data_4R4N
# 
_entry.id   4R4N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4R4N         
RCSB  RCSB086893   
WWPDB D_1000086893 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4R4B . unspecified 
PDB 4R4F . unspecified 
PDB 4R4H . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4R4N 
_pdbx_database_status.recvd_initial_deposition_date   2014-08-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Acharya, P.' 1 
'Louder, R.'  2 
'Kwong, P.D.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Definition of an Antibody-Dependent Cellular Cytotoxicity Response Implicated in Reduced Risk for HIV-1 Infection.' 
_citation.journal_abbrev            J.Virol. 
_citation.journal_volume            88 
_citation.page_first                12895 
_citation.page_last                 12906 
_citation.year                      2014 
_citation.journal_id_ASTM           JOVIAM 
_citation.country                   US 
_citation.journal_id_ISSN           0022-538X 
_citation.journal_id_CSD            0825 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25165110 
_citation.pdbx_database_id_DOI      10.1128/JVI.02194-14 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Acharya, P.'     1  ? 
primary 'Tolbert, W.D.'   2  ? 
primary 'Gohain, N.'      3  ? 
primary 'Wu, X.'          4  ? 
primary 'Yu, L.'          5  ? 
primary 'Liu, T.'         6  ? 
primary 'Huang, W.'       7  ? 
primary 'Huang, C.C.'     8  ? 
primary 'Kwon, Y.D.'      9  ? 
primary 'Louder, R.K.'    10 ? 
primary 'Luongo, T.S.'    11 ? 
primary 'McLellan, J.S.'  12 ? 
primary 'Pancera, M.'     13 ? 
primary 'Yang, Y.'        14 ? 
primary 'Zhang, B.'       15 ? 
primary 'Flinko, R.'      16 ? 
primary 'Foulke, J.S.'    17 ? 
primary 'Sajadi, M.M.'    18 ? 
primary 'Kamin-Lewis, R.' 19 ? 
primary 'Robinson, J.E.'  20 ? 
primary 'Martin, L.'      21 ? 
primary 'Kwong, P.D.'     22 ? 
primary 'Guan, Y.'        23 ? 
primary 'DeVico, A.L.'    24 ? 
primary 'Lewis, G.K.'     25 ? 
primary 'Pazgier, M.'     26 ? 
# 
_cell.entry_id           4R4N 
_cell.length_a           112.967 
_cell.length_b           144.178 
_cell.length_c           158.351 
_cell.angle_alpha        110.58 
_cell.angle_beta         92.30 
_cell.angle_gamma        99.19 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4R4N 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HIV-1 gp120'                            38939.805 8  ? ? ? ? 
2 polymer     syn 'M48U1 peptide'                          3056.804  8  ? ? ? ? 
3 polymer     man 'Antibody 2.2c LIGHT CHAIN'              22912.578 8  ? ? ? ? 
4 polymer     man 'Antibody 2.2c heavy CHAIN'              23746.738 8  ? ? ? ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   19 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;IWKDANTTLFCASDAKAYDTEVHNVWATHACVPTDPSPQELKMENVTEEFNMWKNNMVEQMHTDIISLWDQSLKPCVQLT
GGSALTQACPKVTFEPIPIHYCAPAGYAILKCNDKEFNGTGLCKNVSTVQCTHGIRPVVSTQLLLNGSLAEGKVMIRSEN
ITNNVKNIIVQLNESVTINCTRPNNGGSGSGGDIRQAHCNVSGSQWNKTLHQVVEQLRKYWNNNTIIFNSSSGGDLEITT
HSFNCGGEFFYCNTSGLFNSTWVNGTASIENGTITLPCRIKQIINMWQRVGQAIYAPPIQGVIRCVSNITGLILTRDGGG
NSNENETFRPGGGDMRDNWRSELYKYKVVKIE
;
;IWKDANTTLFCASDAKAYDTEVHNVWATHACVPTDPSPQELKMENVTEEFNMWKNNMVEQMHTDIISLWDQSLKPCVQLT
GGSALTQACPKVTFEPIPIHYCAPAGYAILKCNDKEFNGTGLCKNVSTVQCTHGIRPVVSTQLLLNGSLAEGKVMIRSEN
ITNNVKNIIVQLNESVTINCTRPNNGGSGSGGDIRQAHCNVSGSQWNKTLHQVVEQLRKYWNNNTIIFNSSSGGDLEITT
HSFNCGGEFFYCNTSGLFNSTWVNGTASIENGTITLPCRIKQIINMWQRVGQAIYAPPIQGVIRCVSNITGLILTRDGGG
NSNENETFRPGGGDMRDNWRSELYKYKVVKIE
;
A,B,I,E,M,P,S,V ? 
2 'polypeptide(L)' no yes '(MPT)NLHFCQLRCKSLGLLGRCA(DPR)T(U2X)CACV(NH2)' XNLHFCQLRCKSLGLLGRCAPTXCACVX a,b,e,i,m,p,s,v ? 
3 'polypeptide(L)' no no  
;DIQMTQSPSFVSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLVIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQP
EDFATYYCQHLIGLRSFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE
SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
;
;DIQMTQSPSFVSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLVIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQP
EDFATYYCQHLIGLRSFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE
SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
;
L,D,G,K,O,R,U,X ? 
4 'polypeptide(L)' no yes 
;QVQLQQWGAGLLKPSETLSLTCGVYGESL(OAS)GHYWSWVRQPPGKRLEWIGEIKHNGSPNYHPSLKSRVTISLDMSKN
QFSLNLTSVTAADTAVYFCARRSNWPYLPFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
;QVQLQQWGAGLLKPSETLSLTCGVYGESLSGHYWSWVRQPPGKRLEWIGEIKHNGSPNYHPSLKSRVTISLDMSKNQFSL
NLTSVTAADTAVYFCARRSNWPYLPFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
H,C,F,J,N,Q,T,W ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   TRP n 
1 3   LYS n 
1 4   ASP n 
1 5   ALA n 
1 6   ASN n 
1 7   THR n 
1 8   THR n 
1 9   LEU n 
1 10  PHE n 
1 11  CYS n 
1 12  ALA n 
1 13  SER n 
1 14  ASP n 
1 15  ALA n 
1 16  LYS n 
1 17  ALA n 
1 18  TYR n 
1 19  ASP n 
1 20  THR n 
1 21  GLU n 
1 22  VAL n 
1 23  HIS n 
1 24  ASN n 
1 25  VAL n 
1 26  TRP n 
1 27  ALA n 
1 28  THR n 
1 29  HIS n 
1 30  ALA n 
1 31  CYS n 
1 32  VAL n 
1 33  PRO n 
1 34  THR n 
1 35  ASP n 
1 36  PRO n 
1 37  SER n 
1 38  PRO n 
1 39  GLN n 
1 40  GLU n 
1 41  LEU n 
1 42  LYS n 
1 43  MET n 
1 44  GLU n 
1 45  ASN n 
1 46  VAL n 
1 47  THR n 
1 48  GLU n 
1 49  GLU n 
1 50  PHE n 
1 51  ASN n 
1 52  MET n 
1 53  TRP n 
1 54  LYS n 
1 55  ASN n 
1 56  ASN n 
1 57  MET n 
1 58  VAL n 
1 59  GLU n 
1 60  GLN n 
1 61  MET n 
1 62  HIS n 
1 63  THR n 
1 64  ASP n 
1 65  ILE n 
1 66  ILE n 
1 67  SER n 
1 68  LEU n 
1 69  TRP n 
1 70  ASP n 
1 71  GLN n 
1 72  SER n 
1 73  LEU n 
1 74  LYS n 
1 75  PRO n 
1 76  CYS n 
1 77  VAL n 
1 78  GLN n 
1 79  LEU n 
1 80  THR n 
1 81  GLY n 
1 82  GLY n 
1 83  SER n 
1 84  ALA n 
1 85  LEU n 
1 86  THR n 
1 87  GLN n 
1 88  ALA n 
1 89  CYS n 
1 90  PRO n 
1 91  LYS n 
1 92  VAL n 
1 93  THR n 
1 94  PHE n 
1 95  GLU n 
1 96  PRO n 
1 97  ILE n 
1 98  PRO n 
1 99  ILE n 
1 100 HIS n 
1 101 TYR n 
1 102 CYS n 
1 103 ALA n 
1 104 PRO n 
1 105 ALA n 
1 106 GLY n 
1 107 TYR n 
1 108 ALA n 
1 109 ILE n 
1 110 LEU n 
1 111 LYS n 
1 112 CYS n 
1 113 ASN n 
1 114 ASP n 
1 115 LYS n 
1 116 GLU n 
1 117 PHE n 
1 118 ASN n 
1 119 GLY n 
1 120 THR n 
1 121 GLY n 
1 122 LEU n 
1 123 CYS n 
1 124 LYS n 
1 125 ASN n 
1 126 VAL n 
1 127 SER n 
1 128 THR n 
1 129 VAL n 
1 130 GLN n 
1 131 CYS n 
1 132 THR n 
1 133 HIS n 
1 134 GLY n 
1 135 ILE n 
1 136 ARG n 
1 137 PRO n 
1 138 VAL n 
1 139 VAL n 
1 140 SER n 
1 141 THR n 
1 142 GLN n 
1 143 LEU n 
1 144 LEU n 
1 145 LEU n 
1 146 ASN n 
1 147 GLY n 
1 148 SER n 
1 149 LEU n 
1 150 ALA n 
1 151 GLU n 
1 152 GLY n 
1 153 LYS n 
1 154 VAL n 
1 155 MET n 
1 156 ILE n 
1 157 ARG n 
1 158 SER n 
1 159 GLU n 
1 160 ASN n 
1 161 ILE n 
1 162 THR n 
1 163 ASN n 
1 164 ASN n 
1 165 VAL n 
1 166 LYS n 
1 167 ASN n 
1 168 ILE n 
1 169 ILE n 
1 170 VAL n 
1 171 GLN n 
1 172 LEU n 
1 173 ASN n 
1 174 GLU n 
1 175 SER n 
1 176 VAL n 
1 177 THR n 
1 178 ILE n 
1 179 ASN n 
1 180 CYS n 
1 181 THR n 
1 182 ARG n 
1 183 PRO n 
1 184 ASN n 
1 185 ASN n 
1 186 GLY n 
1 187 GLY n 
1 188 SER n 
1 189 GLY n 
1 190 SER n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 ILE n 
1 195 ARG n 
1 196 GLN n 
1 197 ALA n 
1 198 HIS n 
1 199 CYS n 
1 200 ASN n 
1 201 VAL n 
1 202 SER n 
1 203 GLY n 
1 204 SER n 
1 205 GLN n 
1 206 TRP n 
1 207 ASN n 
1 208 LYS n 
1 209 THR n 
1 210 LEU n 
1 211 HIS n 
1 212 GLN n 
1 213 VAL n 
1 214 VAL n 
1 215 GLU n 
1 216 GLN n 
1 217 LEU n 
1 218 ARG n 
1 219 LYS n 
1 220 TYR n 
1 221 TRP n 
1 222 ASN n 
1 223 ASN n 
1 224 ASN n 
1 225 THR n 
1 226 ILE n 
1 227 ILE n 
1 228 PHE n 
1 229 ASN n 
1 230 SER n 
1 231 SER n 
1 232 SER n 
1 233 GLY n 
1 234 GLY n 
1 235 ASP n 
1 236 LEU n 
1 237 GLU n 
1 238 ILE n 
1 239 THR n 
1 240 THR n 
1 241 HIS n 
1 242 SER n 
1 243 PHE n 
1 244 ASN n 
1 245 CYS n 
1 246 GLY n 
1 247 GLY n 
1 248 GLU n 
1 249 PHE n 
1 250 PHE n 
1 251 TYR n 
1 252 CYS n 
1 253 ASN n 
1 254 THR n 
1 255 SER n 
1 256 GLY n 
1 257 LEU n 
1 258 PHE n 
1 259 ASN n 
1 260 SER n 
1 261 THR n 
1 262 TRP n 
1 263 VAL n 
1 264 ASN n 
1 265 GLY n 
1 266 THR n 
1 267 ALA n 
1 268 SER n 
1 269 ILE n 
1 270 GLU n 
1 271 ASN n 
1 272 GLY n 
1 273 THR n 
1 274 ILE n 
1 275 THR n 
1 276 LEU n 
1 277 PRO n 
1 278 CYS n 
1 279 ARG n 
1 280 ILE n 
1 281 LYS n 
1 282 GLN n 
1 283 ILE n 
1 284 ILE n 
1 285 ASN n 
1 286 MET n 
1 287 TRP n 
1 288 GLN n 
1 289 ARG n 
1 290 VAL n 
1 291 GLY n 
1 292 GLN n 
1 293 ALA n 
1 294 ILE n 
1 295 TYR n 
1 296 ALA n 
1 297 PRO n 
1 298 PRO n 
1 299 ILE n 
1 300 GLN n 
1 301 GLY n 
1 302 VAL n 
1 303 ILE n 
1 304 ARG n 
1 305 CYS n 
1 306 VAL n 
1 307 SER n 
1 308 ASN n 
1 309 ILE n 
1 310 THR n 
1 311 GLY n 
1 312 LEU n 
1 313 ILE n 
1 314 LEU n 
1 315 THR n 
1 316 ARG n 
1 317 ASP n 
1 318 GLY n 
1 319 GLY n 
1 320 GLY n 
1 321 ASN n 
1 322 SER n 
1 323 ASN n 
1 324 GLU n 
1 325 ASN n 
1 326 GLU n 
1 327 THR n 
1 328 PHE n 
1 329 ARG n 
1 330 PRO n 
1 331 GLY n 
1 332 GLY n 
1 333 GLY n 
1 334 ASP n 
1 335 MET n 
1 336 ARG n 
1 337 ASP n 
1 338 ASN n 
1 339 TRP n 
1 340 ARG n 
1 341 SER n 
1 342 GLU n 
1 343 LEU n 
1 344 TYR n 
1 345 LYS n 
1 346 TYR n 
1 347 LYS n 
1 348 VAL n 
1 349 VAL n 
1 350 LYS n 
1 351 ILE n 
1 352 GLU n 
2 1   MPT n 
2 2   ASN n 
2 3   LEU n 
2 4   HIS n 
2 5   PHE n 
2 6   CYS n 
2 7   GLN n 
2 8   LEU n 
2 9   ARG n 
2 10  CYS n 
2 11  LYS n 
2 12  SER n 
2 13  LEU n 
2 14  GLY n 
2 15  LEU n 
2 16  LEU n 
2 17  GLY n 
2 18  ARG n 
2 19  CYS n 
2 20  ALA n 
2 21  DPR n 
2 22  THR n 
2 23  U2X n 
2 24  CYS n 
2 25  ALA n 
2 26  CYS n 
2 27  VAL n 
2 28  NH2 n 
3 1   ASP n 
3 2   ILE n 
3 3   GLN n 
3 4   MET n 
3 5   THR n 
3 6   GLN n 
3 7   SER n 
3 8   PRO n 
3 9   SER n 
3 10  PHE n 
3 11  VAL n 
3 12  SER n 
3 13  ALA n 
3 14  SER n 
3 15  VAL n 
3 16  GLY n 
3 17  ASP n 
3 18  ARG n 
3 19  VAL n 
3 20  THR n 
3 21  ILE n 
3 22  THR n 
3 23  CYS n 
3 24  ARG n 
3 25  ALA n 
3 26  SER n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  SER n 
3 31  SER n 
3 32  TYR n 
3 33  LEU n 
3 34  ALA n 
3 35  TRP n 
3 36  TYR n 
3 37  GLN n 
3 38  GLN n 
3 39  LYS n 
3 40  PRO n 
3 41  GLY n 
3 42  LYS n 
3 43  ALA n 
3 44  PRO n 
3 45  LYS n 
3 46  LEU n 
3 47  VAL n 
3 48  ILE n 
3 49  TYR n 
3 50  ALA n 
3 51  ALA n 
3 52  SER n 
3 53  THR n 
3 54  LEU n 
3 55  GLN n 
3 56  SER n 
3 57  GLY n 
3 58  VAL n 
3 59  PRO n 
3 60  SER n 
3 61  ARG n 
3 62  PHE n 
3 63  SER n 
3 64  GLY n 
3 65  SER n 
3 66  GLY n 
3 67  SER n 
3 68  GLY n 
3 69  THR n 
3 70  GLU n 
3 71  PHE n 
3 72  THR n 
3 73  LEU n 
3 74  THR n 
3 75  ILE n 
3 76  SER n 
3 77  SER n 
3 78  LEU n 
3 79  GLN n 
3 80  PRO n 
3 81  GLU n 
3 82  ASP n 
3 83  PHE n 
3 84  ALA n 
3 85  THR n 
3 86  TYR n 
3 87  TYR n 
3 88  CYS n 
3 89  GLN n 
3 90  HIS n 
3 91  LEU n 
3 92  ILE n 
3 93  GLY n 
3 94  LEU n 
3 95  ARG n 
3 96  SER n 
3 97  PHE n 
3 98  GLY n 
3 99  GLN n 
3 100 GLY n 
3 101 THR n 
3 102 LYS n 
3 103 LEU n 
3 104 GLU n 
3 105 ILE n 
3 106 LYS n 
3 107 ARG n 
3 108 THR n 
3 109 VAL n 
3 110 ALA n 
3 111 ALA n 
3 112 PRO n 
3 113 SER n 
3 114 VAL n 
3 115 PHE n 
3 116 ILE n 
3 117 PHE n 
3 118 PRO n 
3 119 PRO n 
3 120 SER n 
3 121 ASP n 
3 122 GLU n 
3 123 GLN n 
3 124 LEU n 
3 125 LYS n 
3 126 SER n 
3 127 GLY n 
3 128 THR n 
3 129 ALA n 
3 130 SER n 
3 131 VAL n 
3 132 VAL n 
3 133 CYS n 
3 134 LEU n 
3 135 LEU n 
3 136 ASN n 
3 137 ASN n 
3 138 PHE n 
3 139 TYR n 
3 140 PRO n 
3 141 ARG n 
3 142 GLU n 
3 143 ALA n 
3 144 LYS n 
3 145 VAL n 
3 146 GLN n 
3 147 TRP n 
3 148 LYS n 
3 149 VAL n 
3 150 ASP n 
3 151 ASN n 
3 152 ALA n 
3 153 LEU n 
3 154 GLN n 
3 155 SER n 
3 156 GLY n 
3 157 ASN n 
3 158 SER n 
3 159 GLN n 
3 160 GLU n 
3 161 SER n 
3 162 VAL n 
3 163 THR n 
3 164 GLU n 
3 165 GLN n 
3 166 ASP n 
3 167 SER n 
3 168 LYS n 
3 169 ASP n 
3 170 SER n 
3 171 THR n 
3 172 TYR n 
3 173 SER n 
3 174 LEU n 
3 175 SER n 
3 176 SER n 
3 177 THR n 
3 178 LEU n 
3 179 THR n 
3 180 LEU n 
3 181 SER n 
3 182 LYS n 
3 183 ALA n 
3 184 ASP n 
3 185 TYR n 
3 186 GLU n 
3 187 LYS n 
3 188 HIS n 
3 189 LYS n 
3 190 VAL n 
3 191 TYR n 
3 192 ALA n 
3 193 CYS n 
3 194 GLU n 
3 195 VAL n 
3 196 THR n 
3 197 HIS n 
3 198 GLN n 
3 199 GLY n 
3 200 LEU n 
3 201 SER n 
3 202 SER n 
3 203 PRO n 
3 204 VAL n 
3 205 THR n 
3 206 LYS n 
3 207 SER n 
3 208 PHE n 
3 209 ASN n 
3 210 ARG n 
4 1   GLN n 
4 2   VAL n 
4 3   GLN n 
4 4   LEU n 
4 5   GLN n 
4 6   GLN n 
4 7   TRP n 
4 8   GLY n 
4 9   ALA n 
4 10  GLY n 
4 11  LEU n 
4 12  LEU n 
4 13  LYS n 
4 14  PRO n 
4 15  SER n 
4 16  GLU n 
4 17  THR n 
4 18  LEU n 
4 19  SER n 
4 20  LEU n 
4 21  THR n 
4 22  CYS n 
4 23  GLY n 
4 24  VAL n 
4 25  TYR n 
4 26  GLY n 
4 27  GLU n 
4 28  SER n 
4 29  LEU n 
4 30  OAS n 
4 31  GLY n 
4 32  HIS n 
4 33  TYR n 
4 34  TRP n 
4 35  SER n 
4 36  TRP n 
4 37  VAL n 
4 38  ARG n 
4 39  GLN n 
4 40  PRO n 
4 41  PRO n 
4 42  GLY n 
4 43  LYS n 
4 44  ARG n 
4 45  LEU n 
4 46  GLU n 
4 47  TRP n 
4 48  ILE n 
4 49  GLY n 
4 50  GLU n 
4 51  ILE n 
4 52  LYS n 
4 53  HIS n 
4 54  ASN n 
4 55  GLY n 
4 56  SER n 
4 57  PRO n 
4 58  ASN n 
4 59  TYR n 
4 60  HIS n 
4 61  PRO n 
4 62  SER n 
4 63  LEU n 
4 64  LYS n 
4 65  SER n 
4 66  ARG n 
4 67  VAL n 
4 68  THR n 
4 69  ILE n 
4 70  SER n 
4 71  LEU n 
4 72  ASP n 
4 73  MET n 
4 74  SER n 
4 75  LYS n 
4 76  ASN n 
4 77  GLN n 
4 78  PHE n 
4 79  SER n 
4 80  LEU n 
4 81  ASN n 
4 82  LEU n 
4 83  THR n 
4 84  SER n 
4 85  VAL n 
4 86  THR n 
4 87  ALA n 
4 88  ALA n 
4 89  ASP n 
4 90  THR n 
4 91  ALA n 
4 92  VAL n 
4 93  TYR n 
4 94  PHE n 
4 95  CYS n 
4 96  ALA n 
4 97  ARG n 
4 98  ARG n 
4 99  SER n 
4 100 ASN n 
4 101 TRP n 
4 102 PRO n 
4 103 TYR n 
4 104 LEU n 
4 105 PRO n 
4 106 PHE n 
4 107 ASP n 
4 108 PRO n 
4 109 TRP n 
4 110 GLY n 
4 111 GLN n 
4 112 GLY n 
4 113 THR n 
4 114 LEU n 
4 115 VAL n 
4 116 THR n 
4 117 VAL n 
4 118 SER n 
4 119 SER n 
4 120 ALA n 
4 121 SER n 
4 122 THR n 
4 123 LYS n 
4 124 GLY n 
4 125 PRO n 
4 126 SER n 
4 127 VAL n 
4 128 PHE n 
4 129 PRO n 
4 130 LEU n 
4 131 ALA n 
4 132 PRO n 
4 133 SER n 
4 134 SER n 
4 135 LYS n 
4 136 SER n 
4 137 THR n 
4 138 SER n 
4 139 GLY n 
4 140 GLY n 
4 141 THR n 
4 142 ALA n 
4 143 ALA n 
4 144 LEU n 
4 145 GLY n 
4 146 CYS n 
4 147 LEU n 
4 148 VAL n 
4 149 LYS n 
4 150 ASP n 
4 151 TYR n 
4 152 PHE n 
4 153 PRO n 
4 154 GLU n 
4 155 PRO n 
4 156 VAL n 
4 157 THR n 
4 158 VAL n 
4 159 SER n 
4 160 TRP n 
4 161 ASN n 
4 162 SER n 
4 163 GLY n 
4 164 ALA n 
4 165 LEU n 
4 166 THR n 
4 167 SER n 
4 168 GLY n 
4 169 VAL n 
4 170 HIS n 
4 171 THR n 
4 172 PHE n 
4 173 PRO n 
4 174 ALA n 
4 175 VAL n 
4 176 LEU n 
4 177 GLN n 
4 178 SER n 
4 179 SER n 
4 180 GLY n 
4 181 LEU n 
4 182 TYR n 
4 183 SER n 
4 184 LEU n 
4 185 SER n 
4 186 SER n 
4 187 VAL n 
4 188 VAL n 
4 189 THR n 
4 190 VAL n 
4 191 PRO n 
4 192 SER n 
4 193 SER n 
4 194 SER n 
4 195 LEU n 
4 196 GLY n 
4 197 THR n 
4 198 GLN n 
4 199 THR n 
4 200 TYR n 
4 201 ILE n 
4 202 CYS n 
4 203 ASN n 
4 204 VAL n 
4 205 ASN n 
4 206 HIS n 
4 207 LYS n 
4 208 PRO n 
4 209 SER n 
4 210 ASN n 
4 211 THR n 
4 212 LYS n 
4 213 VAL n 
4 214 ASP n 
4 215 LYS n 
4 216 LYS n 
4 217 VAL n 
4 218 GLU n 
4 219 PRO n 
4 220 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HIV-1 ? ? ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
293S ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? human ? ? ? ? ? ? ? ? 'Homo sapiens'                   9606  ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
?    ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? human ? ? ? ? ? ? ? ? 'Homo sapiens'                   9606  ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
?    ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 PDB 4R4N 4R4N 1 ? 
;IWKDANTTLFCASDAKAYDTEVHNVWATHACVPTDPSPQELKMENVTEEFNMWKNNMVEQMHTDIISLWDQSLKPCVQLT
GGSALTQACPKVTFEPIPIHYCAPAGYAILKCNDKEFNGTGLCKNVSTVQCTHGIRPVVSTQLLLNGSLAEGKVMIRSEN
ITNNVKNIIVQLNESVTINCTRPNNGGSGSGGDIRQAHCNVSGSQWNKTLHQVVEQLRKYWNNNTIIFNSSSGGDLEITT
HSFNCGGEFFYCNTSGLFNSTWVNGTASIENGTITLPCRIKQIINMWQRVGQAIYAPPIQGVIRCVSNITGLILTRDGGG
NSNENETFRPGGGDMRDNWRSELYKYKVVKIE
;
? 
2 PDB 4R4N 4R4N 2 ? XNLHFCQLRCKSLGLLGRCAPTXCACX ? 
3 PDB 4R4N 4R4N 3 ? 
;DIQMTQSPSFVSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLVIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQP
EDFATYYCQHLIGLRSFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE
SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
;
? 
4 PDB 4R4N 4R4N 4 ? 
;QVQLQQWGAGLLKPSETLSLTCGVYGESLSGHYWSWVRQPPGKRLEWIGEIKHNGSPNYHPSLKSRVTISLDMSKNQFSL
NLTSVTAADTAVYFCARRSNWPYLPFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4R4N A 1 ? 352 ? 4R4N 44 ? 492 ? 44 492 
2  1 4R4N B 1 ? 352 ? 4R4N 44 ? 492 ? 44 492 
3  1 4R4N E 1 ? 352 ? 4R4N 44 ? 492 ? 44 492 
4  1 4R4N I 1 ? 352 ? 4R4N 44 ? 492 ? 44 492 
5  1 4R4N M 1 ? 352 ? 4R4N 44 ? 492 ? 44 492 
6  1 4R4N P 1 ? 352 ? 4R4N 44 ? 492 ? 44 492 
7  1 4R4N S 1 ? 352 ? 4R4N 44 ? 492 ? 44 492 
8  1 4R4N V 1 ? 352 ? 4R4N 44 ? 492 ? 44 492 
9  2 4R4N a 1 ? 27  ? 4R4N 1  ? 27  ? 1  27  
10 2 4R4N b 1 ? 27  ? 4R4N 1  ? 27  ? 1  27  
11 2 4R4N e 1 ? 27  ? 4R4N 1  ? 27  ? 1  27  
12 2 4R4N i 1 ? 27  ? 4R4N 1  ? 27  ? 1  27  
13 2 4R4N m 1 ? 27  ? 4R4N 1  ? 27  ? 1  27  
14 2 4R4N p 1 ? 27  ? 4R4N 1  ? 27  ? 1  27  
15 2 4R4N s 1 ? 27  ? 4R4N 1  ? 27  ? 1  27  
16 2 4R4N v 1 ? 27  ? 4R4N 1  ? 27  ? 1  27  
17 3 4R4N L 1 ? 210 ? 4R4N 1  ? 211 ? 1  211 
18 3 4R4N D 1 ? 210 ? 4R4N 1  ? 211 ? 1  211 
19 3 4R4N G 1 ? 210 ? 4R4N 1  ? 211 ? 1  211 
20 3 4R4N K 1 ? 210 ? 4R4N 1  ? 211 ? 1  211 
21 3 4R4N O 1 ? 210 ? 4R4N 1  ? 211 ? 1  211 
22 3 4R4N R 1 ? 210 ? 4R4N 1  ? 211 ? 1  211 
23 3 4R4N U 1 ? 210 ? 4R4N 1  ? 211 ? 1  211 
24 3 4R4N X 1 ? 210 ? 4R4N 1  ? 211 ? 1  211 
25 4 4R4N H 1 ? 220 ? 4R4N 1  ? 214 ? 1  214 
26 4 4R4N C 1 ? 220 ? 4R4N 1  ? 214 ? 1  214 
27 4 4R4N F 1 ? 220 ? 4R4N 1  ? 214 ? 1  214 
28 4 4R4N J 1 ? 220 ? 4R4N 1  ? 214 ? 1  214 
29 4 4R4N N 1 ? 220 ? 4R4N 1  ? 214 ? 1  214 
30 4 4R4N Q 1 ? 220 ? 4R4N 1  ? 214 ? 1  214 
31 4 4R4N T 1 ? 220 ? 4R4N 1  ? 214 ? 1  214 
32 4 4R4N W 1 ? 220 ? 4R4N 1  ? 214 ? 1  214 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
DPR 'D-peptide linking'          . D-PROLINE                                ? 'C5 H9 N O2'     115.130 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
MPT non-polymer                  . 'BETA-MERCAPTOPROPIONIC ACID'            ? 'C3 H6 O2 S'     106.144 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
NH2 non-polymer                  . 'AMINO GROUP'                            ? 'H2 N'           16.023  
OAS 'L-peptide linking'          n O-ACETYLSERINE                           ? 'C5 H9 N O4'     147.129 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
U2X 'L-peptide linking'          n 'O-(cyclohexylmethyl)-L-tyrosine'        ? 'C16 H23 N O3'   277.359 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4R4N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.34 
_exptl_crystal.density_percent_sol   63.22 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;14% PEG 3350, 1M sodium formate, 0.1M calcium chloride, and 100 mM sodium acetate pH 4.5 , VAPOR DIFFUSION, HANGING DROP, temperature 291 K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2009-08-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4R4N 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            3.56 
_reflns.number_obs                   71903 
_reflns.number_all                   102718 
_reflns.percent_possible_obs         70.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.78 
_reflns_shell.d_res_low              4.07 
_reflns_shell.percent_possible_all   52.3 
_reflns_shell.Rmerge_I_obs           0.276 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        1.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4R4N 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     68953 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.97 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.145 
_refine.ls_d_res_high                            3.560 
_refine.ls_percent_reflns_obs                    62.66 
_refine.ls_R_factor_obs                          0.2975 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2959 
_refine.ls_R_factor_R_free                       0.3281 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.14 
_refine.ls_number_reflns_R_free                  3541 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.59 
_refine.pdbx_overall_phase_error                 44.11 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        48886 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         266 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               49152 
_refine_hist.d_res_high                       3.560 
_refine_hist.d_res_low                        49.145 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 50365 'X-RAY DIFFRACTION' ? 
f_angle_d          0.985  ? ? 68337 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.298 ? ? 18208 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.050  ? ? 7756  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 8750  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.5601  3.6088  590  0.4110 14.00 0.5125 . . 42  . . . . 
'X-RAY DIFFRACTION' . 3.6088  3.6604  644  0.3741 15.00 0.3672 . . 33  . . . . 
'X-RAY DIFFRACTION' . 3.6604  3.7150  785  0.3811 19.00 0.3515 . . 40  . . . . 
'X-RAY DIFFRACTION' . 3.7150  3.7730  984  0.3592 23.00 0.3875 . . 50  . . . . 
'X-RAY DIFFRACTION' . 3.7730  3.8348  1136 0.3656 27.00 0.4453 . . 55  . . . . 
'X-RAY DIFFRACTION' . 3.8348  3.9009  1446 0.3701 34.00 0.3359 . . 70  . . . . 
'X-RAY DIFFRACTION' . 3.9009  3.9718  1620 0.3636 39.00 0.3298 . . 80  . . . . 
'X-RAY DIFFRACTION' . 3.9718  4.0482  1913 0.3701 46.00 0.3774 . . 99  . . . . 
'X-RAY DIFFRACTION' . 4.0482  4.1308  2173 0.3580 52.00 0.3470 . . 132 . . . . 
'X-RAY DIFFRACTION' . 4.1308  4.2206  2377 0.3529 57.00 0.4005 . . 137 . . . . 
'X-RAY DIFFRACTION' . 4.2206  4.3187  2504 0.3303 60.00 0.3930 . . 131 . . . . 
'X-RAY DIFFRACTION' . 4.3187  4.4266  2611 0.3170 63.00 0.3532 . . 166 . . . . 
'X-RAY DIFFRACTION' . 4.4266  4.5462  2817 0.3144 67.00 0.3213 . . 151 . . . . 
'X-RAY DIFFRACTION' . 4.5462  4.6799  2961 0.3156 70.00 0.3710 . . 156 . . . . 
'X-RAY DIFFRACTION' . 4.6799  4.8308  3042 0.3078 74.00 0.3523 . . 166 . . . . 
'X-RAY DIFFRACTION' . 4.8308  5.0033  3201 0.2959 77.00 0.3317 . . 187 . . . . 
'X-RAY DIFFRACTION' . 5.0033  5.2035  3397 0.3062 81.00 0.3837 . . 174 . . . . 
'X-RAY DIFFRACTION' . 5.2035  5.4400  3509 0.3011 84.00 0.3135 . . 175 . . . . 
'X-RAY DIFFRACTION' . 5.4400  5.7264  3599 0.2988 87.00 0.3630 . . 207 . . . . 
'X-RAY DIFFRACTION' . 5.7264  6.0845  3799 0.3185 91.00 0.3491 . . 199 . . . . 
'X-RAY DIFFRACTION' . 6.0845  6.5533  3991 0.3286 95.00 0.3648 . . 216 . . . . 
'X-RAY DIFFRACTION' . 6.5533  7.2110  4125 0.3245 99.00 0.3221 . . 221 . . . . 
'X-RAY DIFFRACTION' . 7.2110  8.2502  4096 0.3092 99.00 0.3001 . . 239 . . . . 
'X-RAY DIFFRACTION' . 8.2502  10.3782 4113 0.2437 98.00 0.2800 . . 227 . . . . 
'X-RAY DIFFRACTION' . 10.3782 49.1493 3979 0.2423 95.00 0.2901 . . 188 . . . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 2 
3 ? 3 
4 ? 4 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
# 
_struct.entry_id                  4R4N 
_struct.title                     'Crystal structure of the anti-hiv-1 antibody 2.2c in complex with hiv-1 93ug037 gp120' 
_struct.pdbx_descriptor           'HIV-1 gp120, peptide, Antibody 2.2c, Light chain, Antibody 2.2c, Heavy chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4R4N 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN/IMMUNE SYSTEM/INHIBITOR' 
_struct_keywords.text            'HIV-1 attachment glycoprotein, VIRAL PROTEIN-IMMUNE SYSTEM-INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 1 ? 
F  N N 4 ? 
G  N N 2 ? 
H  N N 3 ? 
I  N N 4 ? 
J  N N 1 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 4 ? 
Q  N N 1 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 4 ? 
U  N N 1 ? 
V  N N 2 ? 
W  N N 3 ? 
X  N N 4 ? 
Y  N N 1 ? 
Z  N N 2 ? 
AA N N 3 ? 
BA N N 4 ? 
CA N N 1 ? 
DA N N 2 ? 
EA N N 3 ? 
FA N N 4 ? 
GA N N 5 ? 
HA N N 5 ? 
IA N N 5 ? 
JA N N 5 ? 
KA N N 5 ? 
LA N N 5 ? 
MA N N 5 ? 
NA N N 5 ? 
OA N N 5 ? 
PA N N 5 ? 
QA N N 5 ? 
RA N N 5 ? 
SA N N 5 ? 
TA N N 5 ? 
UA N N 5 ? 
VA N N 5 ? 
WA N N 5 ? 
XA N N 5 ? 
YA N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLU A  21  ? HIS A  29  ? GLU A 64  HIS A 72  1 ? 9  
HELX_P HELX_P2   2   ASN A  55  ? LEU A  73  ? ASN A 98  LEU A 116 1 ? 19 
HELX_P HELX_P3   3   GLY A  203 ? ARG A  218 ? GLY A 335 ARG A 350 1 ? 16 
HELX_P HELX_P4   4   ASP A  235 ? THR A  240 ? ASP A 368 THR A 373 1 ? 6  
HELX_P HELX_P5   5   THR A  254 ? ASN A  259 ? THR A 387 ASN A 392 5 ? 6  
HELX_P HELX_P6   6   MET A  335 ? TYR A  344 ? MET A 475 TYR A 484 1 ? 10 
HELX_P HELX_P7   7   GLU B  21  ? CYS B  31  ? GLU B 64  CYS B 74  1 ? 11 
HELX_P HELX_P8   8   ASN B  55  ? LEU B  73  ? ASN B 98  LEU B 116 1 ? 19 
HELX_P HELX_P9   9   GLY B  203 ? ARG B  218 ? GLY B 335 ARG B 350 1 ? 16 
HELX_P HELX_P10  10  ASP B  235 ? THR B  240 ? ASP B 368 THR B 373 1 ? 6  
HELX_P HELX_P11  11  MET B  335 ? TYR B  344 ? MET B 475 TYR B 484 1 ? 10 
HELX_P HELX_P12  43  ASN C  2   ? LYS C  11  ? ASN a 2   LYS a 11  1 ? 10 
HELX_P HELX_P13  44  SER C  12  ? GLY C  14  ? SER a 12  GLY a 14  5 ? 3  
HELX_P HELX_P14  59  GLN D  79  ? PHE D  83  ? GLN L 79  PHE L 83  5 ? 5  
HELX_P HELX_P15  60  SER D  120 ? LYS D  125 ? SER L 121 LYS L 126 1 ? 6  
HELX_P HELX_P16  61  LYS D  182 ? GLU D  186 ? LYS L 183 GLU L 187 1 ? 5  
HELX_P HELX_P17  17  GLU E  21  ? ALA E  27  ? GLU I 64  ALA I 70  1 ? 7  
HELX_P HELX_P18  18  ASN E  55  ? LEU E  73  ? ASN I 98  LEU I 116 1 ? 19 
HELX_P HELX_P19  19  GLN E  205 ? ARG E  218 ? GLN I 337 ARG I 350 1 ? 14 
HELX_P HELX_P20  20  ASP E  235 ? THR E  240 ? ASP I 368 THR I 373 1 ? 6  
HELX_P HELX_P21  21  MET E  335 ? SER E  341 ? MET I 475 SER I 481 1 ? 7  
HELX_P HELX_P22  83  THR F  86  ? THR F  90  ? THR H 83  THR H 87  5 ? 5  
HELX_P HELX_P23  84  SER F  162 ? ALA F  164 ? SER H 156 ALA H 158 5 ? 3  
HELX_P HELX_P24  85  SER F  193 ? THR F  197 ? SER H 187 THR H 191 5 ? 5  
HELX_P HELX_P25  86  LYS F  207 ? ASN F  210 ? LYS H 201 ASN H 204 5 ? 4  
HELX_P HELX_P26  45  ASN G  2   ? LYS G  11  ? ASN b 2   LYS b 11  1 ? 10 
HELX_P HELX_P27  46  SER G  12  ? GLY G  14  ? SER b 12  GLY b 14  5 ? 3  
HELX_P HELX_P28  62  GLN H  79  ? PHE H  83  ? GLN D 79  PHE D 83  5 ? 5  
HELX_P HELX_P29  63  SER H  120 ? LYS H  125 ? SER D 121 LYS D 126 1 ? 6  
HELX_P HELX_P30  64  LYS H  182 ? LYS H  187 ? LYS D 183 LYS D 188 1 ? 6  
HELX_P HELX_P31  87  PRO I  61  ? LYS I  64  ? PRO C 61  LYS C 64  5 ? 4  
HELX_P HELX_P32  88  MET I  73  ? LYS I  75  ? MET C 73  LYS C 75  5 ? 3  
HELX_P HELX_P33  89  THR I  86  ? THR I  90  ? THR C 83  THR C 87  5 ? 5  
HELX_P HELX_P34  90  SER I  162 ? ALA I  164 ? SER C 156 ALA C 158 5 ? 3  
HELX_P HELX_P35  91  SER I  193 ? LEU I  195 ? SER C 187 LEU C 189 5 ? 3  
HELX_P HELX_P36  92  LYS I  207 ? ASN I  210 ? LYS C 201 ASN C 204 5 ? 4  
HELX_P HELX_P37  12  GLU J  21  ? THR J  28  ? GLU E 64  THR E 71  1 ? 8  
HELX_P HELX_P38  13  ASN J  55  ? LEU J  73  ? ASN E 98  LEU E 116 1 ? 19 
HELX_P HELX_P39  14  SER J  202 ? ARG J  218 ? SER E 334 ARG E 350 1 ? 17 
HELX_P HELX_P40  15  ASP J  235 ? THR J  240 ? ASP E 368 THR E 373 1 ? 6  
HELX_P HELX_P41  16  MET J  335 ? TYR J  344 ? MET E 475 TYR E 484 1 ? 10 
HELX_P HELX_P42  47  ASN K  2   ? LYS K  11  ? ASN e 2   LYS e 11  1 ? 10 
HELX_P HELX_P43  48  SER K  12  ? GLY K  14  ? SER e 12  GLY e 14  5 ? 3  
HELX_P HELX_P44  65  GLN L  79  ? PHE L  83  ? GLN G 79  PHE G 83  5 ? 5  
HELX_P HELX_P45  66  SER L  120 ? LYS L  125 ? SER G 121 LYS G 126 1 ? 6  
HELX_P HELX_P46  67  LYS L  182 ? LYS L  187 ? LYS G 183 LYS G 188 1 ? 6  
HELX_P HELX_P47  93  THR M  86  ? THR M  90  ? THR F 83  THR F 87  5 ? 5  
HELX_P HELX_P48  94  SER M  162 ? ALA M  164 ? SER F 156 ALA F 158 5 ? 3  
HELX_P HELX_P49  95  SER M  193 ? THR M  197 ? SER F 187 THR F 191 5 ? 5  
HELX_P HELX_P50  96  LYS M  207 ? SER M  209 ? LYS F 201 SER F 203 5 ? 3  
HELX_P HELX_P51  49  ASN N  2   ? LYS N  11  ? ASN i 2   LYS i 11  1 ? 10 
HELX_P HELX_P52  50  SER N  12  ? GLY N  14  ? SER i 12  GLY i 14  5 ? 3  
HELX_P HELX_P53  68  GLN O  79  ? PHE O  83  ? GLN K 79  PHE K 83  5 ? 5  
HELX_P HELX_P54  69  SER O  120 ? SER O  126 ? SER K 121 SER K 127 1 ? 7  
HELX_P HELX_P55  70  LYS O  182 ? GLU O  186 ? LYS K 183 GLU K 187 1 ? 5  
HELX_P HELX_P56  97  THR P  86  ? THR P  90  ? THR J 83  THR J 87  5 ? 5  
HELX_P HELX_P57  98  SER P  162 ? ALA P  164 ? SER J 156 ALA J 158 5 ? 3  
HELX_P HELX_P58  99  SER P  193 ? THR P  197 ? SER J 187 THR J 191 5 ? 5  
HELX_P HELX_P59  100 LYS P  207 ? ASN P  210 ? LYS J 201 ASN J 204 5 ? 4  
HELX_P HELX_P60  22  GLU Q  21  ? ALA Q  27  ? GLU M 64  ALA M 70  1 ? 7  
HELX_P HELX_P61  23  THR Q  28  ? ALA Q  30  ? THR M 71  ALA M 73  5 ? 3  
HELX_P HELX_P62  24  ASN Q  55  ? LEU Q  73  ? ASN M 98  LEU M 116 1 ? 19 
HELX_P HELX_P63  25  GLY Q  203 ? ARG Q  218 ? GLY M 335 ARG M 350 1 ? 16 
HELX_P HELX_P64  26  ASP Q  235 ? THR Q  240 ? ASP M 368 THR M 373 1 ? 6  
HELX_P HELX_P65  27  MET Q  335 ? TYR Q  344 ? MET M 475 TYR M 484 1 ? 10 
HELX_P HELX_P66  51  ASN R  2   ? LYS R  11  ? ASN m 2   LYS m 11  1 ? 10 
HELX_P HELX_P67  52  SER R  12  ? GLY R  14  ? SER m 12  GLY m 14  5 ? 3  
HELX_P HELX_P68  71  GLN S  79  ? PHE S  83  ? GLN O 79  PHE O 83  5 ? 5  
HELX_P HELX_P69  72  SER S  120 ? LYS S  125 ? SER O 121 LYS O 126 1 ? 6  
HELX_P HELX_P70  73  LYS S  182 ? LYS S  187 ? LYS O 183 LYS O 188 1 ? 6  
HELX_P HELX_P71  101 PRO T  61  ? LYS T  64  ? PRO N 61  LYS N 64  5 ? 4  
HELX_P HELX_P72  102 THR T  86  ? THR T  90  ? THR N 83  THR N 87  5 ? 5  
HELX_P HELX_P73  103 SER T  193 ? THR T  197 ? SER N 187 THR N 191 5 ? 5  
HELX_P HELX_P74  104 LYS T  207 ? ASN T  210 ? LYS N 201 ASN N 204 5 ? 4  
HELX_P HELX_P75  28  GLU U  21  ? THR U  28  ? GLU P 64  THR P 71  1 ? 8  
HELX_P HELX_P76  29  ASN U  55  ? LEU U  73  ? ASN P 98  LEU P 116 1 ? 19 
HELX_P HELX_P77  30  GLY U  203 ? ARG U  218 ? GLY P 335 ARG P 350 1 ? 16 
HELX_P HELX_P78  31  ASP U  235 ? THR U  240 ? ASP P 368 THR P 373 1 ? 6  
HELX_P HELX_P79  32  MET U  335 ? TYR U  344 ? MET P 475 TYR P 484 1 ? 10 
HELX_P HELX_P80  53  ASN V  2   ? LYS V  11  ? ASN p 2   LYS p 11  1 ? 10 
HELX_P HELX_P81  54  SER V  12  ? GLY V  14  ? SER p 12  GLY p 14  5 ? 3  
HELX_P HELX_P82  74  GLN W  79  ? PHE W  83  ? GLN R 79  PHE R 83  5 ? 5  
HELX_P HELX_P83  75  SER W  120 ? LYS W  125 ? SER R 121 LYS R 126 1 ? 6  
HELX_P HELX_P84  76  LYS W  182 ? LYS W  187 ? LYS R 183 LYS R 188 1 ? 6  
HELX_P HELX_P85  105 THR X  86  ? THR X  90  ? THR Q 83  THR Q 87  5 ? 5  
HELX_P HELX_P86  106 SER X  162 ? ALA X  164 ? SER Q 156 ALA Q 158 5 ? 3  
HELX_P HELX_P87  107 SER X  193 ? THR X  197 ? SER Q 187 THR Q 191 5 ? 5  
HELX_P HELX_P88  108 LYS X  207 ? ASN X  210 ? LYS Q 201 ASN Q 204 5 ? 4  
HELX_P HELX_P89  33  GLU Y  21  ? CYS Y  31  ? GLU S 64  CYS S 74  1 ? 11 
HELX_P HELX_P90  34  ASN Y  55  ? LEU Y  73  ? ASN S 98  LEU S 116 1 ? 19 
HELX_P HELX_P91  35  GLY Y  203 ? TRP Y  221 ? GLY S 335 TRP S 353 1 ? 19 
HELX_P HELX_P92  36  ASP Y  235 ? THR Y  240 ? ASP S 368 THR S 373 1 ? 6  
HELX_P HELX_P93  37  MET Y  335 ? TYR Y  344 ? MET S 475 TYR S 484 1 ? 10 
HELX_P HELX_P94  55  ASN Z  2   ? LYS Z  11  ? ASN s 2   LYS s 11  1 ? 10 
HELX_P HELX_P95  56  SER Z  12  ? GLY Z  14  ? SER s 12  GLY s 14  5 ? 3  
HELX_P HELX_P96  77  GLN AA 79  ? PHE AA 83  ? GLN U 79  PHE U 83  5 ? 5  
HELX_P HELX_P97  78  SER AA 120 ? LYS AA 125 ? SER U 121 LYS U 126 1 ? 6  
HELX_P HELX_P98  79  LYS AA 182 ? GLU AA 186 ? LYS U 183 GLU U 187 1 ? 5  
HELX_P HELX_P99  109 THR BA 86  ? THR BA 90  ? THR T 83  THR T 87  5 ? 5  
HELX_P HELX_P100 110 SER BA 162 ? ALA BA 164 ? SER T 156 ALA T 158 5 ? 3  
HELX_P HELX_P101 111 SER BA 193 ? THR BA 197 ? SER T 187 THR T 191 5 ? 5  
HELX_P HELX_P102 112 LYS BA 207 ? ASN BA 210 ? LYS T 201 ASN T 204 5 ? 4  
HELX_P HELX_P103 38  GLU CA 21  ? THR CA 28  ? GLU V 64  THR V 71  1 ? 8  
HELX_P HELX_P104 39  ASN CA 55  ? LEU CA 73  ? ASN V 98  LEU V 116 1 ? 19 
HELX_P HELX_P105 40  GLY CA 203 ? ARG CA 218 ? GLY V 335 ARG V 350 1 ? 16 
HELX_P HELX_P106 41  ASP CA 235 ? THR CA 240 ? ASP V 368 THR V 373 1 ? 6  
HELX_P HELX_P107 42  MET CA 335 ? TYR CA 344 ? MET V 475 TYR V 484 1 ? 10 
HELX_P HELX_P108 57  ASN DA 2   ? LYS DA 11  ? ASN v 2   LYS v 11  1 ? 10 
HELX_P HELX_P109 58  SER DA 12  ? GLY DA 14  ? SER v 12  GLY v 14  5 ? 3  
HELX_P HELX_P110 80  GLN EA 79  ? PHE EA 83  ? GLN X 79  PHE X 83  5 ? 5  
HELX_P HELX_P111 81  SER EA 120 ? LYS EA 125 ? SER X 121 LYS X 126 1 ? 6  
HELX_P HELX_P112 82  LYS EA 182 ? GLU EA 186 ? LYS X 183 GLU X 187 1 ? 5  
HELX_P HELX_P113 113 PRO FA 61  ? LYS FA 64  ? PRO W 61  LYS W 64  5 ? 4  
HELX_P HELX_P114 114 THR FA 86  ? THR FA 90  ? THR W 83  THR W 87  5 ? 5  
HELX_P HELX_P115 115 SER FA 193 ? THR FA 197 ? SER W 187 THR W 191 5 ? 5  
HELX_P HELX_P116 116 LYS FA 207 ? ASN FA 210 ? LYS W 201 ASN W 204 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1   disulf ?    ? A  CYS 11  SG  ? ? ? 1_555 A  CYS 31  SG ? ? A CYS 54  A CYS 74  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf2   disulf ?    ? A  CYS 76  SG  ? ? ? 1_555 A  CYS 89  SG ? ? A CYS 119 A CYS 205 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf3   disulf ?    ? A  CYS 112 SG  ? ? ? 1_555 A  CYS 123 SG ? ? A CYS 228 A CYS 239 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf4   disulf ?    ? A  CYS 180 SG  ? ? ? 1_555 A  CYS 199 SG ? ? A CYS 296 A CYS 331 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf5   disulf ?    ? A  CYS 245 SG  ? ? ? 1_555 A  CYS 305 SG ? ? A CYS 378 A CYS 445 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf6   disulf ?    ? A  CYS 252 SG  ? ? ? 1_555 A  CYS 278 SG ? ? A CYS 385 A CYS 418 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf7   disulf ?    ? B  CYS 11  SG  ? ? ? 1_555 B  CYS 31  SG ? ? B CYS 54  B CYS 74  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf8   disulf ?    ? B  CYS 76  SG  ? ? ? 1_555 B  CYS 89  SG ? ? B CYS 119 B CYS 205 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf9   disulf ?    ? B  CYS 112 SG  ? ? ? 1_555 B  CYS 123 SG ? ? B CYS 228 B CYS 239 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf10  disulf ?    ? B  CYS 180 SG  ? ? ? 1_555 B  CYS 199 SG ? ? B CYS 296 B CYS 331 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf11  disulf ?    ? B  CYS 199 SG  ? ? ? 1_555 B  CYS 252 SG ? ? B CYS 331 B CYS 385 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf12  disulf ?    ? B  CYS 199 SG  ? ? ? 1_555 B  CYS 278 SG ? ? B CYS 331 B CYS 418 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf13  disulf ?    ? B  CYS 245 SG  ? ? ? 1_555 B  CYS 305 SG ? ? B CYS 378 B CYS 445 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf14  disulf ?    ? B  CYS 252 SG  ? ? ? 1_555 B  CYS 278 SG ? ? B CYS 385 B CYS 418 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf15  disulf ?    ? C  CYS 6   SG  ? ? ? 1_555 C  CYS 24  SG ? ? a CYS 6   a CYS 24  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
disulf16  disulf ?    ? C  CYS 10  SG  ? ? ? 1_555 C  CYS 26  SG ? ? a CYS 10  a CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf17  disulf ?    ? D  CYS 23  SG  ? ? ? 1_555 D  CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf18  disulf ?    ? D  CYS 133 SG  ? ? ? 1_555 D  CYS 193 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf19  disulf ?    ? E  CYS 11  SG  ? ? ? 1_555 E  CYS 31  SG ? ? I CYS 54  I CYS 74  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf20  disulf ?    ? E  CYS 76  SG  ? ? ? 1_555 E  CYS 89  SG ? ? I CYS 119 I CYS 205 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf21  disulf ?    ? E  CYS 112 SG  ? ? ? 1_555 E  CYS 123 SG ? ? I CYS 228 I CYS 239 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf22  disulf ?    ? E  CYS 180 SG  ? ? ? 1_555 E  CYS 199 SG ? ? I CYS 296 I CYS 331 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf23  disulf ?    ? E  CYS 199 SG  ? ? ? 1_555 E  CYS 278 SG ? ? I CYS 331 I CYS 418 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf24  disulf ?    ? E  CYS 245 SG  ? ? ? 1_555 E  CYS 305 SG ? ? I CYS 378 I CYS 445 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf25  disulf ?    ? E  CYS 252 SG  ? ? ? 1_555 E  CYS 278 SG ? ? I CYS 385 I CYS 418 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf26  disulf ?    ? F  CYS 22  SG  ? ? ? 1_555 F  CYS 95  SG ? ? H CYS 22  H CYS 92  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf27  disulf ?    ? F  CYS 146 SG  ? ? ? 1_555 F  CYS 202 SG ? ? H CYS 140 H CYS 196 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf28  disulf ?    ? G  CYS 6   SG  ? ? ? 1_555 G  CYS 24  SG ? ? b CYS 6   b CYS 24  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
disulf29  disulf ?    ? G  CYS 10  SG  ? ? ? 1_555 G  CYS 26  SG ? ? b CYS 10  b CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf30  disulf ?    ? H  CYS 23  SG  ? ? ? 1_555 H  CYS 88  SG ? ? D CYS 23  D CYS 88  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf31  disulf ?    ? H  CYS 133 SG  ? ? ? 1_555 H  CYS 193 SG ? ? D CYS 134 D CYS 194 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf32  disulf ?    ? I  CYS 22  SG  ? ? ? 1_555 I  CYS 95  SG ? ? C CYS 22  C CYS 92  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf33  disulf ?    ? I  CYS 146 SG  ? ? ? 1_555 I  CYS 202 SG ? ? C CYS 140 C CYS 196 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf34  disulf ?    ? J  CYS 11  SG  ? ? ? 1_555 J  CYS 31  SG ? ? E CYS 54  E CYS 74  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf35  disulf ?    ? J  CYS 76  SG  ? ? ? 1_555 J  CYS 89  SG ? ? E CYS 119 E CYS 205 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf36  disulf ?    ? J  CYS 112 SG  ? ? ? 1_555 J  CYS 123 SG ? ? E CYS 228 E CYS 239 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf37  disulf ?    ? J  CYS 180 SG  ? ? ? 1_555 J  CYS 199 SG ? ? E CYS 296 E CYS 331 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf38  disulf ?    ? J  CYS 245 SG  ? ? ? 1_555 J  CYS 305 SG ? ? E CYS 378 E CYS 445 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf39  disulf ?    ? J  CYS 252 SG  ? ? ? 1_555 J  CYS 278 SG ? ? E CYS 385 E CYS 418 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf40  disulf ?    ? K  CYS 6   SG  ? ? ? 1_555 K  CYS 24  SG ? ? e CYS 6   e CYS 24  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
disulf41  disulf ?    ? K  CYS 10  SG  ? ? ? 1_555 K  CYS 26  SG ? ? e CYS 10  e CYS 26  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf42  disulf ?    ? L  CYS 23  SG  ? ? ? 1_555 L  CYS 88  SG ? ? G CYS 23  G CYS 88  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf43  disulf ?    ? L  CYS 133 SG  ? ? ? 1_555 L  CYS 193 SG ? ? G CYS 134 G CYS 194 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf44  disulf ?    ? M  CYS 22  SG  ? ? ? 1_555 M  CYS 95  SG ? ? F CYS 22  F CYS 92  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf45  disulf ?    ? M  CYS 146 SG  ? ? ? 1_555 M  CYS 202 SG ? ? F CYS 140 F CYS 196 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf46  disulf ?    ? N  CYS 6   SG  ? ? ? 1_555 N  CYS 24  SG ? ? i CYS 6   i CYS 24  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
disulf47  disulf ?    ? N  CYS 10  SG  ? ? ? 1_555 N  CYS 26  SG ? ? i CYS 10  i CYS 26  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf48  disulf ?    ? O  CYS 23  SG  ? ? ? 1_555 O  CYS 88  SG ? ? K CYS 23  K CYS 88  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf49  disulf ?    ? O  CYS 133 SG  ? ? ? 1_555 O  CYS 193 SG ? ? K CYS 134 K CYS 194 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf50  disulf ?    ? P  CYS 22  SG  ? ? ? 1_555 P  CYS 95  SG ? ? J CYS 22  J CYS 92  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf51  disulf ?    ? P  CYS 146 SG  ? ? ? 1_555 P  CYS 202 SG ? ? J CYS 140 J CYS 196 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf52  disulf ?    ? Q  CYS 11  SG  ? ? ? 1_555 Q  CYS 31  SG ? ? M CYS 54  M CYS 74  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf53  disulf ?    ? Q  CYS 76  SG  ? ? ? 1_555 Q  CYS 89  SG ? ? M CYS 119 M CYS 205 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf54  disulf ?    ? Q  CYS 112 SG  ? ? ? 1_555 Q  CYS 123 SG ? ? M CYS 228 M CYS 239 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf55  disulf ?    ? Q  CYS 180 SG  ? ? ? 1_555 Q  CYS 199 SG ? ? M CYS 296 M CYS 331 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf56  disulf ?    ? Q  CYS 245 SG  ? ? ? 1_555 Q  CYS 305 SG ? ? M CYS 378 M CYS 445 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf57  disulf ?    ? Q  CYS 252 SG  ? ? ? 1_555 Q  CYS 278 SG ? ? M CYS 385 M CYS 418 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf58  disulf ?    ? R  CYS 6   SG  ? ? ? 1_555 R  CYS 24  SG ? ? m CYS 6   m CYS 24  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
disulf59  disulf ?    ? R  CYS 10  SG  ? ? ? 1_555 R  CYS 26  SG ? ? m CYS 10  m CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf60  disulf ?    ? S  CYS 23  SG  ? ? ? 1_555 S  CYS 88  SG ? ? O CYS 23  O CYS 88  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf61  disulf ?    ? S  CYS 133 SG  ? ? ? 1_555 S  CYS 193 SG ? ? O CYS 134 O CYS 194 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf62  disulf ?    ? T  CYS 22  SG  ? ? ? 1_555 T  CYS 95  SG ? ? N CYS 22  N CYS 92  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf63  disulf ?    ? T  CYS 146 SG  ? ? ? 1_555 T  CYS 202 SG ? ? N CYS 140 N CYS 196 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf64  disulf ?    ? U  CYS 11  SG  ? ? ? 1_555 U  CYS 31  SG ? ? P CYS 54  P CYS 74  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf65  disulf ?    ? U  CYS 76  SG  ? ? ? 1_555 U  CYS 89  SG ? ? P CYS 119 P CYS 205 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf66  disulf ?    ? U  CYS 112 SG  ? ? ? 1_555 U  CYS 123 SG ? ? P CYS 228 P CYS 239 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf67  disulf ?    ? U  CYS 180 SG  ? ? ? 1_555 U  CYS 199 SG ? ? P CYS 296 P CYS 331 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf68  disulf ?    ? U  CYS 245 SG  ? ? ? 1_555 U  CYS 305 SG ? ? P CYS 378 P CYS 445 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf69  disulf ?    ? U  CYS 252 SG  ? ? ? 1_555 U  CYS 278 SG ? ? P CYS 385 P CYS 418 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf70  disulf ?    ? V  CYS 6   SG  ? ? ? 1_555 V  CYS 24  SG ? ? p CYS 6   p CYS 24  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
disulf71  disulf ?    ? V  CYS 10  SG  ? ? ? 1_555 V  CYS 26  SG ? ? p CYS 10  p CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf72  disulf ?    ? W  CYS 23  SG  ? ? ? 1_555 W  CYS 88  SG ? ? R CYS 23  R CYS 88  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf73  disulf ?    ? W  CYS 133 SG  ? ? ? 1_555 W  CYS 193 SG ? ? R CYS 134 R CYS 194 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf74  disulf ?    ? X  CYS 22  SG  ? ? ? 1_555 X  CYS 95  SG ? ? Q CYS 22  Q CYS 92  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf75  disulf ?    ? X  CYS 146 SG  ? ? ? 1_555 X  CYS 202 SG ? ? Q CYS 140 Q CYS 196 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf76  disulf ?    ? Y  CYS 11  SG  ? ? ? 1_555 Y  CYS 31  SG ? ? S CYS 54  S CYS 74  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf77  disulf ?    ? Y  CYS 76  SG  ? ? ? 1_555 Y  CYS 89  SG ? ? S CYS 119 S CYS 205 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf78  disulf ?    ? Y  CYS 112 SG  ? ? ? 1_555 Y  CYS 123 SG ? ? S CYS 228 S CYS 239 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf79  disulf ?    ? Y  CYS 180 SG  ? ? ? 1_555 Y  CYS 199 SG ? ? S CYS 296 S CYS 331 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf80  disulf ?    ? Y  CYS 245 SG  ? ? ? 1_555 Y  CYS 305 SG ? ? S CYS 378 S CYS 445 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf81  disulf ?    ? Y  CYS 252 SG  ? ? ? 1_555 Y  CYS 278 SG ? ? S CYS 385 S CYS 418 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf82  disulf ?    ? Z  CYS 6   SG  ? ? ? 1_555 Z  CYS 24  SG ? ? s CYS 6   s CYS 24  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
disulf83  disulf ?    ? Z  CYS 10  SG  ? ? ? 1_555 Z  CYS 26  SG ? ? s CYS 10  s CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf84  disulf ?    ? AA CYS 23  SG  ? ? ? 1_555 AA CYS 88  SG ? ? U CYS 23  U CYS 88  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf85  disulf ?    ? AA CYS 133 SG  ? ? ? 1_555 AA CYS 193 SG ? ? U CYS 134 U CYS 194 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf86  disulf ?    ? BA CYS 22  SG  ? ? ? 1_555 BA CYS 95  SG ? ? T CYS 22  T CYS 92  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf87  disulf ?    ? BA CYS 146 SG  ? ? ? 1_555 BA CYS 202 SG ? ? T CYS 140 T CYS 196 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf88  disulf ?    ? CA CYS 11  SG  ? ? ? 1_555 CA CYS 31  SG ? ? V CYS 54  V CYS 74  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf89  disulf ?    ? CA CYS 76  SG  ? ? ? 1_555 CA CYS 89  SG ? ? V CYS 119 V CYS 205 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf90  disulf ?    ? CA CYS 112 SG  ? ? ? 1_555 CA CYS 123 SG ? ? V CYS 228 V CYS 239 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf91  disulf ?    ? CA CYS 180 SG  ? ? ? 1_555 CA CYS 199 SG ? ? V CYS 296 V CYS 331 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf92  disulf ?    ? CA CYS 245 SG  ? ? ? 1_555 CA CYS 305 SG ? ? V CYS 378 V CYS 445 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf93  disulf ?    ? CA CYS 252 SG  ? ? ? 1_555 CA CYS 278 SG ? ? V CYS 385 V CYS 418 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf94  disulf ?    ? DA CYS 6   SG  ? ? ? 1_555 DA CYS 24  SG ? ? v CYS 6   v CYS 24  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
disulf95  disulf ?    ? DA CYS 10  SG  ? ? ? 1_555 DA CYS 26  SG ? ? v CYS 10  v CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf96  disulf ?    ? EA CYS 23  SG  ? ? ? 1_555 EA CYS 88  SG ? ? X CYS 23  X CYS 88  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf97  disulf ?    ? EA CYS 133 SG  ? ? ? 1_555 EA CYS 193 SG ? ? X CYS 134 X CYS 194 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf98  disulf ?    ? FA CYS 22  SG  ? ? ? 1_555 FA CYS 95  SG ? ? W CYS 22  W CYS 92  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf99  disulf ?    ? FA CYS 146 SG  ? ? ? 1_555 FA CYS 202 SG ? ? W CYS 140 W CYS 196 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
covale1   covale none ? A  CYS 11  SG  ? ? ? 1_555 A  CYS 31  SG ? ? A CYS 54  A CYS 74  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale2   covale none ? A  CYS 76  SG  ? ? ? 1_555 A  CYS 89  SG ? ? A CYS 119 A CYS 205 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale3   covale none ? A  CYS 112 SG  ? ? ? 1_555 A  CYS 123 SG ? ? A CYS 228 A CYS 239 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
covale4   covale one  ? A  ASN 146 ND2 ? ? ? 1_555 GA NAG .   C1 ? ? A ASN 262 A NAG 501 1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale5   covale one  ? A  ASN 160 ND2 ? ? ? 1_555 JA NAG .   C1 ? ? A ASN 276 A NAG 504 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale6   covale one  ? A  ASN 173 ND2 ? ? ? 1_555 HA NAG .   C1 ? ? A ASN 289 A NAG 502 1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale7   covale none ? A  CYS 180 SG  ? ? ? 1_555 A  CYS 199 SG ? ? A CYS 296 A CYS 331 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale8   covale none ? A  CYS 245 SG  ? ? ? 1_555 A  CYS 305 SG ? ? A CYS 378 A CYS 445 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale9   covale none ? A  CYS 252 SG  ? ? ? 1_555 A  CYS 278 SG ? ? A CYS 385 A CYS 418 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
covale10  covale one  ? A  ASN 253 ND2 ? ? ? 1_555 IA NAG .   C1 ? ? A ASN 386 A NAG 503 1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale11  covale none ? B  CYS 11  SG  ? ? ? 1_555 B  CYS 31  SG ? ? B CYS 54  B CYS 74  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
covale12  covale none ? B  CYS 76  SG  ? ? ? 1_555 B  CYS 89  SG ? ? B CYS 119 B CYS 205 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale13  covale none ? B  CYS 112 SG  ? ? ? 1_555 B  CYS 123 SG ? ? B CYS 228 B CYS 239 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale14  covale one  ? B  ASN 146 ND2 ? ? ? 1_555 KA NAG .   C1 ? ? B ASN 262 B NAG 501 1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale15  covale one  ? B  ASN 173 ND2 ? ? ? 1_555 LA NAG .   C1 ? ? B ASN 289 B NAG 502 1_555 ? ? ? ? ? ? ? 1.457 ? 
N-Glycosylation 
covale16  covale none ? B  CYS 180 SG  ? ? ? 1_555 B  CYS 199 SG ? ? B CYS 296 B CYS 331 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
covale17  covale none ? B  CYS 199 SG  ? ? ? 1_555 B  CYS 252 SG ? ? B CYS 331 B CYS 385 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
covale18  covale none ? B  CYS 199 SG  ? ? ? 1_555 B  CYS 278 SG ? ? B CYS 331 B CYS 418 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
covale19  covale none ? B  CYS 245 SG  ? ? ? 1_555 B  CYS 305 SG ? ? B CYS 378 B CYS 445 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
covale20  covale none ? B  CYS 252 SG  ? ? ? 1_555 B  CYS 278 SG ? ? B CYS 385 B CYS 418 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale21  covale both ? C  MPT 1   C   ? ? ? 1_555 C  ASN 2   N  ? ? a MPT 1   a ASN 2   1_555 ? ? ? ? ? ? ? 1.378 ? ? 
covale22  covale none ? C  MPT 1   SG  ? ? ? 1_555 C  CYS 19  SG ? ? a MPT 1   a CYS 19  1_555 ? ? ? ? ? ? ? 2.114 ? ? 
covale23  covale none ? C  CYS 6   SG  ? ? ? 1_555 C  CYS 24  SG ? ? a CYS 6   a CYS 24  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
covale24  covale none ? C  CYS 10  SG  ? ? ? 1_555 C  CYS 26  SG ? ? a CYS 10  a CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
covale25  covale both ? C  ALA 20  C   ? ? ? 1_555 C  DPR 21  N  ? ? a ALA 20  a DPR 21  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale26  covale both ? C  DPR 21  C   ? ? ? 1_555 C  THR 22  N  ? ? a DPR 21  a THR 22  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale27  covale both ? C  THR 22  C   ? ? ? 1_555 C  U2X 23  N  ? ? a THR 22  a U2X 23  1_555 ? ? ? ? ? ? ? 1.342 ? ? 
covale28  covale both ? C  U2X 23  C   ? ? ? 1_555 C  CYS 24  N  ? ? a U2X 23  a CYS 24  1_555 ? ? ? ? ? ? ? 1.313 ? ? 
covale29  covale both ? C  VAL 27  C   ? ? ? 1_555 C  NH2 28  N  ? ? a VAL 27  a NH2 28  1_555 ? ? ? ? ? ? ? 1.430 ? ? 
covale30  covale none ? D  CYS 23  SG  ? ? ? 1_555 D  CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
covale31  covale none ? D  CYS 133 SG  ? ? ? 1_555 D  CYS 193 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale32  covale none ? E  CYS 112 SG  ? ? ? 1_555 E  CYS 123 SG ? ? I CYS 228 I CYS 239 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale33  covale one  ? E  ASN 146 ND2 ? ? ? 1_555 MA NAG .   C1 ? ? I ASN 262 I NAG 501 1_555 ? ? ? ? ? ? ? 1.445 ? 
N-Glycosylation 
covale34  covale one  ? E  ASN 160 ND2 ? ? ? 1_555 OA NAG .   C1 ? ? I ASN 276 I NAG 503 1_555 ? ? ? ? ? ? ? 1.443 ? 
N-Glycosylation 
covale35  covale one  ? E  ASN 173 ND2 ? ? ? 1_555 NA NAG .   C1 ? ? I ASN 289 I NAG 502 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale36  covale none ? E  CYS 180 SG  ? ? ? 1_555 E  CYS 199 SG ? ? I CYS 296 I CYS 331 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale37  covale none ? E  CYS 199 SG  ? ? ? 1_555 E  CYS 278 SG ? ? I CYS 331 I CYS 418 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
covale38  covale none ? E  CYS 252 SG  ? ? ? 1_555 E  CYS 278 SG ? ? I CYS 385 I CYS 418 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale39  covale one  ? E  ASN 308 ND2 ? ? ? 1_555 PA NAG .   C1 ? ? I ASN 448 I NAG 504 1_555 ? ? ? ? ? ? ? 1.432 ? 
N-Glycosylation 
covale40  covale none ? F  CYS 22  SG  ? ? ? 1_555 F  CYS 95  SG ? ? H CYS 22  H CYS 92  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
covale41  covale both ? F  LEU 29  C   ? ? ? 1_555 F  OAS 30  N  ? ? H LEU 29  H OAS 30  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale42  covale both ? F  OAS 30  C   ? ? ? 1_555 F  GLY 31  N  ? ? H OAS 30  H GLY 31  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale43  covale none ? F  CYS 146 SG  ? ? ? 1_555 F  CYS 202 SG ? ? H CYS 140 H CYS 196 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale44  covale both ? G  MPT 1   C   ? ? ? 1_555 G  ASN 2   N  ? ? b MPT 1   b ASN 2   1_555 ? ? ? ? ? ? ? 1.378 ? ? 
covale45  covale none ? G  MPT 1   SG  ? ? ? 1_555 G  CYS 19  SG ? ? b MPT 1   b CYS 19  1_555 ? ? ? ? ? ? ? 2.114 ? ? 
covale46  covale none ? G  CYS 6   SG  ? ? ? 1_555 G  CYS 24  SG ? ? b CYS 6   b CYS 24  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
covale47  covale none ? G  CYS 10  SG  ? ? ? 1_555 G  CYS 26  SG ? ? b CYS 10  b CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
covale48  covale both ? G  ALA 20  C   ? ? ? 1_555 G  DPR 21  N  ? ? b ALA 20  b DPR 21  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale49  covale both ? G  DPR 21  C   ? ? ? 1_555 G  THR 22  N  ? ? b DPR 21  b THR 22  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale50  covale both ? G  THR 22  C   ? ? ? 1_555 G  U2X 23  N  ? ? b THR 22  b U2X 23  1_555 ? ? ? ? ? ? ? 1.343 ? ? 
covale51  covale both ? G  U2X 23  C   ? ? ? 1_555 G  CYS 24  N  ? ? b U2X 23  b CYS 24  1_555 ? ? ? ? ? ? ? 1.313 ? ? 
covale52  covale both ? G  VAL 27  C   ? ? ? 1_555 G  NH2 28  N  ? ? b VAL 27  b NH2 28  1_555 ? ? ? ? ? ? ? 1.430 ? ? 
covale53  covale none ? H  CYS 23  SG  ? ? ? 1_555 H  CYS 88  SG ? ? D CYS 23  D CYS 88  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale54  covale none ? H  CYS 133 SG  ? ? ? 1_555 H  CYS 193 SG ? ? D CYS 134 D CYS 194 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
covale55  covale none ? I  CYS 22  SG  ? ? ? 1_555 I  CYS 95  SG ? ? C CYS 22  C CYS 92  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
covale56  covale both ? I  LEU 29  C   ? ? ? 1_555 I  OAS 30  N  ? ? C LEU 29  C OAS 30  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale57  covale both ? I  OAS 30  C   ? ? ? 1_555 I  GLY 31  N  ? ? C OAS 30  C GLY 31  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale58  covale none ? I  CYS 146 SG  ? ? ? 1_555 I  CYS 202 SG ? ? C CYS 140 C CYS 196 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
covale59  covale none ? J  CYS 11  SG  ? ? ? 1_555 J  CYS 31  SG ? ? E CYS 54  E CYS 74  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale60  covale none ? J  CYS 76  SG  ? ? ? 1_555 J  CYS 89  SG ? ? E CYS 119 E CYS 205 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
covale61  covale none ? J  CYS 112 SG  ? ? ? 1_555 J  CYS 123 SG ? ? E CYS 228 E CYS 239 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale62  covale one  ? J  ASN 146 ND2 ? ? ? 1_555 QA NAG .   C1 ? ? E ASN 262 E NAG 501 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale63  covale none ? J  CYS 180 SG  ? ? ? 1_555 J  CYS 199 SG ? ? E CYS 296 E CYS 331 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale64  covale none ? J  CYS 245 SG  ? ? ? 1_555 J  CYS 305 SG ? ? E CYS 378 E CYS 445 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale65  covale none ? J  CYS 252 SG  ? ? ? 1_555 J  CYS 278 SG ? ? E CYS 385 E CYS 418 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale66  covale one  ? J  ASN 253 ND2 ? ? ? 1_555 RA NAG .   C1 ? ? E ASN 386 E NAG 502 1_555 ? ? ? ? ? ? ? 1.437 ? 
N-Glycosylation 
covale67  covale both ? K  MPT 1   C   ? ? ? 1_555 K  ASN 2   N  ? ? e MPT 1   e ASN 2   1_555 ? ? ? ? ? ? ? 1.378 ? ? 
covale68  covale none ? K  MPT 1   SG  ? ? ? 1_555 K  CYS 19  SG ? ? e MPT 1   e CYS 19  1_555 ? ? ? ? ? ? ? 2.114 ? ? 
covale69  covale none ? K  CYS 6   SG  ? ? ? 1_555 K  CYS 24  SG ? ? e CYS 6   e CYS 24  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
covale70  covale none ? K  CYS 10  SG  ? ? ? 1_555 K  CYS 26  SG ? ? e CYS 10  e CYS 26  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
covale71  covale both ? K  ALA 20  C   ? ? ? 1_555 K  DPR 21  N  ? ? e ALA 20  e DPR 21  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale72  covale both ? K  DPR 21  C   ? ? ? 1_555 K  THR 22  N  ? ? e DPR 21  e THR 22  1_555 ? ? ? ? ? ? ? 1.314 ? ? 
covale73  covale both ? K  THR 22  C   ? ? ? 1_555 K  U2X 23  N  ? ? e THR 22  e U2X 23  1_555 ? ? ? ? ? ? ? 1.343 ? ? 
covale74  covale both ? K  U2X 23  C   ? ? ? 1_555 K  CYS 24  N  ? ? e U2X 23  e CYS 24  1_555 ? ? ? ? ? ? ? 1.312 ? ? 
covale75  covale both ? K  VAL 27  C   ? ? ? 1_555 K  NH2 28  N  ? ? e VAL 27  e NH2 28  1_555 ? ? ? ? ? ? ? 1.430 ? ? 
covale76  covale none ? L  CYS 23  SG  ? ? ? 1_555 L  CYS 88  SG ? ? G CYS 23  G CYS 88  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
covale77  covale none ? L  CYS 133 SG  ? ? ? 1_555 L  CYS 193 SG ? ? G CYS 134 G CYS 194 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale78  covale none ? M  CYS 22  SG  ? ? ? 1_555 M  CYS 95  SG ? ? F CYS 22  F CYS 92  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
covale79  covale both ? M  LEU 29  C   ? ? ? 1_555 M  OAS 30  N  ? ? F LEU 29  F OAS 30  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale80  covale both ? M  OAS 30  C   ? ? ? 1_555 M  GLY 31  N  ? ? F OAS 30  F GLY 31  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale81  covale none ? M  CYS 146 SG  ? ? ? 1_555 M  CYS 202 SG ? ? F CYS 140 F CYS 196 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale82  covale both ? N  MPT 1   C   ? ? ? 1_555 N  ASN 2   N  ? ? i MPT 1   i ASN 2   1_555 ? ? ? ? ? ? ? 1.378 ? ? 
covale83  covale none ? N  MPT 1   SG  ? ? ? 1_555 N  CYS 19  SG ? ? i MPT 1   i CYS 19  1_555 ? ? ? ? ? ? ? 2.114 ? ? 
covale84  covale none ? N  CYS 6   SG  ? ? ? 1_555 N  CYS 24  SG ? ? i CYS 6   i CYS 24  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
covale85  covale none ? N  CYS 10  SG  ? ? ? 1_555 N  CYS 26  SG ? ? i CYS 10  i CYS 26  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
covale86  covale both ? N  ALA 20  C   ? ? ? 1_555 N  DPR 21  N  ? ? i ALA 20  i DPR 21  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale87  covale both ? N  DPR 21  C   ? ? ? 1_555 N  THR 22  N  ? ? i DPR 21  i THR 22  1_555 ? ? ? ? ? ? ? 1.316 ? ? 
covale88  covale both ? N  THR 22  C   ? ? ? 1_555 N  U2X 23  N  ? ? i THR 22  i U2X 23  1_555 ? ? ? ? ? ? ? 1.342 ? ? 
covale89  covale both ? N  U2X 23  C   ? ? ? 1_555 N  CYS 24  N  ? ? i U2X 23  i CYS 24  1_555 ? ? ? ? ? ? ? 1.312 ? ? 
covale90  covale both ? N  VAL 27  C   ? ? ? 1_555 N  NH2 28  N  ? ? i VAL 27  i NH2 28  1_555 ? ? ? ? ? ? ? 1.430 ? ? 
covale91  covale none ? O  CYS 23  SG  ? ? ? 1_555 O  CYS 88  SG ? ? K CYS 23  K CYS 88  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale92  covale none ? O  CYS 133 SG  ? ? ? 1_555 O  CYS 193 SG ? ? K CYS 134 K CYS 194 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale93  covale none ? P  CYS 22  SG  ? ? ? 1_555 P  CYS 95  SG ? ? J CYS 22  J CYS 92  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale94  covale both ? P  LEU 29  C   ? ? ? 1_555 P  OAS 30  N  ? ? J LEU 29  J OAS 30  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale95  covale both ? P  OAS 30  C   ? ? ? 1_555 P  GLY 31  N  ? ? J OAS 30  J GLY 31  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale96  covale none ? P  CYS 146 SG  ? ? ? 1_555 P  CYS 202 SG ? ? J CYS 140 J CYS 196 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale97  covale none ? Q  CYS 11  SG  ? ? ? 1_555 Q  CYS 31  SG ? ? M CYS 54  M CYS 74  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale98  covale none ? Q  CYS 76  SG  ? ? ? 1_555 Q  CYS 89  SG ? ? M CYS 119 M CYS 205 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale99  covale none ? Q  CYS 112 SG  ? ? ? 1_555 Q  CYS 123 SG ? ? M CYS 228 M CYS 239 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale100 covale one  ? Q  ASN 146 ND2 ? ? ? 1_555 SA NAG .   C1 ? ? M ASN 262 M NAG 501 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale101 covale none ? Q  CYS 180 SG  ? ? ? 1_555 Q  CYS 199 SG ? ? M CYS 296 M CYS 331 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale102 covale none ? Q  CYS 245 SG  ? ? ? 1_555 Q  CYS 305 SG ? ? M CYS 378 M CYS 445 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
covale103 covale none ? Q  CYS 252 SG  ? ? ? 1_555 Q  CYS 278 SG ? ? M CYS 385 M CYS 418 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
covale104 covale both ? R  MPT 1   C   ? ? ? 1_555 R  ASN 2   N  ? ? m MPT 1   m ASN 2   1_555 ? ? ? ? ? ? ? 1.378 ? ? 
covale105 covale none ? R  MPT 1   SG  ? ? ? 1_555 R  CYS 19  SG ? ? m MPT 1   m CYS 19  1_555 ? ? ? ? ? ? ? 2.114 ? ? 
covale106 covale none ? R  CYS 6   SG  ? ? ? 1_555 R  CYS 24  SG ? ? m CYS 6   m CYS 24  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
covale107 covale none ? R  CYS 10  SG  ? ? ? 1_555 R  CYS 26  SG ? ? m CYS 10  m CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
covale108 covale both ? R  ALA 20  C   ? ? ? 1_555 R  DPR 21  N  ? ? m ALA 20  m DPR 21  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale109 covale both ? R  DPR 21  C   ? ? ? 1_555 R  THR 22  N  ? ? m DPR 21  m THR 22  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale110 covale both ? R  THR 22  C   ? ? ? 1_555 R  U2X 23  N  ? ? m THR 22  m U2X 23  1_555 ? ? ? ? ? ? ? 1.342 ? ? 
covale111 covale both ? R  U2X 23  C   ? ? ? 1_555 R  CYS 24  N  ? ? m U2X 23  m CYS 24  1_555 ? ? ? ? ? ? ? 1.313 ? ? 
covale112 covale both ? R  VAL 27  C   ? ? ? 1_555 R  NH2 28  N  ? ? m VAL 27  m NH2 28  1_555 ? ? ? ? ? ? ? 1.430 ? ? 
covale113 covale none ? S  CYS 23  SG  ? ? ? 1_555 S  CYS 88  SG ? ? O CYS 23  O CYS 88  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
covale114 covale none ? S  CYS 133 SG  ? ? ? 1_555 S  CYS 193 SG ? ? O CYS 134 O CYS 194 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale115 covale none ? T  CYS 22  SG  ? ? ? 1_555 T  CYS 95  SG ? ? N CYS 22  N CYS 92  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale116 covale both ? T  LEU 29  C   ? ? ? 1_555 T  OAS 30  N  ? ? N LEU 29  N OAS 30  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale117 covale both ? T  OAS 30  C   ? ? ? 1_555 T  GLY 31  N  ? ? N OAS 30  N GLY 31  1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale118 covale none ? U  CYS 11  SG  ? ? ? 1_555 U  CYS 31  SG ? ? P CYS 54  P CYS 74  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale119 covale none ? U  CYS 76  SG  ? ? ? 1_555 U  CYS 89  SG ? ? P CYS 119 P CYS 205 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale120 covale none ? U  CYS 112 SG  ? ? ? 1_555 U  CYS 123 SG ? ? P CYS 228 P CYS 239 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale121 covale one  ? U  ASN 146 ND2 ? ? ? 1_555 TA NAG .   C1 ? ? P ASN 262 P NAG 501 1_555 ? ? ? ? ? ? ? 1.433 ? 
N-Glycosylation 
covale122 covale one  ? U  ASN 173 ND2 ? ? ? 1_555 UA NAG .   C1 ? ? P ASN 289 P NAG 502 1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale123 covale none ? U  CYS 180 SG  ? ? ? 1_555 U  CYS 199 SG ? ? P CYS 296 P CYS 331 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale124 covale none ? U  CYS 245 SG  ? ? ? 1_555 U  CYS 305 SG ? ? P CYS 378 P CYS 445 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale125 covale none ? U  CYS 252 SG  ? ? ? 1_555 U  CYS 278 SG ? ? P CYS 385 P CYS 418 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
covale126 covale both ? V  MPT 1   C   ? ? ? 1_555 V  ASN 2   N  ? ? p MPT 1   p ASN 2   1_555 ? ? ? ? ? ? ? 1.378 ? ? 
covale127 covale none ? V  MPT 1   SG  ? ? ? 1_555 V  CYS 19  SG ? ? p MPT 1   p CYS 19  1_555 ? ? ? ? ? ? ? 2.114 ? ? 
covale128 covale none ? V  CYS 6   SG  ? ? ? 1_555 V  CYS 24  SG ? ? p CYS 6   p CYS 24  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
covale129 covale none ? V  CYS 10  SG  ? ? ? 1_555 V  CYS 26  SG ? ? p CYS 10  p CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
covale130 covale both ? V  ALA 20  C   ? ? ? 1_555 V  DPR 21  N  ? ? p ALA 20  p DPR 21  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale131 covale both ? V  DPR 21  C   ? ? ? 1_555 V  THR 22  N  ? ? p DPR 21  p THR 22  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale132 covale both ? V  THR 22  C   ? ? ? 1_555 V  U2X 23  N  ? ? p THR 22  p U2X 23  1_555 ? ? ? ? ? ? ? 1.342 ? ? 
covale133 covale both ? V  U2X 23  C   ? ? ? 1_555 V  CYS 24  N  ? ? p U2X 23  p CYS 24  1_555 ? ? ? ? ? ? ? 1.313 ? ? 
covale134 covale both ? V  VAL 27  C   ? ? ? 1_555 V  NH2 28  N  ? ? p VAL 27  p NH2 28  1_555 ? ? ? ? ? ? ? 1.429 ? ? 
covale135 covale none ? W  CYS 23  SG  ? ? ? 1_555 W  CYS 88  SG ? ? R CYS 23  R CYS 88  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
covale136 covale none ? W  CYS 133 SG  ? ? ? 1_555 W  CYS 193 SG ? ? R CYS 134 R CYS 194 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
covale137 covale none ? X  CYS 22  SG  ? ? ? 1_555 X  CYS 95  SG ? ? Q CYS 22  Q CYS 92  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
covale138 covale both ? X  LEU 29  C   ? ? ? 1_555 X  OAS 30  N  ? ? Q LEU 29  Q OAS 30  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale139 covale both ? X  OAS 30  C   ? ? ? 1_555 X  GLY 31  N  ? ? Q OAS 30  Q GLY 31  1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale140 covale none ? X  CYS 146 SG  ? ? ? 1_555 X  CYS 202 SG ? ? Q CYS 140 Q CYS 196 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale141 covale none ? Y  CYS 11  SG  ? ? ? 1_555 Y  CYS 31  SG ? ? S CYS 54  S CYS 74  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
covale142 covale none ? Y  CYS 76  SG  ? ? ? 1_555 Y  CYS 89  SG ? ? S CYS 119 S CYS 205 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
covale143 covale none ? Y  CYS 112 SG  ? ? ? 1_555 Y  CYS 123 SG ? ? S CYS 228 S CYS 239 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
covale144 covale one  ? Y  ASN 146 ND2 ? ? ? 1_555 VA NAG .   C1 ? ? S ASN 262 S NAG 501 1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale145 covale one  ? Y  ASN 173 ND2 ? ? ? 1_555 WA NAG .   C1 ? ? S ASN 289 S NAG 502 1_555 ? ? ? ? ? ? ? 1.469 ? 
N-Glycosylation 
covale146 covale none ? Y  CYS 180 SG  ? ? ? 1_555 Y  CYS 199 SG ? ? S CYS 296 S CYS 331 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale147 covale none ? Y  CYS 245 SG  ? ? ? 1_555 Y  CYS 305 SG ? ? S CYS 378 S CYS 445 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale148 covale none ? Y  CYS 252 SG  ? ? ? 1_555 Y  CYS 278 SG ? ? S CYS 385 S CYS 418 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale149 covale one  ? Y  ASN 253 ND2 ? ? ? 1_555 XA NAG .   C1 ? ? S ASN 386 S NAG 503 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale150 covale both ? Z  MPT 1   C   ? ? ? 1_555 Z  ASN 2   N  ? ? s MPT 1   s ASN 2   1_555 ? ? ? ? ? ? ? 1.378 ? ? 
covale151 covale none ? Z  MPT 1   SG  ? ? ? 1_555 Z  CYS 19  SG ? ? s MPT 1   s CYS 19  1_555 ? ? ? ? ? ? ? 2.114 ? ? 
covale152 covale none ? Z  CYS 6   SG  ? ? ? 1_555 Z  CYS 24  SG ? ? s CYS 6   s CYS 24  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
covale153 covale none ? Z  CYS 10  SG  ? ? ? 1_555 Z  CYS 26  SG ? ? s CYS 10  s CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
covale154 covale both ? Z  ALA 20  C   ? ? ? 1_555 Z  DPR 21  N  ? ? s ALA 20  s DPR 21  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale155 covale both ? Z  DPR 21  C   ? ? ? 1_555 Z  THR 22  N  ? ? s DPR 21  s THR 22  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale156 covale both ? Z  THR 22  C   ? ? ? 1_555 Z  U2X 23  N  ? ? s THR 22  s U2X 23  1_555 ? ? ? ? ? ? ? 1.342 ? ? 
covale157 covale both ? Z  U2X 23  C   ? ? ? 1_555 Z  CYS 24  N  ? ? s U2X 23  s CYS 24  1_555 ? ? ? ? ? ? ? 1.314 ? ? 
covale158 covale both ? Z  VAL 27  C   ? ? ? 1_555 Z  NH2 28  N  ? ? s VAL 27  s NH2 28  1_555 ? ? ? ? ? ? ? 1.430 ? ? 
covale159 covale none ? AA CYS 23  SG  ? ? ? 1_555 AA CYS 88  SG ? ? U CYS 23  U CYS 88  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale160 covale none ? AA CYS 133 SG  ? ? ? 1_555 AA CYS 193 SG ? ? U CYS 134 U CYS 194 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
covale161 covale none ? BA CYS 22  SG  ? ? ? 1_555 BA CYS 95  SG ? ? T CYS 22  T CYS 92  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
covale162 covale both ? BA LEU 29  C   ? ? ? 1_555 BA OAS 30  N  ? ? T LEU 29  T OAS 30  1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale163 covale both ? BA OAS 30  C   ? ? ? 1_555 BA GLY 31  N  ? ? T OAS 30  T GLY 31  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale164 covale none ? BA CYS 146 SG  ? ? ? 1_555 BA CYS 202 SG ? ? T CYS 140 T CYS 196 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
covale165 covale none ? CA CYS 11  SG  ? ? ? 1_555 CA CYS 31  SG ? ? V CYS 54  V CYS 74  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale166 covale none ? CA CYS 76  SG  ? ? ? 1_555 CA CYS 89  SG ? ? V CYS 119 V CYS 205 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
covale167 covale none ? CA CYS 112 SG  ? ? ? 1_555 CA CYS 123 SG ? ? V CYS 228 V CYS 239 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale168 covale one  ? CA ASN 146 ND2 ? ? ? 1_555 YA NAG .   C1 ? ? V ASN 262 V NAG 501 1_555 ? ? ? ? ? ? ? 1.437 ? 
N-Glycosylation 
covale169 covale none ? CA CYS 180 SG  ? ? ? 1_555 CA CYS 199 SG ? ? V CYS 296 V CYS 331 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale170 covale none ? CA CYS 245 SG  ? ? ? 1_555 CA CYS 305 SG ? ? V CYS 378 V CYS 445 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale171 covale none ? CA CYS 252 SG  ? ? ? 1_555 CA CYS 278 SG ? ? V CYS 385 V CYS 418 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale172 covale both ? DA MPT 1   C   ? ? ? 1_555 DA ASN 2   N  ? ? v MPT 1   v ASN 2   1_555 ? ? ? ? ? ? ? 1.378 ? ? 
covale173 covale none ? DA MPT 1   SG  ? ? ? 1_555 DA CYS 19  SG ? ? v MPT 1   v CYS 19  1_555 ? ? ? ? ? ? ? 2.114 ? ? 
covale174 covale none ? DA CYS 6   SG  ? ? ? 1_555 DA CYS 24  SG ? ? v CYS 6   v CYS 24  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
covale175 covale none ? DA CYS 10  SG  ? ? ? 1_555 DA CYS 26  SG ? ? v CYS 10  v CYS 26  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
covale176 covale both ? DA ALA 20  C   ? ? ? 1_555 DA DPR 21  N  ? ? v ALA 20  v DPR 21  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale177 covale both ? DA DPR 21  C   ? ? ? 1_555 DA THR 22  N  ? ? v DPR 21  v THR 22  1_555 ? ? ? ? ? ? ? 1.315 ? ? 
covale178 covale both ? DA THR 22  C   ? ? ? 1_555 DA U2X 23  N  ? ? v THR 22  v U2X 23  1_555 ? ? ? ? ? ? ? 1.342 ? ? 
covale179 covale both ? DA U2X 23  C   ? ? ? 1_555 DA CYS 24  N  ? ? v U2X 23  v CYS 24  1_555 ? ? ? ? ? ? ? 1.313 ? ? 
covale180 covale both ? DA VAL 27  C   ? ? ? 1_555 DA NH2 28  N  ? ? v VAL 27  v NH2 28  1_555 ? ? ? ? ? ? ? 1.429 ? ? 
covale181 covale none ? EA CYS 23  SG  ? ? ? 1_555 EA CYS 88  SG ? ? X CYS 23  X CYS 88  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
covale182 covale none ? EA CYS 133 SG  ? ? ? 1_555 EA CYS 193 SG ? ? X CYS 134 X CYS 194 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
covale183 covale none ? FA CYS 22  SG  ? ? ? 1_555 FA CYS 95  SG ? ? W CYS 22  W CYS 92  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
covale184 covale both ? FA LEU 29  C   ? ? ? 1_555 FA OAS 30  N  ? ? W LEU 29  W OAS 30  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale185 covale both ? FA OAS 30  C   ? ? ? 1_555 FA GLY 31  N  ? ? W OAS 30  W GLY 31  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  THR 34  A  . ? THR 77  A ASP 35  A  ? ASP 78  A 1 2.45   
2  SER 37  A  . ? SER 80  A PRO 38  A  ? PRO 81  A 1 -6.53  
3  SER 37  B  . ? SER 80  B PRO 38  B  ? PRO 81  B 1 -7.13  
4  GLU 116 B  . ? GLU 232 B PHE 117 B  ? PHE 233 B 1 -19.88 
5  SER 7   D  . ? SER 7   L PRO 8   D  ? PRO 8   L 1 -4.26  
6  TYR 139 D  . ? TYR 140 L PRO 140 D  ? PRO 141 L 1 2.69   
7  ALA 5   E  . ? ALA 48  I ASN 6   E  ? ASN 49  I 1 3.55   
8  THR 34  E  . ? THR 77  I ASP 35  E  ? ASP 78  I 1 2.52   
9  SER 37  E  . ? SER 80  I PRO 38  E  ? PRO 81  I 1 -1.29  
10 GLU 116 E  . ? GLU 232 I PHE 117 E  ? PHE 233 I 1 -8.95  
11 TRP 101 F  . ? TRP 98  H PRO 102 F  ? PRO 99  H 1 -5.81  
12 ASP 107 F  . ? ASP 101 H PRO 108 F  ? PRO 102 H 1 0.08   
13 PHE 152 F  . ? PHE 146 H PRO 153 F  ? PRO 147 H 1 -3.44  
14 GLU 154 F  . ? GLU 148 H PRO 155 F  ? PRO 149 H 1 -4.49  
15 SER 7   H  . ? SER 7   D PRO 8   H  ? PRO 8   D 1 -4.62  
16 TYR 139 H  . ? TYR 140 D PRO 140 H  ? PRO 141 D 1 1.91   
17 TRP 101 I  . ? TRP 98  C PRO 102 I  ? PRO 99  C 1 2.57   
18 LEU 104 I  . A LEU 100 C PRO 105 I  B PRO 100 C 1 0.69   
19 ASP 107 I  . ? ASP 101 C PRO 108 I  ? PRO 102 C 1 -0.84  
20 PHE 152 I  . ? PHE 146 C PRO 153 I  ? PRO 147 C 1 -3.45  
21 GLU 154 I  . ? GLU 148 C PRO 155 I  ? PRO 149 C 1 -4.65  
22 THR 34  J  . ? THR 77  E ASP 35  J  ? ASP 78  E 1 4.70   
23 SER 37  J  . ? SER 80  E PRO 38  J  ? PRO 81  E 1 -3.65  
24 GLU 116 J  . ? GLU 232 E PHE 117 J  ? PHE 233 E 1 -11.29 
25 SER 7   L  . ? SER 7   G PRO 8   L  ? PRO 8   G 1 -4.02  
26 TYR 139 L  . ? TYR 140 G PRO 140 L  ? PRO 141 G 1 7.45   
27 TRP 101 M  . ? TRP 98  F PRO 102 M  ? PRO 99  F 1 7.60   
28 LEU 104 M  . A LEU 100 F PRO 105 M  B PRO 100 F 1 -2.72  
29 ASP 107 M  . ? ASP 101 F PRO 108 M  ? PRO 102 F 1 -1.36  
30 PHE 152 M  . ? PHE 146 F PRO 153 M  ? PRO 147 F 1 -3.63  
31 GLU 154 M  . ? GLU 148 F PRO 155 M  ? PRO 149 F 1 -4.19  
32 SER 7   O  . ? SER 7   K PRO 8   O  ? PRO 8   K 1 -4.14  
33 TYR 139 O  . ? TYR 140 K PRO 140 O  ? PRO 141 K 1 2.13   
34 TRP 101 P  . ? TRP 98  J PRO 102 P  ? PRO 99  J 1 3.45   
35 LEU 104 P  . A LEU 100 J PRO 105 P  B PRO 100 J 1 -5.16  
36 ASP 107 P  . ? ASP 101 J PRO 108 P  ? PRO 102 J 1 -0.94  
37 PHE 152 P  . ? PHE 146 J PRO 153 P  ? PRO 147 J 1 -3.44  
38 GLU 154 P  . ? GLU 148 J PRO 155 P  ? PRO 149 J 1 -4.76  
39 THR 34  Q  . ? THR 77  M ASP 35  Q  ? ASP 78  M 1 5.30   
40 SER 37  Q  . ? SER 80  M PRO 38  Q  ? PRO 81  M 1 -4.22  
41 GLU 116 Q  . ? GLU 232 M PHE 117 Q  ? PHE 233 M 1 -16.14 
42 SER 7   S  . ? SER 7   O PRO 8   S  ? PRO 8   O 1 -4.58  
43 TYR 139 S  . ? TYR 140 O PRO 140 S  ? PRO 141 O 1 1.30   
44 TRP 101 T  . ? TRP 98  N PRO 102 T  ? PRO 99  N 1 0.60   
45 ASP 107 T  . ? ASP 101 N PRO 108 T  ? PRO 102 N 1 16.28  
46 PHE 152 T  . ? PHE 146 N PRO 153 T  ? PRO 147 N 1 -2.91  
47 GLU 154 T  . ? GLU 148 N PRO 155 T  ? PRO 149 N 1 -5.61  
48 THR 34  U  . ? THR 77  P ASP 35  U  ? ASP 78  P 1 0.97   
49 SER 37  U  . ? SER 80  P PRO 38  U  ? PRO 81  P 1 -3.72  
50 GLU 116 U  . ? GLU 232 P PHE 117 U  ? PHE 233 P 1 -17.96 
51 SER 7   W  . ? SER 7   R PRO 8   W  ? PRO 8   R 1 -4.14  
52 TYR 139 W  . ? TYR 140 R PRO 140 W  ? PRO 141 R 1 0.76   
53 TRP 101 X  . ? TRP 98  Q PRO 102 X  ? PRO 99  Q 1 -2.51  
54 ASP 107 X  . ? ASP 101 Q PRO 108 X  ? PRO 102 Q 1 -0.10  
55 PHE 152 X  . ? PHE 146 Q PRO 153 X  ? PRO 147 Q 1 -3.02  
56 GLU 154 X  . ? GLU 148 Q PRO 155 X  ? PRO 149 Q 1 -4.29  
57 THR 34  Y  . ? THR 77  S ASP 35  Y  ? ASP 78  S 1 5.73   
58 SER 37  Y  . ? SER 80  S PRO 38  Y  ? PRO 81  S 1 -9.72  
59 GLU 116 Y  . ? GLU 232 S PHE 117 Y  ? PHE 233 S 1 -16.82 
60 SER 7   AA . ? SER 7   U PRO 8   AA ? PRO 8   U 1 -4.36  
61 TYR 139 AA . ? TYR 140 U PRO 140 AA ? PRO 141 U 1 0.19   
62 TRP 101 BA . ? TRP 98  T PRO 102 BA ? PRO 99  T 1 4.18   
63 LEU 104 BA . A LEU 100 T PRO 105 BA B PRO 100 T 1 1.45   
64 ASP 107 BA . ? ASP 101 T PRO 108 BA ? PRO 102 T 1 9.10   
65 PHE 152 BA . ? PHE 146 T PRO 153 BA ? PRO 147 T 1 -3.51  
66 GLU 154 BA . ? GLU 148 T PRO 155 BA ? PRO 149 T 1 -4.38  
67 THR 34  CA . ? THR 77  V ASP 35  CA ? ASP 78  V 1 5.42   
68 SER 37  CA . ? SER 80  V PRO 38  CA ? PRO 81  V 1 -3.87  
69 GLU 116 CA . ? GLU 232 V PHE 117 CA ? PHE 233 V 1 -15.35 
70 SER 7   EA . ? SER 7   X PRO 8   EA ? PRO 8   X 1 -4.71  
71 TYR 139 EA . ? TYR 140 X PRO 140 EA ? PRO 141 X 1 0.54   
72 TRP 101 FA . ? TRP 98  W PRO 102 FA ? PRO 99  W 1 0.64   
73 ASP 107 FA . ? ASP 101 W PRO 108 FA ? PRO 102 W 1 -0.18  
74 PHE 152 FA . ? PHE 146 W PRO 153 FA ? PRO 147 W 1 -2.79  
75 GLU 154 FA . ? GLU 148 W PRO 155 FA ? PRO 149 W 1 -5.89  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 2 ? 
B  ? 2 ? 
