data_4QUM
# 
_entry.id   4QUM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4QUM         
RCSB  RCSB086533   
WWPDB D_1000086533 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4QUN .                                                                                                unspecified 
PDB 2B49 'Crystal Structure of the Catalytic Domain of Protein Tyrosine Phosphatase, non-receptor Type 3' unspecified 
PDB 1CM8 'Phosphorylated MAP Kinase p38-gamma'                                                            unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4QUM 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, K.E.'   1 
'Meng, T.C.'   2 
'Wang, A.H.J.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Reciprocal allosteric regulation of p38 gamma and PTPN3 involves a PDZ domain-modulated complex formation.' 
_citation.journal_abbrev            Sci.Signal. 
_citation.journal_volume            7 
_citation.page_first                ra98 
_citation.page_last                 ra98 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1937-9145 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25314968 
_citation.pdbx_database_id_DOI      10.1126/scisignal.2005722 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen, K.E.'    1 
primary 'Lin, S.Y.'     2 
primary 'Wu, M.J.'      3 
primary 'Ho, M.R.'      4 
primary 'Santhanam, A.' 5 
primary 'Chou, C.C.'    6 
primary 'Meng, T.C.'    7 
primary 'Wang, A.H.J.'  8 
# 
_cell.entry_id           4QUM 
_cell.length_a           75.491 
_cell.length_b           75.491 
_cell.length_c           109.605 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4QUM 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Tyrosine-protein phosphatase non-receptor type 3' 34887.664 1  3.1.3.48  'D811A, C842S' 
'Catalytic domain (UNP RESIDUES 628-909)' ? 
2 polymer syn 'Mitogen-activated protein kinase 12'              1244.252  1  2.7.11.24 W190R          
'Activation loop (UNP RESIDUES 182-190)'  ? 
3 water   nat water                                              18.015    27 ?         ?              ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Protein-tyrosine phosphatase H1, PTP-H1' 
2 
;MAP kinase 12, MAPK 12, Extracellular signal-regulated kinase 6, ERK-6, Mitogen-activated protein kinase p38 gamma, MAP kinase p38 gamma, Stress-activated protein kinase 3
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MHHHHHHSSGVDLGTENLYFQSNADTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYD
TTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPD
VMNHGGFHIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPAHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHSS
AGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQM
;
;MHHHHHHSSGVDLGTENLYFQSNADTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYD
TTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPD
VMNHGGFHIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPAHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHSS
AGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQM
;
A ? 
2 'polypeptide(L)' no yes 'M(TPO)G(PTR)VVTRR' MTGYVVTRR B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  ASN n 
1 24  ALA n 
1 25  ASP n 
1 26  THR n 
1 27  LEU n 
1 28  GLU n 
1 29  GLY n 
1 30  SER n 
1 31  MET n 
1 32  ALA n 
1 33  GLN n 
1 34  LEU n 
1 35  LYS n 
1 36  LYS n 
1 37  GLY n 
1 38  LEU n 
1 39  GLU n 
1 40  SER n 
1 41  GLY n 
1 42  THR n 
1 43  VAL n 
1 44  LEU n 
1 45  ILE n 
1 46  GLN n 
1 47  PHE n 
1 48  GLU n 
1 49  GLN n 
1 50  LEU n 
1 51  TYR n 
1 52  ARG n 
1 53  LYS n 
1 54  LYS n 
1 55  PRO n 
1 56  GLY n 
1 57  LEU n 
1 58  ALA n 
1 59  ILE n 
1 60  THR n 
1 61  PHE n 
1 62  ALA n 
1 63  LYS n 
1 64  LEU n 
1 65  PRO n 
1 66  GLN n 
1 67  ASN n 
1 68  LEU n 
1 69  ASP n 
1 70  LYS n 
1 71  ASN n 
1 72  ARG n 
1 73  TYR n 
1 74  LYS n 
1 75  ASP n 
1 76  VAL n 
1 77  LEU n 
1 78  PRO n 
1 79  TYR n 
1 80  ASP n 
1 81  THR n 
1 82  THR n 
1 83  ARG n 
1 84  VAL n 
1 85  LEU n 
1 86  LEU n 
1 87  GLN n 
1 88  GLY n 
1 89  ASN n 
1 90  GLU n 
1 91  ASP n 
1 92  TYR n 
1 93  ILE n 
1 94  ASN n 
1 95  ALA n 
1 96  SER n 
1 97  TYR n 
1 98  VAL n 
1 99  ASN n 
1 100 MET n 
1 101 GLU n 
1 102 ILE n 
1 103 PRO n 
1 104 ALA n 
1 105 ALA n 
1 106 ASN n 
1 107 LEU n 
1 108 VAL n 
1 109 ASN n 
1 110 LYS n 
1 111 TYR n 
1 112 ILE n 
1 113 ALA n 
1 114 THR n 
1 115 GLN n 
1 116 GLY n 
1 117 PRO n 
1 118 LEU n 
1 119 PRO n 
1 120 HIS n 
1 121 THR n 
1 122 CYS n 
1 123 ALA n 
1 124 GLN n 
1 125 PHE n 
1 126 TRP n 
1 127 GLN n 
1 128 VAL n 
1 129 VAL n 
1 130 TRP n 
1 131 ASP n 
1 132 GLN n 
1 133 LYS n 
1 134 LEU n 
1 135 SER n 
1 136 LEU n 
1 137 ILE n 
1 138 VAL n 
1 139 MET n 
1 140 LEU n 
1 141 THR n 
1 142 THR n 
1 143 LEU n 
1 144 THR n 
1 145 GLU n 
1 146 ARG n 
1 147 GLY n 
1 148 ARG n 
1 149 THR n 
1 150 LYS n 
1 151 CYS n 
1 152 HIS n 
1 153 GLN n 
1 154 TYR n 
1 155 TRP n 
1 156 PRO n 
1 157 ASP n 
1 158 PRO n 
1 159 PRO n 
1 160 ASP n 
1 161 VAL n 
1 162 MET n 
1 163 ASN n 
1 164 HIS n 
1 165 GLY n 
1 166 GLY n 
1 167 PHE n 
1 168 HIS n 
1 169 ILE n 
1 170 GLN n 
1 171 CYS n 
1 172 GLN n 
1 173 SER n 
1 174 GLU n 
1 175 ASP n 
1 176 CYS n 
1 177 THR n 
1 178 ILE n 
1 179 ALA n 
1 180 TYR n 
1 181 VAL n 
1 182 SER n 
1 183 ARG n 
1 184 GLU n 
1 185 MET n 
1 186 LEU n 
1 187 VAL n 
1 188 THR n 
1 189 ASN n 
1 190 THR n 
1 191 GLN n 
1 192 THR n 
1 193 GLY n 
1 194 GLU n 
1 195 GLU n 
1 196 HIS n 
1 197 THR n 
1 198 VAL n 
1 199 THR n 
1 200 HIS n 
1 201 LEU n 
1 202 GLN n 
1 203 TYR n 
1 204 VAL n 
1 205 ALA n 
1 206 TRP n 
1 207 PRO n 
1 208 ALA n 
1 209 HIS n 
1 210 GLY n 
1 211 VAL n 
1 212 PRO n 
1 213 ASP n 
1 214 ASP n 
1 215 SER n 
1 216 SER n 
1 217 ASP n 
1 218 PHE n 
1 219 LEU n 
1 220 GLU n 
1 221 PHE n 
1 222 VAL n 
1 223 ASN n 
1 224 TYR n 
1 225 VAL n 
1 226 ARG n 
1 227 SER n 
1 228 LEU n 
1 229 ARG n 
1 230 VAL n 
1 231 ASP n 
1 232 SER n 
1 233 GLU n 
1 234 PRO n 
1 235 VAL n 
1 236 LEU n 
1 237 VAL n 
1 238 HIS n 
1 239 SER n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 ILE n 
1 244 GLY n 
1 245 ARG n 
1 246 THR n 
1 247 GLY n 
1 248 VAL n 
1 249 LEU n 
1 250 VAL n 
1 251 THR n 
1 252 MET n 
1 253 GLU n 
1 254 THR n 
1 255 ALA n 
1 256 MET n 
1 257 CYS n 
1 258 LEU n 
1 259 THR n 
1 260 GLU n 
1 261 ARG n 
1 262 ASN n 
1 263 LEU n 
1 264 PRO n 
1 265 ILE n 
1 266 TYR n 
1 267 PRO n 
1 268 LEU n 
1 269 ASP n 
1 270 ILE n 
1 271 VAL n 
1 272 ARG n 
1 273 LYS n 
1 274 MET n 
1 275 ARG n 
1 276 ASP n 
1 277 GLN n 
1 278 ARG n 
1 279 ALA n 
1 280 MET n 
1 281 MET n 
1 282 VAL n 
1 283 GLN n 
1 284 THR n 
1 285 SER n 
1 286 SER n 
1 287 GLN n 
1 288 TYR n 
1 289 LYS n 
1 290 PHE n 
1 291 VAL n 
1 292 CYS n 
1 293 GLU n 
1 294 ALA n 
1 295 ILE n 
1 296 LEU n 
1 297 ARG n 
1 298 VAL n 
1 299 TYR n 
1 300 GLU n 
1 301 GLU n 
1 302 GLY n 
1 303 LEU n 
1 304 VAL n 
1 305 GLN n 
1 306 MET n 
2 1   MET n 
2 2   TPO n 
2 3   GLY n 
2 4   PTR n 
2 5   VAL n 
2 6   VAL n 
2 7   THR n 
2 8   ARG n 
2 9   ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PTPH1, PTPN3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMCSG7 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PTN3_HUMAN P26045 1 
;DTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPA
ANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTIAYVSRE
MLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHCSAGIGRTGVLVTMETAMCLTERNLP
IYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQM
;
628 ? 
2 UNP MK12_HUMAN P53778 2 MTGYVVTRW 182 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4QUM A 25 ? 306 ? P26045 628 ? 909 ? 628 909 
2 2 4QUM B 1  ? 9   ? P53778 182 ? 190 ? 182 190 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4QUM MET A 1   ? UNP P26045 ?   ?   'EXPRESSION TAG'      604 1  
1 4QUM HIS A 2   ? UNP P26045 ?   ?   'EXPRESSION TAG'      605 2  
1 4QUM HIS A 3   ? UNP P26045 ?   ?   'EXPRESSION TAG'      606 3  
1 4QUM HIS A 4   ? UNP P26045 ?   ?   'EXPRESSION TAG'      607 4  
1 4QUM HIS A 5   ? UNP P26045 ?   ?   'EXPRESSION TAG'      608 5  
1 4QUM HIS A 6   ? UNP P26045 ?   ?   'EXPRESSION TAG'      609 6  
1 4QUM HIS A 7   ? UNP P26045 ?   ?   'EXPRESSION TAG'      610 7  
1 4QUM SER A 8   ? UNP P26045 ?   ?   'EXPRESSION TAG'      611 8  
1 4QUM SER A 9   ? UNP P26045 ?   ?   'EXPRESSION TAG'      612 9  
1 4QUM GLY A 10  ? UNP P26045 ?   ?   'EXPRESSION TAG'      613 10 
1 4QUM VAL A 11  ? UNP P26045 ?   ?   'EXPRESSION TAG'      614 11 
1 4QUM ASP A 12  ? UNP P26045 ?   ?   'EXPRESSION TAG'      615 12 
1 4QUM LEU A 13  ? UNP P26045 ?   ?   'EXPRESSION TAG'      616 13 
1 4QUM GLY A 14  ? UNP P26045 ?   ?   'EXPRESSION TAG'      617 14 
1 4QUM THR A 15  ? UNP P26045 ?   ?   'EXPRESSION TAG'      618 15 
1 4QUM GLU A 16  ? UNP P26045 ?   ?   'EXPRESSION TAG'      619 16 
1 4QUM ASN A 17  ? UNP P26045 ?   ?   'EXPRESSION TAG'      620 17 
1 4QUM LEU A 18  ? UNP P26045 ?   ?   'EXPRESSION TAG'      621 18 
1 4QUM TYR A 19  ? UNP P26045 ?   ?   'EXPRESSION TAG'      622 19 
1 4QUM PHE A 20  ? UNP P26045 ?   ?   'EXPRESSION TAG'      623 20 
1 4QUM GLN A 21  ? UNP P26045 ?   ?   'EXPRESSION TAG'      624 21 
1 4QUM SER A 22  ? UNP P26045 ?   ?   'EXPRESSION TAG'      625 22 
1 4QUM ASN A 23  ? UNP P26045 ?   ?   'EXPRESSION TAG'      626 23 
1 4QUM ALA A 24  ? UNP P26045 ?   ?   'EXPRESSION TAG'      627 24 
1 4QUM ALA A 208 ? UNP P26045 ASP 811 'ENGINEERED MUTATION' 811 25 
1 4QUM SER A 239 ? UNP P26045 CYS 842 'ENGINEERED MUTATION' 842 26 
2 4QUM ARG B 9   ? UNP P53778 TRP 190 'ENGINEERED MUTATION' 190 27 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                  'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                  'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE  'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE            ?                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                  'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE  PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                  'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4QUM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.50 
_exptl_crystal.density_percent_sol   50.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'0.1M Tris-HCl, 30% PEG 8000, 5% glycerol, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX300HE' 
_diffrn_detector.pdbx_collection_date   2013-03-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSRRC BEAMLINE BL15A1' 
_diffrn_source.pdbx_synchrotron_site       NSRRC 
_diffrn_source.pdbx_synchrotron_beamline   BL15A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     4QUM 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.51 
_reflns.number_obs                   12505 
_reflns.number_all                   12505 
_reflns.percent_possible_obs         98.0 
_reflns.pdbx_Rmerge_I_obs            0.122 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.79 
_reflns.B_iso_Wilson_estimate        41.1 
_reflns.pdbx_redundancy              4.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.51 
_reflns_shell.d_res_low                   2.60 
_reflns_shell.percent_possible_all        95.1 
_reflns_shell.Rmerge_I_obs                0.521 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         2.35 
_reflns_shell.pdbx_redundancy             4.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           1182 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4QUM 
_refine.ls_number_reflns_obs                     12481 
_refine.ls_number_reflns_all                     12505 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             31.325 
_refine.ls_d_res_high                            2.516 
_refine.ls_percent_reflns_obs                    98.13 
_refine.ls_R_factor_obs                          0.1993 
_refine.ls_R_factor_all                          0.1993 
_refine.ls_R_factor_R_work                       0.1970 
_refine.ls_R_factor_R_free                       0.2448 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.90 
_refine.ls_number_reflns_R_free                  611 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB Entry 2B49' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.34 
_refine.pdbx_overall_phase_error                 25.22 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2303 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             27 
_refine_hist.number_atoms_total               2330 
_refine_hist.d_res_high                       2.516 
_refine_hist.d_res_low                        31.325 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.009  ? ? 2364 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.252  ? ? 3221 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 15.435 ? ? 881  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.046  ? ? 366  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 411  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
'X-RAY DIFFRACTION' 4 2.5155 2.7686  2881 0.2470 98.00  0.3302 . . 170 . . . . 
'X-RAY DIFFRACTION' 4 2.7686 3.1688  2982 0.2271 100.00 0.2725 . . 154 . . . . 
'X-RAY DIFFRACTION' 4 3.1688 3.9911  3011 0.1895 100.00 0.2485 . . 142 . . . . 
'X-RAY DIFFRACTION' 4 3.9911 31.3275 2996 0.1770 95.00  0.2086 . . 145 . . . . 
# 
_struct.entry_id                  4QUM 
_struct.title                     'Crystal structure of PTPN3 (PTPH1) in complex with a dually phosphorylated MAPK12 peptide' 
_struct.pdbx_descriptor           
'Tyrosine-protein phosphatase non-receptor type 3 (E.C.3.1.3.48), Mitogen-activated protein kinase 12 (E.C.2.7.11.24)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4QUM 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Alpha Beta, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 26  ? GLY A 41  ? THR A 629 GLY A 644 1 ? 16 
HELX_P HELX_P2  2  GLY A 41  ? LEU A 50  ? GLY A 644 LEU A 653 1 ? 10 
HELX_P HELX_P3  3  THR A 60  ? LEU A 64  ? THR A 663 LEU A 667 5 ? 5  
HELX_P HELX_P4  4  ASN A 67  ? ASN A 71  ? ASN A 670 ASN A 674 5 ? 5  
HELX_P HELX_P5  5  PRO A 103 ? ASN A 106 ? PRO A 706 ASN A 709 5 ? 4  
HELX_P HELX_P6  6  THR A 121 ? GLN A 132 ? THR A 724 GLN A 735 1 ? 12 
HELX_P HELX_P7  7  ASP A 214 ? ARG A 229 ? ASP A 817 ARG A 832 1 ? 16 
HELX_P HELX_P8  8  ILE A 243 ? ARG A 261 ? ILE A 846 ARG A 864 1 ? 19 
HELX_P HELX_P9  9  TYR A 266 ? ASP A 276 ? TYR A 869 ASP A 879 1 ? 11 
HELX_P HELX_P10 10 THR A 284 ? GLY A 302 ? THR A 887 GLY A 905 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B MET 1 C ? ? ? 1_555 B TPO 2 N ? ? B MET 182 B TPO 183 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale2 covale ? ? B TPO 2 C ? ? ? 1_555 B GLY 3 N ? ? B TPO 183 B GLY 184 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3 covale ? ? B GLY 3 C ? ? ? 1_555 B PTR 4 N ? ? B GLY 184 B PTR 185 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale4 covale ? ? B PTR 4 C ? ? ? 1_555 B VAL 5 N ? ? B PTR 185 B VAL 186 1_555 ? ? ? ? ? ? ? 1.334 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 40  A . ? SER 643 A GLY 41  A ? GLY 644 A 1 -12.44 
2 PRO 158 A . ? PRO 761 A PRO 159 A ? PRO 762 A 1 6.72   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? LEU A 85  ? ARG A 686 LEU A 688 
A 2 TYR A 92  ? ILE A 102 ? TYR A 695 ILE A 705 
A 3 LEU A 107 ? THR A 114 ? LEU A 710 THR A 717 
A 4 VAL A 235 ? HIS A 238 ? VAL A 838 HIS A 841 
A 5 LEU A 136 ? MET A 139 ? LEU A 739 MET A 742 
A 6 GLU A 195 ? TYR A 203 ? GLU A 798 TYR A 806 
A 7 TYR A 180 ? ASN A 189 ? TYR A 783 ASN A 792 
A 8 PHE A 167 ? CYS A 176 ? PHE A 770 CYS A 779 
A 9 MET A 162 ? ASN A 163 ? MET A 765 ASN A 766 
B 1 THR A 144 ? GLU A 145 ? THR A 747 GLU A 748 
B 2 ARG A 148 ? THR A 149 ? ARG A 751 THR A 752 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 84  ? N VAL A 687 O ALA A 95  ? O ALA A 698 
A 2 3 N ILE A 102 ? N ILE A 705 O LEU A 107 ? O LEU A 710 
A 3 4 N ILE A 112 ? N ILE A 715 O VAL A 237 ? O VAL A 840 
A 4 5 O LEU A 236 ? O LEU A 839 N VAL A 138 ? N VAL A 741 
A 5 6 N MET A 139 ? N MET A 742 O LEU A 201 ? O LEU A 804 
A 6 7 O HIS A 196 ? O HIS A 799 N VAL A 187 ? N VAL A 790 
A 7 8 O THR A 188 ? O THR A 791 N HIS A 168 ? N HIS A 771 
A 8 9 O ILE A 169 ? O ILE A 772 N MET A 162 ? N MET A 765 
B 1 2 N GLU A 145 ? N GLU A 748 O ARG A 148 ? O ARG A 751 
# 
_database_PDB_matrix.entry_id          4QUM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4QUM 
_atom_sites.fract_transf_matrix[1][1]   0.013247 
_atom_sites.fract_transf_matrix[1][2]   0.007648 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015296 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009124 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 24  ? 28.574 -16.620 9.440   1.00   68.87  ? 627  ALA A N   1 
ATOM   2    C CA  . ALA A 1 24  ? 28.470 -15.345 10.144  1.00   75.82  ? 627  ALA A CA  1 
ATOM   3    C C   . ALA A 1 24  ? 28.065 -14.260 9.151   1.00   66.29  ? 627  ALA A C   1 
ATOM   4    O O   . ALA A 1 24  ? 28.464 -14.310 7.984   1.00   65.64  ? 627  ALA A O   1 
ATOM   5    C CB  . ALA A 1 24  ? 29.801 -14.988 10.854  1.00   67.09  ? 627  ALA A CB  1 
ATOM   6    N N   . ASP A 1 25  ? 27.250 -13.315 9.631   1.00   68.01  ? 628  ASP A N   1 
ATOM   7    C CA  . ASP A 1 25  ? 26.688 -12.196 8.859   1.00   56.41  ? 628  ASP A CA  1 
ATOM   8    C C   . ASP A 1 25  ? 25.722 -12.743 7.788   1.00   53.28  ? 628  ASP A C   1 
ATOM   9    O O   . ASP A 1 25  ? 25.487 -13.950 7.707   1.00   52.34  ? 628  ASP A O   1 
ATOM   10   C CB  . ASP A 1 25  ? 27.818 -11.371 8.210   1.00   60.90  ? 628  ASP A CB  1 
ATOM   11   C CG  . ASP A 1 25  ? 27.404 -9.937  7.878   1.00   65.15  ? 628  ASP A CG  1 
ATOM   12   O OD1 . ASP A 1 25  ? 26.243 -9.717  7.484   1.00   68.03  ? 628  ASP A OD1 1 
ATOM   13   O OD2 . ASP A 1 25  ? 28.228 -9.011  8.083   1.00   71.94  ? 628  ASP A OD2 1 
ATOM   14   N N   . THR A 1 26  ? 25.141 -11.855 6.994   1.00   54.10  ? 629  THR A N   1 
ATOM   15   C CA  . THR A 1 26  ? 24.075 -12.224 6.063   1.00   52.49  ? 629  THR A CA  1 
ATOM   16   C C   . THR A 1 26  ? 24.431 -12.101 4.594   1.00   46.38  ? 629  THR A C   1 
ATOM   17   O O   . THR A 1 26  ? 25.529 -11.669 4.246   1.00   48.12  ? 629  THR A O   1 
ATOM   18   C CB  . THR A 1 26  ? 22.872 -11.317 6.306   1.00   48.90  ? 629  THR A CB  1 
ATOM   19   O OG1 . THR A 1 26  ? 23.284 -9.960  6.103   1.00   53.63  ? 629  THR A OG1 1 
ATOM   20   C CG2 . THR A 1 26  ? 22.345 -11.493 7.710   1.00   44.83  ? 629  THR A CG2 1 
ATOM   21   N N   . LEU A 1 27  ? 23.473 -12.452 3.739   1.00   45.85  ? 630  LEU A N   1 
ATOM   22   C CA  . LEU A 1 27  ? 23.604 -12.270 2.295   1.00   41.44  ? 630  LEU A CA  1 
ATOM   23   C C   . LEU A 1 27  ? 23.813 -10.804 1.934   1.00   47.98  ? 630  LEU A C   1 
ATOM   24   O O   . LEU A 1 27  ? 24.798 -10.462 1.267   1.00   43.93  ? 630  LEU A O   1 
ATOM   25   C CB  . LEU A 1 27  ? 22.371 -12.819 1.573   1.00   46.16  ? 630  LEU A CB  1 
ATOM   26   C CG  . LEU A 1 27  ? 22.196 -12.528 0.078   1.00   47.70  ? 630  LEU A CG  1 
ATOM   27   C CD1 . LEU A 1 27  ? 23.465 -12.830 -0.698  1.00   44.30  ? 630  LEU A CD1 1 
ATOM   28   C CD2 . LEU A 1 27  ? 21.041 -13.350 -0.466  1.00   50.26  ? 630  LEU A CD2 1 
ATOM   29   N N   . GLU A 1 28  ? 22.880 -9.954  2.370   1.00   51.27  ? 631  GLU A N   1 
ATOM   30   C CA  . GLU A 1 28  ? 22.966 -8.519  2.140   1.00   48.87  ? 631  GLU A CA  1 
ATOM   31   C C   . GLU A 1 28  ? 24.350 -8.032  2.598   1.00   51.04  ? 631  GLU A C   1 
ATOM   32   O O   . GLU A 1 28  ? 25.033 -7.290  1.874   1.00   45.42  ? 631  GLU A O   1 
ATOM   33   C CB  . GLU A 1 28  ? 21.839 -7.781  2.878   0.0000 49.71  ? 631  GLU A CB  1 
ATOM   34   C CG  . GLU A 1 28  ? 21.533 -8.334  4.265   0.0000 49.69  ? 631  GLU A CG  1 
ATOM   35   C CD  . GLU A 1 28  ? 20.451 -9.404  4.281   0.0000 50.13  ? 631  GLU A CD  1 
ATOM   36   O OE1 . GLU A 1 28  ? 20.503 -10.324 3.439   0.0000 49.83  ? 631  GLU A OE1 1 
ATOM   37   O OE2 . GLU A 1 28  ? 19.575 -9.352  5.171   0.0000 51.01  ? 631  GLU A OE2 1 
ATOM   38   N N   . GLY A 1 29  ? 24.772 -8.497  3.778   1.00   46.04  ? 632  GLY A N   1 
ATOM   39   C CA  . GLY A 1 29  ? 26.051 -8.114  4.354   1.00   46.83  ? 632  GLY A CA  1 
ATOM   40   C C   . GLY A 1 29  ? 27.296 -8.613  3.640   1.00   46.49  ? 632  GLY A C   1 
ATOM   41   O O   . GLY A 1 29  ? 28.268 -7.872  3.480   1.00   41.37  ? 632  GLY A O   1 
ATOM   42   N N   . SER A 1 30  ? 27.277 -9.876  3.223   1.00   46.37  ? 633  SER A N   1 
ATOM   43   C CA  . SER A 1 30  ? 28.393 -10.446 2.480   1.00   43.41  ? 633  SER A CA  1 
ATOM   44   C C   . SER A 1 30  ? 28.560 -9.721  1.155   1.00   46.23  ? 633  SER A C   1 
ATOM   45   O O   . SER A 1 30  ? 29.687 -9.542  0.667   1.00   46.29  ? 633  SER A O   1 
ATOM   46   C CB  . SER A 1 30  ? 28.193 -11.953 2.249   1.00   44.75  ? 633  SER A CB  1 
ATOM   47   O OG  . SER A 1 30  ? 27.023 -12.245 1.502   1.00   43.94  ? 633  SER A OG  1 
ATOM   48   N N   . MET A 1 31  ? 27.434 -9.290  0.584   1.00   45.12  ? 634  MET A N   1 
ATOM   49   C CA  . MET A 1 31  ? 27.443 -8.662  -0.733  1.00   47.52  ? 634  MET A CA  1 
ATOM   50   C C   . MET A 1 31  ? 27.981 -7.237  -0.641  1.00   49.79  ? 634  MET A C   1 
ATOM   51   O O   . MET A 1 31  ? 28.683 -6.762  -1.552  1.00   38.73  ? 634  MET A O   1 
ATOM   52   C CB  . MET A 1 31  ? 26.045 -8.692  -1.350  1.00   41.57  ? 634  MET A CB  1 
ATOM   53   C CG  . MET A 1 31  ? 25.567 -10.101 -1.767  1.00   52.05  ? 634  MET A CG  1 
ATOM   54   S SD  . MET A 1 31  ? 26.454 -10.865 -3.174  1.00   44.37  ? 634  MET A SD  1 
ATOM   55   C CE  . MET A 1 31  ? 27.751 -11.770 -2.328  1.00   43.83  ? 634  MET A CE  1 
ATOM   56   N N   . ALA A 1 32  ? 27.679 -6.566  0.471   1.00   40.47  ? 635  ALA A N   1 
ATOM   57   C CA  . ALA A 1 32  ? 28.254 -5.246  0.704   1.00   45.69  ? 635  ALA A CA  1 
ATOM   58   C C   . ALA A 1 32  ? 29.757 -5.404  0.894   1.00   41.68  ? 635  ALA A C   1 
ATOM   59   O O   . ALA A 1 32  ? 30.564 -4.627  0.371   1.00   40.37  ? 635  ALA A O   1 
ATOM   60   C CB  . ALA A 1 32  ? 27.613 -4.581  1.911   1.00   45.20  ? 635  ALA A CB  1 
ATOM   61   N N   . GLN A 1 33  ? 30.113 -6.449  1.629   1.00   37.91  ? 636  GLN A N   1 
ATOM   62   C CA  . GLN A 1 33  ? 31.502 -6.767  1.923   1.00   43.81  ? 636  GLN A CA  1 
ATOM   63   C C   . GLN A 1 33  ? 32.265 -7.106  0.651   1.00   45.39  ? 636  GLN A C   1 
ATOM   64   O O   . GLN A 1 33  ? 33.398 -6.658  0.454   1.00   42.80  ? 636  GLN A O   1 
ATOM   65   C CB  . GLN A 1 33  ? 31.566 -7.930  2.922   1.00   48.98  ? 636  GLN A CB  1 
ATOM   66   C CG  . GLN A 1 33  ? 32.944 -8.513  3.169   1.00   48.93  ? 636  GLN A CG  1 
ATOM   67   C CD  . GLN A 1 33  ? 33.490 -8.187  4.548   1.00   69.52  ? 636  GLN A CD  1 
ATOM   68   O OE1 . GLN A 1 33  ? 33.052 -7.233  5.205   1.00   72.09  ? 636  GLN A OE1 1 
ATOM   69   N NE2 . GLN A 1 33  ? 34.442 -8.997  5.005   1.00   68.34  ? 636  GLN A NE2 1 
ATOM   70   N N   . LEU A 1 34  ? 31.633 -7.898  -0.210  1.00   42.84  ? 637  LEU A N   1 
ATOM   71   C CA  . LEU A 1 34  ? 32.215 -8.252  -1.503  1.00   46.19  ? 637  LEU A CA  1 
ATOM   72   C C   . LEU A 1 34  ? 32.433 -7.025  -2.410  1.00   41.59  ? 637  LEU A C   1 
ATOM   73   O O   . LEU A 1 34  ? 33.478 -6.894  -3.043  1.00   40.17  ? 637  LEU A O   1 
ATOM   74   C CB  . LEU A 1 34  ? 31.328 -9.295  -2.205  1.00   45.24  ? 637  LEU A CB  1 
ATOM   75   C CG  . LEU A 1 34  ? 31.729 -9.719  -3.625  1.00   38.33  ? 637  LEU A CG  1 
ATOM   76   C CD1 . LEU A 1 34  ? 33.112 -10.327 -3.649  1.00   32.86  ? 637  LEU A CD1 1 
ATOM   77   C CD2 . LEU A 1 34  ? 30.700 -10.682 -4.185  1.00   35.49  ? 637  LEU A CD2 1 
ATOM   78   N N   . LYS A 1 35  ? 31.445 -6.133  -2.457  1.00   42.95  ? 638  LYS A N   1 
ATOM   79   C CA  . LYS A 1 35  ? 31.531 -4.896  -3.237  1.00   44.57  ? 638  LYS A CA  1 
ATOM   80   C C   . LYS A 1 35  ? 32.683 -3.989  -2.771  1.00   51.50  ? 638  LYS A C   1 
ATOM   81   O O   . LYS A 1 35  ? 33.484 -3.514  -3.588  1.00   49.39  ? 638  LYS A O   1 
ATOM   82   C CB  . LYS A 1 35  ? 30.203 -4.153  -3.159  0.0000 46.84  ? 638  LYS A CB  1 
ATOM   83   C CG  . LYS A 1 35  ? 30.230 -2.745  -3.708  0.0000 48.83  ? 638  LYS A CG  1 
ATOM   84   C CD  . LYS A 1 35  ? 28.855 -2.249  -4.194  0.0000 50.58  ? 638  LYS A CD  1 
ATOM   85   C CE  . LYS A 1 35  ? 27.600 -2.932  -3.600  0.0000 51.20  ? 638  LYS A CE  1 
ATOM   86   N NZ  . LYS A 1 35  ? 27.542 -3.249  -2.137  0.0000 50.70  ? 638  LYS A NZ  1 
ATOM   87   N N   . LYS A 1 36  ? 32.748 -3.759  -1.458  1.00   45.32  ? 639  LYS A N   1 
ATOM   88   C CA  . LYS A 1 36  ? 33.850 -3.047  -0.817  1.00   49.37  ? 639  LYS A CA  1 
ATOM   89   C C   . LYS A 1 36  ? 35.197 -3.623  -1.275  1.00   54.75  ? 639  LYS A C   1 
ATOM   90   O O   . LYS A 1 36  ? 36.093 -2.884  -1.713  1.00   47.96  ? 639  LYS A O   1 
ATOM   91   C CB  . LYS A 1 36  ? 33.709 -3.134  0.719   1.00   51.49  ? 639  LYS A CB  1 
ATOM   92   C CG  . LYS A 1 36  ? 34.444 -2.058  1.520   0.0000 54.12  ? 639  LYS A CG  1 
ATOM   93   C CD  . LYS A 1 36  ? 34.759 -0.816  0.695   0.0000 54.92  ? 639  LYS A CD  1 
ATOM   94   C CE  . LYS A 1 36  ? 35.359 0.288   1.562   0.0000 56.38  ? 639  LYS A CE  1 
ATOM   95   N NZ  . LYS A 1 36  ? 36.566 -0.169  2.310   0.0000 56.12  ? 639  LYS A NZ  1 
ATOM   96   N N   . GLY A 1 37  ? 35.320 -4.948  -1.191  1.00   44.77  ? 640  GLY A N   1 
ATOM   97   C CA  . GLY A 1 37  ? 36.544 -5.633  -1.551  1.00   43.09  ? 640  GLY A CA  1 
ATOM   98   C C   . GLY A 1 37  ? 36.881 -5.583  -3.031  1.00   50.15  ? 640  GLY A C   1 
ATOM   99   O O   . GLY A 1 37  ? 38.048 -5.653  -3.402  1.00   46.03  ? 640  GLY A O   1 
ATOM   100  N N   . LEU A 1 38  ? 35.867 -5.484  -3.887  1.00   48.65  ? 641  LEU A N   1 
ATOM   101  C CA  . LEU A 1 38  ? 36.120 -5.313  -5.317  1.00   51.60  ? 641  LEU A CA  1 
ATOM   102  C C   . LEU A 1 38  ? 36.591 -3.897  -5.587  1.00   53.55  ? 641  LEU A C   1 
ATOM   103  O O   . LEU A 1 38  ? 37.547 -3.685  -6.335  1.00   49.48  ? 641  LEU A O   1 
ATOM   104  C CB  . LEU A 1 38  ? 34.878 -5.633  -6.146  1.00   42.84  ? 641  LEU A CB  1 
ATOM   105  C CG  . LEU A 1 38  ? 34.646 -7.130  -6.322  1.00   40.91  ? 641  LEU A CG  1 
ATOM   106  C CD1 . LEU A 1 38  ? 33.228 -7.425  -6.757  1.00   36.82  ? 641  LEU A CD1 1 
ATOM   107  C CD2 . LEU A 1 38  ? 35.651 -7.682  -7.314  1.00   43.71  ? 641  LEU A CD2 1 
ATOM   108  N N   . GLU A 1 39  ? 35.927 -2.936  -4.948  1.00   52.26  ? 642  GLU A N   1 
ATOM   109  C CA  . GLU A 1 39  ? 36.295 -1.529  -5.074  1.00   57.26  ? 642  GLU A CA  1 
ATOM   110  C C   . GLU A 1 39  ? 37.692 -1.203  -4.491  1.00   61.93  ? 642  GLU A C   1 
ATOM   111  O O   . GLU A 1 39  ? 38.364 -0.302  -4.990  1.00   59.98  ? 642  GLU A O   1 
ATOM   112  C CB  . GLU A 1 39  ? 35.222 -0.658  -4.407  1.00   51.29  ? 642  GLU A CB  1 
ATOM   113  C CG  . GLU A 1 39  ? 33.873 -0.684  -5.108  0.0000 53.18  ? 642  GLU A CG  1 
ATOM   114  C CD  . GLU A 1 39  ? 32.822 0.129   -4.379  0.0000 52.71  ? 642  GLU A CD  1 
ATOM   115  O OE1 . GLU A 1 39  ? 33.089 0.557   -3.236  0.0000 52.66  ? 642  GLU A OE1 1 
ATOM   116  O OE2 . GLU A 1 39  ? 31.730 0.341   -4.947  0.0000 52.92  ? 642  GLU A OE2 1 
ATOM   117  N N   . SER A 1 40  ? 38.134 -1.963  -3.482  1.00   61.18  ? 643  SER A N   1 
ATOM   118  C CA  . SER A 1 40  ? 39.336 -1.648  -2.683  1.00   55.55  ? 643  SER A CA  1 
ATOM   119  C C   . SER A 1 40  ? 40.727 -1.743  -3.359  1.00   59.95  ? 643  SER A C   1 
ATOM   120  O O   . SER A 1 40  ? 41.526 -0.828  -3.171  1.00   72.01  ? 643  SER A O   1 
ATOM   121  C CB  . SER A 1 40  ? 39.355 -2.520  -1.429  1.00   50.31  ? 643  SER A CB  1 
ATOM   122  O OG  . SER A 1 40  ? 38.251 -2.222  -0.612  1.00   63.36  ? 643  SER A OG  1 
ATOM   123  N N   . GLY A 1 41  ? 41.091 -2.819  -4.067  1.00   59.46  ? 644  GLY A N   1 
ATOM   124  C CA  . GLY A 1 41  ? 40.416 -4.101  -4.108  1.00   54.74  ? 644  GLY A CA  1 
ATOM   125  C C   . GLY A 1 41  ? 41.205 -5.136  -3.315  1.00   52.95  ? 644  GLY A C   1 
ATOM   126  O O   . GLY A 1 41  ? 42.279 -5.581  -3.728  1.00   52.26  ? 644  GLY A O   1 
ATOM   127  N N   . THR A 1 42  ? 40.686 -5.524  -2.160  1.00   50.69  ? 645  THR A N   1 
ATOM   128  C CA  . THR A 1 42  ? 41.398 -6.501  -1.355  1.00   55.90  ? 645  THR A CA  1 
ATOM   129  C C   . THR A 1 42  ? 41.033 -7.931  -1.750  1.00   52.37  ? 645  THR A C   1 
ATOM   130  O O   . THR A 1 42  ? 41.784 -8.856  -1.443  1.00   56.63  ? 645  THR A O   1 
ATOM   131  C CB  . THR A 1 42  ? 41.141 -6.312  0.170   1.00   54.41  ? 645  THR A CB  1 
ATOM   132  O OG1 . THR A 1 42  ? 39.836 -6.787  0.521   1.00   60.31  ? 645  THR A OG1 1 
ATOM   133  C CG2 . THR A 1 42  ? 41.279 -4.859  0.563   1.00   48.04  ? 645  THR A CG2 1 
ATOM   134  N N   . VAL A 1 43  ? 39.898 -8.121  -2.426  1.00   44.20  ? 646  VAL A N   1 
ATOM   135  C CA  . VAL A 1 43  ? 39.472 -9.470  -2.780  1.00   45.43  ? 646  VAL A CA  1 
ATOM   136  C C   . VAL A 1 43  ? 40.476 -10.124 -3.730  1.00   49.81  ? 646  VAL A C   1 
ATOM   137  O O   . VAL A 1 43  ? 40.734 -11.324 -3.638  1.00   52.33  ? 646  VAL A O   1 
ATOM   138  C CB  . VAL A 1 43  ? 38.051 -9.505  -3.417  1.00   46.52  ? 646  VAL A CB  1 
ATOM   139  C CG1 . VAL A 1 43  ? 37.034 -8.892  -2.491  1.00   41.81  ? 646  VAL A CG1 1 
ATOM   140  C CG2 . VAL A 1 43  ? 38.022 -8.828  -4.772  1.00   53.90  ? 646  VAL A CG2 1 
ATOM   141  N N   . LEU A 1 44  ? 41.071 -9.326  -4.610  1.00   47.20  ? 647  LEU A N   1 
ATOM   142  C CA  . LEU A 1 44  ? 42.022 -9.837  -5.580  1.00   49.87  ? 647  LEU A CA  1 
ATOM   143  C C   . LEU A 1 44  ? 43.372 -10.156 -4.934  1.00   50.88  ? 647  LEU A C   1 
ATOM   144  O O   . LEU A 1 44  ? 44.085 -11.076 -5.361  1.00   48.57  ? 647  LEU A O   1 
ATOM   145  C CB  . LEU A 1 44  ? 42.193 -8.834  -6.723  1.00   44.25  ? 647  LEU A CB  1 
ATOM   146  C CG  . LEU A 1 44  ? 41.569 -9.307  -8.031  1.00   48.84  ? 647  LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 44  ? 40.106 -9.632  -7.832  1.00   48.48  ? 647  LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 44  ? 41.742 -8.263  -9.115  1.00   61.88  ? 647  LEU A CD2 1 
ATOM   149  N N   . ILE A 1 45  ? 43.718 -9.388  -3.906  1.00   50.88  ? 648  ILE A N   1 
ATOM   150  C CA  . ILE A 1 45  ? 44.949 -9.626  -3.161  1.00   58.12  ? 648  ILE A CA  1 
ATOM   151  C C   . ILE A 1 45  ? 44.862 -10.947 -2.415  1.00   50.68  ? 648  ILE A C   1 
ATOM   152  O O   . ILE A 1 45  ? 45.763 -11.787 -2.496  1.00   47.43  ? 648  ILE A O   1 
ATOM   153  C CB  . ILE A 1 45  ? 45.253 -8.488  -2.149  1.00   57.78  ? 648  ILE A CB  1 
ATOM   154  C CG1 . ILE A 1 45  ? 45.430 -7.151  -2.878  1.00   62.53  ? 648  ILE A CG1 1 
ATOM   155  C CG2 . ILE A 1 45  ? 46.495 -8.818  -1.340  1.00   56.86  ? 648  ILE A CG2 1 
