILE D 85  ? 0.4046 0.4744 0.4187 0.0150  0.0217  0.0907  78  ILE D C   
4332 O O   . ILE D 85  ? 0.3972 0.4851 0.4101 0.0155  0.0188  0.0881  78  ILE D O   
4333 C CB  . ILE D 85  ? 0.3802 0.3818 0.3900 0.0124  0.0244  0.0530  78  ILE D CB  
4334 C CG1 . ILE D 85  ? 0.3826 0.3595 0.3854 0.0103  0.0253  0.0300  78  ILE D CG1 
4335 C CG2 . ILE D 85  ? 0.3810 0.3522 0.4036 0.0149  0.0250  0.0677  78  ILE D CG2 
4336 C CD1 . ILE D 85  ? 0.4159 0.3670 0.4212 0.0060  0.0236  0.0196  78  ILE D CD1 
4337 N N   . ASN D 86  ? 0.4185 0.4899 0.4433 0.0149  0.0211  0.1171  79  ASN D N   
4338 C CA  . ASN D 86  ? 0.4557 0.5531 0.4909 0.0165  0.0164  0.1461  79  ASN D CA  
4339 C C   . ASN D 86  ? 0.4548 0.5134 0.5083 0.0216  0.0119  0.1580  79  ASN D C   
4340 O O   . ASN D 86  ? 0.4355 0.4522 0.4914 0.0237  0.0134  0.1416  79  ASN D O   
4341 C CB  . ASN D 86  ? 0.4469 0.5799 0.4851 0.0122  0.0159  0.1729  79  ASN D CB  
4342 C CG  . ASN D 86  ? 0.4430 0.5422 0.4935 0.0076  0.0158  0.1848  79  ASN D CG  
4343 O OD1 . ASN D 86  ? 0.4164 0.4636 0.4771 0.0091  0.0140  0.1793  79  ASN D OD1 
4344 N ND2 . ASN D 86  ? 0.4563 0.5912 0.5065 0.0014  0.0172  0.2020  79  ASN D ND2 
4345 N N   . SER D 87  ? 0.4748 0.5503 0.5417 0.0248  0.0058  0.1861  80  SER D N   
4346 C CA  . SER D 87  ? 0.4912 0.5335 0.5778 0.0338  -0.0004 0.1961  80  SER D CA  
4347 C C   . SER D 87  ? 0.5161 0.5067 0.6183 0.0339  -0.0037 0.2004  80  SER D C   
4348 O O   . SER D 87  ? 0.5022 0.4579 0.6182 0.0436  -0.0082 0.1956  80  SER D O   
4349 C CB  . SER D 87  ? 0.5305 0.6042 0.6298 0.0385  -0.0080 0.2275  80  SER D CB  
4350 O OG  . SER D 87  ? 0.5238 0.6191 0.6296 0.0308  -0.0115 0.2593  80  SER D OG  
4351 N N   . ASN D 88  ? 0.5288 0.5177 0.6293 0.0238  -0.0021 0.2070  81  ASN D N   
4352 C CA  . ASN D 88  ? 0.5364 0.4776 0.6496 0.0214  -0.0054 0.2056  81  ASN D CA  
4353 C C   . ASN D 88  ? 0.5038 0.4199 0.6034 0.0218  0.0017  0.1716  81  ASN D C   
4354 O O   . ASN D 88  ? 0.5071 0.3868 0.6148 0.0205  -0.0005 0.1655  81  ASN D O   
4355 C CB  . ASN D 88  ? 0.5692 0.5240 0.6899 0.0084  -0.0079 0.2317  81  ASN D CB  
4356 C CG  . ASN D 88  ? 0.6776 0.6483 0.8185 0.0061  -0.0181 0.2723  81  ASN D CG  
4357 O OD1 . ASN D 88  ? 0.7120 0.6607 0.8692 0.0159  -0.0265 0.2807  81  ASN D OD1 
4358 N ND2 . ASN D 88  ? 0.6990 0.7119 0.8401 -0.0060 -0.0177 0.2992  81  ASN D ND2 
4359 N N   . GLY D 89  ? 0.4697 0.4061 0.5501 0.0228  0.0091  0.1507  82  GLY D N   
4360 C CA  . GLY D 89  ? 0.4099 0.3262 0.4786 0.0220  0.0150  0.1234  82  GLY D CA  
4361 C C   . GLY D 89  ? 0.4019 0.3251 0.4611 0.0144  0.0193  0.1190  82  GLY D C   
4362 O O   . GLY D 89  ? 0.4041 0.3082 0.4561 0.0138  0.0228  0.1001  82  GLY D O   
4363 N N   . SER D 90  ? 0.3845 0.3401 0.4442 0.0093  0.0189  0.1374  83  SER D N   
4364 C CA  . SER D 90  ? 0.3949 0.3673 0.4457 0.0046  0.0235  0.1319  83  SER D CA  
4365 C C   . SER D 90  ? 0.3543 0.3414 0.3860 0.0083  0.0287  0.1044  83  SER D C   
4366 O O   . SER D 90  ? 0.3467 0.3545 0.3716 0.0108  0.0282  0.0987  83  SER D O   
4367 C CB  . SER D 90  ? 0.4124 0.4278 0.4682 -0.0013 0.0223  0.1591  83  SER D CB  
4368 O OG  . SER D 90  ? 0.4755 0.4702 0.5528 -0.0074 0.0151  0.1861  83  SER D OG  
4369 N N   . ILE D 91  ? 0.3645 0.3404 0.3900 0.0086  0.0320  0.0879  84  ILE D N   
4370 C CA  . ILE D 91  ? 0.3714 0.3488 0.3831 0.0127  0.0341  0.0607  84  ILE D CA  
4371 C C   . ILE D 91  ? 0.3963 0.4102 0.3999 0.0160  0.0367  0.0537  84  ILE D C   
4372 O O   . ILE D 91  ? 0.4265 0.4425 0.4339 0.0154  0.0389  0.0589  84  ILE D O   
4373 C CB  . ILE D 91  ? 0.3766 0.3106 0.3883 0.0132  0.0346  0.0455  84  ILE D CB  
4374 C CG1 . ILE D 91  ? 0.4111 0.3163 0.4306 0.0119  0.0327  0.0505  84  ILE D CG1 
4375 C CG2 . ILE D 91  ? 0.3905 0.3207 0.3923 0.0162  0.0338  0.0210  84  ILE D CG2 
4376 C CD1 . ILE D 91  ? 0.4138 0.2851 0.4342 0.0117  0.0334  0.0407  84  ILE D CD1 
4377 N N   . CYS D 92  ? 0.3982 0.4444 0.3913 0.0202  0.0360  0.0398  85  CYS D N   
4378 C CA  . CYS D 92  ? 0.4252 0.5134 0.4094 0.0271  0.0380  0.0272  85  CYS D CA  
4379 C C   . CYS D 92  ? 0.4118 0.4721 0.3906 0.0344  0.0364  -0.0043 85  CYS D C   
4380 O O   . CYS D 92  ? 0.4260 0.4788 0.3992 0.0366  0.0318  -0.0258 85  CYS D O   
4381 C CB  . CYS D 92  ? 0.4813 0.6216 0.4568 0.0292  0.0365  0.0255  85  CYS D CB  
4382 S SG  . CYS D 92  ? 0.4871 0.7028 0.4529 0.0381  0.0402  0.0199  85  CYS D SG  
4383 N N   . LEU D 93  ? 0.3910 0.4361 0.3739 0.0373  0.0388  -0.0052 86  LEU D N   
4384 C CA  . LEU D 93  ? 0.4127 0.4255 0.3945 0.0449  0.0363  -0.0298 86  LEU D CA  
4385 C C   . LEU D 93  ? 0.3889 0.4250 0.3721 0.0533  0.0400  -0.0312 86  LEU D C   
4386 O O   . LEU D 93  ? 0.3902 0.4321 0.3806 0.0470  0.0438  -0.0088 86  LEU D O   
4387 C CB  . LEU D 93  ? 0.4239 0.3808 0.4125 0.0376  0.0349  -0.0238 86  LEU D CB  
4388 C CG  . LEU D 93  ? 0.4832 0.3990 0.4718 0.0384  0.0290  -0.0426 86  LEU D CG  
4389 C CD1 . LEU D 93  ? 0.4850 0.3621 0.4801 0.0334  0.0295  -0.0326 86  LEU D CD1 
4390 C CD2 . LEU D 93  ? 0.4866 0.4049 0.4723 0.0505  0.0240  -0.0695 86  LEU D CD2 
4391 N N   . ASP D 94  ? 0.3812 0.4307 0.3594 0.0678  0.0378  -0.0582 87  ASP D N   
4392 C CA  . ASP D 94  ? 0.3906 0.4759 0.3703 0.0789  0.0417  -0.0611 87  ASP D CA  
4393 C C   . ASP D 94  ? 0.3781 0.4322 0.3674 0.0763  0.0432  -0.0497 87  ASP D C   
4394 O O   . ASP D 94  ? 0.3642 0.4523 0.3582 0.0766  0.0479  -0.0364 87  ASP D O   
4395 C CB  . ASP D 94  ? 0.4161 0.5225 0.3896 0.0993  0.0378  -0.0972 87  ASP D CB  
4396 C CG  . ASP D 94  ? 0.4544 0.4988 0.4316 0.1060  0.0286  -0.1218 87  ASP D CG  
4397 O OD1 . ASP D 94  ? 0.5051 0.4958 0.4874 0.0936  0.0258  -0.1108 87  ASP D OD1 
4398 O OD2 . ASP D 94  ? 0.5233 0.5761 0.4993 0.1246  0.0232  -0.1529 87  ASP D OD2 
4399 N N   . ILE D 95  ? 0.3794 0.3747 0.3721 0.0720  0.0389  -0.0526 88  ILE D N   
4400 C CA  . ILE D 95  ? 0.3766 0.3460 0.3772 0.0695  0.0395  -0.0424 88  ILE D CA  
4401 C C   . ILE D 95  ? 0.3587 0.3255 0.3650 0.0531  0.0429  -0.0144 88  ILE D C   
4402 O O   . ILE D 95  ? 0.3719 0.3258 0.3846 0.0495  0.0432  -0.0054 88  ILE D O   
4403 C CB  . ILE D 95  ? 0.3886 0.3043 0.3914 0.0720  0.0331  -0.0541 88  ILE D CB  
4404 C CG1 . ILE D 95  ? 0.4123 0.2952 0.4132 0.0595  0.0303  -0.0497 88  ILE D CG1 
4405 C CG2 . ILE D 95  ? 0.4149 0.3286 0.4171 0.0897  0.0270  -0.0817 88  ILE D CG2 
4406 C CD1 . ILE D 95  ? 0.4354 0.2724 0.4408 0.0560  0.0255  -0.0487 88  ILE D CD1 
4407 N N   . LEU D 96  ? 0.3609 0.3410 0.3660 0.0440  0.0441  -0.0012 89  LEU D N   
4408 C CA  . LEU D 96  ? 0.3548 0.3348 0.3688 0.0303  0.0451  0.0248  89  LEU D CA  
4409 C C   . LEU D 96  ? 0.3588 0.3910 0.3779 0.0265  0.0480  0.0430  89  LEU D C   
4410 O O   . LEU D 96  ? 0.3765 0.4085 0.4066 0.0136  0.0466  0.0669  89  LEU D O   
4411 C CB  . LEU D 96  ? 0.3616 0.3189 0.3760 0.0225  0.0429  0.0329  89  LEU D CB  
4412 C CG  . LEU D 96  ? 0.3748 0.2838 0.3881 0.0221  0.0404  0.0226  89  LEU D CG  
4413 C CD1 . LEU D 96  ? 0.3825 0.2801 0.3956 0.0176  0.0388  0.0274  89  LEU D CD1 
4414 C CD2 . LEU D 96  ? 0.3669 0.2526 0.3874 0.0177  0.0396  0.0286  89  LEU D CD2 
4415 N N   . ARG D 97  ? 0.3816 0.4599 0.3943 0.0376  0.0509  0.0319  90  ARG D N   
4416 C CA  . ARG D 97  ? 0.4060 0.5472 0.4235 0.0348  0.0545  0.0497  90  ARG D CA  
4417 C C   . ARG D 97  ? 0.4151 0.5818 0.4319 0.0488  0.0571  0.0332  90  ARG D C   
4418 O O   . ARG D 97  ? 0.4168 0.5484 0.4389 0.0494  0.0554  0.0287  90  ARG D O   
4419 C CB  . ARG D 97  ? 0.4141 0.6047 0.4245 0.0354  0.0561  0.0557  90  ARG D CB  
4420 C CG  . ARG D 97  ? 0.4069 0.5914 0.4028 0.0486  0.0546  0.0255  90  ARG D CG  
4421 C CD  . ARG D 97  ? 0.3886 0.6338 0.3765 0.0499  0.0560  0.0304  90  ARG D CD  
4422 N NE  . ARG D 97  ? 0.3924 0.6524 0.3669 0.0678  0.0546  -0.0074 90  ARG D NE  
4423 C CZ  . ARG D 97  ? 0.3983 0.6374 0.3646 0.0702  0.0498  -0.0265 90  ARG D CZ  
4424 N NH1 . ARG D 97  ? 0.4077 0.6154 0.3767 0.0572  0.0472  -0.0102 90  ARG D NH1 
4425 N NH2 . ARG D 97  ? 0.4306 0.6827 0.3873 0.0867  0.0464  -0.0638 90  ARG D NH2 
4426 N N   . SER D 98  ? 0.4050 0.6335 0.4154 0.0620  0.0607  0.0222  91  SER D N   
4427 C CA  . SER D 98  ? 0.4236 0.6909 0.4369 0.0759  0.0637  0.0114  91  SER D CA  
4428 C C   . SER D 98  ? 0.4163 0.6468 0.4262 0.0965  0.0603  -0.0226 91  SER D C   
4429 O O   . SER D 98  ? 0.3885 0.6425 0.4039 0.1085  0.0617  -0.0295 91  SER D O   
4430 C CB  . SER D 98  ? 0.4375 0.7939 0.4459 0.0846  0.0689  0.0116  91  SER D CB  
4431 O OG  . SER D 98  ? 0.5330 0.9244 0.5489 0.0628  0.0709  0.0510  91  SER D OG  
4432 N N   . GLN D 99  ? 0.4161 0.5910 0.4193 0.0999  0.0549  -0.0414 92  GLN D N   
4433 C CA  . GLN D 99  ? 0.4101 0.5394 0.4139 0.1158  0.0490  -0.0683 92  GLN D CA  
4434 C C   . GLN D 99  ? 0.4106 0.4781 0.4214 0.1043  0.0460  -0.0555 92  GLN D C   
4435 O O   . GLN D 99  ? 0.4217 0.4453 0.4341 0.1131  0.0400  -0.0708 92  GLN D O   
4436 C CB  . GLN D 99  ? 0.4201 0.5274 0.4154 0.1250  0.0428  -0.0961 92  GLN D CB  
4437 C CG  . GLN D 99  ? 0.4485 0.6229 0.4349 0.1370  0.0452  -0.1119 92  GLN D CG  
4438 C CD  . GLN D 99  ? 0.4881 0.7246 0.4771 0.1562  0.0495  -0.1212 92  GLN D CD  
4439 O OE1 . GLN D 99  ? 0.4821 0.7019 0.4759 0.1762  0.0447  -0.1451 92  GLN D OE1 
4440 N NE2 . GLN D 99  ? 0.5029 0.8149 0.4904 0.1504  0.0578  -0.1005 92  GLN D NE2 
4441 N N   . TRP D 100 ? 0.3687 0.4343 0.3846 0.0849  0.0490  -0.0276 93  TRP D N   
4442 C CA  . TRP D 100 ? 0.3692 0.3923 0.3917 0.0763  0.0465  -0.0175 93  TRP D CA  
4443 C C   . TRP D 100 ? 0.3693 0.4021 0.3979 0.0897  0.0456  -0.0250 93  TRP D C   
4444 O O   . TRP D 100 ? 0.3720 0.4573 0.4037 0.1000  0.0489  -0.0276 93  TRP D O   
4445 C CB  . TRP D 100 ? 0.3617 0.3882 0.3913 0.0553  0.0482  0.0098  93  TRP D CB  
4446 C CG  . TRP D 100 ? 0.3434 0.3365 0.3794 0.0483  0.0452  0.0160  93  TRP D CG  
4447 C CD1 . TRP D 100 ? 0.3492 0.3624 0.3948 0.0441  0.0451  0.0261  93  TRP D CD1 
4448 C CD2 . TRP D 100 ? 0.3511 0.2927 0.3842 0.0447  0.0415  0.0122  93  TRP D CD2 
4449 N NE1 . TRP D 100 ? 0.3604 0.3365 0.4080 0.0386  0.0412  0.0270  93  TRP D NE1 
4450 C CE2 . TRP D 100 ? 0.3588 0.2928 0.3985 0.0393  0.0394  0.0190  93  TRP D CE2 
4451 C CE3 . TRP D 100 ? 0.3416 0.2485 0.3676 0.0447  0.0397  0.0044  93  TRP D CE3 
4452 C CZ2 . TRP D 100 ? 0.3586 0.2548 0.3964 0.0356  0.0360  0.0175  93  TRP D CZ2 
4453 C CZ3 . TRP D 100 ? 0.3682 0.2389 0.3938 0.0398  0.0368  0.0053  93  TRP D CZ3 
4454 C CH2 . TRP D 100 ? 0.3563 0.2230 0.3869 0.0362  0.0352  0.0113  93  TRP D CH2 
4455 N N   . SER D 101 ? 0.3728 0.3598 0.4038 0.0902  0.0410  -0.0270 94  SER D N   
4456 C CA  . SER D 101 ? 0.3993 0.3906 0.4374 0.1020  0.0387  -0.0303 94  SER D CA  
4457 C C   . SER D 101 ? 0.3679 0.3259 0.4092 0.0884  0.0362  -0.0159 94  SER D C   
4458 O O   . SER D 101 ? 0.3612 0.2794 0.3978 0.0794  0.0339  -0.0141 94  SER D O   
4459 C CB  . SER D 101 ? 0.4419 0.4093 0.4797 0.1234  0.0325  -0.0535 94  SER D CB  
4460 O OG  . SER D 101 ? 0.4846 0.4455 0.5308 0.1347  0.0284  -0.0536 94  SER D OG  
4461 N N   . PRO D 102 ? 0.3603 0.3396 0.4095 0.0873  0.0362  -0.0066 95  PRO D N   
4462 C CA  . PRO D 102 ? 0.3582 0.3093 0.4090 0.0764  0.0327  0.0030  95  PRO D CA  