C  ? 8 ? 
D  ? 3 ? 
E  ? 7 ? 
F  ? 4 ? 
G  ? 2 ? 
H  ? 8 ? 
I  ? 3 ? 
J  ? 7 ? 
K  ? 4 ? 
L  ? 2 ? 
M  ? 2 ? 
N  ? 4 ? 
O  ? 3 ? 
P  ? 7 ? 
Q  ? 4 ? 
R  ? 3 ? 
S  ? 4 ? 
T  ? 2 ? 
U  ? 8 ? 
V  ? 6 ? 
W  ? 4 ? 
X  ? 2 ? 
Y  ? 2 ? 
Z  ? 3 ? 
AA ? 7 ? 
AB ? 4 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 3 ? 
AF ? 7 ? 
AG ? 4 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 4 ? 
AK ? 3 ? 
AL ? 7 ? 
AM ? 4 ? 
AN ? 2 ? 
AO ? 2 ? 
AP ? 3 ? 
AQ ? 7 ? 
AR ? 4 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 2 ? 
AV ? 2 ? 
AW ? 2 ? 
AX ? 2 ? 
AY ? 2 ? 
AZ ? 2 ? 
BA ? 4 ? 
BB ? 6 ? 
BC ? 4 ? 
BD ? 3 ? 
BE ? 4 ? 
BF ? 6 ? 
BG ? 4 ? 
BH ? 3 ? 
BI ? 4 ? 
BJ ? 6 ? 
BK ? 4 ? 
BL ? 3 ? 
BM ? 4 ? 
BN ? 6 ? 
BO ? 4 ? 
BP ? 3 ? 
BQ ? 4 ? 
BR ? 6 ? 
BS ? 4 ? 
BT ? 3 ? 
BU ? 4 ? 
BV ? 6 ? 
BW ? 4 ? 
BX ? 3 ? 
BY ? 4 ? 
BZ ? 6 ? 
CA ? 4 ? 
CB ? 3 ? 
CC ? 4 ? 
CD ? 6 ? 
CE ? 4 ? 
CF ? 3 ? 
CG ? 4 ? 
CH ? 6 ? 
CI ? 4 ? 
CJ ? 4 ? 
CK ? 3 ? 
CL ? 4 ? 
CM ? 6 ? 
CN ? 4 ? 
CO ? 4 ? 
CP ? 3 ? 
CQ ? 3 ? 
CR ? 4 ? 
CS ? 6 ? 
CT ? 4 ? 
CU ? 4 ? 
CV ? 4 ? 
CW ? 6 ? 
CX ? 4 ? 
CY ? 6 ? 
CZ ? 4 ? 
DA ? 4 ? 
DB ? 4 ? 
DC ? 3 ? 
DD ? 4 ? 
DE ? 6 ? 
DF ? 4 ? 
DG ? 4 ? 
DH ? 3 ? 
DI ? 4 ? 
DJ ? 5 ? 
DK ? 4 ? 
DL ? 4 ? 
DM ? 3 ? 
DN ? 4 ? 
DO ? 6 ? 
DP ? 4 ? 
DQ ? 4 ? 
DR ? 4 ? 
DS ? 4 ? 
DT ? 6 ? 
DU ? 4 ? 
DV ? 4 ? 
DW ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
C  4 5 ? anti-parallel 
C  5 6 ? anti-parallel 
C  6 7 ? anti-parallel 
C  7 8 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
E  5 6 ? anti-parallel 
E  6 7 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
H  5 6 ? anti-parallel 
H  6 7 ? anti-parallel 
H  7 8 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
J  4 5 ? anti-parallel 
J  5 6 ? anti-parallel 
J  6 7 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
P  4 5 ? anti-parallel 
P  5 6 ? anti-parallel 
P  6 7 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? parallel      
R  2 3 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
U  4 5 ? anti-parallel 
U  5 6 ? anti-parallel 
U  6 7 ? anti-parallel 
U  7 8 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
V  4 5 ? anti-parallel 
V  5 6 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AF 6 7 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AL 4 5 ? anti-parallel 
AL 5 6 ? anti-parallel 
AL 6 7 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AQ 4 5 ? anti-parallel 
AQ 5 6 ? anti-parallel 
AQ 6 7 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AS 1 2 ? anti-parallel 
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
AW 1 2 ? anti-parallel 
AX 1 2 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? parallel      
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BB 5 6 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BF 1 2 ? parallel      
BF 2 3 ? anti-parallel 
BF 3 4 ? anti-parallel 
BF 4 5 ? anti-parallel 
BF 5 6 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BI 3 4 ? anti-parallel 
BJ 1 2 ? parallel      
BJ 2 3 ? anti-parallel 
BJ 3 4 ? anti-parallel 
BJ 4 5 ? anti-parallel 
BJ 5 6 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? anti-parallel 
BK 3 4 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BM 1 2 ? anti-parallel 
BM 2 3 ? anti-parallel 
BM 3 4 ? anti-parallel 
BN 1 2 ? parallel      
BN 2 3 ? anti-parallel 
BN 3 4 ? anti-parallel 
BN 4 5 ? anti-parallel 
BN 5 6 ? anti-parallel 
BO 1 2 ? anti-parallel 
BO 2 3 ? anti-parallel 
BO 3 4 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BQ 2 3 ? anti-parallel 
BQ 3 4 ? anti-parallel 
BR 1 2 ? parallel      
BR 2 3 ? anti-parallel 
BR 3 4 ? anti-parallel 
BR 4 5 ? anti-parallel 
BR 5 6 ? anti-parallel 
BS 1 2 ? anti-parallel 
BS 2 3 ? anti-parallel 
BS 3 4 ? anti-parallel 
BT 1 2 ? anti-parallel 
BT 2 3 ? anti-parallel 
BU 1 2 ? anti-parallel 
BU 2 3 ? anti-parallel 
BU 3 4 ? anti-parallel 
BV 1 2 ? parallel      
BV 2 3 ? anti-parallel 
BV 3 4 ? anti-parallel 
BV 4 5 ? anti-parallel 
BV 5 6 ? anti-parallel 
BW 1 2 ? anti-parallel 
BW 2 3 ? anti-parallel 
BW 3 4 ? anti-parallel 
BX 1 2 ? anti-parallel 
BX 2 3 ? anti-parallel 
BY 1 2 ? anti-parallel 
BY 2 3 ? anti-parallel 
BY 3 4 ? anti-parallel 
BZ 1 2 ? parallel      
BZ 2 3 ? anti-parallel 
BZ 3 4 ? anti-parallel 
BZ 4 5 ? anti-parallel 
BZ 5 6 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
CC 3 4 ? anti-parallel 
CD 1 2 ? parallel      
CD 2 3 ? anti-parallel 
CD 3 4 ? anti-parallel 
CD 4 5 ? anti-parallel 
CD 5 6 ? anti-parallel 
CE 1 2 ? anti-parallel 
CE 2 3 ? anti-parallel 
CE 3 4 ? anti-parallel 
CF 1 2 ? anti-parallel 
CF 2 3 ? anti-parallel 
CG 1 2 ? anti-parallel 
CG 2 3 ? anti-parallel 
CG 3 4 ? anti-parallel 
CH 1 2 ? parallel      
CH 2 3 ? anti-parallel 
CH 3 4 ? anti-parallel 
CH 4 5 ? anti-parallel 
CH 5 6 ? anti-parallel 
CI 1 2 ? anti-parallel 
CI 2 3 ? anti-parallel 
CI 3 4 ? anti-parallel 
CJ 1 2 ? anti-parallel 
CJ 2 3 ? anti-parallel 
CJ 3 4 ? anti-parallel 
CK 1 2 ? anti-parallel 
CK 2 3 ? anti-parallel 
CL 1 2 ? anti-parallel 
CL 2 3 ? anti-parallel 
CL 3 4 ? anti-parallel 
CM 1 2 ? parallel      
CM 2 3 ? anti-parallel 
CM 3 4 ? anti-parallel 
CM 4 5 ? anti-parallel 
CM 5 6 ? anti-parallel 
CN 1 2 ? parallel      
CN 2 3 ? anti-parallel 
CN 3 4 ? anti-parallel 
CO 1 2 ? anti-parallel 
CO 2 3 ? anti-parallel 
CO 3 4 ? anti-parallel 
CP 1 2 ? anti-parallel 
CP 2 3 ? anti-parallel 
CQ 1 2 ? anti-parallel 
CQ 2 3 ? anti-parallel 
CR 1 2 ? anti-parallel 
CR 2 3 ? anti-parallel 
CR 3 4 ? anti-parallel 
CS 1 2 ? parallel      
CS 2 3 ? anti-parallel 
CS 3 4 ? anti-parallel 
CS 4 5 ? anti-parallel 
CS 5 6 ? anti-parallel 
CT 1 2 ? parallel      
CT 2 3 ? anti-parallel 
CT 3 4 ? anti-parallel 
CU 1 2 ? anti-parallel 
CU 2 3 ? anti-parallel 
CU 3 4 ? anti-parallel 
CV 1 2 ? anti-parallel 
CV 2 3 ? anti-parallel 
CV 3 4 ? anti-parallel 
CW 1 2 ? anti-parallel 
CW 2 3 ? anti-parallel 
CW 3 4 ? anti-parallel 
CW 4 5 ? anti-parallel 
CW 5 6 ? anti-parallel 
CX 1 2 ? anti-parallel 
CX 2 3 ? anti-parallel 
CX 3 4 ? anti-parallel 
CY 1 2 ? parallel      
CY 2 3 ? anti-parallel 
CY 3 4 ? anti-parallel 
CY 4 5 ? anti-parallel 
CY 5 6 ? anti-parallel 
CZ 1 2 ? parallel      
CZ 2 3 ? anti-parallel 
CZ 3 4 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? anti-parallel 
DC 1 2 ? anti-parallel 
DC 2 3 ? anti-parallel 
DD 1 2 ? anti-parallel 
DD 2 3 ? anti-parallel 
DD 3 4 ? anti-parallel 
DE 1 2 ? parallel      
DE 2 3 ? anti-parallel 
DE 3 4 ? anti-parallel 
DE 4 5 ? anti-parallel 
DE 5 6 ? anti-parallel 
DF 1 2 ? anti-parallel 
DF 2 3 ? anti-parallel 
DF 3 4 ? anti-parallel 
DG 1 2 ? anti-parallel 
DG 2 3 ? anti-parallel 
DG 3 4 ? anti-parallel 
DH 1 2 ? anti-parallel 
DH 2 3 ? anti-parallel 
DI 1 2 ? anti-parallel 
DI 2 3 ? anti-parallel 
DI 3 4 ? anti-parallel 
DJ 1 2 ? parallel      
DJ 2 3 ? anti-parallel 
DJ 3 4 ? anti-parallel 
DJ 4 5 ? anti-parallel 
DK 1 2 ? anti-parallel 
DK 2 3 ? anti-parallel 
DK 3 4 ? anti-parallel 
DL 1 2 ? anti-parallel 
DL 2 3 ? anti-parallel 
DL 3 4 ? anti-parallel 
DM 1 2 ? anti-parallel 
DM 2 3 ? anti-parallel 
DN 1 2 ? anti-parallel 
DN 2 3 ? anti-parallel 
DN 3 4 ? anti-parallel 
DO 1 2 ? parallel      
DO 2 3 ? anti-parallel 
DO 3 4 ? anti-parallel 
DO 4 5 ? anti-parallel 
DO 5 6 ? anti-parallel 
DP 1 2 ? parallel      
DP 2 3 ? anti-parallel 
DP 3 4 ? anti-parallel 
DQ 1 2 ? anti-parallel 
DQ 2 3 ? anti-parallel 
DQ 3 4 ? anti-parallel 
DR 1 2 ? anti-parallel 
DR 2 3 ? anti-parallel 
DR 3 4 ? anti-parallel 
DS 1 2 ? anti-parallel 
DS 2 3 ? anti-parallel 
DS 3 4 ? anti-parallel 
DT 1 2 ? parallel      
DT 2 3 ? anti-parallel 
DT 3 4 ? anti-parallel 
DT 4 5 ? anti-parallel 
DT 5 6 ? anti-parallel 
DU 1 2 ? anti-parallel 
DU 2 3 ? anti-parallel 
DU 3 4 ? anti-parallel 
DV 1 2 ? anti-parallel 
DV 2 3 ? anti-parallel 
DV 3 4 ? anti-parallel 
DW 1 2 ? anti-parallel 
DW 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 PHE A  10  ? ALA A  12  ? PHE A 53  ALA A 55  
A  2 HIS A  100 ? CYS A  102 ? HIS A 216 CYS A 218 
B  1 GLU A  48  ? ASN A  51  ? GLU A 91  ASN A 94  
B  2 THR A  120 ? CYS A  123 ? THR A 236 CYS A 239 
C  1 ILE A  283 ? ASN A  285 ? ILE A 423 ASN A 425 
C  2 GLN A  292 ? ILE A  294 ? GLN A 432 ILE A 434 
C  3 VAL A  77  ? THR A  80  ? VAL A 120 THR A 123 
C  4 SER A  83  ? THR A  86  ? SER A 199 THR A 202 
C  5 SER Q  83  ? THR Q  86  ? SER M 199 THR M 202 
C  6 VAL Q  77  ? THR Q  80  ? VAL M 120 THR M 123 
C  7 GLN Q  292 ? ILE Q  294 ? GLN M 432 ILE M 434 
C  8 ILE Q  283 ? ASN Q  285 ? ILE M 423 ASN M 425 
D  1 VAL A  126 ? VAL A  129 ? VAL A 242 VAL A 245 
D  2 TYR A  107 ? CYS A  112 ? TYR A 223 CYS A 228 
D  3 TYR A  346 ? LYS A  350 ? TYR A 486 LYS A 490 
E  1 LEU A  143 ? LEU A  145 ? LEU A 259 LEU A 261 
E  2 ILE A  303 ? ARG A  316 ? ILE A 443 ARG A 456 
E  3 ILE A  168 ? ARG A  182 ? ILE A 284 ARG A 298 
E  4 GLN A  196 ? SER A  202 ? GLN A 328 SER A 334 
E  5 THR A  273 ? ILE A  280 ? THR A 413 ILE A 420 
E  6 GLU A  248 ? CYS A  252 ? GLU A 381 CYS A 385 
E  7 HIS A  241 ? CYS A  245 ? HIS A 374 CYS A 378 
F  1 MET A  155 ? ARG A  157 ? MET A 271 ARG A 273 
F  2 ILE A  168 ? ARG A  182 ? ILE A 284 ARG A 298 
F  3 ILE A  303 ? ARG A  316 ? ILE A 443 ARG A 456 
F  4 PHE A  328 ? PRO A  330 ? PHE A 468 PRO A 470 
G  1 GLU B  48  ? ASN B  51  ? GLU B 91  ASN B 94  
G  2 THR B  120 ? CYS B  123 ? THR B 236 CYS B 239 
H  1 ILE B  283 ? ASN B  285 ? ILE B 423 ASN B 425 
H  2 GLN B  292 ? ILE B  294 ? GLN B 432 ILE B 434 
H  3 VAL B  77  ? THR B  80  ? VAL B 120 THR B 123 
H  4 SER B  83  ? THR B  86  ? SER B 199 THR B 202 
H  5 SER U  83  ? THR U  86  ? SER P 199 THR P 202 
H  6 VAL U  77  ? THR U  80  ? VAL P 120 THR P 123 
H  7 GLN U  292 ? ILE U  294 ? GLN P 432 ILE P 434 
H  8 ILE U  283 ? ASN U  285 ? ILE P 423 ASN P 425 
I  1 VAL B  126 ? VAL B  129 ? VAL B 242 VAL B 245 
I  2 TYR B  107 ? CYS B  112 ? TYR B 223 CYS B 228 
I  3 TYR B  346 ? LYS B  350 ? TYR B 486 LYS B 490 
J  1 LEU B  143 ? LEU B  145 ? LEU B 259 LEU B 261 
J  2 ILE B  303 ? ARG B  316 ? ILE B 443 ARG B 456 
J  3 ILE B  168 ? ARG B  182 ? ILE B 284 ARG B 298 
J  4 GLN B  196 ? SER B  202 ? GLN B 328 SER B 334 
J  5 THR B  273 ? ILE B  280 ? THR B 413 ILE B 420 
J  6 PHE B  250 ? CYS B  252 ? PHE B 383 CYS B 385 
J  7 HIS B  241 ? PHE B  243 ? HIS B 374 PHE B 376 
K  1 MET B  155 ? ARG B  157 ? MET B 271 ARG B 273 
K  2 ILE B  168 ? ARG B  182 ? ILE B 284 ARG B 298 
K  3 ILE B  303 ? ARG B  316 ? ILE B 443 ARG B 456 
K  4 PHE B  328 ? PRO B  330 ? PHE B 468 PRO B 470 
L  1 PHE J  10  ? ALA J  12  ? PHE E 53  ALA E 55  
L  2 HIS J  100 ? CYS J  102 ? HIS E 216 CYS E 218 
M  1 GLU J  48  ? ASN J  51  ? GLU E 91  ASN E 94  
M  2 THR J  120 ? CYS J  123 ? THR E 236 CYS E 239 
N  1 SER J  83  ? THR J  86  ? SER E 199 THR E 202 
N  2 VAL J  77  ? THR J  80  ? VAL E 120 THR E 123 
N  3 GLN J  292 ? ILE J  294 ? GLN E 432 ILE E 434 
N  4 ILE J  283 ? ASN J  285 ? ILE E 423 ASN E 425 
O  1 VAL J  126 ? VAL J  129 ? VAL E 242 VAL E 245 
O  2 TYR J  107 ? CYS J  112 ? TYR E 223 CYS E 228 
O  3 TYR J  346 ? LYS J  350 ? TYR E 486 LYS E 490 
P  1 LEU J  143 ? LEU J  145 ? LEU E 259 LEU E 261 
P  2 ILE J  303 ? ARG J  316 ? ILE E 443 ARG E 456 
P  3 ILE J  168 ? ARG J  182 ? ILE E 284 ARG E 298 
P  4 GLN J  196 ? ASN J  200 ? GLN E 328 ASN E 332 
P  5 LEU J  276 ? ILE J  280 ? LEU E 416 ILE E 420 
P  6 PHE J  250 ? CYS J  252 ? PHE E 383 CYS E 385 
P  7 SER J  242 ? PHE J  243 ? SER E 375 PHE E 376 
Q  1 MET J  155 ? ARG J  157 ? MET E 271 ARG E 273 
Q  2 ILE J  168 ? ARG J  182 ? ILE E 284 ARG E 298 
Q  3 ILE J  303 ? ARG J  316 ? ILE E 443 ARG E 456 
Q  4 PHE J  328 ? PRO J  330 ? PHE E 468 PRO E 470 
R  1 CYS E  31  ? VAL E  32  ? CYS I 74  VAL I 75  
R  2 PHE E  10  ? ALA E  12  ? PHE I 53  ALA I 55  
R  3 HIS E  100 ? CYS E  102 ? HIS I 216 CYS I 218 
S  1 LEU E  41  ? LYS E  42  ? LEU I 84  LYS I 85  
S  2 VAL E  126 ? VAL E  129 ? VAL I 242 VAL I 245 
S  3 TYR E  107 ? CYS E  112 ? TYR I 223 CYS I 228 
S  4 TYR E  346 ? LYS E  350 ? TYR I 486 LYS I 490 
T  1 PHE E  50  ? ASN E  51  ? PHE I 93  ASN I 94  
T  2 THR E  120 ? GLY E  121 ? THR I 236 GLY I 237 
U  1 ILE E  283 ? ILE E  284 ? ILE I 423 ILE I 424 
U  2 GLN E  292 ? ILE E  294 ? GLN I 432 ILE I 434 
U  3 VAL E  77  ? THR E  80  ? VAL I 120 THR I 123 
U  4 SER E  83  ? THR E  86  ? SER I 199 THR I 202 
U  5 SER CA 83  ? THR CA 86  ? SER V 199 THR V 202 
U  6 VAL CA 77  ? THR CA 80  ? VAL V 120 THR V 123 
U  7 GLN CA 292 ? ILE CA 294 ? GLN V 432 ILE V 434 
U  8 ILE CA 283 ? ASN CA 285 ? ILE V 423 ASN V 425 
V  1 LEU E  143 ? LEU E  145 ? LEU I 259 LEU I 261 
V  2 ILE E  303 ? ARG E  316 ? ILE I 443 ARG I 456 
V  3 ILE E  168 ? ARG E  182 ? ILE I 284 ARG I 298 
V  4 ALA E  197 ? ASN E  200 ? ALA I 329 ASN I 332 
V  5 LEU E  276 ? ILE E  280 ? LEU I 416 ILE I 420 
V  6 PHE E  250 ? CYS E  252 ? PHE I 383 CYS I 385 
W  1 MET E  155 ? ARG E  157 ? MET I 271 ARG I 273 
W  2 ILE E  168 ? ARG E  182 ? ILE I 284 ARG I 298 
W  3 ILE E  303 ? ARG E  316 ? ILE I 443 ARG I 456 
W  4 PHE E  328 ? PRO E  330 ? PHE I 468 PRO I 470 
X  1 PHE Q  10  ? SER Q  13  ? PHE M 53  SER M 56  
X  2 ILE Q  99  ? CYS Q  102 ? ILE M 215 CYS M 218 
Y  1 GLU Q  48  ? ASN Q  51  ? GLU M 91  ASN M 94  
Y  2 THR Q  120 ? CYS Q  123 ? THR M 236 CYS M 239 
Z  1 VAL Q  126 ? VAL Q  129 ? VAL M 242 VAL M 245 
Z  2 TYR Q  107 ? CYS Q  112 ? TYR M 223 CYS M 228 
Z  3 TYR Q  346 ? LYS Q  350 ? TYR M 486 LYS M 490 
AA 1 LEU Q  143 ? LEU Q  145 ? LEU M 259 LEU M 261 
AA 2 ILE Q  303 ? ARG Q  316 ? ILE M 443 ARG M 456 
AA 3 ILE Q  168 ? ARG Q  182 ? ILE M 284 ARG M 298 
AA 4 GLN Q  196 ? SER Q  202 ? GLN M 328 SER M 334 
AA 5 THR Q  273 ? ILE Q  280 ? THR M 413 ILE M 420 
AA 6 PHE Q  250 ? CYS Q  252 ? PHE M 383 CYS M 385 
AA 7 HIS Q  241 ? PHE Q  243 ? HIS M 374 PHE M 376 
AB 1 MET Q  155 ? ARG Q  157 ? MET M 271 ARG M 273 
AB 2 ILE Q  168 ? ARG Q  182 ? ILE M 284 ARG M 298 
AB 3 ILE Q  303 ? ARG Q  316 ? ILE M 443 ARG M 456 
AB 4 PHE Q  328 ? PRO Q  330 ? PHE M 468 PRO M 470 
AC 1 PHE U  10  ? ALA U  12  ? PHE P 53  ALA P 55  
AC 2 HIS U  100 ? CYS U  102 ? HIS P 216 CYS P 218 
AD 1 GLU U  48  ? ASN U  51  ? GLU P 91  ASN P 94  
AD 2 THR U  120 ? CYS U  123 ? THR P 236 CYS P 239 
AE 1 VAL U  126 ? VAL U  129 ? VAL P 242 VAL P 245 
AE 2 TYR U  107 ? CYS U  112 ? TYR P 223 CYS P 228 
AE 3 TYR U  346 ? LYS U  350 ? TYR P 486 LYS P 490 
AF 1 LEU U  143 ? LEU U  145 ? LEU P 259 LEU P 261 
AF 2 ILE U  303 ? ARG U  316 ? ILE P 443 ARG P 456 
AF 3 ILE U  168 ? ARG U  182 ? ILE P 284 ARG P 298 
AF 4 GLN U  196 ? SER U  202 ? GLN P 328 SER P 334 
AF 5 THR U  273 ? ILE U  280 ? THR P 413 ILE P 420 
AF 6 PHE U  250 ? CYS U  252 ? PHE P 383 CYS P 385 
AF 7 HIS U  241 ? PHE U  243 ? HIS P 374 PHE P 376 
AG 1 MET U  155 ? ARG U  157 ? MET P 271 ARG P 273 
AG 2 ILE U  168 ? ARG U  182 ? ILE P 284 ARG P 298 
AG 3 ILE U  303 ? ARG U  316 ? ILE P 443 ARG P 456 
AG 4 PHE U  328 ? PRO U  330 ? PHE P 468 PRO P 470 
AH 1 PHE Y  10  ? ALA Y  12  ? PHE S 53  ALA S 55  
AH 2 HIS Y  100 ? CYS Y  102 ? HIS S 216 CYS S 218 
AI 1 GLU Y  48  ? ASN Y  51  ? GLU S 91  ASN S 94  
AI 2 THR Y  120 ? CYS Y  123 ? THR S 236 CYS S 239 
AJ 1 SER Y  83  ? THR Y  86  ? SER S 199 THR S 202 
AJ 2 VAL Y  77  ? THR Y  80  ? VAL S 120 THR S 123 
AJ 3 GLN Y  292 ? ILE Y  294 ? GLN S 432 ILE S 434 
AJ 4 ILE Y  283 ? ASN Y  285 ? ILE S 423 ASN S 425 
AK 1 VAL Y  126 ? VAL Y  129 ? VAL S 242 VAL S 245 
AK 2 TYR Y  107 ? CYS Y  112 ? TYR S 223 CYS S 228 
AK 3 TYR Y  346 ? LYS Y  350 ? TYR S 486 LYS S 490 
AL 1 LEU Y  143 ? LEU Y  145 ? LEU S 259 LEU S 261 
AL 2 ILE Y  303 ? ARG Y  316 ? ILE S 443 ARG S 456 
AL 3 ILE Y  168 ? ARG Y  182 ? ILE S 284 ARG S 298 
AL 4 GLN Y  196 ? SER Y  202 ? GLN S 328 SER S 334 
AL 5 THR Y  273 ? ILE Y  280 ? THR S 413 ILE S 420 
AL 6 GLU Y  248 ? CYS Y  252 ? GLU S 381 CYS S 385 
AL 7 HIS Y  241 ? CYS Y  245 ? HIS S 374 CYS S 378 
AM 1 MET Y  155 ? ARG Y  157 ? MET S 271 ARG S 273 
AM 2 ILE Y  168 ? ARG Y  182 ? ILE S 284 ARG S 298 
AM 3 ILE Y  303 ? ARG Y  316 ? ILE S 443 ARG S 456 
AM 4 PHE Y  328 ? PRO Y  330 ? PHE S 468 PRO S 470 
AN 1 PHE CA 10  ? SER CA 13  ? PHE V 53  SER V 56  
AN 2 ILE CA 99  ? CYS CA 102 ? ILE V 215 CYS V 218 
AO 1 GLU CA 48  ? ASN CA 51  ? GLU V 91  ASN V 94  
AO 2 THR CA 120 ? CYS CA 123 ? THR V 236 CYS V 239 
AP 1 VAL CA 126 ? VAL CA 129 ? VAL V 242 VAL V 245 
AP 2 TYR CA 107 ? CYS CA 112 ? TYR V 223 CYS V 228 
AP 3 TYR CA 346 ? LYS CA 350 ? TYR V 486 LYS V 490 
AQ 1 LEU CA 143 ? LEU CA 145 ? LEU V 259 LEU V 261 
AQ 2 ILE CA 303 ? ARG CA 316 ? ILE V 443 ARG V 456 
AQ 3 ILE CA 168 ? ARG CA 182 ? ILE V 284 ARG V 298 
AQ 4 GLN CA 196 ? SER CA 202 ? GLN V 328 SER V 334 
AQ 5 THR CA 273 ? ILE CA 280 ? THR V 413 ILE V 420 
AQ 6 GLU CA 248 ? CYS CA 252 ? GLU V 381 CYS V 385 
AQ 7 HIS CA 241 ? CYS CA 245 ? HIS V 374 CYS V 378 
AR 1 MET CA 155 ? ARG CA 157 ? MET V 271 ARG V 273 
AR 2 ILE CA 168 ? ARG CA 182 ? ILE V 284 ARG V 298 
AR 3 ILE CA 303 ? ARG CA 316 ? ILE V 443 ARG V 456 
AR 4 PHE CA 328 ? PRO CA 330 ? PHE V 468 PRO V 470 
AS 1 GLY C  17  ? ALA C  20  ? GLY a 17  ALA a 20  
AS 2 U2X C  23  ? CYS C  26  ? U2X a 23  CYS a 26  
AT 1 GLY G  17  ? ALA G  20  ? GLY b 17  ALA b 20  
AT 2 U2X G  23  ? CYS G  26  ? U2X b 23  CYS b 26  
AU 1 GLY K  17  ? ALA K  20  ? GLY e 17  ALA e 20  
AU 2 U2X K  23  ? CYS K  26  ? U2X e 23  CYS e 26  
AV 1 GLY N  17  ? ALA N  20  ? GLY i 17  ALA i 20  
AV 2 U2X N  23  ? CYS N  26  ? U2X i 23  CYS i 26  
AW 1 GLY R  17  ? ALA R  20  ? GLY m 17  ALA m 20  
AW 2 U2X R  23  ? CYS R  26  ? U2X m 23  CYS m 26  
AX 1 GLY V  17  ? ALA V  20  ? GLY p 17  ALA p 20  
AX 2 U2X V  23  ? CYS V  26  ? U2X p 23  CYS p 26  
AY 1 GLY Z  17  ? ALA Z  20  ? GLY s 17  ALA s 20  
AY 2 U2X Z  23  ? CYS Z  26  ? U2X s 23  CYS s 26  
AZ 1 GLY DA 17  ? ALA DA 20  ? GLY v 17  ALA v 20  
AZ 2 U2X DA 23  ? CYS DA 26  ? U2X v 23  CYS v 26  
BA 1 MET D  4   ? SER D  7   ? MET L 4   SER L 7   
BA 2 VAL D  19  ? ALA D  25  ? VAL L 19  ALA L 25  
BA 3 GLU D  70  ? ILE D  75  ? GLU L 70  ILE L 75  
BA 4 PHE D  62  ? SER D  67  ? PHE L 62  SER L 67  
BB 1 PHE D  10  ? ALA D  13  ? PHE L 10  ALA L 13  
BB 2 THR D  101 ? ILE D  105 ? THR L 102 ILE L 106 
BB 3 THR D  85  ? HIS D  90  ? THR L 85  HIS L 90  
BB 4 LEU D  33  ? GLN D  38  ? LEU L 33  GLN L 38  
BB 5 LYS D  45  ? TYR D  49  ? LYS L 45  TYR L 49  
BB 6 THR D  53  ? LEU D  54  ? THR L 53  LEU L 54  
BC 1 SER D  113 ? PHE D  117 ? SER L 114 PHE L 118 
BC 2 THR D  128 ? PHE D  138 ? THR L 129 PHE L 139 
BC 3 TYR D  172 ? SER D  181 ? TYR L 173 SER L 182 
BC 4 SER D  158 ? VAL D  162 ? SER L 159 VAL L 163 
BD 1 LYS D  144 ? VAL D  149 ? LYS L 145 VAL L 150 
BD 2 VAL D  190 ? THR D  196 ? VAL L 191 THR L 197 
BD 3 VAL D  204 ? ASN D  209 ? VAL L 205 ASN L 210 
BE 1 MET H  4   ? SER H  7   ? MET D 4   SER D 7   
BE 2 VAL H  19  ? ALA H  25  ? VAL D 19  ALA D 25  
BE 3 GLU H  70  ? ILE H  75  ? GLU D 70  ILE D 75  
BE 4 PHE H  62  ? GLY H  66  ? PHE D 62  GLY D 66  
BF 1 PHE H  10  ? ALA H  13  ? PHE D 10  ALA D 13  
BF 2 THR H  101 ? ILE H  105 ? THR D 102 ILE D 106 
BF 3 THR H  85  ? HIS H  90  ? THR D 85  HIS D 90  
BF 4 LEU H  33  ? GLN H  38  ? LEU D 33  GLN D 38  
BF 5 LYS H  45  ? TYR H  49  ? LYS D 45  TYR D 49  
BF 6 THR H  53  ? LEU H  54  ? THR D 53  LEU D 54  
BG 1 SER H  113 ? PHE H  117 ? SER D 114 PHE D 118 
BG 2 THR H  128 ? PHE H  138 ? THR D 129 PHE D 139 
BG 3 TYR H  172 ? SER H  181 ? TYR D 173 SER D 182 
BG 4 SER H  158 ? GLN H  159 ? SER D 159 GLN D 160 
BH 1 LYS H  144 ? VAL H  149 ? LYS D 145 VAL D 150 
BH 2 VAL H  190 ? THR H  196 ? VAL D 191 THR D 197 
BH 3 VAL H  204 ? ASN H  209 ? VAL D 205 ASN D 210 
BI 1 MET L  4   ? SER L  7   ? MET G 4   SER G 7   
BI 2 VAL L  19  ? ALA L  25  ? VAL G 19  ALA G 25  
BI 3 GLU L  70  ? ILE L  75  ? GLU G 70  ILE G 75  
BI 4 PHE L  62  ? SER L  67  ? PHE G 62  SER G 67  
BJ 1 PHE L  10  ? ALA L  13  ? PHE G 10  ALA G 13  
BJ 2 THR L  101 ? ILE L  105 ? THR G 102 ILE G 106 
BJ 3 THR L  85  ? HIS L  90  ? THR G 85  HIS G 90  
BJ 4 LEU L  33  ? GLN L  38  ? LEU G 33  GLN G 38  
BJ 5 LYS L  45  ? TYR L  49  ? LYS G 45  TYR G 49  
BJ 6 THR L  53  ? LEU L  54  ? THR G 53  LEU G 54  
BK 1 SER L  113 ? PHE L  117 ? SER G 114 PHE G 118 
BK 2 THR L  128 ? PHE L  138 ? THR G 129 PHE G 139 
BK 3 TYR L  172 ? SER L  181 ? TYR G 173 SER G 182 
BK 4 SER L  158 ? VAL L  162 ? SER G 159 VAL G 163 
BL 1 LYS L  144 ? VAL L  149 ? LYS G 145 VAL G 150 
BL 2 VAL L  190 ? THR L  196 ? VAL G 191 THR G 197 
BL 3 VAL L  204 ? ASN L  209 ? VAL G 205 ASN G 210 
BM 1 MET O  4   ? SER O  7   ? MET K 4   SER K 7   
BM 2 VAL O  19  ? ALA O  25  ? VAL K 19  ALA K 25  
BM 3 GLU O  70  ? ILE O  75  ? GLU K 70  ILE K 75  
BM 4 PHE O  62  ? SER O  67  ? PHE K 62  SER K 67  
BN 1 PHE O  10  ? ALA O  13  ? PHE K 10  ALA K 13  
BN 2 THR O  101 ? ILE O  105 ? THR K 102 ILE K 106 
BN 3 THR O  85  ? HIS O  90  ? THR K 85  HIS K 90  
BN 4 LEU O  33  ? GLN O  38  ? LEU K 33  GLN K 38  
BN 5 LYS O  45  ? TYR O  49  ? LYS K 45  TYR K 49  
BN 6 THR O  53  ? LEU O  54  ? THR K 53  LEU K 54  
BO 1 SER O  113 ? PHE O  117 ? SER K 114 PHE K 118 
BO 2 THR O  128 ? PHE O  138 ? THR K 129 PHE K 139 
BO 3 TYR O  172 ? SER O  181 ? TYR K 173 SER K 182 
BO 4 SER O  158 ? VAL O  162 ? SER K 159 VAL K 163 
BP 1 LYS O  144 ? VAL O  149 ? LYS K 145 VAL K 150 
BP 2 VAL O  190 ? THR O  196 ? VAL K 191 THR K 197 
BP 3 VAL O  204 ? ASN O  209 ? VAL K 205 ASN K 210 
BQ 1 MET S  4   ? SER S  7   ? MET O 4   SER O 7   
BQ 2 VAL S  19  ? ALA S  25  ? VAL O 19  ALA O 25  
BQ 3 GLU S  70  ? ILE S  75  ? GLU O 70  ILE O 75  
BQ 4 PHE S  62  ? SER S  67  ? PHE O 62  SER O 67  
BR 1 PHE S  10  ? ALA S  13  ? PHE O 10  ALA O 13  
BR 2 THR S  101 ? ILE S  105 ? THR O 102 ILE O 106 
BR 3 THR S  85  ? HIS S  90  ? THR O 85  HIS O 90  
BR 4 LEU S  33  ? GLN S  38  ? LEU O 33  GLN O 38  
BR 5 LYS S  45  ? TYR S  49  ? LYS O 45  TYR O 49  
BR 6 THR S  53  ? LEU S  54  ? THR O 53  LEU O 54  
BS 1 SER S  113 ? PHE S  117 ? SER O 114 PHE O 118 
BS 2 THR S  128 ? PHE S  138 ? THR O 129 PHE O 139 
BS 3 TYR S  172 ? SER S  181 ? TYR O 173 SER O 182 
BS 4 SER S  158 ? VAL S  162 ? SER O 159 VAL O 163 
BT 1 LYS S  144 ? VAL S  149 ? LYS O 145 VAL O 150 
BT 2 VAL S  190 ? THR S  196 ? VAL O 191 THR O 197 
BT 3 VAL S  204 ? ASN S  209 ? VAL O 205 ASN O 210 
BU 1 MET W  4   ? SER W  7   ? MET R 4   SER R 7   
BU 2 VAL W  19  ? ALA W  25  ? VAL R 19  ALA R 25  
BU 3 GLU W  70  ? ILE W  75  ? GLU R 70  ILE R 75  
BU 4 PHE W  62  ? SER W  67  ? PHE R 62  SER R 67  
BV 1 PHE W  10  ? ALA W  13  ? PHE R 10  ALA R 13  
BV 2 THR W  101 ? ILE W  105 ? THR R 102 ILE R 106 
BV 3 THR W  85  ? HIS W  90  ? THR R 85  HIS R 90  
BV 4 LEU W  33  ? GLN W  38  ? LEU R 33  GLN R 38  
BV 5 LYS W  45  ? TYR W  49  ? LYS R 45  TYR R 49  
BV 6 THR W  53  ? LEU W  54  ? THR R 53  LEU R 54  
BW 1 SER W  113 ? PHE W  117 ? SER R 114 PHE R 118 
BW 2 THR W  128 ? PHE W  138 ? THR R 129 PHE R 139 
BW 3 TYR W  172 ? SER W  181 ? TYR R 173 SER R 182 
BW 4 SER W  158 ? VAL W  162 ? SER R 159 VAL R 163 
BX 1 LYS W  144 ? VAL W  149 ? LYS R 145 VAL R 150 
BX 2 VAL W  190 ? THR W  196 ? VAL R 191 THR R 197 
BX 3 VAL W  204 ? ASN W  209 ? VAL R 205 ASN R 210 
BY 1 MET AA 4   ? SER AA 7   ? MET U 4   SER U 7   
BY 2 VAL AA 19  ? ALA AA 25  ? VAL U 19  ALA U 25  
BY 3 GLU AA 70  ? ILE AA 75  ? GLU U 70  ILE U 75  
BY 4 PHE AA 62  ? SER AA 67  ? PHE U 62  SER U 67  
BZ 1 PHE AA 10  ? ALA AA 13  ? PHE U 10  ALA U 13  
BZ 2 THR AA 101 ? ILE AA 105 ? THR U 102 ILE U 106 
BZ 3 THR AA 85  ? HIS AA 90  ? THR U 85  HIS U 90  
BZ 4 LEU AA 33  ? GLN AA 38  ? LEU U 33  GLN U 38  
BZ 5 LYS AA 45  ? TYR AA 49  ? LYS U 45  TYR U 49  
BZ 6 THR AA 53  ? LEU AA 54  ? THR U 53  LEU U 54  
CA 1 SER AA 113 ? PHE AA 117 ? SER U 114 PHE U 118 
CA 2 THR AA 128 ? PHE AA 138 ? THR U 129 PHE U 139 
CA 3 TYR AA 172 ? SER AA 181 ? TYR U 173 SER U 182 
CA 4 SER AA 158 ? VAL AA 162 ? SER U 159 VAL U 163 
CB 1 LYS AA 144 ? VAL AA 149 ? LYS U 145 VAL U 150 
CB 2 VAL AA 190 ? THR AA 196 ? VAL U 191 THR U 197 
CB 3 VAL AA 204 ? ASN AA 209 ? VAL U 205 ASN U 210 
CC 1 MET EA 4   ? SER EA 7   ? MET X 4   SER X 7   
CC 2 VAL EA 19  ? ALA EA 25  ? VAL X 19  ALA X 25  
CC 3 GLU EA 70  ? ILE EA 75  ? GLU X 70  ILE X 75  
CC 4 PHE EA 62  ? SER EA 67  ? PHE X 62  SER X 67  
CD 1 PHE EA 10  ? ALA EA 13  ? PHE X 10  ALA X 13  
CD 2 THR EA 101 ? ILE EA 105 ? THR X 102 ILE X 106 
CD 3 THR EA 85  ? HIS EA 90  ? THR X 85  HIS X 90  
CD 4 LEU EA 33  ? GLN EA 38  ? LEU X 33  GLN X 38  
CD 5 LYS EA 45  ? TYR EA 49  ? LYS X 45  TYR X 49  
CD 6 THR EA 53  ? LEU EA 54  ? THR X 53  LEU X 54  
CE 1 SER EA 113 ? PHE EA 117 ? SER X 114 PHE X 118 
CE 2 THR EA 128 ? PHE EA 138 ? THR X 129 PHE X 139 
CE 3 TYR EA 172 ? SER EA 181 ? TYR X 173 SER X 182 
CE 4 SER EA 158 ? VAL EA 162 ? SER X 159 VAL X 163 
CF 1 LYS EA 144 ? VAL EA 149 ? LYS X 145 VAL X 150 
CF 2 VAL EA 190 ? THR EA 196 ? VAL X 191 THR X 197 
CF 3 VAL EA 204 ? ASN EA 209 ? VAL X 205 ASN X 210 
CG 1 GLN F  3   ? GLY F  8   ? GLN H 3   GLY H 8   
CG 2 LEU F  18  ? TYR F  25  ? LEU H 18  TYR H 25  
CG 3 GLN F  77  ? LEU F  82  ? GLN H 77  LEU H 82  
CG 4 VAL F  67  ? ASP F  72  ? VAL H 67  ASP H 72  
CH 1 LEU F  11  ? LEU F  12  ? LEU H 11  LEU H 12  
CH 2 THR F  113 ? VAL F  117 ? THR H 107 VAL H 111 
CH 3 ALA F  91  ? SER F  99  ? ALA H 88  SER H 96  
CH 4 HIS F  32  ? GLN F  39  ? HIS H 32  GLN H 39  
CH 5 GLU F  46  ? ILE F  51  ? GLU H 46  ILE H 51  
CH 6 ASN F  58  ? TYR F  59  ? ASN H 58  TYR H 59  
CI 1 SER F  126 ? LEU F  130 ? SER H 120 LEU H 124 
CI 2 THR F  141 ? TYR F  151 ? THR H 135 TYR H 145 
CI 3 TYR F  182 ? PRO F  191 ? TYR H 176 PRO H 185 
CI 4 VAL F  169 ? THR F  171 ? VAL H 163 THR H 165 
CJ 1 SER F  126 ? LEU F  130 ? SER H 120 LEU H 124 
CJ 2 THR F  141 ? TYR F  151 ? THR H 135 TYR H 145 
CJ 3 TYR F  182 ? PRO F  191 ? TYR H 176 PRO H 185 
CJ 4 VAL F  175 ? LEU F  176 ? VAL H 169 LEU H 170 
CK 1 THR F  157 ? TRP F  160 ? THR H 151 TRP H 154 
CK 2 ILE F  201 ? HIS F  206 ? ILE H 195 HIS H 200 
CK 3 THR F  211 ? LYS F  216 ? THR H 205 LYS H 210 
CL 1 GLN I  3   ? ALA I  9   ? GLN C 3   ALA C 9   
CL 2 LEU I  18  ? TYR I  25  ? LEU C 18  TYR C 25  
CL 3 GLN I  77  ? LEU I  82  ? GLN C 77  LEU C 82  
CL 4 VAL I  67  ? ASP I  72  ? VAL C 67  ASP C 72  
CM 1 LEU I  11  ? LEU I  12  ? LEU C 11  LEU C 12  
CM 2 THR I  113 ? VAL I  117 ? THR C 107 VAL C 111 
CM 3 ALA I  91  ? ARG I  98  ? ALA C 88  ARG C 95  
CM 4 TYR I  33  ? GLN I  39  ? TYR C 33  GLN C 39  
CM 5 GLU I  46  ? ILE I  51  ? GLU C 46  ILE C 51  
CM 6 PRO I  57  ? TYR I  59  ? PRO C 57  TYR C 59  
CN 1 LEU I  11  ? LEU I  12  ? LEU C 11  LEU C 12  
CN 2 THR I  113 ? VAL I  117 ? THR C 107 VAL C 111 
CN 3 ALA I  91  ? ARG I  98  ? ALA C 88  ARG C 95  
CN 4 PHE I  106 C TRP I  109 ? PHE C 100 TRP C 103 
CO 1 SER I  126 ? LEU I  130 ? SER C 120 LEU C 124 
CO 2 GLY I  145 ? TYR I  151 ? GLY C 139 TYR C 145 
CO 3 TYR I  182 ? PRO I  191 ? TYR C 176 PRO C 185 
CO 4 VAL I  169 ? THR I  171 ? VAL C 163 THR C 165 
CP 1 THR I  141 ? ALA I  143 ? THR C 135 ALA C 137 
CP 2 TYR I  182 ? PRO I  191 ? TYR C 176 PRO C 185 
CP 3 VAL I  175 ? LEU I  176 ? VAL C 169 LEU C 170 
CQ 1 THR I  157 ? TRP I  160 ? THR C 151 TRP C 154 
CQ 2 ILE I  201 ? HIS I  206 ? ILE C 195 HIS C 200 
CQ 3 THR I  211 ? LYS I  216 ? THR C 205 LYS C 210 
CR 1 GLN M  3   ? GLY M  8   ? GLN F 3   GLY F 8   
CR 2 LEU M  18  ? TYR M  25  ? LEU F 18  TYR F 25  
CR 3 GLN M  77  ? LEU M  82  ? GLN F 77  LEU F 82  
CR 4 VAL M  67  ? ASP M  72  ? VAL F 67  ASP F 72  
CS 1 LEU M  11  ? LEU M  12  ? LEU F 11  LEU F 12  
CS 2 THR M  113 ? VAL M  117 ? THR F 107 VAL F 111 
CS 3 ALA M  91  ? ARG M  98  ? ALA F 88  ARG F 95  
CS 4 TYR M  33  ? GLN M  39  ? TYR F 33  GLN F 39  
CS 5 GLU M  46  ? ILE M  51  ? GLU F 46  ILE F 51  
CS 6 ASN M  58  ? TYR M  59  ? ASN F 58  TYR F 59  
CT 1 LEU M  11  ? LEU M  12  ? LEU F 11  LEU F 12  
CT 2 THR M  113 ? VAL M  117 ? THR F 107 VAL F 111 
CT 3 ALA M  91  ? ARG M  98  ? ALA F 88  ARG F 95  
CT 4 PHE M  106 C TRP M  109 ? PHE F 100 TRP F 103 
CU 1 SER M  126 ? LEU M  130 ? SER F 120 LEU F 124 
CU 2 THR M  141 ? TYR M  151 ? THR F 135 TYR F 145 
CU 3 TYR M  182 ? PRO M  191 ? TYR F 176 PRO F 185 
CU 4 VAL M  169 ? THR M  171 ? VAL F 163 THR F 165 
CV 1 SER M  126 ? LEU M  130 ? SER F 120 LEU F 124 
CV 2 THR M  141 ? TYR M  151 ? THR F 135 TYR F 145 
CV 3 TYR M  182 ? PRO M  191 ? TYR F 176 PRO F 185 
CV 4 VAL M  175 ? LEU M  176 ? VAL F 169 LEU F 170 
CW 1 THR M  157 ? TRP M  160 ? THR F 151 TRP F 154 
CW 2 ILE M  201 ? HIS M  206 ? ILE F 195 HIS F 200 
CW 3 THR M  211 ? LYS M  216 ? THR F 205 LYS F 210 
CW 4 THR BA 211 ? LYS BA 216 ? THR T 205 LYS T 210 
CW 5 ILE BA 201 ? HIS BA 206 ? ILE T 195 HIS T 200 
CW 6 THR BA 157 ? TRP BA 160 ? THR T 151 TRP T 154 
CX 1 GLN P  3   ? GLY P  8   ? GLN J 3   GLY J 8   
CX 2 LEU P  18  ? TYR P  25  ? LEU J 18  TYR J 25  
CX 3 GLN P  77  ? LEU P  82  ? GLN J 77  LEU J 82  
CX 4 VAL P  67  ? ASP P  72  ? VAL J 67  ASP J 72  
CY 1 LEU P  11  ? LEU P  12  ? LEU J 11  LEU J 12  
CY 2 THR P  113 ? VAL P  117 ? THR J 107 VAL J 111 
CY 3 ALA P  91  ? ARG P  98  ? ALA J 88  ARG J 95  
CY 4 TYR P  33  ? GLN P  39  ? TYR J 33  GLN J 39  
CY 5 GLU P  46  ? ILE P  51  ? GLU J 46  ILE J 51  
CY 6 PRO P  57  ? TYR P  59  ? PRO J 57  TYR J 59  
CZ 1 LEU P  11  ? LEU P  12  ? LEU J 11  LEU J 12  
CZ 2 THR P  113 ? VAL P  117 ? THR J 107 VAL J 111 
CZ 3 ALA P  91  ? ARG P  98  ? ALA J 88  ARG J 95  
CZ 4 PHE P  106 C TRP P  109 ? PHE J 100 TRP J 103 
DA 1 SER P  126 ? LEU P  130 ? SER J 120 LEU J 124 
DA 2 THR P  141 ? TYR P  151 ? THR J 135 TYR J 145 
DA 3 TYR P  182 ? PRO P  191 ? TYR J 176 PRO J 185 
DA 4 VAL P  169 ? THR P  171 ? VAL J 163 THR J 165 
DB 1 SER P  126 ? LEU P  130 ? SER J 120 LEU J 124 
DB 2 THR P  141 ? TYR P  151 ? THR J 135 TYR J 145 
DB 3 TYR P  182 ? PRO P  191 ? TYR J 176 PRO J 185 
DB 4 VAL P  175 ? LEU P  176 ? VAL J 169 LEU J 170 
DC 1 THR P  157 ? TRP P  160 ? THR J 151 TRP J 154 
DC 2 ILE P  201 ? HIS P  206 ? ILE J 195 HIS J 200 
DC 3 THR P  211 ? LYS P  216 ? THR J 205 LYS J 210 
DD 1 GLN T  3   ? GLY T  8   ? GLN N 3   GLY N 8   
DD 2 LEU T  18  ? TYR T  25  ? LEU N 18  TYR N 25  
DD 3 GLN T  77  ? LEU T  82  ? GLN N 77  LEU N 82  
DD 4 VAL T  67  ? ASP T  72  ? VAL N 67  ASP N 72  
DE 1 LEU T  11  ? LEU T  12  ? LEU N 11  LEU N 12  
DE 2 THR T  113 ? VAL T  117 ? THR N 107 VAL N 111 
DE 3 ALA T  91  ? ARG T  98  ? ALA N 88  ARG N 95  
DE 4 TYR T  33  ? GLN T  39  ? TYR N 33  GLN N 39  
DE 5 GLU T  46  ? ILE T  51  ? GLU N 46  ILE N 51  
DE 6 ASN T  58  ? TYR T  59  ? ASN N 58  TYR N 59  
DF 1 SER T  126 ? LEU T  130 ? SER N 120 LEU N 124 
DF 2 THR T  141 ? TYR T  151 ? THR N 135 TYR N 145 
DF 3 TYR T  182 ? PRO T  191 ? TYR N 176 PRO N 185 
DF 4 HIS T  170 ? THR T  171 ? HIS N 164 THR N 165 
DG 1 SER T  126 ? LEU T  130 ? SER N 120 LEU N 124 
DG 2 THR T  141 ? TYR T  151 ? THR N 135 TYR N 145 
DG 3 TYR T  182 ? PRO T  191 ? TYR N 176 PRO N 185 
DG 4 VAL T  175 ? LEU T  176 ? VAL N 169 LEU N 170 
DH 1 THR T  157 ? TRP T  160 ? THR N 151 TRP N 154 
DH 2 ILE T  201 ? HIS T  206 ? ILE N 195 HIS N 200 
DH 3 THR T  211 ? LYS T  216 ? THR N 205 LYS N 210 
DI 1 GLN X  3   ? GLY X  8   ? GLN Q 3   GLY Q 8   
DI 2 LEU X  18  ? TYR X  25  ? LEU Q 18  TYR Q 25  
DI 3 GLN X  77  ? LEU X  82  ? GLN Q 77  LEU Q 82  
DI 4 VAL X  67  ? ASP X  72  ? VAL Q 67  ASP Q 72  
DJ 1 LEU X  11  ? LEU X  12  ? LEU Q 11  LEU Q 12  
DJ 2 THR X  113 ? VAL X  117 ? THR Q 107 VAL Q 111 
DJ 3 ALA X  91  ? SER X  99  ? ALA Q 88  SER Q 96  
DJ 4 HIS X  32  ? GLN X  39  ? HIS Q 32  GLN Q 39  
DJ 5 GLU X  46  ? ILE X  51  ? GLU Q 46  ILE Q 51  
DK 1 SER X  126 ? LEU X  130 ? SER Q 120 LEU Q 124 
DK 2 THR X  141 ? TYR X  151 ? THR Q 135 TYR Q 145 
DK 3 TYR X  182 ? PRO X  191 ? TYR Q 176 PRO Q 185 
DK 4 VAL X  169 ? THR X  171 ? VAL Q 163 THR Q 165 
DL 1 SER X  126 ? LEU X  130 ? SER Q 120 LEU Q 124 
DL 2 THR X  141 ? TYR X  151 ? THR Q 135 TYR Q 145 
DL 3 TYR X  182 ? PRO X  191 ? TYR Q 176 PRO Q 185 
DL 4 VAL X  175 ? LEU X  176 ? VAL Q 169 LEU Q 170 
DM 1 THR X  157 ? TRP X  160 ? THR Q 151 TRP Q 154 
DM 2 ILE X  201 ? HIS X  206 ? ILE Q 195 HIS Q 200 
DM 3 THR X  211 ? LYS X  216 ? THR Q 205 LYS Q 210 
DN 1 GLN BA 3   ? GLY BA 8   ? GLN T 3   GLY T 8   
DN 2 LEU BA 18  ? TYR BA 25  ? LEU T 18  TYR T 25  
DN 3 GLN BA 77  ? LEU BA 82  ? GLN T 77  LEU T 82  
DN 4 VAL BA 67  ? ASP BA 72  ? VAL T 67  ASP T 72  
DO 1 LEU BA 11  ? LEU BA 12  ? LEU T 11  LEU T 12  
DO 2 THR BA 113 ? VAL BA 117 ? THR T 107 VAL T 111 
DO 3 ALA BA 91  ? ARG BA 98  ? ALA T 88  ARG T 95  
DO 4 TYR BA 33  ? GLN BA 39  ? TYR T 33  GLN T 39  
DO 5 GLU BA 46  ? ILE BA 51  ? GLU T 46  ILE T 51  
DO 6 PRO BA 57  ? TYR BA 59  ? PRO T 57  TYR T 59  
DP 1 LEU BA 11  ? LEU BA 12  ? LEU T 11  LEU T 12  
DP 2 THR BA 113 ? VAL BA 117 ? THR T 107 VAL T 111 
DP 3 ALA BA 91  ? ARG BA 98  ? ALA T 88  ARG T 95  
DP 4 PHE BA 106 C TRP BA 109 ? PHE T 100 TRP T 103 
DQ 1 SER BA 126 ? LEU BA 130 ? SER T 120 LEU T 124 
DQ 2 THR BA 141 ? TYR BA 151 ? THR T 135 TYR T 145 
DQ 3 TYR BA 182 ? PRO BA 191 ? TYR T 176 PRO T 185 
DQ 4 VAL BA 169 ? THR BA 171 ? VAL T 163 THR T 165 
DR 1 SER BA 126 ? LEU BA 130 ? SER T 120 LEU T 124 
DR 2 THR BA 141 ? TYR BA 151 ? THR T 135 TYR T 145 
DR 3 TYR BA 182 ? PRO BA 191 ? TYR T 176 PRO T 185 
DR 4 VAL BA 175 ? LEU BA 176 ? VAL T 169 LEU T 170 
DS 1 GLN FA 3   ? TRP FA 7   ? GLN W 3   TRP W 7   
DS 2 LEU FA 18  ? TYR FA 25  ? LEU W 18  TYR W 25  
DS 3 GLN FA 77  ? LEU FA 82  ? GLN W 77  LEU W 82  
DS 4 VAL FA 67  ? ASP FA 72  ? VAL W 67  ASP W 72  
DT 1 LEU FA 11  ? LEU FA 12  ? LEU W 11  LEU W 12  
DT 2 THR FA 113 ? VAL FA 117 ? THR W 107 VAL W 111 
DT 3 ALA FA 91  ? SER FA 99  ? ALA W 88  SER W 96  
DT 4 HIS FA 32  ? GLN FA 39  ? HIS W 32  GLN W 39  
DT 5 GLU FA 46  ? ILE FA 51  ? GLU W 46  ILE W 51  
DT 6 PRO FA 57  ? TYR FA 59  ? PRO W 57  TYR W 59  
DU 1 SER FA 126 ? LEU FA 130 ? SER W 120 LEU W 124 
DU 2 THR FA 141 ? TYR FA 151 ? THR W 135 TYR W 145 
DU 3 TYR FA 182 ? PRO FA 191 ? TYR W 176 PRO W 185 
DU 4 HIS FA 170 ? THR FA 171 ? HIS W 164 THR W 165 
DV 1 SER FA 126 ? LEU FA 130 ? SER W 120 LEU W 124 
DV 2 THR FA 141 ? TYR FA 151 ? THR W 135 TYR W 145 
DV 3 TYR FA 182 ? PRO FA 191 ? TYR W 176 PRO W 185 
DV 4 VAL FA 175 ? LEU FA 176 ? VAL W 169 LEU W 170 
DW 1 THR FA 157 ? TRP FA 160 ? THR W 151 TRP W 154 
DW 2 ILE FA 201 ? HIS FA 206 ? ILE W 195 HIS W 200 
DW 3 THR FA 211 ? LYS FA 216 ? THR W 205 LYS W 210 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ALA A  12  ? N ALA A 55  O HIS A  100 ? O HIS A 216 
B  1 2 N GLU A  48  ? N GLU A 91  O CYS A  123 ? O CYS A 239 
C  1 2 N ILE A  284 ? N ILE A 424 O ALA A  293 ? O ALA A 433 
C  2 3 O GLN A  292 ? O GLN A 432 N LEU A  79  ? N LEU A 122 
C  3 4 N THR A  80  ? N THR A 123 O SER A  83  ? O SER A 199 
C  4 5 N ALA A  84  ? N ALA A 200 O THR Q  86  ? O THR M 202 
C  5 6 O SER Q  83  ? O SER M 199 N THR Q  80  ? N THR M 123 
C  6 7 N VAL Q  77  ? N VAL M 120 O ILE Q  294 ? O ILE M 434 
C  7 8 O ALA Q  293 ? O ALA M 433 N ILE Q  284 ? N ILE M 424 
D  1 2 O VAL A  129 ? O VAL A 245 N ILE A  109 ? N ILE A 225 
D  2 3 N LEU A  110 ? N LEU A 226 O LYS A  347 ? O LYS A 487 
E  1 2 N LEU A  144 ? N LEU A 260 O GLY A  311 ? O GLY A 451 
E  2 3 O LEU A  314 ? O LEU A 454 N ILE A  168 ? N ILE A 284 
E  3 4 N ASN A  179 ? N ASN A 295 O ASN A  200 ? O ASN A 332 
E  4 5 N ALA A  197 ? N ALA A 329 O CYS A  278 ? O CYS A 418 
E  5 6 O ARG A  279 ? O ARG A 419 N TYR A  251 ? N TYR A 384 
E  6 7 O GLU A  248 ? O GLU A 381 N CYS A  245 ? N CYS A 378 
F  1 2 N ARG A  157 ? N ARG A 273 O ILE A  169 ? O ILE A 285 
F  2 3 N ILE A  168 ? N ILE A 284 O LEU A  314 ? O LEU A 454 
F  3 4 N THR A  315 ? N THR A 455 O ARG A  329 ? O ARG A 469 
G  1 2 N PHE B  50  ? N PHE B 93  O GLY B  121 ? O GLY B 237 
H  1 2 N ILE B  284 ? N ILE B 424 O ALA B  293 ? O ALA B 433 
H  2 3 O GLN B  292 ? O GLN B 432 N LEU B  79  ? N LEU B 122 
H  3 4 N THR B  80  ? N THR B 123 O SER B  83  ? O SER B 199 
H  4 5 N THR B  86  ? N THR B 202 O ALA U  84  ? O ALA P 200 
H  5 6 O SER U  83  ? O SER P 199 N THR U  80  ? N THR P 123 
H  6 7 N LEU U  79  ? N LEU P 122 O GLN U  292 ? O GLN P 432 
H  7 8 O ALA U  293 ? O ALA P 433 N ILE U  284 ? N ILE P 424 
I  1 2 O SER B  127 ? O SER B 243 N LYS B  111 ? N LYS B 227 
I  2 3 N LEU B  110 ? N LEU B 226 O LYS B  347 ? O LYS B 487 
J  1 2 N LEU B  144 ? N LEU B 260 O GLY B  311 ? O GLY B 451 
J  2 3 O LEU B  314 ? O LEU B 454 N ILE B  168 ? N ILE B 284 
J  3 4 N ASN B  179 ? N ASN B 295 O ASN B  200 ? O ASN B 332 
J  4 5 N CYS B  199 ? N CYS B 331 O LEU B  276 ? O LEU B 416 
J  5 6 O ARG B  279 ? O ARG B 419 N TYR B  251 ? N TYR B 384 
J  6 7 O CYS B  252 ? O CYS B 385 N HIS B  241 ? N HIS B 374 
K  1 2 N ARG B  157 ? N ARG B 273 O ILE B  169 ? O ILE B 285 
K  2 3 N ILE B  168 ? N ILE B 284 O LEU B  314 ? O LEU B 454 
K  3 4 N THR B  315 ? N THR B 455 O ARG B  329 ? O ARG B 469 
L  1 2 N ALA J  12  ? N ALA E 55  O HIS J  100 ? O HIS E 216 
M  1 2 N GLU J  48  ? N GLU E 91  O CYS J  123 ? O CYS E 239 
N  1 2 O SER J  83  ? O SER E 199 N THR J  80  ? N THR E 123 
N  2 3 N LEU J  79  ? N LEU E 122 O GLN J  292 ? O GLN E 432 
N  3 4 O ALA J  293 ? O ALA E 433 N ILE J  284 ? N ILE E 424 
O  1 2 O VAL J  129 ? O VAL E 245 N ILE J  109 ? N ILE E 225 
O  2 3 N LEU J  110 ? N LEU E 226 O LYS J  347 ? O LYS E 487 
P  1 2 N LEU J  144 ? N LEU E 260 O GLY J  311 ? O GLY E 451 
P  2 3 O LEU J  314 ? O LEU E 454 N ILE J  168 ? N ILE E 284 
P  3 4 N THR J  181 ? N THR E 297 O HIS J  198 ? O HIS E 330 
P  4 5 N ALA J  197 ? N ALA E 329 O CYS J  278 ? O CYS E 418 
P  5 6 O ARG J  279 ? O ARG E 419 N TYR J  251 ? N TYR E 384 
P  6 7 O PHE J  250 ? O PHE E 383 N PHE J  243 ? N PHE E 376 
Q  1 2 N ARG J  157 ? N ARG E 273 O ILE J  169 ? O ILE E 285 
Q  2 3 N ILE J  168 ? N ILE E 284 O LEU J  314 ? O LEU E 454 
Q  3 4 N THR J  315 ? N THR E 455 O ARG J  329 ? O ARG E 469 
R  1 2 O VAL E  32  ? O VAL I 75  N CYS E  11  ? N CYS I 54  
R  2 3 N ALA E  12  ? N ALA I 55  O HIS E  100 ? O HIS I 216 
S  1 2 N LEU E  41  ? N LEU I 84  O THR E  128 ? O THR I 244 
S  2 3 O SER E  127 ? O SER I 243 N LYS E  111 ? N LYS I 227 
S  3 4 N LEU E  110 ? N LEU I 226 O LYS E  347 ? O LYS I 487 
T  1 2 N PHE E  50  ? N PHE I 93  O GLY E  121 ? O GLY I 237 
U  1 2 N ILE E  284 ? N ILE I 424 O ALA E  293 ? O ALA I 433 
U  2 3 O GLN E  292 ? O GLN I 432 N LEU E  79  ? N LEU I 122 
U  3 4 N THR E  80  ? N THR I 123 O SER E  83  ? O SER I 199 
U  4 5 N THR E  86  ? N THR I 202 O ALA CA 84  ? O ALA V 200 
U  5 6 O LEU CA 85  ? O LEU V 201 N GLN CA 78  ? N GLN V 121 
U  6 7 N LEU CA 79  ? N LEU V 122 O GLN CA 292 ? O GLN V 432 
U  7 8 O ALA CA 293 ? O ALA V 433 N ILE CA 284 ? N ILE V 424 
V  1 2 N LEU E  144 ? N LEU I 260 O GLY E  311 ? O GLY I 451 
V  2 3 O THR E  310 ? O THR I 450 N LEU E  172 ? N LEU I 288 
V  3 4 N THR E  181 ? N THR I 297 O HIS E  198 ? O HIS I 330 
V  4 5 N ALA E  197 ? N ALA I 329 O CYS E  278 ? O CYS I 418 
V  5 6 O ARG E  279 ? O ARG I 419 N TYR E  251 ? N TYR I 384 
W  1 2 N ARG E  157 ? N ARG I 273 O ILE E  169 ? O ILE I 285 
W  2 3 N LEU E  172 ? N LEU I 288 O THR E  310 ? O THR I 450 
W  3 4 N THR E  315 ? N THR I 455 O ARG E  329 ? O ARG I 469 
X  1 2 N ALA Q  12  ? N ALA M 55  O HIS Q  100 ? O HIS M 216 
Y  1 2 N GLU Q  48  ? N GLU M 91  O CYS Q  123 ? O CYS M 239 
Z  1 2 O SER Q  127 ? O SER M 243 N LYS Q  111 ? N LYS M 227 
Z  2 3 N ALA Q  108 ? N ALA M 224 O VAL Q  349 ? O VAL M 489 
AA 1 2 N LEU Q  144 ? N LEU M 260 O GLY Q  311 ? O GLY M 451 
AA 2 3 O LEU Q  314 ? O LEU M 454 N ILE Q  168 ? N ILE M 284 
AA 3 4 N THR Q  181 ? N THR M 297 O HIS Q  198 ? O HIS M 330 
AA 4 5 N ALA Q  197 ? N ALA M 329 O CYS Q  278 ? O CYS M 418 
AA 5 6 O ARG Q  279 ? O ARG M 419 N TYR Q  251 ? N TYR M 384 
AA 6 7 O CYS Q  252 ? O CYS M 385 N HIS Q  241 ? N HIS M 374 
AB 1 2 N MET Q  155 ? N MET M 271 O GLN Q  171 ? O GLN M 287 
AB 2 3 N ILE Q  168 ? N ILE M 284 O LEU Q  314 ? O LEU M 454 
AB 3 4 N THR Q  315 ? N THR M 455 O ARG Q  329 ? O ARG M 469 
AC 1 2 N ALA U  12  ? N ALA P 55  O HIS U  100 ? O HIS P 216 
AD 1 2 N GLU U  48  ? N GLU P 91  O CYS U  123 ? O CYS P 239 
AE 1 2 O VAL U  129 ? O VAL P 245 N ILE U  109 ? N ILE P 225 
AE 2 3 N ALA U  108 ? N ALA P 224 O VAL U  349 ? O VAL P 489 
AF 1 2 N LEU U  144 ? N LEU P 260 O GLY U  311 ? O GLY P 451 
AF 2 3 O LEU U  314 ? O LEU P 454 N ILE U  168 ? N ILE P 284 
AF 3 4 N THR U  181 ? N THR P 297 O HIS U  198 ? O HIS P 330 
AF 4 5 N ALA U  197 ? N ALA P 329 O CYS U  278 ? O CYS P 418 
AF 5 6 O ARG U  279 ? O ARG P 419 N TYR U  251 ? N TYR P 384 
AF 6 7 O CYS U  252 ? O CYS P 385 N HIS U  241 ? N HIS P 374 
AG 1 2 N ARG U  157 ? N ARG P 273 O ILE U  169 ? O ILE P 285 
AG 2 3 N ILE U  168 ? N ILE P 284 O LEU U  314 ? O LEU P 454 
AG 3 4 N THR U  315 ? N THR P 455 O ARG U  329 ? O ARG P 469 
AH 1 2 N ALA Y  12  ? N ALA S 55  O HIS Y  100 ? O HIS S 216 
AI 1 2 N PHE Y  50  ? N PHE S 93  O GLY Y  121 ? O GLY S 237 
AJ 1 2 O SER Y  83  ? O SER S 199 N THR Y  80  ? N THR S 123 
AJ 2 3 N LEU Y  79  ? N LEU S 122 O GLN Y  292 ? O GLN S 432 
AJ 3 4 O ALA Y  293 ? O ALA S 433 N ILE Y  284 ? N ILE S 424 
AK 1 2 O VAL Y  129 ? O VAL S 245 N ILE Y  109 ? N ILE S 225 
AK 2 3 N ALA Y  108 ? N ALA S 224 O VAL Y  349 ? O VAL S 489 
AL 1 2 N LEU Y  144 ? N LEU S 260 O GLY Y  311 ? O GLY S 451 
AL 2 3 O LEU Y  314 ? O LEU S 454 N ILE Y  168 ? N ILE S 284 
AL 3 4 N ASN Y  179 ? N ASN S 295 O ASN Y  200 ? O ASN S 332 
AL 4 5 N ALA Y  197 ? N ALA S 329 O CYS Y  278 ? O CYS S 418 
AL 5 6 O ARG Y  279 ? O ARG S 419 N TYR Y  251 ? N TYR S 384 
AL 6 7 O CYS Y  252 ? O CYS S 385 N HIS Y  241 ? N HIS S 374 
AM 1 2 N MET Y  155 ? N MET S 271 O GLN Y  171 ? O GLN S 287 
AM 2 3 N ILE Y  168 ? N ILE S 284 O LEU Y  314 ? O LEU S 454 
AM 3 4 N THR Y  315 ? N THR S 455 O ARG Y  329 ? O ARG S 469 
AN 1 2 N ALA CA 12  ? N ALA V 55  O HIS CA 100 ? O HIS V 216 
AO 1 2 N GLU CA 48  ? N GLU V 91  O CYS CA 123 ? O CYS V 239 
AP 1 2 O VAL CA 129 ? O VAL V 245 N ILE CA 109 ? N ILE V 225 
AP 2 3 N ALA CA 108 ? N ALA V 224 O VAL CA 349 ? O VAL V 489 
AQ 1 2 N LEU CA 144 ? N LEU V 260 O GLY CA 311 ? O GLY V 451 
AQ 2 3 O ILE CA 309 ? O ILE V 449 N VAL CA 176 ? N VAL V 292 
AQ 3 4 N THR CA 181 ? N THR V 297 O HIS CA 198 ? O HIS V 330 
AQ 4 5 N ALA CA 197 ? N ALA V 329 O CYS CA 278 ? O CYS V 418 
AQ 5 6 O ARG CA 279 ? O ARG V 419 N TYR CA 251 ? N TYR V 384 
AQ 6 7 O CYS CA 252 ? O CYS V 385 N HIS CA 241 ? N HIS V 374 
AR 1 2 N ARG CA 157 ? N ARG V 273 O ILE CA 169 ? O ILE V 285 
AR 2 3 N VAL CA 176 ? N VAL V 292 O ILE CA 309 ? O ILE V 449 
AR 3 4 N THR CA 315 ? N THR V 455 O ARG CA 329 ? O ARG V 469 
AS 1 2 N ALA C  20  ? N ALA a 20  O U2X C  23  ? O U2X a 23  
AT 1 2 N ALA G  20  ? N ALA b 20  O U2X G  23  ? O U2X b 23  
AU 1 2 N ALA K  20  ? N ALA e 20  O U2X K  23  ? O U2X e 23  
AV 1 2 N ALA N  20  ? N ALA i 20  O U2X N  23  ? O U2X i 23  
AW 1 2 N ALA R  20  ? N ALA m 20  O U2X R  23  ? O U2X m 23  
AX 1 2 N ALA V  20  ? N ALA p 20  O U2X V  23  ? O U2X p 23  
AY 1 2 N ALA Z  20  ? N ALA s 20  O U2X Z  23  ? O U2X s 23  
AZ 1 2 N ALA DA 20  ? N ALA v 20  O U2X DA 23  ? O U2X v 23  
BA 1 2 N THR D  5   ? N THR L 5   O ARG D  24  ? O ARG L 24  
BA 2 3 N VAL D  19  ? N VAL L 19  O ILE D  75  ? O ILE L 75  
BA 3 4 O THR D  74  ? O THR L 74  N SER D  63  ? N SER L 63  
BB 1 2 N VAL D  11  ? N VAL L 11  O GLU D  104 ? O GLU L 105 
BB 2 3 O THR D  101 ? O THR L 102 N TYR D  86  ? N TYR L 86  
BB 3 4 O TYR D  87  ? O TYR L 87  N TYR D  36  ? N TYR L 36  
BB 4 5 N GLN D  37  ? N GLN L 37  O LYS D  45  ? O LYS L 45  
BB 5 6 N TYR D  49  ? N TYR L 49  O THR D  53  ? O THR L 53  
BC 1 2 N PHE D  115 ? N PHE L 116 O LEU D  134 ? O LEU L 135 
BC 2 3 N LEU D  135 ? N LEU L 136 O LEU D  174 ? O LEU L 175 
BC 3 4 O THR D  177 ? O THR L 178 N GLN D  159 ? N GLN L 160 
BD 1 2 N LYS D  148 ? N LYS L 149 O ALA D  192 ? O ALA L 193 
BD 2 3 N VAL D  195 ? N VAL L 196 O VAL D  204 ? O VAL L 205 
BE 1 2 N THR H  5   ? N THR D 5   O ARG H  24  ? O ARG D 24  
BE 2 3 N CYS H  23  ? N CYS D 23  O PHE H  71  ? O PHE D 71  
BE 3 4 O THR H  72  ? O THR D 72  N SER H  65  ? N SER D 65  
BF 1 2 N VAL H  11  ? N VAL D 11  O LYS H  102 ? O LYS D 103 
BF 2 3 O THR H  101 ? O THR D 102 N TYR H  86  ? N TYR D 86  
BF 3 4 O TYR H  87  ? O TYR D 87  N TYR H  36  ? N TYR D 36  
BF 4 5 N TRP H  35  ? N TRP D 35  O ILE H  48  ? O ILE D 48  
BF 5 6 N TYR H  49  ? N TYR D 49  O THR H  53  ? O THR D 53  
BG 1 2 N SER H  113 ? N SER D 114 O ASN H  136 ? O ASN D 137 
BG 2 3 N PHE H  138 ? N PHE D 139 O TYR H  172 ? O TYR D 173 
BG 3 4 O THR H  177 ? O THR D 178 N GLN H  159 ? N GLN D 160 
BH 1 2 N LYS H  148 ? N LYS D 149 O ALA H  192 ? O ALA D 193 
BH 2 3 N VAL H  195 ? N VAL D 196 O VAL H  204 ? O VAL D 205 
BI 1 2 N THR L  5   ? N THR G 5   O ARG L  24  ? O ARG G 24  
BI 2 3 N VAL L  19  ? N VAL G 19  O ILE L  75  ? O ILE G 75  
BI 3 4 O THR L  72  ? O THR G 72  N SER L  65  ? N SER G 65  
BJ 1 2 N VAL L  11  ? N VAL G 11  O LYS L  102 ? O LYS G 103 
BJ 2 3 O THR L  101 ? O THR G 102 N TYR L  86  ? N TYR G 86  
BJ 3 4 O TYR L  87  ? O TYR G 87  N TYR L  36  ? N TYR G 36  
BJ 4 5 N TRP L  35  ? N TRP G 35  O ILE L  48  ? O ILE G 48  
BJ 5 6 N TYR L  49  ? N TYR G 49  O THR L  53  ? O THR G 53  
BK 1 2 N PHE L  115 ? N PHE G 116 O LEU L  134 ? O LEU G 135 
BK 2 3 N LEU L  135 ? N LEU G 136 O LEU L  174 ? O LEU G 175 
BK 3 4 O THR L  177 ? O THR G 178 N GLN L  159 ? N GLN G 160 
BL 1 2 N LYS L  148 ? N LYS G 149 O ALA L  192 ? O ALA G 193 
BL 2 3 N VAL L  195 ? N VAL G 196 O VAL L  204 ? O VAL G 205 
BM 1 2 N THR O  5   ? N THR K 5   O ARG O  24  ? O ARG K 24  
BM 2 3 N VAL O  19  ? N VAL K 19  O ILE O  75  ? O ILE K 75  
BM 3 4 O THR O  72  ? O THR K 72  N SER O  65  ? N SER K 65  
BN 1 2 N VAL O  11  ? N VAL K 11  O LYS O  102 ? O LYS K 103 
BN 2 3 O THR O  101 ? O THR K 102 N TYR O  86  ? N TYR K 86  
BN 3 4 O TYR O  87  ? O TYR K 87  N TYR O  36  ? N TYR K 36  
BN 4 5 N TRP O  35  ? N TRP K 35  O VAL O  47  ? O VAL K 47  
BN 5 6 N TYR O  49  ? N TYR K 49  O THR O  53  ? O THR K 53  
BO 1 2 N PHE O  115 ? N PHE K 116 O LEU O  134 ? O LEU K 135 
BO 2 3 N ALA O  129 ? N ALA K 130 O LEU O  180 ? O LEU K 181 
BO 3 4 O THR O  177 ? O THR K 178 N GLN O  159 ? N GLN K 160 
BP 1 2 N LYS O  148 ? N LYS K 149 O ALA O  192 ? O ALA K 193 
BP 2 3 N VAL O  195 ? N VAL K 196 O VAL O  204 ? O VAL K 205 
BQ 1 2 N THR S  5   ? N THR O 5   O ARG S  24  ? O ARG O 24  
BQ 2 3 N ILE S  21  ? N ILE O 21  O LEU S  73  ? O LEU O 73  
BQ 3 4 O THR S  72  ? O THR O 72  N SER S  65  ? N SER O 65  
BR 1 2 N VAL S  11  ? N VAL O 11  O LYS S  102 ? O LYS O 103 
BR 2 3 O THR S  101 ? O THR O 102 N TYR S  86  ? N TYR O 86  
BR 3 4 O TYR S  87  ? O TYR O 87  N TYR S  36  ? N TYR O 36  
BR 4 5 N GLN S  37  ? N GLN O 37  O LYS S  45  ? O LYS O 45  
BR 5 6 N TYR S  49  ? N TYR O 49  O THR S  53  ? O THR O 53  
BS 1 2 N PHE S  115 ? N PHE O 116 O LEU S  134 ? O LEU O 135 
BS 2 3 N LEU S  135 ? N LEU O 136 O LEU S  174 ? O LEU O 175 
BS 3 4 O THR S  177 ? O THR O 178 N GLN S  159 ? N GLN O 160 
BT 1 2 N GLN S  146 ? N GLN O 147 O GLU S  194 ? O GLU O 195 
BT 2 3 N VAL S  195 ? N VAL O 196 O VAL S  204 ? O VAL O 205 
BU 1 2 N SER W  7   ? N SER R 7   O THR W  22  ? O THR R 22  
BU 2 3 N ILE W  21  ? N ILE R 21  O LEU W  73  ? O LEU R 73  
BU 3 4 O THR W  72  ? O THR R 72  N SER W  65  ? N SER R 65  
BV 1 2 N VAL W  11  ? N VAL R 11  O LYS W  102 ? O LYS R 103 
BV 2 3 O THR W  101 ? O THR R 102 N TYR W  86  ? N TYR R 86  
BV 3 4 O TYR W  87  ? O TYR R 87  N TYR W  36  ? N TYR R 36  
BV 4 5 N TRP W  35  ? N TRP R 35  O ILE W  48  ? O ILE R 48  
BV 5 6 N TYR W  49  ? N TYR R 49  O THR W  53  ? O THR R 53  
BW 1 2 N PHE W  115 ? N PHE R 116 O LEU W  134 ? O LEU R 135 
BW 2 3 N LEU W  135 ? N LEU R 136 O LEU W  174 ? O LEU R 175 
BW 3 4 O SER W  175 ? O SER R 176 N SER W  161 ? N SER R 162 
BX 1 2 N LYS W  148 ? N LYS R 149 O ALA W  192 ? O ALA R 193 
BX 2 3 N TYR W  191 ? N TYR R 192 O PHE W  208 ? O PHE R 209 
BY 1 2 N THR AA 5   ? N THR U 5   O ARG AA 24  ? O ARG U 24  
BY 2 3 N ILE AA 21  ? N ILE U 21  O LEU AA 73  ? O LEU U 73  
BY 3 4 O THR AA 72  ? O THR U 72  N SER AA 65  ? N SER U 65  
BZ 1 2 N VAL AA 11  ? N VAL U 11  O LYS AA 102 ? O LYS U 103 
BZ 2 3 O THR AA 101 ? O THR U 102 N TYR AA 86  ? N TYR U 86  
BZ 3 4 O TYR AA 87  ? O TYR U 87  N TYR AA 36  ? N TYR U 36  
BZ 4 5 N GLN AA 37  ? N GLN U 37  O LYS AA 45  ? O LYS U 45  
BZ 5 6 N TYR AA 49  ? N TYR U 49  O THR AA 53  ? O THR U 53  
CA 1 2 N PHE AA 115 ? N PHE U 116 O LEU AA 134 ? O LEU U 135 
CA 2 3 N LEU AA 135 ? N LEU U 136 O LEU AA 174 ? O LEU U 175 
CA 3 4 O THR AA 177 ? O THR U 178 N GLN AA 159 ? N GLN U 160 
CB 1 2 N GLN AA 146 ? N GLN U 147 O GLU AA 194 ? O GLU U 195 
CB 2 3 N VAL AA 195 ? N VAL U 196 O VAL AA 204 ? O VAL U 205 
CC 1 2 N THR EA 5   ? N THR X 5   O ARG EA 24  ? O ARG X 24  
CC 2 3 N ILE EA 21  ? N ILE X 21  O LEU EA 73  ? O LEU X 73  
CC 3 4 O THR EA 74  ? O THR X 74  N SER EA 63  ? N SER X 63  
CD 1 2 N VAL EA 11  ? N VAL X 11  O LYS EA 102 ? O LYS X 103 
CD 2 3 O THR EA 101 ? O THR X 102 N TYR EA 86  ? N TYR X 86  
CD 3 4 O TYR EA 87  ? O TYR X 87  N TYR EA 36  ? N TYR X 36  
CD 4 5 N GLN EA 37  ? N GLN X 37  O LYS EA 45  ? O LYS X 45  
CD 5 6 N TYR EA 49  ? N TYR X 49  O THR EA 53  ? O THR X 53  
CE 1 2 N PHE EA 115 ? N PHE X 116 O LEU EA 134 ? O LEU X 135 
CE 2 3 N PHE EA 138 ? N PHE X 139 O TYR EA 172 ? O TYR X 173 
CE 3 4 O THR EA 177 ? O THR X 178 N GLN EA 159 ? N GLN X 160 
CF 1 2 N GLN EA 146 ? N GLN X 147 O GLU EA 194 ? O GLU X 195 
CF 2 3 N VAL EA 195 ? N VAL X 196 O VAL EA 204 ? O VAL X 205 
CG 1 2 N TRP F  7   ? N TRP H 7   O THR F  21  ? O THR H 21  
CG 2 3 N CYS F  22  ? N CYS H 22  O PHE F  78  ? O PHE H 78  
CG 3 4 O ASN F  81  ? O ASN H 81  N THR F  68  ? N THR H 68  
CH 1 2 N LEU F  12  ? N LEU H 12  O THR F  116 ? O THR H 110 
CH 2 3 O THR F  113 ? O THR H 107 N TYR F  93  ? N TYR H 90  
CH 3 4 O PHE F  94  ? O PHE H 91  N VAL F  37  ? N VAL H 37  
CH 4 5 N TRP F  34  ? N TRP H 34  O ILE F  51  ? O ILE H 51  
CH 5 6 N GLU F  50  ? N GLU H 50  O ASN F  58  ? O ASN H 58  
CI 1 2 N SER F  126 ? N SER H 120 O LYS F  149 ? O LYS H 143 
CI 2 3 N ALA F  142 ? N ALA H 136 O VAL F  190 ? O VAL H 184 
CI 3 4 O VAL F  187 ? O VAL H 181 N HIS F  170 ? N HIS H 164 
CJ 1 2 N SER F  126 ? N SER H 120 O LYS F  149 ? O LYS H 143 
CJ 2 3 N ALA F  142 ? N ALA H 136 O VAL F  190 ? O VAL H 184 
CJ 3 4 O SER F  183 ? O SER H 177 N VAL F  175 ? N VAL H 169 
CK 1 2 N SER F  159 ? N SER H 153 O ASN F  203 ? O ASN H 197 
CK 2 3 N VAL F  204 ? N VAL H 198 O VAL F  213 ? O VAL H 207 
CL 1 2 N GLN I  3   ? N GLN C 3   O TYR I  25  ? O TYR C 25  
CL 2 3 N LEU I  18  ? N LEU C 18  O LEU I  82  ? O LEU C 82  
CL 3 4 O ASN I  81  ? O ASN C 81  N THR I  68  ? N THR C 68  
CM 1 2 N LEU I  12  ? N LEU C 12  O THR I  116 ? O THR C 110 
CM 2 3 O THR I  113 ? O THR C 107 N TYR I  93  ? N TYR C 90  
CM 3 4 O ARG I  98  ? O ARG C 95  N TYR I  33  ? N TYR C 33  
CM 4 5 N TRP I  34  ? N TRP C 34  O ILE I  51  ? O ILE C 51  
CM 5 6 N GLU I  50  ? N GLU C 50  O ASN I  58  ? O ASN C 58  
CN 1 2 N LEU I  12  ? N LEU C 12  O THR I  116 ? O THR C 110 
CN 2 3 O THR I  113 ? O THR C 107 N TYR I  93  ? N TYR C 90  
CN 3 4 N ARG I  97  ? N ARG C 94  O ASP I  107 ? O ASP C 101 
CO 1 2 N PHE I  128 ? N PHE C 122 O LEU I  147 ? O LEU C 141 
CO 2 3 N TYR I  151 ? N TYR C 145 O TYR I  182 ? O TYR C 176 
CO 3 4 O VAL I  187 ? O VAL C 181 N HIS I  170 ? N HIS C 164 
CP 1 2 N ALA I  142 ? N ALA C 136 O VAL I  190 ? O VAL C 184 
CP 2 3 O SER I  183 ? O SER C 177 N VAL I  175 ? N VAL C 169 
CQ 1 2 N SER I  159 ? N SER C 153 O ASN I  203 ? O ASN C 197 
CQ 2 3 N HIS I  206 ? N HIS C 200 O THR I  211 ? O THR C 205 
CR 1 2 N GLN M  5   ? N GLN F 5   O GLY M  23  ? O GLY F 23  
CR 2 3 N LEU M  18  ? N LEU F 18  O LEU M  82  ? O LEU F 82  
CR 3 4 O GLN M  77  ? O GLN F 77  N ASP M  72  ? N ASP F 72  
CS 1 2 N LEU M  12  ? N LEU F 12  O THR M  116 ? O THR F 110 
CS 2 3 O THR M  113 ? O THR F 107 N TYR M  93  ? N TYR F 90  
CS 3 4 O PHE M  94  ? O PHE F 91  N VAL M  37  ? N VAL F 37  
CS 4 5 N ARG M  38  ? N ARG F 38  O GLU M  46  ? O GLU F 46  
CS 5 6 N GLU M  50  ? N GLU F 50  O ASN M  58  ? O ASN F 58  
CT 1 2 N LEU M  12  ? N LEU F 12  O THR M  116 ? O THR F 110 
CT 2 3 O THR M  113 ? O THR F 107 N TYR M  93  ? N TYR F 90  
CT 3 4 N ARG M  97  ? N ARG F 94  O ASP M  107 ? O ASP F 101 
CU 1 2 N SER M  126 ? N SER F 120 O LYS M  149 ? O LYS F 143 
CU 2 3 N TYR M  151 ? N TYR F 145 O TYR M  182 ? O TYR F 176 
CU 3 4 O VAL M  187 ? O VAL F 181 N HIS M  170 ? N HIS F 164 
CV 1 2 N SER M  126 ? N SER F 120 O LYS M  149 ? O LYS F 143 
CV 2 3 N TYR M  151 ? N TYR F 145 O TYR M  182 ? O TYR F 176 
CV 3 4 O SER M  183 ? O SER F 177 N VAL M  175 ? N VAL F 169 
CW 1 2 N SER M  159 ? N SER F 153 O ASN M  203 ? O ASN F 197 
CW 2 3 N HIS M  206 ? N HIS F 200 O THR M  211 ? O THR F 205 
CW 3 4 N LYS M  212 ? N LYS F 206 O ASP BA 214 ? O ASP T 208 
CW 4 5 O VAL BA 213 ? O VAL T 207 N VAL BA 204 ? N VAL T 198 
CW 5 6 O ASN BA 203 ? O ASN T 197 N SER BA 159 ? N SER T 153 
CX 1 2 N TRP P  7   ? N TRP J 7   O THR P  21  ? O THR J 21  
CX 2 3 N CYS P  22  ? N CYS J 22  O PHE P  78  ? O PHE J 78  
CX 3 4 O ASN P  81  ? O ASN J 81  N THR P  68  ? N THR J 68  
CY 1 2 N LEU P  12  ? N LEU J 12  O THR P  116 ? O THR J 110 
CY 2 3 O THR P  113 ? O THR J 107 N TYR P  93  ? N TYR J 90  
CY 3 4 O ALA P  96  ? O ALA J 93  N SER P  35  ? N SER J 35  
CY 4 5 N ARG P  38  ? N ARG J 38  O GLU P  46  ? O GLU J 46  
CY 5 6 N GLU P  50  ? N GLU J 50  O ASN P  58  ? O ASN J 58  
CZ 1 2 N LEU P  12  ? N LEU J 12  O THR P  116 ? O THR J 110 
CZ 2 3 O THR P  113 ? O THR J 107 N TYR P  93  ? N TYR J 90  
CZ 3 4 N ARG P  97  ? N ARG J 94  O ASP P  107 ? O ASP J 101 
DA 1 2 N SER P  126 ? N SER J 120 O LYS P  149 ? O LYS J 143 
DA 2 3 N LEU P  144 ? N LEU J 138 O VAL P  188 ? O VAL J 182 
DA 3 4 O VAL P  187 ? O VAL J 181 N HIS P  170 ? N HIS J 164 
DB 1 2 N SER P  126 ? N SER J 120 O LYS P  149 ? O LYS J 143 
DB 2 3 N LEU P  144 ? N LEU J 138 O VAL P  188 ? O VAL J 182 
DB 3 4 O SER P  183 ? O SER J 177 N VAL P  175 ? N VAL J 169 
DC 1 2 N SER P  159 ? N SER J 153 O ASN P  203 ? O ASN J 197 
DC 2 3 N HIS P  206 ? N HIS J 200 O THR P  211 ? O THR J 205 
DD 1 2 N GLN T  5   ? N GLN N 5   O GLY T  23  ? O GLY N 23  
DD 2 3 N LEU T  18  ? N LEU N 18  O LEU T  82  ? O LEU N 82  
DD 3 4 O GLN T  77  ? O GLN N 77  N ASP T  72  ? N ASP N 72  
DE 1 2 N LEU T  12  ? N LEU N 12  O THR T  116 ? O THR N 110 
DE 2 3 O THR T  113 ? O THR N 107 N TYR T  93  ? N TYR N 90  
DE 3 4 O PHE T  94  ? O PHE N 91  N VAL T  37  ? N VAL N 37  
DE 4 5 N ARG T  38  ? N ARG N 38  O GLU T  46  ? O GLU N 46  
DE 5 6 N GLU T  50  ? N GLU N 50  O ASN T  58  ? O ASN N 58  
DF 1 2 N SER T  126 ? N SER N 120 O LYS T  149 ? O LYS N 143 
DF 2 3 N VAL T  148 ? N VAL N 142 O LEU T  184 ? O LEU N 178 
DF 3 4 O VAL T  187 ? O VAL N 181 N HIS T  170 ? N HIS N 164 
DG 1 2 N SER T  126 ? N SER N 120 O LYS T  149 ? O LYS N 143 
DG 2 3 N VAL T  148 ? N VAL N 142 O LEU T  184 ? O LEU N 178 
DG 3 4 O SER T  183 ? O SER N 177 N VAL T  175 ? N VAL N 169 
DH 1 2 N SER T  159 ? N SER N 153 O ASN T  203 ? O ASN N 197 
DH 2 3 N HIS T  206 ? N HIS N 200 O THR T  211 ? O THR N 205 
DI 1 2 N GLN X  3   ? N GLN Q 3   O TYR X  25  ? O TYR Q 25  
DI 2 3 N CYS X  22  ? N CYS Q 22  O PHE X  78  ? O PHE Q 78  
DI 3 4 O GLN X  77  ? O GLN Q 77  N ASP X  72  ? N ASP Q 72  
DJ 1 2 N LEU X  12  ? N LEU Q 12  O THR X  116 ? O THR Q 110 
DJ 2 3 O THR X  113 ? O THR Q 107 N TYR X  93  ? N TYR Q 90  
DJ 3 4 O PHE X  94  ? O PHE Q 91  N VAL X  37  ? N VAL Q 37  
DJ 4 5 N TRP X  34  ? N TRP Q 34  O ILE X  51  ? O ILE Q 51  
DK 1 2 N SER X  126 ? N SER Q 120 O LYS X  149 ? O LYS Q 143 
DK 2 3 N ALA X  142 ? N ALA Q 136 O VAL X  190 ? O VAL Q 184 
DK 3 4 O VAL X  187 ? O VAL Q 181 N HIS X  170 ? N HIS Q 164 
DL 1 2 N SER X  126 ? N SER Q 120 O LYS X  149 ? O LYS Q 143 
DL 2 3 N ALA X  142 ? N ALA Q 136 O VAL X  190 ? O VAL Q 184 
DL 3 4 O SER X  183 ? O SER Q 177 N VAL X  175 ? N VAL Q 169 
DM 1 2 N SER X  159 ? N SER Q 153 O ASN X  203 ? O ASN Q 197 
DM 2 3 N HIS X  206 ? N HIS Q 200 O THR X  211 ? O THR Q 205 
DN 1 2 N GLN BA 3   ? N GLN T 3   O TYR BA 25  ? O TYR T 25  
DN 2 3 N CYS BA 22  ? N CYS T 22  O PHE BA 78  ? O PHE T 78  
DN 3 4 O GLN BA 77  ? O GLN T 77  N ASP BA 72  ? N ASP T 72  
DO 1 2 N LEU BA 12  ? N LEU T 12  O THR BA 116 ? O THR T 110 
DO 2 3 O THR BA 113 ? O THR T 107 N TYR BA 93  ? N TYR T 90  
DO 3 4 O PHE BA 94  ? O PHE T 91  N VAL BA 37  ? N VAL T 37  
DO 4 5 N ARG BA 38  ? N ARG T 38  O GLU BA 46  ? O GLU T 46  
DO 5 6 N GLU BA 50  ? N GLU T 50  O ASN BA 58  ? O ASN T 58  
DP 1 2 N LEU BA 12  ? N LEU T 12  O THR BA 116 ? O THR T 110 
DP 2 3 O THR BA 113 ? O THR T 107 N TYR BA 93  ? N TYR T 90  
DP 3 4 N ARG BA 97  ? N ARG T 94  O ASP BA 107 ? O ASP T 101 
DQ 1 2 N SER BA 126 ? N SER T 120 O LYS BA 149 ? O LYS T 143 
DQ 2 3 N TYR BA 151 ? N TYR T 145 O TYR BA 182 ? O TYR T 176 
DQ 3 4 O VAL BA 187 ? O VAL T 181 N HIS BA 170 ? N HIS T 164 
DR 1 2 N SER BA 126 ? N SER T 120 O LYS BA 149 ? O LYS T 143 
DR 2 3 N TYR BA 151 ? N TYR T 145 O TYR BA 182 ? O TYR T 176 
DR 3 4 O SER BA 183 ? O SER T 177 N VAL BA 175 ? N VAL T 169 
DS 1 2 N GLN FA 5   ? N GLN W 5   O GLY FA 23  ? O GLY W 23  
DS 2 3 N LEU FA 18  ? N LEU W 18  O LEU FA 82  ? O LEU W 82  
DS 3 4 O SER FA 79  ? O SER W 79  N SER FA 70  ? N SER W 70  
DT 1 2 N LEU FA 12  ? N LEU W 12  O THR FA 116 ? O THR W 110 
DT 2 3 O THR FA 113 ? O THR W 107 N TYR FA 93  ? N TYR W 90  
DT 3 4 O PHE FA 94  ? O PHE W 91  N VAL FA 37  ? N VAL W 37  
DT 4 5 N ARG FA 38  ? N ARG W 38  O GLU FA 46  ? O GLU W 46  
DT 5 6 N GLU FA 50  ? N GLU W 50  O ASN FA 58  ? O ASN W 58  
DU 1 2 N SER FA 126 ? N SER W 120 O LYS FA 149 ? O LYS W 143 
DU 2 3 N TYR FA 151 ? N TYR W 145 O TYR FA 182 ? O TYR W 176 
DU 3 4 O VAL FA 187 ? O VAL W 181 N HIS FA 170 ? N HIS W 164 
DV 1 2 N SER FA 126 ? N SER W 120 O LYS FA 149 ? O LYS W 143 
DV 2 3 N TYR FA 151 ? N TYR W 145 O TYR FA 182 ? O TYR W 176 
DV 3 4 O SER FA 183 ? O SER W 177 N VAL FA 175 ? N VAL W 169 
DW 1 2 N SER FA 159 ? N SER W 153 O ASN FA 203 ? O ASN W 197 
DW 2 3 N VAL FA 204 ? N VAL W 198 O VAL FA 213 ? O VAL W 207 
# 
_database_PDB_matrix.entry_id          4R4N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4R4N 
_atom_sites.fract_transf_matrix[1][1]   0.008852 
_atom_sites.fract_transf_matrix[1][2]   0.001432 
_atom_sites.fract_transf_matrix[1][3]   0.000939 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007026 
_atom_sites.fract_transf_matrix[2][3]   0.002736 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006782 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . ASN A  1 6   ? 97.234  -11.922  -52.120  1.00 135.69 ? 49  ASN A N    1 
ATOM   2     C CA   . ASN A  1 6   ? 97.182  -13.124  -51.297  1.00 137.67 ? 49  ASN A CA   1 
ATOM   3     C C    . ASN A  1 6   ? 96.046  -14.047  -51.724  1.00 137.57 ? 49  ASN A C    1 
ATOM   4     O O    . ASN A  1 6   ? 95.294  -13.737  -52.651  1.00 135.53 ? 49  ASN A O    1 
ATOM   5     C CB   . ASN A  1 6   ? 97.029  -12.751  -49.817  1.00 137.37 ? 49  ASN A CB   1 
ATOM   6     C CG   . ASN A  1 6   ? 98.304  -12.177  -49.220  1.00 137.76 ? 49  ASN A CG   1 
ATOM   7     O OD1  . ASN A  1 6   ? 98.318  -11.051  -48.722  1.00 136.47 ? 49  ASN A OD1  1 
ATOM   8     N ND2  . ASN A  1 6   ? 99.380  -12.955  -49.258  1.00 139.29 ? 49  ASN A ND2  1 
ATOM   9     H HA   . ASN A  1 6   ? 98.016  -13.610  -51.398  1.00 162.53 ? 49  ASN A HA   1 
ATOM   10    H HB2  . ASN A  1 6   ? 96.330  -12.085  -49.729  1.00 162.36 ? 49  ASN A HB2  1 
ATOM   11    H HB3  . ASN A  1 6   ? 96.794  -13.547  -49.313  1.00 162.36 ? 49  ASN A HB3  1 
ATOM   12    H HD21 . ASN A  1 6   ? 100.126 -12.675  -48.932  1.00 163.61 ? 49  ASN A HD21 1 
ATOM   13    H HD22 . ASN A  1 6   ? 99.332  -13.740  -49.607  1.00 163.61 ? 49  ASN A HD22 1 
ATOM   14    N N    . THR A  1 7   ? 95.935  -15.182  -51.040  1.00 139.97 ? 50  THR A N    1 
ATOM   15    C CA   . THR A  1 7   ? 94.919  -16.186  -51.341  1.00 140.35 ? 50  THR A CA   1 
ATOM   16    C C    . THR A  1 7   ? 94.454  -16.837  -50.044  1.00 141.63 ? 50  THR A C    1 
ATOM   17    O O    . THR A  1 7   ? 95.126  -16.739  -49.016  1.00 142.62 ? 50  THR A O    1 
ATOM   18    C CB   . THR A  1 7   ? 95.459  -17.270  -52.307  1.00 142.87 ? 50  THR A CB   1 
ATOM   19    O OG1  . THR A  1 7   ? 96.274  -16.655  -53.310  1.00 142.39 ? 50  THR A OG1  1 
ATOM   20    C CG2  . THR A  1 7   ? 94.324  -18.026  -52.986  1.00 142.51 ? 50  THR A CG2  1 
ATOM   21    H H    . THR A  1 7   ? 96.446  -15.398  -50.383  1.00 219.89 ? 50  THR A H    1 
ATOM   22    H HA   . THR A  1 7   ? 94.156  -15.757  -51.759  1.00 218.87 ? 50  THR A HA   1 
ATOM   23    H HB   . THR A  1 7   ? 95.993  -17.907  -51.807  1.00 223.68 ? 50  THR A HB   1 
ATOM   24    H HG1  . THR A  1 7   ? 95.822  -16.098  -53.747  1.00 227.43 ? 50  THR A HG1  1 
ATOM   25    H HG21 . THR A  1 7   ? 94.685  -18.698  -53.584  1.00 223.51 ? 50  THR A HG21 1 
ATOM   26    H HG22 . THR A  1 7   ? 93.771  -18.462  -52.319  1.00 223.51 ? 50  THR A HG22 1 
ATOM   27    H HG23 . THR A  1 7   ? 93.775  -17.411  -53.497  1.00 223.51 ? 50  THR A HG23 1 
ATOM   28    N N    . THR A  1 8   ? 93.297  -17.488  -50.094  1.00 144.04 ? 51  THR A N    1 
ATOM   29    C CA   . THR A  1 8   ? 92.738  -18.175  -48.935  1.00 145.43 ? 51  THR A CA   1 
ATOM   30    C C    . THR A  1 8   ? 93.342  -19.569  -48.756  1.00 149.51 ? 51  THR A C    1 
ATOM   31    O O    . THR A  1 8   ? 93.556  -20.294  -49.729  1.00 151.04 ? 51  THR A O    1 
ATOM   32    C CB   . THR A  1 8   ? 91.211  -18.301  -49.055  1.00 143.02 ? 51  THR A CB   1 
ATOM   33    O OG1  . THR A  1 8   ? 90.881  -19.100  -50.199  1.00 142.95 ? 51  THR A OG1  1 
ATOM   34    C CG2  . THR A  1 8   ? 90.569  -16.924  -49.196  1.00 139.06 ? 51  THR A CG2  1 
ATOM   35    H H    . THR A  1 8   ? 92.808  -17.547  -50.800  1.00 208.62 ? 51  THR A H    1 
ATOM   36    H HA   . THR A  1 8   ? 92.934  -17.659  -48.137  1.00 205.67 ? 51  THR A HA   1 
ATOM   37    H HB   . THR A  1 8   ? 90.858  -18.723  -48.256  1.00 206.29 ? 51  THR A HB   1 
ATOM   38    H HG1  . THR A  1 8   ? 91.215  -19.867  -50.120  1.00 210.96 ? 51  THR A HG1  1 
ATOM   39    H HG21 . THR A  1 8   ? 89.606  -17.013  -49.272  1.00 205.98 ? 51  THR A HG21 1 
ATOM   40    H HG22 . THR A  1 8   ? 90.775  -16.381  -48.419  1.00 205.98 ? 51  THR A HG22 1 
ATOM   41    H HG23 . THR A  1 8   ? 90.907  -16.480  -49.990  1.00 205.98 ? 51  THR A HG23 1 
ATOM   42    N N    . LEU A  1 9   ? 93.598  -19.937  -47.504  1.00 143.70 ? 52  LEU A N    1 
ATOM   43    C CA   . LEU A  1 9   ? 94.247  -21.203  -47.172  1.00 147.29 ? 52  LEU A CA   1 
ATOM   44    C C    . LEU A  1 9   ? 93.248  -22.212  -46.623  1.00 149.36 ? 52  LEU A C    1 
ATOM   45    O O    . LEU A  1 9   ? 92.125  -21.855  -46.276  1.00 147.39 ? 52  LEU A O    1 
ATOM   46    C CB   . LEU A  1 9   ? 95.357  -20.977  -46.140  1.00 146.67 ? 52  LEU A CB   1 
ATOM   47    C CG   . LEU A  1 9   ? 96.628  -20.242  -46.581  1.00 144.86 ? 52  LEU A CG   1 
ATOM   48    C CD1  . LEU A  1 9   ? 96.369  -18.763  -46.845  1.00 142.13 ? 52  LEU A CD1  1 
ATOM   49    C CD2  . LEU A  1 9   ? 97.720  -20.410  -45.532  1.00 143.63 ? 52  LEU A CD2  1 
ATOM   50    H H    . LEU A  1 9   ? 93.403  -19.460  -46.815  1.00 101.84 ? 52  LEU A H    1 
ATOM   51    H HA   . LEU A  1 9   ? 94.647  -21.576  -47.972  1.00 104.69 ? 52  LEU A HA   1 
ATOM   52    H HB2  . LEU A  1 9   ? 94.980  -20.469  -45.406  1.00 104.82 ? 52  LEU A HB2  1 
ATOM   53    H HB3  . LEU A  1 9   ? 95.636  -21.846  -45.811  1.00 104.82 ? 52  LEU A HB3  1 
ATOM   54    H HG   . LEU A  1 9   ? 96.948  -20.638  -47.407  1.00 106.23 ? 52  LEU A HG   1 
ATOM   55    H HD11 . LEU A  1 9   ? 97.198  -18.341  -47.120  1.00 103.59 ? 52  LEU A HD11 1 
ATOM   56    H HD12 . LEU A  1 9   ? 95.705  -18.679  -47.548  1.00 103.59 ? 52  LEU A HD12 1 
ATOM   57    H HD13 . LEU A  1 9   ? 96.042  -18.350  -46.030  1.00 103.59 ? 52  LEU A HD13 1 
ATOM   58    H HD21 . LEU A  1 9   ? 98.516  -19.939  -45.827  1.00 106.96 ? 52  LEU A HD21 1 
ATOM   59    H HD22 . LEU A  1 9   ? 97.409  -20.040  -44.691  1.00 106.96 ? 52  LEU A HD22 1 
ATOM   60    H HD23 . LEU A  1 9   ? 97.914  -21.354  -45.427  1.00 106.96 ? 52  LEU A HD23 1 
ATOM   61    N N    . PHE A  1 10  ? 93.665  -23.475  -46.556  1.00 154.77 ? 53  PHE A N    1 