ATOM   156  C CD1 . ILE A 1 45  ? 46.350 -7.227  -4.099  1.00   59.03  ? 648  ILE A CD1 1 
ATOM   157  N N   . GLN A 1 46  ? 43.767 -11.129 -1.691  1.00   43.02  ? 649  GLN A N   1 
ATOM   158  C CA  . GLN A 1 46  ? 43.584 -12.347 -0.918  1.00   48.77  ? 649  GLN A CA  1 
ATOM   159  C C   . GLN A 1 46  ? 43.486 -13.566 -1.825  1.00   46.54  ? 649  GLN A C   1 
ATOM   160  O O   . GLN A 1 46  ? 43.940 -14.644 -1.464  1.00   43.70  ? 649  GLN A O   1 
ATOM   161  C CB  . GLN A 1 46  ? 42.347 -12.240 -0.043  1.00   42.46  ? 649  GLN A CB  1 
ATOM   162  C CG  . GLN A 1 46  ? 42.459 -11.177 1.024   1.00   48.35  ? 649  GLN A CG  1 
ATOM   163  C CD  . GLN A 1 46  ? 41.130 -10.933 1.658   1.00   57.18  ? 649  GLN A CD  1 
ATOM   164  O OE1 . GLN A 1 46  ? 40.096 -11.163 1.033   1.00   61.10  ? 649  GLN A OE1 1 
ATOM   165  N NE2 . GLN A 1 46  ? 41.132 -10.510 2.916   1.00   62.26  ? 649  GLN A NE2 1 
ATOM   166  N N   . PHE A 1 47  ? 42.904 -13.387 -3.007  1.00   44.66  ? 650  PHE A N   1 
ATOM   167  C CA  . PHE A 1 47  ? 42.860 -14.473 -3.970  1.00   43.17  ? 650  PHE A CA  1 
ATOM   168  C C   . PHE A 1 47  ? 44.262 -14.859 -4.418  1.00   43.94  ? 650  PHE A C   1 
ATOM   169  O O   . PHE A 1 47  ? 44.573 -16.050 -4.563  1.00   44.07  ? 650  PHE A O   1 
ATOM   170  C CB  . PHE A 1 47  ? 42.023 -14.109 -5.196  1.00   35.01  ? 650  PHE A CB  1 
ATOM   171  C CG  . PHE A 1 47  ? 42.146 -15.112 -6.304  1.00   39.16  ? 650  PHE A CG  1 
ATOM   172  C CD1 . PHE A 1 47  ? 41.364 -16.261 -6.301  1.00   36.37  ? 650  PHE A CD1 1 
ATOM   173  C CD2 . PHE A 1 47  ? 43.075 -14.933 -7.329  1.00   33.12  ? 650  PHE A CD2 1 
ATOM   174  C CE1 . PHE A 1 47  ? 41.481 -17.196 -7.315  1.00   35.63  ? 650  PHE A CE1 1 
ATOM   175  C CE2 . PHE A 1 47  ? 43.203 -15.861 -8.327  1.00   33.13  ? 650  PHE A CE2 1 
ATOM   176  C CZ  . PHE A 1 47  ? 42.399 -16.997 -8.329  1.00   30.84  ? 650  PHE A CZ  1 
ATOM   177  N N   . GLU A 1 48  ? 45.093 -13.850 -4.673  1.00   43.26  ? 651  GLU A N   1 
ATOM   178  C CA  . GLU A 1 48  ? 46.449 -14.096 -5.137  1.00   42.65  ? 651  GLU A CA  1 
ATOM   179  C C   . GLU A 1 48  ? 47.261 -14.779 -4.039  1.00   45.63  ? 651  GLU A C   1 
ATOM   180  O O   . GLU A 1 48  ? 48.149 -15.586 -4.338  1.00   45.49  ? 651  GLU A O   1 
ATOM   181  C CB  . GLU A 1 48  ? 47.121 -12.796 -5.588  1.00   46.97  ? 651  GLU A CB  1 
ATOM   182  C CG  . GLU A 1 48  ? 46.892 -12.436 -7.067  1.00   42.55  ? 651  GLU A CG  1 
ATOM   183  C CD  . GLU A 1 48  ? 47.207 -13.583 -8.012  0.0000 43.21  ? 651  GLU A CD  1 
ATOM   184  O OE1 . GLU A 1 48  ? 48.168 -14.336 -7.747  0.0000 44.27  ? 651  GLU A OE1 1 
ATOM   185  O OE2 . GLU A 1 48  ? 46.490 -13.734 -9.023  0.0000 41.64  ? 651  GLU A OE2 1 
ATOM   186  N N   . GLN A 1 49  ? 46.927 -14.489 -2.781  1.00   37.05  ? 652  GLN A N   1 
ATOM   187  C CA  . GLN A 1 49  ? 47.646 -15.058 -1.639  1.00   44.13  ? 652  GLN A CA  1 
ATOM   188  C C   . GLN A 1 49  ? 47.159 -16.453 -1.247  1.00   40.86  ? 652  GLN A C   1 
ATOM   189  O O   . GLN A 1 49  ? 47.818 -17.152 -0.481  1.00   40.73  ? 652  GLN A O   1 
ATOM   190  C CB  . GLN A 1 49  ? 47.542 -14.133 -0.425  1.00   39.62  ? 652  GLN A CB  1 
ATOM   191  C CG  . GLN A 1 49  ? 48.451 -12.928 -0.503  1.00   45.46  ? 652  GLN A CG  1 
ATOM   192  C CD  . GLN A 1 49  ? 48.054 -11.834 0.469   1.00   54.77  ? 652  GLN A CD  1 
ATOM   193  O OE1 . GLN A 1 49  ? 47.138 -12.001 1.288   1.00   59.17  ? 652  GLN A OE1 1 
ATOM   194  N NE2 . GLN A 1 49  ? 48.731 -10.700 0.377   1.00   53.16  ? 652  GLN A NE2 1 
ATOM   195  N N   . LEU A 1 50  ? 46.002 -16.850 -1.762  1.00   37.31  ? 653  LEU A N   1 
ATOM   196  C CA  . LEU A 1 50  ? 45.438 -18.151 -1.438  1.00   32.71  ? 653  LEU A CA  1 
ATOM   197  C C   . LEU A 1 50  ? 46.301 -19.256 -2.041  1.00   32.52  ? 653  LEU A C   1 
ATOM   198  O O   . LEU A 1 50  ? 46.835 -19.121 -3.138  1.00   33.88  ? 653  LEU A O   1 
ATOM   199  C CB  . LEU A 1 50  ? 43.997 -18.257 -1.935  1.00   30.29  ? 653  LEU A CB  1 
ATOM   200  C CG  . LEU A 1 50  ? 43.275 -19.570 -1.625  1.00   33.05  ? 653  LEU A CG  1 
ATOM   201  C CD1 . LEU A 1 50  ? 43.070 -19.721 -0.134  1.00   27.32  ? 653  LEU A CD1 1 
ATOM   202  C CD2 . LEU A 1 50  ? 41.938 -19.649 -2.362  1.00   33.81  ? 653  LEU A CD2 1 
ATOM   203  N N   . TYR A 1 51  ? 46.462 -20.348 -1.315  1.00   33.68  ? 654  TYR A N   1 
ATOM   204  C CA  . TYR A 1 51  ? 47.257 -21.434 -1.846  1.00   33.87  ? 654  TYR A CA  1 
ATOM   205  C C   . TYR A 1 51  ? 46.585 -22.073 -3.065  1.00   37.19  ? 654  TYR A C   1 
ATOM   206  O O   . TYR A 1 51  ? 45.346 -22.096 -3.187  1.00   32.06  ? 654  TYR A O   1 
ATOM   207  C CB  . TYR A 1 51  ? 47.536 -22.478 -0.772  1.00   28.99  ? 654  TYR A CB  1 
ATOM   208  C CG  . TYR A 1 51  ? 46.341 -23.095 -0.063  1.00   32.55  ? 654  TYR A CG  1 
ATOM   209  C CD1 . TYR A 1 51  ? 45.530 -24.039 -0.697  1.00   30.25  ? 654  TYR A CD1 1 
ATOM   210  C CD2 . TYR A 1 51  ? 46.091 -22.809 1.277   1.00   30.61  ? 654  TYR A CD2 1 
ATOM   211  C CE1 . TYR A 1 51  ? 44.465 -24.629 -0.028  1.00   33.55  ? 654  TYR A CE1 1 
ATOM   212  C CE2 . TYR A 1 51  ? 45.040 -23.397 1.958   1.00   30.73  ? 654  TYR A CE2 1 
ATOM   213  C CZ  . TYR A 1 51  ? 44.227 -24.306 1.314   1.00   37.07  ? 654  TYR A CZ  1 
ATOM   214  O OH  . TYR A 1 51  ? 43.177 -24.876 2.007   1.00   28.70  ? 654  TYR A OH  1 
ATOM   215  N N   . ARG A 1 52  ? 47.417 -22.571 -3.971  1.00   33.89  ? 655  ARG A N   1 
ATOM   216  C CA  . ARG A 1 52  ? 46.926 -23.237 -5.167  1.00   35.35  ? 655  ARG A CA  1 
ATOM   217  C C   . ARG A 1 52  ? 46.776 -24.733 -4.897  1.00   36.97  ? 655  ARG A C   1 
ATOM   218  O O   . ARG A 1 52  ? 45.802 -25.343 -5.348  1.00   37.44  ? 655  ARG A O   1 
ATOM   219  C CB  . ARG A 1 52  ? 47.848 -22.942 -6.348  1.00   33.76  ? 655  ARG A CB  1 
ATOM   220  C CG  . ARG A 1 52  ? 47.709 -21.488 -6.787  1.00   39.00  ? 655  ARG A CG  1 
ATOM   221  C CD  . ARG A 1 52  ? 49.003 -20.856 -7.258  1.00   51.13  ? 655  ARG A CD  1 
ATOM   222  N NE  . ARG A 1 52  ? 49.120 -20.855 -8.718  1.00   62.08  ? 655  ARG A NE  1 
ATOM   223  C CZ  . ARG A 1 52  ? 49.907 -21.676 -9.409  1.00   62.83  ? 655  ARG A CZ  1 
ATOM   224  N NH1 . ARG A 1 52  ? 50.662 -22.572 -8.779  1.00   64.41  ? 655  ARG A NH1 1 
ATOM   225  N NH2 . ARG A 1 52  ? 49.950 -21.596 -10.730 1.00   60.79  ? 655  ARG A NH2 1 
ATOM   226  N N   . LYS A 1 53  ? 47.712 -25.307 -4.139  1.00   30.40  ? 656  LYS A N   1 
ATOM   227  C CA  . LYS A 1 53  ? 47.566 -26.674 -3.636  1.00   28.57  ? 656  LYS A CA  1 
ATOM   228  C C   . LYS A 1 53  ? 47.397 -26.684 -2.114  1.00   34.59  ? 656  LYS A C   1 
ATOM   229  O O   . LYS A 1 53  ? 48.098 -25.962 -1.393  1.00   33.46  ? 656  LYS A O   1 
ATOM   230  C CB  . LYS A 1 53  ? 48.772 -27.540 -3.996  1.00   30.73  ? 656  LYS A CB  1 
ATOM   231  C CG  . LYS A 1 53  ? 49.138 -27.603 -5.443  1.00   41.83  ? 656  LYS A CG  1 
ATOM   232  C CD  . LYS A 1 53  ? 50.208 -28.666 -5.662  1.00   49.74  ? 656  LYS A CD  1 
ATOM   233  C CE  . LYS A 1 53  ? 51.144 -28.304 -6.820  1.00   46.03  ? 656  LYS A CE  1 
ATOM   234  N NZ  . LYS A 1 53  ? 50.434 -28.322 -8.129  1.00   59.25  ? 656  LYS A NZ  1 
ATOM   235  N N   . LYS A 1 54  ? 46.479 -27.510 -1.620  1.00   34.26  ? 657  LYS A N   1 
ATOM   236  C CA  . LYS A 1 54  ? 46.307 -27.608 -0.185  1.00   34.15  ? 657  LYS A CA  1 
ATOM   237  C C   . LYS A 1 54  ? 47.610 -28.081 0.441   1.00   34.79  ? 657  LYS A C   1 
ATOM   238  O O   . LYS A 1 54  ? 48.132 -29.136 0.068   1.00   37.65  ? 657  LYS A O   1 
ATOM   239  C CB  . LYS A 1 54  ? 45.165 -28.550 0.207   1.00   31.84  ? 657  LYS A CB  1 
ATOM   240  C CG  . LYS A 1 54  ? 44.795 -28.328 1.672   1.00   34.08  ? 657  LYS A CG  1 
ATOM   241  C CD  . LYS A 1 54  ? 43.970 -29.436 2.259   1.00   38.44  ? 657  LYS A CD  1 
ATOM   242  C CE  . LYS A 1 54  ? 43.616 -29.084 3.695   1.00   38.87  ? 657  LYS A CE  1 
ATOM   243  N NZ  . LYS A 1 54  ? 44.815 -28.508 4.346   1.00   41.88  ? 657  LYS A NZ  1 
ATOM   244  N N   . PRO A 1 55  ? 48.151 -27.281 1.375   1.00   37.46  ? 658  PRO A N   1 
ATOM   245  C CA  . PRO A 1 55  ? 49.395 -27.657 2.047   1.00   33.90  ? 658  PRO A CA  1 
ATOM   246  C C   . PRO A 1 55  ? 49.292 -29.053 2.655   1.00   36.06  ? 658  PRO A C   1 
ATOM   247  O O   . PRO A 1 55  ? 48.345 -29.362 3.389   1.00   33.68  ? 658  PRO A O   1 
ATOM   248  C CB  . PRO A 1 55  ? 49.545 -26.574 3.117   1.00   33.86  ? 658  PRO A CB  1 
ATOM   249  C CG  . PRO A 1 55  ? 48.848 -25.379 2.512   1.00   33.96  ? 658  PRO A CG  1 
ATOM   250  C CD  . PRO A 1 55  ? 47.663 -25.957 1.812   1.00   31.63  ? 658  PRO A CD  1 
ATOM   251  N N   . GLY A 1 56  ? 50.239 -29.907 2.290   1.00   33.16  ? 659  GLY A N   1 
ATOM   252  C CA  . GLY A 1 56  ? 50.339 -31.222 2.880   1.00   39.24  ? 659  GLY A CA  1 
ATOM   253  C C   . GLY A 1 56  ? 49.559 -32.371 2.268   1.00   41.62  ? 659  GLY A C   1 
ATOM   254  O O   . GLY A 1 56  ? 49.667 -33.496 2.754   1.00   46.52  ? 659  GLY A O   1 
ATOM   255  N N   . LEU A 1 57  ? 48.767 -32.121 1.231   1.00   36.56  ? 660  LEU A N   1 
ATOM   256  C CA  . LEU A 1 57  ? 48.005 -33.208 0.607   1.00   34.96  ? 660  LEU A CA  1 
ATOM   257  C C   . LEU A 1 57  ? 48.846 -33.953 -0.416  1.00   36.12  ? 660  LEU A C   1 
ATOM   258  O O   . LEU A 1 57  ? 49.350 -33.350 -1.367  1.00   32.94  ? 660  LEU A O   1 
ATOM   259  C CB  . LEU A 1 57  ? 46.741 -32.681 -0.059  1.00   32.87  ? 660  LEU A CB  1 
ATOM   260  C CG  . LEU A 1 57  ? 45.420 -32.856 0.669   1.00   31.88  ? 660  LEU A CG  1 
ATOM   261  C CD1 . LEU A 1 57  ? 44.267 -32.521 -0.268  1.00   30.90  ? 660  LEU A CD1 1 
ATOM   262  C CD2 . LEU A 1 57  ? 45.301 -34.273 1.196   1.00   36.45  ? 660  LEU A CD2 1 
ATOM   263  N N   . ALA A 1 58  ? 48.988 -35.262 -0.222  1.00   38.45  ? 661  ALA A N   1 
ATOM   264  C CA  . ALA A 1 58  ? 49.808 -36.089 -1.112  1.00   41.03  ? 661  ALA A CA  1 
ATOM   265  C C   . ALA A 1 58  ? 49.317 -36.115 -2.577  1.00   45.17  ? 661  ALA A C   1 
ATOM   266  O O   . ALA A 1 58  ? 48.117 -36.239 -2.865  1.00   36.62  ? 661  ALA A O   1 
ATOM   267  C CB  . ALA A 1 58  ? 49.888 -37.519 -0.574  1.00   37.93  ? 661  ALA A CB  1 
ATOM   268  N N   . ILE A 1 59  ? 50.271 -36.006 -3.495  1.00   41.47  ? 662  ILE A N   1 
ATOM   269  C CA  . ILE A 1 59  ? 50.028 -36.274 -4.904  1.00   41.79  ? 662  ILE A CA  1 
ATOM   270  C C   . ILE A 1 59  ? 51.039 -37.319 -5.379  1.00   41.94  ? 662  ILE A C   1 
ATOM   271  O O   . ILE A 1 59  ? 52.135 -36.974 -5.817  1.00   35.27  ? 662  ILE A O   1 
ATOM   272  C CB  . ILE A 1 59  ? 50.125 -34.992 -5.748  1.00   37.42  ? 662  ILE A CB  1 
ATOM   273  C CG1 . ILE A 1 59  ? 49.016 -34.017 -5.333  1.00   38.82  ? 662  ILE A CG1 1 
ATOM   274  C CG2 . ILE A 1 59  ? 49.995 -35.317 -7.222  1.00   41.02  ? 662  ILE A CG2 1 
ATOM   275  C CD1 . ILE A 1 59  ? 49.226 -32.577 -5.808  1.00   37.40  ? 662  ILE A CD1 1 
ATOM   276  N N   . THR A 1 60  ? 50.676 -38.597 -5.260  1.00   41.91  ? 663  THR A N   1 
ATOM   277  C CA  . THR A 1 60  ? 51.604 -39.685 -5.602  1.00   42.26  ? 663  THR A CA  1 
ATOM   278  C C   . THR A 1 60  ? 51.171 -40.562 -6.780  1.00   38.43  ? 663  THR A C   1 
ATOM   279  O O   . THR A 1 60  ? 51.932 -40.721 -7.734  1.00   44.81  ? 663  THR A O   1 
ATOM   280  C CB  . THR A 1 60  ? 51.869 -40.627 -4.374  1.00   45.47  ? 663  THR A CB  1 
ATOM   281  O OG1 . THR A 1 60  ? 50.704 -41.412 -4.069  1.00   44.91  ? 663  THR A OG1 1 
ATOM   282  C CG2 . THR A 1 60  ? 52.264 -39.817 -3.168  1.00   45.36  ? 663  THR A CG2 1 
ATOM   283  N N   . PHE A 1 61  ? 49.975 -41.145 -6.707  1.00   37.44  ? 664  PHE A N   1 
ATOM   284  C CA  . PHE A 1 61  ? 49.502 -42.035 -7.761  1.00   40.69  ? 664  PHE A CA  1 
ATOM   285  C C   . PHE A 1 61  ? 49.627 -41.431 -9.144  1.00   39.00  ? 664  PHE A C   1 
ATOM   286  O O   . PHE A 1 61  ? 49.960 -42.132 -10.083 1.00   42.66  ? 664  PHE A O   1 
ATOM   287  C CB  . PHE A 1 61  ? 48.049 -42.431 -7.533  1.00   43.34  ? 664  PHE A CB  1 
ATOM   288  C CG  . PHE A 1 61  ? 47.875 -43.468 -6.488  1.00   45.30  ? 664  PHE A CG  1 
ATOM   289  C CD1 . PHE A 1 61  ? 47.722 -43.106 -5.158  1.00   51.15  ? 664  PHE A CD1 1 
ATOM   290  C CD2 . PHE A 1 61  ? 47.883 -44.809 -6.825  1.00   48.33  ? 664  PHE A CD2 1 
ATOM   291  C CE1 . PHE A 1 61  ? 47.574 -44.073 -4.171  1.00   57.34  ? 664  PHE A CE1 1 
ATOM   292  C CE2 . PHE A 1 61  ? 47.731 -45.788 -5.847  1.00   55.59  ? 664  PHE A CE2 1 
ATOM   293  C CZ  . PHE A 1 61  ? 47.581 -45.420 -4.516  1.00   54.81  ? 664  PHE A CZ  1 
ATOM   294  N N   . ALA A 1 62  ? 49.361 -40.132 -9.258  1.00   36.93  ? 665  ALA A N   1 
ATOM   295  C CA  . ALA A 1 62  ? 49.336 -39.458 -10.556 1.00   38.03  ? 665  ALA A CA  1 
ATOM   296  C C   . ALA A 1 62  ? 50.716 -39.377 -11.182 1.00   38.07  ? 665  ALA A C   1 
ATOM   297  O O   . ALA A 1 62  ? 50.834 -39.162 -12.382 1.00   36.05  ? 665  ALA A O   1 
ATOM   298  C CB  . ALA A 1 62  ? 48.747 -38.062 -10.426 1.00   33.59  ? 665  ALA A CB  1 
ATOM   299  N N   . LYS A 1 63  ? 51.756 -39.547 -10.368 1.00   41.47  ? 666  LYS A N   1 
ATOM   300  C CA  . LYS A 1 63  ? 53.121 -39.458 -10.875 1.00   44.23  ? 666  LYS A CA  1 
ATOM   301  C C   . LYS A 1 63  ? 53.824 -40.824 -10.900 1.00   44.60  ? 666  LYS A C   1 
ATOM   302  O O   . LYS A 1 63  ? 55.020 -40.887 -11.168 1.00   42.74  ? 666  LYS A O   1 
ATOM   303  C CB  . LYS A 1 63  ? 53.963 -38.472 -10.052 1.00   47.29  ? 666  LYS A CB  1 
ATOM   304  C CG  . LYS A 1 63  ? 53.267 -37.191 -9.578  1.00   49.87  ? 666  LYS A CG  1 
ATOM   305  C CD  . LYS A 1 63  ? 54.307 -36.118 -9.219  1.00   49.37  ? 666  LYS A CD  1 
ATOM   306  C CE  . LYS A 1 63  ? 53.714 -34.933 -8.439  1.00   58.91  ? 666  LYS A CE  1 
ATOM   307  N NZ  . LYS A 1 63  ? 53.526 -35.159 -6.945  1.00   43.06  ? 666  LYS A NZ  1 
ATOM   308  N N   . LEU A 1 64  ? 53.098 -41.906 -10.611 1.00   43.16  ? 667  LEU A N   1 
ATOM   309  C CA  . LEU A 1 64  ? 53.646 -43.245 -10.812 1.00   39.52  ? 667  LEU A CA  1 
ATOM   310  C C   . LEU A 1 64  ? 53.942 -43.427 -12.298 1.00   46.28  ? 667  LEU A C   1 
ATOM   311  O O   . LEU A 1 64  ? 53.257 -42.845 -13.139 1.00   46.31  ? 667  LEU A O   1 
ATOM   312  C CB  . LEU A 1 64  ? 52.687 -44.321 -10.314 1.00   41.33  ? 667  LEU A CB  1 
ATOM   313  C CG  . LEU A 1 64  ? 52.395 -44.310 -8.810  1.00   45.95  ? 667  LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 64  ? 51.310 -45.320 -8.446  1.00   43.34  ? 667  LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 64  ? 53.659 -44.575 -7.999  1.00   38.95  ? 667  LEU A CD2 1 
ATOM   316  N N   . PRO A 1 65  ? 54.999 -44.193 -12.629 1.00   47.96  ? 668  PRO A N   1 
ATOM   317  C CA  . PRO A 1 65  ? 55.357 -44.440 -14.034 1.00   45.30  ? 668  PRO A CA  1 
ATOM   318  C C   . PRO A 1 65  ? 54.198 -44.936 -14.915 1.00   43.47  ? 668  PRO A C   1 
ATOM   319  O O   . PRO A 1 65  ? 54.045 -44.441 -16.026 1.00   39.84  ? 668  PRO A O   1 
ATOM   320  C CB  . PRO A 1 65  ? 56.449 -45.500 -13.919 1.00   41.20  ? 668  PRO A CB  1 
ATOM   321  C CG  . PRO A 1 65  ? 57.141 -45.136 -12.643 1.00   45.53  ? 668  PRO A CG  1 
ATOM   322  C CD  . PRO A 1 65  ? 56.042 -44.683 -11.708 1.00   40.86  ? 668  PRO A CD  1 
ATOM   323  N N   . GLN A 1 66  ? 53.377 -45.867 -14.439 1.00   44.25  ? 669  GLN A N   1 
ATOM   324  C CA  . GLN A 1 66  ? 52.312 -46.390 -15.299 1.00   47.13  ? 669  GLN A CA  1 
ATOM   325  C C   . GLN A 1 66  ? 51.178 -45.386 -15.523 1.00   46.81  ? 669  GLN A C   1 
ATOM   326  O O   . GLN A 1 66  ? 50.289 -45.632 -16.339 1.00   48.22  ? 669  GLN A O   1 
ATOM   327  C CB  . GLN A 1 66  ? 51.737 -47.690 -14.735 1.00   44.88  ? 669  GLN A CB  1 
ATOM   328  C CG  . GLN A 1 66  ? 51.024 -47.543 -13.403 1.00   50.59  ? 669  GLN A CG  1 
ATOM   329  C CD  . GLN A 1 66  ? 51.946 -47.760 -12.218 1.00   56.51  ? 669  GLN A CD  1 
ATOM   330  O OE1 . GLN A 1 66  ? 53.124 -47.369 -12.238 1.00   56.45  ? 669  GLN A OE1 1 
ATOM   331  N NE2 . GLN A 1 66  ? 51.417 -48.394 -11.176 1.00   55.76  ? 669  GLN A NE2 1 
ATOM   332  N N   . ASN A 1 67  ? 51.225 -44.249 -14.829 1.00   43.79  ? 670  ASN A N   1 
ATOM   333  C CA  . ASN A 1 67  ? 50.130 -43.278 -14.871 1.00   41.68  ? 670  ASN A CA  1 
ATOM   334  C C   . ASN A 1 67  ? 50.472 -41.950 -15.534 1.00   40.45  ? 670  ASN A C   1 
ATOM   335  O O   . ASN A 1 67  ? 49.573 -41.224 -15.947 1.00   42.71  ? 670  ASN A O   1 
ATOM   336  C CB  . ASN A 1 67  ? 49.620 -43.006 -13.454 1.00   36.93  ? 670  ASN A CB  1 
ATOM   337  C CG  . ASN A 1 67  ? 48.939 -44.212 -12.846 1.00   38.69  ? 670  ASN A CG  1 
ATOM   338  O OD1 . ASN A 1 67  ? 48.385 -45.031 -13.559 1.00   38.90  ? 670  ASN A OD1 1 
ATOM   339  N ND2 . ASN A 1 67  ? 48.979 -44.326 -11.523 1.00   41.21  ? 670  ASN A ND2 1 
ATOM   340  N N   . LEU A 1 68  ? 51.760 -41.638 -15.637 1.00   36.47  ? 671  LEU A N   1 
ATOM   341  C CA  . LEU A 1 68  ? 52.202 -40.318 -16.082 1.00   37.32  ? 671  LEU A CA  1 
ATOM   342  C C   . LEU A 1 68  ? 51.527 -39.835 -17.376 1.00   39.55  ? 671  LEU A C   1 
ATOM   343  O O   . LEU A 1 68  ? 51.006 -38.718 -17.420 1.00   40.14  ? 671  LEU A O   1 
ATOM   344  C CB  . LEU A 1 68  ? 53.732 -40.303 -16.229 1.00   39.96  ? 671  LEU A CB  1 
ATOM   345  C CG  . LEU A 1 68  ? 54.427 -40.313 -14.846 1.00   58.32  ? 671  LEU A CG  1 
ATOM   346  C CD1 . LEU A 1 68  ? 55.855 -40.919 -14.829 1.00   48.34  ? 671  LEU A CD1 1 
ATOM   347  C CD2 . LEU A 1 68  ? 54.431 -38.913 -14.222 1.00   45.97  ? 671  LEU A CD2 1 
ATOM   348  N N   . ASP A 1 69  ? 51.489 -40.669 -18.412 1.00   40.99  ? 672  ASP A N   1 
ATOM   349  C CA  . ASP A 1 69  ? 50.963 -40.193 -19.690 1.00   45.98  ? 672  ASP A CA  1 
ATOM   350  C C   . ASP A 1 69  ? 49.424 -40.181 -19.746 1.00   46.17  ? 672  ASP A C   1 
ATOM   351  O O   . ASP A 1 69  ? 48.841 -39.916 -20.800 1.00   41.88  ? 672  ASP A O   1 
ATOM   352  C CB  . ASP A 1 69  ? 51.529 -41.017 -20.856 1.00   39.55  ? 672  ASP A CB  1 
ATOM   353  C CG  . ASP A 1 69  ? 51.093 -42.469 -20.830 1.00   49.60  ? 672  ASP A CG  1 
ATOM   354  O OD1 . ASP A 1 69  ? 50.074 -42.805 -20.179 1.00   51.58  ? 672  ASP A OD1 1 
ATOM   355  O OD2 . ASP A 1 69  ? 51.785 -43.286 -21.478 1.00   59.12  ? 672  ASP A OD2 1 
ATOM   356  N N   . LYS A 1 70  ? 48.771 -40.470 -18.622 1.00   41.50  ? 673  LYS A N   1 
ATOM   357  C CA  . LYS A 1 70  ? 47.316 -40.338 -18.569 1.00   41.40  ? 673  LYS A CA  1 
ATOM   358  C C   . LYS A 1 70  ? 46.928 -38.920 -18.121 1.00   37.34  ? 673  LYS A C   1 
ATOM   359  O O   . LYS A 1 70  ? 45.754 -38.573 -18.035 1.00   37.00  ? 673  LYS A O   1 
ATOM   360  C CB  . LYS A 1 70  ? 46.708 -41.398 -17.651 1.00   36.31  ? 673  LYS A CB  1 
ATOM   361  C CG  . LYS A 1 70  ? 47.125 -42.812 -18.007 1.00   38.88  ? 673  LYS A CG  1 
ATOM   362  C CD  . LYS A 1 70  ? 46.294 -43.830 -17.265 1.00   43.46  ? 673  LYS A CD  1 
ATOM   363  C CE  . LYS A 1 70  ? 47.158 -44.764 -16.453 1.00   43.49  ? 673  LYS A CE  1 
ATOM   364  N NZ  . LYS A 1 70  ? 47.670 -45.888 -17.262 1.00   48.94  ? 673  LYS A NZ  1 
ATOM   365  N N   . ASN A 1 71  ? 47.930 -38.097 -17.856 1.00   36.74  ? 674  ASN A N   1 
ATOM   366  C CA  . ASN A 1 71  ? 47.693 -36.693 -17.574 1.00   35.07  ? 674  ASN A CA  1 
ATOM   367  C C   . ASN A 1 71  ? 47.931 -35.838 -18.827 1.00   36.13  ? 674  ASN A C   1 
ATOM   368  O O   . ASN A 1 71  ? 48.927 -35.990 -19.519 1.00   35.14  ? 674  ASN A O   1 
ATOM   369  C CB  . ASN A 1 71  ? 48.586 -36.234 -16.420 1.00   28.32  ? 674  ASN A CB  1 
ATOM   370  C CG  . ASN A 1 71  ? 48.406 -37.085 -15.175 1.00   34.18  ? 674  ASN A CG  1 
ATOM   371  O OD1 . ASN A 1 71  ? 47.294 -37.271 -14.696 1.00   34.43  ? 674  ASN A OD1 1 
ATOM   372  N ND2 . ASN A 1 71  ? 49.499 -37.615 -14.656 1.00   34.42  ? 674  ASN A ND2 1 
ATOM   373  N N   . ARG A 1 72  ? 47.011 -34.936 -19.113 1.00   30.90  ? 675  ARG A N   1 
ATOM   374  C CA  . ARG A 1 72  ? 47.179 -34.032 -20.233 1.00   34.29  ? 675  ARG A CA  1 
ATOM   375  C C   . ARG A 1 72  ? 48.222 -32.957 -19.895 1.00   37.15  ? 675  ARG A C   1 
ATOM   376  O O   . ARG A 1 72  ? 49.003 -32.543 -20.741 1.00   39.20  ? 675  ARG A O   1 
ATOM   377  C CB  . ARG A 1 72  ? 45.824 -33.412 -20.606 1.00   31.24  ? 675  ARG A CB  1 
ATOM   378  C CG  . ARG A 1 72  ? 45.875 -32.193 -21.487 1.00   31.61  ? 675  ARG A CG  1 
ATOM   379  C CD  . ARG A 1 72  ? 44.474 -31.755 -21.947 1.00   30.68  ? 675  ARG A CD  1 
ATOM   380  N NE  . ARG A 1 72  ? 43.769 -32.813 -22.667 1.00   30.31  ? 675  ARG A NE  1 
ATOM   381  C CZ  . ARG A 1 72  ? 43.894 -33.060 -23.969 1.00   33.60  ? 675  ARG A CZ  1 
ATOM   382  N NH1 . ARG A 1 72  ? 44.703 -32.317 -24.727 1.00   31.14  ? 675  ARG A NH1 1 
ATOM   383  N NH2 . ARG A 1 72  ? 43.206 -34.054 -24.512 1.00   28.08  ? 675  ARG A NH2 1 
ATOM   384  N N   . TYR A 1 73  ? 48.241 -32.508 -18.648 1.00   35.84  ? 676  TYR A N   1 
ATOM   385  C CA  . TYR A 1 73  ? 49.182 -31.468 -18.249 1.00   37.99  ? 676  TYR A CA  1 
ATOM   386  C C   . TYR A 1 73  ? 50.027 -31.961 -17.095 1.00   38.16  ? 676  TYR A C   1 
ATOM   387  O O   . TYR A 1 73  ? 49.496 -32.529 -16.143 1.00   36.73  ? 676  TYR A O   1 
ATOM   388  C CB  . TYR A 1 73  ? 48.445 -30.183 -17.871 1.00   33.46  ? 676  TYR A CB  1 
ATOM   389  C CG  . TYR A 1 73  ? 47.693 -29.583 -19.018 1.00   35.87  ? 676  TYR A CG  1 
ATOM   390  C CD1 . TYR A 1 73  ? 48.377 -28.982 -20.071 1.00   38.66  ? 676  TYR A CD1 1 
ATOM   391  C CD2 . TYR A 1 73  ? 46.301 -29.621 -19.069 1.00   35.15  ? 676  TYR A CD2 1 
ATOM   392  C CE1 . TYR A 1 73  ? 47.699 -28.420 -21.147 1.00   39.00  ? 676  TYR A CE1 1 
ATOM   393  C CE2 . TYR A 1 73  ? 45.604 -29.062 -20.149 1.00   29.65  ? 676  TYR A CE2 1 
ATOM   394  C CZ  . TYR A 1 73  ? 46.314 -28.465 -21.187 1.00   36.76  ? 676  TYR A CZ  1 
ATOM   395  O OH  . TYR A 1 73  ? 45.658 -27.891 -22.268 1.00   33.38  ? 676  TYR A OH  1 
ATOM   396  N N   . LYS A 1 74  ? 51.339 -31.752 -17.180 1.00   38.88  ? 677  LYS A N   1 
ATOM   397  C CA  . LYS A 1 74  ? 52.243 -32.274 -16.161 1.00   35.84  ? 677  LYS A CA  1 
ATOM   398  C C   . LYS A 1 74  ? 51.993 -31.635 -14.801 1.00   37.17  ? 677  LYS A C   1 
ATOM   399  O O   . LYS A 1 74  ? 52.283 -32.248 -13.778 1.00   40.51  ? 677  LYS A O   1 
ATOM   400  C CB  . LYS A 1 74  ? 53.702 -32.087 -16.575 1.00   36.43  ? 677  LYS A CB  1 
ATOM   401  C CG  . LYS A 1 74  ? 53.991 -30.783 -17.280 1.00   44.24  ? 677  LYS A CG  1 
ATOM   402  C CD  . LYS A 1 74  ? 55.483 -30.568 -17.397 1.00   44.96  ? 677  LYS A CD  1 
ATOM   403  C CE  . LYS A 1 74  ? 55.811 -29.123 -17.701 1.00   58.61  ? 677  LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 74  ? 57.254 -28.826 -17.428 1.00   60.93  ? 677  LYS A NZ  1 
ATOM   405  N N   . ASP A 1 75  ? 51.424 -30.430 -14.789 1.00   35.31  ? 678  ASP A N   1 
ATOM   406  C CA  . ASP A 1 75  ? 51.216 -29.689 -13.553 1.00   33.04  ? 678  ASP A CA  1 
ATOM   407  C C   . ASP A 1 75  ? 49.772 -29.674 -13.019 1.00   35.43  ? 678  ASP A C   1 
ATOM   408  O O   . ASP A 1 75  ? 49.467 -28.969 -12.064 1.00   40.30  ? 678  ASP A O   1 
ATOM   409  C CB  . ASP A 1 75  ? 51.707 -28.245 -13.723 1.00   35.94  ? 678  ASP A CB  1 
ATOM   410  C CG  . ASP A 1 75  ? 51.139 -27.558 -14.963 1.00   54.62  ? 678  ASP A CG  1 
ATOM   411  O OD1 . ASP A 1 75  ? 50.562 -28.235 -15.853 1.00   46.87  ? 678  ASP A OD1 1 
ATOM   412  O OD2 . ASP A 1 75  ? 51.294 -26.319 -15.057 1.00   56.85  ? 678  ASP A OD2 1 
ATOM   413  N N   . VAL A 1 76  ? 48.881 -30.454 -13.600 1.00   37.54  ? 679  VAL A N   1 
ATOM   414  C CA  . VAL A 1 76  ? 47.514 -30.475 -13.099 1.00   31.66  ? 679  VAL A CA  1 
ATOM   415  C C   . VAL A 1 76  ? 47.165 -31.906 -12.735 1.00   31.39  ? 679  VAL A C   1 
ATOM   416  O O   . VAL A 1 76  ? 46.735 -32.701 -13.578 1.00   34.40  ? 679  VAL A O   1 
ATOM   417  C CB  . VAL A 1 76  ? 46.517 -29.903 -14.132 1.00   30.43  ? 679  VAL A CB  1 
ATOM   418  C CG1 . VAL A 1 76  ? 45.119 -29.821 -13.541 1.00   28.36  ? 679  VAL A CG1 1 
ATOM   419  C CG2 . VAL A 1 76  ? 46.976 -28.529 -14.601 1.00   31.37  ? 679  VAL A CG2 1 
ATOM   420  N N   . LEU A 1 77  ? 47.380 -32.246 -11.473 1.00   31.83  ? 680  LEU A N   1 
ATOM   421  C CA  . LEU A 1 77  ? 47.244 -33.625 -11.032 1.00   29.73  ? 680  LEU A CA  1 
ATOM   422  C C   . LEU A 1 77  ? 46.292 -33.712 -9.862  1.00   33.36  ? 680  LEU A C   1 
ATOM   423  O O   . LEU A 1 77  ? 46.223 -32.789 -9.051  1.00   36.75  ? 680  LEU A O   1 
ATOM   424  C CB  . LEU A 1 77  ? 48.616 -34.194 -10.653 1.00   33.64  ? 680  LEU A CB  1 
ATOM   425  C CG  . LEU A 1 77  ? 49.774 -33.909 -11.626 1.00   39.62  ? 680  LEU A CG  1 
ATOM   426  C CD1 . LEU A 1 77  ? 51.082 -34.486 -11.087 1.00   39.44  ? 680  LEU A CD1 1 
ATOM   427  C CD2 . LEU A 1 77  ? 49.491 -34.446 -13.033 1.00   32.10  ? 680  LEU A CD2 1 
ATOM   428  N N   . PRO A 1 78  ? 45.547 -34.820 -9.762  1.00   31.95  ? 681  PRO A N   1 
ATOM   429  C CA  . PRO A 1 78  ? 44.616 -35.045 -8.648  1.00   26.92  ? 681  PRO A CA  1 
ATOM   430  C C   . PRO A 1 78  ? 45.321 -35.410 -7.348  1.00   30.69  ? 681  PRO A C   1 
ATOM   431  O O   . PRO A 1 78  ? 46.381 -36.040 -7.367  1.00   31.18  ? 681  PRO A O   1 
ATOM   432  C CB  . PRO A 1 78  ? 43.775 -36.229 -9.136  1.00   30.43  ? 681  PRO A CB  1 
ATOM   433  C CG  . PRO A 1 78  ? 44.700 -36.994 -10.013 1.00   31.57  ? 681  PRO A CG  1 
ATOM   434  C CD  . PRO A 1 78  ? 45.572 -35.958 -10.696 1.00   27.57  ? 681  PRO A CD  1 
ATOM   435  N N   . TYR A 1 79  ? 44.727 -35.016 -6.225  1.00   36.23  ? 682  TYR A N   1 
ATOM   436  C CA  . TYR A 1 79  ? 45.173 -35.473 -4.913  1.00   29.79  ? 682  TYR A CA  1 
ATOM   437  C C   . TYR A 1 79  ? 44.849 -36.961 -4.756  1.00   36.74  ? 682  TYR A C   1 
ATOM   438  O O   . TYR A 1 79  ? 43.830 -37.428 -5.283  1.00   40.61  ? 682  TYR A O   1 
ATOM   439  C CB  . TYR A 1 79  ? 44.486 -34.692 -3.799  1.00   30.45  ? 682  TYR A CB  1 
ATOM   440  C CG  . TYR A 1 79  ? 44.611 -33.178 -3.803  1.00   33.09  ? 682  TYR A CG  1 
ATOM   441  C CD1 . TYR A 1 79  ? 45.860 -32.558 -3.715  1.00   31.30  ? 682  TYR A CD1 1 
ATOM   442  C CD2 . TYR A 1 79  ? 43.470 -32.365 -3.793  1.00   27.61  ? 682  TYR A CD2 1 
ATOM   443  C CE1 . TYR A 1 79  ? 45.975 -31.176 -3.673  1.00   26.55  ? 682  TYR A CE1 1 
ATOM   444  C CE2 . TYR A 1 79  ? 43.575 -30.974 -3.740  1.00   25.27  ? 682  TYR A CE2 1 
ATOM   445  C CZ  . TYR A 1 79  ? 44.836 -30.388 -3.678  1.00   29.17  ? 682  TYR A CZ  1 
ATOM   446  O OH  . TYR A 1 79  ? 44.968 -29.017 -3.632  1.00   24.91  ? 682  TYR A OH  1 
ATOM   447  N N   . ASP A 1 80  ? 45.684 -37.713 -4.038  1.00   34.66  ? 683  ASP A N   1 
ATOM   448  C CA  . ASP A 1 80  ? 45.389 -39.138 -3.805  1.00   35.72  ? 683  ASP A CA  1 
ATOM   449  C C   . ASP A 1 80  ? 44.056 -39.343 -3.107  1.00   34.00  ? 683  ASP A C   1 
ATOM   450  O O   . ASP A 1 80  ? 43.295 -40.243 -3.464  1.00   37.17  ? 683  ASP A O   1 
ATOM   451  C CB  . ASP A 1 80  ? 46.488 -39.816 -2.979  1.00   33.80  ? 683  ASP A CB  1 
ATOM   452  C CG  . ASP A 1 80  ? 47.840 -39.763 -3.654  1.00   41.62  ? 683  ASP A CG  1 
ATOM   453  O OD1 . ASP A 1 80  ? 47.896 -39.618 -4.894  1.00   45.99  ? 683  ASP A OD1 1 
ATOM   454  O OD2 . ASP A 1 80  ? 48.857 -39.861 -2.949  1.00   45.94  ? 683  ASP A OD2 1 
ATOM   455  N N   . THR A 1 81  ? 43.778 -38.496 -2.118  1.00   32.43  ? 684  THR A N   1 
ATOM   456  C CA  . THR A 1 81  ? 42.588 -38.632 -1.282  1.00   32.50  ? 684  THR A CA  1 
ATOM   457  C C   . THR A 1 81  ? 41.264 -38.434 -2.017  1.00   34.89  ? 684  THR A C   1 
ATOM   458  O O   . THR A 1 81  ? 40.251 -39.008 -1.644  1.00   40.49  ? 684  THR A O   1 
ATOM   459  C CB  . THR A 1 81  ? 42.629 -37.638 -0.103  1.00   39.00  ? 684  THR A CB  1 
ATOM   460  O OG1 . THR A 1 81  ? 43.004 -36.341 -0.585  1.00   39.58  ? 684  THR A OG1 1 
ATOM   461  C CG2 . THR A 1 81  ? 43.646 -38.078 0.948   1.00   32.31  ? 684  THR A CG2 1 
ATOM   462  N N   . THR A 1 82  ? 41.256 -37.628 -3.064  1.00   40.60  ? 685  THR A N   1 
ATOM   463  C CA  . THR A 1 82  ? 39.989 -37.284 -3.705  1.00   39.18  ? 685  THR A CA  1 
ATOM   464  C C   . THR A 1 82  ? 39.911 -37.754 -5.160  1.00   35.24  ? 685  THR A C   1 
ATOM   465  O O   . THR A 1 82  ? 38.938 -37.462 -5.884  1.00   33.42  ? 685  THR A O   1 
ATOM   466  C CB  . THR A 1 82  ? 39.754 -35.763 -3.640  1.00   37.68  ? 685  THR A CB  1 
ATOM   467  O OG1 . THR A 1 82  ? 40.752 -35.093 -4.432  1.00   33.94  ? 685  THR A OG1 1 
ATOM   468  C CG2 . THR A 1 82  ? 39.821 -35.274 -2.160  1.00   27.48  ? 685  THR A CG2 1 
ATOM   469  N N   . ARG A 1 83  ? 40.927 -38.486 -5.595  1.00   29.60  ? 686  ARG A N   1 
ATOM   470  C CA  . ARG A 1 83  ? 40.925 -38.926 -6.984  1.00   36.76  ? 686  ARG A CA  1 
ATOM   471  C C   . ARG A 1 83  ? 39.843 -39.977 -7.214  1.00   35.51  ? 686  ARG A C   1 
ATOM   472  O O   . ARG A 1 83  ? 39.457 -40.715 -6.304  1.00   34.74  ? 686  ARG A O   1 
ATOM   473  C CB  . ARG A 1 83  ? 42.287 -39.458 -7.396  1.00   34.30  ? 686  ARG A CB  1 
ATOM   474  C CG  . ARG A 1 83  ? 42.643 -40.793 -6.805  1.00   37.18  ? 686  ARG A CG  1 
ATOM   475  C CD  . ARG A 1 83  ? 44.080 -41.119 -7.163  1.00   36.99  ? 686  ARG A CD  1 
ATOM   476  N NE  . ARG A 1 83  ? 44.406 -42.471 -6.759  1.00   41.96  ? 686  ARG A NE  1 
ATOM   477  C CZ  . ARG A 1 83  ? 44.207 -43.539 -7.517  1.00   41.37  ? 686  ARG A CZ  1 
ATOM   478  N NH1 . ARG A 1 83  ? 43.695 -43.410 -8.739  1.00   38.26  ? 686  ARG A NH1 1 
ATOM   479  N NH2 . ARG A 1 83  ? 44.536 -44.732 -7.053  1.00   38.11  ? 686  ARG A NH2 1 
ATOM   480  N N   . VAL A 1 84  ? 39.324 -40.004 -8.431  1.00   30.93  ? 687  VAL A N   1 
ATOM   481  C CA  . VAL A 1 84  ? 38.242 -40.909 -8.760  1.00   34.20  ? 687  VAL A CA  1 
ATOM   482  C C   . VAL A 1 84  ? 38.839 -42.297 -8.968  1.00   36.02  ? 687  VAL A C   1 
ATOM   483  O O   . VAL A 1 84  ? 39.853 -42.450 -9.655  1.00   35.18  ? 687  VAL A O   1 
ATOM   484  C CB  . VAL A 1 84  ? 37.466 -40.425 -10.002 1.00   32.61  ? 687  VAL A CB  1 
ATOM   485  C CG1 . VAL A 1 84  ? 36.413 -41.442 -10.414 1.00   30.10  ? 687  VAL A CG1 1 
ATOM   486  C CG2 . VAL A 1 84  ? 36.827 -39.056 -9.723  1.00   30.31  ? 687  VAL A CG2 1 
ATOM   487  N N   . LEU A 1 85  ? 38.243 -43.299 -8.331  1.00   35.51  ? 688  LEU A N   1 
ATOM   488  C CA  . LEU A 1 85  ? 38.717 -44.663 -8.484  1.00   39.07  ? 688  LEU A CA  1 
ATOM   489  C C   . LEU A 1 85  ? 37.892 -45.377 -9.522  1.00   44.70  ? 688  LEU A C   1 
ATOM   490  O O   . LEU A 1 85  ? 36.665 -45.400 -9.467  1.00   46.41  ? 688  LEU A O   1 
ATOM   491  C CB  . LEU A 1 85  ? 38.669 -45.413 -7.167  1.00   35.97  ? 688  LEU A CB  1 