4463 C C   . PRO D 102 ? 0.3614 0.2719 0.4097 0.0858  0.0270  -0.0033 95  PRO D C   
4464 O O   . PRO D 102 ? 0.3451 0.2333 0.3917 0.0759  0.0245  0.0046  95  PRO D O   
4465 C CB  . PRO D 102 ? 0.3549 0.3442 0.4155 0.0752  0.0328  0.0117  95  PRO D CB  
4466 C CG  . PRO D 102 ? 0.3872 0.4223 0.4519 0.0906  0.0362  0.0051  95  PRO D CG  
4467 C CD  . PRO D 102 ? 0.3699 0.4057 0.4269 0.0937  0.0395  -0.0036 95  PRO D CD  
4468 N N   . ALA D 103 ? 0.3739 0.2769 0.4233 0.1044  0.0238  -0.0173 96  ALA D N   
4469 C CA  . ALA D 103 ? 0.4026 0.2623 0.4529 0.1106  0.0162  -0.0203 96  ALA D CA  
4470 C C   . ALA D 103 ? 0.4220 0.2470 0.4651 0.0967  0.0154  -0.0186 96  ALA D C   
4471 O O   . ALA D 103 ? 0.4416 0.2337 0.4861 0.0945  0.0092  -0.0135 96  ALA D O   
4472 C CB  . ALA D 103 ? 0.4319 0.2877 0.4885 0.1346  0.0104  -0.0383 96  ALA D CB  
4473 N N   . LEU D 104 ? 0.4087 0.2444 0.4456 0.0874  0.0209  -0.0206 97  LEU D N   
4474 C CA  . LEU D 104 ? 0.4368 0.2471 0.4676 0.0740  0.0209  -0.0177 97  LEU D CA  
4475 C C   . LEU D 104 ? 0.4433 0.2514 0.4717 0.0583  0.0236  -0.0033 97  LEU D C   
4476 O O   . LEU D 104 ? 0.4323 0.2603 0.4633 0.0548  0.0258  0.0031  97  LEU D O   
4477 C CB  . LEU D 104 ? 0.4382 0.2630 0.4641 0.0723  0.0247  -0.0256 97  LEU D CB  
4478 C CG  . LEU D 104 ? 0.4642 0.2946 0.4905 0.0883  0.0213  -0.0455 97  LEU D CG  
4479 C CD1 . LEU D 104 ? 0.4862 0.3464 0.5062 0.0862  0.0261  -0.0509 97  LEU D CD1 
4480 C CD2 . LEU D 104 ? 0.5071 0.2949 0.5361 0.0906  0.0119  -0.0540 97  LEU D CD2 
4481 N N   . THR D 105 ? 0.4489 0.2349 0.4734 0.0495  0.0225  -0.0001 98  THR D N   
4482 C CA  . THR D 105 ? 0.4550 0.2392 0.4766 0.0375  0.0244  0.0085  98  THR D CA  
4483 C C   . THR D 105 ? 0.4579 0.2374 0.4757 0.0300  0.0271  0.0072  98  THR D C   
4484 O O   . THR D 105 ? 0.4295 0.2039 0.4461 0.0322  0.0264  0.0011  98  THR D O   
4485 C CB  . THR D 105 ? 0.4366 0.2071 0.4577 0.0354  0.0203  0.0160  98  THR D CB  
4486 O OG1 . THR D 105 ? 0.4235 0.1735 0.4455 0.0348  0.0165  0.0154  98  THR D OG1 
4487 C CG2 . THR D 105 ? 0.4853 0.2611 0.5111 0.0437  0.0165  0.0199  98  THR D CG2 
4488 N N   . VAL D 106 ? 0.4258 0.2081 0.4427 0.0225  0.0289  0.0112  99  VAL D N   
4489 C CA  . VAL D 106 ? 0.4029 0.1809 0.4177 0.0175  0.0305  0.0109  99  VAL D CA  
4490 C C   . VAL D 106 ? 0.4166 0.1834 0.4288 0.0157  0.0288  0.0111  99  VAL D C   
4491 O O   . VAL D 106 ? 0.4299 0.1954 0.4413 0.0139  0.0291  0.0086  99  VAL D O   
4492 C CB  . VAL D 106 ? 0.4053 0.1855 0.4214 0.0133  0.0308  0.0120  99  VAL D CB  
4493 C CG1 . VAL D 106 ? 0.4276 0.2051 0.4429 0.0114  0.0319  0.0111  99  VAL D CG1 
4494 C CG2 . VAL D 106 ? 0.4209 0.2083 0.4434 0.0114  0.0301  0.0136  99  VAL D CG2 
4495 N N   . SER D 107 ? 0.3967 0.1579 0.4088 0.0149  0.0260  0.0160  100 SER D N   
4496 C CA  . SER D 107 ? 0.4366 0.1874 0.4499 0.0103  0.0223  0.0207  100 SER D CA  
4497 C C   . SER D 107 ? 0.4165 0.1535 0.4328 0.0131  0.0184  0.0128  100 SER D C   
4498 O O   . SER D 107 ? 0.3963 0.1301 0.4132 0.0073  0.0170  0.0112  100 SER D O   
4499 C CB  . SER D 107 ? 0.4530 0.2016 0.4682 0.0092  0.0183  0.0316  100 SER D CB  
4500 O OG  . SER D 107 ? 0.5044 0.2415 0.5241 0.0022  0.0129  0.0402  100 SER D OG  
4501 N N   . LYS D 108 ? 0.4179 0.1515 0.4365 0.0228  0.0164  0.0059  101 LYS D N   
4502 C CA  . LYS D 108 ? 0.4707 0.1955 0.4918 0.0291  0.0120  -0.0072 101 LYS D CA  
4503 C C   . LYS D 108 ? 0.4152 0.1561 0.4314 0.0279  0.0163  -0.0151 101 LYS D C   
4504 O O   . LYS D 108 ? 0.4192 0.1546 0.4358 0.0270  0.0121  -0.0246 101 LYS D O   
4505 C CB  . LYS D 108 ? 0.5175 0.2445 0.5420 0.0436  0.0099  -0.0152 101 LYS D CB  
4506 C CG  . LYS D 108 ? 0.5805 0.2922 0.6117 0.0475  0.0040  -0.0065 101 LYS D CG  
4507 C CD  . LYS D 108 ? 0.7500 0.4317 0.7909 0.0538  -0.0075 -0.0131 101 LYS D CD  
4508 C CE  . LYS D 108 ? 0.8054 0.4771 0.8550 0.0633  -0.0136 -0.0047 101 LYS D CE  
4509 N NZ  . LYS D 108 ? 0.9049 0.6026 0.9533 0.0783  -0.0086 -0.0123 101 LYS D NZ  
4510 N N   . VAL D 109 ? 0.3860 0.1470 0.3988 0.0269  0.0233  -0.0102 102 VAL D N   
4511 C CA  . VAL D 109 ? 0.3740 0.1524 0.3838 0.0252  0.0266  -0.0123 102 VAL D CA  
4512 C C   . VAL D 109 ? 0.3845 0.1574 0.3936 0.0165  0.0257  -0.0094 102 VAL D C   
4513 O O   . VAL D 109 ? 0.4004 0.1821 0.4077 0.0157  0.0246  -0.0151 102 VAL D O   
4514 C CB  . VAL D 109 ? 0.3802 0.1769 0.3908 0.0241  0.0318  -0.0034 102 VAL D CB  
4515 C CG1 . VAL D 109 ? 0.4127 0.2272 0.4223 0.0215  0.0339  -0.0002 102 VAL D CG1 
4516 C CG2 . VAL D 109 ? 0.4060 0.2176 0.4187 0.0311  0.0328  -0.0050 102 VAL D CG2 
4517 N N   . LEU D 110 ? 0.3768 0.1418 0.3872 0.0106  0.0262  -0.0007 103 LEU D N   
4518 C CA  . LEU D 110 ? 0.4034 0.1700 0.4144 0.0029  0.0256  0.0029  103 LEU D CA  
4519 C C   . LEU D 110 ? 0.4120 0.1674 0.4258 -0.0024 0.0188  -0.0015 103 LEU D C   
4520 O O   . LEU D 110 ? 0.3847 0.1483 0.3990 -0.0074 0.0174  -0.0038 103 LEU D O   
4521 C CB  . LEU D 110 ? 0.3993 0.1679 0.4108 -0.0004 0.0275  0.0118  103 LEU D CB  
4522 C CG  . LEU D 110 ? 0.4242 0.2018 0.4350 0.0040  0.0319  0.0125  103 LEU D CG  
4523 C CD1 . LEU D 110 ? 0.4537 0.2368 0.4637 0.0029  0.0326  0.0160  103 LEU D CD1 
4524 C CD2 . LEU D 110 ? 0.4726 0.2604 0.4853 0.0052  0.0336  0.0123  103 LEU D CD2 
4525 N N   . LEU D 111 ? 0.4254 0.1615 0.4429 -0.0013 0.0130  -0.0029 104 LEU D N   
4526 C CA  . LEU D 111 ? 0.4711 0.1883 0.4950 -0.0061 0.0029  -0.0095 104 LEU D CA  
4527 C C   . LEU D 111 ? 0.4714 0.1945 0.4927 -0.0005 0.0004  -0.0283 104 LEU D C   
4528 O O   . LEU D 111 ? 0.4602 0.1800 0.4848 -0.0080 -0.0061 -0.0350 104 LEU D O   
4529 C CB  . LEU D 111 ? 0.5130 0.2046 0.5438 -0.0021 -0.0044 -0.0083 104 LEU D CB  
4530 C CG  . LEU D 111 ? 0.6110 0.2968 0.6467 -0.0108 -0.0060 0.0124  104 LEU D CG  
4531 C CD1 . LEU D 111 ? 0.6513 0.3179 0.6928 -0.0023 -0.0117 0.0154  104 LEU D CD1 
4532 C CD2 . LEU D 111 ? 0.6633 0.3411 0.7079 -0.0276 -0.0138 0.0223  104 LEU D CD2 
4533 N N   . SER D 112 ? 0.4698 0.2072 0.4855 0.0118  0.0054  -0.0363 105 SER D N   
4534 C CA  . SER D 112 ? 0.4611 0.2155 0.4725 0.0192  0.0042  -0.0537 105 SER D CA  
4535 C C   . SER D 112 ? 0.4430 0.2233 0.4496 0.0126  0.0083  -0.0496 105 SER D C   
4536 O O   . SER D 112 ? 0.4149 0.2067 0.4195 0.0121  0.0038  -0.0627 105 SER D O   
4537 C CB  . SER D 112 ? 0.4558 0.2280 0.4637 0.0333  0.0092  -0.0588 105 SER D CB  
4538 O OG  . SER D 112 ? 0.5278 0.3296 0.5300 0.0406  0.0097  -0.0733 105 SER D OG  
4539 N N   . ILE D 113 ? 0.3971 0.1865 0.4029 0.0083  0.0155  -0.0325 106 ILE D N   
4540 C CA  . ILE D 113 ? 0.4042 0.2146 0.4086 0.0034  0.0182  -0.0260 106 ILE D CA  
4541 C C   . ILE D 113 ? 0.4079 0.2129 0.4163 -0.0073 0.0123  -0.0274 106 ILE D C   
4542 O O   . ILE D 113 ? 0.4021 0.2265 0.4092 -0.0101 0.0101  -0.0318 106 ILE D O   
4543 C CB  . ILE D 113 ? 0.3631 0.1789 0.3689 0.0038  0.0250  -0.0099 106 ILE D CB  
4544 C CG1 . ILE D 113 ? 0.3806 0.2081 0.3850 0.0108  0.0291  -0.0061 106 ILE D CG1 
4545 C CG2 . ILE D 113 ? 0.3822 0.2152 0.3897 0.0005  0.0259  -0.0028 106 ILE D CG2 
4546 C CD1 . ILE D 113 ? 0.3241 0.1463 0.3328 0.0106  0.0325  0.0063  106 ILE D CD1 
4547 N N   . CYS D 114 ? 0.4218 0.2051 0.4360 -0.0146 0.0090  -0.0220 107 CYS D N   
4548 C CA  . CYS D 114 ? 0.4481 0.2279 0.4693 -0.0283 0.0019  -0.0201 107 CYS D CA  
4549 C C   . CYS D 114 ? 0.4426 0.2135 0.4660 -0.0308 -0.0086 -0.0385 107 CYS D C   
4550 O O   . CYS D 114 ? 0.4318 0.2137 0.4586 -0.0406 -0.0141 -0.0420 107 CYS D O   
4551 C CB  . CYS D 114 ? 0.4726 0.2346 0.5009 -0.0369 -0.0004 -0.0067 107 CYS D CB  
4552 S SG  . CYS D 114 ? 0.5177 0.3003 0.5433 -0.0350 0.0105  0.0105  107 CYS D SG  
4553 N N   . SER D 115 ? 0.4669 0.2208 0.4891 -0.0207 -0.0122 -0.0525 108 SER D N   
4554 C CA  . SER D 115 ? 0.4876 0.2330 0.5119 -0.0188 -0.0235 -0.0762 108 SER D CA  
4555 C C   . SER D 115 ? 0.4705 0.2540 0.4851 -0.0137 -0.0208 -0.0886 108 SER D C   
4556 O O   . SER D 115 ? 0.4900 0.2783 0.5065 -0.0192 -0.0303 -0.1048 108 SER D O   
4557 C CB  . SER D 115 ? 0.5127 0.2343 0.5389 -0.0048 -0.0279 -0.0900 108 SER D CB  
4558 O OG  . SER D 115 ? 0.5862 0.3086 0.6120 0.0027  -0.0374 -0.1188 108 SER D OG  
4559 N N   . LEU D 116 ? 0.4660 0.2781 0.4717 -0.0050 -0.0090 -0.0791 109 LEU D N   
4560 C CA  . LEU D 116 ? 0.4477 0.3017 0.4450 -0.0007 -0.0058 -0.0835 109 LEU D CA  
4561 C C   . LEU D 116 ? 0.4270 0.2976 0.4266 -0.0126 -0.0070 -0.0740 109 LEU D C   
4562 O O   . LEU D 116 ? 0.4150 0.3146 0.4107 -0.0136 -0.0109 -0.0839 109 LEU D O   
4563 C CB  . LEU D 116 ? 0.4711 0.3468 0.4628 0.0083  0.0056  -0.0682 109 LEU D CB  
4564 C CG  . LEU D 116 ? 0.4885 0.4103 0.4717 0.0164  0.0092  -0.0703 109 LEU D CG  
4565 C CD1 . LEU D 116 ? 0.5082 0.4414 0.4861 0.0274  0.0044  -0.0974 109 LEU D CD1 
4566 C CD2 . LEU D 116 ? 0.4790 0.4127 0.4627 0.0197  0.0187  -0.0474 109 LEU D CD2 
4567 N N   . LEU D 117 ? 0.4120 0.2705 0.4181 -0.0206 -0.0035 -0.0550 110 LEU D N   
4568 C CA  . LEU D 117 ? 0.4228 0.2992 0.4336 -0.0312 -0.0051 -0.0461 110 LEU D CA  
4569 C C   . LEU D 117 ? 0.4328 0.3022 0.4500 -0.0445 -0.0180 -0.0607 110 LEU D C   
4570 O O   . LEU D 117 ? 0.4341 0.3308 0.4521 -0.0510 -0.0220 -0.0634 110 LEU D O   
4571 C CB  . LEU D 117 ? 0.4348 0.3031 0.4518 -0.0352 0.0006  -0.0264 110 LEU D CB  
4572 C CG  . LEU D 117 ? 0.4425 0.3280 0.4582 -0.0261 0.0103  -0.0109 110 LEU D CG  
4573 C CD1 . LEU D 117 ? 0.4674 0.3634 0.4765 -0.0143 0.0147  -0.0102 110 LEU D CD1 
4574 C CD2 . LEU D 117 ? 0.4492 0.3163 0.4685 -0.0260 0.0147  -0.0012 110 LEU D CD2 
4575 N N   . CYS D 118 ? 0.4591 0.2911 0.4826 -0.0490 -0.0260 -0.0694 111 CYS D N   
4576 C CA  . CYS D 118 ? 0.4918 0.3076 0.5253 -0.0628 -0.0418 -0.0844 111 CYS D CA  
4577 C C   . CYS D 118 ? 0.5202 0.3475 0.5474 -0.0554 -0.0502 -0.1150 111 CYS D C   
4578 O O   . CYS D 118 ? 0.5257 0.3622 0.5577 -0.0667 -0.0616 -0.1281 111 CYS D O   
4579 C CB  . CYS D 118 ? 0.5405 0.3084 0.5852 -0.0682 -0.0499 -0.0827 111 CYS D CB  
4580 S SG  . CYS D 118 ? 0.5996 0.3602 0.6550 -0.0836 -0.0456 -0.0484 111 CYS D SG  
4581 N N   . ASP D 119 ? 0.5423 0.3743 0.5589 -0.0365 -0.0449 -0.1272 112 ASP D N   
4582 C CA  . ASP D 119 ? 0.5657 0.4135 0.5752 -0.0257 -0.0525 -0.1595 112 ASP D CA  
4583 C C   . ASP D 119 ? 0.5494 0.4407 0.5437 -0.0088 -0.0388 -0.1552 112 ASP D C   
4584 O O   . ASP D 119 ? 0.5271 0.4115 0.5179 0.0049  -0.0332 -0.1570 112 ASP D O   
4585 C CB  . ASP D 119 ? 0.6090 0.4117 0.6267 -0.0191 -0.0646 -0.1827 112 ASP D CB  
4586 C CG  . ASP D 119 ? 0.6705 0.4339 0.7058 -0.0378 -0.0837 -0.1919 112 ASP D CG  
4587 O OD1 . ASP D 119 ? 0.7008 0.4779 0.7370 -0.0435 -0.0956 -0.2154 112 ASP D OD1 
4588 O OD2 . ASP D 119 ? 0.6960 0.4173 0.7453 -0.0483 -0.0878 -0.1746 112 ASP D OD2 
4589 N N   . PRO D 120 ? 0.5408 0.4789 0.5278 -0.0110 -0.0337 -0.1454 113 PRO D N   
4590 C CA  . PRO D 120 ? 0.5346 0.5164 0.5101 0.0017  -0.0219 -0.1343 113 PRO D CA  
4591 C C   . PRO D 120 ? 0.5477 0.5567 0.5131 0.0173  -0.0242 -0.1615 113 PRO D C   
4592 O O   . PRO D 120 ? 0.5775 0.5797 0.5434 0.0192  -0.0365 -0.1939 113 PRO D O   
4593 C CB  . PRO D 120 ? 0.5247 0.5487 0.4977 -0.0052 -0.0204 -0.1195 113 PRO D CB  