ATOM   62    C CA   . PHE A  1 10  ? 92.940  -24.482  -45.784  1.00 157.40 ? 53  PHE A CA   1 
ATOM   63    C C    . PHE A  1 10  ? 93.534  -24.508  -44.387  1.00 157.17 ? 53  PHE A C    1 
ATOM   64    O O    . PHE A  1 10  ? 94.343  -23.650  -44.031  1.00 154.04 ? 53  PHE A O    1 
ATOM   65    C CB   . PHE A  1 10  ? 93.040  -25.888  -46.392  1.00 162.00 ? 53  PHE A CB   1 
ATOM   66    C CG   . PHE A  1 10  ? 92.919  -25.933  -47.888  1.00 161.70 ? 53  PHE A CG   1 
ATOM   67    C CD1  . PHE A  1 10  ? 92.053  -25.089  -48.564  1.00 157.01 ? 53  PHE A CD1  1 
ATOM   68    C CD2  . PHE A  1 10  ? 93.672  -26.840  -48.619  1.00 165.75 ? 53  PHE A CD2  1 
ATOM   69    C CE1  . PHE A  1 10  ? 91.947  -25.143  -49.944  1.00 156.07 ? 53  PHE A CE1  1 
ATOM   70    C CE2  . PHE A  1 10  ? 93.572  -26.900  -49.996  1.00 165.61 ? 53  PHE A CE2  1 
ATOM   71    C CZ   . PHE A  1 10  ? 92.709  -26.052  -50.661  1.00 160.62 ? 53  PHE A CZ   1 
ATOM   72    H H    . PHE A  1 10  ? 94.367  -23.775  -46.951  1.00 169.21 ? 53  PHE A H    1 
ATOM   73    H HA   . PHE A  1 10  ? 92.004  -24.236  -45.721  1.00 169.75 ? 53  PHE A HA   1 
ATOM   74    H HB2  . PHE A  1 10  ? 93.900  -26.268  -46.155  1.00 175.97 ? 53  PHE A HB2  1 
ATOM   75    H HB3  . PHE A  1 10  ? 92.329  -26.435  -46.023  1.00 175.97 ? 53  PHE A HB3  1 
ATOM   76    H HD1  . PHE A  1 10  ? 91.541  -24.477  -48.087  1.00 178.99 ? 53  PHE A HD1  1 
ATOM   77    H HD2  . PHE A  1 10  ? 94.255  -27.413  -48.177  1.00 187.10 ? 53  PHE A HD2  1 
ATOM   78    H HE1  . PHE A  1 10  ? 91.365  -24.571  -50.388  1.00 183.75 ? 53  PHE A HE1  1 
ATOM   79    H HE2  . PHE A  1 10  ? 94.084  -27.511  -50.474  1.00 192.12 ? 53  PHE A HE2  1 
ATOM   80    H HZ   . PHE A  1 10  ? 92.639  -26.090  -51.587  1.00 190.19 ? 53  PHE A HZ   1 
ATOM   81    N N    . CYS A  1 11  ? 93.142  -25.509  -43.608  1.00 147.37 ? 54  CYS A N    1 
ATOM   82    C CA   . CYS A  1 11  ? 93.762  -25.767  -42.317  1.00 146.07 ? 54  CYS A CA   1 
ATOM   83    C C    . CYS A  1 11  ? 93.918  -27.269  -42.145  1.00 150.87 ? 54  CYS A C    1 
ATOM   84    O O    . CYS A  1 11  ? 93.686  -28.033  -43.081  1.00 155.45 ? 54  CYS A O    1 
ATOM   85    C CB   . CYS A  1 11  ? 92.936  -25.176  -41.172  1.00 142.22 ? 54  CYS A CB   1 
ATOM   86    S SG   . CYS A  1 11  ? 91.375  -26.036  -40.838  1.00 144.73 ? 54  CYS A SG   1 
ATOM   87    H H    . CYS A  1 11  ? 92.511  -26.059  -43.807  1.00 140.25 ? 54  CYS A H    1 
ATOM   88    H HA   . CYS A  1 11  ? 94.644  -25.364  -42.298  1.00 143.29 ? 54  CYS A HA   1 
ATOM   89    H HB2  . CYS A  1 11  ? 93.466  -25.205  -40.361  1.00 138.04 ? 54  CYS A HB2  1 
ATOM   90    H HB3  . CYS A  1 11  ? 92.722  -24.255  -41.389  1.00 138.04 ? 54  CYS A HB3  1 
ATOM   91    N N    . ALA A  1 12  ? 94.318  -27.691  -40.951  1.00 138.28 ? 55  ALA A N    1 
ATOM   92    C CA   . ALA A  1 12  ? 94.462  -29.111  -40.660  1.00 143.11 ? 55  ALA A CA   1 
ATOM   93    C C    . ALA A  1 12  ? 94.373  -29.372  -39.166  1.00 140.72 ? 55  ALA A C    1 
ATOM   94    O O    . ALA A  1 12  ? 94.750  -28.528  -38.353  1.00 134.46 ? 55  ALA A O    1 
ATOM   95    C CB   . ALA A  1 12  ? 95.768  -29.627  -41.201  1.00 144.04 ? 55  ALA A CB   1 
ATOM   96    H H    . ALA A  1 12  ? 94.512  -27.174  -40.291  1.00 115.07 ? 55  ALA A H    1 
ATOM   97    H HA   . ALA A  1 12  ? 93.743  -29.597  -41.094  1.00 123.01 ? 55  ALA A HA   1 
ATOM   98    H HB1  . ALA A  1 12  ? 95.843  -30.572  -40.997  1.00 132.83 ? 55  ALA A HB1  1 
ATOM   99    H HB2  . ALA A  1 12  ? 95.786  -29.493  -42.162  1.00 132.83 ? 55  ALA A HB2  1 
ATOM   100   H HB3  . ALA A  1 12  ? 96.496  -29.139  -40.785  1.00 132.83 ? 55  ALA A HB3  1 
ATOM   101   N N    . SER A  1 13  ? 93.884  -30.556  -38.814  1.00 140.27 ? 56  SER A N    1 
ATOM   102   C CA   . SER A  1 13  ? 93.668  -30.908  -37.417  1.00 138.52 ? 56  SER A CA   1 
ATOM   103   C C    . SER A  1 13  ? 93.473  -32.405  -37.245  1.00 145.14 ? 56  SER A C    1 
ATOM   104   O O    . SER A  1 13  ? 92.567  -32.999  -37.832  1.00 151.21 ? 56  SER A O    1 
ATOM   105   C CB   . SER A  1 13  ? 92.453  -30.162  -36.859  1.00 135.65 ? 56  SER A CB   1 
ATOM   106   O OG   . SER A  1 13  ? 91.257  -30.590  -37.490  1.00 140.08 ? 56  SER A OG   1 
ATOM   107   H H    . SER A  1 13  ? 93.668  -31.176  -39.369  1.00 189.49 ? 56  SER A H    1 
ATOM   108   H HA   . SER A  1 13  ? 94.446  -30.645  -36.901  1.00 191.77 ? 56  SER A HA   1 
ATOM   109   H HB2  . SER A  1 13  ? 92.387  -30.336  -35.907  1.00 182.78 ? 56  SER A HB2  1 
ATOM   110   H HB3  . SER A  1 13  ? 92.568  -29.212  -37.015  1.00 182.78 ? 56  SER A HB3  1 
ATOM   111   H HG   . SER A  1 13  ? 91.143  -31.413  -37.363  1.00 178.33 ? 56  SER A HG   1 
ATOM   112   N N    . ASP A  1 14  ? 94.330  -33.009  -36.433  1.00 144.42 ? 57  ASP A N    1 
ATOM   113   C CA   . ASP A  1 14  ? 94.183  -34.411  -36.081  1.00 148.37 ? 57  ASP A CA   1 
ATOM   114   C C    . ASP A  1 14  ? 93.131  -34.545  -34.979  1.00 147.04 ? 57  ASP A C    1 
ATOM   115   O O    . ASP A  1 14  ? 93.430  -34.988  -33.869  1.00 144.68 ? 57  ASP A O    1 
ATOM   116   C CB   . ASP A  1 14  ? 95.527  -34.999  -35.633  1.00 146.33 ? 57  ASP A CB   1 
ATOM   117   C CG   . ASP A  1 14  ? 96.563  -35.021  -36.753  1.00 147.10 ? 57  ASP A CG   1 
ATOM   118   O OD1  . ASP A  1 14  ? 97.163  -33.962  -37.043  1.00 143.07 ? 57  ASP A OD1  1 
ATOM   119   O OD2  . ASP A  1 14  ? 96.787  -36.102  -37.336  1.00 151.09 ? 57  ASP A OD2  1 
ATOM   120   H H    . ASP A  1 14  ? 95.009  -32.626  -36.071  1.00 199.92 ? 57  ASP A H    1 
ATOM   121   H HA   . ASP A  1 14  ? 93.876  -34.907  -36.856  1.00 206.93 ? 57  ASP A HA   1 
ATOM   122   H HB2  . ASP A  1 14  ? 95.881  -34.462  -34.907  1.00 214.87 ? 57  ASP A HB2  1 
ATOM   123   H HB3  . ASP A  1 14  ? 95.389  -35.912  -35.334  1.00 214.87 ? 57  ASP A HB3  1 
ATOM   124   N N    . ALA A  1 15  ? 91.899  -34.150  -35.297  1.00 152.16 ? 58  ALA A N    1 
ATOM   125   C CA   . ALA A  1 15  ? 90.797  -34.167  -34.339  1.00 148.55 ? 58  ALA A CA   1 
ATOM   126   C C    . ALA A  1 15  ? 89.831  -35.308  -34.636  1.00 148.26 ? 58  ALA A C    1 
ATOM   127   O O    . ALA A  1 15  ? 89.499  -35.565  -35.794  1.00 149.38 ? 58  ALA A O    1 
ATOM   128   C CB   . ALA A  1 15  ? 90.066  -32.842  -34.361  1.00 145.40 ? 58  ALA A CB   1 
ATOM   129   H H    . ALA A  1 15  ? 91.674  -33.864  -36.076  1.00 180.22 ? 58  ALA A H    1 
ATOM   130   H HA   . ALA A  1 15  ? 91.154  -34.299  -33.447  1.00 175.54 ? 58  ALA A HA   1 
ATOM   131   H HB1  . ALA A  1 15  ? 89.339  -32.872  -33.720  1.00 166.63 ? 58  ALA A HB1  1 
ATOM   132   H HB2  . ALA A  1 15  ? 90.687  -32.136  -34.125  1.00 166.63 ? 58  ALA A HB2  1 
ATOM   133   H HB3  . ALA A  1 15  ? 89.715  -32.691  -35.253  1.00 166.63 ? 58  ALA A HB3  1 
ATOM   134   N N    . LYS A  1 16  ? 89.377  -35.983  -33.586  1.00 155.23 ? 59  LYS A N    1 
ATOM   135   C CA   . LYS A  1 16  ? 88.498  -37.139  -33.737  1.00 154.79 ? 59  LYS A CA   1 
ATOM   136   C C    . LYS A  1 16  ? 87.117  -36.735  -34.240  1.00 151.46 ? 59  LYS A C    1 
ATOM   137   O O    . LYS A  1 16  ? 86.669  -35.613  -34.013  1.00 148.57 ? 59  LYS A O    1 
ATOM   138   C CB   . LYS A  1 16  ? 88.368  -37.884  -32.410  1.00 153.67 ? 59  LYS A CB   1 
ATOM   139   C CG   . LYS A  1 16  ? 89.686  -38.410  -31.864  1.00 156.06 ? 59  LYS A CG   1 
ATOM   140   C CD   . LYS A  1 16  ? 89.453  -39.479  -30.804  1.00 155.46 ? 59  LYS A CD   1 
ATOM   141   C CE   . LYS A  1 16  ? 90.760  -40.003  -30.217  1.00 157.08 ? 59  LYS A CE   1 
ATOM   142   N NZ   . LYS A  1 16  ? 91.577  -40.730  -31.229  1.00 160.63 ? 59  LYS A NZ   1 
ATOM   143   H H    . LYS A  1 16  ? 89.564  -35.792  -32.768  1.00 170.63 ? 59  LYS A H    1 
ATOM   144   H HA   . LYS A  1 16  ? 88.886  -37.747  -34.385  1.00 177.27 ? 59  LYS A HA   1 
ATOM   145   H HB2  . LYS A  1 16  ? 87.993  -37.281  -31.749  1.00 184.23 ? 59  LYS A HB2  1 
ATOM   146   H HB3  . LYS A  1 16  ? 87.776  -38.642  -32.535  1.00 184.23 ? 59  LYS A HB3  1 
ATOM   147   H HG2  . LYS A  1 16  ? 90.199  -38.804  -32.587  1.00 191.31 ? 59  LYS A HG2  1 
ATOM   148   H HG3  . LYS A  1 16  ? 90.180  -37.681  -31.458  1.00 191.31 ? 59  LYS A HG3  1 
ATOM   149   H HD2  . LYS A  1 16  ? 88.928  -39.102  -30.082  1.00 199.53 ? 59  LYS A HD2  1 
ATOM   150   H HD3  . LYS A  1 16  ? 88.982  -40.227  -31.205  1.00 199.53 ? 59  LYS A HD3  1 
ATOM   151   H HE2  . LYS A  1 16  ? 91.283  -39.256  -29.887  1.00 208.72 ? 59  LYS A HE2  1 
ATOM   152   H HE3  . LYS A  1 16  ? 90.560  -40.617  -29.493  1.00 208.72 ? 59  LYS A HE3  1 
ATOM   153   H HZ1  . LYS A  1 16  ? 92.331  -41.023  -30.858  1.00 216.54 ? 59  LYS A HZ1  1 
ATOM   154   H HZ2  . LYS A  1 16  ? 91.121  -41.426  -31.545  1.00 216.54 ? 59  LYS A HZ2  1 
ATOM   155   H HZ3  . LYS A  1 16  ? 91.779  -40.186  -31.904  1.00 216.54 ? 59  LYS A HZ3  1 
ATOM   156   N N    . ALA A  1 17  ? 86.446  -37.663  -34.914  1.00 154.33 ? 60  ALA A N    1 
ATOM   157   C CA   . ALA A  1 17  ? 85.136  -37.395  -35.496  1.00 151.11 ? 60  ALA A CA   1 
ATOM   158   C C    . ALA A  1 17  ? 84.013  -37.658  -34.499  1.00 147.96 ? 60  ALA A C    1 
ATOM   159   O O    . ALA A  1 17  ? 82.989  -36.976  -34.520  1.00 144.63 ? 60  ALA A O    1 
ATOM   160   C CB   . ALA A  1 17  ? 84.934  -38.236  -36.741  1.00 152.94 ? 60  ALA A CB   1 
ATOM   161   H H    . ALA A  1 17  ? 86.730  -38.463  -35.049  1.00 194.01 ? 60  ALA A H    1 
ATOM   162   H HA   . ALA A  1 17  ? 85.093  -36.462  -35.755  1.00 192.09 ? 60  ALA A HA   1 
ATOM   163   H HB1  . ALA A  1 17  ? 84.059  -38.044  -37.113  1.00 196.96 ? 60  ALA A HB1  1 
ATOM   164   H HB2  . ALA A  1 17  ? 85.624  -38.015  -37.386  1.00 196.96 ? 60  ALA A HB2  1 
ATOM   165   H HB3  . ALA A  1 17  ? 84.994  -39.174  -36.502  1.00 196.96 ? 60  ALA A HB3  1 
ATOM   166   N N    . TYR A  1 18  ? 84.203  -38.645  -33.629  1.00 173.01 ? 61  TYR A N    1 
ATOM   167   C CA   . TYR A  1 18  ? 83.165  -39.029  -32.675  1.00 170.63 ? 61  TYR A CA   1 
ATOM   168   C C    . TYR A  1 18  ? 83.174  -38.165  -31.420  1.00 168.71 ? 61  TYR A C    1 
ATOM   169   O O    . TYR A  1 18  ? 82.117  -37.801  -30.905  1.00 166.02 ? 61  TYR A O    1 
ATOM   170   C CB   . TYR A  1 18  ? 83.320  -40.495  -32.271  1.00 172.78 ? 61  TYR A CB   1 
ATOM   171   C CG   . TYR A  1 18  ? 82.344  -40.928  -31.192  1.00 170.79 ? 61  TYR A CG   1 
ATOM   172   C CD1  . TYR A  1 18  ? 80.971  -40.798  -31.375  1.00 168.20 ? 61  TYR A CD1  1 
ATOM   173   C CD2  . TYR A  1 18  ? 82.792  -41.466  -29.990  1.00 171.61 ? 61  TYR A CD2  1 
ATOM   174   C CE1  . TYR A  1 18  ? 80.074  -41.192  -30.393  1.00 166.78 ? 61  TYR A CE1  1 
ATOM   175   C CE2  . TYR A  1 18  ? 81.903  -41.866  -29.004  1.00 170.11 ? 61  TYR A CE2  1 
ATOM   176   C CZ   . TYR A  1 18  ? 80.546  -41.725  -29.211  1.00 167.83 ? 61  TYR A CZ   1 
ATOM   177   O OH   . TYR A  1 18  ? 79.657  -42.115  -28.235  1.00 166.71 ? 61  TYR A OH   1 
ATOM   178   H H    . TYR A  1 18  ? 84.924  -39.109  -33.570  1.00 233.71 ? 61  TYR A H    1 
ATOM   179   H HA   . TYR A  1 18  ? 82.298  -38.928  -33.099  1.00 237.14 ? 61  TYR A HA   1 
ATOM   180   H HB2  . TYR A  1 18  ? 83.170  -41.053  -33.050  1.00 247.87 ? 61  TYR A HB2  1 
ATOM   181   H HB3  . TYR A  1 18  ? 84.219  -40.634  -31.934  1.00 247.87 ? 61  TYR A HB3  1 
ATOM   182   H HD1  . TYR A  1 18  ? 80.649  -40.440  -32.170  1.00 256.52 ? 61  TYR A HD1  1 
ATOM   183   H HD2  . TYR A  1 18  ? 83.706  -41.564  -29.847  1.00 255.32 ? 61  TYR A HD2  1 
ATOM   184   H HE1  . TYR A  1 18  ? 79.159  -41.098  -30.532  1.00 262.38 ? 61  TYR A HE1  1 
ATOM   185   H HE2  . TYR A  1 18  ? 82.219  -42.223  -28.206  1.00 260.83 ? 61  TYR A HE2  1 
ATOM   186   H HH   . TYR A  1 18  ? 80.073  -42.420  -27.572  1.00 270.98 ? 61  TYR A HH   1 
ATOM   187   N N    . ASP A  1 19  ? 84.368  -37.855  -30.923  1.00 158.67 ? 62  ASP A N    1 
ATOM   188   C CA   . ASP A  1 19  ? 84.512  -37.082  -29.693  1.00 157.24 ? 62  ASP A CA   1 
ATOM   189   C C    . ASP A  1 19  ? 83.826  -35.728  -29.830  1.00 154.57 ? 62  ASP A C    1 
ATOM   190   O O    . ASP A  1 19  ? 84.359  -34.811  -30.454  1.00 154.83 ? 62  ASP A O    1 
ATOM   191   C CB   . ASP A  1 19  ? 85.992  -36.895  -29.344  1.00 159.42 ? 62  ASP A CB   1 
ATOM   192   C CG   . ASP A  1 19  ? 86.206  -36.451  -27.904  1.00 158.23 ? 62  ASP A CG   1 
ATOM   193   O OD1  . ASP A  1 19  ? 85.272  -35.875  -27.304  1.00 155.88 ? 62  ASP A OD1  1 
ATOM   194   O OD2  . ASP A  1 19  ? 87.316  -36.678  -27.373  1.00 159.68 ? 62  ASP A OD2  1 
ATOM   195   H H    . ASP A  1 19  ? 85.115  -38.082  -31.282  1.00 184.42 ? 62  ASP A H    1 
ATOM   196   H HA   . ASP A  1 19  ? 84.088  -37.563  -28.964  1.00 181.32 ? 62  ASP A HA   1 
ATOM   197   H HB2  . ASP A  1 19  ? 86.456  -37.738  -29.469  1.00 180.40 ? 62  ASP A HB2  1 
ATOM   198   H HB3  . ASP A  1 19  ? 86.371  -36.218  -29.926  1.00 180.40 ? 62  ASP A HB3  1 
ATOM   199   N N    . THR A  1 20  ? 82.640  -35.613  -29.242  1.00 154.76 ? 63  THR A N    1 
ATOM   200   C CA   . THR A  1 20  ? 81.859  -34.384  -29.325  1.00 152.42 ? 63  THR A CA   1 
ATOM   201   C C    . THR A  1 20  ? 82.411  -33.324  -28.382  1.00 152.25 ? 63  THR A C    1 
ATOM   202   O O    . THR A  1 20  ? 82.052  -33.272  -27.205  1.00 151.77 ? 63  THR A O    1 
ATOM   203   C CB   . THR A  1 20  ? 80.374  -34.631  -28.994  1.00 150.58 ? 63  THR A CB   1 
ATOM   204   O OG1  . THR A  1 20  ? 79.865  -35.688  -29.816  1.00 150.77 ? 63  THR A OG1  1 
ATOM   205   C CG2  . THR A  1 20  ? 79.548  -33.369  -29.231  1.00 148.60 ? 63  THR A CG2  1 
ATOM   206   H H    . THR A  1 20  ? 82.262  -36.237  -28.785  1.00 224.15 ? 63  THR A H    1 
ATOM   207   H HA   . THR A  1 20  ? 81.911  -34.038  -30.230  1.00 219.01 ? 63  THR A HA   1 
ATOM   208   H HB   . THR A  1 20  ? 80.289  -34.880  -28.060  1.00 225.39 ? 63  THR A HB   1 
ATOM   209   H HG1  . THR A  1 20  ? 79.055  -35.826  -29.639  1.00 233.37 ? 63  THR A HG1  1 
ATOM   210   H HG21 . THR A  1 20  ? 78.617  -33.538  -29.018  1.00 222.84 ? 63  THR A HG21 1 
ATOM   211   H HG22 . THR A  1 20  ? 79.875  -32.649  -28.668  1.00 222.84 ? 63  THR A HG22 1 
ATOM   212   H HG23 . THR A  1 20  ? 79.616  -33.099  -30.160  1.00 222.84 ? 63  THR A HG23 1 
ATOM   213   N N    . GLU A  1 21  ? 83.296  -32.487  -28.913  1.00 144.74 ? 64  GLU A N    1 
ATOM   214   C CA   . GLU A  1 21  ? 83.820  -31.337  -28.186  1.00 144.42 ? 64  GLU A CA   1 
ATOM   215   C C    . GLU A  1 21  ? 83.886  -30.161  -29.141  1.00 143.33 ? 64  GLU A C    1 
ATOM   216   O O    . GLU A  1 21  ? 84.235  -30.327  -30.311  1.00 144.12 ? 64  GLU A O    1 
ATOM   217   C CB   . GLU A  1 21  ? 85.196  -31.637  -27.595  1.00 146.47 ? 64  GLU A CB   1 
ATOM   218   C CG   . GLU A  1 21  ? 85.716  -30.552  -26.653  1.00 145.85 ? 64  GLU A CG   1 
ATOM   219   C CD   . GLU A  1 21  ? 86.778  -29.666  -27.280  1.00 144.67 ? 64  GLU A CD   1 
ATOM   220   O OE1  . GLU A  1 21  ? 86.712  -28.436  -27.089  1.00 140.15 ? 64  GLU A OE1  1 
ATOM   221   O OE2  . GLU A  1 21  ? 87.691  -30.196  -27.947  1.00 146.66 ? 64  GLU A OE2  1 
ATOM   222   H H    . GLU A  1 21  ? 83.614  -32.566  -29.708  1.00 126.20 ? 64  GLU A H    1 
ATOM   223   H HA   . GLU A  1 21  ? 83.216  -31.110  -27.461  1.00 121.33 ? 64  GLU A HA   1 
ATOM   224   H HB2  . GLU A  1 21  ? 85.147  -32.465  -27.093  1.00 124.27 ? 64  GLU A HB2  1 
ATOM   225   H HB3  . GLU A  1 21  ? 85.834  -31.730  -28.320  1.00 124.27 ? 64  GLU A HB3  1 
ATOM   226   H HG2  . GLU A  1 21  ? 84.974  -29.985  -26.388  1.00 123.02 ? 64  GLU A HG2  1 
ATOM   227   H HG3  . GLU A  1 21  ? 86.104  -30.974  -25.871  1.00 123.02 ? 64  GLU A HG3  1 
ATOM   228   N N    . VAL A  1 22  ? 83.539  -28.983  -28.635  1.00 149.99 ? 65  VAL A N    1 
ATOM   229   C CA   . VAL A  1 22  ? 83.384  -27.784  -29.456  1.00 147.62 ? 65  VAL A CA   1 
ATOM   230   C C    . VAL A  1 22  ? 84.481  -27.599  -30.502  1.00 147.98 ? 65  VAL A C    1 
ATOM   231   O O    . VAL A  1 22  ? 84.207  -27.184  -31.627  1.00 147.05 ? 65  VAL A O    1 
ATOM   232   C CB   . VAL A  1 22  ? 83.338  -26.524  -28.580  1.00 143.24 ? 65  VAL A CB   1 
ATOM   233   C CG1  . VAL A  1 22  ? 82.008  -26.433  -27.845  1.00 142.86 ? 65  VAL A CG1  1 
ATOM   234   C CG2  . VAL A  1 22  ? 84.501  -26.496  -27.605  1.00 142.64 ? 65  VAL A CG2  1 
ATOM   235   H H    . VAL A  1 22  ? 83.384  -28.848  -27.799  1.00 198.88 ? 65  VAL A H    1 
ATOM   236   H HA   . VAL A  1 22  ? 82.538  -27.843  -29.928  1.00 192.54 ? 65  VAL A HA   1 
ATOM   237   H HB   . VAL A  1 22  ? 83.413  -25.744  -29.153  1.00 189.83 ? 65  VAL A HB   1 
ATOM   238   H HG11 . VAL A  1 22  ? 82.003  -25.630  -27.300  1.00 191.50 ? 65  VAL A HG11 1 
ATOM   239   H HG12 . VAL A  1 22  ? 81.289  -26.395  -28.496  1.00 191.50 ? 65  VAL A HG12 1 
ATOM   240   H HG13 . VAL A  1 22  ? 81.904  -27.216  -27.282  1.00 191.50 ? 65  VAL A HG13 1 
ATOM   241   H HG21 . VAL A  1 22  ? 84.443  -25.690  -27.069  1.00 193.05 ? 65  VAL A HG21 1 
ATOM   242   H HG22 . VAL A  1 22  ? 84.452  -27.278  -27.034  1.00 193.05 ? 65  VAL A HG22 1 
ATOM   243   H HG23 . VAL A  1 22  ? 85.332  -26.502  -28.105  1.00 193.05 ? 65  VAL A HG23 1 
ATOM   244   N N    . HIS A  1 23  ? 85.716  -27.921  -30.136  1.00 138.04 ? 66  HIS A N    1 
ATOM   245   C CA   . HIS A  1 23  ? 86.834  -27.752  -31.051  1.00 137.98 ? 66  HIS A CA   1 
ATOM   246   C C    . HIS A  1 23  ? 86.857  -28.880  -32.069  1.00 143.55 ? 66  HIS A C    1 
ATOM   247   O O    . HIS A  1 23  ? 87.005  -28.642  -33.263  1.00 144.30 ? 66  HIS A O    1 
ATOM   248   C CB   . HIS A  1 23  ? 88.154  -27.695  -30.282  1.00 135.88 ? 66  HIS A CB   1 
ATOM   249   C CG   . HIS A  1 23  ? 88.313  -26.457  -29.456  1.00 129.60 ? 66  HIS A CG   1 
ATOM   250   N ND1  . HIS A  1 23  ? 89.409  -26.231  -28.652  1.00 127.11 ? 66  HIS A ND1  1 
ATOM   251   C CD2  . HIS A  1 23  ? 87.514  -25.373  -29.315  1.00 125.79 ? 66  HIS A CD2  1 
ATOM   252   C CE1  . HIS A  1 23  ? 89.276  -25.063  -28.049  1.00 122.58 ? 66  HIS A CE1  1 
ATOM   253   N NE2  . HIS A  1 23  ? 88.136  -24.522  -28.435  1.00 121.68 ? 66  HIS A NE2  1 
ATOM   254   H H    . HIS A  1 23  ? 85.932  -28.238  -29.366  1.00 124.33 ? 66  HIS A H    1 
ATOM   255   H HA   . HIS A  1 23  ? 86.728  -26.916  -31.530  1.00 123.55 ? 66  HIS A HA   1 
ATOM   256   H HB2  . HIS A  1 23  ? 88.202  -28.458  -29.686  1.00 126.93 ? 66  HIS A HB2  1 
ATOM   257   H HB3  . HIS A  1 23  ? 88.887  -27.725  -30.916  1.00 126.93 ? 66  HIS A HB3  1 
ATOM   258   H HD1  . HIS A  1 23  ? 90.074  -26.768  -28.556  1.00 129.63 ? 66  HIS A HD1  1 
ATOM   259   H HD2  . HIS A  1 23  ? 86.697  -25.232  -29.735  1.00 119.54 ? 66  HIS A HD2  1 
ATOM   260   H HE1  . HIS A  1 23  ? 89.884  -24.686  -27.454  1.00 127.37 ? 66  HIS A HE1  1 
ATOM   261   H HE2  . HIS A  1 23  ? 87.831  -23.761  -28.176  1.00 121.12 ? 66  HIS A HE2  1 
ATOM   262   N N    . ASN A  1 24  ? 86.685  -30.107  -31.595  1.00 135.77 ? 67  ASN A N    1 
ATOM   263   C CA   . ASN A  1 24  ? 86.758  -31.269  -32.467  1.00 138.41 ? 67  ASN A CA   1 
ATOM   264   C C    . ASN A  1 24  ? 85.651  -31.281  -33.512  1.00 136.47 ? 67  ASN A C    1 
ATOM   265   O O    . ASN A  1 24  ? 85.919  -31.455  -34.699  1.00 137.92 ? 67  ASN A O    1 
ATOM   266   C CB   . ASN A  1 24  ? 86.701  -32.556  -31.644  1.00 139.47 ? 67  ASN A CB   1 
ATOM   267   C CG   . ASN A  1 24  ? 87.857  -32.676  -30.675  1.00 141.05 ? 67  ASN A CG   1 
ATOM   268   O OD1  . ASN A  1 24  ? 88.416  -31.673  -30.237  1.00 140.26 ? 67  ASN A OD1  1 
ATOM   269   N ND2  . ASN A  1 24  ? 88.228  -33.906  -30.340  1.00 142.72 ? 67  ASN A ND2  1 
ATOM   270   H H    . ASN A  1 24  ? 86.524  -30.294  -30.771  1.00 95.41  ? 67  ASN A H    1 
ATOM   271   H HA   . ASN A  1 24  ? 87.607  -31.254  -32.936  1.00 99.93  ? 67  ASN A HA   1 
ATOM   272   H HB2  . ASN A  1 24  ? 85.877  -32.569  -31.132  1.00 107.49 ? 67  ASN A HB2  1 
ATOM   273   H HB3  . ASN A  1 24  ? 86.731  -33.318  -32.244  1.00 107.49 ? 67  ASN A HB3  1 
ATOM   274   H HD21 . ASN A  1 24  ? 88.881  -34.025  -29.792  1.00 118.67 ? 67  ASN A HD21 1 
ATOM   275   H HD22 . ASN A  1 24  ? 87.816  -34.585  -30.670  1.00 118.67 ? 67  ASN A HD22 1 
ATOM   276   N N    . VAL A  1 25  ? 84.413  -31.088  -33.070  1.00 137.63 ? 68  VAL A N    1 
ATOM   277   C CA   . VAL A  1 25  ? 83.263  -31.177  -33.963  1.00 135.63 ? 68  VAL A CA   1 
ATOM   278   C C    . VAL A  1 25  ? 83.367  -30.151  -35.082  1.00 134.68 ? 68  VAL A C    1 
ATOM   279   O O    . VAL A  1 25  ? 83.049  -30.445  -36.234  1.00 134.57 ? 68  VAL A O    1 
ATOM   280   C CB   . VAL A  1 25  ? 81.939  -30.965  -33.211  1.00 132.94 ? 68  VAL A CB   1 
ATOM   281   C CG1  . VAL A  1 25  ? 80.753  -31.119  -34.158  1.00 131.12 ? 68  VAL A CG1  1 
ATOM   282   C CG2  . VAL A  1 25  ? 81.819  -31.951  -32.059  1.00 133.77 ? 68  VAL A CG2  1 
ATOM   283   H H    . VAL A  1 25  ? 84.211  -30.903  -32.255  1.00 146.95 ? 68  VAL A H    1 
ATOM   284   H HA   . VAL A  1 25  ? 83.242  -32.060  -34.365  1.00 147.26 ? 68  VAL A HA   1 
ATOM   285   H HB   . VAL A  1 25  ? 81.920  -30.067  -32.844  1.00 148.70 ? 68  VAL A HB   1 
ATOM   286   H HG11 . VAL A  1 25  ? 79.932  -30.981  -33.661  1.00 150.24 ? 68  VAL A HG11 1 
ATOM   287   H HG12 . VAL A  1 25  ? 80.827  -30.459  -34.865  1.00 150.24 ? 68  VAL A HG12 1 
ATOM   288   H HG13 . VAL A  1 25  ? 80.765  -32.012  -34.537  1.00 150.24 ? 68  VAL A HG13 1 
ATOM   289   H HG21 . VAL A  1 25  ? 80.978  -31.799  -31.600  1.00 155.12 ? 68  VAL A HG21 1 
ATOM   290   H HG22 . VAL A  1 25  ? 81.845  -32.854  -32.413  1.00 155.12 ? 68  VAL A HG22 1 
ATOM   291   H HG23 . VAL A  1 25  ? 82.559  -31.814  -31.448  1.00 155.12 ? 68  VAL A HG23 1 
ATOM   292   N N    . TRP A  1 26  ? 83.808  -28.946  -34.736  1.00 137.93 ? 69  TRP A N    1 
ATOM   293   C CA   . TRP A  1 26  ? 84.045  -27.910  -35.733  1.00 136.91 ? 69  TRP A CA   1 
ATOM   294   C C    . TRP A  1 26  ? 85.250  -28.277  -36.591  1.00 140.11 ? 69  TRP A C    1 
ATOM   295   O O    . TRP A  1 26  ? 85.235  -28.094  -37.809  1.00 140.09 ? 69  TRP A O    1 
ATOM   296   C CB   . TRP A  1 26  ? 84.268  -26.548  -35.067  1.00 134.41 ? 69  TRP A CB   1 
ATOM   297   C CG   . TRP A  1 26  ? 84.775  -25.500  -36.019  1.00 133.06 ? 69  TRP A CG   1 
ATOM   298   C CD1  . TRP A  1 26  ? 84.029  -24.605  -36.729  1.00 130.65 ? 69  TRP A CD1  1 
ATOM   299   C CD2  . TRP A  1 26  ? 86.142  -25.247  -36.367  1.00 134.01 ? 69  TRP A CD2  1 
ATOM   300   N NE1  . TRP A  1 26  ? 84.847  -23.810  -37.496  1.00 130.25 ? 69  TRP A NE1  1 
ATOM   301   C CE2  . TRP A  1 26  ? 86.148  -24.185  -37.292  1.00 132.17 ? 69  TRP A CE2  1 
ATOM   302   C CE3  . TRP A  1 26  ? 87.361  -25.819  -35.988  1.00 136.08 ? 69  TRP A CE3  1 
ATOM   303   C CZ2  . TRP A  1 26  ? 87.326  -23.682  -37.843  1.00 132.37 ? 69  TRP A CZ2  1 
ATOM   304   C CZ3  . TRP A  1 26  ? 88.530  -25.317  -36.536  1.00 135.61 ? 69  TRP A CZ3  1 
ATOM   305   C CH2  . TRP A  1 26  ? 88.504  -24.261  -37.453  1.00 133.86 ? 69  TRP A CH2  1 
ATOM   306   H H    . TRP A  1 26  ? 83.979  -28.704  -33.929  1.00 150.43 ? 69  TRP A H    1 
ATOM   307   H HA   . TRP A  1 26  ? 83.269  -27.841  -36.312  1.00 145.99 ? 69  TRP A HA   1 
ATOM   308   H HB2  . TRP A  1 26  ? 83.426  -26.235  -34.701  1.00 141.80 ? 69  TRP A HB2  1 
ATOM   309   H HB3  . TRP A  1 26  ? 84.921  -26.647  -34.357  1.00 141.80 ? 69  TRP A HB3  1 
ATOM   310   H HD1  . TRP A  1 26  ? 83.102  -24.541  -36.697  1.00 136.94 ? 69  TRP A HD1  1 
ATOM   311   H HE1  . TRP A  1 26  ? 84.584  -23.180  -38.019  1.00 134.27 ? 69  TRP A HE1  1 
ATOM   312   H HE3  . TRP A  1 26  ? 87.386  -26.523  -35.381  1.00 138.30 ? 69  TRP A HE3  1 
ATOM   313   H HZ2  . TRP A  1 26  ? 87.313  -22.979  -38.451  1.00 132.52 ? 69  TRP A HZ2  1 
ATOM   314   H HZ3  . TRP A  1 26  ? 89.346  -25.689  -36.290  1.00 137.51 ? 69  TRP A HZ3  1 
ATOM   315   H HH2  . TRP A  1 26  ? 89.305  -23.943  -37.803  1.00 134.39 ? 69  TRP A HH2  1 
ATOM   316   N N    . ALA A  1 27  ? 86.292  -28.794  -35.945  1.00 135.52 ? 70  ALA A N    1 
ATOM   317   C CA   . ALA A  1 27  ? 87.524  -29.168  -36.634  1.00 139.54 ? 70  ALA A CA   1 
ATOM   318   C C    . ALA A  1 27  ? 87.259  -30.270  -37.647  1.00 141.87 ? 70  ALA A C    1 
ATOM   319   O O    . ALA A  1 27  ? 87.864  -30.304  -38.717  1.00 144.34 ? 70  ALA A O    1 
ATOM   320   C CB   . ALA A  1 27  ? 88.583  -29.618  -35.630  1.00 142.39 ? 70  ALA A CB   1 
ATOM   321   H H    . ALA A  1 27  ? 86.310  -28.940  -35.097  1.00 109.05 ? 70  ALA A H    1 
ATOM   322   H HA   . ALA A  1 27  ? 87.869  -28.397  -37.110  1.00 111.27 ? 70  ALA A HA   1 
ATOM   323   H HB1  . ALA A  1 27  ? 89.390  -29.861  -36.110  1.00 114.97 ? 70  ALA A HB1  1 
ATOM   324   H HB2  . ALA A  1 27  ? 88.768  -28.888  -35.019  1.00 114.97 ? 70  ALA A HB2  1 
ATOM   325   H HB3  . ALA A  1 27  ? 88.246  -30.384  -35.139  1.00 114.97 ? 70  ALA A HB3  1 
ATOM   326   N N    . THR A  1 28  ? 86.344  -31.167  -37.303  1.00 141.77 ? 71  THR A N    1 
ATOM   327   C CA   . THR A  1 28  ? 86.032  -32.302  -38.158  1.00 143.34 ? 71  THR A CA   1 
ATOM   328   C C    . THR A  1 28  ? 85.281  -31.849  -39.411  1.00 141.00 ? 71  THR A C    1 
ATOM   329   O O    . THR A  1 28  ? 85.381  -32.482  -40.461  1.00 142.95 ? 71  THR A O    1 
ATOM   330   C CB   . THR A  1 28  ? 85.198  -33.352  -37.402  1.00 142.24 ? 71  THR A CB   1 
ATOM   331   O OG1  . THR A  1 28  ? 85.759  -33.571  -36.101  1.00 143.38 ? 71  THR A OG1  1 
ATOM   332   C CG2  . THR A  1 28  ? 85.171  -34.668  -38.155  1.00 144.76 ? 71  THR A CG2  1 
ATOM   333   H H    . THR A  1 28  ? 85.887  -31.141  -36.575  1.00 167.27 ? 71  THR A H    1 
ATOM   334   H HA   . THR A  1 28  ? 86.860  -32.722  -38.440  1.00 172.97 ? 71  THR A HA   1 
ATOM   335   H HB   . THR A  1 28  ? 84.286  -33.034  -37.310  1.00 178.34 ? 71  THR A HB   1 
ATOM   336   H HG1  . THR A  1 28  ? 85.759  -32.853  -35.664  1.00 181.13 ? 71  THR A HG1  1 
ATOM   337   H HG21 . THR A  1 28  ? 84.642  -35.318  -37.668  1.00 185.33 ? 71  THR A HG21 1 
ATOM   338   H HG22 . THR A  1 28  ? 84.779  -34.538  -39.034  1.00 185.33 ? 71  THR A HG22 1 
ATOM   339   H HG23 . THR A  1 28  ? 86.073  -35.008  -38.260  1.00 185.33 ? 71  THR A HG23 1 
ATOM   340   N N    . HIS A  1 29  ? 84.547  -30.746  -39.299  1.00 146.59 ? 72  HIS A N    1 
ATOM   341   C CA   . HIS A  1 29  ? 83.762  -30.219  -40.413  1.00 143.80 ? 72  HIS A CA   1 
ATOM   342   C C    . HIS A  1 29  ? 84.375  -28.954  -41.025  1.00 143.34 ? 72  HIS A C    1 
ATOM   343   O O    . HIS A  1 29  ? 83.653  -28.104  -41.553  1.00 139.85 ? 72  HIS A O    1 
ATOM   344   C CB   . HIS A  1 29  ? 82.332  -29.916  -39.952  1.00 139.59 ? 72  HIS A CB   1 
ATOM   345   C CG   . HIS A  1 29  ? 81.493  -31.134  -39.719  1.00 139.37 ? 72  HIS A CG   1 
ATOM   346   N ND1  . HIS A  1 29  ? 81.321  -32.113  -40.673  1.00 140.44 ? 72  HIS A ND1  1 
ATOM   347   C CD2  . HIS A  1 29  ? 80.756  -31.517  -38.649  1.00 138.31 ? 72  HIS A CD2  1 
ATOM   348   C CE1  . HIS A  1 29  ? 80.524  -33.054  -40.197  1.00 139.95 ? 72  HIS A CE1  1 
ATOM   349   N NE2  . HIS A  1 29  ? 80.167  -32.716  -38.971  1.00 138.63 ? 72  HIS A NE2  1 
ATOM   350   H H    . HIS A  1 29  ? 84.485  -30.279  -38.580  1.00 237.25 ? 72  HIS A H    1 
ATOM   351   H HA   . HIS A  1 29  ? 83.714  -30.893  -41.109  1.00 237.60 ? 72  HIS A HA   1 
ATOM   352   H HB2  . HIS A  1 29  ? 82.372  -29.421  -39.119  1.00 238.36 ? 72  HIS A HB2  1 
ATOM   353   H HB3  . HIS A  1 29  ? 81.892  -29.380  -40.631  1.00 238.36 ? 72  HIS A HB3  1 
ATOM   354   H HD1  . HIS A  1 29  ? 81.680  -32.115  -41.454  1.00 242.39 ? 72  HIS A HD1  1 
ATOM   355   H HD2  . HIS A  1 29  ? 80.669  -31.058  -37.845  1.00 244.59 ? 72  HIS A HD2  1 
ATOM   356   H HE1  . HIS A  1 29  ? 80.260  -33.823  -40.648  1.00 246.39 ? 72  HIS A HE1  1 
ATOM   357   H HE2  . HIS A  1 29  ? 79.651  -33.173  -38.457  1.00 247.90 ? 72  HIS A HE2  1 
ATOM   358   N N    . ALA A  1 30  ? 85.699  -28.822  -40.962  1.00 142.36 ? 73  ALA A N    1 
ATOM   359   C CA   . ALA A  1 30  ? 86.355  -27.625  -41.492  1.00 141.72 ? 73  ALA A CA   1 
ATOM   360   C C    . ALA A  1 30  ? 87.860  -27.782  -41.709  1.00 146.33 ? 73  ALA A C    1 
ATOM   361   O O    . ALA A  1 30  ? 88.551  -26.792  -41.946  1.00 145.62 ? 73  ALA A O    1 
ATOM   362   C CB   . ALA A  1 30  ? 86.099  -26.450  -40.563  1.00 138.23 ? 73  ALA A CB   1 
ATOM   363   H H    . ALA A  1 30  ? 86.235  -29.403  -40.622  1.00 155.27 ? 73  ALA A H    1 
ATOM   364   H HA   . ALA A  1 30  ? 85.958  -27.412  -42.350  1.00 151.31 ? 73  ALA A HA   1 
ATOM   365   H HB1  . ALA A  1 30  ? 86.537  -25.663  -40.923  1.00 146.06 ? 73  ALA A HB1  1 
ATOM   366   H HB2  . ALA A  1 30  ? 85.142  -26.298  -40.503  1.00 146.06 ? 73  ALA A HB2  1 
ATOM   367   H HB3  . ALA A  1 30  ? 86.457  -26.657  -39.686  1.00 146.06 ? 73  ALA A HB3  1 
ATOM   368   N N    . CYS A  1 31  ? 88.366  -29.012  -41.640  1.00 144.01 ? 74  CYS A N    1 
ATOM   369   C CA   . CYS A  1 31  ? 89.800  -29.257  -41.793  1.00 148.72 ? 74  CYS A CA   1 
ATOM   370   C C    . CYS A  1 31  ? 90.080  -30.632  -42.397  1.00 153.54 ? 74  CYS A C    1 
ATOM   371   O O    . CYS A  1 31  ? 89.155  -31.368  -42.744  1.00 152.11 ? 74  CYS A O    1 
ATOM   372   C CB   . CYS A  1 31  ? 90.507  -29.130  -40.439  1.00 149.07 ? 74  CYS A CB   1 
ATOM   373   S SG   . CYS A  1 31  ? 90.470  -27.468  -39.714  1.00 142.29 ? 74  CYS A SG   1 
ATOM   374   H H    . CYS A  1 31  ? 87.900  -29.722  -41.507  1.00 96.46  ? 74  CYS A H    1 
ATOM   375   H HA   . CYS A  1 31  ? 90.172  -28.588  -42.389  1.00 99.82  ? 74  CYS A HA   1 
ATOM   376   H HB2  . CYS A  1 31  ? 90.083  -29.734  -39.810  1.00 98.73  ? 74  CYS A HB2  1 
ATOM   377   H HB3  . CYS A  1 31  ? 91.438  -29.379  -40.552  1.00 98.73  ? 74  CYS A HB3  1 
ATOM   378   N N    . VAL A  1 32  ? 91.365  -30.960  -42.523  1.00 146.10 ? 75  VAL A N    1 
ATOM   379   C CA   . VAL A  1 32  ? 91.809  -32.252  -43.048  1.00 151.46 ? 75  VAL A CA   1 
ATOM   380   C C    . VAL A  1 32  ? 92.949  -32.781  -42.177  1.00 156.41 ? 75  VAL A C    1 
ATOM   381   O O    . VAL A  1 32  ? 93.705  -31.995  -41.616  1.00 152.56 ? 75  VAL A O    1 
ATOM   382   C CB   . VAL A  1 32  ? 92.286  -32.138  -44.506  1.00 152.95 ? 75  VAL A CB   1 
ATOM   383   C CG1  . VAL A  1 32  ? 92.521  -33.509  -45.098  1.00 157.24 ? 75  VAL A CG1  1 
ATOM   384   C CG2  . VAL A  1 32  ? 91.272  -31.380  -45.343  1.00 146.75 ? 75  VAL A CG2  1 
ATOM   385   H H    . VAL A  1 32  ? 92.014  -30.439  -42.306  1.00 102.01 ? 75  VAL A H    1 
ATOM   386   H HA   . VAL A  1 32  ? 91.075  -32.885  -43.013  1.00 111.24 ? 75  VAL A HA   1 
ATOM   387   H HB   . VAL A  1 32  ? 93.124  -31.650  -44.530  1.00 114.82 ? 75  VAL A HB   1 
ATOM   388   H HG11 . VAL A  1 32  ? 92.821  -33.409  -46.015  1.00 126.00 ? 75  VAL A HG11 1 
ATOM   389   H HG12 . VAL A  1 32  ? 93.199  -33.966  -44.576  1.00 126.00 ? 75  VAL A HG12 1 
ATOM   390   H HG13 . VAL A  1 32  ? 91.691  -34.010  -45.074  1.00 126.00 ? 75  VAL A HG13 1 
ATOM   391   H HG21 . VAL A  1 32  ? 91.597  -31.323  -46.256  1.00 112.24 ? 75  VAL A HG21 1 
ATOM   392   H HG22 . VAL A  1 32  ? 90.427  -31.855  -45.322  1.00 112.24 ? 75  VAL A HG22 1 
ATOM   393   H HG23 . VAL A  1 32  ? 91.162  -30.490  -44.975  1.00 112.24 ? 75  VAL A HG23 1 
ATOM   394   N N    . PRO A  1 33  ? 93.068  -34.111  -42.044  1.00 157.30 ? 76  PRO A N    1 
ATOM   395   C CA   . PRO A  1 33  ? 94.170  -34.657  -41.239  1.00 157.95 ? 76  PRO A CA   1 
ATOM   396   C C    . PRO A  1 33  ? 95.575  -34.313  -41.740  1.00 154.32 ? 76  PRO A C    1 
ATOM   397   O O    . PRO A  1 33  ? 96.387  -33.834  -40.943  1.00 148.69 ? 76  PRO A O    1 
ATOM   398   C CB   . PRO A  1 33  ? 93.932  -36.162  -41.318  1.00 159.31 ? 76  PRO A CB   1 
ATOM   399   C CG   . PRO A  1 33  ? 92.454  -36.289  -41.490  1.00 156.73 ? 76  PRO A CG   1 
ATOM   400   C CD   . PRO A  1 33  ? 92.060  -35.140  -42.362  1.00 155.05 ? 76  PRO A CD   1 
ATOM   401   H HA   . PRO A  1 33  ? 94.083  -34.370  -40.317  1.00 51.63  ? 76  PRO A HA   1 
ATOM   402   H HB2  . PRO A  1 33  ? 94.402  -36.531  -42.082  1.00 59.52  ? 76  PRO A HB2  1 
ATOM   403   H HB3  . PRO A  1 33  ? 94.222  -36.586  -40.495  1.00 59.52  ? 76  PRO A HB3  1 
ATOM   404   H HG2  . PRO A  1 33  ? 92.247  -37.133  -41.922  1.00 52.52  ? 76  PRO A HG2  1 
ATOM   405   H HG3  . PRO A  1 33  ? 92.018  -36.229  -40.626  1.00 52.52  ? 76  PRO A HG3  1 
ATOM   406   H HD2  . PRO A  1 33  ? 92.116  -35.390  -43.297  1.00 44.71  ? 76  PRO A HD2  1 
ATOM   407   H HD3  . PRO A  1 33  ? 91.172  -34.827  -42.129  1.00 44.71  ? 76  PRO A HD3  1 
ATOM   408   N N    . THR A  1 34  ? 95.873  -34.593  -43.009  1.00 185.79 ? 77  THR A N    1 
ATOM   409   C CA   . THR A  1 34  ? 97.166  -34.237  -43.607  1.00 181.67 ? 77  THR A CA   1 
ATOM   410   C C    . THR A  1 34  ? 98.282  -35.071  -42.969  1.00 180.00 ? 77  THR A C    1 
ATOM   411   O O    . THR A  1 34  ? 98.019  -35.779  -42.000  1.00 181.20 ? 77  THR A O    1 
ATOM   412   C CB   . THR A  1 34  ? 97.456  -32.729  -43.441  1.00 175.68 ? 77  THR A CB   1 
ATOM   413   O OG1  . THR A  1 34  ? 97.853  -32.448  -42.092  1.00 171.38 ? 77  THR A OG1  1 
ATOM   414   C CG2  . THR A  1 34  ? 96.241  -31.900  -43.810  1.00 176.62 ? 77  THR A CG2  1 
ATOM   415   H H    . THR A  1 34  ? 95.339  -34.993  -43.552  1.00 203.49 ? 77  THR A H    1 
ATOM   416   H HA   . THR A  1 34  ? 97.144  -34.438  -44.556  1.00 212.49 ? 77  THR A HA   1 
ATOM   417   H HB   . THR A  1 34  ? 98.178  -32.480  -44.039  1.00 208.16 ? 77  THR A HB   1 
ATOM   418   H HG1  . THR A  1 34  ? 98.548  -32.880  -41.901  1.00 204.71 ? 77  THR A HG1  1 
ATOM   419   H HG21 . THR A  1 34  ? 96.438  -30.956  -43.701  1.00 197.61 ? 77  THR A HG21 1 
ATOM   420   H HG22 . THR A  1 34  ? 95.996  -32.066  -44.734  1.00 197.61 ? 77  THR A HG22 1 
ATOM   421   H HG23 . THR A  1 34  ? 95.494  -32.134  -43.238  1.00 197.61 ? 77  THR A HG23 1 
ATOM   422   N N    . ASP A  1 35  ? 99.521  -35.019  -43.471  1.00 208.68 ? 78  ASP A N    1 
ATOM   423   C CA   . ASP A  1 35  ? 99.958  -34.175  -44.587  1.00 206.52 ? 78  ASP A CA   1 
ATOM   424   C C    . ASP A  1 35  ? 100.954 -34.917  -45.476  1.00 207.11 ? 78  ASP A C    1 
ATOM   425   O O    . ASP A  1 35  ? 101.446 -35.982  -45.103  1.00 208.43 ? 78  ASP A O    1 
ATOM   426   C CB   . ASP A  1 35  ? 100.613 -32.887  -44.063  1.00 200.61 ? 78  ASP A CB   1 
ATOM   427   C CG   . ASP A  1 35  ? 102.049 -33.098  -43.616  1.00 197.64 ? 78  ASP A CG   1 
ATOM   428   O OD1  . ASP A  1 35  ? 102.329 -34.134  -42.977  1.00 199.15 ? 78  ASP A OD1  1 
ATOM   429   O OD2  . ASP A  1 35  ? 102.896 -32.228  -43.906  1.00 194.05 ? 78  ASP A OD2  1 
ATOM   430   H H    . ASP A  1 35  ? 100.164 -35.496  -43.157  1.00 422.14 ? 78  ASP A H    1 
ATOM   431   H HA   . ASP A  1 35  ? 99.189  -33.930  -45.126  1.00 421.51 ? 78  ASP A HA   1 
ATOM   432   H HB2  . ASP A  1 35  ? 100.614 -32.223  -44.770  1.00 415.19 ? 78  ASP A HB2  1 
ATOM   433   H HB3  . ASP A  1 35  ? 100.107 -32.561  -43.302  1.00 415.19 ? 78  ASP A HB3  1 
ATOM   434   N N    . PRO A  1 36  ? 101.260 -34.352  -46.659  1.00 210.06 ? 79  PRO A N    1 
ATOM   435   C CA   . PRO A  1 36  ? 102.359 -34.878  -47.477  1.00 209.65 ? 79  PRO A CA   1 
ATOM   436   C C    . PRO A  1 36  ? 103.692 -34.785  -46.758  1.00 206.33 ? 79  PRO A C    1 
ATOM   437   O O    . PRO A  1 36  ? 104.175 -33.687  -46.485  1.00 202.47 ? 79  PRO A O    1 
ATOM   438   C CB   . PRO A  1 36  ? 102.350 -33.975  -48.716  1.00 208.06 ? 79  PRO A CB   1 
ATOM   439   C CG   . PRO A  1 36  ? 100.978 -33.449  -48.790  1.00 209.57 ? 79  PRO A CG   1 
ATOM   440   C CD   . PRO A  1 36  ? 100.507 -33.304  -47.369  1.00 209.41 ? 79  PRO A CD   1 
ATOM   441   H HA   . PRO A  1 36  ? 102.187 -35.797  -47.737  1.00 352.27 ? 79  PRO A HA   1 
ATOM   442   H HB2  . PRO A  1 36  ? 102.988 -33.255  -48.601  1.00 345.65 ? 79  PRO A HB2  1 
ATOM   443   H HB3  . PRO A  1 36  ? 102.560 -34.500  -49.505  1.00 345.65 ? 79  PRO A HB3  1 
ATOM   444   H HG2  . PRO A  1 36  ? 100.985 -32.588  -49.236  1.00 332.20 ? 79  PRO A HG2  1 
ATOM   445   H HG3  . PRO A  1 36  ? 100.416 -34.077  -49.272  1.00 332.20 ? 79  PRO A HG3  1 
ATOM   446   H HD2  . PRO A  1 36  ? 100.739 -32.427  -47.023  1.00 325.23 ? 79  PRO A HD2  1 
ATOM   447   H HD3  . PRO A  1 36  ? 99.554  -33.471  -47.308  1.00 325.23 ? 79  PRO A HD3  1 
ATOM   448   N N    . SER A  1 37  ? 104.283 -35.930  -46.455  1.00 206.84 ? 80  SER A N    1 
ATOM   449   C CA   . SER A  1 37  ? 105.576 -35.956  -45.797  1.00 204.20 ? 80  SER A CA   1 
ATOM   450   C C    . SER A  1 37  ? 106.618 -35.294  -46.704  1.00 201.69 ? 80  SER A C    1 
ATOM   451   O O    . SER A  1 37  ? 106.333 -35.025  -47.871  1.00 202.27 ? 80  SER A O    1 
ATOM   452   C CB   . SER A  1 37  ? 105.954 -37.397  -45.469  1.00 206.88 ? 80  SER A CB   1 
ATOM   453   O OG   . SER A  1 37  ? 104.863 -38.068  -44.864  1.00 209.88 ? 80  SER A OG   1 
ATOM   454   H H    . SER A  1 37  ? 103.955 -36.708  -46.620  1.00 249.16 ? 80  SER A H    1 
ATOM   455   H HA   . SER A  1 37  ? 105.527 -35.454  -44.969  1.00 253.11 ? 80  SER A HA   1 
ATOM   456   H HB2  . SER A  1 37  ? 106.194 -37.857  -46.288  1.00 269.73 ? 80  SER A HB2  1 
ATOM   457   H HB3  . SER A  1 37  ? 106.705 -37.396  -44.855  1.00 269.73 ? 80  SER A HB3  1 
ATOM   458   H HG   . SER A  1 37  ? 104.644 -37.678  -44.153  1.00 281.21 ? 80  SER A HG   1 
ATOM   459   N N    . PRO A  1 38  ? 107.822 -35.004  -46.178  1.00 211.12 ? 81  PRO A N    1 
ATOM   460   C CA   . PRO A  1 38  ? 108.248 -35.121  -44.782  1.00 209.76 ? 81  PRO A CA   1 
ATOM   461   C C    . PRO A  1 38  ? 108.514 -33.783  -44.089  1.00 205.73 ? 81  PRO A C    1 
ATOM   462   O O    . PRO A  1 38  ? 107.817 -33.438  -43.131  1.00 204.59 ? 81  PRO A O    1 
ATOM   463   C CB   . PRO A  1 38  ? 109.543 -35.933  -44.901  1.00 210.38 ? 81  PRO A CB   1 
ATOM   464   C CG   . PRO A  1 38  ? 110.081 -35.616  -46.312  1.00 210.17 ? 81  PRO A CG   1 
ATOM   465   C CD   . PRO A  1 38  ? 108.995 -34.860  -47.059  1.00 210.02 ? 81  PRO A CD   1 
ATOM   466   H HA   . PRO A  1 38  ? 107.597 -35.626  -44.270  1.00 341.51 ? 81  PRO A HA   1 
ATOM   467   H HB2  . PRO A  1 38  ? 110.173 -35.647  -44.221  1.00 358.77 ? 81  PRO A HB2  1 
ATOM   468   H HB3  . PRO A  1 38  ? 109.347 -36.879  -44.813  1.00 358.77 ? 81  PRO A HB3  1 
ATOM   469   H HG2  . PRO A  1 38  ? 110.878 -35.069  -46.235  1.00 366.27 ? 81  PRO A HG2  1 
ATOM   470   H HG3  . PRO A  1 38  ? 110.287 -36.446  -46.770  1.00 366.27 ? 81  PRO A HG3  1 
ATOM   471   H HD2  . PRO A  1 38  ? 109.236 -33.925  -47.153  1.00 351.66 ? 81  PRO A HD2  1 
ATOM   472   H HD3  . PRO A  1 38  ? 108.825 -35.273  -47.920  1.00 351.66 ? 81  PRO A HD3  1 
ATOM   473   N N    . GLN A  1 39  ? 109.508 -33.044  -44.577  1.00 193.59 ? 82  GLN A N    1 
ATOM   474   C CA   . GLN A  1 39  ? 110.055 -31.898  -43.856  1.00 190.11 ? 82  GLN A CA   1 
ATOM   475   C C    . GLN A  1 39  ? 110.011 -30.615  -44.676  1.00 188.18 ? 82  GLN A C    1 
ATOM   476   O O    . GLN A  1 39  ? 109.444 -30.577  -45.768  1.00 189.21 ? 82  GLN A O    1 
ATOM   477   C CB   . GLN A  1 39  ? 111.499 -32.189  -43.448  1.00 189.94 ? 82  GLN A CB   1 
ATOM   478   C CG   . GLN A  1 39  ? 111.691 -33.523  -42.725  1.00 192.17 ? 82  GLN A CG   1 
ATOM   479   C CD   . GLN A  1 39  ? 112.739 -34.428  -43.366  1.00 194.71 ? 82  GLN A CD   1 
ATOM   480   O OE1  . GLN A  1 39  ? 113.096 -34.269  -44.536  1.00 195.23 ? 82  GLN A OE1  1 
ATOM   481   N NE2  . GLN A  1 39  ? 113.238 -35.388  -42.590  1.00 196.29 ? 82  GLN A NE2  1 
ATOM   482   H H    . GLN A  1 39  ? 109.887 -33.189  -45.335  1.00 365.76 ? 82  GLN A H    1 
ATOM   483   H HA   . GLN A  1 39  ? 109.537 -31.756  -43.048  1.00 356.29 ? 82  GLN A HA   1 
ATOM   484   H HB2  . GLN A  1 39  ? 112.051 -32.204  -44.245  1.00 364.98 ? 82  GLN A HB2  1 
ATOM   485   H HB3  . GLN A  1 39  ? 111.802 -31.485  -42.853  1.00 364.98 ? 82  GLN A HB3  1 
ATOM   486   H HG2  . GLN A  1 39  ? 111.971 -33.346  -41.813  1.00 379.80 ? 82  GLN A HG2  1 
ATOM   487   H HG3  . GLN A  1 39  ? 110.848 -34.002  -42.723  1.00 379.80 ? 82  GLN A HG3  1 
ATOM   488   H HE21 . GLN A  1 39  ? 113.832 -35.927  -42.900  1.00 379.17 ? 82  GLN A HE21 1 
ATOM   489   H HE22 . GLN A  1 39  ? 112.965 -35.469  -41.778  1.00 379.17 ? 82  GLN A HE22 1 
ATOM   490   N N    . GLU A  1 40  ? 110.632 -29.569  -44.135  1.00 178.20 ? 83  GLU A N    1 
ATOM   491   C CA   . GLU A  1 40  ? 110.736 -28.283  -44.817  1.00 176.05 ? 83  GLU A CA   1 
ATOM   492   C C    . GLU A  1 40  ? 111.944 -28.293  -45.741  1.00 176.52 ? 83  GLU A C    1 
ATOM   493   O O    . GLU A  1 40  ? 113.082 -28.313  -45.278  1.00 176.56 ? 83  GLU A O    1 
ATOM   494   C CB   . GLU A  1 40  ? 110.866 -27.117  -43.824  1.00 172.99 ? 83  GLU A CB   1 
ATOM   495   C CG   . GLU A  1 40  ? 110.440 -27.396  -42.381  1.00 172.54 ? 83  GLU A CG   1 
ATOM   496   C CD   . GLU A  1 40  ? 111.599 -27.838  -41.500  1.00 172.38 ? 83  GLU A CD   1 
ATOM   497   O OE1  . GLU A  1 40  ? 112.593 -27.087  -41.407  1.00 171.28 ? 83  GLU A OE1  1 
ATOM   498   O OE2  . GLU A  1 40  ? 111.518 -28.932  -40.902  1.00 173.73 ? 83  GLU A OE2  1 
ATOM   499   H H    . GLU A  1 40  ? 111.006 -29.581  -43.361  1.00 298.45 ? 83  GLU A H    1 
ATOM   500   H HA   . GLU A  1 40  ? 109.941 -28.139  -45.355  1.00 287.95 ? 83  GLU A HA   1 
ATOM   501   H HB2  . GLU A  1 40  ? 111.795 -26.841  -43.800  1.00 275.76 ? 83  GLU A HB2  1 
ATOM   502   H HB3  . GLU A  1 40  ? 110.321 -26.382  -44.146  1.00 275.76 ? 83  GLU A HB3  1 
ATOM   503   H HG2  . GLU A  1 40  ? 110.066 -26.586  -42.000  1.00 270.03 ? 83  GLU A HG2  1 
ATOM   504   H HG3  . GLU A  1 40  ? 109.775 -28.102  -42.379  1.00 270.03 ? 83  GLU A HG3  1 
ATOM   505   N N    . LEU A  1 41  ? 111.700 -28.282  -47.045  1.00 174.37 ? 84  LEU A N    1 
ATOM   506   C CA   . LEU A  1 41  ? 112.796 -28.248  -48.000  1.00 175.05 ? 84  LEU A CA   1 
ATOM   507   C C    . LEU A  1 41  ? 113.546 -26.931  -47.827  1.00 172.67 ? 84  LEU A C    1 
ATOM   508   O O    . LEU A  1 41  ? 113.031 -25.864  -48.155  1.00 170.90 ? 84  LEU A O    1 
ATOM   509   C CB   . LEU A  1 41  ? 112.281 -28.407  -49.430  1.00 176.18 ? 84  LEU A CB   1 
ATOM   510   C CG   . LEU A  1 41  ? 111.361 -29.608  -49.660  1.00 178.71 ? 84  LEU A CG   1 
ATOM   511   C CD1  . LEU A  1 41  ? 109.940 -29.145  -49.956  1.00 178.21 ? 84  LEU A CD1  1 
ATOM   512   C CD2  . LEU A  1 41  ? 111.891 -30.489  -50.780  1.00 181.21 ? 84  LEU A CD2  1 
ATOM   513   H H    . LEU A  1 41  ? 110.917 -28.295  -47.399  1.00 122.67 ? 84  LEU A H    1 
ATOM   514   H HA   . LEU A  1 41  ? 113.408 -28.976  -47.813  1.00 128.15 ? 84  LEU A HA   1 
ATOM   515   H HB2  . LEU A  1 41  ? 111.784 -27.609  -49.670  1.00 125.01 ? 84  LEU A HB2  1 
ATOM   516   H HB3  . LEU A  1 41  ? 113.043 -28.505  -50.023  1.00 125.01 ? 84  LEU A HB3  1 
ATOM   517   H HG   . LEU A  1 41  ? 111.336 -30.142  -48.851  1.00 133.26 ? 84  LEU A HG   1 
ATOM   518   H HD11 . LEU A  1 41  ? 109.378 -29.923  -50.098  1.00 128.70 ? 84  LEU A HD11 1 
ATOM   519   H HD12 . LEU A  1 41  ? 109.611 -28.632  -49.201  1.00 128.70 ? 84  LEU A HD12 1 
ATOM   520   H HD13 . LEU A  1 41  ? 109.948 -28.592  -50.753  1.00 128.70 ? 84  LEU A HD13 1 
ATOM   521   H HD21 . LEU A  1 41  ? 111.289 -31.240  -50.902  1.00 151.15 ? 84  LEU A HD21 1 
ATOM   522   H HD22 . LEU A  1 41  ? 111.939 -29.967  -51.596  1.00 151.15 ? 84  LEU A HD22 1 
ATOM   523   H HD23 . LEU A  1 41  ? 112.774 -30.809  -50.538  1.00 151.15 ? 84  LEU A HD23 1 
ATOM   524   N N    . LYS A  1 42  ? 114.758 -27.016  -47.284  1.00 189.30 ? 85  LYS A N    1 
ATOM   525   C CA   . LYS A  1 42  ? 115.542 -25.828  -46.954  1.00 188.53 ? 85  LYS A CA   1 
ATOM   526   C C    . LYS A  1 42  ? 116.157 -25.154  -48.172  1.00 189.83 ? 85  LYS A C    1 
ATOM   527   O O    . LYS A  1 42  ? 116.436 -25.796  -49.187  1.00 192.38 ? 85  LYS A O    1 
ATOM   528   C CB   . LYS A  1 42  ? 116.659 -26.189  -45.975  1.00 190.66 ? 85  LYS A CB   1 
ATOM   529   C CG   . LYS A  1 42  ? 116.305 -26.035  -44.503  1.00 188.45 ? 85  LYS A CG   1 
ATOM   530   C CD   . LYS A  1 42  ? 117.373 -26.701  -43.639  1.00 191.29 ? 85  LYS A CD   1 
ATOM   531   C CE   . LYS A  1 42  ? 117.091 -26.565  -42.149  1.00 189.30 ? 85  LYS A CE   1 
ATOM   532   N NZ   . LYS A  1 42  ? 117.950 -27.498  -41.348  1.00 192.39 ? 85  LYS A NZ   1 
ATOM   533   H H    . LYS A  1 42  ? 115.152 -27.756  -47.095  1.00 77.39  ? 85  LYS A H    1 
ATOM   534   H HA   . LYS A  1 42  ? 114.962 -25.183  -46.519  1.00 74.39  ? 85  LYS A HA   1 
ATOM   535   H HB2  . LYS A  1 42  ? 116.908 -27.115  -46.120  1.00 84.11  ? 85  LYS A HB2  1 
ATOM   536   H HB3  . LYS A  1 42  ? 117.421 -25.616  -46.153  1.00 84.11  ? 85  LYS A HB3  1 
ATOM   537   H HG2  . LYS A  1 42  ? 116.266 -25.093  -44.275  1.00 81.71  ? 85  LYS A HG2  1 
ATOM   538   H HG3  . LYS A  1 42  ? 115.453 -26.464  -44.327  1.00 81.71  ? 85  LYS A HG3  1 
ATOM   539   H HD2  . LYS A  1 42  ? 117.410 -27.646  -43.854  1.00 90.51  ? 85  LYS A HD2  1 
ATOM   540   H HD3  . LYS A  1 42  ? 118.231 -26.286  -43.821  1.00 90.51  ? 85  LYS A HD3  1 
ATOM   541   H HE2  . LYS A  1 42  ? 117.282 -25.657  -41.867  1.00 89.24  ? 85  LYS A HE2  1 
ATOM   542   H HE3  . LYS A  1 42  ? 116.161 -26.783  -41.977  1.00 89.24  ? 85  LYS A HE3  1 
ATOM   543   H HZ1  . LYS A  1 42  ? 117.772 -27.406  -40.481  1.00 99.14  ? 85  LYS A HZ1  1 
ATOM   544   H HZ2  . LYS A  1 42  ? 117.790 -28.340  -41.588  1.00 99.14  ? 85  LYS A HZ2  1 
ATOM   545   H HZ3  . LYS A  1 42  ? 118.810 -27.316  -41.488  1.00 99.14  ? 85  LYS A HZ3  1 
ATOM   546   N N    . MET A  1 43  ? 116.366 -23.847  -48.048  1.00 182.32 ? 86  MET A N    1 
ATOM   547   C CA   . MET A  1 43  ? 117.101 -23.074  -49.037  1.00 183.87 ? 86  MET A CA   1 
ATOM   548   C C    . MET A  1 43  ? 118.440 -22.664  -48.439  1.00 185.79 ? 86  MET A C    1 
ATOM   549   O O    . MET A  1 43  ? 118.604 -22.639  -47.217  1.00 184.96 ? 86  MET A O    1 
ATOM   550   C CB   . MET A  1 43  ? 116.305 -21.839  -49.478  1.00 181.11 ? 86  MET A CB   1 
ATOM   551   C CG   . MET A  1 43  ? 114.905 -22.130  -50.015  1.00 179.12 ? 86  MET A CG   1 
ATOM   552   S SD   . MET A  1 43  ? 114.832 -23.573  -51.097  1.00 181.98 ? 86  MET A SD   1 
ATOM   553   C CE   . MET A  1 43  ? 116.070 -23.176  -52.339  1.00 185.44 ? 86  MET A CE   1 
ATOM   554   H H    . MET A  1 43  ? 116.085 -23.377  -47.385  1.00 138.69 ? 86  MET A H    1 
ATOM   555   H HA   . MET A  1 43  ? 117.259 -23.626  -49.819  1.00 139.99 ? 86  MET A HA   1 
ATOM   556   H HB2  . MET A  1 43  ? 116.208 -21.247  -48.716  1.00 128.15 ? 86  MET A HB2  1 
ATOM   557   H HB3  . MET A  1 43  ? 116.799 -21.388  -50.180  1.00 128.15 ? 86  MET A HB3  1 
ATOM   558   H HG2  . MET A  1 43  ? 114.309 -22.289  -49.267  1.00 123.56 ? 86  MET A HG2  1 
ATOM   559   H HG3  . MET A  1 43  ? 114.599 -21.362  -50.523  1.00 123.56 ? 86  MET A HG3  1 
ATOM   560   H HE1  . MET A  1 43  ? 116.114 -23.900  -52.983  1.00 134.66 ? 86  MET A HE1  1 
ATOM   561   H HE2  . MET A  1 43  ? 115.817 -22.352  -52.784  1.00 134.66 ? 86  MET A HE2  1 
ATOM   562   H HE3  . MET A  1 43  ? 116.930 -23.067  -51.904  1.00 134.66 ? 86  MET A HE3  1 
ATOM   563   N N    . GLU A  1 44  ? 119.397 -22.360  -49.308  1.00 192.63 ? 87  GLU A N    1 
ATOM   564   C CA   . GLU A  1 44  ? 120.727 -21.941  -48.879  1.00 194.99 ? 87  GLU A CA   1 
ATOM   565   C C    . GLU A  1 44  ? 121.200 -20.739  -49.693  1.00 195.76 ? 87  GLU A C    1 
ATOM   566   O O    . GLU A  1 44  ? 120.944 -20.649  -50.895  1.00 196.28 ? 87  GLU A O    1 
ATOM   567   C CB   . GLU A  1 44  ? 121.727 -23.097  -49.004  1.00 199.41 ? 87  GLU A CB   1 
ATOM   568   C CG   . GLU A  1 44  ? 121.969 -23.613  -50.425  1.00 202.78 ? 87  GLU A CG   1 
ATOM   569   C CD   . GLU A  1 44  ? 120.794 -24.389  -50.994  1.00 200.67 ? 87  GLU A CD   1 
ATOM   570   O OE1  . GLU A  1 44  ? 119.789 -24.576  -50.276  1.00 197.32 ? 87  GLU A OE1  1 
ATOM   571   O OE2  . GLU A  1 44  ? 120.880 -24.811  -52.167  1.00 203.18 ? 87  GLU A OE2  1 
ATOM   572   H H    . GLU A  1 44  ? 119.300 -22.390  -50.162  1.00 366.95 ? 87  GLU A H    1 
ATOM   573   H HA   . GLU A  1 44  ? 120.690 -21.676  -47.947  1.00 370.21 ? 87  GLU A HA   1 
ATOM   574   H HB2  . GLU A  1 44  ? 122.582 -22.801  -48.653  1.00 379.25 ? 87  GLU A HB2  1 
ATOM   575   H HB3  . GLU A  1 44  ? 121.401 -23.842  -48.475  1.00 379.25 ? 87  GLU A HB3  1 
ATOM   576   H HG2  . GLU A  1 44  ? 122.138 -22.858  -51.009  1.00 381.77 ? 87  GLU A HG2  1 
ATOM   577   H HG3  . GLU A  1 44  ? 122.739 -24.203  -50.417  1.00 381.77 ? 87  GLU A HG3  1 
ATOM   578   N N    . ASN A  1 45  ? 121.882 -19.815  -49.022  1.00 190.17 ? 88  ASN A N    1 
ATOM   579   C CA   . ASN A  1 45  ? 122.349 -18.582  -49.648  1.00 191.64 ? 88  ASN A CA   1 
ATOM   580   C C    . ASN A  1 45  ? 121.196 -17.802  -50.280  1.00 186.95 ? 88  ASN A C    1 
ATOM   581   O O    . ASN A  1 45  ? 121.396 -17.023  -51.214  1.00 188.42 ? 88  ASN A O    1 
ATOM   582   C CB   . ASN A  1 45  ? 123.424 -18.889  -50.693  1.00 197.96 ? 88  ASN A CB   1 
ATOM   583   C CG   . ASN A  1 45  ? 124.663 -19.513  -50.085  1.00 203.31 ? 88  ASN A CG   1 
ATOM   584   O OD1  . ASN A  1 45  ? 124.637 -20.002  -48.956  1.00 202.32 ? 88  ASN A OD1  1 
ATOM   585   N ND2  . ASN A  1 45  ? 125.759 -19.499  -50.834  1.00 209.35 ? 88  ASN A ND2  1 
ATOM   586   H H    . ASN A  1 45  ? 122.090 -19.880  -48.190  1.00 180.86 ? 88  ASN A H    1 
ATOM   587   H HA   . ASN A  1 45  ? 122.750 -18.019  -48.967  1.00 180.23 ? 88  ASN A HA   1 
ATOM   588   H HB2  . ASN A  1 45  ? 123.064 -19.510  -51.346  1.00 192.60 ? 88  ASN A HB2  1 
ATOM   589   H HB3  . ASN A  1 45  ? 123.687 -18.063  -51.129  1.00 192.60 ? 88  ASN A HB3  1 
ATOM   590   H HD21 . ASN A  1 45  ? 126.489 -19.841  -50.534  1.00 216.88 ? 88  ASN A HD21 1 
ATOM   591   H HD22 . ASN A  1 45  ? 125.739 -19.149  -51.619  1.00 216.88 ? 88  ASN A HD22 1 
ATOM   592   N N    . VAL A  1 46  ? 119.990 -18.028  -49.761  1.00 186.19 ? 89  VAL A N    1 
ATOM   593   C CA   . VAL A  1 46  ? 118.795 -17.305  -50.184  1.00 183.29 ? 89  VAL A CA   1 
ATOM   594   C C    . VAL A  1 46  ? 118.430 -16.268  -49.136  1.00 180.71 ? 89  VAL A C    1 
ATOM   595   O O    . VAL A  1 46  ? 118.425 -16.560  -47.938  1.00 179.61 ? 89  VAL A O    1 
ATOM   596   C CB   . VAL A  1 46  ? 117.595 -18.256  -50.401  1.00 181.39 ? 89  VAL A CB   1 
ATOM   597   C CG1  . VAL A  1 46  ? 116.277 -17.488  -50.484  1.00 178.09 ? 89  VAL A CG1  1 
ATOM   598   C CG2  . VAL A  1 46  ? 117.794 -19.080  -51.658  1.00 183.99 ? 89  VAL A CG2  1 
ATOM   599   H H    . VAL A  1 46  ? 119.837 -18.610  -49.147  1.00 106.58 ? 89  VAL A H    1 
ATOM   600   H HA   . VAL A  1 46  ? 118.975 -16.845  -51.019  1.00 97.16  ? 89  VAL A HA   1 
ATOM   601   H HB   . VAL A  1 46  ? 117.538 -18.867  -49.650  1.00 92.03  ? 89  VAL A HB   1 
ATOM   602   H HG11 . VAL A  1 46  ? 115.552 -18.119  -50.620  1.00 82.32  ? 89  VAL A HG11 1 
ATOM   603   H HG12 . VAL A  1 46  ? 116.142 -17.003  -49.655  1.00 82.32  ? 89  VAL A HG12 1 
ATOM   604   H HG13 . VAL A  1 46  ? 116.319 -16.868  -51.228  1.00 82.32  ? 89  VAL A HG13 1 
ATOM   605   H HG21 . VAL A  1 46  ? 117.031 -19.668  -51.773  1.00 100.29 ? 89  VAL A HG21 1 
ATOM   606   H HG22 . VAL A  1 46  ? 117.869 -18.483  -52.418  1.00 100.29 ? 89  VAL A HG22 1 
ATOM   607   H HG23 . VAL A  1 46  ? 118.605 -19.604  -51.567  1.00 100.29 ? 89  VAL A HG23 1 
ATOM   608   N N    . THR A  1 47  ? 118.126 -15.059  -49.594  1.00 179.05 ? 90  THR A N    1 
ATOM   609   C CA   . THR A  1 47  ? 117.669 -13.993  -48.715  1.00 176.83 ? 90  THR A CA   1 
ATOM   610   C C    . THR A  1 47  ? 116.250 -13.587  -49.093  1.00 174.03 ? 90  THR A C    1 
ATOM   611   O O    . THR A  1 47  ? 115.948 -13.370  -50.267  1.00 174.64 ? 90  THR A O    1 
ATOM   612   C CB   . THR A  1 47  ? 118.595 -12.764  -48.780  1.00 178.87 ? 90  THR A CB   1 
ATOM   613   O OG1  . THR A  1 47  ? 119.941 -13.158  -48.479  1.00 181.85 ? 90  THR A OG1  1 
ATOM   614   C CG2  . THR A  1 47  ? 118.146 -11.716  -47.776  1.00 176.85 ? 90  THR A CG2  1 
ATOM   615   H H    . THR A  1 47  ? 118.178 -14.829  -50.421  1.00 276.62 ? 90  THR A H    1 
ATOM   616   H HA   . THR A  1 47  ? 117.658 -14.316  -47.800  1.00 270.30 ? 90  THR A HA   1 
ATOM   617   H HB   . THR A  1 47  ? 118.560 -12.377  -49.669  1.00 275.12 ? 90  THR A HB   1 
ATOM   618   H HG1  . THR A  1 47  ? 120.450 -12.490  -48.513  1.00 284.98 ? 90  THR A HG1  1 
ATOM   619   H HG21 . THR A  1 47  ? 118.731 -10.944  -47.820  1.00 269.84 ? 90  THR A HG21 1 
ATOM   620   H HG22 . THR A  1 47  ? 117.238 -11.436  -47.974  1.00 269.84 ? 90  THR A HG22 1 
ATOM   621   H HG23 . THR A  1 47  ? 118.174 -12.083  -46.879  1.00 269.84 ? 90  THR A HG23 1 
ATOM   622   N N    . GLU A  1 48  ? 115.384 -13.495  -48.088  1.00 168.44 ? 91  GLU A N    1 
ATOM   623   C CA   . GLU A  1 48  ? 113.983 -13.146  -48.293  1.00 165.85 ? 91  GLU A CA   1 
ATOM   624   C C    . GLU A  1 48  ? 113.511 -12.210  -47.184  1.00 163.80 ? 91  GLU A C    1 
ATOM   625   O O    . GLU A  1 48  ? 113.876 -12.384  -46.022  1.00 163.35 ? 91  GLU A O    1 
ATOM   626   C CB   . GLU A  1 48  ? 113.123 -14.413  -48.331  1.00 164.48 ? 91  GLU A CB   1 
ATOM   627   C CG   . GLU A  1 48  ? 111.633 -14.173  -48.551  1.00 163.52 ? 91  GLU A CG   1 
ATOM   628   C CD   . GLU A  1 48  ? 111.305 -13.716  -49.962  1.00 164.54 ? 91  GLU A CD   1 
ATOM   629   O OE1  . GLU A  1 48  ? 112.196 -13.774  -50.835  1.00 165.66 ? 91  GLU A OE1  1 
ATOM   630   O OE2  . GLU A  1 48  ? 110.151 -13.298  -50.199  1.00 164.26 ? 91  GLU A OE2  1 
ATOM   631   H H    . GLU A  1 48  ? 115.588 -13.633  -47.264  1.00 196.19 ? 91  GLU A H    1 
ATOM   632   H HA   . GLU A  1 48  ? 113.888 -12.686  -49.142  1.00 188.40 ? 91  GLU A HA   1 
ATOM   633   H HB2  . GLU A  1 48  ? 113.438 -14.979  -49.053  1.00 184.50 ? 91  GLU A HB2  1 
ATOM   634   H HB3  . GLU A  1 48  ? 113.222 -14.879  -47.486  1.00 184.50 ? 91  GLU A HB3  1 
ATOM   635   H HG2  . GLU A  1 48  ? 111.153 -15.000  -48.386  1.00 177.43 ? 91  GLU A HG2  1 
ATOM   636   H HG3  . GLU A  1 48  ? 111.331 -13.486  -47.937  1.00 177.43 ? 91  GLU A HG3  1 
ATOM   637   N N    . GLU A  1 49  ? 112.703 -11.217  -47.549  1.00 167.46 ? 92  GLU A N    1 
ATOM   638   C CA   . GLU A  1 49  ? 112.149 -10.272  -46.579  1.00 166.49 ? 92  GLU A CA   1 
ATOM   639   C C    . GLU A  1 49  ? 110.895 -10.812  -45.900  1.00 165.22 ? 92  GLU A C    1 
ATOM   640   O O    . GLU A  1 49  ? 110.049 -11.430  -46.546  1.00 165.47 ? 92  GLU A O    1 
ATOM   641   C CB   . GLU A  1 49  ? 111.817 -8.944   -47.255  1.00 167.18 ? 92  GLU A CB   1 
ATOM   642   C CG   . GLU A  1 49  ? 113.029 -8.139   -47.680  1.00 168.95 ? 92  GLU A CG   1 
ATOM   643   C CD   . GLU A  1 49  ? 112.655 -6.790   -48.269  1.00 169.46 ? 92  GLU A CD   1 
ATOM   644   O OE1  . GLU A  1 49  ? 111.450 -6.457   -48.278  1.00 168.35 ? 92  GLU A OE1  1 
ATOM   645   O OE2  . GLU A  1 49  ? 113.567 -6.062   -48.720  1.00 171.93 ? 92  GLU A OE2  1 
ATOM   646   H H    . GLU A  1 49  ? 112.458 -11.068  -48.360  1.00 253.85 ? 92  GLU A H    1 
ATOM   647   H HA   . GLU A  1 49  ? 112.812 -10.101  -45.892  1.00 249.90 ? 92  GLU A HA   1 
ATOM   648   H HB2  . GLU A  1 49  ? 111.288 -9.122   -48.048  1.00 248.08 ? 92  GLU A HB2  1 
ATOM   649   H HB3  . GLU A  1 49  ? 111.304 -8.400   -46.636  1.00 248.08 ? 92  GLU A HB3  1 
ATOM   650   H HG2  . GLU A  1 49  ? 113.593 -7.984   -46.906  1.00 254.25 ? 92  GLU A HG2  1 
ATOM   651   H HG3  . GLU A  1 49  ? 113.519 -8.636   -48.354  1.00 254.25 ? 92  GLU A HG3  1 
ATOM   652   N N    . PHE A  1 50  ? 110.779 -10.557  -44.600  1.00 156.79 ? 93  PHE A N    1 
ATOM   653   C CA   . PHE A  1 50  ? 109.608 -10.959  -43.823  1.00 155.46 ? 93  PHE A CA   1 
ATOM   654   C C    . PHE A  1 50  ? 109.007 -9.764   -43.091  1.00 154.84 ? 93  PHE A C    1 
ATOM   655   O O    . PHE A  1 50  ? 109.677 -8.756   -42.871  1.00 155.31 ? 93  PHE A O    1 
ATOM   656   C CB   . PHE A  1 50  ? 109.974 -12.048  -42.813  1.00 154.41 ? 93  PHE A CB   1 
ATOM   657   C CG   . PHE A  1 50  ? 110.112 -13.417  -43.414  1.00 155.06 ? 93  PHE A CG   1 
ATOM   658   C CD1  . PHE A  1 50  ? 111.227 -13.751  -44.162  1.00 156.36 ? 93  PHE A CD1  1 
ATOM   659   C CD2  . PHE A  1 50  ? 109.131 -14.376  -43.219  1.00 154.80 ? 93  PHE A CD2  1 
ATOM   660   C CE1  . PHE A  1 50  ? 111.357 -15.013  -44.712  1.00 157.28 ? 93  PHE A CE1  1 
ATOM   661   C CE2  . PHE A  1 50  ? 109.257 -15.638  -43.766  1.00 155.96 ? 93  PHE A CE2  1 
ATOM   662   C CZ   . PHE A  1 50  ? 110.371 -15.957  -44.512  1.00 157.07 ? 93  PHE A CZ   1 
ATOM   663   H H    . PHE A  1 50  ? 111.375 -10.146  -44.136  1.00 140.10 ? 93  PHE A H    1 
ATOM   664   H HA   . PHE A  1 50  ? 108.935 -11.316  -44.423  1.00 135.24 ? 93  PHE A HA   1 
ATOM   665   H HB2  . PHE A  1 50  ? 110.822 -11.819  -42.401  1.00 137.40 ? 93  PHE A HB2  1 
ATOM   666   H HB3  . PHE A  1 50  ? 109.282 -12.091  -42.135  1.00 137.40 ? 93  PHE A HB3  1 
ATOM   667   H HD1  . PHE A  1 50  ? 111.894 -13.118  -44.299  1.00 144.32 ? 93  PHE A HD1  1 
ATOM   668   H HD2  . PHE A  1 50  ? 108.377 -14.166  -42.716  1.00 134.90 ? 93  PHE A HD2  1 
ATOM   669   H HE1  . PHE A  1 50  ? 112.110 -15.225  -45.215  1.00 146.96 ? 93  PHE A HE1  1 
ATOM   670   H HE2  . PHE A  1 50  ? 108.591 -16.273  -43.631  1.00 136.36 ? 93  PHE A HE2  1 
ATOM   671   H HZ   . PHE A  1 50  ? 110.457 -16.806  -44.882  1.00 142.49 ? 93  PHE A HZ   1 
ATOM   672   N N    . ASN A  1 51  ? 107.739 -9.884   -42.717  1.00 153.10 ? 94  ASN A N    1 
ATOM   673   C CA   . ASN A  1 51  ? 107.078 -8.863   -41.920  1.00 152.45 ? 94  ASN A CA   1 
ATOM   674   C C    . ASN A  1 51  ? 105.932 -9.494   -41.139  1.00 151.25 ? 94  ASN A C    1 
ATOM   675   O O    . ASN A  1 51  ? 104.855 -9.735   -41.684  1.00 151.92 ? 94  ASN A O    1 
ATOM   676   C CB   . ASN A  1 51  ? 106.572 -7.721   -42.808  1.00 153.82 ? 94  ASN A CB   1 
ATOM   677   C CG   . ASN A  1 51  ? 105.961 -6.577   -42.006  1.00 153.38 ? 94  ASN A CG   1 
ATOM   678   O OD1  . ASN A  1 51  ? 104.818 -6.660   -41.554  1.00 152.83 ? 94  ASN A OD1  1 
ATOM   679   N ND2  . ASN A  1 51  ? 106.721 -5.497   -41.836  1.00 153.75 ? 94  ASN A ND2  1 
ATOM   680   H H    . ASN A  1 51  ? 107.237 -10.554  -42.914  1.00 184.24 ? 94  ASN A H    1 
ATOM   681   H HA   . ASN A  1 51  ? 107.711 -8.495   -41.284  1.00 183.07 ? 94  ASN A HA   1 
ATOM   682   H HB2  . ASN A  1 51  ? 107.316 -7.366   -43.319  1.00 182.95 ? 94  ASN A HB2  1 
ATOM   683   H HB3  . ASN A  1 51  ? 105.891 -8.065   -43.407  1.00 182.95 ? 94  ASN A HB3  1 
ATOM   684   H HD21 . ASN A  1 51  ? 106.421 -4.825   -41.391  1.00 185.18 ? 94  ASN A HD21 1 
ATOM   685   H HD22 . ASN A  1 51  ? 107.512 -5.471   -42.172  1.00 185.18 ? 94  ASN A HD22 1 
ATOM   686   N N    . MET A  1 52  ? 106.182 -9.780   -39.864  1.00 143.75 ? 95  MET A N    1 
ATOM   687   C CA   . MET A  1 52  ? 105.196 -10.434  -39.008  1.00 142.31 ? 95  MET A CA   1 
ATOM   688   C C    . MET A  1 52  ? 103.963 -9.565   -38.776  1.00 142.30 ? 95  MET A C    1 
ATOM   689   O O    . MET A  1 52  ? 102.867 -10.079  -38.551  1.00 141.64 ? 95  MET A O    1 
ATOM   690   C CB   . MET A  1 52  ? 105.824 -10.795  -37.658  1.00 140.47 ? 95  MET A CB   1 
ATOM   691   C CG   . MET A  1 52  ? 106.265 -9.584   -36.839  1.00 140.61 ? 95  MET A CG   1 
ATOM   692   S SD   . MET A  1 52  ? 106.942 -9.994   -35.219  1.00 139.39 ? 95  MET A SD   1 
ATOM   693   C CE   . MET A  1 52  ? 105.470 -10.518  -34.350  1.00 137.48 ? 95  MET A CE   1 
ATOM   694   H H    . MET A  1 52  ? 106.924 -9.603   -39.467  1.00 137.80 ? 95  MET A H    1 
ATOM   695   H HA   . MET A  1 52  ? 104.917 -11.260  -39.433  1.00 136.09 ? 95  MET A HA   1 
ATOM   696   H HB2  . MET A  1 52  ? 105.174 -11.287  -37.132  1.00 139.34 ? 95  MET A HB2  1 
ATOM   697   H HB3  . MET A  1 52  ? 106.605 -11.348  -37.815  1.00 139.34 ? 95  MET A HB3  1 
ATOM   698   H HG2  . MET A  1 52  ? 106.950 -9.107   -37.333  1.00 141.20 ? 95  MET A HG2  1 
ATOM   699   H HG3  . MET A  1 52  ? 105.499 -9.005   -36.700  1.00 141.20 ? 95  MET A HG3  1 
ATOM   700   H HE1  . MET A  1 52  ? 105.711 -10.770  -33.445  1.00 142.40 ? 95  MET A HE1  1 
ATOM   701   H HE2  . MET A  1 52  ? 104.836 -9.783   -34.332  1.00 142.40 ? 95  MET A HE2  1 
ATOM   702   H HE3  . MET A  1 52  ? 105.083 -11.277  -34.814  1.00 142.40 ? 95  MET A HE3  1 
ATOM   703   N N    . TRP A  1 53  ? 104.151 -8.249   -38.830  1.00 147.96 ? 96  TRP A N    1 
ATOM   704   C CA   . TRP A  1 53  ? 103.100 -7.298   -38.476  1.00 148.12 ? 96  TRP A CA   1 
ATOM   705   C C    . TRP A  1 53  ? 102.142 -7.036   -39.634  1.00 149.62 ? 96  TRP A C    1 
ATOM   706   O O    . TRP A  1 53  ? 101.060 -6.482   -39.439  1.00 149.73 ? 96  TRP A O    1 
ATOM   707   C CB   . TRP A  1 53  ? 103.723 -5.984   -38.004  1.00 148.68 ? 96  TRP A CB   1 
ATOM   708   C CG   . TRP A  1 53  ? 104.755 -6.181   -36.939  1.00 147.84 ? 96  TRP A CG   1 
ATOM   709   C CD1  . TRP A  1 53  ? 106.109 -6.142   -37.095  1.00 148.55 ? 96  TRP A CD1  1 
ATOM   710   C CD2  . TRP A  1 53  ? 104.519 -6.461   -35.552  1.00 146.54 ? 96  TRP A CD2  1 
ATOM   711   N NE1  . TRP A  1 53  ? 106.731 -6.375   -35.892  1.00 147.87 ? 96  TRP A NE1  1 
ATOM   712   C CE2  . TRP A  1 53  ? 105.777 -6.572   -34.929  1.00 146.64 ? 96  TRP A CE2  1 
ATOM   713   C CE3  . TRP A  1 53  ? 103.367 -6.623   -34.778  1.00 145.43 ? 96  TRP A CE3  1 
ATOM   714   C CZ2  . TRP A  1 53  ? 105.915 -6.843   -33.569  1.00 145.81 ? 96  TRP A CZ2  1 
ATOM   715   C CZ3  . TRP A  1 53  ? 103.507 -6.889   -33.426  1.00 144.50 ? 96  TRP A CZ3  1 
ATOM   716   C CH2  . TRP A  1 53  ? 104.772 -6.996   -32.837  1.00 144.77 ? 96  TRP A CH2  1 
ATOM   717   H H    . TRP A  1 53  ? 104.888 -7.877   -39.072  1.00 117.70 ? 96  TRP A H    1 
ATOM   718   H HA   . TRP A  1 53  ? 102.583 -7.663   -37.740  1.00 117.41 ? 96  TRP A HA   1 
ATOM   719   H HB2  . TRP A  1 53  ? 104.149 -5.548   -38.758  1.00 121.73 ? 96  TRP A HB2  1 
ATOM   720   H HB3  . TRP A  1 53  ? 103.025 -5.415   -37.643  1.00 121.73 ? 96  TRP A HB3  1 
ATOM   721   H HD1  . TRP A  1 53  ? 106.547 -5.980   -37.899  1.00 126.33 ? 96  TRP A HD1  1 
ATOM   722   H HE1  . TRP A  1 53  ? 107.582 -6.393   -35.764  1.00 128.53 ? 96  TRP A HE1  1 
ATOM   723   H HE3  . TRP A  1 53  ? 102.523 -6.554   -35.162  1.00 122.55 ? 96  TRP A HE3  1 
ATOM   724   H HZ2  . TRP A  1 53  ? 106.754 -6.912   -33.174  1.00 128.36 ? 96  TRP A HZ2  1 
ATOM   725   H HZ3  . TRP A  1 53  ? 102.747 -7.000   -32.901  1.00 123.76 ? 96  TRP A HZ3  1 
ATOM   726   H HH2  . TRP A  1 53  ? 104.835 -7.175   -31.926  1.00 126.58 ? 96  TRP A HH2  1 
ATOM   727   N N    . LYS A  1 54  ? 102.550 -7.427   -40.837  1.00 154.79 ? 97  LYS A N    1 
ATOM   728   C CA   . LYS A  1 54  ? 101.686 -7.350   -42.010  1.00 156.08 ? 97  LYS A CA   1 
ATOM   729   C C    . LYS A  1 54  ? 101.683 -8.699   -42.721  1.00 156.72 ? 97  LYS A C    1 
ATOM   730   O O    . LYS A  1 54  ? 102.382 -8.897   -43.717  1.00 157.75 ? 97  LYS A O    1 
ATOM   731   C CB   . LYS A  1 54  ? 102.146 -6.235   -42.952  1.00 157.06 ? 97  LYS A CB   1 
ATOM   732   C CG   . LYS A  1 54  ? 101.176 -5.938   -44.088  1.00 157.67 ? 97  LYS A CG   1 
ATOM   733   C CD   . LYS A  1 54  ? 99.823  -5.471   -43.562  1.00 157.19 ? 97  LYS A CD   1 
ATOM   734   C CE   . LYS A  1 54  ? 98.937  -4.939   -44.680  1.00 157.31 ? 97  LYS A CE   1 
ATOM   735   N NZ   . LYS A  1 54  ? 97.598  -4.504   -44.182  1.00 157.18 ? 97  LYS A NZ   1 
ATOM   736   H H    . LYS A  1 54  ? 103.332 -7.744   -41.002  1.00 127.39 ? 97  LYS A H    1 
ATOM   737   H HA   . LYS A  1 54  ? 100.779 -7.153   -41.727  1.00 126.40 ? 97  LYS A HA   1 