ATOM   492  C CG  . LEU A 1 85  ? 39.605 -44.806 -6.137  1.00   41.29  ? 688  LEU A CG  1 
ATOM   493  C CD1 . LEU A 1 85  ? 39.579 -45.643 -4.868  1.00   33.96  ? 688  LEU A CD1 1 
ATOM   494  C CD2 . LEU A 1 85  ? 41.014 -44.681 -6.710  1.00   37.75  ? 688  LEU A CD2 1 
ATOM   495  N N   . LEU A 1 86  ? 38.579 -45.949 -10.489 1.00   53.94  ? 689  LEU A N   1 
ATOM   496  C CA  . LEU A 1 86  ? 37.902 -46.598 -11.590 1.00   63.78  ? 689  LEU A CA  1 
ATOM   497  C C   . LEU A 1 86  ? 37.370 -47.963 -11.184 1.00   72.77  ? 689  LEU A C   1 
ATOM   498  O O   . LEU A 1 86  ? 38.111 -48.762 -10.635 1.00   69.72  ? 689  LEU A O   1 
ATOM   499  C CB  . LEU A 1 86  ? 38.855 -46.724 -12.764 1.00   56.64  ? 689  LEU A CB  1 
ATOM   500  C CG  . LEU A 1 86  ? 38.875 -45.357 -13.420 1.00   51.30  ? 689  LEU A CG  1 
ATOM   501  C CD1 . LEU A 1 86  ? 40.055 -45.182 -14.354 1.00   47.85  ? 689  LEU A CD1 1 
ATOM   502  C CD2 . LEU A 1 86  ? 37.560 -45.241 -14.156 1.00   54.28  ? 689  LEU A CD2 1 
ATOM   503  N N   . GLN A 1 87  ? 36.084 -48.214 -11.436 1.00   75.43  ? 690  GLN A N   1 
ATOM   504  C CA  . GLN A 1 87  ? 35.523 -49.555 -11.280 1.00   83.24  ? 690  GLN A CA  1 
ATOM   505  C C   . GLN A 1 87  ? 35.590 -50.277 -12.633 1.00   86.39  ? 690  GLN A C   1 
ATOM   506  O O   . GLN A 1 87  ? 34.732 -51.112 -12.956 1.00   89.05  ? 690  GLN A O   1 
ATOM   507  C CB  . GLN A 1 87  ? 34.071 -49.535 -10.725 1.00   81.02  ? 690  GLN A CB  1 
ATOM   508  C CG  . GLN A 1 87  ? 33.947 -49.025 -9.285  1.00   82.11  ? 690  GLN A CG  1 
ATOM   509  C CD  . GLN A 1 87  ? 32.550 -48.537 -8.895  1.00   76.90  ? 690  GLN A CD  1 
ATOM   510  O OE1 . GLN A 1 87  ? 31.565 -48.754 -9.606  1.00   77.16  ? 690  GLN A OE1 1 
ATOM   511  N NE2 . GLN A 1 87  ? 32.470 -47.873 -7.752  1.00   75.00  ? 690  GLN A NE2 1 
ATOM   512  N N   . GLY A 1 88  ? 36.593 -49.890 -13.425 1.00   83.29  ? 691  GLY A N   1 
ATOM   513  C CA  . GLY A 1 88  ? 37.174 -50.753 -14.438 1.00   81.78  ? 691  GLY A CA  1 
ATOM   514  C C   . GLY A 1 88  ? 38.262 -51.504 -13.676 1.00   87.75  ? 691  GLY A C   1 
ATOM   515  O O   . GLY A 1 88  ? 38.813 -52.525 -14.115 1.00   87.46  ? 691  GLY A O   1 
ATOM   516  N N   . ASN A 1 89  ? 38.590 -50.886 -12.540 1.00   84.49  ? 692  ASN A N   1 
ATOM   517  C CA  . ASN A 1 89  ? 39.190 -51.432 -11.305 1.00   86.84  ? 692  ASN A CA  1 
ATOM   518  C C   . ASN A 1 89  ? 40.719 -51.542 -11.167 1.00   89.60  ? 692  ASN A C   1 
ATOM   519  O O   . ASN A 1 89  ? 41.432 -52.117 -11.995 1.00   91.51  ? 692  ASN A O   1 
ATOM   520  C CB  . ASN A 1 89  ? 38.535 -52.769 -10.950 1.00   92.44  ? 692  ASN A CB  1 
ATOM   521  C CG  . ASN A 1 89  ? 37.131 -52.575 -10.366 1.00   93.57  ? 692  ASN A CG  1 
ATOM   522  O OD1 . ASN A 1 89  ? 36.988 -52.034 -9.263  1.00   89.98  ? 692  ASN A OD1 1 
ATOM   523  N ND2 . ASN A 1 89  ? 36.103 -53.069 -11.067 1.00   98.78  ? 692  ASN A ND2 1 
ATOM   524  N N   . GLU A 1 90  ? 41.156 -50.952 -10.048 1.00   82.21  ? 693  GLU A N   1 
ATOM   525  C CA  . GLU A 1 90  ? 42.523 -50.503 -9.742  1.00   78.28  ? 693  GLU A CA  1 
ATOM   526  C C   . GLU A 1 90  ? 43.262 -49.832 -10.909 1.00   73.60  ? 693  GLU A C   1 
ATOM   527  O O   . GLU A 1 90  ? 44.487 -49.892 -11.002 0.0000 72.76  ? 693  GLU A O   1 
ATOM   528  C CB  . GLU A 1 90  ? 43.380 -51.659 -9.220  0.0000 80.68  ? 693  GLU A CB  1 
ATOM   529  C CG  . GLU A 1 90  ? 42.875 -52.276 -7.933  1.00   86.70  ? 693  GLU A CG  1 
ATOM   530  C CD  . GLU A 1 90  ? 42.464 -53.732 -8.061  1.00   96.61  ? 693  GLU A CD  1 
ATOM   531  O OE1 . GLU A 1 90  ? 42.839 -54.375 -9.075  1.00   93.22  ? 693  GLU A OE1 1 
ATOM   532  O OE2 . GLU A 1 90  ? 41.748 -54.216 -7.145  1.00   86.57  ? 693  GLU A OE2 1 
ATOM   533  N N   . ASP A 1 91  ? 42.519 -49.174 -11.789 1.00   68.78  ? 694  ASP A N   1 
ATOM   534  C CA  . ASP A 1 91  ? 43.099 -48.278 -12.783 1.00   57.83  ? 694  ASP A CA  1 
ATOM   535  C C   . ASP A 1 91  ? 43.186 -46.857 -12.196 1.00   59.63  ? 694  ASP A C   1 
ATOM   536  O O   . ASP A 1 91  ? 42.897 -46.631 -11.012 1.00   53.67  ? 694  ASP A O   1 
ATOM   537  C CB  . ASP A 1 91  ? 42.266 -48.231 -14.077 1.00   57.44  ? 694  ASP A CB  1 
ATOM   538  C CG  . ASP A 1 91  ? 42.747 -49.205 -15.158 1.00   74.48  ? 694  ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 91  ? 43.640 -50.039 -14.887 1.00   80.21  ? 694  ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 91  ? 42.220 -49.121 -16.301 1.00   60.68  ? 694  ASP A OD2 1 
ATOM   541  N N   . TYR A 1 92  ? 43.585 -45.914 -13.055 1.00   50.18  ? 695  TYR A N   1 
ATOM   542  C CA  . TYR A 1 92  ? 43.776 -44.509 -12.704 1.00   37.07  ? 695  TYR A CA  1 
ATOM   543  C C   . TYR A 1 92  ? 43.134 -43.532 -13.715 1.00   35.50  ? 695  TYR A C   1 
ATOM   544  O O   . TYR A 1 92  ? 43.155 -43.766 -14.923 1.00   39.06  ? 695  TYR A O   1 
ATOM   545  C CB  . TYR A 1 92  ? 45.279 -44.200 -12.583 1.00   32.73  ? 695  TYR A CB  1 
ATOM   546  C CG  . TYR A 1 92  ? 45.589 -42.720 -12.572 1.00   31.84  ? 695  TYR A CG  1 
ATOM   547  C CD1 . TYR A 1 92  ? 45.583 -42.007 -11.385 1.00   30.50  ? 695  TYR A CD1 1 
ATOM   548  C CD2 . TYR A 1 92  ? 45.875 -42.028 -13.758 1.00   34.03  ? 695  TYR A CD2 1 
ATOM   549  C CE1 . TYR A 1 92  ? 45.847 -40.659 -11.359 1.00   28.91  ? 695  TYR A CE1 1 
ATOM   550  C CE2 . TYR A 1 92  ? 46.141 -40.676 -13.747 1.00   29.05  ? 695  TYR A CE2 1 
ATOM   551  C CZ  . TYR A 1 92  ? 46.120 -39.995 -12.532 1.00   33.59  ? 695  TYR A CZ  1 
ATOM   552  O OH  . TYR A 1 92  ? 46.373 -38.648 -12.477 1.00   29.68  ? 695  TYR A OH  1 
ATOM   553  N N   . ILE A 1 93  ? 42.590 -42.422 -13.221 1.00   32.55  ? 696  ILE A N   1 
ATOM   554  C CA  . ILE A 1 93  ? 42.151 -41.325 -14.089 1.00   30.18  ? 696  ILE A CA  1 
ATOM   555  C C   . ILE A 1 93  ? 42.413 -39.962 -13.445 1.00   24.81  ? 696  ILE A C   1 
ATOM   556  O O   . ILE A 1 93  ? 42.331 -39.798 -12.229 1.00   29.20  ? 696  ILE A O   1 
ATOM   557  C CB  . ILE A 1 93  ? 40.646 -41.441 -14.470 1.00   30.75  ? 696  ILE A CB  1 
ATOM   558  C CG1 . ILE A 1 93  ? 40.226 -40.295 -15.404 1.00   33.93  ? 696  ILE A CG1 1 
ATOM   559  C CG2 . ILE A 1 93  ? 39.766 -41.454 -13.246 1.00   28.87  ? 696  ILE A CG2 1 
ATOM   560  C CD1 . ILE A 1 93  ? 38.885 -40.508 -16.103 1.00   31.06  ? 696  ILE A CD1 1 
ATOM   561  N N   . ASN A 1 94  ? 42.770 -38.990 -14.270 1.00   25.70  ? 697  ASN A N   1 
ATOM   562  C CA  . ASN A 1 94  ? 42.936 -37.631 -13.811 1.00   29.58  ? 697  ASN A CA  1 
ATOM   563  C C   . ASN A 1 94  ? 41.556 -37.011 -13.604 1.00   31.38  ? 697  ASN A C   1 
ATOM   564  O O   . ASN A 1 94  ? 41.003 -36.376 -14.502 1.00   33.97  ? 697  ASN A O   1 
ATOM   565  C CB  . ASN A 1 94  ? 43.774 -36.817 -14.802 1.00   25.62  ? 697  ASN A CB  1 
ATOM   566  C CG  . ASN A 1 94  ? 44.230 -35.483 -14.225 1.00   30.81  ? 697  ASN A CG  1 
ATOM   567  O OD1 . ASN A 1 94  ? 43.456 -34.764 -13.589 1.00   32.00  ? 697  ASN A OD1 1 
ATOM   568  N ND2 . ASN A 1 94  ? 45.499 -35.155 -14.433 1.00   31.05  ? 697  ASN A ND2 1 
ATOM   569  N N   . ALA A 1 95  ? 41.013 -37.207 -12.408 1.00   26.16  ? 698  ALA A N   1 
ATOM   570  C CA  . ALA A 1 95  ? 39.678 -36.759 -12.056 1.00   27.19  ? 698  ALA A CA  1 
ATOM   571  C C   . ALA A 1 95  ? 39.557 -36.691 -10.532 1.00   29.85  ? 698  ALA A C   1 
ATOM   572  O O   . ALA A 1 95  ? 40.124 -37.525 -9.830  1.00   31.50  ? 698  ALA A O   1 
ATOM   573  C CB  . ALA A 1 95  ? 38.639 -37.693 -12.632 1.00   26.35  ? 698  ALA A CB  1 
ATOM   574  N N   . SER A 1 96  ? 38.821 -35.710 -10.024 1.00   25.71  ? 699  SER A N   1 
ATOM   575  C CA  . SER A 1 96  ? 38.700 -35.524 -8.580  1.00   31.67  ? 699  SER A CA  1 
ATOM   576  C C   . SER A 1 96  ? 37.238 -35.442 -8.146  1.00   34.14  ? 699  SER A C   1 
ATOM   577  O O   . SER A 1 96  ? 36.400 -34.884 -8.856  1.00   29.91  ? 699  SER A O   1 
ATOM   578  C CB  . SER A 1 96  ? 39.417 -34.246 -8.123  1.00   29.54  ? 699  SER A CB  1 
ATOM   579  O OG  . SER A 1 96  ? 40.734 -34.172 -8.609  1.00   31.87  ? 699  SER A OG  1 
ATOM   580  N N   . TYR A 1 97  ? 36.934 -35.982 -6.969  1.00   32.12  ? 700  TYR A N   1 
ATOM   581  C CA  . TYR A 1 97  ? 35.646 -35.704 -6.358  1.00   26.63  ? 700  TYR A CA  1 
ATOM   582  C C   . TYR A 1 97  ? 35.711 -34.297 -5.790  1.00   24.38  ? 700  TYR A C   1 
ATOM   583  O O   . TYR A 1 97  ? 36.722 -33.886 -5.226  1.00   23.75  ? 700  TYR A O   1 
ATOM   584  C CB  . TYR A 1 97  ? 35.316 -36.713 -5.276  1.00   26.53  ? 700  TYR A CB  1 
ATOM   585  C CG  . TYR A 1 97  ? 35.119 -38.113 -5.775  1.00   28.79  ? 700  TYR A CG  1 
ATOM   586  C CD1 . TYR A 1 97  ? 33.974 -38.461 -6.459  1.00   22.80  ? 700  TYR A CD1 1 
ATOM   587  C CD2 . TYR A 1 97  ? 36.069 -39.098 -5.531  1.00   28.97  ? 700  TYR A CD2 1 
ATOM   588  C CE1 . TYR A 1 97  ? 33.775 -39.737 -6.898  1.00   27.39  ? 700  TYR A CE1 1 
ATOM   589  C CE2 . TYR A 1 97  ? 35.880 -40.380 -5.965  1.00   24.71  ? 700  TYR A CE2 1 
ATOM   590  C CZ  . TYR A 1 97  ? 34.728 -40.701 -6.658  1.00   31.98  ? 700  TYR A CZ  1 
ATOM   591  O OH  . TYR A 1 97  ? 34.519 -41.994 -7.124  1.00   37.02  ? 700  TYR A OH  1 
ATOM   592  N N   . VAL A 1 98  ? 34.649 -33.540 -5.997  1.00   23.48  ? 701  VAL A N   1 
ATOM   593  C CA  . VAL A 1 98  ? 34.606 -32.160 -5.549  1.00   29.70  ? 701  VAL A CA  1 
ATOM   594  C C   . VAL A 1 98  ? 33.187 -31.938 -5.043  1.00   34.15  ? 701  VAL A C   1 
ATOM   595  O O   . VAL A 1 98  ? 32.227 -31.877 -5.825  1.00   27.71  ? 701  VAL A O   1 
ATOM   596  C CB  . VAL A 1 98  ? 34.972 -31.130 -6.680  1.00   30.68  ? 701  VAL A CB  1 
ATOM   597  C CG1 . VAL A 1 98  ? 34.743 -29.692 -6.205  1.00   28.52  ? 701  VAL A CG1 1 
ATOM   598  C CG2 . VAL A 1 98  ? 36.414 -31.319 -7.178  1.00   25.77  ? 701  VAL A CG2 1 
ATOM   599  N N   . ASN A 1 99  ? 33.052 -31.867 -3.721  1.00   32.67  ? 702  ASN A N   1 
ATOM   600  C CA  . ASN A 1 99  ? 31.739 -31.729 -3.125  1.00   30.64  ? 702  ASN A CA  1 
ATOM   601  C C   . ASN A 1 99  ? 31.660 -30.386 -2.458  1.00   32.97  ? 702  ASN A C   1 
ATOM   602  O O   . ASN A 1 99  ? 32.556 -30.000 -1.720  1.00   35.06  ? 702  ASN A O   1 
ATOM   603  C CB  . ASN A 1 99  ? 31.456 -32.877 -2.157  1.00   28.65  ? 702  ASN A CB  1 
ATOM   604  C CG  . ASN A 1 99  ? 31.499 -34.236 -2.852  1.00   34.49  ? 702  ASN A CG  1 
ATOM   605  O OD1 . ASN A 1 99  ? 30.891 -34.415 -3.902  1.00   37.00  ? 702  ASN A OD1 1 
ATOM   606  N ND2 . ASN A 1 99  ? 32.237 -35.186 -2.284  1.00   34.38  ? 702  ASN A ND2 1 
ATOM   607  N N   . MET A 1 100 ? 30.617 -29.642 -2.788  1.00   35.03  ? 703  MET A N   1 
ATOM   608  C CA  . MET A 1 100 ? 30.414 -28.332 -2.213  1.00   38.57  ? 703  MET A CA  1 
ATOM   609  C C   . MET A 1 100 ? 29.237 -28.393 -1.254  1.00   44.44  ? 703  MET A C   1 
ATOM   610  O O   . MET A 1 100 ? 28.077 -28.528 -1.668  1.00   43.05  ? 703  MET A O   1 
ATOM   611  C CB  . MET A 1 100 ? 30.184 -27.295 -3.301  1.00   39.31  ? 703  MET A CB  1 
ATOM   612  C CG  . MET A 1 100 ? 31.348 -27.191 -4.274  1.00   48.98  ? 703  MET A CG  1 
ATOM   613  S SD  . MET A 1 100 ? 32.911 -26.674 -3.514  1.00   39.92  ? 703  MET A SD  1 
ATOM   614  C CE  . MET A 1 100 ? 32.507 -24.988 -3.065  1.00   34.67  ? 703  MET A CE  1 
ATOM   615  N N   . GLU A 1 101 ? 29.551 -28.314 0.035   1.00   44.36  ? 704  GLU A N   1 
ATOM   616  C CA  . GLU A 1 101 ? 28.534 -28.414 1.062   1.00   47.78  ? 704  GLU A CA  1 
ATOM   617  C C   . GLU A 1 101 ? 28.011 -27.033 1.417   1.00   52.06  ? 704  GLU A C   1 
ATOM   618  O O   . GLU A 1 101 ? 28.773 -26.083 1.604   1.00   57.30  ? 704  GLU A O   1 
ATOM   619  C CB  . GLU A 1 101 ? 29.069 -29.157 2.294   1.00   39.19  ? 704  GLU A CB  1 
ATOM   620  C CG  . GLU A 1 101 ? 30.121 -30.208 1.964   0.0000 44.33  ? 704  GLU A CG  1 
ATOM   621  C CD  . GLU A 1 101 ? 30.197 -31.299 3.017   0.0000 45.95  ? 704  GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 101 ? 29.555 -31.147 4.076   0.0000 46.18  ? 704  GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 101 ? 30.885 -32.315 2.782   0.0000 46.53  ? 704  GLU A OE2 1 
ATOM   624  N N   . ILE A 1 102 ? 26.687 -26.933 1.441   1.00   51.39  ? 705  ILE A N   1 
ATOM   625  C CA  . ILE A 1 102 ? 25.969 -25.767 1.934   1.00   52.20  ? 705  ILE A CA  1 
ATOM   626  C C   . ILE A 1 102 ? 25.212 -26.236 3.182   1.00   55.20  ? 705  ILE A C   1 
ATOM   627  O O   . ILE A 1 102 ? 24.021 -26.567 3.116   1.00   50.76  ? 705  ILE A O   1 
ATOM   628  C CB  . ILE A 1 102 ? 25.029 -25.206 0.860   1.00   47.61  ? 705  ILE A CB  1 
ATOM   629  C CG1 . ILE A 1 102 ? 25.837 -24.931 -0.412  1.00   55.34  ? 705  ILE A CG1 1 
ATOM   630  C CG2 . ILE A 1 102 ? 24.319 -23.969 1.351   1.00   49.26  ? 705  ILE A CG2 1 
ATOM   631  C CD1 . ILE A 1 102 ? 25.021 -24.433 -1.608  1.00   51.75  ? 705  ILE A CD1 1 
ATOM   632  N N   . PRO A 1 103 ? 25.925 -26.305 4.319   1.00   51.25  ? 706  PRO A N   1 
ATOM   633  C CA  . PRO A 1 103 ? 25.434 -26.963 5.537   1.00   60.44  ? 706  PRO A CA  1 
ATOM   634  C C   . PRO A 1 103 ? 24.138 -26.338 6.034   1.00   54.88  ? 706  PRO A C   1 
ATOM   635  O O   . PRO A 1 103 ? 23.252 -27.041 6.520   1.00   52.25  ? 706  PRO A O   1 
ATOM   636  C CB  . PRO A 1 103 ? 26.570 -26.740 6.537   1.00   48.73  ? 706  PRO A CB  1 
ATOM   637  C CG  . PRO A 1 103 ? 27.766 -26.421 5.697   1.00   49.92  ? 706  PRO A CG  1 
ATOM   638  C CD  . PRO A 1 103 ? 27.231 -25.667 4.537   1.00   47.37  ? 706  PRO A CD  1 
ATOM   639  N N   . ALA A 1 104 ? 24.045 -25.022 5.868   1.00   56.37  ? 707  ALA A N   1 
ATOM   640  C CA  . ALA A 1 104 ? 22.897 -24.233 6.293   1.00   58.78  ? 707  ALA A CA  1 
ATOM   641  C C   . ALA A 1 104 ? 21.607 -24.656 5.593   1.00   67.19  ? 707  ALA A C   1 
ATOM   642  O O   . ALA A 1 104 ? 20.513 -24.473 6.131   1.00   65.12  ? 707  ALA A O   1 
ATOM   643  C CB  . ALA A 1 104 ? 23.167 -22.753 6.043   1.00   58.23  ? 707  ALA A CB  1 
ATOM   644  N N   . ALA A 1 105 ? 21.734 -25.214 4.393   1.00   66.08  ? 708  ALA A N   1 
ATOM   645  C CA  . ALA A 1 105 ? 20.568 -25.659 3.634   1.00   59.17  ? 708  ALA A CA  1 
ATOM   646  C C   . ALA A 1 105 ? 20.488 -27.179 3.611   1.00   56.15  ? 708  ALA A C   1 
ATOM   647  O O   . ALA A 1 105 ? 19.612 -27.756 2.963   1.00   54.16  ? 708  ALA A O   1 
ATOM   648  C CB  . ALA A 1 105 ? 20.620 -25.114 2.232   1.00   59.83  ? 708  ALA A CB  1 
ATOM   649  N N   . ASN A 1 106 ? 21.412 -27.809 4.335   1.00   60.44  ? 709  ASN A N   1 
ATOM   650  C CA  . ASN A 1 106 ? 21.547 -29.263 4.357   1.00   64.54  ? 709  ASN A CA  1 
ATOM   651  C C   . ASN A 1 106 ? 21.793 -29.830 2.979   1.00   61.55  ? 709  ASN A C   1 
ATOM   652  O O   . ASN A 1 106 ? 21.162 -30.808 2.584   1.00   66.53  ? 709  ASN A O   1 
ATOM   653  C CB  . ASN A 1 106 ? 20.305 -29.908 4.952   1.00   66.08  ? 709  ASN A CB  1 
ATOM   654  C CG  . ASN A 1 106 ? 20.576 -30.544 6.275   1.00   65.70  ? 709  ASN A CG  1 
ATOM   655  O OD1 . ASN A 1 106 ? 21.226 -31.591 6.346   1.00   70.21  ? 709  ASN A OD1 1 
ATOM   656  N ND2 . ASN A 1 106 ? 20.084 -29.923 7.342   1.00   61.34  ? 709  ASN A ND2 1 
ATOM   657  N N   . LEU A 1 107 ? 22.719 -29.214 2.253   1.00   60.34  ? 710  LEU A N   1 
ATOM   658  C CA  . LEU A 1 107 ? 22.829 -29.435 0.814   1.00   59.89  ? 710  LEU A CA  1 
ATOM   659  C C   . LEU A 1 107 ? 24.262 -29.714 0.393   1.00   56.25  ? 710  LEU A C   1 
ATOM   660  O O   . LEU A 1 107 ? 25.196 -29.050 0.844   1.00   49.64  ? 710  LEU A O   1 
ATOM   661  C CB  . LEU A 1 107 ? 22.288 -28.218 0.051   1.00   53.04  ? 710  LEU A CB  1 
ATOM   662  C CG  . LEU A 1 107 ? 22.175 -28.268 -1.473  1.00   47.83  ? 710  LEU A CG  1 
ATOM   663  C CD1 . LEU A 1 107 ? 21.107 -29.262 -1.893  1.00   47.02  ? 710  LEU A CD1 1 
ATOM   664  C CD2 . LEU A 1 107 ? 21.883 -26.873 -2.016  1.00   43.95  ? 710  LEU A CD2 1 
ATOM   665  N N   . VAL A 1 108 ? 24.424 -30.714 -0.466  1.00   50.98  ? 711  VAL A N   1 
ATOM   666  C CA  . VAL A 1 108 ? 25.697 -30.956 -1.117  1.00   43.56  ? 711  VAL A CA  1 
ATOM   667  C C   . VAL A 1 108 ? 25.537 -30.998 -2.633  1.00   46.98  ? 711  VAL A C   1 
ATOM   668  O O   . VAL A 1 108 ? 24.688 -31.720 -3.177  1.00   47.36  ? 711  VAL A O   1 
ATOM   669  C CB  . VAL A 1 108 ? 26.324 -32.256 -0.653  1.00   47.74  ? 711  VAL A CB  1 
ATOM   670  C CG1 . VAL A 1 108 ? 27.620 -32.492 -1.410  1.00   44.90  ? 711  VAL A CG1 1 
ATOM   671  C CG2 . VAL A 1 108 ? 26.577 -32.205 0.830   1.00   45.45  ? 711  VAL A CG2 1 
ATOM   672  N N   . ASN A 1 109 ? 26.342 -30.210 -3.327  1.00   48.16  ? 712  ASN A N   1 
ATOM   673  C CA  . ASN A 1 109 ? 26.395 -30.344 -4.774  1.00   44.99  ? 712  ASN A CA  1 
ATOM   674  C C   . ASN A 1 109 ? 27.646 -31.138 -5.141  1.00   42.58  ? 712  ASN A C   1 
ATOM   675  O O   . ASN A 1 109 ? 28.769 -30.657 -5.000  1.00   44.22  ? 712  ASN A O   1 
ATOM   676  C CB  . ASN A 1 109 ? 26.343 -28.976 -5.446  1.00   34.02  ? 712  ASN A CB  1 
ATOM   677  C CG  . ASN A 1 109 ? 25.019 -28.278 -5.206  1.00   38.80  ? 712  ASN A CG  1 
ATOM   678  O OD1 . ASN A 1 109 ? 24.015 -28.923 -4.901  1.00   43.12  ? 712  ASN A OD1 1 
ATOM   679  N ND2 . ASN A 1 109 ? 25.004 -26.963 -5.347  1.00   39.38  ? 712  ASN A ND2 1 
ATOM   680  N N   . LYS A 1 110 ? 27.439 -32.387 -5.542  1.00   36.98  ? 713  LYS A N   1 
ATOM   681  C CA  . LYS A 1 110 ? 28.536 -33.252 -5.917  1.00   33.58  ? 713  LYS A CA  1 
ATOM   682  C C   . LYS A 1 110 ? 28.969 -32.925 -7.334  1.00   40.04  ? 713  LYS A C   1 
ATOM   683  O O   . LYS A 1 110 ? 28.130 -32.652 -8.212  1.00   33.51  ? 713  LYS A O   1 
ATOM   684  C CB  . LYS A 1 110 ? 28.141 -34.726 -5.817  1.00   36.05  ? 713  LYS A CB  1 
ATOM   685  C CG  . LYS A 1 110 ? 27.621 -35.157 -4.459  1.00   40.63  ? 713  LYS A CG  1 
ATOM   686  C CD  . LYS A 1 110 ? 27.395 -36.666 -4.425  1.00   48.62  ? 713  LYS A CD  1 
ATOM   687  C CE  . LYS A 1 110 ? 26.729 -37.092 -3.125  0.0000 50.30  ? 713  LYS A CE  1 
ATOM   688  N NZ  . LYS A 1 110 ? 25.411 -36.427 -2.930  0.0000 52.39  ? 713  LYS A NZ  1 
ATOM   689  N N   . TYR A 1 111 ? 30.286 -32.944 -7.535  1.00   36.70  ? 714  TYR A N   1 
ATOM   690  C CA  . TYR A 1 111 ? 30.898 -32.854 -8.859  1.00   31.37  ? 714  TYR A CA  1 
ATOM   691  C C   . TYR A 1 111 ? 31.951 -33.930 -9.015  1.00   32.65  ? 714  TYR A C   1 
ATOM   692  O O   . TYR A 1 111 ? 32.516 -34.409 -8.039  1.00   30.79  ? 714  TYR A O   1 
ATOM   693  C CB  . TYR A 1 111 ? 31.575 -31.503 -9.097  1.00   27.34  ? 714  TYR A CB  1 
ATOM   694  C CG  . TYR A 1 111 ? 30.716 -30.267 -8.993  1.00   29.39  ? 714  TYR A CG  1 
ATOM   695  C CD1 . TYR A 1 111 ? 30.479 -29.672 -7.762  1.00   30.05  ? 714  TYR A CD1 1 
ATOM   696  C CD2 . TYR A 1 111 ? 30.182 -29.669 -10.132 1.00   28.85  ? 714  TYR A CD2 1 
ATOM   697  C CE1 . TYR A 1 111 ? 29.727 -28.542 -7.658  1.00   35.03  ? 714  TYR A CE1 1 
ATOM   698  C CE2 . TYR A 1 111 ? 29.428 -28.535 -10.046 1.00   27.19  ? 714  TYR A CE2 1 
ATOM   699  C CZ  . TYR A 1 111 ? 29.200 -27.967 -8.805  1.00   38.47  ? 714  TYR A CZ  1 
ATOM   700  O OH  . TYR A 1 111 ? 28.452 -26.821 -8.687  1.00   36.06  ? 714  TYR A OH  1 
ATOM   701  N N   . ILE A 1 112 ? 32.217 -34.308 -10.258 1.00   35.73  ? 715  ILE A N   1 
ATOM   702  C CA  . ILE A 1 112 ? 33.479 -34.942 -10.590 1.00   28.26  ? 715  ILE A CA  1 
ATOM   703  C C   . ILE A 1 112 ? 34.135 -33.971 -11.552 1.00   31.04  ? 715  ILE A C   1 
ATOM   704  O O   . ILE A 1 112 ? 33.536 -33.614 -12.579 1.00   29.58  ? 715  ILE A O   1 
ATOM   705  C CB  . ILE A 1 112 ? 33.301 -36.338 -11.197 1.00   33.67  ? 715  ILE A CB  1 
ATOM   706  C CG1 . ILE A 1 112 ? 32.837 -37.315 -10.107 1.00   36.14  ? 715  ILE A CG1 1 
ATOM   707  C CG2 . ILE A 1 112 ? 34.590 -36.803 -11.855 1.00   31.52  ? 715  ILE A CG2 1 
ATOM   708  C CD1 . ILE A 1 112 ? 32.691 -38.741 -10.570 1.00   36.31  ? 715  ILE A CD1 1 
ATOM   709  N N   . ALA A 1 113 ? 35.322 -33.491 -11.176 1.00   24.55  ? 716  ALA A N   1 
ATOM   710  C CA  . ALA A 1 113 ? 36.073 -32.530 -11.972 1.00   27.64  ? 716  ALA A CA  1 
ATOM   711  C C   . ALA A 1 113 ? 37.283 -33.209 -12.642 1.00   32.33  ? 716  ALA A C   1 
ATOM   712  O O   . ALA A 1 113 ? 38.127 -33.821 -11.983 1.00   27.46  ? 716  ALA A O   1 
ATOM   713  C CB  . ALA A 1 113 ? 36.501 -31.361 -11.118 1.00   23.02  ? 716  ALA A CB  1 
ATOM   714  N N   . THR A 1 114 ? 37.360 -33.122 -13.963 1.00   27.24  ? 717  THR A N   1 
ATOM   715  C CA  . THR A 1 114 ? 38.366 -33.904 -14.663 1.00   30.78  ? 717  THR A CA  1 
ATOM   716  C C   . THR A 1 114 ? 38.972 -33.125 -15.839 1.00   31.25  ? 717  THR A C   1 
ATOM   717  O O   . THR A 1 114 ? 38.495 -32.047 -16.163 1.00   34.00  ? 717  THR A O   1 
ATOM   718  C CB  . THR A 1 114 ? 37.766 -35.255 -15.145 1.00   31.74  ? 717  THR A CB  1 
ATOM   719  O OG1 . THR A 1 114 ? 38.817 -36.128 -15.562 1.00   30.31  ? 717  THR A OG1 1 
ATOM   720  C CG2 . THR A 1 114 ? 36.762 -35.065 -16.290 1.00   30.83  ? 717  THR A CG2 1 
ATOM   721  N N   . GLN A 1 115 ? 40.056 -33.645 -16.419 1.00   27.11  ? 718  GLN A N   1 
ATOM   722  C CA  . GLN A 1 115 ? 40.681 -33.074 -17.614 1.00   27.58  ? 718  GLN A CA  1 
ATOM   723  C C   . GLN A 1 115 ? 39.905 -33.486 -18.865 1.00   29.16  ? 718  GLN A C   1 
ATOM   724  O O   . GLN A 1 115 ? 39.113 -34.425 -18.820 1.00   32.76  ? 718  GLN A O   1 
ATOM   725  C CB  . GLN A 1 115 ? 42.126 -33.545 -17.750 1.00   24.20  ? 718  GLN A CB  1 
ATOM   726  C CG  . GLN A 1 115 ? 42.214 -35.026 -18.035 1.00   22.12  ? 718  GLN A CG  1 
ATOM   727  C CD  . GLN A 1 115 ? 43.635 -35.557 -18.078 1.00   27.60  ? 718  GLN A CD  1 
ATOM   728  O OE1 . GLN A 1 115 ? 44.562 -34.936 -17.566 1.00   28.45  ? 718  GLN A OE1 1 
ATOM   729  N NE2 . GLN A 1 115 ? 43.810 -36.722 -18.695 1.00   23.65  ? 718  GLN A NE2 1 
ATOM   730  N N   . GLY A 1 116 ? 40.129 -32.783 -19.972 1.00   29.77  ? 719  GLY A N   1 
ATOM   731  C CA  . GLY A 1 116 ? 39.696 -33.266 -21.272 1.00   28.00  ? 719  GLY A CA  1 
ATOM   732  C C   . GLY A 1 116 ? 40.455 -34.555 -21.574 1.00   30.73  ? 719  GLY A C   1 
ATOM   733  O O   . GLY A 1 116 ? 41.688 -34.574 -21.576 1.00   23.60  ? 719  GLY A O   1 
ATOM   734  N N   . PRO A 1 117 ? 39.725 -35.651 -21.827 1.00   26.89  ? 720  PRO A N   1 
ATOM   735  C CA  . PRO A 1 117 ? 40.416 -36.929 -21.989 1.00   26.32  ? 720  PRO A CA  1 
ATOM   736  C C   . PRO A 1 117 ? 41.424 -36.944 -23.149 1.00   33.41  ? 720  PRO A C   1 
ATOM   737  O O   . PRO A 1 117 ? 41.373 -36.139 -24.106 1.00   26.88  ? 720  PRO A O   1 
ATOM   738  C CB  . PRO A 1 117 ? 39.277 -37.928 -22.266 1.00   25.86  ? 720  PRO A CB  1 
ATOM   739  C CG  . PRO A 1 117 ? 38.021 -37.223 -21.994 1.00   24.52  ? 720  PRO A CG  1 
ATOM   740  C CD  . PRO A 1 117 ? 38.287 -35.754 -22.115 1.00   28.13  ? 720  PRO A CD  1 
ATOM   741  N N   . LEU A 1 118 ? 42.345 -37.892 -23.036 1.00   31.27  ? 721  LEU A N   1 
ATOM   742  C CA  . LEU A 1 118 ? 43.298 -38.202 -24.090 1.00   37.14  ? 721  LEU A CA  1 
ATOM   743  C C   . LEU A 1 118 ? 42.757 -39.348 -24.957 1.00   37.76  ? 721  LEU A C   1 
ATOM   744  O O   . LEU A 1 118 ? 41.826 -40.051 -24.539 1.00   35.99  ? 721  LEU A O   1 
ATOM   745  C CB  . LEU A 1 118 ? 44.643 -38.556 -23.466 1.00   33.42  ? 721  LEU A CB  1 
ATOM   746  C CG  . LEU A 1 118 ? 45.179 -37.366 -22.665 1.00   34.87  ? 721  LEU A CG  1 
ATOM   747  C CD1 . LEU A 1 118 ? 46.118 -37.827 -21.546 1.00   28.46  ? 721  LEU A CD1 1 
ATOM   748  C CD2 . LEU A 1 118 ? 45.846 -36.376 -23.609 1.00   27.88  ? 721  LEU A CD2 1 
ATOM   749  N N   . PRO A 1 119 ? 43.322 -39.535 -26.164 1.00   32.11  ? 722  PRO A N   1 
ATOM   750  C CA  . PRO A 1 119 ? 42.864 -40.637 -27.021 1.00   35.27  ? 722  PRO A CA  1 
ATOM   751  C C   . PRO A 1 119 ? 42.866 -41.982 -26.305 1.00   35.42  ? 722  PRO A C   1 
ATOM   752  O O   . PRO A 1 119 ? 41.940 -42.780 -26.452 1.00   38.45  ? 722  PRO A O   1 
ATOM   753  C CB  . PRO A 1 119 ? 43.877 -40.627 -28.175 1.00   40.88  ? 722  PRO A CB  1 
ATOM   754  C CG  . PRO A 1 119 ? 44.304 -39.202 -28.278 1.00   33.71  ? 722  PRO A CG  1 
ATOM   755  C CD  . PRO A 1 119 ? 44.353 -38.719 -26.832 1.00   34.99  ? 722  PRO A CD  1 
ATOM   756  N N   . HIS A 1 120 ? 43.885 -42.214 -25.498 1.00   37.03  ? 723  HIS A N   1 
ATOM   757  C CA  . HIS A 1 120 ? 43.975 -43.473 -24.783 1.00   38.23  ? 723  HIS A CA  1 
ATOM   758  C C   . HIS A 1 120 ? 43.377 -43.448 -23.370 1.00   35.25  ? 723  HIS A C   1 
ATOM   759  O O   . HIS A 1 120 ? 43.435 -44.462 -22.683 1.00   42.87  ? 723  HIS A O   1 
ATOM   760  C CB  . HIS A 1 120 ? 45.427 -43.915 -24.711 1.00   32.36  ? 723  HIS A CB  1 
ATOM   761  C CG  . HIS A 1 120 ? 46.291 -42.986 -23.927 1.00   35.67  ? 723  HIS A CG  1 
ATOM   762  N ND1 . HIS A 1 120 ? 46.588 -41.711 -24.356 1.00   38.52  ? 723  HIS A ND1 1 
ATOM   763  C CD2 . HIS A 1 120 ? 46.912 -43.141 -22.735 1.00   38.23  ? 723  HIS A CD2 1 
ATOM   764  C CE1 . HIS A 1 120 ? 47.361 -41.119 -23.463 1.00   39.62  ? 723  HIS A CE1 1 
ATOM   765  N NE2 . HIS A 1 120 ? 47.573 -41.965 -22.471 1.00   45.02  ? 723  HIS A NE2 1 
ATOM   766  N N   . THR A 1 121 ? 42.806 -42.326 -22.925 1.00   37.66  ? 724  THR A N   1 
ATOM   767  C CA  . THR A 1 121 ? 42.079 -42.322 -21.633 1.00   37.60  ? 724  THR A CA  1 
ATOM   768  C C   . THR A 1 121 ? 40.558 -42.230 -21.795 1.00   33.41  ? 724  THR A C   1 
ATOM   769  O O   . THR A 1 121 ? 39.834 -42.245 -20.811 1.00   34.91  ? 724  THR A O   1 
ATOM   770  C CB  . THR A 1 121 ? 42.519 -41.165 -20.697 1.00   34.14  ? 724  THR A CB  1 
ATOM   771  O OG1 . THR A 1 121 ? 42.174 -39.902 -21.282 1.00   34.13  ? 724  THR A OG1 1 
ATOM   772  C CG2 . THR A 1 121 ? 44.011 -41.235 -20.397 1.00   33.53  ? 724  THR A CG2 1 
ATOM   773  N N   . CYS A 1 122 ? 40.088 -42.157 -23.039 1.00   37.78  ? 725  CYS A N   1 
ATOM   774  C CA  . CYS A 1 122 ? 38.653 -42.123 -23.350 1.00   34.61  ? 725  CYS A CA  1 
ATOM   775  C C   . CYS A 1 122 ? 37.852 -43.256 -22.745 1.00   34.43  ? 725  CYS A C   1 
ATOM   776  O O   . CYS A 1 122 ? 36.733 -43.050 -22.281 1.00   37.49  ? 725  CYS A O   1 
ATOM   777  C CB  . CYS A 1 122 ? 38.438 -42.137 -24.866 1.00   32.64  ? 725  CYS A CB  1 
ATOM   778  S SG  . CYS A 1 122 ? 38.642 -40.523 -25.573 1.00   39.72  ? 725  CYS A SG  1 
ATOM   779  N N   . ALA A 1 123 ? 38.418 -44.454 -22.793 1.00   32.58  ? 726  ALA A N   1 
ATOM   780  C CA  . ALA A 1 123 ? 37.773 -45.620 -22.237 1.00   35.79  ? 726  ALA A CA  1 
ATOM   781  C C   . ALA A 1 123 ? 37.561 -45.438 -20.727 1.00   33.05  ? 726  ALA A C   1 
ATOM   782  O O   . ALA A 1 123 ? 36.506 -45.785 -20.207 1.00   31.88  ? 726  ALA A O   1 
ATOM   783  C CB  . ALA A 1 123 ? 38.592 -46.865 -22.530 1.00   35.58  ? 726  ALA A CB  1 
ATOM   784  N N   . GLN A 1 124 ? 38.540 -44.853 -20.041 1.00   29.24  ? 727  GLN A N   1 
ATOM   785  C CA  . GLN A 1 124 ? 38.416 -44.614 -18.597 1.00   32.55  ? 727  GLN A CA  1 
ATOM   786  C C   . GLN A 1 124 ? 37.393 -43.531 -18.268 1.00   34.64  ? 727  GLN A C   1 
ATOM   787  O O   . GLN A 1 124 ? 36.745 -43.581 -17.219 1.00   36.16  ? 727  GLN A O   1 
ATOM   788  C CB  . GLN A 1 124 ? 39.766 -44.231 -17.973 1.00   32.34  ? 727  GLN A CB  1 
ATOM   789  C CG  . GLN A 1 124 ? 40.789 -45.356 -17.923 1.00   33.85  ? 727  GLN A CG  1 
ATOM   790  C CD  . GLN A 1 124 ? 41.736 -45.309 -19.088 1.00   39.49  ? 727  GLN A CD  1 
ATOM   791  O OE1 . GLN A 1 124 ? 42.738 -44.591 -19.066 1.00   54.39  ? 727  GLN A OE1 1 
ATOM   792  N NE2 . GLN A 1 124 ? 41.421 -46.056 -20.123 1.00   42.11  ? 727  GLN A NE2 1 
ATOM   793  N N   . PHE A 1 125 ? 37.264 -42.546 -19.153 1.00   34.16  ? 728  PHE A N   1 
ATOM   794  C CA  . PHE A 1 125 ? 36.301 -41.465 -18.970 1.00   32.19  ? 728  PHE A CA  1 
ATOM   795  C C   . PHE A 1 125 ? 34.871 -41.997 -19.011 1.00   36.35  ? 728  PHE A C   1 
ATOM   796  O O   . PHE A 1 125 ? 34.030 -41.628 -18.193 1.00   35.27  ? 728  PHE A O   1 
ATOM   797  C CB  . PHE A 1 125 ? 36.512 -40.389 -20.038 1.00   30.78  ? 728  PHE A CB  1 
ATOM   798  C CG  . PHE A 1 125 ? 35.478 -39.281 -20.031 1.00   29.21  ? 728  PHE A CG  1 
ATOM   799  C CD1 . PHE A 1 125 ? 34.289 -39.403 -20.746 1.00   32.87  ? 728  PHE A CD1 1 
ATOM   800  C CD2 . PHE A 1 125 ? 35.718 -38.101 -19.356 1.00   30.41  ? 728  PHE A CD2 1 
ATOM   801  C CE1 . PHE A 1 125 ? 33.349 -38.377 -20.757 1.00   32.23  ? 728  PHE A CE1 1 
ATOM   802  C CE2 . PHE A 1 125 ? 34.785 -37.070 -19.368 1.00   32.85  ? 728  PHE A CE2 1 
ATOM   803  C CZ  . PHE A 1 125 ? 33.598 -37.211 -20.072 1.00   31.24  ? 728  PHE A CZ  1 
ATOM   804  N N   . TRP A 1 126 ? 34.593 -42.871 -19.970 1.00   38.02  ? 729  TRP A N   1 
ATOM   805  C CA  . TRP A 1 126 ? 33.260 -43.437 -20.064 1.00   39.36  ? 729  TRP A CA  1 
ATOM   806  C C   . TRP A 1 126 ? 32.988 -44.445 -18.938 1.00   36.44  ? 729  TRP A C   1 
ATOM   807  O O   . TRP A 1 126 ? 31.837 -44.629 -18.545 1.00   35.07  ? 729  TRP A O   1 
ATOM   808  C CB  . TRP A 1 126 ? 33.053 -44.069 -21.442 1.00   35.20  ? 729  TRP A CB  1 
ATOM   809  C CG  . TRP A 1 126 ? 32.824 -43.035 -22.479 1.00   34.43  ? 729  TRP A CG  1 
ATOM   810  C CD1 . TRP A 1 126 ? 33.647 -42.722 -23.505 1.00   37.75  ? 729  TRP A CD1 1 
ATOM   811  C CD2 . TRP A 1 126 ? 31.710 -42.138 -22.571 1.00   34.08  ? 729  TRP A CD2 1 
ATOM   812  N NE1 . TRP A 1 126 ? 33.113 -41.702 -24.248 1.00   35.79  ? 729  TRP A NE1 1 
ATOM   813  C CE2 . TRP A 1 126 ? 31.918 -41.331 -23.702 1.00   32.07  ? 729  TRP A CE2 1 
ATOM   814  C CE3 . TRP A 1 126 ? 30.546 -41.954 -21.819 1.00   38.97  ? 729  TRP A CE3 1 
ATOM   815  C CZ2 . TRP A 1 126 ? 31.016 -40.344 -24.101 1.00   33.94  ? 729  TRP A CZ2 1 
ATOM   816  C CZ3 . TRP A 1 126 ? 29.641 -40.968 -22.223 1.00   42.47  ? 729  TRP A CZ3 1 
ATOM   817  C CH2 . TRP A 1 126 ? 29.887 -40.178 -23.356 1.00   31.25  ? 729  TRP A CH2 1 
ATOM   818  N N   . GLN A 1 127 ? 34.043 -45.072 -18.413 1.00   38.19  ? 730  GLN A N   1 
ATOM   819  C CA  . GLN A 1 127 ? 33.908 -45.995 -17.278 1.00   39.59  ? 730  GLN A CA  1 
ATOM   820  C C   . GLN A 1 127 ? 33.398 -45.265 -16.037 1.00   37.98  ? 730  GLN A C   1 
ATOM   821  O O   . GLN A 1 127 ? 32.534 -45.772 -15.335 1.00   36.23  ? 730  GLN A O   1 
ATOM   822  C CB  . GLN A 1 127 ? 35.235 -46.693 -16.968 1.00   39.89  ? 730  GLN A CB  1 
ATOM   823  C CG  . GLN A 1 127 ? 35.082 -47.920 -16.077 1.00   46.60  ? 730  GLN A CG  1 
ATOM   824  C CD  . GLN A 1 127 ? 34.189 -48.979 -16.709 1.00   54.37  ? 730  GLN A CD  1 
ATOM   825  O OE1 . GLN A 1 127 ? 34.484 -49.491 -17.795 1.00   50.39  ? 730  GLN A OE1 1 
ATOM   826  N NE2 . GLN A 1 127 ? 33.085 -49.304 -16.038 1.00   49.72  ? 730  GLN A NE2 1 
ATOM   827  N N   . VAL A 1 128 ? 33.926 -44.067 -15.792 1.00   37.50  ? 731  VAL A N   1 