4594 C CG  . PRO D 120 ? 0.5120 0.5090 0.4969 -0.0214 -0.0260 -0.1126 113 PRO D CG  
4595 C CD  . PRO D 120 ? 0.5199 0.4730 0.5119 -0.0266 -0.0380 -0.1369 113 PRO D CD  
4596 N N   . ASN D 121 ? 0.5743 0.6150 0.5324 0.0285  -0.0133 -0.1487 114 ASN D N   
4597 C CA  . ASN D 121 ? 0.5976 0.6759 0.5460 0.0453  -0.0130 -0.1712 114 ASN D CA  
4598 C C   . ASN D 121 ? 0.5772 0.7314 0.5135 0.0486  -0.0088 -0.1647 114 ASN D C   
4599 O O   . ASN D 121 ? 0.5435 0.7312 0.4771 0.0510  0.0015  -0.1371 114 ASN D O   
4600 C CB  . ASN D 121 ? 0.6284 0.6944 0.5790 0.0547  -0.0042 -0.1601 114 ASN D CB  
4601 C CG  . ASN D 121 ? 0.6931 0.7961 0.6362 0.0740  -0.0044 -0.1863 114 ASN D CG  
4602 O OD1 . ASN D 121 ? 0.8417 0.9688 0.7784 0.0823  -0.0129 -0.2198 114 ASN D OD1 
4603 N ND2 . ASN D 121 ? 0.7848 0.8962 0.7291 0.0820  0.0044  -0.1731 114 ASN D ND2 
4604 N N   . PRO D 122 ? 0.6315 0.8150 0.5616 0.0478  -0.0182 -0.1890 115 PRO D N   
4605 C CA  . PRO D 122 ? 0.6423 0.9016 0.5612 0.0489  -0.0150 -0.1781 115 PRO D CA  
4606 C C   . PRO D 122 ? 0.6455 0.9712 0.5522 0.0651  -0.0082 -0.1825 115 PRO D C   
4607 O O   . PRO D 122 ? 0.5825 0.9732 0.4822 0.0646  -0.0024 -0.1585 115 PRO D O   
4608 C CB  . PRO D 122 ? 0.6704 0.9404 0.5860 0.0443  -0.0290 -0.2104 115 PRO D CB  
4609 C CG  . PRO D 122 ? 0.7033 0.9246 0.6237 0.0510  -0.0396 -0.2512 115 PRO D CG  
4610 C CD  . PRO D 122 ? 0.6789 0.8339 0.6117 0.0482  -0.0337 -0.2310 115 PRO D CD  
4611 N N   . ASP D 123 ? 0.6672 0.9802 0.5731 0.0795  -0.0092 -0.2100 116 ASP D N   
4612 C CA  . ASP D 123 ? 0.6780 1.0586 0.5739 0.0963  -0.0020 -0.2150 116 ASP D CA  
4613 C C   . ASP D 123 ? 0.6066 0.9928 0.5082 0.0936  0.0114  -0.1722 116 ASP D C   
4614 O O   . ASP D 123 ? 0.6115 1.0541 0.5078 0.1052  0.0182  -0.1708 116 ASP D O   
4615 C CB  . ASP D 123 ? 0.7598 1.1280 0.6542 0.1161  -0.0096 -0.2650 116 ASP D CB  
4616 C CG  . ASP D 123 ? 0.9244 1.2950 0.8137 0.1202  -0.0255 -0.3125 116 ASP D CG  
4617 O OD1 . ASP D 123 ? 0.9393 1.3520 0.8207 0.1113  -0.0285 -0.3093 116 ASP D OD1 
4618 O OD2 . ASP D 123 ? 1.1087 1.4382 1.0035 0.1325  -0.0365 -0.3536 116 ASP D OD2 
4619 N N   . ASP D 124 ? 0.5624 0.8952 0.4758 0.0783  0.0147  -0.1383 117 ASP D N   
4620 C CA  . ASP D 124 ? 0.5417 0.8758 0.4629 0.0727  0.0250  -0.0971 117 ASP D CA  
4621 C C   . ASP D 124 ? 0.5310 0.8629 0.4581 0.0572  0.0262  -0.0580 117 ASP D C   
4622 O O   . ASP D 124 ? 0.5275 0.8056 0.4665 0.0480  0.0279  -0.0364 117 ASP D O   
4623 C CB  . ASP D 124 ? 0.5543 0.8177 0.4861 0.0732  0.0259  -0.1004 117 ASP D CB  
4624 C CG  . ASP D 124 ? 0.5220 0.7958 0.4611 0.0713  0.0350  -0.0693 117 ASP D CG  
4625 O OD1 . ASP D 124 ? 0.4805 0.8149 0.4181 0.0688  0.0403  -0.0436 117 ASP D OD1 
4626 O OD2 . ASP D 124 ? 0.5411 0.7633 0.4886 0.0710  0.0359  -0.0692 117 ASP D OD2 
4627 N N   . PRO D 125 ? 0.5539 0.9486 0.4731 0.0560  0.0248  -0.0499 118 PRO D N   
4628 C CA  . PRO D 125 ? 0.5533 0.9446 0.4779 0.0447  0.0224  -0.0230 118 PRO D CA  
4629 C C   . PRO D 125 ? 0.5271 0.9216 0.4642 0.0363  0.0273  0.0272  118 PRO D C   
4630 O O   . PRO D 125 ? 0.5739 1.0319 0.5094 0.0348  0.0287  0.0543  118 PRO D O   
4631 C CB  . PRO D 125 ? 0.5457 1.0114 0.4563 0.0487  0.0181  -0.0360 118 PRO D CB  
4632 C CG  . PRO D 125 ? 0.5741 1.1053 0.4745 0.0601  0.0230  -0.0441 118 PRO D CG  
4633 C CD  . PRO D 125 ? 0.5569 1.0362 0.4612 0.0673  0.0250  -0.0670 118 PRO D CD  
4634 N N   . LEU D 126 ? 0.4680 0.7941 0.4186 0.0307  0.0285  0.0395  119 LEU D N   
4635 C CA  . LEU D 126 ? 0.4439 0.7570 0.4100 0.0229  0.0299  0.0823  119 LEU D CA  
4636 C C   . LEU D 126 ? 0.4406 0.7734 0.4116 0.0193  0.0254  0.1061  119 LEU D C   
4637 O O   . LEU D 126 ? 0.4283 0.7814 0.4104 0.0149  0.0246  0.1451  119 LEU D O   
4638 C CB  . LEU D 126 ? 0.4348 0.6702 0.4128 0.0198  0.0306  0.0814  119 LEU D CB  
4639 C CG  . LEU D 126 ? 0.4395 0.6521 0.4356 0.0131  0.0303  0.1189  119 LEU D CG  
4640 C CD1 . LEU D 126 ? 0.4509 0.7041 0.4506 0.0095  0.0332  0.1417  119 LEU D CD1 
4641 C CD2 . LEU D 126 ? 0.4370 0.5783 0.4420 0.0118  0.0303  0.1104  119 LEU D CD2 
4642 N N   . VAL D 127 ? 0.4295 0.7561 0.3946 0.0205  0.0211  0.0841  120 VAL D N   
4643 C CA  . VAL D 127 ? 0.4430 0.7960 0.4115 0.0188  0.0162  0.1021  120 VAL D CA  
4644 C C   . VAL D 127 ? 0.4608 0.8744 0.4120 0.0216  0.0127  0.0773  120 VAL D C   
4645 O O   . VAL D 127 ? 0.4361 0.8327 0.3823 0.0208  0.0083  0.0461  120 VAL D O   
4646 C CB  . VAL D 127 ? 0.4444 0.7407 0.4244 0.0169  0.0132  0.1000  120 VAL D CB  
4647 C CG1 . VAL D 127 ? 0.4555 0.7809 0.4433 0.0174  0.0083  0.1255  120 VAL D CG1 
4648 C CG2 . VAL D 127 ? 0.4424 0.6772 0.4367 0.0161  0.0161  0.1125  120 VAL D CG2 
4649 N N   . PRO D 128 ? 0.4731 0.9617 0.4159 0.0240  0.0138  0.0913  121 PRO D N   
4650 C CA  . PRO D 128 ? 0.4916 1.0464 0.4157 0.0286  0.0104  0.0632  121 PRO D CA  
4651 C C   . PRO D 128 ? 0.4790 1.0413 0.4011 0.0258  0.0023  0.0506  121 PRO D C   
4652 O O   . PRO D 128 ? 0.4761 1.0420 0.3873 0.0271  -0.0029 0.0083  121 PRO D O   
4653 C CB  . PRO D 128 ? 0.5198 1.1590 0.4398 0.0297  0.0132  0.0970  121 PRO D CB  
4654 C CG  . PRO D 128 ? 0.4997 1.1098 0.4326 0.0266  0.0194  0.1253  121 PRO D CG  
4655 C CD  . PRO D 128 ? 0.4911 1.0095 0.4414 0.0219  0.0180  0.1323  121 PRO D CD  
4656 N N   . ASP D 129 ? 0.4931 1.0574 0.4275 0.0221  0.0001  0.0863  122 ASP D N   
4657 C CA  . ASP D 129 ? 0.5146 1.0948 0.4489 0.0195  -0.0073 0.0786  122 ASP D CA  
4658 C C   . ASP D 129 ? 0.4790 0.9960 0.4159 0.0149  -0.0107 0.0418  122 ASP D C   
4659 O O   . ASP D 129 ? 0.4710 1.0072 0.4006 0.0114  -0.0182 0.0124  122 ASP D O   
4660 C CB  . ASP D 129 ? 0.5520 1.1353 0.5034 0.0191  -0.0091 0.1248  122 ASP D CB  
4661 C CG  . ASP D 129 ? 0.6302 1.2920 0.5797 0.0212  -0.0100 0.1635  122 ASP D CG  
4662 O OD1 . ASP D 129 ? 0.7143 1.3845 0.6787 0.0223  -0.0138 0.2023  122 ASP D OD1 
4663 O OD2 . ASP D 129 ? 0.6698 1.3880 0.6039 0.0227  -0.0074 0.1565  122 ASP D OD2 
4664 N N   . ILE D 130 ? 0.4553 0.8997 0.4032 0.0137  -0.0061 0.0442  123 ILE D N   
4665 C CA  . ILE D 130 ? 0.4529 0.8385 0.4046 0.0080  -0.0089 0.0150  123 ILE D CA  
4666 C C   . ILE D 130 ? 0.4702 0.8510 0.4095 0.0084  -0.0123 -0.0281 123 ILE D C   
4667 O O   . ILE D 130 ? 0.4754 0.8436 0.4139 0.0018  -0.0206 -0.0575 123 ILE D O   
4668 C CB  . ILE D 130 ? 0.4329 0.7502 0.3987 0.0078  -0.0031 0.0299  123 ILE D CB  
4669 C CG1 . ILE D 130 ? 0.4222 0.7401 0.4027 0.0097  -0.0028 0.0649  123 ILE D CG1 
4670 C CG2 . ILE D 130 ? 0.4413 0.7051 0.4102 0.0010  -0.0057 0.0025  123 ILE D CG2 
4671 C CD1 . ILE D 130 ? 0.4132 0.6689 0.4077 0.0113  0.0014  0.0757  123 ILE D CD1 
4672 N N   . ALA D 131 ? 0.4731 0.8656 0.4045 0.0162  -0.0070 -0.0316 124 ALA D N   
4673 C CA  . ALA D 131 ? 0.4794 0.8705 0.4001 0.0213  -0.0105 -0.0737 124 ALA D CA  
4674 C C   . ALA D 131 ? 0.5192 0.9638 0.4279 0.0218  -0.0205 -0.1044 124 ALA D C   
4675 O O   . ALA D 131 ? 0.5244 0.9446 0.4315 0.0206  -0.0298 -0.1448 124 ALA D O   
4676 C CB  . ALA D 131 ? 0.4782 0.8920 0.3927 0.0317  -0.0024 -0.0680 124 ALA D CB  
4677 N N   . GLN D 132 ? 0.5402 1.0573 0.4422 0.0230  -0.0202 -0.0847 125 GLN D N   
4678 C CA  . GLN D 132 ? 0.6085 1.1875 0.4977 0.0237  -0.0300 -0.1129 125 GLN D CA  
4679 C C   . GLN D 132 ? 0.5838 1.1315 0.4813 0.0109  -0.0412 -0.1306 125 GLN D C   
4680 O O   . GLN D 132 ? 0.6007 1.1550 0.4924 0.0091  -0.0530 -0.1738 125 GLN D O   
4681 C CB  . GLN D 132 ? 0.6678 1.3356 0.5493 0.0266  -0.0272 -0.0803 125 GLN D CB  
4682 C CG  . GLN D 132 ? 0.7948 1.5442 0.6581 0.0313  -0.0357 -0.1128 125 GLN D CG  
4683 C CD  . GLN D 132 ? 0.8635 1.6320 0.7128 0.0445  -0.0355 -0.1542 125 GLN D CD  
4684 O OE1 . GLN D 132 ? 0.9166 1.6986 0.7635 0.0529  -0.0251 -0.1376 125 GLN D OE1 
4685 N NE2 . GLN D 132 ? 0.9202 1.6895 0.7620 0.0468  -0.0480 -0.2092 125 GLN D NE2 
4686 N N   . ILE D 133 ? 0.5601 1.0746 0.4726 0.0023  -0.0386 -0.0985 126 ILE D N   
4687 C CA  . ILE D 133 ? 0.5575 1.0450 0.4808 -0.0113 -0.0480 -0.1094 126 ILE D CA  
4688 C C   . ILE D 133 ? 0.5581 0.9759 0.4875 -0.0181 -0.0544 -0.1436 126 ILE D C   
4689 O O   . ILE D 133 ? 0.5603 0.9737 0.4925 -0.0288 -0.0678 -0.1732 126 ILE D O   
4690 C CB  . ILE D 133 ? 0.5285 0.9979 0.4677 -0.0156 -0.0425 -0.0679 126 ILE D CB  
4691 C CG1 . ILE D 133 ? 0.5479 1.0884 0.4845 -0.0101 -0.0412 -0.0360 126 ILE D CG1 
4692 C CG2 . ILE D 133 ? 0.5332 0.9720 0.4855 -0.0304 -0.0507 -0.0790 126 ILE D CG2 
4693 C CD1 . ILE D 133 ? 0.5595 1.0836 0.5129 -0.0080 -0.0357 0.0064  126 ILE D CD1 
4694 N N   . TYR D 134 ? 0.5315 0.8960 0.4645 -0.0127 -0.0463 -0.1381 127 TYR D N   
4695 C CA  . TYR D 134 ? 0.5447 0.8420 0.4848 -0.0175 -0.0523 -0.1653 127 TYR D CA  
4696 C C   . TYR D 134 ? 0.6011 0.9108 0.5331 -0.0146 -0.0659 -0.2140 127 TYR D C   
4697 O O   . TYR D 134 ? 0.6020 0.8740 0.5438 -0.0265 -0.0796 -0.2393 127 TYR D O   
4698 C CB  . TYR D 134 ? 0.5312 0.7844 0.4731 -0.0085 -0.0413 -0.1531 127 TYR D CB  
4699 C CG  . TYR D 134 ? 0.5497 0.7340 0.5008 -0.0130 -0.0479 -0.1756 127 TYR D CG  
4700 C CD1 . TYR D 134 ? 0.5445 0.6790 0.5107 -0.0268 -0.0491 -0.1609 127 TYR D CD1 
4701 C CD2 . TYR D 134 ? 0.6014 0.7743 0.5472 -0.0027 -0.0541 -0.2111 127 TYR D CD2 
4702 C CE1 . TYR D 134 ? 0.5786 0.6531 0.5547 -0.0326 -0.0564 -0.1764 127 TYR D CE1 
4703 C CE2 . TYR D 134 ? 0.6297 0.7369 0.5868 -0.0063 -0.0623 -0.2291 127 TYR D CE2 
4704 C CZ  . TYR D 134 ? 0.6281 0.6859 0.6004 -0.0225 -0.0636 -0.2095 127 TYR D CZ  
4705 O OH  . TYR D 134 ? 0.6984 0.6937 0.6834 -0.0275 -0.0726 -0.2221 127 TYR D OH  
4706 N N   . LYS D 135 ? 0.6226 0.9876 0.5382 0.0009  -0.0629 -0.2267 128 LYS D N   
4707 C CA  . LYS D 135 ? 0.6810 1.0691 0.5869 0.0090  -0.0755 -0.2776 128 LYS D CA  
4708 C C   . LYS D 135 ? 0.7021 1.1312 0.6056 -0.0015 -0.0903 -0.2993 128 LYS D C   
4709 O O   . LYS D 135 ? 0.7276 1.1370 0.6340 -0.0047 -0.1072 -0.3443 128 LYS D O   
4710 C CB  . LYS D 135 ? 0.6920 1.1457 0.5798 0.0297  -0.0667 -0.2824 128 LYS D CB  
4711 C CG  . LYS D 135 ? 0.7084 1.1327 0.5974 0.0419  -0.0543 -0.2699 128 LYS D CG  
4712 C CD  . LYS D 135 ? 0.7847 1.2883 0.6563 0.0611  -0.0475 -0.2779 128 LYS D CD  
4713 C CE  . LYS D 135 ? 0.8270 1.3224 0.7007 0.0691  -0.0321 -0.2477 128 LYS D CE  
4714 N NZ  . LYS D 135 ? 0.9498 1.5356 0.8077 0.0849  -0.0248 -0.2486 128 LYS D NZ  
4715 N N   . SER D 136 ? 0.6892 1.1754 0.5888 -0.0066 -0.0854 -0.2680 129 SER D N   
4716 C CA  . SER D 136 ? 0.7175 1.2602 0.6126 -0.0151 -0.0985 -0.2858 129 SER D CA  
4717 C C   . SER D 136 ? 0.6949 1.1982 0.6085 -0.0379 -0.1096 -0.2840 129 SER D C   
4718 O O   . SER D 136 ? 0.6978 1.2114 0.6135 -0.0484 -0.1273 -0.3194 129 SER D O   
4719 C CB  . SER D 136 ? 0.7297 1.3587 0.6135 -0.0095 -0.0893 -0.2497 129 SER D CB  
4720 O OG  . SER D 136 ? 0.7882 1.4670 0.6553 0.0089  -0.0799 -0.2486 129 SER D OG  
4721 N N   . ASP D 137 ? 0.6538 1.1167 0.5816 -0.0457 -0.0998 -0.2433 130 ASP D N   
4722 C CA  . ASP D 137 ? 0.6459 1.0915 0.5912 -0.0662 -0.1069 -0.2308 130 ASP D CA  
4723 C C   . ASP D 137 ? 0.6325 1.0039 0.5942 -0.0726 -0.0991 -0.2069 130 ASP D C   
4724 O O   . ASP D 137 ? 0.5761 0.9486 0.5431 -0.0700 -0.0865 -0.1673 130 ASP D O   
4725 C CB  . ASP D 137 ? 0.6317 1.1468 0.5748 -0.0657 -0.1018 -0.1974 130 ASP D CB  