ATOM   738   H HB2  . LYS A  1 54  ? 102.258 -5.420   -42.439  1.00 128.91 ? 97  LYS A HB2  1 
ATOM   739   H HB3  . LYS A  1 54  ? 102.994 -6.492   -43.348  1.00 128.91 ? 97  LYS A HB3  1 
ATOM   740   H HG2  . LYS A  1 54  ? 101.544 -5.236   -44.647  1.00 127.81 ? 97  LYS A HG2  1 
ATOM   741   H HG3  . LYS A  1 54  ? 101.038 -6.744   -44.609  1.00 127.81 ? 97  LYS A HG3  1 
ATOM   742   H HD2  . LYS A  1 54  ? 99.367  -6.218   -43.143  1.00 125.75 ? 97  LYS A HD2  1 
ATOM   743   H HD3  . LYS A  1 54  ? 99.959  -4.758   -42.918  1.00 125.75 ? 97  LYS A HD3  1 
ATOM   744   H HE2  . LYS A  1 54  ? 99.369  -4.175   -45.092  1.00 125.43 ? 97  LYS A HE2  1 
ATOM   745   H HE3  . LYS A  1 54  ? 98.801  -5.640   -45.338  1.00 125.43 ? 97  LYS A HE3  1 
ATOM   746   H HZ1  . LYS A  1 54  ? 97.176  -5.190   -43.804  1.00 128.88 ? 97  LYS A HZ1  1 
ATOM   747   H HZ2  . LYS A  1 54  ? 97.693  -3.856   -43.580  1.00 128.88 ? 97  LYS A HZ2  1 
ATOM   748   H HZ3  . LYS A  1 54  ? 97.106  -4.200   -44.859  1.00 128.88 ? 97  LYS A HZ3  1 
ATOM   749   N N    . ASN A  1 55  ? 100.884 -9.619   -42.190  1.00 147.97 ? 98  ASN A N    1 
ATOM   750   C CA   . ASN A  1 55  ? 100.870 -11.005  -42.641  1.00 148.72 ? 98  ASN A CA   1 
ATOM   751   C C    . ASN A  1 55  ? 99.440  -11.515  -42.757  1.00 149.25 ? 98  ASN A C    1 
ATOM   752   O O    . ASN A  1 55  ? 98.779  -11.770  -41.751  1.00 147.93 ? 98  ASN A O    1 
ATOM   753   C CB   . ASN A  1 55  ? 101.679 -11.869  -41.674  1.00 147.21 ? 98  ASN A CB   1 
ATOM   754   C CG   . ASN A  1 55  ? 101.797 -13.311  -42.128  1.00 148.24 ? 98  ASN A CG   1 
ATOM   755   O OD1  . ASN A  1 55  ? 101.368 -13.674  -43.223  1.00 150.32 ? 98  ASN A OD1  1 
ATOM   756   N ND2  . ASN A  1 55  ? 102.402 -14.139  -41.286  1.00 146.88 ? 98  ASN A ND2  1 
ATOM   757   H H    . ASN A  1 55  ? 100.329 -9.460   -41.553  1.00 126.67 ? 98  ASN A H    1 
ATOM   758   H HA   . ASN A  1 55  ? 101.284 -11.060  -43.516  1.00 125.38 ? 98  ASN A HA   1 
ATOM   759   H HB2  . ASN A  1 55  ? 102.575 -11.505  -41.599  1.00 125.18 ? 98  ASN A HB2  1 
ATOM   760   H HB3  . ASN A  1 55  ? 101.245 -11.863  -40.806  1.00 125.18 ? 98  ASN A HB3  1 
ATOM   761   H HD21 . ASN A  1 55  ? 102.497 -14.968  -41.493  1.00 124.29 ? 98  ASN A HD21 1 
ATOM   762   H HD22 . ASN A  1 55  ? 102.699 -13.846  -40.534  1.00 124.29 ? 98  ASN A HD22 1 
ATOM   763   N N    . ASN A  1 56  ? 98.975  -11.668  -43.993  1.00 142.81 ? 99  ASN A N    1 
ATOM   764   C CA   . ASN A  1 56  ? 97.569  -11.953  -44.267  1.00 143.35 ? 99  ASN A CA   1 
ATOM   765   C C    . ASN A  1 56  ? 97.036  -13.193  -43.556  1.00 143.63 ? 99  ASN A C    1 
ATOM   766   O O    . ASN A  1 56  ? 95.838  -13.298  -43.296  1.00 143.55 ? 99  ASN A O    1 
ATOM   767   C CB   . ASN A  1 56  ? 97.355  -12.101  -45.775  1.00 144.57 ? 99  ASN A CB   1 
ATOM   768   C CG   . ASN A  1 56  ? 95.932  -12.503  -46.125  1.00 144.66 ? 99  ASN A CG   1 
ATOM   769   O OD1  . ASN A  1 56  ? 95.659  -13.667  -46.420  1.00 145.94 ? 99  ASN A OD1  1 
ATOM   770   N ND2  . ASN A  1 56  ? 95.015  -11.540  -46.083  1.00 143.24 ? 99  ASN A ND2  1 
ATOM   771   H H    . ASN A  1 56  ? 99.461  -11.611  -44.701  1.00 135.40 ? 99  ASN A H    1 
ATOM   772   H HA   . ASN A  1 56  ? 97.040  -11.196  -43.970  1.00 134.17 ? 99  ASN A HA   1 
ATOM   773   H HB2  . ASN A  1 56  ? 97.542  -11.253  -46.206  1.00 135.01 ? 99  ASN A HB2  1 
ATOM   774   H HB3  . ASN A  1 56  ? 97.953  -12.786  -46.114  1.00 135.01 ? 99  ASN A HB3  1 
ATOM   775   H HD21 . ASN A  1 56  ? 94.195  -11.717  -46.273  1.00 129.72 ? 99  ASN A HD21 1 
ATOM   776   H HD22 . ASN A  1 56  ? 95.242  -10.739  -45.865  1.00 129.72 ? 99  ASN A HD22 1 
ATOM   777   N N    . MET A  1 57  ? 97.923  -14.126  -43.235  1.00 140.64 ? 100 MET A N    1 
ATOM   778   C CA   . MET A  1 57  ? 97.514  -15.347  -42.556  1.00 140.83 ? 100 MET A CA   1 
ATOM   779   C C    . MET A  1 57  ? 96.981  -15.043  -41.152  1.00 138.16 ? 100 MET A C    1 
ATOM   780   O O    . MET A  1 57  ? 96.136  -15.774  -40.632  1.00 138.30 ? 100 MET A O    1 
ATOM   781   C CB   . MET A  1 57  ? 98.681  -16.330  -42.488  1.00 141.14 ? 100 MET A CB   1 
ATOM   782   C CG   . MET A  1 57  ? 99.113  -16.863  -43.836  1.00 143.75 ? 100 MET A CG   1 
ATOM   783   S SD   . MET A  1 57  ? 100.510 -17.981  -43.678  1.00 143.93 ? 100 MET A SD   1 
ATOM   784   C CE   . MET A  1 57  ? 101.790 -16.839  -43.174  1.00 140.93 ? 100 MET A CE   1 
ATOM   785   H H    . MET A  1 57  ? 98.766  -14.077  -43.399  1.00 114.78 ? 100 MET A H    1 
ATOM   786   H HA   . MET A  1 57  ? 96.807  -15.766  -43.071  1.00 111.80 ? 100 MET A HA   1 
ATOM   787   H HB2  . MET A  1 57  ? 99.443  -15.883  -42.088  1.00 112.30 ? 100 MET A HB2  1 
ATOM   788   H HB3  . MET A  1 57  ? 98.420  -17.087  -41.940  1.00 112.30 ? 100 MET A HB3  1 
ATOM   789   H HG2  . MET A  1 57  ? 98.378  -17.349  -44.240  1.00 114.02 ? 100 MET A HG2  1 
ATOM   790   H HG3  . MET A  1 57  ? 99.379  -16.122  -44.404  1.00 114.02 ? 100 MET A HG3  1 
ATOM   791   H HE1  . MET A  1 57  ? 102.619 -17.329  -43.051  1.00 118.97 ? 100 MET A HE1  1 
ATOM   792   H HE2  . MET A  1 57  ? 101.902 -16.166  -43.864  1.00 118.97 ? 100 MET A HE2  1 
ATOM   793   H HE3  . MET A  1 57  ? 101.528 -16.418  -42.341  1.00 118.97 ? 100 MET A HE3  1 
ATOM   794   N N    . VAL A  1 58  ? 97.469  -13.963  -40.547  1.00 141.17 ? 101 VAL A N    1 
ATOM   795   C CA   . VAL A  1 58  ? 97.001  -13.547  -39.226  1.00 138.35 ? 101 VAL A CA   1 
ATOM   796   C C    . VAL A  1 58  ? 95.529  -13.156  -39.286  1.00 138.63 ? 101 VAL A C    1 
ATOM   797   O O    . VAL A  1 58  ? 94.727  -13.593  -38.461  1.00 137.20 ? 101 VAL A O    1 
ATOM   798   C CB   . VAL A  1 58  ? 97.830  -12.361  -38.674  1.00 136.65 ? 101 VAL A CB   1 
ATOM   799   C CG1  . VAL A  1 58  ? 97.188  -11.763  -37.429  1.00 134.35 ? 101 VAL A CG1  1 
ATOM   800   C CG2  . VAL A  1 58  ? 99.245  -12.811  -38.361  1.00 135.85 ? 101 VAL A CG2  1 
ATOM   801   H H    . VAL A  1 58  ? 98.073  -13.451  -40.881  1.00 135.20 ? 101 VAL A H    1 
ATOM   802   H HA   . VAL A  1 58  ? 97.091  -14.290  -38.609  1.00 135.59 ? 101 VAL A HA   1 
ATOM   803   H HB   . VAL A  1 58  ? 97.877  -11.668  -39.351  1.00 139.67 ? 101 VAL A HB   1 
ATOM   804   H HG11 . VAL A  1 58  ? 97.735  -11.026  -37.116  1.00 141.18 ? 101 VAL A HG11 1 
ATOM   805   H HG12 . VAL A  1 58  ? 96.300  -11.444  -37.655  1.00 141.18 ? 101 VAL A HG12 1 
ATOM   806   H HG13 . VAL A  1 58  ? 97.130  -12.447  -36.744  1.00 141.18 ? 101 VAL A HG13 1 
ATOM   807   H HG21 . VAL A  1 58  ? 99.747  -12.055  -38.018  1.00 140.29 ? 101 VAL A HG21 1 
ATOM   808   H HG22 . VAL A  1 58  ? 99.213  -13.516  -37.697  1.00 140.29 ? 101 VAL A HG22 1 
ATOM   809   H HG23 . VAL A  1 58  ? 99.658  -13.141  -39.175  1.00 140.29 ? 101 VAL A HG23 1 
ATOM   810   N N    . GLU A  1 59  ? 95.182  -12.339  -40.275  1.00 142.08 ? 102 GLU A N    1 
ATOM   811   C CA   . GLU A  1 59  ? 93.816  -11.856  -40.420  1.00 142.32 ? 102 GLU A CA   1 
ATOM   812   C C    . GLU A  1 59  ? 92.857  -13.005  -40.701  1.00 143.52 ? 102 GLU A C    1 
ATOM   813   O O    . GLU A  1 59  ? 91.722  -13.005  -40.225  1.00 142.75 ? 102 GLU A O    1 
ATOM   814   C CB   . GLU A  1 59  ? 93.726  -10.817  -41.540  1.00 143.57 ? 102 GLU A CB   1 
ATOM   815   C CG   . GLU A  1 59  ? 92.316  -10.302  -41.794  1.00 143.68 ? 102 GLU A CG   1 
ATOM   816   C CD   . GLU A  1 59  ? 91.637  -9.801   -40.530  1.00 142.37 ? 102 GLU A CD   1 
ATOM   817   O OE1  . GLU A  1 59  ? 92.248  -8.982   -39.811  1.00 141.58 ? 102 GLU A OE1  1 
ATOM   818   O OE2  . GLU A  1 59  ? 90.496  -10.229  -40.252  1.00 142.10 ? 102 GLU A OE2  1 
ATOM   819   H H    . GLU A  1 59  ? 95.722  -12.049  -40.877  1.00 92.07  ? 102 GLU A H    1 
ATOM   820   H HA   . GLU A  1 59  ? 93.541  -11.430  -39.593  1.00 90.16  ? 102 GLU A HA   1 
ATOM   821   H HB2  . GLU A  1 59  ? 94.281  -10.056  -41.305  1.00 92.59  ? 102 GLU A HB2  1 
ATOM   822   H HB3  . GLU A  1 59  ? 94.048  -11.216  -42.363  1.00 92.59  ? 102 GLU A HB3  1 
ATOM   823   H HG2  . GLU A  1 59  ? 92.356  -9.567   -42.425  1.00 91.04  ? 102 GLU A HG2  1 
ATOM   824   H HG3  . GLU A  1 59  ? 91.777  -11.022  -42.158  1.00 91.04  ? 102 GLU A HG3  1 
ATOM   825   N N    . GLN A  1 60  ? 93.314  -13.982  -41.478  1.00 141.72 ? 103 GLN A N    1 
ATOM   826   C CA   . GLN A  1 60  ? 92.491  -15.142  -41.797  1.00 143.65 ? 103 GLN A CA   1 
ATOM   827   C C    . GLN A  1 60  ? 92.251  -15.992  -40.561  1.00 142.66 ? 103 GLN A C    1 
ATOM   828   O O    . GLN A  1 60  ? 91.149  -16.498  -40.356  1.00 142.80 ? 103 GLN A O    1 
ATOM   829   C CB   . GLN A  1 60  ? 93.141  -15.992  -42.886  1.00 146.43 ? 103 GLN A CB   1 
ATOM   830   C CG   . GLN A  1 60  ? 93.193  -15.319  -44.248  1.00 146.58 ? 103 GLN A CG   1 
ATOM   831   C CD   . GLN A  1 60  ? 93.733  -16.235  -45.333  1.00 148.74 ? 103 GLN A CD   1 
ATOM   832   O OE1  . GLN A  1 60  ? 93.676  -17.460  -45.215  1.00 150.74 ? 103 GLN A OE1  1 
ATOM   833   N NE2  . GLN A  1 60  ? 94.264  -15.642  -46.398  1.00 148.36 ? 103 GLN A NE2  1 
ATOM   834   H H    . GLN A  1 60  ? 94.097  -13.996  -41.833  1.00 182.28 ? 103 GLN A H    1 
ATOM   835   H HA   . GLN A  1 60  ? 91.630  -14.839  -42.126  1.00 180.06 ? 103 GLN A HA   1 
ATOM   836   H HB2  . GLN A  1 60  ? 94.052  -16.194  -42.622  1.00 181.30 ? 103 GLN A HB2  1 
ATOM   837   H HB3  . GLN A  1 60  ? 92.637  -16.815  -42.982  1.00 181.30 ? 103 GLN A HB3  1 
ATOM   838   H HG2  . GLN A  1 60  ? 92.297  -15.049  -44.501  1.00 182.66 ? 103 GLN A HG2  1 
ATOM   839   H HG3  . GLN A  1 60  ? 93.772  -14.542  -44.195  1.00 182.66 ? 103 GLN A HG3  1 
ATOM   840   H HE21 . GLN A  1 60  ? 94.584  -16.117  -47.040  1.00 187.20 ? 103 GLN A HE21 1 
ATOM   841   H HE22 . GLN A  1 60  ? 94.288  -14.784  -46.445  1.00 187.20 ? 103 GLN A HE22 1 
ATOM   842   N N    . MET A  1 61  ? 93.283  -16.156  -39.741  1.00 143.49 ? 104 MET A N    1 
ATOM   843   C CA   . MET A  1 61  ? 93.146  -16.922  -38.512  1.00 141.39 ? 104 MET A CA   1 
ATOM   844   C C    . MET A  1 61  ? 92.168  -16.243  -37.563  1.00 138.22 ? 104 MET A C    1 
ATOM   845   O O    . MET A  1 61  ? 91.308  -16.900  -36.980  1.00 137.60 ? 104 MET A O    1 
ATOM   846   C CB   . MET A  1 61  ? 94.498  -17.101  -37.821  1.00 139.44 ? 104 MET A CB   1 
ATOM   847   C CG   . MET A  1 61  ? 94.389  -17.789  -36.463  1.00 136.96 ? 104 MET A CG   1 
ATOM   848   S SD   . MET A  1 61  ? 95.948  -18.406  -35.804  1.00 135.73 ? 104 MET A SD   1 
ATOM   849   C CE   . MET A  1 61  ? 96.065  -20.005  -36.617  1.00 140.36 ? 104 MET A CE   1 
ATOM   850   H H    . MET A  1 61  ? 94.070  -15.835  -39.874  1.00 115.04 ? 104 MET A H    1 
ATOM   851   H HA   . MET A  1 61  ? 92.807  -17.804  -38.730  1.00 115.35 ? 104 MET A HA   1 
ATOM   852   H HB2  . MET A  1 61  ? 95.071  -17.642  -38.386  1.00 118.43 ? 104 MET A HB2  1 
ATOM   853   H HB3  . MET A  1 61  ? 94.899  -16.228  -37.683  1.00 118.43 ? 104 MET A HB3  1 
ATOM   854   H HG2  . MET A  1 61  ? 94.030  -17.155  -35.822  1.00 119.01 ? 104 MET A HG2  1 
ATOM   855   H HG3  . MET A  1 61  ? 93.786  -18.544  -36.546  1.00 119.01 ? 104 MET A HG3  1 
ATOM   856   H HE1  . MET A  1 61  ? 96.883  -20.444  -36.335  1.00 122.96 ? 104 MET A HE1  1 
ATOM   857   H HE2  . MET A  1 61  ? 95.298  -20.543  -36.367  1.00 122.96 ? 104 MET A HE2  1 
ATOM   858   H HE3  . MET A  1 61  ? 96.076  -19.871  -37.578  1.00 122.96 ? 104 MET A HE3  1 
ATOM   859   N N    . HIS A  1 62  ? 92.301  -14.929  -37.416  1.00 138.86 ? 105 HIS A N    1 
ATOM   860   C CA   . HIS A  1 62  ? 91.442  -14.176  -36.517  1.00 136.42 ? 105 HIS A CA   1 
ATOM   861   C C    . HIS A  1 62  ? 89.974  -14.445  -36.825  1.00 137.37 ? 105 HIS A C    1 
ATOM   862   O O    . HIS A  1 62  ? 89.179  -14.689  -35.921  1.00 135.57 ? 105 HIS A O    1 
ATOM   863   C CB   . HIS A  1 62  ? 91.737  -12.681  -36.623  1.00 136.23 ? 105 HIS A CB   1 
ATOM   864   C CG   . HIS A  1 62  ? 91.109  -11.862  -35.537  1.00 134.24 ? 105 HIS A CG   1 
ATOM   865   N ND1  . HIS A  1 62  ? 91.495  -11.955  -34.217  1.00 131.79 ? 105 HIS A ND1  1 
ATOM   866   C CD2  . HIS A  1 62  ? 90.121  -10.937  -35.575  1.00 134.89 ? 105 HIS A CD2  1 
ATOM   867   C CE1  . HIS A  1 62  ? 90.773  -11.122  -33.489  1.00 131.22 ? 105 HIS A CE1  1 
ATOM   868   N NE2  . HIS A  1 62  ? 89.932  -10.491  -34.288  1.00 133.06 ? 105 HIS A NE2  1 
ATOM   869   H H    . HIS A  1 62  ? 92.885  -14.450  -37.827  1.00 117.51 ? 105 HIS A H    1 
ATOM   870   H HA   . HIS A  1 62  ? 91.614  -14.454  -35.604  1.00 117.63 ? 105 HIS A HA   1 
ATOM   871   H HB2  . HIS A  1 62  ? 92.697  -12.547  -36.576  1.00 120.42 ? 105 HIS A HB2  1 
ATOM   872   H HB3  . HIS A  1 62  ? 91.400  -12.355  -37.472  1.00 120.42 ? 105 HIS A HB3  1 
ATOM   873   H HD1  . HIS A  1 62  ? 92.110  -12.474  -33.915  1.00 124.97 ? 105 HIS A HD1  1 
ATOM   874   H HD2  . HIS A  1 62  ? 89.657  -10.654  -36.330  1.00 123.72 ? 105 HIS A HD2  1 
ATOM   875   H HE1  . HIS A  1 62  ? 90.845  -11.000  -32.569  1.00 128.01 ? 105 HIS A HE1  1 
ATOM   876   H HE2  . HIS A  1 62  ? 89.359  -9.899   -34.044  1.00 126.63 ? 105 HIS A HE2  1 
ATOM   877   N N    . THR A  1 63  ? 89.624  -14.422  -38.107  1.00 132.05 ? 106 THR A N    1 
ATOM   878   C CA   . THR A  1 63  ? 88.238  -14.614  -38.523  1.00 132.75 ? 106 THR A CA   1 
ATOM   879   C C    . THR A  1 63  ? 87.738  -16.030  -38.238  1.00 133.37 ? 106 THR A C    1 
ATOM   880   O O    . THR A  1 63  ? 86.571  -16.221  -37.897  1.00 132.62 ? 106 THR A O    1 
ATOM   881   C CB   . THR A  1 63  ? 88.057  -14.321  -40.023  1.00 135.10 ? 106 THR A CB   1 
ATOM   882   O OG1  . THR A  1 63  ? 88.960  -15.130  -40.785  1.00 137.56 ? 106 THR A OG1  1 
ATOM   883   C CG2  . THR A  1 63  ? 88.317  -12.846  -40.321  1.00 134.79 ? 106 THR A CG2  1 
ATOM   884   H H    . THR A  1 63  ? 90.171  -14.297  -38.758  1.00 107.10 ? 106 THR A H    1 
ATOM   885   H HA   . THR A  1 63  ? 87.676  -13.996  -38.029  1.00 105.80 ? 106 THR A HA   1 
ATOM   886   H HB   . THR A  1 63  ? 87.145  -14.527  -40.283  1.00 106.09 ? 106 THR A HB   1 
ATOM   887   H HG1  . THR A  1 63  ? 89.753  -14.960  -40.565  1.00 106.24 ? 106 THR A HG1  1 
ATOM   888   H HG21 . THR A  1 63  ? 88.200  -12.673  -41.268  1.00 107.69 ? 106 THR A HG21 1 
ATOM   889   H HG22 . THR A  1 63  ? 87.697  -12.292  -39.821  1.00 107.69 ? 106 THR A HG22 1 
ATOM   890   H HG23 . THR A  1 63  ? 89.224  -12.612  -40.068  1.00 107.69 ? 106 THR A HG23 1 
ATOM   891   N N    . ASP A  1 64  ? 88.615  -17.019  -38.376  1.00 127.69 ? 107 ASP A N    1 
ATOM   892   C CA   . ASP A  1 64  ? 88.219  -18.412  -38.186  1.00 129.43 ? 107 ASP A CA   1 
ATOM   893   C C    . ASP A  1 64  ? 87.905  -18.724  -36.728  1.00 126.62 ? 107 ASP A C    1 
ATOM   894   O O    . ASP A  1 64  ? 86.923  -19.405  -36.433  1.00 127.31 ? 107 ASP A O    1 
ATOM   895   C CB   . ASP A  1 64  ? 89.314  -19.356  -38.694  1.00 132.74 ? 107 ASP A CB   1 
ATOM   896   C CG   . ASP A  1 64  ? 89.334  -19.470  -40.209  1.00 136.42 ? 107 ASP A CG   1 
ATOM   897   O OD1  . ASP A  1 64  ? 88.324  -19.114  -40.853  1.00 136.15 ? 107 ASP A OD1  1 
ATOM   898   O OD2  . ASP A  1 64  ? 90.358  -19.927  -40.759  1.00 139.07 ? 107 ASP A OD2  1 
ATOM   899   H H    . ASP A  1 64  ? 89.443  -16.911  -38.579  1.00 91.05  ? 107 ASP A H    1 
ATOM   900   H HA   . ASP A  1 64  ? 87.417  -18.582  -38.704  1.00 91.54  ? 107 ASP A HA   1 
ATOM   901   H HB2  . ASP A  1 64  ? 90.178  -19.022  -38.407  1.00 92.69  ? 107 ASP A HB2  1 
ATOM   902   H HB3  . ASP A  1 64  ? 89.163  -20.242  -38.328  1.00 92.69  ? 107 ASP A HB3  1 
ATOM   903   N N    . ILE A  1 65  ? 88.734  -18.223  -35.817  1.00 129.38 ? 108 ILE A N    1 
ATOM   904   C CA   . ILE A  1 65  ? 88.545  -18.490  -34.394  1.00 126.77 ? 108 ILE A CA   1 
ATOM   905   C C    . ILE A  1 65  ? 87.288  -17.798  -33.882  1.00 124.86 ? 108 ILE A C    1 
ATOM   906   O O    . ILE A  1 65  ? 86.619  -18.294  -32.977  1.00 124.24 ? 108 ILE A O    1 
ATOM   907   C CB   . ILE A  1 65  ? 89.766  -18.033  -33.567  1.00 124.18 ? 108 ILE A CB   1 
ATOM   908   C CG1  . ILE A  1 65  ? 91.052  -18.635  -34.131  1.00 125.97 ? 108 ILE A CG1  1 
ATOM   909   C CG2  . ILE A  1 65  ? 89.617  -18.430  -32.107  1.00 122.38 ? 108 ILE A CG2  1 
ATOM   910   C CD1  . ILE A  1 65  ? 90.993  -20.130  -34.372  1.00 129.37 ? 108 ILE A CD1  1 
ATOM   911   H H    . ILE A  1 65  ? 89.412  -17.726  -35.996  1.00 56.01  ? 108 ILE A H    1 
ATOM   912   H HA   . ILE A  1 65  ? 88.436  -19.445  -34.264  1.00 57.80  ? 108 ILE A HA   1 
ATOM   913   H HB   . ILE A  1 65  ? 89.829  -17.066  -33.619  1.00 59.53  ? 108 ILE A HB   1 
ATOM   914   H HG12 . ILE A  1 65  ? 91.248  -18.208  -34.979  1.00 60.36  ? 108 ILE A HG12 1 
ATOM   915   H HG13 . ILE A  1 65  ? 91.774  -18.466  -33.505  1.00 60.36  ? 108 ILE A HG13 1 
ATOM   916   H HG21 . ILE A  1 65  ? 90.398  -18.128  -31.617  1.00 62.42  ? 108 ILE A HG21 1 
ATOM   917   H HG22 . ILE A  1 65  ? 88.818  -18.013  -31.746  1.00 62.42  ? 108 ILE A HG22 1 
ATOM   918   H HG23 . ILE A  1 65  ? 89.541  -19.395  -32.048  1.00 62.42  ? 108 ILE A HG23 1 
ATOM   919   H HD11 . ILE A  1 65  ? 91.846  -20.426  -34.727  1.00 61.47  ? 108 ILE A HD11 1 
ATOM   920   H HD12 . ILE A  1 65  ? 90.812  -20.578  -33.531  1.00 61.47  ? 108 ILE A HD12 1 
ATOM   921   H HD13 . ILE A  1 65  ? 90.285  -20.319  -35.007  1.00 61.47  ? 108 ILE A HD13 1 
ATOM   922   N N    . ILE A  1 66  ? 86.972  -16.648  -34.465  1.00 128.39 ? 109 ILE A N    1 
ATOM   923   C CA   . ILE A  1 66  ? 85.738  -15.952  -34.139  1.00 127.29 ? 109 ILE A CA   1 
ATOM   924   C C    . ILE A  1 66  ? 84.544  -16.836  -34.495  1.00 128.91 ? 109 ILE A C    1 
ATOM   925   O O    . ILE A  1 66  ? 83.598  -16.961  -33.713  1.00 127.95 ? 109 ILE A O    1 
ATOM   926   C CB   . ILE A  1 66  ? 85.645  -14.596  -34.875  1.00 127.69 ? 109 ILE A CB   1 
ATOM   927   C CG1  . ILE A  1 66  ? 86.627  -13.601  -34.251  1.00 126.36 ? 109 ILE A CG1  1 
ATOM   928   C CG2  . ILE A  1 66  ? 84.222  -14.030  -34.821  1.00 127.47 ? 109 ILE A CG2  1 
ATOM   929   C CD1  . ILE A  1 66  ? 86.796  -12.327  -35.035  1.00 127.86 ? 109 ILE A CD1  1 
ATOM   930   H H    . ILE A  1 66  ? 87.457  -16.251  -35.053  1.00 56.23  ? 109 ILE A H    1 
ATOM   931   H HA   . ILE A  1 66  ? 85.713  -15.780  -33.184  1.00 57.61  ? 109 ILE A HA   1 
ATOM   932   H HB   . ILE A  1 66  ? 85.890  -14.731  -35.804  1.00 57.67  ? 109 ILE A HB   1 
ATOM   933   H HG12 . ILE A  1 66  ? 86.308  -13.363  -33.366  1.00 59.04  ? 109 ILE A HG12 1 
ATOM   934   H HG13 . ILE A  1 66  ? 87.497  -14.024  -34.183  1.00 59.04  ? 109 ILE A HG13 1 
ATOM   935   H HG21 . ILE A  1 66  ? 84.202  -13.182  -35.292  1.00 59.57  ? 109 ILE A HG21 1 
ATOM   936   H HG22 . ILE A  1 66  ? 83.616  -14.658  -35.245  1.00 59.57  ? 109 ILE A HG22 1 
ATOM   937   H HG23 . ILE A  1 66  ? 83.969  -13.900  -33.894  1.00 59.57  ? 109 ILE A HG23 1 
ATOM   938   H HD11 . ILE A  1 66  ? 87.430  -11.755  -34.575  1.00 59.75  ? 109 ILE A HD11 1 
ATOM   939   H HD12 . ILE A  1 66  ? 87.128  -12.544  -35.920  1.00 59.75  ? 109 ILE A HD12 1 
ATOM   940   H HD13 . ILE A  1 66  ? 85.937  -11.882  -35.103  1.00 59.75  ? 109 ILE A HD13 1 
ATOM   941   N N    . SER A  1 67  ? 84.600  -17.461  -35.668  1.00 130.80 ? 110 SER A N    1 
ATOM   942   C CA   . SER A  1 67  ? 83.517  -18.322  -36.134  1.00 132.90 ? 110 SER A CA   1 
ATOM   943   C C    . SER A  1 67  ? 83.352  -19.536  -35.233  1.00 133.75 ? 110 SER A C    1 
ATOM   944   O O    . SER A  1 67  ? 82.234  -19.985  -34.976  1.00 134.22 ? 110 SER A O    1 
ATOM   945   C CB   . SER A  1 67  ? 83.776  -18.775  -37.571  0.99 136.19 ? 110 SER A CB   1 
ATOM   946   O OG   . SER A  1 67  ? 83.806  -17.667  -38.451  0.99 135.63 ? 110 SER A OG   1 
ATOM   947   H H    . SER A  1 67  ? 85.260  -17.402  -36.216  1.00 139.23 ? 110 SER A H    1 
ATOM   948   H HA   . SER A  1 67  ? 82.686  -17.821  -36.121  1.00 140.91 ? 110 SER A HA   1 
ATOM   949   H HB2  . SER A  1 67  ? 84.630  -19.233  -37.609  0.99 139.86 ? 110 SER A HB2  1 
ATOM   950   H HB3  . SER A  1 67  ? 83.065  -19.377  -37.845  0.99 139.86 ? 110 SER A HB3  1 
ATOM   951   H HG   . SER A  1 67  ? 83.071  -17.261  -38.427  0.99 140.02 ? 110 SER A HG   1 
ATOM   952   N N    . LEU A  1 68  ? 84.475  -20.063  -34.761  1.00 131.10 ? 111 LEU A N    1 
ATOM   953   C CA   . LEU A  1 68  ? 84.463  -21.228  -33.891  1.00 132.51 ? 111 LEU A CA   1 
ATOM   954   C C    . LEU A  1 68  ? 83.710  -20.903  -32.604  1.00 129.87 ? 111 LEU A C    1 
ATOM   955   O O    . LEU A  1 68  ? 82.744  -21.581  -32.257  1.00 131.51 ? 111 LEU A O    1 
ATOM   956   C CB   . LEU A  1 68  ? 85.896  -21.690  -33.591  1.00 133.06 ? 111 LEU A CB   1 
ATOM   957   C CG   . LEU A  1 68  ? 86.083  -23.053  -32.913  1.00 136.04 ? 111 LEU A CG   1 
ATOM   958   C CD1  . LEU A  1 68  ? 87.448  -23.628  -33.248  1.00 138.10 ? 111 LEU A CD1  1 
ATOM   959   C CD2  . LEU A  1 68  ? 85.923  -22.956  -31.403  1.00 133.61 ? 111 LEU A CD2  1 
ATOM   960   H H    . LEU A  1 68  ? 85.263  -19.761  -34.932  1.00 148.38 ? 111 LEU A H    1 
ATOM   961   H HA   . LEU A  1 68  ? 83.999  -21.953  -34.337  1.00 150.55 ? 111 LEU A HA   1 
ATOM   962   H HB2  . LEU A  1 68  ? 86.381  -21.723  -34.431  1.00 150.44 ? 111 LEU A HB2  1 
ATOM   963   H HB3  . LEU A  1 68  ? 86.309  -21.028  -33.014  1.00 150.44 ? 111 LEU A HB3  1 
ATOM   964   H HG   . LEU A  1 68  ? 85.410  -23.666  -33.247  1.00 153.78 ? 111 LEU A HG   1 
ATOM   965   H HD11 . LEU A  1 68  ? 87.544  -24.487  -32.810  1.00 155.12 ? 111 LEU A HD11 1 
ATOM   966   H HD12 . LEU A  1 68  ? 87.518  -23.736  -34.209  1.00 155.12 ? 111 LEU A HD12 1 
ATOM   967   H HD13 . LEU A  1 68  ? 88.133  -23.017  -32.933  1.00 155.12 ? 111 LEU A HD13 1 
ATOM   968   H HD21 . LEU A  1 68  ? 86.049  -23.837  -31.016  1.00 156.72 ? 111 LEU A HD21 1 
ATOM   969   H HD22 . LEU A  1 68  ? 86.589  -22.343  -31.054  1.00 156.72 ? 111 LEU A HD22 1 
ATOM   970   H HD23 . LEU A  1 68  ? 85.033  -22.629  -31.201  1.00 156.72 ? 111 LEU A HD23 1 
ATOM   971   N N    . TRP A  1 69  ? 84.140  -19.851  -31.914  1.00 125.99 ? 112 TRP A N    1 
ATOM   972   C CA   . TRP A  1 69  ? 83.541  -19.479  -30.638  1.00 124.17 ? 112 TRP A CA   1 
ATOM   973   C C    . TRP A  1 69  ? 82.055  -19.181  -30.780  1.00 124.22 ? 112 TRP A C    1 
ATOM   974   O O    . TRP A  1 69  ? 81.248  -19.618  -29.961  1.00 124.91 ? 112 TRP A O    1 
ATOM   975   C CB   . TRP A  1 69  ? 84.254  -18.262  -30.052  1.00 121.22 ? 112 TRP A CB   1 
ATOM   976   C CG   . TRP A  1 69  ? 85.478  -18.601  -29.267  1.00 120.89 ? 112 TRP A CG   1 
ATOM   977   C CD1  . TRP A  1 69  ? 86.572  -19.273  -29.715  1.00 121.88 ? 112 TRP A CD1  1 
ATOM   978   C CD2  . TRP A  1 69  ? 85.738  -18.275  -27.897  1.00 120.03 ? 112 TRP A CD2  1 
ATOM   979   N NE1  . TRP A  1 69  ? 87.499  -19.391  -28.708  1.00 121.28 ? 112 TRP A NE1  1 
ATOM   980   C CE2  . TRP A  1 69  ? 87.011  -18.784  -27.582  1.00 120.35 ? 112 TRP A CE2  1 
ATOM   981   C CE3  . TRP A  1 69  ? 85.017  -17.601  -26.906  1.00 119.65 ? 112 TRP A CE3  1 
ATOM   982   C CZ2  . TRP A  1 69  ? 87.581  -18.643  -26.317  1.00 120.40 ? 112 TRP A CZ2  1 
ATOM   983   C CZ3  . TRP A  1 69  ? 85.585  -17.462  -25.650  1.00 120.10 ? 112 TRP A CZ3  1 
ATOM   984   C CH2  . TRP A  1 69  ? 86.854  -17.981  -25.368  1.00 120.54 ? 112 TRP A CH2  1 
ATOM   985   H H    . TRP A  1 69  ? 84.780  -19.335  -32.165  1.00 70.64  ? 112 TRP A H    1 
ATOM   986   H HA   . TRP A  1 69  ? 83.642  -20.215  -30.014  1.00 74.54  ? 112 TRP A HA   1 
ATOM   987   H HB2  . TRP A  1 69  ? 84.520  -17.676  -30.777  1.00 74.85  ? 112 TRP A HB2  1 
ATOM   988   H HB3  . TRP A  1 69  ? 83.643  -17.796  -29.460  1.00 74.85  ? 112 TRP A HB3  1 
ATOM   989   H HD1  . TRP A  1 69  ? 86.677  -19.606  -30.576  1.00 74.02  ? 112 TRP A HD1  1 
ATOM   990   H HE1  . TRP A  1 69  ? 88.263  -19.781  -28.775  1.00 76.77  ? 112 TRP A HE1  1 
ATOM   991   H HE3  . TRP A  1 69  ? 84.174  -17.253  -27.087  1.00 82.72  ? 112 TRP A HE3  1 
ATOM   992   H HZ2  . TRP A  1 69  ? 88.423  -18.988  -26.127  1.00 84.10  ? 112 TRP A HZ2  1 
ATOM   993   H HZ3  . TRP A  1 69  ? 85.115  -17.016  -24.983  1.00 86.75  ? 112 TRP A HZ3  1 
ATOM   994   H HH2  . TRP A  1 69  ? 87.210  -17.873  -24.516  1.00 87.35  ? 112 TRP A HH2  1 
ATOM   995   N N    . ASP A  1 70  ? 81.699  -18.440  -31.824  1.00 135.15 ? 113 ASP A N    1 
ATOM   996   C CA   . ASP A  1 70  ? 80.313  -18.033  -32.036  1.00 135.03 ? 113 ASP A CA   1 
ATOM   997   C C    . ASP A  1 70  ? 79.403  -19.230  -32.268  1.00 137.60 ? 113 ASP A C    1 
ATOM   998   O O    . ASP A  1 70  ? 78.238  -19.212  -31.877  1.00 137.54 ? 113 ASP A O    1 
ATOM   999   C CB   . ASP A  1 70  ? 80.205  -17.075  -33.224  1.00 134.78 ? 113 ASP A CB   1 
ATOM   1000  C CG   . ASP A  1 70  ? 80.781  -15.701  -32.925  1.00 132.94 ? 113 ASP A CG   1 
ATOM   1001  O OD1  . ASP A  1 70  ? 80.635  -15.226  -31.778  1.00 131.63 ? 113 ASP A OD1  1 
ATOM   1002  O OD2  . ASP A  1 70  ? 81.374  -15.091  -33.842  1.00 133.42 ? 113 ASP A OD2  1 
ATOM   1003  H H    . ASP A  1 70  ? 82.243  -18.159  -32.428  1.00 140.19 ? 113 ASP A H    1 
ATOM   1004  H HA   . ASP A  1 70  ? 79.998  -17.567  -31.246  1.00 141.88 ? 113 ASP A HA   1 
ATOM   1005  H HB2  . ASP A  1 70  ? 80.692  -17.447  -33.975  1.00 139.67 ? 113 ASP A HB2  1 
ATOM   1006  H HB3  . ASP A  1 70  ? 79.270  -16.964  -33.456  1.00 139.67 ? 113 ASP A HB3  1 
ATOM   1007  N N    . GLN A  1 71  ? 79.931  -20.265  -32.909  1.00 140.45 ? 114 GLN A N    1 
ATOM   1008  C CA   . GLN A  1 71  ? 79.145  -21.460  -33.189  1.00 143.65 ? 114 GLN A CA   1 
ATOM   1009  C C    . GLN A  1 71  ? 79.201  -22.448  -32.026  1.00 145.30 ? 114 GLN A C    1 
ATOM   1010  O O    . GLN A  1 71  ? 78.331  -23.311  -31.889  1.00 147.56 ? 114 GLN A O    1 
ATOM   1011  C CB   . GLN A  1 71  ? 79.640  -22.133  -34.472  1.00 146.55 ? 114 GLN A CB   1 
ATOM   1012  C CG   . GLN A  1 71  ? 78.710  -23.223  -35.001  1.00 149.09 ? 114 GLN A CG   1 
ATOM   1013  C CD   . GLN A  1 71  ? 77.321  -22.699  -35.354  1.00 147.51 ? 114 GLN A CD   1 
ATOM   1014  O OE1  . GLN A  1 71  ? 77.165  -21.543  -35.757  1.00 145.22 ? 114 GLN A OE1  1 
ATOM   1015  N NE2  . GLN A  1 71  ? 76.305  -23.548  -35.195  1.00 148.58 ? 114 GLN A NE2  1 
ATOM   1016  H H    . GLN A  1 71  ? 80.742  -20.301  -33.193  1.00 189.81 ? 114 GLN A H    1 
ATOM   1017  H HA   . GLN A  1 71  ? 78.219  -21.205  -33.321  1.00 193.94 ? 114 GLN A HA   1 
ATOM   1018  H HB2  . GLN A  1 71  ? 79.729  -21.459  -35.163  1.00 193.30 ? 114 GLN A HB2  1 
ATOM   1019  H HB3  . GLN A  1 71  ? 80.503  -22.540  -34.298  1.00 193.30 ? 114 GLN A HB3  1 
ATOM   1020  H HG2  . GLN A  1 71  ? 79.097  -23.606  -35.803  1.00 198.72 ? 114 GLN A HG2  1 
ATOM   1021  H HG3  . GLN A  1 71  ? 78.608  -23.908  -34.322  1.00 198.72 ? 114 GLN A HG3  1 
ATOM   1022  H HE21 . GLN A  1 71  ? 75.503  -23.298  -35.381  1.00 208.80 ? 114 GLN A HE21 1 
ATOM   1023  H HE22 . GLN A  1 71  ? 76.452  -24.345  -34.908  1.00 208.80 ? 114 GLN A HE22 1 
ATOM   1024  N N    . SER A  1 72  ? 80.217  -22.302  -31.180  1.00 136.53 ? 115 SER A N    1 
ATOM   1025  C CA   . SER A  1 72  ? 80.489  -23.270  -30.121  1.00 138.86 ? 115 SER A CA   1 
ATOM   1026  C C    . SER A  1 72  ? 80.005  -22.803  -28.752  1.00 137.19 ? 115 SER A C    1 
ATOM   1027  O O    . SER A  1 72  ? 79.225  -23.496  -28.098  1.00 139.56 ? 115 SER A O    1 
ATOM   1028  C CB   . SER A  1 72  ? 81.983  -23.562  -30.061  1.00 139.42 ? 115 SER A CB   1 
ATOM   1029  O OG   . SER A  1 72  ? 82.426  -24.173  -31.260  1.00 142.09 ? 115 SER A OG   1 
ATOM   1030  H H    . SER A  1 72  ? 80.770  -21.643  -31.200  1.00 241.30 ? 115 SER A H    1 
ATOM   1031  H HA   . SER A  1 72  ? 80.032  -24.099  -30.330  1.00 243.75 ? 115 SER A HA   1 
ATOM   1032  H HB2  . SER A  1 72  ? 82.463  -22.728  -29.935  1.00 239.81 ? 115 SER A HB2  1 
ATOM   1033  H HB3  . SER A  1 72  ? 82.159  -24.161  -29.318  1.00 239.81 ? 115 SER A HB3  1 
ATOM   1034  H HG   . SER A  1 72  ? 83.250  -24.330  -31.216  1.00 236.67 ? 115 SER A HG   1 
ATOM   1035  N N    . LEU A  1 73  ? 80.482  -21.639  -28.319  1.00 134.60 ? 116 LEU A N    1 
ATOM   1036  C CA   . LEU A  1 73  ? 80.091  -21.076  -27.028  1.00 133.49 ? 116 LEU A CA   1 
ATOM   1037  C C    . LEU A  1 73  ? 79.014  -20.019  -27.201  1.00 131.36 ? 116 LEU A C    1 
ATOM   1038  O O    . LEU A  1 73  ? 79.306  -18.833  -27.349  1.00 128.85 ? 116 LEU A O    1 
ATOM   1039  C CB   . LEU A  1 73  ? 81.301  -20.475  -26.307  1.00 131.83 ? 116 LEU A CB   1 
ATOM   1040  C CG   . LEU A  1 73  ? 82.193  -21.450  -25.535  1.00 134.44 ? 116 LEU A CG   1 
ATOM   1041  C CD1  . LEU A  1 73  ? 83.422  -20.731  -25.000  1.00 132.50 ? 116 LEU A CD1  1 
ATOM   1042  C CD2  . LEU A  1 73  ? 81.434  -22.114  -24.393  1.00 137.76 ? 116 LEU A CD2  1 
ATOM   1043  H H    . LEU A  1 73  ? 81.037  -21.151  -28.758  1.00 122.92 ? 116 LEU A H    1 
ATOM   1044  H HA   . LEU A  1 73  ? 79.730  -21.783  -26.471  1.00 126.22 ? 116 LEU A HA   1 
ATOM   1045  H HB2  . LEU A  1 73  ? 81.859  -20.036  -26.967  1.00 124.05 ? 116 LEU A HB2  1 
ATOM   1046  H HB3  . LEU A  1 73  ? 80.978  -19.817  -25.672  1.00 124.05 ? 116 LEU A HB3  1 
ATOM   1047  H HG   . LEU A  1 73  ? 82.494  -22.147  -26.139  1.00 123.70 ? 116 LEU A HG   1 
ATOM   1048  H HD11 . LEU A  1 73  ? 83.973  -21.365  -24.516  1.00 122.47 ? 116 LEU A HD11 1 
ATOM   1049  H HD12 . LEU A  1 73  ? 83.921  -20.361  -25.746  1.00 122.47 ? 116 LEU A HD12 1 
ATOM   1050  H HD13 . LEU A  1 73  ? 83.137  -20.018  -24.407  1.00 122.47 ? 116 LEU A HD13 1 
ATOM   1051  H HD21 . LEU A  1 73  ? 82.031  -22.722  -23.930  1.00 129.85 ? 116 LEU A HD21 1 
ATOM   1052  H HD22 . LEU A  1 73  ? 81.120  -21.428  -23.783  1.00 129.85 ? 116 LEU A HD22 1 
ATOM   1053  H HD23 . LEU A  1 73  ? 80.680  -22.603  -24.758  1.00 129.85 ? 116 LEU A HD23 1 
ATOM   1054  N N    . LYS A  1 74  ? 77.765  -20.463  -27.174  1.00 136.90 ? 117 LYS A N    1 
ATOM   1055  C CA   . LYS A  1 74  ? 76.625  -19.575  -27.346  1.00 135.40 ? 117 LYS A CA   1 
ATOM   1056  C C    . LYS A  1 74  ? 76.313  -18.826  -26.054  1.00 134.64 ? 117 LYS A C    1 
ATOM   1057  O O    . LYS A  1 74  ? 75.971  -19.448  -25.051  1.00 136.48 ? 117 LYS A O    1 
ATOM   1058  C CB   . LYS A  1 74  ? 75.392  -20.370  -27.777  1.00 137.34 ? 117 LYS A CB   1 
ATOM   1059  C CG   . LYS A  1 74  ? 75.583  -21.250  -28.999  1.00 139.17 ? 117 LYS A CG   1 
ATOM   1060  C CD   . LYS A  1 74  ? 75.520  -20.446  -30.282  1.00 137.58 ? 117 LYS A CD   1 
ATOM   1061  C CE   . LYS A  1 74  ? 75.500  -21.359  -31.496  1.00 140.00 ? 117 LYS A CE   1 
ATOM   1062  N NZ   . LYS A  1 74  ? 75.528  -20.596  -32.776  1.00 138.91 ? 117 LYS A NZ   1 
ATOM   1063  H H    . LYS A  1 74  ? 77.548  -21.287  -27.056  1.00 179.17 ? 117 LYS A H    1 
ATOM   1064  H HA   . LYS A  1 74  ? 76.826  -18.924  -28.036  1.00 180.64 ? 117 LYS A HA   1 
ATOM   1065  H HB2  . LYS A  1 74  ? 75.125  -20.945  -27.043  1.00 184.53 ? 117 LYS A HB2  1 
ATOM   1066  H HB3  . LYS A  1 74  ? 74.677  -19.746  -27.976  1.00 184.53 ? 117 LYS A HB3  1 
ATOM   1067  H HG2  . LYS A  1 74  ? 76.452  -21.678  -28.952  1.00 181.94 ? 117 LYS A HG2  1 
ATOM   1068  H HG3  . LYS A  1 74  ? 74.881  -21.919  -29.025  1.00 181.94 ? 117 LYS A HG3  1 
ATOM   1069  H HD2  . LYS A  1 74  ? 74.710  -19.912  -30.287  1.00 177.89 ? 117 LYS A HD2  1 
ATOM   1070  H HD3  . LYS A  1 74  ? 76.301  -19.875  -30.342  1.00 177.89 ? 117 LYS A HD3  1 
ATOM   1071  H HE2  . LYS A  1 74  ? 76.278  -21.937  -31.472  1.00 177.06 ? 117 LYS A HE2  1 
ATOM   1072  H HE3  . LYS A  1 74  ? 74.689  -21.891  -31.480  1.00 177.06 ? 117 LYS A HE3  1 
ATOM   1073  H HZ1  . LYS A  1 74  ? 75.515  -21.159  -33.466  1.00 173.71 ? 117 LYS A HZ1  1 
ATOM   1074  H HZ2  . LYS A  1 74  ? 74.819  -20.061  -32.827  1.00 173.71 ? 117 LYS A HZ2  1 
ATOM   1075  H HZ3  . LYS A  1 74  ? 76.267  -20.102  -32.820  1.00 173.71 ? 117 LYS A HZ3  1 
ATOM   1076  N N    . PRO A  1 75  ? 76.425  -17.490  -26.064  1.00 126.68 ? 118 PRO A N    1 
ATOM   1077  C CA   . PRO A  1 75  ? 75.947  -16.775  -24.879  1.00 126.82 ? 118 PRO A CA   1 
ATOM   1078  C C    . PRO A  1 75  ? 74.425  -16.705  -24.851  1.00 127.64 ? 118 PRO A C    1 
ATOM   1079  O O    . PRO A  1 75  ? 73.788  -16.665  -25.902  1.00 127.25 ? 118 PRO A O    1 
ATOM   1080  C CB   . PRO A  1 75  ? 76.563  -15.387  -25.034  1.00 125.35 ? 118 PRO A CB   1 
ATOM   1081  C CG   . PRO A  1 75  ? 76.726  -15.221  -26.496  1.00 124.15 ? 118 PRO A CG   1 
ATOM   1082  C CD   . PRO A  1 75  ? 77.066  -16.581  -27.029  1.00 124.88 ? 118 PRO A CD   1 
ATOM   1083  H HA   . PRO A  1 75  ? 76.274  -17.193  -24.067  1.00 83.83  ? 118 PRO A HA   1 
ATOM   1084  H HB2  . PRO A  1 75  ? 75.960  -14.717  -24.676  1.00 81.56  ? 118 PRO A HB2  1 
ATOM   1085  H HB3  . PRO A  1 75  ? 77.422  -15.355  -24.585  1.00 81.56  ? 118 PRO A HB3  1 
ATOM   1086  H HG2  . PRO A  1 75  ? 75.895  -14.902  -26.881  1.00 75.06  ? 118 PRO A HG2  1 
ATOM   1087  H HG3  . PRO A  1 75  ? 77.446  -14.596  -26.673  1.00 75.06  ? 118 PRO A HG3  1 
ATOM   1088  H HD2  . PRO A  1 75  ? 76.686  -16.702  -27.913  1.00 72.64  ? 118 PRO A HD2  1 
ATOM   1089  H HD3  . PRO A  1 75  ? 78.027  -16.713  -27.032  1.00 72.64  ? 118 PRO A HD3  1 
ATOM   1090  N N    . CYS A  1 76  ? 73.847  -16.699  -23.660  1.00 130.76 ? 119 CYS A N    1 
ATOM   1091  C CA   . CYS A  1 76  ? 72.403  -16.653  -23.529  1.00 131.68 ? 119 CYS A CA   1 
ATOM   1092  C C    . CYS A  1 76  ? 71.872  -15.304  -23.954  1.00 130.79 ? 119 CYS A C    1 
ATOM   1093  O O    . CYS A  1 76  ? 70.766  -15.192  -24.486  1.00 131.06 ? 119 CYS A O    1 
ATOM   1094  C CB   . CYS A  1 76  ? 72.014  -16.945  -22.096  1.00 133.64 ? 119 CYS A CB   1 
ATOM   1095  S SG   . CYS A  1 76  ? 73.128  -18.163  -21.380  1.00 135.12 ? 119 CYS A SG   1 
ATOM   1096  H H    . CYS A  1 76  ? 74.271  -16.721  -22.911  1.00 180.30 ? 119 CYS A H    1 
ATOM   1097  H HA   . CYS A  1 76  ? 72.006  -17.331  -24.098  1.00 187.16 ? 119 CYS A HA   1 
ATOM   1098  H HB2  . CYS A  1 76  ? 72.073  -16.130  -21.573  1.00 195.02 ? 119 CYS A HB2  1 
ATOM   1099  H HB3  . CYS A  1 76  ? 71.112  -17.301  -22.071  1.00 195.02 ? 119 CYS A HB3  1 
ATOM   1100  N N    . VAL A  1 77  ? 72.675  -14.278  -23.701  1.00 121.40 ? 120 VAL A N    1 
ATOM   1101  C CA   . VAL A  1 77  ? 72.308  -12.913  -24.036  1.00 121.30 ? 120 VAL A CA   1 
ATOM   1102  C C    . VAL A  1 77  ? 73.520  -12.140  -24.547  1.00 120.27 ? 120 VAL A C    1 
ATOM   1103  O O    . VAL A  1 77  ? 74.630  -12.298  -24.043  1.00 119.95 ? 120 VAL A O    1 
ATOM   1104  C CB   . VAL A  1 77  ? 71.709  -12.177  -22.817  1.00 123.03 ? 120 VAL A CB   1 
ATOM   1105  C CG1  . VAL A  1 77  ? 71.250  -10.775  -23.204  1.00 123.63 ? 120 VAL A CG1  1 
ATOM   1106  C CG2  . VAL A  1 77  ? 70.547  -12.963  -22.227  1.00 125.25 ? 120 VAL A CG2  1 
ATOM   1107  H H    . VAL A  1 77  ? 73.448  -14.350  -23.331  1.00 149.18 ? 120 VAL A H    1 
ATOM   1108  H HA   . VAL A  1 77  ? 71.639  -12.926  -24.738  1.00 148.87 ? 120 VAL A HA   1 
ATOM   1109  H HB   . VAL A  1 77  ? 72.391  -12.092  -22.133  1.00 155.35 ? 120 VAL A HB   1 
ATOM   1110  H HG11 . VAL A  1 77  ? 70.879  -10.338  -22.421  1.00 157.47 ? 120 VAL A HG11 1 
ATOM   1111  H HG12 . VAL A  1 77  ? 72.012  -10.274  -23.533  1.00 157.47 ? 120 VAL A HG12 1 
ATOM   1112  H HG13 . VAL A  1 77  ? 70.574  -10.845  -23.896  1.00 157.47 ? 120 VAL A HG13 1 
ATOM   1113  H HG21 . VAL A  1 77  ? 70.192  -12.477  -21.465  1.00 163.73 ? 120 VAL A HG21 1 
ATOM   1114  H HG22 . VAL A  1 77  ? 69.859  -13.065  -22.903  1.00 163.73 ? 120 VAL A HG22 1 
ATOM   1115  H HG23 . VAL A  1 77  ? 70.866  -13.834  -21.944  1.00 163.73 ? 120 VAL A HG23 1 
ATOM   1116  N N    . GLN A  1 78  ? 73.288  -11.306  -25.556  1.00 128.90 ? 121 GLN A N    1 
ATOM   1117  C CA   . GLN A  1 78  ? 74.321  -10.453  -26.133  1.00 128.54 ? 121 GLN A CA   1 
ATOM   1118  C C    . GLN A  1 78  ? 73.811  -9.026   -26.298  1.00 130.25 ? 121 GLN A C    1 
ATOM   1119  O O    . GLN A  1 78  ? 72.710  -8.810   -26.807  1.00 131.02 ? 121 GLN A O    1 
ATOM   1120  C CB   . GLN A  1 78  ? 74.767  -10.997  -27.486  1.00 127.26 ? 121 GLN A CB   1 
ATOM   1121  C CG   . GLN A  1 78  ? 76.073  -11.759  -27.452  1.00 125.99 ? 121 GLN A CG   1 
ATOM   1122  C CD   . GLN A  1 78  ? 76.332  -12.494  -28.749  1.00 125.30 ? 121 GLN A CD   1 
ATOM   1123  O OE1  . GLN A  1 78  ? 75.552  -13.358  -29.148  1.00 125.40 ? 121 GLN A OE1  1 
ATOM   1124  N NE2  . GLN A  1 78  ? 77.419  -12.144  -29.424  1.00 125.09 ? 121 GLN A NE2  1 
ATOM   1125  H H    . GLN A  1 78  ? 72.520  -11.215  -25.932  1.00 207.89 ? 121 GLN A H    1 
ATOM   1126  H HA   . GLN A  1 78  ? 75.090  -10.436  -25.542  1.00 202.92 ? 121 GLN A HA   1 
ATOM   1127  H HB2  . GLN A  1 78  ? 74.084  -11.599  -27.819  1.00 196.06 ? 121 GLN A HB2  1 
ATOM   1128  H HB3  . GLN A  1 78  ? 74.876  -10.254  -28.099  1.00 196.06 ? 121 GLN A HB3  1 
ATOM   1129  H HG2  . GLN A  1 78  ? 76.802  -11.136  -27.306  1.00 192.17 ? 121 GLN A HG2  1 
ATOM   1130  H HG3  . GLN A  1 78  ? 76.042  -12.412  -26.735  1.00 192.17 ? 121 GLN A HG3  1 
ATOM   1131  H HE21 . GLN A  1 78  ? 77.608  -12.534  -30.167  1.00 183.15 ? 121 GLN A HE21 1 
ATOM   1132  H HE22 . GLN A  1 78  ? 77.936  -11.528  -29.119  1.00 183.15 ? 121 GLN A HE22 1 
ATOM   1133  N N    . LEU A  1 79  ? 74.619  -8.057   -25.874  1.00 132.17 ? 122 LEU A N    1 
ATOM   1134  C CA   . LEU A  1 79  ? 74.255  -6.646   -25.971  1.00 134.52 ? 122 LEU A CA   1 
ATOM   1135  C C    . LEU A  1 79  ? 75.295  -5.867   -26.771  1.00 135.18 ? 122 LEU A C    1 
ATOM   1136  O O    . LEU A  1 79  ? 76.458  -5.771   -26.374  1.00 134.97 ? 122 LEU A O    1 
ATOM   1137  C CB   . LEU A  1 79  ? 74.097  -6.036   -24.577  1.00 136.26 ? 122 LEU A CB   1 
ATOM   1138  C CG   . LEU A  1 79  ? 73.832  -4.527   -24.539  1.00 139.16 ? 122 LEU A CG   1 
ATOM   1139  C CD1  . LEU A  1 79  ? 72.543  -4.174   -25.272  1.00 140.28 ? 122 LEU A CD1  1 
ATOM   1140  C CD2  . LEU A  1 79  ? 73.786  -4.023   -23.104  1.00 141.04 ? 122 LEU A CD2  1 
ATOM   1141  H H    . LEU A  1 79  ? 75.391  -8.193   -25.522  1.00 164.20 ? 122 LEU A H    1 
ATOM   1142  H HA   . LEU A  1 79  ? 73.404  -6.569   -26.430  1.00 169.73 ? 122 LEU A HA   1 
ATOM   1143  H HB2  . LEU A  1 79  ? 73.353  -6.472   -24.134  1.00 177.36 ? 122 LEU A HB2  1 
ATOM   1144  H HB3  . LEU A  1 79  ? 74.912  -6.200   -24.077  1.00 177.36 ? 122 LEU A HB3  1 
ATOM   1145  H HG   . LEU A  1 79  ? 74.561  -4.071   -24.989  1.00 182.29 ? 122 LEU A HG   1 
ATOM   1146  H HD11 . LEU A  1 79  ? 72.408  -3.215   -25.228  1.00 189.04 ? 122 LEU A HD11 1 
ATOM   1147  H HD12 . LEU A  1 79  ? 72.619  -4.456   -26.197  1.00 189.04 ? 122 LEU A HD12 1 
ATOM   1148  H HD13 . LEU A  1 79  ? 71.803  -4.633   -24.846  1.00 189.04 ? 122 LEU A HD13 1 
ATOM   1149  H HD21 . LEU A  1 79  ? 73.617  -3.068   -23.110  1.00 189.30 ? 122 LEU A HD21 1 
ATOM   1150  H HD22 . LEU A  1 79  ? 73.073  -4.483   -22.632  1.00 189.30 ? 122 LEU A HD22 1 
ATOM   1151  H HD23 . LEU A  1 79  ? 74.637  -4.206   -22.678  1.00 189.30 ? 122 LEU A HD23 1 
ATOM   1152  N N    . THR A  1 80  ? 74.862  -5.324   -27.905  1.00 137.51 ? 123 THR A N    1 
ATOM   1153  C CA   . THR A  1 80  ? 75.710  -4.482   -28.747  1.00 139.10 ? 123 THR A CA   1 
ATOM   1154  C C    . THR A  1 80  ? 74.912  -3.308   -29.313  1.00 141.89 ? 123 THR A C    1 
ATOM   1155  O O    . THR A  1 80  ? 73.908  -3.501   -29.999  1.00 141.81 ? 123 THR A O    1 
ATOM   1156  C CB   . THR A  1 80  ? 76.335  -5.282   -29.916  1.00 137.78 ? 123 THR A CB   1 
ATOM   1157  O OG1  . THR A  1 80  ? 75.303  -5.832   -30.746  1.00 137.65 ? 123 THR A OG1  1 
ATOM   1158  C CG2  . THR A  1 80  ? 77.208  -6.404   -29.397  1.00 134.87 ? 123 THR A CG2  1 
ATOM   1159  H H    . THR A  1 80  ? 74.066  -5.429   -28.215  1.00 182.09 ? 123 THR A H    1 
ATOM   1160  H HA   . THR A  1 80  ? 76.433  -4.123   -28.209  1.00 177.55 ? 123 THR A HA   1 
ATOM   1161  H HB   . THR A  1 80  ? 76.889  -4.689   -30.448  1.00 171.59 ? 123 THR A HB   1 
ATOM   1162  H HG1  . THR A  1 80  ? 75.645  -6.265   -31.379  1.00 167.17 ? 123 THR A HG1  1 
ATOM   1163  H HG21 . THR A  1 80  ? 77.592  -6.896   -30.139  1.00 176.64 ? 123 THR A HG21 1 
ATOM   1164  H HG22 . THR A  1 80  ? 77.925  -6.041   -28.854  1.00 176.64 ? 123 THR A HG22 1 
ATOM   1165  H HG23 . THR A  1 80  ? 76.680  -7.012   -28.856  1.00 176.64 ? 123 THR A HG23 1 
ATOM   1166  N N    . GLY A  1 81  ? 75.364  -2.093   -29.014  1.00 139.80 ? 124 GLY A N    1 
ATOM   1167  C CA   . GLY A  1 81  ? 74.746  -0.888   -29.542  1.00 142.75 ? 124 GLY A CA   1 
ATOM   1168  C C    . GLY A  1 81  ? 73.260  -0.792   -29.251  1.00 143.01 ? 124 GLY A C    1 
ATOM   1169  O O    . GLY A  1 81  ? 72.472  -0.443   -30.130  1.00 143.83 ? 124 GLY A O    1 
ATOM   1170  H H    . GLY A  1 81  ? 76.037  -1.942   -28.501  1.00 237.91 ? 124 GLY A H    1 
ATOM   1171  H HA2  . GLY A  1 81  ? 75.181  -0.111   -29.158  1.00 244.30 ? 124 GLY A HA2  1 
ATOM   1172  H HA3  . GLY A  1 81  ? 74.869  -0.861   -30.504  1.00 244.30 ? 124 GLY A HA3  1 
ATOM   1173  N N    . GLY A  1 82  ? 72.875  -1.112   -28.019  1.00 141.09 ? 198 GLY A N    1 
ATOM   1174  C CA   . GLY A  1 82  ? 71.484  -1.024   -27.608  1.00 141.85 ? 198 GLY A CA   1 
ATOM   1175  C C    . GLY A  1 82  ? 70.612  -2.138   -28.165  1.00 140.00 ? 198 GLY A C    1 
ATOM   1176  O O    . GLY A  1 82  ? 69.405  -2.181   -27.902  1.00 140.74 ? 198 GLY A O    1 
ATOM   1177  H H    . GLY A  1 82  ? 73.406  -1.384   -27.401  1.00 119.96 ? 198 GLY A H    1 
ATOM   1178  H HA2  . GLY A  1 82  ? 71.435  -1.056   -26.640  1.00 130.27 ? 198 GLY A HA2  1 
ATOM   1179  H HA3  . GLY A  1 82  ? 71.116  -0.176   -27.903  1.00 130.27 ? 198 GLY A HA3  1 
ATOM   1180  N N    . SER A  1 83  ? 71.227  -3.038   -28.933  1.00 139.74 ? 199 SER A N    1 
ATOM   1181  C CA   . SER A  1 83  ? 70.521  -4.167   -29.543  1.00 137.77 ? 199 SER A CA   1 
ATOM   1182  C C    . SER A  1 83  ? 70.787  -5.460   -28.774  1.00 135.43 ? 199 SER A C    1 
ATOM   1183  O O    . SER A  1 83  ? 71.925  -5.752   -28.405  1.00 134.29 ? 199 SER A O    1 
ATOM   1184  C CB   . SER A  1 83  ? 70.938  -4.330   -31.010  1.00 136.55 ? 199 SER A CB   1 
ATOM   1185  O OG   . SER A  1 83  ? 70.642  -3.164   -31.757  1.00 138.64 ? 199 SER A OG   1 
ATOM   1186  H H    . SER A  1 83  ? 72.066  -3.017   -29.118  1.00 164.07 ? 199 SER A H    1 
ATOM   1187  H HA   . SER A  1 83  ? 69.567  -3.993   -29.519  1.00 163.99 ? 199 SER A HA   1 
ATOM   1188  H HB2  . SER A  1 83  ? 71.893  -4.496   -31.049  1.00 157.20 ? 199 SER A HB2  1 
ATOM   1189  H HB3  . SER A  1 83  ? 70.456  -5.080   -31.392  1.00 157.20 ? 199 SER A HB3  1 
ATOM   1190  H HG   . SER A  1 83  ? 69.817  -3.008   -31.732  1.00 163.15 ? 199 SER A HG   1 
ATOM   1191  N N    . ALA A  1 84  ? 69.728  -6.230   -28.544  1.00 123.30 ? 200 ALA A N    1 
ATOM   1192  C CA   . ALA A  1 84  ? 69.818  -7.460   -27.772  1.00 122.83 ? 200 ALA A CA   1 
ATOM   1193  C C    . ALA A  1 84  ? 69.587  -8.676   -28.659  1.00 120.92 ? 200 ALA A C    1 
ATOM   1194  O O    . ALA A  1 84  ? 68.653  -8.703   -29.458  1.00 122.00 ? 200 ALA A O    1 
ATOM   1195  C CB   . ALA A  1 84  ? 68.819  -7.436   -26.629  1.00 126.90 ? 200 ALA A CB   1 
ATOM   1196  H H    . ALA A  1 84  ? 68.935  -6.057   -28.830  1.00 143.21 ? 200 ALA A H    1 
ATOM   1197  H HA   . ALA A  1 84  ? 70.708  -7.531   -27.391  1.00 139.44 ? 200 ALA A HA   1 
ATOM   1198  H HB1  . ALA A  1 84  ? 68.894  -8.262   -26.127  1.00 147.55 ? 200 ALA A HB1  1 
ATOM   1199  H HB2  . ALA A  1 84  ? 69.015  -6.680   -26.054  1.00 147.55 ? 200 ALA A HB2  1 
ATOM   1200  H HB3  . ALA A  1 84  ? 67.924  -7.351   -26.995  1.00 147.55 ? 200 ALA A HB3  1 
ATOM   1201  N N    . LEU A  1 85  ? 70.458  -9.669   -28.515  1.00 129.34 ? 201 LEU A N    1 
ATOM   1202  C CA   . LEU A  1 85  ? 70.351  -10.928  -29.239  1.00 128.04 ? 201 LEU A CA   1 
ATOM   1203  C C    . LEU A  1 85  ? 70.323  -12.061  -28.217  1.00 127.73 ? 201 LEU A C    1 
ATOM   1204  O O    . LEU A  1 85  ? 71.099  -12.052  -27.261  1.00 127.57 ? 201 LEU A O    1 
ATOM   1205  C CB   . LEU A  1 85  ? 71.526  -11.089  -30.212  1.00 126.98 ? 201 LEU A CB   1 
ATOM   1206  C CG   . LEU A  1 85  ? 71.308  -11.846  -31.530  1.00 126.56 ? 201 LEU A CG   1 
ATOM   1207  C CD1  . LEU A  1 85  ? 72.604  -11.889  -32.341  1.00 125.90 ? 201 LEU A CD1  1 
ATOM   1208  C CD2  . LEU A  1 85  ? 70.780  -13.255  -31.301  1.00 126.52 ? 201 LEU A CD2  1 
ATOM   1209  H H    . LEU A  1 85  ? 71.138  -9.634   -27.990  1.00 123.61 ? 201 LEU A H    1 
ATOM   1210  H HA   . LEU A  1 85  ? 69.524  -10.945  -29.745  1.00 121.92 ? 201 LEU A HA   1 
ATOM   1211  H HB2  . LEU A  1 85  ? 71.835  -10.201  -30.449  1.00 114.32 ? 201 LEU A HB2  1 
ATOM   1212  H HB3  . LEU A  1 85  ? 72.236  -11.552  -29.740  1.00 114.32 ? 201 LEU A HB3  1 
ATOM   1213  H HG   . LEU A  1 85  ? 70.649  -11.368  -32.055  1.00 115.16 ? 201 LEU A HG   1 
ATOM   1214  H HD11 . LEU A  1 85  ? 72.442  -12.371  -33.167  1.00 107.84 ? 201 LEU A HD11 1 
ATOM   1215  H HD12 . LEU A  1 85  ? 72.884  -10.981  -32.537  1.00 107.84 ? 201 LEU A HD12 1 
ATOM   1216  H HD13 . LEU A  1 85  ? 73.286  -12.342  -31.822  1.00 107.84 ? 201 LEU A HD13 1 
ATOM   1217  H HD21 . LEU A  1 85  ? 70.660  -13.690  -32.159  1.00 122.82 ? 201 LEU A HD21 1 
ATOM   1218  H HD22 . LEU A  1 85  ? 71.421  -13.749  -30.766  1.00 122.82 ? 201 LEU A HD22 1 
ATOM   1219  H HD23 . LEU A  1 85  ? 69.931  -13.202  -30.834  1.00 122.82 ? 201 LEU A HD23 1 
ATOM   1220  N N    . THR A  1 86  ? 69.413  -13.014  -28.404  1.00 128.62 ? 202 THR A N    1 
ATOM   1221  C CA   . THR A  1 86  ? 69.310  -14.171  -27.515  1.00 129.07 ? 202 THR A CA   1 
ATOM   1222  C C    . THR A  1 86  ? 69.254  -15.497  -28.266  1.00 129.21 ? 202 THR A C    1 
ATOM   1223  O O    . THR A  1 86  ? 68.742  -15.576  -29.384  1.00 129.29 ? 202 THR A O    1 
ATOM   1224  C CB   . THR A  1 86  ? 68.071  -14.081  -26.638  1.00 130.49 ? 202 THR A CB   1 
ATOM   1225  O OG1  . THR A  1 86  ? 66.917  -13.893  -27.465  1.00 131.01 ? 202 THR A OG1  1 
ATOM   1226  C CG2  . THR A  1 86  ? 68.195  -12.925  -25.668  1.00 131.27 ? 202 THR A CG2  1 
ATOM   1227  H H    . THR A  1 86  ? 68.839  -13.015  -29.044  1.00 187.46 ? 202 THR A H    1 
ATOM   1228  H HA   . THR A  1 86  ? 70.087  -14.190  -26.934  1.00 188.27 ? 202 THR A HA   1 
ATOM   1229  H HB   . THR A  1 86  ? 67.974  -14.901  -26.129  1.00 195.71 ? 202 THR A HB   1 
ATOM   1230  H HG1  . THR A  1 86  ? 66.995  -13.184  -27.909  1.00 199.67 ? 202 THR A HG1  1 
ATOM   1231  H HG21 . THR A  1 86  ? 67.402  -12.872  -25.112  1.00 200.09 ? 202 THR A HG21 1 
ATOM   1232  H HG22 . THR A  1 86  ? 68.971  -13.051  -25.100  1.00 200.09 ? 202 THR A HG22 1 
ATOM   1233  H HG23 . THR A  1 86  ? 68.293  -12.092  -26.156  1.00 200.09 ? 202 THR A HG23 1 
ATOM   1234  N N    . GLN A  1 87  ? 69.767  -16.539  -27.620  1.00 136.81 ? 203 GLN A N    1 
ATOM   1235  C CA   . GLN A  1 87  ? 69.822  -17.876  -28.198  1.00 137.73 ? 203 GLN A CA   1 
ATOM   1236  C C    . GLN A  1 87  ? 70.045  -18.892  -27.086  1.00 139.13 ? 203 GLN A C    1 
ATOM   1237  O O    . GLN A  1 87  ? 70.342  -18.517  -25.951  1.00 139.08 ? 203 GLN A O    1 
ATOM   1238  C CB   . GLN A  1 87  ? 70.942  -17.973  -29.230  1.00 136.88 ? 203 GLN A CB   1 
ATOM   1239  C CG   . GLN A  1 87  ? 72.328  -17.819  -28.629  1.00 135.97 ? 203 GLN A CG   1 
ATOM   1240  C CD   . GLN A  1 87  ? 73.403  -17.649  -29.678  1.00 135.22 ? 203 GLN A CD   1 
ATOM   1241  O OE1  . GLN A  1 87  ? 73.141  -17.747  -30.875  1.00 135.57 ? 203 GLN A OE1  1 
ATOM   1242  N NE2  . GLN A  1 87  ? 74.626  -17.396  -29.232  1.00 134.42 ? 203 GLN A NE2  1 
ATOM   1243  H H    . GLN A  1 87  ? 70.097  -16.495  -26.827  1.00 171.27 ? 203 GLN A H    1 
ATOM   1244  H HA   . GLN A  1 87  ? 68.980  -18.076  -28.635  1.00 170.82 ? 203 GLN A HA   1 
ATOM   1245  H HB2  . GLN A  1 87  ? 70.898  -18.841  -29.660  1.00 164.26 ? 203 GLN A HB2  1 
ATOM   1246  H HB3  . GLN A  1 87  ? 70.823  -17.271  -29.889  1.00 164.26 ? 203 GLN A HB3  1 
ATOM   1247  H HG2  . GLN A  1 87  ? 72.339  -17.035  -28.057  1.00 157.48 ? 203 GLN A HG2  1 
ATOM   1248  H HG3  . GLN A  1 87  ? 72.537  -18.611  -28.110  1.00 157.48 ? 203 GLN A HG3  1 
ATOM   1249  H HE21 . GLN A  1 87  ? 75.273  -17.291  -29.788  1.00 150.22 ? 203 GLN A HE21 1 
ATOM   1250  H HE22 . GLN A  1 87  ? 74.772  -17.336  -28.386  1.00 150.22 ? 203 GLN A HE22 1 
ATOM   1251  N N    . ALA A  1 88  ? 69.909  -20.174  -27.412  1.00 145.91 ? 204 ALA A N    1 
ATOM   1252  C CA   . ALA A  1 88  ? 70.173  -21.237  -26.447  1.00 147.81 ? 204 ALA A CA   1 
ATOM   1253  C C    . ALA A  1 88  ? 71.645  -21.209  -26.050  1.00 147.42 ? 204 ALA A C    1 
ATOM   1254  O O    . ALA A  1 88  ? 72.511  -20.947  -26.886  1.00 146.46 ? 204 ALA A O    1 
ATOM   1255  C CB   . ALA A  1 88  ? 69.797  -22.599  -27.024  1.00 149.91 ? 204 ALA A CB   1 
ATOM   1256  H H    . ALA A  1 88  ? 69.666  -20.455  -28.188  1.00 107.90 ? 204 ALA A H    1 
ATOM   1257  H HA   . ALA A  1 88  ? 69.639  -21.086  -25.651  1.00 111.67 ? 204 ALA A HA   1 
ATOM   1258  H HB1  . ALA A  1 88  ? 69.982  -23.283  -26.362  1.00 116.41 ? 204 ALA A HB1  1 
ATOM   1259  H HB2  . ALA A  1 88  ? 68.852  -22.598  -27.244  1.00 116.41 ? 204 ALA A HB2  1 
ATOM   1260  H HB3  . ALA A  1 88  ? 70.324  -22.759  -27.823  1.00 116.41 ? 204 ALA A HB3  1 
ATOM   1261  N N    . CYS A  1 89  ? 71.921  -21.474  -24.776  1.00 152.33 ? 205 CYS A N    1 
ATOM   1262  C CA   . CYS A  1 89  ? 73.287  -21.443  -24.259  1.00 152.42 ? 205 CYS A CA   1 
ATOM   1263  C C    . CYS A  1 89  ? 73.573  -22.657  -23.386  1.00 155.52 ? 205 CYS A C    1 
ATOM   1264  O O    . CYS A  1 89  ? 73.784  -22.527  -22.180  1.00 156.24 ? 205 CYS A O    1 
ATOM   1265  C CB   . CYS A  1 89  ? 73.526  -20.159  -23.461  1.00 150.53 ? 205 CYS A CB   1 
ATOM   1266  S SG   . CYS A  1 89  ? 72.318  -19.865  -22.147  1.00 151.88 ? 205 CYS A SG   1 
ATOM   1267  H H    . CYS A  1 89  ? 71.330  -21.677  -24.186  1.00 198.82 ? 205 CYS A H    1 
ATOM   1268  H HA   . CYS A  1 89  ? 73.908  -21.454  -25.003  1.00 193.53 ? 205 CYS A HA   1 
ATOM   1269  H HB2  . CYS A  1 89  ? 74.404  -20.207  -23.049  1.00 193.10 ? 205 CYS A HB2  1 
ATOM   1270  H HB3  . CYS A  1 89  ? 73.491  -19.404  -24.068  1.00 193.10 ? 205 CYS A HB3  1 
ATOM   1271  N N    . PRO A  1 90  ? 73.585  -23.849  -23.996  1.00 142.71 ? 206 PRO A N    1 
ATOM   1272  C CA   . PRO A  1 90  ? 73.878  -25.065  -23.235  1.00 145.69 ? 206 PRO A CA   1 
ATOM   1273  C C    . PRO A  1 90  ? 75.337  -25.093  -22.793  1.00 146.56 ? 206 PRO A C    1 
ATOM   1274  O O    . PRO A  1 90  ? 76.196  -24.583  -23.516  1.00 145.24 ? 206 PRO A O    1 
ATOM   1275  C CB   . PRO A  1 90  ? 73.569  -26.182  -24.235  1.00 147.20 ? 206 PRO A CB   1 
ATOM   1276  C CG   . PRO A  1 90  ? 73.816  -25.560  -25.565  1.00 145.66 ? 206 PRO A CG   1 
ATOM   1277  C CD   . PRO A  1 90  ? 73.405  -24.124  -25.433  1.00 142.63 ? 206 PRO A CD   1 
ATOM   1278  H HA   . PRO A  1 90  ? 73.295  -25.141  -22.464  1.00 154.48 ? 206 PRO A HA   1 
ATOM   1279  H HB2  . PRO A  1 90  ? 74.167  -26.931  -24.088  1.00 156.13 ? 206 PRO A HB2  1 
ATOM   1280  H HB3  . PRO A  1 90  ? 72.643  -26.455  -24.148  1.00 156.13 ? 206 PRO A HB3  1 
ATOM   1281  H HG2  . PRO A  1 90  ? 74.759  -25.625  -25.783  1.00 147.31 ? 206 PRO A HG2  1 
ATOM   1282  H HG3  . PRO A  1 90  ? 73.279  -26.008  -26.237  1.00 147.31 ? 206 PRO A HG3  1 
ATOM   1283  H HD2  . PRO A  1 90  ? 73.986  -23.556  -25.961  1.00 144.49 ? 206 PRO A HD2  1 
ATOM   1284  H HD3  . PRO A  1 90  ? 72.474  -24.014  -25.684  1.00 144.49 ? 206 PRO A HD3  1 
ATOM   1285  N N    . LYS A  1 91  ? 75.612  -25.655  -21.619  1.00 150.30 ? 207 LYS A N    1 
ATOM   1286  C CA   . LYS A  1 91  ? 76.987  -25.812  -21.162  1.00 151.84 ? 207 LYS A CA   1 
ATOM   1287  C C    . LYS A  1 91  ? 77.682  -26.860  -22.019  1.00 153.67 ? 207 LYS A C    1 
ATOM   1288  O O    . LYS A  1 91  ? 77.084  -27.880  -22.373  1.00 154.55 ? 207 LYS A O    1 
ATOM   1289  C CB   . LYS A  1 91  ? 77.040  -26.209  -19.684  1.00 153.74 ? 207 LYS A CB   1 
ATOM   1290  C CG   . LYS A  1 91  ? 76.577  -25.127  -18.715  1.00 152.40 ? 207 LYS A CG   1 
ATOM   1291  C CD   . LYS A  1 91  ? 77.400  -23.842  -18.819  1.00 150.48 ? 207 LYS A CD   1 
ATOM   1292  C CE   . LYS A  1 91  ? 78.869  -24.065  -18.483  1.00 152.42 ? 207 LYS A CE   1 
ATOM   1293  N NZ   . LYS A  1 91  ? 79.663  -22.808  -18.592  1.00 150.26 ? 207 LYS A NZ   1 
ATOM   1294  H H    . LYS A  1 91  ? 75.020  -25.953  -21.070  1.00 200.17 ? 207 LYS A H    1 
ATOM   1295  H HA   . LYS A  1 91  ? 77.458  -24.971  -21.268  1.00 196.23 ? 207 LYS A HA   1 
ATOM   1296  H HB2  . LYS A  1 91  ? 76.471  -26.984  -19.551  1.00 204.01 ? 207 LYS A HB2  1 
ATOM   1297  H HB3  . LYS A  1 91  ? 77.955  -26.435  -19.457  1.00 204.01 ? 207 LYS A HB3  1 
ATOM   1298  H HG2  . LYS A  1 91  ? 75.652  -24.906  -18.906  1.00 210.26 ? 207 LYS A HG2  1 
ATOM   1299  H HG3  . LYS A  1 91  ? 76.657  -25.460  -17.807  1.00 210.26 ? 207 LYS A HG3  1 
ATOM   1300  H HD2  . LYS A  1 91  ? 77.347  -23.504  -19.726  1.00 205.76 ? 207 LYS A HD2  1 
ATOM   1301  H HD3  . LYS A  1 91  ? 77.045  -23.187  -18.198  1.00 205.76 ? 207 LYS A HD3  1 
ATOM   1302  H HE2  . LYS A  1 91  ? 78.942  -24.390  -17.572  1.00 204.22 ? 207 LYS A HE2  1 
ATOM   1303  H HE3  . LYS A  1 91  ? 79.243  -24.713  -19.100  1.00 204.22 ? 207 LYS A HE3  1 
ATOM   1304  H HZ1  . LYS A  1 91  ? 80.515  -22.968  -18.391  1.00 201.07 ? 207 LYS A HZ1  1 
ATOM   1305  H HZ2  . LYS A  1 91  ? 79.616  -22.491  -19.423  1.00 201.07 ? 207 LYS A HZ2  1 
ATOM   1306  H HZ3  . LYS A  1 91  ? 79.342  -22.196  -18.031  1.00 201.07 ? 207 LYS A HZ3  1 
ATOM   1307  N N    . VAL A  1 92  ? 78.944  -26.599  -22.349  1.00 151.71 ? 208 VAL A N    1 
ATOM   1308  C CA   . VAL A  1 92  ? 79.715  -27.471  -23.228  1.00 153.14 ? 208 VAL A CA   1 
ATOM   1309  C C    . VAL A  1 92  ? 81.075  -27.797  -22.633  1.00 154.98 ? 208 VAL A C    1 
ATOM   1310  O O    . VAL A  1 92  ? 81.527  -27.146  -21.688  1.00 154.90 ? 208 VAL A O    1 
ATOM   1311  C CB   . VAL A  1 92  ? 79.932  -26.828  -24.615  1.00 151.20 ? 208 VAL A CB   1 
ATOM   1312  C CG1  . VAL A  1 92  ? 78.601  -26.566  -25.298  1.00 149.58 ? 208 VAL A CG1  1 
ATOM   1313  C CG2  . VAL A  1 92  ? 80.735  -25.533  -24.492  1.00 148.18 ? 208 VAL A CG2  1 
ATOM   1314  H H    . VAL A  1 92  ? 79.381  -25.912  -22.072  1.00 116.91 ? 208 VAL A H    1 
ATOM   1315  H HA   . VAL A  1 92  ? 79.232  -28.303  -23.354  1.00 111.49 ? 208 VAL A HA   1 
ATOM   1316  H HB   . VAL A  1 92  ? 80.437  -27.441  -25.170  1.00 103.98 ? 208 VAL A HB   1 
ATOM   1317  H HG11 . VAL A  1 92  ? 78.765  -26.163  -26.164  1.00 107.40 ? 208 VAL A HG11 1 
ATOM   1318  H HG12 . VAL A  1 92  ? 78.132  -27.408  -25.407  1.00 107.40 ? 208 VAL A HG12 1 
ATOM   1319  H HG13 . VAL A  1 92  ? 78.077  -25.964  -24.746  1.00 107.40 ? 208 VAL A HG13 1 
ATOM   1320  H HG21 . VAL A  1 92  ? 80.855  -25.152  -25.375  1.00 98.11  ? 208 VAL A HG21 1 
ATOM   1321  H HG22 . VAL A  1 92  ? 80.248  -24.912  -23.927  1.00 98.11  ? 208 VAL A HG22 1 
ATOM   1322  H HG23 . VAL A  1 92  ? 81.597  -25.733  -24.096  1.00 98.11  ? 208 VAL A HG23 1 
ATOM   1323  N N    . THR A  1 93  ? 81.719  -28.816  -23.194  1.00 149.41 ? 209 THR A N    1 
ATOM   1324  C CA   . THR A  1 93  ? 83.103  -29.133  -22.866  1.00 150.95 ? 209 THR A CA   1 
ATOM   1325  C C    . THR A  1 93  ? 84.004  -28.353  -23.816  1.00 149.80 ? 209 THR A C    1 
ATOM   1326  O O    . THR A  1 93  ? 83.747  -28.293  -25.016  1.00 149.09 ? 209 THR A O    1 
ATOM   1327  C CB   . THR A  1 93  ? 83.393  -30.652  -22.959  1.00 152.42 ? 209 THR A CB   1 
ATOM   1328  O OG1  . THR A  1 93  ? 84.795  -30.885  -22.773  1.00 153.74 ? 209 THR A OG1  1 
ATOM   1329  C CG2  . THR A  1 93  ? 82.957  -31.229  -24.304  1.00 152.01 ? 209 THR A CG2  1 
ATOM   1330  H H    . THR A  1 93  ? 81.370  -29.345  -23.776  1.00 213.28 ? 209 THR A H    1 
ATOM   1331  H HA   . THR A  1 93  ? 83.291  -28.843  -21.960  1.00 213.14 ? 209 THR A HA   1 
ATOM   1332  H HB   . THR A  1 93  ? 82.901  -31.112  -22.261  1.00 214.35 ? 209 THR A HB   1 
ATOM   1333  H HG1  . THR A  1 93  ? 85.036  -30.603  -22.018  1.00 209.28 ? 209 THR A HG1  1 
ATOM   1334  H HG21 . THR A  1 93  ? 83.150  -32.179  -24.336  1.00 214.06 ? 209 THR A HG21 1 
ATOM   1335  H HG22 . THR A  1 93  ? 82.004  -31.096  -24.428  1.00 214.06 ? 209 THR A HG22 1 
ATOM   1336  H HG23 . THR A  1 93  ? 83.433  -30.786  -25.024  1.00 214.06 ? 209 THR A HG23 1 
ATOM   1337  N N    . PHE A  1 94  ? 85.051  -27.748  -23.265  1.00 147.87 ? 210 PHE A N    1 
ATOM   1338  C CA   . PHE A  1 94  ? 85.888  -26.814  -24.007  1.00 143.44 ? 210 PHE A CA   1 
ATOM   1339  C C    . PHE A  1 94  ? 87.357  -27.052  -23.682  1.00 143.02 ? 210 PHE A C    1 
ATOM   1340  O O    . PHE A  1 94  ? 87.749  -27.035  -22.517  1.00 143.84 ? 210 PHE A O    1 
ATOM   1341  C CB   . PHE A  1 94  ? 85.482  -25.377  -23.670  1.00 139.04 ? 210 PHE A CB   1 
ATOM   1342  C CG   . PHE A  1 94  ? 86.194  -24.328  -24.480  1.00 133.81 ? 210 PHE A CG   1 
ATOM   1343  C CD1  . PHE A  1 94  ? 87.471  -23.920  -24.138  1.00 131.85 ? 210 PHE A CD1  1 
ATOM   1344  C CD2  . PHE A  1 94  ? 85.573  -23.727  -25.564  1.00 131.25 ? 210 PHE A CD2  1 
ATOM   1345  C CE1  . PHE A  1 94  ? 88.126  -22.951  -24.873  1.00 127.63 ? 210 PHE A CE1  1 
ATOM   1346  C CE2  . PHE A  1 94  ? 86.222  -22.755  -26.304  1.00 127.25 ? 210 PHE A CE2  1 
ATOM   1347  C CZ   . PHE A  1 94  ? 87.501  -22.367  -25.957  1.00 125.52 ? 210 PHE A CZ   1 
ATOM   1348  H H    . PHE A  1 94  ? 85.301  -27.864  -22.450  1.00 132.60 ? 210 PHE A H    1 
ATOM   1349  H HA   . PHE A  1 94  ? 85.760  -26.953  -24.958  1.00 127.79 ? 210 PHE A HA   1 
ATOM   1350  H HB2  . PHE A  1 94  ? 84.530  -25.278  -23.830  1.00 126.74 ? 210 PHE A HB2  1 
ATOM   1351  H HB3  . PHE A  1 94  ? 85.675  -25.210  -22.735  1.00 126.74 ? 210 PHE A HB3  1 
ATOM   1352  H HD1  . PHE A  1 94  ? 87.899  -24.312  -23.411  1.00 114.90 ? 210 PHE A HD1  1 
ATOM   1353  H HD2  . PHE A  1 94  ? 84.713  -23.987  -25.803  1.00 124.45 ? 210 PHE A HD2  1 
ATOM   1354  H HE1  . PHE A  1 94  ? 88.987  -22.690  -24.637  1.00 110.95 ? 210 PHE A HE1  1 
ATOM   1355  H HE2  . PHE A  1 94  ? 85.798  -22.364  -27.033  1.00 118.93 ? 210 PHE A HE2  1 
ATOM   1356  H HZ   . PHE A  1 94  ? 87.940  -21.713  -26.451  1.00 113.38 ? 210 PHE A HZ   1 
ATOM   1357  N N    . GLU A  1 95  ? 88.163  -27.271  -24.717  1.00 145.41 ? 211 GLU A N    1 
ATOM   1358  C CA   . GLU A  1 95  ? 89.578  -27.588  -24.541  1.00 144.94 ? 211 GLU A CA   1 
ATOM   1359  C C    . GLU A  1 95  ? 90.312  -27.427  -25.880  1.00 143.10 ? 211 GLU A C    1 
ATOM   1360  O O    . GLU A  1 95  ? 89.804  -27.855  -26.913  1.00 145.37 ? 211 GLU A O    1 
ATOM   1361  C CB   . GLU A  1 95  ? 89.735  -29.014  -23.999  1.00 149.81 ? 211 GLU A CB   1 
ATOM   1362  C CG   . GLU A  1 95  ? 91.031  -29.304  -23.246  1.00 149.23 ? 211 GLU A CG   1 
ATOM   1363  C CD   . GLU A  1 95  ? 91.094  -28.643  -21.877  1.00 148.19 ? 211 GLU A CD   1 
ATOM   1364  O OE1  . GLU A  1 95  ? 90.230  -27.797  -21.572  1.00 147.38 ? 211 GLU A OE1  1 
ATOM   1365  O OE2  . GLU A  1 95  ? 92.010  -28.980  -21.096  1.00 148.52 ? 211 GLU A OE2  1 
ATOM   1366  H H    . GLU A  1 95  ? 87.912  -27.242  -25.540  1.00 198.78 ? 211 GLU A H    1 
ATOM   1367  H HA   . GLU A  1 95  ? 89.969  -26.973  -23.902  1.00 204.28 ? 211 GLU A HA   1 
ATOM   1368  H HB2  . GLU A  1 95  ? 89.001  -29.191  -23.390  1.00 213.13 ? 211 GLU A HB2  1 
ATOM   1369  H HB3  . GLU A  1 95  ? 89.689  -29.631  -24.746  1.00 213.13 ? 211 GLU A HB3  1 
ATOM   1370  H HG2  . GLU A  1 95  ? 91.112  -30.262  -23.119  1.00 222.51 ? 211 GLU A HG2  1 
ATOM   1371  H HG3  . GLU A  1 95  ? 91.778  -28.976  -23.770  1.00 222.51 ? 211 GLU A HG3  1 
ATOM   1372  N N    . PRO A  1 96  ? 91.507  -26.805  -25.869  1.00 145.54 ? 212 PRO A N    1 
ATOM   1373  C CA   . PRO A  1 96  ? 92.226  -26.513  -27.119  1.00 143.94 ? 212 PRO A CA   1 
ATOM   1374  C C    . PRO A  1 96  ? 92.586  -27.734  -27.960  1.00 148.33 ? 212 PRO A C    1 
ATOM   1375  O O    . PRO A  1 96  ? 92.739  -28.832  -27.429  1.00 151.82 ? 212 PRO A O    1 
ATOM   1376  C CB   . PRO A  1 96  ? 93.501  -25.822  -26.630  1.00 140.53 ? 212 PRO A CB   1 
ATOM   1377  C CG   . PRO A  1 96  ? 93.680  -26.304  -25.249  1.00 142.02 ? 212 PRO A CG   1 
ATOM   1378  C CD   . PRO A  1 96  ? 92.285  -26.355  -24.704  1.00 143.69 ? 212 PRO A CD   1 
ATOM   1379  H HA   . PRO A  1 96  ? 91.715  -25.892  -27.661  1.00 286.41 ? 212 PRO A HA   1 
ATOM   1380  H HB2  . PRO A  1 96  ? 94.251  -26.084  -27.187  1.00 285.51 ? 212 PRO A HB2  1 
ATOM   1381  H HB3  . PRO A  1 96  ? 93.379  -24.859  -26.646  1.00 285.51 ? 212 PRO A HB3  1 
ATOM   1382  H HG2  . PRO A  1 96  ? 94.081  -27.187  -25.257  1.00 293.28 ? 212 PRO A HG2  1 
ATOM   1383  H HG3  . PRO A  1 96  ? 94.226  -25.678  -24.748  1.00 293.28 ? 212 PRO A HG3  1 
ATOM   1384  H HD2  . PRO A  1 96  ? 92.224  -27.000  -23.983  1.00 293.41 ? 212 PRO A HD2  1 
ATOM   1385  H HD3  . PRO A  1 96  ? 91.997  -25.472  -24.422  1.00 293.41 ? 212 PRO A HD3  1 
ATOM   1386  N N    . ILE A  1 97  ? 92.724  -27.509  -29.266  1.00 139.28 ? 213 ILE A N    1 
ATOM   1387  C CA   . ILE A  1 97  ? 93.162  -28.532  -30.216  1.00 143.91 ? 213 ILE A CA   1 
ATOM   1388  C C    . ILE A  1 97  ? 94.270  -27.949  -31.098  1.00 141.74 ? 213 ILE A C    1 
ATOM   1389  O O    . ILE A  1 97  ? 94.233  -26.765  -31.425  1.00 137.78 ? 213 ILE A O    1 
ATOM   1390  C CB   . ILE A  1 97  ? 91.993  -29.021  -31.103  1.00 148.72 ? 213 ILE A CB   1 
ATOM   1391  C CG1  . ILE A  1 97  ? 90.850  -29.561  -30.236  1.00 151.03 ? 213 ILE A CG1  1 
ATOM   1392  C CG2  . ILE A  1 97  ? 92.462  -30.077  -32.105  1.00 154.54 ? 213 ILE A CG2  1 
ATOM   1393  C CD1  . ILE A  1 97  ? 91.201  -30.809  -29.440  1.00 154.35 ? 213 ILE A CD1  1 
ATOM   1394  H H    . ILE A  1 97  ? 92.564  -26.750  -29.635  1.00 159.39 ? 213 ILE A H    1 
ATOM   1395  H HA   . ILE A  1 97  ? 93.520  -29.292  -29.732  1.00 160.98 ? 213 ILE A HA   1 
ATOM   1396  H HB   . ILE A  1 97  ? 91.657  -28.261  -31.603  1.00 155.52 ? 213 ILE A HB   1 
ATOM   1397  H HG12 . ILE A  1 97  ? 90.587  -28.873  -29.605  1.00 157.81 ? 213 ILE A HG12 1 
ATOM   1398  H HG13 . ILE A  1 97  ? 90.101  -29.781  -30.812  1.00 157.81 ? 213 ILE A HG13 1 
ATOM   1399  H HG21 . ILE A  1 97  ? 91.706  -30.360  -32.642  1.00 158.57 ? 213 ILE A HG21 1 
ATOM   1400  H HG22 . ILE A  1 97  ? 93.146  -29.690  -32.673  1.00 158.57 ? 213 ILE A HG22 1 
ATOM   1401  H HG23 . ILE A  1 97  ? 92.824  -30.834  -31.618  1.00 158.57 ? 213 ILE A HG23 1 
ATOM   1402  H HD11 . ILE A  1 97  ? 90.426  -31.081  -28.923  1.00 167.94 ? 213 ILE A HD11 1 
ATOM   1403  H HD12 . ILE A  1 97  ? 91.454  -31.515  -30.055  1.00 167.94 ? 213 ILE A HD12 1 
ATOM   1404  H HD13 . ILE A  1 97  ? 91.941  -30.606  -28.846  1.00 167.94 ? 213 ILE A HD13 1 
ATOM   1405  N N    . PRO A  1 98  ? 95.263  -28.767  -31.484  1.00 139.07 ? 214 PRO A N    1 
ATOM   1406  C CA   . PRO A  1 98  ? 96.297  -28.242  -32.386  1.00 137.58 ? 214 PRO A CA   1 
ATOM   1407  C C    . PRO A  1 98  ? 95.748  -27.914  -33.775  1.00 139.70 ? 214 PRO A C    1 
ATOM   1408  O O    . PRO A  1 98  ? 94.787  -28.549  -34.209  1.00 144.27 ? 214 PRO A O    1 
ATOM   1409  C CB   . PRO A  1 98  ? 97.318  -29.385  -32.460  1.00 140.72 ? 214 PRO A CB   1 
ATOM   1410  C CG   . PRO A  1 98  ? 97.042  -30.238  -31.272  1.00 142.11 ? 214 PRO A CG   1 
ATOM   1411  C CD   . PRO A  1 98  ? 95.573  -30.131  -31.029  1.00 143.11 ? 214 PRO A CD   1 
ATOM   1412  H HA   . PRO A  1 98  ? 96.716  -27.455  -32.006  1.00 253.15 ? 214 PRO A HA   1 
ATOM   1413  H HB2  . PRO A  1 98  ? 97.188  -29.887  -33.279  1.00 260.66 ? 214 PRO A HB2  1 
ATOM   1414  H HB3  . PRO A  1 98  ? 98.217  -29.023  -32.419  1.00 260.66 ? 214 PRO A HB3  1 