ATOM   828  C CA  . VAL A 1 128 ? 33.445 -43.213 -14.714 1.00   38.29  ? 731  VAL A CA  1 
ATOM   829  C C   . VAL A 1 128 ? 31.973 -42.861 -14.925 1.00   34.77  ? 731  VAL A C   1 
ATOM   830  O O   . VAL A 1 128 ? 31.163 -42.977 -14.005 1.00   40.80  ? 731  VAL A O   1 
ATOM   831  C CB  . VAL A 1 128 ? 34.268 -41.896 -14.589 1.00   32.10  ? 731  VAL A CB  1 
ATOM   832  C CG1 . VAL A 1 128 ? 33.672 -40.982 -13.517 1.00   26.66  ? 731  VAL A CG1 1 
ATOM   833  C CG2 . VAL A 1 128 ? 35.709 -42.195 -14.292 1.00   33.45  ? 731  VAL A CG2 1 
ATOM   834  N N   . VAL A 1 129 ? 31.624 -42.428 -16.127 1.00   28.06  ? 732  VAL A N   1 
ATOM   835  C CA  . VAL A 1 129 ? 30.250 -42.038 -16.385 1.00   37.86  ? 732  VAL A CA  1 
ATOM   836  C C   . VAL A 1 129 ? 29.314 -43.243 -16.201 1.00   39.66  ? 732  VAL A C   1 
ATOM   837  O O   . VAL A 1 129 ? 28.212 -43.101 -15.669 1.00   37.19  ? 732  VAL A O   1 
ATOM   838  C CB  . VAL A 1 129 ? 30.072 -41.435 -17.801 1.00   35.80  ? 732  VAL A CB  1 
ATOM   839  C CG1 . VAL A 1 129 ? 28.600 -41.155 -18.078 1.00   34.55  ? 732  VAL A CG1 1 
ATOM   840  C CG2 . VAL A 1 129 ? 30.866 -40.159 -17.929 1.00   32.72  ? 732  VAL A CG2 1 
ATOM   841  N N   . TRP A 1 130 ? 29.768 -44.425 -16.609 1.00   34.54  ? 733  TRP A N   1 
ATOM   842  C CA  . TRP A 1 130 ? 28.948 -45.628 -16.492 1.00   39.47  ? 733  TRP A CA  1 
ATOM   843  C C   . TRP A 1 130 ? 28.881 -46.163 -15.060 1.00   44.30  ? 733  TRP A C   1 
ATOM   844  O O   . TRP A 1 130 ? 27.811 -46.557 -14.605 1.00   43.86  ? 733  TRP A O   1 
ATOM   845  C CB  . TRP A 1 130 ? 29.459 -46.731 -17.414 1.00   40.40  ? 733  TRP A CB  1 
ATOM   846  C CG  . TRP A 1 130 ? 28.644 -47.997 -17.335 1.00   47.44  ? 733  TRP A CG  1 
ATOM   847  C CD1 . TRP A 1 130 ? 28.812 -49.021 -16.453 1.00   42.01  ? 733  TRP A CD1 1 
ATOM   848  C CD2 . TRP A 1 130 ? 27.537 -48.371 -18.175 1.00   48.39  ? 733  TRP A CD2 1 
ATOM   849  N NE1 . TRP A 1 130 ? 27.879 -50.002 -16.681 1.00   42.71  ? 733  TRP A NE1 1 
ATOM   850  C CE2 . TRP A 1 130 ? 27.089 -49.633 -17.732 1.00   48.05  ? 733  TRP A CE2 1 
ATOM   851  C CE3 . TRP A 1 130 ? 26.888 -47.763 -19.257 1.00   51.08  ? 733  TRP A CE3 1 
ATOM   852  C CZ2 . TRP A 1 130 ? 26.012 -50.300 -18.334 1.00   53.71  ? 733  TRP A CZ2 1 
ATOM   853  C CZ3 . TRP A 1 130 ? 25.817 -48.427 -19.857 1.00   48.12  ? 733  TRP A CZ3 1 
ATOM   854  C CH2 . TRP A 1 130 ? 25.393 -49.683 -19.393 1.00   53.92  ? 733  TRP A CH2 1 
ATOM   855  N N   . ASP A 1 131 ? 30.010 -46.188 -14.355 1.00   40.80  ? 734  ASP A N   1 
ATOM   856  C CA  . ASP A 1 131 ? 30.017 -46.728 -12.996 1.00   47.71  ? 734  ASP A CA  1 
ATOM   857  C C   . ASP A 1 131 ? 29.060 -45.985 -12.077 1.00   42.63  ? 734  ASP A C   1 
ATOM   858  O O   . ASP A 1 131 ? 28.414 -46.597 -11.244 1.00   45.57  ? 734  ASP A O   1 
ATOM   859  C CB  . ASP A 1 131 ? 31.419 -46.703 -12.384 1.00   45.12  ? 734  ASP A CB  1 
ATOM   860  C CG  . ASP A 1 131 ? 32.359 -47.675 -13.050 1.00   57.43  ? 734  ASP A CG  1 
ATOM   861  O OD1 . ASP A 1 131 ? 31.884 -48.619 -13.728 1.00   57.60  ? 734  ASP A OD1 1 
ATOM   862  O OD2 . ASP A 1 131 ? 33.584 -47.491 -12.897 1.00   64.58  ? 734  ASP A OD2 1 
ATOM   863  N N   . GLN A 1 132 ? 28.953 -44.674 -12.249 1.00   46.57  ? 735  GLN A N   1 
ATOM   864  C CA  . GLN A 1 132 ? 28.130 -43.854 -11.364 1.00   43.68  ? 735  GLN A CA  1 
ATOM   865  C C   . GLN A 1 132 ? 26.820 -43.430 -12.020 1.00   41.79  ? 735  GLN A C   1 
ATOM   866  O O   . GLN A 1 132 ? 26.040 -42.678 -11.435 1.00   41.26  ? 735  GLN A O   1 
ATOM   867  C CB  . GLN A 1 132 ? 28.911 -42.617 -10.923 1.00   46.21  ? 735  GLN A CB  1 
ATOM   868  C CG  . GLN A 1 132 ? 30.385 -42.883 -10.630 1.00   43.32  ? 735  GLN A CG  1 
ATOM   869  C CD  . GLN A 1 132 ? 30.888 -42.138 -9.401  1.00   48.09  ? 735  GLN A CD  1 
ATOM   870  O OE1 . GLN A 1 132 ? 30.129 -41.433 -8.715  1.00   40.75  ? 735  GLN A OE1 1 
ATOM   871  N NE2 . GLN A 1 132 ? 32.178 -42.303 -9.108  1.00   50.59  ? 735  GLN A NE2 1 
ATOM   872  N N   . LYS A 1 133 ? 26.595 -43.924 -13.236 1.00   39.33  ? 736  LYS A N   1 
ATOM   873  C CA  . LYS A 1 133 ? 25.454 -43.528 -14.065 1.00   45.68  ? 736  LYS A CA  1 
ATOM   874  C C   . LYS A 1 133 ? 25.205 -42.015 -14.080 1.00   44.01  ? 736  LYS A C   1 
ATOM   875  O O   . LYS A 1 133 ? 24.075 -41.565 -13.902 1.00   43.79  ? 736  LYS A O   1 
ATOM   876  C CB  . LYS A 1 133 ? 24.186 -44.245 -13.601 1.00   52.15  ? 736  LYS A CB  1 
ATOM   877  C CG  . LYS A 1 133 ? 24.338 -45.747 -13.420 1.00   49.73  ? 736  LYS A CG  1 
ATOM   878  C CD  . LYS A 1 133 ? 24.416 -46.477 -14.750 1.00   49.63  ? 736  LYS A CD  1 
ATOM   879  C CE  . LYS A 1 133 ? 24.918 -47.887 -14.534 1.00   46.62  ? 736  LYS A CE  1 
ATOM   880  N NZ  . LYS A 1 133 ? 25.098 -48.547 -15.833 1.00   53.21  ? 736  LYS A NZ  1 
ATOM   881  N N   . LEU A 1 134 ? 26.267 -41.242 -14.281 1.00   41.15  ? 737  LEU A N   1 
ATOM   882  C CA  . LEU A 1 134 ? 26.157 -39.798 -14.407 1.00   44.92  ? 737  LEU A CA  1 
ATOM   883  C C   . LEU A 1 134 ? 25.276 -39.456 -15.612 1.00   46.14  ? 737  LEU A C   1 
ATOM   884  O O   . LEU A 1 134 ? 25.465 -40.004 -16.701 1.00   37.09  ? 737  LEU A O   1 
ATOM   885  C CB  . LEU A 1 134 ? 27.539 -39.163 -14.568 1.00   37.71  ? 737  LEU A CB  1 
ATOM   886  C CG  . LEU A 1 134 ? 28.610 -39.652 -13.607 1.00   38.45  ? 737  LEU A CG  1 
ATOM   887  C CD1 . LEU A 1 134 ? 29.905 -38.877 -13.816 1.00   31.92  ? 737  LEU A CD1 1 
ATOM   888  C CD2 . LEU A 1 134 ? 28.099 -39.523 -12.172 1.00   43.17  ? 737  LEU A CD2 1 
ATOM   889  N N   . SER A 1 135 ? 24.327 -38.545 -15.427 1.00   39.81  ? 738  SER A N   1 
ATOM   890  C CA  A SER A 1 135 ? 23.390 -38.205 -16.491 0.72   43.50  ? 738  SER A CA  1 
ATOM   891  C CA  B SER A 1 135 ? 23.400 -38.214 -16.500 0.28   43.05  ? 738  SER A CA  1 
ATOM   892  C C   . SER A 1 135 ? 23.738 -36.877 -17.151 1.00   38.46  ? 738  SER A C   1 
ATOM   893  O O   . SER A 1 135 ? 23.142 -36.502 -18.155 1.00   36.55  ? 738  SER A O   1 
ATOM   894  C CB  A SER A 1 135 ? 21.966 -38.141 -15.942 0.72   43.02  ? 738  SER A CB  1 
ATOM   895  C CB  B SER A 1 135 ? 21.967 -38.195 -15.967 0.28   42.68  ? 738  SER A CB  1 
ATOM   896  O OG  A SER A 1 135 ? 21.805 -36.998 -15.114 0.72   38.92  ? 738  SER A OG  1 
ATOM   897  O OG  B SER A 1 135 ? 21.695 -39.363 -15.210 0.28   43.23  ? 738  SER A OG  1 
ATOM   898  N N   . LEU A 1 136 ? 24.690 -36.161 -16.568 1.00   32.97  ? 739  LEU A N   1 
ATOM   899  C CA  . LEU A 1 136 ? 25.034 -34.839 -17.051 1.00   31.90  ? 739  LEU A CA  1 
ATOM   900  C C   . LEU A 1 136 ? 26.545 -34.602 -17.101 1.00   31.50  ? 739  LEU A C   1 
ATOM   901  O O   . LEU A 1 136 ? 27.262 -34.788 -16.117 1.00   36.31  ? 739  LEU A O   1 
ATOM   902  C CB  . LEU A 1 136 ? 24.368 -33.779 -16.178 1.00   29.46  ? 739  LEU A CB  1 
ATOM   903  C CG  . LEU A 1 136 ? 24.689 -32.337 -16.586 1.00   35.54  ? 739  LEU A CG  1 
ATOM   904  C CD1 . LEU A 1 136 ? 24.387 -32.117 -18.078 1.00   33.93  ? 739  LEU A CD1 1 
ATOM   905  C CD2 . LEU A 1 136 ? 23.945 -31.321 -15.718 1.00   28.23  ? 739  LEU A CD2 1 
ATOM   906  N N   . ILE A 1 137 ? 27.006 -34.191 -18.274 1.00   33.30  ? 740  ILE A N   1 
ATOM   907  C CA  . ILE A 1 137 ? 28.406 -33.896 -18.544 1.00   33.50  ? 740  ILE A CA  1 
ATOM   908  C C   . ILE A 1 137 ? 28.487 -32.456 -18.996 1.00   31.71  ? 740  ILE A C   1 
ATOM   909  O O   . ILE A 1 137 ? 27.754 -32.067 -19.902 1.00   32.74  ? 740  ILE A O   1 
ATOM   910  C CB  . ILE A 1 137 ? 29.001 -34.824 -19.651 1.00   33.74  ? 740  ILE A CB  1 
ATOM   911  C CG1 . ILE A 1 137 ? 29.053 -36.274 -19.160 1.00   30.07  ? 740  ILE A CG1 1 
ATOM   912  C CG2 . ILE A 1 137 ? 30.389 -34.335 -20.112 1.00   22.64  ? 740  ILE A CG2 1 
ATOM   913  C CD1 . ILE A 1 137 ? 29.427 -37.266 -20.226 1.00   28.64  ? 740  ILE A CD1 1 
ATOM   914  N N   . VAL A 1 138 ? 29.357 -31.669 -18.368 1.00   27.94  ? 741  VAL A N   1 
ATOM   915  C CA  . VAL A 1 138 ? 29.573 -30.287 -18.779 1.00   27.31  ? 741  VAL A CA  1 
ATOM   916  C C   . VAL A 1 138 ? 31.024 -30.103 -19.222 1.00   29.06  ? 741  VAL A C   1 
ATOM   917  O O   . VAL A 1 138 ? 31.957 -30.327 -18.453 1.00   28.19  ? 741  VAL A O   1 
ATOM   918  C CB  . VAL A 1 138 ? 29.230 -29.273 -17.656 1.00   25.68  ? 741  VAL A CB  1 
ATOM   919  C CG1 . VAL A 1 138 ? 29.385 -27.833 -18.156 1.00   29.62  ? 741  VAL A CG1 1 
ATOM   920  C CG2 . VAL A 1 138 ? 27.830 -29.479 -17.175 1.00   26.59  ? 741  VAL A CG2 1 
ATOM   921  N N   . MET A 1 139 ? 31.185 -29.707 -20.482 1.00   30.38  ? 742  MET A N   1 
ATOM   922  C CA  . MET A 1 139 ? 32.482 -29.543 -21.123 1.00   29.62  ? 742  MET A CA  1 
ATOM   923  C C   . MET A 1 139 ? 32.677 -28.073 -21.469 1.00   30.34  ? 742  MET A C   1 
ATOM   924  O O   . MET A 1 139 ? 31.870 -27.478 -22.175 1.00   26.84  ? 742  MET A O   1 
ATOM   925  C CB  . MET A 1 139 ? 32.569 -30.420 -22.371 1.00   31.08  ? 742  MET A CB  1 
ATOM   926  C CG  . MET A 1 139 ? 33.735 -30.115 -23.308 1.00   29.94  ? 742  MET A CG  1 
ATOM   927  S SD  . MET A 1 139 ? 33.724 -31.247 -24.707 1.00   35.24  ? 742  MET A SD  1 
ATOM   928  C CE  . MET A 1 139 ? 35.212 -30.777 -25.595 1.00   30.72  ? 742  MET A CE  1 
ATOM   929  N N   . LEU A 1 140 ? 33.738 -27.482 -20.943 1.00   32.38  ? 743  LEU A N   1 
ATOM   930  C CA  . LEU A 1 140 ? 33.902 -26.039 -21.010 1.00   33.25  ? 743  LEU A CA  1 
ATOM   931  C C   . LEU A 1 140 ? 35.083 -25.667 -21.894 1.00   31.63  ? 743  LEU A C   1 
ATOM   932  O O   . LEU A 1 140 ? 35.861 -24.785 -21.557 1.00   37.14  ? 743  LEU A O   1 
ATOM   933  C CB  . LEU A 1 140 ? 34.078 -25.454 -19.597 1.00   27.90  ? 743  LEU A CB  1 
ATOM   934  C CG  . LEU A 1 140 ? 32.937 -25.666 -18.597 1.00   28.87  ? 743  LEU A CG  1 
ATOM   935  C CD1 . LEU A 1 140 ? 33.370 -25.265 -17.213 1.00   28.36  ? 743  LEU A CD1 1 
ATOM   936  C CD2 . LEU A 1 140 ? 31.699 -24.899 -18.976 1.00   23.95  ? 743  LEU A CD2 1 
ATOM   937  N N   . THR A 1 141 ? 35.211 -26.342 -23.028 1.00   31.82  ? 744  THR A N   1 
ATOM   938  C CA  . THR A 1 141 ? 36.329 -26.117 -23.945 1.00   29.38  ? 744  THR A CA  1 
ATOM   939  C C   . THR A 1 141 ? 35.948 -26.548 -25.353 1.00   33.25  ? 744  THR A C   1 
ATOM   940  O O   . THR A 1 141 ? 35.163 -27.481 -25.538 1.00   32.67  ? 744  THR A O   1 
ATOM   941  C CB  . THR A 1 141 ? 37.621 -26.900 -23.508 1.00   32.71  ? 744  THR A CB  1 
ATOM   942  O OG1 . THR A 1 141 ? 38.748 -26.466 -24.269 1.00   24.31  ? 744  THR A OG1 1 
ATOM   943  C CG2 . THR A 1 141 ? 37.457 -28.415 -23.664 1.00   28.19  ? 744  THR A CG2 1 
ATOM   944  N N   . THR A 1 142 ? 36.502 -25.851 -26.337 1.00   30.80  ? 745  THR A N   1 
ATOM   945  C CA  . THR A 1 142 ? 36.501 -26.308 -27.719 1.00   30.64  ? 745  THR A CA  1 
ATOM   946  C C   . THR A 1 142 ? 37.556 -27.406 -27.853 1.00   32.64  ? 745  THR A C   1 
ATOM   947  O O   . THR A 1 142 ? 38.406 -27.543 -26.960 1.00   33.31  ? 745  THR A O   1 
ATOM   948  C CB  . THR A 1 142 ? 36.801 -25.160 -28.675 1.00   33.16  ? 745  THR A CB  1 
ATOM   949  O OG1 . THR A 1 142 ? 38.053 -24.573 -28.303 1.00   38.37  ? 745  THR A OG1 1 
ATOM   950  C CG2 . THR A 1 142 ? 35.706 -24.101 -28.584 1.00   24.51  ? 745  THR A CG2 1 
ATOM   951  N N   . LEU A 1 143 ? 37.517 -28.200 -28.929 1.00   26.74  ? 746  LEU A N   1 
ATOM   952  C CA  . LEU A 1 143 ? 38.445 -29.337 -29.016 1.00   27.50  ? 746  LEU A CA  1 
ATOM   953  C C   . LEU A 1 143 ? 39.868 -28.890 -29.320 1.00   31.10  ? 746  LEU A C   1 
ATOM   954  O O   . LEU A 1 143 ? 40.846 -29.518 -28.905 1.00   30.35  ? 746  LEU A O   1 
ATOM   955  C CB  . LEU A 1 143 ? 37.980 -30.334 -30.053 1.00   22.21  ? 746  LEU A CB  1 
ATOM   956  C CG  . LEU A 1 143 ? 36.694 -31.073 -29.706 1.00   35.01  ? 746  LEU A CG  1 
ATOM   957  C CD1 . LEU A 1 143 ? 36.122 -31.792 -30.933 1.00   26.89  ? 746  LEU A CD1 1 
ATOM   958  C CD2 . LEU A 1 143 ? 36.937 -32.050 -28.538 1.00   30.59  ? 746  LEU A CD2 1 
ATOM   959  N N   . THR A 1 144 ? 39.970 -27.791 -30.052 1.00   34.03  ? 747  THR A N   1 
ATOM   960  C CA  . THR A 1 144 ? 41.250 -27.228 -30.436 1.00   37.63  ? 747  THR A CA  1 
ATOM   961  C C   . THR A 1 144 ? 41.187 -25.721 -30.228 1.00   34.40  ? 747  THR A C   1 
ATOM   962  O O   . THR A 1 144 ? 40.130 -25.103 -30.360 1.00   34.67  ? 747  THR A O   1 
ATOM   963  C CB  . THR A 1 144 ? 41.637 -27.568 -31.926 1.00   40.39  ? 747  THR A CB  1 
ATOM   964  O OG1 . THR A 1 144 ? 40.665 -27.034 -32.844 1.00   34.91  ? 747  THR A OG1 1 
ATOM   965  C CG2 . THR A 1 144 ? 41.777 -29.082 -32.124 1.00   34.78  ? 747  THR A CG2 1 
ATOM   966  N N   . GLU A 1 145 ? 42.322 -25.133 -29.897 1.00   35.09  ? 748  GLU A N   1 
ATOM   967  C CA  . GLU A 1 145 ? 42.354 -23.725 -29.539 1.00   40.10  ? 748  GLU A CA  1 
ATOM   968  C C   . GLU A 1 145 ? 43.763 -23.240 -29.777 1.00   40.35  ? 748  GLU A C   1 
ATOM   969  O O   . GLU A 1 145 ? 44.717 -23.854 -29.314 1.00   41.21  ? 748  GLU A O   1 
ATOM   970  C CB  . GLU A 1 145 ? 41.921 -23.514 -28.075 1.00   35.03  ? 748  GLU A CB  1 
ATOM   971  C CG  . GLU A 1 145 ? 41.533 -22.087 -27.720 1.00   37.94  ? 748  GLU A CG  1 
ATOM   972  C CD  . GLU A 1 145 ? 41.214 -21.874 -26.215 1.00   47.60  ? 748  GLU A CD  1 
ATOM   973  O OE1 . GLU A 1 145 ? 41.192 -22.842 -25.407 1.00   45.76  ? 748  GLU A OE1 1 
ATOM   974  O OE2 . GLU A 1 145 ? 40.980 -20.709 -25.836 1.00   45.31  ? 748  GLU A OE2 1 
ATOM   975  N N   . ARG A 1 146 ? 43.887 -22.166 -30.547 1.00   45.33  ? 749  ARG A N   1 
ATOM   976  C CA  . ARG A 1 146 ? 45.168 -21.520 -30.797 1.00   42.41  ? 749  ARG A CA  1 
ATOM   977  C C   . ARG A 1 146 ? 46.270 -22.517 -31.161 1.00   46.02  ? 749  ARG A C   1 
ATOM   978  O O   . ARG A 1 146 ? 47.273 -22.613 -30.455 1.00   51.51  ? 749  ARG A O   1 
ATOM   979  C CB  . ARG A 1 146 ? 45.591 -20.690 -29.572 1.00   42.63  ? 749  ARG A CB  1 
ATOM   980  C CG  . ARG A 1 146 ? 44.526 -19.713 -29.095 1.00   45.89  ? 749  ARG A CG  1 
ATOM   981  C CD  . ARG A 1 146 ? 45.077 -18.708 -28.123 1.00   42.73  ? 749  ARG A CD  1 
ATOM   982  N NE  . ARG A 1 146 ? 44.097 -17.686 -27.769 0.0000 50.43  ? 749  ARG A NE  1 
ATOM   983  C CZ  . ARG A 1 146 ? 43.446 -17.644 -26.611 0.0000 49.21  ? 749  ARG A CZ  1 
ATOM   984  N NH1 . ARG A 1 146 ? 43.669 -18.571 -25.690 0.0000 48.01  ? 749  ARG A NH1 1 
ATOM   985  N NH2 . ARG A 1 146 ? 42.571 -16.677 -26.374 0.0000 48.42  ? 749  ARG A NH2 1 
ATOM   986  N N   . GLY A 1 147 ? 46.079 -23.262 -32.247 1.00   39.49  ? 750  GLY A N   1 
ATOM   987  C CA  . GLY A 1 147 ? 47.084 -24.211 -32.700 1.00   39.51  ? 750  GLY A CA  1 
ATOM   988  C C   . GLY A 1 147 ? 47.243 -25.505 -31.905 1.00   50.98  ? 750  GLY A C   1 
ATOM   989  O O   . GLY A 1 147 ? 47.994 -26.388 -32.309 1.00   51.77  ? 750  GLY A O   1 
ATOM   990  N N   . ARG A 1 148 ? 46.548 -25.640 -30.778 1.00   46.32  ? 751  ARG A N   1 
ATOM   991  C CA  . ARG A 1 148 ? 46.738 -26.820 -29.939 1.00   45.31  ? 751  ARG A CA  1 
ATOM   992  C C   . ARG A 1 148 ? 45.455 -27.631 -29.736 1.00   42.44  ? 751  ARG A C   1 
ATOM   993  O O   . ARG A 1 148 ? 44.338 -27.095 -29.769 1.00   37.67  ? 751  ARG A O   1 
ATOM   994  C CB  . ARG A 1 148 ? 47.315 -26.410 -28.579 1.00   46.03  ? 751  ARG A CB  1 
ATOM   995  C CG  . ARG A 1 148 ? 48.840 -26.313 -28.543 1.00   53.00  ? 751  ARG A CG  1 
ATOM   996  C CD  . ARG A 1 148 ? 49.319 -24.889 -28.277 1.00   63.40  ? 751  ARG A CD  1 
ATOM   997  N NE  . ARG A 1 148 ? 50.779 -24.783 -28.329 1.00   80.58  ? 751  ARG A NE  1 
ATOM   998  C CZ  . ARG A 1 148 ? 51.474 -23.721 -27.919 1.00   80.98  ? 751  ARG A CZ  1 
ATOM   999  N NH1 . ARG A 1 148 ? 52.800 -23.717 -27.999 1.00   78.75  ? 751  ARG A NH1 1 
ATOM   1000 N NH2 . ARG A 1 148 ? 50.843 -22.656 -27.438 1.00   78.47  ? 751  ARG A NH2 1 
ATOM   1001 N N   . THR A 1 149 ? 45.639 -28.932 -29.540 1.00   39.73  ? 752  THR A N   1 
ATOM   1002 C CA  . THR A 1 149 ? 44.565 -29.835 -29.136 1.00   38.00  ? 752  THR A CA  1 
ATOM   1003 C C   . THR A 1 149 ? 44.270 -29.726 -27.640 1.00   33.52  ? 752  THR A C   1 
ATOM   1004 O O   . THR A 1 149 ? 45.158 -29.926 -26.818 1.00   35.80  ? 752  THR A O   1 
ATOM   1005 C CB  . THR A 1 149 ? 44.926 -31.276 -29.467 1.00   38.61  ? 752  THR A CB  1 
ATOM   1006 O OG1 . THR A 1 149 ? 45.144 -31.388 -30.876 1.00   49.85  ? 752  THR A OG1 1 
ATOM   1007 C CG2 . THR A 1 149 ? 43.823 -32.219 -29.036 1.00   36.60  ? 752  THR A CG2 1 
ATOM   1008 N N   . LYS A 1 150 ? 43.027 -29.403 -27.280 1.00   37.24  ? 753  LYS A N   1 
ATOM   1009 C CA  . LYS A 1 150 ? 42.696 -29.142 -25.873 1.00   31.35  ? 753  LYS A CA  1 
ATOM   1010 C C   . LYS A 1 150 ? 41.949 -30.305 -25.247 1.00   33.19  ? 753  LYS A C   1 
ATOM   1011 O O   . LYS A 1 150 ? 41.950 -30.478 -24.028 1.00   32.77  ? 753  LYS A O   1 
ATOM   1012 C CB  . LYS A 1 150 ? 41.873 -27.864 -25.739 1.00   28.10  ? 753  LYS A CB  1 
ATOM   1013 C CG  . LYS A 1 150 ? 42.581 -26.632 -26.264 1.00   37.73  ? 753  LYS A CG  1 
ATOM   1014 C CD  . LYS A 1 150 ? 44.068 -26.661 -25.919 1.00   40.84  ? 753  LYS A CD  1 
ATOM   1015 C CE  . LYS A 1 150 ? 44.398 -25.696 -24.815 1.00   35.02  ? 753  LYS A CE  1 
ATOM   1016 N NZ  . LYS A 1 150 ? 44.186 -24.313 -25.324 1.00   53.90  ? 753  LYS A NZ  1 
ATOM   1017 N N   . CYS A 1 151 ? 41.317 -31.103 -26.100 1.00   31.27  ? 754  CYS A N   1 
ATOM   1018 C CA  . CYS A 1 151 ? 40.532 -32.242 -25.662 1.00   31.09  ? 754  CYS A CA  1 
ATOM   1019 C C   . CYS A 1 151 ? 40.317 -33.168 -26.860 1.00   33.89  ? 754  CYS A C   1 
ATOM   1020 O O   . CYS A 1 151 ? 40.118 -32.694 -27.967 1.00   31.55  ? 754  CYS A O   1 
ATOM   1021 C CB  . CYS A 1 151 ? 39.203 -31.767 -25.066 1.00   28.58  ? 754  CYS A CB  1 
ATOM   1022 S SG  . CYS A 1 151 ? 38.128 -33.063 -24.486 1.00   31.39  ? 754  CYS A SG  1 
ATOM   1023 N N   . HIS A 1 152 ? 40.392 -34.479 -26.647 1.00   33.14  ? 755  HIS A N   1 
ATOM   1024 C CA  . HIS A 1 152 ? 40.076 -35.448 -27.698 1.00   29.82  ? 755  HIS A CA  1 
ATOM   1025 C C   . HIS A 1 152 ? 38.555 -35.516 -27.864 1.00   32.15  ? 755  HIS A C   1 
ATOM   1026 O O   . HIS A 1 152 ? 37.824 -35.339 -26.892 1.00   31.22  ? 755  HIS A O   1 
ATOM   1027 C CB  . HIS A 1 152 ? 40.648 -36.831 -27.360 1.00   31.49  ? 755  HIS A CB  1 
ATOM   1028 C CG  . HIS A 1 152 ? 40.578 -37.817 -28.489 1.00   37.75  ? 755  HIS A CG  1 
ATOM   1029 N ND1 . HIS A 1 152 ? 41.481 -37.822 -29.534 1.00   38.13  ? 755  HIS A ND1 1 
ATOM   1030 C CD2 . HIS A 1 152 ? 39.717 -38.834 -28.734 1.00   37.92  ? 755  HIS A CD2 1 
ATOM   1031 C CE1 . HIS A 1 152 ? 41.174 -38.794 -30.374 1.00   33.92  ? 755  HIS A CE1 1 
ATOM   1032 N NE2 . HIS A 1 152 ? 40.104 -39.419 -29.918 1.00   37.93  ? 755  HIS A NE2 1 
ATOM   1033 N N   . GLN A 1 153 ? 38.065 -35.733 -29.084 1.00   33.94  ? 756  GLN A N   1 
ATOM   1034 C CA  . GLN A 1 153 ? 36.617 -35.885 -29.261 1.00   33.33  ? 756  GLN A CA  1 
ATOM   1035 C C   . GLN A 1 153 ? 36.226 -37.318 -28.941 1.00   35.21  ? 756  GLN A C   1 
ATOM   1036 O O   . GLN A 1 153 ? 36.417 -38.223 -29.765 1.00   34.97  ? 756  GLN A O   1 
ATOM   1037 C CB  . GLN A 1 153 ? 36.169 -35.517 -30.669 1.00   28.36  ? 756  GLN A CB  1 
ATOM   1038 C CG  . GLN A 1 153 ? 34.655 -35.507 -30.843 1.00   30.54  ? 756  GLN A CG  1 
ATOM   1039 C CD  . GLN A 1 153 ? 34.207 -35.102 -32.255 1.00   36.26  ? 756  GLN A CD  1 
ATOM   1040 O OE1 . GLN A 1 153 ? 34.911 -34.373 -32.966 1.00   24.79  ? 756  GLN A OE1 1 
ATOM   1041 N NE2 . GLN A 1 153 ? 33.031 -35.580 -32.656 1.00   34.26  ? 756  GLN A NE2 1 
ATOM   1042 N N   . TYR A 1 154 ? 35.679 -37.499 -27.738 1.00   28.75  ? 757  TYR A N   1 
ATOM   1043 C CA  . TYR A 1 154 ? 35.344 -38.809 -27.187 1.00   31.69  ? 757  TYR A CA  1 
ATOM   1044 C C   . TYR A 1 154 ? 33.882 -39.196 -27.485 1.00   34.00  ? 757  TYR A C   1 
ATOM   1045 O O   . TYR A 1 154 ? 33.427 -40.279 -27.112 1.00   40.09  ? 757  TYR A O   1 
ATOM   1046 C CB  . TYR A 1 154 ? 35.619 -38.824 -25.672 1.00   26.77  ? 757  TYR A CB  1 
ATOM   1047 C CG  . TYR A 1 154 ? 34.960 -37.672 -24.938 1.00   31.77  ? 757  TYR A CG  1 
ATOM   1048 C CD1 . TYR A 1 154 ? 33.649 -37.781 -24.483 1.00   27.70  ? 757  TYR A CD1 1 
ATOM   1049 C CD2 . TYR A 1 154 ? 35.634 -36.466 -24.734 1.00   28.03  ? 757  TYR A CD2 1 
ATOM   1050 C CE1 . TYR A 1 154 ? 33.036 -36.744 -23.853 1.00   29.14  ? 757  TYR A CE1 1 
ATOM   1051 C CE2 . TYR A 1 154 ? 35.023 -35.409 -24.096 1.00   26.81  ? 757  TYR A CE2 1 
ATOM   1052 C CZ  . TYR A 1 154 ? 33.721 -35.560 -23.648 1.00   30.63  ? 757  TYR A CZ  1 
ATOM   1053 O OH  . TYR A 1 154 ? 33.078 -34.531 -22.997 1.00   30.54  ? 757  TYR A OH  1 
ATOM   1054 N N   . TRP A 1 155 ? 33.157 -38.306 -28.156 1.00   29.89  ? 758  TRP A N   1 
ATOM   1055 C CA  . TRP A 1 155 ? 31.826 -38.613 -28.687 1.00   39.18  ? 758  TRP A CA  1 
ATOM   1056 C C   . TRP A 1 155 ? 31.813 -38.572 -30.231 1.00   43.04  ? 758  TRP A C   1 
ATOM   1057 O O   . TRP A 1 155 ? 32.602 -37.850 -30.846 1.00   37.23  ? 758  TRP A O   1 
ATOM   1058 C CB  . TRP A 1 155 ? 30.794 -37.626 -28.137 1.00   35.31  ? 758  TRP A CB  1 
ATOM   1059 C CG  . TRP A 1 155 ? 30.912 -36.256 -28.750 1.00   40.48  ? 758  TRP A CG  1 
ATOM   1060 C CD1 . TRP A 1 155 ? 30.252 -35.793 -29.854 1.00   42.52  ? 758  TRP A CD1 1 
ATOM   1061 C CD2 . TRP A 1 155 ? 31.764 -35.183 -28.315 1.00   33.48  ? 758  TRP A CD2 1 
ATOM   1062 N NE1 . TRP A 1 155 ? 30.632 -34.500 -30.128 1.00   38.25  ? 758  TRP A NE1 1 
ATOM   1063 C CE2 . TRP A 1 155 ? 31.560 -34.100 -29.200 1.00   35.79  ? 758  TRP A CE2 1 
ATOM   1064 C CE3 . TRP A 1 155 ? 32.678 -35.032 -27.262 1.00   34.94  ? 758  TRP A CE3 1 
ATOM   1065 C CZ2 . TRP A 1 155 ? 32.226 -32.883 -29.065 1.00   36.47  ? 758  TRP A CZ2 1 
ATOM   1066 C CZ3 . TRP A 1 155 ? 33.337 -33.821 -27.119 1.00   33.95  ? 758  TRP A CZ3 1 
ATOM   1067 C CH2 . TRP A 1 155 ? 33.109 -32.760 -28.020 1.00   39.85  ? 758  TRP A CH2 1 
ATOM   1068 N N   . PRO A 1 156 ? 30.905 -39.338 -30.867 1.00   52.85  ? 759  PRO A N   1 
ATOM   1069 C CA  . PRO A 1 156 ? 30.818 -39.327 -32.337 1.00   51.37  ? 759  PRO A CA  1 
ATOM   1070 C C   . PRO A 1 156 ? 29.976 -38.191 -32.919 1.00   50.41  ? 759  PRO A C   1 
ATOM   1071 O O   . PRO A 1 156 ? 28.952 -37.815 -32.342 1.00   47.62  ? 759  PRO A O   1 
ATOM   1072 C CB  . PRO A 1 156 ? 30.172 -40.672 -32.647 1.00   52.17  ? 759  PRO A CB  1 
ATOM   1073 C CG  . PRO A 1 156 ? 29.271 -40.903 -31.470 1.00   52.02  ? 759  PRO A CG  1 
ATOM   1074 C CD  . PRO A 1 156 ? 30.007 -40.349 -30.272 1.00   50.72  ? 759  PRO A CD  1 
ATOM   1075 N N   . ASP A 1 157 ? 30.436 -37.643 -34.044 1.00   58.59  ? 760  ASP A N   1 
ATOM   1076 C CA  . ASP A 1 157 ? 29.620 -36.769 -34.896 1.00   62.78  ? 760  ASP A CA  1 
ATOM   1077 C C   . ASP A 1 157 ? 28.570 -37.610 -35.597 1.00   62.99  ? 760  ASP A C   1 
ATOM   1078 O O   . ASP A 1 157 ? 28.932 -38.561 -36.283 1.00   68.56  ? 760  ASP A O   1 
ATOM   1079 C CB  . ASP A 1 157 ? 30.472 -36.062 -35.954 1.00   51.32  ? 760  ASP A CB  1 
ATOM   1080 C CG  . ASP A 1 157 ? 31.372 -34.998 -35.371 1.00   60.53  ? 760  ASP A CG  1 
ATOM   1081 O OD1 . ASP A 1 157 ? 30.880 -34.133 -34.603 1.00   54.19  ? 760  ASP A OD1 1 
ATOM   1082 O OD2 . ASP A 1 157 ? 32.583 -35.029 -35.691 1.00   65.95  ? 760  ASP A OD2 1 
ATOM   1083 N N   . PRO A 1 158 ? 27.273 -37.283 -35.432 1.00   63.96  ? 761  PRO A N   1 
ATOM   1084 C CA  . PRO A 1 158 ? 26.282 -38.074 -36.181 1.00   61.05  ? 761  PRO A CA  1 
ATOM   1085 C C   . PRO A 1 158 ? 26.515 -37.900 -37.687 1.00   62.26  ? 761  PRO A C   1 
ATOM   1086 O O   . PRO A 1 158 ? 26.951 -36.829 -38.101 1.00   63.72  ? 761  PRO A O   1 
ATOM   1087 C CB  . PRO A 1 158 ? 24.935 -37.485 -35.736 1.00   59.43  ? 761  PRO A CB  1 
ATOM   1088 C CG  . PRO A 1 158 ? 25.228 -36.733 -34.461 1.00   50.80  ? 761  PRO A CG  1 
ATOM   1089 C CD  . PRO A 1 158 ? 26.647 -36.251 -34.583 1.00   52.44  ? 761  PRO A CD  1 
ATOM   1090 N N   . PRO A 1 159 ? 26.245 -38.935 -38.501 1.00   75.17  ? 762  PRO A N   1 
ATOM   1091 C CA  . PRO A 1 159 ? 25.612 -40.218 -38.161 1.00   77.36  ? 762  PRO A CA  1 
ATOM   1092 C C   . PRO A 1 159 ? 26.556 -41.212 -37.481 1.00   76.04  ? 762  PRO A C   1 
ATOM   1093 O O   . PRO A 1 159 ? 26.065 -42.186 -36.884 1.00   70.24  ? 762  PRO A O   1 
ATOM   1094 C CB  . PRO A 1 159 ? 25.169 -40.750 -39.530 1.00   66.25  ? 762  PRO A CB  1 
ATOM   1095 C CG  . PRO A 1 159 ? 26.210 -40.210 -40.482 1.00   60.28  ? 762  PRO A CG  1 
ATOM   1096 C CD  . PRO A 1 159 ? 26.614 -38.863 -39.932 1.00   66.56  ? 762  PRO A CD  1 
ATOM   1097 N N   . ASP A 1 160 ? 27.866 -40.947 -37.570 1.00   69.24  ? 763  ASP A N   1 
ATOM   1098 C CA  . ASP A 1 160 ? 28.919 -41.838 -37.077 1.00   63.54  ? 763  ASP A CA  1 
ATOM   1099 C C   . ASP A 1 160 ? 28.750 -42.306 -35.639 1.00   65.62  ? 763  ASP A C   1 
ATOM   1100 O O   . ASP A 1 160 ? 28.046 -41.708 -34.826 1.00   72.14  ? 763  ASP A O   1 
ATOM   1101 C CB  . ASP A 1 160 ? 30.281 -41.134 -37.069 1.00   61.58  ? 763  ASP A CB  1 
ATOM   1102 C CG  . ASP A 1 160 ? 30.709 -40.649 -38.432 1.00   73.42  ? 763  ASP A CG  1 
ATOM   1103 O OD1 . ASP A 1 160 ? 30.499 -41.376 -39.430 1.00   71.74  ? 763  ASP A OD1 1 
ATOM   1104 O OD2 . ASP A 1 160 ? 31.265 -39.529 -38.496 1.00   72.80  ? 763  ASP A OD2 1 
ATOM   1105 N N   . VAL A 1 161 ? 29.455 -43.372 -35.320 1.00   63.13  ? 764  VAL A N   1 
ATOM   1106 C CA  . VAL A 1 161 ? 29.361 -43.945 -34.006 1.00   61.69  ? 764  VAL A CA  1 
ATOM   1107 C C   . VAL A 1 161 ? 30.734 -44.481 -33.584 1.00   65.74  ? 764  VAL A C   1 
ATOM   1108 O O   . VAL A 1 161 ? 31.544 -44.848 -34.442 1.00   65.26  ? 764  VAL A O   1 
ATOM   1109 C CB  . VAL A 1 161 ? 28.294 -45.036 -34.080 1.00   67.95  ? 764  VAL A CB  1 
ATOM   1110 C CG1 . VAL A 1 161 ? 28.890 -46.339 -34.579 1.00   65.31  ? 764  VAL A CG1 1 
ATOM   1111 C CG2 . VAL A 1 161 ? 27.625 -45.194 -32.743 1.00   68.43  ? 764  VAL A CG2 1 
ATOM   1112 N N   . MET A 1 162 ? 31.038 -44.475 -32.286 1.00   59.70  ? 765  MET A N   1 
ATOM   1113 C CA  . MET A 1 162 ? 32.365 -44.923 -31.858 1.00   60.54  ? 765  MET A CA  1 
ATOM   1114 C C   . MET A 1 162 ? 32.307 -45.832 -30.645 1.00   52.84  ? 765  MET A C   1 
ATOM   1115 O O   . MET A 1 162 ? 31.328 -45.847 -29.905 1.00   55.04  ? 765  MET A O   1 
ATOM   1116 C CB  . MET A 1 162 ? 33.305 -43.728 -31.580 1.00   56.39  ? 765  MET A CB  1 
ATOM   1117 C CG  . MET A 1 162 ? 32.808 -42.680 -30.581 1.00   57.41  ? 765  MET A CG  1 
ATOM   1118 S SD  . MET A 1 162 ? 33.956 -41.281 -30.281 1.00   47.30  ? 765  MET A SD  1 
ATOM   1119 C CE  . MET A 1 162 ? 34.112 -40.571 -31.923 1.00   47.47  ? 765  MET A CE  1 
ATOM   1120 N N   . ASN A 1 163 ? 33.369 -46.608 -30.467 1.00   55.95  ? 766  ASN A N   1 
ATOM   1121 C CA  . ASN A 1 163 ? 33.489 -47.505 -29.324 1.00   52.83  ? 766  ASN A CA  1 
ATOM   1122 C C   . ASN A 1 163 ? 34.699 -47.161 -28.434 1.00   48.77  ? 766  ASN A C   1 
ATOM   1123 O O   . ASN A 1 163 ? 35.813 -46.945 -28.928 1.00   43.52  ? 766  ASN A O   1 
ATOM   1124 C CB  . ASN A 1 163 ? 33.566 -48.954 -29.813 1.00   51.96  ? 766  ASN A CB  1 
ATOM   1125 C CG  . ASN A 1 163 ? 32.285 -49.401 -30.527 1.00   66.38  ? 766  ASN A CG  1 
ATOM   1126 O OD1 . ASN A 1 163 ? 31.195 -49.385 -29.948 1.00   69.70  ? 766  ASN A OD1 1 
ATOM   1127 N ND2 . ASN A 1 163 ? 32.412 -49.777 -31.796 1.00   63.93  ? 766  ASN A ND2 1 
ATOM   1128 N N   . HIS A 1 164 ? 34.459 -47.085 -27.126 1.00   48.24  ? 767  HIS A N   1 
ATOM   1129 C CA  . HIS A 1 164 ? 35.519 -46.834 -26.146 1.00   46.18  ? 767  HIS A CA  1 
ATOM   1130 C C   . HIS A 1 164 ? 35.456 -47.820 -24.996 1.00   49.27  ? 767  HIS A C   1 
ATOM   1131 O O   . HIS A 1 164 ? 34.600 -47.696 -24.112 1.00   51.10  ? 767  HIS A O   1 
ATOM   1132 C CB  . HIS A 1 164 ? 35.439 -45.407 -25.586 1.00   42.70  ? 767  HIS A CB  1 
ATOM   1133 C CG  . HIS A 1 164 ? 35.746 -44.348 -26.594 1.00   45.94  ? 767  HIS A CG  1 
ATOM   1134 N ND1 . HIS A 1 164 ? 37.006 -44.173 -27.124 1.00   44.09  ? 767  HIS A ND1 1 
ATOM   1135 C CD2 . HIS A 1 164 ? 34.953 -43.422 -27.184 1.00   45.47  ? 767  HIS A CD2 1 
ATOM   1136 C CE1 . HIS A 1 164 ? 36.977 -43.182 -27.998 1.00   42.50  ? 767  HIS A CE1 1 
ATOM   1137 N NE2 . HIS A 1 164 ? 35.745 -42.710 -28.052 1.00   45.44  ? 767  HIS A NE2 1 
ATOM   1138 N N   . GLY A 1 165 ? 36.363 -48.793 -25.008 1.00   50.11  ? 768  GLY A N   1 
ATOM   1139 C CA  . GLY A 1 165 ? 36.523 -49.696 -23.880 1.00   50.34  ? 768  GLY A CA  1 
ATOM   1140 C C   . GLY A 1 165 ? 35.281 -50.490 -23.524 1.00   54.09  ? 768  GLY A C   1 
ATOM   1141 O O   . GLY A 1 165 ? 34.907 -50.606 -22.350 1.00   52.47  ? 768  GLY A O   1 
ATOM   1142 N N   . GLY A 1 166 ? 34.636 -51.039 -24.547 1.00   56.34  ? 769  GLY A N   1 
ATOM   1143 C CA  . GLY A 1 166 ? 33.437 -51.830 -24.345 1.00   55.37  ? 769  GLY A CA  1 
ATOM   1144 C C   . GLY A 1 166 ? 32.189 -50.985 -24.218 1.00   47.74  ? 769  GLY A C   1 
ATOM   1145 O O   . GLY A 1 166 ? 31.166 -51.453 -23.743 1.00   59.02  ? 769  GLY A O   1 
ATOM   1146 N N   . PHE A 1 167 ? 32.271 -49.731 -24.630 1.00   48.53  ? 770  PHE A N   1 
ATOM   1147 C CA  . PHE A 1 167 ? 31.099 -48.876 -24.630 1.00   47.29  ? 770  PHE A CA  1 
ATOM   1148 C C   . PHE A 1 167 ? 30.806 -48.389 -26.039 1.00   54.58  ? 770  PHE A C   1 
ATOM   1149 O O   . PHE A 1 167 ? 31.690 -47.890 -26.732 1.00   50.22  ? 770  PHE A O   1 
ATOM   1150 C CB  . PHE A 1 167 ? 31.291 -47.691 -23.687 1.00   51.11  ? 770  PHE A CB  1 
ATOM   1151 C CG  . PHE A 1 167 ? 31.416 -48.087 -22.248 1.00   47.66  ? 770  PHE A CG  1 
ATOM   1152 C CD1 . PHE A 1 167 ? 30.384 -48.757 -21.612 1.00   45.44  ? 770  PHE A CD1 1 
ATOM   1153 C CD2 . PHE A 1 167 ? 32.563 -47.795 -21.535 1.00   42.21  ? 770  PHE A CD2 1 
ATOM   1154 C CE1 . PHE A 1 167 ? 30.495 -49.128 -20.292 1.00   47.64  ? 770  PHE A CE1 1 
ATOM   1155 C CE2 . PHE A 1 167 ? 32.680 -48.164 -20.216 1.00   44.26  ? 770  PHE A CE2 1 
ATOM   1156 C CZ  . PHE A 1 167 ? 31.643 -48.833 -19.594 1.00   46.21  ? 770  PHE A CZ  1 
ATOM   1157 N N   . HIS A 1 168 ? 29.561 -48.560 -26.464 1.00   55.50  ? 771  HIS A N   1 
ATOM   1158 C CA  . HIS A 1 168 ? 29.123 -48.037 -27.735 1.00   49.09  ? 771  HIS A CA  1 
ATOM   1159 C C   . HIS A 1 168 ? 28.513 -46.675 -27.487 1.00   48.70  ? 771  HIS A C   1 
ATOM   1160 O O   . HIS A 1 168 ? 27.540 -46.557 -26.753 1.00   47.83  ? 771  HIS A O   1 
ATOM   1161 C CB  . HIS A 1 168 ? 28.117 -48.967 -28.399 0.0000 55.30  ? 771  HIS A CB  1 
ATOM   1162 C CG  . HIS A 1 168 ? 27.853 -48.626 -29.826 0.0000 58.31  ? 771  HIS A CG  1 
ATOM   1163 N ND1 . HIS A 1 168 ? 28.855 -48.576 -30.771 1.00   66.64  ? 771  HIS A ND1 1 
ATOM   1164 C CD2 . HIS A 1 168 ? 26.711 -48.291 -30.471 1.00   59.35  ? 771  HIS A CD2 1 