4726 C CG  . ASP D 137 ? 0.6537 1.1783 0.6122 -0.0863 -0.1129 -0.1945 130 ASP D CG  
4727 O OD1 . ASP D 137 ? 0.6730 1.1462 0.6463 -0.1038 -0.1232 -0.2115 130 ASP D OD1 
4728 O OD2 . ASP D 137 ? 0.6255 1.2128 0.5830 -0.0852 -0.1117 -0.1723 130 ASP D OD2 
4729 N N   . LYS D 138 ? 0.6618 0.9700 0.6322 -0.0801 -0.1082 -0.2323 131 LYS D N   
4730 C CA  . LYS D 138 ? 0.6792 0.9191 0.6634 -0.0852 -0.1018 -0.2128 131 LYS D CA  
4731 C C   . LYS D 138 ? 0.6637 0.9003 0.6652 -0.1037 -0.1017 -0.1844 131 LYS D C   
4732 O O   . LYS D 138 ? 0.6166 0.8262 0.6250 -0.1022 -0.0898 -0.1550 131 LYS D O   
4733 C CB  . LYS D 138 ? 0.7362 0.9131 0.7277 -0.0893 -0.1144 -0.2458 131 LYS D CB  
4734 C CG  . LYS D 138 ? 0.7937 0.9115 0.7899 -0.0824 -0.1040 -0.2297 131 LYS D CG  
4735 C CD  . LYS D 138 ? 0.9208 0.9993 0.9150 -0.0713 -0.1124 -0.2655 131 LYS D CD  
4736 C CE  . LYS D 138 ? 0.9448 0.9653 0.9453 -0.0658 -0.1038 -0.2489 131 LYS D CE  
4737 N NZ  . LYS D 138 ? 0.9895 0.9488 1.0118 -0.0858 -0.1158 -0.2450 131 LYS D NZ  
4738 N N   . GLU D 139 ? 0.6970 0.9665 0.7054 -0.1202 -0.1151 -0.1943 132 GLU D N   
4739 C CA  . GLU D 139 ? 0.7091 0.9903 0.7346 -0.1374 -0.1154 -0.1678 132 GLU D CA  
4740 C C   . GLU D 139 ? 0.6337 0.9549 0.6547 -0.1222 -0.0982 -0.1305 132 GLU D C   
4741 O O   . GLU D 139 ? 0.6033 0.9105 0.6358 -0.1240 -0.0895 -0.1027 132 GLU D O   
4742 C CB  . GLU D 139 ? 0.7741 1.0935 0.8073 -0.1577 -0.1341 -0.1870 132 GLU D CB  
4743 C CG  . GLU D 139 ? 0.8655 1.1943 0.9208 -0.1807 -0.1380 -0.1640 132 GLU D CG  
4744 C CD  . GLU D 139 ? 0.8946 1.2889 0.9496 -0.1727 -0.1272 -0.1323 132 GLU D CD  
4745 O OE1 . GLU D 139 ? 0.9815 1.4304 1.0229 -0.1601 -0.1265 -0.1358 132 GLU D OE1 
4746 O OE2 . GLU D 139 ? 0.8347 1.2297 0.9043 -0.1782 -0.1200 -0.1034 132 GLU D OE2 
4747 N N   . LYS D 140 ? 0.5999 0.9726 0.6054 -0.1066 -0.0946 -0.1302 133 LYS D N   
4748 C CA  . LYS D 140 ? 0.5716 0.9798 0.5744 -0.0905 -0.0809 -0.0943 133 LYS D CA  
4749 C C   . LYS D 140 ? 0.5415 0.9031 0.5430 -0.0761 -0.0659 -0.0754 133 LYS D C   
4750 O O   . LYS D 140 ? 0.5159 0.8748 0.5258 -0.0691 -0.0564 -0.0456 133 LYS D O   
4751 C CB  . LYS D 140 ? 0.5899 1.0637 0.5767 -0.0788 -0.0821 -0.0969 133 LYS D CB  
4752 C CG  . LYS D 140 ? 0.6145 1.1246 0.6007 -0.0622 -0.0708 -0.0571 133 LYS D CG  
4753 C CD  . LYS D 140 ? 0.6964 1.2792 0.6672 -0.0540 -0.0743 -0.0584 133 LYS D CD  
4754 C CE  . LYS D 140 ? 0.7250 1.3294 0.6921 -0.0356 -0.0629 -0.0210 133 LYS D CE  
4755 N NZ  . LYS D 140 ? 0.7507 1.3930 0.7302 -0.0303 -0.0623 0.0152  133 LYS D NZ  
4756 N N   . TYR D 141 ? 0.5288 0.8556 0.5204 -0.0706 -0.0648 -0.0945 134 TYR D N   
4757 C CA  . TYR D 141 ? 0.5077 0.7890 0.4991 -0.0596 -0.0523 -0.0795 134 TYR D CA  
4758 C C   . TYR D 141 ? 0.4979 0.7348 0.5049 -0.0686 -0.0493 -0.0662 134 TYR D C   
4759 O O   . TYR D 141 ? 0.4410 0.6701 0.4531 -0.0598 -0.0387 -0.0400 134 TYR D O   
4760 C CB  . TYR D 141 ? 0.5243 0.7752 0.5056 -0.0544 -0.0537 -0.1060 134 TYR D CB  
4761 C CG  . TYR D 141 ? 0.5075 0.7085 0.4910 -0.0467 -0.0427 -0.0922 134 TYR D CG  
4762 C CD1 . TYR D 141 ? 0.5198 0.6635 0.5128 -0.0554 -0.0452 -0.0993 134 TYR D CD1 
4763 C CD2 . TYR D 141 ? 0.5148 0.7280 0.4927 -0.0322 -0.0311 -0.0695 134 TYR D CD2 
4764 C CE1 . TYR D 141 ? 0.5287 0.6321 0.5231 -0.0481 -0.0354 -0.0864 134 TYR D CE1 
4765 C CE2 . TYR D 141 ? 0.5306 0.7006 0.5114 -0.0263 -0.0222 -0.0580 134 TYR D CE2 
4766 C CZ  . TYR D 141 ? 0.5127 0.6299 0.5006 -0.0336 -0.0240 -0.0676 134 TYR D CZ  
4767 O OH  . TYR D 141 ? 0.5895 0.6701 0.5792 -0.0273 -0.0156 -0.0563 134 TYR D OH  
4768 N N   . ASN D 142 ? 0.5098 0.7191 0.5253 -0.0863 -0.0598 -0.0845 135 ASN D N   
4769 C CA  . ASN D 142 ? 0.5105 0.6864 0.5413 -0.0979 -0.0583 -0.0708 135 ASN D CA  
4770 C C   . ASN D 142 ? 0.4797 0.6936 0.5203 -0.0978 -0.0530 -0.0445 135 ASN D C   
4771 O O   . ASN D 142 ? 0.4544 0.6535 0.5020 -0.0934 -0.0437 -0.0252 135 ASN D O   
4772 C CB  . ASN D 142 ? 0.5573 0.7068 0.5992 -0.1210 -0.0741 -0.0908 135 ASN D CB  
4773 C CG  . ASN D 142 ? 0.6101 0.7017 0.6494 -0.1195 -0.0782 -0.1103 135 ASN D CG  
4774 O OD1 . ASN D 142 ? 0.6139 0.6815 0.6456 -0.1040 -0.0672 -0.1038 135 ASN D OD1 
4775 N ND2 . ASN D 142 ? 0.6610 0.7298 0.7089 -0.1357 -0.0957 -0.1347 135 ASN D ND2 
4776 N N   . ARG D 143 ? 0.4797 0.7467 0.5208 -0.1009 -0.0591 -0.0454 136 ARG D N   
4777 C CA  . ARG D 143 ? 0.4857 0.7952 0.5373 -0.0979 -0.0551 -0.0215 136 ARG D CA  
4778 C C   . ARG D 143 ? 0.4298 0.7382 0.4787 -0.0735 -0.0413 0.0018  136 ARG D C   
4779 O O   . ARG D 143 ? 0.4017 0.7075 0.4615 -0.0674 -0.0343 0.0193  136 ARG D O   
4780 C CB  . ARG D 143 ? 0.5100 0.8806 0.5614 -0.1037 -0.0650 -0.0268 136 ARG D CB  
4781 C CG  . ARG D 143 ? 0.5479 0.9664 0.6139 -0.1032 -0.0636 -0.0046 136 ARG D CG  
4782 C CD  . ARG D 143 ? 0.5868 1.0641 0.6558 -0.1165 -0.0767 -0.0134 136 ARG D CD  
4783 N NE  . ARG D 143 ? 0.6256 1.1326 0.6779 -0.1070 -0.0804 -0.0238 136 ARG D NE  
4784 C CZ  . ARG D 143 ? 0.6714 1.2111 0.7173 -0.0854 -0.0734 -0.0035 136 ARG D CZ  
4785 N NH1 . ARG D 143 ? 0.6396 1.1795 0.6955 -0.0688 -0.0633 0.0256  136 ARG D NH1 
4786 N NH2 . ARG D 143 ? 0.7201 1.2940 0.7505 -0.0799 -0.0776 -0.0123 136 ARG D NH2 
4787 N N   . HIS D 144 ? 0.4340 0.7460 0.4698 -0.0597 -0.0384 0.0016  137 HIS D N   
4788 C CA  . HIS D 144 ? 0.4204 0.7253 0.4561 -0.0391 -0.0281 0.0245  137 HIS D CA  
4789 C C   . HIS D 144 ? 0.3855 0.6346 0.4238 -0.0350 -0.0198 0.0270  137 HIS D C   
4790 O O   . HIS D 144 ? 0.3852 0.6271 0.4316 -0.0219 -0.0133 0.0447  137 HIS D O   
4791 C CB  . HIS D 144 ? 0.4314 0.7535 0.4537 -0.0291 -0.0274 0.0263  137 HIS D CB  
4792 C CG  . HIS D 144 ? 0.4820 0.8685 0.5023 -0.0270 -0.0334 0.0341  137 HIS D CG  
4793 N ND1 . HIS D 144 ? 0.5119 0.9330 0.5174 -0.0260 -0.0372 0.0253  137 HIS D ND1 
4794 C CD2 . HIS D 144 ? 0.4987 0.9270 0.5301 -0.0245 -0.0365 0.0500  137 HIS D CD2 
4795 C CE1 . HIS D 144 ? 0.5761 1.0577 0.5828 -0.0242 -0.0425 0.0367  137 HIS D CE1 
4796 N NE2 . HIS D 144 ? 0.5384 1.0238 0.5613 -0.0231 -0.0425 0.0522  137 HIS D NE2 
4797 N N   . ALA D 145 ? 0.3819 0.5927 0.4140 -0.0448 -0.0213 0.0082  138 ALA D N   
4798 C CA  . ALA D 145 ? 0.3754 0.5362 0.4091 -0.0421 -0.0143 0.0101  138 ALA D CA  
4799 C C   . ALA D 145 ? 0.3610 0.5196 0.4080 -0.0466 -0.0119 0.0198  138 ALA D C   
4800 O O   . ALA D 145 ? 0.3478 0.4891 0.3983 -0.0354 -0.0041 0.0304  138 ALA D O   
4801 C CB  . ALA D 145 ? 0.3796 0.5035 0.4060 -0.0512 -0.0182 -0.0111 138 ALA D CB  
4802 N N   . ARG D 146 ? 0.3904 0.5706 0.4453 -0.0633 -0.0191 0.0155  139 ARG D N   
4803 C CA  . ARG D 146 ? 0.3890 0.5848 0.4578 -0.0682 -0.0167 0.0274  139 ARG D CA  
4804 C C   . ARG D 146 ? 0.3682 0.5990 0.4442 -0.0487 -0.0104 0.0440  139 ARG D C   
4805 O O   . ARG D 146 ? 0.3445 0.5722 0.4273 -0.0394 -0.0035 0.0522  139 ARG D O   
4806 C CB  . ARG D 146 ? 0.4295 0.6498 0.5078 -0.0928 -0.0274 0.0224  139 ARG D CB  
4807 C CG  . ARG D 146 ? 0.5085 0.6876 0.5887 -0.1136 -0.0345 0.0116  139 ARG D CG  
4808 C CD  . ARG D 146 ? 0.5830 0.7838 0.6777 -0.1412 -0.0471 0.0105  139 ARG D CD  
4809 N NE  . ARG D 146 ? 0.6544 0.8680 0.7459 -0.1499 -0.0598 -0.0087 139 ARG D NE  
4810 C CZ  . ARG D 146 ? 0.7294 0.9968 0.8241 -0.1520 -0.0643 -0.0078 139 ARG D CZ  
4811 N NH1 . ARG D 146 ? 0.7556 1.0703 0.8589 -0.1450 -0.0573 0.0123  139 ARG D NH1 
4812 N NH2 . ARG D 146 ? 0.7110 0.9885 0.8007 -0.1600 -0.0767 -0.0291 139 ARG D NH2 
4813 N N   . GLU D 147 ? 0.3886 0.6545 0.4639 -0.0415 -0.0139 0.0481  140 GLU D N   
4814 C CA  . GLU D 147 ? 0.3983 0.6956 0.4828 -0.0206 -0.0105 0.0648  140 GLU D CA  
4815 C C   . GLU D 147 ? 0.3604 0.6226 0.4448 0.0010  -0.0030 0.0725  140 GLU D C   
4816 O O   . GLU D 147 ? 0.3419 0.6109 0.4375 0.0166  0.0008  0.0801  140 GLU D O   
4817 C CB  . GLU D 147 ? 0.4237 0.7630 0.5065 -0.0170 -0.0168 0.0703  140 GLU D CB  
4818 C CG  . GLU D 147 ? 0.4951 0.8818 0.5828 -0.0354 -0.0254 0.0646  140 GLU D CG  
4819 C CD  . GLU D 147 ? 0.5819 1.0107 0.6634 -0.0352 -0.0330 0.0652  140 GLU D CD  
4820 O OE1 . GLU D 147 ? 0.5644 0.9901 0.6380 -0.0205 -0.0310 0.0738  140 GLU D OE1 
4821 O OE2 . GLU D 147 ? 0.6123 1.0815 0.6974 -0.0513 -0.0417 0.0580  140 GLU D OE2 
4822 N N   . TRP D 148 ? 0.3522 0.5798 0.4251 0.0023  -0.0020 0.0693  141 TRP D N   
4823 C CA  . TRP D 148 ? 0.3577 0.5479 0.4314 0.0183  0.0033  0.0759  141 TRP D CA  
4824 C C   . TRP D 148 ? 0.3303 0.4885 0.4053 0.0170  0.0088  0.0677  141 TRP D C   
4825 O O   . TRP D 148 ? 0.3345 0.4758 0.4162 0.0329  0.0123  0.0716  141 TRP D O   
4826 C CB  . TRP D 148 ? 0.3673 0.5359 0.4292 0.0172  0.0030  0.0759  141 TRP D CB  
4827 C CG  . TRP D 148 ? 0.3963 0.5957 0.4584 0.0246  -0.0009 0.0914  141 TRP D CG  
4828 C CD1 . TRP D 148 ? 0.4152 0.6644 0.4807 0.0244  -0.0062 0.0981  141 TRP D CD1 
4829 C CD2 . TRP D 148 ? 0.4160 0.6043 0.4756 0.0314  -0.0005 0.1048  141 TRP D CD2 
4830 N NE1 . TRP D 148 ? 0.4073 0.6775 0.4717 0.0318  -0.0091 0.1159  141 TRP D NE1 
4831 C CE2 . TRP D 148 ? 0.4469 0.6808 0.5081 0.0354  -0.0057 0.1215  141 TRP D CE2 
4832 C CE3 . TRP D 148 ? 0.4096 0.5579 0.4665 0.0333  0.0030  0.1064  141 TRP D CE3 
4833 C CZ2 . TRP D 148 ? 0.4334 0.6753 0.4942 0.0403  -0.0072 0.1421  141 TRP D CZ2 
4834 C CZ3 . TRP D 148 ? 0.4257 0.5809 0.4832 0.0375  0.0014  0.1258  141 TRP D CZ3 
4835 C CH2 . TRP D 148 ? 0.4397 0.6417 0.4994 0.0406  -0.0036 0.1446  141 TRP D CH2 
4836 N N   . THR D 149 ? 0.3224 0.4722 0.3919 -0.0015 0.0083  0.0564  142 THR D N   
4837 C CA  . THR D 149 ? 0.3246 0.4537 0.3958 -0.0041 0.0131  0.0526  142 THR D CA  
4838 C C   . THR D 149 ? 0.3218 0.4852 0.4058 0.0063  0.0160  0.0587  142 THR D C   
4839 O O   . THR D 149 ? 0.3265 0.4783 0.4134 0.0199  0.0211  0.0577  142 THR D O   
4840 C CB  . THR D 149 ? 0.3253 0.4437 0.3928 -0.0277 0.0097  0.0444  142 THR D CB  
4841 O OG1 . THR D 149 ? 0.3286 0.4150 0.3850 -0.0327 0.0069  0.0350  142 THR D OG1 
4842 C CG2 . THR D 149 ? 0.3280 0.4332 0.3980 -0.0307 0.0144  0.0458  142 THR D CG2 
4843 N N   . GLN D 150 ? 0.3309 0.5406 0.4228 0.0014  0.0123  0.0635  143 GLN D N   
4844 C CA  . GLN D 150 ? 0.3481 0.6009 0.4534 0.0124  0.0150  0.0689  143 GLN D CA  
4845 C C   . GLN D 150 ? 0.3535 0.6046 0.4662 0.0429  0.0167  0.0725  143 GLN D C   
4846 O O   . GLN D 150 ? 0.3488 0.6089 0.4691 0.0596  0.0210  0.0694  143 GLN D O   
4847 C CB  . GLN D 150 ? 0.3718 0.6780 0.4852 -0.0009 0.0095  0.0740  143 GLN D CB  
4848 C CG  . GLN D 150 ? 0.4057 0.7128 0.5175 -0.0324 0.0054  0.0710  143 GLN D CG  
4849 C CD  . GLN D 150 ? 0.4690 0.8202 0.5879 -0.0496 -0.0032 0.0733  143 GLN D CD  
4850 O OE1 . GLN D 150 ? 0.5155 0.9075 0.6411 -0.0369 -0.0045 0.0792  143 GLN D OE1 
4851 N NE2 . GLN D 150 ? 0.4665 0.8095 0.5857 -0.0788 -0.0107 0.0689  143 GLN D NE2 
4852 N N   . LYS D 151 ? 0.3604 0.6000 0.4716 0.0502  0.0125  0.0787  144 LYS D N   
4853 C CA  . LYS D 151 ? 0.4053 0.6397 0.5275 0.0774  0.0108  0.0864  144 LYS D CA  
4854 C C   . LYS D 151 ? 0.3809 0.5647 0.5026 0.0903  0.0134  0.0803  144 LYS D C   
4855 O O   . LYS D 151 ? 0.3787 0.5613 0.5129 0.1130  0.0131  0.0773  144 LYS D O   
4856 C CB  . LYS D 151 ? 0.4549 0.6946 0.5762 0.0782  0.0045  0.1001  144 LYS D CB  