ATOM   1415  H HG2  . PRO A  1 98  ? 97.290  -31.156  -31.466  1.00 263.02 ? 214 PRO A HG2  1 
ATOM   1416  H HG3  . PRO A  1 98  ? 97.539  -29.904  -30.509  1.00 263.02 ? 214 PRO A HG3  1 
ATOM   1417  H HD2  . PRO A  1 98  ? 95.093  -30.784  -31.562  1.00 262.63 ? 214 PRO A HD2  1 
ATOM   1418  H HD3  . PRO A  1 98  ? 95.378  -30.227  -30.084  1.00 262.63 ? 214 PRO A HD3  1 
ATOM   1419  N N    . ILE A  1 99  ? 96.350  -26.938  -34.452  1.00 133.77 ? 215 ILE A N    1 
ATOM   1420  C CA   . ILE A  1 99  ? 95.921  -26.543  -35.793  1.00 135.97 ? 215 ILE A CA   1 
ATOM   1421  C C    . ILE A  1 99  ? 97.108  -26.193  -36.682  1.00 135.72 ? 215 ILE A C    1 
ATOM   1422  O O    . ILE A  1 99  ? 98.037  -25.507  -36.254  1.00 131.73 ? 215 ILE A O    1 
ATOM   1423  C CB   . ILE A  1 99  ? 94.975  -25.323  -35.749  1.00 132.72 ? 215 ILE A CB   1 
ATOM   1424  C CG1  . ILE A  1 99  ? 93.661  -25.677  -35.047  1.00 133.43 ? 215 ILE A CG1  1 
ATOM   1425  C CG2  . ILE A  1 99  ? 94.689  -24.791  -37.153  1.00 134.92 ? 215 ILE A CG2  1 
ATOM   1426  C CD1  . ILE A  1 99  ? 92.804  -26.688  -35.785  1.00 139.98 ? 215 ILE A CD1  1 
ATOM   1427  H H    . ILE A  1 99  ? 97.016  -26.484  -34.153  1.00 128.68 ? 215 ILE A H    1 
ATOM   1428  H HA   . ILE A  1 99  ? 95.443  -27.280  -36.203  1.00 129.75 ? 215 ILE A HA   1 
ATOM   1429  H HB   . ILE A  1 99  ? 95.410  -24.621  -35.241  1.00 121.39 ? 215 ILE A HB   1 
ATOM   1430  H HG12 . ILE A  1 99  ? 93.866  -26.046  -34.174  1.00 118.56 ? 215 ILE A HG12 1 
ATOM   1431  H HG13 . ILE A  1 99  ? 93.138  -24.867  -34.944  1.00 118.56 ? 215 ILE A HG13 1 
ATOM   1432  H HG21 . ILE A  1 99  ? 94.093  -24.028  -37.085  1.00 123.54 ? 215 ILE A HG21 1 
ATOM   1433  H HG22 . ILE A  1 99  ? 95.525  -24.523  -37.565  1.00 123.54 ? 215 ILE A HG22 1 
ATOM   1434  H HG23 . ILE A  1 99  ? 94.271  -25.492  -37.677  1.00 123.54 ? 215 ILE A HG23 1 
ATOM   1435  H HD11 . ILE A  1 99  ? 91.997  -26.851  -35.271  1.00 117.85 ? 215 ILE A HD11 1 
ATOM   1436  H HD12 . ILE A  1 99  ? 92.575  -26.331  -36.657  1.00 117.85 ? 215 ILE A HD12 1 
ATOM   1437  H HD13 . ILE A  1 99  ? 93.305  -27.512  -35.885  1.00 117.85 ? 215 ILE A HD13 1 
ATOM   1438  N N    . HIS A  1 100 ? 97.058  -26.668  -37.923  1.00 135.52 ? 216 HIS A N    1 
ATOM   1439  C CA   . HIS A  1 100 ? 98.017  -26.274  -38.949  1.00 135.74 ? 216 HIS A CA   1 
ATOM   1440  C C    . HIS A  1 100 ? 97.295  -25.557  -40.091  1.00 137.35 ? 216 HIS A C    1 
ATOM   1441  O O    . HIS A  1 100 ? 96.145  -25.871  -40.392  1.00 140.49 ? 216 HIS A O    1 
ATOM   1442  C CB   . HIS A  1 100 ? 98.767  -27.490  -39.504  1.00 139.84 ? 216 HIS A CB   1 
ATOM   1443  C CG   . HIS A  1 100 ? 99.158  -28.500  -38.469  1.00 140.06 ? 216 HIS A CG   1 
ATOM   1444  N ND1  . HIS A  1 100 ? 100.230 -28.322  -37.620  1.00 136.23 ? 216 HIS A ND1  1 
ATOM   1445  C CD2  . HIS A  1 100 ? 98.639  -29.714  -38.168  1.00 144.18 ? 216 HIS A CD2  1 
ATOM   1446  C CE1  . HIS A  1 100 ? 100.344 -29.376  -36.831  1.00 137.70 ? 216 HIS A CE1  1 
ATOM   1447  N NE2  . HIS A  1 100 ? 99.391  -30.235  -37.144  1.00 142.50 ? 216 HIS A NE2  1 
ATOM   1448  H H    . HIS A  1 100 ? 96.467  -27.228  -38.200  1.00 118.02 ? 216 HIS A H    1 
ATOM   1449  H HA   . HIS A  1 100 ? 98.666  -25.663  -38.566  1.00 117.85 ? 216 HIS A HA   1 
ATOM   1450  H HB2  . HIS A  1 100 ? 98.199  -27.936  -40.151  1.00 128.15 ? 216 HIS A HB2  1 
ATOM   1451  H HB3  . HIS A  1 100 ? 99.578  -27.183  -39.938  1.00 128.15 ? 216 HIS A HB3  1 
ATOM   1452  H HD1  . HIS A  1 100 ? 100.741 -27.630  -37.602  1.00 141.98 ? 216 HIS A HD1  1 
ATOM   1453  H HD2  . HIS A  1 100 ? 97.906  -30.116  -38.575  1.00 142.83 ? 216 HIS A HD2  1 
ATOM   1454  H HE1  . HIS A  1 100 ? 100.986 -29.493  -36.169  1.00 150.86 ? 216 HIS A HE1  1 
ATOM   1455  H HE2  . HIS A  1 100 ? 99.261  -30.997  -36.766  1.00 151.62 ? 216 HIS A HE2  1 
ATOM   1456  N N    . TYR A  1 101 ? 97.974  -24.599  -40.718  1.00 137.40 ? 217 TYR A N    1 
ATOM   1457  C CA   . TYR A  1 101 ? 97.451  -23.914  -41.899  1.00 138.99 ? 217 TYR A CA   1 
ATOM   1458  C C    . TYR A  1 101 ? 98.308  -24.231  -43.116  1.00 141.14 ? 217 TYR A C    1 
ATOM   1459  O O    . TYR A  1 101 ? 99.528  -24.087  -43.067  1.00 139.24 ? 217 TYR A O    1 
ATOM   1460  C CB   . TYR A  1 101 ? 97.401  -22.405  -41.667  1.00 134.68 ? 217 TYR A CB   1 
ATOM   1461  C CG   . TYR A  1 101 ? 96.080  -21.919  -41.109  1.00 133.42 ? 217 TYR A CG   1 
ATOM   1462  C CD1  . TYR A  1 101 ? 95.823  -21.949  -39.743  1.00 130.18 ? 217 TYR A CD1  1 
ATOM   1463  C CD2  . TYR A  1 101 ? 95.088  -21.432  -41.951  1.00 134.91 ? 217 TYR A CD2  1 
ATOM   1464  C CE1  . TYR A  1 101 ? 94.616  -21.512  -39.235  1.00 128.57 ? 217 TYR A CE1  1 
ATOM   1465  C CE2  . TYR A  1 101 ? 93.879  -20.992  -41.449  1.00 133.46 ? 217 TYR A CE2  1 
ATOM   1466  C CZ   . TYR A  1 101 ? 93.650  -21.035  -40.091  1.00 130.31 ? 217 TYR A CZ   1 
ATOM   1467  O OH   . TYR A  1 101 ? 92.449  -20.597  -39.589  1.00 128.37 ? 217 TYR A OH   1 
ATOM   1468  H H    . TYR A  1 101 ? 98.751  -24.323  -40.475  1.00 106.82 ? 217 TYR A H    1 
ATOM   1469  H HA   . TYR A  1 101 ? 96.549  -24.224  -42.074  1.00 102.86 ? 217 TYR A HA   1 
ATOM   1470  H HB2  . TYR A  1 101 ? 98.097  -22.162  -41.037  1.00 96.63  ? 217 TYR A HB2  1 
ATOM   1471  H HB3  . TYR A  1 101 ? 97.551  -21.954  -42.513  1.00 96.63  ? 217 TYR A HB3  1 
ATOM   1472  H HD1  . TYR A  1 101 ? 96.473  -22.272  -39.162  1.00 93.04  ? 217 TYR A HD1  1 
ATOM   1473  H HD2  . TYR A  1 101 ? 95.239  -21.405  -42.868  1.00 90.45  ? 217 TYR A HD2  1 
ATOM   1474  H HE1  . TYR A  1 101 ? 94.458  -21.537  -38.319  1.00 90.87  ? 217 TYR A HE1  1 
ATOM   1475  H HE2  . TYR A  1 101 ? 93.224  -20.669  -42.024  1.00 86.81  ? 217 TYR A HE2  1 
ATOM   1476  H HH   . TYR A  1 101 ? 91.954  -20.334  -40.215  1.00 84.65  ? 217 TYR A HH   1 
ATOM   1477  N N    . CYS A  1 102 ? 97.668  -24.651  -44.207  1.00 140.84 ? 218 CYS A N    1 
ATOM   1478  C CA   . CYS A  1 102 ? 98.387  -25.100  -45.402  1.00 142.51 ? 218 CYS A CA   1 
ATOM   1479  C C    . CYS A  1 102 ? 98.008  -24.291  -46.646  1.00 141.95 ? 218 CYS A C    1 
ATOM   1480  O O    . CYS A  1 102 ? 96.926  -23.712  -46.713  1.00 141.50 ? 218 CYS A O    1 
ATOM   1481  C CB   . CYS A  1 102 ? 98.126  -26.591  -45.642  1.00 147.37 ? 218 CYS A CB   1 
ATOM   1482  S SG   . CYS A  1 102 ? 96.445  -26.998  -46.157  1.00 151.52 ? 218 CYS A SG   1 
ATOM   1483  H H    . CYS A  1 102 ? 96.812  -24.685  -44.281  1.00 174.63 ? 218 CYS A H    1 
ATOM   1484  H HA   . CYS A  1 102 ? 99.339  -24.986  -45.254  1.00 180.54 ? 218 CYS A HA   1 
ATOM   1485  H HB2  . CYS A  1 102 ? 98.727  -26.901  -46.337  1.00 188.32 ? 218 CYS A HB2  1 
ATOM   1486  H HB3  . CYS A  1 102 ? 98.304  -27.072  -44.819  1.00 188.32 ? 218 CYS A HB3  1 
ATOM   1487  N N    . ALA A  1 103 ? 98.908  -24.266  -47.629  1.00 136.23 ? 219 ALA A N    1 
ATOM   1488  C CA   . ALA A  1 103 ? 98.718  -23.467  -48.841  1.00 135.24 ? 219 ALA A CA   1 
ATOM   1489  C C    . ALA A  1 103 ? 98.066  -24.281  -49.960  1.00 138.46 ? 219 ALA A C    1 
ATOM   1490  O O    . ALA A  1 103 ? 98.222  -25.500  -50.013  1.00 141.66 ? 219 ALA A O    1 
ATOM   1491  C CB   . ALA A  1 103 ? 100.046 -22.908  -49.313  1.00 133.00 ? 219 ALA A CB   1 
ATOM   1492  H H    . ALA A  1 103 ? 99.645  -24.708  -47.618  1.00 88.05  ? 219 ALA A H    1 
ATOM   1493  H HA   . ALA A  1 103 ? 98.134  -22.719  -48.636  1.00 86.73  ? 219 ALA A HA   1 
ATOM   1494  H HB1  . ALA A  1 103 ? 99.900  -22.383  -50.116  1.00 87.43  ? 219 ALA A HB1  1 
ATOM   1495  H HB2  . ALA A  1 103 ? 100.419 -22.348  -48.614  1.00 87.43  ? 219 ALA A HB2  1 
ATOM   1496  H HB3  . ALA A  1 103 ? 100.648 -23.644  -49.504  1.00 87.43  ? 219 ALA A HB3  1 
ATOM   1497  N N    . PRO A  1 104 ? 97.335  -23.605  -50.863  1.00 138.37 ? 220 PRO A N    1 
ATOM   1498  C CA   . PRO A  1 104 ? 96.653  -24.272  -51.976  1.00 140.68 ? 220 PRO A CA   1 
ATOM   1499  C C    . PRO A  1 104 ? 97.545  -24.465  -53.200  1.00 141.22 ? 220 PRO A C    1 
ATOM   1500  O O    . PRO A  1 104 ? 98.714  -24.075  -53.177  1.00 139.50 ? 220 PRO A O    1 
ATOM   1501  C CB   . PRO A  1 104 ? 95.507  -23.316  -52.293  1.00 137.57 ? 220 PRO A CB   1 
ATOM   1502  C CG   . PRO A  1 104 ? 96.065  -21.977  -51.975  1.00 134.11 ? 220 PRO A CG   1 
ATOM   1503  C CD   . PRO A  1 104 ? 97.036  -22.163  -50.834  1.00 134.68 ? 220 PRO A CD   1 
ATOM   1504  H HA   . PRO A  1 104 ? 96.294  -25.128  -51.695  1.00 156.46 ? 220 PRO A HA   1 
ATOM   1505  H HB2  . PRO A  1 104 ? 95.273  -23.380  -53.233  1.00 151.09 ? 220 PRO A HB2  1 
ATOM   1506  H HB3  . PRO A  1 104 ? 94.743  -23.517  -51.730  1.00 151.09 ? 220 PRO A HB3  1 
ATOM   1507  H HG2  . PRO A  1 104 ? 96.523  -21.626  -52.754  1.00 145.52 ? 220 PRO A HG2  1 
ATOM   1508  H HG3  . PRO A  1 104 ? 95.345  -21.383  -51.711  1.00 145.52 ? 220 PRO A HG3  1 
ATOM   1509  H HD2  . PRO A  1 104 ? 97.843  -21.648  -50.990  1.00 143.97 ? 220 PRO A HD2  1 
ATOM   1510  H HD3  . PRO A  1 104 ? 96.618  -21.922  -49.993  1.00 143.97 ? 220 PRO A HD3  1 
ATOM   1511  N N    . ALA A  1 105 ? 96.983  -25.045  -54.258  1.00 153.47 ? 221 ALA A N    1 
ATOM   1512  C CA   . ALA A  1 105 ? 97.733  -25.369  -55.472  1.00 154.30 ? 221 ALA A CA   1 
ATOM   1513  C C    . ALA A  1 105 ? 98.108  -24.124  -56.270  1.00 150.73 ? 221 ALA A C    1 
ATOM   1514  O O    . ALA A  1 105 ? 97.290  -23.583  -57.017  1.00 149.36 ? 221 ALA A O    1 
ATOM   1515  C CB   . ALA A  1 105 ? 96.925  -26.324  -56.348  1.00 157.67 ? 221 ALA A CB   1 
ATOM   1516  H H    . ALA A  1 105 ? 96.153  -25.265  -54.298  1.00 170.21 ? 221 ALA A H    1 
ATOM   1517  H HA   . ALA A  1 105 ? 98.555  -25.819  -55.221  1.00 176.51 ? 221 ALA A HA   1 
ATOM   1518  H HB1  . ALA A  1 105 ? 97.436  -26.527  -57.147  1.00 184.85 ? 221 ALA A HB1  1 
ATOM   1519  H HB2  . ALA A  1 105 ? 96.751  -27.137  -55.850  1.00 184.85 ? 221 ALA A HB2  1 
ATOM   1520  H HB3  . ALA A  1 105 ? 96.088  -25.897  -56.590  1.00 184.85 ? 221 ALA A HB3  1 
ATOM   1521  N N    . GLY A  1 106 ? 99.357  -23.694  -56.123  1.00 149.83 ? 222 GLY A N    1 
ATOM   1522  C CA   . GLY A  1 106 ? 99.853  -22.505  -56.791  1.00 146.99 ? 222 GLY A CA   1 
ATOM   1523  C C    . GLY A  1 106 ? 100.563 -21.565  -55.834  1.00 144.50 ? 222 GLY A C    1 
ATOM   1524  O O    . GLY A  1 106 ? 101.011 -20.489  -56.232  1.00 142.38 ? 222 GLY A O    1 
ATOM   1525  H H    . GLY A  1 106 ? 99.945  -24.084  -55.632  1.00 99.56  ? 222 GLY A H    1 
ATOM   1526  H HA2  . GLY A  1 106 ? 100.476 -22.762  -57.490  1.00 96.79  ? 222 GLY A HA2  1 
ATOM   1527  H HA3  . GLY A  1 106 ? 99.112  -22.029  -57.198  1.00 96.79  ? 222 GLY A HA3  1 
ATOM   1528  N N    . TYR A  1 107 ? 100.662 -21.970  -54.570  1.00 147.30 ? 223 TYR A N    1 
ATOM   1529  C CA   . TYR A  1 107 ? 101.320 -21.163  -53.543  1.00 145.01 ? 223 TYR A CA   1 
ATOM   1530  C C    . TYR A  1 107 ? 102.083 -22.055  -52.572  1.00 145.66 ? 223 TYR A C    1 
ATOM   1531  O O    . TYR A  1 107 ? 101.926 -23.277  -52.581  1.00 148.12 ? 223 TYR A O    1 
ATOM   1532  C CB   . TYR A  1 107 ? 100.294 -20.309  -52.792  1.00 143.64 ? 223 TYR A CB   1 
ATOM   1533  C CG   . TYR A  1 107 ? 99.548  -19.350  -53.694  1.00 142.29 ? 223 TYR A CG   1 
ATOM   1534  C CD1  . TYR A  1 107 ? 98.370  -19.732  -54.322  1.00 142.99 ? 223 TYR A CD1  1 
ATOM   1535  C CD2  . TYR A  1 107 ? 100.032 -18.068  -53.935  1.00 140.12 ? 223 TYR A CD2  1 
ATOM   1536  C CE1  . TYR A  1 107 ? 97.688  -18.863  -55.156  1.00 140.84 ? 223 TYR A CE1  1 
ATOM   1537  C CE2  . TYR A  1 107 ? 99.358  -17.193  -54.770  1.00 138.56 ? 223 TYR A CE2  1 
ATOM   1538  C CZ   . TYR A  1 107 ? 98.187  -17.597  -55.379  1.00 138.61 ? 223 TYR A CZ   1 
ATOM   1539  O OH   . TYR A  1 107 ? 97.510  -16.734  -56.211  1.00 136.22 ? 223 TYR A OH   1 
ATOM   1540  H H    . TYR A  1 107 ? 100.354 -22.717  -54.278  1.00 145.84 ? 223 TYR A H    1 
ATOM   1541  H HA   . TYR A  1 107 ? 101.956 -20.566  -53.968  1.00 141.21 ? 223 TYR A HA   1 
ATOM   1542  H HB2  . TYR A  1 107 ? 99.643  -20.894  -52.374  1.00 134.23 ? 223 TYR A HB2  1 
ATOM   1543  H HB3  . TYR A  1 107 ? 100.753 -19.788  -52.115  1.00 134.23 ? 223 TYR A HB3  1 
ATOM   1544  H HD1  . TYR A  1 107 ? 98.031  -20.586  -54.176  1.00 132.92 ? 223 TYR A HD1  1 
ATOM   1545  H HD2  . TYR A  1 107 ? 100.822 -17.794  -53.528  1.00 135.38 ? 223 TYR A HD2  1 
ATOM   1546  H HE1  . TYR A  1 107 ? 96.899  -19.134  -55.568  1.00 132.29 ? 223 TYR A HE1  1 
ATOM   1547  H HE2  . TYR A  1 107 ? 99.692  -16.338  -54.921  1.00 136.27 ? 223 TYR A HE2  1 
ATOM   1548  H HH   . TYR A  1 107 ? 96.818  -17.105  -56.509  1.00 134.53 ? 223 TYR A HH   1 
ATOM   1549  N N    . ALA A  1 108 ? 102.916 -21.440  -51.740  1.00 138.03 ? 224 ALA A N    1 
ATOM   1550  C CA   . ALA A  1 108 ? 103.712 -22.179  -50.768  1.00 137.98 ? 224 ALA A CA   1 
ATOM   1551  C C    . ALA A  1 108 ? 104.008 -21.308  -49.557  1.00 135.40 ? 224 ALA A C    1 
ATOM   1552  O O    . ALA A  1 108 ? 103.953 -20.082  -49.639  1.00 133.68 ? 224 ALA A O    1 
ATOM   1553  C CB   . ALA A  1 108 ? 105.003 -22.668  -51.403  1.00 138.19 ? 224 ALA A CB   1 
ATOM   1554  H H    . ALA A  1 108 ? 103.039 -20.589  -51.718  1.00 134.91 ? 224 ALA A H    1 
ATOM   1555  H HA   . ALA A  1 108 ? 103.210 -22.953  -50.469  1.00 137.29 ? 224 ALA A HA   1 
ATOM   1556  H HB1  . ALA A  1 108 ? 105.516 -23.155  -50.739  1.00 144.56 ? 224 ALA A HB1  1 
ATOM   1557  H HB2  . ALA A  1 108 ? 104.788 -23.250  -52.148  1.00 144.56 ? 224 ALA A HB2  1 
ATOM   1558  H HB3  . ALA A  1 108 ? 105.510 -21.902  -51.716  1.00 144.56 ? 224 ALA A HB3  1 
ATOM   1559  N N    . ILE A  1 109 ? 104.324 -21.949  -48.437  1.00 146.22 ? 225 ILE A N    1 
ATOM   1560  C CA   . ILE A  1 109 ? 104.575 -21.241  -47.187  1.00 143.71 ? 225 ILE A CA   1 
ATOM   1561  C C    . ILE A  1 109 ? 106.059 -21.252  -46.841  1.00 142.33 ? 225 ILE A C    1 
ATOM   1562  O O    . ILE A  1 109 ? 106.616 -22.288  -46.472  1.00 143.28 ? 225 ILE A O    1 
ATOM   1563  C CB   . ILE A  1 109 ? 103.775 -21.859  -46.018  1.00 144.22 ? 225 ILE A CB   1 
ATOM   1564  C CG1  . ILE A  1 109 ? 102.287 -21.925  -46.373  1.00 146.04 ? 225 ILE A CG1  1 
ATOM   1565  C CG2  . ILE A  1 109 ? 103.981 -21.042  -44.734  1.00 141.16 ? 225 ILE A CG2  1 
ATOM   1566  C CD1  . ILE A  1 109 ? 101.431 -22.670  -45.356  1.00 147.30 ? 225 ILE A CD1  1 
ATOM   1567  H H    . ILE A  1 109 ? 104.399 -22.804  -48.375  1.00 43.16  ? 225 ILE A H    1 
ATOM   1568  H HA   . ILE A  1 109 ? 104.296 -20.317  -47.286  1.00 39.27  ? 225 ILE A HA   1 
ATOM   1569  H HB   . ILE A  1 109 ? 104.097 -22.761  -45.865  1.00 37.16  ? 225 ILE A HB   1 
ATOM   1570  H HG12 . ILE A  1 109 ? 101.943 -21.021  -46.442  1.00 31.81  ? 225 ILE A HG12 1 
ATOM   1571  H HG13 . ILE A  1 109 ? 102.191 -22.377  -47.226  1.00 31.81  ? 225 ILE A HG13 1 
ATOM   1572  H HG21 . ILE A  1 109 ? 103.471 -21.449  -44.017  1.00 35.10  ? 225 ILE A HG21 1 
ATOM   1573  H HG22 . ILE A  1 109 ? 104.925 -21.040  -44.510  1.00 35.10  ? 225 ILE A HG22 1 
ATOM   1574  H HG23 . ILE A  1 109 ? 103.675 -20.134  -44.886  1.00 35.10  ? 225 ILE A HG23 1 
ATOM   1575  H HD11 . ILE A  1 109 ? 100.509 -22.665  -45.656  1.00 30.79  ? 225 ILE A HD11 1 
ATOM   1576  H HD12 . ILE A  1 109 ? 101.751 -23.583  -45.283  1.00 30.79  ? 225 ILE A HD12 1 
ATOM   1577  H HD13 . ILE A  1 109 ? 101.503 -22.224  -44.497  1.00 30.79  ? 225 ILE A HD13 1 
ATOM   1578  N N    . LEU A  1 110 ? 106.696 -20.093  -46.970  1.00 148.32 ? 226 LEU A N    1 
ATOM   1579  C CA   . LEU A  1 110 ? 108.091 -19.938  -46.579  1.00 147.04 ? 226 LEU A CA   1 
ATOM   1580  C C    . LEU A  1 110 ? 108.224 -19.891  -45.065  1.00 145.32 ? 226 LEU A C    1 
ATOM   1581  O O    . LEU A  1 110 ? 107.355 -19.366  -44.372  1.00 144.16 ? 226 LEU A O    1 
ATOM   1582  C CB   . LEU A  1 110 ? 108.691 -18.675  -47.194  1.00 146.03 ? 226 LEU A CB   1 
ATOM   1583  C CG   . LEU A  1 110 ? 109.394 -18.882  -48.537  1.00 147.31 ? 226 LEU A CG   1 
ATOM   1584  C CD1  . LEU A  1 110 ? 108.413 -19.413  -49.570  1.00 149.15 ? 226 LEU A CD1  1 
ATOM   1585  C CD2  . LEU A  1 110 ? 110.047 -17.587  -49.019  1.00 146.42 ? 226 LEU A CD2  1 
ATOM   1586  H H    . LEU A  1 110 ? 106.338 -19.376  -47.282  1.00 92.41  ? 226 LEU A H    1 
ATOM   1587  H HA   . LEU A  1 110 ? 108.597 -20.700  -46.902  1.00 97.62  ? 226 LEU A HA   1 
ATOM   1588  H HB2  . LEU A  1 110 ? 107.979 -18.031  -47.333  1.00 98.23  ? 226 LEU A HB2  1 
ATOM   1589  H HB3  . LEU A  1 110 ? 109.344 -18.310  -46.576  1.00 98.23  ? 226 LEU A HB3  1 
ATOM   1590  H HG   . LEU A  1 110 ? 110.094 -19.543  -48.425  1.00 104.05 ? 226 LEU A HG   1 
ATOM   1591  H HD11 . LEU A  1 110 ? 108.878 -19.537  -50.412  1.00 106.21 ? 226 LEU A HD11 1 
ATOM   1592  H HD12 . LEU A  1 110 ? 108.057 -20.261  -49.260  1.00 106.21 ? 226 LEU A HD12 1 
ATOM   1593  H HD13 . LEU A  1 110 ? 107.693 -18.772  -49.679  1.00 106.21 ? 226 LEU A HD13 1 
ATOM   1594  H HD21 . LEU A  1 110 ? 110.483 -17.751  -49.870  1.00 102.93 ? 226 LEU A HD21 1 
ATOM   1595  H HD22 . LEU A  1 110 ? 109.362 -16.908  -49.122  1.00 102.93 ? 226 LEU A HD22 1 
ATOM   1596  H HD23 . LEU A  1 110 ? 110.701 -17.300  -48.362  1.00 102.93 ? 226 LEU A HD23 1 
ATOM   1597  N N    . LYS A  1 111 ? 109.327 -20.437  -44.565  1.00 153.15 ? 227 LYS A N    1 
ATOM   1598  C CA   . LYS A  1 111 ? 109.567 -20.545  -43.133  1.00 151.61 ? 227 LYS A CA   1 
ATOM   1599  C C    . LYS A  1 111 ? 110.956 -20.025  -42.792  1.00 150.66 ? 227 LYS A C    1 
ATOM   1600  O O    . LYS A  1 111 ? 111.955 -20.500  -43.330  1.00 152.24 ? 227 LYS A O    1 
ATOM   1601  C CB   . LYS A  1 111 ? 109.410 -21.999  -42.687  1.00 153.42 ? 227 LYS A CB   1 
ATOM   1602  C CG   . LYS A  1 111 ? 109.625 -22.245  -41.205  1.00 152.03 ? 227 LYS A CG   1 
ATOM   1603  C CD   . LYS A  1 111 ? 109.534 -23.733  -40.896  1.00 154.77 ? 227 LYS A CD   1 
ATOM   1604  C CE   . LYS A  1 111 ? 109.605 -24.011  -39.404  1.00 153.24 ? 227 LYS A CE   1 
ATOM   1605  N NZ   . LYS A  1 111 ? 109.709 -25.470  -39.129  1.00 155.72 ? 227 LYS A NZ   1 
ATOM   1606  H H    . LYS A  1 111 ? 109.964 -20.758  -45.046  1.00 49.37  ? 227 LYS A H    1 
ATOM   1607  H HA   . LYS A  1 111 ? 108.915 -20.007  -42.657  1.00 49.27  ? 227 LYS A HA   1 
ATOM   1608  H HB2  . LYS A  1 111 ? 108.511 -22.293  -42.904  1.00 53.52  ? 227 LYS A HB2  1 
ATOM   1609  H HB3  . LYS A  1 111 ? 110.054 -22.541  -43.169  1.00 53.52  ? 227 LYS A HB3  1 
ATOM   1610  H HG2  . LYS A  1 111 ? 110.506 -21.930  -40.949  1.00 55.45  ? 227 LYS A HG2  1 
ATOM   1611  H HG3  . LYS A  1 111 ? 108.939 -21.783  -40.698  1.00 55.45  ? 227 LYS A HG3  1 
ATOM   1612  H HD2  . LYS A  1 111 ? 108.689 -24.076  -41.228  1.00 61.79  ? 227 LYS A HD2  1 
ATOM   1613  H HD3  . LYS A  1 111 ? 110.273 -24.192  -41.325  1.00 61.79  ? 227 LYS A HD3  1 
ATOM   1614  H HE2  . LYS A  1 111 ? 110.389 -23.575  -39.034  1.00 62.90  ? 227 LYS A HE2  1 
ATOM   1615  H HE3  . LYS A  1 111 ? 108.801 -23.677  -38.977  1.00 62.90  ? 227 LYS A HE3  1 
ATOM   1616  H HZ1  . LYS A  1 111 ? 109.749 -25.611  -38.251  1.00 71.50  ? 227 LYS A HZ1  1 
ATOM   1617  H HZ2  . LYS A  1 111 ? 108.998 -25.893  -39.457  1.00 71.50  ? 227 LYS A HZ2  1 
ATOM   1618  H HZ3  . LYS A  1 111 ? 110.443 -25.800  -39.509  1.00 71.50  ? 227 LYS A HZ3  1 
ATOM   1619  N N    . CYS A  1 112 ? 111.014 -19.043  -41.901  1.00 162.11 ? 228 CYS A N    1 
ATOM   1620  C CA   . CYS A  1 112 ? 112.284 -18.460  -41.487  1.00 161.77 ? 228 CYS A CA   1 
ATOM   1621  C C    . CYS A  1 112 ? 112.859 -19.271  -40.332  1.00 161.99 ? 228 CYS A C    1 
ATOM   1622  O O    . CYS A  1 112 ? 112.182 -19.489  -39.326  1.00 160.53 ? 228 CYS A O    1 
ATOM   1623  C CB   . CYS A  1 112 ? 112.094 -16.994  -41.089  1.00 160.09 ? 228 CYS A CB   1 
ATOM   1624  S SG   . CYS A  1 112 ? 113.627 -16.093  -40.738  1.00 161.79 ? 228 CYS A SG   1 
ATOM   1625  H H    . CYS A  1 112 ? 110.327 -18.695  -41.518  1.00 206.74 ? 228 CYS A H    1 
ATOM   1626  H HA   . CYS A  1 112 ? 112.910 -18.497  -42.227  1.00 212.41 ? 228 CYS A HA   1 
ATOM   1627  H HB2  . CYS A  1 112 ? 111.643 -16.533  -41.814  1.00 209.02 ? 228 CYS A HB2  1 
ATOM   1628  H HB3  . CYS A  1 112 ? 111.545 -16.960  -40.290  1.00 209.02 ? 228 CYS A HB3  1 
ATOM   1629  N N    . ASN A  1 113 ? 114.102 -19.721  -40.483  1.00 170.49 ? 229 ASN A N    1 
ATOM   1630  C CA   . ASN A  1 113 ? 114.714 -20.620  -39.512  1.00 172.03 ? 229 ASN A CA   1 
ATOM   1631  C C    . ASN A  1 113 ? 115.825 -19.976  -38.686  1.00 173.38 ? 229 ASN A C    1 
ATOM   1632  O O    . ASN A  1 113 ? 116.400 -20.624  -37.813  1.00 174.91 ? 229 ASN A O    1 
ATOM   1633  C CB   . ASN A  1 113 ? 115.257 -21.861  -40.226  1.00 175.02 ? 229 ASN A CB   1 
ATOM   1634  C CG   . ASN A  1 113 ? 114.161 -22.670  -40.902  1.00 174.22 ? 229 ASN A CG   1 
ATOM   1635  O OD1  . ASN A  1 113 ? 113.000 -22.630  -40.489  1.00 172.09 ? 229 ASN A OD1  1 
ATOM   1636  N ND2  . ASN A  1 113 ? 114.526 -23.411  -41.946  1.00 176.75 ? 229 ASN A ND2  1 
ATOM   1637  H H    . ASN A  1 113 ? 114.614 -19.518  -41.144  1.00 180.74 ? 229 ASN A H    1 
ATOM   1638  H HA   . ASN A  1 113 ? 114.028 -20.917  -38.894  1.00 188.02 ? 229 ASN A HA   1 
ATOM   1639  H HB2  . ASN A  1 113 ? 115.890 -21.584  -40.907  1.00 197.05 ? 229 ASN A HB2  1 
ATOM   1640  H HB3  . ASN A  1 113 ? 115.696 -22.433  -39.577  1.00 197.05 ? 229 ASN A HB3  1 
ATOM   1641  H HD21 . ASN A  1 113 ? 113.941 -23.886  -42.361  1.00 190.75 ? 229 ASN A HD21 1 
ATOM   1642  H HD22 . ASN A  1 113 ? 115.346 -23.415  -42.205  1.00 190.75 ? 229 ASN A HD22 1 
ATOM   1643  N N    . ASP A  1 114 ? 116.126 -18.707  -38.950  1.00 177.79 ? 230 ASP A N    1 
ATOM   1644  C CA   . ASP A  1 114 ? 117.083 -17.982  -38.120  1.00 179.09 ? 230 ASP A CA   1 
ATOM   1645  C C    . ASP A  1 114 ? 116.562 -17.959  -36.687  1.00 177.29 ? 230 ASP A C    1 
ATOM   1646  O O    . ASP A  1 114 ? 115.428 -17.556  -36.441  1.00 174.33 ? 230 ASP A O    1 
ATOM   1647  C CB   . ASP A  1 114 ? 117.306 -16.559  -38.640  1.00 179.03 ? 230 ASP A CB   1 
ATOM   1648  C CG   . ASP A  1 114 ? 118.144 -16.523  -39.912  1.00 181.70 ? 230 ASP A CG   1 
ATOM   1649  O OD1  . ASP A  1 114 ? 118.314 -17.582  -40.552  1.00 183.02 ? 230 ASP A OD1  1 
ATOM   1650  O OD2  . ASP A  1 114 ? 118.632 -15.430  -40.273  1.00 182.71 ? 230 ASP A OD2  1 
ATOM   1651  H H    . ASP A  1 114 ? 115.794 -18.248  -39.597  1.00 214.74 ? 230 ASP A H    1 
ATOM   1652  H HA   . ASP A  1 114 ? 117.934 -18.448  -38.129  1.00 220.73 ? 230 ASP A HA   1 
ATOM   1653  H HB2  . ASP A  1 114 ? 116.446 -16.155  -38.836  1.00 218.83 ? 230 ASP A HB2  1 
ATOM   1654  H HB3  . ASP A  1 114 ? 117.768 -16.044  -37.961  1.00 218.83 ? 230 ASP A HB3  1 
ATOM   1655  N N    . LYS A  1 115 ? 117.392 -18.401  -35.747  1.00 184.47 ? 231 LYS A N    1 
ATOM   1656  C CA   . LYS A  1 115 ? 116.955 -18.576  -34.365  1.00 183.37 ? 231 LYS A CA   1 
ATOM   1657  C C    . LYS A  1 115 ? 116.555 -17.253  -33.720  1.00 181.62 ? 231 LYS A C    1 
ATOM   1658  O O    . LYS A  1 115 ? 115.526 -17.167  -33.048  1.00 179.17 ? 231 LYS A O    1 
ATOM   1659  C CB   . LYS A  1 115 ? 118.056 -19.239  -33.533  1.00 186.70 ? 231 LYS A CB   1 
ATOM   1660  C CG   . LYS A  1 115 ? 118.621 -20.530  -34.121  1.00 189.29 ? 231 LYS A CG   1 
ATOM   1661  C CD   . LYS A  1 115 ? 117.528 -21.537  -34.458  1.00 187.37 ? 231 LYS A CD   1 
ATOM   1662  C CE   . LYS A  1 115 ? 118.099 -22.939  -34.646  1.00 190.53 ? 231 LYS A CE   1 
ATOM   1663  N NZ   . LYS A  1 115 ? 119.252 -22.960  -35.589  1.00 193.84 ? 231 LYS A NZ   1 
ATOM   1664  H H    . LYS A  1 115 ? 118.215 -18.608  -35.884  1.00 343.70 ? 231 LYS A H    1 
ATOM   1665  H HA   . LYS A  1 115 ? 116.180 -19.160  -34.353  1.00 345.10 ? 231 LYS A HA   1 
ATOM   1666  H HB2  . LYS A  1 115 ? 118.792 -18.613  -33.441  1.00 354.01 ? 231 LYS A HB2  1 
ATOM   1667  H HB3  . LYS A  1 115 ? 117.697 -19.449  -32.657  1.00 354.01 ? 231 LYS A HB3  1 
ATOM   1668  H HG2  . LYS A  1 115 ? 119.102 -20.323  -34.937  1.00 358.26 ? 231 LYS A HG2  1 
ATOM   1669  H HG3  . LYS A  1 115 ? 119.219 -20.938  -33.475  1.00 358.26 ? 231 LYS A HG3  1 
ATOM   1670  H HD2  . LYS A  1 115 ? 116.884 -21.566  -33.732  1.00 357.80 ? 231 LYS A HD2  1 
ATOM   1671  H HD3  . LYS A  1 115 ? 117.092 -21.273  -35.283  1.00 357.80 ? 231 LYS A HD3  1 
ATOM   1672  H HE2  . LYS A  1 115 ? 118.405 -23.275  -33.789  1.00 362.18 ? 231 LYS A HE2  1 
ATOM   1673  H HE3  . LYS A  1 115 ? 117.408 -23.518  -35.003  1.00 362.18 ? 231 LYS A HE3  1 
ATOM   1674  H HZ1  . LYS A  1 115 ? 119.559 -23.791  -35.674  1.00 360.67 ? 231 LYS A HZ1  1 
ATOM   1675  H HZ2  . LYS A  1 115 ? 118.996 -22.662  -36.387  1.00 360.67 ? 231 LYS A HZ2  1 
ATOM   1676  H HZ3  . LYS A  1 115 ? 119.905 -22.440  -35.281  1.00 360.67 ? 231 LYS A HZ3  1 
ATOM   1677  N N    . GLU A  1 116 ? 117.374 -16.228  -33.933  1.00 176.19 ? 232 GLU A N    1 
ATOM   1678  C CA   . GLU A  1 116 ? 117.149 -14.915  -33.332  1.00 175.31 ? 232 GLU A CA   1 
ATOM   1679  C C    . GLU A  1 116 ? 116.521 -13.959  -34.344  1.00 173.66 ? 232 GLU A C    1 
ATOM   1680  O O    . GLU A  1 116 ? 117.217 -13.197  -35.015  1.00 175.38 ? 232 GLU A O    1 
ATOM   1681  C CB   . GLU A  1 116 ? 118.463 -14.343  -32.789  1.00 178.86 ? 232 GLU A CB   1 
ATOM   1682  C CG   . GLU A  1 116 ? 119.652 -14.439  -33.739  1.00 182.48 ? 232 GLU A CG   1 
ATOM   1683  C CD   . GLU A  1 116 ? 120.935 -13.935  -33.115  1.00 187.27 ? 232 GLU A CD   1 
ATOM   1684  O OE1  . GLU A  1 116 ? 120.870 -13.353  -32.012  1.00 187.69 ? 232 GLU A OE1  1 
ATOM   1685  O OE2  . GLU A  1 116 ? 122.008 -14.123  -33.725  1.00 191.18 ? 232 GLU A OE2  1 
ATOM   1686  H H    . GLU A  1 116 ? 118.076 -16.266  -34.429  1.00 226.36 ? 232 GLU A H    1 
ATOM   1687  H HA   . GLU A  1 116 ? 116.534 -15.011  -32.588  1.00 225.31 ? 232 GLU A HA   1 
ATOM   1688  H HB2  . GLU A  1 116 ? 118.329 -13.405  -32.582  1.00 223.66 ? 232 GLU A HB2  1 
ATOM   1689  H HB3  . GLU A  1 116 ? 118.697 -14.824  -31.979  1.00 223.66 ? 232 GLU A HB3  1 
ATOM   1690  H HG2  . GLU A  1 116 ? 119.784 -15.367  -33.989  1.00 232.30 ? 232 GLU A HG2  1 
ATOM   1691  H HG3  . GLU A  1 116 ? 119.471 -13.904  -34.528  1.00 232.30 ? 232 GLU A HG3  1 
ATOM   1692  N N    . PHE A  1 117 ? 115.194 -14.006  -34.438  1.00 164.74 ? 233 PHE A N    1 
ATOM   1693  C CA   . PHE A  1 117 ? 114.455 -13.259  -35.452  1.00 163.19 ? 233 PHE A CA   1 
ATOM   1694  C C    . PHE A  1 117 ? 113.519 -12.237  -34.806  1.00 161.23 ? 233 PHE A C    1 
ATOM   1695  O O    . PHE A  1 117 ? 112.699 -12.588  -33.959  1.00 159.46 ? 233 PHE A O    1 
ATOM   1696  C CB   . PHE A  1 117 ? 113.667 -14.231  -36.336  1.00 161.69 ? 233 PHE A CB   1 
ATOM   1697  C CG   . PHE A  1 117 ? 113.024 -13.586  -37.531  1.00 160.74 ? 233 PHE A CG   1 
ATOM   1698  C CD1  . PHE A  1 117 ? 113.779 -12.855  -38.433  1.00 162.70 ? 233 PHE A CD1  1 
ATOM   1699  C CD2  . PHE A  1 117 ? 111.667 -13.731  -37.764  1.00 158.17 ? 233 PHE A CD2  1 
ATOM   1700  C CE1  . PHE A  1 117 ? 113.189 -12.267  -39.535  1.00 162.12 ? 233 PHE A CE1  1 
ATOM   1701  C CE2  . PHE A  1 117 ? 111.073 -13.147  -38.864  1.00 158.64 ? 233 PHE A CE2  1 
ATOM   1702  C CZ   . PHE A  1 117 ? 111.834 -12.414  -39.750  1.00 160.09 ? 233 PHE A CZ   1 
ATOM   1703  H H    . PHE A  1 117 ? 114.692 -14.471  -33.918  1.00 175.76 ? 233 PHE A H    1 
ATOM   1704  H HA   . PHE A  1 117 ? 115.083 -12.780  -36.015  1.00 172.73 ? 233 PHE A HA   1 
ATOM   1705  H HB2  . PHE A  1 117 ? 114.271 -14.918  -36.659  1.00 166.84 ? 233 PHE A HB2  1 
ATOM   1706  H HB3  . PHE A  1 117 ? 112.964 -14.636  -35.804  1.00 166.84 ? 233 PHE A HB3  1 
ATOM   1707  H HD1  . PHE A  1 117 ? 114.692 -12.752  -38.291  1.00 163.47 ? 233 PHE A HD1  1 
ATOM   1708  H HD2  . PHE A  1 117 ? 111.149 -14.223  -37.168  1.00 153.65 ? 233 PHE A HD2  1 
ATOM   1709  H HE1  . PHE A  1 117 ? 113.705 -11.774  -40.132  1.00 158.22 ? 233 PHE A HE1  1 
ATOM   1710  H HE2  . PHE A  1 117 ? 110.159 -13.247  -39.008  1.00 148.73 ? 233 PHE A HE2  1 
ATOM   1711  H HZ   . PHE A  1 117 ? 111.435 -12.020  -40.492  1.00 150.91 ? 233 PHE A HZ   1 
ATOM   1712  N N    . ASN A  1 118 ? 113.649 -10.974  -35.209  1.00 159.26 ? 234 ASN A N    1 
ATOM   1713  C CA   . ASN A  1 118 ? 112.866 -9.890   -34.616  1.00 158.06 ? 234 ASN A CA   1 
ATOM   1714  C C    . ASN A  1 118 ? 111.585 -9.594   -35.396  1.00 155.77 ? 234 ASN A C    1 
ATOM   1715  O O    . ASN A  1 118 ? 110.840 -8.676   -35.047  1.00 155.27 ? 234 ASN A O    1 
ATOM   1716  C CB   . ASN A  1 118 ? 113.712 -8.616   -34.511  1.00 160.50 ? 234 ASN A CB   1 
ATOM   1717  C CG   . ASN A  1 118 ? 114.001 -7.993   -35.861  1.00 161.60 ? 234 ASN A CG   1 
ATOM   1718  O OD1  . ASN A  1 118 ? 113.911 -8.653   -36.893  1.00 161.26 ? 234 ASN A OD1  1 
ATOM   1719  N ND2  . ASN A  1 118 ? 114.356 -6.714   -35.859  1.00 163.19 ? 234 ASN A ND2  1 
ATOM   1720  H H    . ASN A  1 118 ? 114.188 -10.716  -35.828  1.00 281.13 ? 234 ASN A H    1 
ATOM   1721  H HA   . ASN A  1 118 ? 112.609 -10.148  -33.717  1.00 275.81 ? 234 ASN A HA   1 
ATOM   1722  H HB2  . ASN A  1 118 ? 113.235 -7.963   -33.975  1.00 279.16 ? 234 ASN A HB2  1 
ATOM   1723  H HB3  . ASN A  1 118 ? 114.560 -8.834   -34.093  1.00 279.16 ? 234 ASN A HB3  1 
ATOM   1724  H HD21 . ASN A  1 118 ? 114.530 -6.315   -36.600  1.00 283.43 ? 234 ASN A HD21 1 
ATOM   1725  H HD22 . ASN A  1 118 ? 114.412 -6.284   -35.116  1.00 283.43 ? 234 ASN A HD22 1 
ATOM   1726  N N    . GLY A  1 119 ? 111.338 -10.360  -36.457  1.00 156.99 ? 235 GLY A N    1 
ATOM   1727  C CA   . GLY A  1 119 ? 110.083 -10.274  -37.186  1.00 156.60 ? 235 GLY A CA   1 
ATOM   1728  C C    . GLY A  1 119 ? 110.129 -9.415   -38.434  1.00 158.13 ? 235 GLY A C    1 
ATOM   1729  O O    . GLY A  1 119 ? 109.200 -9.438   -39.243  1.00 158.25 ? 235 GLY A O    1 
ATOM   1730  H H    . GLY A  1 119 ? 111.888 -10.940  -36.774  1.00 316.73 ? 235 GLY A H    1 
ATOM   1731  H HA2  . GLY A  1 119 ? 109.810 -11.167  -37.448  1.00 309.91 ? 235 GLY A HA2  1 
ATOM   1732  H HA3  . GLY A  1 119 ? 109.402 -9.911   -36.599  1.00 309.91 ? 235 GLY A HA3  1 
ATOM   1733  N N    . THR A  1 120 ? 111.205 -8.651   -38.588  1.00 163.15 ? 236 THR A N    1 
ATOM   1734  C CA   . THR A  1 120 ? 111.368 -7.773   -39.741  1.00 164.71 ? 236 THR A CA   1 
ATOM   1735  C C    . THR A  1 120 ? 112.755 -7.921   -40.341  1.00 166.14 ? 236 THR A C    1 
ATOM   1736  O O    . THR A  1 120 ? 113.720 -8.199   -39.630  1.00 167.48 ? 236 THR A O    1 
ATOM   1737  C CB   . THR A  1 120 ? 111.156 -6.298   -39.366  1.00 165.41 ? 236 THR A CB   1 
ATOM   1738  O OG1  . THR A  1 120 ? 112.027 -5.951   -38.282  1.00 165.64 ? 236 THR A OG1  1 
ATOM   1739  C CG2  . THR A  1 120 ? 109.708 -6.044   -38.961  1.00 164.44 ? 236 THR A CG2  1 
ATOM   1740  H H    . THR A  1 120 ? 111.862 -8.623   -38.034  1.00 175.06 ? 236 THR A H    1 
ATOM   1741  H HA   . THR A  1 120 ? 110.717 -8.011   -40.419  1.00 174.49 ? 236 THR A HA   1 
ATOM   1742  H HB   . THR A  1 120 ? 111.360 -5.739   -40.132  1.00 174.37 ? 236 THR A HB   1 
ATOM   1743  H HG1  . THR A  1 120 ? 112.828 -6.066   -38.508  1.00 179.73 ? 236 THR A HG1  1 
ATOM   1744  H HG21 . THR A  1 120 ? 109.589 -5.110   -38.728  1.00 169.64 ? 236 THR A HG21 1 
ATOM   1745  H HG22 . THR A  1 120 ? 109.115 -6.263   -39.697  1.00 169.64 ? 236 THR A HG22 1 
ATOM   1746  H HG23 . THR A  1 120 ? 109.477 -6.593   -38.196  1.00 169.64 ? 236 THR A HG23 1 
ATOM   1747  N N    . GLY A  1 121 ? 112.847 -7.732   -41.653  1.00 169.64 ? 237 GLY A N    1 
ATOM   1748  C CA   . GLY A  1 121 ? 114.124 -7.741   -42.343  1.00 172.54 ? 237 GLY A CA   1 
ATOM   1749  C C    . GLY A  1 121 ? 114.468 -9.056   -43.010  1.00 173.03 ? 237 GLY A C    1 
ATOM   1750  O O    . GLY A  1 121 ? 113.594 -9.875   -43.301  1.00 171.19 ? 237 GLY A O    1 
ATOM   1751  H H    . GLY A  1 121 ? 112.173 -7.596   -42.170  1.00 193.68 ? 237 GLY A H    1 
ATOM   1752  H HA2  . GLY A  1 121 ? 114.119 -7.051   -43.024  1.00 199.74 ? 237 GLY A HA2  1 
ATOM   1753  H HA3  . GLY A  1 121 ? 114.827 -7.533   -41.708  1.00 199.74 ? 237 GLY A HA3  1 
ATOM   1754  N N    . LEU A  1 122 ? 115.759 -9.257   -43.246  1.00 168.60 ? 238 LEU A N    1 
ATOM   1755  C CA   . LEU A  1 122 ? 116.237 -10.376  -44.050  1.00 169.87 ? 238 LEU A CA   1 
ATOM   1756  C C    . LEU A  1 122 ? 116.388 -11.669  -43.256  1.00 169.35 ? 238 LEU A C    1 
ATOM   1757  O O    . LEU A  1 122 ? 116.826 -11.658  -42.104  1.00 169.49 ? 238 LEU A O    1 
ATOM   1758  C CB   . LEU A  1 122 ? 117.576 -10.005  -44.686  1.00 173.43 ? 238 LEU A CB   1 
ATOM   1759  C CG   . LEU A  1 122 ? 117.581 -8.675   -45.445  1.00 174.53 ? 238 LEU A CG   1 
ATOM   1760  C CD1  . LEU A  1 122 ? 118.961 -8.381   -46.013  1.00 178.33 ? 238 LEU A CD1  1 
ATOM   1761  C CD2  . LEU A  1 122 ? 116.531 -8.662   -46.548  1.00 173.18 ? 238 LEU A CD2  1 
ATOM   1762  H H    . LEU A  1 122 ? 116.387 -8.752   -42.947  1.00 187.33 ? 238 LEU A H    1 
ATOM   1763  H HA   . LEU A  1 122 ? 115.603 -10.539  -44.766  1.00 191.07 ? 238 LEU A HA   1 
ATOM   1764  H HB2  . LEU A  1 122 ? 118.245 -9.945   -43.986  1.00 198.62 ? 238 LEU A HB2  1 
ATOM   1765  H HB3  . LEU A  1 122 ? 117.824 -10.701  -45.314  1.00 198.62 ? 238 LEU A HB3  1 
ATOM   1766  H HG   . LEU A  1 122 ? 117.362 -7.964   -44.823  1.00 196.29 ? 238 LEU A HG   1 
ATOM   1767  H HD11 . LEU A  1 122 ? 118.933 -7.535   -46.487  1.00 205.07 ? 238 LEU A HD11 1 
ATOM   1768  H HD12 . LEU A  1 122 ? 119.598 -8.331   -45.283  1.00 205.07 ? 238 LEU A HD12 1 
ATOM   1769  H HD13 . LEU A  1 122 ? 119.211 -9.093   -46.622  1.00 205.07 ? 238 LEU A HD13 1 
ATOM   1770  H HD21 . LEU A  1 122 ? 116.564 -7.807   -47.005  1.00 190.65 ? 238 LEU A HD21 1 
ATOM   1771  H HD22 . LEU A  1 122 ? 116.721 -9.379   -47.173  1.00 190.65 ? 238 LEU A HD22 1 
ATOM   1772  H HD23 . LEU A  1 122 ? 115.655 -8.792   -46.151  1.00 190.65 ? 238 LEU A HD23 1 
ATOM   1773  N N    . CYS A  1 123 ? 116.016 -12.778  -43.889  1.00 175.32 ? 239 CYS A N    1 
ATOM   1774  C CA   . CYS A  1 123 ? 116.202 -14.111  -43.322  1.00 175.39 ? 239 CYS A CA   1 
ATOM   1775  C C    . CYS A  1 123 ? 117.128 -14.913  -44.229  1.00 178.38 ? 239 CYS A C    1 
ATOM   1776  O O    . CYS A  1 123 ? 116.926 -14.969  -45.443  1.00 178.98 ? 239 CYS A O    1 
ATOM   1777  C CB   . CYS A  1 123 ? 114.857 -14.825  -43.156  1.00 172.53 ? 239 CYS A CB   1 
ATOM   1778  S SG   . CYS A  1 123 ? 114.940 -16.399  -42.259  1.00 172.56 ? 239 CYS A SG   1 
ATOM   1779  H H    . CYS A  1 123 ? 115.645 -12.785  -44.665  1.00 220.60 ? 239 CYS A H    1 
ATOM   1780  H HA   . CYS A  1 123 ? 116.618 -14.035  -42.449  1.00 223.79 ? 239 CYS A HA   1 
ATOM   1781  H HB2  . CYS A  1 123 ? 114.255 -14.241  -42.668  1.00 216.79 ? 239 CYS A HB2  1 
ATOM   1782  H HB3  . CYS A  1 123 ? 114.493 -15.007  -44.036  1.00 216.79 ? 239 CYS A HB3  1 
ATOM   1783  N N    . LYS A  1 124 ? 118.141 -15.532  -43.632  1.00 179.31 ? 240 LYS A N    1 
ATOM   1784  C CA   . LYS A  1 124 ? 119.199 -16.181  -44.394  1.00 182.76 ? 240 LYS A CA   1 
ATOM   1785  C C    . LYS A  1 124 ? 119.070 -17.704  -44.417  1.00 183.30 ? 240 LYS A C    1 
ATOM   1786  O O    . LYS A  1 124 ? 119.780 -18.374  -45.169  1.00 186.20 ? 240 LYS A O    1 
ATOM   1787  C CB   . LYS A  1 124 ? 120.559 -15.773  -43.825  1.00 185.60 ? 240 LYS A CB   1 
ATOM   1788  C CG   . LYS A  1 124 ? 120.785 -14.267  -43.838  1.00 185.73 ? 240 LYS A CG   1 
ATOM   1789  C CD   . LYS A  1 124 ? 122.165 -13.888  -43.323  1.00 189.21 ? 240 LYS A CD   1 
ATOM   1790  C CE   . LYS A  1 124 ? 122.370 -12.380  -43.356  1.00 189.76 ? 240 LYS A CE   1 
ATOM   1791  N NZ   . LYS A  1 124 ? 123.723 -11.974  -42.883  1.00 194.59 ? 240 LYS A NZ   1 
ATOM   1792  H H    . LYS A  1 124 ? 118.237 -15.592  -42.779  1.00 173.16 ? 240 LYS A H    1 
ATOM   1793  H HA   . LYS A  1 124 ? 119.158 -15.868  -45.311  1.00 181.10 ? 240 LYS A HA   1 
ATOM   1794  H HB2  . LYS A  1 124 ? 120.619 -16.076  -42.906  1.00 191.53 ? 240 LYS A HB2  1 
ATOM   1795  H HB3  . LYS A  1 124 ? 121.258 -16.184  -44.356  1.00 191.53 ? 240 LYS A HB3  1 
ATOM   1796  H HG2  . LYS A  1 124 ? 120.702 -13.940  -44.747  1.00 191.08 ? 240 LYS A HG2  1 
ATOM   1797  H HG3  . LYS A  1 124 ? 120.124 -13.841  -43.269  1.00 191.08 ? 240 LYS A HG3  1 
ATOM   1798  H HD2  . LYS A  1 124 ? 122.259 -14.189  -42.406  1.00 202.17 ? 240 LYS A HD2  1 
ATOM   1799  H HD3  . LYS A  1 124 ? 122.841 -14.300  -43.884  1.00 202.17 ? 240 LYS A HD3  1 
ATOM   1800  H HE2  . LYS A  1 124 ? 122.264 -12.066  -44.268  1.00 202.58 ? 240 LYS A HE2  1 
ATOM   1801  H HE3  . LYS A  1 124 ? 121.712 -11.959  -42.782  1.00 202.58 ? 240 LYS A HE3  1 
ATOM   1802  H HZ1  . LYS A  1 124 ? 123.804 -11.088  -42.917  1.00 214.28 ? 240 LYS A HZ1  1 
ATOM   1803  H HZ2  . LYS A  1 124 ? 123.845 -12.243  -42.044  1.00 214.28 ? 240 LYS A HZ2  1 
ATOM   1804  H HZ3  . LYS A  1 124 ? 124.348 -12.342  -43.399  1.00 214.28 ? 240 LYS A HZ3  1 
ATOM   1805  N N    . ASN A  1 125 ? 118.167 -18.245  -43.601  1.00 176.42 ? 241 ASN A N    1 
ATOM   1806  C CA   . ASN A  1 125 ? 117.892 -19.681  -43.602  1.00 176.92 ? 241 ASN A CA   1 
ATOM   1807  C C    . ASN A  1 125 ? 116.429 -19.956  -43.936  1.00 174.10 ? 241 ASN A C    1 
ATOM   1808  O O    . ASN A  1 125 ? 115.634 -20.300  -43.063  1.00 171.99 ? 241 ASN A O    1 
ATOM   1809  C CB   . ASN A  1 125 ? 118.250 -20.307  -42.251  1.00 177.37 ? 241 ASN A CB   1 
ATOM   1810  C CG   . ASN A  1 125 ? 119.746 -20.307  -41.982  1.00 180.91 ? 241 ASN A CG   1 
ATOM   1811  O OD1  . ASN A  1 125 ? 120.557 -20.236  -42.907  1.00 183.57 ? 241 ASN A OD1  1 
ATOM   1812  N ND2  . ASN A  1 125 ? 120.119 -20.401  -40.709  1.00 181.19 ? 241 ASN A ND2  1 
ATOM   1813  H H    . ASN A  1 125 ? 117.698 -17.800  -43.035  1.00 143.00 ? 241 ASN A H    1 
ATOM   1814  H HA   . ASN A  1 125 ? 118.438 -20.106  -44.282  1.00 146.17 ? 241 ASN A HA   1 
ATOM   1815  H HB2  . ASN A  1 125 ? 117.818 -19.802  -41.544  1.00 154.70 ? 241 ASN A HB2  1 
ATOM   1816  H HB3  . ASN A  1 125 ? 117.943 -21.227  -42.237  1.00 154.70 ? 241 ASN A HB3  1 
ATOM   1817  H HD21 . ASN A  1 125 ? 120.954 -20.405  -40.505  1.00 173.39 ? 241 ASN A HD21 1 
ATOM   1818  H HD22 . ASN A  1 125 ? 119.524 -20.458  -40.090  1.00 173.39 ? 241 ASN A HD22 1 
ATOM   1819  N N    . VAL A  1 126 ? 116.088 -19.805  -45.211  1.00 170.02 ? 242 VAL A N    1 
ATOM   1820  C CA   . VAL A  1 126 ? 114.716 -19.965  -45.673  1.00 167.74 ? 242 VAL A CA   1 
ATOM   1821  C C    . VAL A  1 126 ? 114.445 -21.415  -46.062  1.00 169.10 ? 242 VAL A C    1 
ATOM   1822  O O    . VAL A  1 126 ? 115.368 -22.159  -46.388  1.00 172.16 ? 242 VAL A O    1 
ATOM   1823  C CB   . VAL A  1 126 ? 114.426 -19.050  -46.881  1.00 167.51 ? 242 VAL A CB   1 
ATOM   1824  C CG1  . VAL A  1 126 ? 112.928 -18.974  -47.156  1.00 165.12 ? 242 VAL A CG1  1 
ATOM   1825  C CG2  . VAL A  1 126 ? 114.987 -17.653  -46.641  1.00 167.39 ? 242 VAL A CG2  1 
ATOM   1826  H H    . VAL A  1 126 ? 116.643 -19.607  -45.837  1.00 97.90  ? 242 VAL A H    1 
ATOM   1827  H HA   . VAL A  1 126 ? 114.107 -19.724  -44.957  1.00 87.82  ? 242 VAL A HA   1 
ATOM   1828  H HB   . VAL A  1 126 ? 114.858 -19.417  -47.668  1.00 83.96  ? 242 VAL A HB   1 
ATOM   1829  H HG11 . VAL A  1 126 ? 112.777 -18.394  -47.918  1.00 75.85  ? 242 VAL A HG11 1 
ATOM   1830  H HG12 . VAL A  1 126 ? 112.597 -19.866  -47.347  1.00 75.85  ? 242 VAL A HG12 1 
ATOM   1831  H HG13 . VAL A  1 126 ? 112.482 -18.616  -46.373  1.00 75.85  ? 242 VAL A HG13 1 
ATOM   1832  H HG21 . VAL A  1 126 ? 114.792 -17.098  -47.412  1.00 82.42  ? 242 VAL A HG21 1 
ATOM   1833  H HG22 . VAL A  1 126 ? 114.570 -17.278  -45.849  1.00 82.42  ? 242 VAL A HG22 1 
ATOM   1834  H HG23 . VAL A  1 126 ? 115.946 -17.716  -46.512  1.00 82.42  ? 242 VAL A HG23 1 
ATOM   1835  N N    . SER A  1 127 ? 113.178 -21.811  -46.015  1.00 159.39 ? 243 SER A N    1 
ATOM   1836  C CA   . SER A  1 127 ? 112.759 -23.136  -46.460  1.00 161.52 ? 243 SER A CA   1 
ATOM   1837  C C    . SER A  1 127 ? 111.362 -23.044  -47.070  1.00 161.50 ? 243 SER A C    1 
ATOM   1838  O O    . SER A  1 127 ? 110.940 -21.969  -47.496  1.00 160.21 ? 243 SER A O    1 
ATOM   1839  C CB   . SER A  1 127 ? 112.780 -24.131  -45.300  1.00 162.23 ? 243 SER A CB   1 
ATOM   1840  O OG   . SER A  1 127 ? 111.765 -23.831  -44.358  1.00 160.69 ? 243 SER A OG   1 
ATOM   1841  H H    . SER A  1 127 ? 112.532 -21.324  -45.725  1.00 60.17  ? 243 SER A H    1 
ATOM   1842  H HA   . SER A  1 127 ? 113.370 -23.453  -47.144  1.00 64.29  ? 243 SER A HA   1 
ATOM   1843  H HB2  . SER A  1 127 ? 112.634 -25.025  -45.647  1.00 70.40  ? 243 SER A HB2  1 
ATOM   1844  H HB3  . SER A  1 127 ? 113.643 -24.083  -44.859  1.00 70.40  ? 243 SER A HB3  1 
ATOM   1845  H HG   . SER A  1 127 ? 111.787 -24.384  -43.726  1.00 62.78  ? 243 SER A HG   1 
ATOM   1846  N N    . THR A  1 128 ? 110.643 -24.162  -47.114  1.00 156.48 ? 244 THR A N    1 
ATOM   1847  C CA   . THR A  1 128 ? 109.300 -24.176  -47.690  1.00 157.54 ? 244 THR A CA   1 
ATOM   1848  C C    . THR A  1 128 ? 108.494 -25.402  -47.271  1.00 159.93 ? 244 THR A C    1 
ATOM   1849  O O    . THR A  1 128 ? 108.593 -26.467  -47.886  1.00 162.33 ? 244 THR A O    1 
ATOM   1850  C CB   . THR A  1 128 ? 109.350 -24.124  -49.234  1.00 158.54 ? 244 THR A CB   1 
ATOM   1851  O OG1  . THR A  1 128 ? 108.135 -24.658  -49.775  1.00 160.53 ? 244 THR A OG1  1 
ATOM   1852  C CG2  . THR A  1 128 ? 110.520 -24.926  -49.768  1.00 159.71 ? 244 THR A CG2  1 
ATOM   1853  H H    . THR A  1 128 ? 110.908 -24.925  -46.818  1.00 119.15 ? 244 THR A H    1 
ATOM   1854  H HA   . THR A  1 128 ? 108.823 -23.389  -47.383  1.00 112.44 ? 244 THR A HA   1 
ATOM   1855  H HB   . THR A  1 128 ? 109.453 -23.204  -49.522  1.00 114.35 ? 244 THR A HB   1 
ATOM   1856  H HG1  . THR A  1 128 ? 107.478 -24.208  -49.506  1.00 108.14 ? 244 THR A HG1  1 
ATOM   1857  H HG21 . THR A  1 128 ? 110.537 -24.883  -50.737  1.00 126.62 ? 244 THR A HG21 1 
ATOM   1858  H HG22 . THR A  1 128 ? 111.352 -24.568  -49.422  1.00 126.62 ? 244 THR A HG22 1 
ATOM   1859  H HG23 . THR A  1 128 ? 110.438 -25.853  -49.495  1.00 126.62 ? 244 THR A HG23 1 
ATOM   1860  N N    . VAL A  1 129 ? 107.695 -25.239  -46.219  1.00 152.89 ? 245 VAL A N    1 
ATOM   1861  C CA   . VAL A  1 129 ? 106.746 -26.266  -45.802  1.00 155.37 ? 245 VAL A CA   1 
ATOM   1862  C C    . VAL A  1 129 ? 105.456 -26.125  -46.597  1.00 156.85 ? 245 VAL A C    1 
ATOM   1863  O O    . VAL A  1 129 ? 105.269 -25.143  -47.317  1.00 155.56 ? 245 VAL A O    1 
ATOM   1864  C CB   . VAL A  1 129 ? 106.415 -26.182  -44.296  1.00 154.21 ? 245 VAL A CB   1 
ATOM   1865  C CG1  . VAL A  1 129 ? 107.645 -26.464  -43.463  1.00 153.24 ? 245 VAL A CG1  1 
ATOM   1866  C CG2  . VAL A  1 129 ? 105.827 -24.819  -43.940  1.00 151.39 ? 245 VAL A CG2  1 
ATOM   1867  H H    . VAL A  1 129 ? 107.685 -24.535  -45.725  1.00 86.94  ? 245 VAL A H    1 
ATOM   1868  H HA   . VAL A  1 129 ? 107.122 -27.142  -45.982  1.00 89.51  ? 245 VAL A HA   1 
ATOM   1869  H HB   . VAL A  1 129 ? 105.751 -26.856  -44.083  1.00 86.53  ? 245 VAL A HB   1 
ATOM   1870  H HG11 . VAL A  1 129 ? 107.410 -26.404  -42.524  1.00 93.81  ? 245 VAL A HG11 1 
ATOM   1871  H HG12 . VAL A  1 129 ? 107.967 -27.356  -43.668  1.00 93.81  ? 245 VAL A HG12 1 
ATOM   1872  H HG13 . VAL A  1 129 ? 108.327 -25.808  -43.676  1.00 93.81  ? 245 VAL A HG13 1 
ATOM   1873  H HG21 . VAL A  1 129 ? 105.631 -24.799  -42.990  1.00 74.92  ? 245 VAL A HG21 1 
ATOM   1874  H HG22 . VAL A  1 129 ? 106.473 -24.130  -44.159  1.00 74.92  ? 245 VAL A HG22 1 
ATOM   1875  H HG23 . VAL A  1 129 ? 105.013 -24.684  -44.449  1.00 74.92  ? 245 VAL A HG23 1 
ATOM   1876  N N    . GLN A  1 130 ? 104.570 -27.107  -46.457  1.00 145.58 ? 246 GLN A N    1 
ATOM   1877  C CA   . GLN A  1 130 ? 103.261 -27.054  -47.097  1.00 147.57 ? 246 GLN A CA   1 
ATOM   1878  C C    . GLN A  1 130 ? 102.199 -26.674  -46.073  1.00 147.15 ? 246 GLN A C    1 
ATOM   1879  O O    . GLN A  1 130 ? 101.106 -26.249  -46.439  1.00 147.96 ? 246 GLN A O    1 
ATOM   1880  C CB   . GLN A  1 130 ? 102.920 -28.393  -47.752  1.00 151.77 ? 246 GLN A CB   1 
ATOM   1881  C CG   . GLN A  1 130 ? 101.754 -28.340  -48.739  1.00 154.11 ? 246 GLN A CG   1 
ATOM   1882  C CD   . GLN A  1 130 ? 102.085 -27.588  -50.018  1.00 152.53 ? 246 GLN A CD   1 
ATOM   1883  O OE1  . GLN A  1 130 ? 103.147 -26.974  -50.140  1.00 149.75 ? 246 GLN A OE1  1 
ATOM   1884  N NE2  . GLN A  1 130 ? 101.175 -27.640  -50.982  1.00 154.46 ? 246 GLN A NE2  1 
ATOM   1885  H H    . GLN A  1 130 ? 104.705 -27.819  -45.994  1.00 120.85 ? 246 GLN A H    1 
ATOM   1886  H HA   . GLN A  1 130 ? 103.272 -26.373  -47.788  1.00 116.38 ? 246 GLN A HA   1 
ATOM   1887  H HB2  . GLN A  1 130 ? 103.699 -28.710  -48.234  1.00 126.76 ? 246 GLN A HB2  1 
ATOM   1888  H HB3  . GLN A  1 130 ? 102.686 -29.028  -47.056  1.00 126.76 ? 246 GLN A HB3  1 
ATOM   1889  H HG2  . GLN A  1 130 ? 101.506 -29.245  -48.982  1.00 131.84 ? 246 GLN A HG2  1 
ATOM   1890  H HG3  . GLN A  1 130 ? 101.004 -27.893  -48.317  1.00 131.84 ? 246 GLN A HG3  1 
ATOM   1891  H HE21 . GLN A  1 130 ? 101.314 -27.232  -51.727  1.00 125.71 ? 246 GLN A HE21 1 
ATOM   1892  H HE22 . GLN A  1 130 ? 100.448 -28.083  -50.864  1.00 125.71 ? 246 GLN A HE22 1 
ATOM   1893  N N    . CYS A  1 131 ? 102.526 -26.828  -44.792  1.00 143.54 ? 247 CYS A N    1 
ATOM   1894  C CA   . CYS A  1 131 ? 101.624 -26.419  -43.717  1.00 142.46 ? 247 CYS A CA   1 
ATOM   1895  C C    . CYS A  1 131 ? 102.402 -25.996  -42.472  1.00 138.90 ? 247 CYS A C    1 
ATOM   1896  O O    . CYS A  1 131 ? 103.532 -26.432  -42.249  1.00 138.43 ? 247 CYS A O    1 
ATOM   1897  C CB   . CYS A  1 131 ? 100.644 -27.545  -43.372  1.00 146.16 ? 247 CYS A CB   1 
ATOM   1898  S SG   . CYS A  1 131 ? 101.373 -28.973  -42.540  1.00 147.71 ? 247 CYS A SG   1 
ATOM   1899  H H    . CYS A  1 131 ? 103.267 -27.168  -44.517  1.00 156.33 ? 247 CYS A H    1 
ATOM   1900  H HA   . CYS A  1 131 ? 101.106 -25.656  -44.017  1.00 149.13 ? 247 CYS A HA   1 
ATOM   1901  H HB2  . CYS A  1 131 ? 99.956  -27.187  -42.789  1.00 153.26 ? 247 CYS A HB2  1 
ATOM   1902  H HB3  . CYS A  1 131 ? 100.238 -27.863  -44.195  1.00 153.26 ? 247 CYS A HB3  1 
ATOM   1903  N N    . THR A  1 132 ? 101.781 -25.140  -41.666  1.00 139.18 ? 248 THR A N    1 
ATOM   1904  C CA   . THR A  1 132 ? 102.436 -24.547  -40.502  1.00 134.93 ? 248 THR A CA   1 
ATOM   1905  C C    . THR A  1 132 ? 102.571 -25.526  -39.341  1.00 134.48 ? 248 THR A C    1 
ATOM   1906  O O    . THR A  1 132 ? 102.076 -26.650  -39.401  1.00 137.67 ? 248 THR A O    1 
ATOM   1907  C CB   . THR A  1 132 ? 101.663 -23.306  -39.997  1.00 131.69 ? 248 THR A CB   1 
ATOM   1908  O OG1  . THR A  1 132 ? 100.346 -23.688  -39.576  1.00 132.50 ? 248 THR A OG1  1 
ATOM   1909  C CG2  . THR A  1 132 ? 101.556 -22.253  -41.086  1.00 131.75 ? 248 THR A CG2  1 
ATOM   1910  H H    . THR A  1 132 ? 100.968 -24.882  -41.773  1.00 140.36 ? 248 THR A H    1 
ATOM   1911  H HA   . THR A  1 132 ? 103.328 -24.261  -40.756  1.00 139.40 ? 248 THR A HA   1 
ATOM   1912  H HB   . THR A  1 132 ? 102.138 -22.917  -39.246  1.00 130.92 ? 248 THR A HB   1 
ATOM   1913  H HG1  . THR A  1 132 ? 99.925  -23.015  -39.302  1.00 129.44 ? 248 THR A HG1  1 
ATOM   1914  H HG21 . THR A  1 132 ? 101.069 -21.482  -40.755  1.00 125.55 ? 248 THR A HG21 1 
ATOM   1915  H HG22 . THR A  1 132 ? 102.442 -21.971  -41.364  1.00 125.55 ? 248 THR A HG22 1 
ATOM   1916  H HG23 . THR A  1 132 ? 101.086 -22.616  -41.853  1.00 125.55 ? 248 THR A HG23 1 
ATOM   1917  N N    . HIS A  1 133 ? 103.250 -25.084  -38.286  1.00 152.21 ? 249 HIS A N    1 
ATOM   1918  C CA   . HIS A  1 133 ? 103.344 -25.854  -37.052  1.00 151.32 ? 249 HIS A CA   1 
ATOM   1919  C C    . HIS A  1 133 ? 102.011 -25.834  -36.328  1.00 150.51 ? 249 HIS A C    1 
ATOM   1920  O O    . HIS A  1 133 ? 101.125 -25.051  -36.671  1.00 149.75 ? 249 HIS A O    1 
ATOM   1921  C CB   . HIS A  1 133 ? 104.438 -25.301  -36.137  1.00 147.80 ? 249 HIS A CB   1 
ATOM   1922  C CG   . HIS A  1 133 ? 105.771 -25.955  -36.328  1.00 149.24 ? 249 HIS A CG   1 
ATOM   1923  N ND1  . HIS A  1 133 ? 106.021 -27.255  -35.941  1.00 151.48 ? 249 HIS A ND1  1 
ATOM   1924  C CD2  . HIS A  1 133 ? 106.928 -25.493  -36.861  1.00 148.97 ? 249 HIS A CD2  1 
ATOM   1925  C CE1  . HIS A  1 133 ? 107.272 -27.567  -36.232  1.00 152.36 ? 249 HIS A CE1  1 
ATOM   1926  N NE2  . HIS A  1 133 ? 107.844 -26.516  -36.791  1.00 150.88 ? 249 HIS A NE2  1 
ATOM   1927  H H    . HIS A  1 133 ? 103.670 -24.333  -38.261  1.00 229.36 ? 249 HIS A H    1 
ATOM   1928  H HA   . HIS A  1 133 ? 103.561 -26.775  -37.265  1.00 235.82 ? 249 HIS A HA   1 
ATOM   1929  H HB2  . HIS A  1 133 ? 104.545 -24.353  -36.314  1.00 236.09 ? 249 HIS A HB2  1 
ATOM   1930  H HB3  . HIS A  1 133 ? 104.171 -25.435  -35.214  1.00 236.09 ? 249 HIS A HB3  1 
ATOM   1931  H HD1  . HIS A  1 133 ? 105.450 -27.782  -35.572  1.00 254.18 ? 249 HIS A HD1  1 
ATOM   1932  H HD2  . HIS A  1 133 ? 107.073 -24.645  -37.213  1.00 250.16 ? 249 HIS A HD2  1 
ATOM   1933  H HE1  . HIS A  1 133 ? 107.680 -28.387  -36.069  1.00 263.20 ? 249 HIS A HE1  1 
ATOM   1934  H HE2  . HIS A  1 133 ? 108.658 -26.476  -37.064  1.00 260.83 ? 249 HIS A HE2  1 
ATOM   1935  N N    . GLY A  1 134 ? 101.872 -26.694  -35.326  1.00 153.65 ? 250 GLY A N    1 
ATOM   1936  C CA   . GLY A  1 134 ? 100.647 -26.762  -34.552  1.00 153.18 ? 250 GLY A CA   1 
ATOM   1937  C C    . GLY A  1 134 ? 100.377 -25.493  -33.768  1.00 148.42 ? 250 GLY A C    1 
ATOM   1938  O O    . GLY A  1 134 ? 101.207 -25.060  -32.967  1.00 145.65 ? 250 GLY A O    1 
ATOM   1939  H H    . GLY A  1 134 ? 102.478 -27.250  -35.076  1.00 200.39 ? 250 GLY A H    1 
ATOM   1940  H HA2  . GLY A  1 134 ? 99.898  -26.920  -35.147  1.00 197.00 ? 250 GLY A HA2  1 
ATOM   1941  H HA3  . GLY A  1 134 ? 100.702 -27.502  -33.927  1.00 197.00 ? 250 GLY A HA3  1 
ATOM   1942  N N    . ILE A  1 135 ? 99.209  -24.899  -33.995  1.00 141.31 ? 251 ILE A N    1 
ATOM   1943  C CA   . ILE A  1 135 ? 98.819  -23.676  -33.309  1.00 137.10 ? 251 ILE A CA   1 
ATOM   1944  C C    . ILE A  1 135 ? 97.605  -23.954  -32.431  1.00 136.86 ? 251 ILE A C    1 
ATOM   1945  O O    . ILE A  1 135 ? 96.569  -24.405  -32.917  1.00 139.44 ? 251 ILE A O    1 
ATOM   1946  C CB   . ILE A  1 135 ? 98.498  -22.536  -34.310  1.00 136.42 ? 251 ILE A CB   1 
ATOM   1947  C CG1  . ILE A  1 135 ? 99.731  -22.206  -35.155  1.00 137.00 ? 251 ILE A CG1  1 
ATOM   1948  C CG2  . ILE A  1 135 ? 98.037  -21.279  -33.578  1.00 132.55 ? 251 ILE A CG2  1 
ATOM   1949  C CD1  . ILE A  1 135 ? 99.451  -21.307  -36.343  1.00 137.97 ? 251 ILE A CD1  1 
ATOM   1950  H H    . ILE A  1 135 ? 98.620  -25.191  -34.550  1.00 134.06 ? 251 ILE A H    1 
ATOM   1951  H HA   . ILE A  1 135 ? 99.546  -23.383  -32.738  1.00 128.60 ? 251 ILE A HA   1 
ATOM   1952  H HB   . ILE A  1 135 ? 97.787  -22.831  -34.900  1.00 121.67 ? 251 ILE A HB   1 
ATOM   1953  H HG12 . ILE A  1 135 ? 100.382 -21.758  -34.593  1.00 123.20 ? 251 ILE A HG12 1 
ATOM   1954  H HG13 . ILE A  1 135 ? 100.106 -23.034  -35.494  1.00 123.20 ? 251 ILE A HG13 1 
ATOM   1955  H HG21 . ILE A  1 135 ? 97.845  -20.587  -34.230  1.00 117.78 ? 251 ILE A HG21 1 
ATOM   1956  H HG22 . ILE A  1 135 ? 97.238  -21.486  -33.069  1.00 117.78 ? 251 ILE A HG22 1 
ATOM   1957  H HG23 . ILE A  1 135 ? 98.743  -20.985  -32.981  1.00 117.78 ? 251 ILE A HG23 1 
ATOM   1958  H HD11 . ILE A  1 135 ? 100.281 -21.149  -36.821  1.00 118.22 ? 251 ILE A HD11 1 
ATOM   1959  H HD12 . ILE A  1 135 ? 98.811  -21.745  -36.926  1.00 118.22 ? 251 ILE A HD12 1 
ATOM   1960  H HD13 . ILE A  1 135 ? 99.088  -20.467  -36.024  1.00 118.22 ? 251 ILE A HD13 1 
ATOM   1961  N N    . ARG A  1 136 ? 97.751  -23.709  -31.132  1.00 136.65 ? 252 ARG A N    1 
ATOM   1962  C CA   . ARG A  1 136 ? 96.634  -23.795  -30.192  1.00 136.25 ? 252 ARG A CA   1 
ATOM   1963  C C    . ARG A  1 136 ? 95.836  -22.489  -30.205  1.00 133.38 ? 252 ARG A C    1 
ATOM   1964  O O    . ARG A  1 136 ? 96.366  -21.452  -29.817  1.00 130.71 ? 252 ARG A O    1 
ATOM   1965  C CB   . ARG A  1 136 ? 97.140  -24.078  -28.775  1.00 135.62 ? 252 ARG A CB   1 
ATOM   1966  C CG   . ARG A  1 136 ? 97.929  -25.369  -28.630  1.00 138.66 ? 252 ARG A CG   1 
ATOM   1967  C CD   . ARG A  1 136 ? 97.055  -26.533  -28.192  1.00 142.17 ? 252 ARG A CD   1 
ATOM   1968  N NE   . ARG A  1 136 ? 97.863  -27.662  -27.738  1.00 144.77 ? 252 ARG A NE   1 
ATOM   1969  C CZ   . ARG A  1 136 ? 97.370  -28.837  -27.360  1.00 148.58 ? 252 ARG A CZ   1 
ATOM   1970  N NH1  . ARG A  1 136 ? 96.062  -29.057  -27.385  1.00 150.49 ? 252 ARG A NH1  1 
ATOM   1971  N NH2  . ARG A  1 136 ? 98.192  -29.798  -26.958  1.00 150.66 ? 252 ARG A NH2  1 
ATOM   1972  H H    . ARG A  1 136 ? 98.497  -23.488  -30.765  1.00 151.18 ? 252 ARG A H    1 
ATOM   1973  H HA   . ARG A  1 136 ? 96.044  -24.518  -30.457  1.00 150.66 ? 252 ARG A HA   1 
ATOM   1974  H HB2  . ARG A  1 136 ? 97.717  -23.348  -28.501  1.00 156.34 ? 252 ARG A HB2  1 
ATOM   1975  H HB3  . ARG A  1 136 ? 96.377  -24.131  -28.179  1.00 156.34 ? 252 ARG A HB3  1 
ATOM   1976  H HG2  . ARG A  1 136 ? 98.327  -25.596  -29.485  1.00 164.43 ? 252 ARG A HG2  1 
ATOM   1977  H HG3  . ARG A  1 136 ? 98.622  -25.245  -27.963  1.00 164.43 ? 252 ARG A HG3  1 
ATOM   1978  H HD2  . ARG A  1 136 ? 96.488  -26.250  -27.458  1.00 170.86 ? 252 ARG A HD2  1 
ATOM   1979  H HD3  . ARG A  1 136 ? 96.514  -26.828  -28.941  1.00 170.86 ? 252 ARG A HD3  1 
ATOM   1980  H HE   . ARG A  1 136 ? 98.716  -27.559  -27.713  1.00 177.87 ? 252 ARG A HE   1 
ATOM   1981  H HH11 . ARG A  1 136 ? 95.526  -28.436  -27.644  1.00 191.10 ? 252 ARG A HH11 1 
ATOM   1982  H HH12 . ARG A  1 136 ? 95.749  -29.820  -27.140  1.00 191.10 ? 252 ARG A HH12 1 
ATOM   1983  H HH21 . ARG A  1 136 ? 99.041  -29.659  -26.943  1.00 194.81 ? 252 ARG A HH21 1 
ATOM   1984  H HH22 . ARG A  1 136 ? 97.877  -30.561  -26.716  1.00 194.81 ? 252 ARG A HH22 1 
ATOM   1985  N N    . PRO A  1 137 ? 94.567  -22.525  -30.652  1.00 125.10 ? 253 PRO A N    1 
ATOM   1986  C CA   . PRO A  1 137 ? 93.795  -21.274  -30.686  1.00 122.47 ? 253 PRO A CA   1 
ATOM   1987  C C    . PRO A  1 137 ? 93.408  -20.762  -29.293  1.00 120.31 ? 253 PRO A C    1 
ATOM   1988  O O    . PRO A  1 137 ? 92.224  -20.627  -28.971  1.00 120.22 ? 253 PRO A O    1 
ATOM   1989  C CB   . PRO A  1 137 ? 92.549  -21.649  -31.511  1.00 124.80 ? 253 PRO A CB   1 
ATOM   1990  C CG   . PRO A  1 137 ? 92.896  -22.937  -32.194  1.00 129.11 ? 253 PRO A CG   1 
ATOM   1991  C CD   . PRO A  1 137 ? 93.821  -23.637  -31.261  1.00 129.25 ? 253 PRO A CD   1 
ATOM   1992  H HA   . PRO A  1 137 ? 94.292  -20.585  -31.153  1.00 93.28  ? 253 PRO A HA   1 
ATOM   1993  H HB2  . PRO A  1 137 ? 91.790  -21.769  -30.919  1.00 92.43  ? 253 PRO A HB2  1 
ATOM   1994  H HB3  . PRO A  1 137 ? 92.369  -20.954  -32.163  1.00 92.43  ? 253 PRO A HB3  1 
ATOM   1995  H HG2  . PRO A  1 137 ? 92.090  -23.459  -32.334  1.00 95.44  ? 253 PRO A HG2  1 
ATOM   1996  H HG3  . PRO A  1 137 ? 93.336  -22.751  -33.038  1.00 95.44  ? 253 PRO A HG3  1 
ATOM   1997  H HD2  . PRO A  1 137 ? 93.321  -24.121  -30.586  1.00 100.60 ? 253 PRO A HD2  1 
ATOM   1998  H HD3  . PRO A  1 137 ? 94.420  -24.221  -31.751  1.00 100.60 ? 253 PRO A HD3  1 
ATOM   1999  N N    . VAL A  1 138 ? 94.419  -20.448  -28.488  1.00 129.96 ? 254 VAL A N    1 
ATOM   2000  C CA   . VAL A  1 138 ? 94.209  -20.027  -27.109  1.00 129.20 ? 254 VAL A CA   1 
ATOM   2001  C C    . VAL A  1 138 ? 93.848  -18.546  -27.038  1.00 127.20 ? 254 VAL A C    1 
ATOM   2002  O O    . VAL A  1 138 ? 94.603  -17.688  -27.503  1.00 126.16 ? 254 VAL A O    1 
ATOM   2003  C CB   . VAL A  1 138 ? 95.464  -20.288  -26.245  1.00 129.74 ? 254 VAL A CB   1 
ATOM   2004  C CG1  . VAL A  1 138 ? 95.208  -19.907  -24.792  1.00 130.46 ? 254 VAL A CG1  1 
ATOM   2005  C CG2  . VAL A  1 138 ? 95.880  -21.747  -26.338  1.00 132.08 ? 254 VAL A CG2  1 
ATOM   2006  H H    . VAL A  1 138 ? 95.247  -20.472  -28.721  1.00 169.59 ? 254 VAL A H    1 
ATOM   2007  H HA   . VAL A  1 138 ? 93.473  -20.535  -26.731  1.00 171.37 ? 254 VAL A HA   1 
ATOM   2008  H HB   . VAL A  1 138 ? 96.195  -19.744  -26.576  1.00 175.35 ? 254 VAL A HB   1 
ATOM   2009  H HG11 . VAL A  1 138 ? 96.009  -20.081  -24.274  1.00 177.56 ? 254 VAL A HG11 1 
ATOM   2010  H HG12 . VAL A  1 138 ? 94.983  -18.965  -24.748  1.00 177.56 ? 254 VAL A HG12 1 
ATOM   2011  H HG13 . VAL A  1 138 ? 94.472  -20.439  -24.451  1.00 177.56 ? 254 VAL A HG13 1 
ATOM   2012  H HG21 . VAL A  1 138 ? 96.668  -21.885  -25.789  1.00 180.18 ? 254 VAL A HG21 1 
ATOM   2013  H HG22 . VAL A  1 138 ? 95.152  -22.303  -26.019  1.00 180.18 ? 254 VAL A HG22 1 
ATOM   2014  H HG23 . VAL A  1 138 ? 96.079  -21.960  -27.263  1.00 180.18 ? 254 VAL A HG23 1 
ATOM   2015  N N    . VAL A  1 139 ? 92.687  -18.260  -26.455  1.00 123.78 ? 255 VAL A N    1 
ATOM   2016  C CA   . VAL A  1 139 ? 92.238  -16.890  -26.228  1.00 122.74 ? 255 VAL A CA   1 
ATOM   2017  C C    . VAL A  1 139 ? 92.557  -16.487  -24.792  1.00 124.02 ? 255 VAL A C    1 
ATOM   2018  O O    . VAL A  1 139 ? 92.064  -17.099  -23.844  1.00 125.72 ? 255 VAL A O    1 
ATOM   2019  C CB   . VAL A  1 139 ? 90.721  -16.735  -26.489  1.00 122.72 ? 255 VAL A CB   1 
ATOM   2020  C CG1  . VAL A  1 139 ? 90.272  -15.311  -26.238  1.00 122.27 ? 255 VAL A CG1  1 
ATOM   2021  C CG2  . VAL A  1 139 ? 90.382  -17.136  -27.913  1.00 122.64 ? 255 VAL A CG2  1 
ATOM   2022  H H    . VAL A  1 139 ? 92.132  -18.855  -26.176  1.00 66.36  ? 255 VAL A H    1 
ATOM   2023  H HA   . VAL A  1 139 ? 92.713  -16.292  -26.826  1.00 66.91  ? 255 VAL A HA   1 
ATOM   2024  H HB   . VAL A  1 139 ? 90.233  -17.317  -25.885  1.00 66.45  ? 255 VAL A HB   1 
ATOM   2025  H HG11 . VAL A  1 139 ? 89.320  -15.246  -26.409  1.00 69.11  ? 255 VAL A HG11 1 
ATOM   2026  H HG12 . VAL A  1 139 ? 90.459  -15.079  -25.315  1.00 69.11  ? 255 VAL A HG12 1 
ATOM   2027  H HG13 . VAL A  1 139 ? 90.757  -14.718  -26.833  1.00 69.11  ? 255 VAL A HG13 1 
ATOM   2028  H HG21 . VAL A  1 139 ? 89.428  -17.031  -28.052  1.00 63.00  ? 255 VAL A HG21 1 
ATOM   2029  H HG22 . VAL A  1 139 ? 90.870  -16.565  -28.526  1.00 63.00  ? 255 VAL A HG22 1 
ATOM   2030  H HG23 . VAL A  1 139 ? 90.636  -18.063  -28.049  1.00 63.00  ? 255 VAL A HG23 1 
ATOM   2031  N N    . SER A  1 140 ? 93.390  -15.464  -24.635  1.00 126.54 ? 256 SER A N    1 
ATOM   2032  C CA   . SER A  1 140 ? 93.797  -15.009  -23.310  1.00 128.71 ? 256 SER A CA   1 
ATOM   2033  C C    . SER A  1 140 ? 94.382  -13.594  -23.349  1.00 129.18 ? 256 SER A C    1 
ATOM   2034  O O    . SER A  1 140 ? 94.640  -13.044  -24.424  1.00 127.74 ? 256 SER A O    1 
ATOM   2035  C CB   . SER A  1 140 ? 94.816  -15.984  -22.706  1.00 129.90 ? 256 SER A CB   1 
ATOM   2036  O OG   . SER A  1 140 ? 96.038  -15.973  -23.427  1.00 128.74 ? 256 SER A OG   1 
ATOM   2037  H H    . SER A  1 140 ? 93.735  -15.014  -25.282  1.00 134.74 ? 256 SER A H    1 
ATOM   2038  H HA   . SER A  1 140 ? 93.019  -14.993  -22.730  1.00 139.84 ? 256 SER A HA   1 
ATOM   2039  H HB2  . SER A  1 140 ? 94.991  -15.725  -21.788  1.00 141.37 ? 256 SER A HB2  1 
ATOM   2040  H HB3  . SER A  1 140 ? 94.445  -16.880  -22.731  1.00 141.37 ? 256 SER A HB3  1 
ATOM   2041  H HG   . SER A  1 140 ? 96.581  -16.513  -23.080  1.00 140.58 ? 256 SER A HG   1 
ATOM   2042  N N    . THR A  1 141 ? 94.568  -13.011  -22.167  1.00 129.07 ? 257 THR A N    1 
ATOM   2043  C CA   . THR A  1 141 ? 95.214  -11.710  -22.020  1.00 130.70 ? 257 THR A CA   1 
ATOM   2044  C C    . THR A  1 141 ? 96.415  -11.830  -21.092  1.00 132.88 ? 257 THR A C    1 
ATOM   2045  O O    . THR A  1 141 ? 96.532  -12.800  -20.346  1.00 133.81 ? 257 THR A O    1 
ATOM   2046  C CB   . THR A  1 141 ? 94.249  -10.661  -21.458  1.00 133.35 ? 257 THR A CB   1 
ATOM   2047  O OG1  . THR A  1 141 ? 93.813  -11.058  -20.152  1.00 136.49 ? 257 THR A OG1  1 
ATOM   2048  C CG2  . THR A  1 141 ? 93.042  -10.503  -22.369  1.00 131.22 ? 257 THR A CG2  1 
ATOM   2049  H H    . THR A  1 141 ? 94.324  -13.358  -21.419  1.00 137.50 ? 257 THR A H    1 
ATOM   2050  H HA   . THR A  1 141 ? 95.525  -11.405  -22.887  1.00 141.35 ? 257 THR A HA   1 
ATOM   2051  H HB   . THR A  1 141 ? 94.702  -9.805   -21.400  1.00 146.47 ? 257 THR A HB   1 
ATOM   2052  H HG1  . THR A  1 141 ? 94.473  -11.128  -19.638  1.00 149.44 ? 257 THR A HG1  1 
ATOM   2053  H HG21 . THR A  1 141 ? 92.437  -9.837   -22.005  1.00 145.44 ? 257 THR A HG21 1 
ATOM   2054  H HG22 . THR A  1 141 ? 93.328  -10.221  -23.251  1.00 145.44 ? 257 THR A HG22 1 
ATOM   2055  H HG23 . THR A  1 141 ? 92.572  -11.348  -22.444  1.00 145.44 ? 257 THR A HG23 1 
ATOM   2056  N N    . GLN A  1 142 ? 97.304  -10.843  -21.147  1.00 129.59 ? 258 GLN A N    1 
ATOM   2057  C CA   . GLN A  1 142 ? 98.520  -10.832  -20.335  1.00 131.69 ? 258 GLN A CA   1 
ATOM   2058  C C    . GLN A  1 142 ? 99.458  -11.998  -20.654  1.00 129.60 ? 258 GLN A C    1 
ATOM   2059  O O    . GLN A  1 142 ? 100.566 -11.787  -21.152  1.00 128.93 ? 258 GLN A O    1 
ATOM   2060  C CB   . GLN A  1 142 ? 98.180  -10.854  -18.843  1.00 135.59 ? 258 GLN A CB   1 
ATOM   2061  C CG   . GLN A  1 142 ? 97.241  -9.764   -18.408  1.00 138.65 ? 258 GLN A CG   1 
ATOM   2062  C CD   . GLN A  1 142 ? 97.217  -9.603   -16.906  1.00 143.51 ? 258 GLN A CD   1 
ATOM   2063  O OE1  . GLN A  1 142 ? 97.788  -10.407  -16.171  1.00 144.48 ? 258 GLN A OE1  1 
ATOM   2064  N NE2  . GLN A  1 142 ? 96.556  -8.554   -16.440  1.00 146.97 ? 258 GLN A NE2  1 
ATOM   2065  H H    . GLN A  1 142 ? 97.224  -10.154  -21.656  1.00 95.47  ? 258 GLN A H    1 
ATOM   2066  H HA   . GLN A  1 142 ? 99.002  -10.010  -20.513  1.00 99.31  ? 258 GLN A HA   1 
ATOM   2067  H HB2  . GLN A  1 142 ? 97.763  -11.704  -18.631  1.00 104.25 ? 258 GLN A HB2  1 
ATOM   2068  H HB3  . GLN A  1 142 ? 99.000  -10.757  -18.335  1.00 104.25 ? 258 GLN A HB3  1 
ATOM   2069  H HG2  . GLN A  1 142 ? 97.528  -8.924   -18.798  1.00 107.75 ? 258 GLN A HG2  1 
ATOM   2070  H HG3  . GLN A  1 142 ? 96.343  -9.981   -18.703  1.00 107.75 ? 258 GLN A HG3  1 
ATOM   2071  H HE21 . GLN A  1 142 ? 96.511  -8.416   -15.593  1.00 117.80 ? 258 GLN A HE21 1 
ATOM   2072  H HE22 . GLN A  1 142 ? 96.172  -8.011   -16.986  1.00 117.80 ? 258 GLN A HE22 1 
ATOM   2073  N N    . LEU A  1 143 ? 99.020  -13.220  -20.360  1.00 131.64 ? 259 LEU A N    1 
ATOM   2074  C CA   . LEU A  1 143 ? 99.860  -14.406  -20.521  1.00 130.66 ? 259 LEU A CA   1 
ATOM   2075  C C    . LEU A  1 143 ? 99.448  -15.246  -21.726  1.00 127.76 ? 259 LEU A C    1 
ATOM   2076  O O    . LEU A  1 143 ? 98.259  -15.479  -21.959  1.00 126.99 ? 259 LEU A O    1 
ATOM   2077  C CB   . LEU A  1 143 ? 99.808  -15.267  -19.256  1.00 133.23 ? 259 LEU A CB   1 
ATOM   2078  C CG   . LEU A  1 143 ? 100.150 -14.551  -17.949  1.00 136.89 ? 259 LEU A CG   1 
ATOM   2079  C CD1  . LEU A  1 143 ? 100.039 -15.517  -16.782  1.00 139.60 ? 259 LEU A CD1  1 
ATOM   2080  C CD2  . LEU A  1 143 ? 101.539 -13.927  -18.006  1.00 137.16 ? 259 LEU A CD2  1 
ATOM   2081  H H    . LEU A  1 143 ? 98.231  -13.390  -20.062  1.00 104.68 ? 259 LEU A H    1 
ATOM   2082  H HA   . LEU A  1 143 ? 100.779 -14.125  -20.653  1.00 104.82 ? 259 LEU A HA   1 
ATOM   2083  H HB2  . LEU A  1 143 ? 98.910  -15.622  -19.166  1.00 109.00 ? 259 LEU A HB2  1 
ATOM   2084  H HB3  . LEU A  1 143 ? 100.436 -15.999  -19.359  1.00 109.00 ? 259 LEU A HB3  1 
ATOM   2085  H HG   . LEU A  1 143 ? 99.509  -13.837  -17.805  1.00 114.57 ? 259 LEU A HG   1 
ATOM   2086  H HD11 . LEU A  1 143 ? 100.259 -15.048  -15.962  1.00 118.77 ? 259 LEU A HD11 1 
ATOM   2087  H HD12 . LEU A  1 143 ? 99.131  -15.855  -16.738  1.00 118.77 ? 259 LEU A HD12 1 
ATOM   2088  H HD13 . LEU A  1 143 ? 100.659 -16.251  -16.921  1.00 118.77 ? 259 LEU A HD13 1 
ATOM   2089  H HD21 . LEU A  1 143 ? 101.720 -13.483  -17.163  1.00 117.51 ? 259 LEU A HD21 1 
ATOM   2090  H HD22 . LEU A  1 143 ? 102.193 -14.627  -18.159  1.00 117.51 ? 259 LEU A HD22 1 
ATOM   2091  H HD23 . LEU A  1 143 ? 101.566 -13.284  -18.731  1.00 117.51 ? 259 LEU A HD23 1 