ATOM   1165 C CE1 . HIS A 1 168 ? 28.339 -48.243 -31.939 1.00   62.99  ? 771  HIS A CE1 1 
ATOM   1166 N NE2 . HIS A 1 168 ? 27.038 -48.065 -31.785 1.00   62.55  ? 771  HIS A NE2 1 
ATOM   1167 N N   . ILE A 1 169 ? 29.103 -45.648 -28.089 1.00   47.84  ? 772  ILE A N   1 
ATOM   1168 C CA  . ILE A 1 169 ? 28.646 -44.277 -27.907 1.00   48.24  ? 772  ILE A CA  1 
ATOM   1169 C C   . ILE A 1 169 ? 28.012 -43.739 -29.189 1.00   50.84  ? 772  ILE A C   1 
ATOM   1170 O O   . ILE A 1 169 ? 28.639 -43.745 -30.248 1.00   54.09  ? 772  ILE A O   1 
ATOM   1171 C CB  . ILE A 1 169 ? 29.809 -43.332 -27.493 1.00   50.74  ? 772  ILE A CB  1 
ATOM   1172 C CG1 . ILE A 1 169 ? 30.658 -43.941 -26.373 1.00   47.07  ? 772  ILE A CG1 1 
ATOM   1173 C CG2 . ILE A 1 169 ? 29.272 -41.972 -27.064 1.00   43.85  ? 772  ILE A CG2 1 
ATOM   1174 C CD1 . ILE A 1 169 ? 30.045 -43.802 -25.004 1.00   44.26  ? 772  ILE A CD1 1 
ATOM   1175 N N   . GLN A 1 170 ? 26.773 -43.269 -29.100 1.00   47.84  ? 773  GLN A N   1 
ATOM   1176 C CA  . GLN A 1 170 ? 26.156 -42.607 -30.241 1.00   48.70  ? 773  GLN A CA  1 
ATOM   1177 C C   . GLN A 1 170 ? 25.510 -41.303 -29.810 1.00   50.03  ? 773  GLN A C   1 
ATOM   1178 O O   . GLN A 1 170 ? 25.007 -41.182 -28.691 1.00   49.65  ? 773  GLN A O   1 
ATOM   1179 C CB  . GLN A 1 170 ? 25.132 -43.516 -30.944 1.00   54.65  ? 773  GLN A CB  1 
ATOM   1180 C CG  . GLN A 1 170 ? 24.557 -44.653 -30.102 1.00   66.68  ? 773  GLN A CG  1 
ATOM   1181 C CD  . GLN A 1 170 ? 23.900 -45.744 -30.945 1.00   58.59  ? 773  GLN A CD  1 
ATOM   1182 O OE1 . GLN A 1 170 ? 23.948 -45.712 -32.176 1.00   73.09  ? 773  GLN A OE1 1 
ATOM   1183 N NE2 . GLN A 1 170 ? 23.280 -46.712 -30.279 1.00   58.22  ? 773  GLN A NE2 1 
ATOM   1184 N N   . CYS A 1 171 ? 25.555 -40.316 -30.700 1.00   49.33  ? 774  CYS A N   1 
ATOM   1185 C CA  . CYS A 1 171 ? 24.986 -39.015 -30.411 1.00   43.28  ? 774  CYS A CA  1 
ATOM   1186 C C   . CYS A 1 171 ? 23.598 -38.928 -31.020 1.00   45.72  ? 774  CYS A C   1 
ATOM   1187 O O   . CYS A 1 171 ? 23.443 -38.850 -32.232 1.00   47.67  ? 774  CYS A O   1 
ATOM   1188 C CB  . CYS A 1 171 ? 25.886 -37.905 -30.936 1.00   45.29  ? 774  CYS A CB  1 
ATOM   1189 S SG  . CYS A 1 171 ? 25.181 -36.274 -30.714 1.00   46.32  ? 774  CYS A SG  1 
ATOM   1190 N N   . GLN A 1 172 ? 22.587 -38.960 -30.166 1.00   51.50  ? 775  GLN A N   1 
ATOM   1191 C CA  . GLN A 1 172 ? 21.206 -39.053 -30.617 1.00   53.80  ? 775  GLN A CA  1 
ATOM   1192 C C   . GLN A 1 172 ? 20.663 -37.722 -31.073 1.00   47.58  ? 775  GLN A C   1 
ATOM   1193 O O   . GLN A 1 172 ? 19.601 -37.662 -31.682 1.00   56.72  ? 775  GLN A O   1 
ATOM   1194 C CB  . GLN A 1 172 ? 20.304 -39.578 -29.503 1.00   46.75  ? 775  GLN A CB  1 
ATOM   1195 C CG  . GLN A 1 172 ? 20.552 -40.995 -29.095 1.00   50.21  ? 775  GLN A CG  1 
ATOM   1196 C CD  . GLN A 1 172 ? 19.686 -41.410 -27.913 1.00   68.13  ? 775  GLN A CD  1 
ATOM   1197 O OE1 . GLN A 1 172 ? 19.229 -40.570 -27.125 1.00   71.57  ? 775  GLN A OE1 1 
ATOM   1198 N NE2 . GLN A 1 172 ? 19.462 -42.712 -27.778 1.00   71.68  ? 775  GLN A NE2 1 
ATOM   1199 N N   . SER A 1 173 ? 21.369 -36.649 -30.763 1.00   44.06  ? 776  SER A N   1 
ATOM   1200 C CA  . SER A 1 173 ? 20.737 -35.350 -30.881 1.00   48.26  ? 776  SER A CA  1 
ATOM   1201 C C   . SER A 1 173 ? 21.731 -34.218 -30.694 1.00   49.72  ? 776  SER A C   1 
ATOM   1202 O O   . SER A 1 173 ? 22.596 -34.276 -29.807 1.00   49.77  ? 776  SER A O   1 
ATOM   1203 C CB  . SER A 1 173 ? 19.607 -35.247 -29.852 1.00   46.07  ? 776  SER A CB  1 
ATOM   1204 O OG  . SER A 1 173 ? 19.082 -33.948 -29.797 1.00   41.48  ? 776  SER A OG  1 
ATOM   1205 N N   . GLU A 1 174 ? 21.605 -33.192 -31.530 1.00   43.92  ? 777  GLU A N   1 
ATOM   1206 C CA  . GLU A 1 174 ? 22.492 -32.038 -31.468 1.00   42.98  ? 777  GLU A CA  1 
ATOM   1207 C C   . GLU A 1 174 ? 21.729 -30.744 -31.652 1.00   41.74  ? 777  GLU A C   1 
ATOM   1208 O O   . GLU A 1 174 ? 21.021 -30.588 -32.630 1.00   55.60  ? 777  GLU A O   1 
ATOM   1209 C CB  . GLU A 1 174 ? 23.589 -32.138 -32.530 1.00   46.19  ? 777  GLU A CB  1 
ATOM   1210 C CG  . GLU A 1 174 ? 24.769 -32.982 -32.109 1.00   50.42  ? 777  GLU A CG  1 
ATOM   1211 C CD  . GLU A 1 174 ? 25.929 -32.920 -33.086 1.00   54.45  ? 777  GLU A CD  1 
ATOM   1212 O OE1 . GLU A 1 174 ? 25.688 -32.591 -34.275 1.00   56.51  ? 777  GLU A OE1 1 
ATOM   1213 O OE2 . GLU A 1 174 ? 27.082 -33.186 -32.652 1.00   46.44  ? 777  GLU A OE2 1 
ATOM   1214 N N   . ASP A 1 175 ? 21.867 -29.819 -30.710 1.00   41.44  ? 778  ASP A N   1 
ATOM   1215 C CA  . ASP A 1 175 ? 21.302 -28.482 -30.860 1.00   45.86  ? 778  ASP A CA  1 
ATOM   1216 C C   . ASP A 1 175 ? 22.235 -27.487 -30.197 1.00   47.20  ? 778  ASP A C   1 
ATOM   1217 O O   . ASP A 1 175 ? 23.039 -27.863 -29.346 1.00   45.71  ? 778  ASP A O   1 
ATOM   1218 C CB  . ASP A 1 175 ? 19.896 -28.397 -30.268 1.00   44.11  ? 778  ASP A CB  1 
ATOM   1219 C CG  . ASP A 1 175 ? 18.937 -29.392 -30.915 1.00   58.71  ? 778  ASP A CG  1 
ATOM   1220 O OD1 . ASP A 1 175 ? 18.570 -29.202 -32.107 1.00   58.65  ? 778  ASP A OD1 1 
ATOM   1221 O OD2 . ASP A 1 175 ? 18.581 -30.389 -30.237 1.00   53.68  ? 778  ASP A OD2 1 
ATOM   1222 N N   . CYS A 1 176 ? 22.159 -26.224 -30.594 1.00   41.48  ? 779  CYS A N   1 
ATOM   1223 C CA  . CYS A 1 176 ? 23.096 -25.256 -30.058 1.00   40.29  ? 779  CYS A CA  1 
ATOM   1224 C C   . CYS A 1 176 ? 22.520 -23.871 -29.956 1.00   40.71  ? 779  CYS A C   1 
ATOM   1225 O O   . CYS A 1 176 ? 21.545 -23.531 -30.614 1.00   44.32  ? 779  CYS A O   1 
ATOM   1226 C CB  . CYS A 1 176 ? 24.370 -25.200 -30.911 1.00   47.03  ? 779  CYS A CB  1 
ATOM   1227 S SG  . CYS A 1 176 ? 24.205 -24.298 -32.488 1.00   45.42  ? 779  CYS A SG  1 
ATOM   1228 N N   . THR A 1 177 ? 23.155 -23.096 -29.090 1.00   39.97  ? 780  THR A N   1 
ATOM   1229 C CA  . THR A 1 177 ? 22.946 -21.678 -28.953 1.00   37.53  ? 780  THR A CA  1 
ATOM   1230 C C   . THR A 1 177 ? 24.242 -21.024 -29.398 1.00   40.10  ? 780  THR A C   1 
ATOM   1231 O O   . THR A 1 177 ? 25.179 -21.698 -29.846 1.00   38.54  ? 780  THR A O   1 
ATOM   1232 C CB  . THR A 1 177 ? 22.632 -21.292 -27.503 1.00   41.65  ? 780  THR A CB  1 
ATOM   1233 O OG1 . THR A 1 177 ? 23.852 -21.264 -26.753 1.00   42.23  ? 780  THR A OG1 1 
ATOM   1234 C CG2 . THR A 1 177 ? 21.720 -22.322 -26.875 1.00   43.80  ? 780  THR A CG2 1 
ATOM   1235 N N   . ILE A 1 178 ? 24.331 -19.718 -29.236 1.00   36.61  ? 781  ILE A N   1 
ATOM   1236 C CA  . ILE A 1 178 ? 25.541 -19.042 -29.651 1.00   35.92  ? 781  ILE A CA  1 
ATOM   1237 C C   . ILE A 1 178 ? 26.714 -19.460 -28.767 1.00   41.25  ? 781  ILE A C   1 
ATOM   1238 O O   . ILE A 1 178 ? 27.861 -19.438 -29.202 1.00   38.79  ? 781  ILE A O   1 
ATOM   1239 C CB  . ILE A 1 178 ? 25.351 -17.508 -29.619 1.00   47.92  ? 781  ILE A CB  1 
ATOM   1240 C CG1 . ILE A 1 178 ? 26.447 -16.821 -30.430 1.00   53.88  ? 781  ILE A CG1 1 
ATOM   1241 C CG2 . ILE A 1 178 ? 25.223 -16.975 -28.166 1.00   41.19  ? 781  ILE A CG2 1 
ATOM   1242 C CD1 . ILE A 1 178 ? 26.530 -17.309 -31.852 1.00   34.50  ? 781  ILE A CD1 1 
ATOM   1243 N N   . ALA A 1 179 ? 26.429 -19.863 -27.523 1.00   42.65  ? 782  ALA A N   1 
ATOM   1244 C CA  . ALA A 1 179 ? 27.504 -20.093 -26.561 1.00   35.74  ? 782  ALA A CA  1 
ATOM   1245 C C   . ALA A 1 179 ? 27.787 -21.572 -26.280 1.00   35.29  ? 782  ALA A C   1 
ATOM   1246 O O   . ALA A 1 179 ? 28.923 -21.932 -25.938 1.00   30.98  ? 782  ALA A O   1 
ATOM   1247 C CB  . ALA A 1 179 ? 27.204 -19.369 -25.275 1.00   34.72  ? 782  ALA A CB  1 
ATOM   1248 N N   . TYR A 1 180 ? 26.784 -22.433 -26.434 1.00   29.06  ? 783  TYR A N   1 
ATOM   1249 C CA  . TYR A 1 180 ? 27.014 -23.841 -26.131 1.00   27.25  ? 783  TYR A CA  1 
ATOM   1250 C C   . TYR A 1 180 ? 26.247 -24.790 -27.033 1.00   32.95  ? 783  TYR A C   1 
ATOM   1251 O O   . TYR A 1 180 ? 25.277 -24.407 -27.694 1.00   34.40  ? 783  TYR A O   1 
ATOM   1252 C CB  . TYR A 1 180 ? 26.670 -24.141 -24.661 1.00   29.54  ? 783  TYR A CB  1 
ATOM   1253 C CG  . TYR A 1 180 ? 25.202 -24.000 -24.337 1.00   29.50  ? 783  TYR A CG  1 
ATOM   1254 C CD1 . TYR A 1 180 ? 24.675 -22.782 -23.933 1.00   26.94  ? 783  TYR A CD1 1 
ATOM   1255 C CD2 . TYR A 1 180 ? 24.346 -25.088 -24.449 1.00   32.87  ? 783  TYR A CD2 1 
ATOM   1256 C CE1 . TYR A 1 180 ? 23.348 -22.652 -23.642 1.00   33.24  ? 783  TYR A CE1 1 
ATOM   1257 C CE2 . TYR A 1 180 ? 23.018 -24.970 -24.164 1.00   36.38  ? 783  TYR A CE2 1 
ATOM   1258 C CZ  . TYR A 1 180 ? 22.521 -23.752 -23.758 1.00   41.96  ? 783  TYR A CZ  1 
ATOM   1259 O OH  . TYR A 1 180 ? 21.181 -23.646 -23.481 1.00   54.40  ? 783  TYR A OH  1 
ATOM   1260 N N   . VAL A 1 181 ? 26.712 -26.035 -27.051 1.00   31.35  ? 784  VAL A N   1 
ATOM   1261 C CA  . VAL A 1 181 ? 26.050 -27.106 -27.775 1.00   35.66  ? 784  VAL A CA  1 
ATOM   1262 C C   . VAL A 1 181 ? 25.496 -28.126 -26.777 1.00   35.23  ? 784  VAL A C   1 
ATOM   1263 O O   . VAL A 1 181 ? 26.213 -28.636 -25.928 1.00   34.49  ? 784  VAL A O   1 
ATOM   1264 C CB  . VAL A 1 181 ? 27.005 -27.815 -28.773 1.00   38.19  ? 784  VAL A CB  1 
ATOM   1265 C CG1 . VAL A 1 181 ? 26.238 -28.813 -29.657 1.00   28.77  ? 784  VAL A CG1 1 
ATOM   1266 C CG2 . VAL A 1 181 ? 27.759 -26.792 -29.610 1.00   36.39  ? 784  VAL A CG2 1 
ATOM   1267 N N   . SER A 1 182 ? 24.206 -28.405 -26.889 1.00   38.71  ? 785  SER A N   1 
ATOM   1268 C CA  . SER A 1 182 ? 23.549 -29.399 -26.068 1.00   33.64  ? 785  SER A CA  1 
ATOM   1269 C C   . SER A 1 182 ? 23.384 -30.681 -26.880 1.00   40.71  ? 785  SER A C   1 
ATOM   1270 O O   . SER A 1 182 ? 22.848 -30.655 -27.991 1.00   39.02  ? 785  SER A O   1 
ATOM   1271 C CB  . SER A 1 182 ? 22.205 -28.868 -25.586 1.00   36.35  ? 785  SER A CB  1 
ATOM   1272 O OG  . SER A 1 182 ? 21.448 -29.881 -24.954 1.00   52.20  ? 785  SER A OG  1 
ATOM   1273 N N   . ARG A 1 183 ? 23.872 -31.795 -26.333 1.00   37.17  ? 786  ARG A N   1 
ATOM   1274 C CA  . ARG A 1 183 ? 23.829 -33.086 -27.012 1.00   40.05  ? 786  ARG A CA  1 
ATOM   1275 C C   . ARG A 1 183 ? 23.218 -34.167 -26.132 1.00   40.62  ? 786  ARG A C   1 
ATOM   1276 O O   . ARG A 1 183 ? 23.502 -34.235 -24.939 1.00   41.18  ? 786  ARG A O   1 
ATOM   1277 C CB  . ARG A 1 183 ? 25.234 -33.531 -27.434 1.00   38.04  ? 786  ARG A CB  1 
ATOM   1278 C CG  . ARG A 1 183 ? 25.815 -32.863 -28.674 1.00   42.06  ? 786  ARG A CG  1 
ATOM   1279 C CD  . ARG A 1 183 ? 27.285 -33.234 -28.775 1.00   33.52  ? 786  ARG A CD  1 
ATOM   1280 N NE  . ARG A 1 183 ? 27.974 -32.604 -29.888 1.00   37.76  ? 786  ARG A NE  1 
ATOM   1281 C CZ  . ARG A 1 183 ? 28.771 -31.547 -29.791 1.00   34.84  ? 786  ARG A CZ  1 
ATOM   1282 N NH1 . ARG A 1 183 ? 29.355 -31.060 -30.888 1.00   32.21  ? 786  ARG A NH1 1 
ATOM   1283 N NH2 . ARG A 1 183 ? 28.986 -30.986 -28.611 1.00   28.84  ? 786  ARG A NH2 1 
ATOM   1284 N N   . GLU A 1 184 ? 22.392 -35.024 -26.718 1.00   40.19  ? 787  GLU A N   1 
ATOM   1285 C CA  . GLU A 1 184 ? 21.957 -36.212 -26.003 1.00   43.65  ? 787  GLU A CA  1 
ATOM   1286 C C   . GLU A 1 184 ? 22.782 -37.400 -26.475 1.00   40.77  ? 787  GLU A C   1 
ATOM   1287 O O   . GLU A 1 184 ? 22.953 -37.602 -27.667 1.00   43.35  ? 787  GLU A O   1 
ATOM   1288 C CB  . GLU A 1 184 ? 20.454 -36.457 -26.198 1.00   50.89  ? 787  GLU A CB  1 
ATOM   1289 C CG  . GLU A 1 184 ? 19.555 -35.381 -25.576 1.00   49.15  ? 787  GLU A CG  1 
ATOM   1290 C CD  . GLU A 1 184 ? 19.783 -35.198 -24.055 1.00   69.54  ? 787  GLU A CD  1 
ATOM   1291 O OE1 . GLU A 1 184 ? 19.995 -36.211 -23.347 1.00   71.68  ? 787  GLU A OE1 1 
ATOM   1292 O OE2 . GLU A 1 184 ? 19.734 -34.044 -23.560 1.00   76.88  ? 787  GLU A OE2 1 
ATOM   1293 N N   . MET A 1 185 ? 23.315 -38.174 -25.540 1.00   41.92  ? 788  MET A N   1 
ATOM   1294 C CA  . MET A 1 185 ? 24.112 -39.333 -25.910 1.00   40.56  ? 788  MET A CA  1 
ATOM   1295 C C   . MET A 1 185 ? 23.613 -40.649 -25.350 1.00   44.34  ? 788  MET A C   1 
ATOM   1296 O O   . MET A 1 185 ? 23.055 -40.731 -24.257 1.00   48.27  ? 788  MET A O   1 
ATOM   1297 C CB  . MET A 1 185 ? 25.559 -39.121 -25.502 1.00   38.14  ? 788  MET A CB  1 
ATOM   1298 C CG  . MET A 1 185 ? 26.273 -38.199 -26.467 1.00   48.23  ? 788  MET A CG  1 
ATOM   1299 S SD  . MET A 1 185 ? 27.801 -37.561 -25.811 1.00   63.01  ? 788  MET A SD  1 
ATOM   1300 C CE  . MET A 1 185 ? 27.967 -36.088 -26.811 1.00   47.52  ? 788  MET A CE  1 
ATOM   1301 N N   . LEU A 1 186 ? 23.816 -41.692 -26.131 1.00   45.04  ? 789  LEU A N   1 
ATOM   1302 C CA  . LEU A 1 186 ? 23.439 -43.014 -25.707 1.00   44.98  ? 789  LEU A CA  1 
ATOM   1303 C C   . LEU A 1 186 ? 24.697 -43.822 -25.523 1.00   47.78  ? 789  LEU A C   1 
ATOM   1304 O O   . LEU A 1 186 ? 25.526 -43.916 -26.426 1.00   50.75  ? 789  LEU A O   1 
ATOM   1305 C CB  . LEU A 1 186 ? 22.519 -43.676 -26.720 1.00   54.14  ? 789  LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 186 ? 21.982 -45.034 -26.270 1.00   58.97  ? 789  LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 186 ? 21.001 -44.858 -25.120 1.00   47.85  ? 789  LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 186 ? 21.355 -45.788 -27.444 1.00   56.38  ? 789  LEU A CD2 1 
ATOM   1309 N N   . VAL A 1 187 ? 24.842 -44.387 -24.336 1.00   46.49  ? 790  VAL A N   1 
ATOM   1310 C CA  . VAL A 1 187 ? 25.987 -45.209 -24.022 1.00   48.29  ? 790  VAL A CA  1 
ATOM   1311 C C   . VAL A 1 187 ? 25.502 -46.642 -23.922 1.00   48.79  ? 790  VAL A C   1 
ATOM   1312 O O   . VAL A 1 187 ? 24.628 -46.945 -23.119 1.00   54.25  ? 790  VAL A O   1 
ATOM   1313 C CB  . VAL A 1 187 ? 26.651 -44.771 -22.695 1.00   47.88  ? 790  VAL A CB  1 
ATOM   1314 C CG1 . VAL A 1 187 ? 27.847 -45.651 -22.381 1.00   41.87  ? 790  VAL A CG1 1 
ATOM   1315 C CG2 . VAL A 1 187 ? 27.051 -43.312 -22.762 1.00   39.69  ? 790  VAL A CG2 1 
ATOM   1316 N N   . THR A 1 188 ? 26.045 -47.530 -24.738 1.00   46.77  ? 791  THR A N   1 
ATOM   1317 C CA  . THR A 1 188 ? 25.621 -48.919 -24.660 1.00   53.43  ? 791  THR A CA  1 
ATOM   1318 C C   . THR A 1 188 ? 26.759 -49.845 -24.237 1.00   52.05  ? 791  THR A C   1 
ATOM   1319 O O   . THR A 1 188 ? 27.790 -49.919 -24.896 1.00   52.50  ? 791  THR A O   1 
ATOM   1320 C CB  . THR A 1 188 ? 25.047 -49.419 -26.004 1.00   50.98  ? 791  THR A CB  1 
ATOM   1321 O OG1 . THR A 1 188 ? 24.050 -48.503 -26.479 1.00   58.25  ? 791  THR A OG1 1 
ATOM   1322 C CG2 . THR A 1 188 ? 24.416 -50.786 -25.818 1.00   50.71  ? 791  THR A CG2 1 
ATOM   1323 N N   . ASN A 1 189 ? 26.563 -50.542 -23.124 1.00   51.96  ? 792  ASN A N   1 
ATOM   1324 C CA  . ASN A 1 189 ? 27.444 -51.637 -22.744 1.00   57.95  ? 792  ASN A CA  1 
ATOM   1325 C C   . ASN A 1 189 ? 27.359 -52.745 -23.775 1.00   57.77  ? 792  ASN A C   1 
ATOM   1326 O O   . ASN A 1 189 ? 26.294 -53.309 -24.001 1.00   58.35  ? 792  ASN A O   1 
ATOM   1327 C CB  . ASN A 1 189 ? 27.079 -52.180 -21.356 1.00   64.53  ? 792  ASN A CB  1 
ATOM   1328 C CG  . ASN A 1 189 ? 28.092 -53.190 -20.833 1.00   62.42  ? 792  ASN A CG  1 
ATOM   1329 O OD1 . ASN A 1 189 ? 28.902 -53.739 -21.586 1.00   65.25  ? 792  ASN A OD1 1 
ATOM   1330 N ND2 . ASN A 1 189 ? 28.049 -53.435 -19.533 1.00   66.02  ? 792  ASN A ND2 1 
ATOM   1331 N N   . THR A 1 190 ? 28.485 -53.068 -24.393 1.00   57.11  ? 793  THR A N   1 
ATOM   1332 C CA  . THR A 1 190 ? 28.468 -54.023 -25.490 1.00   64.04  ? 793  THR A CA  1 
ATOM   1333 C C   . THR A 1 190 ? 28.397 -55.465 -24.997 1.00   70.69  ? 793  THR A C   1 
ATOM   1334 O O   . THR A 1 190 ? 27.882 -56.333 -25.699 1.00   76.33  ? 793  THR A O   1 
ATOM   1335 C CB  . THR A 1 190 ? 29.687 -53.838 -26.407 1.00   62.46  ? 793  THR A CB  1 
ATOM   1336 O OG1 . THR A 1 190 ? 30.874 -53.771 -25.609 1.00   65.55  ? 793  THR A OG1 1 
ATOM   1337 C CG2 . THR A 1 190 ? 29.554 -52.551 -27.217 1.00   56.94  ? 793  THR A CG2 1 
ATOM   1338 N N   . GLN A 1 191 ? 28.890 -55.738 -23.794 1.00   71.55  ? 794  GLN A N   1 
ATOM   1339 C CA  . GLN A 1 191 ? 28.652 -57.063 -23.220 1.00   78.88  ? 794  GLN A CA  1 
ATOM   1340 C C   . GLN A 1 191 ? 27.155 -57.239 -22.922 1.00   76.21  ? 794  GLN A C   1 
ATOM   1341 O O   . GLN A 1 191 ? 26.445 -57.940 -23.633 1.00   74.63  ? 794  GLN A O   1 
ATOM   1342 C CB  . GLN A 1 191 ? 29.470 -57.294 -21.937 1.00   80.76  ? 794  GLN A CB  1 
ATOM   1343 C CG  . GLN A 1 191 ? 30.963 -57.669 -22.120 1.00   89.25  ? 794  GLN A CG  1 
ATOM   1344 C CD  . GLN A 1 191 ? 31.249 -58.477 -23.392 1.00   103.44 ? 794  GLN A CD  1 
ATOM   1345 O OE1 . GLN A 1 191 ? 31.363 -57.922 -24.494 1.00   102.25 ? 794  GLN A OE1 1 
ATOM   1346 N NE2 . GLN A 1 191 ? 31.356 -59.796 -23.241 1.00   100.60 ? 794  GLN A NE2 1 
ATOM   1347 N N   . THR A 1 192 ? 26.660 -56.545 -21.906 1.00   78.07  ? 795  THR A N   1 
ATOM   1348 C CA  . THR A 1 192 ? 25.303 -56.772 -21.406 1.00   73.36  ? 795  THR A CA  1 
ATOM   1349 C C   . THR A 1 192 ? 24.182 -56.244 -22.302 1.00   66.10  ? 795  THR A C   1 
ATOM   1350 O O   . THR A 1 192 ? 23.055 -56.717 -22.214 1.00   72.34  ? 795  THR A O   1 
ATOM   1351 C CB  . THR A 1 192 ? 25.112 -56.139 -20.016 1.00   66.51  ? 795  THR A CB  1 
ATOM   1352 O OG1 . THR A 1 192 ? 25.361 -54.728 -20.088 1.00   64.86  ? 795  THR A OG1 1 
ATOM   1353 C CG2 . THR A 1 192 ? 26.057 -56.772 -19.008 1.00   65.67  ? 795  THR A CG2 1 
ATOM   1354 N N   . GLY A 1 193 ? 24.471 -55.273 -23.159 1.00   68.69  ? 796  GLY A N   1 
ATOM   1355 C CA  . GLY A 1 193 ? 23.424 -54.666 -23.969 1.00   62.92  ? 796  GLY A CA  1 
ATOM   1356 C C   . GLY A 1 193 ? 22.619 -53.616 -23.213 1.00   59.64  ? 796  GLY A C   1 
ATOM   1357 O O   . GLY A 1 193 ? 21.621 -53.099 -23.714 1.00   60.52  ? 796  GLY A O   1 
ATOM   1358 N N   . GLU A 1 194 ? 23.060 -53.301 -21.999 1.00   56.72  ? 797  GLU A N   1 
ATOM   1359 C CA  . GLU A 1 194 ? 22.421 -52.280 -21.177 1.00   58.43  ? 797  GLU A CA  1 
ATOM   1360 C C   . GLU A 1 194 ? 22.669 -50.858 -21.703 1.00   59.81  ? 797  GLU A C   1 
ATOM   1361 O O   . GLU A 1 194 ? 23.755 -50.541 -22.190 1.00   50.70  ? 797  GLU A O   1 
ATOM   1362 C CB  . GLU A 1 194 ? 22.918 -52.398 -19.749 1.00   53.19  ? 797  GLU A CB  1 
ATOM   1363 C CG  . GLU A 1 194 ? 22.240 -51.464 -18.807 1.00   54.02  ? 797  GLU A CG  1 
ATOM   1364 C CD  . GLU A 1 194 ? 22.616 -51.749 -17.376 1.00   65.95  ? 797  GLU A CD  1 
ATOM   1365 O OE1 . GLU A 1 194 ? 23.510 -52.597 -17.157 1.00   69.01  ? 797  GLU A OE1 1 
ATOM   1366 O OE2 . GLU A 1 194 ? 22.022 -51.129 -16.470 1.00   69.36  ? 797  GLU A OE2 1 
ATOM   1367 N N   . GLU A 1 195 ? 21.658 -50.003 -21.601 1.00   54.76  ? 798  GLU A N   1 
ATOM   1368 C CA  . GLU A 1 195 ? 21.752 -48.655 -22.143 1.00   50.18  ? 798  GLU A CA  1 
ATOM   1369 C C   . GLU A 1 195 ? 21.704 -47.588 -21.065 1.00   48.83  ? 798  GLU A C   1 
ATOM   1370 O O   . GLU A 1 195 ? 21.006 -47.731 -20.066 1.00   46.07  ? 798  GLU A O   1 
ATOM   1371 C CB  . GLU A 1 195 ? 20.624 -48.397 -23.133 1.00   48.40  ? 798  GLU A CB  1 
ATOM   1372 C CG  . GLU A 1 195 ? 20.662 -49.247 -24.361 1.00   59.07  ? 798  GLU A CG  1 
ATOM   1373 C CD  . GLU A 1 195 ? 19.562 -48.870 -25.323 1.00   66.05  ? 798  GLU A CD  1 
ATOM   1374 O OE1 . GLU A 1 195 ? 18.529 -48.335 -24.857 1.00   70.86  ? 798  GLU A OE1 1 
ATOM   1375 O OE2 . GLU A 1 195 ? 19.736 -49.094 -26.538 1.00   65.70  ? 798  GLU A OE2 1 
ATOM   1376 N N   . HIS A 1 196 ? 22.426 -46.500 -21.300 1.00   45.99  ? 799  HIS A N   1 
ATOM   1377 C CA  . HIS A 1 196 ? 22.415 -45.352 -20.409 1.00   43.91  ? 799  HIS A CA  1 
ATOM   1378 C C   . HIS A 1 196 ? 22.438 -44.073 -21.228 1.00   45.87  ? 799  HIS A C   1 
ATOM   1379 O O   . HIS A 1 196 ? 23.223 -43.947 -22.178 1.00   49.45  ? 799  HIS A O   1 
ATOM   1380 C CB  . HIS A 1 196 ? 23.609 -45.399 -19.460 1.00   42.95  ? 799  HIS A CB  1 
ATOM   1381 C CG  . HIS A 1 196 ? 23.779 -44.157 -18.641 1.00   46.69  ? 799  HIS A CG  1 
ATOM   1382 N ND1 . HIS A 1 196 ? 22.799 -43.676 -17.803 1.00   47.81  ? 799  HIS A ND1 1 
ATOM   1383 C CD2 . HIS A 1 196 ? 24.821 -43.300 -18.533 1.00   43.78  ? 799  HIS A CD2 1 
ATOM   1384 C CE1 . HIS A 1 196 ? 23.229 -42.576 -17.212 1.00   48.52  ? 799  HIS A CE1 1 
ATOM   1385 N NE2 . HIS A 1 196 ? 24.456 -42.331 -17.633 1.00   45.91  ? 799  HIS A NE2 1 
ATOM   1386 N N   . THR A 1 197 ? 21.574 -43.132 -20.869 1.00   40.00  ? 800  THR A N   1 
ATOM   1387 C CA  . THR A 1 197 ? 21.470 -41.879 -21.603 1.00   48.88  ? 800  THR A CA  1 
ATOM   1388 C C   . THR A 1 197 ? 22.137 -40.741 -20.840 1.00   48.00  ? 800  THR A C   1 
ATOM   1389 O O   . THR A 1 197 ? 21.978 -40.619 -19.617 1.00   50.33  ? 800  THR A O   1 
ATOM   1390 C CB  . THR A 1 197 ? 19.999 -41.492 -21.895 1.00   49.88  ? 800  THR A CB  1 
ATOM   1391 O OG1 . THR A 1 197 ? 19.971 -40.206 -22.523 1.00   57.44  ? 800  THR A OG1 1 
ATOM   1392 C CG2 . THR A 1 197 ? 19.186 -41.414 -20.608 1.00   55.18  ? 800  THR A CG2 1 
ATOM   1393 N N   . VAL A 1 198 ? 22.890 -39.912 -21.561 1.00   39.78  ? 801  VAL A N   1 
ATOM   1394 C CA  . VAL A 1 198 ? 23.590 -38.802 -20.931 1.00   39.31  ? 801  VAL A CA  1 
ATOM   1395 C C   . VAL A 1 198 ? 23.345 -37.501 -21.661 1.00   38.04  ? 801  VAL A C   1 
ATOM   1396 O O   . VAL A 1 198 ? 23.397 -37.455 -22.882 1.00   40.10  ? 801  VAL A O   1 
ATOM   1397 C CB  . VAL A 1 198 ? 25.114 -39.058 -20.867 1.00   42.10  ? 801  VAL A CB  1 
ATOM   1398 C CG1 . VAL A 1 198 ? 25.819 -37.915 -20.145 1.00   42.72  ? 801  VAL A CG1 1 
ATOM   1399 C CG2 . VAL A 1 198 ? 25.406 -40.358 -20.151 1.00   43.62  ? 801  VAL A CG2 1 
ATOM   1400 N N   . THR A 1 199 ? 23.062 -36.444 -20.916 1.00   35.18  ? 802  THR A N   1 
ATOM   1401 C CA  . THR A 1 199 ? 23.050 -35.114 -21.499 1.00   36.06  ? 802  THR A CA  1 
ATOM   1402 C C   . THR A 1 199 ? 24.464 -34.554 -21.443 1.00   36.67  ? 802  THR A C   1 
ATOM   1403 O O   . THR A 1 199 ? 25.156 -34.674 -20.419 1.00   30.65  ? 802  THR A O   1 
ATOM   1404 C CB  . THR A 1 199 ? 22.069 -34.172 -20.779 1.00   36.06  ? 802  THR A CB  1 
ATOM   1405 O OG1 . THR A 1 199 ? 20.749 -34.673 -20.945 1.00   44.32  ? 802  THR A OG1 1 
ATOM   1406 C CG2 . THR A 1 199 ? 22.130 -32.756 -21.347 1.00   32.38  ? 802  THR A CG2 1 
ATOM   1407 N N   . HIS A 1 200 ? 24.881 -33.947 -22.554 1.00   33.09  ? 803  HIS A N   1 
ATOM   1408 C CA  . HIS A 1 200 ? 26.227 -33.419 -22.711 1.00   30.25  ? 803  HIS A CA  1 
ATOM   1409 C C   . HIS A 1 200 ? 26.139 -31.949 -23.098 1.00   33.87  ? 803  HIS A C   1 
ATOM   1410 O O   . HIS A 1 200 ? 25.485 -31.598 -24.074 1.00   34.08  ? 803  HIS A O   1 
ATOM   1411 C CB  . HIS A 1 200 ? 26.984 -34.236 -23.762 1.00   28.29  ? 803  HIS A CB  1 
ATOM   1412 C CG  . HIS A 1 200 ? 28.422 -33.844 -23.952 1.00   32.53  ? 803  HIS A CG  1 
ATOM   1413 N ND1 . HIS A 1 200 ? 28.815 -32.812 -24.781 1.00   32.58  ? 803  HIS A ND1 1 
ATOM   1414 C CD2 . HIS A 1 200 ? 29.564 -34.392 -23.466 1.00   29.01  ? 803  HIS A CD2 1 
ATOM   1415 C CE1 . HIS A 1 200 ? 30.135 -32.724 -24.776 1.00   32.12  ? 803  HIS A CE1 1 
ATOM   1416 N NE2 . HIS A 1 200 ? 30.613 -33.670 -23.986 1.00   31.13  ? 803  HIS A NE2 1 
ATOM   1417 N N   . LEU A 1 201 ? 26.774 -31.077 -22.323 1.00   33.41  ? 804  LEU A N   1 
ATOM   1418 C CA  . LEU A 1 201 ? 26.782 -29.661 -22.665 1.00   30.91  ? 804  LEU A CA  1 
ATOM   1419 C C   . LEU A 1 201 ? 28.205 -29.191 -22.941 1.00   35.56  ? 804  LEU A C   1 
ATOM   1420 O O   . LEU A 1 201 ? 29.098 -29.359 -22.101 1.00   35.44  ? 804  LEU A O   1 
ATOM   1421 C CB  . LEU A 1 201 ? 26.157 -28.826 -21.550 1.00   32.68  ? 804  LEU A CB  1 
ATOM   1422 C CG  . LEU A 1 201 ? 24.742 -29.180 -21.091 1.00   33.30  ? 804  LEU A CG  1 
ATOM   1423 C CD1 . LEU A 1 201 ? 24.313 -28.232 -19.967 1.00   31.49  ? 804  LEU A CD1 1 
ATOM   1424 C CD2 . LEU A 1 201 ? 23.769 -29.112 -22.251 1.00   34.54  ? 804  LEU A CD2 1 
ATOM   1425 N N   . GLN A 1 202 ? 28.416 -28.611 -24.120 1.00   30.05  ? 805  GLN A N   1 
ATOM   1426 C CA  . GLN A 1 202 ? 29.719 -28.070 -24.481 1.00   30.65  ? 805  GLN A CA  1 
ATOM   1427 C C   . GLN A 1 202 ? 29.645 -26.561 -24.643 1.00   32.94  ? 805  GLN A C   1 
ATOM   1428 O O   . GLN A 1 202 ? 29.091 -26.063 -25.609 1.00   34.38  ? 805  GLN A O   1 
ATOM   1429 C CB  . GLN A 1 202 ? 30.259 -28.689 -25.775 1.00   29.51  ? 805  GLN A CB  1 
ATOM   1430 C CG  . GLN A 1 202 ? 31.690 -28.276 -26.042 1.00   26.43  ? 805  GLN A CG  1 
ATOM   1431 C CD  . GLN A 1 202 ? 32.151 -28.551 -27.458 1.00   34.69  ? 805  GLN A CD  1 
ATOM   1432 O OE1 . GLN A 1 202 ? 31.356 -28.921 -28.328 1.00   32.88  ? 805  GLN A OE1 1 
ATOM   1433 N NE2 . GLN A 1 202 ? 33.449 -28.352 -27.706 1.00   26.56  ? 805  GLN A NE2 1 
ATOM   1434 N N   . TYR A 1 203 ? 30.196 -25.835 -23.683 1.00   33.05  ? 806  TYR A N   1 
ATOM   1435 C CA  . TYR A 1 203 ? 30.304 -24.395 -23.802 1.00   31.59  ? 806  TYR A CA  1 
ATOM   1436 C C   . TYR A 1 203 ? 31.492 -24.083 -24.702 1.00   34.55  ? 806  TYR A C   1 
ATOM   1437 O O   . TYR A 1 203 ? 32.622 -24.429 -24.364 1.00   34.22  ? 806  TYR A O   1 
ATOM   1438 C CB  . TYR A 1 203 ? 30.476 -23.768 -22.423 1.00   29.63  ? 806  TYR A CB  1 
ATOM   1439 C CG  . TYR A 1 203 ? 30.031 -22.343 -22.324 1.00   30.94  ? 806  TYR A CG  1 
ATOM   1440 C CD1 . TYR A 1 203 ? 30.882 -21.303 -22.676 1.00   30.80  ? 806  TYR A CD1 1 
ATOM   1441 C CD2 . TYR A 1 203 ? 28.758 -22.027 -21.863 1.00   32.59  ? 806  TYR A CD2 1 
ATOM   1442 C CE1 . TYR A 1 203 ? 30.479 -19.984 -22.571 1.00   28.38  ? 806  TYR A CE1 1 
ATOM   1443 C CE2 . TYR A 1 203 ? 28.346 -20.708 -21.756 1.00   33.47  ? 806  TYR A CE2 1 
ATOM   1444 C CZ  . TYR A 1 203 ? 29.212 -19.690 -22.113 1.00   30.09  ? 806  TYR A CZ  1 
ATOM   1445 O OH  . TYR A 1 203 ? 28.808 -18.378 -22.005 1.00   33.08  ? 806  TYR A OH  1 
ATOM   1446 N N   . VAL A 1 204 ? 31.244 -23.442 -25.846 1.00   31.88  ? 807  VAL A N   1 
ATOM   1447 C CA  . VAL A 1 204 ? 32.319 -23.165 -26.798 1.00   30.09  ? 807  VAL A CA  1 
ATOM   1448 C C   . VAL A 1 204 ? 32.764 -21.709 -26.835 1.00   32.17  ? 807  VAL A C   1 
ATOM   1449 O O   . VAL A 1 204 ? 33.717 -21.391 -27.538 1.00   35.03  ? 807  VAL A O   1 
ATOM   1450 C CB  . VAL A 1 204 ? 31.930 -23.559 -28.252 1.00   33.64  ? 807  VAL A CB  1 
ATOM   1451 C CG1 . VAL A 1 204 ? 31.805 -25.071 -28.394 1.00   32.58  ? 807  VAL A CG1 1 
ATOM   1452 C CG2 . VAL A 1 204 ? 30.651 -22.854 -28.681 1.00   27.69  ? 807  VAL A CG2 1 
ATOM   1453 N N   . ALA A 1 205 ? 32.100 -20.821 -26.103 1.00   29.40  ? 808  ALA A N   1 
ATOM   1454 C CA  . ALA A 1 205 ? 32.490 -19.411 -26.167 1.00   34.62  ? 808  ALA A CA  1 
ATOM   1455 C C   . ALA A 1 205 ? 33.223 -18.945 -24.889 1.00   31.75  ? 808  ALA A C   1 
ATOM   1456 O O   . ALA A 1 205 ? 32.839 -17.969 -24.241 1.00   32.11  ? 808  ALA A O   1 
ATOM   1457 C CB  . ALA A 1 205 ? 31.263 -18.537 -26.453 1.00   25.57  ? 808  ALA A CB  1 
ATOM   1458 N N   . TRP A 1 206 ? 34.297 -19.645 -24.549 1.00   30.04  ? 809  TRP A N   1 
ATOM   1459 C CA  . TRP A 1 206 ? 35.024 -19.404 -23.301 1.00   31.70  ? 809  TRP A CA  1 
ATOM   1460 C C   . TRP A 1 206 ? 36.464 -19.894 -23.455 1.00   32.24  ? 809  TRP A C   1 
ATOM   1461 O O   . TRP A 1 206 ? 36.763 -21.041 -23.162 1.00   34.50  ? 809  TRP A O   1 
ATOM   1462 C CB  . TRP A 1 206 ? 34.319 -20.119 -22.140 1.00   27.96  ? 809  TRP A CB  1 
ATOM   1463 C CG  . TRP A 1 206 ? 34.772 -19.774 -20.738 1.00   32.31  ? 809  TRP A CG  1 
ATOM   1464 C CD1 . TRP A 1 206 ? 35.819 -18.976 -20.375 1.00   32.13  ? 809  TRP A CD1 1 
ATOM   1465 C CD2 . TRP A 1 206 ? 34.177 -20.232 -19.514 1.00   31.45  ? 809  TRP A CD2 1 
ATOM   1466 N NE1 . TRP A 1 206 ? 35.903 -18.892 -19.005 1.00   27.96  ? 809  TRP A NE1 1 
ATOM   1467 C CE2 . TRP A 1 206 ? 34.913 -19.659 -18.453 1.00   31.24  ? 809  TRP A CE2 1 
ATOM   1468 C CE3 . TRP A 1 206 ? 33.094 -21.071 -19.215 1.00   28.06  ? 809  TRP A CE3 1 
ATOM   1469 C CZ2 . TRP A 1 206 ? 34.600 -19.902 -17.109 1.00   30.15  ? 809  TRP A CZ2 1 
ATOM   1470 C CZ3 . TRP A 1 206 ? 32.784 -21.305 -17.883 1.00   29.76  ? 809  TRP A CZ3 1 
ATOM   1471 C CH2 . TRP A 1 206 ? 33.535 -20.719 -16.847 1.00   29.72  ? 809  TRP A CH2 1 
ATOM   1472 N N   . PRO A 1 207 ? 37.361 -19.028 -23.936 1.00   32.11  ? 810  PRO A N   1 
ATOM   1473 C CA  . PRO A 1 207 ? 38.768 -19.395 -24.134 1.00   29.80  ? 810  PRO A CA  1 
ATOM   1474 C C   . PRO A 1 207 ? 39.519 -19.793 -22.850 1.00   36.41  ? 810  PRO A C   1 
ATOM   1475 O O   . PRO A 1 207 ? 39.310 -19.198 -21.780 1.00   32.25  ? 810  PRO A O   1 
ATOM   1476 C CB  . PRO A 1 207 ? 39.374 -18.121 -24.713 1.00   28.27  ? 810  PRO A CB  1 
ATOM   1477 C CG  . PRO A 1 207 ? 38.523 -17.045 -24.195 1.00   34.68  ? 810  PRO A CG  1 
ATOM   1478 C CD  . PRO A 1 207 ? 37.131 -17.597 -24.172 1.00   32.25  ? 810  PRO A CD  1 
ATOM   1479 N N   . ALA A 1 208 ? 40.394 -20.791 -22.977 1.00   33.60  ? 811  ALA A N   1 
ATOM   1480 C CA  . ALA A 1 208 ? 41.256 -21.220 -21.885 1.00   32.81  ? 811  ALA A CA  1 
ATOM   1481 C C   . ALA A 1 208 ? 41.970 -20.030 -21.269 1.00   34.08  ? 811  ALA A C   1 
ATOM   1482 O O   . ALA A 1 208 ? 42.380 -19.116 -21.974 1.00   34.10  ? 811  ALA A O   1 
ATOM   1483 C CB  . ALA A 1 208 ? 42.262 -22.241 -22.369 1.00   33.38  ? 811  ALA A CB  1 
ATOM   1484 N N   . HIS A 1 209 ? 42.097 -20.058 -19.943 1.00   37.82  ? 812  HIS A N   1 
ATOM   1485 C CA  . HIS A 1 209 ? 42.744 -19.009 -19.148 1.00   41.02  ? 812  HIS A CA  1 
ATOM   1486 C C   . HIS A 1 209 ? 41.986 -17.675 -19.216 1.00   39.03  ? 812  HIS A C   1 
ATOM   1487 O O   . HIS A 1 209 ? 42.511 -16.647 -18.802 1.00   40.55  ? 812  HIS A O   1 
ATOM   1488 C CB  . HIS A 1 209 ? 44.204 -18.791 -19.581 1.00   33.91  ? 812  HIS A CB  1 
ATOM   1489 C CG  . HIS A 1 209 ? 44.917 -20.047 -19.976 1.00   40.44  ? 812  HIS A CG  1 
ATOM   1490 N ND1 . HIS A 1 209 ? 45.181 -21.068 -19.087 1.00   43.63  ? 812  HIS A ND1 1 
ATOM   1491 C CD2 . HIS A 1 209 ? 45.412 -20.454 -21.171 1.00   32.87  ? 812  HIS A CD2 1 
ATOM   1492 C CE1 . HIS A 1 209 ? 45.816 -22.043 -19.713 1.00   38.20  ? 812  HIS A CE1 1 
ATOM   1493 N NE2 . HIS A 1 209 ? 45.966 -21.698 -20.980 1.00   33.75  ? 812  HIS A NE2 1 
ATOM   1494 N N   . GLY A 1 210 ? 40.749 -17.693 -19.709 1.00   39.93  ? 813  GLY A N   1 
ATOM   1495 C CA  . GLY A 1 210 ? 39.952 -16.477 -19.792 1.00   35.52  ? 813  GLY A CA  1 
ATOM   1496 C C   . GLY A 1 210 ? 38.540 -16.552 -19.230 1.00   33.92  ? 813  GLY A C   1 
ATOM   1497 O O   . GLY A 1 210 ? 38.155 -17.525 -18.598 1.00   34.88  ? 813  GLY A O   1 
ATOM   1498 N N   . VAL A 1 211 ? 37.765 -15.508 -19.491 1.00   33.53  ? 814  VAL A N   1 
ATOM   1499 C CA  . VAL A 1 211 ? 36.383 -15.391 -19.048 1.00   31.49  ? 814  VAL A CA  1 
ATOM   1500 C C   . VAL A 1 211 ? 35.436 -15.683 -20.209 1.00   34.60  ? 814  VAL A C   1 
ATOM   1501 O O   . VAL A 1 211 ? 35.833 -15.563 -21.370 1.00   38.74  ? 814  VAL A O   1 