4857 C CG  . LYS D 151 ? 0.5389 0.7821 0.6770 0.1049  -0.0002 0.1141  144 LYS D CG  
4858 C CD  . LYS D 151 ? 0.6176 0.8860 0.7563 0.1037  -0.0069 0.1327  144 LYS D CD  
4859 C CE  . LYS D 151 ? 0.6740 0.9460 0.8333 0.1308  -0.0137 0.1508  144 LYS D CE  
4860 N NZ  . LYS D 151 ? 0.7445 1.0459 0.9050 0.1297  -0.0208 0.1738  144 LYS D NZ  
4861 N N   . TYR D 152 ? 0.3751 0.5194 0.4835 0.0765  0.0149  0.0764  145 TYR D N   
4862 C CA  . TYR D 152 ? 0.4111 0.5072 0.5194 0.0861  0.0154  0.0733  145 TYR D CA  
4863 C C   . TYR D 152 ? 0.3989 0.4727 0.4989 0.0795  0.0211  0.0589  145 TYR D C   
4864 O O   . TYR D 152 ? 0.4113 0.4532 0.5140 0.0906  0.0211  0.0529  145 TYR D O   
4865 C CB  . TYR D 152 ? 0.4086 0.4808 0.5102 0.0783  0.0124  0.0833  145 TYR D CB  
4866 C CG  . TYR D 152 ? 0.4272 0.5223 0.5373 0.0859  0.0061  0.1015  145 TYR D CG  
4867 C CD1 . TYR D 152 ? 0.4568 0.5452 0.5854 0.1076  0.0005  0.1124  145 TYR D CD1 
4868 C CD2 . TYR D 152 ? 0.4337 0.5583 0.5344 0.0722  0.0045  0.1078  145 TYR D CD2 
4869 C CE1 . TYR D 152 ? 0.4771 0.5878 0.6153 0.1147  -0.0063 0.1337  145 TYR D CE1 
4870 C CE2 . TYR D 152 ? 0.4442 0.5971 0.5520 0.0790  -0.0013 0.1267  145 TYR D CE2 
4871 C CZ  . TYR D 152 ? 0.4817 0.6279 0.6085 0.0998  -0.0066 0.1420  145 TYR D CZ  
4872 O OH  . TYR D 152 ? 0.5303 0.7058 0.6656 0.1065  -0.0135 0.1649  145 TYR D OH  
4873 N N   . ALA D 153 ? 0.3722 0.4633 0.4638 0.0609  0.0244  0.0545  146 ALA D N   
4874 C CA  . ALA D 153 ? 0.3516 0.4229 0.4345 0.0511  0.0288  0.0458  146 ALA D CA  
4875 C C   . ALA D 153 ? 0.3422 0.4504 0.4281 0.0469  0.0326  0.0432  146 ALA D C   
4876 O O   . ALA D 153 ? 0.3280 0.4276 0.4074 0.0362  0.0355  0.0401  146 ALA D O   
4877 C CB  . ALA D 153 ? 0.3451 0.3932 0.4158 0.0304  0.0276  0.0456  146 ALA D CB  
4878 N N   . MET D 154 ? 0.3249 0.4790 0.4216 0.0553  0.0323  0.0465  147 MET D N   
4879 C CA  . MET D 154 ? 0.3409 0.5420 0.4423 0.0520  0.0364  0.0465  147 MET D CA  
4880 C C   . MET D 154 ? 0.3680 0.5992 0.4808 0.0815  0.0385  0.0394  147 MET D C   
4881 O O   . MET D 154 ? 0.3993 0.6209 0.5203 0.1018  0.0345  0.0385  147 MET D O   
4882 C CB  . MET D 154 ? 0.3314 0.5729 0.4375 0.0316  0.0334  0.0567  147 MET D CB  
4883 C CG  . MET D 154 ? 0.3381 0.5534 0.4357 0.0021  0.0294  0.0598  147 MET D CG  
4884 S SD  . MET D 154 ? 0.3620 0.6287 0.4695 -0.0239 0.0239  0.0700  147 MET D SD  
4885 C CE  . MET D 154 ? 0.3691 0.5860 0.4676 -0.0512 0.0156  0.0663  147 MET D CE  
4886 O OXT . MET D 154 ? 0.3878 0.6564 0.5031 0.0872  0.0433  0.0345  147 MET D OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   29  ?   ?   ?   A . n 
A 1 2   SER 2   30  30  SER SER A . n 
A 1 3   LEU 3   31  31  LEU LEU A . n 
A 1 4   THR 4   32  32  THR THR A . n 
A 1 5   VAL 5   33  33  VAL VAL A . n 
A 1 6   PRO 6   34  34  PRO PRO A . n 
A 1 7   GLU 7   35  35  GLU GLU A . n 
A 1 8   CYS 8   36  36  CYS CYS A . n 
A 1 9   ALA 9   37  37  ALA ALA A . n 
A 1 10  ILE 10  38  38  ILE ILE A . n 
A 1 11  CYS 11  39  39  CYS CYS A . n 
A 1 12  LEU 12  40  40  LEU LEU A . n 
A 1 13  GLN 13  41  41  GLN GLN A . n 
A 1 14  THR 14  42  42  THR THR A . n 
A 1 15  CYS 15  43  43  CYS CYS A . n 
A 1 16  VAL 16  44  44  VAL VAL A . n 
A 1 17  HIS 17  45  45  HIS HIS A . n 
A 1 18  PRO 18  46  46  PRO PRO A . n 
A 1 19  VAL 19  47  47  VAL VAL A . n 
A 1 20  SER 20  48  48  SER SER A . n 
A 1 21  LEU 21  49  49  LEU LEU A . n 
A 1 22  PRO 22  50  50  PRO PRO A . n 
A 1 23  CYS 23  51  51  CYS CYS A . n 
A 1 24  LYS 24  52  52  LYS LYS A . n 
A 1 25  HIS 25  53  53  HIS HIS A . n 
A 1 26  VAL 26  54  54  VAL VAL A . n 
A 1 27  PHE 27  55  55  PHE PHE A . n 
A 1 28  CYS 28  56  56  CYS CYS A . n 
A 1 29  TYR 29  57  57  TYR TYR A . n 
A 1 30  LEU 30  58  58  LEU LEU A . n 
A 1 31  CYS 31  59  59  CYS CYS A . n 
A 1 32  VAL 32  60  60  VAL VAL A . n 
A 1 33  LYS 33  61  61  LYS LYS A . n 
A 1 34  GLY 34  62  62  GLY GLY A . n 
A 1 35  ALA 35  63  63  ALA ALA A . n 
A 1 36  SER 36  64  64  SER SER A . n 
A 1 37  TRP 37  65  65  TRP TRP A . n 
A 1 38  LEU 38  66  66  LEU LEU A . n 
A 1 39  GLY 39  67  67  GLY GLY A . n 
A 1 40  LYS 40  68  68  LYS LYS A . n 
A 1 41  ARG 41  69  69  ARG ARG A . n 
A 1 42  CYS 42  70  70  CYS CYS A . n 
A 1 43  ALA 43  71  71  ALA ALA A . n 
A 1 44  LEU 44  72  72  LEU LEU A . n 
A 1 45  CYS 45  73  73  CYS CYS A . n 
A 1 46  ARG 46  74  74  ARG ARG A . n 
A 1 47  GLN 47  75  75  GLN GLN A . n 
A 1 48  GLU 48  76  76  GLU GLU A . n 
A 1 49  ILE 49  77  77  ILE ILE A . n 
A 1 50  PRO 50  78  78  PRO PRO A . n 
A 1 51  GLU 51  79  79  GLU GLU A . n 
A 1 52  ASP 52  80  80  ASP ASP A . n 
A 1 53  PHE 53  81  81  PHE PHE A . n 
A 1 54  LEU 54  82  82  LEU LEU A . n 
A 1 55  ASP 55  83  83  ASP ASP A . n 
A 1 56  LYS 56  84  84  LYS LYS A . n 
A 1 57  PRO 57  85  85  PRO PRO A . n 
A 1 58  THR 58  86  86  THR THR A . n 
A 1 59  LEU 59  87  87  LEU LEU A . n 
A 1 60  LEU 60  88  88  LEU LEU A . n 
A 1 61  SER 61  89  89  SER SER A . n 
A 1 62  PRO 62  90  90  PRO PRO A . n 
A 1 63  GLU 63  91  91  GLU GLU A . n 
A 1 64  GLU 64  92  92  GLU GLU A . n 
A 1 65  LEU 65  93  93  LEU LEU A . n 
A 1 66  LYS 66  94  94  LYS LYS A . n 
A 1 67  ALA 67  95  95  ALA ALA A . n 
A 1 68  ALA 68  96  96  ALA ALA A . n 
A 1 69  SER 69  97  97  SER SER A . n 
A 1 70  ARG 70  98  98  ARG ARG A . n 
A 1 71  GLY 71  99  99  GLY GLY A . n 
A 1 72  ASN 72  100 100 ASN ASN A . n 
A 1 73  GLY 73  101 101 GLY GLY A . n 
A 1 74  GLU 74  102 102 GLU GLU A . n 
A 1 75  TYR 75  103 103 TYR TYR A . n 
A 1 76  ALA 76  104 104 ALA ALA A . n 
A 1 77  TRP 77  105 105 TRP TRP A . n 
A 1 78  TYR 78  106 106 TYR TYR A . n 
A 1 79  TYR 79  107 107 TYR TYR A . n 
A 1 80  GLU 80  108 108 GLU GLU A . n 
A 1 81  GLY 81  109 109 GLY GLY A . n 
A 1 82  ARG 82  110 110 ARG ARG A . n 
A 1 83  ASN 83  111 111 ASN ASN A . n 
A 1 84  GLY 84  112 112 GLY GLY A . n 
A 1 85  TRP 85  113 113 TRP TRP A . n 
A 1 86  TRP 86  114 114 TRP TRP A . n 
A 1 87  GLN 87  115 115 GLN GLN A . n 
A 1 88  TYR 88  116 116 TYR TYR A . n 
A 1 89  ASP 89  117 117 ASP ASP A . n 
A 1 90  GLU 90  118 118 GLU GLU A . n 
A 1 91  ARG 91  119 119 ARG ARG A . n 
A 1 92  THR 92  120 120 THR THR A . n 
A 1 93  SER 93  121 121 SER SER A . n 
A 1 94  ARG 94  122 122 ARG ARG A . n 
A 1 95  GLU 95  123 123 GLU GLU A . n 
A 1 96  LEU 96  124 124 LEU LEU A . n 
A 1 97  GLU 97  125 125 GLU GLU A . n 
A 1 98  ASP 98  126 126 ASP ASP A . n 
A 1 99  ALA 99  127 127 ALA ALA A . n 
A 1 100 PHE 100 128 128 PHE PHE A . n 
A 1 101 SER 101 129 129 SER SER A . n 
A 1 102 LYS 102 130 130 LYS LYS A . n 
A 1 103 GLY 103 131 131 GLY GLY A . n 
A 1 104 LYS 104 132 132 LYS LYS A . n 
A 1 105 LYS 105 133 133 LYS LYS A . n 
A 1 106 ASN 106 134 134 ASN ASN A . n 
A 1 107 THR 107 135 135 THR THR A . n 
A 1 108 GLU 108 136 136 GLU GLU A . n 
A 1 109 MET 109 137 137 MET MET A . n 
A 1 110 LEU 110 138 138 LEU LEU A . n 
A 1 111 ILE 111 139 139 ILE ILE A . n 
A 1 112 ALA 112 140 140 ALA ALA A . n 
A 1 113 GLY 113 141 141 GLY GLY A . n 
A 1 114 PHE 114 142 142 PHE PHE A . n 
A 1 115 LEU 115 143 143 LEU LEU A . n 
A 1 116 TYR 116 144 144 TYR TYR A . n 
A 1 117 VAL 117 145 145 VAL VAL A . n 
A 1 118 ALA 118 146 146 ALA ALA A . n 
A 1 119 ASP 119 147 147 ASP ASP A . n 
A 1 120 LEU 120 148 148 LEU LEU A . n 
A 1 121 GLU 121 149 149 GLU GLU A . n 
A 1 122 ASN 122 150 150 ASN ASN A . n 
A 1 123 MET 123 151 151 MET MET A . n 
A 1 124 VAL 124 152 152 VAL VAL A . n 
A 1 125 GLN 125 153 153 GLN GLN A . n 
A 1 126 TYR 126 154 154 TYR TYR A . n 
A 1 127 ARG 127 155 155 ARG ARG A . n 
A 1 128 ARG 128 156 156 ARG ARG A . n 
A 1 129 ASN 129 157 157 ASN ASN A . n 
A 1 130 GLU 130 158 158 GLU GLU A . n 
A 1 131 HIS 131 159 159 HIS HIS A . n 
A 1 132 GLY 132 160 160 GLY GLY A . n 
A 1 133 ARG 133 161 161 ARG ARG A . n 
A 1 134 ARG 134 162 162 ARG ARG A . n 
A 1 135 ARG 135 163 163 ARG ARG A . n 
A 1 136 LYS 136 164 164 LYS LYS A . n 
A 1 137 ILE 137 165 165 ILE ILE A . n 
A 1 138 LYS 138 166 166 LYS LYS A . n 
A 1 139 ARG 139 167 167 ARG ARG A . n 
A 1 140 ASP 140 168 168 ASP ASP A . n 
A 1 141 ILE 141 169 169 ILE ILE A . n 
A 1 142 ILE 142 170 170 ILE ILE A . n 
A 1 143 ASP 143 171 171 ASP ASP A . n 
A 1 144 ILE 144 172 172 ILE ILE A . n 
A 1 145 PRO 145 173 173 PRO PRO A . n 
A 1 146 LYS 146 174 174 LYS LYS A . n 
A 1 147 LYS 147 175 175 LYS LYS A . n 
A 1 148 GLY 148 176 176 GLY GLY A . n 
A 1 149 VAL 149 177 177 VAL VAL A . n 
A 1 150 ALA 150 178 178 ALA ALA A . n 
A 1 151 GLY 151 179 179 GLY GLY A . n 
A 1 152 LEU 152 180 180 LEU LEU A . n 
A 1 153 ARG 153 181 181 ARG ARG A . n 
A 1 154 LEU 154 182 182 LEU LEU A . n 
A 1 155 ASP 155 183 ?   ?   ?   A . n 
B 2 1   HIS 1   -6  ?   ?   ?   B . n 
B 2 2   HIS 2   -5  ?   ?   ?   B . n 
B 2 3   HIS 3   -4  ?   ?   ?   B . n 
B 2 4   HIS 4   -3  ?   ?   ?   B . n 
B 2 5   HIS 5   -2  ?   ?   ?   B . n 
B 2 6   HIS 6   -1  -1  HIS HIS B . n 
B 2 7   ALA 7   0   0   ALA ALA B . n 
B 2 8   MET 8   1   1   MET MET B . n 
B 2 9   ALA 9   2   2   ALA ALA B . n 
B 2 10  LEU 10  3   3   LEU LEU B . n 
B 2 11  LYS 11  4   4   LYS LYS B . n 
B 2 12  ARG 12  5   5   ARG ARG B . n 
B 2 13  ILE 13  6   6   ILE ILE B . n 
B 2 14  GLN 14  7   7   GLN GLN B . n 
B 2 15  LYS 15  8   8   LYS LYS B . n 
B 2 16  GLU 16  9   9   GLU GLU B . n 
B 2 17  LEU 17  10  10  LEU LEU B . n 
B 2 18  SER 18  11  11  SER SER B . n 
B 2 19  ASP 19  12  12  ASP ASP B . n 
B 2 20  LEU 20  13  13  LEU LEU B . n 
B 2 21  GLN 21  14  14  GLN GLN B . n 
B 2 22  ARG 22  15  15  ARG ARG B . n 
B 2 23  ASP 23  16  16  ASP ASP B . n 
B 2 24  PRO 24  17  17  PRO PRO B . n 
B 2 25  PRO 25  18  18  PRO PRO B . n 
B 2 26  ALA 26  19  19  ALA ALA B . n 
B 2 27  HIS 27  20  20  HIS HIS B . n 
B 2 28  CYS 28  21  21  CYS CYS B . n 
B 2 29  SER 29  22  22  SER SER B . n 
B 2 30  ALA 30  23  23  ALA ALA B . n 
B 2 31  GLY 31  24  24  GLY GLY B . n 
B 2 32  PRO 32  25  25  PRO PRO B . n 
B 2 33  VAL 33  26  26  VAL VAL B . n 
B 2 34  GLY 34  27  27  GLY GLY B . n 
B 2 35  ASP 35  28  28  ASP ASP B . n 
B 2 36  ASP 36  29  29  ASP ASP B . n 
B 2 37  LEU 37  30  30  LEU LEU B . n 
B 2 38  PHE 38  31  31  PHE PHE B . n 
B 2 39  HIS 39  32  32  HIS HIS B . n 
B 2 40  TRP 40  33  33  TRP TRP B . n 
B 2 41  GLN 41  34  34  GLN GLN B . n 
B 2 42  ALA 42  35  35  ALA ALA B . n 
B 2 43  THR 43  36  36  THR THR B . n 
B 2 44  ILE 44  37  37  ILE ILE B . n 
B 2 45  MET 45  38  38  MET MET B . n 
B 2 46  GLY 46  39  39  GLY GLY B . n 
B 2 47  PRO 47  40  40  PRO PRO B . n 
B 2 48  PRO 48  41  41  PRO PRO B . n 
B 2 49  ASP 49  42  42  ASP ASP B . n 
B 2 50  SER 50  43  43  SER SER B . n 
B 2 51  ALA 51  44  44  ALA ALA B . n 
B 2 52  TYR 52  45  45  TYR TYR B . n 
B 2 53  GLN 53  46  46  GLN GLN B . n 
B 2 54  GLY 54  47  47  GLY GLY B . n 
B 2 55  GLY 55  48  48  GLY GLY B . n 
B 2 56  VAL 56  49  49  VAL VAL B . n 
B 2 57  PHE 57  50  50  PHE PHE B . n 
B 2 58  PHE 58  51  51  PHE PHE B . n 
B 2 59  LEU 59  52  52  LEU LEU B . n 
B 2 60  THR 60  53  53  THR THR B . n 
B 2 61  VAL 61  54  54  VAL VAL B . n 
B 2 62  HIS 62  55  55  HIS HIS B . n 
B 2 63  PHE 63  56  56  PHE PHE B . n 
B 2 64  PRO 64  57  57  PRO PRO B . n 
B 2 65  THR 65  58  58  THR THR B . n 