ATOM   2092  N N    . LEU A  1 144 ? 100.446 -15.693  -22.485  1.00 132.41 ? 260 LEU A N    1 
ATOM   2093  C CA   . LEU A  1 144 ? 100.227 -16.593  -23.614  1.00 130.61 ? 260 LEU A CA   1 
ATOM   2094  C C    . LEU A  1 144 ? 100.443 -18.030  -23.160  1.00 131.79 ? 260 LEU A C    1 
ATOM   2095  O O    . LEU A  1 144 ? 101.471 -18.354  -22.565  1.00 133.19 ? 260 LEU A O    1 
ATOM   2096  C CB   . LEU A  1 144 ? 101.158 -16.241  -24.776  1.00 129.55 ? 260 LEU A CB   1 
ATOM   2097  C CG   . LEU A  1 144 ? 100.951 -14.840  -25.362  1.00 128.90 ? 260 LEU A CG   1 
ATOM   2098  C CD1  . LEU A  1 144 ? 102.067 -14.502  -26.327  1.00 128.74 ? 260 LEU A CD1  1 
ATOM   2099  C CD2  . LEU A  1 144 ? 99.592  -14.713  -26.055  1.00 127.64 ? 260 LEU A CD2  1 
ATOM   2100  H H    . LEU A  1 144 ? 101.272 -15.486  -22.364  1.00 86.62  ? 260 LEU A H    1 
ATOM   2101  H HA   . LEU A  1 144 ? 99.311  -16.505  -23.921  1.00 81.50  ? 260 LEU A HA   1 
ATOM   2102  H HB2  . LEU A  1 144 ? 102.075 -16.297  -24.466  1.00 80.33  ? 260 LEU A HB2  1 
ATOM   2103  H HB3  . LEU A  1 144 ? 101.016 -16.881  -25.491  1.00 80.33  ? 260 LEU A HB3  1 
ATOM   2104  H HG   . LEU A  1 144 ? 100.977 -14.192  -24.640  1.00 79.07  ? 260 LEU A HG   1 
ATOM   2105  H HD11 . LEU A  1 144 ? 101.917 -13.614  -26.685  1.00 79.66  ? 260 LEU A HD11 1 
ATOM   2106  H HD12 . LEU A  1 144 ? 102.913 -14.530  -25.853  1.00 79.66  ? 260 LEU A HD12 1 
ATOM   2107  H HD13 . LEU A  1 144 ? 102.069 -15.153  -27.047  1.00 79.66  ? 260 LEU A HD13 1 
ATOM   2108  H HD21 . LEU A  1 144 ? 99.502  -13.815  -26.410  1.00 74.00  ? 260 LEU A HD21 1 
ATOM   2109  H HD22 . LEU A  1 144 ? 99.544  -15.361  -26.775  1.00 74.00  ? 260 LEU A HD22 1 
ATOM   2110  H HD23 . LEU A  1 144 ? 98.891  -14.885  -25.407  1.00 74.00  ? 260 LEU A HD23 1 
ATOM   2111  N N    . LEU A  1 145 ? 99.463  -18.881  -23.441  1.00 125.15 ? 261 LEU A N    1 
ATOM   2112  C CA   . LEU A  1 145 ? 99.454  -20.247  -22.937  1.00 127.03 ? 261 LEU A CA   1 
ATOM   2113  C C    . LEU A  1 145 ? 99.472  -21.257  -24.075  1.00 126.80 ? 261 LEU A C    1 
ATOM   2114  O O    . LEU A  1 145 ? 98.898  -21.018  -25.140  1.00 125.37 ? 261 LEU A O    1 
ATOM   2115  C CB   . LEU A  1 145 ? 98.224  -20.471  -22.057  1.00 128.46 ? 261 LEU A CB   1 
ATOM   2116  C CG   . LEU A  1 145 ? 97.999  -19.418  -20.968  1.00 129.47 ? 261 LEU A CG   1 
ATOM   2117  C CD1  . LEU A  1 145 ? 96.682  -19.655  -20.241  1.00 131.26 ? 261 LEU A CD1  1 
ATOM   2118  C CD2  . LEU A  1 145 ? 99.158  -19.397  -19.981  1.00 131.49 ? 261 LEU A CD2  1 
ATOM   2119  H H    . LEU A  1 145 ? 98.781  -18.687  -23.929  1.00 91.82  ? 261 LEU A H    1 
ATOM   2120  H HA   . LEU A  1 145 ? 100.244 -20.391  -22.394  1.00 96.08  ? 261 LEU A HA   1 
ATOM   2121  H HB2  . LEU A  1 145 ? 97.437  -20.478  -22.624  1.00 96.39  ? 261 LEU A HB2  1 
ATOM   2122  H HB3  . LEU A  1 145 ? 98.314  -21.331  -21.616  1.00 96.39  ? 261 LEU A HB3  1 
ATOM   2123  H HG   . LEU A  1 145 ? 97.952  -18.543  -21.386  1.00 97.95  ? 261 LEU A HG   1 
ATOM   2124  H HD11 . LEU A  1 145 ? 96.570  -18.973  -19.561  1.00 98.46  ? 261 LEU A HD11 1 
ATOM   2125  H HD12 . LEU A  1 145 ? 95.955  -19.607  -20.882  1.00 98.46  ? 261 LEU A HD12 1 
ATOM   2126  H HD13 . LEU A  1 145 ? 96.703  -20.534  -19.830  1.00 98.46  ? 261 LEU A HD13 1 
ATOM   2127  H HD21 . LEU A  1 145 ? 98.986  -18.722  -19.307  1.00 104.58 ? 261 LEU A HD21 1 
ATOM   2128  H HD22 . LEU A  1 145 ? 99.233  -20.270  -19.565  1.00 104.58 ? 261 LEU A HD22 1 
ATOM   2129  H HD23 . LEU A  1 145 ? 99.975  -19.187  -20.459  1.00 104.58 ? 261 LEU A HD23 1 
ATOM   2130  N N    . ASN A  1 146 ? 100.149 -22.377  -23.841  1.00 128.64 ? 262 ASN A N    1 
ATOM   2131  C CA   . ASN A  1 146 ? 100.197 -23.486  -24.791  1.00 129.63 ? 262 ASN A CA   1 
ATOM   2132  C C    . ASN A  1 146 ? 100.782 -23.100  -26.154  1.00 128.29 ? 262 ASN A C    1 
ATOM   2133  O O    . ASN A  1 146 ? 100.453 -23.700  -27.179  1.00 129.04 ? 262 ASN A O    1 
ATOM   2134  C CB   . ASN A  1 146 ? 98.792  -24.076  -24.960  1.00 130.52 ? 262 ASN A CB   1 
ATOM   2135  C CG   . ASN A  1 146 ? 98.360  -24.902  -23.763  1.00 133.18 ? 262 ASN A CG   1 
ATOM   2136  O OD1  . ASN A  1 146 ? 99.099  -25.041  -22.788  1.00 134.35 ? 262 ASN A OD1  1 
ATOM   2137  N ND2  . ASN A  1 146 ? 97.152  -25.450  -23.831  1.00 134.55 ? 262 ASN A ND2  1 
ATOM   2138  H H    . ASN A  1 146 ? 100.599 -22.522  -23.123  1.00 112.52 ? 262 ASN A H    1 
ATOM   2139  H HA   . ASN A  1 146 ? 100.762 -24.181  -24.420  1.00 114.89 ? 262 ASN A HA   1 
ATOM   2140  H HB2  . ASN A  1 146 ? 98.155  -23.352  -25.071  1.00 114.05 ? 262 ASN A HB2  1 
ATOM   2141  H HB3  . ASN A  1 146 ? 98.781  -24.651  -25.741  1.00 114.05 ? 262 ASN A HB3  1 
ATOM   2142  N N    . GLY A  1 147 ? 101.676 -22.115  -26.153  1.00 136.92 ? 263 GLY A N    1 
ATOM   2143  C CA   . GLY A  1 147 ? 102.320 -21.659  -27.373  1.00 136.12 ? 263 GLY A CA   1 
ATOM   2144  C C    . GLY A  1 147 ? 103.603 -22.422  -27.635  1.00 137.75 ? 263 GLY A C    1 
ATOM   2145  O O    . GLY A  1 147 ? 103.874 -23.433  -26.986  1.00 139.56 ? 263 GLY A O    1 
ATOM   2146  H H    . GLY A  1 147 ? 101.927 -21.692  -25.448  1.00 218.32 ? 263 GLY A H    1 
ATOM   2147  H HA2  . GLY A  1 147 ? 101.723 -21.787  -28.126  1.00 215.26 ? 263 GLY A HA2  1 
ATOM   2148  H HA3  . GLY A  1 147 ? 102.530 -20.715  -27.298  1.00 215.26 ? 263 GLY A HA3  1 
ATOM   2149  N N    . SER A  1 148 ? 104.389 -21.936  -28.591  1.00 143.43 ? 264 SER A N    1 
ATOM   2150  C CA   . SER A  1 148 ? 105.680 -22.536  -28.923  1.00 145.06 ? 264 SER A CA   1 
ATOM   2151  C C    . SER A  1 148 ? 106.812 -21.805  -28.207  1.00 144.76 ? 264 SER A C    1 
ATOM   2152  O O    . SER A  1 148 ? 106.703 -20.614  -27.915  1.00 143.40 ? 264 SER A O    1 
ATOM   2153  C CB   . SER A  1 148 ? 105.910 -22.512  -30.435  1.00 145.61 ? 264 SER A CB   1 
ATOM   2154  O OG   . SER A  1 148 ? 104.873 -23.194  -31.120  1.00 146.56 ? 264 SER A OG   1 
ATOM   2155  H H    . SER A  1 148 ? 104.195 -21.249  -29.070  1.00 147.16 ? 264 SER A H    1 
ATOM   2156  H HA   . SER A  1 148 ? 105.685 -23.461  -28.631  1.00 154.34 ? 264 SER A HA   1 
ATOM   2157  H HB2  . SER A  1 148 ? 105.932 -21.589  -30.735  1.00 152.08 ? 264 SER A HB2  1 
ATOM   2158  H HB3  . SER A  1 148 ? 106.755 -22.944  -30.632  1.00 152.08 ? 264 SER A HB3  1 
ATOM   2159  H HG   . SER A  1 148 ? 105.012 -23.172  -31.948  1.00 150.45 ? 264 SER A HG   1 
ATOM   2160  N N    . LEU A  1 149 ? 107.899 -22.520  -27.935  1.00 148.25 ? 265 LEU A N    1 
ATOM   2161  C CA   . LEU A  1 149 ? 109.013 -21.964  -27.174  1.00 150.02 ? 265 LEU A CA   1 
ATOM   2162  C C    . LEU A  1 149 ? 110.079 -21.361  -28.071  1.00 150.85 ? 265 LEU A C    1 
ATOM   2163  O O    . LEU A  1 149 ? 110.253 -21.779  -29.216  1.00 151.06 ? 265 LEU A O    1 
ATOM   2164  C CB   . LEU A  1 149 ? 109.647 -23.041  -26.299  1.00 153.07 ? 265 LEU A CB   1 
ATOM   2165  C CG   . LEU A  1 149 ? 108.760 -23.599  -25.189  1.00 153.13 ? 265 LEU A CG   1 
ATOM   2166  C CD1  . LEU A  1 149 ? 109.387 -24.843  -24.595  1.00 156.54 ? 265 LEU A CD1  1 
ATOM   2167  C CD2  . LEU A  1 149 ? 108.538 -22.558  -24.115  1.00 152.71 ? 265 LEU A CD2  1 
ATOM   2168  H H    . LEU A  1 149 ? 108.017 -23.335  -28.182  1.00 92.30  ? 265 LEU A H    1 
ATOM   2169  H HA   . LEU A  1 149 ? 108.679 -21.263  -26.592  1.00 96.95  ? 265 LEU A HA   1 
ATOM   2170  H HB2  . LEU A  1 149 ? 109.904 -23.784  -26.866  1.00 107.70 ? 265 LEU A HB2  1 
ATOM   2171  H HB3  . LEU A  1 149 ? 110.437 -22.667  -25.878  1.00 107.70 ? 265 LEU A HB3  1 
ATOM   2172  H HG   . LEU A  1 149 ? 107.898 -23.841  -25.561  1.00 108.43 ? 265 LEU A HG   1 
ATOM   2173  H HD11 . LEU A  1 149 ? 108.810 -25.182  -23.893  1.00 120.91 ? 265 LEU A HD11 1 
ATOM   2174  H HD12 . LEU A  1 149 ? 109.487 -25.510  -25.293  1.00 120.91 ? 265 LEU A HD12 1 
ATOM   2175  H HD13 . LEU A  1 149 ? 110.255 -24.615  -24.228  1.00 120.91 ? 265 LEU A HD13 1 
ATOM   2176  H HD21 . LEU A  1 149 ? 107.973 -22.935  -23.423  1.00 103.95 ? 265 LEU A HD21 1 
ATOM   2177  H HD22 . LEU A  1 149 ? 109.396 -22.303  -23.741  1.00 103.95 ? 265 LEU A HD22 1 
ATOM   2178  H HD23 . LEU A  1 149 ? 108.106 -21.785  -24.510  1.00 103.95 ? 265 LEU A HD23 1 
ATOM   2179  N N    . ALA A  1 150 ? 110.793 -20.376  -27.536  1.00 167.30 ? 266 ALA A N    1 
ATOM   2180  C CA   . ALA A  1 150 ? 111.941 -19.800  -28.222  1.00 168.75 ? 266 ALA A CA   1 
ATOM   2181  C C    . ALA A  1 150 ? 113.019 -20.864  -28.386  1.00 171.92 ? 266 ALA A C    1 
ATOM   2182  O O    . ALA A  1 150 ? 113.231 -21.682  -27.491  1.00 173.81 ? 266 ALA A O    1 
ATOM   2183  C CB   . ALA A  1 150 ? 112.477 -18.600  -27.453  1.00 169.69 ? 266 ALA A CB   1 
ATOM   2184  H H    . ALA A  1 150 ? 110.630 -20.021  -26.770  1.00 207.15 ? 266 ALA A H    1 
ATOM   2185  H HA   . ALA A  1 150 ? 111.671 -19.501  -29.105  1.00 210.90 ? 266 ALA A HA   1 
ATOM   2186  H HB1  . ALA A  1 150 ? 113.239 -18.235  -27.930  1.00 212.13 ? 266 ALA A HB1  1 
ATOM   2187  H HB2  . ALA A  1 150 ? 111.778 -17.931  -27.385  1.00 212.13 ? 266 ALA A HB2  1 
ATOM   2188  H HB3  . ALA A  1 150 ? 112.747 -18.888  -26.567  1.00 212.13 ? 266 ALA A HB3  1 
ATOM   2189  N N    . GLU A  1 151 ? 113.700 -20.854  -29.526  1.00 173.12 ? 267 GLU A N    1 
ATOM   2190  C CA   . GLU A  1 151 ? 114.645 -21.917  -29.846  1.00 176.27 ? 267 GLU A CA   1 
ATOM   2191  C C    . GLU A  1 151 ? 115.859 -21.897  -28.926  1.00 179.78 ? 267 GLU A C    1 
ATOM   2192  O O    . GLU A  1 151 ? 116.313 -22.946  -28.461  1.00 182.89 ? 267 GLU A O    1 
ATOM   2193  C CB   . GLU A  1 151 ? 115.088 -21.809  -31.307  1.00 176.69 ? 267 GLU A CB   1 
ATOM   2194  C CG   . GLU A  1 151 ? 113.955 -21.958  -32.319  1.00 174.13 ? 267 GLU A CG   1 
ATOM   2195  C CD   . GLU A  1 151 ? 113.111 -23.199  -32.089  1.00 173.85 ? 267 GLU A CD   1 
ATOM   2196  O OE1  . GLU A  1 151 ? 113.681 -24.245  -31.706  1.00 176.53 ? 267 GLU A OE1  1 
ATOM   2197  O OE2  . GLU A  1 151 ? 111.880 -23.127  -32.287  1.00 171.22 ? 267 GLU A OE2  1 
ATOM   2198  H H    . GLU A  1 151 ? 113.633 -20.246  -30.130  1.00 190.16 ? 267 GLU A H    1 
ATOM   2199  H HA   . GLU A  1 151 ? 114.202 -22.773  -29.733  1.00 201.10 ? 267 GLU A HA   1 
ATOM   2200  H HB2  . GLU A  1 151 ? 115.494 -20.939  -31.445  1.00 200.16 ? 267 GLU A HB2  1 
ATOM   2201  H HB3  . GLU A  1 151 ? 115.738 -22.505  -31.487  1.00 200.16 ? 267 GLU A HB3  1 
ATOM   2202  H HG2  . GLU A  1 151 ? 113.373 -21.185  -32.256  1.00 191.44 ? 267 GLU A HG2  1 
ATOM   2203  H HG3  . GLU A  1 151 ? 114.334 -22.015  -33.210  1.00 191.44 ? 267 GLU A HG3  1 
ATOM   2204  N N    . GLY A  1 152 ? 116.381 -20.702  -28.667  1.00 172.47 ? 268 GLY A N    1 
ATOM   2205  C CA   . GLY A  1 152 ? 117.537 -20.541  -27.803  1.00 177.27 ? 268 GLY A CA   1 
ATOM   2206  C C    . GLY A  1 152 ? 117.170 -19.809  -26.531  1.00 177.00 ? 268 GLY A C    1 
ATOM   2207  O O    . GLY A  1 152 ? 116.669 -20.406  -25.576  1.00 177.17 ? 268 GLY A O    1 
ATOM   2208  H H    . GLY A  1 152 ? 116.077 -19.963  -28.985  1.00 168.24 ? 268 GLY A H    1 
ATOM   2209  H HA2  . GLY A  1 152 ? 117.895 -21.411  -27.569  1.00 177.71 ? 268 GLY A HA2  1 
ATOM   2210  H HA3  . GLY A  1 152 ? 118.223 -20.035  -28.266  1.00 177.71 ? 268 GLY A HA3  1 
ATOM   2211  N N    . LYS A  1 153 ? 117.422 -18.506  -26.528  1.00 179.52 ? 269 LYS A N    1 
ATOM   2212  C CA   . LYS A  1 153 ? 117.075 -17.652  -25.401  1.00 179.43 ? 269 LYS A CA   1 
ATOM   2213  C C    . LYS A  1 153 ? 115.840 -16.842  -25.749  1.00 174.30 ? 269 LYS A C    1 
ATOM   2214  O O    . LYS A  1 153 ? 115.370 -16.874  -26.886  1.00 171.35 ? 269 LYS A O    1 
ATOM   2215  C CB   . LYS A  1 153 ? 118.237 -16.731  -25.038  1.00 183.70 ? 269 LYS A CB   1 
ATOM   2216  C CG   . LYS A  1 153 ? 119.452 -17.477  -24.519  1.00 189.55 ? 269 LYS A CG   1 
ATOM   2217  C CD   . LYS A  1 153 ? 120.453 -16.557  -23.841  1.00 194.15 ? 269 LYS A CD   1 
ATOM   2218  C CE   . LYS A  1 153 ? 121.584 -17.359  -23.216  1.00 200.31 ? 269 LYS A CE   1 
ATOM   2219  N NZ   . LYS A  1 153 ? 122.628 -16.503  -22.588  1.00 205.39 ? 269 LYS A NZ   1 
ATOM   2220  H H    . LYS A  1 153 ? 117.798 -18.086  -27.177  1.00 178.09 ? 269 LYS A H    1 
ATOM   2221  H HA   . LYS A  1 153 ? 116.871 -18.204  -24.630  1.00 178.14 ? 269 LYS A HA   1 
ATOM   2222  H HB2  . LYS A  1 153 ? 118.506 -16.237  -25.828  1.00 186.19 ? 269 LYS A HB2  1 
ATOM   2223  H HB3  . LYS A  1 153 ? 117.947 -16.116  -24.347  1.00 186.19 ? 269 LYS A HB3  1 
ATOM   2224  H HG2  . LYS A  1 153 ? 119.164 -18.138  -23.871  1.00 199.17 ? 269 LYS A HG2  1 
ATOM   2225  H HG3  . LYS A  1 153 ? 119.898 -17.911  -25.263  1.00 199.17 ? 269 LYS A HG3  1 
ATOM   2226  H HD2  . LYS A  1 153 ? 120.833 -15.953  -24.498  1.00 207.65 ? 269 LYS A HD2  1 
ATOM   2227  H HD3  . LYS A  1 153 ? 120.008 -16.057  -23.139  1.00 207.65 ? 269 LYS A HD3  1 
ATOM   2228  H HE2  . LYS A  1 153 ? 121.218 -17.937  -22.528  1.00 221.45 ? 269 LYS A HE2  1 
ATOM   2229  H HE3  . LYS A  1 153 ? 122.010 -17.894  -23.905  1.00 221.45 ? 269 LYS A HE3  1 
ATOM   2230  H HZ1  . LYS A  1 153 ? 123.268 -17.012  -22.236  1.00 230.65 ? 269 LYS A HZ1  1 
ATOM   2231  H HZ2  . LYS A  1 153 ? 122.989 -15.966  -23.199  1.00 230.65 ? 269 LYS A HZ2  1 
ATOM   2232  H HZ3  . LYS A  1 153 ? 122.267 -16.006  -21.944  1.00 230.65 ? 269 LYS A HZ3  1 
ATOM   2233  N N    . VAL A  1 154 ? 115.327 -16.116  -24.762  1.00 172.17 ? 270 VAL A N    1 
ATOM   2234  C CA   . VAL A  1 154 ? 114.106 -15.332  -24.919  1.00 168.08 ? 270 VAL A CA   1 
ATOM   2235  C C    . VAL A  1 154 ? 114.263 -14.321  -26.057  1.00 167.08 ? 270 VAL A C    1 
ATOM   2236  O O    . VAL A  1 154 ? 115.374 -13.880  -26.353  1.00 169.66 ? 270 VAL A O    1 
ATOM   2237  C CB   . VAL A  1 154 ? 113.744 -14.611  -23.596  1.00 169.01 ? 270 VAL A CB   1 
ATOM   2238  C CG1  . VAL A  1 154 ? 112.533 -13.693  -23.767  1.00 165.97 ? 270 VAL A CG1  1 
ATOM   2239  C CG2  . VAL A  1 154 ? 113.489 -15.630  -22.494  1.00 170.34 ? 270 VAL A CG2  1 
ATOM   2240  H H    . VAL A  1 154 ? 115.674 -16.060  -23.977  1.00 245.88 ? 270 VAL A H    1 
ATOM   2241  H HA   . VAL A  1 154 ? 113.374 -15.928  -25.146  1.00 236.90 ? 270 VAL A HA   1 
ATOM   2242  H HB   . VAL A  1 154 ? 114.496 -14.062  -23.323  1.00 238.87 ? 270 VAL A HB   1 
ATOM   2243  H HG11 . VAL A  1 154 ? 112.341 -13.263  -22.919  1.00 229.70 ? 270 VAL A HG11 1 
ATOM   2244  H HG12 . VAL A  1 154 ? 112.736 -13.025  -24.439  1.00 229.70 ? 270 VAL A HG12 1 
ATOM   2245  H HG13 . VAL A  1 154 ? 111.772 -14.225  -24.048  1.00 229.70 ? 270 VAL A HG13 1 
ATOM   2246  H HG21 . VAL A  1 154 ? 113.264 -15.160  -21.676  1.00 242.74 ? 270 VAL A HG21 1 
ATOM   2247  H HG22 . VAL A  1 154 ? 112.752 -16.203  -22.759  1.00 242.74 ? 270 VAL A HG22 1 
ATOM   2248  H HG23 . VAL A  1 154 ? 114.290 -16.160  -22.363  1.00 242.74 ? 270 VAL A HG23 1 
ATOM   2249  N N    . MET A  1 155 ? 113.152 -13.986  -26.710  1.00 162.55 ? 271 MET A N    1 
ATOM   2250  C CA   . MET A  1 155 ? 113.147 -12.999  -27.789  1.00 161.70 ? 271 MET A CA   1 
ATOM   2251  C C    . MET A  1 155 ? 111.961 -12.041  -27.657  1.00 159.48 ? 271 MET A C    1 
ATOM   2252  O O    . MET A  1 155 ? 110.852 -12.453  -27.300  1.00 157.44 ? 271 MET A O    1 
ATOM   2253  C CB   . MET A  1 155 ? 113.106 -13.699  -29.152  1.00 160.54 ? 271 MET A CB   1 
ATOM   2254  C CG   . MET A  1 155 ? 114.411 -14.371  -29.570  1.00 163.26 ? 271 MET A CG   1 
ATOM   2255  S SD   . MET A  1 155 ? 115.840 -13.267  -29.595  1.00 166.75 ? 271 MET A SD   1 
ATOM   2256  C CE   . MET A  1 155 ? 115.243 -11.942  -30.640  1.00 164.95 ? 271 MET A CE   1 
ATOM   2257  H H    . MET A  1 155 ? 112.377 -14.321  -26.544  1.00 170.23 ? 271 MET A H    1 
ATOM   2258  H HA   . MET A  1 155 ? 113.968 -12.485  -27.745  1.00 167.23 ? 271 MET A HA   1 
ATOM   2259  H HB2  . MET A  1 155 ? 112.419 -14.383  -29.128  1.00 162.60 ? 271 MET A HB2  1 
ATOM   2260  H HB3  . MET A  1 155 ? 112.885 -13.041  -29.830  1.00 162.60 ? 271 MET A HB3  1 
ATOM   2261  H HG2  . MET A  1 155 ? 114.604 -15.089  -28.947  1.00 168.26 ? 271 MET A HG2  1 
ATOM   2262  H HG3  . MET A  1 155 ? 114.302 -14.733  -30.463  1.00 168.26 ? 271 MET A HG3  1 
ATOM   2263  H HE1  . MET A  1 155 ? 115.940 -11.273  -30.730  1.00 173.96 ? 271 MET A HE1  1 
ATOM   2264  H HE2  . MET A  1 155 ? 115.017 -12.304  -31.511  1.00 173.96 ? 271 MET A HE2  1 
ATOM   2265  H HE3  . MET A  1 155 ? 114.456 -11.548  -30.232  1.00 173.96 ? 271 MET A HE3  1 
ATOM   2266  N N    . ILE A  1 156 ? 112.205 -10.764  -27.945  1.00 153.16 ? 272 ILE A N    1 
ATOM   2267  C CA   . ILE A  1 156 ? 111.164 -9.738   -27.895  1.00 151.75 ? 272 ILE A CA   1 
ATOM   2268  C C    . ILE A  1 156 ? 110.968 -9.086   -29.264  1.00 150.87 ? 272 ILE A C    1 
ATOM   2269  O O    . ILE A  1 156 ? 111.918 -8.933   -30.033  1.00 152.39 ? 272 ILE A O    1 
ATOM   2270  C CB   . ILE A  1 156 ? 111.491 -8.652   -26.847  1.00 154.05 ? 272 ILE A CB   1 
ATOM   2271  C CG1  . ILE A  1 156 ? 112.837 -7.984   -27.149  1.00 156.97 ? 272 ILE A CG1  1 
ATOM   2272  C CG2  . ILE A  1 156 ? 111.507 -9.267   -25.454  1.00 155.13 ? 272 ILE A CG2  1 
ATOM   2273  C CD1  . ILE A  1 156 ? 113.107 -6.755   -26.307  1.00 159.48 ? 272 ILE A CD1  1 
ATOM   2274  H H    . ILE A  1 156 ? 112.976 -10.462  -28.175  1.00 124.23 ? 272 ILE A H    1 
ATOM   2275  H HA   . ILE A  1 156 ? 110.325 -10.154  -27.641  1.00 118.55 ? 272 ILE A HA   1 
ATOM   2276  H HB   . ILE A  1 156 ? 110.797 -7.975   -26.878  1.00 123.21 ? 272 ILE A HB   1 
ATOM   2277  H HG12 . ILE A  1 156 ? 113.548 -8.621   -26.980  1.00 129.19 ? 272 ILE A HG12 1 
ATOM   2278  H HG13 . ILE A  1 156 ? 112.851 -7.715   -28.081  1.00 129.19 ? 272 ILE A HG13 1 
ATOM   2279  H HG21 . ILE A  1 156 ? 111.714 -8.575   -24.806  1.00 127.74 ? 272 ILE A HG21 1 
ATOM   2280  H HG22 . ILE A  1 156 ? 110.635 -9.646   -25.266  1.00 127.74 ? 272 ILE A HG22 1 
ATOM   2281  H HG23 . ILE A  1 156 ? 112.184 -9.962   -25.423  1.00 127.74 ? 272 ILE A HG23 1 
ATOM   2282  H HD11 . ILE A  1 156 ? 113.971 -6.388   -26.553  1.00 134.55 ? 272 ILE A HD11 1 
ATOM   2283  H HD12 . ILE A  1 156 ? 112.410 -6.100   -26.473  1.00 134.55 ? 272 ILE A HD12 1 
ATOM   2284  H HD13 . ILE A  1 156 ? 113.108 -7.008   -25.371  1.00 134.55 ? 272 ILE A HD13 1 
ATOM   2285  N N    . ARG A  1 157 ? 109.725 -8.716   -29.563  1.00 153.50 ? 273 ARG A N    1 
ATOM   2286  C CA   . ARG A  1 157 ? 109.370 -8.140   -30.859  1.00 153.04 ? 273 ARG A CA   1 
ATOM   2287  C C    . ARG A  1 157 ? 108.314 -7.045   -30.728  1.00 153.50 ? 273 ARG A C    1 
ATOM   2288  O O    . ARG A  1 157 ? 107.376 -7.161   -29.937  1.00 152.82 ? 273 ARG A O    1 
ATOM   2289  C CB   . ARG A  1 157 ? 108.855 -9.230   -31.800  1.00 151.55 ? 273 ARG A CB   1 
ATOM   2290  C CG   . ARG A  1 157 ? 109.833 -10.365  -32.040  1.00 151.56 ? 273 ARG A CG   1 
ATOM   2291  C CD   . ARG A  1 157 ? 109.264 -11.385  -33.016  1.00 150.48 ? 273 ARG A CD   1 
ATOM   2292  N NE   . ARG A  1 157 ? 110.205 -12.461  -33.316  1.00 151.20 ? 273 ARG A NE   1 
ATOM   2293  C CZ   . ARG A  1 157 ? 110.274 -13.624  -32.674  1.00 151.37 ? 273 ARG A CZ   1 
ATOM   2294  N NH1  . ARG A  1 157 ? 109.456 -13.896  -31.669  1.00 150.25 ? 273 ARG A NH1  1 
ATOM   2295  N NH2  . ARG A  1 157 ? 111.179 -14.523  -33.042  1.00 153.00 ? 273 ARG A NH2  1 
ATOM   2296  H H    . ARG A  1 157 ? 109.059 -8.791   -29.024  1.00 204.41 ? 273 ARG A H    1 
ATOM   2297  H HA   . ARG A  1 157 ? 110.163 -7.748   -31.258  1.00 200.58 ? 273 ARG A HA   1 
ATOM   2298  H HB2  . ARG A  1 157 ? 108.048 -9.612   -31.421  1.00 196.23 ? 273 ARG A HB2  1 
ATOM   2299  H HB3  . ARG A  1 157 ? 108.654 -8.828   -32.660  1.00 196.23 ? 273 ARG A HB3  1 
ATOM   2300  H HG2  . ARG A  1 157 ? 110.653 -10.009  -32.415  1.00 200.27 ? 273 ARG A HG2  1 
ATOM   2301  H HG3  . ARG A  1 157 ? 110.015 -10.815  -31.200  1.00 200.27 ? 273 ARG A HG3  1 
ATOM   2302  H HD2  . ARG A  1 157 ? 108.467 -11.782  -32.630  1.00 197.35 ? 273 ARG A HD2  1 
ATOM   2303  H HD3  . ARG A  1 157 ? 109.042 -10.938  -33.848  1.00 197.35 ? 273 ARG A HD3  1 
ATOM   2304  H HE   . ARG A  1 157 ? 110.760 -12.332  -33.961  1.00 202.99 ? 273 ARG A HE   1 
ATOM   2305  H HH11 . ARG A  1 157 ? 108.868 -13.317  -31.424  1.00 192.66 ? 273 ARG A HH11 1 
ATOM   2306  H HH12 . ARG A  1 157 ? 109.511 -14.651  -31.261  1.00 192.66 ? 273 ARG A HH12 1 
ATOM   2307  H HH21 . ARG A  1 157 ? 111.713 -14.353  -33.694  1.00 203.51 ? 273 ARG A HH21 1 
ATOM   2308  H HH22 . ARG A  1 157 ? 111.228 -15.277  -32.630  1.00 203.51 ? 273 ARG A HH22 1 
ATOM   2309  N N    . SER A  1 158 ? 108.470 -5.986   -31.518  1.00 158.30 ? 274 SER A N    1 
ATOM   2310  C CA   . SER A  1 158 ? 107.503 -4.894   -31.545  1.00 159.19 ? 274 SER A CA   1 
ATOM   2311  C C    . SER A  1 158 ? 107.566 -4.156   -32.878  1.00 160.27 ? 274 SER A C    1 
ATOM   2312  O O    . SER A  1 158 ? 108.599 -4.155   -33.546  1.00 160.94 ? 274 SER A O    1 
ATOM   2313  C CB   . SER A  1 158 ? 107.760 -3.914   -30.401  1.00 160.98 ? 274 SER A CB   1 
ATOM   2314  O OG   . SER A  1 158 ? 108.704 -2.929   -30.787  1.00 162.87 ? 274 SER A OG   1 
ATOM   2315  H H    . SER A  1 158 ? 109.135 -5.876   -32.052  1.00 197.36 ? 274 SER A H    1 
ATOM   2316  H HA   . SER A  1 158 ? 106.609 -5.255   -31.440  1.00 196.67 ? 274 SER A HA   1 
ATOM   2317  H HB2  . SER A  1 158 ? 106.927 -3.478   -30.165  1.00 202.95 ? 274 SER A HB2  1 
ATOM   2318  H HB3  . SER A  1 158 ? 108.107 -4.403   -29.638  1.00 202.95 ? 274 SER A HB3  1 
ATOM   2319  H HG   . SER A  1 158 ? 109.432 -3.294   -30.995  1.00 208.62 ? 274 SER A HG   1 
ATOM   2320  N N    . GLU A  1 159 ? 106.459 -3.528   -33.262  1.00 161.04 ? 275 GLU A N    1 
ATOM   2321  C CA   . GLU A  1 159 ? 106.422 -2.710   -34.471  1.00 162.29 ? 275 GLU A CA   1 
ATOM   2322  C C    . GLU A  1 159 ? 107.364 -1.521   -34.340  1.00 164.30 ? 275 GLU A C    1 
ATOM   2323  O O    . GLU A  1 159 ? 107.974 -1.085   -35.314  1.00 165.24 ? 275 GLU A O    1 
ATOM   2324  C CB   . GLU A  1 159 ? 105.004 -2.217   -34.748  1.00 162.52 ? 275 GLU A CB   1 
ATOM   2325  C CG   . GLU A  1 159 ? 104.036 -3.312   -35.146  1.00 160.80 ? 275 GLU A CG   1 
ATOM   2326  C CD   . GLU A  1 159 ? 102.631 -2.796   -35.393  1.00 161.28 ? 275 GLU A CD   1 
ATOM   2327  O OE1  . GLU A  1 159 ? 102.417 -1.568   -35.287  1.00 163.07 ? 275 GLU A OE1  1 
ATOM   2328  O OE2  . GLU A  1 159 ? 101.740 -3.618   -35.692  1.00 160.04 ? 275 GLU A OE2  1 
ATOM   2329  H H    . GLU A  1 159 ? 105.711 -3.561   -32.838  1.00 211.02 ? 275 GLU A H    1 
ATOM   2330  H HA   . GLU A  1 159 ? 106.711 -3.245   -35.227  1.00 211.43 ? 275 GLU A HA   1 
ATOM   2331  H HB2  . GLU A  1 159 ? 104.658 -1.794   -33.946  1.00 209.84 ? 275 GLU A HB2  1 
ATOM   2332  H HB3  . GLU A  1 159 ? 105.034 -1.572   -35.472  1.00 209.84 ? 275 GLU A HB3  1 
ATOM   2333  H HG2  . GLU A  1 159 ? 104.351 -3.729   -35.963  1.00 203.35 ? 275 GLU A HG2  1 
ATOM   2334  H HG3  . GLU A  1 159 ? 103.993 -3.969   -34.433  1.00 203.35 ? 275 GLU A HG3  1 
ATOM   2335  N N    . ASN A  1 160 ? 107.468 -1.000   -33.123  1.00 167.30 ? 276 ASN A N    1 
ATOM   2336  C CA   . ASN A  1 160 ? 108.353 0.117    -32.834  1.00 169.35 ? 276 ASN A CA   1 
ATOM   2337  C C    . ASN A  1 160 ? 108.558 0.212    -31.328  1.00 170.01 ? 276 ASN A C    1 
ATOM   2338  O O    . ASN A  1 160 ? 107.674 0.661    -30.598  1.00 170.69 ? 276 ASN A O    1 
ATOM   2339  C CB   . ASN A  1 160 ? 107.779 1.422    -33.395  1.00 170.90 ? 276 ASN A CB   1 
ATOM   2340  C CG   . ASN A  1 160 ? 108.765 2.576    -33.323  1.00 172.98 ? 276 ASN A CG   1 
ATOM   2341  O OD1  . ASN A  1 160 ? 109.801 2.483    -32.665  1.00 173.51 ? 276 ASN A OD1  1 
ATOM   2342  N ND2  . ASN A  1 160 ? 108.445 3.676    -34.000  1.00 174.23 ? 276 ASN A ND2  1 
ATOM   2343  H H    . ASN A  1 160 ? 107.029 -1.281   -32.439  1.00 249.49 ? 276 ASN A H    1 
ATOM   2344  H HA   . ASN A  1 160 ? 109.215 -0.041   -33.250  1.00 258.00 ? 276 ASN A HA   1 
ATOM   2345  H HB2  . ASN A  1 160 ? 107.542 1.288    -34.326  1.00 262.48 ? 276 ASN A HB2  1 
ATOM   2346  H HB3  . ASN A  1 160 ? 106.992 1.667    -32.884  1.00 262.48 ? 276 ASN A HB3  1 
ATOM   2347  N N    . ILE A  1 161 ? 109.726 -0.226   -30.869  1.00 167.08 ? 277 ILE A N    1 
ATOM   2348  C CA   . ILE A  1 161 ? 110.027 -0.271   -29.442  1.00 167.81 ? 277 ILE A CA   1 
ATOM   2349  C C    . ILE A  1 161 ? 109.980 1.120    -28.810  1.00 170.34 ? 277 ILE A C    1 
ATOM   2350  O O    . ILE A  1 161 ? 109.603 1.265    -27.647  1.00 171.24 ? 277 ILE A O    1 
ATOM   2351  C CB   . ILE A  1 161 ? 111.414 -0.906   -29.190  1.00 168.59 ? 277 ILE A CB   1 
ATOM   2352  C CG1  . ILE A  1 161 ? 111.415 -2.356   -29.685  1.00 166.21 ? 277 ILE A CG1  1 
ATOM   2353  C CG2  . ILE A  1 161 ? 111.783 -0.838   -27.711  1.00 170.57 ? 277 ILE A CG2  1 
ATOM   2354  C CD1  . ILE A  1 161 ? 112.716 -3.111   -29.475  1.00 167.77 ? 277 ILE A CD1  1 
ATOM   2355  H H    . ILE A  1 161 ? 110.367 -0.506   -31.369  1.00 163.52 ? 277 ILE A H    1 
ATOM   2356  H HA   . ILE A  1 161 ? 109.363 -0.821   -28.999  1.00 168.21 ? 277 ILE A HA   1 
ATOM   2357  H HB   . ILE A  1 161 ? 112.076 -0.408   -29.695  1.00 170.96 ? 277 ILE A HB   1 
ATOM   2358  H HG12 . ILE A  1 161 ? 110.717 -2.841   -29.218  1.00 163.78 ? 277 ILE A HG12 1 
ATOM   2359  H HG13 . ILE A  1 161 ? 111.228 -2.356   -30.637  1.00 163.78 ? 277 ILE A HG13 1 
ATOM   2360  H HG21 . ILE A  1 161 ? 112.655 -1.243   -27.584  1.00 177.55 ? 277 ILE A HG21 1 
ATOM   2361  H HG22 . ILE A  1 161 ? 111.805 0.091    -27.434  1.00 177.55 ? 277 ILE A HG22 1 
ATOM   2362  H HG23 . ILE A  1 161 ? 111.116 -1.321   -27.198  1.00 177.55 ? 277 ILE A HG23 1 
ATOM   2363  H HD11 . ILE A  1 161 ? 112.616 -4.013   -29.819  1.00 167.65 ? 277 ILE A HD11 1 
ATOM   2364  H HD12 . ILE A  1 161 ? 113.427 -2.653   -29.949  1.00 167.65 ? 277 ILE A HD12 1 
ATOM   2365  H HD13 . ILE A  1 161 ? 112.915 -3.139   -28.526  1.00 167.65 ? 277 ILE A HD13 1 
ATOM   2366  N N    . THR A  1 162 ? 110.357 2.135    -29.582  1.00 174.47 ? 278 THR A N    1 
ATOM   2367  C CA   . THR A  1 162 ? 110.416 3.504    -29.073  1.00 177.14 ? 278 THR A CA   1 
ATOM   2368  C C    . THR A  1 162 ? 109.018 4.105    -28.884  1.00 177.59 ? 278 THR A C    1 
ATOM   2369  O O    . THR A  1 162 ? 108.848 5.081    -28.152  1.00 179.75 ? 278 THR A O    1 
ATOM   2370  C CB   . THR A  1 162 ? 111.242 4.410    -30.018  1.00 179.31 ? 278 THR A CB   1 
ATOM   2371  O OG1  . THR A  1 162 ? 112.434 3.724    -30.423  1.00 179.73 ? 278 THR A OG1  1 
ATOM   2372  C CG2  . THR A  1 162 ? 111.627 5.715    -29.330  1.00 182.98 ? 278 THR A CG2  1 
ATOM   2373  H H    . THR A  1 162 ? 110.584 2.058    -30.407  1.00 185.00 ? 278 THR A H    1 
ATOM   2374  H HA   . THR A  1 162 ? 110.856 3.498    -28.209  1.00 195.87 ? 278 THR A HA   1 
ATOM   2375  H HB   . THR A  1 162 ? 110.712 4.624    -30.802  1.00 202.61 ? 278 THR A HB   1 
ATOM   2376  H HG1  . THR A  1 162 ? 112.886 4.212    -30.936  1.00 197.93 ? 278 THR A HG1  1 
ATOM   2377  H HG21 . THR A  1 162 ? 112.143 6.270    -29.935  1.00 203.17 ? 278 THR A HG21 1 
ATOM   2378  H HG22 . THR A  1 162 ? 110.828 6.197    -29.064  1.00 203.17 ? 278 THR A HG22 1 
ATOM   2379  H HG23 . THR A  1 162 ? 112.160 5.529    -28.541  1.00 203.17 ? 278 THR A HG23 1 
ATOM   2380  N N    . ASN A  1 163 ? 108.023 3.509    -29.537  1.00 174.76 ? 279 ASN A N    1 
ATOM   2381  C CA   . ASN A  1 163 ? 106.642 3.979    -29.454  1.00 175.44 ? 279 ASN A CA   1 
ATOM   2382  C C    . ASN A  1 163 ? 105.872 3.200    -28.385  1.00 174.98 ? 279 ASN A C    1 
ATOM   2383  O O    . ASN A  1 163 ? 105.693 1.986    -28.495  1.00 172.75 ? 279 ASN A O    1 
ATOM   2384  C CB   . ASN A  1 163 ? 105.966 3.852    -30.820  1.00 174.21 ? 279 ASN A CB   1 
ATOM   2385  C CG   . ASN A  1 163 ? 104.555 4.409    -30.834  1.00 175.25 ? 279 ASN A CG   1 
ATOM   2386  O OD1  . ASN A  1 163 ? 103.611 3.755    -30.392  1.00 174.62 ? 279 ASN A OD1  1 
ATOM   2387  N ND2  . ASN A  1 163 ? 104.404 5.623    -31.355  1.00 176.99 ? 279 ASN A ND2  1 
ATOM   2388  H H    . ASN A  1 163 ? 108.124 2.821    -30.042  1.00 224.07 ? 279 ASN A H    1 
ATOM   2389  H HA   . ASN A  1 163 ? 106.640 4.916    -29.203  1.00 226.44 ? 279 ASN A HA   1 
ATOM   2390  H HB2  . ASN A  1 163 ? 106.487 4.341    -31.476  1.00 222.66 ? 279 ASN A HB2  1 
ATOM   2391  H HB3  . ASN A  1 163 ? 105.921 2.915    -31.065  1.00 222.66 ? 279 ASN A HB3  1 
ATOM   2392  H HD21 . ASN A  1 163 ? 103.624 5.984    -31.387  1.00 222.00 ? 279 ASN A HD21 1 
ATOM   2393  H HD22 . ASN A  1 163 ? 105.087 6.048    -31.661  1.00 222.00 ? 279 ASN A HD22 1 
ATOM   2394  N N    . ASN A  1 164 ? 105.424 3.911    -27.354  1.00 171.82 ? 280 ASN A N    1 
ATOM   2395  C CA   . ASN A  1 164 ? 104.846 3.288    -26.163  1.00 172.13 ? 280 ASN A CA   1 
ATOM   2396  C C    . ASN A  1 164 ? 103.459 2.679    -26.355  1.00 171.20 ? 280 ASN A C    1 
ATOM   2397  O O    . ASN A  1 164 ? 103.013 1.878    -25.533  1.00 170.80 ? 280 ASN A O    1 
ATOM   2398  C CB   . ASN A  1 164 ? 104.776 4.315    -25.031  1.00 175.45 ? 280 ASN A CB   1 
ATOM   2399  C CG   . ASN A  1 164 ? 106.145 4.746    -24.548  1.00 176.47 ? 280 ASN A CG   1 
ATOM   2400  O OD1  . ASN A  1 164 ? 106.723 4.124    -23.657  1.00 176.38 ? 280 ASN A OD1  1 
ATOM   2401  N ND2  . ASN A  1 164 ? 106.670 5.819    -25.129  1.00 177.59 ? 280 ASN A ND2  1 
ATOM   2402  H H    . ASN A  1 164 ? 105.443 4.770    -27.318  1.00 259.42 ? 280 ASN A H    1 
ATOM   2403  H HA   . ASN A  1 164 ? 105.438 2.576    -25.873  1.00 255.31 ? 280 ASN A HA   1 
ATOM   2404  H HB2  . ASN A  1 164 ? 104.308 5.104    -25.348  1.00 266.90 ? 280 ASN A HB2  1 
ATOM   2405  H HB3  . ASN A  1 164 ? 104.300 3.926    -24.280  1.00 266.90 ? 280 ASN A HB3  1 
ATOM   2406  H HD21 . ASN A  1 164 ? 107.445 6.102    -24.888  1.00 285.34 ? 280 ASN A HD21 1 
ATOM   2407  H HD22 . ASN A  1 164 ? 106.234 6.230    -25.745  1.00 285.34 ? 280 ASN A HD22 1 
ATOM   2408  N N    . VAL A  1 165 ? 102.772 3.062    -27.426  1.00 171.99 ? 281 VAL A N    1 
ATOM   2409  C CA   . VAL A  1 165 ? 101.411 2.589    -27.662  1.00 171.43 ? 281 VAL A CA   1 
ATOM   2410  C C    . VAL A  1 165 ? 101.407 1.141    -28.150  1.00 167.84 ? 281 VAL A C    1 
ATOM   2411  O O    . VAL A  1 165 ? 100.433 0.413    -27.951  1.00 166.88 ? 281 VAL A O    1 
ATOM   2412  C CB   . VAL A  1 165 ? 100.676 3.489    -28.687  1.00 172.65 ? 281 VAL A CB   1 
ATOM   2413  C CG1  . VAL A  1 165 ? 99.256  2.981    -28.962  1.00 172.32 ? 281 VAL A CG1  1 
ATOM   2414  C CG2  . VAL A  1 165 ? 100.628 4.926    -28.182  1.00 176.23 ? 281 VAL A CG2  1 
ATOM   2415  H H    . VAL A  1 165 ? 103.071 3.595    -28.031  1.00 199.27 ? 281 VAL A H    1 
ATOM   2416  H HA   . VAL A  1 165 ? 100.917 2.624    -26.827  1.00 194.41 ? 281 VAL A HA   1 
ATOM   2417  H HB   . VAL A  1 165 ? 101.166 3.480    -29.524  1.00 200.29 ? 281 VAL A HB   1 
ATOM   2418  H HG11 . VAL A  1 165 ? 98.830  3.568    -29.606  1.00 195.68 ? 281 VAL A HG11 1 
ATOM   2419  H HG12 . VAL A  1 165 ? 99.307  2.080    -29.317  1.00 195.68 ? 281 VAL A HG12 1 
ATOM   2420  H HG13 . VAL A  1 165 ? 98.755  2.981    -28.131  1.00 195.68 ? 281 VAL A HG13 1 
ATOM   2421  H HG21 . VAL A  1 165 ? 100.165 5.474    -28.835  1.00 214.12 ? 281 VAL A HG21 1 
ATOM   2422  H HG22 . VAL A  1 165 ? 100.154 4.947    -27.336  1.00 214.12 ? 281 VAL A HG22 1 
ATOM   2423  H HG23 . VAL A  1 165 ? 101.535 5.248    -28.061  1.00 214.12 ? 281 VAL A HG23 1 
ATOM   2424  N N    . LYS A  1 166 ? 102.508 0.721    -28.765  1.00 166.25 ? 282 LYS A N    1 
ATOM   2425  C CA   . LYS A  1 166 ? 102.589 -0.602   -29.372  1.00 163.07 ? 282 LYS A CA   1 
ATOM   2426  C C    . LYS A  1 166 ? 103.055 -1.663   -28.379  1.00 161.66 ? 282 LYS A C    1 
ATOM   2427  O O    . LYS A  1 166 ? 103.993 -1.447   -27.610  1.00 162.75 ? 282 LYS A O    1 
ATOM   2428  C CB   . LYS A  1 166 ? 103.521 -0.561   -30.581  1.00 162.38 ? 282 LYS A CB   1 
ATOM   2429  C CG   . LYS A  1 166 ? 102.954 0.241    -31.743  1.00 163.31 ? 282 LYS A CG   1 
ATOM   2430  C CD   . LYS A  1 166 ? 104.024 1.072    -32.424  1.00 164.44 ? 282 LYS A CD   1 
ATOM   2431  C CE   . LYS A  1 166 ? 103.417 2.077    -33.392  1.00 165.76 ? 282 LYS A CE   1 
ATOM   2432  N NZ   . LYS A  1 166 ? 104.430 3.034    -33.927  1.00 167.05 ? 282 LYS A NZ   1 
ATOM   2433  H H    . LYS A  1 166 ? 103.226 1.188    -28.845  1.00 236.93 ? 282 LYS A H    1 
ATOM   2434  H HA   . LYS A  1 166 ? 101.707 -0.856   -29.686  1.00 227.52 ? 282 LYS A HA   1 
ATOM   2435  H HB2  . LYS A  1 166 ? 104.361 -0.152   -30.318  1.00 226.48 ? 282 LYS A HB2  1 
ATOM   2436  H HB3  . LYS A  1 166 ? 103.677 -1.467   -30.890  1.00 226.48 ? 282 LYS A HB3  1 
ATOM   2437  H HG2  . LYS A  1 166 ? 102.580 -0.368   -32.399  1.00 229.40 ? 282 LYS A HG2  1 
ATOM   2438  H HG3  . LYS A  1 166 ? 102.268 0.841    -31.413  1.00 229.40 ? 282 LYS A HG3  1 
ATOM   2439  H HD2  . LYS A  1 166 ? 104.525 1.560    -31.753  1.00 228.79 ? 282 LYS A HD2  1 
ATOM   2440  H HD3  . LYS A  1 166 ? 104.614 0.486    -32.924  1.00 228.79 ? 282 LYS A HD3  1 
ATOM   2441  H HE2  . LYS A  1 166 ? 103.028 1.601    -34.142  1.00 232.16 ? 282 LYS A HE2  1 
ATOM   2442  H HE3  . LYS A  1 166 ? 102.734 2.588    -32.932  1.00 232.16 ? 282 LYS A HE3  1 
ATOM   2443  H HZ3  . LYS A  1 166 ? 104.042 3.606    -34.488  1.00 232.19 ? 282 LYS A HZ3  1 
ATOM   2444  N N    . ASN A  1 167 ? 102.386 -2.812   -28.409  1.00 157.11 ? 283 ASN A N    1 
ATOM   2445  C CA   . ASN A  1 167 ? 102.668 -3.900   -27.480  1.00 155.67 ? 283 ASN A CA   1 
ATOM   2446  C C    . ASN A  1 167 ? 103.985 -4.609   -27.780  1.00 154.38 ? 283 ASN A C    1 
ATOM   2447  O O    . ASN A  1 167 ? 104.381 -4.750   -28.939  1.00 153.55 ? 283 ASN A O    1 
ATOM   2448  C CB   . ASN A  1 167 ? 101.522 -4.917   -27.500  1.00 153.39 ? 283 ASN A CB   1 
ATOM   2449  C CG   . ASN A  1 167 ? 100.220 -4.341   -26.975  1.00 154.94 ? 283 ASN A CG   1 
ATOM   2450  O OD1  . ASN A  1 167 ? 100.213 -3.347   -26.249  1.00 158.03 ? 283 ASN A OD1  1 
ATOM   2451  N ND2  . ASN A  1 167 ? 99.109  -4.971   -27.337  1.00 153.07 ? 283 ASN A ND2  1 
ATOM   2452  H H    . ASN A  1 167 ? 101.755 -2.988   -28.966  1.00 200.86 ? 283 ASN A H    1 
ATOM   2453  H HA   . ASN A  1 167 ? 102.726 -3.536   -26.582  1.00 198.26 ? 283 ASN A HA   1 
ATOM   2454  H HB2  . ASN A  1 167 ? 101.374 -5.209   -28.413  1.00 193.05 ? 283 ASN A HB2  1 
ATOM   2455  H HB3  . ASN A  1 167 ? 101.761 -5.674   -26.943  1.00 193.05 ? 283 ASN A HB3  1 
ATOM   2456  H HD21 . ASN A  1 167 ? 98.344  -4.685   -27.066  1.00 192.57 ? 283 ASN A HD21 1 
ATOM   2457  H HD22 . ASN A  1 167 ? 99.153  -5.666   -27.842  1.00 192.57 ? 283 ASN A HD22 1 
ATOM   2458  N N    . ILE A  1 168 ? 104.655 -5.047   -26.717  1.00 154.39 ? 284 ILE A N    1 
ATOM   2459  C CA   . ILE A  1 168 ? 105.889 -5.822   -26.817  1.00 153.50 ? 284 ILE A CA   1 
ATOM   2460  C C    . ILE A  1 168 ? 105.591 -7.297   -26.560  1.00 151.25 ? 284 ILE A C    1 
ATOM   2461  O O    . ILE A  1 168 ? 105.063 -7.655   -25.506  1.00 151.39 ? 284 ILE A O    1 
ATOM   2462  C CB   . ILE A  1 168 ? 106.948 -5.325   -25.811  1.00 155.73 ? 284 ILE A CB   1 
ATOM   2463  C CG1  . ILE A  1 168 ? 107.301 -3.863   -26.102  1.00 158.06 ? 284 ILE A CG1  1 
ATOM   2464  C CG2  . ILE A  1 168 ? 108.200 -6.195   -25.870  1.00 155.03 ? 284 ILE A CG2  1 
ATOM   2465  C CD1  . ILE A  1 168 ? 108.124 -3.196   -25.021  1.00 160.63 ? 284 ILE A CD1  1 
ATOM   2466  H H    . ILE A  1 168 ? 104.408 -4.903   -25.906  1.00 176.34 ? 284 ILE A H    1 
ATOM   2467  H HA   . ILE A  1 168 ? 106.252 -5.735   -27.712  1.00 176.48 ? 284 ILE A HA   1 
ATOM   2468  H HB   . ILE A  1 168 ? 106.575 -5.380   -24.918  1.00 183.23 ? 284 ILE A HB   1 
ATOM   2469  H HG12 . ILE A  1 168 ? 107.811 -3.825   -26.927  1.00 188.23 ? 284 ILE A HG12 1 
ATOM   2470  H HG13 . ILE A  1 168 ? 106.479 -3.358   -26.202  1.00 188.23 ? 284 ILE A HG13 1 
ATOM   2471  H HG21 . ILE A  1 168 ? 108.847 -5.860   -25.230  1.00 184.63 ? 284 ILE A HG21 1 
ATOM   2472  H HG22 . ILE A  1 168 ? 107.959 -7.109   -25.651  1.00 184.63 ? 284 ILE A HG22 1 
ATOM   2473  H HG23 . ILE A  1 168 ? 108.570 -6.156   -26.766  1.00 184.63 ? 284 ILE A HG23 1 
ATOM   2474  H HD11 . ILE A  1 168 ? 108.303 -2.279   -25.282  1.00 196.12 ? 284 ILE A HD11 1 
ATOM   2475  H HD12 . ILE A  1 168 ? 107.624 -3.212   -24.190  1.00 196.12 ? 284 ILE A HD12 1 
ATOM   2476  H HD13 . ILE A  1 168 ? 108.958 -3.680   -24.916  1.00 196.12 ? 284 ILE A HD13 1 
ATOM   2477  N N    . ILE A  1 169 ? 105.937 -8.145   -27.524  1.00 148.80 ? 285 ILE A N    1 
ATOM   2478  C CA   . ILE A  1 169 ? 105.638 -9.574   -27.445  1.00 146.85 ? 285 ILE A CA   1 
ATOM   2479  C C    . ILE A  1 169 ? 106.868 -10.376  -27.025  1.00 147.16 ? 285 ILE A C    1 
ATOM   2480  O O    . ILE A  1 169 ? 107.873 -10.401  -27.735  1.00 147.69 ? 285 ILE A O    1 
ATOM   2481  C CB   . ILE A  1 169 ? 105.114 -10.108  -28.798  1.00 145.28 ? 285 ILE A CB   1 
ATOM   2482  C CG1  . ILE A  1 169 ? 103.860 -9.331   -29.215  1.00 145.21 ? 285 ILE A CG1  1 
ATOM   2483  C CG2  . ILE A  1 169 ? 104.825 -11.611  -28.709  1.00 143.76 ? 285 ILE A CG2  1 
ATOM   2484  C CD1  . ILE A  1 169 ? 103.304 -9.702   -30.578  1.00 144.31 ? 285 ILE A CD1  1 
ATOM   2485  H H    . ILE A  1 169 ? 106.351 -7.916   -28.242  1.00 128.07 ? 285 ILE A H    1 
ATOM   2486  H HA   . ILE A  1 169 ? 104.947 -9.715   -26.779  1.00 126.24 ? 285 ILE A HA   1 
ATOM   2487  H HB   . ILE A  1 169 ? 105.800 -9.967   -29.470  1.00 121.71 ? 285 ILE A HB   1 
ATOM   2488  H HG12 . ILE A  1 169 ? 103.164 -9.494   -28.560  1.00 117.95 ? 285 ILE A HG12 1 
ATOM   2489  H HG13 . ILE A  1 169 ? 104.074 -8.385   -29.234  1.00 117.95 ? 285 ILE A HG13 1 
ATOM   2490  H HG21 . ILE A  1 169 ? 104.499 -11.921  -29.568  1.00 121.97 ? 285 ILE A HG21 1 
ATOM   2491  H HG22 . ILE A  1 169 ? 105.645 -12.077  -28.478  1.00 121.97 ? 285 ILE A HG22 1 
ATOM   2492  H HG23 . ILE A  1 169 ? 104.154 -11.764  -28.025  1.00 121.97 ? 285 ILE A HG23 1 
ATOM   2493  H HD11 . ILE A  1 169 ? 102.517 -9.164   -30.755  1.00 114.17 ? 285 ILE A HD11 1 
ATOM   2494  H HD12 . ILE A  1 169 ? 103.980 -9.532   -31.252  1.00 114.17 ? 285 ILE A HD12 1 
ATOM   2495  H HD13 . ILE A  1 169 ? 103.067 -10.643  -30.576  1.00 114.17 ? 285 ILE A HD13 1 
ATOM   2496  N N    . VAL A  1 170 ? 106.778 -11.036  -25.873  1.00 145.74 ? 286 VAL A N    1 
ATOM   2497  C CA   . VAL A  1 170 ? 107.880 -11.844  -25.352  1.00 147.64 ? 286 VAL A CA   1 
ATOM   2498  C C    . VAL A  1 170 ? 107.664 -13.324  -25.666  1.00 146.37 ? 286 VAL A C    1 
ATOM   2499  O O    . VAL A  1 170 ? 106.546 -13.832  -25.548  1.00 144.57 ? 286 VAL A O    1 
ATOM   2500  C CB   . VAL A  1 170 ? 108.035 -11.667  -23.825  1.00 149.91 ? 286 VAL A CB   1 
ATOM   2501  C CG1  . VAL A  1 170 ? 109.220 -12.481  -23.297  1.00 152.41 ? 286 VAL A CG1  1 
ATOM   2502  C CG2  . VAL A  1 170 ? 108.205 -10.199  -23.474  1.00 151.55 ? 286 VAL A CG2  1 
ATOM   2503  H H    . VAL A  1 170 ? 106.082 -11.032  -25.368  1.00 134.00 ? 286 VAL A H    1 
ATOM   2504  H HA   . VAL A  1 170 ? 108.707 -11.564  -25.774  1.00 140.20 ? 286 VAL A HA   1 
ATOM   2505  H HB   . VAL A  1 170 ? 107.232 -11.989  -23.387  1.00 144.92 ? 286 VAL A HB   1 
ATOM   2506  H HG11 . VAL A  1 170 ? 109.291 -12.349  -22.338  1.00 151.47 ? 286 VAL A HG11 1 
ATOM   2507  H HG12 . VAL A  1 170 ? 109.071 -13.420  -23.492  1.00 151.47 ? 286 VAL A HG12 1 
ATOM   2508  H HG13 . VAL A  1 170 ? 110.032 -12.177  -23.733  1.00 151.47 ? 286 VAL A HG13 1 
ATOM   2509  H HG21 . VAL A  1 170 ? 108.301 -10.114  -22.512  1.00 146.35 ? 286 VAL A HG21 1 
ATOM   2510  H HG22 . VAL A  1 170 ? 108.998 -9.859   -23.917  1.00 146.35 ? 286 VAL A HG22 1 
ATOM   2511  H HG23 . VAL A  1 170 ? 107.423 -9.711   -23.773  1.00 146.35 ? 286 VAL A HG23 1 
ATOM   2512  N N    . GLN A  1 171 ? 108.736 -14.002  -26.074  1.00 154.28 ? 287 GLN A N    1 
ATOM   2513  C CA   . GLN A  1 171 ? 108.704 -15.443  -26.329  1.00 153.91 ? 287 GLN A CA   1 
ATOM   2514  C C    . GLN A  1 171 ? 109.706 -16.170  -25.436  1.00 156.79 ? 287 GLN A C    1 
ATOM   2515  O O    . GLN A  1 171 ? 110.917 -16.064  -25.631  1.00 158.96 ? 287 GLN A O    1 
ATOM   2516  C CB   . GLN A  1 171 ? 109.009 -15.739  -27.799  1.00 153.23 ? 287 GLN A CB   1 
ATOM   2517  C CG   . GLN A  1 171 ? 108.118 -16.804  -28.416  1.00 151.60 ? 287 GLN A CG   1 
ATOM   2518  C CD   . GLN A  1 171 ? 108.567 -17.196  -29.810  1.00 151.80 ? 287 GLN A CD   1 
ATOM   2519  O OE1  . GLN A  1 171 ? 108.549 -16.380  -30.733  1.00 151.19 ? 287 GLN A OE1  1 
ATOM   2520  N NE2  . GLN A  1 171 ? 108.984 -18.445  -29.968  1.00 153.06 ? 287 GLN A NE2  1 
ATOM   2521  H H    . GLN A  1 171 ? 109.506 -13.645  -26.212  1.00 220.57 ? 287 GLN A H    1 
ATOM   2522  H HA   . GLN A  1 171 ? 107.818 -15.783  -26.129  1.00 219.29 ? 287 GLN A HA   1 
ATOM   2523  H HB2  . GLN A  1 171 ? 108.893 -14.923  -28.311  1.00 216.40 ? 287 GLN A HB2  1 
ATOM   2524  H HB3  . GLN A  1 171 ? 109.927 -16.043  -27.871  1.00 216.40 ? 287 GLN A HB3  1 
ATOM   2525  H HG2  . GLN A  1 171 ? 108.139 -17.597  -27.858  1.00 208.80 ? 287 GLN A HG2  1 
ATOM   2526  H HG3  . GLN A  1 171 ? 107.211 -16.463  -28.476  1.00 208.80 ? 287 GLN A HG3  1 
ATOM   2527  H HE21 . GLN A  1 171 ? 109.249 -18.716  -30.740  1.00 200.62 ? 287 GLN A HE21 1 
ATOM   2528  H HE22 . GLN A  1 171 ? 108.990 -18.984  -29.298  1.00 200.62 ? 287 GLN A HE22 1 
ATOM   2529  N N    . LEU A  1 172 ? 109.197 -16.914  -24.460  1.00 153.72 ? 288 LEU A N    1 
ATOM   2530  C CA   . LEU A  1 172 ? 110.055 -17.605  -23.502  1.00 156.82 ? 288 LEU A CA   1 
ATOM   2531  C C    . LEU A  1 172 ? 110.750 -18.802  -24.144  1.00 157.91 ? 288 LEU A C    1 
ATOM   2532  O O    . LEU A  1 172 ? 110.307 -19.309  -25.176  1.00 156.11 ? 288 LEU A O    1 
ATOM   2533  C CB   . LEU A  1 172 ? 109.243 -18.065  -22.283  1.00 157.20 ? 288 LEU A CB   1 
ATOM   2534  C CG   . LEU A  1 172 ? 108.553 -17.005  -21.417  1.00 157.00 ? 288 LEU A CG   1 
ATOM   2535  C CD1  . LEU A  1 172 ? 107.925 -17.670  -20.202  1.00 158.19 ? 288 LEU A CD1  1 
ATOM   2536  C CD2  . LEU A  1 172 ? 109.515 -15.908  -20.982  1.00 159.32 ? 288 LEU A CD2  1 
ATOM   2537  H H    . LEU A  1 172 ? 108.356 -17.035  -24.329  1.00 103.68 ? 288 LEU A H    1 
ATOM   2538  H HA   . LEU A  1 172 ? 110.739 -16.992  -23.192  1.00 112.44 ? 288 LEU A HA   1 
ATOM   2539  H HB2  . LEU A  1 172 ? 108.547 -18.663  -22.600  1.00 113.57 ? 288 LEU A HB2  1 
ATOM   2540  H HB3  . LEU A  1 172 ? 109.840 -18.559  -21.699  1.00 113.57 ? 288 LEU A HB3  1 
ATOM   2541  H HG   . LEU A  1 172 ? 107.842 -16.592  -21.932  1.00 112.97 ? 288 LEU A HG   1 
ATOM   2542  H HD11 . LEU A  1 172 ? 107.492 -16.992  -19.660  1.00 113.77 ? 288 LEU A HD11 1 
ATOM   2543  H HD12 . LEU A  1 172 ? 107.273 -18.322  -20.502  1.00 113.77 ? 288 LEU A HD12 1 
ATOM   2544  H HD13 . LEU A  1 172 ? 108.621 -18.110  -19.689  1.00 113.77 ? 288 LEU A HD13 1 
ATOM   2545  H HD21 . LEU A  1 172 ? 109.033 -15.264  -20.439  1.00 119.40 ? 288 LEU A HD21 1 
ATOM   2546  H HD22 . LEU A  1 172 ? 110.234 -16.305  -20.466  1.00 119.40 ? 288 LEU A HD22 1 
ATOM   2547  H HD23 . LEU A  1 172 ? 109.874 -15.473  -21.771  1.00 119.40 ? 288 LEU A HD23 1 
ATOM   2548  N N    . ASN A  1 173 ? 111.847 -19.239  -23.531  1.00 164.99 ? 289 ASN A N    1 
ATOM   2549  C CA   . ASN A  1 173 ? 112.529 -20.456  -23.953  1.00 166.77 ? 289 ASN A CA   1 
ATOM   2550  C C    . ASN A  1 173 ? 112.371 -21.568  -22.922  1.00 168.84 ? 289 ASN A C    1 
ATOM   2551  O O    . ASN A  1 173 ? 112.846 -22.684  -23.129  1.00 171.01 ? 289 ASN A O    1 
ATOM   2552  C CB   . ASN A  1 173 ? 114.013 -20.185  -24.214  1.00 170.24 ? 289 ASN A CB   1 
ATOM   2553  C CG   . ASN A  1 173 ? 114.779 -19.808  -22.959  1.00 174.54 ? 289 ASN A CG   1 
ATOM   2554  O OD1  . ASN A  1 173 ? 114.214 -19.267  -22.004  1.00 174.13 ? 289 ASN A OD1  1 
ATOM   2555  N ND2  . ASN A  1 173 ? 116.081 -20.089  -22.961  1.00 179.18 ? 289 ASN A ND2  1 
ATOM   2556  H H    . ASN A  1 173 ? 112.218 -18.844  -22.863  1.00 123.18 ? 289 ASN A H    1 
ATOM   2557  H HA   . ASN A  1 173 ? 112.133 -20.764  -24.783  1.00 130.50 ? 289 ASN A HA   1 
ATOM   2558  H HB2  . ASN A  1 173 ? 114.420 -20.984  -24.584  1.00 139.32 ? 289 ASN A HB2  1 
ATOM   2559  H HB3  . ASN A  1 173 ? 114.093 -19.451  -24.844  1.00 139.32 ? 289 ASN A HB3  1 
ATOM   2560  N N    . GLU A  1 174 ? 111.701 -21.259  -21.816  1.00 165.92 ? 290 GLU A N    1 
ATOM   2561  C CA   . GLU A  1 174 ? 111.418 -22.254  -20.787  1.00 168.12 ? 290 GLU A CA   1 
ATOM   2562  C C    . GLU A  1 174 ? 109.982 -22.117  -20.294  1.00 165.56 ? 290 GLU A C    1 
ATOM   2563  O O    . GLU A  1 174 ? 109.565 -21.046  -19.850  1.00 164.63 ? 290 GLU A O    1 
ATOM   2564  C CB   . GLU A  1 174 ? 112.391 -22.119  -19.614  1.00 173.34 ? 290 GLU A CB   1 
ATOM   2565  C CG   . GLU A  1 174 ? 113.857 -22.260  -20.003  1.00 177.21 ? 290 GLU A CG   1 
ATOM   2566  C CD   . GLU A  1 174 ? 114.778 -22.380  -18.802  1.00 183.11 ? 290 GLU A CD   1 
ATOM   2567  O OE1  . GLU A  1 174 ? 114.472 -21.773  -17.752  1.00 184.01 ? 290 GLU A OE1  1 
ATOM   2568  O OE2  . GLU A  1 174 ? 115.803 -23.087  -18.908  1.00 187.15 ? 290 GLU A OE2  1 
ATOM   2569  H H    . GLU A  1 174 ? 111.398 -20.475  -21.636  1.00 311.42 ? 290 GLU A H    1 
ATOM   2570  H HA   . GLU A  1 174 ? 111.523 -23.141  -21.166  1.00 316.21 ? 290 GLU A HA   1 
ATOM   2571  H HB2  . GLU A  1 174 ? 112.274 -21.244  -19.212  1.00 328.20 ? 290 GLU A HB2  1 
ATOM   2572  H HB3  . GLU A  1 174 ? 112.190 -22.809  -18.962  1.00 328.20 ? 290 GLU A HB3  1 
ATOM   2573  H HG2  . GLU A  1 174 ? 113.965 -23.058  -20.544  1.00 338.30 ? 290 GLU A HG2  1 
ATOM   2574  H HG3  . GLU A  1 174 ? 114.126 -21.477  -20.510  1.00 338.30 ? 290 GLU A HG3  1 
ATOM   2575  N N    . SER A  1 175 ? 109.228 -23.207  -20.374  1.00 165.12 ? 291 SER A N    1 
ATOM   2576  C CA   . SER A  1 175 ? 107.831 -23.201  -19.958  1.00 163.32 ? 291 SER A CA   1 
ATOM   2577  C C    . SER A  1 175 ? 107.687 -23.104  -18.441  1.00 165.78 ? 291 SER A C    1 
ATOM   2578  O O    . SER A  1 175 ? 108.470 -23.695  -17.697  1.00 169.26 ? 291 SER A O    1 
ATOM   2579  C CB   . SER A  1 175 ? 107.125 -24.462  -20.458  1.00 162.74 ? 291 SER A CB   1 
ATOM   2580  O OG   . SER A  1 175 ? 107.795 -25.629  -20.009  1.00 166.12 ? 291 SER A OG   1 
ATOM   2581  H H    . SER A  1 175 ? 109.503 -23.967  -20.668  1.00 175.57 ? 291 SER A H    1 
ATOM   2582  H HA   . SER A  1 175 ? 107.388 -22.433  -20.351  1.00 169.04 ? 291 SER A HA   1 
ATOM   2583  H HB2  . SER A  1 175 ? 106.216 -24.470  -20.119  1.00 166.96 ? 291 SER A HB2  1 
ATOM   2584  H HB3  . SER A  1 175 ? 107.117 -24.456  -21.428  1.00 166.96 ? 291 SER A HB3  1 
ATOM   2585  H HG   . SER A  1 175 ? 107.399 -26.314  -20.289  1.00 178.17 ? 291 SER A HG   1 
ATOM   2586  N N    . VAL A  1 176 ? 106.687 -22.348  -17.994  1.00 153.91 ? 292 VAL A N    1 
ATOM   2587  C CA   . VAL A  1 176 ? 106.312 -22.312  -16.585  1.00 156.41 ? 292 VAL A CA   1 
ATOM   2588  C C    . VAL A  1 176 ? 104.908 -22.880  -16.440  1.00 154.97 ? 292 VAL A C    1 
ATOM   2589  O O    . VAL A  1 176 ? 103.929 -22.266  -16.862  1.00 152.24 ? 292 VAL A O    1 
ATOM   2590  C CB   . VAL A  1 176 ? 106.357 -20.887  -16.002  1.00 156.69 ? 292 VAL A CB   1 
ATOM   2591  C CG1  . VAL A  1 176 ? 105.981 -20.904  -14.526  1.00 159.95 ? 292 VAL A CG1  1 
ATOM   2592  C CG2  . VAL A  1 176 ? 107.738 -20.279  -16.183  1.00 158.96 ? 292 VAL A CG2  1 
ATOM   2593  H H    . VAL A  1 176 ? 106.206 -21.840  -18.495  1.00 145.66 ? 292 VAL A H    1 
ATOM   2594  H HA   . VAL A  1 176 ? 106.921 -22.869  -16.076  1.00 150.90 ? 292 VAL A HA   1 
ATOM   2595  H HB   . VAL A  1 176 ? 105.716 -20.329  -16.472  1.00 148.58 ? 292 VAL A HB   1 
ATOM   2596  H HG11 . VAL A  1 176 ? 106.016 -19.998  -14.181  1.00 151.88 ? 292 VAL A HG11 1 
ATOM   2597  H HG12 . VAL A  1 176 ? 105.083 -21.259  -14.434  1.00 151.88 ? 292 VAL A HG12 1 
ATOM   2598  H HG13 . VAL A  1 176 ? 106.610 -21.466  -14.047  1.00 151.88 ? 292 VAL A HG13 1 
ATOM   2599  H HG21 . VAL A  1 176 ? 107.741 -19.384  -15.809  1.00 153.52 ? 292 VAL A HG21 1 
ATOM   2600  H HG22 . VAL A  1 176 ? 108.389 -20.832  -15.723  1.00 153.52 ? 292 VAL A HG22 1 
ATOM   2601  H HG23 . VAL A  1 176 ? 107.945 -20.243  -17.130  1.00 153.52 ? 292 VAL A HG23 1 
ATOM   2602  N N    . THR A  1 177 ? 104.818 -24.064  -15.850  1.00 153.61 ? 293 THR A N    1 
ATOM   2603  C CA   . THR A  1 177 ? 103.540 -24.736  -15.682  1.00 152.24 ? 293 THR A CA   1 
ATOM   2604  C C    . THR A  1 177 ? 102.683 -24.020  -14.648  1.00 152.62 ? 293 THR A C    1 
ATOM   2605  O O    . THR A  1 177 ? 103.173 -23.638  -13.584  1.00 156.24 ? 293 THR A O    1 
ATOM   2606  C CB   . THR A  1 177 ? 103.733 -26.198  -15.252  1.00 155.75 ? 293 THR A CB   1 
ATOM   2607  O OG1  . THR A  1 177 ? 104.444 -26.239  -14.008  1.00 160.82 ? 293 THR A OG1  1 
ATOM   2608  C CG2  . THR A  1 177 ? 104.516 -26.970  -16.309  1.00 155.66 ? 293 THR A CG2  1 
ATOM   2609  H H    . THR A  1 177 ? 105.489 -24.502  -15.536  1.00 91.90  ? 293 THR A H    1 
ATOM   2610  H HA   . THR A  1 177 ? 103.063 -24.730  -16.527  1.00 89.94  ? 293 THR A HA   1 
ATOM   2611  H HB   . THR A  1 177 ? 102.866 -26.620  -15.143  1.00 101.54 ? 293 THR A HB   1 
ATOM   2612  H HG1  . THR A  1 177 ? 104.553 -27.036  -13.766  1.00 111.68 ? 293 THR A HG1  1 
ATOM   2613  H HG21 . THR A  1 177 ? 104.633 -27.891  -16.028  1.00 106.22 ? 293 THR A HG21 1 
ATOM   2614  H HG22 . THR A  1 177 ? 104.037 -26.956  -17.153  1.00 106.22 ? 293 THR A HG22 1 
ATOM   2615  H HG23 . THR A  1 177 ? 105.389 -26.566  -16.436  1.00 106.22 ? 293 THR A HG23 1 
ATOM   2616  N N    . ILE A  1 178 ? 101.407 -23.832  -14.973  1.00 150.67 ? 294 ILE A N    1 
ATOM   2617  C CA   . ILE A  1 178 ? 100.461 -23.205  -14.056  1.00 152.50 ? 294 ILE A CA   1 
ATOM   2618  C C    . ILE A  1 178 ? 99.260  -24.108  -13.807  1.00 154.28 ? 294 ILE A C    1 
ATOM   2619  O O    . ILE A  1 178 ? 98.611  -24.577  -14.742  1.00 152.72 ? 294 ILE A O    1 
ATOM   2620  C CB   . ILE A  1 178 ? 99.980  -21.829  -14.583  1.00 150.27 ? 294 ILE A CB   1 
ATOM   2621  C CG1  . ILE A  1 178 ? 98.956  -21.216  -13.624  1.00 152.89 ? 294 ILE A CG1  1 
ATOM   2622  C CG2  . ILE A  1 178 ? 99.401  -21.941  -15.991  1.00 146.86 ? 294 ILE A CG2  1 
ATOM   2623  C CD1  . ILE A  1 178 ? 98.651  -19.757  -13.908  1.00 151.69 ? 294 ILE A CD1  1 
ATOM   2624  H H    . ILE A  1 178 ? 101.062 -24.061  -15.726  1.00 151.51 ? 294 ILE A H    1 
ATOM   2625  H HA   . ILE A  1 178 ? 100.902 -23.058  -13.204  1.00 149.50 ? 294 ILE A HA   1 
ATOM   2626  H HB   . ILE A  1 178 ? 100.748 -21.237  -14.620  1.00 140.34 ? 294 ILE A HB   1 
ATOM   2627  H HG12 . ILE A  1 178 ? 98.126  -21.712  -13.694  1.00 139.02 ? 294 ILE A HG12 1 
ATOM   2628  H HG13 . ILE A  1 178 ? 99.300  -21.276  -12.719  1.00 139.02 ? 294 ILE A HG13 1 
ATOM   2629  H HG21 . ILE A  1 178 ? 99.113  -21.063  -16.285  1.00 132.60 ? 294 ILE A HG21 1 
ATOM   2630  H HG22 . ILE A  1 178 ? 100.087 -22.281  -16.588  1.00 132.60 ? 294 ILE A HG22 1 
ATOM   2631  H HG23 . ILE A  1 178 ? 98.646  -22.549  -15.974  1.00 132.60 ? 294 ILE A HG23 1 
ATOM   2632  H HD11 . ILE A  1 178 ? 97.999  -19.440  -13.264  1.00 133.43 ? 294 ILE A HD11 1 
ATOM   2633  H HD12 . ILE A  1 178 ? 99.470  -19.243  -13.831  1.00 133.43 ? 294 ILE A HD12 1 
ATOM   2634  H HD13 . ILE A  1 178 ? 98.295  -19.679  -14.807  1.00 133.43 ? 294 ILE A HD13 1 
ATOM   2635  N N    . ASN A  1 179 ? 98.987  -24.357  -12.531  1.00 153.17 ? 295 ASN A N    1 
ATOM   2636  C CA   . ASN A  1 179 ? 97.861  -25.179  -12.126  1.00 155.37 ? 295 ASN A CA   1 
ATOM   2637  C C    . ASN A  1 179 ? 96.793  -24.345  -11.440  1.00 157.16 ? 295 ASN A C    1 
ATOM   2638  O O    . ASN A  1 179 ? 97.021  -23.786  -10.366  1.00 159.39 ? 295 ASN A O    1 
ATOM   2639  C CB   . ASN A  1 179 ? 98.325  -26.300  -11.194  1.00 158.16 ? 295 ASN A CB   1 
ATOM   2640  C CG   . ASN A  1 179 ? 98.411  -27.646  -11.890  1.00 157.80 ? 295 ASN A CG   1 
ATOM   2641  O OD1  . ASN A  1 179 ? 97.681  -27.919  -12.843  1.00 156.43 ? 295 ASN A OD1  1 
ATOM   2642  N ND2  . ASN A  1 179 ? 99.302  -28.503  -11.405  1.00 159.35 ? 295 ASN A ND2  1 
ATOM   2643  H H    . ASN A  1 179 ? 99.450  -24.054  -11.873  1.00 135.15 ? 295 ASN A H    1 
ATOM   2644  H HA   . ASN A  1 179 ? 97.465  -25.586  -12.913  1.00 137.39 ? 295 ASN A HA   1 
ATOM   2645  H HB2  . ASN A  1 179 ? 99.207  -26.083  -10.853  1.00 149.52 ? 295 ASN A HB2  1 
ATOM   2646  H HB3  . ASN A  1 179 ? 97.696  -26.382  -10.460  1.00 149.52 ? 295 ASN A HB3  1 
ATOM   2647  H HD21 . ASN A  1 179 ? 99.391  -29.280  -11.763  1.00 167.53 ? 295 ASN A HD21 1 
ATOM   2648  H HD22 . ASN A  1 179 ? 99.791  -28.281  -10.733  1.00 167.53 ? 295 ASN A HD22 1 
ATOM   2649  N N    . CYS A  1 180 ? 95.629  -24.263  -12.075  1.00 165.54 ? 296 CYS A N    1 
ATOM   2650  C CA   . CYS A  1 180 ? 94.479  -23.572  -11.507  1.00 167.77 ? 296 CYS A CA   1 
ATOM   2651  C C    . CYS A  1 180 ? 93.418  -24.594  -11.128  1.00 170.13 ? 296 CYS A C    1 
ATOM   2652  O O    . CYS A  1 180 ? 93.128  -25.501  -11.905  1.00 169.12 ? 296 CYS A O    1 
ATOM   2653  C CB   . CYS A  1 180 ? 93.914  -22.555  -12.499  1.00 165.45 ? 296 CYS A CB   1 
ATOM   2654  S SG   . CYS A  1 180 ? 95.108  -21.327  -13.090  1.00 161.83 ? 296 CYS A SG   1 
ATOM   2655  H H    . CYS A  1 180 ? 95.478  -24.606  -12.849  1.00 225.05 ? 296 CYS A H    1 
ATOM   2656  H HA   . CYS A  1 180 ? 94.750  -23.099  -10.705  1.00 222.92 ? 296 CYS A HA   1 
ATOM   2657  H HB2  . CYS A  1 180 ? 93.577  -23.032  -13.274  1.00 213.95 ? 296 CYS A HB2  1 
ATOM   2658  H HB3  . CYS A  1 180 ? 93.188  -22.075  -12.071  1.00 213.95 ? 296 CYS A HB3  1 
ATOM   2659  N N    . THR A  1 181 ? 92.842  -24.448  -9.937   1.00 173.67 ? 297 THR A N    1 
ATOM   2660  C CA   . THR A  1 181 ? 91.855  -25.406  -9.441   1.00 175.29 ? 297 THR A CA   1 
ATOM   2661  C C    . THR A  1 181 ? 90.724  -24.732  -8.667   1.00 177.14 ? 297 THR A C    1 
ATOM   2662  O O    . THR A  1 181 ? 90.948  -23.793  -7.900   1.00 178.25 ? 297 THR A O    1 
ATOM   2663  C CB   . THR A  1 181 ? 92.510  -26.461  -8.522   1.00 176.58 ? 297 THR A CB   1 
ATOM   2664  O OG1  . THR A  1 181 ? 93.692  -26.980  -9.145   1.00 175.02 ? 297 THR A OG1  1 
ATOM   2665  C CG2  . THR A  1 181 ? 91.541  -27.607  -8.236   1.00 177.54 ? 297 THR A CG2  1 
ATOM   2666  H H    . THR A  1 181 ? 93.005  -23.800  -9.396   1.00 248.34 ? 297 THR A H    1 
ATOM   2667  H HA   . THR A  1 181 ? 91.463  -25.871  -10.196  1.00 254.97 ? 297 THR A HA   1 
ATOM   2668  H HB   . THR A  1 181 ? 92.749  -26.046  -7.678   1.00 265.33 ? 297 THR A HB   1 
ATOM   2669  H HG1  . THR A  1 181 ? 94.050  -27.554  -8.647   1.00 272.59 ? 297 THR A HG1  1 
ATOM   2670  H HG21 . THR A  1 181 ? 91.963  -28.262  -7.659   1.00 266.90 ? 297 THR A HG21 1 
ATOM   2671  H HG22 . THR A  1 181 ? 90.745  -27.266  -7.798   1.00 266.90 ? 297 THR A HG22 1 
ATOM   2672  H HG23 . THR A  1 181 ? 91.283  -28.037  -9.066   1.00 266.90 ? 297 THR A HG23 1 
ATOM   2673  N N    . ARG A  1 182 ? 89.511  -25.235  -8.878   1.00 176.67 ? 298 ARG A N    1 
ATOM   2674  C CA   . ARG A  1 182 ? 88.324  -24.784  -8.157   1.00 177.39 ? 298 ARG A CA   1 
ATOM   2675  C C    . ARG A  1 182 ? 87.753  -25.937  -7.325   1.00 178.23 ? 298 ARG A C    1 
ATOM   2676  O O    . ARG A  1 182 ? 87.065  -26.803  -7.864   1.00 177.40 ? 298 ARG A O    1 
ATOM   2677  C CB   . ARG A  1 182 ? 87.275  -24.270  -9.136   1.00 175.83 ? 298 ARG A CB   1 
ATOM   2678  C CG   . ARG A  1 182 ? 86.104  -23.584  -8.477   1.00 175.77 ? 298 ARG A CG   1 
ATOM   2679  C CD   . ARG A  1 182 ? 84.885  -23.659  -9.366   1.00 173.64 ? 298 ARG A CD   1 
ATOM   2680  N NE   . ARG A  1 182 ? 84.082  -24.847  -9.103   1.00 173.86 ? 298 ARG A NE   1 
ATOM   2681  C CZ   . ARG A  1 182 ? 82.907  -25.100  -9.668   1.00 172.33 ? 298 ARG A CZ   1 
ATOM   2682  N NH1  . ARG A  1 182 ? 82.381  -24.244  -10.532  1.00 170.22 ? 298 ARG A NH1  1 
ATOM   2683  N NH2  . ARG A  1 182 ? 82.253  -26.213  -9.365   1.00 172.82 ? 298 ARG A NH2  1 
ATOM   2684  H H    . ARG A  1 182 ? 89.346  -25.855  -9.451   1.00 178.10 ? 298 ARG A H    1 
ATOM   2685  H HA   . ARG A  1 182 ? 88.565  -24.062  -7.557   1.00 180.70 ? 298 ARG A HA   1 
ATOM   2686  H HB2  . ARG A  1 182 ? 87.693  -23.632  -9.735   1.00 175.54 ? 298 ARG A HB2  1 
ATOM   2687  H HB3  . ARG A  1 182 ? 86.929  -25.020  -9.646   1.00 175.54 ? 298 ARG A HB3  1 
ATOM   2688  H HG2  . ARG A  1 182 ? 85.900  -24.025  -7.637   1.00 178.40 ? 298 ARG A HG2  1 
ATOM   2689  H HG3  . ARG A  1 182 ? 86.318  -22.650  -8.326   1.00 178.40 ? 298 ARG A HG3  1 
ATOM   2690  H HD2  . ARG A  1 182 ? 84.330  -22.879  -9.211   1.00 179.98 ? 298 ARG A HD2  1 
ATOM   2691  H HD3  . ARG A  1 182 ? 85.169  -23.686  -10.293  1.00 179.98 ? 298 ARG A HD3  1 
ATOM   2692  H HE   . ARG A  1 182 ? 84.391  -25.423  -8.544   1.00 188.10 ? 298 ARG A HE   1 
ATOM   2693  H HH11 . ARG A  1 182 ? 82.802  -23.521  -10.732  1.00 186.62 ? 298 ARG A HH11 1 
ATOM   2694  H HH12 . ARG A  1 182 ? 81.619  -24.412  -10.895  1.00 186.62 ? 298 ARG A HH12 1 
ATOM   2695  H HH21 . ARG A  1 182 ? 82.590  -26.771  -8.803   1.00 200.44 ? 298 ARG A HH21 1 
ATOM   2696  H HH22 . ARG A  1 182 ? 81.491  -26.377  -9.728   1.00 200.44 ? 298 ARG A HH22 1 
ATOM   2697  N N    . PRO A  1 183 ? 88.035  -25.957  -6.012   1.00 186.50 ? 299 PRO A N    1 
ATOM   2698  C CA   . PRO A  1 183 ? 87.624  -27.111  -5.200   1.00 187.70 ? 299 PRO A CA   1 
ATOM   2699  C C    . PRO A  1 183 ? 86.107  -27.277  -5.085   1.00 187.35 ? 299 PRO A C    1 
ATOM   2700  O O    . PRO A  1 183 ? 85.365  -26.315  -5.293   1.00 186.51 ? 299 PRO A O    1 
ATOM   2701  C CB   . PRO A  1 183 ? 88.243  -26.814  -3.828   1.00 190.36 ? 299 PRO A CB   1 
ATOM   2702  C CG   . PRO A  1 183 ? 88.492  -25.349  -3.813   1.00 190.14 ? 299 PRO A CG   1 
ATOM   2703  C CD   . PRO A  1 183 ? 88.763  -24.949  -5.222   1.00 187.85 ? 299 PRO A CD   1 
ATOM   2704  H HA   . PRO A  1 183 ? 88.010  -27.926  -5.556   1.00 254.29 ? 299 PRO A HA   1 
ATOM   2705  H HB2  . PRO A  1 183 ? 87.619  -27.062  -3.128   1.00 258.65 ? 299 PRO A HB2  1 
ATOM   2706  H HB3  . PRO A  1 183 ? 89.076  -27.303  -3.733   1.00 258.65 ? 299 PRO A HB3  1 
ATOM   2707  H HG2  . PRO A  1 183 ? 87.705  -24.892  -3.476   1.00 251.46 ? 299 PRO A HG2  1 
ATOM   2708  H HG3  . PRO A  1 183 ? 89.260  -25.158  -3.253   1.00 251.46 ? 299 PRO A HG3  1 
ATOM   2709  H HD2  . PRO A  1 183 ? 88.408  -24.063  -5.395   1.00 241.75 ? 299 PRO A HD2  1 
ATOM   2710  H HD3  . PRO A  1 183 ? 89.713  -24.995  -5.409   1.00 241.75 ? 299 PRO A HD3  1 
ATOM   2711  N N    . ASN A  1 184 ? 85.665  -28.493  -4.765   1.00 201.78 ? 300 ASN A N    1 
ATOM   2712  C CA   . ASN A  1 184 ? 84.243  -28.798  -4.586   1.00 201.56 ? 300 ASN A CA   1 
ATOM   2713  C C    . ASN A  1 184 ? 83.639  -28.107  -3.366   1.00 204.18 ? 300 ASN A C    1 
ATOM   2714  O O    . ASN A  1 184 ? 83.513  -28.709  -2.296   1.00 208.37 ? 300 ASN A O    1 
ATOM   2715  C CB   . ASN A  1 184 ? 84.032  -30.313  -4.461   1.00 202.97 ? 300 ASN A CB   1 
ATOM   2716  C CG   . ASN A  1 184 ? 83.833  -30.987  -5.801   1.00 200.29 ? 300 ASN A CG   1 
ATOM   2717  O OD1  . ASN A  1 184 ? 84.343  -30.528  -6.821   1.00 198.83 ? 300 ASN A OD1  1 
ATOM   2718  N ND2  . ASN A  1 184 ? 83.079  -32.081  -5.805   1.00 201.51 ? 300 ASN A ND2  1 
ATOM   2719  H H    . ASN A  1 184 ? 86.179  -29.172  -4.643   1.00 343.53 ? 300 ASN A H    1 
ATOM   2720  H HA   . ASN A  1 184 ? 83.758  -28.494  -5.369   1.00 348.56 ? 300 ASN A HA   1 
ATOM   2721  H HB2  . ASN A  1 184 ? 84.812  -30.707  -4.040   1.00 356.35 ? 300 ASN A HB2  1 
ATOM   2722  H HB3  . ASN A  1 184 ? 83.244  -30.479  -3.922   1.00 356.35 ? 300 ASN A HB3  1 
ATOM   2723  H HD21 . ASN A  1 184 ? 82.935  -32.502  -6.541   1.00 357.00 ? 300 ASN A HD21 1 
ATOM   2724  H HD22 . ASN A  1 184 ? 82.735  -32.369  -5.071   1.00 357.00 ? 300 ASN A HD22 1 
ATOM   2725  N N    . ASN A  1 185 ? 83.265  -26.842  -3.540   1.00 205.43 ? 301 ASN A N    1 
ATOM   2726  C CA   . ASN A  1 185 ? 82.678  -26.048  -2.465   1.00 208.36 ? 301 ASN A CA   1 
ATOM   2727  C C    . ASN A  1 185 ? 81.325  -25.477  -2.873   1.00 207.18 ? 301 ASN A C    1 
ATOM   2728  O O    . ASN A  1 185 ? 80.294  -25.819  -2.291   1.00 209.78 ? 301 ASN A O    1 
ATOM   2729  C CB   . ASN A  1 185 ? 83.627  -24.914  -2.064   1.00 208.58 ? 301 ASN A CB   1 
ATOM   2730  C CG   . ASN A  1 185 ? 84.928  -25.421  -1.458   1.00 210.66 ? 301 ASN A CG   1 
ATOM   2731  O OD1  . ASN A  1 185 ? 85.151  -26.626  -1.351   1.00 211.99 ? 301 ASN A OD1  1 
ATOM   2732  N ND2  . ASN A  1 185 ? 85.797  -24.496  -1.062   1.00 211.27 ? 301 ASN A ND2  1 
ATOM   2733  H H    . ASN A  1 185 ? 83.342  -26.416  -4.282   1.00 246.64 ? 301 ASN A H    1 
ATOM   2734  H HA   . ASN A  1 185 ? 82.544  -26.616  -1.690   1.00 253.77 ? 301 ASN A HA   1 
ATOM   2735  H HB2  . ASN A  1 185 ? 83.846  -24.392  -2.851   1.00 250.75 ? 301 ASN A HB2  1 
ATOM   2736  H HB3  . ASN A  1 185 ? 83.188  -24.354  -1.405   1.00 250.75 ? 301 ASN A HB3  1 
ATOM   2737  H HD21 . ASN A  1 185 ? 86.547  -24.731  -0.713   1.00 247.82 ? 301 ASN A HD21 1 
ATOM   2738  H HD22 . ASN A  1 185 ? 85.609  -23.662  -1.155   1.00 247.82 ? 301 ASN A HD22 1 
ATOM   2739  N N    . SER A  1 190 ? 81.392  -28.422  1.876    1.00 218.95 ? 322 SER A N    1 
ATOM   2740  C CA   . SER A  1 190 ? 82.204  -27.249  2.174    1.00 218.41 ? 322 SER A CA   1 
ATOM   2741  C C    . SER A  1 190 ? 81.433  -25.960  1.907    1.00 216.17 ? 322 SER A C    1 
ATOM   2742  O O    . SER A  1 190 ? 81.206  -25.593  0.753    1.00 210.46 ? 322 SER A O    1 
ATOM   2743  C CB   . SER A  1 190 ? 83.490  -27.266  1.345    1.00 213.82 ? 322 SER A CB   1 
ATOM   2744  O OG   . SER A  1 190 ? 84.309  -26.154  1.657    1.00 213.72 ? 322 SER A OG   1 
ATOM   2745  H HA   . SER A  1 190 ? 82.450  -27.264  3.112    1.00 241.37 ? 322 SER A HA   1 
ATOM   2746  H HB2  . SER A  1 190 ? 83.978  -28.082  1.538    1.00 233.17 ? 322 SER A HB2  1 
ATOM   2747  H HB3  . SER A  1 190 ? 83.258  -27.234  0.404    1.00 233.17 ? 322 SER A HB3  1 
ATOM   2748  H HG   . SER A  1 190 ? 85.010  -26.176  1.195    1.00 224.36 ? 322 SER A HG   1 
ATOM   2749  N N    . GLY A  1 191 ? 81.030  -25.281  2.978    1.00 220.47 ? 323 GLY A N    1 
ATOM   2750  C CA   . GLY A  1 191 ? 80.352  -24.003  2.862    1.00 219.32 ? 323 GLY A CA   1 
ATOM   2751  C C    . GLY A  1 191 ? 81.275  -22.977  2.237    1.00 214.78 ? 323 GLY A C    1 
ATOM   2752  O O    . GLY A  1 191 ? 82.036  -22.308  2.940    1.00 217.30 ? 323 GLY A O    1 
ATOM   2753  H H    . GLY A  1 191 ? 81.141  -25.546  3.789    1.00 311.18 ? 323 GLY A H    1 
ATOM   2754  H HA2  . GLY A  1 191 ? 79.563  -24.097  2.305    1.00 307.05 ? 323 GLY A HA2  1 
ATOM   2755  H HA3  . GLY A  1 191 ? 80.082  -23.691  3.740    1.00 307.05 ? 323 GLY A HA3  1 
ATOM   2756  N N    . GLY A  1 192 ? 81.209  -22.851  0.914    1.00 208.46 ? 324 GLY A N    1 
ATOM   2757  C CA   . GLY A  1 192 ? 82.147  -22.015  0.186    1.00 204.13 ? 324 GLY A CA   1 
ATOM   2758  C C    . GLY A  1 192 ? 81.612  -21.418  -1.102   1.00 199.33 ? 324 GLY A C    1 
ATOM   2759  O O    . GLY A  1 192 ? 80.606  -21.866  -1.655   1.00 198.01 ? 324 GLY A O    1 
ATOM   2760  H H    . GLY A  1 192 ? 80.628  -23.243  0.416    1.00 215.00 ? 324 GLY A H    1 
ATOM   2761  H HA2  . GLY A  1 192 ? 82.426  -21.284  0.760    1.00 205.75 ? 324 GLY A HA2  1 
ATOM   2762  H HA3  . GLY A  1 192 ? 82.932  -22.540  -0.032   1.00 205.75 ? 324 GLY A HA3  1 
ATOM   2763  N N    . ASP A  1 193 ? 82.309  -20.390  -1.575   1.00 188.78 ? 325 ASP A N    1 
ATOM   2764  C CA   . ASP A  1 193 ? 81.975  -19.721  -2.825   1.00 184.72 ? 325 ASP A CA   1 
ATOM   2765  C C    . ASP A  1 193 ? 82.347  -20.611  -4.007   1.00 182.06 ? 325 ASP A C    1 
ATOM   2766  O O    . ASP A  1 193 ? 83.515  -20.965  -4.179   1.00 182.78 ? 325 ASP A O    1 
ATOM   2767  C CB   . ASP A  1 193 ? 82.698  -18.369  -2.910   1.00 184.02 ? 325 ASP A CB   1 
ATOM   2768  C CG   . ASP A  1 193 ? 82.256  -17.531  -4.104   1.00 181.05 ? 325 ASP A CG   1 