ATOM   1502 C CB  . VAL A 1 211 ? 36.114 -13.973 -18.503 1.00   40.61  ? 814  VAL A CB  1 
ATOM   1503 C CG1 . VAL A 1 211 ? 37.041 -13.681 -17.324 1.00   36.65  ? 814  VAL A CG1 1 
ATOM   1504 C CG2 . VAL A 1 211 ? 36.343 -12.942 -19.601 1.00   29.48  ? 814  VAL A CG2 1 
ATOM   1505 N N   . PRO A 1 212 ? 34.184 -16.075 -19.910 1.00   36.12  ? 815  PRO A N   1 
ATOM   1506 C CA  . PRO A 1 212 ? 33.181 -16.277 -20.967 1.00   33.16  ? 815  PRO A CA  1 
ATOM   1507 C C   . PRO A 1 212 ? 33.130 -15.101 -21.930 1.00   35.43  ? 815  PRO A C   1 
ATOM   1508 O O   . PRO A 1 212 ? 33.339 -13.970 -21.503 1.00   36.01  ? 815  PRO A O   1 
ATOM   1509 C CB  . PRO A 1 212 ? 31.870 -16.386 -20.195 1.00   36.11  ? 815  PRO A CB  1 
ATOM   1510 C CG  . PRO A 1 212 ? 32.287 -16.912 -18.848 1.00   39.03  ? 815  PRO A CG  1 
ATOM   1511 C CD  . PRO A 1 212 ? 33.629 -16.311 -18.564 1.00   35.15  ? 815  PRO A CD  1 
ATOM   1512 N N   . ASP A 1 213 ? 32.881 -15.363 -23.207 1.00   38.76  ? 816  ASP A N   1 
ATOM   1513 C CA  . ASP A 1 213 ? 32.764 -14.294 -24.186 1.00   33.59  ? 816  ASP A CA  1 
ATOM   1514 C C   . ASP A 1 213 ? 31.609 -13.371 -23.822 1.00   40.81  ? 816  ASP A C   1 
ATOM   1515 O O   . ASP A 1 213 ? 31.700 -12.155 -23.988 1.00   40.22  ? 816  ASP A O   1 
ATOM   1516 C CB  . ASP A 1 213 ? 32.578 -14.867 -25.590 1.00   35.68  ? 816  ASP A CB  1 
ATOM   1517 C CG  . ASP A 1 213 ? 33.848 -15.542 -26.109 1.00   52.78  ? 816  ASP A CG  1 
ATOM   1518 O OD1 . ASP A 1 213 ? 34.936 -15.228 -25.555 1.00   52.79  ? 816  ASP A OD1 1 
ATOM   1519 O OD2 . ASP A 1 213 ? 33.771 -16.367 -27.061 1.00   48.76  ? 816  ASP A OD2 1 
ATOM   1520 N N   . ASP A 1 214 ? 30.536 -13.949 -23.289 1.00   41.77  ? 817  ASP A N   1 
ATOM   1521 C CA  . ASP A 1 214 ? 29.366 -13.171 -22.904 1.00   41.81  ? 817  ASP A CA  1 
ATOM   1522 C C   . ASP A 1 214 ? 28.841 -13.558 -21.524 1.00   41.93  ? 817  ASP A C   1 
ATOM   1523 O O   . ASP A 1 214 ? 28.422 -14.693 -21.303 1.00   44.07  ? 817  ASP A O   1 
ATOM   1524 C CB  . ASP A 1 214 ? 28.251 -13.335 -23.937 1.00   41.22  ? 817  ASP A CB  1 
ATOM   1525 C CG  . ASP A 1 214 ? 27.038 -12.496 -23.606 1.00   50.63  ? 817  ASP A CG  1 
ATOM   1526 O OD1 . ASP A 1 214 ? 26.211 -12.929 -22.769 1.00   50.16  ? 817  ASP A OD1 1 
ATOM   1527 O OD2 . ASP A 1 214 ? 26.920 -11.389 -24.171 1.00   62.67  ? 817  ASP A OD2 1 
ATOM   1528 N N   . SER A 1 215 ? 28.805 -12.594 -20.613 1.00   42.65  ? 818  SER A N   1 
ATOM   1529 C CA  A SER A 1 215 ? 28.432 -12.852 -19.223 0.51   44.42  ? 818  SER A CA  1 
ATOM   1530 C CA  B SER A 1 215 ? 28.444 -12.877 -19.230 0.49   44.41  ? 818  SER A CA  1 
ATOM   1531 C C   . SER A 1 215 ? 26.992 -13.331 -19.057 1.00   43.67  ? 818  SER A C   1 
ATOM   1532 O O   . SER A 1 215 ? 26.695 -14.158 -18.196 1.00   43.53  ? 818  SER A O   1 
ATOM   1533 C CB  A SER A 1 215 ? 28.642 -11.592 -18.384 0.51   46.13  ? 818  SER A CB  1 
ATOM   1534 C CB  B SER A 1 215 ? 28.717 -11.644 -18.372 0.49   46.12  ? 818  SER A CB  1 
ATOM   1535 O OG  A SER A 1 215 ? 27.824 -10.534 -18.852 0.51   47.13  ? 818  SER A OG  1 
ATOM   1536 O OG  B SER A 1 215 ? 30.039 -11.182 -18.596 0.49   42.90  ? 818  SER A OG  1 
ATOM   1537 N N   . SER A 1 216 ? 26.089 -12.802 -19.871 1.00   43.68  ? 819  SER A N   1 
ATOM   1538 C CA  . SER A 1 216 ? 24.687 -13.177 -19.746 1.00   42.33  ? 819  SER A CA  1 
ATOM   1539 C C   . SER A 1 216 ? 24.408 -14.606 -20.220 1.00   41.69  ? 819  SER A C   1 
ATOM   1540 O O   . SER A 1 216 ? 23.588 -15.308 -19.626 1.00   40.27  ? 819  SER A O   1 
ATOM   1541 C CB  . SER A 1 216 ? 23.832 -12.185 -20.509 1.00   42.43  ? 819  SER A CB  1 
ATOM   1542 O OG  . SER A 1 216 ? 24.182 -10.880 -20.102 1.00   54.48  ? 819  SER A OG  1 
ATOM   1543 N N   . ASP A 1 217 ? 25.087 -15.029 -21.285 1.00   37.30  ? 820  ASP A N   1 
ATOM   1544 C CA  . ASP A 1 217 ? 25.074 -16.431 -21.714 1.00   41.05  ? 820  ASP A CA  1 
ATOM   1545 C C   . ASP A 1 217 ? 25.623 -17.352 -20.624 1.00   45.19  ? 820  ASP A C   1 
ATOM   1546 O O   . ASP A 1 217 ? 25.128 -18.468 -20.427 1.00   38.45  ? 820  ASP A O   1 
ATOM   1547 C CB  . ASP A 1 217 ? 25.900 -16.632 -22.992 1.00   36.69  ? 820  ASP A CB  1 
ATOM   1548 C CG  . ASP A 1 217 ? 25.347 -15.859 -24.172 1.00   47.22  ? 820  ASP A CG  1 
ATOM   1549 O OD1 . ASP A 1 217 ? 24.163 -15.456 -24.106 1.00   49.85  ? 820  ASP A OD1 1 
ATOM   1550 O OD2 . ASP A 1 217 ? 26.090 -15.657 -25.159 1.00   44.93  ? 820  ASP A OD2 1 
ATOM   1551 N N   . PHE A 1 218 ? 26.661 -16.883 -19.930 1.00   40.18  ? 821  PHE A N   1 
ATOM   1552 C CA  . PHE A 1 218 ? 27.262 -17.665 -18.874 1.00   36.72  ? 821  PHE A CA  1 
ATOM   1553 C C   . PHE A 1 218 ? 26.250 -17.929 -17.767 1.00   36.77  ? 821  PHE A C   1 
ATOM   1554 O O   . PHE A 1 218 ? 26.033 -19.085 -17.379 1.00   34.65  ? 821  PHE A O   1 
ATOM   1555 C CB  . PHE A 1 218 ? 28.498 -16.968 -18.310 1.00   39.94  ? 821  PHE A CB  1 
ATOM   1556 C CG  . PHE A 1 218 ? 29.072 -17.666 -17.125 1.00   37.14  ? 821  PHE A CG  1 
ATOM   1557 C CD1 . PHE A 1 218 ? 29.827 -18.816 -17.285 1.00   41.08  ? 821  PHE A CD1 1 
ATOM   1558 C CD2 . PHE A 1 218 ? 28.820 -17.204 -15.842 1.00   39.34  ? 821  PHE A CD2 1 
ATOM   1559 C CE1 . PHE A 1 218 ? 30.336 -19.486 -16.179 1.00   44.03  ? 821  PHE A CE1 1 
ATOM   1560 C CE2 . PHE A 1 218 ? 29.332 -17.861 -14.737 1.00   39.68  ? 821  PHE A CE2 1 
ATOM   1561 C CZ  . PHE A 1 218 ? 30.089 -19.001 -14.902 1.00   42.12  ? 821  PHE A CZ  1 
ATOM   1562 N N   . LEU A 1 219 ? 25.637 -16.859 -17.264 1.00   35.98  ? 822  LEU A N   1 
ATOM   1563 C CA  . LEU A 1 219 ? 24.654 -16.974 -16.188 1.00   34.24  ? 822  LEU A CA  1 
ATOM   1564 C C   . LEU A 1 219 ? 23.462 -17.836 -16.623 1.00   36.98  ? 822  LEU A C   1 
ATOM   1565 O O   . LEU A 1 219 ? 22.954 -18.659 -15.848 1.00   32.85  ? 822  LEU A O   1 
ATOM   1566 C CB  . LEU A 1 219 ? 24.182 -15.591 -15.750 1.00   34.34  ? 822  LEU A CB  1 
ATOM   1567 C CG  . LEU A 1 219 ? 25.221 -14.712 -15.062 1.00   40.82  ? 822  LEU A CG  1 
ATOM   1568 C CD1 . LEU A 1 219 ? 24.661 -13.331 -14.793 1.00   42.00  ? 822  LEU A CD1 1 
ATOM   1569 C CD2 . LEU A 1 219 ? 25.700 -15.366 -13.763 1.00   44.67  ? 822  LEU A CD2 1 
ATOM   1570 N N   . GLU A 1 220 ? 23.035 -17.648 -17.874 1.00   36.34  ? 823  GLU A N   1 
ATOM   1571 C CA  . GLU A 1 220 ? 22.005 -18.481 -18.484 1.00   38.34  ? 823  GLU A CA  1 
ATOM   1572 C C   . GLU A 1 220 ? 22.408 -19.953 -18.384 1.00   36.52  ? 823  GLU A C   1 
ATOM   1573 O O   . GLU A 1 220 ? 21.660 -20.800 -17.879 1.00   36.04  ? 823  GLU A O   1 
ATOM   1574 C CB  . GLU A 1 220 ? 21.806 -18.085 -19.950 1.00   49.70  ? 823  GLU A CB  1 
ATOM   1575 C CG  . GLU A 1 220 ? 20.422 -17.615 -20.330 1.00   45.43  ? 823  GLU A CG  1 
ATOM   1576 C CD  . GLU A 1 220 ? 20.385 -17.031 -21.747 1.00   69.18  ? 823  GLU A CD  1 
ATOM   1577 O OE1 . GLU A 1 220 ? 21.268 -17.368 -22.592 1.00   49.49  ? 823  GLU A OE1 1 
ATOM   1578 O OE2 . GLU A 1 220 ? 19.467 -16.222 -22.008 1.00   76.97  ? 823  GLU A OE2 1 
ATOM   1579 N N   . PHE A 1 221 ? 23.620 -20.227 -18.852 1.00   31.21  ? 824  PHE A N   1 
ATOM   1580 C CA  . PHE A 1 221 ? 24.164 -21.572 -18.905 1.00   36.83  ? 824  PHE A CA  1 
ATOM   1581 C C   . PHE A 1 221 ? 24.216 -22.249 -17.541 1.00   34.75  ? 824  PHE A C   1 
ATOM   1582 O O   . PHE A 1 221 ? 23.846 -23.418 -17.391 1.00   32.76  ? 824  PHE A O   1 
ATOM   1583 C CB  . PHE A 1 221 ? 25.569 -21.533 -19.515 1.00   40.83  ? 824  PHE A CB  1 
ATOM   1584 C CG  . PHE A 1 221 ? 26.183 -22.882 -19.698 1.00   38.14  ? 824  PHE A CG  1 
ATOM   1585 C CD1 . PHE A 1 221 ? 25.852 -23.658 -20.790 1.00   30.67  ? 824  PHE A CD1 1 
ATOM   1586 C CD2 . PHE A 1 221 ? 27.078 -23.386 -18.766 1.00   37.48  ? 824  PHE A CD2 1 
ATOM   1587 C CE1 . PHE A 1 221 ? 26.406 -24.909 -20.964 1.00   33.32  ? 824  PHE A CE1 1 
ATOM   1588 C CE2 . PHE A 1 221 ? 27.635 -24.644 -18.937 1.00   38.47  ? 824  PHE A CE2 1 
ATOM   1589 C CZ  . PHE A 1 221 ? 27.302 -25.399 -20.046 1.00   33.29  ? 824  PHE A CZ  1 
ATOM   1590 N N   . VAL A 1 222 ? 24.692 -21.502 -16.556 1.00   33.57  ? 825  VAL A N   1 
ATOM   1591 C CA  . VAL A 1 222 ? 24.862 -22.028 -15.216 1.00   37.61  ? 825  VAL A CA  1 
ATOM   1592 C C   . VAL A 1 222 ? 23.506 -22.425 -14.656 1.00   37.93  ? 825  VAL A C   1 
ATOM   1593 O O   . VAL A 1 222 ? 23.372 -23.463 -14.004 1.00   37.94  ? 825  VAL A O   1 
ATOM   1594 C CB  . VAL A 1 222 ? 25.567 -20.998 -14.299 1.00   38.37  ? 825  VAL A CB  1 
ATOM   1595 C CG1 . VAL A 1 222 ? 25.581 -21.465 -12.866 1.00   35.07  ? 825  VAL A CG1 1 
ATOM   1596 C CG2 . VAL A 1 222 ? 26.984 -20.759 -14.791 1.00   40.12  ? 825  VAL A CG2 1 
ATOM   1597 N N   . ASN A 1 223 ? 22.494 -21.612 -14.944 1.00   37.77  ? 826  ASN A N   1 
ATOM   1598 C CA  . ASN A 1 223 ? 21.124 -21.935 -14.557 1.00   36.70  ? 826  ASN A CA  1 
ATOM   1599 C C   . ASN A 1 223 ? 20.576 -23.158 -15.296 1.00   37.19  ? 826  ASN A C   1 
ATOM   1600 O O   . ASN A 1 223 ? 19.862 -23.980 -14.716 1.00   38.22  ? 826  ASN A O   1 
ATOM   1601 C CB  . ASN A 1 223 ? 20.230 -20.724 -14.778 1.00   42.04  ? 826  ASN A CB  1 
ATOM   1602 C CG  . ASN A 1 223 ? 20.259 -19.772 -13.596 1.00   52.96  ? 826  ASN A CG  1 
ATOM   1603 O OD1 . ASN A 1 223 ? 19.932 -20.157 -12.458 1.00   57.52  ? 826  ASN A OD1 1 
ATOM   1604 N ND2 . ASN A 1 223 ? 20.672 -18.530 -13.844 1.00   42.73  ? 826  ASN A ND2 1 
ATOM   1605 N N   . TYR A 1 224 ? 20.939 -23.298 -16.565 1.00   35.03  ? 827  TYR A N   1 
ATOM   1606 C CA  . TYR A 1 224 ? 20.625 -24.521 -17.304 1.00   44.61  ? 827  TYR A CA  1 
ATOM   1607 C C   . TYR A 1 224 ? 21.216 -25.763 -16.590 1.00   42.14  ? 827  TYR A C   1 
ATOM   1608 O O   . TYR A 1 224 ? 20.516 -26.750 -16.345 1.00   40.97  ? 827  TYR A O   1 
ATOM   1609 C CB  . TYR A 1 224 ? 21.147 -24.407 -18.743 1.00   42.38  ? 827  TYR A CB  1 
ATOM   1610 C CG  . TYR A 1 224 ? 20.714 -25.517 -19.675 1.00   57.03  ? 827  TYR A CG  1 
ATOM   1611 C CD1 . TYR A 1 224 ? 19.648 -26.370 -19.349 1.00   56.60  ? 827  TYR A CD1 1 
ATOM   1612 C CD2 . TYR A 1 224 ? 21.368 -25.715 -20.893 1.00   50.26  ? 827  TYR A CD2 1 
ATOM   1613 C CE1 . TYR A 1 224 ? 19.253 -27.392 -20.217 1.00   51.95  ? 827  TYR A CE1 1 
ATOM   1614 C CE2 . TYR A 1 224 ? 20.978 -26.725 -21.766 1.00   48.54  ? 827  TYR A CE2 1 
ATOM   1615 C CZ  . TYR A 1 224 ? 19.925 -27.562 -21.428 1.00   56.11  ? 827  TYR A CZ  1 
ATOM   1616 O OH  . TYR A 1 224 ? 19.554 -28.569 -22.310 1.00   61.86  ? 827  TYR A OH  1 
ATOM   1617 N N   . VAL A 1 225 ? 22.499 -25.690 -16.242 1.00   42.43  ? 828  VAL A N   1 
ATOM   1618 C CA  . VAL A 1 225 ? 23.177 -26.755 -15.506 1.00   37.52  ? 828  VAL A CA  1 
ATOM   1619 C C   . VAL A 1 225 ? 22.459 -27.106 -14.196 1.00   39.99  ? 828  VAL A C   1 
ATOM   1620 O O   . VAL A 1 225 ? 22.229 -28.282 -13.907 1.00   39.86  ? 828  VAL A O   1 
ATOM   1621 C CB  . VAL A 1 225 ? 24.637 -26.362 -15.188 1.00   38.94  ? 828  VAL A CB  1 
ATOM   1622 C CG1 . VAL A 1 225 ? 25.274 -27.371 -14.249 1.00   32.06  ? 828  VAL A CG1 1 
ATOM   1623 C CG2 . VAL A 1 225 ? 25.446 -26.214 -16.469 1.00   35.61  ? 828  VAL A CG2 1 
ATOM   1624 N N   . ARG A 1 226 ? 22.101 -26.092 -13.407 1.00   40.98  ? 829  ARG A N   1 
ATOM   1625 C CA  . ARG A 1 226 ? 21.389 -26.334 -12.141 1.00   42.61  ? 829  ARG A CA  1 
ATOM   1626 C C   . ARG A 1 226 ? 20.036 -27.014 -12.362 1.00   41.39  ? 829  ARG A C   1 
ATOM   1627 O O   . ARG A 1 226 ? 19.639 -27.879 -11.587 1.00   36.61  ? 829  ARG A O   1 
ATOM   1628 C CB  . ARG A 1 226 ? 21.175 -25.031 -11.360 1.00   38.89  ? 829  ARG A CB  1 
ATOM   1629 C CG  . ARG A 1 226 ? 22.444 -24.297 -11.011 1.00   42.65  ? 829  ARG A CG  1 
ATOM   1630 C CD  . ARG A 1 226 ? 22.181 -23.198 -10.011 1.00   45.12  ? 829  ARG A CD  1 
ATOM   1631 N NE  . ARG A 1 226 ? 21.462 -23.673 -8.837  1.00   47.91  ? 829  ARG A NE  1 
ATOM   1632 C CZ  . ARG A 1 226 ? 20.469 -23.009 -8.263  1.00   40.38  ? 829  ARG A CZ  1 
ATOM   1633 N NH1 . ARG A 1 226 ? 20.090 -21.842 -8.746  1.00   39.91  ? 829  ARG A NH1 1 
ATOM   1634 N NH2 . ARG A 1 226 ? 19.863 -23.514 -7.206  1.00   42.58  ? 829  ARG A NH2 1 
ATOM   1635 N N   . SER A 1 227 ? 19.338 -26.636 -13.435 1.00   43.83  ? 830  SER A N   1 
ATOM   1636 C CA  . SER A 1 227 ? 18.009 -27.183 -13.690 1.00   44.46  ? 830  SER A CA  1 
ATOM   1637 C C   . SER A 1 227 ? 18.096 -28.635 -14.180 1.00   49.09  ? 830  SER A C   1 
ATOM   1638 O O   . SER A 1 227 ? 17.150 -29.408 -13.999 1.00   45.42  ? 830  SER A O   1 
ATOM   1639 C CB  . SER A 1 227 ? 17.240 -26.303 -14.683 1.00   42.17  ? 830  SER A CB  1 
ATOM   1640 O OG  . SER A 1 227 ? 17.383 -26.743 -16.011 1.00   44.93  ? 830  SER A OG  1 
ATOM   1641 N N   . LEU A 1 228 ? 19.242 -29.004 -14.760 1.00   46.70  ? 831  LEU A N   1 
ATOM   1642 C CA  . LEU A 1 228 ? 19.488 -30.375 -15.215 1.00   42.17  ? 831  LEU A CA  1 
ATOM   1643 C C   . LEU A 1 228 ? 20.048 -31.293 -14.130 1.00   43.68  ? 831  LEU A C   1 
ATOM   1644 O O   . LEU A 1 228 ? 20.021 -32.518 -14.272 1.00   43.54  ? 831  LEU A O   1 
ATOM   1645 C CB  . LEU A 1 228 ? 20.441 -30.369 -16.411 1.00   44.09  ? 831  LEU A CB  1 
ATOM   1646 C CG  . LEU A 1 228 ? 19.809 -29.939 -17.735 1.00   48.64  ? 831  LEU A CG  1 
ATOM   1647 C CD1 . LEU A 1 228 ? 20.794 -30.072 -18.876 1.00   37.89  ? 831  LEU A CD1 1 
ATOM   1648 C CD2 . LEU A 1 228 ? 18.569 -30.775 -17.979 1.00   49.91  ? 831  LEU A CD2 1 
ATOM   1649 N N   . ARG A 1 229 ? 20.549 -30.700 -13.050 1.00   47.87  ? 832  ARG A N   1 
ATOM   1650 C CA  . ARG A 1 229 ? 21.183 -31.462 -11.972 1.00   46.63  ? 832  ARG A CA  1 
ATOM   1651 C C   . ARG A 1 229 ? 20.230 -32.467 -11.336 1.00   39.67  ? 832  ARG A C   1 
ATOM   1652 O O   . ARG A 1 229 ? 19.086 -32.142 -11.063 1.00   45.53  ? 832  ARG A O   1 
ATOM   1653 C CB  . ARG A 1 229 ? 21.728 -30.516 -10.898 1.00   38.68  ? 832  ARG A CB  1 
ATOM   1654 C CG  . ARG A 1 229 ? 22.339 -31.233 -9.712  1.00   37.52  ? 832  ARG A CG  1 
ATOM   1655 C CD  . ARG A 1 229 ? 22.839 -30.275 -8.642  1.00   35.98  ? 832  ARG A CD  1 
ATOM   1656 N NE  . ARG A 1 229 ? 24.138 -29.682 -8.941  1.00   34.98  ? 832  ARG A NE  1 
ATOM   1657 C CZ  . ARG A 1 229 ? 25.306 -30.321 -8.853  1.00   38.31  ? 832  ARG A CZ  1 
ATOM   1658 N NH1 . ARG A 1 229 ? 25.358 -31.594 -8.489  1.00   33.81  ? 832  ARG A NH1 1 
ATOM   1659 N NH2 . ARG A 1 229 ? 26.435 -29.684 -9.145  1.00   40.03  ? 832  ARG A NH2 1 
ATOM   1660 N N   . VAL A 1 230 ? 20.712 -33.692 -11.138 1.00   44.81  ? 833  VAL A N   1 
ATOM   1661 C CA  . VAL A 1 230 ? 19.981 -34.727 -10.410 1.00   45.14  ? 833  VAL A CA  1 
ATOM   1662 C C   . VAL A 1 230 ? 20.532 -34.808 -8.990  1.00   53.08  ? 833  VAL A C   1 
ATOM   1663 O O   . VAL A 1 230 ? 21.747 -34.855 -8.793  1.00   54.76  ? 833  VAL A O   1 
ATOM   1664 C CB  . VAL A 1 230 ? 20.100 -36.115 -11.090 1.00   51.81  ? 833  VAL A CB  1 
ATOM   1665 C CG1 . VAL A 1 230 ? 19.357 -37.178 -10.288 1.00   52.77  ? 833  VAL A CG1 1 
ATOM   1666 C CG2 . VAL A 1 230 ? 19.586 -36.067 -12.514 1.00   41.76  ? 833  VAL A CG2 1 
ATOM   1667 N N   . ASP A 1 231 ? 19.650 -34.808 -7.997  1.00   56.85  ? 834  ASP A N   1 
ATOM   1668 C CA  . ASP A 1 231 ? 20.105 -34.789 -6.616  1.00   56.33  ? 834  ASP A CA  1 
ATOM   1669 C C   . ASP A 1 231 ? 20.869 -36.071 -6.288  1.00   50.20  ? 834  ASP A C   1 
ATOM   1670 O O   . ASP A 1 231 ? 20.526 -37.152 -6.757  1.00   50.73  ? 834  ASP A O   1 
ATOM   1671 C CB  . ASP A 1 231 ? 18.924 -34.579 -5.655  1.00   56.90  ? 834  ASP A CB  1 
ATOM   1672 C CG  . ASP A 1 231 ? 17.701 -35.392 -6.040  0.0000 56.40  ? 834  ASP A CG  1 
ATOM   1673 O OD1 . ASP A 1 231 ? 17.061 -35.066 -7.062  0.0000 57.11  ? 834  ASP A OD1 1 
ATOM   1674 O OD2 . ASP A 1 231 ? 17.372 -36.351 -5.311  0.0000 57.33  ? 834  ASP A OD2 1 
ATOM   1675 N N   . SER A 1 232 ? 21.939 -35.913 -5.515  1.00   57.20  ? 835  SER A N   1 
ATOM   1676 C CA  . SER A 1 232 ? 22.789 -37.013 -5.036  1.00   65.66  ? 835  SER A CA  1 
ATOM   1677 C C   . SER A 1 232 ? 23.598 -37.689 -6.145  1.00   56.59  ? 835  SER A C   1 
ATOM   1678 O O   . SER A 1 232 ? 24.323 -38.659 -5.896  1.00   54.38  ? 835  SER A O   1 
ATOM   1679 C CB  . SER A 1 232 ? 21.956 -38.062 -4.289  1.00   61.64  ? 835  SER A CB  1 
ATOM   1680 O OG  . SER A 1 232 ? 21.758 -37.682 -2.937  1.00   73.85  ? 835  SER A OG  1 
ATOM   1681 N N   . GLU A 1 233 ? 23.486 -37.149 -7.352  1.00   50.01  ? 836  GLU A N   1 
ATOM   1682 C CA  . GLU A 1 233 ? 24.262 -37.611 -8.503  1.00   48.72  ? 836  GLU A CA  1 
ATOM   1683 C C   . GLU A 1 233 ? 25.301 -36.538 -8.874  1.00   44.89  ? 836  GLU A C   1 
ATOM   1684 O O   . GLU A 1 233 ? 24.950 -35.368 -9.056  1.00   44.61  ? 836  GLU A O   1 
ATOM   1685 C CB  . GLU A 1 233 ? 23.315 -37.907 -9.669  1.00   43.09  ? 836  GLU A CB  1 
ATOM   1686 C CG  . GLU A 1 233 ? 23.943 -38.420 -10.931 1.00   46.44  ? 836  GLU A CG  1 
ATOM   1687 C CD  . GLU A 1 233 ? 22.962 -38.392 -12.101 1.00   51.65  ? 836  GLU A CD  1 
ATOM   1688 O OE1 . GLU A 1 233 ? 22.034 -39.232 -12.139 1.00   51.30  ? 836  GLU A OE1 1 
ATOM   1689 O OE2 . GLU A 1 233 ? 23.107 -37.514 -12.981 1.00   52.57  ? 836  GLU A OE2 1 
ATOM   1690 N N   . PRO A 1 234 ? 26.587 -36.909 -8.946  1.00   41.30  ? 837  PRO A N   1 
ATOM   1691 C CA  . PRO A 1 234 ? 27.560 -35.872 -9.330  1.00   40.37  ? 837  PRO A CA  1 
ATOM   1692 C C   . PRO A 1 234 ? 27.407 -35.419 -10.780 1.00   39.08  ? 837  PRO A C   1 
ATOM   1693 O O   . PRO A 1 234 ? 27.034 -36.200 -11.662 1.00   40.81  ? 837  PRO A O   1 
ATOM   1694 C CB  . PRO A 1 234 ? 28.921 -36.544 -9.125  1.00   36.80  ? 837  PRO A CB  1 
ATOM   1695 C CG  . PRO A 1 234 ? 28.636 -38.009 -9.059  1.00   44.59  ? 837  PRO A CG  1 
ATOM   1696 C CD  . PRO A 1 234 ? 27.227 -38.180 -8.575  1.00   45.52  ? 837  PRO A CD  1 
ATOM   1697 N N   . VAL A 1 235 ? 27.668 -34.139 -11.004 1.00   31.93  ? 838  VAL A N   1 
ATOM   1698 C CA  . VAL A 1 235 ? 27.765 -33.606 -12.345 1.00   33.63  ? 838  VAL A CA  1 
ATOM   1699 C C   . VAL A 1 235 ? 29.233 -33.716 -12.758 1.00   32.29  ? 838  VAL A C   1 
ATOM   1700 O O   . VAL A 1 235 ? 30.133 -33.330 -12.004 1.00   27.11  ? 838  VAL A O   1 
ATOM   1701 C CB  . VAL A 1 235 ? 27.245 -32.147 -12.421 1.00   28.92  ? 838  VAL A CB  1 
ATOM   1702 C CG1 . VAL A 1 235 ? 27.621 -31.493 -13.725 1.00   25.96  ? 838  VAL A CG1 1 
ATOM   1703 C CG2 . VAL A 1 235 ? 25.741 -32.130 -12.246 1.00   33.10  ? 838  VAL A CG2 1 
ATOM   1704 N N   . LEU A 1 236 ? 29.472 -34.295 -13.928 1.00   28.29  ? 839  LEU A N   1 
ATOM   1705 C CA  . LEU A 1 236 ? 30.829 -34.383 -14.434 1.00   31.00  ? 839  LEU A CA  1 
ATOM   1706 C C   . LEU A 1 236 ? 31.137 -33.093 -15.163 1.00   27.80  ? 839  LEU A C   1 
ATOM   1707 O O   . LEU A 1 236 ? 30.445 -32.721 -16.096 1.00   30.68  ? 839  LEU A O   1 
ATOM   1708 C CB  . LEU A 1 236 ? 31.021 -35.595 -15.356 1.00   28.67  ? 839  LEU A CB  1 
ATOM   1709 C CG  . LEU A 1 236 ? 32.472 -35.984 -15.677 1.00   30.33  ? 839  LEU A CG  1 
ATOM   1710 C CD1 . LEU A 1 236 ? 32.531 -37.375 -16.244 1.00   35.99  ? 839  LEU A CD1 1 
ATOM   1711 C CD2 . LEU A 1 236 ? 33.116 -35.035 -16.682 1.00   38.40  ? 839  LEU A CD2 1 
ATOM   1712 N N   . VAL A 1 237 ? 32.200 -32.431 -14.748 1.00   23.65  ? 840  VAL A N   1 
ATOM   1713 C CA  . VAL A 1 237 ? 32.549 -31.153 -15.318 1.00   27.00  ? 840  VAL A CA  1 
ATOM   1714 C C   . VAL A 1 237 ? 34.024 -31.182 -15.691 1.00   31.99  ? 840  VAL A C   1 
ATOM   1715 O O   . VAL A 1 237 ? 34.880 -31.592 -14.896 1.00   32.75  ? 840  VAL A O   1 
ATOM   1716 C CB  . VAL A 1 237 ? 32.227 -29.992 -14.344 1.00   27.94  ? 840  VAL A CB  1 
ATOM   1717 C CG1 . VAL A 1 237 ? 32.907 -30.201 -12.981 1.00   32.07  ? 840  VAL A CG1 1 
ATOM   1718 C CG2 . VAL A 1 237 ? 32.632 -28.688 -14.933 1.00   29.94  ? 840  VAL A CG2 1 
ATOM   1719 N N   . HIS A 1 238 ? 34.315 -30.801 -16.930 1.00   31.51  ? 841  HIS A N   1 
ATOM   1720 C CA  . HIS A 1 238 ? 35.690 -30.749 -17.394 1.00   29.63  ? 841  HIS A CA  1 
ATOM   1721 C C   . HIS A 1 238 ? 35.889 -29.597 -18.375 1.00   33.94  ? 841  HIS A C   1 
ATOM   1722 O O   . HIS A 1 238 ? 34.937 -29.057 -18.951 1.00   30.50  ? 841  HIS A O   1 
ATOM   1723 C CB  . HIS A 1 238 ? 36.112 -32.099 -18.016 1.00   29.21  ? 841  HIS A CB  1 
ATOM   1724 C CG  . HIS A 1 238 ? 35.670 -32.319 -19.439 1.00   34.84  ? 841  HIS A CG  1 
ATOM   1725 N ND1 . HIS A 1 238 ? 36.409 -31.902 -20.525 1.00   31.04  ? 841  HIS A ND1 1 
ATOM   1726 C CD2 . HIS A 1 238 ? 34.599 -32.979 -19.949 1.00   29.56  ? 841  HIS A CD2 1 
ATOM   1727 C CE1 . HIS A 1 238 ? 35.793 -32.256 -21.640 1.00   30.21  ? 841  HIS A CE1 1 
ATOM   1728 N NE2 . HIS A 1 238 ? 34.697 -32.914 -21.316 1.00   29.83  ? 841  HIS A NE2 1 
ATOM   1729 N N   . SER A 1 239 ? 37.135 -29.241 -18.568 1.00   30.21  ? 842  SER A N   1 
ATOM   1730 C CA  . SER A 1 239 ? 37.531 -28.321 -19.586 1.00   33.53  ? 842  SER A CA  1 
ATOM   1731 C C   . SER A 1 239 ? 38.746 -29.048 -20.086 1.00   36.09  ? 842  SER A C   1 
ATOM   1732 O O   . SER A 1 239 ? 38.821 -30.202 -19.925 1.00   34.55  ? 842  SER A O   1 
ATOM   1733 C CB  . SER A 1 239 ? 37.922 -26.990 -18.975 1.00   35.85  ? 842  SER A CB  1 
ATOM   1734 O OG  . SER A 1 239 ? 38.550 -27.147 -17.743 1.00   26.02  ? 842  SER A OG  1 
ATOM   1735 N N   . SER A 1 240 ? 39.690 -28.375 -20.705 1.00   34.82  ? 843  SER A N   1 
ATOM   1736 C CA  . SER A 1 240 ? 41.004 -28.948 -20.944 1.00   29.93  ? 843  SER A CA  1 
ATOM   1737 C C   . SER A 1 240 ? 41.842 -29.549 -19.816 1.00   32.58  ? 843  SER A C   1 
ATOM   1738 O O   . SER A 1 240 ? 42.124 -30.752 -19.830 1.00   31.88  ? 843  SER A O   1 
ATOM   1739 C CB  . SER A 1 240 ? 41.813 -27.964 -21.797 1.00   33.36  ? 843  SER A CB  1 
ATOM   1740 O OG  . SER A 1 240 ? 42.974 -28.561 -22.333 1.00   33.25  ? 843  SER A OG  1 
ATOM   1741 N N   . ALA A 1 241 ? 42.213 -28.718 -18.836 1.00   30.87  ? 844  ALA A N   1 
ATOM   1742 C CA  . ALA A 1 241 ? 42.898 -29.168 -17.608 1.00   32.48  ? 844  ALA A CA  1 
ATOM   1743 C C   . ALA A 1 241 ? 41.921 -29.551 -16.501 1.00   32.08  ? 844  ALA A C   1 
ATOM   1744 O O   . ALA A 1 241 ? 42.250 -30.361 -15.650 1.00   31.38  ? 844  ALA A O   1 
ATOM   1745 C CB  . ALA A 1 241 ? 43.848 -28.081 -17.077 1.00   31.11  ? 844  ALA A CB  1 
ATOM   1746 N N   . GLY A 1 242 ? 40.741 -28.934 -16.497 1.00   27.57  ? 845  GLY A N   1 
ATOM   1747 C CA  . GLY A 1 242 ? 39.720 -29.245 -15.513 1.00   31.26  ? 845  GLY A CA  1 
ATOM   1748 C C   . GLY A 1 242 ? 39.833 -28.514 -14.183 1.00   29.67  ? 845  GLY A C   1 
ATOM   1749 O O   . GLY A 1 242 ? 39.426 -29.045 -13.152 1.00   30.11  ? 845  GLY A O   1 
ATOM   1750 N N   . ILE A 1 243 ? 40.398 -27.308 -14.201 1.00   30.50  ? 846  ILE A N   1 
ATOM   1751 C CA  . ILE A 1 243 ? 40.581 -26.516 -12.987 1.00   34.02  ? 846  ILE A CA  1 
ATOM   1752 C C   . ILE A 1 243 ? 40.195 -25.049 -13.181 1.00   31.28  ? 846  ILE A C   1 
ATOM   1753 O O   . ILE A 1 243 ? 39.648 -24.436 -12.272 1.00   27.65  ? 846  ILE A O   1 
ATOM   1754 C CB  . ILE A 1 243 ? 42.057 -26.593 -12.460 1.00   31.51  ? 846  ILE A CB  1 
ATOM   1755 C CG1 . ILE A 1 243 ? 43.058 -26.253 -13.567 1.00   35.79  ? 846  ILE A CG1 1 
ATOM   1756 C CG2 . ILE A 1 243 ? 42.364 -27.980 -11.944 1.00   26.46  ? 846  ILE A CG2 1 
ATOM   1757 C CD1 . ILE A 1 243 ? 43.701 -24.888 -13.426 1.00   38.90  ? 846  ILE A CD1 1 
ATOM   1758 N N   . GLY A 1 244 ? 40.461 -24.497 -14.367 1.00   34.51  ? 847  GLY A N   1 
ATOM   1759 C CA  . GLY A 1 244 ? 40.291 -23.067 -14.613 1.00   30.31  ? 847  GLY A CA  1 
ATOM   1760 C C   . GLY A 1 244 ? 38.845 -22.672 -14.807 1.00   29.77  ? 847  GLY A C   1 
ATOM   1761 O O   . GLY A 1 244 ? 38.217 -22.052 -13.946 1.00   31.37  ? 847  GLY A O   1 
ATOM   1762 N N   . ARG A 1 245 ? 38.296 -23.045 -15.950 1.00   30.35  ? 848  ARG A N   1 
ATOM   1763 C CA  . ARG A 1 245 ? 36.909 -22.718 -16.244 1.00   34.78  ? 848  ARG A CA  1 
ATOM   1764 C C   . ARG A 1 245 ? 35.923 -23.566 -15.417 1.00   33.00  ? 848  ARG A C   1 
ATOM   1765 O O   . ARG A 1 245 ? 34.822 -23.106 -15.112 1.00   27.01  ? 848  ARG A O   1 
ATOM   1766 C CB  . ARG A 1 245 ? 36.653 -22.869 -17.747 1.00   31.20  ? 848  ARG A CB  1 
ATOM   1767 C CG  . ARG A 1 245 ? 37.468 -21.877 -18.547 1.00   33.68  ? 848  ARG A CG  1 
ATOM   1768 C CD  . ARG A 1 245 ? 37.628 -22.289 -20.004 1.00   33.52  ? 848  ARG A CD  1 
ATOM   1769 N NE  . ARG A 1 245 ? 38.556 -23.407 -20.143 1.00   35.71  ? 848  ARG A NE  1 
ATOM   1770 C CZ  . ARG A 1 245 ? 39.013 -23.863 -21.303 1.00   30.87  ? 848  ARG A CZ  1 
ATOM   1771 N NH1 . ARG A 1 245 ? 38.621 -23.294 -22.419 1.00   27.82  ? 848  ARG A NH1 1 
ATOM   1772 N NH2 . ARG A 1 245 ? 39.850 -24.890 -21.341 1.00   29.88  ? 848  ARG A NH2 1 
ATOM   1773 N N   . THR A 1 246 ? 36.310 -24.791 -15.050 1.00   30.95  ? 849  THR A N   1 
ATOM   1774 C CA  . THR A 1 246 ? 35.450 -25.607 -14.204 1.00   30.15  ? 849  THR A CA  1 
ATOM   1775 C C   . THR A 1 246 ? 35.328 -24.944 -12.823 1.00   33.77  ? 849  THR A C   1 
ATOM   1776 O O   . THR A 1 246 ? 34.265 -24.942 -12.208 1.00   26.59  ? 849  THR A O   1 
ATOM   1777 C CB  . THR A 1 246 ? 35.978 -27.046 -14.023 1.00   32.21  ? 849  THR A CB  1 
ATOM   1778 O OG1 . THR A 1 246 ? 37.243 -27.004 -13.367 1.00   40.34  ? 849  THR A OG1 1 
ATOM   1779 C CG2 . THR A 1 246 ? 36.148 -27.745 -15.340 1.00   32.27  ? 849  THR A CG2 1 
ATOM   1780 N N   . GLY A 1 247 ? 36.425 -24.368 -12.346 1.00   30.42  ? 850  GLY A N   1 
ATOM   1781 C CA  . GLY A 1 247 ? 36.424 -23.779 -11.027 1.00   32.06  ? 850  GLY A CA  1 
ATOM   1782 C C   . GLY A 1 247 ? 35.476 -22.605 -10.964 1.00   31.37  ? 850  GLY A C   1 
ATOM   1783 O O   . GLY A 1 247 ? 34.755 -22.429 -9.966  1.00   28.55  ? 850  GLY A O   1 
ATOM   1784 N N   . VAL A 1 248 ? 35.488 -21.811 -12.037 1.00   28.18  ? 851  VAL A N   1 
ATOM   1785 C CA  . VAL A 1 248 ? 34.588 -20.681 -12.198 1.00   26.09  ? 851  VAL A CA  1 
ATOM   1786 C C   . VAL A 1 248 ? 33.144 -21.145 -12.184 1.00   30.09  ? 851  VAL A C   1 
ATOM   1787 O O   . VAL A 1 248 ? 32.300 -20.524 -11.525 1.00   30.21  ? 851  VAL A O   1 
ATOM   1788 C CB  . VAL A 1 248 ? 34.877 -19.909 -13.497 1.00   29.87  ? 851  VAL A CB  1 
ATOM   1789 C CG1 . VAL A 1 248 ? 33.787 -18.868 -13.773 1.00   35.44  ? 851  VAL A CG1 1 
ATOM   1790 C CG2 . VAL A 1 248 ? 36.229 -19.242 -13.412 1.00   30.84  ? 851  VAL A CG2 1 
ATOM   1791 N N   . LEU A 1 249 ? 32.865 -22.254 -12.867 1.00   27.35  ? 852  LEU A N   1 
ATOM   1792 C CA  . LEU A 1 249 ? 31.496 -22.752 -12.933 1.00   32.68  ? 852  LEU A CA  1 
ATOM   1793 C C   . LEU A 1 249 ? 31.005 -23.266 -11.579 1.00   30.04  ? 852  LEU A C   1 
ATOM   1794 O O   . LEU A 1 249 ? 29.870 -22.980 -11.189 1.00   30.54  ? 852  LEU A O   1 
ATOM   1795 C CB  . LEU A 1 249 ? 31.345 -23.846 -14.003 1.00   33.85  ? 852  LEU A CB  1 
ATOM   1796 C CG  . LEU A 1 249 ? 29.887 -24.285 -14.256 1.00   32.44  ? 852  LEU A CG  1 
ATOM   1797 C CD1 . LEU A 1 249 ? 29.656 -24.465 -15.718 1.00   36.93  ? 852  LEU A CD1 1 
ATOM   1798 C CD2 . LEU A 1 249 ? 29.542 -25.588 -13.533 1.00   33.85  ? 852  LEU A CD2 1 
ATOM   1799 N N   . VAL A 1 250 ? 31.854 -24.002 -10.861 1.00   33.73  ? 853  VAL A N   1 
ATOM   1800 C CA  . VAL A 1 250 ? 31.491 -24.525 -9.535  1.00   34.14  ? 853  VAL A CA  1 
ATOM   1801 C C   . VAL A 1 250 ? 31.255 -23.391 -8.528  1.00   30.98  ? 853  VAL A C   1 
ATOM   1802 O O   . VAL A 1 250 ? 30.332 -23.464 -7.732  1.00   29.35  ? 853  VAL A O   1 
ATOM   1803 C CB  . VAL A 1 250 ? 32.568 -25.504 -8.977  1.00   31.70  ? 853  VAL A CB  1 
ATOM   1804 C CG1 . VAL A 1 250 ? 32.260 -25.876 -7.519  1.00   27.78  ? 853  VAL A CG1 1 
ATOM   1805 C CG2 . VAL A 1 250 ? 32.674 -26.761 -9.850  1.00   26.30  ? 853  VAL A CG2 1 
ATOM   1806 N N   . THR A 1 251 ? 32.071 -22.339 -8.586  1.00   29.80  ? 854  THR A N   1 
ATOM   1807 C CA  . THR A 1 251 ? 31.879 -21.174 -7.715  1.00   30.96  ? 854  THR A CA  1 
ATOM   1808 C C   . THR A 1 251 ? 30.527 -20.500 -7.967  1.00   37.86  ? 854  THR A C   1 
ATOM   1809 O O   . THR A 1 251 ? 29.809 -20.125 -7.018  1.00   32.77  ? 854  THR A O   1 
ATOM   1810 C CB  . THR A 1 251 ? 32.994 -20.130 -7.913  1.00   29.18  ? 854  THR A CB  1 
ATOM   1811 O OG1 . THR A 1 251 ? 34.257 -20.736 -7.646  1.00   29.46  ? 854  THR A OG1 1 
ATOM   1812 C CG2 . THR A 1 251 ? 32.804 -18.927 -6.998  1.00   24.56  ? 854  THR A CG2 1 
ATOM   1813 N N   . MET A 1 252 ? 30.181 -20.364 -9.251  1.00   34.08  ? 855  MET A N   1 
ATOM   1814 C CA  . MET A 1 252 ? 28.982 -19.644 -9.642  1.00   31.45  ? 855  MET A CA  1 
ATOM   1815 C C   . MET A 1 252 ? 27.727 -20.422 -9.301  1.00   34.74  ? 855  MET A C   1 
ATOM   1816 O O   . MET A 1 252 ? 26.748 -19.841 -8.826  1.00   41.71  ? 855  MET A O   1 
ATOM   1817 C CB  . MET A 1 252 ? 28.997 -19.309 -11.136 1.00   36.27  ? 855  MET A CB  1 
ATOM   1818 C CG  . MET A 1 252 ? 27.810 -18.455 -11.548 1.00   37.01  ? 855  MET A CG  1 
ATOM   1819 S SD  . MET A 1 252 ? 27.952 -16.770 -10.914 1.00   45.38  ? 855  MET A SD  1 
ATOM   1820 C CE  . MET A 1 252 ? 26.328 -16.540 -10.175 1.00   38.47  ? 855  MET A CE  1 
ATOM   1821 N N   . GLU A 1 253 ? 27.736 -21.729 -9.539  1.00   33.85  ? 856  GLU A N   1 
ATOM   1822 C CA  . GLU A 1 253 ? 26.591 -22.539 -9.120  1.00   43.50  ? 856  GLU A CA  1 
ATOM   1823 C C   . GLU A 1 253 ? 26.421 -22.492 -7.576  1.00   40.22  ? 856  GLU A C   1 
ATOM   1824 O O   . GLU A 1 253 ? 25.291 -22.439 -7.067  1.00   39.76  ? 856  GLU A O   1 
ATOM   1825 C CB  . GLU A 1 253 ? 26.706 -23.999 -9.610  1.00   32.91  ? 856  GLU A CB  1 
ATOM   1826 C CG  . GLU A 1 253 ? 25.687 -24.915 -8.915  1.00   41.36  ? 856  GLU A CG  1 
ATOM   1827 C CD  . GLU A 1 253 ? 25.491 -26.272 -9.563  1.00   41.95  ? 856  GLU A CD  1 
ATOM   1828 O OE1 . GLU A 1 253 ? 24.352 -26.774 -9.525  1.00   48.39  ? 856  GLU A OE1 1 
ATOM   1829 O OE2 . GLU A 1 253 ? 26.459 -26.860 -10.085 1.00   43.17  ? 856  GLU A OE2 1 
ATOM   1830 N N   . THR A 1 254 ? 27.533 -22.488 -6.835  1.00   38.74  ? 857  THR A N   1 
ATOM   1831 C CA  . THR A 1 254 ? 27.461 -22.453 -5.368  1.00   33.05  ? 857  THR A CA  1 
ATOM   1832 C C   . THR A 1 254 ? 26.829 -21.148 -4.914  1.00   36.96  ? 857  THR A C   1 
ATOM   1833 O O   . THR A 1 254 ? 25.904 -21.141 -4.099  1.00   38.47  ? 857  THR A O   1 
ATOM   1834 C CB  . THR A 1 254 ? 28.841 -22.594 -4.710  1.00   29.95  ? 857  THR A CB  1 
ATOM   1835 O OG1 . THR A 1 254 ? 29.485 -23.780 -5.183  1.00   37.37  ? 857  THR A OG1 1 
ATOM   1836 C CG2 . THR A 1 254 ? 28.712 -22.672 -3.186  1.00   34.64  ? 857  THR A CG2 1 
ATOM   1837 N N   . ALA A 1 255 ? 27.340 -20.048 -5.458  1.00   34.97  ? 858  ALA A N   1 
ATOM   1838 C CA  . ALA A 1 255 ? 26.839 -18.723 -5.151  1.00   33.70  ? 858  ALA A CA  1 