B 2 66  ASP 66  59  59  ASP ASP B . n 
B 2 67  TYR 67  60  60  TYR TYR B . n 
B 2 68  PRO 68  61  61  PRO PRO B . n 
B 2 69  PHE 69  62  62  PHE PHE B . n 
B 2 70  LYS 70  63  63  LYS LYS B . n 
B 2 71  PRO 71  64  64  PRO PRO B . n 
B 2 72  PRO 72  65  65  PRO PRO B . n 
B 2 73  LYS 73  66  66  LYS LYS B . n 
B 2 74  ILE 74  67  67  ILE ILE B . n 
B 2 75  ALA 75  68  68  ALA ALA B . n 
B 2 76  PHE 76  69  69  PHE PHE B . n 
B 2 77  THR 77  70  70  THR THR B . n 
B 2 78  THR 78  71  71  THR THR B . n 
B 2 79  LYS 79  72  72  LYS LYS B . n 
B 2 80  ILE 80  73  73  ILE ILE B . n 
B 2 81  TYR 81  74  74  TYR TYR B . n 
B 2 82  HIS 82  75  75  HIS HIS B . n 
B 2 83  PRO 83  76  76  PRO PRO B . n 
B 2 84  ASN 84  77  77  ASN ASN B . n 
B 2 85  ILE 85  78  78  ILE ILE B . n 
B 2 86  ASN 86  79  79  ASN ASN B . n 
B 2 87  SER 87  80  80  SER SER B . n 
B 2 88  ASN 88  81  81  ASN ASN B . n 
B 2 89  GLY 89  82  82  GLY GLY B . n 
B 2 90  SER 90  83  83  SER SER B . n 
B 2 91  ILE 91  84  84  ILE ILE B . n 
B 2 92  CYS 92  85  85  CYS CYS B . n 
B 2 93  LEU 93  86  86  LEU LEU B . n 
B 2 94  ASP 94  87  87  ASP ASP B . n 
B 2 95  ILE 95  88  88  ILE ILE B . n 
B 2 96  LEU 96  89  89  LEU LEU B . n 
B 2 97  ARG 97  90  90  ARG ARG B . n 
B 2 98  SER 98  91  91  SER SER B . n 
B 2 99  GLN 99  92  92  GLN GLN B . n 
B 2 100 TRP 100 93  93  TRP TRP B . n 
B 2 101 SER 101 94  94  SER SER B . n 
B 2 102 PRO 102 95  95  PRO PRO B . n 
B 2 103 ALA 103 96  96  ALA ALA B . n 
B 2 104 LEU 104 97  97  LEU LEU B . n 
B 2 105 THR 105 98  98  THR THR B . n 
B 2 106 VAL 106 99  99  VAL VAL B . n 
B 2 107 SER 107 100 100 SER SER B . n 
B 2 108 LYS 108 101 101 LYS LYS B . n 
B 2 109 VAL 109 102 102 VAL VAL B . n 
B 2 110 LEU 110 103 103 LEU LEU B . n 
B 2 111 LEU 111 104 104 LEU LEU B . n 
B 2 112 SER 112 105 105 SER SER B . n 
B 2 113 ILE 113 106 106 ILE ILE B . n 
B 2 114 CYS 114 107 107 CYS CYS B . n 
B 2 115 SER 115 108 108 SER SER B . n 
B 2 116 LEU 116 109 109 LEU LEU B . n 
B 2 117 LEU 117 110 110 LEU LEU B . n 
B 2 118 CYS 118 111 111 CYS CYS B . n 
B 2 119 ASP 119 112 112 ASP ASP B . n 
B 2 120 PRO 120 113 113 PRO PRO B . n 
B 2 121 ASN 121 114 114 ASN ASN B . n 
B 2 122 PRO 122 115 115 PRO PRO B . n 
B 2 123 ASP 123 116 116 ASP ASP B . n 
B 2 124 ASP 124 117 117 ASP ASP B . n 
B 2 125 PRO 125 118 118 PRO PRO B . n 
B 2 126 LEU 126 119 119 LEU LEU B . n 
B 2 127 VAL 127 120 120 VAL VAL B . n 
B 2 128 PRO 128 121 121 PRO PRO B . n 
B 2 129 ASP 129 122 122 ASP ASP B . n 
B 2 130 ILE 130 123 123 ILE ILE B . n 
B 2 131 ALA 131 124 124 ALA ALA B . n 
B 2 132 GLN 132 125 125 GLN GLN B . n 
B 2 133 ILE 133 126 126 ILE ILE B . n 
B 2 134 TYR 134 127 127 TYR TYR B . n 
B 2 135 LYS 135 128 128 LYS LYS B . n 
B 2 136 SER 136 129 129 SER SER B . n 
B 2 137 ASP 137 130 130 ASP ASP B . n 
B 2 138 LYS 138 131 131 LYS LYS B . n 
B 2 139 GLU 139 132 132 GLU GLU B . n 
B 2 140 LYS 140 133 133 LYS LYS B . n 
B 2 141 TYR 141 134 134 TYR TYR B . n 
B 2 142 ASN 142 135 135 ASN ASN B . n 
B 2 143 ARG 143 136 136 ARG ARG B . n 
B 2 144 HIS 144 137 137 HIS HIS B . n 
B 2 145 ALA 145 138 138 ALA ALA B . n 
B 2 146 ARG 146 139 139 ARG ARG B . n 
B 2 147 GLU 147 140 140 GLU GLU B . n 
B 2 148 TRP 148 141 141 TRP TRP B . n 
B 2 149 THR 149 142 142 THR THR B . n 
B 2 150 GLN 150 143 143 GLN GLN B . n 
B 2 151 LYS 151 144 144 LYS LYS B . n 
B 2 152 TYR 152 145 145 TYR TYR B . n 
B 2 153 ALA 153 146 146 ALA ALA B . n 
B 2 154 MET 154 147 147 MET MET B . n 
C 1 1   GLY 1   29  ?   ?   ?   C . n 
C 1 2   SER 2   30  30  SER SER C . n 
C 1 3   LEU 3   31  31  LEU LEU C . n 
C 1 4   THR 4   32  32  THR THR C . n 
C 1 5   VAL 5   33  33  VAL VAL C . n 
C 1 6   PRO 6   34  34  PRO PRO C . n 
C 1 7   GLU 7   35  35  GLU GLU C . n 
C 1 8   CYS 8   36  36  CYS CYS C . n 
C 1 9   ALA 9   37  37  ALA ALA C . n 
C 1 10  ILE 10  38  38  ILE ILE C . n 
C 1 11  CYS 11  39  39  CYS CYS C . n 
C 1 12  LEU 12  40  40  LEU LEU C . n 
C 1 13  GLN 13  41  41  GLN GLN C . n 
C 1 14  THR 14  42  42  THR THR C . n 
C 1 15  CYS 15  43  43  CYS CYS C . n 
C 1 16  VAL 16  44  44  VAL VAL C . n 
C 1 17  HIS 17  45  45  HIS HIS C . n 
C 1 18  PRO 18  46  46  PRO PRO C . n 
C 1 19  VAL 19  47  47  VAL VAL C . n 
C 1 20  SER 20  48  48  SER SER C . n 
C 1 21  LEU 21  49  49  LEU LEU C . n 
C 1 22  PRO 22  50  50  PRO PRO C . n 
C 1 23  CYS 23  51  51  CYS CYS C . n 
C 1 24  LYS 24  52  52  LYS LYS C . n 
C 1 25  HIS 25  53  53  HIS HIS C . n 
C 1 26  VAL 26  54  54  VAL VAL C . n 
C 1 27  PHE 27  55  55  PHE PHE C . n 
C 1 28  CYS 28  56  56  CYS CYS C . n 
C 1 29  TYR 29  57  57  TYR TYR C . n 
C 1 30  LEU 30  58  58  LEU LEU C . n 
C 1 31  CYS 31  59  59  CYS CYS C . n 
C 1 32  VAL 32  60  60  VAL VAL C . n 
C 1 33  LYS 33  61  61  LYS LYS C . n 
C 1 34  GLY 34  62  62  GLY GLY C . n 
C 1 35  ALA 35  63  63  ALA ALA C . n 
C 1 36  SER 36  64  64  SER SER C . n 
C 1 37  TRP 37  65  65  TRP TRP C . n 
C 1 38  LEU 38  66  66  LEU LEU C . n 
C 1 39  GLY 39  67  67  GLY GLY C . n 
C 1 40  LYS 40  68  68  LYS LYS C . n 
C 1 41  ARG 41  69  69  ARG ARG C . n 
C 1 42  CYS 42  70  70  CYS CYS C . n 
C 1 43  ALA 43  71  71  ALA ALA C . n 
C 1 44  LEU 44  72  72  LEU LEU C . n 
C 1 45  CYS 45  73  73  CYS CYS C . n 
C 1 46  ARG 46  74  74  ARG ARG C . n 
C 1 47  GLN 47  75  75  GLN GLN C . n 
C 1 48  GLU 48  76  76  GLU GLU C . n 
C 1 49  ILE 49  77  77  ILE ILE C . n 
C 1 50  PRO 50  78  78  PRO PRO C . n 
C 1 51  GLU 51  79  79  GLU GLU C . n 
C 1 52  ASP 52  80  80  ASP ASP C . n 
C 1 53  PHE 53  81  81  PHE PHE C . n 
C 1 54  LEU 54  82  82  LEU LEU C . n 
C 1 55  ASP 55  83  83  ASP ASP C . n 
C 1 56  LYS 56  84  84  LYS LYS C . n 
C 1 57  PRO 57  85  85  PRO PRO C . n 
C 1 58  THR 58  86  86  THR THR C . n 
C 1 59  LEU 59  87  87  LEU LEU C . n 
C 1 60  LEU 60  88  88  LEU LEU C . n 
C 1 61  SER 61  89  89  SER SER C . n 
C 1 62  PRO 62  90  90  PRO PRO C . n 
C 1 63  GLU 63  91  91  GLU GLU C . n 
C 1 64  GLU 64  92  92  GLU GLU C . n 
C 1 65  LEU 65  93  93  LEU LEU C . n 
C 1 66  LYS 66  94  94  LYS LYS C . n 
C 1 67  ALA 67  95  95  ALA ALA C . n 
C 1 68  ALA 68  96  96  ALA ALA C . n 
C 1 69  SER 69  97  97  SER SER C . n 
C 1 70  ARG 70  98  98  ARG ARG C . n 
C 1 71  GLY 71  99  99  GLY GLY C . n 
C 1 72  ASN 72  100 100 ASN ASN C . n 
C 1 73  GLY 73  101 101 GLY GLY C . n 
C 1 74  GLU 74  102 102 GLU GLU C . n 
C 1 75  TYR 75  103 103 TYR TYR C . n 
C 1 76  ALA 76  104 104 ALA ALA C . n 
C 1 77  TRP 77  105 105 TRP TRP C . n 
C 1 78  TYR 78  106 106 TYR TYR C . n 
C 1 79  TYR 79  107 107 TYR TYR C . n 
C 1 80  GLU 80  108 108 GLU GLU C . n 
C 1 81  GLY 81  109 109 GLY GLY C . n 
C 1 82  ARG 82  110 110 ARG ARG C . n 
C 1 83  ASN 83  111 111 ASN ASN C . n 
C 1 84  GLY 84  112 112 GLY GLY C . n 
C 1 85  TRP 85  113 113 TRP TRP C . n 
C 1 86  TRP 86  114 114 TRP TRP C . n 
C 1 87  GLN 87  115 115 GLN GLN C . n 
C 1 88  TYR 88  116 116 TYR TYR C . n 
C 1 89  ASP 89  117 117 ASP ASP C . n 
C 1 90  GLU 90  118 118 GLU GLU C . n 
C 1 91  ARG 91  119 119 ARG ARG C . n 
C 1 92  THR 92  120 120 THR THR C . n 
C 1 93  SER 93  121 121 SER SER C . n 
C 1 94  ARG 94  122 122 ARG ARG C . n 
C 1 95  GLU 95  123 123 GLU GLU C . n 
C 1 96  LEU 96  124 124 LEU LEU C . n 
C 1 97  GLU 97  125 125 GLU GLU C . n 
C 1 98  ASP 98  126 126 ASP ASP C . n 
C 1 99  ALA 99  127 127 ALA ALA C . n 
C 1 100 PHE 100 128 128 PHE PHE C . n 
C 1 101 SER 101 129 129 SER SER C . n 
C 1 102 LYS 102 130 130 LYS LYS C . n 
C 1 103 GLY 103 131 131 GLY GLY C . n 
C 1 104 LYS 104 132 132 LYS LYS C . n 
C 1 105 LYS 105 133 133 LYS LYS C . n 
C 1 106 ASN 106 134 134 ASN ASN C . n 
C 1 107 THR 107 135 135 THR THR C . n 
C 1 108 GLU 108 136 136 GLU GLU C . n 
C 1 109 MET 109 137 137 MET MET C . n 
C 1 110 LEU 110 138 138 LEU LEU C . n 
C 1 111 ILE 111 139 139 ILE ILE C . n 
C 1 112 ALA 112 140 140 ALA ALA C . n 
C 1 113 GLY 113 141 141 GLY GLY C . n 
C 1 114 PHE 114 142 142 PHE PHE C . n 
C 1 115 LEU 115 143 143 LEU LEU C . n 
C 1 116 TYR 116 144 144 TYR TYR C . n 
C 1 117 VAL 117 145 145 VAL VAL C . n 
C 1 118 ALA 118 146 146 ALA ALA C . n 
C 1 119 ASP 119 147 147 ASP ASP C . n 
C 1 120 LEU 120 148 148 LEU LEU C . n 
C 1 121 GLU 121 149 149 GLU GLU C . n 
C 1 122 ASN 122 150 150 ASN ASN C . n 
C 1 123 MET 123 151 151 MET MET C . n 
C 1 124 VAL 124 152 152 VAL VAL C . n 
C 1 125 GLN 125 153 153 GLN GLN C . n 
C 1 126 TYR 126 154 154 TYR TYR C . n 
C 1 127 ARG 127 155 155 ARG ARG C . n 
C 1 128 ARG 128 156 156 ARG ARG C . n 
C 1 129 ASN 129 157 157 ASN ASN C . n 
C 1 130 GLU 130 158 158 GLU GLU C . n 
C 1 131 HIS 131 159 159 HIS HIS C . n 
C 1 132 GLY 132 160 160 GLY GLY C . n 
C 1 133 ARG 133 161 161 ARG ARG C . n 
C 1 134 ARG 134 162 162 ARG ARG C . n 
C 1 135 ARG 135 163 163 ARG ARG C . n 
C 1 136 LYS 136 164 164 LYS LYS C . n 
C 1 137 ILE 137 165 165 ILE ILE C . n 
C 1 138 LYS 138 166 166 LYS LYS C . n 
C 1 139 ARG 139 167 167 ARG ARG C . n 
C 1 140 ASP 140 168 168 ASP ASP C . n 
C 1 141 ILE 141 169 169 ILE ILE C . n 
C 1 142 ILE 142 170 170 ILE ILE C . n 
C 1 143 ASP 143 171 171 ASP ASP C . n 
C 1 144 ILE 144 172 172 ILE ILE C . n 
C 1 145 PRO 145 173 173 PRO PRO C . n 
C 1 146 LYS 146 174 174 LYS LYS C . n 
C 1 147 LYS 147 175 175 LYS LYS C . n 
C 1 148 GLY 148 176 176 GLY GLY C . n 
C 1 149 VAL 149 177 177 VAL VAL C . n 
C 1 150 ALA 150 178 178 ALA ALA C . n 
C 1 151 GLY 151 179 179 GLY GLY C . n 
C 1 152 LEU 152 180 180 LEU LEU C . n 
C 1 153 ARG 153 181 181 ARG ARG C . n 
C 1 154 LEU 154 182 182 LEU LEU C . n 
C 1 155 ASP 155 183 ?   ?   ?   C . n 
D 2 1   HIS 1   -6  ?   ?   ?   D . n 
D 2 2   HIS 2   -5  -5  HIS HIS D . n 
D 2 3   HIS 3   -4  -4  HIS HIS D . n 
D 2 4   HIS 4   -3  -3  HIS HIS D . n 
D 2 5   HIS 5   -2  -2  HIS HIS D . n 
D 2 6   HIS 6   -1  -1  HIS HIS D . n 
D 2 7   ALA 7   0   0   ALA ALA D . n 
D 2 8   MET 8   1   1   MET MET D . n 
D 2 9   ALA 9   2   2   ALA ALA D . n 
D 2 10  LEU 10  3   3   LEU LEU D . n 
D 2 11  LYS 11  4   4   LYS LYS D . n 
D 2 12  ARG 12  5   5   ARG ARG D . n 
D 2 13  ILE 13  6   6   ILE ILE D . n 
D 2 14  GLN 14  7   7   GLN GLN D . n 
D 2 15  LYS 15  8   8   LYS LYS D . n 
D 2 16  GLU 16  9   9   GLU GLU D . n 
D 2 17  LEU 17  10  10  LEU LEU D . n 
D 2 18  SER 18  11  11  SER SER D . n 
D 2 19  ASP 19  12  12  ASP ASP D . n 
D 2 20  LEU 20  13  13  LEU LEU D . n 
D 2 21  GLN 21  14  14  GLN GLN D . n 
D 2 22  ARG 22  15  15  ARG ARG D . n 
D 2 23  ASP 23  16  16  ASP ASP D . n 
D 2 24  PRO 24  17  17  PRO PRO D . n 
D 2 25  PRO 25  18  18  PRO PRO D . n 
D 2 26  ALA 26  19  19  ALA ALA D . n 
D 2 27  HIS 27  20  20  HIS HIS D . n 
D 2 28  CYS 28  21  21  CYS CYS D . n 
D 2 29  SER 29  22  22  SER SER D . n 
D 2 30  ALA 30  23  23  ALA ALA D . n 
D 2 31  GLY 31  24  24  GLY GLY D . n 
D 2 32  PRO 32  25  25  PRO PRO D . n 
D 2 33  VAL 33  26  26  VAL VAL D . n 
D 2 34  GLY 34  27  27  GLY GLY D . n 
D 2 35  ASP 35  28  28  ASP ASP D . n 
D 2 36  ASP 36  29  29  ASP ASP D . n 
D 2 37  LEU 37  30  30  LEU LEU D . n 
D 2 38  PHE 38  31  31  PHE PHE D . n 
D 2 39  HIS 39  32  32  HIS HIS D . n 
D 2 40  TRP 40  33  33  TRP TRP D . n 
D 2 41  GLN 41  34  34  GLN GLN D . n 
D 2 42  ALA 42  35  35  ALA ALA D . n 
D 2 43  THR 43  36  36  THR THR D . n 