ATOM   2769  O OD1  . ASP A  1 193 ? 81.106  -17.695  -4.562   1.00 179.56 ? 325 ASP A OD1  1 
ATOM   2770  O OD2  . ASP A  1 193 ? 83.061  -16.697  -4.580   1.00 180.76 ? 325 ASP A OD2  1 
ATOM   2771  H H    . ASP A  1 193 ? 82.996  -20.055  -1.179   1.00 210.51 ? 325 ASP A H    1 
ATOM   2772  H HA   . ASP A  1 193 ? 81.019  -19.557  -2.855   1.00 204.74 ? 325 ASP A HA   1 
ATOM   2773  H HB2  . ASP A  1 193 ? 82.514  -17.861  -2.104   1.00 200.96 ? 325 ASP A HB2  1 
ATOM   2774  H HB3  . ASP A  1 193 ? 83.652  -18.526  -2.991   1.00 200.96 ? 325 ASP A HB3  1 
ATOM   2775  N N    . ILE A  1 194 ? 81.354  -20.983  -4.811   1.00 184.12 ? 326 ILE A N    1 
ATOM   2776  C CA   . ILE A  1 194 ? 81.587  -21.849  -5.967   1.00 182.63 ? 326 ILE A CA   1 
ATOM   2777  C C    . ILE A  1 194 ? 82.344  -21.144  -7.092   1.00 181.06 ? 326 ILE A C    1 
ATOM   2778  O O    . ILE A  1 194 ? 82.645  -21.757  -8.113   1.00 179.94 ? 326 ILE A O    1 
ATOM   2779  C CB   . ILE A  1 194 ? 80.261  -22.396  -6.549   1.00 180.94 ? 326 ILE A CB   1 
ATOM   2780  C CG1  . ILE A  1 194 ? 79.404  -21.258  -7.121   1.00 178.72 ? 326 ILE A CG1  1 
ATOM   2781  C CG2  . ILE A  1 194 ? 79.493  -23.171  -5.487   1.00 183.52 ? 326 ILE A CG2  1 
ATOM   2782  C CD1  . ILE A  1 194 ? 78.245  -21.734  -7.968   1.00 176.88 ? 326 ILE A CD1  1 
ATOM   2783  H H    . ILE A  1 194 ? 80.533  -20.746  -4.710   1.00 320.79 ? 326 ILE A H    1 
ATOM   2784  H HA   . ILE A  1 194 ? 82.120  -22.608  -5.683   1.00 315.83 ? 326 ILE A HA   1 
ATOM   2785  H HB   . ILE A  1 194 ? 80.476  -23.005  -7.272   1.00 317.77 ? 326 ILE A HB   1 
ATOM   2786  H HG12 . ILE A  1 194 ? 79.041  -20.741  -6.385   1.00 313.80 ? 326 ILE A HG12 1 
ATOM   2787  H HG13 . ILE A  1 194 ? 79.965  -20.694  -7.675   1.00 313.80 ? 326 ILE A HG13 1 
ATOM   2788  H HG21 . ILE A  1 194 ? 78.668  -23.503  -5.873   1.00 329.12 ? 326 ILE A HG21 1 
ATOM   2789  H HG22 . ILE A  1 194 ? 80.039  -23.913  -5.182   1.00 329.12 ? 326 ILE A HG22 1 
ATOM   2790  H HG23 . ILE A  1 194 ? 79.296  -22.578  -4.745   1.00 329.12 ? 326 ILE A HG23 1 
ATOM   2791  H HD11 . ILE A  1 194 ? 77.754  -20.962  -8.292   1.00 315.06 ? 326 ILE A HD11 1 
ATOM   2792  H HD12 . ILE A  1 194 ? 78.591  -22.244  -8.717   1.00 315.06 ? 326 ILE A HD12 1 
ATOM   2793  H HD13 . ILE A  1 194 ? 77.666  -22.291  -7.426   1.00 315.06 ? 326 ILE A HD13 1 
ATOM   2794  N N    . ARG A  1 195 ? 82.623  -19.857  -6.911   1.00 173.40 ? 327 ARG A N    1 
ATOM   2795  C CA   . ARG A  1 195 ? 83.353  -19.073  -7.903   1.00 171.98 ? 327 ARG A CA   1 
ATOM   2796  C C    . ARG A  1 195 ? 84.786  -18.797  -7.454   1.00 174.20 ? 327 ARG A C    1 
ATOM   2797  O O    . ARG A  1 195 ? 85.602  -18.298  -8.231   1.00 173.52 ? 327 ARG A O    1 
ATOM   2798  C CB   . ARG A  1 195 ? 82.621  -17.758  -8.180   1.00 170.09 ? 327 ARG A CB   1 
ATOM   2799  C CG   . ARG A  1 195 ? 81.290  -17.945  -8.883   1.00 167.41 ? 327 ARG A CG   1 
ATOM   2800  C CD   . ARG A  1 195 ? 80.594  -16.625  -9.127   1.00 165.58 ? 327 ARG A CD   1 
ATOM   2801  N NE   . ARG A  1 195 ? 79.340  -16.821  -9.838   1.00 163.09 ? 327 ARG A NE   1 
ATOM   2802  C CZ   . ARG A  1 195 ? 78.204  -17.189  -9.255   1.00 164.25 ? 327 ARG A CZ   1 
ATOM   2803  N NH1  . ARG A  1 195 ? 78.160  -17.397  -7.945   1.00 167.77 ? 327 ARG A NH1  1 
ATOM   2804  N NH2  . ARG A  1 195 ? 77.108  -17.349  -9.980   1.00 162.92 ? 327 ARG A NH2  1 
ATOM   2805  H H    . ARG A  1 195 ? 82.397  -19.408  -6.213   1.00 201.30 ? 327 ARG A H    1 
ATOM   2806  H HA   . ARG A  1 195 ? 83.391  -19.574  -8.733   1.00 193.56 ? 327 ARG A HA   1 
ATOM   2807  H HB2  . ARG A  1 195 ? 82.452  -17.309  -7.337   1.00 194.02 ? 327 ARG A HB2  1 
ATOM   2808  H HB3  . ARG A  1 195 ? 83.179  -17.201  -8.744   1.00 194.02 ? 327 ARG A HB3  1 
ATOM   2809  H HG2  . ARG A  1 195 ? 81.439  -18.372  -9.741   1.00 193.22 ? 327 ARG A HG2  1 
ATOM   2810  H HG3  . ARG A  1 195 ? 80.712  -18.495  -8.331   1.00 193.22 ? 327 ARG A HG3  1 
ATOM   2811  H HD2  . ARG A  1 195 ? 80.401  -16.201  -8.276   1.00 196.14 ? 327 ARG A HD2  1 
ATOM   2812  H HD3  . ARG A  1 195 ? 81.165  -16.055  -9.665   1.00 196.14 ? 327 ARG A HD3  1 
ATOM   2813  H HE   . ARG A  1 195 ? 79.348  -16.752  -10.695  1.00 197.73 ? 327 ARG A HE   1 
ATOM   2814  H HH11 . ARG A  1 195 ? 78.870  -17.295  -7.470   1.00 212.70 ? 327 ARG A HH11 1 
ATOM   2815  H HH12 . ARG A  1 195 ? 77.423  -17.634  -7.572   1.00 212.70 ? 327 ARG A HH12 1 
ATOM   2816  H HH21 . ARG A  1 195 ? 77.131  -17.214  -10.829  1.00 207.47 ? 327 ARG A HH21 1 
ATOM   2817  H HH22 . ARG A  1 195 ? 76.373  -17.585  -9.602   1.00 207.47 ? 327 ARG A HH22 1 
ATOM   2818  N N    . GLN A  1 196 ? 85.091  -19.129  -6.203   1.00 172.78 ? 328 GLN A N    1 
ATOM   2819  C CA   . GLN A  1 196 ? 86.438  -18.944  -5.674   1.00 174.92 ? 328 GLN A CA   1 
ATOM   2820  C C    . GLN A  1 196 ? 87.361  -20.051  -6.158   1.00 175.08 ? 328 GLN A C    1 
ATOM   2821  O O    . GLN A  1 196 ? 87.123  -21.234  -5.910   1.00 175.31 ? 328 GLN A O    1 
ATOM   2822  C CB   . GLN A  1 196 ? 86.426  -18.901  -4.145   1.00 177.31 ? 328 GLN A CB   1 
ATOM   2823  C CG   . GLN A  1 196 ? 86.284  -17.498  -3.576   1.00 178.15 ? 328 GLN A CG   1 
ATOM   2824  C CD   . GLN A  1 196 ? 86.130  -17.482  -2.067   1.00 180.78 ? 328 GLN A CD   1 
ATOM   2825  O OE1  . GLN A  1 196 ? 86.697  -18.318  -1.363   1.00 182.48 ? 328 GLN A OE1  1 
ATOM   2826  N NE2  . GLN A  1 196 ? 85.355  -16.529  -1.562   1.00 181.19 ? 328 GLN A NE2  1 
ATOM   2827  H H    . GLN A  1 196 ? 84.535  -19.464  -5.639   1.00 170.26 ? 328 GLN A H    1 
ATOM   2828  H HA   . GLN A  1 196 ? 86.789  -18.099  -5.995   1.00 169.27 ? 328 GLN A HA   1 
ATOM   2829  H HB2  . GLN A  1 196 ? 85.679  -19.430  -3.822   1.00 177.21 ? 328 GLN A HB2  1 
ATOM   2830  H HB3  . GLN A  1 196 ? 87.259  -19.272  -3.815   1.00 177.21 ? 328 GLN A HB3  1 
ATOM   2831  H HG2  . GLN A  1 196 ? 87.075  -16.985  -3.802   1.00 182.10 ? 328 GLN A HG2  1 
ATOM   2832  H HG3  . GLN A  1 196 ? 85.498  -17.080  -3.961   1.00 182.10 ? 328 GLN A HG3  1 
ATOM   2833  H HE21 . GLN A  1 196 ? 85.235  -16.477  -0.712   1.00 195.56 ? 328 GLN A HE21 1 
ATOM   2834  H HE22 . GLN A  1 196 ? 84.973  -15.964  -2.086   1.00 195.56 ? 328 GLN A HE22 1 
ATOM   2835  N N    . ALA A  1 197 ? 88.415  -19.644  -6.855   1.00 176.63 ? 329 ALA A N    1 
ATOM   2836  C CA   . ALA A  1 197 ? 89.428  -20.560  -7.354   1.00 176.54 ? 329 ALA A CA   1 
ATOM   2837  C C    . ALA A  1 197 ? 90.797  -19.929  -7.143   1.00 177.23 ? 329 ALA A C    1 
ATOM   2838  O O    . ALA A  1 197 ? 90.892  -18.750  -6.799   1.00 178.00 ? 329 ALA A O    1 
ATOM   2839  C CB   . ALA A  1 197 ? 89.197  -20.870  -8.821   1.00 174.59 ? 329 ALA A CB   1 
ATOM   2840  H H    . ALA A  1 197 ? 88.566  -18.822  -7.056   1.00 298.17 ? 329 ALA A H    1 
ATOM   2841  H HA   . ALA A  1 197 ? 89.390  -21.390  -6.853   1.00 295.95 ? 329 ALA A HA   1 
ATOM   2842  H HB1  . ALA A  1 197 ? 89.885  -21.481  -9.127   1.00 289.58 ? 329 ALA A HB1  1 
ATOM   2843  H HB2  . ALA A  1 197 ? 88.323  -21.278  -8.923   1.00 289.58 ? 329 ALA A HB2  1 
ATOM   2844  H HB3  . ALA A  1 197 ? 89.238  -20.044  -9.328   1.00 289.58 ? 329 ALA A HB3  1 
ATOM   2845  N N    . HIS A  1 198 ? 91.851  -20.714  -7.342   1.00 182.35 ? 330 HIS A N    1 
ATOM   2846  C CA   . HIS A  1 198 ? 93.216  -20.229  -7.159   1.00 182.14 ? 330 HIS A CA   1 
ATOM   2847  C C    . HIS A  1 198 ? 94.165  -20.882  -8.153   1.00 179.23 ? 330 HIS A C    1 
ATOM   2848  O O    . HIS A  1 198 ? 93.897  -21.975  -8.651   1.00 178.10 ? 330 HIS A O    1 
ATOM   2849  C CB   . HIS A  1 198 ? 93.701  -20.494  -5.730   1.00 184.37 ? 330 HIS A CB   1 
ATOM   2850  C CG   . HIS A  1 198 ? 92.857  -19.848  -4.674   1.00 186.65 ? 330 HIS A CG   1 
ATOM   2851  N ND1  . HIS A  1 198 ? 93.071  -18.559  -4.235   1.00 187.80 ? 330 HIS A ND1  1 
ATOM   2852  C CD2  . HIS A  1 198 ? 91.795  -20.313  -3.972   1.00 187.70 ? 330 HIS A CD2  1 
ATOM   2853  C CE1  . HIS A  1 198 ? 92.178  -18.258  -3.308   1.00 189.41 ? 330 HIS A CE1  1 
ATOM   2854  N NE2  . HIS A  1 198 ? 91.393  -19.305  -3.130   1.00 189.27 ? 330 HIS A NE2  1 
ATOM   2855  H H    . HIS A  1 198 ? 91.802  -21.538  -7.586   1.00 321.02 ? 330 HIS A H    1 
ATOM   2856  H HA   . HIS A  1 198 ? 93.234  -19.271  -7.311   1.00 321.05 ? 330 HIS A HA   1 
ATOM   2857  H HB2  . HIS A  1 198 ? 93.695  -21.451  -5.570   1.00 329.11 ? 330 HIS A HB2  1 
ATOM   2858  H HB3  . HIS A  1 198 ? 94.604  -20.152  -5.638   1.00 329.11 ? 330 HIS A HB3  1 
ATOM   2859  H HD1  . HIS A  1 198 ? 93.688  -18.033  -4.519   1.00 331.61 ? 330 HIS A HD1  1 
ATOM   2860  H HD2  . HIS A  1 198 ? 91.411  -21.156  -4.047   1.00 338.58 ? 330 HIS A HD2  1 
ATOM   2861  H HE1  . HIS A  1 198 ? 92.115  -17.447  -2.857   1.00 336.84 ? 330 HIS A HE1  1 
ATOM   2862  H HE2  . HIS A  1 198 ? 90.736  -19.348  -2.576   1.00 340.75 ? 330 HIS A HE2  1 
ATOM   2863  N N    . CYS A  1 199 ? 95.274  -20.202  -8.431   1.00 174.20 ? 331 CYS A N    1 
ATOM   2864  C CA   . CYS A  1 199 ? 96.307  -20.721  -9.321   1.00 170.88 ? 331 CYS A CA   1 
ATOM   2865  C C    . CYS A  1 199 ? 97.640  -20.827  -8.586   1.00 171.70 ? 331 CYS A C    1 
ATOM   2866  O O    . CYS A  1 199 ? 98.033  -19.909  -7.866   1.00 173.36 ? 331 CYS A O    1 
ATOM   2867  C CB   . CYS A  1 199 ? 96.455  -19.828  -10.557  1.00 167.40 ? 331 CYS A CB   1 
ATOM   2868  S SG   . CYS A  1 199 ? 95.041  -19.858  -11.686  1.00 165.52 ? 331 CYS A SG   1 
ATOM   2869  H HA   . CYS A  1 199 ? 96.054  -21.609  -9.618   1.00 166.38 ? 331 CYS A HA   1 
ATOM   2870  H HB2  . CYS A  1 199 ? 96.577  -18.912  -10.263  1.00 158.88 ? 331 CYS A HB2  1 
ATOM   2871  H HB3  . CYS A  1 199 ? 97.235  -20.118  -11.055  1.00 158.88 ? 331 CYS A HB3  1 
ATOM   2872  N N    . ASN A  1 200 ? 98.322  -21.955  -8.771   1.00 167.90 ? 332 ASN A N    1 
ATOM   2873  C CA   . ASN A  1 200 ? 99.613  -22.200  -8.139   1.00 168.85 ? 332 ASN A CA   1 
ATOM   2874  C C    . ASN A  1 200 ? 100.721 -22.344  -9.170   1.00 165.81 ? 332 ASN A C    1 
ATOM   2875  O O    . ASN A  1 200 ? 100.562 -23.030  -10.180  1.00 163.54 ? 332 ASN A O    1 
ATOM   2876  C CB   . ASN A  1 200 ? 99.554  -23.457  -7.267   1.00 171.36 ? 332 ASN A CB   1 
ATOM   2877  C CG   . ASN A  1 200 ? 98.685  -23.275  -6.036   1.00 174.68 ? 332 ASN A CG   1 
ATOM   2878  O OD1  . ASN A  1 200 ? 98.718  -22.231  -5.387   1.00 176.17 ? 332 ASN A OD1  1 
ATOM   2879  N ND2  . ASN A  1 200 ? 97.897  -24.295  -5.711   1.00 175.90 ? 332 ASN A ND2  1 
ATOM   2880  H H    . ASN A  1 200 ? 98.052  -22.603  -9.268   1.00 180.24 ? 332 ASN A H    1 
ATOM   2881  H HA   . ASN A  1 200 ? 99.832  -21.448  -7.567   1.00 187.90 ? 332 ASN A HA   1 
ATOM   2882  H HB2  . ASN A  1 200 ? 99.187  -24.187  -7.789   1.00 197.63 ? 332 ASN A HB2  1 
ATOM   2883  H HB3  . ASN A  1 200 ? 100.451 -23.678  -6.971   1.00 197.63 ? 332 ASN A HB3  1 
ATOM   2884  H HD21 . ASN A  1 200 ? 97.386  -24.240  -5.022   1.00 217.09 ? 332 ASN A HD21 1 
ATOM   2885  H HD22 . ASN A  1 200 ? 97.899  -25.010  -6.189   1.00 217.09 ? 332 ASN A HD22 1 
ATOM   2886  N N    . VAL A  1 201 ? 101.839 -21.674  -8.910   1.00 169.62 ? 333 VAL A N    1 
ATOM   2887  C CA   . VAL A  1 201 ? 103.029 -21.783  -9.744   1.00 167.27 ? 333 VAL A CA   1 
ATOM   2888  C C    . VAL A  1 201 ? 104.258 -21.735  -8.848   1.00 171.49 ? 333 VAL A C    1 
ATOM   2889  O O    . VAL A  1 201 ? 104.254 -21.074  -7.809   1.00 174.73 ? 333 VAL A O    1 
ATOM   2890  C CB   . VAL A  1 201 ? 103.109 -20.656  -10.796  1.00 164.11 ? 333 VAL A CB   1 
ATOM   2891  C CG1  . VAL A  1 201 ? 104.325 -20.842  -11.697  1.00 162.20 ? 333 VAL A CG1  1 
ATOM   2892  C CG2  . VAL A  1 201 ? 101.846 -20.618  -11.635  1.00 161.94 ? 333 VAL A CG2  1 
ATOM   2893  H H    . VAL A  1 201 ? 101.933 -21.140  -8.243   1.00 140.42 ? 333 VAL A H    1 
ATOM   2894  H HA   . VAL A  1 201 ? 103.021 -22.635  -10.207  1.00 141.37 ? 333 VAL A HA   1 
ATOM   2895  H HB   . VAL A  1 201 ? 103.197 -19.803  -10.343  1.00 132.04 ? 333 VAL A HB   1 
ATOM   2896  H HG11 . VAL A  1 201 ? 104.349 -20.122  -12.346  1.00 134.38 ? 333 VAL A HG11 1 
ATOM   2897  H HG12 . VAL A  1 201 ? 105.127 -20.824  -11.152  1.00 134.38 ? 333 VAL A HG12 1 
ATOM   2898  H HG13 . VAL A  1 201 ? 104.252 -21.696  -12.152  1.00 134.38 ? 333 VAL A HG13 1 
ATOM   2899  H HG21 . VAL A  1 201 ? 101.921 -19.903  -12.286  1.00 124.33 ? 333 VAL A HG21 1 
ATOM   2900  H HG22 . VAL A  1 201 ? 101.742 -21.469  -12.088  1.00 124.33 ? 333 VAL A HG22 1 
ATOM   2901  H HG23 . VAL A  1 201 ? 101.086 -20.457  -11.053  1.00 124.33 ? 333 VAL A HG23 1 
ATOM   2902  N N    . SER A  1 202 ? 105.308 -22.441  -9.251   1.00 177.40 ? 334 SER A N    1 
ATOM   2903  C CA   . SER A  1 202 ? 106.548 -22.459  -8.489   1.00 182.92 ? 334 SER A CA   1 
ATOM   2904  C C    . SER A  1 202 ? 107.143 -21.060  -8.396   1.00 183.45 ? 334 SER A C    1 
ATOM   2905  O O    . SER A  1 202 ? 107.440 -20.430  -9.412   1.00 180.08 ? 334 SER A O    1 
ATOM   2906  C CB   . SER A  1 202 ? 107.556 -23.423  -9.122   1.00 184.05 ? 334 SER A CB   1 
ATOM   2907  O OG   . SER A  1 202 ? 108.855 -23.235  -8.584   1.00 189.05 ? 334 SER A OG   1 
ATOM   2908  H H    . SER A  1 202 ? 105.326 -22.921  -9.964   1.00 124.16 ? 334 SER A H    1 
ATOM   2909  H HA   . SER A  1 202 ? 106.363 -22.767  -7.588   1.00 133.95 ? 334 SER A HA   1 
ATOM   2910  H HB2  . SER A  1 202 ? 107.272 -24.334  -8.948   1.00 140.55 ? 334 SER A HB2  1 
ATOM   2911  H HB3  . SER A  1 202 ? 107.586 -23.263  -10.079  1.00 140.55 ? 334 SER A HB3  1 
ATOM   2912  H HG   . SER A  1 202 ? 109.395 -23.770  -8.941   1.00 133.26 ? 334 SER A HG   1 
ATOM   2913  N N    . GLY A  1 203 ? 107.298 -20.574  -7.169   1.00 183.89 ? 335 GLY A N    1 
ATOM   2914  C CA   . GLY A  1 203 ? 107.921 -19.287  -6.934   1.00 185.47 ? 335 GLY A CA   1 
ATOM   2915  C C    . GLY A  1 203 ? 109.375 -19.303  -7.364   1.00 187.55 ? 335 GLY A C    1 
ATOM   2916  O O    . GLY A  1 203 ? 109.851 -18.368  -8.004   1.00 185.94 ? 335 GLY A O    1 
ATOM   2917  H H    . GLY A  1 203 ? 107.048 -20.978  -6.453   1.00 314.81 ? 335 GLY A H    1 
ATOM   2918  H HA2  . GLY A  1 203 ? 107.455 -18.600  -7.435   1.00 314.73 ? 335 GLY A HA2  1 
ATOM   2919  H HA3  . GLY A  1 203 ? 107.877 -19.068  -5.990   1.00 314.73 ? 335 GLY A HA3  1 
ATOM   2920  N N    . SER A  1 204 ? 110.078 -20.377  -7.018   1.00 188.66 ? 336 SER A N    1 
ATOM   2921  C CA   . SER A  1 204 ? 111.497 -20.511  -7.333   1.00 191.57 ? 336 SER A CA   1 
ATOM   2922  C C    . SER A  1 204 ? 111.759 -20.604  -8.837   1.00 186.91 ? 336 SER A C    1 
ATOM   2923  O O    . SER A  1 204 ? 112.681 -19.972  -9.354   1.00 187.37 ? 336 SER A O    1 
ATOM   2924  C CB   . SER A  1 204 ? 112.073 -21.742  -6.633   1.00 196.93 ? 336 SER A CB   1 
ATOM   2925  O OG   . SER A  1 204 ? 111.278 -22.888  -6.887   1.00 194.73 ? 336 SER A OG   1 
ATOM   2926  H H    . SER A  1 204 ? 109.751 -21.051  -6.595   1.00 190.70 ? 336 SER A H    1 
ATOM   2927  H HA   . SER A  1 204 ? 111.967 -19.731  -6.998   1.00 196.11 ? 336 SER A HA   1 
ATOM   2928  H HB2  . SER A  1 204 ? 112.971 -21.902  -6.964   1.00 209.67 ? 336 SER A HB2  1 
ATOM   2929  H HB3  . SER A  1 204 ? 112.096 -21.579  -5.677   1.00 209.67 ? 336 SER A HB3  1 
ATOM   2930  H HG   . SER A  1 204 ? 111.605 -23.556  -6.497   1.00 209.85 ? 336 SER A HG   1 
ATOM   2931  N N    . GLN A  1 205 ? 110.950 -21.402  -9.528   1.00 192.80 ? 337 GLN A N    1 
ATOM   2932  C CA   . GLN A  1 205 ? 111.047 -21.539  -10.979  1.00 188.29 ? 337 GLN A CA   1 
ATOM   2933  C C    . GLN A  1 205 ? 110.832 -20.197  -11.661  1.00 184.35 ? 337 GLN A C    1 
ATOM   2934  O O    . GLN A  1 205 ? 111.521 -19.853  -12.619  1.00 183.03 ? 337 GLN A O    1 
ATOM   2935  C CB   . GLN A  1 205 ? 110.013 -22.546  -11.494  1.00 184.66 ? 337 GLN A CB   1 
ATOM   2936  C CG   . GLN A  1 205 ? 109.914 -22.637  -13.016  1.00 179.70 ? 337 GLN A CG   1 
ATOM   2937  C CD   . GLN A  1 205 ? 108.810 -23.570  -13.478  1.00 176.36 ? 337 GLN A CD   1 
ATOM   2938  O OE1  . GLN A  1 205 ? 107.951 -23.975  -12.693  1.00 177.00 ? 337 GLN A OE1  1 
ATOM   2939  N NE2  . GLN A  1 205 ? 108.824 -23.908  -14.762  1.00 173.04 ? 337 GLN A NE2  1 
ATOM   2940  H H    . GLN A  1 205 ? 110.329 -21.882  -9.176   1.00 191.95 ? 337 GLN A H    1 
ATOM   2941  H HA   . GLN A  1 205 ? 111.931 -21.862  -11.213  1.00 185.11 ? 337 GLN A HA   1 
ATOM   2942  H HB2  . GLN A  1 205 ? 110.247 -23.427  -11.162  1.00 183.81 ? 337 GLN A HB2  1 
ATOM   2943  H HB3  . GLN A  1 205 ? 109.139 -22.292  -11.158  1.00 183.81 ? 337 GLN A HB3  1 
ATOM   2944  H HG2  . GLN A  1 205 ? 109.730 -21.755  -13.374  1.00 172.29 ? 337 GLN A HG2  1 
ATOM   2945  H HG3  . GLN A  1 205 ? 110.754 -22.970  -13.368  1.00 172.29 ? 337 GLN A HG3  1 
ATOM   2946  H HE21 . GLN A  1 205 ? 108.220 -24.434  -15.074  1.00 163.09 ? 337 GLN A HE21 1 
ATOM   2947  H HE22 . GLN A  1 205 ? 109.437 -23.600  -15.281  1.00 163.09 ? 337 GLN A HE22 1 
ATOM   2948  N N    . TRP A  1 206 ? 109.858 -19.450  -11.158  1.00 184.69 ? 338 TRP A N    1 
ATOM   2949  C CA   . TRP A  1 206 ? 109.449 -18.205  -11.784  1.00 180.85 ? 338 TRP A CA   1 
ATOM   2950  C C    . TRP A  1 206 ? 110.424 -17.060  -11.507  1.00 183.88 ? 338 TRP A C    1 
ATOM   2951  O O    . TRP A  1 206 ? 110.581 -16.163  -12.337  1.00 181.36 ? 338 TRP A O    1 
ATOM   2952  C CB   . TRP A  1 206 ? 108.051 -17.825  -11.309  1.00 178.66 ? 338 TRP A CB   1 
ATOM   2953  C CG   . TRP A  1 206 ? 107.535 -16.575  -11.927  1.00 175.14 ? 338 TRP A CG   1 
ATOM   2954  C CD1  . TRP A  1 206 ? 106.884 -16.454  -13.121  1.00 170.73 ? 338 TRP A CD1  1 
ATOM   2955  C CD2  . TRP A  1 206 ? 107.626 -15.257  -11.383  1.00 176.89 ? 338 TRP A CD2  1 
ATOM   2956  N NE1  . TRP A  1 206 ? 106.563 -15.139  -13.352  1.00 169.72 ? 338 TRP A NE1  1 
ATOM   2957  C CE2  . TRP A  1 206 ? 107.008 -14.384  -12.299  1.00 173.34 ? 338 TRP A CE2  1 
ATOM   2958  C CE3  . TRP A  1 206 ? 108.169 -14.730  -10.208  1.00 181.91 ? 338 TRP A CE3  1 
ATOM   2959  C CZ2  . TRP A  1 206 ? 106.920 -13.016  -12.076  1.00 174.24 ? 338 TRP A CZ2  1 
ATOM   2960  C CZ3  . TRP A  1 206 ? 108.080 -13.371  -9.989   1.00 182.56 ? 338 TRP A CZ3  1 
ATOM   2961  C CH2  . TRP A  1 206 ? 107.457 -12.530  -10.915  1.00 178.51 ? 338 TRP A CH2  1 
ATOM   2962  H H    . TRP A  1 206 ? 109.416 -19.645  -10.447  1.00 380.54 ? 338 TRP A H    1 
ATOM   2963  H HA   . TRP A  1 206 ? 109.411 -18.336  -12.745  1.00 376.12 ? 338 TRP A HA   1 
ATOM   2964  H HB2  . TRP A  1 206 ? 107.438 -18.543  -11.533  1.00 374.63 ? 338 TRP A HB2  1 
ATOM   2965  H HB3  . TRP A  1 206 ? 108.071 -17.696  -10.348  1.00 374.63 ? 338 TRP A HB3  1 
ATOM   2966  H HD1  . TRP A  1 206 ? 106.687 -17.159  -13.694  1.00 374.57 ? 338 TRP A HD1  1 
ATOM   2967  H HE1  . TRP A  1 206 ? 106.150 -14.838  -14.044  1.00 371.88 ? 338 TRP A HE1  1 
ATOM   2968  H HE3  . TRP A  1 206 ? 108.582 -15.284  -9.586   1.00 357.78 ? 338 TRP A HE3  1 
ATOM   2969  H HZ2  . TRP A  1 206 ? 106.507 -12.452  -12.690  1.00 356.44 ? 338 TRP A HZ2  1 
ATOM   2970  H HZ3  . TRP A  1 206 ? 108.437 -13.009  -9.210   1.00 350.28 ? 338 TRP A HZ3  1 
ATOM   2971  H HH2  . TRP A  1 206 ? 107.414 -11.617  -10.742  1.00 349.58 ? 338 TRP A HH2  1 
ATOM   2972  N N    . ASN A  1 207 ? 111.086 -17.093  -10.352  1.00 188.18 ? 339 ASN A N    1 
ATOM   2973  C CA   . ASN A  1 207 ? 112.070 -16.067  -9.999   1.00 191.91 ? 339 ASN A CA   1 
ATOM   2974  C C    . ASN A  1 207 ? 113.407 -16.265  -10.722  1.00 193.52 ? 339 ASN A C    1 
ATOM   2975  O O    . ASN A  1 207 ? 114.458 -15.843  -10.235  1.00 198.39 ? 339 ASN A O    1 
ATOM   2976  C CB   . ASN A  1 207 ? 112.297 -16.045  -8.480   1.00 197.97 ? 339 ASN A CB   1 
ATOM   2977  C CG   . ASN A  1 207 ? 111.154 -15.381  -7.725   1.00 197.33 ? 339 ASN A CG   1 
ATOM   2978  O OD1  . ASN A  1 207 ? 111.031 -14.155  -7.717   1.00 196.93 ? 339 ASN A OD1  1 
ATOM   2979  N ND2  . ASN A  1 207 ? 110.330 -16.188  -7.067   1.00 197.68 ? 339 ASN A ND2  1 
ATOM   2980  H H    . ASN A  1 207 ? 110.985 -17.701  -9.753   1.00 328.37 ? 339 ASN A H    1 
ATOM   2981  H HA   . ASN A  1 207 ? 111.721 -15.200  -10.258  1.00 334.17 ? 339 ASN A HA   1 
ATOM   2982  H HB2  . ASN A  1 207 ? 112.379 -16.957  -8.159   1.00 344.66 ? 339 ASN A HB2  1 
ATOM   2983  H HB3  . ASN A  1 207 ? 113.110 -15.552  -8.288   1.00 344.66 ? 339 ASN A HB3  1 
ATOM   2984  H HD21 . ASN A  1 207 ? 109.669 -15.860  -6.626   1.00 349.20 ? 339 ASN A HD21 1 
ATOM   2985  H HD22 . ASN A  1 207 ? 110.457 -17.039  -7.083   1.00 349.20 ? 339 ASN A HD22 1 
ATOM   2986  N N    . LYS A  1 208 ? 113.360 -16.917  -11.881  1.00 189.94 ? 340 LYS A N    1 
ATOM   2987  C CA   . LYS A  1 208 ? 114.529 -17.088  -12.737  1.00 191.00 ? 340 LYS A CA   1 
ATOM   2988  C C    . LYS A  1 208 ? 114.179 -16.755  -14.185  1.00 185.34 ? 340 LYS A C    1 
ATOM   2989  O O    . LYS A  1 208 ? 115.052 -16.401  -14.975  1.00 185.74 ? 340 LYS A O    1 
ATOM   2990  C CB   . LYS A  1 208 ? 115.064 -18.515  -12.627  1.00 193.81 ? 340 LYS A CB   1 
ATOM   2991  C CG   . LYS A  1 208 ? 115.567 -18.861  -11.236  1.00 200.17 ? 340 LYS A CG   1 
ATOM   2992  C CD   . LYS A  1 208 ? 116.006 -20.309  -11.133  1.00 203.04 ? 340 LYS A CD   1 
ATOM   2993  C CE   . LYS A  1 208 ? 116.541 -20.612  -9.744   1.00 209.83 ? 340 LYS A CE   1 
ATOM   2994  N NZ   . LYS A  1 208 ? 116.809 -22.060  -9.540   1.00 212.81 ? 340 LYS A NZ   1 
ATOM   2995  H H    . LYS A  1 208 ? 112.647 -17.277  -12.198  1.00 193.05 ? 340 LYS A H    1 
ATOM   2996  H HA   . LYS A  1 208 ? 115.227 -16.480  -12.448  1.00 195.91 ? 340 LYS A HA   1 
ATOM   2997  H HB2  . LYS A  1 208 ? 114.353 -19.135  -12.851  1.00 202.42 ? 340 LYS A HB2  1 
ATOM   2998  H HB3  . LYS A  1 208 ? 115.803 -18.622  -13.247  1.00 202.42 ? 340 LYS A HB3  1 
ATOM   2999  H HG2  . LYS A  1 208 ? 116.328 -18.299  -11.024  1.00 215.26 ? 340 LYS A HG2  1 
ATOM   3000  H HG3  . LYS A  1 208 ? 114.854 -18.715  -10.595  1.00 215.26 ? 340 LYS A HG3  1 
ATOM   3001  H HD2  . LYS A  1 208 ? 115.248 -20.890  -11.302  1.00 223.26 ? 340 LYS A HD2  1 
ATOM   3002  H HD3  . LYS A  1 208 ? 116.712 -20.479  -11.776  1.00 223.26 ? 340 LYS A HD3  1 
ATOM   3003  H HE2  . LYS A  1 208 ? 117.373 -20.131  -9.614   1.00 237.45 ? 340 LYS A HE2  1 
ATOM   3004  H HE3  . LYS A  1 208 ? 115.887 -20.331  -9.085   1.00 237.45 ? 340 LYS A HE3  1 
ATOM   3005  H HZ1  . LYS A  1 208 ? 117.120 -22.198  -8.718   1.00 247.41 ? 340 LYS A HZ1  1 
ATOM   3006  H HZ2  . LYS A  1 208 ? 116.058 -22.526  -9.647   1.00 247.41 ? 340 LYS A HZ2  1 
ATOM   3007  H HZ3  . LYS A  1 208 ? 117.412 -22.343  -10.129  1.00 247.41 ? 340 LYS A HZ3  1 
ATOM   3008  N N    . THR A  1 209 ? 112.900 -16.875  -14.530  1.00 186.62 ? 341 THR A N    1 
ATOM   3009  C CA   . THR A  1 209 ? 112.432 -16.482  -15.852  1.00 181.30 ? 341 THR A CA   1 
ATOM   3010  C C    . THR A  1 209 ? 112.549 -14.970  -16.032  1.00 180.77 ? 341 THR A C    1 
ATOM   3011  O O    . THR A  1 209 ? 113.082 -14.509  -17.037  1.00 179.59 ? 341 THR A O    1 
ATOM   3012  C CB   . THR A  1 209 ? 110.977 -16.915  -16.092  1.00 176.61 ? 341 THR A CB   1 
ATOM   3013  O OG1  . THR A  1 209 ? 110.209 -16.692  -14.905  1.00 177.76 ? 341 THR A OG1  1 
ATOM   3014  C CG2  . THR A  1 209 ? 110.909 -18.386  -16.459  1.00 176.09 ? 341 THR A CG2  1 
ATOM   3015  H H    . THR A  1 209 ? 112.284 -17.183  -14.015  1.00 335.75 ? 341 THR A H    1 
ATOM   3016  H HA   . THR A  1 209 ? 112.987 -16.909  -16.524  1.00 326.54 ? 341 THR A HA   1 
ATOM   3017  H HB   . THR A  1 209 ? 110.602 -16.398  -16.823  1.00 317.87 ? 341 THR A HB   1 
ATOM   3018  H HG1  . THR A  1 209 ? 109.412 -16.927  -15.030  1.00 315.99 ? 341 THR A HG1  1 
ATOM   3019  H HG21 . THR A  1 209 ? 109.988 -18.648  -16.608  1.00 322.14 ? 341 THR A HG21 1 
ATOM   3020  H HG22 . THR A  1 209 ? 111.419 -18.550  -17.268  1.00 322.14 ? 341 THR A HG22 1 
ATOM   3021  H HG23 . THR A  1 209 ? 111.278 -18.923  -15.740  1.00 322.14 ? 341 THR A HG23 1 
ATOM   3022  N N    . LEU A  1 210 ? 112.051 -14.202  -15.065  1.00 182.50 ? 342 LEU A N    1 
ATOM   3023  C CA   . LEU A  1 210 ? 112.208 -12.749  -15.097  1.00 182.90 ? 342 LEU A CA   1 
ATOM   3024  C C    . LEU A  1 210 ? 113.681 -12.365  -15.144  1.00 187.24 ? 342 LEU A C    1 
ATOM   3025  O O    . LEU A  1 210 ? 114.067 -11.437  -15.855  1.00 186.60 ? 342 LEU A O    1 
ATOM   3026  C CB   . LEU A  1 210 ? 111.560 -12.088  -13.880  1.00 184.73 ? 342 LEU A CB   1 
ATOM   3027  C CG   . LEU A  1 210 ? 110.037 -11.957  -13.804  1.00 181.10 ? 342 LEU A CG   1 
ATOM   3028  C CD1  . LEU A  1 210 ? 109.692 -11.039  -12.653  1.00 184.00 ? 342 LEU A CD1  1 
ATOM   3029  C CD2  . LEU A  1 210 ? 109.424 -11.431  -15.093  1.00 176.51 ? 342 LEU A CD2  1 
ATOM   3030  H H    . LEU A  1 210 ? 111.620 -14.496  -14.381  1.00 207.78 ? 342 LEU A H    1 
ATOM   3031  H HA   . LEU A  1 210 ? 111.780 -12.400  -15.895  1.00 206.69 ? 342 LEU A HA   1 
ATOM   3032  H HB2  . LEU A  1 210 ? 111.832 -12.590  -13.096  1.00 208.06 ? 342 LEU A HB2  1 
ATOM   3033  H HB3  . LEU A  1 210 ? 111.917 -11.188  -13.813  1.00 208.06 ? 342 LEU A HB3  1 
ATOM   3034  H HG   . LEU A  1 210 ? 109.652 -12.829  -13.621  1.00 201.57 ? 342 LEU A HG   1 
ATOM   3035  H HD11 . LEU A  1 210 ? 108.728 -10.951  -12.598  1.00 205.13 ? 342 LEU A HD11 1 
ATOM   3036  H HD12 . LEU A  1 210 ? 110.037 -11.420  -11.831  1.00 205.13 ? 342 LEU A HD12 1 
ATOM   3037  H HD13 . LEU A  1 210 ? 110.095 -10.171  -12.810  1.00 205.13 ? 342 LEU A HD13 1 
ATOM   3038  H HD21 . LEU A  1 210 ? 108.462 -11.371  -14.982  1.00 192.67 ? 342 LEU A HD21 1 
ATOM   3039  H HD22 . LEU A  1 210 ? 109.791 -10.553  -15.281  1.00 192.67 ? 342 LEU A HD22 1 
ATOM   3040  H HD23 . LEU A  1 210 ? 109.637 -12.041  -15.816  1.00 192.67 ? 342 LEU A HD23 1 
ATOM   3041  N N    . HIS A  1 211 ? 114.498 -13.089  -14.382  1.00 188.38 ? 343 HIS A N    1 
ATOM   3042  C CA   . HIS A  1 211 ? 115.934 -12.819  -14.297  1.00 193.37 ? 343 HIS A CA   1 
ATOM   3043  C C    . HIS A  1 211 ? 116.638 -12.929  -15.654  1.00 191.85 ? 343 HIS A C    1 
ATOM   3044  O O    . HIS A  1 211 ? 117.799 -12.534  -15.787  1.00 195.59 ? 343 HIS A O    1 
ATOM   3045  C CB   . HIS A  1 211 ? 116.595 -13.777  -13.295  1.00 198.65 ? 343 HIS A CB   1 
ATOM   3046  C CG   . HIS A  1 211 ? 116.206 -13.535  -11.867  1.00 201.83 ? 343 HIS A CG   1 
ATOM   3047  N ND1  . HIS A  1 211 ? 115.065 -12.848  -11.507  1.00 199.24 ? 343 HIS A ND1  1 
ATOM   3048  C CD2  . HIS A  1 211 ? 116.812 -13.889  -10.708  1.00 207.77 ? 343 HIS A CD2  1 
ATOM   3049  C CE1  . HIS A  1 211 ? 114.985 -12.791  -10.189  1.00 203.44 ? 343 HIS A CE1  1 
ATOM   3050  N NE2  . HIS A  1 211 ? 116.032 -13.416  -9.680   1.00 208.64 ? 343 HIS A NE2  1 
ATOM   3051  H H    . HIS A  1 211 ? 114.242 -13.751  -13.898  1.00 401.08 ? 343 HIS A H    1 
ATOM   3052  H HA   . HIS A  1 211 ? 116.062 -11.914  -13.970  1.00 404.48 ? 343 HIS A HA   1 
ATOM   3053  H HB2  . HIS A  1 211 ? 116.343 -14.686  -13.520  1.00 410.20 ? 343 HIS A HB2  1 
ATOM   3054  H HB3  . HIS A  1 211 ? 117.558 -13.679  -13.360  1.00 410.20 ? 343 HIS A HB3  1 
ATOM   3055  H HD2  . HIS A  1 211 ? 117.606 -14.365  -10.623  1.00 413.72 ? 343 HIS A HD2  1 
ATOM   3056  H HE1  . HIS A  1 211 ? 114.306 -12.382  -9.702   1.00 415.58 ? 343 HIS A HE1  1 
ATOM   3057  H HE2  . HIS A  1 211 ? 116.199 -13.510  -8.842   1.00 415.56 ? 343 HIS A HE2  1 
ATOM   3058  N N    . GLN A  1 212 ? 115.937 -13.474  -16.648  1.00 189.57 ? 344 GLN A N    1 
ATOM   3059  C CA   . GLN A  1 212 ? 116.470 -13.615  -18.002  1.00 187.87 ? 344 GLN A CA   1 
ATOM   3060  C C    . GLN A  1 212 ? 115.760 -12.695  -18.998  1.00 182.98 ? 344 GLN A C    1 
ATOM   3061  O O    . GLN A  1 212 ? 116.377 -12.214  -19.949  1.00 182.86 ? 344 GLN A O    1 
ATOM   3062  C CB   . GLN A  1 212 ? 116.360 -15.071  -18.458  1.00 186.57 ? 344 GLN A CB   1 
ATOM   3063  C CG   . GLN A  1 212 ? 117.143 -16.044  -17.585  1.00 191.79 ? 344 GLN A CG   1 
ATOM   3064  C CD   . GLN A  1 212 ? 118.611 -15.678  -17.470  1.00 197.30 ? 344 GLN A CD   1 
ATOM   3065  O OE1  . GLN A  1 212 ? 119.238 -15.268  -18.446  1.00 197.08 ? 344 GLN A OE1  1 
ATOM   3066  N NE2  . GLN A  1 212 ? 119.161 -15.809  -16.269  1.00 202.58 ? 344 GLN A NE2  1 
ATOM   3067  H H    . GLN A  1 212 ? 115.136 -13.774  -16.561  1.00 288.24 ? 344 GLN A H    1 
ATOM   3068  H HA   . GLN A  1 212 ? 117.411 -13.376  -17.995  1.00 286.79 ? 344 GLN A HA   1 
ATOM   3069  H HB2  . GLN A  1 212 ? 115.427 -15.337  -18.435  1.00 286.97 ? 344 GLN A HB2  1 
ATOM   3070  H HB3  . GLN A  1 212 ? 116.701 -15.143  -19.363  1.00 286.97 ? 344 GLN A HB3  1 
ATOM   3071  H HG2  . GLN A  1 212 ? 116.763 -16.044  -16.692  1.00 298.89 ? 344 GLN A HG2  1 
ATOM   3072  H HG3  . GLN A  1 212 ? 117.084 -16.933  -17.970  1.00 298.89 ? 344 GLN A HG3  1 
ATOM   3073  H HE21 . GLN A  1 212 ? 119.991 -15.614  -16.153  1.00 320.61 ? 344 GLN A HE21 1 
ATOM   3074  H HE22 . GLN A  1 212 ? 118.689 -16.089  -15.608  1.00 320.61 ? 344 GLN A HE22 1 
ATOM   3075  N N    . VAL A  1 213 ? 114.468 -12.454  -18.786  1.00 183.11 ? 345 VAL A N    1 
ATOM   3076  C CA   . VAL A  1 213 ? 113.728 -11.507  -19.620  1.00 179.16 ? 345 VAL A CA   1 
ATOM   3077  C C    . VAL A  1 213 ? 114.235 -10.092  -19.358  1.00 181.73 ? 345 VAL A C    1 
ATOM   3078  O O    . VAL A  1 213 ? 114.476 -9.326   -20.290  1.00 180.74 ? 345 VAL A O    1 
ATOM   3079  C CB   . VAL A  1 213 ? 112.198 -11.556  -19.358  1.00 175.50 ? 345 VAL A CB   1 
ATOM   3080  C CG1  . VAL A  1 213 ? 111.468 -10.544  -20.233  1.00 172.80 ? 345 VAL A CG1  1 
ATOM   3081  C CG2  . VAL A  1 213 ? 111.644 -12.945  -19.619  1.00 173.21 ? 345 VAL A CG2  1 
ATOM   3082  H H    . VAL A  1 213 ? 113.998 -12.823  -18.169  1.00 149.08 ? 345 VAL A H    1 
ATOM   3083  H HA   . VAL A  1 213 ? 113.882 -11.716  -20.555  1.00 139.29 ? 345 VAL A HA   1 
ATOM   3084  H HB   . VAL A  1 213 ? 112.027 -11.331  -18.430  1.00 131.59 ? 345 VAL A HB   1 
ATOM   3085  H HG11 . VAL A  1 213 ? 110.517 -10.596  -20.050  1.00 124.55 ? 345 VAL A HG11 1 
ATOM   3086  H HG12 . VAL A  1 213 ? 111.798 -9.655   -20.029  1.00 124.55 ? 345 VAL A HG12 1 
ATOM   3087  H HG13 . VAL A  1 213 ? 111.638 -10.754  -21.165  1.00 124.55 ? 345 VAL A HG13 1 
ATOM   3088  H HG21 . VAL A  1 213 ? 110.689 -12.942  -19.446  1.00 128.83 ? 345 VAL A HG21 1 
ATOM   3089  H HG22 . VAL A  1 213 ? 111.812 -13.183  -20.544  1.00 128.83 ? 345 VAL A HG22 1 
ATOM   3090  H HG23 . VAL A  1 213 ? 112.084 -13.576  -19.029  1.00 128.83 ? 345 VAL A HG23 1 
ATOM   3091  N N    . VAL A  1 214 ? 114.396 -9.760   -18.079  1.00 180.51 ? 346 VAL A N    1 
ATOM   3092  C CA   . VAL A  1 214 ? 114.815 -8.424   -17.661  1.00 183.53 ? 346 VAL A CA   1 
ATOM   3093  C C    . VAL A  1 214 ? 116.160 -8.032   -18.267  1.00 186.60 ? 346 VAL A C    1 
ATOM   3094  O O    . VAL A  1 214 ? 116.356 -6.881   -18.660  1.00 187.04 ? 346 VAL A O    1 
ATOM   3095  C CB   . VAL A  1 214 ? 114.903 -8.330   -16.119  1.00 188.03 ? 346 VAL A CB   1 
ATOM   3096  C CG1  . VAL A  1 214 ? 115.618 -7.053   -15.675  1.00 192.46 ? 346 VAL A CG1  1 
ATOM   3097  C CG2  . VAL A  1 214 ? 113.505 -8.393   -15.502  1.00 185.38 ? 346 VAL A CG2  1 
ATOM   3098  H H    . VAL A  1 214 ? 114.266 -10.301  -17.424  1.00 280.46 ? 346 VAL A H    1 
ATOM   3099  H HA   . VAL A  1 214 ? 114.154 -7.781   -17.961  1.00 285.64 ? 346 VAL A HA   1 
ATOM   3100  H HB   . VAL A  1 214 ? 115.410 -9.087   -15.786  1.00 293.29 ? 346 VAL A HB   1 
ATOM   3101  H HG11 . VAL A  1 214 ? 115.652 -7.031   -14.706  1.00 300.64 ? 346 VAL A HG11 1 
ATOM   3102  H HG12 . VAL A  1 214 ? 116.517 -7.052   -16.038  1.00 300.64 ? 346 VAL A HG12 1 
ATOM   3103  H HG13 . VAL A  1 214 ? 115.126 -6.285   -16.006  1.00 300.64 ? 346 VAL A HG13 1 
ATOM   3104  H HG21 . VAL A  1 214 ? 113.584 -8.332   -14.537  1.00 288.21 ? 346 VAL A HG21 1 
ATOM   3105  H HG22 . VAL A  1 214 ? 112.978 -7.651   -15.838  1.00 288.21 ? 346 VAL A HG22 1 
ATOM   3106  H HG23 . VAL A  1 214 ? 113.089 -9.234   -15.748  1.00 288.21 ? 346 VAL A HG23 1 
ATOM   3107  N N    . GLU A  1 215 ? 117.080 -8.989   -18.339  1.00 183.66 ? 347 GLU A N    1 
ATOM   3108  C CA   . GLU A  1 215 ? 118.397 -8.743   -18.916  1.00 187.02 ? 347 GLU A CA   1 
ATOM   3109  C C    . GLU A  1 215 ? 118.263 -8.298   -20.367  1.00 183.33 ? 347 GLU A C    1 
ATOM   3110  O O    . GLU A  1 215 ? 118.990 -7.420   -20.827  1.00 185.45 ? 347 GLU A O    1 
ATOM   3111  C CB   . GLU A  1 215 ? 119.268 -9.999   -18.834  1.00 189.92 ? 347 GLU A CB   1 
ATOM   3112  C CG   . GLU A  1 215 ? 120.751 -9.740   -19.059  1.00 195.15 ? 347 GLU A CG   1 
ATOM   3113  C CD   . GLU A  1 215 ? 121.460 -9.216   -17.824  1.00 201.25 ? 347 GLU A CD   1 
ATOM   3114  O OE1  . GLU A  1 215 ? 120.772 -8.830   -16.855  1.00 201.25 ? 347 GLU A OE1  1 
ATOM   3115  O OE2  . GLU A  1 215 ? 122.708 -9.192   -17.818  1.00 206.37 ? 347 GLU A OE2  1 
ATOM   3116  H H    . GLU A  1 215 ? 116.966 -9.794   -18.058  1.00 209.02 ? 347 GLU A H    1 
ATOM   3117  H HA   . GLU A  1 215 ? 118.837 -8.035   -18.419  1.00 215.79 ? 347 GLU A HA   1 
ATOM   3118  H HB2  . GLU A  1 215 ? 119.167 -10.392  -17.953  1.00 222.62 ? 347 GLU A HB2  1 
ATOM   3119  H HB3  . GLU A  1 215 ? 118.973 -10.629  -19.510  1.00 222.62 ? 347 GLU A HB3  1 
ATOM   3120  H HG2  . GLU A  1 215 ? 121.179 -10.570  -19.320  1.00 232.06 ? 347 GLU A HG2  1 
ATOM   3121  H HG3  . GLU A  1 215 ? 120.851 -9.080   -19.763  1.00 232.06 ? 347 GLU A HG3  1 
ATOM   3122  N N    . GLN A  1 216 ? 117.319 -8.906   -21.076  1.00 187.84 ? 348 GLN A N    1 
ATOM   3123  C CA   . GLN A  1 216 ? 117.090 -8.600   -22.482  1.00 184.30 ? 348 GLN A CA   1 
ATOM   3124  C C    . GLN A  1 216 ? 116.171 -7.393   -22.669  1.00 181.80 ? 348 GLN A C    1 
ATOM   3125  O O    . GLN A  1 216 ? 116.169 -6.770   -23.731  1.00 180.39 ? 348 GLN A O    1 
ATOM   3126  C CB   . GLN A  1 216 ? 116.510 -9.819   -23.189  1.00 180.57 ? 348 GLN A CB   1 
ATOM   3127  C CG   . GLN A  1 216 ? 117.471 -10.995  -23.253  1.00 183.26 ? 348 GLN A CG   1 
ATOM   3128  C CD   . GLN A  1 216 ? 116.846 -12.202  -23.906  1.00 179.71 ? 348 GLN A CD   1 
ATOM   3129  O OE1  . GLN A  1 216 ? 115.670 -12.181  -24.260  1.00 175.35 ? 348 GLN A OE1  1 
ATOM   3130  N NE2  . GLN A  1 216 ? 117.628 -13.264  -24.072  1.00 182.13 ? 348 GLN A NE2  1 
ATOM   3131  H H    . GLN A  1 216 ? 116.790 -9.507   -20.761  1.00 302.45 ? 348 GLN A H    1 
ATOM   3132  H HA   . GLN A  1 216 ? 117.940 -8.392   -22.899  1.00 295.46 ? 348 GLN A HA   1 
ATOM   3133  H HB2  . GLN A  1 216 ? 115.715 -10.109  -22.714  1.00 287.33 ? 348 GLN A HB2  1 
ATOM   3134  H HB3  . GLN A  1 216 ? 116.278 -9.574   -24.099  1.00 287.33 ? 348 GLN A HB3  1 
ATOM   3135  H HG2  . GLN A  1 216 ? 118.251 -10.741  -23.770  1.00 292.38 ? 348 GLN A HG2  1 
ATOM   3136  H HG3  . GLN A  1 216 ? 117.733 -11.241  -22.352  1.00 292.38 ? 348 GLN A HG3  1 
ATOM   3137  H HE21 . GLN A  1 216 ? 117.314 -13.975  -24.441  1.00 287.94 ? 348 GLN A HE21 1 
ATOM   3138  H HE22 . GLN A  1 216 ? 118.447 -13.240  -23.812  1.00 287.94 ? 348 GLN A HE22 1 
ATOM   3139  N N    . LEU A  1 217 ? 115.388 -7.067   -21.644  1.00 189.30 ? 349 LEU A N    1 
ATOM   3140  C CA   . LEU A  1 217 ? 114.568 -5.857   -21.672  1.00 187.90 ? 349 LEU A CA   1 
ATOM   3141  C C    . LEU A  1 217 ? 115.458 -4.631   -21.545  1.00 191.86 ? 349 LEU A C    1 
ATOM   3142  O O    . LEU A  1 217 ? 115.155 -3.572   -22.096  1.00 191.06 ? 349 LEU A O    1 
ATOM   3143  C CB   . LEU A  1 217 ? 113.521 -5.870   -20.559  1.00 187.32 ? 349 LEU A CB   1 
ATOM   3144  C CG   . LEU A  1 217 ? 112.348 -6.832   -20.744  1.00 183.68 ? 349 LEU A CG   1 
ATOM   3145  C CD1  . LEU A  1 217 ? 111.503 -6.850   -19.486  1.00 184.37 ? 349 LEU A CD1  1 
ATOM   3146  C CD2  . LEU A  1 217 ? 111.504 -6.452   -21.953  1.00 180.41 ? 349 LEU A CD2  1 
ATOM   3147  H H    . LEU A  1 217 ? 115.314 -7.527   -20.921  1.00 250.52 ? 349 LEU A H    1 
ATOM   3148  H HA   . LEU A  1 217 ? 114.104 -5.807   -22.523  1.00 249.27 ? 349 LEU A HA   1 
ATOM   3149  H HB2  . LEU A  1 217 ? 113.963 -6.111   -19.729  1.00 247.87 ? 349 LEU A HB2  1 
ATOM   3150  H HB3  . LEU A  1 217 ? 113.152 -4.977   -20.479  1.00 247.87 ? 349 LEU A HB3  1 
ATOM   3151  H HG   . LEU A  1 217 ? 112.693 -7.727   -20.888  1.00 238.94 ? 349 LEU A HG   1 
ATOM   3152  H HD11 . LEU A  1 217 ? 110.761 -7.463   -19.613  1.00 239.68 ? 349 LEU A HD11 1 
ATOM   3153  H HD12 . LEU A  1 217 ? 112.051 -7.143   -18.742  1.00 239.68 ? 349 LEU A HD12 1 
ATOM   3154  H HD13 . LEU A  1 217 ? 111.168 -5.955   -19.318  1.00 239.68 ? 349 LEU A HD13 1 
ATOM   3155  H HD21 . LEU A  1 217 ? 110.772 -7.083   -22.037  1.00 231.57 ? 349 LEU A HD21 1 
ATOM   3156  H HD22 . LEU A  1 217 ? 111.155 -5.556   -21.825  1.00 231.57 ? 349 LEU A HD22 1 
ATOM   3157  H HD23 . LEU A  1 217 ? 112.059 -6.481   -22.748  1.00 231.57 ? 349 LEU A HD23 1 
ATOM   3158  N N    . ARG A  1 218 ? 116.560 -4.780   -20.814  1.00 191.56 ? 350 ARG A N    1 
ATOM   3159  C CA   . ARG A  1 218 ? 117.626 -3.785   -20.825  1.00 196.08 ? 350 ARG A CA   1 
ATOM   3160  C C    . ARG A  1 218 ? 118.280 -3.817   -22.201  1.00 195.38 ? 350 ARG A C    1 
ATOM   3161  O O    . ARG A  1 218 ? 117.674 -4.296   -23.158  1.00 190.99 ? 350 ARG A O    1 
ATOM   3162  C CB   . ARG A  1 218 ? 118.651 -4.063   -19.722  1.00 202.00 ? 350 ARG A CB   1 
ATOM   3163  C CG   . ARG A  1 218 ? 118.150 -3.761   -18.322  1.00 204.00 ? 350 ARG A CG   1 
ATOM   3164  C CD   . ARG A  1 218 ? 119.265 -3.887   -17.294  1.00 210.59 ? 350 ARG A CD   1 
ATOM   3165  N NE   . ARG A  1 218 ? 118.857 -3.415   -15.973  1.00 213.27 ? 350 ARG A NE   1 
ATOM   3166  C CZ   . ARG A  1 218 ? 119.689 -3.228   -14.952  1.00 219.51 ? 350 ARG A CZ   1 
ATOM   3167  N NH1  . ARG A  1 218 ? 120.986 -3.467   -15.092  1.00 223.76 ? 350 ARG A NH1  1 
ATOM   3168  N NH2  . ARG A  1 218 ? 119.224 -2.796   -13.788  1.00 221.84 ? 350 ARG A NH2  1 
ATOM   3169  H H    . ARG A  1 218 ? 116.714 -5.452   -20.301  1.00 235.24 ? 350 ARG A H    1 
ATOM   3170  H HA   . ARG A  1 218 ? 117.249 -2.903   -20.682  1.00 245.05 ? 350 ARG A HA   1 
ATOM   3171  H HB2  . ARG A  1 218 ? 118.895 -5.001   -19.752  1.00 255.68 ? 350 ARG A HB2  1 
ATOM   3172  H HB3  . ARG A  1 218 ? 119.435 -3.515   -19.880  1.00 255.68 ? 350 ARG A HB3  1 
ATOM   3173  H HG2  . ARG A  1 218 ? 117.810 -2.853   -18.292  1.00 258.80 ? 350 ARG A HG2  1 
ATOM   3174  H HG3  . ARG A  1 218 ? 117.449 -4.390   -18.090  1.00 258.80 ? 350 ARG A HG3  1 
ATOM   3175  H HD2  . ARG A  1 218 ? 119.521 -4.819   -17.216  1.00 270.16 ? 350 ARG A HD2  1 
ATOM   3176  H HD3  . ARG A  1 218 ? 120.024 -3.356   -17.583  1.00 270.16 ? 350 ARG A HD3  1 
ATOM   3177  H HE   . ARG A  1 218 ? 118.023 -3.247   -15.847  1.00 272.98 ? 350 ARG A HE   1 
ATOM   3178  H HH11 . ARG A  1 218 ? 121.293 -3.747   -15.845  1.00 289.98 ? 350 ARG A HH11 1 
ATOM   3179  H HH12 . ARG A  1 218 ? 121.520 -3.344   -14.429  1.00 289.98 ? 350 ARG A HH12 1 
ATOM   3180  H HH21 . ARG A  1 218 ? 118.384 -2.639   -13.692  1.00 284.69 ? 350 ARG A HH21 1 
ATOM   3181  H HH22 . ARG A  1 218 ? 119.763 -2.674   -13.128  1.00 284.69 ? 350 ARG A HH22 1 
ATOM   3182  N N    . LYS A  1 219 ? 119.495 -3.292   -22.319  1.00 208.02 ? 351 LYS A N    1 
ATOM   3183  C CA   . LYS A  1 219 ? 120.249 -3.376   -23.569  1.00 208.27 ? 351 LYS A CA   1 
ATOM   3184  C C    . LYS A  1 219 ? 119.618 -2.503   -24.659  1.00 204.92 ? 351 LYS A C    1 
ATOM   3185  O O    . LYS A  1 219 ? 120.306 -1.713   -25.307  1.00 207.31 ? 351 LYS A O    1 
ATOM   3186  C CB   . LYS A  1 219 ? 120.348 -4.833   -24.033  1.00 206.34 ? 351 LYS A CB   1 
ATOM   3187  C CG   . LYS A  1 219 ? 120.796 -5.798   -22.942  1.00 209.33 ? 351 LYS A CG   1 
ATOM   3188  C CD   . LYS A  1 219 ? 120.689 -7.245   -23.377  1.00 207.05 ? 351 LYS A CD   1 
ATOM   3189  C CE   . LYS A  1 219 ? 121.570 -8.150   -22.525  1.00 211.72 ? 351 LYS A CE   1 
ATOM   3190  N NZ   . LYS A  1 219 ? 121.413 -9.595   -22.859  1.00 209.82 ? 351 LYS A NZ   1 
ATOM   3191  H H    . LYS A  1 219 ? 119.908 -2.879   -21.688  1.00 239.98 ? 351 LYS A H    1 
ATOM   3192  H HA   . LYS A  1 219 ? 121.150 -3.051   -23.414  1.00 239.46 ? 351 LYS A HA   1 
ATOM   3193  H HB2  . LYS A  1 219 ? 119.476 -5.122   -24.344  1.00 238.18 ? 351 LYS A HB2  1 
ATOM   3194  H HB3  . LYS A  1 219 ? 120.990 -4.887   -24.759  1.00 238.18 ? 351 LYS A HB3  1 
ATOM   3195  H HG2  . LYS A  1 219 ? 121.723 -5.618   -22.720  1.00 249.39 ? 351 LYS A HG2  1 
ATOM   3196  H HG3  . LYS A  1 219 ? 120.236 -5.676   -22.160  1.00 249.39 ? 351 LYS A HG3  1 
ATOM   3197  H HD2  . LYS A  1 219 ? 119.769 -7.540   -23.284  1.00 249.46 ? 351 LYS A HD2  1 
ATOM   3198  H HD3  . LYS A  1 219 ? 120.975 -7.324   -24.301  1.00 249.46 ? 351 LYS A HD3  1 
ATOM   3199  H HE2  . LYS A  1 219 ? 122.499 -7.908   -22.665  1.00 262.26 ? 351 LYS A HE2  1 
ATOM   3200  H HE3  . LYS A  1 219 ? 121.333 -8.031   -21.591  1.00 262.26 ? 351 LYS A HE3  1 
ATOM   3201  H HZ1  . LYS A  1 219 ? 121.943 -10.087  -22.340  1.00 264.36 ? 351 LYS A HZ1  1 
ATOM   3202  H HZ2  . LYS A  1 219 ? 120.569 -9.847   -22.732  1.00 264.36 ? 351 LYS A HZ2  1 
ATOM   3203  H HZ3  . LYS A  1 219 ? 121.632 -9.736   -23.711  1.00 264.36 ? 351 LYS A HZ3  1 
ATOM   3204  N N    . TYR A  1 220 ? 118.312 -2.654   -24.858  1.00 200.01 ? 352 TYR A N    1 
ATOM   3205  C CA   . TYR A  1 220 ? 117.546 -1.776   -25.734  1.00 197.31 ? 352 TYR A CA   1 
ATOM   3206  C C    . TYR A  1 220 ? 117.414 -0.398   -25.095  1.00 199.74 ? 352 TYR A C    1 
ATOM   3207  O O    . TYR A  1 220 ? 117.557 0.628    -25.761  1.00 200.68 ? 352 TYR A O    1 
ATOM   3208  C CB   . TYR A  1 220 ? 116.153 -2.357   -26.003  1.00 192.17 ? 352 TYR A CB   1 
ATOM   3209  C CG   . TYR A  1 220 ? 116.148 -3.663   -26.769  1.00 189.75 ? 352 TYR A CG   1 
ATOM   3210  C CD1  . TYR A  1 220 ? 116.724 -4.810   -26.237  1.00 190.62 ? 352 TYR A CD1  1 
ATOM   3211  C CD2  . TYR A  1 220 ? 115.546 -3.754   -28.016  1.00 187.05 ? 352 TYR A CD2  1 
ATOM   3212  C CE1  . TYR A  1 220 ? 116.716 -6.004   -26.933  1.00 188.57 ? 352 TYR A CE1  1 
ATOM   3213  C CE2  . TYR A  1 220 ? 115.529 -4.945   -28.718  1.00 185.11 ? 352 TYR A CE2  1 
ATOM   3214  C CZ   . TYR A  1 220 ? 116.117 -6.067   -28.172  1.00 185.86 ? 352 TYR A CZ   1 
ATOM   3215  O OH   . TYR A  1 220 ? 116.106 -7.257   -28.864  1.00 184.27 ? 352 TYR A OH   1 
ATOM   3216  H H    . TYR A  1 220 ? 117.839 -3.271   -24.490  1.00 236.90 ? 352 TYR A H    1 
ATOM   3217  H HA   . TYR A  1 220 ? 118.008 -1.679   -26.581  1.00 229.85 ? 352 TYR A HA   1 
ATOM   3218  H HB2  . TYR A  1 220 ? 115.714 -2.513   -25.153  1.00 218.92 ? 352 TYR A HB2  1 
ATOM   3219  H HB3  . TYR A  1 220 ? 115.644 -1.712   -26.519  1.00 218.92 ? 352 TYR A HB3  1 
ATOM   3220  H HD1  . TYR A  1 220 ? 117.132 -4.771   -25.402  1.00 210.93 ? 352 TYR A HD1  1 
ATOM   3221  H HD2  . TYR A  1 220 ? 115.151 -2.999   -28.388  1.00 216.59 ? 352 TYR A HD2  1 
ATOM   3222  H HE1  . TYR A  1 220 ? 117.110 -6.761   -26.565  1.00 208.68 ? 352 TYR A HE1  1 
ATOM   3223  H HE2  . TYR A  1 220 ? 115.126 -4.989   -29.556  1.00 214.92 ? 352 TYR A HE2  1 
ATOM   3224  H HH   . TYR A  1 220 ? 116.495 -7.853   -28.418  1.00 210.64 ? 352 TYR A HH   1 
ATOM   3225  N N    . TRP A  1 221 ? 117.141 -0.394   -23.793  1.00 195.07 ? 353 TRP A N    1 
ATOM   3226  C CA   . TRP A  1 221 ? 116.929 0.835    -23.040  1.00 197.66 ? 353 TRP A CA   1 
ATOM   3227  C C    . TRP A  1 221 ? 118.144 1.177    -22.189  1.00 203.69 ? 353 TRP A C    1 
ATOM   3228  O O    . TRP A  1 221 ? 118.013 1.722    -21.091  1.00 206.53 ? 353 TRP A O    1 
ATOM   3229  C CB   . TRP A  1 221 ? 115.687 0.706    -22.158  1.00 195.41 ? 353 TRP A CB   1 
ATOM   3230  C CG   . TRP A  1 221 ? 114.435 0.570    -22.949  1.00 190.74 ? 353 TRP A CG   1 
ATOM   3231  C CD1  . TRP A  1 221 ? 113.562 -0.477   -22.936  1.00 187.43 ? 353 TRP A CD1  1 
ATOM   3232  C CD2  . TRP A  1 221 ? 113.917 1.514    -23.891  1.00 189.83 ? 353 TRP A CD2  1 
ATOM   3233  N NE1  . TRP A  1 221 ? 112.527 -0.241   -23.808  1.00 184.53 ? 353 TRP A NE1  1 
ATOM   3234  C CE2  . TRP A  1 221 ? 112.724 0.976    -24.407  1.00 185.96 ? 353 TRP A CE2  1 
ATOM   3235  C CE3  . TRP A  1 221 ? 114.347 2.764    -24.346  1.00 192.14 ? 353 TRP A CE3  1 
ATOM   3236  C CZ2  . TRP A  1 221 ? 111.956 1.644    -25.354  1.00 184.39 ? 353 TRP A CZ2  1 
ATOM   3237  C CZ3  . TRP A  1 221 ? 113.583 3.425    -25.286  1.00 190.55 ? 353 TRP A CZ3  1 
ATOM   3238  C CH2  . TRP A  1 221 ? 112.401 2.865    -25.780  1.00 186.74 ? 353 TRP A CH2  1 
ATOM   3239  H H    . TRP A  1 221 ? 117.072 -1.106   -23.316  1.00 232.00 ? 353 TRP A H    1 
ATOM   3240  H HA   . TRP A  1 221 ? 116.783 1.566    -23.661  1.00 238.65 ? 353 TRP A HA   1 
ATOM   3241  H HB2  . TRP A  1 221 ? 115.776 -0.082   -21.600  1.00 234.28 ? 353 TRP A HB2  1 
ATOM   3242  H HB3  . TRP A  1 221 ? 115.608 1.499    -21.605  1.00 234.28 ? 353 TRP A HB3  1 
ATOM   3243  H HD1  . TRP A  1 221 ? 113.652 -1.239   -22.411  1.00 214.30 ? 353 TRP A HD1  1 
ATOM   3244  H HE1  . TRP A  1 221 ? 111.865 -0.770   -23.954  1.00 208.19 ? 353 TRP A HE1  1 
ATOM   3245  H HE3  . TRP A  1 221 ? 115.132 3.142    -24.021  1.00 234.10 ? 353 TRP A HE3  1 
ATOM   3246  H HZ2  . TRP A  1 221 ? 111.169 1.275    -25.684  1.00 213.21 ? 353 TRP A HZ2  1 
ATOM   3247  H HZ3  . TRP A  1 221 ? 113.859 4.258    -25.596  1.00 233.16 ? 353 TRP A HZ3  1 
ATOM   3248  H HH2  . TRP A  1 221 ? 111.905 3.334    -26.413  1.00 222.74 ? 353 TRP A HH2  1 
ATOM   3249  N N    . ASN A  1 222 ? 119.324 0.847    -22.702  1.00 211.73 ? 354 ASN A N    1 
ATOM   3250  C CA   . ASN A  1 222 ? 120.577 1.152    -22.025  1.00 218.31 ? 354 ASN A CA   1 
ATOM   3251  C C    . ASN A  1 222 ? 120.637 0.483    -20.649  1.00 220.55 ? 354 ASN A C    1 
ATOM   3252  O O    . ASN A  1 222 ? 120.160 -0.642   -20.484  1.00 217.46 ? 354 ASN A O    1 
ATOM   3253  C CB   . ASN A  1 222 ? 120.755 2.671    -21.907  1.00 221.83 ? 354 ASN A CB   1 
ATOM   3254  C CG   . ASN A  1 222 ? 120.493 3.395    -23.218  1.00 219.40 ? 354 ASN A CG   1 
ATOM   3255  O OD1  . ASN A  1 222 ? 120.772 2.870    -24.297  1.00 217.40 ? 354 ASN A OD1  1 
ATOM   3256  N ND2  . ASN A  1 222 ? 119.953 4.606    -23.129  1.00 219.93 ? 354 ASN A ND2  1 
ATOM   3257  H H    . ASN A  1 222 ? 119.425 0.439    -23.453  1.00 271.99 ? 354 ASN A H    1 
ATOM   3258  H HA   . ASN A  1 222 ? 121.312 0.807    -22.556  1.00 284.70 ? 354 ASN A HA   1 
ATOM   3259  H HB2  . ASN A  1 222 ? 120.133 3.012    -21.246  1.00 294.61 ? 354 ASN A HB2  1 
ATOM   3260  H HB3  . ASN A  1 222 ? 121.666 2.863    -21.635  1.00 294.61 ? 354 ASN A HB3  1 
ATOM   3261  H HD21 . ASN A  1 222 ? 119.786 5.056    -23.843  1.00 301.47 ? 354 ASN A HD21 1 
ATOM   3262  H HD22 . ASN A  1 222 ? 119.772 4.941    -22.358  1.00 301.47 ? 354 ASN A HD22 1 
ATOM   3263  N N    . ASN A  1 223 ? 121.217 1.168    -19.666  1.00 214.28 ? 355 ASN A N    1 
ATOM   3264  C CA   . ASN A  1 223 ? 121.369 0.616    -18.322  1.00 217.37 ? 355 ASN A CA   1 
ATOM   3265  C C    . ASN A  1 223 ? 120.327 1.160    -17.348  1.00 216.84 ? 355 ASN A C    1 
ATOM   3266  O O    . ASN A  1 223 ? 120.628 1.426    -16.184  1.00 221.67 ? 355 ASN A O    1 
ATOM   3267  C CB   . ASN A  1 223 ? 122.779 0.903    -17.802  1.00 224.81 ? 355 ASN A CB   1 
ATOM   3268  C CG   . ASN A  1 223 ? 123.848 0.187    -18.602  1.00 226.04 ? 355 ASN A CG   1 
ATOM   3269  O OD1  . ASN A  1 223 ? 123.630 -0.921   -19.094  1.00 222.30 ? 355 ASN A OD1  1 
ATOM   3270  N ND2  . ASN A  1 223 ? 125.008 0.816    -18.741  1.00 231.60 ? 355 ASN A ND2  1 
ATOM   3271  H H    . ASN A  1 223 ? 121.534 1.963    -19.754  1.00 213.24 ? 355 ASN A H    1 
ATOM   3272  H HA   . ASN A  1 223 ? 121.259 -0.347   -18.366  1.00 216.35 ? 355 ASN A HA   1 
ATOM   3273  H HB2  . ASN A  1 223 ? 122.950 1.856    -17.858  1.00 227.52 ? 355 ASN A HB2  1 
ATOM   3274  H HB3  . ASN A  1 223 ? 122.844 0.607    -16.881  1.00 227.52 ? 355 ASN A HB3  1 
ATOM   3275  H HD21 . ASN A  1 223 ? 125.645 0.449    -19.186  1.00 222.82 ? 355 ASN A HD21 1 
ATOM   3276  H HD22 . ASN A  1 223 ? 125.122 1.590    -18.385  1.00 222.82 ? 355 ASN A HD22 1 
ATOM   3277  N N    . ASN A  1 224 ? 119.100 1.324    -17.832  1.00 216.78 ? 357 ASN A N    1 
ATOM   3278  C CA   . ASN A  1 224 ? 117.990 1.723    -16.975  1.00 215.84 ? 357 ASN A CA   1 
ATOM   3279  C C    . ASN A  1 224 ? 117.515 0.539    -16.136  1.00 214.57 ? 357 ASN A C    1 
ATOM   3280  O O    . ASN A  1 224 ? 117.582 -0.607   -16.583  1.00 211.77 ? 357 ASN A O    1 
ATOM   3281  C CB   . ASN A  1 224 ? 116.833 2.277    -17.811  1.00 210.62 ? 357 ASN A CB   1 
ATOM   3282  C CG   . ASN A  1 224 ? 117.250 3.437    -18.693  1.00 211.88 ? 357 ASN A CG   1 
ATOM   3283  O OD1  . ASN A  1 224 ? 118.258 4.097    -18.438  1.00 217.31 ? 357 ASN A OD1  1 
ATOM   3284  N ND2  . ASN A  1 224 ? 116.470 3.696    -19.737  1.00 207.17 ? 357 ASN A ND2  1 
ATOM   3285  H H    . ASN A  1 224 ? 118.883 1.210    -18.656  1.00 279.79 ? 357 ASN A H    1 
ATOM   3286  H HA   . ASN A  1 224 ? 118.289 2.421    -16.371  1.00 278.30 ? 357 ASN A HA   1 
ATOM   3287  H HB2  . ASN A  1 224 ? 116.491 1.572    -18.384  1.00 271.53 ? 357 ASN A HB2  1 
ATOM   3288  H HB3  . ASN A  1 224 ? 116.134 2.589    -17.215  1.00 271.53 ? 357 ASN A HB3  1 
ATOM   3289  H HD21 . ASN A  1 224 ? 116.664 4.344    -20.268  1.00 274.88 ? 357 ASN A HD21 1 
ATOM   3290  H HD22 . ASN A  1 224 ? 115.772 3.215    -19.882  1.00 274.88 ? 357 ASN A HD22 1 
ATOM   3291  N N    . THR A  1 225 ? 117.042 0.818    -14.924  1.00 210.57 ? 358 THR A N    1 
ATOM   3292  C CA   . THR A  1 225 ? 116.526 -0.223   -14.032  1.00 209.89 ? 358 THR A CA   1 
ATOM   3293  C C    . THR A  1 225 ? 115.032 -0.426   -14.258  1.00 204.05 ? 358 THR A C    1 
ATOM   3294  O O    . THR A  1 225 ? 114.265 0.533    -14.248  1.00 203.25 ? 358 THR A O    1 
ATOM   3295  C CB   . THR A  1 225 ? 116.776 0.124    -12.549  1.00 216.01 ? 358 THR A CB   1 
ATOM   3296  O OG1  . THR A  1 225 ? 118.187 0.194    -12.304  1.00 221.77 ? 358 THR A OG1  1 
ATOM   3297  C CG2  . THR A  1 225 ? 116.157 -0.928   -11.625  1.00 215.41 ? 358 THR A CG2  1 
ATOM   3298  H H    . THR A  1 225 ? 117.008 1.609    -14.589  1.00 276.95 ? 358 THR A H    1 
ATOM   3299  H HA   . THR A  1 225 ? 116.977 -1.060   -14.227  1.00 272.37 ? 358 THR A HA   1 
ATOM   3300  H HB   . THR A  1 225 ? 116.373 0.983    -12.347  1.00 281.11 ? 358 THR A HB   1 
ATOM   3301  H HG1  . THR A  1 225 ? 118.330 0.383    -11.498  1.00 293.71 ? 358 THR A HG1  1 
ATOM   3302  H HG21 . THR A  1 225 ? 116.324 -0.694   -10.699  1.00 277.24 ? 358 THR A HG21 1 
ATOM   3303  H HG22 . THR A  1 225 ? 115.200 -0.975   -11.772  1.00 277.24 ? 358 THR A HG22 1 
ATOM   3304  H HG23 . THR A  1 225 ? 116.547 -1.798   -11.806  1.00 277.24 ? 358 THR A HG23 1 
ATOM   3305  N N    . ILE A  1 226 ? 114.626 -1.678   -14.445  1.00 201.14 ? 359 ILE A N    1 
ATOM   3306  C CA   . ILE A  1 226 ? 113.242 -1.996   -14.784  1.00 195.59 ? 359 ILE A CA   1 
ATOM   3307  C C    . ILE A  1 226 ? 112.445 -2.423   -13.554  1.00 196.47 ? 359 ILE A C    1 
ATOM   3308  O O    . ILE A  1 226 ? 112.934 -3.171   -12.704  1.00 199.54 ? 359 ILE A O    1 
ATOM   3309  C CB   . ILE A  1 226 ? 113.167 -3.113   -15.852  1.00 190.94 ? 359 ILE A CB   1 
ATOM   3310  C CG1  . ILE A  1 226 ? 113.803 -2.641   -17.162  1.00 189.81 ? 359 ILE A CG1  1 
ATOM   3311  C CG2  . ILE A  1 226 ? 111.720 -3.517   -16.125  1.00 186.00 ? 359 ILE A CG2  1 
ATOM   3312  C CD1  . ILE A  1 226 ? 115.302 -2.814   -17.225  1.00 193.79 ? 359 ILE A CD1  1 
ATOM   3313  H H    . ILE A  1 226 ? 115.136 -2.367   -14.381  1.00 277.76 ? 359 ILE A H    1 
ATOM   3314  H HA   . ILE A  1 226 ? 112.820 -1.204   -15.151  1.00 266.50 ? 359 ILE A HA   1 
ATOM   3315  H HB   . ILE A  1 226 ? 113.652 -3.888   -15.529  1.00 258.90 ? 359 ILE A HB   1 
ATOM   3316  H HG12 . ILE A  1 226 ? 113.418 -3.147   -17.894  1.00 254.88 ? 359 ILE A HG12 1 
ATOM   3317  H HG13 . ILE A  1 226 ? 113.611 -1.698   -17.279  1.00 254.88 ? 359 ILE A HG13 1 
ATOM   3318  H HG21 . ILE A  1 226 ? 111.710 -4.217   -16.797  1.00 250.24 ? 359 ILE A HG21 1 
ATOM   3319  H HG22 . ILE A  1 226 ? 111.323 -3.842   -15.302  1.00 250.24 ? 359 ILE A HG22 1 
ATOM   3320  H HG23 . ILE A  1 226 ? 111.232 -2.743   -16.445  1.00 250.24 ? 359 ILE A HG23 1 
ATOM   3321  H HD11 . ILE A  1 226 ? 115.621 -2.492   -18.082  1.00 263.60 ? 359 ILE A HD11 1 
ATOM   3322  H HD12 . ILE A  1 226 ? 115.709 -2.303   -16.507  1.00 263.60 ? 359 ILE A HD12 1 
ATOM   3323  H HD13 . ILE A  1 226 ? 115.516 -3.755   -17.124  1.00 263.60 ? 359 ILE A HD13 1 
ATOM   3324  N N    . ILE A  1 227 ? 111.213 -1.927   -13.476  1.00 181.13 ? 360 ILE A N    1 
ATOM   3325  C CA   . ILE A  1 227 ? 110.273 -2.283   -12.420  1.00 181.59 ? 360 ILE A CA   1 
ATOM   3326  C C    . ILE A  1 227 ? 108.941 -2.693   -13.034  1.00 177.06 ? 360 ILE A C    1 
ATOM   3327  O O    . ILE A  1 227 ? 108.438 -2.028   -13.940  1.00 174.98 ? 360 ILE A O    1 
ATOM   3328  C CB   . ILE A  1 227 ? 110.037 -1.114   -11.443  1.00 185.85 ? 360 ILE A CB   1 
ATOM   3329  C CG1  . ILE A  1 227 ? 109.934 0.205    -12.212  1.00 185.25 ? 360 ILE A CG1  1 
ATOM   3330  C CG2  . ILE A  1 227 ? 111.154 -1.047   -10.411  1.00 192.18 ? 360 ILE A CG2  1 
ATOM   3331  C CD1  . ILE A  1 227 ? 109.530 1.389    -11.366  1.00 189.07 ? 360 ILE A CD1  1 
ATOM   3332  H H    . ILE A  1 227 ? 110.891 -1.364   -14.042  1.00 199.01 ? 360 ILE A H    1 
ATOM   3333  H HA   . ILE A  1 227 ? 110.623 -3.036   -11.918  1.00 198.80 ? 360 ILE A HA   1 
ATOM   3334  H HB   . ILE A  1 227 ? 109.199 -1.265   -10.979  1.00 209.17 ? 360 ILE A HB   1 
ATOM   3335  H HG12 . ILE A  1 227 ? 110.799 0.405    -12.604  1.00 210.85 ? 360 ILE A HG12 1 
ATOM   3336  H HG13 . ILE A  1 227 ? 109.273 0.105    -12.914  1.00 210.85 ? 360 ILE A HG13 1 
ATOM   3337  H HG21 . ILE A  1 227 ? 110.983 -0.305   -9.810   1.00 219.44 ? 360 ILE A HG21 1 
ATOM   3338  H HG22 . ILE A  1 227 ? 111.174 -1.879   -9.913   1.00 219.44 ? 360 ILE A HG22 1 
ATOM   3339  H HG23 . ILE A  1 227 ? 111.999 -0.914   -10.869  1.00 219.44 ? 360 ILE A HG23 1 
ATOM   3340  H HD11 . ILE A  1 227 ? 109.489 2.179    -11.928  1.00 222.66 ? 360 ILE A HD11 1 
ATOM   3341  H HD12 . ILE A  1 227 ? 108.659 1.215    -10.976  1.00 222.66 ? 360 ILE A HD12 1 
ATOM   3342  H HD13 . ILE A  1 227 ? 110.188 1.515    -10.665  1.00 222.66 ? 360 ILE A HD13 1 
ATOM   3343  N N    . PHE A  1 228 ? 108.375 -3.790   -12.543  1.00 176.34 ? 361 PHE A N    1 
ATOM   3344  C CA   . PHE A  1 228 ? 107.077 -4.254   -13.013  1.00 173.36 ? 361 PHE A CA   1 
ATOM   3345  C C    . PHE A  1 228 ? 105.982 -3.842   -12.042  1.00 176.40 ? 361 PHE A C    1 
ATOM   3346  O O    . PHE A  1 228 ? 106.108 -4.033   -10.832  1.00 178.99 ? 361 PHE A O    1 
ATOM   3347  C CB   . PHE A  1 228 ? 107.068 -5.772   -13.189  1.00 170.86 ? 361 PHE A CB   1 
ATOM   3348  C CG   . PHE A  1 228 ? 107.938 -6.260   -14.317  1.00 168.28 ? 361 PHE A CG   1 
ATOM   3349  C CD1  . PHE A  1 228 ? 107.457 -6.292   -15.616  1.00 164.41 ? 361 PHE A CD1  1 
ATOM   3350  C CD2  . PHE A  1 228 ? 109.231 -6.694   -14.076  1.00 170.28 ? 361 PHE A CD2  1 
ATOM   3351  C CE1  . PHE A  1 228 ? 108.252 -6.744   -16.654  1.00 162.58 ? 361 PHE A CE1  1 
ATOM   3352  C CE2  . PHE A  1 228 ? 110.028 -7.147   -15.110  1.00 168.53 ? 361 PHE A CE2  1 
ATOM   3353  C CZ   . PHE A  1 228 ? 109.537 -7.171   -16.400  1.00 164.67 ? 361 PHE A CZ   1 
ATOM   3354  H H    . PHE A  1 228 ? 108.725 -4.286   -11.933  1.00 149.96 ? 361 PHE A H    1 
ATOM   3355  H HA   . PHE A  1 228 ? 106.886 -3.848   -13.873  1.00 141.75 ? 361 PHE A HA   1 
ATOM   3356  H HB2  . PHE A  1 228 ? 107.386 -6.183   -12.371  1.00 136.05 ? 361 PHE A HB2  1 
ATOM   3357  H HB3  . PHE A  1 228 ? 106.160 -6.060   -13.370  1.00 136.05 ? 361 PHE A HB3  1 
ATOM   3358  H HD1  . PHE A  1 228 ? 106.591 -6.005   -15.793  1.00 138.36 ? 361 PHE A HD1  1 
ATOM   3359  H HD2  . PHE A  1 228 ? 109.567 -6.680   -13.209  1.00 125.12 ? 361 PHE A HD2  1 
ATOM   3360  H HE1  . PHE A  1 228 ? 107.920 -6.759   -17.523  1.00 136.64 ? 361 PHE A HE1  1 
ATOM   3361  H HE2  . PHE A  1 228 ? 110.895 -7.434   -14.937  1.00 122.87 ? 361 PHE A HE2  1 
ATOM   3362  H HZ   . PHE A  1 228 ? 110.073 -7.474   -17.096  1.00 128.77 ? 361 PHE A HZ   1 
ATOM   3363  N N    . ASN A  1 229 ? 104.917 -3.265   -12.588  1.00 172.89 ? 362 ASN A N    1 
ATOM   3364  C CA   . ASN A  1 229 ? 103.728 -2.921   -11.817  1.00 175.77 ? 362 ASN A CA   1 
ATOM   3365  C C    . ASN A  1 229 ? 102.486 -3.480   -12.498  1.00 174.02 ? 362 ASN A C    1 
ATOM   3366  O O    . ASN A  1 229 ? 102.518 -3.815   -13.683  1.00 170.54 ? 362 ASN A O    1 
ATOM   3367  C CB   . ASN A  1 229 ? 103.602 -1.404   -11.650  1.00 178.49 ? 362 ASN A CB   1 
ATOM   3368  C CG   . ASN A  1 229 ? 104.445 -0.866   -10.507  1.00 181.42 ? 362 ASN A CG   1 
ATOM   3369  O OD1  . ASN A  1 229 ? 105.642 -0.619   -10.661  1.00 180.96 ? 362 ASN A OD1  1 
ATOM   3370  N ND2  . ASN A  1 229 ? 103.817 -0.671   -9.351   1.00 184.56 ? 362 ASN A ND2  1 
ATOM   3371  H H    . ASN A  1 229 ? 104.858 -3.059   -13.420  1.00 216.04 ? 362 ASN A H    1 
ATOM   3372  H HA   . ASN A  1 229 ? 103.794 -3.319   -10.934  1.00 219.87 ? 362 ASN A HA   1 
ATOM   3373  H HB2  . ASN A  1 229 ? 103.895 -0.971   -12.467  1.00 227.49 ? 362 ASN A HB2  1 
ATOM   3374  H HB3  . ASN A  1 229 ? 102.676 -1.181   -11.470  1.00 227.49 ? 362 ASN A HB3  1 
ATOM   3375  H HD21 . ASN A  1 229 ? 104.249 -0.368   -8.673   1.00 239.86 ? 362 ASN A HD21 1 
ATOM   3376  H HD22 . ASN A  1 229 ? 102.978 -0.848   -9.283   1.00 239.86 ? 362 ASN A HD22 1 
ATOM   3377  N N    . SER A  1 230 ? 101.395 -3.583   -11.746  1.00 168.88 ? 363 SER A N    1 
ATOM   3378  C CA   . SER A  1 230 ? 100.144 -4.109   -12.280  1.00 167.89 ? 363 SER A CA   1 
ATOM   3379  C C    . SER A  1 230 ? 99.560  -3.166   -13.327  1.00 167.60 ? 363 SER A C    1 
ATOM   3380  O O    . SER A  1 230 ? 100.063 -2.060   -13.527  1.00 168.47 ? 363 SER A O    1 
ATOM   3381  C CB   . SER A  1 230 ? 99.132  -4.336   -11.153  1.00 171.36 ? 363 SER A CB   1 
ATOM   3382  O OG   . SER A  1 230 ? 98.867  -3.132   -10.453  1.00 174.90 ? 363 SER A OG   1 
ATOM   3383  H H    . SER A  1 230 ? 101.353 -3.355   -10.918  1.00 216.55 ? 363 SER A H    1 
ATOM   3384  H HA   . SER A  1 230 ? 100.315 -4.963   -12.706  1.00 211.70 ? 363 SER A HA   1 
ATOM   3385  H HB2  . SER A  1 230 ? 98.304  -4.666   -11.536  1.00 218.37 ? 363 SER A HB2  1 
ATOM   3386  H HB3  . SER A  1 230 ? 99.493  -4.988   -10.533  1.00 218.37 ? 363 SER A HB3  1 
ATOM   3387  H HG   . SER A  1 230 ? 98.311  -3.273   -9.839   1.00 227.02 ? 363 SER A HG   1 
ATOM   3388  N N    . SER A  1 231 ? 98.503  -3.617   -13.994  1.00 164.74 ? 364 SER A N    1 
ATOM   3389  C CA   . SER A  1 231 ? 97.822  -2.813   -15.002  1.00 164.54 ? 364 SER A CA   1 
ATOM   3390  C C    . SER A  1 231 ? 97.392  -1.466   -14.427  1.00 169.24 ? 364 SER A C    1 
ATOM   3391  O O    . SER A  1 231 ? 97.040  -1.369   -13.251  1.00 172.55 ? 364 SER A O    1 
ATOM   3392  C CB   . SER A  1 231 ? 96.608  -3.565   -15.544  1.00 163.07 ? 364 SER A CB   1 
ATOM   3393  O OG   . SER A  1 231 ? 95.833  -4.095   -14.483  1.00 165.98 ? 364 SER A OG   1 
ATOM   3394  H H    . SER A  1 231 ? 98.156  -4.395   -13.879  1.00 260.98 ? 364 SER A H    1 
ATOM   3395  H HA   . SER A  1 231 ? 98.429  -2.646   -15.740  1.00 260.14 ? 364 SER A HA   1 
ATOM   3396  H HB2  . SER A  1 231 ? 96.061  -2.953   -16.061  1.00 257.33 ? 364 SER A HB2  1 
ATOM   3397  H HB3  . SER A  1 231 ? 96.913  -4.294   -16.108  1.00 257.33 ? 364 SER A HB3  1 
ATOM   3398  H HG   . SER A  1 231 ? 95.563  -3.474   -13.987  1.00 263.66 ? 364 SER A HG   1 
ATOM   3399  N N    . SER A  1 232 ? 97.429  -0.430   -15.259  1.00 175.64 ? 365 SER A N    1 
ATOM   3400  C CA   . SER A  1 232 ? 97.070  0.914    -14.821  1.00 179.54 ? 365 SER A CA   1 
ATOM   3401  C C    . SER A  1 232 ? 95.556  1.097    -14.725  1.00 182.77 ? 365 SER A C    1 
ATOM   3402  O O    . SER A  1 232 ? 95.081  2.063    -14.125  1.00 185.61 ? 365 SER A O    1 
ATOM   3403  C CB   . SER A  1 232 ? 97.663  1.956    -15.770  1.00 178.63 ? 365 SER A CB   1 
ATOM   3404  O OG   . SER A  1 232 ? 97.400  1.618    -17.120  1.00 175.65 ? 365 SER A OG   1 
ATOM   3405  H H    . SER A  1 232 ? 97.661  -0.480   -16.085  1.00 200.78 ? 365 SER A H    1 
ATOM   3406  H HA   . SER A  1 232 ? 97.444  1.067    -13.940  1.00 212.58 ? 365 SER A HA   1 
ATOM   3407  H HB2  . SER A  1 232 ? 97.266  2.820    -15.578  1.00 216.34 ? 365 SER A HB2  1 
ATOM   3408  H HB3  . SER A  1 232 ? 98.623  1.995    -15.636  1.00 216.34 ? 365 SER A HB3  1 
ATOM   3409  H HG   . SER A  1 232 ? 97.730  2.197    -17.631  1.00 210.53 ? 365 SER A HG   1 
ATOM   3410  N N    . GLY A  1 233 ? 94.804  0.170    -15.315  1.00 177.17 ? 366 GLY A N    1 
ATOM   3411  C CA   . GLY A  1 233 ? 93.352  0.198    -15.248  1.00 179.60 ? 366 GLY A CA   1 
ATOM   3412  C C    . GLY A  1 233 ? 92.685  -0.098   -16.576  1.00 175.82 ? 366 GLY A C    1 
ATOM   3413  O O    . GLY A  1 233 ? 93.349  -0.247   -17.604  1.00 172.81 ? 366 GLY A O    1 
ATOM   3414  H H    . GLY A  1 233 ? 95.118  -0.492   -15.766  1.00 403.09 ? 366 GLY A H    1 
ATOM   3415  H HA2  . GLY A  1 233 ? 93.049  -0.459   -14.601  1.00 405.22 ? 366 GLY A HA2  1 
ATOM   3416  H HA3  . GLY A  1 233 ? 93.063  1.075    -14.950  1.00 405.22 ? 366 GLY A HA3  1 
ATOM   3417  N N    . GLY A  1 234 ? 91.358  -0.176   -16.547  1.00 168.61 ? 367 GLY A N    1 
ATOM   3418  C CA   . GLY A  1 234 ? 90.567  -0.491   -17.724  1.00 164.99 ? 367 GLY A CA   1 
ATOM   3419  C C    . GLY A  1 234 ? 89.510  -1.521   -17.384  1.00 160.81 ? 367 GLY A C    1 
ATOM   3420  O O    . GLY A  1 234 ? 89.111  -1.651   -16.226  1.00 161.92 ? 367 GLY A O    1 
ATOM   3421  H H    . GLY A  1 234 ? 90.886  -0.048   -15.840  1.00 99.63  ? 367 GLY A H    1 
ATOM   3422  H HA2  . GLY A  1 234 ? 90.131  0.310    -18.053  1.00 94.10  ? 367 GLY A HA2  1 
ATOM   3423  H HA3  . GLY A  1 234 ? 91.140  -0.847   -18.421  1.00 94.10  ? 367 GLY A HA3  1 
ATOM   3424  N N    . ASP A  1 235 ? 89.050  -2.253   -18.393  1.00 164.03 ? 368 ASP A N    1 
ATOM   3425  C CA   . ASP A  1 235 ? 88.102  -3.335   -18.167  1.00 159.68 ? 368 ASP A CA   1 
ATOM   3426  C C    . ASP A  1 235 ? 88.751  -4.412   -17.306  1.00 160.04 ? 368 ASP A C    1 
ATOM   3427  O O    . ASP A  1 235 ? 89.959  -4.628   -17.377  1.00 161.19 ? 368 ASP A O    1 
ATOM   3428  C CB   . ASP A  1 235 ? 87.622  -3.923   -19.496  1.00 153.98 ? 368 ASP A CB   1 
ATOM   3429  C CG   . ASP A  1 235 ? 86.719  -2.972   -20.268  1.00 153.85 ? 368 ASP A CG   1 
ATOM   3430  O OD1  . ASP A  1 235 ? 86.014  -2.157   -19.631  1.00 156.73 ? 368 ASP A OD1  1 
ATOM   3431  O OD2  . ASP A  1 235 ? 86.711  -3.042   -21.516  1.00 151.01 ? 368 ASP A OD2  1 
ATOM   3432  H H    . ASP A  1 235 ? 89.272  -2.142   -19.216  1.00 231.24 ? 368 ASP A H    1 
ATOM   3433  H HA   . ASP A  1 235 ? 87.330  -2.990   -17.691  1.00 227.46 ? 368 ASP A HA   1 
ATOM   3434  H HB2  . ASP A  1 235 ? 88.393  -4.121   -20.051  1.00 217.26 ? 368 ASP A HB2  1 
ATOM   3435  H HB3  . ASP A  1 235 ? 87.122  -4.736   -19.320  1.00 217.26 ? 368 ASP A HB3  1 
ATOM   3436  N N    . LEU A  1 236 ? 87.945  -5.083   -16.492  1.00 158.66 ? 369 LEU A N    1 
ATOM   3437  C CA   . LEU A  1 236 ? 88.446  -6.099   -15.569  1.00 160.01 ? 369 LEU A CA   1 
ATOM   3438  C C    . LEU A  1 236 ? 89.152  -7.239   -16.301  1.00 156.77 ? 369 LEU A C    1 
ATOM   3439  O O    . LEU A  1 236 ? 89.972  -7.947   -15.720  1.00 158.73 ? 369 LEU A O    1 
ATOM   3440  C CB   . LEU A  1 236 ? 87.300  -6.665   -14.731  1.00 159.31 ? 369 LEU A CB   1 
ATOM   3441  C CG   . LEU A  1 236 ? 86.469  -5.651   -13.939  1.00 161.43 ? 369 LEU A CG   1 
ATOM   3442  C CD1  . LEU A  1 236 ? 85.191  -6.298   -13.403  1.00 159.52 ? 369 LEU A CD1  1 
ATOM   3443  C CD2  . LEU A  1 236 ? 87.290  -5.049   -12.805  1.00 166.37 ? 369 LEU A CD2  1 
ATOM   3444  H H    . LEU A  1 236 ? 87.093  -4.969   -16.453  1.00 165.37 ? 369 LEU A H    1 