ATOM   1839 C C   . ALA A 1 255 ? 25.333 -18.644 -5.376  1.00   41.51  ? 858  ALA A C   1 
ATOM   1840 O O   . ALA A 1 255 ? 24.593 -18.179 -4.509  1.00   51.91  ? 858  ALA A O   1 
ATOM   1841 C CB  . ALA A 1 255 ? 27.558 -17.687 -5.978  1.00   34.37  ? 858  ALA A CB  1 
ATOM   1842 N N   . MET A 1 256 ? 24.866 -19.141 -6.510  1.00   39.05  ? 859  MET A N   1 
ATOM   1843 C CA  . MET A 1 256 ? 23.445 -19.066 -6.806  1.00   46.98  ? 859  MET A CA  1 
ATOM   1844 C C   . MET A 1 256 ? 22.553 -19.863 -5.847  1.00   47.85  ? 859  MET A C   1 
ATOM   1845 O O   . MET A 1 256 ? 21.469 -19.396 -5.503  1.00   48.38  ? 859  MET A O   1 
ATOM   1846 C CB  . MET A 1 256 ? 23.189 -19.507 -8.244  1.00   45.52  ? 859  MET A CB  1 
ATOM   1847 C CG  . MET A 1 256 ? 23.123 -18.339 -9.182  1.00   41.90  ? 859  MET A CG  1 
ATOM   1848 S SD  . MET A 1 256 ? 23.783 -18.914 -10.706 1.00   73.68  ? 859  MET A SD  1 
ATOM   1849 C CE  . MET A 1 256 ? 22.529 -20.091 -11.098 1.00   53.22  ? 859  MET A CE  1 
ATOM   1850 N N   . CYS A 1 257 ? 22.996 -21.049 -5.425  1.00   39.03  ? 860  CYS A N   1 
ATOM   1851 C CA  . CYS A 1 257 ? 22.262 -21.823 -4.423  1.00   47.70  ? 860  CYS A CA  1 
ATOM   1852 C C   . CYS A 1 257 ? 22.147 -21.076 -3.094  1.00   49.32  ? 860  CYS A C   1 
ATOM   1853 O O   . CYS A 1 257 ? 21.131 -21.168 -2.408  1.00   46.96  ? 860  CYS A O   1 
ATOM   1854 C CB  . CYS A 1 257 ? 22.930 -23.170 -4.168  1.00   51.52  ? 860  CYS A CB  1 
ATOM   1855 S SG  . CYS A 1 257 ? 22.855 -24.336 -5.513  1.00   48.43  ? 860  CYS A SG  1 
ATOM   1856 N N   . LEU A 1 258 ? 23.209 -20.357 -2.733  1.00   50.00  ? 861  LEU A N   1 
ATOM   1857 C CA  . LEU A 1 258 ? 23.215 -19.544 -1.521  1.00   50.18  ? 861  LEU A CA  1 
ATOM   1858 C C   . LEU A 1 258 ? 22.241 -18.358 -1.631  1.00   51.06  ? 861  LEU A C   1 
ATOM   1859 O O   . LEU A 1 258 ? 21.459 -18.113 -0.717  1.00   40.72  ? 861  LEU A O   1 
ATOM   1860 C CB  . LEU A 1 258 ? 24.637 -19.048 -1.223  1.00   44.67  ? 861  LEU A CB  1 
ATOM   1861 C CG  . LEU A 1 258 ? 25.641 -20.139 -0.836  1.00   45.18  ? 861  LEU A CG  1 
ATOM   1862 C CD1 . LEU A 1 258 ? 27.080 -19.643 -0.955  1.00   38.02  ? 861  LEU A CD1 1 
ATOM   1863 C CD2 . LEU A 1 258 ? 25.363 -20.654 0.553   1.00   36.83  ? 861  LEU A CD2 1 
ATOM   1864 N N   . THR A 1 259 ? 22.281 -17.645 -2.761  1.00   51.03  ? 862  THR A N   1 
ATOM   1865 C CA  . THR A 1 259 ? 21.460 -16.442 -2.954  1.00   50.97  ? 862  THR A CA  1 
ATOM   1866 C C   . THR A 1 259 ? 19.960 -16.717 -2.851  1.00   52.55  ? 862  THR A C   1 
ATOM   1867 O O   . THR A 1 259 ? 19.217 -15.932 -2.270  1.00   56.82  ? 862  THR A O   1 
ATOM   1868 C CB  . THR A 1 259 ? 21.732 -15.782 -4.314  1.00   51.92  ? 862  THR A CB  1 
ATOM   1869 O OG1 . THR A 1 259 ? 23.113 -15.916 -4.629  1.00   63.94  ? 862  THR A OG1 1 
ATOM   1870 C CG2 . THR A 1 259 ? 21.403 -14.300 -4.277  1.00   55.67  ? 862  THR A CG2 1 
ATOM   1871 N N   . GLU A 1 260 ? 19.519 -17.834 -3.406  1.00   50.30  ? 863  GLU A N   1 
ATOM   1872 C CA  . GLU A 1 260 ? 18.114 -18.202 -3.338  1.00   51.54  ? 863  GLU A CA  1 
ATOM   1873 C C   . GLU A 1 260 ? 17.669 -18.594 -1.942  1.00   58.80  ? 863  GLU A C   1 
ATOM   1874 O O   . GLU A 1 260 ? 16.473 -18.601 -1.647  1.00   55.14  ? 863  GLU A O   1 
ATOM   1875 C CB  . GLU A 1 260 ? 17.832 -19.349 -4.283  1.00   48.30  ? 863  GLU A CB  1 
ATOM   1876 C CG  . GLU A 1 260 ? 18.117 -18.985 -5.690  1.00   58.78  ? 863  GLU A CG  1 
ATOM   1877 C CD  . GLU A 1 260 ? 18.207 -20.192 -6.575  1.00   66.04  ? 863  GLU A CD  1 
ATOM   1878 O OE1 . GLU A 1 260 ? 18.163 -21.317 -6.001  1.00   61.00  ? 863  GLU A OE1 1 
ATOM   1879 O OE2 . GLU A 1 260 ? 18.315 -19.997 -7.820  1.00   50.03  ? 863  GLU A OE2 1 
ATOM   1880 N N   . ARG A 1 261 ? 18.622 -18.940 -1.087  1.00   52.17  ? 864  ARG A N   1 
ATOM   1881 C CA  . ARG A 1 261 ? 18.274 -19.363 0.255   1.00   48.18  ? 864  ARG A CA  1 
ATOM   1882 C C   . ARG A 1 261 ? 18.595 -18.264 1.252   1.00   53.27  ? 864  ARG A C   1 
ATOM   1883 O O   . ARG A 1 261 ? 18.609 -18.501 2.464   1.00   53.41  ? 864  ARG A O   1 
ATOM   1884 C CB  . ARG A 1 261 ? 19.003 -20.653 0.618   1.00   46.01  ? 864  ARG A CB  1 
ATOM   1885 C CG  . ARG A 1 261 ? 18.436 -21.878 -0.057  1.00   45.64  ? 864  ARG A CG  1 
ATOM   1886 C CD  . ARG A 1 261 ? 19.495 -22.937 -0.138  1.00   50.16  ? 864  ARG A CD  1 
ATOM   1887 N NE  . ARG A 1 261 ? 19.066 -24.146 -0.836  1.00   60.13  ? 864  ARG A NE  1 
ATOM   1888 C CZ  . ARG A 1 261 ? 19.179 -24.337 -2.152  1.00   63.27  ? 864  ARG A CZ  1 
ATOM   1889 N NH1 . ARG A 1 261 ? 19.695 -23.397 -2.944  1.00   53.90  ? 864  ARG A NH1 1 
ATOM   1890 N NH2 . ARG A 1 261 ? 18.766 -25.479 -2.683  1.00   67.56  ? 864  ARG A NH2 1 
ATOM   1891 N N   . ASN A 1 262 ? 18.852 -17.064 0.729   1.00   52.20  ? 865  ASN A N   1 
ATOM   1892 C CA  . ASN A 1 262 ? 19.211 -15.915 1.556   1.00   51.13  ? 865  ASN A CA  1 
ATOM   1893 C C   . ASN A 1 262 ? 20.374 -16.246 2.506   1.00   50.58  ? 865  ASN A C   1 
ATOM   1894 O O   . ASN A 1 262 ? 20.359 -15.907 3.695   1.00   50.38  ? 865  ASN A O   1 
ATOM   1895 C CB  . ASN A 1 262 ? 17.990 -15.429 2.346   1.00   51.14  ? 865  ASN A CB  1 
ATOM   1896 C CG  . ASN A 1 262 ? 18.144 -14.003 2.824   1.00   53.09  ? 865  ASN A CG  1 
ATOM   1897 O OD1 . ASN A 1 262 ? 18.577 -13.132 2.070   1.00   51.93  ? 865  ASN A OD1 1 
ATOM   1898 N ND2 . ASN A 1 262 ? 17.823 -13.762 4.092   1.00   52.82  ? 865  ASN A ND2 1 
ATOM   1899 N N   . LEU A 1 263 ? 21.372 -16.935 1.972   1.00   49.99  ? 866  LEU A N   1 
ATOM   1900 C CA  . LEU A 1 263 ? 22.541 -17.338 2.744   1.00   46.48  ? 866  LEU A CA  1 
ATOM   1901 C C   . LEU A 1 263 ? 23.752 -16.520 2.284   1.00   41.11  ? 866  LEU A C   1 
ATOM   1902 O O   . LEU A 1 263 ? 23.811 -16.080 1.137   1.00   45.73  ? 866  LEU A O   1 
ATOM   1903 C CB  . LEU A 1 263 ? 22.786 -18.845 2.596   1.00   42.01  ? 866  LEU A CB  1 
ATOM   1904 C CG  . LEU A 1 263 ? 21.686 -19.768 3.135   1.00   48.50  ? 866  LEU A CG  1 
ATOM   1905 C CD1 . LEU A 1 263 ? 22.017 -21.249 2.936   1.00   44.80  ? 866  LEU A CD1 1 
ATOM   1906 C CD2 . LEU A 1 263 ? 21.451 -19.476 4.606   1.00   45.71  ? 866  LEU A CD2 1 
ATOM   1907 N N   . PRO A 1 264 ? 24.704 -16.270 3.190   1.00   42.90  ? 867  PRO A N   1 
ATOM   1908 C CA  . PRO A 1 264 ? 25.808 -15.391 2.803   1.00   41.43  ? 867  PRO A CA  1 
ATOM   1909 C C   . PRO A 1 264 ? 26.795 -16.054 1.838   1.00   37.99  ? 867  PRO A C   1 
ATOM   1910 O O   . PRO A 1 264 ? 26.972 -17.273 1.841   1.00   35.56  ? 867  PRO A O   1 
ATOM   1911 C CB  . PRO A 1 264 ? 26.476 -15.056 4.149   1.00   36.47  ? 867  PRO A CB  1 
ATOM   1912 C CG  . PRO A 1 264 ? 26.081 -16.136 5.037   1.00   36.00  ? 867  PRO A CG  1 
ATOM   1913 C CD  . PRO A 1 264 ? 24.730 -16.582 4.629   1.00   37.01  ? 867  PRO A CD  1 
ATOM   1914 N N   . ILE A 1 265 ? 27.434 -15.231 1.023   1.00   31.68  ? 868  ILE A N   1 
ATOM   1915 C CA  . ILE A 1 265 ? 28.390 -15.727 0.055   1.00   38.76  ? 868  ILE A CA  1 
ATOM   1916 C C   . ILE A 1 265 ? 29.799 -15.171 0.326   1.00   42.19  ? 868  ILE A C   1 
ATOM   1917 O O   . ILE A 1 265 ? 30.011 -13.952 0.397   1.00   37.11  ? 868  ILE A O   1 
ATOM   1918 C CB  . ILE A 1 265 ? 27.955 -15.378 -1.398  1.00   33.52  ? 868  ILE A CB  1 
ATOM   1919 C CG1 . ILE A 1 265 ? 26.587 -16.002 -1.724  1.00   40.95  ? 868  ILE A CG1 1 
ATOM   1920 C CG2 . ILE A 1 265 ? 29.001 -15.841 -2.390  1.00   35.55  ? 868  ILE A CG2 1 
ATOM   1921 C CD1 . ILE A 1 265 ? 25.883 -15.372 -2.920  1.00   34.92  ? 868  ILE A CD1 1 
ATOM   1922 N N   . TYR A 1 266 ? 30.755 -16.084 0.474   1.00   32.64  ? 869  TYR A N   1 
ATOM   1923 C CA  . TYR A 1 266 ? 32.154 -15.724 0.660   1.00   35.50  ? 869  TYR A CA  1 
ATOM   1924 C C   . TYR A 1 266 ? 33.010 -16.432 -0.396  1.00   33.33  ? 869  TYR A C   1 
ATOM   1925 O O   . TYR A 1 266 ? 33.454 -17.557 -0.176  1.00   38.92  ? 869  TYR A O   1 
ATOM   1926 C CB  . TYR A 1 266 ? 32.602 -16.076 2.100   1.00   32.46  ? 869  TYR A CB  1 
ATOM   1927 C CG  . TYR A 1 266 ? 31.723 -15.419 3.149   1.00   36.82  ? 869  TYR A CG  1 
ATOM   1928 C CD1 . TYR A 1 266 ? 31.718 -14.031 3.302   1.00   41.32  ? 869  TYR A CD1 1 
ATOM   1929 C CD2 . TYR A 1 266 ? 30.873 -16.169 3.954   1.00   37.74  ? 869  TYR A CD2 1 
ATOM   1930 C CE1 . TYR A 1 266 ? 30.915 -13.413 4.233   1.00   36.70  ? 869  TYR A CE1 1 
ATOM   1931 C CE2 . TYR A 1 266 ? 30.056 -15.560 4.892   1.00   40.61  ? 869  TYR A CE2 1 
ATOM   1932 C CZ  . TYR A 1 266 ? 30.082 -14.178 5.026   1.00   47.70  ? 869  TYR A CZ  1 
ATOM   1933 O OH  . TYR A 1 266 ? 29.278 -13.545 5.952   1.00   51.32  ? 869  TYR A OH  1 
ATOM   1934 N N   . PRO A 1 267 ? 33.232 -15.786 -1.556  1.00   36.25  ? 870  PRO A N   1 
ATOM   1935 C CA  . PRO A 1 267 ? 33.822 -16.520 -2.690  1.00   37.27  ? 870  PRO A CA  1 
ATOM   1936 C C   . PRO A 1 267 ? 35.205 -17.110 -2.405  1.00   35.38  ? 870  PRO A C   1 
ATOM   1937 O O   . PRO A 1 267 ? 35.532 -18.148 -2.985  1.00   35.47  ? 870  PRO A O   1 
ATOM   1938 C CB  . PRO A 1 267 ? 33.909 -15.457 -3.804  1.00   33.27  ? 870  PRO A CB  1 
ATOM   1939 C CG  . PRO A 1 267 ? 32.921 -14.405 -3.418  1.00   34.15  ? 870  PRO A CG  1 
ATOM   1940 C CD  . PRO A 1 267 ? 32.887 -14.396 -1.914  1.00   36.34  ? 870  PRO A CD  1 
ATOM   1941 N N   . LEU A 1 268 ? 35.997 -16.483 -1.534  1.00   35.91  ? 871  LEU A N   1 
ATOM   1942 C CA  . LEU A 1 268 ? 37.314 -17.033 -1.223  1.00   32.86  ? 871  LEU A CA  1 
ATOM   1943 C C   . LEU A 1 268 ? 37.196 -18.334 -0.417  1.00   31.95  ? 871  LEU A C   1 
ATOM   1944 O O   . LEU A 1 268 ? 38.018 -19.232 -0.568  1.00   31.40  ? 871  LEU A O   1 
ATOM   1945 C CB  . LEU A 1 268 ? 38.180 -16.024 -0.476  1.00   31.03  ? 871  LEU A CB  1 
ATOM   1946 C CG  . LEU A 1 268 ? 39.666 -16.410 -0.480  1.00   37.23  ? 871  LEU A CG  1 
ATOM   1947 C CD1 . LEU A 1 268 ? 40.308 -16.215 -1.864  1.00   31.39  ? 871  LEU A CD1 1 
ATOM   1948 C CD2 . LEU A 1 268 ? 40.430 -15.642 0.581   1.00   41.54  ? 871  LEU A CD2 1 
ATOM   1949 N N   . ASP A 1 269 ? 36.160 -18.447 0.412   1.00   29.63  ? 872  ASP A N   1 
ATOM   1950 C CA  . ASP A 1 269 ? 35.908 -19.691 1.129   1.00   29.87  ? 872  ASP A CA  1 
ATOM   1951 C C   . ASP A 1 269 ? 35.469 -20.787 0.157   1.00   30.26  ? 872  ASP A C   1 
ATOM   1952 O O   . ASP A 1 269 ? 35.818 -21.962 0.308   1.00   32.96  ? 872  ASP A O   1 
ATOM   1953 C CB  . ASP A 1 269 ? 34.844 -19.500 2.213   1.00   29.94  ? 872  ASP A CB  1 
ATOM   1954 C CG  . ASP A 1 269 ? 35.314 -18.638 3.377   1.00   36.96  ? 872  ASP A CG  1 
ATOM   1955 O OD1 . ASP A 1 269 ? 36.456 -18.111 3.364   1.00   35.37  ? 872  ASP A OD1 1 
ATOM   1956 O OD2 . ASP A 1 269 ? 34.504 -18.481 4.313   1.00   36.88  ? 872  ASP A OD2 1 
ATOM   1957 N N   . ILE A 1 270 ? 34.696 -20.392 -0.849  1.00   34.69  ? 873  ILE A N   1 
ATOM   1958 C CA  . ILE A 1 270 ? 34.226 -21.315 -1.882  1.00   34.64  ? 873  ILE A CA  1 
ATOM   1959 C C   . ILE A 1 270 ? 35.398 -21.850 -2.718  1.00   29.60  ? 873  ILE A C   1 
ATOM   1960 O O   . ILE A 1 270 ? 35.517 -23.055 -2.931  1.00   29.55  ? 873  ILE A O   1 
ATOM   1961 C CB  . ILE A 1 270 ? 33.162 -20.629 -2.771  1.00   33.54  ? 873  ILE A CB  1 
ATOM   1962 C CG1 . ILE A 1 270 ? 31.907 -20.337 -1.921  1.00   32.51  ? 873  ILE A CG1 1 
ATOM   1963 C CG2 . ILE A 1 270 ? 32.831 -21.492 -3.980  1.00   31.99  ? 873  ILE A CG2 1 
ATOM   1964 C CD1 . ILE A 1 270 ? 30.869 -19.439 -2.580  1.00   33.41  ? 873  ILE A CD1 1 
ATOM   1965 N N   . VAL A 1 271 ? 36.282 -20.955 -3.145  1.00   29.13  ? 874  VAL A N   1 
ATOM   1966 C CA  . VAL A 1 271 ? 37.481 -21.356 -3.870  1.00   28.56  ? 874  VAL A CA  1 
ATOM   1967 C C   . VAL A 1 271 ? 38.418 -22.255 -3.026  1.00   32.13  ? 874  VAL A C   1 
ATOM   1968 O O   . VAL A 1 271 ? 38.901 -23.273 -3.524  1.00   31.36  ? 874  VAL A O   1 
ATOM   1969 C CB  . VAL A 1 271 ? 38.237 -20.115 -4.384  1.00   28.96  ? 874  VAL A CB  1 
ATOM   1970 C CG1 . VAL A 1 271 ? 39.563 -20.512 -5.028  1.00   29.69  ? 874  VAL A CG1 1 
ATOM   1971 C CG2 . VAL A 1 271 ? 37.358 -19.357 -5.370  1.00   26.37  ? 874  VAL A CG2 1 
ATOM   1972 N N   . ARG A 1 272 ? 38.658 -21.901 -1.758  1.00   32.89  ? 875  ARG A N   1 
ATOM   1973 C CA  . ARG A 1 272 ? 39.495 -22.724 -0.875  1.00   31.82  ? 875  ARG A CA  1 
ATOM   1974 C C   . ARG A 1 272 ? 38.939 -24.135 -0.726  1.00   30.78  ? 875  ARG A C   1 
ATOM   1975 O O   . ARG A 1 272 ? 39.675 -25.119 -0.780  1.00   29.78  ? 875  ARG A O   1 
ATOM   1976 C CB  . ARG A 1 272 ? 39.634 -22.103 0.520   1.00   31.00  ? 875  ARG A CB  1 
ATOM   1977 C CG  . ARG A 1 272 ? 40.440 -23.006 1.495   1.00   39.09  ? 875  ARG A CG  1 
ATOM   1978 C CD  . ARG A 1 272 ? 40.499 -22.454 2.930   1.00   42.99  ? 875  ARG A CD  1 
ATOM   1979 N NE  . ARG A 1 272 ? 40.470 -21.005 2.869   1.00   45.52  ? 875  ARG A NE  1 
ATOM   1980 C CZ  . ARG A 1 272 ? 39.686 -20.231 3.611   1.00   56.07  ? 875  ARG A CZ  1 
ATOM   1981 N NH1 . ARG A 1 272 ? 38.872 -20.765 4.533   1.00   44.63  ? 875  ARG A NH1 1 
ATOM   1982 N NH2 . ARG A 1 272 ? 39.732 -18.908 3.425   1.00   51.28  ? 875  ARG A NH2 1 
ATOM   1983 N N   . LYS A 1 273 ? 37.632 -24.225 -0.541  1.00   27.92  ? 876  LYS A N   1 
ATOM   1984 C CA  . LYS A 1 273 ? 36.999 -25.507 -0.331  1.00   28.95  ? 876  LYS A CA  1 
ATOM   1985 C C   . LYS A 1 273 ? 37.125 -26.388 -1.587  1.00   35.54  ? 876  LYS A C   1 
ATOM   1986 O O   . LYS A 1 273 ? 37.285 -27.612 -1.466  1.00   31.20  ? 876  LYS A O   1 
ATOM   1987 C CB  . LYS A 1 273 ? 35.536 -25.306 0.075   1.00   32.47  ? 876  LYS A CB  1 
ATOM   1988 C CG  . LYS A 1 273 ? 34.808 -26.614 0.389   1.00   45.22  ? 876  LYS A CG  1 
ATOM   1989 C CD  . LYS A 1 273 ? 33.313 -26.411 0.549   0.0000 39.04  ? 876  LYS A CD  1 
ATOM   1990 C CE  . LYS A 1 273 ? 32.622 -27.705 0.931   0.0000 41.34  ? 876  LYS A CE  1 
ATOM   1991 N NZ  . LYS A 1 273 ? 32.994 -28.111 2.312   0.0000 42.51  ? 876  LYS A NZ  1 
ATOM   1992 N N   . MET A 1 274 ? 37.070 -25.764 -2.778  1.00   31.12  ? 877  MET A N   1 
ATOM   1993 C CA  . MET A 1 274 ? 37.346 -26.469 -4.039  1.00   30.84  ? 877  MET A CA  1 
ATOM   1994 C C   . MET A 1 274 ? 38.790 -26.924 -4.089  1.00   29.44  ? 877  MET A C   1 
ATOM   1995 O O   . MET A 1 274 ? 39.076 -28.081 -4.389  1.00   29.75  ? 877  MET A O   1 
ATOM   1996 C CB  . MET A 1 274 ? 37.072 -25.594 -5.262  1.00   29.66  ? 877  MET A CB  1 
ATOM   1997 C CG  . MET A 1 274 ? 35.629 -25.336 -5.538  1.00   36.76  ? 877  MET A CG  1 
ATOM   1998 S SD  . MET A 1 274 ? 35.394 -24.443 -7.086  1.00   40.30  ? 877  MET A SD  1 
ATOM   1999 C CE  . MET A 1 274 ? 36.241 -22.915 -6.741  1.00   37.00  ? 877  MET A CE  1 
ATOM   2000 N N   . ARG A 1 275 ? 39.700 -26.001 -3.801  1.00   28.61  ? 878  ARG A N   1 
ATOM   2001 C CA  . ARG A 1 275 ? 41.124 -26.295 -3.908  1.00   34.05  ? 878  ARG A CA  1 
ATOM   2002 C C   . ARG A 1 275 ? 41.552 -27.389 -2.943  1.00   33.57  ? 878  ARG A C   1 
ATOM   2003 O O   . ARG A 1 275 ? 42.545 -28.093 -3.196  1.00   29.90  ? 878  ARG A O   1 
ATOM   2004 C CB  . ARG A 1 275 ? 41.956 -25.038 -3.686  1.00   30.06  ? 878  ARG A CB  1 
ATOM   2005 C CG  . ARG A 1 275 ? 41.793 -24.070 -4.827  1.00   33.23  ? 878  ARG A CG  1 
ATOM   2006 C CD  . ARG A 1 275 ? 42.738 -22.910 -4.740  1.00   29.59  ? 878  ARG A CD  1 
ATOM   2007 N NE  . ARG A 1 275 ? 42.566 -22.074 -5.916  1.00   31.44  ? 878  ARG A NE  1 
ATOM   2008 C CZ  . ARG A 1 275 ? 43.275 -20.987 -6.184  1.00   31.33  ? 878  ARG A CZ  1 
ATOM   2009 N NH1 . ARG A 1 275 ? 44.242 -20.592 -5.365  1.00   33.66  ? 878  ARG A NH1 1 
ATOM   2010 N NH2 . ARG A 1 275 ? 43.019 -20.302 -7.284  1.00   30.17  ? 878  ARG A NH2 1 
ATOM   2011 N N   . ASP A 1 276 ? 40.784 -27.558 -1.867  1.00   28.56  ? 879  ASP A N   1 
ATOM   2012 C CA  . ASP A 1 276 ? 41.053 -28.634 -0.917  1.00   31.58  ? 879  ASP A CA  1 
ATOM   2013 C C   . ASP A 1 276 ? 40.704 -30.011 -1.495  1.00   28.48  ? 879  ASP A C   1 
ATOM   2014 O O   . ASP A 1 276 ? 41.129 -31.027 -0.966  1.00   29.72  ? 879  ASP A O   1 
ATOM   2015 C CB  . ASP A 1 276 ? 40.298 -28.394 0.388   1.00   28.59  ? 879  ASP A CB  1 
ATOM   2016 C CG  . ASP A 1 276 ? 40.876 -27.231 1.189   1.00   33.71  ? 879  ASP A CG  1 
ATOM   2017 O OD1 . ASP A 1 276 ? 41.941 -26.706 0.795   1.00   33.43  ? 879  ASP A OD1 1 
ATOM   2018 O OD2 . ASP A 1 276 ? 40.279 -26.845 2.215   1.00   34.80  ? 879  ASP A OD2 1 
ATOM   2019 N N   . GLN A 1 277 ? 39.976 -30.034 -2.607  1.00   31.92  ? 880  GLN A N   1 
ATOM   2020 C CA  . GLN A 1 277 ? 39.542 -31.285 -3.221  1.00   28.76  ? 880  GLN A CA  1 
ATOM   2021 C C   . GLN A 1 277 ? 40.112 -31.502 -4.618  1.00   30.50  ? 880  GLN A C   1 
ATOM   2022 O O   . GLN A 1 277 ? 40.183 -32.634 -5.080  1.00   33.96  ? 880  GLN A O   1 
ATOM   2023 C CB  . GLN A 1 277 ? 38.023 -31.333 -3.270  1.00   28.25  ? 880  GLN A CB  1 
ATOM   2024 C CG  . GLN A 1 277 ? 37.376 -31.111 -1.906  1.00   22.02  ? 880  GLN A CG  1 
ATOM   2025 C CD  . GLN A 1 277 ? 35.877 -30.901 -2.014  1.00   26.13  ? 880  GLN A CD  1 
ATOM   2026 O OE1 . GLN A 1 277 ? 35.112 -31.864 -2.096  1.00   27.64  ? 880  GLN A OE1 1 
ATOM   2027 N NE2 . GLN A 1 277 ? 35.448 -29.631 -2.030  1.00   23.68  ? 880  GLN A NE2 1 
ATOM   2028 N N   . ARG A 1 278 ? 40.492 -30.422 -5.295  1.00   31.91  ? 881  ARG A N   1 
ATOM   2029 C CA  . ARG A 1 278 ? 41.244 -30.492 -6.556  1.00   28.21  ? 881  ARG A CA  1 
ATOM   2030 C C   . ARG A 1 278 ? 42.057 -29.207 -6.677  1.00   33.75  ? 881  ARG A C   1 
ATOM   2031 O O   . ARG A 1 278 ? 41.502 -28.104 -6.582  1.00   31.78  ? 881  ARG A O   1 
ATOM   2032 C CB  . ARG A 1 278 ? 40.318 -30.660 -7.764  1.00   29.13  ? 881  ARG A CB  1 
ATOM   2033 C CG  . ARG A 1 278 ? 41.004 -30.609 -9.139  1.00   26.55  ? 881  ARG A CG  1 
ATOM   2034 C CD  . ARG A 1 278 ? 40.075 -31.160 -10.213 1.00   28.48  ? 881  ARG A CD  1 
ATOM   2035 N NE  . ARG A 1 278 ? 40.655 -31.233 -11.565 1.00   31.49  ? 881  ARG A NE  1 
ATOM   2036 C CZ  . ARG A 1 278 ? 41.383 -32.252 -12.018 1.00   29.64  ? 881  ARG A CZ  1 
ATOM   2037 N NH1 . ARG A 1 278 ? 41.666 -33.285 -11.221 1.00   30.00  ? 881  ARG A NH1 1 
ATOM   2038 N NH2 . ARG A 1 278 ? 41.842 -32.234 -13.259 1.00   24.10  ? 881  ARG A NH2 1 
ATOM   2039 N N   . ALA A 1 279 ? 43.369 -29.347 -6.862  1.00   27.25  ? 882  ALA A N   1 
ATOM   2040 C CA  . ALA A 1 279 ? 44.261 -28.190 -6.824  1.00   29.05  ? 882  ALA A CA  1 
ATOM   2041 C C   . ALA A 1 279 ? 43.977 -27.202 -7.955  1.00   34.40  ? 882  ALA A C   1 
ATOM   2042 O O   . ALA A 1 279 ? 43.643 -27.608 -9.073  1.00   28.27  ? 882  ALA A O   1 
ATOM   2043 C CB  . ALA A 1 279 ? 45.711 -28.641 -6.883  1.00   29.64  ? 882  ALA A CB  1 
ATOM   2044 N N   . MET A 1 280 ? 44.082 -25.914 -7.621  1.00   34.60  ? 883  MET A N   1 
ATOM   2045 C CA  . MET A 1 280 ? 44.202 -24.802 -8.579  1.00   35.08  ? 883  MET A CA  1 
ATOM   2046 C C   . MET A 1 280 ? 42.900 -24.329 -9.217  1.00   31.20  ? 883  MET A C   1 
ATOM   2047 O O   . MET A 1 280 ? 42.957 -23.495 -10.111 1.00   30.24  ? 883  MET A O   1 
ATOM   2048 C CB  . MET A 1 280 ? 45.200 -25.150 -9.704  1.00   30.66  ? 883  MET A CB  1 
ATOM   2049 C CG  . MET A 1 280 ? 46.672 -25.218 -9.255  1.00   42.05  ? 883  MET A CG  1 
ATOM   2050 S SD  . MET A 1 280 ? 47.812 -25.921 -10.503 1.00   59.05  ? 883  MET A SD  1 
ATOM   2051 C CE  . MET A 1 280 ? 47.028 -27.515 -10.744 1.00   44.99  ? 883  MET A CE  1 
ATOM   2052 N N   . MET A 1 281 ? 41.751 -24.835 -8.751  1.00   34.20  ? 884  MET A N   1 
ATOM   2053 C CA  . MET A 1 281 ? 40.432 -24.409 -9.253  1.00   28.91  ? 884  MET A CA  1 
ATOM   2054 C C   . MET A 1 281 ? 40.317 -22.884 -9.271  1.00   27.25  ? 884  MET A C   1 
ATOM   2055 O O   . MET A 1 281 ? 40.768 -22.223 -8.342  1.00   31.13  ? 884  MET A O   1 
ATOM   2056 C CB  . MET A 1 281 ? 39.299 -24.998 -8.405  1.00   35.38  ? 884  MET A CB  1 
ATOM   2057 C CG  . MET A 1 281 ? 39.380 -26.502 -8.138  1.00   32.80  ? 884  MET A CG  1 
ATOM   2058 S SD  . MET A 1 281 ? 38.608 -27.529 -9.397  1.00   49.81  ? 884  MET A SD  1 
ATOM   2059 C CE  . MET A 1 281 ? 36.861 -27.280 -9.083  1.00   34.57  ? 884  MET A CE  1 
ATOM   2060 N N   . VAL A 1 282 ? 39.698 -22.345 -10.325 1.00   32.41  ? 885  VAL A N   1 
ATOM   2061 C CA  . VAL A 1 282 ? 39.768 -20.917 -10.678 1.00   29.69  ? 885  VAL A CA  1 
ATOM   2062 C C   . VAL A 1 282 ? 41.115 -20.249 -10.991 1.00   30.72  ? 885  VAL A C   1 
ATOM   2063 O O   . VAL A 1 282 ? 41.629 -19.441 -10.217 1.00   31.51  ? 885  VAL A O   1 
ATOM   2064 C CB  . VAL A 1 282 ? 39.080 -20.018 -9.626  1.00   30.72  ? 885  VAL A CB  1 
ATOM   2065 C CG1 . VAL A 1 282 ? 38.970 -18.595 -10.129 1.00   31.99  ? 885  VAL A CG1 1 
ATOM   2066 C CG2 . VAL A 1 282 ? 37.712 -20.570 -9.284  1.00   32.21  ? 885  VAL A CG2 1 
ATOM   2067 N N   . GLN A 1 283 ? 41.687 -20.601 -12.135 1.00   32.96  ? 886  GLN A N   1 
ATOM   2068 C CA  . GLN A 1 283 ? 43.075 -20.252 -12.417 1.00   36.99  ? 886  GLN A CA  1 
ATOM   2069 C C   . GLN A 1 283 ? 43.617 -18.821 -12.364 1.00   34.45  ? 886  GLN A C   1 
ATOM   2070 O O   . GLN A 1 283 ? 44.641 -18.577 -11.753 1.00   36.18  ? 886  GLN A O   1 
ATOM   2071 C CB  . GLN A 1 283 ? 43.361 -20.854 -13.791 1.00   33.97  ? 886  GLN A CB  1 
ATOM   2072 C CG  . GLN A 1 283 ? 44.806 -20.727 -14.233 1.00   33.21  ? 886  GLN A CG  1 
ATOM   2073 C CD  . GLN A 1 283 ? 45.029 -21.221 -15.657 1.00   41.30  ? 886  GLN A CD  1 
ATOM   2074 O OE1 . GLN A 1 283 ? 44.098 -21.302 -16.470 1.00   35.41  ? 886  GLN A OE1 1 
ATOM   2075 N NE2 . GLN A 1 283 ? 46.269 -21.562 -15.962 1.00   46.10  ? 886  GLN A NE2 1 
ATOM   2076 N N   . THR A 1 284 ? 42.941 -17.876 -12.993 1.00   33.26  ? 887  THR A N   1 
ATOM   2077 C CA  . THR A 1 284 ? 43.504 -16.539 -13.101 1.00   35.98  ? 887  THR A CA  1 
ATOM   2078 C C   . THR A 1 284 ? 42.761 -15.566 -12.209 1.00   36.08  ? 887  THR A C   1 
ATOM   2079 O O   . THR A 1 284 ? 41.628 -15.837 -11.810 1.00   39.31  ? 887  THR A O   1 
ATOM   2080 C CB  . THR A 1 284 ? 43.470 -16.023 -14.575 1.00   40.60  ? 887  THR A CB  1 
ATOM   2081 O OG1 . THR A 1 284 ? 42.127 -15.694 -14.950 1.00   37.13  ? 887  THR A OG1 1 
ATOM   2082 C CG2 . THR A 1 284 ? 44.027 -17.079 -15.531 1.00   35.74  ? 887  THR A CG2 1 
ATOM   2083 N N   . SER A 1 285 ? 43.391 -14.434 -11.895 1.00   38.39  ? 888  SER A N   1 
ATOM   2084 C CA  A SER A 1 285 ? 42.715 -13.393 -11.123 0.47   36.90  ? 888  SER A CA  1 
ATOM   2085 C CA  B SER A 1 285 ? 42.732 -13.365 -11.138 0.53   36.64  ? 888  SER A CA  1 
ATOM   2086 C C   . SER A 1 285 ? 41.552 -12.792 -11.920 1.00   40.34  ? 888  SER A C   1 
ATOM   2087 O O   . SER A 1 285 ? 40.554 -12.354 -11.325 1.00   35.93  ? 888  SER A O   1 
ATOM   2088 C CB  A SER A 1 285 ? 43.697 -12.297 -10.703 0.47   36.00  ? 888  SER A CB  1 
ATOM   2089 C CB  B SER A 1 285 ? 43.715 -12.242 -10.801 0.53   35.99  ? 888  SER A CB  1 
ATOM   2090 O OG  A SER A 1 285 ? 44.327 -11.708 -11.824 0.47   40.58  ? 888  SER A OG  1 
ATOM   2091 O OG  B SER A 1 285 ? 44.827 -12.727 -10.074 0.53   39.68  ? 888  SER A OG  1 
ATOM   2092 N N   . SER A 1 286 ? 41.670 -12.794 -13.258 1.00   30.56  ? 889  SER A N   1 
ATOM   2093 C CA  . SER A 1 286 ? 40.592 -12.316 -14.130 1.00   33.04  ? 889  SER A CA  1 
ATOM   2094 C C   . SER A 1 286 ? 39.354 -13.204 -14.051 1.00   37.11  ? 889  SER A C   1 
ATOM   2095 O O   . SER A 1 286 ? 38.226 -12.707 -13.938 1.00   36.10  ? 889  SER A O   1 
ATOM   2096 C CB  . SER A 1 286 ? 41.067 -12.213 -15.570 1.00   39.47  ? 889  SER A CB  1 
ATOM   2097 O OG  . SER A 1 286 ? 41.809 -11.019 -15.733 1.00   53.53  ? 889  SER A OG  1 
ATOM   2098 N N   . GLN A 1 287 ? 39.565 -14.514 -14.081 1.00   34.05  ? 890  GLN A N   1 
ATOM   2099 C CA  . GLN A 1 287 ? 38.483 -15.454 -13.812 1.00   37.10  ? 890  GLN A CA  1 
ATOM   2100 C C   . GLN A 1 287 ? 37.836 -15.219 -12.427 1.00   41.17  ? 890  GLN A C   1 
ATOM   2101 O O   . GLN A 1 287 ? 36.614 -15.315 -12.289 1.00   38.75  ? 890  GLN A O   1 
ATOM   2102 C CB  . GLN A 1 287 ? 38.989 -16.897 -13.906 1.00   32.49  ? 890  GLN A CB  1 
ATOM   2103 C CG  . GLN A 1 287 ? 39.423 -17.302 -15.297 1.00   36.59  ? 890  GLN A CG  1 
ATOM   2104 C CD  . GLN A 1 287 ? 39.977 -18.718 -15.349 1.00   35.36  ? 890  GLN A CD  1 
ATOM   2105 O OE1 . GLN A 1 287 ? 40.477 -19.238 -14.353 1.00   34.38  ? 890  GLN A OE1 1 
ATOM   2106 N NE2 . GLN A 1 287 ? 39.878 -19.348 -16.511 1.00   32.51  ? 890  GLN A NE2 1 
ATOM   2107 N N   . TYR A 1 288 ? 38.635 -14.920 -11.401 1.00   31.15  ? 891  TYR A N   1 
ATOM   2108 C CA  . TYR A 1 288 ? 38.063 -14.777 -10.074 1.00   32.60  ? 891  TYR A CA  1 
ATOM   2109 C C   . TYR A 1 288 ? 37.280 -13.471 -9.981  1.00   34.90  ? 891  TYR A C   1 
ATOM   2110 O O   . TYR A 1 288 ? 36.158 -13.444 -9.469  1.00   32.73  ? 891  TYR A O   1 
ATOM   2111 C CB  . TYR A 1 288 ? 39.160 -14.834 -8.997  1.00   39.87  ? 891  TYR A CB  1 
ATOM   2112 C CG  . TYR A 1 288 ? 38.660 -14.668 -7.581  1.00   30.93  ? 891  TYR A CG  1 
ATOM   2113 C CD1 . TYR A 1 288 ? 37.915 -15.669 -6.969  1.00   33.45  ? 891  TYR A CD1 1 
ATOM   2114 C CD2 . TYR A 1 288 ? 38.942 -13.518 -6.851  1.00   35.79  ? 891  TYR A CD2 1 
ATOM   2115 C CE1 . TYR A 1 288 ? 37.453 -15.526 -5.664  1.00   38.07  ? 891  TYR A CE1 1 
ATOM   2116 C CE2 . TYR A 1 288 ? 38.506 -13.372 -5.533  1.00   37.69  ? 891  TYR A CE2 1 
ATOM   2117 C CZ  . TYR A 1 288 ? 37.759 -14.384 -4.946  1.00   40.53  ? 891  TYR A CZ  1 
ATOM   2118 O OH  . TYR A 1 288 ? 37.293 -14.264 -3.659  1.00   34.32  ? 891  TYR A OH  1 
ATOM   2119 N N   . LYS A 1 289 ? 37.880 -12.394 -10.488 1.00   35.25  ? 892  LYS A N   1 
ATOM   2120 C CA  . LYS A 1 289 ? 37.228 -11.087 -10.521 1.00   42.16  ? 892  LYS A CA  1 
ATOM   2121 C C   . LYS A 1 289 ? 35.916 -11.167 -11.281 1.00   41.11  ? 892  LYS A C   1 
ATOM   2122 O O   . LYS A 1 289 ? 34.913 -10.583 -10.871 1.00   38.74  ? 892  LYS A O   1 
ATOM   2123 C CB  . LYS A 1 289 ? 38.128 -10.035 -11.166 1.00   42.28  ? 892  LYS A CB  1 
ATOM   2124 C CG  . LYS A 1 289 ? 37.549 -8.636  -11.109 1.00   40.39  ? 892  LYS A CG  1 
ATOM   2125 C CD  . LYS A 1 289 ? 38.531 -7.617  -11.665 0.0000 47.44  ? 892  LYS A CD  1 
ATOM   2126 C CE  . LYS A 1 289 ? 38.069 -6.197  -11.390 0.0000 50.20  ? 892  LYS A CE  1 
ATOM   2127 N NZ  . LYS A 1 289 ? 38.006 -5.913  -9.930  0.0000 50.17  ? 892  LYS A NZ  1 
ATOM   2128 N N   . PHE A 1 290 ? 35.937 -11.916 -12.380 1.00   37.23  ? 893  PHE A N   1 
ATOM   2129 C CA  . PHE A 1 290 ? 34.744 -12.148 -13.182 1.00   36.83  ? 893  PHE A CA  1 
ATOM   2130 C C   . PHE A 1 290 ? 33.617 -12.824 -12.415 1.00   38.33  ? 893  PHE A C   1 
ATOM   2131 O O   . PHE A 1 290 ? 32.469 -12.399 -12.497 1.00   41.69  ? 893  PHE A O   1 
ATOM   2132 C CB  . PHE A 1 290 ? 35.078 -12.990 -14.414 1.00   37.56  ? 893  PHE A CB  1 
ATOM   2133 C CG  . PHE A 1 290 ? 33.859 -13.513 -15.139 1.00   41.92  ? 893  PHE A CG  1 
ATOM   2134 C CD1 . PHE A 1 290 ? 33.272 -12.774 -16.154 1.00   32.33  ? 893  PHE A CD1 1 
ATOM   2135 C CD2 . PHE A 1 290 ? 33.303 -14.750 -14.805 1.00   40.90  ? 893  PHE A CD2 1 
ATOM   2136 C CE1 . PHE A 1 290 ? 32.168 -13.250 -16.814 1.00   39.27  ? 893  PHE A CE1 1 
ATOM   2137 C CE2 . PHE A 1 290 ? 32.179 -15.234 -15.474 1.00   41.80  ? 893  PHE A CE2 1 
ATOM   2138 C CZ  . PHE A 1 290 ? 31.617 -14.479 -16.472 1.00   43.52  ? 893  PHE A CZ  1 
ATOM   2139 N N   . VAL A 1 291 ? 33.919 -13.902 -11.697 1.00   40.42  ? 894  VAL A N   1 
ATOM   2140 C CA  . VAL A 1 291 ? 32.843 -14.643 -11.048 1.00   40.69  ? 894  VAL A CA  1 
ATOM   2141 C C   . VAL A 1 291 ? 32.304 -13.838 -9.851  1.00   42.93  ? 894  VAL A C   1 
ATOM   2142 O O   . VAL A 1 291 ? 31.109 -13.917 -9.529  1.00   38.43  ? 894  VAL A O   1 
ATOM   2143 C CB  . VAL A 1 291 ? 33.290 -16.069 -10.613 1.00   35.23  ? 894  VAL A CB  1 
ATOM   2144 C CG1 . VAL A 1 291 ? 34.276 -16.024 -9.428  1.00   34.28  ? 894  VAL A CG1 1 
ATOM   2145 C CG2 . VAL A 1 291 ? 32.068 -16.920 -10.284 1.00   31.02  ? 894  VAL A CG2 1 
ATOM   2146 N N   . CYS A 1 292 ? 33.173 -13.042 -9.222  1.00   39.06  ? 895  CYS A N   1 
ATOM   2147 C CA  . CYS A 1 292 ? 32.742 -12.179 -8.122  1.00   44.56  ? 895  CYS A CA  1 
ATOM   2148 C C   . CYS A 1 292 ? 31.746 -11.125 -8.614  1.00   44.92  ? 895  CYS A C   1 
ATOM   2149 O O   . CYS A 1 292 ? 30.743 -10.861 -7.953  1.00   42.57  ? 895  CYS A O   1 
ATOM   2150 C CB  . CYS A 1 292 ? 33.941 -11.504 -7.443  1.00   44.36  ? 895  CYS A CB  1 
ATOM   2151 S SG  . CYS A 1 292 ? 34.927 -12.614 -6.398  1.00   37.98  ? 895  CYS A SG  1 
ATOM   2152 N N   . GLU A 1 293 ? 32.017 -10.543 -9.782  1.00   44.29  ? 896  GLU A N   1 
ATOM   2153 C CA  . GLU A 1 293 ? 31.130 -9.535  -10.361 1.00   42.80  ? 896  GLU A CA  1 
ATOM   2154 C C   . GLU A 1 293 ? 29.795 -10.124 -10.787 1.00   39.75  ? 896  GLU A C   1 
ATOM   2155 O O   . GLU A 1 293 ? 28.751 -9.491  -10.639 1.00   46.12  ? 896  GLU A O   1 
ATOM   2156 C CB  . GLU A 1 293 ? 31.806 -8.856  -11.540 1.00   38.94  ? 896  GLU A CB  1 
ATOM   2157 C CG  . GLU A 1 293 ? 32.886 -7.891  -11.104 1.00   42.48  ? 896  GLU A CG  1 
ATOM   2158 C CD  . GLU A 1 293 ? 33.886 -7.600  -12.201 1.00   57.37  ? 896  GLU A CD  1 
ATOM   2159 O OE1 . GLU A 1 293 ? 33.606 -7.899  -13.388 1.00   55.45  ? 896  GLU A OE1 1 
ATOM   2160 O OE2 . GLU A 1 293 ? 34.973 -7.084  -11.867 1.00   70.47  ? 896  GLU A OE2 1 
ATOM   2161 N N   . ALA A 1 294 ? 29.833 -11.347 -11.292 1.00   39.99  ? 897  ALA A N   1 
ATOM   2162 C CA  . ALA A 1 294 ? 28.620 -12.051 -11.666 1.00   36.30  ? 897  ALA A CA  1 
ATOM   2163 C C   . ALA A 1 294 ? 27.757 -12.320 -10.447 1.00   43.03  ? 897  ALA A C   1 
ATOM   2164 O O   . ALA A 1 294 ? 26.528 -12.262 -10.529 1.00   43.98  ? 897  ALA A O   1 
ATOM   2165 C CB  . ALA A 1 294 ? 28.960 -13.346 -12.366 1.00   39.13  ? 897  ALA A CB  1 
ATOM   2166 N N   . ILE A 1 295 ? 28.409 -12.619 -9.320  1.00   41.61  ? 898  ILE A N   1 
ATOM   2167 C CA  . ILE A 1 295 ? 27.716 -12.911 -8.067  1.00   40.00  ? 898  ILE A CA  1 
ATOM   2168 C C   . ILE A 1 295 ? 26.990 -11.665 -7.551  1.00   40.39  ? 898  ILE A C   1 
ATOM   2169 O O   . ILE A 1 295 ? 25.833 -11.739 -7.160  1.00   45.00  ? 898  ILE A O   1 
ATOM   2170 C CB  . ILE A 1 295 ? 28.697 -13.441 -6.983  1.00   45.10  ? 898  ILE A CB  1 
ATOM   2171 C CG1 . ILE A 1 295 ? 29.143 -14.867 -7.304  1.00   46.02  ? 898  ILE A CG1 1 
ATOM   2172 C CG2 . ILE A 1 295 ? 28.065 -13.396 -5.580  1.00   41.89  ? 898  ILE A CG2 1 
ATOM   2173 C CD1 . ILE A 1 295 ? 30.271 -15.385 -6.401  1.00   41.90  ? 898  ILE A CD1 1 
ATOM   2174 N N   . LEU A 1 296 ? 27.669 -10.522 -7.552  1.00   43.29  ? 899  LEU A N   1 
ATOM   2175 C CA  . LEU A 1 296 ? 27.034 -9.249  -7.213  1.00   47.36  ? 899  LEU A CA  1 