D 2 44  ILE 44  37  37  ILE ILE D . n 
D 2 45  MET 45  38  38  MET MET D . n 
D 2 46  GLY 46  39  39  GLY GLY D . n 
D 2 47  PRO 47  40  40  PRO PRO D . n 
D 2 48  PRO 48  41  41  PRO PRO D . n 
D 2 49  ASP 49  42  42  ASP ASP D . n 
D 2 50  SER 50  43  43  SER SER D . n 
D 2 51  ALA 51  44  44  ALA ALA D . n 
D 2 52  TYR 52  45  45  TYR TYR D . n 
D 2 53  GLN 53  46  46  GLN GLN D . n 
D 2 54  GLY 54  47  47  GLY GLY D . n 
D 2 55  GLY 55  48  48  GLY GLY D . n 
D 2 56  VAL 56  49  49  VAL VAL D . n 
D 2 57  PHE 57  50  50  PHE PHE D . n 
D 2 58  PHE 58  51  51  PHE PHE D . n 
D 2 59  LEU 59  52  52  LEU LEU D . n 
D 2 60  THR 60  53  53  THR THR D . n 
D 2 61  VAL 61  54  54  VAL VAL D . n 
D 2 62  HIS 62  55  55  HIS HIS D . n 
D 2 63  PHE 63  56  56  PHE PHE D . n 
D 2 64  PRO 64  57  57  PRO PRO D . n 
D 2 65  THR 65  58  58  THR THR D . n 
D 2 66  ASP 66  59  59  ASP ASP D . n 
D 2 67  TYR 67  60  60  TYR TYR D . n 
D 2 68  PRO 68  61  61  PRO PRO D . n 
D 2 69  PHE 69  62  62  PHE PHE D . n 
D 2 70  LYS 70  63  63  LYS LYS D . n 
D 2 71  PRO 71  64  64  PRO PRO D . n 
D 2 72  PRO 72  65  65  PRO PRO D . n 
D 2 73  LYS 73  66  66  LYS LYS D . n 
D 2 74  ILE 74  67  67  ILE ILE D . n 
D 2 75  ALA 75  68  68  ALA ALA D . n 
D 2 76  PHE 76  69  69  PHE PHE D . n 
D 2 77  THR 77  70  70  THR THR D . n 
D 2 78  THR 78  71  71  THR THR D . n 
D 2 79  LYS 79  72  72  LYS LYS D . n 
D 2 80  ILE 80  73  73  ILE ILE D . n 
D 2 81  TYR 81  74  74  TYR TYR D . n 
D 2 82  HIS 82  75  75  HIS HIS D . n 
D 2 83  PRO 83  76  76  PRO PRO D . n 
D 2 84  ASN 84  77  77  ASN ASN D . n 
D 2 85  ILE 85  78  78  ILE ILE D . n 
D 2 86  ASN 86  79  79  ASN ASN D . n 
D 2 87  SER 87  80  80  SER SER D . n 
D 2 88  ASN 88  81  81  ASN ASN D . n 
D 2 89  GLY 89  82  82  GLY GLY D . n 
D 2 90  SER 90  83  83  SER SER D . n 
D 2 91  ILE 91  84  84  ILE ILE D . n 
D 2 92  CYS 92  85  85  CYS CYS D . n 
D 2 93  LEU 93  86  86  LEU LEU D . n 
D 2 94  ASP 94  87  87  ASP ASP D . n 
D 2 95  ILE 95  88  88  ILE ILE D . n 
D 2 96  LEU 96  89  89  LEU LEU D . n 
D 2 97  ARG 97  90  90  ARG ARG D . n 
D 2 98  SER 98  91  91  SER SER D . n 
D 2 99  GLN 99  92  92  GLN GLN D . n 
D 2 100 TRP 100 93  93  TRP TRP D . n 
D 2 101 SER 101 94  94  SER SER D . n 
D 2 102 PRO 102 95  95  PRO PRO D . n 
D 2 103 ALA 103 96  96  ALA ALA D . n 
D 2 104 LEU 104 97  97  LEU LEU D . n 
D 2 105 THR 105 98  98  THR THR D . n 
D 2 106 VAL 106 99  99  VAL VAL D . n 
D 2 107 SER 107 100 100 SER SER D . n 
D 2 108 LYS 108 101 101 LYS LYS D . n 
D 2 109 VAL 109 102 102 VAL VAL D . n 
D 2 110 LEU 110 103 103 LEU LEU D . n 
D 2 111 LEU 111 104 104 LEU LEU D . n 
D 2 112 SER 112 105 105 SER SER D . n 
D 2 113 ILE 113 106 106 ILE ILE D . n 
D 2 114 CYS 114 107 107 CYS CYS D . n 
D 2 115 SER 115 108 108 SER SER D . n 
D 2 116 LEU 116 109 109 LEU LEU D . n 
D 2 117 LEU 117 110 110 LEU LEU D . n 
D 2 118 CYS 118 111 111 CYS CYS D . n 
D 2 119 ASP 119 112 112 ASP ASP D . n 
D 2 120 PRO 120 113 113 PRO PRO D . n 
D 2 121 ASN 121 114 114 ASN ASN D . n 
D 2 122 PRO 122 115 115 PRO PRO D . n 
D 2 123 ASP 123 116 116 ASP ASP D . n 
D 2 124 ASP 124 117 117 ASP ASP D . n 
D 2 125 PRO 125 118 118 PRO PRO D . n 
D 2 126 LEU 126 119 119 LEU LEU D . n 
D 2 127 VAL 127 120 120 VAL VAL D . n 
D 2 128 PRO 128 121 121 PRO PRO D . n 
D 2 129 ASP 129 122 122 ASP ASP D . n 
D 2 130 ILE 130 123 123 ILE ILE D . n 
D 2 131 ALA 131 124 124 ALA ALA D . n 
D 2 132 GLN 132 125 125 GLN GLN D . n 
D 2 133 ILE 133 126 126 ILE ILE D . n 
D 2 134 TYR 134 127 127 TYR TYR D . n 
D 2 135 LYS 135 128 128 LYS LYS D . n 
D 2 136 SER 136 129 129 SER SER D . n 
D 2 137 ASP 137 130 130 ASP ASP D . n 
D 2 138 LYS 138 131 131 LYS LYS D . n 
D 2 139 GLU 139 132 132 GLU GLU D . n 
D 2 140 LYS 140 133 133 LYS LYS D . n 
D 2 141 TYR 141 134 134 TYR TYR D . n 
D 2 142 ASN 142 135 135 ASN ASN D . n 
D 2 143 ARG 143 136 136 ARG ARG D . n 
D 2 144 HIS 144 137 137 HIS HIS D . n 
D 2 145 ALA 145 138 138 ALA ALA D . n 
D 2 146 ARG 146 139 139 ARG ARG D . n 
D 2 147 GLU 147 140 140 GLU GLU D . n 
D 2 148 TRP 148 141 141 TRP TRP D . n 
D 2 149 THR 149 142 142 THR THR D . n 
D 2 150 GLN 150 143 143 GLN GLN D . n 
D 2 151 LYS 151 144 144 LYS LYS D . n 
D 2 152 TYR 152 145 145 TYR TYR D . n 
D 2 153 ALA 153 146 146 ALA ALA D . n 
D 2 154 MET 154 147 147 MET MET D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 V3L 1   201 1   V3L V3L A . 
F 4 ZN  1   202 1   ZN  ZN  A . 
G 4 ZN  1   203 2   ZN  ZN  A . 
H 3 V3L 1   201 1   V3L V3L C . 
I 4 ZN  1   202 3   ZN  ZN  C . 
J 4 ZN  1   203 4   ZN  ZN  C . 
K 5 HOH 1   301 1   HOH HOH A . 
K 5 HOH 2   302 3   HOH HOH A . 
K 5 HOH 3   303 15  HOH HOH A . 
K 5 HOH 4   304 19  HOH HOH A . 
K 5 HOH 5   305 20  HOH HOH A . 
K 5 HOH 6   306 22  HOH HOH A . 
K 5 HOH 7   307 37  HOH HOH A . 
K 5 HOH 8   308 43  HOH HOH A . 
K 5 HOH 9   309 49  HOH HOH A . 
K 5 HOH 10  310 54  HOH HOH A . 
K 5 HOH 11  311 58  HOH HOH A . 
K 5 HOH 12  312 61  HOH HOH A . 
K 5 HOH 13  313 73  HOH HOH A . 
K 5 HOH 14  314 77  HOH HOH A . 
K 5 HOH 15  315 79  HOH HOH A . 
K 5 HOH 16  316 82  HOH HOH A . 
K 5 HOH 17  317 84  HOH HOH A . 
K 5 HOH 18  318 92  HOH HOH A . 
K 5 HOH 19  319 98  HOH HOH A . 
K 5 HOH 20  320 103 HOH HOH A . 
K 5 HOH 21  321 109 HOH HOH A . 
K 5 HOH 22  322 114 HOH HOH A . 
K 5 HOH 23  323 118 HOH HOH A . 
K 5 HOH 24  324 119 HOH HOH A . 
K 5 HOH 25  325 120 HOH HOH A . 
K 5 HOH 26  326 121 HOH HOH A . 
K 5 HOH 27  327 122 HOH HOH A . 
K 5 HOH 28  328 123 HOH HOH A . 
K 5 HOH 29  329 124 HOH HOH A . 
K 5 HOH 30  330 125 HOH HOH A . 
K 5 HOH 31  331 160 HOH HOH A . 
K 5 HOH 32  332 161 HOH HOH A . 
K 5 HOH 33  333 162 HOH HOH A . 
K 5 HOH 34  334 163 HOH HOH A . 
K 5 HOH 35  335 164 HOH HOH A . 
K 5 HOH 36  336 165 HOH HOH A . 
K 5 HOH 37  337 166 HOH HOH A . 
K 5 HOH 38  338 167 HOH HOH A . 
K 5 HOH 39  339 168 HOH HOH A . 
K 5 HOH 40  340 169 HOH HOH A . 
K 5 HOH 41  341 170 HOH HOH A . 
K 5 HOH 42  342 171 HOH HOH A . 
K 5 HOH 43  343 172 HOH HOH A . 
K 5 HOH 44  344 173 HOH HOH A . 
K 5 HOH 45  345 174 HOH HOH A . 
K 5 HOH 46  346 175 HOH HOH A . 
K 5 HOH 47  347 176 HOH HOH A . 
K 5 HOH 48  348 229 HOH HOH A . 
K 5 HOH 49  349 230 HOH HOH A . 
K 5 HOH 50  350 231 HOH HOH A . 
K 5 HOH 51  351 232 HOH HOH A . 
K 5 HOH 52  352 233 HOH HOH A . 
K 5 HOH 53  353 234 HOH HOH A . 
K 5 HOH 54  354 235 HOH HOH A . 
K 5 HOH 55  355 236 HOH HOH A . 
K 5 HOH 56  356 249 HOH HOH A . 
K 5 HOH 57  357 252 HOH HOH A . 
K 5 HOH 58  358 254 HOH HOH A . 
K 5 HOH 59  359 259 HOH HOH A . 
K 5 HOH 60  360 262 HOH HOH A . 
K 5 HOH 61  361 272 HOH HOH A . 
K 5 HOH 62  362 274 HOH HOH A . 
K 5 HOH 63  363 280 HOH HOH A . 
K 5 HOH 64  364 289 HOH HOH A . 
K 5 HOH 65  365 291 HOH HOH A . 
K 5 HOH 66  366 305 HOH HOH A . 
K 5 HOH 67  367 306 HOH HOH A . 
K 5 HOH 68  368 307 HOH HOH A . 
K 5 HOH 69  369 308 HOH HOH A . 
K 5 HOH 70  370 310 HOH HOH A . 
K 5 HOH 71  371 311 HOH HOH A . 
K 5 HOH 72  372 312 HOH HOH A . 
K 5 HOH 73  373 313 HOH HOH A . 
K 5 HOH 74  374 314 HOH HOH A . 
K 5 HOH 75  375 315 HOH HOH A . 
K 5 HOH 76  376 318 HOH HOH A . 
K 5 HOH 77  377 319 HOH HOH A . 
K 5 HOH 78  378 320 HOH HOH A . 
K 5 HOH 79  379 321 HOH HOH A . 
K 5 HOH 80  380 322 HOH HOH A . 
K 5 HOH 81  381 323 HOH HOH A . 
K 5 HOH 82  382 324 HOH HOH A . 
L 5 HOH 1   201 4   HOH HOH B . 
L 5 HOH 2   202 8   HOH HOH B . 
L 5 HOH 3   203 9   HOH HOH B . 
L 5 HOH 4   204 12  HOH HOH B . 
L 5 HOH 5   205 16  HOH HOH B . 
L 5 HOH 6   206 17  HOH HOH B . 
L 5 HOH 7   207 23  HOH HOH B . 
L 5 HOH 8   208 26  HOH HOH B . 
L 5 HOH 9   209 28  HOH HOH B . 
L 5 HOH 10  210 31  HOH HOH B . 
L 5 HOH 11  211 32  HOH HOH B . 
L 5 HOH 12  212 33  HOH HOH B . 
L 5 HOH 13  213 35  HOH HOH B . 
L 5 HOH 14  214 38  HOH HOH B . 
L 5 HOH 15  215 57  HOH HOH B . 
L 5 HOH 16  216 60  HOH HOH B . 
L 5 HOH 17  217 63  HOH HOH B . 
L 5 HOH 18  218 67  HOH HOH B . 
L 5 HOH 19  219 80  HOH HOH B . 
L 5 HOH 20  220 81  HOH HOH B . 
L 5 HOH 21  221 85  HOH HOH B . 
L 5 HOH 22  222 86  HOH HOH B . 
L 5 HOH 23  223 89  HOH HOH B . 
L 5 HOH 24  224 90  HOH HOH B . 
L 5 HOH 25  225 91  HOH HOH B . 
L 5 HOH 26  226 97  HOH HOH B . 
L 5 HOH 27  227 101 HOH HOH B . 
L 5 HOH 28  228 102 HOH HOH B . 
L 5 HOH 29  229 104 HOH HOH B . 
L 5 HOH 30  230 105 HOH HOH B . 
L 5 HOH 31  231 107 HOH HOH B . 
L 5 HOH 32  232 113 HOH HOH B . 
L 5 HOH 33  233 116 HOH HOH B . 
L 5 HOH 34  234 126 HOH HOH B . 
L 5 HOH 35  235 127 HOH HOH B . 
L 5 HOH 36  236 128 HOH HOH B . 
L 5 HOH 37  237 129 HOH HOH B . 
L 5 HOH 38  238 130 HOH HOH B . 
L 5 HOH 39  239 131 HOH HOH B . 
L 5 HOH 40  240 132 HOH HOH B . 
L 5 HOH 41  241 133 HOH HOH B . 
L 5 HOH 42  242 134 HOH HOH B . 
L 5 HOH 43  243 135 HOH HOH B . 
L 5 HOH 44  244 153 HOH HOH B . 
L 5 HOH 45  245 154 HOH HOH B . 
L 5 HOH 46  246 177 HOH HOH B . 
L 5 HOH 47  247 178 HOH HOH B . 
L 5 HOH 48  248 179 HOH HOH B . 
L 5 HOH 49  249 180 HOH HOH B . 
L 5 HOH 50  250 182 HOH HOH B . 
L 5 HOH 51  251 183 HOH HOH B . 
L 5 HOH 52  252 184 HOH HOH B . 
L 5 HOH 53  253 185 HOH HOH B . 
L 5 HOH 54  254 186 HOH HOH B . 
L 5 HOH 55  255 187 HOH HOH B . 
L 5 HOH 56  256 188 HOH HOH B . 
L 5 HOH 57  257 189 HOH HOH B . 
L 5 HOH 58  258 190 HOH HOH B . 
L 5 HOH 59  259 191 HOH HOH B . 
L 5 HOH 60  260 192 HOH HOH B . 
L 5 HOH 61  261 193 HOH HOH B . 
L 5 HOH 62  262 194 HOH HOH B . 
L 5 HOH 63  263 195 HOH HOH B . 
L 5 HOH 64  264 196 HOH HOH B . 
L 5 HOH 65  265 197 HOH HOH B . 
L 5 HOH 66  266 198 HOH HOH B . 
L 5 HOH 67  267 199 HOH HOH B . 
L 5 HOH 68  268 227 HOH HOH B . 
L 5 HOH 69  269 237 HOH HOH B . 
L 5 HOH 70  270 238 HOH HOH B . 
L 5 HOH 71  271 239 HOH HOH B . 
L 5 HOH 72  272 240 HOH HOH B . 
L 5 HOH 73  273 241 HOH HOH B . 
L 5 HOH 74  274 242 HOH HOH B . 
L 5 HOH 75  275 247 HOH HOH B . 
L 5 HOH 76  276 248 HOH HOH B . 
L 5 HOH 77  277 255 HOH HOH B . 
L 5 HOH 78  278 256 HOH HOH B . 
L 5 HOH 79  279 261 HOH HOH B . 
L 5 HOH 80  280 265 HOH HOH B . 
L 5 HOH 81  281 273 HOH HOH B . 
L 5 HOH 82  282 281 HOH HOH B . 
L 5 HOH 83  283 285 HOH HOH B . 
L 5 HOH 84  284 286 HOH HOH B . 
L 5 HOH 85  285 290 HOH HOH B . 
L 5 HOH 86  286 309 HOH HOH B . 
L 5 HOH 87  287 316 HOH HOH B . 
L 5 HOH 88  288 317 HOH HOH B . 
L 5 HOH 89  289 326 HOH HOH B . 
L 5 HOH 90  290 328 HOH HOH B . 
L 5 HOH 91  291 330 HOH HOH B . 
L 5 HOH 92  292 331 HOH HOH B . 
L 5 HOH 93  293 332 HOH HOH B . 
L 5 HOH 94  294 333 HOH HOH B . 
L 5 HOH 95  295 334 HOH HOH B . 
L 5 HOH 96  296 335 HOH HOH B . 
L 5 HOH 97  297 336 HOH HOH B . 
L 5 HOH 98  298 337 HOH HOH B . 
L 5 HOH 99  299 338 HOH HOH B . 
L 5 HOH 100 300 339 HOH HOH B . 
L 5 HOH 101 301 340 HOH HOH B . 
L 5 HOH 102 302 365 HOH HOH B . 
M 5 HOH 1   301 2   HOH HOH C . 
M 5 HOH 2   302 7   HOH HOH C . 
M 5 HOH 3   303 10  HOH HOH C . 
M 5 HOH 4   304 13  HOH HOH C . 
M 5 HOH 5   305 14  HOH HOH C . 
M 5 HOH 6   306 18  HOH HOH C . 
M 5 HOH 7   307 21  HOH HOH C . 
M 5 HOH 8   308 24  HOH HOH C . 
M 5 HOH 9   309 27  HOH HOH C . 
M 5 HOH 10  310 34  HOH HOH C . 
M 5 HOH 11  311 39  HOH HOH C . 
M 5 HOH 12  312 40  HOH HOH C . 
M 5 HOH 13  313 41  HOH HOH C . 
M 5 HOH 14  314 42  HOH HOH C . 
M 5 HOH 15  315 44  HOH HOH C . 
M 5 HOH 16  316 46  HOH HOH C . 