ATOM   2176 C C   . LEU A 1 296 ? 25.899 -8.903  -8.184  1.00   55.09  ? 899  LEU A C   1 
ATOM   2177 O O   . LEU A 1 296 ? 24.853 -8.398  -7.774  1.00   56.56  ? 899  LEU A O   1 
ATOM   2178 C CB  . LEU A 1 296 ? 28.062 -8.119  -7.220  1.00   46.20  ? 899  LEU A CB  1 
ATOM   2179 C CG  . LEU A 1 296 ? 28.648 -7.574  -5.922  1.00   48.68  ? 899  LEU A CG  1 
ATOM   2180 C CD1 . LEU A 1 296 ? 29.633 -6.498  -6.298  1.00   42.35  ? 899  LEU A CD1 1 
ATOM   2181 C CD2 . LEU A 1 296 ? 27.572 -7.029  -4.981  1.00   42.34  ? 899  LEU A CD2 1 
ATOM   2182 N N   . ARG A 1 297 ? 26.127 -9.169  -9.472  1.00   52.32  ? 900  ARG A N   1 
ATOM   2183 C CA  . ARG A 1 297 ? 25.141 -8.928  -10.512 1.00   44.72  ? 900  ARG A CA  1 
ATOM   2184 C C   . ARG A 1 297 ? 23.855 -9.715  -10.291 1.00   52.12  ? 900  ARG A C   1 
ATOM   2185 O O   . ARG A 1 297 ? 22.766 -9.148  -10.310 1.00   57.59  ? 900  ARG A O   1 
ATOM   2186 C CB  . ARG A 1 297 ? 25.726 -9.278  -11.872 1.00   49.91  ? 900  ARG A CB  1 
ATOM   2187 C CG  . ARG A 1 297 ? 25.063 -8.545  -13.008 1.00   56.78  ? 900  ARG A CG  1 
ATOM   2188 C CD  . ARG A 1 297 ? 25.544 -9.048  -14.336 1.00   56.47  ? 900  ARG A CD  1 
ATOM   2189 N NE  . ARG A 1 297 ? 24.427 -9.520  -15.146 1.00   71.62  ? 900  ARG A NE  1 
ATOM   2190 C CZ  . ARG A 1 297 ? 24.545 -10.002 -16.381 1.00   64.23  ? 900  ARG A CZ  1 
ATOM   2191 N NH1 . ARG A 1 297 ? 23.462 -10.398 -17.041 1.00   63.48  ? 900  ARG A NH1 1 
ATOM   2192 N NH2 . ARG A 1 297 ? 25.744 -10.086 -16.958 1.00   53.89  ? 900  ARG A NH2 1 
ATOM   2193 N N   . VAL A 1 298 ? 23.982 -11.022 -10.089 1.00   47.49  ? 901  VAL A N   1 
ATOM   2194 C CA  . VAL A 1 298 ? 22.822 -11.870 -9.835  1.00   51.20  ? 901  VAL A CA  1 
ATOM   2195 C C   . VAL A 1 298 ? 22.045 -11.396 -8.598  1.00   58.28  ? 901  VAL A C   1 
ATOM   2196 O O   . VAL A 1 298 ? 20.809 -11.342 -8.602  1.00   58.34  ? 901  VAL A O   1 
ATOM   2197 C CB  . VAL A 1 298 ? 23.242 -13.339 -9.646  1.00   44.01  ? 901  VAL A CB  1 
ATOM   2198 C CG1 . VAL A 1 298 ? 22.115 -14.150 -9.031  1.00   49.69  ? 901  VAL A CG1 1 
ATOM   2199 C CG2 . VAL A 1 298 ? 23.681 -13.931 -10.956 1.00   42.28  ? 901  VAL A CG2 1 
ATOM   2200 N N   . TYR A 1 299 ? 22.782 -11.037 -7.551  1.00   50.81  ? 902  TYR A N   1 
ATOM   2201 C CA  . TYR A 1 299 ? 22.182 -10.582 -6.300  1.00   58.00  ? 902  TYR A CA  1 
ATOM   2202 C C   . TYR A 1 299 ? 21.376 -9.280  -6.453  1.00   62.75  ? 902  TYR A C   1 
ATOM   2203 O O   . TYR A 1 299 ? 20.235 -9.180  -5.984  1.00   57.38  ? 902  TYR A O   1 
ATOM   2204 C CB  . TYR A 1 299 ? 23.268 -10.396 -5.235  1.00   49.16  ? 902  TYR A CB  1 
ATOM   2205 C CG  . TYR A 1 299 ? 22.782 -9.629  -4.039  1.00   50.61  ? 902  TYR A CG  1 
ATOM   2206 C CD1 . TYR A 1 299 ? 21.909 -10.210 -3.129  1.00   49.76  ? 902  TYR A CD1 1 
ATOM   2207 C CD2 . TYR A 1 299 ? 23.179 -8.308  -3.827  1.00   51.11  ? 902  TYR A CD2 1 
ATOM   2208 C CE1 . TYR A 1 299 ? 21.449 -9.499  -2.033  1.00   57.38  ? 902  TYR A CE1 1 
ATOM   2209 C CE2 . TYR A 1 299 ? 22.721 -7.589  -2.737  1.00   47.27  ? 902  TYR A CE2 1 
ATOM   2210 C CZ  . TYR A 1 299 ? 21.862 -8.187  -1.844  1.00   51.37  ? 902  TYR A CZ  1 
ATOM   2211 O OH  . TYR A 1 299 ? 21.412 -7.481  -0.755  1.00   55.46  ? 902  TYR A OH  1 
ATOM   2212 N N   . GLU A 1 300 ? 21.975 -8.292  -7.108  1.00   52.94  ? 903  GLU A N   1 
ATOM   2213 C CA  . GLU A 1 300 ? 21.354 -6.988  -7.270  1.00   57.85  ? 903  GLU A CA  1 
ATOM   2214 C C   . GLU A 1 300 ? 20.131 -7.031  -8.186  1.00   69.74  ? 903  GLU A C   1 
ATOM   2215 O O   . GLU A 1 300 ? 19.157 -6.318  -7.951  1.00   77.03  ? 903  GLU A O   1 
ATOM   2216 C CB  . GLU A 1 300 ? 22.385 -5.986  -7.799  1.00   57.62  ? 903  GLU A CB  1 
ATOM   2217 C CG  . GLU A 1 300 ? 23.255 -5.385  -6.693  1.00   63.83  ? 903  GLU A CG  1 
ATOM   2218 C CD  . GLU A 1 300 ? 24.533 -4.763  -7.217  1.00   61.84  ? 903  GLU A CD  1 
ATOM   2219 O OE1 . GLU A 1 300 ? 24.861 -5.010  -8.394  1.00   65.94  ? 903  GLU A OE1 1 
ATOM   2220 O OE2 . GLU A 1 300 ? 25.214 -4.037  -6.454  1.00   68.47  ? 903  GLU A OE2 1 
ATOM   2221 N N   . GLU A 1 301 ? 20.177 -7.874  -9.215  1.00   64.42  ? 904  GLU A N   1 
ATOM   2222 C CA  . GLU A 1 301 ? 19.068 -8.001  -10.157 1.00   67.84  ? 904  GLU A CA  1 
ATOM   2223 C C   . GLU A 1 301 ? 17.909 -8.835  -9.612  1.00   70.76  ? 904  GLU A C   1 
ATOM   2224 O O   . GLU A 1 301 ? 16.818 -8.824  -10.175 1.00   80.51  ? 904  GLU A O   1 
ATOM   2225 C CB  . GLU A 1 301 ? 19.555 -8.613  -11.467 1.00   60.46  ? 904  GLU A CB  1 
ATOM   2226 C CG  . GLU A 1 301 ? 20.566 -7.758  -12.195 1.00   64.92  ? 904  GLU A CG  1 
ATOM   2227 C CD  . GLU A 1 301 ? 21.080 -8.429  -13.455 1.00   67.72  ? 904  GLU A CD  1 
ATOM   2228 O OE1 . GLU A 1 301 ? 20.767 -9.625  -13.650 1.00   65.94  ? 904  GLU A OE1 1 
ATOM   2229 O OE2 . GLU A 1 301 ? 21.792 -7.761  -14.243 1.00   58.36  ? 904  GLU A OE2 1 
ATOM   2230 N N   . GLY A 1 302 ? 18.145 -9.571  -8.534  1.00   62.85  ? 905  GLY A N   1 
ATOM   2231 C CA  . GLY A 1 302 ? 17.082 -10.338 -7.908  1.00   69.97  ? 905  GLY A CA  1 
ATOM   2232 C C   . GLY A 1 302 ? 16.570 -9.671  -6.636  1.00   81.99  ? 905  GLY A C   1 
ATOM   2233 O O   . GLY A 1 302 ? 15.747 -10.236 -5.900  1.00   74.81  ? 905  GLY A O   1 
ATOM   2234 N N   . LEU A 1 303 ? 17.054 -8.456  -6.384  1.00   73.05  ? 906  LEU A N   1 
ATOM   2235 C CA  . LEU A 1 303 ? 16.727 -7.719  -5.168  1.00   71.99  ? 906  LEU A CA  1 
ATOM   2236 C C   . LEU A 1 303 ? 15.449 -6.902  -5.344  1.00   75.70  ? 906  LEU A C   1 
ATOM   2237 O O   . LEU A 1 303 ? 14.999 -6.672  -6.471  1.00   74.76  ? 906  LEU A O   1 
ATOM   2238 C CB  . LEU A 1 303 ? 17.898 -6.811  -4.787  1.00   69.88  ? 906  LEU A CB  1 
ATOM   2239 C CG  . LEU A 1 303 ? 17.965 -6.162  -3.402  1.00   72.43  ? 906  LEU A CG  1 
ATOM   2240 C CD1 . LEU A 1 303 ? 17.920 -7.201  -2.274  1.00   64.77  ? 906  LEU A CD1 1 
ATOM   2241 C CD2 . LEU A 1 303 ? 19.222 -5.303  -3.307  1.00   54.78  ? 906  LEU A CD2 1 
ATOM   2242 N N   . MET B 2 1   ? 54.561 -32.953 -22.798 1.00   58.01  ? 182  MET B N   1 
ATOM   2243 C CA  . MET B 2 1   ? 53.419 -32.258 -22.211 1.00   68.22  ? 182  MET B CA  1 
ATOM   2244 C C   . MET B 2 1   ? 53.746 -30.790 -22.041 1.00   73.59  ? 182  MET B C   1 
ATOM   2245 O O   . MET B 2 1   ? 54.796 -30.430 -21.503 1.00   76.27  ? 182  MET B O   1 
ATOM   2246 C CB  . MET B 2 1   ? 53.026 -32.868 -20.857 1.00   55.39  ? 182  MET B CB  1 
ATOM   2247 C CG  . MET B 2 1   ? 52.233 -34.153 -20.981 1.00   58.91  ? 182  MET B CG  1 
ATOM   2248 S SD  . MET B 2 1   ? 52.575 -35.386 -19.689 1.00   80.86  ? 182  MET B SD  1 
ATOM   2249 C CE  . MET B 2 1   ? 51.545 -34.831 -18.344 1.00   45.90  ? 182  MET B CE  1 
HETATM 2250 N N   . TPO B 2 2   ? 52.848 -29.938 -22.512 1.00   74.04  ? 183  TPO B N   1 
HETATM 2251 C CA  . TPO B 2 2   ? 52.972 -28.520 -22.248 1.00   74.51  ? 183  TPO B CA  1 
HETATM 2252 C CB  . TPO B 2 2   ? 52.184 -27.726 -23.292 1.00   78.15  ? 183  TPO B CB  1 
HETATM 2253 C CG2 . TPO B 2 2   ? 50.707 -27.591 -22.906 1.00   69.21  ? 183  TPO B CG2 1 
HETATM 2254 O OG1 . TPO B 2 2   ? 52.796 -26.445 -23.517 1.00   88.88  ? 183  TPO B OG1 1 
HETATM 2255 P P   . TPO B 2 2   ? 53.362 -26.426 -25.042 1.00   117.11 ? 183  TPO B P   1 
HETATM 2256 O O1P . TPO B 2 2   ? 54.020 -27.715 -25.389 1.00   86.73  ? 183  TPO B O1P 1 
HETATM 2257 O O2P . TPO B 2 2   ? 52.140 -26.211 -26.077 1.00   88.27  ? 183  TPO B O2P 1 
HETATM 2258 O O3P . TPO B 2 2   ? 54.424 -25.219 -25.211 1.00   98.44  ? 183  TPO B O3P 1 
HETATM 2259 C C   . TPO B 2 2   ? 52.469 -28.275 -20.820 1.00   68.18  ? 183  TPO B C   1 
HETATM 2260 O O   . TPO B 2 2   ? 51.782 -29.123 -20.251 1.00   65.38  ? 183  TPO B O   1 
ATOM   2261 N N   . GLY B 2 3   ? 52.846 -27.152 -20.220 1.00   66.29  ? 184  GLY B N   1 
ATOM   2262 C CA  . GLY B 2 3   ? 52.362 -26.828 -18.890 1.00   58.60  ? 184  GLY B CA  1 
ATOM   2263 C C   . GLY B 2 3   ? 51.103 -26.000 -19.021 1.00   59.28  ? 184  GLY B C   1 
ATOM   2264 O O   . GLY B 2 3   ? 50.995 -25.194 -19.936 1.00   62.49  ? 184  GLY B O   1 
HETATM 2265 N N   . PTR B 2 4   ? 50.143 -26.202 -18.124 1.00   54.98  ? 185  PTR B N   1 
HETATM 2266 C CA  . PTR B 2 4   ? 48.888 -25.450 -18.173 1.00   49.75  ? 185  PTR B CA  1 
HETATM 2267 C C   . PTR B 2 4   ? 48.980 -24.178 -17.328 1.00   57.69  ? 185  PTR B C   1 
HETATM 2268 O O   . PTR B 2 4   ? 48.136 -23.288 -17.460 1.00   57.79  ? 185  PTR B O   1 
HETATM 2269 C CB  . PTR B 2 4   ? 47.722 -26.332 -17.708 1.00   46.90  ? 185  PTR B CB  1 
HETATM 2270 C CG  . PTR B 2 4   ? 46.337 -25.718 -17.823 1.00   43.46  ? 185  PTR B CG  1 
HETATM 2271 C CD1 . PTR B 2 4   ? 45.620 -25.796 -19.011 1.00   40.06  ? 185  PTR B CD1 1 
HETATM 2272 C CD2 . PTR B 2 4   ? 45.728 -25.089 -16.731 1.00   39.52  ? 185  PTR B CD2 1 
HETATM 2273 C CE1 . PTR B 2 4   ? 44.344 -25.253 -19.122 1.00   38.36  ? 185  PTR B CE1 1 
HETATM 2274 C CE2 . PTR B 2 4   ? 44.451 -24.541 -16.831 1.00   37.62  ? 185  PTR B CE2 1 
HETATM 2275 C CZ  . PTR B 2 4   ? 43.755 -24.632 -18.031 1.00   41.94  ? 185  PTR B CZ  1 
HETATM 2276 O OH  . PTR B 2 4   ? 42.553 -24.106 -18.162 1.00   41.46  ? 185  PTR B OH  1 
HETATM 2277 P P   . PTR B 2 4   ? 41.165 -24.912 -17.926 1.00   39.84  ? 185  PTR B P   1 
HETATM 2278 O O1P . PTR B 2 4   ? 41.008 -25.967 -18.967 1.00   39.50  ? 185  PTR B O1P 1 
HETATM 2279 O O2P . PTR B 2 4   ? 41.221 -25.608 -16.551 1.00   41.05  ? 185  PTR B O2P 1 
HETATM 2280 O O3P . PTR B 2 4   ? 39.970 -23.935 -17.979 1.00   34.94  ? 185  PTR B O3P 1 
ATOM   2281 N N   . VAL B 2 5   ? 49.993 -24.098 -16.464 1.00   54.83  ? 186  VAL B N   1 
ATOM   2282 C CA  . VAL B 2 5   ? 50.207 -22.915 -15.630 1.00   58.54  ? 186  VAL B CA  1 
ATOM   2283 C C   . VAL B 2 5   ? 50.632 -21.703 -16.458 1.00   62.02  ? 186  VAL B C   1 
ATOM   2284 O O   . VAL B 2 5   ? 51.570 -21.771 -17.253 1.00   63.81  ? 186  VAL B O   1 
ATOM   2285 C CB  . VAL B 2 5   ? 51.261 -23.179 -14.541 1.00   62.38  ? 186  VAL B CB  1 
ATOM   2286 C CG1 . VAL B 2 5   ? 51.924 -21.880 -14.110 1.00   61.53  ? 186  VAL B CG1 1 
ATOM   2287 C CG2 . VAL B 2 5   ? 50.626 -23.899 -13.348 1.00   56.33  ? 186  VAL B CG2 1 
ATOM   2288 N N   . VAL B 2 6   ? 49.931 -20.593 -16.248 1.00   67.25  ? 187  VAL B N   1 
ATOM   2289 C CA  . VAL B 2 6   ? 50.109 -19.368 -17.024 1.00   70.11  ? 187  VAL B CA  1 
ATOM   2290 C C   . VAL B 2 6   ? 50.385 -18.183 -16.068 1.00   75.75  ? 187  VAL B C   1 
ATOM   2291 O O   . VAL B 2 6   ? 50.686 -18.401 -14.891 1.00   78.36  ? 187  VAL B O   1 
ATOM   2292 C CB  . VAL B 2 6   ? 48.852 -19.124 -17.927 1.00   68.83  ? 187  VAL B CB  1 
ATOM   2293 C CG1 . VAL B 2 6   ? 47.677 -18.539 -17.120 1.00   57.54  ? 187  VAL B CG1 1 
ATOM   2294 C CG2 . VAL B 2 6   ? 49.192 -18.274 -19.167 1.00   70.21  ? 187  VAL B CG2 1 
ATOM   2295 N N   . THR B 2 7   ? 50.306 -16.945 -16.561 1.00   76.81  ? 188  THR B N   1 
ATOM   2296 C CA  . THR B 2 7   ? 50.546 -15.762 -15.729 1.00   82.60  ? 188  THR B CA  1 
ATOM   2297 C C   . THR B 2 7   ? 49.350 -14.806 -15.524 1.00   83.59  ? 188  THR B C   1 
ATOM   2298 O O   . THR B 2 7   ? 48.606 -14.950 -14.553 1.00   87.76  ? 188  THR B O   1 
ATOM   2299 C CB  . THR B 2 7   ? 51.723 -14.932 -16.289 1.00   88.53  ? 188  THR B CB  1 
ATOM   2300 O OG1 . THR B 2 7   ? 51.302 -14.198 -17.446 1.00   79.18  ? 188  THR B OG1 1 
ATOM   2301 C CG2 . THR B 2 7   ? 52.894 -15.850 -16.661 1.00   81.81  ? 188  THR B CG2 1 
ATOM   2302 N N   . ARG B 2 8   ? 49.180 -13.839 -16.426 1.00   88.82  ? 189  ARG B N   1 
ATOM   2303 C CA  . ARG B 2 8   ? 48.035 -12.918 -16.402 1.00   87.93  ? 189  ARG B CA  1 
ATOM   2304 C C   . ARG B 2 8   ? 47.713 -12.316 -15.035 1.00   77.87  ? 189  ARG B C   1 
ATOM   2305 O O   . ARG B 2 8   ? 47.911 -11.123 -14.812 1.00   77.00  ? 189  ARG B O   1 
ATOM   2306 C CB  . ARG B 2 8   ? 46.809 -13.672 -16.937 1.00   77.45  ? 189  ARG B CB  1 
ATOM   2307 C CG  . ARG B 2 8   ? 46.249 -13.119 -18.235 0.0000 79.12  ? 189  ARG B CG  1 
ATOM   2308 C CD  . ARG B 2 8   ? 44.814 -13.578 -18.426 0.0000 73.27  ? 189  ARG B CD  1 
ATOM   2309 N NE  . ARG B 2 8   ? 44.205 -13.063 -19.648 0.0000 79.60  ? 189  ARG B NE  1 
ATOM   2310 C CZ  . ARG B 2 8   ? 44.192 -13.709 -20.810 0.0000 80.22  ? 189  ARG B CZ  1 
ATOM   2311 N NH1 . ARG B 2 8   ? 44.765 -14.900 -20.916 0.0000 84.38  ? 189  ARG B NH1 1 
ATOM   2312 N NH2 . ARG B 2 8   ? 43.607 -13.164 -21.868 0.0000 82.13  ? 189  ARG B NH2 1 
HETATM 2313 O O   . HOH C 3 .   ? 45.850 -36.635 -1.140  1.00   39.39  ? 1001 HOH A O   1 
HETATM 2314 O O   . HOH C 3 .   ? 27.453 -31.003 -26.272 1.00   34.53  ? 1002 HOH A O   1 
HETATM 2315 O O   . HOH C 3 .   ? 44.385 -31.607 -7.040  1.00   30.67  ? 1003 HOH A O   1 
HETATM 2316 O O   . HOH C 3 .   ? 42.766 -24.000 4.822   1.00   39.55  ? 1004 HOH A O   1 
HETATM 2317 O O   . HOH C 3 .   ? 47.458 -38.833 -7.185  1.00   39.76  ? 1005 HOH A O   1 
HETATM 2318 O O   . HOH C 3 .   ? 34.627 -50.369 -26.893 1.00   56.16  ? 1006 HOH A O   1 
HETATM 2319 O O   . HOH C 3 .   ? 33.296 -32.162 -33.541 1.00   47.11  ? 1007 HOH A O   1 
HETATM 2320 O O   . HOH C 3 .   ? 31.302 -28.302 -31.130 1.00   37.24  ? 1008 HOH A O   1 
HETATM 2321 O O   . HOH C 3 .   ? 47.737 -36.489 1.418   1.00   48.37  ? 1009 HOH A O   1 
HETATM 2322 O O   . HOH C 3 .   ? 49.780 -18.687 -4.405  1.00   51.29  ? 1010 HOH A O   1 
HETATM 2323 O O   . HOH C 3 .   ? 29.896 -18.456 1.200   1.00   42.09  ? 1011 HOH A O   1 
HETATM 2324 O O   . HOH C 3 .   ? 36.691 -13.962 -23.366 1.00   45.94  ? 1012 HOH A O   1 
HETATM 2325 O O   . HOH C 3 .   ? 34.939 -27.796 -30.603 1.00   20.87  ? 1013 HOH A O   1 
HETATM 2326 O O   . HOH C 3 .   ? 44.701 -26.111 4.765   1.00   41.50  ? 1014 HOH A O   1 
HETATM 2327 O O   . HOH C 3 .   ? 32.995 -30.058 -31.823 1.00   45.81  ? 1015 HOH A O   1 
HETATM 2328 O O   . HOH C 3 .   ? 48.764 -20.982 -27.613 1.00   54.37  ? 1016 HOH A O   1 
HETATM 2329 O O   . HOH C 3 .   ? 48.327 -30.278 -9.368  1.00   40.81  ? 1017 HOH A O   1 
HETATM 2330 O O   . HOH C 3 .   ? 42.344 -41.574 -10.290 1.00   38.47  ? 1018 HOH A O   1 
HETATM 2331 O O   . HOH C 3 .   ? 31.437 -11.619 0.530   1.00   45.45  ? 1019 HOH A O   1 
HETATM 2332 O O   . HOH C 3 .   ? 40.567 -44.495 -25.002 1.00   44.65  ? 1020 HOH A O   1 
HETATM 2333 O O   . HOH C 3 .   ? 43.136 -42.407 -17.143 1.00   39.32  ? 1021 HOH A O   1 
HETATM 2334 O O   . HOH C 3 .   ? 20.905 -34.038 -34.352 1.00   50.30  ? 1022 HOH A O   1 
HETATM 2335 O O   . HOH C 3 .   ? 48.654 -29.844 -29.186 1.00   48.88  ? 1023 HOH A O   1 
HETATM 2336 O O   . HOH C 3 .   ? 23.167 -38.111 -38.718 1.00   51.53  ? 1024 HOH A O   1 
HETATM 2337 O O   . HOH C 3 .   ? 40.477 -42.964 -29.237 1.00   48.60  ? 1025 HOH A O   1 
HETATM 2338 O O   . HOH C 3 .   ? 23.427 -34.289 -11.021 1.00   46.77  ? 1026 HOH A O   1 
HETATM 2339 O O   . HOH D 3 .   ? 41.336 -21.532 -17.564 1.00   37.38  ? 201  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   604 ?   ?   ?   A . n 
A 1 2   HIS 2   605 ?   ?   ?   A . n 
A 1 3   HIS 3   606 ?   ?   ?   A . n 
A 1 4   HIS 4   607 ?   ?   ?   A . n 
A 1 5   HIS 5   608 ?   ?   ?   A . n 
A 1 6   HIS 6   609 ?   ?   ?   A . n 
A 1 7   HIS 7   610 ?   ?   ?   A . n 
A 1 8   SER 8   611 ?   ?   ?   A . n 
A 1 9   SER 9   612 ?   ?   ?   A . n 
A 1 10  GLY 10  613 ?   ?   ?   A . n 
A 1 11  VAL 11  614 ?   ?   ?   A . n 
A 1 12  ASP 12  615 ?   ?   ?   A . n 
A 1 13  LEU 13  616 ?   ?   ?   A . n 
A 1 14  GLY 14  617 ?   ?   ?   A . n 
A 1 15  THR 15  618 ?   ?   ?   A . n 
A 1 16  GLU 16  619 ?   ?   ?   A . n 
A 1 17  ASN 17  620 ?   ?   ?   A . n 
A 1 18  LEU 18  621 ?   ?   ?   A . n 
A 1 19  TYR 19  622 ?   ?   ?   A . n 
A 1 20  PHE 20  623 ?   ?   ?   A . n 
A 1 21  GLN 21  624 ?   ?   ?   A . n 
A 1 22  SER 22  625 ?   ?   ?   A . n 
A 1 23  ASN 23  626 ?   ?   ?   A . n 
A 1 24  ALA 24  627 627 ALA ALA A . n 
A 1 25  ASP 25  628 628 ASP ASP A . n 
A 1 26  THR 26  629 629 THR THR A . n 
A 1 27  LEU 27  630 630 LEU LEU A . n 
A 1 28  GLU 28  631 631 GLU GLU A . n 
A 1 29  GLY 29  632 632 GLY GLY A . n 
A 1 30  SER 30  633 633 SER SER A . n 
A 1 31  MET 31  634 634 MET MET A . n 
A 1 32  ALA 32  635 635 ALA ALA A . n 
A 1 33  GLN 33  636 636 GLN GLN A . n 
A 1 34  LEU 34  637 637 LEU LEU A . n 
A 1 35  LYS 35  638 638 LYS LYS A . n 
A 1 36  LYS 36  639 639 LYS LYS A . n 
A 1 37  GLY 37  640 640 GLY GLY A . n 
A 1 38  LEU 38  641 641 LEU LEU A . n 
A 1 39  GLU 39  642 642 GLU GLU A . n 
A 1 40  SER 40  643 643 SER SER A . n 
A 1 41  GLY 41  644 644 GLY GLY A . n 
A 1 42  THR 42  645 645 THR THR A . n 
A 1 43  VAL 43  646 646 VAL VAL A . n 
A 1 44  LEU 44  647 647 LEU LEU A . n 
A 1 45  ILE 45  648 648 ILE ILE A . n 
A 1 46  GLN 46  649 649 GLN GLN A . n 
A 1 47  PHE 47  650 650 PHE PHE A . n 
A 1 48  GLU 48  651 651 GLU GLU A . n 
A 1 49  GLN 49  652 652 GLN GLN A . n 
A 1 50  LEU 50  653 653 LEU LEU A . n 
A 1 51  TYR 51  654 654 TYR TYR A . n 
A 1 52  ARG 52  655 655 ARG ARG A . n 
A 1 53  LYS 53  656 656 LYS LYS A . n 
A 1 54  LYS 54  657 657 LYS LYS A . n 
A 1 55  PRO 55  658 658 PRO PRO A . n 
A 1 56  GLY 56  659 659 GLY GLY A . n 
A 1 57  LEU 57  660 660 LEU LEU A . n 
A 1 58  ALA 58  661 661 ALA ALA A . n 
A 1 59  ILE 59  662 662 ILE ILE A . n 
A 1 60  THR 60  663 663 THR THR A . n 
A 1 61  PHE 61  664 664 PHE PHE A . n 
A 1 62  ALA 62  665 665 ALA ALA A . n 
A 1 63  LYS 63  666 666 LYS LYS A . n 
A 1 64  LEU 64  667 667 LEU LEU A . n 
A 1 65  PRO 65  668 668 PRO PRO A . n 
A 1 66  GLN 66  669 669 GLN GLN A . n 
A 1 67  ASN 67  670 670 ASN ASN A . n 
A 1 68  LEU 68  671 671 LEU LEU A . n 
A 1 69  ASP 69  672 672 ASP ASP A . n 
A 1 70  LYS 70  673 673 LYS LYS A . n 
A 1 71  ASN 71  674 674 ASN ASN A . n 
A 1 72  ARG 72  675 675 ARG ARG A . n 
A 1 73  TYR 73  676 676 TYR TYR A . n 
A 1 74  LYS 74  677 677 LYS LYS A . n 
A 1 75  ASP 75  678 678 ASP ASP A . n 
A 1 76  VAL 76  679 679 VAL VAL A . n 
A 1 77  LEU 77  680 680 LEU LEU A . n 
A 1 78  PRO 78  681 681 PRO PRO A . n 
A 1 79  TYR 79  682 682 TYR TYR A . n 
A 1 80  ASP 80  683 683 ASP ASP A . n 
A 1 81  THR 81  684 684 THR THR A . n 
A 1 82  THR 82  685 685 THR THR A . n 
A 1 83  ARG 83  686 686 ARG ARG A . n 
A 1 84  VAL 84  687 687 VAL VAL A . n 
A 1 85  LEU 85  688 688 LEU LEU A . n 
A 1 86  LEU 86  689 689 LEU LEU A . n 
A 1 87  GLN 87  690 690 GLN GLN A . n 
A 1 88  GLY 88  691 691 GLY GLY A . n 
A 1 89  ASN 89  692 692 ASN ASN A . n 
A 1 90  GLU 90  693 693 GLU GLU A . n 
A 1 91  ASP 91  694 694 ASP ASP A . n 
A 1 92  TYR 92  695 695 TYR TYR A . n 
A 1 93  ILE 93  696 696 ILE ILE A . n 
A 1 94  ASN 94  697 697 ASN ASN A . n 
A 1 95  ALA 95  698 698 ALA ALA A . n 
A 1 96  SER 96  699 699 SER SER A . n 
A 1 97  TYR 97  700 700 TYR TYR A . n 
A 1 98  VAL 98  701 701 VAL VAL A . n 
A 1 99  ASN 99  702 702 ASN ASN A . n 
A 1 100 MET 100 703 703 MET MET A . n 
A 1 101 GLU 101 704 704 GLU GLU A . n 
A 1 102 ILE 102 705 705 ILE ILE A . n 
A 1 103 PRO 103 706 706 PRO PRO A . n 
A 1 104 ALA 104 707 707 ALA ALA A . n 
A 1 105 ALA 105 708 708 ALA ALA A . n 
A 1 106 ASN 106 709 709 ASN ASN A . n 
A 1 107 LEU 107 710 710 LEU LEU A . n 
A 1 108 VAL 108 711 711 VAL VAL A . n 
A 1 109 ASN 109 712 712 ASN ASN A . n 
A 1 110 LYS 110 713 713 LYS LYS A . n 
A 1 111 TYR 111 714 714 TYR TYR A . n 
A 1 112 ILE 112 715 715 ILE ILE A . n 
A 1 113 ALA 113 716 716 ALA ALA A . n 
A 1 114 THR 114 717 717 THR THR A . n 
A 1 115 GLN 115 718 718 GLN GLN A . n 
A 1 116 GLY 116 719 719 GLY GLY A . n 
A 1 117 PRO 117 720 720 PRO PRO A . n 
A 1 118 LEU 118 721 721 LEU LEU A . n 
A 1 119 PRO 119 722 722 PRO PRO A . n 
A 1 120 HIS 120 723 723 HIS HIS A . n 
A 1 121 THR 121 724 724 THR THR A . n 
A 1 122 CYS 122 725 725 CYS CYS A . n 
A 1 123 ALA 123 726 726 ALA ALA A . n 
A 1 124 GLN 124 727 727 GLN GLN A . n 
A 1 125 PHE 125 728 728 PHE PHE A . n 
A 1 126 TRP 126 729 729 TRP TRP A . n 
A 1 127 GLN 127 730 730 GLN GLN A . n 
A 1 128 VAL 128 731 731 VAL VAL A . n 
A 1 129 VAL 129 732 732 VAL VAL A . n 
A 1 130 TRP 130 733 733 TRP TRP A . n 
A 1 131 ASP 131 734 734 ASP ASP A . n 
A 1 132 GLN 132 735 735 GLN GLN A . n 
A 1 133 LYS 133 736 736 LYS LYS A . n 
A 1 134 LEU 134 737 737 LEU LEU A . n 
A 1 135 SER 135 738 738 SER SER A . n 
A 1 136 LEU 136 739 739 LEU LEU A . n 
A 1 137 ILE 137 740 740 ILE ILE A . n 
A 1 138 VAL 138 741 741 VAL VAL A . n 
A 1 139 MET 139 742 742 MET MET A . n 
A 1 140 LEU 140 743 743 LEU LEU A . n 
A 1 141 THR 141 744 744 THR THR A . n 
A 1 142 THR 142 745 745 THR THR A . n 
A 1 143 LEU 143 746 746 LEU LEU A . n 
A 1 144 THR 144 747 747 THR THR A . n 
A 1 145 GLU 145 748 748 GLU GLU A . n 
A 1 146 ARG 146 749 749 ARG ARG A . n 
A 1 147 GLY 147 750 750 GLY GLY A . n 
A 1 148 ARG 148 751 751 ARG ARG A . n 
A 1 149 THR 149 752 752 THR THR A . n 
A 1 150 LYS 150 753 753 LYS LYS A . n 
A 1 151 CYS 151 754 754 CYS CYS A . n 
A 1 152 HIS 152 755 755 HIS HIS A . n 
A 1 153 GLN 153 756 756 GLN GLN A . n 
A 1 154 TYR 154 757 757 TYR TYR A . n 
A 1 155 TRP 155 758 758 TRP TRP A . n 
A 1 156 PRO 156 759 759 PRO PRO A . n 
A 1 157 ASP 157 760 760 ASP ASP A . n 
A 1 158 PRO 158 761 761 PRO PRO A . n 
A 1 159 PRO 159 762 762 PRO PRO A . n 
A 1 160 ASP 160 763 763 ASP ASP A . n 
A 1 161 VAL 161 764 764 VAL VAL A . n 
A 1 162 MET 162 765 765 MET MET A . n 
A 1 163 ASN 163 766 766 ASN ASN A . n 
A 1 164 HIS 164 767 767 HIS HIS A . n 
A 1 165 GLY 165 768 768 GLY GLY A . n 
A 1 166 GLY 166 769 769 GLY GLY A . n 
A 1 167 PHE 167 770 770 PHE PHE A . n 
A 1 168 HIS 168 771 771 HIS HIS A . n 
A 1 169 ILE 169 772 772 ILE ILE A . n 
A 1 170 GLN 170 773 773 GLN GLN A . n 
A 1 171 CYS 171 774 774 CYS CYS A . n 
A 1 172 GLN 172 775 775 GLN GLN A . n 
A 1 173 SER 173 776 776 SER SER A . n 
A 1 174 GLU 174 777 777 GLU GLU A . n 
A 1 175 ASP 175 778 778 ASP ASP A . n 
A 1 176 CYS 176 779 779 CYS CYS A . n 
A 1 177 THR 177 780 780 THR THR A . n 
A 1 178 ILE 178 781 781 ILE ILE A . n 
A 1 179 ALA 179 782 782 ALA ALA A . n 
A 1 180 TYR 180 783 783 TYR TYR A . n 
A 1 181 VAL 181 784 784 VAL VAL A . n 
A 1 182 SER 182 785 785 SER SER A . n 
A 1 183 ARG 183 786 786 ARG ARG A . n 
A 1 184 GLU 184 787 787 GLU GLU A . n 
A 1 185 MET 185 788 788 MET MET A . n 
A 1 186 LEU 186 789 789 LEU LEU A . n 
A 1 187 VAL 187 790 790 VAL VAL A . n 
A 1 188 THR 188 791 791 THR THR A . n 
A 1 189 ASN 189 792 792 ASN ASN A . n 
A 1 190 THR 190 793 793 THR THR A . n 
A 1 191 GLN 191 794 794 GLN GLN A . n 
A 1 192 THR 192 795 795 THR THR A . n 
A 1 193 GLY 193 796 796 GLY GLY A . n 
A 1 194 GLU 194 797 797 GLU GLU A . n 
A 1 195 GLU 195 798 798 GLU GLU A . n 
A 1 196 HIS 196 799 799 HIS HIS A . n 
A 1 197 THR 197 800 800 THR THR A . n 
A 1 198 VAL 198 801 801 VAL VAL A . n 
A 1 199 THR 199 802 802 THR THR A . n 
A 1 200 HIS 200 803 803 HIS HIS A . n 
A 1 201 LEU 201 804 804 LEU LEU A . n 
A 1 202 GLN 202 805 805 GLN GLN A . n 
A 1 203 TYR 203 806 806 TYR TYR A . n 
A 1 204 VAL 204 807 807 VAL VAL A . n 
A 1 205 ALA 205 808 808 ALA ALA A . n 
A 1 206 TRP 206 809 809 TRP TRP A . n 
A 1 207 PRO 207 810 810 PRO PRO A . n 
A 1 208 ALA 208 811 811 ALA ALA A . n 
A 1 209 HIS 209 812 812 HIS HIS A . n 
A 1 210 GLY 210 813 813 GLY GLY A . n 
A 1 211 VAL 211 814 814 VAL VAL A . n 
A 1 212 PRO 212 815 815 PRO PRO A . n 
A 1 213 ASP 213 816 816 ASP ASP A . n 
A 1 214 ASP 214 817 817 ASP ASP A . n 
A 1 215 SER 215 818 818 SER SER A . n 
A 1 216 SER 216 819 819 SER SER A . n 
A 1 217 ASP 217 820 820 ASP ASP A . n 
A 1 218 PHE 218 821 821 PHE PHE A . n 
A 1 219 LEU 219 822 822 LEU LEU A . n 
A 1 220 GLU 220 823 823 GLU GLU A . n 
A 1 221 PHE 221 824 824 PHE PHE A . n 
A 1 222 VAL 222 825 825 VAL VAL A . n 
A 1 223 ASN 223 826 826 ASN ASN A . n 
A 1 224 TYR 224 827 827 TYR TYR A . n 
A 1 225 VAL 225 828 828 VAL VAL A . n 
A 1 226 ARG 226 829 829 ARG ARG A . n 
A 1 227 SER 227 830 830 SER SER A . n 
A 1 228 LEU 228 831 831 LEU LEU A . n 
A 1 229 ARG 229 832 832 ARG ARG A . n 
A 1 230 VAL 230 833 833 VAL VAL A . n 
A 1 231 ASP 231 834 834 ASP ASP A . n 
A 1 232 SER 232 835 835 SER SER A . n 
A 1 233 GLU 233 836 836 GLU GLU A . n 
A 1 234 PRO 234 837 837 PRO PRO A . n 
A 1 235 VAL 235 838 838 VAL VAL A . n 
A 1 236 LEU 236 839 839 LEU LEU A . n 
A 1 237 VAL 237 840 840 VAL VAL A . n 
A 1 238 HIS 238 841 841 HIS HIS A . n 
A 1 239 SER 239 842 842 SER SER A . n 
A 1 240 SER 240 843 843 SER SER A . n 
A 1 241 ALA 241 844 844 ALA ALA A . n 
A 1 242 GLY 242 845 845 GLY GLY A . n 
A 1 243 ILE 243 846 846 ILE ILE A . n 
A 1 244 GLY 244 847 847 GLY GLY A . n 
A 1 245 ARG 245 848 848 ARG ARG A . n 
A 1 246 THR 246 849 849 THR THR A . n 
A 1 247 GLY 247 850 850 GLY GLY A . n 
A 1 248 VAL 248 851 851 VAL VAL A . n 
A 1 249 LEU 249 852 852 LEU LEU A . n 
A 1 250 VAL 250 853 853 VAL VAL A . n 
A 1 251 THR 251 854 854 THR THR A . n 
A 1 252 MET 252 855 855 MET MET A . n 
A 1 253 GLU 253 856 856 GLU GLU A . n 
A 1 254 THR 254 857 857 THR THR A . n 
A 1 255 ALA 255 858 858 ALA ALA A . n 
A 1 256 MET 256 859 859 MET MET A . n 
A 1 257 CYS 257 860 860 CYS CYS A . n 
A 1 258 LEU 258 861 861 LEU LEU A . n 
A 1 259 THR 259 862 862 THR THR A . n 
A 1 260 GLU 260 863 863 GLU GLU A . n 
A 1 261 ARG 261 864 864 ARG ARG A . n 
A 1 262 ASN 262 865 865 ASN ASN A . n 
A 1 263 LEU 263 866 866 LEU LEU A . n 
A 1 264 PRO 264 867 867 PRO PRO A . n 
A 1 265 ILE 265 868 868 ILE ILE A . n 
A 1 266 TYR 266 869 869 TYR TYR A . n 
A 1 267 PRO 267 870 870 PRO PRO A . n 
A 1 268 LEU 268 871 871 LEU LEU A . n 
A 1 269 ASP 269 872 872 ASP ASP A . n 
A 1 270 ILE 270 873 873 ILE ILE A . n 
A 1 271 VAL 271 874 874 VAL VAL A . n 
A 1 272 ARG 272 875 875 ARG ARG A . n 
A 1 273 LYS 273 876 876 LYS LYS A . n 
A 1 274 MET 274 877 877 MET MET A . n 
A 1 275 ARG 275 878 878 ARG ARG A . n 
A 1 276 ASP 276 879 879 ASP ASP A . n 
A 1 277 GLN 277 880 880 GLN GLN A . n 
A 1 278 ARG 278 881 881 ARG ARG A . n 
A 1 279 ALA 279 882 882 ALA ALA A . n 
A 1 280 MET 280 883 883 MET MET A . n 
A 1 281 MET 281 884 884 MET MET A . n 
A 1 282 VAL 282 885 885 VAL VAL A . n 
A 1 283 GLN 283 886 886 GLN GLN A . n 
A 1 284 THR 284 887 887 THR THR A . n 
A 1 285 SER 285 888 888 SER SER A . n 
A 1 286 SER 286 889 889 SER SER A . n 
A 1 287 GLN 287 890 890 GLN GLN A . n 
A 1 288 TYR 288 891 891 TYR TYR A . n 
A 1 289 LYS 289 892 892 LYS LYS A . n 
A 1 290 PHE 290 893 893 PHE PHE A . n 
A 1 291 VAL 291 894 894 VAL VAL A . n 
A 1 292 CYS 292 895 895 CYS CYS A . n 
A 1 293 GLU 293 896 896 GLU GLU A . n 
A 1 294 ALA 294 897 897 ALA ALA A . n 
A 1 295 ILE 295 898 898 ILE ILE A . n 
A 1 296 LEU 296 899 899 LEU LEU A . n 
A 1 297 ARG 297 900 900 ARG ARG A . n 
A 1 298 VAL 298 901 901 VAL VAL A . n 
A 1 299 TYR 299 902 902 TYR TYR A . n 
A 1 300 GLU 300 903 903 GLU GLU A . n 
A 1 301 GLU 301 904 904 GLU GLU A . n 
A 1 302 GLY 302 905 905 GLY GLY A . n 
A 1 303 LEU 303 906 906 LEU LEU A . n 
A 1 304 VAL 304 907 ?   ?   ?   A . n 
A 1 305 GLN 305 908 ?   ?   ?   A . n 
A 1 306 MET 306 909 ?   ?   ?   A . n 
B 2 1   MET 1   182 182 MET MET B . n 
B 2 2   TPO 2   183 183 TPO TPO B . n 
B 2 3   GLY 3   184 184 GLY GLY B . n 
B 2 4   PTR 4   185 185 PTR PTR B . n 
B 2 5   VAL 5   186 186 VAL VAL B . n 
B 2 6   VAL 6   187 187 VAL VAL B . n 
B 2 7   THR 7   188 188 THR THR B . n 
B 2 8   ARG 8   189 189 ARG ARG B . n 
B 2 9   ARG 9   190 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  1001 1  HOH HOH A . 
C 3 HOH 2  1002 2  HOH HOH A . 
C 3 HOH 3  1003 4  HOH HOH A . 
C 3 HOH 4  1004 5  HOH HOH A . 
C 3 HOH 5  1005 6  HOH HOH A . 
C 3 HOH 6  1006 7  HOH HOH A . 
C 3 HOH 7  1007 8  HOH HOH A . 
C 3 HOH 8  1008 9  HOH HOH A . 
C 3 HOH 9  1009 10 HOH HOH A . 
C 3 HOH 10 1010 11 HOH HOH A . 
C 3 HOH 11 1011 12 HOH HOH A . 
C 3 HOH 12 1012 13 HOH HOH A . 
C 3 HOH 13 1013 14 HOH HOH A . 
C 3 HOH 14 1014 15 HOH HOH A . 
C 3 HOH 15 1015 16 HOH HOH A . 
C 3 HOH 16 1016 17 HOH HOH A . 
C 3 HOH 17 1017 18 HOH HOH A . 
C 3 HOH 18 1018 19 HOH HOH A . 
C 3 HOH 19 1019 20 HOH HOH A . 
C 3 HOH 20 1020 21 HOH HOH A . 
C 3 HOH 21 1021 22 HOH HOH A . 
C 3 HOH 22 1022 23 HOH HOH A . 
C 3 HOH 23 1023 24 HOH HOH A . 
C 3 HOH 24 1024 25 HOH HOH A . 
C 3 HOH 25 1025 26 HOH HOH A . 
C 3 HOH 26 1026 27 HOH HOH A . 
D 3 HOH 1  201  3  HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B TPO 2 B TPO 183 ? THR PHOSPHOTHREONINE  
2 B PTR 4 B PTR 185 ? TYR O-PHOSPHOTYROSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1280  ? 
1 MORE         -16   ? 
1 'SSA (A^2)'  12630 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-12-10 
2 'Structure model' 1 1 2018-07-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory          
2 2 'Structure model' 'Data collection' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' diffrn_source                
2 2 'Structure model' pdbx_unobs_or_zero_occ_atoms 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' 
2 2 'Structure model' '_diffrn_source.type'                      
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
Blu-Ice  'data collection' GUI                           ? 1 ? ? ? ? 
PHASES   phasing           .                             ? 2 ? ? ? ? 
PHENIX   refinement        '(phenix.refine: 1.8.4_1496)' ? 3 ? ? ? ? 
HKL-2000 'data reduction'  .                             ? 4 ? ? ? ? 
HKL-2000 'data scaling'    .                             ? 5 ? ? ? ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 628 ? ? 65.94   -179.25 
2  1 ASN A 692 ? ? 86.91   126.98  
3  1 SER A 776 ? ? -171.39 138.11  
4  1 GLN A 794 ? ? -66.80  -71.55  
5  1 ALA A 808 ? ? -106.91 55.59   
6  1 TRP A 809 ? ? -156.16 88.74   
7  1 SER A 842 ? ? -136.87 -156.67 
8  1 ILE A 846 ? ? -135.67 -35.88  
9  1 MET A 883 ? ? 80.44   7.84    
10 1 VAL A 885 ? ? 60.01   70.73   
11 1 VAL B 187 ? ? -125.63 -166.66 
12 1 THR B 188 ? ? -116.10 -88.23  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 604 ? A MET 1   
2  1 Y 1 A HIS 605 ? A HIS 2   
3  1 Y 1 A HIS 606 ? A HIS 3   
4  1 Y 1 A HIS 607 ? A HIS 4   
5  1 Y 1 A HIS 608 ? A HIS 5   
6  1 Y 1 A HIS 609 ? A HIS 6   
7  1 Y 1 A HIS 610 ? A HIS 7   
8  1 Y 1 A SER 611 ? A SER 8   
9  1 Y 1 A SER 612 ? A SER 9   
10 1 Y 1 A GLY 613 ? A GLY 10  
11 1 Y 1 A VAL 614 ? A VAL 11  
12 1 Y 1 A ASP 615 ? A ASP 12  
13 1 Y 1 A LEU 616 ? A LEU 13  
14 1 Y 1 A GLY 617 ? A GLY 14  
15 1 Y 1 A THR 618 ? A THR 15  
16 1 Y 1 A GLU 619 ? A GLU 16  
17 1 Y 1 A ASN 620 ? A ASN 17  
18 1 Y 1 A LEU 621 ? A LEU 18  
19 1 Y 1 A TYR 622 ? A TYR 19  
20 1 Y 1 A PHE 623 ? A PHE 20  
21 1 Y 1 A GLN 624 ? A GLN 21  
22 1 Y 1 A SER 625 ? A SER 22  
23 1 Y 1 A ASN 626 ? A ASN 23  
24 1 Y 1 A VAL 907 ? A VAL 304 
25 1 Y 1 A GLN 908 ? A GLN 305 
26 1 Y 1 A MET 909 ? A MET 306 
27 1 Y 1 B ARG 190 ? B ARG 9   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#