M 5 HOH 17  317 48  HOH HOH C . 
M 5 HOH 18  318 50  HOH HOH C . 
M 5 HOH 19  319 55  HOH HOH C . 
M 5 HOH 20  320 56  HOH HOH C . 
M 5 HOH 21  321 62  HOH HOH C . 
M 5 HOH 22  322 68  HOH HOH C . 
M 5 HOH 23  323 69  HOH HOH C . 
M 5 HOH 24  324 74  HOH HOH C . 
M 5 HOH 25  325 75  HOH HOH C . 
M 5 HOH 26  326 95  HOH HOH C . 
M 5 HOH 27  327 96  HOH HOH C . 
M 5 HOH 28  328 99  HOH HOH C . 
M 5 HOH 29  329 100 HOH HOH C . 
M 5 HOH 30  330 106 HOH HOH C . 
M 5 HOH 31  331 108 HOH HOH C . 
M 5 HOH 32  332 111 HOH HOH C . 
M 5 HOH 33  333 112 HOH HOH C . 
M 5 HOH 34  334 117 HOH HOH C . 
M 5 HOH 35  335 136 HOH HOH C . 
M 5 HOH 36  336 137 HOH HOH C . 
M 5 HOH 37  337 138 HOH HOH C . 
M 5 HOH 38  338 139 HOH HOH C . 
M 5 HOH 39  339 140 HOH HOH C . 
M 5 HOH 40  340 141 HOH HOH C . 
M 5 HOH 41  341 142 HOH HOH C . 
M 5 HOH 42  342 143 HOH HOH C . 
M 5 HOH 43  343 144 HOH HOH C . 
M 5 HOH 44  344 145 HOH HOH C . 
M 5 HOH 45  345 146 HOH HOH C . 
M 5 HOH 46  346 147 HOH HOH C . 
M 5 HOH 47  347 148 HOH HOH C . 
M 5 HOH 48  348 200 HOH HOH C . 
M 5 HOH 49  349 201 HOH HOH C . 
M 5 HOH 50  350 202 HOH HOH C . 
M 5 HOH 51  351 203 HOH HOH C . 
M 5 HOH 52  352 204 HOH HOH C . 
M 5 HOH 53  353 205 HOH HOH C . 
M 5 HOH 54  354 206 HOH HOH C . 
M 5 HOH 55  355 207 HOH HOH C . 
M 5 HOH 56  356 208 HOH HOH C . 
M 5 HOH 57  357 209 HOH HOH C . 
M 5 HOH 58  358 210 HOH HOH C . 
M 5 HOH 59  359 211 HOH HOH C . 
M 5 HOH 60  360 212 HOH HOH C . 
M 5 HOH 61  361 213 HOH HOH C . 
M 5 HOH 62  362 214 HOH HOH C . 
M 5 HOH 63  363 215 HOH HOH C . 
M 5 HOH 64  364 216 HOH HOH C . 
M 5 HOH 65  365 217 HOH HOH C . 
M 5 HOH 66  366 218 HOH HOH C . 
M 5 HOH 67  367 243 HOH HOH C . 
M 5 HOH 68  368 251 HOH HOH C . 
M 5 HOH 69  369 258 HOH HOH C . 
M 5 HOH 70  370 263 HOH HOH C . 
M 5 HOH 71  371 267 HOH HOH C . 
M 5 HOH 72  372 275 HOH HOH C . 
M 5 HOH 73  373 276 HOH HOH C . 
M 5 HOH 74  374 278 HOH HOH C . 
M 5 HOH 75  375 282 HOH HOH C . 
M 5 HOH 76  376 284 HOH HOH C . 
M 5 HOH 77  377 288 HOH HOH C . 
M 5 HOH 78  378 292 HOH HOH C . 
M 5 HOH 79  379 296 HOH HOH C . 
M 5 HOH 80  380 297 HOH HOH C . 
M 5 HOH 81  381 301 HOH HOH C . 
M 5 HOH 82  382 341 HOH HOH C . 
M 5 HOH 83  383 342 HOH HOH C . 
M 5 HOH 84  384 343 HOH HOH C . 
M 5 HOH 85  385 344 HOH HOH C . 
M 5 HOH 86  386 345 HOH HOH C . 
M 5 HOH 87  387 346 HOH HOH C . 
M 5 HOH 88  388 347 HOH HOH C . 
M 5 HOH 89  389 348 HOH HOH C . 
M 5 HOH 90  390 349 HOH HOH C . 
M 5 HOH 91  391 350 HOH HOH C . 
M 5 HOH 92  392 351 HOH HOH C . 
M 5 HOH 93  393 352 HOH HOH C . 
M 5 HOH 94  394 353 HOH HOH C . 
M 5 HOH 95  395 354 HOH HOH C . 
M 5 HOH 96  396 355 HOH HOH C . 
M 5 HOH 97  397 356 HOH HOH C . 
M 5 HOH 98  398 357 HOH HOH C . 
N 5 HOH 1   201 5   HOH HOH D . 
N 5 HOH 2   202 6   HOH HOH D . 
N 5 HOH 3   203 11  HOH HOH D . 
N 5 HOH 4   204 25  HOH HOH D . 
N 5 HOH 5   205 29  HOH HOH D . 
N 5 HOH 6   206 30  HOH HOH D . 
N 5 HOH 7   207 36  HOH HOH D . 
N 5 HOH 8   208 45  HOH HOH D . 
N 5 HOH 9   209 47  HOH HOH D . 
N 5 HOH 10  210 51  HOH HOH D . 
N 5 HOH 11  211 52  HOH HOH D . 
N 5 HOH 12  212 53  HOH HOH D . 
N 5 HOH 13  213 59  HOH HOH D . 
N 5 HOH 14  214 64  HOH HOH D . 
N 5 HOH 15  215 65  HOH HOH D . 
N 5 HOH 16  216 66  HOH HOH D . 
N 5 HOH 17  217 70  HOH HOH D . 
N 5 HOH 18  218 71  HOH HOH D . 
N 5 HOH 19  219 72  HOH HOH D . 
N 5 HOH 20  220 76  HOH HOH D . 
N 5 HOH 21  221 78  HOH HOH D . 
N 5 HOH 22  222 83  HOH HOH D . 
N 5 HOH 23  223 87  HOH HOH D . 
N 5 HOH 24  224 88  HOH HOH D . 
N 5 HOH 25  225 93  HOH HOH D . 
N 5 HOH 26  226 94  HOH HOH D . 
N 5 HOH 27  227 110 HOH HOH D . 
N 5 HOH 28  228 115 HOH HOH D . 
N 5 HOH 29  229 149 HOH HOH D . 
N 5 HOH 30  230 150 HOH HOH D . 
N 5 HOH 31  231 151 HOH HOH D . 
N 5 HOH 32  232 152 HOH HOH D . 
N 5 HOH 33  233 155 HOH HOH D . 
N 5 HOH 34  234 156 HOH HOH D . 
N 5 HOH 35  235 157 HOH HOH D . 
N 5 HOH 36  236 158 HOH HOH D . 
N 5 HOH 37  237 159 HOH HOH D . 
N 5 HOH 38  238 181 HOH HOH D . 
N 5 HOH 39  239 219 HOH HOH D . 
N 5 HOH 40  240 220 HOH HOH D . 
N 5 HOH 41  241 221 HOH HOH D . 
N 5 HOH 42  242 222 HOH HOH D . 
N 5 HOH 43  243 223 HOH HOH D . 
N 5 HOH 44  244 224 HOH HOH D . 
N 5 HOH 45  245 225 HOH HOH D . 
N 5 HOH 46  246 226 HOH HOH D . 
N 5 HOH 47  247 228 HOH HOH D . 
N 5 HOH 48  248 244 HOH HOH D . 
N 5 HOH 49  249 245 HOH HOH D . 
N 5 HOH 50  250 246 HOH HOH D . 
N 5 HOH 51  251 250 HOH HOH D . 
N 5 HOH 52  252 253 HOH HOH D . 
N 5 HOH 53  253 257 HOH HOH D . 
N 5 HOH 54  254 260 HOH HOH D . 
N 5 HOH 55  255 264 HOH HOH D . 
N 5 HOH 56  256 266 HOH HOH D . 
N 5 HOH 57  257 268 HOH HOH D . 
N 5 HOH 58  258 269 HOH HOH D . 
N 5 HOH 59  259 270 HOH HOH D . 
N 5 HOH 60  260 271 HOH HOH D . 
N 5 HOH 61  261 277 HOH HOH D . 
N 5 HOH 62  262 279 HOH HOH D . 
N 5 HOH 63  263 283 HOH HOH D . 
N 5 HOH 64  264 287 HOH HOH D . 
N 5 HOH 65  265 293 HOH HOH D . 
N 5 HOH 66  266 294 HOH HOH D . 
N 5 HOH 67  267 295 HOH HOH D . 
N 5 HOH 68  268 298 HOH HOH D . 
N 5 HOH 69  269 299 HOH HOH D . 
N 5 HOH 70  270 300 HOH HOH D . 
N 5 HOH 71  271 302 HOH HOH D . 
N 5 HOH 72  272 303 HOH HOH D . 
N 5 HOH 73  273 304 HOH HOH D . 
N 5 HOH 74  274 325 HOH HOH D . 
N 5 HOH 75  275 327 HOH HOH D . 
N 5 HOH 76  276 329 HOH HOH D . 
N 5 HOH 77  277 358 HOH HOH D . 
N 5 HOH 78  278 359 HOH HOH D . 
N 5 HOH 79  279 360 HOH HOH D . 
N 5 HOH 80  280 361 HOH HOH D . 
N 5 HOH 81  281 362 HOH HOH D . 
N 5 HOH 82  282 363 HOH HOH D . 
N 5 HOH 83  283 364 HOH HOH D . 
N 5 HOH 84  284 366 HOH HOH D . 
N 5 HOH 85  285 367 HOH HOH D . 
N 5 HOH 86  286 368 HOH HOH D . 
N 5 HOH 87  287 369 HOH HOH D . 
N 5 HOH 88  288 370 HOH HOH D . 
N 5 HOH 89  289 371 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,G,K,L 
2 1 C,D,H,I,J,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1280  ? 
1 MORE         -10   ? 
1 'SSA (A^2)'  15730 ? 
2 'ABSA (A^2)' 1450  ? 
2 MORE         -9    ? 
2 'SSA (A^2)'  15840 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? C HIS 25 ? C HIS 53 ? 1_555 ZN ? J ZN . ? C ZN 203 ? 1_555 SG ? C CYS 23 ? C CYS 51 ? 1_555 107.4 ? 
2  ND1 ? C HIS 25 ? C HIS 53 ? 1_555 ZN ? J ZN . ? C ZN 203 ? 1_555 SG ? C CYS 45 ? C CYS 73 ? 1_555 112.8 ? 
3  SG  ? C CYS 23 ? C CYS 51 ? 1_555 ZN ? J ZN . ? C ZN 203 ? 1_555 SG ? C CYS 45 ? C CYS 73 ? 1_555 107.0 ? 
4  ND1 ? C HIS 25 ? C HIS 53 ? 1_555 ZN ? J ZN . ? C ZN 203 ? 1_555 SG ? C CYS 42 ? C CYS 70 ? 1_555 109.5 ? 
5  SG  ? C CYS 23 ? C CYS 51 ? 1_555 ZN ? J ZN . ? C ZN 203 ? 1_555 SG ? C CYS 42 ? C CYS 70 ? 1_555 107.3 ? 
6  SG  ? C CYS 45 ? C CYS 73 ? 1_555 ZN ? J ZN . ? C ZN 203 ? 1_555 SG ? C CYS 42 ? C CYS 70 ? 1_555 112.5 ? 
7  ND1 ? A HIS 25 ? A HIS 53 ? 1_555 ZN ? G ZN . ? A ZN 203 ? 1_555 SG ? A CYS 23 ? A CYS 51 ? 1_555 103.1 ? 
8  ND1 ? A HIS 25 ? A HIS 53 ? 1_555 ZN ? G ZN . ? A ZN 203 ? 1_555 SG ? A CYS 42 ? A CYS 70 ? 1_555 108.5 ? 
9  SG  ? A CYS 23 ? A CYS 51 ? 1_555 ZN ? G ZN . ? A ZN 203 ? 1_555 SG ? A CYS 42 ? A CYS 70 ? 1_555 110.0 ? 
10 ND1 ? A HIS 25 ? A HIS 53 ? 1_555 ZN ? G ZN . ? A ZN 203 ? 1_555 SG ? A CYS 45 ? A CYS 73 ? 1_555 113.7 ? 
11 SG  ? A CYS 23 ? A CYS 51 ? 1_555 ZN ? G ZN . ? A ZN 203 ? 1_555 SG ? A CYS 45 ? A CYS 73 ? 1_555 106.7 ? 
12 SG  ? A CYS 42 ? A CYS 70 ? 1_555 ZN ? G ZN . ? A ZN 203 ? 1_555 SG ? A CYS 45 ? A CYS 73 ? 1_555 114.2 ? 
13 SG  ? A CYS 11 ? A CYS 39 ? 1_555 ZN ? F ZN . ? A ZN 202 ? 1_555 SG ? A CYS 8  ? A CYS 36 ? 1_555 109.7 ? 
14 SG  ? A CYS 11 ? A CYS 39 ? 1_555 ZN ? F ZN . ? A ZN 202 ? 1_555 SG ? A CYS 31 ? A CYS 59 ? 1_555 106.6 ? 
15 SG  ? A CYS 8  ? A CYS 36 ? 1_555 ZN ? F ZN . ? A ZN 202 ? 1_555 SG ? A CYS 31 ? A CYS 59 ? 1_555 114.2 ? 
16 SG  ? A CYS 11 ? A CYS 39 ? 1_555 ZN ? F ZN . ? A ZN 202 ? 1_555 SG ? A CYS 28 ? A CYS 56 ? 1_555 106.5 ? 
17 SG  ? A CYS 8  ? A CYS 36 ? 1_555 ZN ? F ZN . ? A ZN 202 ? 1_555 SG ? A CYS 28 ? A CYS 56 ? 1_555 107.1 ? 
18 SG  ? A CYS 31 ? A CYS 59 ? 1_555 ZN ? F ZN . ? A ZN 202 ? 1_555 SG ? A CYS 28 ? A CYS 56 ? 1_555 112.5 ? 
19 SG  ? C CYS 8  ? C CYS 36 ? 1_555 ZN ? I ZN . ? C ZN 202 ? 1_555 SG ? C CYS 11 ? C CYS 39 ? 1_555 109.0 ? 
20 SG  ? C CYS 8  ? C CYS 36 ? 1_555 ZN ? I ZN . ? C ZN 202 ? 1_555 SG ? C CYS 28 ? C CYS 56 ? 1_555 107.0 ? 
21 SG  ? C CYS 11 ? C CYS 39 ? 1_555 ZN ? I ZN . ? C ZN 202 ? 1_555 SG ? C CYS 28 ? C CYS 56 ? 1_555 106.2 ? 
22 SG  ? C CYS 8  ? C CYS 36 ? 1_555 ZN ? I ZN . ? C ZN 202 ? 1_555 SG ? C CYS 31 ? C CYS 59 ? 1_555 114.0 ? 
23 SG  ? C CYS 11 ? C CYS 39 ? 1_555 ZN ? I ZN . ? C ZN 202 ? 1_555 SG ? C CYS 31 ? C CYS 59 ? 1_555 109.7 ? 
24 SG  ? C CYS 28 ? C CYS 56 ? 1_555 ZN ? I ZN . ? C ZN 202 ? 1_555 SG ? C CYS 31 ? C CYS 59 ? 1_555 110.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-10-15 
2 'Structure model' 1 1 2014-11-05 
3 'Structure model' 1 2 2015-01-21 
4 'Structure model' 1 3 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 4 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 50.6899  18.1555 33.1286 0.2238 0.1462 0.2826 -0.0126 -0.0001 0.0030  2.0234 0.7871 6.4481 -0.2993 
1.5666 -1.5195 -0.0762 -0.0228 0.0990 -0.0367 0.0814  -0.0785 0.0421  -0.1194 0.3217  
'X-RAY DIFFRACTION' 2 ? refined 20.1171  15.1450 14.2281 0.2196 0.0254 0.2179 -0.0169 0.0313  -0.0123 5.4974 0.8567 3.1919 0.1396  
1.3741 0.2990  -0.0816 0.0337  0.0479 0.2941  0.0053  0.0535  -0.0409 -0.0780 -0.0625 
'X-RAY DIFFRACTION' 3 ? refined -30.4402 16.2010 14.0249 0.2260 0.0105 0.2448 0.0114  0.0098  0.0165  2.0692 1.3325 4.6966 0.1484  
1.2254 1.4667  -0.0283 0.0125  0.0158 -0.1127 0.0445  0.0154  -0.0498 -0.1128 -0.1242 
'X-RAY DIFFRACTION' 4 ? refined -0.0988  13.8440 32.6713 0.2239 0.0505 0.2382 0.0100  0.0336  0.0173  5.3275 0.7171 3.3805 -0.2405 
1.5145 -0.4182 -0.0229 0.0082  0.0147 -0.4411 -0.0563 -0.0149 0.0388  -0.0691 0.0687  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 30 A 182 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B -1 B 147 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 C 30 C 182 ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 D -5 D 147 ? . . . . ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 REFMAC      5.8.0049 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.14     'Dec. 10, 2013' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 HKL-2000    .        ?               ?       ?                    ?                        'data collection' ? ?          ? 
6 HKL-2000    .        ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
7 SOLVE       .        ?               ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 52  ? ? 83.05   10.43   
2 1 ARG A 98  ? ? -142.65 17.96   
3 1 ARG A 161 ? ? -67.05  89.93   
4 1 ASP B 42  ? ? 72.09   -12.94  
5 1 ARG B 90  ? ? -121.49 -129.95 
6 1 LYS C 52  ? ? 80.35   3.90    
7 1 GLU C 102 ? ? -109.94 -65.49  
8 1 ASP D 42  ? ? 70.35   -14.48  
9 1 ARG D 90  ? ? -125.09 -124.24 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 29  ? A GLY 1   
2  1 Y 1 A ASP 183 ? A ASP 155 
3  1 Y 1 B HIS -6  ? B HIS 1   
4  1 Y 1 B HIS -5  ? B HIS 2   
5  1 Y 1 B HIS -4  ? B HIS 3   
6  1 Y 1 B HIS -3  ? B HIS 4   
7  1 Y 1 B HIS -2  ? B HIS 5   
8  1 Y 1 C GLY 29  ? C GLY 1   
9  1 Y 1 C ASP 183 ? C ASP 155 
10 1 Y 1 D HIS -6  ? D HIS 1   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 
;2'-O-(5-O-phosphono-alpha-D-ribofuranosyl)adenosine 5'-(dihydrogen phosphate)
;
V3L 
4 'ZINC ION'                                                                      ZN  
5 water                                                                           HOH 
#