ATOM   3445  H HA   . LEU A  1 236 ? 89.085  -5.689   -14.966  1.00 164.09 ? 369 LEU A HA   1 
ATOM   3446  H HB2  . LEU A  1 236 ? 86.693  -7.134   -15.325  1.00 167.54 ? 369 LEU A HB2  1 
ATOM   3447  H HB3  . LEU A  1 236 ? 87.672  -7.293   -14.092  1.00 167.54 ? 369 LEU A HB3  1 
ATOM   3448  H HG   . LEU A  1 236 ? 86.209  -4.929   -14.533  1.00 178.10 ? 369 LEU A HG   1 
ATOM   3449  H HD11 . LEU A  1 236 ? 84.685  -5.635   -12.907  1.00 180.06 ? 369 LEU A HD11 1 
ATOM   3450  H HD12 . LEU A  1 236 ? 84.665  -6.625   -14.150  1.00 180.06 ? 369 LEU A HD12 1 
ATOM   3451  H HD13 . LEU A  1 236 ? 85.431  -7.035   -12.820  1.00 180.06 ? 369 LEU A HD13 1 
ATOM   3452  H HD21 . LEU A  1 236 ? 86.741  -4.413   -12.321  1.00 182.22 ? 369 LEU A HD21 1 
ATOM   3453  H HD22 . LEU A  1 236 ? 87.574  -5.761   -12.210  1.00 182.22 ? 369 LEU A HD22 1 
ATOM   3454  H HD23 . LEU A  1 236 ? 88.065  -4.602   -13.180  1.00 182.22 ? 369 LEU A HD23 1 
ATOM   3455  N N    . GLU A  1 237 ? 88.826  -7.407   -17.578  1.00 153.87 ? 370 GLU A N    1 
ATOM   3456  C CA   . GLU A  1 237 ? 89.326  -8.527   -18.368  1.00 149.45 ? 370 GLU A CA   1 
ATOM   3457  C C    . GLU A  1 237 ? 90.782  -8.382   -18.800  1.00 149.15 ? 370 GLU A C    1 
ATOM   3458  O O    . GLU A  1 237 ? 91.471  -9.382   -19.007  1.00 146.55 ? 370 GLU A O    1 
ATOM   3459  C CB   . GLU A  1 237 ? 88.444  -8.707   -19.600  1.00 144.34 ? 370 GLU A CB   1 
ATOM   3460  C CG   . GLU A  1 237 ? 87.106  -9.327   -19.274  1.00 143.38 ? 370 GLU A CG   1 
ATOM   3461  C CD   . GLU A  1 237 ? 85.961  -8.666   -20.004  1.00 141.49 ? 370 GLU A CD   1 
ATOM   3462  O OE1  . GLU A  1 237 ? 85.541  -9.216   -21.041  1.00 137.78 ? 370 GLU A OE1  1 
ATOM   3463  O OE2  . GLU A  1 237 ? 85.481  -7.608   -19.540  1.00 144.09 ? 370 GLU A OE2  1 
ATOM   3464  H H    . GLU A  1 237 ? 88.310  -6.877   -18.017  1.00 176.83 ? 370 GLU A H    1 
ATOM   3465  H HA   . GLU A  1 237 ? 89.257  -9.336   -17.836  1.00 167.03 ? 370 GLU A HA   1 
ATOM   3466  H HB2  . GLU A  1 237 ? 88.282  -7.839   -20.002  1.00 163.98 ? 370 GLU A HB2  1 
ATOM   3467  H HB3  . GLU A  1 237 ? 88.897  -9.286   -20.232  1.00 163.98 ? 370 GLU A HB3  1 
ATOM   3468  H HG2  . GLU A  1 237 ? 87.122  -10.264  -19.526  1.00 163.75 ? 370 GLU A HG2  1 
ATOM   3469  H HG3  . GLU A  1 237 ? 86.942  -9.244   -18.321  1.00 163.75 ? 370 GLU A HG3  1 
ATOM   3470  N N    . ILE A  1 238 ? 91.243  -7.145   -18.944  1.00 144.82 ? 371 ILE A N    1 
ATOM   3471  C CA   . ILE A  1 238 ? 92.625  -6.886   -19.340  1.00 144.34 ? 371 ILE A CA   1 
ATOM   3472  C C    . ILE A  1 238 ? 93.474  -6.414   -18.164  1.00 149.32 ? 371 ILE A C    1 
ATOM   3473  O O    . ILE A  1 238 ? 94.696  -6.323   -18.275  1.00 148.35 ? 371 ILE A O    1 
ATOM   3474  C CB   . ILE A  1 238 ? 92.717  -5.845   -20.476  1.00 143.60 ? 371 ILE A CB   1 
ATOM   3475  C CG1  . ILE A  1 238 ? 91.979  -4.557   -20.118  1.00 148.76 ? 371 ILE A CG1  1 
ATOM   3476  C CG2  . ILE A  1 238 ? 92.169  -6.415   -21.769  1.00 137.91 ? 371 ILE A CG2  1 
ATOM   3477  C CD1  . ILE A  1 238 ? 92.892  -3.398   -19.832  1.00 153.51 ? 371 ILE A CD1  1 
ATOM   3478  H H    . ILE A  1 238 ? 90.775  -6.434   -18.819  1.00 86.58  ? 371 ILE A H    1 
ATOM   3479  H HA   . ILE A  1 238 ? 93.012  -7.713   -19.667  1.00 83.94  ? 371 ILE A HA   1 
ATOM   3480  H HB   . ILE A  1 238 ? 93.652  -5.629   -20.613  1.00 84.44  ? 371 ILE A HB   1 
ATOM   3481  H HG12 . ILE A  1 238 ? 91.406  -4.308   -20.860  1.00 93.68  ? 371 ILE A HG12 1 
ATOM   3482  H HG13 . ILE A  1 238 ? 91.441  -4.715   -19.326  1.00 93.68  ? 371 ILE A HG13 1 
ATOM   3483  H HG21 . ILE A  1 238 ? 92.238  -5.743   -22.465  1.00 79.44  ? 371 ILE A HG21 1 
ATOM   3484  H HG22 . ILE A  1 238 ? 92.687  -7.198   -22.013  1.00 79.44  ? 371 ILE A HG22 1 
ATOM   3485  H HG23 . ILE A  1 238 ? 91.240  -6.661   -21.637  1.00 79.44  ? 371 ILE A HG23 1 
ATOM   3486  H HD11 . ILE A  1 238 ? 92.356  -2.620   -19.613  1.00 98.97  ? 371 ILE A HD11 1 
ATOM   3487  H HD12 . ILE A  1 238 ? 93.466  -3.626   -19.083  1.00 98.97  ? 371 ILE A HD12 1 
ATOM   3488  H HD13 . ILE A  1 238 ? 93.430  -3.219   -20.619  1.00 98.97  ? 371 ILE A HD13 1 
ATOM   3489  N N    . THR A  1 239 ? 92.832  -6.121   -17.038  1.00 148.58 ? 372 THR A N    1 
ATOM   3490  C CA   . THR A  1 239 ? 93.565  -5.809   -15.815  1.00 153.12 ? 372 THR A CA   1 
ATOM   3491  C C    . THR A  1 239 ? 94.041  -7.086   -15.139  1.00 151.88 ? 372 THR A C    1 
ATOM   3492  O O    . THR A  1 239 ? 95.070  -7.097   -14.462  1.00 153.05 ? 372 THR A O    1 
ATOM   3493  C CB   . THR A  1 239 ? 92.712  -5.020   -14.812  1.00 158.66 ? 372 THR A CB   1 
ATOM   3494  O OG1  . THR A  1 239 ? 91.506  -5.744   -14.540  1.00 157.84 ? 372 THR A OG1  1 
ATOM   3495  C CG2  . THR A  1 239 ? 92.376  -3.637   -15.351  1.00 160.46 ? 372 THR A CG2  1 
ATOM   3496  H H    . THR A  1 239 ? 91.977  -6.096   -16.954  1.00 200.88 ? 372 THR A H    1 
ATOM   3497  H HA   . THR A  1 239 ? 94.344  -5.274   -16.037  1.00 205.81 ? 372 THR A HA   1 
ATOM   3498  H HB   . THR A  1 239 ? 93.210  -4.910   -13.987  1.00 215.15 ? 372 THR A HB   1 
ATOM   3499  H HG1  . THR A  1 239 ? 91.033  -5.318   -13.991  1.00 215.15 ? 372 THR A HG1  1 
ATOM   3500  H HG21 . THR A  1 239 ? 91.837  -3.152   -14.707  1.00 220.49 ? 372 THR A HG21 1 
ATOM   3501  H HG22 . THR A  1 239 ? 93.192  -3.140   -15.518  1.00 220.49 ? 372 THR A HG22 1 
ATOM   3502  H HG23 . THR A  1 239 ? 91.880  -3.717   -16.181  1.00 220.49 ? 372 THR A HG23 1 
ATOM   3503  N N    . THR A  1 240 ? 93.269  -8.154   -15.314  1.00 155.26 ? 373 THR A N    1 
ATOM   3504  C CA   . THR A  1 240 ? 93.602  -9.464   -14.759  1.00 154.38 ? 373 THR A CA   1 
ATOM   3505  C C    . THR A  1 240 ? 93.986  -10.445  -15.859  1.00 148.17 ? 373 THR A C    1 
ATOM   3506  O O    . THR A  1 240 ? 93.729  -10.203  -17.038  1.00 144.38 ? 373 THR A O    1 
ATOM   3507  C CB   . THR A  1 240 ? 92.424  -10.062  -13.972  1.00 157.14 ? 373 THR A CB   1 
ATOM   3508  O OG1  . THR A  1 240 ? 91.359  -10.384  -14.875  1.00 153.73 ? 373 THR A OG1  1 
ATOM   3509  C CG2  . THR A  1 240 ? 91.921  -9.090   -12.916  1.00 162.32 ? 373 THR A CG2  1 
ATOM   3510  H H    . THR A  1 240 ? 92.533  -8.146   -15.758  1.00 206.88 ? 373 THR A H    1 
ATOM   3511  H HA   . THR A  1 240 ? 94.356  -9.373   -14.155  1.00 203.98 ? 373 THR A HA   1 
ATOM   3512  H HB   . THR A  1 240 ? 92.717  -10.871  -13.524  1.00 204.80 ? 373 THR A HB   1 
ATOM   3513  H HG1  . THR A  1 240 ? 90.712  -10.712  -14.452  1.00 201.43 ? 373 THR A HG1  1 
ATOM   3514  H HG21 . THR A  1 240 ? 91.179  -9.483   -12.431  1.00 213.89 ? 373 THR A HG21 1 
ATOM   3515  H HG22 . THR A  1 240 ? 92.633  -8.882   -12.291  1.00 213.89 ? 373 THR A HG22 1 
ATOM   3516  H HG23 . THR A  1 240 ? 91.622  -8.269   -13.338  1.00 213.89 ? 373 THR A HG23 1 
ATOM   3517  N N    . HIS A  1 241 ? 94.598  -11.557  -15.464  1.00 150.77 ? 374 HIS A N    1 
ATOM   3518  C CA   . HIS A  1 241 ? 94.891  -12.637  -16.396  1.00 145.76 ? 374 HIS A CA   1 
ATOM   3519  C C    . HIS A  1 241 ? 93.633  -13.469  -16.619  1.00 144.99 ? 374 HIS A C    1 
ATOM   3520  O O    . HIS A  1 241 ? 93.165  -14.155  -15.710  1.00 148.16 ? 374 HIS A O    1 
ATOM   3521  C CB   . HIS A  1 241 ? 96.028  -13.518  -15.877  1.00 146.10 ? 374 HIS A CB   1 
ATOM   3522  C CG   . HIS A  1 241 ? 96.114  -14.850  -16.554  1.00 142.87 ? 374 HIS A CG   1 
ATOM   3523  N ND1  . HIS A  1 241 ? 96.079  -14.992  -17.925  1.00 138.46 ? 374 HIS A ND1  1 
ATOM   3524  C CD2  . HIS A  1 241 ? 96.227  -16.102  -16.049  1.00 143.98 ? 374 HIS A CD2  1 
ATOM   3525  C CE1  . HIS A  1 241 ? 96.170  -16.273  -18.235  1.00 137.17 ? 374 HIS A CE1  1 
ATOM   3526  N NE2  . HIS A  1 241 ? 96.260  -16.968  -17.115  1.00 140.47 ? 374 HIS A NE2  1 
ATOM   3527  H H    . HIS A  1 241 ? 94.855  -11.710  -14.658  1.00 199.61 ? 374 HIS A H    1 
ATOM   3528  H HA   . HIS A  1 241 ? 95.162  -12.261  -17.248  1.00 193.34 ? 374 HIS A HA   1 
ATOM   3529  H HB2  . HIS A  1 241 ? 96.870  -13.057  -16.019  1.00 194.08 ? 374 HIS A HB2  1 
ATOM   3530  H HB3  . HIS A  1 241 ? 95.894  -13.674  -14.929  1.00 194.08 ? 374 HIS A HB3  1 
ATOM   3531  H HD1  . HIS A  1 241 ? 96.011  -14.347  -18.490  1.00 194.76 ? 374 HIS A HD1  1 
ATOM   3532  H HD2  . HIS A  1 241 ? 96.274  -16.332  -15.149  1.00 202.95 ? 374 HIS A HD2  1 
ATOM   3533  H HE1  . HIS A  1 241 ? 96.170  -16.626  -19.096  1.00 199.29 ? 374 HIS A HE1  1 
ATOM   3534  H HE2  . HIS A  1 241 ? 96.329  -17.823  -17.062  1.00 204.34 ? 374 HIS A HE2  1 
ATOM   3535  N N    . SER A  1 242 ? 93.091  -13.396  -17.830  1.00 139.47 ? 375 SER A N    1 
ATOM   3536  C CA   . SER A  1 242 ? 91.848  -14.080  -18.167  1.00 138.26 ? 375 SER A CA   1 
ATOM   3537  C C    . SER A  1 242 ? 92.058  -15.171  -19.208  1.00 134.03 ? 375 SER A C    1 
ATOM   3538  O O    . SER A  1 242 ? 92.940  -15.075  -20.059  1.00 131.08 ? 375 SER A O    1 
ATOM   3539  C CB   . SER A  1 242 ? 90.827  -13.070  -18.673  1.00 137.43 ? 375 SER A CB   1 
ATOM   3540  O OG   . SER A  1 242 ? 90.784  -11.950  -17.814  1.00 141.80 ? 375 SER A OG   1 
ATOM   3541  H H    . SER A  1 242 ? 93.429  -12.950  -18.483  1.00 175.53 ? 375 SER A H    1 
ATOM   3542  H HA   . SER A  1 242 ? 91.490  -14.494  -17.367  1.00 174.07 ? 375 SER A HA   1 
ATOM   3543  H HB2  . SER A  1 242 ? 91.081  -12.779  -19.563  1.00 175.36 ? 375 SER A HB2  1 
ATOM   3544  H HB3  . SER A  1 242 ? 89.952  -13.488  -18.695  1.00 175.36 ? 375 SER A HB3  1 
ATOM   3545  H HG   . SER A  1 242 ? 90.220  -11.394  -18.094  1.00 182.10 ? 375 SER A HG   1 
ATOM   3546  N N    . PHE A  1 243 ? 91.230  -16.206  -19.132  1.00 134.27 ? 376 PHE A N    1 
ATOM   3547  C CA   . PHE A  1 243 ? 91.300  -17.328  -20.060  1.00 131.67 ? 376 PHE A CA   1 
ATOM   3548  C C    . PHE A  1 243 ? 90.066  -18.210  -19.917  1.00 133.34 ? 376 PHE A C    1 
ATOM   3549  O O    . PHE A  1 243 ? 89.315  -18.079  -18.951  1.00 136.70 ? 376 PHE A O    1 
ATOM   3550  C CB   . PHE A  1 243 ? 92.561  -18.153  -19.813  1.00 132.27 ? 376 PHE A CB   1 
ATOM   3551  C CG   . PHE A  1 243 ? 92.661  -18.704  -18.419  1.00 136.80 ? 376 PHE A CG   1 
ATOM   3552  C CD1  . PHE A  1 243 ? 93.191  -17.939  -17.394  1.00 139.36 ? 376 PHE A CD1  1 
ATOM   3553  C CD2  . PHE A  1 243 ? 92.227  -19.989  -18.134  1.00 139.11 ? 376 PHE A CD2  1 
ATOM   3554  C CE1  . PHE A  1 243 ? 93.287  -18.442  -16.113  1.00 143.84 ? 376 PHE A CE1  1 
ATOM   3555  C CE2  . PHE A  1 243 ? 92.320  -20.497  -16.853  1.00 143.61 ? 376 PHE A CE2  1 
ATOM   3556  C CZ   . PHE A  1 243 ? 92.850  -19.723  -15.842  1.00 145.82 ? 376 PHE A CZ   1 
ATOM   3557  H H    . PHE A  1 243 ? 90.609  -16.283  -18.542  1.00 206.96 ? 376 PHE A H    1 
ATOM   3558  H HA   . PHE A  1 243 ? 91.329  -16.991  -20.969  1.00 202.09 ? 376 PHE A HA   1 
ATOM   3559  H HB2  . PHE A  1 243 ? 92.571  -18.902  -20.429  1.00 201.10 ? 376 PHE A HB2  1 
ATOM   3560  H HB3  . PHE A  1 243 ? 93.337  -17.591  -19.965  1.00 201.10 ? 376 PHE A HB3  1 
ATOM   3561  H HD1  . PHE A  1 243 ? 93.487  -17.075  -17.572  1.00 208.39 ? 376 PHE A HD1  1 
ATOM   3562  H HD2  . PHE A  1 243 ? 91.869  -20.514  -18.812  1.00 210.50 ? 376 PHE A HD2  1 
ATOM   3563  H HE1  . PHE A  1 243 ? 93.644  -17.919  -15.433  1.00 214.54 ? 376 PHE A HE1  1 
ATOM   3564  H HE2  . PHE A  1 243 ? 92.025  -21.361  -16.673  1.00 216.11 ? 376 PHE A HE2  1 
ATOM   3565  H HZ   . PHE A  1 243 ? 92.913  -20.063  -14.979  1.00 218.14 ? 376 PHE A HZ   1 
ATOM   3566  N N    . ASN A  1 244 ? 89.868  -19.117  -20.868  1.00 126.28 ? 377 ASN A N    1 
ATOM   3567  C CA   . ASN A  1 244 ? 88.713  -20.008  -20.852  1.00 128.28 ? 377 ASN A CA   1 
ATOM   3568  C C    . ASN A  1 244 ? 89.120  -21.432  -20.492  1.00 131.51 ? 377 ASN A C    1 
ATOM   3569  O O    . ASN A  1 244 ? 89.973  -22.023  -21.148  1.00 130.39 ? 377 ASN A O    1 
ATOM   3570  C CB   . ASN A  1 244 ? 88.006  -19.985  -22.210  1.00 125.36 ? 377 ASN A CB   1 
ATOM   3571  C CG   . ASN A  1 244 ? 86.645  -20.661  -22.174  1.00 127.51 ? 377 ASN A CG   1 
ATOM   3572  O OD1  . ASN A  1 244 ? 86.552  -21.885  -22.074  1.00 130.65 ? 377 ASN A OD1  1 
ATOM   3573  N ND2  . ASN A  1 244 ? 85.583  -19.867  -22.269  1.00 126.16 ? 377 ASN A ND2  1 
ATOM   3574  H H    . ASN A  1 244 ? 90.392  -19.237  -21.540  1.00 103.07 ? 377 ASN A H    1 
ATOM   3575  H HA   . ASN A  1 244 ? 88.084  -19.698  -20.181  1.00 105.19 ? 377 ASN A HA   1 
ATOM   3576  H HB2  . ASN A  1 244 ? 87.877  -19.064  -22.483  1.00 101.44 ? 377 ASN A HB2  1 
ATOM   3577  H HB3  . ASN A  1 244 ? 88.556  -20.450  -22.860  1.00 101.44 ? 377 ASN A HB3  1 
ATOM   3578  H HD21 . ASN A  1 244 ? 84.791  -20.204  -22.253  1.00 102.91 ? 377 ASN A HD21 1 
ATOM   3579  H HD22 . ASN A  1 244 ? 85.687  -19.017  -22.345  1.00 102.91 ? 377 ASN A HD22 1 
ATOM   3580  N N    . CYS A  1 245 ? 88.508  -21.973  -19.443  1.00 135.69 ? 378 CYS A N    1 
ATOM   3581  C CA   . CYS A  1 245 ? 88.810  -23.322  -18.975  1.00 139.58 ? 378 CYS A CA   1 
ATOM   3582  C C    . CYS A  1 245 ? 87.557  -24.183  -18.852  1.00 143.28 ? 378 CYS A C    1 
ATOM   3583  O O    . CYS A  1 245 ? 86.706  -23.940  -17.995  1.00 146.00 ? 378 CYS A O    1 
ATOM   3584  C CB   . CYS A  1 245 ? 89.522  -23.266  -17.623  1.00 142.52 ? 378 CYS A CB   1 
ATOM   3585  S SG   . CYS A  1 245 ? 89.764  -24.889  -16.860  1.00 147.31 ? 378 CYS A SG   1 
ATOM   3586  H H    . CYS A  1 245 ? 87.904  -21.573  -18.979  1.00 215.94 ? 378 CYS A H    1 
ATOM   3587  H HA   . CYS A  1 245 ? 89.406  -23.750  -19.610  1.00 221.51 ? 378 CYS A HA   1 
ATOM   3588  H HB2  . CYS A  1 245 ? 90.395  -22.863  -17.746  1.00 226.29 ? 378 CYS A HB2  1 
ATOM   3589  H HB3  . CYS A  1 245 ? 88.994  -22.728  -17.014  1.00 226.29 ? 378 CYS A HB3  1 
ATOM   3590  N N    . GLY A  1 246 ? 87.454  -25.196  -19.707  1.00 142.74 ? 379 GLY A N    1 
ATOM   3591  C CA   . GLY A  1 246 ? 86.341  -26.129  -19.658  1.00 146.43 ? 379 GLY A CA   1 
ATOM   3592  C C    . GLY A  1 246 ? 84.993  -25.466  -19.873  1.00 145.61 ? 379 GLY A C    1 
ATOM   3593  O O    . GLY A  1 246 ? 83.968  -25.966  -19.406  1.00 147.81 ? 379 GLY A O    1 
ATOM   3594  H H    . GLY A  1 246 ? 88.023  -25.364  -20.330  1.00 77.83  ? 379 GLY A H    1 
ATOM   3595  H HA2  . GLY A  1 246 ? 86.461  -26.805  -20.344  1.00 83.59  ? 379 GLY A HA2  1 
ATOM   3596  H HA3  . GLY A  1 246 ? 86.330  -26.569  -18.794  1.00 83.59  ? 379 GLY A HA3  1 
ATOM   3597  N N    . GLY A  1 247 ? 84.993  -24.340  -20.579  1.00 145.55 ? 380 GLY A N    1 
ATOM   3598  C CA   . GLY A  1 247 ? 83.774  -23.594  -20.842  1.00 143.26 ? 380 GLY A CA   1 
ATOM   3599  C C    . GLY A  1 247 ? 83.526  -22.526  -19.795  1.00 142.78 ? 380 GLY A C    1 
ATOM   3600  O O    . GLY A  1 247 ? 82.604  -21.718  -19.922  1.00 140.48 ? 380 GLY A O    1 
ATOM   3601  H H    . GLY A  1 247 ? 85.698  -23.985  -20.920  1.00 89.43  ? 380 GLY A H    1 
ATOM   3602  H HA2  . GLY A  1 247 ? 83.836  -23.166  -21.710  1.00 86.61  ? 380 GLY A HA2  1 
ATOM   3603  H HA3  . GLY A  1 247 ? 83.018  -24.201  -20.849  1.00 86.61  ? 380 GLY A HA3  1 
ATOM   3604  N N    . GLU A  1 248 ? 84.358  -22.527  -18.757  1.00 145.70 ? 381 GLU A N    1 
ATOM   3605  C CA   . GLU A  1 248 ? 84.248  -21.569  -17.664  1.00 146.37 ? 381 GLU A CA   1 
ATOM   3606  C C    . GLU A  1 248 ? 85.294  -20.468  -17.780  1.00 144.02 ? 381 GLU A C    1 
ATOM   3607  O O    . GLU A  1 248 ? 86.421  -20.712  -18.199  1.00 142.96 ? 381 GLU A O    1 
ATOM   3608  C CB   . GLU A  1 248 ? 84.390  -22.290  -16.330  1.00 151.40 ? 381 GLU A CB   1 
ATOM   3609  C CG   . GLU A  1 248 ? 83.438  -23.476  -16.192  1.00 152.93 ? 381 GLU A CG   1 
ATOM   3610  C CD   . GLU A  1 248 ? 82.639  -23.466  -14.903  1.00 154.04 ? 381 GLU A CD   1 
ATOM   3611  O OE1  . GLU A  1 248 ? 83.064  -22.811  -13.931  1.00 155.08 ? 381 GLU A OE1  1 
ATOM   3612  O OE2  . GLU A  1 248 ? 81.588  -24.133  -14.856  1.00 153.86 ? 381 GLU A OE2  1 
ATOM   3613  H H    . GLU A  1 248 ? 85.007  -23.084  -18.663  1.00 311.16 ? 381 GLU A H    1 
ATOM   3614  H HA   . GLU A  1 248 ? 83.371  -21.156  -17.691  1.00 312.99 ? 381 GLU A HA   1 
ATOM   3615  H HB2  . GLU A  1 248 ? 85.298  -22.623  -16.246  1.00 320.30 ? 381 GLU A HB2  1 
ATOM   3616  H HB3  . GLU A  1 248 ? 84.198  -21.667  -15.612  1.00 320.30 ? 381 GLU A HB3  1 
ATOM   3617  H HG2  . GLU A  1 248 ? 82.810  -23.461  -16.932  1.00 326.23 ? 381 GLU A HG2  1 
ATOM   3618  H HG3  . GLU A  1 248 ? 83.955  -24.297  -16.216  1.00 326.23 ? 381 GLU A HG3  1 
ATOM   3619  N N    . PHE A  1 249 ? 84.912  -19.258  -17.388  1.00 140.73 ? 382 PHE A N    1 
ATOM   3620  C CA   . PHE A  1 249 ? 85.762  -18.087  -17.546  1.00 138.81 ? 382 PHE A CA   1 
ATOM   3621  C C    . PHE A  1 249 ? 86.471  -17.737  -16.243  1.00 143.00 ? 382 PHE A C    1 
ATOM   3622  O O    . PHE A  1 249 ? 85.831  -17.375  -15.259  1.00 145.46 ? 382 PHE A O    1 
ATOM   3623  C CB   . PHE A  1 249 ? 84.927  -16.901  -18.024  1.00 135.34 ? 382 PHE A CB   1 
ATOM   3624  C CG   . PHE A  1 249 ? 84.322  -17.095  -19.385  1.00 131.18 ? 382 PHE A CG   1 
ATOM   3625  C CD1  . PHE A  1 249 ? 83.206  -17.899  -19.558  1.00 131.59 ? 382 PHE A CD1  1 
ATOM   3626  C CD2  . PHE A  1 249 ? 84.867  -16.470  -20.492  1.00 127.46 ? 382 PHE A CD2  1 
ATOM   3627  C CE1  . PHE A  1 249 ? 82.648  -18.078  -20.811  1.00 128.69 ? 382 PHE A CE1  1 
ATOM   3628  C CE2  . PHE A  1 249 ? 84.314  -16.643  -21.747  1.00 124.55 ? 382 PHE A CE2  1 
ATOM   3629  C CZ   . PHE A  1 249 ? 83.203  -17.447  -21.907  1.00 125.29 ? 382 PHE A CZ   1 
ATOM   3630  H H    . PHE A  1 249 ? 84.152  -19.088  -17.022  1.00 115.13 ? 382 PHE A H    1 
ATOM   3631  H HA   . PHE A  1 249 ? 86.437  -18.272  -18.217  1.00 113.26 ? 382 PHE A HA   1 
ATOM   3632  H HB2  . PHE A  1 249 ? 84.203  -16.755  -17.396  1.00 116.36 ? 382 PHE A HB2  1 
ATOM   3633  H HB3  . PHE A  1 249 ? 85.494  -16.114  -18.060  1.00 116.36 ? 382 PHE A HB3  1 
ATOM   3634  H HD1  . PHE A  1 249 ? 82.829  -18.326  -18.822  1.00 115.92 ? 382 PHE A HD1  1 
ATOM   3635  H HD2  . PHE A  1 249 ? 85.615  -15.927  -20.391  1.00 110.56 ? 382 PHE A HD2  1 
ATOM   3636  H HE1  . PHE A  1 249 ? 81.900  -18.620  -20.915  1.00 113.79 ? 382 PHE A HE1  1 
ATOM   3637  H HE2  . PHE A  1 249 ? 84.690  -16.218  -22.484  1.00 108.61 ? 382 PHE A HE2  1 
ATOM   3638  H HZ   . PHE A  1 249 ? 82.831  -17.565  -22.751  1.00 109.11 ? 382 PHE A HZ   1 
ATOM   3639  N N    . PHE A  1 250 ? 87.794  -17.847  -16.246  1.00 137.03 ? 383 PHE A N    1 
ATOM   3640  C CA   . PHE A  1 250 ? 88.603  -17.560  -15.067  1.00 141.38 ? 383 PHE A CA   1 
ATOM   3641  C C    . PHE A  1 250 ? 89.230  -16.170  -15.152  1.00 140.30 ? 383 PHE A C    1 
ATOM   3642  O O    . PHE A  1 250 ? 89.604  -15.717  -16.233  1.00 135.66 ? 383 PHE A O    1 
ATOM   3643  C CB   . PHE A  1 250 ? 89.692  -18.623  -14.913  1.00 141.72 ? 383 PHE A CB   1 
ATOM   3644  C CG   . PHE A  1 250 ? 89.207  -19.903  -14.298  1.00 145.14 ? 383 PHE A CG   1 
ATOM   3645  C CD1  . PHE A  1 250 ? 88.186  -20.632  -14.886  1.00 144.66 ? 383 PHE A CD1  1 
ATOM   3646  C CD2  . PHE A  1 250 ? 89.781  -20.382  -13.134  1.00 148.85 ? 383 PHE A CD2  1 
ATOM   3647  C CE1  . PHE A  1 250 ? 87.740  -21.813  -14.319  1.00 147.73 ? 383 PHE A CE1  1 
ATOM   3648  C CE2  . PHE A  1 250 ? 89.343  -21.561  -12.561  1.00 151.90 ? 383 PHE A CE2  1 
ATOM   3649  C CZ   . PHE A  1 250 ? 88.320  -22.278  -13.154  1.00 151.13 ? 383 PHE A CZ   1 
ATOM   3650  H H    . PHE A  1 250 ? 88.254  -18.090  -16.930  1.00 213.62 ? 383 PHE A H    1 
ATOM   3651  H HA   . PHE A  1 250 ? 88.038  -17.590  -14.279  1.00 217.38 ? 383 PHE A HA   1 
ATOM   3652  H HB2  . PHE A  1 250 ? 90.051  -18.832  -15.790  1.00 214.27 ? 383 PHE A HB2  1 
ATOM   3653  H HB3  . PHE A  1 250 ? 90.395  -18.269  -14.346  1.00 214.27 ? 383 PHE A HB3  1 
ATOM   3654  H HD1  . PHE A  1 250 ? 87.792  -20.321  -15.669  1.00 223.72 ? 383 PHE A HD1  1 
ATOM   3655  H HD2  . PHE A  1 250 ? 90.468  -19.903  -12.730  1.00 213.55 ? 383 PHE A HD2  1 
ATOM   3656  H HE1  . PHE A  1 250 ? 87.053  -22.293  -14.721  1.00 227.58 ? 383 PHE A HE1  1 
ATOM   3657  H HE2  . PHE A  1 250 ? 89.735  -21.871  -11.777  1.00 217.94 ? 383 PHE A HE2  1 
ATOM   3658  H HZ   . PHE A  1 250 ? 88.024  -23.072  -12.771  1.00 225.05 ? 383 PHE A HZ   1 
ATOM   3659  N N    . TYR A  1 251 ? 89.329  -15.495  -14.009  1.00 147.01 ? 384 TYR A N    1 
ATOM   3660  C CA   . TYR A  1 251 ? 89.969  -14.180  -13.920  1.00 147.58 ? 384 TYR A CA   1 
ATOM   3661  C C    . TYR A  1 251 ? 90.957  -14.161  -12.756  1.00 151.28 ? 384 TYR A C    1 
ATOM   3662  O O    . TYR A  1 251 ? 90.550  -14.242  -11.599  1.00 154.95 ? 384 TYR A O    1 
ATOM   3663  C CB   . TYR A  1 251 ? 88.925  -13.074  -13.732  1.00 148.00 ? 384 TYR A CB   1 
ATOM   3664  C CG   . TYR A  1 251 ? 88.031  -12.829  -14.928  1.00 142.57 ? 384 TYR A CG   1 
ATOM   3665  C CD1  . TYR A  1 251 ? 88.411  -11.954  -15.936  1.00 139.63 ? 384 TYR A CD1  1 
ATOM   3666  C CD2  . TYR A  1 251 ? 86.799  -13.459  -15.038  1.00 140.62 ? 384 TYR A CD2  1 
ATOM   3667  C CE1  . TYR A  1 251 ? 87.592  -11.723  -17.026  1.00 135.06 ? 384 TYR A CE1  1 
ATOM   3668  C CE2  . TYR A  1 251 ? 85.975  -13.233  -16.123  1.00 136.14 ? 384 TYR A CE2  1 
ATOM   3669  C CZ   . TYR A  1 251 ? 86.374  -12.367  -17.112  1.00 133.41 ? 384 TYR A CZ   1 
ATOM   3670  O OH   . TYR A  1 251 ? 85.538  -12.156  -18.184  1.00 129.25 ? 384 TYR A OH   1 
ATOM   3671  H H    . TYR A  1 251 ? 89.027  -15.781  -13.256  1.00 121.49 ? 384 TYR A H    1 
ATOM   3672  H HA   . TYR A  1 251 ? 90.457  -14.004  -14.739  1.00 124.26 ? 384 TYR A HA   1 
ATOM   3673  H HB2  . TYR A  1 251 ? 88.355  -13.311  -12.984  1.00 130.18 ? 384 TYR A HB2  1 
ATOM   3674  H HB3  . TYR A  1 251 ? 89.387  -12.244  -13.538  1.00 130.18 ? 384 TYR A HB3  1 
ATOM   3675  H HD1  . TYR A  1 251 ? 89.231  -11.520  -15.880  1.00 126.23 ? 384 TYR A HD1  1 
ATOM   3676  H HD2  . TYR A  1 251 ? 86.525  -14.046  -14.371  1.00 128.94 ? 384 TYR A HD2  1 
ATOM   3677  H HE1  . TYR A  1 251 ? 87.860  -11.137  -17.696  1.00 124.50 ? 384 TYR A HE1  1 
ATOM   3678  H HE2  . TYR A  1 251 ? 85.154  -13.665  -16.183  1.00 126.10 ? 384 TYR A HE2  1 
ATOM   3679  H HH   . TYR A  1 251 ? 85.888  -11.611  -18.719  1.00 121.92 ? 384 TYR A HH   1 
ATOM   3680  N N    . CYS A  1 252 ? 92.248  -14.036  -13.060  1.00 159.20 ? 385 CYS A N    1 
ATOM   3681  C CA   . CYS A  1 252 ? 93.293  -14.143  -12.040  1.00 161.88 ? 385 CYS A CA   1 
ATOM   3682  C C    . CYS A  1 252 ? 94.055  -12.845  -11.796  1.00 163.04 ? 385 CYS A C    1 
ATOM   3683  O O    . CYS A  1 252 ? 94.625  -12.257  -12.715  1.00 159.59 ? 385 CYS A O    1 
ATOM   3684  C CB   . CYS A  1 252 ? 94.283  -15.242  -12.425  1.00 158.39 ? 385 CYS A CB   1 
ATOM   3685  S SG   . CYS A  1 252 ? 93.650  -16.912  -12.161  1.00 159.20 ? 385 CYS A SG   1 
ATOM   3686  H H    . CYS A  1 252 ? 92.547  -13.889  -13.853  1.00 186.58 ? 385 CYS A H    1 
ATOM   3687  H HA   . CYS A  1 252 ? 92.880  -14.402  -11.201  1.00 190.30 ? 385 CYS A HA   1 
ATOM   3688  H HB2  . CYS A  1 252 ? 94.500  -15.152  -13.366  1.00 187.46 ? 385 CYS A HB2  1 
ATOM   3689  H HB3  . CYS A  1 252 ? 95.086  -15.141  -11.891  1.00 187.46 ? 385 CYS A HB3  1 
ATOM   3690  N N    . ASN A  1 253 ? 94.064  -12.420  -10.536  1.00 160.23 ? 386 ASN A N    1 
ATOM   3691  C CA   . ASN A  1 253 ? 94.824  -11.253  -10.099  1.00 162.21 ? 386 ASN A CA   1 
ATOM   3692  C C    . ASN A  1 253 ? 96.317  -11.579  -10.089  1.00 159.85 ? 386 ASN A C    1 
ATOM   3693  O O    . ASN A  1 253 ? 96.745  -12.522  -9.422   1.00 160.21 ? 386 ASN A O    1 
ATOM   3694  C CB   . ASN A  1 253 ? 94.342  -10.815  -8.709   1.00 167.02 ? 386 ASN A CB   1 
ATOM   3695  C CG   . ASN A  1 253 ? 94.963  -9.505   -8.242   1.00 168.39 ? 386 ASN A CG   1 
ATOM   3696  O OD1  . ASN A  1 253 ? 96.087  -9.160   -8.608   1.00 166.73 ? 386 ASN A OD1  1 
ATOM   3697  N ND2  . ASN A  1 253 ? 94.222  -8.769   -7.417   1.00 170.66 ? 386 ASN A ND2  1 
ATOM   3698  H H    . ASN A  1 253 ? 93.627  -12.800  -9.901   1.00 170.79 ? 386 ASN A H    1 
ATOM   3699  H HA   . ASN A  1 253 ? 94.675  -10.522  -10.718  1.00 176.39 ? 386 ASN A HA   1 
ATOM   3700  H HB2  . ASN A  1 253 ? 93.380  -10.698  -8.732   1.00 184.56 ? 386 ASN A HB2  1 
ATOM   3701  H HB3  . ASN A  1 253 ? 94.576  -11.502  -8.065   1.00 184.56 ? 386 ASN A HB3  1 
ATOM   3702  N N    . THR A  1 254 ? 97.099  -10.794  -10.827  1.00 160.58 ? 387 THR A N    1 
ATOM   3703  C CA   . THR A  1 254 ? 98.524  -11.067  -11.018  1.00 158.12 ? 387 THR A CA   1 
ATOM   3704  C C    . THR A  1 254 ? 99.428  -10.072  -10.290  1.00 160.80 ? 387 THR A C    1 
ATOM   3705  O O    . THR A  1 254 ? 100.597 -9.920   -10.645  1.00 159.21 ? 387 THR A O    1 
ATOM   3706  C CB   . THR A  1 254 ? 98.897  -11.047  -12.516  1.00 153.13 ? 387 THR A CB   1 
ATOM   3707  O OG1  . THR A  1 254 ? 98.693  -9.733   -13.050  1.00 153.33 ? 387 THR A OG1  1 
ATOM   3708  C CG2  . THR A  1 254 ? 98.056  -12.043  -13.295  1.00 150.20 ? 387 THR A CG2  1 
ATOM   3709  H H    . THR A  1 254 ? 96.825  -10.087  -11.234  1.00 283.69 ? 387 THR A H    1 
ATOM   3710  H HA   . THR A  1 254 ? 98.721  -11.953  -10.674  1.00 282.35 ? 387 THR A HA   1 
ATOM   3711  H HB   . THR A  1 254 ? 99.830  -11.292  -12.617  1.00 275.74 ? 387 THR A HB   1 
ATOM   3712  H HG1  . THR A  1 254 ? 98.895  -9.719   -13.865  1.00 275.77 ? 387 THR A HG1  1 
ATOM   3713  H HG21 . THR A  1 254 ? 98.301  -12.020  -14.234  1.00 269.11 ? 387 THR A HG21 1 
ATOM   3714  H HG22 . THR A  1 254 ? 98.202  -12.939  -12.953  1.00 269.11 ? 387 THR A HG22 1 
ATOM   3715  H HG23 . THR A  1 254 ? 97.116  -11.822  -13.209  1.00 269.11 ? 387 THR A HG23 1 
ATOM   3716  N N    . SER A  1 255 ? 98.893  -9.401   -9.273   1.00 163.58 ? 388 SER A N    1 
ATOM   3717  C CA   . SER A  1 255 ? 99.657  -8.396   -8.536   1.00 166.30 ? 388 SER A CA   1 
ATOM   3718  C C    . SER A  1 255 ? 100.929 -8.990   -7.927   1.00 166.67 ? 388 SER A C    1 
ATOM   3719  O O    . SER A  1 255 ? 102.003 -8.392   -8.008   1.00 166.62 ? 388 SER A O    1 
ATOM   3720  C CB   . SER A  1 255 ? 98.795  -7.766   -7.438   1.00 170.47 ? 388 SER A CB   1 
ATOM   3721  O OG   . SER A  1 255 ? 98.375  -8.733   -6.490   1.00 172.13 ? 388 SER A OG   1 
ATOM   3722  H HA   . SER A  1 255 ? 99.922  -7.691   -9.149   1.00 211.04 ? 388 SER A HA   1 
ATOM   3723  H HB2  . SER A  1 255 ? 99.315  -7.085   -6.982   1.00 217.49 ? 388 SER A HB2  1 
ATOM   3724  H HB3  . SER A  1 255 ? 98.011  -7.365   -7.845   1.00 217.49 ? 388 SER A HB3  1 
ATOM   3725  H HG   . SER A  1 255 ? 97.921  -9.330   -6.870   1.00 219.96 ? 388 SER A HG   1 
ATOM   3726  N N    . GLY A  1 256 ? 100.803 -10.168  -7.325   1.00 168.75 ? 389 GLY A N    1 
ATOM   3727  C CA   . GLY A  1 256 ? 101.944 -10.849  -6.741   1.00 170.50 ? 389 GLY A CA   1 
ATOM   3728  C C    . GLY A  1 256 ? 102.917 -11.290  -7.816   1.00 166.94 ? 389 GLY A C    1 
ATOM   3729  O O    . GLY A  1 256 ? 104.101 -11.502  -7.552   1.00 168.34 ? 389 GLY A O    1 
ATOM   3730  H H    . GLY A  1 256 ? 100.061 -10.595  -7.244   1.00 131.55 ? 389 GLY A H    1 
ATOM   3731  H HA2  . GLY A  1 256 ? 102.404 -10.253  -6.129   1.00 136.48 ? 389 GLY A HA2  1 
ATOM   3732  H HA3  . GLY A  1 256 ? 101.645 -11.630  -6.250   1.00 136.48 ? 389 GLY A HA3  1 
ATOM   3733  N N    . LEU A  1 257 ? 102.407 -11.426  -9.036   1.00 170.89 ? 390 LEU A N    1 
ATOM   3734  C CA   . LEU A  1 257 ? 103.218 -11.834  -10.177  1.00 166.95 ? 390 LEU A CA   1 
ATOM   3735  C C    . LEU A  1 257 ? 104.031 -10.668  -10.736  1.00 166.37 ? 390 LEU A C    1 
ATOM   3736  O O    . LEU A  1 257 ? 105.053 -10.870  -11.387  1.00 164.81 ? 390 LEU A O    1 
ATOM   3737  C CB   . LEU A  1 257 ? 102.325 -12.412  -11.277  1.00 163.20 ? 390 LEU A CB   1 
ATOM   3738  C CG   . LEU A  1 257 ? 102.785 -13.701  -11.954  1.00 160.18 ? 390 LEU A CG   1 
ATOM   3739  C CD1  . LEU A  1 257 ? 102.751 -14.864  -10.977  1.00 162.61 ? 390 LEU A CD1  1 
ATOM   3740  C CD2  . LEU A  1 257 ? 101.910 -13.988  -13.163  1.00 156.34 ? 390 LEU A CD2  1 
ATOM   3741  H H    . LEU A  1 257 ? 101.581 -11.286  -9.231   1.00 238.46 ? 390 LEU A H    1 
ATOM   3742  H HA   . LEU A  1 257 ? 103.837 -12.526  -9.896   1.00 235.48 ? 390 LEU A HA   1 
ATOM   3743  H HB2  . LEU A  1 257 ? 101.452 -12.589  -10.893  1.00 226.54 ? 390 LEU A HB2  1 
ATOM   3744  H HB3  . LEU A  1 257 ? 102.236 -11.742  -11.974  1.00 226.54 ? 390 LEU A HB3  1 
ATOM   3745  H HG   . LEU A  1 257 ? 103.699 -13.591  -12.261  1.00 222.56 ? 390 LEU A HG   1 
ATOM   3746  H HD11 . LEU A  1 257 ? 103.048 -15.667  -11.432  1.00 227.01 ? 390 LEU A HD11 1 
ATOM   3747  H HD12 . LEU A  1 257 ? 103.342 -14.668  -10.233  1.00 227.01 ? 390 LEU A HD12 1 
ATOM   3748  H HD13 . LEU A  1 257 ? 101.843 -14.980  -10.657  1.00 227.01 ? 390 LEU A HD13 1 
ATOM   3749  H HD21 . LEU A  1 257 ? 102.211 -14.808  -13.584  1.00 214.57 ? 390 LEU A HD21 1 
ATOM   3750  H HD22 . LEU A  1 257 ? 100.990 -14.084  -12.871  1.00 214.57 ? 390 LEU A HD22 1 
ATOM   3751  H HD23 . LEU A  1 257 ? 101.983 -13.249  -13.788  1.00 214.57 ? 390 LEU A HD23 1 
ATOM   3752  N N    . PHE A  1 258 ? 103.563 -9.450   -10.482  1.00 168.11 ? 391 PHE A N    1 
ATOM   3753  C CA   . PHE A  1 258 ? 104.180 -8.252   -11.037  1.00 167.80 ? 391 PHE A CA   1 
ATOM   3754  C C    . PHE A  1 258 ? 104.535 -7.260   -9.932   1.00 171.75 ? 391 PHE A C    1 
ATOM   3755  O O    . PHE A  1 258 ? 104.260 -6.063   -10.036  1.00 173.05 ? 391 PHE A O    1 
ATOM   3756  C CB   . PHE A  1 258 ? 103.244 -7.614   -12.067  1.00 166.22 ? 391 PHE A CB   1 
ATOM   3757  C CG   . PHE A  1 258 ? 102.989 -8.485   -13.268  1.00 161.88 ? 391 PHE A CG   1 
ATOM   3758  C CD1  . PHE A  1 258 ? 103.960 -8.640   -14.240  1.00 158.76 ? 391 PHE A CD1  1 
ATOM   3759  C CD2  . PHE A  1 258 ? 101.782 -9.150   -13.422  1.00 161.04 ? 391 PHE A CD2  1 
ATOM   3760  C CE1  . PHE A  1 258 ? 103.735 -9.439   -15.343  1.00 154.82 ? 391 PHE A CE1  1 
ATOM   3761  C CE2  . PHE A  1 258 ? 101.552 -9.952   -14.527  1.00 156.87 ? 391 PHE A CE2  1 
ATOM   3762  C CZ   . PHE A  1 258 ? 102.531 -10.096  -15.486  1.00 153.74 ? 391 PHE A CZ   1 
ATOM   3763  H H    . PHE A  1 258 ? 102.880 -9.289   -9.984   1.00 166.50 ? 391 PHE A H    1 
ATOM   3764  H HA   . PHE A  1 258 ? 105.001 -8.501   -11.491  1.00 168.70 ? 391 PHE A HA   1 
ATOM   3765  H HB2  . PHE A  1 258 ? 102.390 -7.433   -11.645  1.00 163.62 ? 391 PHE A HB2  1 
ATOM   3766  H HB3  . PHE A  1 258 ? 103.640 -6.786   -12.380  1.00 163.62 ? 391 PHE A HB3  1 
ATOM   3767  H HD1  . PHE A  1 258 ? 104.774 -8.201   -14.149  1.00 151.41 ? 391 PHE A HD1  1 
ATOM   3768  H HD2  . PHE A  1 258 ? 101.119 -9.056   -12.776  1.00 153.31 ? 391 PHE A HD2  1 
ATOM   3769  H HE1  . PHE A  1 258 ? 104.397 -9.535   -15.989  1.00 144.97 ? 391 PHE A HE1  1 
ATOM   3770  H HE2  . PHE A  1 258 ? 100.739 -10.393  -14.621  1.00 146.73 ? 391 PHE A HE2  1 
ATOM   3771  H HZ   . PHE A  1 258 ? 102.380 -10.633  -16.230  1.00 142.58 ? 391 PHE A HZ   1 
ATOM   3772  N N    . ASN A  1 259 ? 105.140 -7.784   -8.870   1.00 166.40 ? 392 ASN A N    1 
ATOM   3773  C CA   . ASN A  1 259 ? 105.692 -6.970   -7.794   1.00 172.25 ? 392 ASN A CA   1 
ATOM   3774  C C    . ASN A  1 259 ? 107.195 -7.196   -7.705   1.00 175.64 ? 392 ASN A C    1 
ATOM   3775  O O    . ASN A  1 259 ? 107.652 -8.187   -7.136   1.00 178.06 ? 392 ASN A O    1 
ATOM   3776  C CB   . ASN A  1 259 ? 105.016 -7.305   -6.463   1.00 175.73 ? 392 ASN A CB   1 
ATOM   3777  C CG   . ASN A  1 259 ? 105.736 -6.698   -5.274   1.00 182.54 ? 392 ASN A CG   1 
ATOM   3778  O OD1  . ASN A  1 259 ? 106.282 -5.597   -5.357   1.00 184.47 ? 392 ASN A OD1  1 
ATOM   3779  N ND2  . ASN A  1 259 ? 105.746 -7.420   -4.160   1.00 186.54 ? 392 ASN A ND2  1 
ATOM   3780  H H    . ASN A  1 259 ? 105.244 -8.629   -8.749   1.00 328.59 ? 392 ASN A H    1 
ATOM   3781  H HA   . ASN A  1 259 ? 105.535 -6.033   -7.988   1.00 337.60 ? 392 ASN A HA   1 
ATOM   3782  H HB2  . ASN A  1 259 ? 104.109 -6.961   -6.473   1.00 342.02 ? 392 ASN A HB2  1 
ATOM   3783  H HB3  . ASN A  1 259 ? 105.004 -8.268   -6.348   1.00 342.02 ? 392 ASN A HB3  1 
ATOM   3784  H HD21 . ASN A  1 259 ? 106.141 -7.120   -3.458   1.00 354.83 ? 392 ASN A HD21 1 
ATOM   3785  H HD22 . ASN A  1 259 ? 105.358 -8.187   -4.142   1.00 354.83 ? 392 ASN A HD22 1 
ATOM   3786  N N    . SER A  1 260 ? 107.961 -6.274   -8.278   1.00 167.22 ? 393 SER A N    1 
ATOM   3787  C CA   . SER A  1 260 ? 109.410 -6.413   -8.328   1.00 170.42 ? 393 SER A CA   1 
ATOM   3788  C C    . SER A  1 260 ? 110.021 -6.263   -6.939   1.00 177.42 ? 393 SER A C    1 
ATOM   3789  O O    . SER A  1 260 ? 110.896 -5.426   -6.720   1.00 181.42 ? 393 SER A O    1 
ATOM   3790  C CB   . SER A  1 260 ? 110.007 -5.381   -9.285   1.00 169.43 ? 393 SER A CB   1 
ATOM   3791  O OG   . SER A  1 260 ? 109.723 -4.065   -8.846   1.00 171.79 ? 393 SER A OG   1 
ATOM   3792  H H    . SER A  1 260 ? 107.664 -5.556   -8.646   1.00 205.46 ? 393 SER A H    1 
ATOM   3793  H HA   . SER A  1 260 ? 109.632 -7.296   -8.662   1.00 211.27 ? 393 SER A HA   1 
ATOM   3794  H HB2  . SER A  1 260 ? 110.969 -5.501   -9.319   1.00 215.97 ? 393 SER A HB2  1 
ATOM   3795  H HB3  . SER A  1 260 ? 109.625 -5.509   -10.167  1.00 215.97 ? 393 SER A HB3  1 
ATOM   3796  H HG   . SER A  1 260 ? 110.055 -3.507   -9.378   1.00 223.35 ? 393 SER A HG   1 
ATOM   3797  N N    . ASN A  1 271 ? 111.452 -18.008  -3.594   1.00 191.69 ? 411 ASN A N    1 
ATOM   3798  C CA   . ASN A  1 271 ? 111.777 -19.412  -3.372   1.00 194.29 ? 411 ASN A CA   1 
ATOM   3799  C C    . ASN A  1 271 ? 110.675 -20.131  -2.594   1.00 194.91 ? 411 ASN A C    1 
ATOM   3800  O O    . ASN A  1 271 ? 110.911 -20.677  -1.516   1.00 200.66 ? 411 ASN A O    1 
ATOM   3801  C CB   . ASN A  1 271 ? 113.110 -19.535  -2.631   1.00 201.53 ? 411 ASN A CB   1 
ATOM   3802  C CG   . ASN A  1 271 ? 113.609 -20.967  -2.558   1.00 204.41 ? 411 ASN A CG   1 
ATOM   3803  O OD1  . ASN A  1 271 ? 113.511 -21.720  -3.527   1.00 200.62 ? 411 ASN A OD1  1 
ATOM   3804  N ND2  . ASN A  1 271 ? 114.132 -21.354  -1.401   1.00 211.45 ? 411 ASN A ND2  1 
ATOM   3805  H H    . ASN A  1 271 ? 111.823 -17.471  -3.035   1.00 242.55 ? 411 ASN A H    1 
ATOM   3806  H HA   . ASN A  1 271 ? 111.871 -19.853  -4.231   1.00 249.32 ? 411 ASN A HA   1 
ATOM   3807  H HB2  . ASN A  1 271 ? 113.779 -19.007  -3.095   1.00 264.65 ? 411 ASN A HB2  1 
ATOM   3808  H HB3  . ASN A  1 271 ? 113.000 -19.209  -1.725   1.00 264.65 ? 411 ASN A HB3  1 
ATOM   3809  H HD21 . ASN A  1 271 ? 114.429 -22.157  -1.310   1.00 286.46 ? 411 ASN A HD21 1 
ATOM   3810  H HD22 . ASN A  1 271 ? 114.176 -20.803  -0.742   1.00 286.46 ? 411 ASN A HD22 1 
ATOM   3811  N N    . GLY A  1 272 ? 109.468 -20.121  -3.153   1.00 196.69 ? 412 GLY A N    1 
ATOM   3812  C CA   . GLY A  1 272 ? 108.327 -20.787  -2.551   1.00 196.78 ? 412 GLY A CA   1 
ATOM   3813  C C    . GLY A  1 272 ? 107.264 -21.023  -3.603   1.00 189.87 ? 412 GLY A C    1 
ATOM   3814  O O    . GLY A  1 272 ? 107.574 -21.459  -4.711   1.00 186.39 ? 412 GLY A O    1 
ATOM   3815  H H    . GLY A  1 272 ? 109.286 -19.726  -3.895   1.00 210.71 ? 412 GLY A H    1 
ATOM   3816  H HA2  . GLY A  1 272 ? 108.598 -21.641  -2.178   1.00 207.93 ? 412 GLY A HA2  1 
ATOM   3817  H HA3  . GLY A  1 272 ? 107.955 -20.237  -1.843   1.00 207.93 ? 412 GLY A HA3  1 
ATOM   3818  N N    . THR A  1 273 ? 106.013 -20.732  -3.263   1.00 185.44 ? 413 THR A N    1 
ATOM   3819  C CA   . THR A  1 273 ? 104.919 -20.830  -4.223   1.00 179.12 ? 413 THR A CA   1 
ATOM   3820  C C    . THR A  1 273 ? 104.171 -19.513  -4.321   1.00 176.36 ? 413 THR A C    1 
ATOM   3821  O O    . THR A  1 273 ? 103.939 -18.840  -3.315   1.00 179.77 ? 413 THR A O    1 
ATOM   3822  C CB   . THR A  1 273 ? 103.919 -21.935  -3.843   1.00 179.48 ? 413 THR A CB   1 
ATOM   3823  O OG1  . THR A  1 273 ? 104.617 -23.169  -3.636   1.00 182.88 ? 413 THR A OG1  1 
ATOM   3824  C CG2  . THR A  1 273 ? 102.879 -22.123  -4.947   1.00 173.11 ? 413 THR A CG2  1 
ATOM   3825  H H    . THR A  1 273 ? 105.770 -20.476  -2.479   1.00 197.28 ? 413 THR A H    1 
ATOM   3826  H HA   . THR A  1 273 ? 105.282 -21.037  -5.098   1.00 186.58 ? 413 THR A HA   1 
ATOM   3827  H HB   . THR A  1 273 ? 103.457 -21.686  -3.027   1.00 188.85 ? 413 THR A HB   1 
ATOM   3828  H HG1  . THR A  1 273 ? 104.074 -23.775  -3.429   1.00 197.49 ? 413 THR A HG1  1 
ATOM   3829  H HG21 . THR A  1 273 ? 102.254 -22.821  -4.698   1.00 178.24 ? 413 THR A HG21 1 
ATOM   3830  H HG22 . THR A  1 273 ? 102.390 -21.296  -5.085   1.00 178.24 ? 413 THR A HG22 1 
ATOM   3831  H HG23 . THR A  1 273 ? 103.317 -22.372  -5.775   1.00 178.24 ? 413 THR A HG23 1 
ATOM   3832  N N    . ILE A  1 274 ? 103.806 -19.146  -5.543   1.00 178.24 ? 414 ILE A N    1 
ATOM   3833  C CA   . ILE A  1 274 ? 102.917 -18.018  -5.775   1.00 175.49 ? 414 ILE A CA   1 
ATOM   3834  C C    . ILE A  1 274 ? 101.484 -18.533  -5.873   1.00 175.41 ? 414 ILE A C    1 
ATOM   3835  O O    . ILE A  1 274 ? 101.195 -19.432  -6.667   1.00 173.25 ? 414 ILE A O    1 
ATOM   3836  C CB   . ILE A  1 274 ? 103.294 -17.247  -7.059   1.00 172.11 ? 414 ILE A CB   1 
ATOM   3837  C CG1  . ILE A  1 274 ? 104.653 -16.569  -6.883   1.00 173.79 ? 414 ILE A CG1  1 
ATOM   3838  C CG2  . ILE A  1 274 ? 102.232 -16.194  -7.394   1.00 171.83 ? 414 ILE A CG2  1 
ATOM   3839  C CD1  . ILE A  1 274 ? 105.200 -15.948  -8.148   1.00 170.29 ? 414 ILE A CD1  1 
ATOM   3840  H H    . ILE A  1 274 ? 104.063 -19.540  -6.263   1.00 249.37 ? 414 ILE A H    1 
ATOM   3841  H HA   . ILE A  1 274 ? 102.971 -17.406  -5.024   1.00 242.43 ? 414 ILE A HA   1 
ATOM   3842  H HB   . ILE A  1 274 ? 103.352 -17.876  -7.795   1.00 237.11 ? 414 ILE A HB   1 
ATOM   3843  H HG12 . ILE A  1 274 ? 104.568 -15.865  -6.222   1.00 244.24 ? 414 ILE A HG12 1 
ATOM   3844  H HG13 . ILE A  1 274 ? 105.294 -17.230  -6.578   1.00 244.24 ? 414 ILE A HG13 1 
ATOM   3845  H HG21 . ILE A  1 274 ? 102.494 -15.727  -8.202   1.00 232.43 ? 414 ILE A HG21 1 
ATOM   3846  H HG22 . ILE A  1 274 ? 101.380 -16.637  -7.529   1.00 232.43 ? 414 ILE A HG22 1 
ATOM   3847  H HG23 . ILE A  1 274 ? 102.166 -15.567  -6.656   1.00 232.43 ? 414 ILE A HG23 1 
ATOM   3848  H HD11 . ILE A  1 274 ? 106.059 -15.542  -7.954   1.00 240.40 ? 414 ILE A HD11 1 
ATOM   3849  H HD12 . ILE A  1 274 ? 105.305 -16.641  -8.819   1.00 240.40 ? 414 ILE A HD12 1 
ATOM   3850  H HD13 . ILE A  1 274 ? 104.578 -15.274  -8.462   1.00 240.40 ? 414 ILE A HD13 1 
ATOM   3851  N N    . THR A  1 275 ? 100.598 -17.969  -5.056   1.00 171.53 ? 415 THR A N    1 
ATOM   3852  C CA   . THR A  1 275 ? 99.181  -18.320  -5.082   1.00 169.60 ? 415 THR A CA   1 
ATOM   3853  C C    . THR A  1 275 ? 98.357  -17.134  -5.568   1.00 167.98 ? 415 THR A C    1 
ATOM   3854  O O    . THR A  1 275 ? 98.295  -16.099  -4.907   1.00 170.32 ? 415 THR A O    1 
ATOM   3855  C CB   . THR A  1 275 ? 98.674  -18.758  -3.692   1.00 174.65 ? 415 THR A CB   1 
ATOM   3856  O OG1  . THR A  1 275 ? 99.526  -19.786  -3.171   1.00 178.51 ? 415 THR A OG1  1 
ATOM   3857  C CG2  . THR A  1 275 ? 97.239  -19.282  -3.778   1.00 173.20 ? 415 THR A CG2  1 
ATOM   3858  H H    . THR A  1 275 ? 100.796 -17.372  -4.469   1.00 205.99 ? 415 THR A H    1 
ATOM   3859  H HA   . THR A  1 275 ? 99.047  -19.056  -5.699   1.00 201.93 ? 415 THR A HA   1 
ATOM   3860  H HB   . THR A  1 275 ? 98.686  -17.996  -3.091   1.00 208.97 ? 415 THR A HB   1 
ATOM   3861  H HG1  . THR A  1 275 ? 99.254  -20.028  -2.414   1.00 215.67 ? 415 THR A HG1  1 
ATOM   3862  H HG21 . THR A  1 275 ? 96.932  -19.553  -2.899   1.00 205.44 ? 415 THR A HG21 1 
ATOM   3863  H HG22 . THR A  1 275 ? 96.652  -18.587  -4.116   1.00 205.44 ? 415 THR A HG22 1 
ATOM   3864  H HG23 . THR A  1 275 ? 97.200  -20.045  -4.376   1.00 205.44 ? 415 THR A HG23 1 
ATOM   3865  N N    . LEU A  1 276 ? 97.728  -17.296  -6.729   1.00 167.68 ? 416 LEU A N    1 
ATOM   3866  C CA   . LEU A  1 276 ? 96.912  -16.242  -7.324   1.00 167.13 ? 416 LEU A CA   1 
ATOM   3867  C C    . LEU A  1 276 ? 95.430  -16.484  -7.042   1.00 168.97 ? 416 LEU A C    1 
ATOM   3868  O O    . LEU A  1 276 ? 94.941  -17.586  -7.267   1.00 168.27 ? 416 LEU A O    1 
ATOM   3869  C CB   . LEU A  1 276 ? 97.144  -16.170  -8.833   1.00 163.05 ? 416 LEU A CB   1 
ATOM   3870  C CG   . LEU A  1 276 ? 98.597  -16.035  -9.292   1.00 160.49 ? 416 LEU A CG   1 
ATOM   3871  C CD1  . LEU A  1 276 ? 98.666  -15.983  -10.810  1.00 155.95 ? 416 LEU A CD1  1 
ATOM   3872  C CD2  . LEU A  1 276 ? 99.255  -14.804  -8.684   1.00 162.43 ? 416 LEU A CD2  1 
ATOM   3873  H H    . LEU A  1 276 ? 97.759  -18.017  -7.197   1.00 232.69 ? 416 LEU A H    1 
ATOM   3874  H HA   . LEU A  1 276 ? 97.160  -15.388  -6.937   1.00 228.62 ? 416 LEU A HA   1 
ATOM   3875  H HB2  . LEU A  1 276 ? 96.790  -16.980  -9.233   1.00 221.09 ? 416 LEU A HB2  1 
ATOM   3876  H HB3  . LEU A  1 276 ? 96.661  -15.403  -9.178   1.00 221.09 ? 416 LEU A HB3  1 
ATOM   3877  H HG   . LEU A  1 276 ? 99.094  -16.815  -8.998   1.00 220.79 ? 416 LEU A HG   1 
ATOM   3878  H HD11 . LEU A  1 276 ? 99.593  -15.898  -11.081  1.00 213.45 ? 416 LEU A HD11 1 
ATOM   3879  H HD12 . LEU A  1 276 ? 98.290  -16.801  -11.171  1.00 213.45 ? 416 LEU A HD12 1 
ATOM   3880  H HD13 . LEU A  1 276 ? 98.158  -15.219  -11.123  1.00 213.45 ? 416 LEU A HD13 1 
ATOM   3881  H HD21 . LEU A  1 276 ? 100.172 -14.750  -8.996   1.00 225.62 ? 416 LEU A HD21 1 
ATOM   3882  H HD22 . LEU A  1 276 ? 98.764  -14.015  -8.961   1.00 225.62 ? 416 LEU A HD22 1 
ATOM   3883  H HD23 . LEU A  1 276 ? 99.238  -14.883  -7.718   1.00 225.62 ? 416 LEU A HD23 1 
ATOM   3884  N N    . PRO A  1 277 ? 94.710  -15.459  -6.549   1.00 164.98 ? 417 PRO A N    1 
ATOM   3885  C CA   . PRO A  1 277 ? 93.265  -15.611  -6.335   1.00 165.88 ? 417 PRO A CA   1 
ATOM   3886  C C    . PRO A  1 277 ? 92.480  -15.494  -7.643   1.00 163.82 ? 417 PRO A C    1 
ATOM   3887  O O    . PRO A  1 277 ? 92.880  -14.722  -8.517   1.00 162.99 ? 417 PRO A O    1 
ATOM   3888  C CB   . PRO A  1 277 ? 92.933  -14.462  -5.379   1.00 168.18 ? 417 PRO A CB   1 
ATOM   3889  C CG   . PRO A  1 277 ? 93.937  -13.416  -5.701   1.00 168.14 ? 417 PRO A CG   1 
ATOM   3890  C CD   . PRO A  1 277 ? 95.193  -14.138  -6.109   1.00 166.48 ? 417 PRO A CD   1 
ATOM   3891  H HA   . PRO A  1 277 ? 93.069  -16.460  -5.909   1.00 260.68 ? 417 PRO A HA   1 
ATOM   3892  H HB2  . PRO A  1 277 ? 92.033  -14.142  -5.549   1.00 267.54 ? 417 PRO A HB2  1 
ATOM   3893  H HB3  . PRO A  1 277 ? 93.026  -14.761  -4.461   1.00 267.54 ? 417 PRO A HB3  1 
ATOM   3894  H HG2  . PRO A  1 277 ? 93.609  -12.867  -6.430   1.00 268.39 ? 417 PRO A HG2  1 
ATOM   3895  H HG3  . PRO A  1 277 ? 94.099  -12.872  -4.914   1.00 268.39 ? 417 PRO A HG3  1 
ATOM   3896  H HD2  . PRO A  1 277 ? 95.625  -13.674  -6.844   1.00 265.47 ? 417 PRO A HD2  1 
ATOM   3897  H HD3  . PRO A  1 277 ? 95.789  -14.232  -5.350   1.00 265.47 ? 417 PRO A HD3  1 
ATOM   3898  N N    . CYS A  1 278 ? 91.391  -16.252  -7.771   1.00 164.65 ? 418 CYS A N    1 
ATOM   3899  C CA   . CYS A  1 278 ? 90.604  -16.270  -9.004   1.00 162.19 ? 418 CYS A CA   1 
ATOM   3900  C C    . CYS A  1 278 ? 89.102  -16.133  -8.766   1.00 160.92 ? 418 CYS A C    1 
ATOM   3901  O O    . CYS A  1 278 ? 88.596  -16.419  -7.682   1.00 162.15 ? 418 CYS A O    1 
ATOM   3902  C CB   . CYS A  1 278 ? 90.876  -17.558  -9.783   1.00 161.12 ? 418 CYS A CB   1 
ATOM   3903  S SG   . CYS A  1 278 ? 91.871  -17.329  -11.271  1.00 155.82 ? 418 CYS A SG   1 
ATOM   3904  H H    . CYS A  1 278 ? 91.085  -16.768  -7.155   1.00 206.53 ? 418 CYS A H    1 
ATOM   3905  H HA   . CYS A  1 278 ? 90.883  -15.525  -9.559   1.00 200.96 ? 418 CYS A HA   1 
ATOM   3906  H HB2  . CYS A  1 278 ? 91.348  -18.178  -9.205   1.00 196.07 ? 418 CYS A HB2  1 
ATOM   3907  H HB3  . CYS A  1 278 ? 90.027  -17.944  -10.052  1.00 196.07 ? 418 CYS A HB3  1 
ATOM   3908  N N    . ARG A  1 279 ? 88.405  -15.694  -9.810   1.00 160.29 ? 419 ARG A N    1 
ATOM   3909  C CA   . ARG A  1 279 ? 86.954  -15.552  -9.802   1.00 158.32 ? 419 ARG A CA   1 
ATOM   3910  C C    . ARG A  1 279 ? 86.378  -16.109  -11.096  1.00 155.09 ? 419 ARG A C    1 
ATOM   3911  O O    . ARG A  1 279 ? 86.935  -15.896  -12.171  1.00 153.34 ? 419 ARG A O    1 
ATOM   3912  C CB   . ARG A  1 279 ? 86.560  -14.080  -9.638   1.00 157.79 ? 419 ARG A CB   1 
ATOM   3913  C CG   . ARG A  1 279 ? 85.079  -13.760  -9.882   1.00 155.04 ? 419 ARG A CG   1 
ATOM   3914  C CD   . ARG A  1 279 ? 84.890  -12.288  -10.217  1.00 154.04 ? 419 ARG A CD   1 
ATOM   3915  N NE   . ARG A  1 279 ? 83.483  -11.924  -10.369  1.00 151.56 ? 419 ARG A NE   1 
ATOM   3916  C CZ   . ARG A  1 279 ? 83.055  -10.702  -10.675  1.00 150.60 ? 419 ARG A CZ   1 
ATOM   3917  N NH1  . ARG A  1 279 ? 83.921  -9.715   -10.867  1.00 151.74 ? 419 ARG A NH1  1 
ATOM   3918  N NH2  . ARG A  1 279 ? 81.753  -10.462  -10.790  1.00 148.99 ? 419 ARG A NH2  1 
ATOM   3919  H H    . ARG A  1 279 ? 88.763  -15.466  -10.557  1.00 197.80 ? 419 ARG A H    1 
ATOM   3920  H HA   . ARG A  1 279 ? 86.583  -16.054  -9.059   1.00 200.27 ? 419 ARG A HA   1 
ATOM   3921  H HB2  . ARG A  1 279 ? 86.771  -13.805  -8.732   1.00 203.92 ? 419 ARG A HB2  1 
ATOM   3922  H HB3  . ARG A  1 279 ? 87.078  -13.552  -10.265  1.00 203.92 ? 419 ARG A HB3  1 
ATOM   3923  H HG2  . ARG A  1 279 ? 84.755  -14.288  -10.628  1.00 208.63 ? 419 ARG A HG2  1 
ATOM   3924  H HG3  . ARG A  1 279 ? 84.570  -13.960  -9.081   1.00 208.63 ? 419 ARG A HG3  1 
ATOM   3925  H HD2  . ARG A  1 279 ? 85.263  -11.750  -9.501   1.00 214.46 ? 419 ARG A HD2  1 
ATOM   3926  H HD3  . ARG A  1 279 ? 85.343  -12.092  -11.052  1.00 214.46 ? 419 ARG A HD3  1 
ATOM   3927  H HE   . ARG A  1 279 ? 82.894  -12.540  -10.254  1.00 220.61 ? 419 ARG A HE   1 
ATOM   3928  H HH11 . ARG A  1 279 ? 84.765  -9.863   -10.793  1.00 232.18 ? 419 ARG A HH11 1 
ATOM   3929  H HH12 . ARG A  1 279 ? 83.639  -8.927   -11.065  1.00 232.18 ? 419 ARG A HH12 1 
ATOM   3930  H HH21 . ARG A  1 279 ? 81.187  -11.097  -10.668  1.00 235.50 ? 419 ARG A HH21 1 
ATOM   3931  H HH22 . ARG A  1 279 ? 81.478  -9.672   -10.990  1.00 235.50 ? 419 ARG A HH22 1 
ATOM   3932  N N    . ILE A  1 280 ? 85.266  -16.827  -10.988  1.00 151.04 ? 420 ILE A N    1 
ATOM   3933  C CA   . ILE A  1 280 ? 84.511  -17.246  -12.161  1.00 147.74 ? 420 ILE A CA   1 
ATOM   3934  C C    . ILE A  1 280 ? 83.439  -16.211  -12.441  1.00 144.85 ? 420 ILE A C    1 
ATOM   3935  O O    . ILE A  1 280 ? 82.632  -15.914  -11.566  1.00 145.57 ? 420 ILE A O    1 
ATOM   3936  C CB   . ILE A  1 280 ? 83.858  -18.620  -11.964  1.00 148.39 ? 420 ILE A CB   1 
ATOM   3937  C CG1  . ILE A  1 280 ? 84.928  -19.666  -11.653  1.00 151.28 ? 420 ILE A CG1  1 
ATOM   3938  C CG2  . ILE A  1 280 ? 83.054  -19.010  -13.206  1.00 145.15 ? 420 ILE A CG2  1 
ATOM   3939  C CD1  . ILE A  1 280 ? 84.377  -21.028  -11.282  1.00 152.32 ? 420 ILE A CD1  1 
ATOM   3940  H H    . ILE A  1 280 ? 84.926  -17.086  -10.242  1.00 94.39  ? 420 ILE A H    1 
ATOM   3941  H HA   . ILE A  1 280 ? 85.103  -17.293  -12.928  1.00 88.56  ? 420 ILE A HA   1 
ATOM   3942  H HB   . ILE A  1 280 ? 83.251  -18.567  -11.209  1.00 89.40  ? 420 ILE A HB   1 
ATOM   3943  H HG12 . ILE A  1 280 ? 85.490  -19.778  -12.435  1.00 88.47  ? 420 ILE A HG12 1 
ATOM   3944  H HG13 . ILE A  1 280 ? 85.463  -19.351  -10.907  1.00 88.47  ? 420 ILE A HG13 1 
ATOM   3945  H HG21 . ILE A  1 280 ? 82.650  -19.880  -13.060  1.00 85.04  ? 420 ILE A HG21 1 
ATOM   3946  H HG22 . ILE A  1 280 ? 82.364  -18.346  -13.357  1.00 85.04  ? 420 ILE A HG22 1 
ATOM   3947  H HG23 . ILE A  1 280 ? 83.651  -19.046  -13.970  1.00 85.04  ? 420 ILE A HG23 1 
ATOM   3948  H HD11 . ILE A  1 280 ? 85.117  -21.628  -11.101  1.00 92.27  ? 420 ILE A HD11 1 
ATOM   3949  H HD12 . ILE A  1 280 ? 83.822  -20.939  -10.492  1.00 92.27  ? 420 ILE A HD12 1 
ATOM   3950  H HD13 . ILE A  1 280 ? 83.849  -21.366  -12.022  1.00 92.27  ? 420 ILE A HD13 1 
ATOM   3951  N N    . LYS A  1 281 ? 83.428  -15.658  -13.649  1.00 142.32 ? 421 LYS A N    1 
ATOM   3952  C CA   . LYS A  1 281 ? 82.431  -14.656  -14.008  1.00 139.55 ? 421 LYS A CA   1 
ATOM   3953  C C    . LYS A  1 281 ? 81.496  -15.176  -15.094  1.00 136.07 ? 421 LYS A C    1 
ATOM   3954  O O    . LYS A  1 281 ? 81.905  -15.943  -15.965  1.00 134.81 ? 421 LYS A O    1 
ATOM   3955  C CB   . LYS A  1 281 ? 83.105  -13.361  -14.467  1.00 138.66 ? 421 LYS A CB   1 
ATOM   3956  C CG   . LYS A  1 281 ? 82.250  -12.128  -14.226  1.00 138.22 ? 421 LYS A CG   1 
ATOM   3957  C CD   . LYS A  1 281 ? 82.958  -10.838  -14.621  1.00 138.31 ? 421 LYS A CD   1 
ATOM   3958  C CE   . LYS A  1 281 ? 82.028  -9.626   -14.501  1.00 138.23 ? 421 LYS A CE   1 
ATOM   3959  N NZ   . LYS A  1 281 ? 80.734  -9.931   -13.809  1.00 138.64 ? 421 LYS A NZ   1 
ATOM   3960  H H    . LYS A  1 281 ? 83.985  -15.845  -14.277  1.00 108.76 ? 421 LYS A H    1 
ATOM   3961  H HA   . LYS A  1 281 ? 81.895  -14.452  -13.225  1.00 113.28 ? 421 LYS A HA   1 
ATOM   3962  H HB2  . LYS A  1 281 ? 83.936  -13.248  -13.979  1.00 117.20 ? 421 LYS A HB2  1 
ATOM   3963  H HB3  . LYS A  1 281 ? 83.285  -13.419  -15.418  1.00 117.20 ? 421 LYS A HB3  1 
ATOM   3964  H HG2  . LYS A  1 281 ? 81.438  -12.199  -14.752  1.00 123.87 ? 421 LYS A HG2  1 
ATOM   3965  H HG3  . LYS A  1 281 ? 82.031  -12.074  -13.282  1.00 123.87 ? 421 LYS A HG3  1 
ATOM   3966  H HD2  . LYS A  1 281 ? 83.718  -10.698  -14.035  1.00 126.11 ? 421 LYS A HD2  1 
ATOM   3967  H HD3  . LYS A  1 281 ? 83.252  -10.904  -15.543  1.00 126.11 ? 421 LYS A HD3  1 
ATOM   3968  H HE2  . LYS A  1 281 ? 82.480  -8.933   -13.993  1.00 130.71 ? 421 LYS A HE2  1 
ATOM   3969  H HE3  . LYS A  1 281 ? 81.820  -9.300   -15.390  1.00 130.71 ? 421 LYS A HE3  1 
ATOM   3970  H HZ1  . LYS A  1 281 ? 80.232  -9.198   -13.765  1.00 140.79 ? 421 LYS A HZ1  1 
ATOM   3971  H HZ2  . LYS A  1 281 ? 80.290  -10.559  -14.258  1.00 140.79 ? 421 LYS A HZ2  1 
ATOM   3972  H HZ3  . LYS A  1 281 ? 80.892  -10.224  -12.984  1.00 140.79 ? 421 LYS A HZ3  1 
ATOM   3973  N N    . GLN A  1 282 ? 80.235  -14.758  -15.022  1.00 136.62 ? 422 GLN A N    1 
ATOM   3974  C CA   . GLN A  1 282 ? 79.231  -15.125  -16.015  1.00 133.93 ? 422 GLN A CA   1 
ATOM   3975  C C    . GLN A  1 282 ? 79.019  -14.018  -17.039  1.00 131.11 ? 422 GLN A C    1 
ATOM   3976  O O    . GLN A  1 282 ? 78.527  -14.265  -18.140  1.00 128.72 ? 422 GLN A O    1 
ATOM   3977  C CB   . GLN A  1 282 ? 77.909  -15.441  -15.330  1.00 135.18 ? 422 GLN A CB   1 
ATOM   3978  C CG   . GLN A  1 282 ? 77.915  -16.736  -14.549  1.00 137.78 ? 422 GLN A CG   1 
ATOM   3979  C CD   . GLN A  1 282 ? 76.643  -16.936  -13.753  1.00 139.35 ? 422 GLN A CD   1 
ATOM   3980  O OE1  . GLN A  1 282 ? 76.660  -16.912  -12.524  1.00 142.44 ? 422 GLN A OE1  1 
ATOM   3981  N NE2  . GLN A  1 282 ? 75.530  -17.136  -14.450  1.00 138.35 ? 422 GLN A NE2  1 
ATOM   3982  H H    . GLN A  1 282 ? 79.932  -14.252  -14.396  1.00 126.90 ? 422 GLN A H    1 
ATOM   3983  H HA   . GLN A  1 282 ? 79.525  -15.920  -16.486  1.00 121.76 ? 422 GLN A HA   1 
ATOM   3984  H HB2  . GLN A  1 282 ? 77.698  -14.724  -14.712  1.00 127.47 ? 422 GLN A HB2  1 
ATOM   3985  H HB3  . GLN A  1 282 ? 77.215  -15.506  -16.005  1.00 127.47 ? 422 GLN A HB3  1 
ATOM   3986  H HG2  . GLN A  1 282 ? 78.003  -17.478  -15.166  1.00 132.07 ? 422 GLN A HG2  1 
ATOM   3987  H HG3  . GLN A  1 282 ? 78.660  -16.728  -13.928  1.00 132.07 ? 422 GLN A HG3  1 
ATOM   3988  H HE21 . GLN A  1 282 ? 74.782  -17.254  -14.042  1.00 139.91 ? 422 GLN A HE21 1 
ATOM   3989  H HE22 . GLN A  1 282 ? 75.557  -17.147  -15.310  1.00 139.91 ? 422 GLN A HE22 1 
ATOM   3990  N N    . ILE A  1 283 ? 79.379  -12.797  -16.655  1.00 130.67 ? 423 ILE A N    1 
ATOM   3991  C CA   . ILE A  1 283 ? 79.244  -11.625  -17.515  1.00 128.90 ? 423 ILE A CA   1 
ATOM   3992  C C    . ILE A  1 283 ? 80.600  -11.189  -18.072  1.00 128.16 ? 423 ILE A C    1 
ATOM   3993  O O    . ILE A  1 283 ? 81.510  -10.867  -17.310  1.00 130.50 ? 423 ILE A O    1 
ATOM   3994  C CB   . ILE A  1 283 ? 78.619  -10.457  -16.748  1.00 130.96 ? 423 ILE A CB   1 
ATOM   3995  C CG1  . ILE A  1 283 ? 77.271  -10.879  -16.165  1.00 131.82 ? 423 ILE A CG1  1 
ATOM   3996  C CG2  . ILE A  1 283 ? 78.455  -9.251   -17.659  1.00 129.90 ? 423 ILE A CG2  1 
ATOM   3997  C CD1  . ILE A  1 283 ? 76.645  -9.857   -15.240  1.00 135.08 ? 423 ILE A CD1  1 
ATOM   3998  H H    . ILE A  1 283 ? 79.713  -12.617  -15.883  1.00 185.36 ? 423 ILE A H    1 
ATOM   3999  H HA   . ILE A  1 283 ? 78.665  -11.843  -18.262  1.00 181.99 ? 423 ILE A HA   1 
ATOM   4000  H HB   . ILE A  1 283 ? 79.209  -10.215  -16.018  1.00 189.95 ? 423 ILE A HB   1 
ATOM   4001  H HG12 . ILE A  1 283 ? 76.651  -11.035  -16.895  1.00 194.43 ? 423 ILE A HG12 1 
ATOM   4002  H HG13 . ILE A  1 283 ? 77.394  -11.698  -15.660  1.00 194.43 ? 423 ILE A HG13 1 
ATOM   4003  H HG21 . ILE A  1 283 ? 78.058  -8.525   -17.153  1.00 187.00 ? 423 ILE A HG21 1 
ATOM   4004  H HG22 . ILE A  1 283 ? 79.327  -8.986   -17.990  1.00 187.00 ? 423 ILE A HG22 1 
ATOM   4005  H HG23 . ILE A  1 283 ? 77.878  -9.492   -18.401  1.00 187.00 ? 423 ILE A HG23 1 
ATOM   4006  H HD11 . ILE A  1 283 ? 75.798  -10.201  -14.916  1.00 204.29 ? 423 ILE A HD11 1 
ATOM   4007  H HD12 . ILE A  1 283 ? 77.245  -9.697   -14.494  1.00 204.29 ? 423 ILE A HD12 1 
ATOM   4008  H HD13 . ILE A  1 283 ? 76.501  -9.033   -15.731  1.00 204.29 ? 423 ILE A HD13 1 
ATOM   4009  N N    . ILE A  1 284 ? 80.719  -11.155  -19.398  1.00 129.24 ? 424 ILE A N    1 
ATOM   4010  C CA   . ILE A  1 284 ? 81.995  -10.875  -20.060  1.00 128.33 ? 424 ILE A CA   1 
ATOM   4011  C C    . ILE A  1 284 ? 81.846  -9.859   -21.202  1.00 126.87 ? 424 ILE A C    1 
ATOM   4012  O O    . ILE A  1 284 ? 80.838  -9.853   -21.907  1.00 125.52 ? 424 ILE A O    1 
ATOM   4013  C CB   . ILE A  1 284 ? 82.624  -12.179  -20.628  1.00 126.58 ? 424 ILE A CB   1 
ATOM   4014  C CG1  . ILE A  1 284 ? 82.805  -13.231  -19.532  1.00 129.04 ? 424 ILE A CG1  1 
ATOM   4015  C CG2  . ILE A  1 284 ? 83.968  -11.908  -21.272  1.00 125.56 ? 424 ILE A CG2  1 
ATOM   4016  C CD1  . ILE A  1 284 ? 81.815  -14.355  -19.614  1.00 128.75 ? 424 ILE A CD1  1 
ATOM   4017  H H    . ILE A  1 284 ? 80.068  -11.292  -19.944  1.00 95.86  ? 424 ILE A H    1 
ATOM   4018  H HA   . ILE A  1 284 ? 82.612  -10.504  -19.409  1.00 92.07  ? 424 ILE A HA   1 
ATOM   4019  H HB   . ILE A  1 284 ? 82.027  -12.538  -21.303  1.00 85.77  ? 424 ILE A HB   1 
ATOM   4020  H HG12 . ILE A  1 284 ? 83.695  -13.611  -19.606  1.00 90.30  ? 424 ILE A HG12 1 
ATOM   4021  H HG13 . ILE A  1 284 ? 82.700  -12.804  -18.667  1.00 90.30  ? 424 ILE A HG13 1 
ATOM   4022  H HG21 . ILE A  1 284 ? 84.328  -12.741  -21.614  1.00 82.87  ? 424 ILE A HG21 1 
ATOM   4023  H HG22 . ILE A  1 284 ? 83.848  -11.276  -21.999  1.00 82.87  ? 424 ILE A HG22 1 
ATOM   4024  H HG23 . ILE A  1 284 ? 84.568  -11.536  -20.607  1.00 82.87  ? 424 ILE A HG23 1 
ATOM   4025  H HD11 . ILE A  1 284 ? 81.988  -14.981  -18.894  1.00 90.87  ? 424 ILE A HD11 1 
ATOM   4026  H HD12 . ILE A  1 284 ? 80.919  -13.993  -19.531  1.00 90.87  ? 424 ILE A HD12 1 
ATOM   4027  H HD13 . ILE A  1 284 ? 81.914  -14.800  -20.471  1.00 90.87  ? 424 ILE A HD13 1 
ATOM   4028  N N    . ASN A  1 285 ? 82.848  -8.994   -21.363  1.00 130.96 ? 425 ASN A N    1 
ATOM   4029  C CA   . ASN A  1 285 ? 82.959  -8.149   -22.555  1.00 130.17 ? 425 ASN A CA   1 
ATOM   4030  C C    . ASN A  1 285 ? 83.579  -8.929   -23.715  1.00 127.27 ? 425 ASN A C    1 
ATOM   4031  O O    . ASN A  1 285 ? 84.690  -9.451   -23.602  1.00 126.74 ? 425 ASN A O    1 
ATOM   4032  C CB   . ASN A  1 285 ? 83.799  -6.896   -22.283  1.00 133.24 ? 425 ASN A CB   1 
ATOM   4033  C CG   . ASN A  1 285 ? 83.146  -5.951   -21.302  1.00 136.66 ? 425 ASN A CG   1 
ATOM   4034  O OD1  . ASN A  1 285 ? 82.164  -5.286   -21.629  1.00 137.02 ? 425 ASN A OD1  1 
ATOM   4035  N ND2  . ASN A  1 285 ? 83.704  -5.862   -20.102  1.00 139.58 ? 425 ASN A ND2  1 
ATOM   4036  H H    . ASN A  1 285 ? 83.481  -8.877   -20.793  1.00 215.95 ? 425 ASN A H    1 
ATOM   4037  H HA   . ASN A  1 285 ? 82.072  -7.864   -22.824  1.00 211.52 ? 425 ASN A HA   1 
ATOM   4038  H HB2  . ASN A  1 285 ? 84.656  -7.164   -21.916  1.00 216.35 ? 425 ASN A HB2  1 
ATOM   4039  H HB3  . ASN A  1 285 ? 83.931  -6.418   -23.117  1.00 216.35 ? 425 ASN A HB3  1 
ATOM   4040  H HD21 . ASN A  1 285 ? 83.368  -5.337   -19.510  1.00 233.38 ? 425 ASN A HD21 1 
ATOM   4041  H HD22 . ASN A  1 285 ? 84.402  -6.328   -19.917  1.00 233.38 ? 425 ASN A HD22 1 
ATOM   4042  N N    . MET A  1 286 ? 82.873  -8.989   -24.839  1.00 131.09 ? 426 MET A N    1 
ATOM   4043  C CA   . MET A  1 286 ? 83.286  -9.845   -25.945  1.00 128.90 ? 426 MET A CA   1 
ATOM   4044  C C    . MET A  1 286 ? 84.601  -9.401   -26.580  1.00 128.92 ? 426 MET A C    1 
ATOM   4045  O O    . MET A  1 286 ? 84.880  -8.208   -26.697  1.00 130.82 ? 426 MET A O    1 
ATOM   4046  C CB   . MET A  1 286 ? 82.185  -9.889   -27.008  1.00 128.52 ? 426 MET A CB   1 
ATOM   4047  C CG   . MET A  1 286 ? 80.924  -10.610  -26.552  1.00 128.26 ? 426 MET A CG   1 
ATOM   4048  S SD   . MET A  1 286 ? 79.713  -10.836  -27.871  1.00 128.17 ? 426 MET A SD   1 
ATOM   4049  C CE   . MET A  1 286 ? 79.422  -9.146   -28.379  1.00 130.25 ? 426 MET A CE   1 
ATOM   4050  H H    . MET A  1 286 ? 82.153  -8.543   -24.987  1.00 97.95  ? 426 MET A H    1 
ATOM   4051  H HA   . MET A  1 286 ? 83.399  -10.747  -25.607  1.00 91.70  ? 426 MET A HA   1 
ATOM   4052  H HB2  . MET A  1 286 ? 81.940  -8.980   -27.242  1.00 86.95  ? 426 MET A HB2  1 
ATOM   4053  H HB3  . MET A  1 286 ? 82.525  -10.350  -27.791  1.00 86.95  ? 426 MET A HB3  1 
ATOM   4054  H HG2  . MET A  1 286 ? 81.167  -11.487  -26.217  1.00 89.46  ? 426 MET A HG2  1 
ATOM   4055  H HG3  . MET A  1 286 ? 80.503  -10.093  -25.847  1.00 89.46  ? 426 MET A HG3  1 
ATOM   4056  H HE1  . MET A  1 286 ? 78.774  -9.141   -29.100  1.00 87.95  ? 426 MET A HE1  1 
ATOM   4057  H HE2  . MET A  1 286 ? 79.081  -8.644   -27.623  1.00 87.95  ? 426 MET A HE2  1 
ATOM   4058  H HE3  . MET A  1 286 ? 80.259  -8.760   -28.683  1.00 87.95  ? 426 MET A HE3  1 
ATOM   4059  N N    . TRP A  1 287 ? 85.410  -10.382  -26.971  1.00 124.12 ? 427 TRP A N    1 
ATOM   4060  C CA   . TRP A  1 287 ? 86.610  -10.133  -27.763  1.00 123.92 ? 427 TRP A CA   1 
ATOM   4061  C C    . TRP A  1 287 ? 86.265  -10.198  -29.250  1.00 123.87 ? 427 TRP A C    1 
ATOM   4062  O O    . TRP A  1 287 ? 86.933  -9.584   -30.083  1.00 124.83 ? 427 TRP A O    1 
ATOM   4063  C CB   . TRP A  1 287 ? 87.707  -11.144  -27.416  1.00 122.71 ? 427 TRP A CB   1 
ATOM   4064  C CG   . TRP A  1 287 ? 87.374  -12.558  -27.753  1.00 121.55 ? 427 TRP A CG   1 
ATOM   4065  C CD1  . TRP A  1 287 ? 86.682  -13.438  -26.978  1.00 121.65 ? 427 TRP A CD1  1 
ATOM   4066  C CD2  . TRP A  1 287 ? 87.729  -13.265  -28.947  1.00 121.15 ? 427 TRP A CD2  1 
ATOM   4067  N NE1  . TRP A  1 287 ? 86.575  -14.648  -27.616  1.00 121.43 ? 427 TRP A NE1  1 
ATOM   4068  C CE2  . TRP A  1 287 ? 87.210  -14.570  -28.828  1.00 121.20 ? 427 TRP A CE2  1 
ATOM   4069  C CE3  . TRP A  1 287 ? 88.431  -12.921  -30.107  1.00 121.56 ? 427 TRP A CE3  1 
ATOM   4070  C CZ2  . TRP A  1 287 ? 87.372  -15.533  -29.823  1.00 121.87 ? 427 TRP A CZ2  1 
ATOM   4071  C CZ3  . TRP A  1 287 ? 88.588  -13.876  -31.095  1.00 122.10 ? 427 TRP A CZ3  1 
ATOM   4072  C CH2  . TRP A  1 287 ? 88.062  -15.168  -30.947  1.00 122.35 ? 427 TRP A CH2  1 
ATOM   4073  H H    . TRP A  1 287 ? 85.283  -11.213  -26.788  1.00 102.52 ? 427 TRP A H    1 
ATOM   4074  H HA   . TRP A  1 287 ? 86.944  -9.243   -27.567  1.00 101.33 ? 427 TRP A HA   1 
ATOM   4075  H HB2  . TRP A  1 287 ? 88.512  -10.907  -27.903  1.00 101.80 ? 427 TRP A HB2  1 
ATOM   4076  H HB3  . TRP A  1 287 ? 87.878  -11.101  -26.462  1.00 101.80 ? 427 TRP A HB3  1 
ATOM   4077  H HD1  . TRP A  1 287 ? 86.330  -13.245  -26.140  1.00 96.24  ? 427 TRP A HD1  1 
ATOM   4078  H HE1  . TRP A  1 287 ? 86.176  -15.343  -27.305  1.00 91.52  ? 427 TRP A HE1  1 
ATOM   4079  H HE3  . TRP A  1 287 ? 88.782  -12.067  -30.212  1.00 88.28  ? 427 TRP A HE3  1 
ATOM   4080  H HZ2  . TRP A  1 287 ? 87.022  -16.390  -29.728  1.00 83.58  ? 427 TRP A HZ2  1 
ATOM   4081  H HZ3  . TRP A  1 287 ? 89.054  -13.659  -31.870  1.00 83.54  ? 427 TRP A HZ3  1 
ATOM   4082  H HH2  . TRP A  1 287 ? 88.184  -15.789  -31.627  1.00 81.39  ? 427 TRP A HH2  1 
ATOM   4083  N N    . GLN A  1 288 ? 85.203  -10.933  -29.571  1.00 120.65 ? 428 GLN A N    1 
ATOM   4084  C CA   . GLN A  1 288 ? 84.761  -11.104  -30.949  1.00 121.38 ? 428 GLN A CA   1 
ATOM   4085  C C    . GLN A  1 288 ? 84.218  -9.785   -31.502  1.00 123.47 ? 428 GLN A C    1 
ATOM   4086  O O    . GLN A  1 288 ? 84.323  -9.506   -32.700  1.00 125.07 ? 428 GLN A O    1 
ATOM   4087  C CB   . GLN A  1 288 ? 83.690  -12.204  -31.032  1.00 120.91 ? 428 GLN A CB   1 
ATOM   4088  C CG   . GLN A  1 288 ? 84.064  -13.513  -30.326  1.00 119.88 ? 428 GLN A CG   1 
ATOM   4089  C CD   . GLN A  1 288 ? 83.569  -13.580  -28.885  1.00 119.49 ? 428 GLN A CD   1 
ATOM   4090  O OE1  . GLN A  1 288 ? 83.841  -12.688  -28.082  1.00 119.56 ? 428 GLN A OE1  1 
ATOM   4091  N NE2  . GLN A  1 288 ? 82.840  -14.643  -28.555  1.00 119.84 ? 428 GLN A NE2  1 
ATOM   4092  H H    . GLN A  1 288 ? 84.716  -11.348  -28.997  1.00 90.93  ? 428 GLN A H    1 
ATOM   4093  H HA   . GLN A  1 288 ? 85.515  -11.375  -31.495  1.00 86.40  ? 428 GLN A HA   1 
ATOM   4094  H HB2  . GLN A  1 288 ? 82.874  -11.873  -30.625  1.00 84.13  ? 428 GLN A HB2  1 
ATOM   4095  H HB3  . GLN A  1 288 ? 83.528  -12.410  -31.966  1.00 84.13  ? 428 GLN A HB3  1 
ATOM   4096  H HG2  . GLN A  1 288 ? 83.672  -14.255  -30.811  1.00 84.52  ? 428 GLN A HG2  1 
ATOM   4097  H HG3  . GLN A  1 288 ? 85.030  -13.599  -30.314  1.00 84.52  ? 428 GLN A HG3  1 
ATOM   4098  H HE21 . GLN A  1 288 ? 82.538  -14.726  -27.753  1.00 88.53  ? 428 GLN A HE21 1 
ATOM   4099  H HE22 . GLN A  1 288 ? 82.670  -15.248  -29.142  1.00 88.53  ? 428 GLN A HE22 1 
ATOM   4100  N N    . ARG A  1 289 ? 83.650  -8.977   -30.611  1.00 133.96 ? 429 ARG A N    1 
ATOM   4101  C CA   . ARG A  1 289 ? 83.009  -7.719   -30.980  1.00 136.55 ? 429 ARG A CA   1 
ATOM   4102  C C    . ARG A  1 289 ? 82.940  -6.808   -29.765  1.00 137.63 ? 429 ARG A C    1 
ATOM   4103  O O    . ARG A  1 289 ? 83.010  -7.277   -28.631  1.00 136.36 ? 429 ARG A O    1 
ATOM   4104  C CB   . ARG A  1 289 ? 81.600  -7.975   -31.523  1.00 137.02 ? 429 ARG A CB   1 
ATOM   4105  C CG   . ARG A  1 289 ? 81.318  -7.371   -32.894  1.00 139.63 ? 429 ARG A CG   1 
ATOM   4106  C CD   . ARG A  1 289 ? 80.258  -8.172   -33.651  1.00 138.73 ? 429 ARG A CD   1 
ATOM   4107  N NE   . ARG A  1 289 ? 80.753  -9.490   -34.062  1.00 136.84 ? 429 ARG A NE   1 
ATOM   4108  C CZ   . ARG A  1 289 ? 80.546  -10.634  -33.409  1.00 134.82 ? 429 ARG A CZ   1 
ATOM   4109  N NH1  . ARG A  1 289 ? 79.835  -10.663  -32.291  1.00 133.98 ? 429 ARG A NH1  1 
ATOM   4110  N NH2  . ARG A  1 289 ? 81.054  -11.767  -33.882  1.00 134.25 ? 429 ARG A NH2  1 
ATOM   4111  H H    . ARG A  1 289 ? 83.623  -9.141   -29.767  1.00 145.97 ? 429 ARG A H    1 
ATOM   4112  H HA   . ARG A  1 289 ? 83.530  -7.278   -31.669  1.00 148.20 ? 429 ARG A HA   1 
ATOM   4113  H HB2  . ARG A  1 289 ? 81.466  -8.933   -31.593  1.00 147.71 ? 429 ARG A HB2  1 
ATOM   4114  H HB3  . ARG A  1 289 ? 80.957  -7.601   -30.901  1.00 147.71 ? 429 ARG A HB3  1 
ATOM   4115  H HG2  . ARG A  1 289 ? 80.992  -6.464   -32.783  1.00 150.98 ? 429 ARG A HG2  1 
ATOM   4116  H HG3  . ARG A  1 289 ? 82.133  -7.373   -33.419  1.00 150.98 ? 429 ARG A HG3  1 
ATOM   4117  H HD2  . ARG A  1 289 ? 79.488  -8.304   -33.075  1.00 152.00 ? 429 ARG A HD2  1 
ATOM   4118  H HD3  . ARG A  1 289 ? 79.999  -7.684   -34.448  1.00 152.00 ? 429 ARG A HD3  1 
ATOM   4119  H HE   . ARG A  1 289 ? 81.217  -9.528   -34.785  1.00 148.54 ? 429 ARG A HE   1 
ATOM   4120  H HH11 . ARG A  1 289 ? 79.502  -9.936   -31.974  1.00 147.09 ? 429 ARG A HH11 1 
ATOM   4121  H HH12 . ARG A  1 289 ? 79.708  -11.408  -31.880  1.00 147.09 ? 429 ARG A HH12 1 
ATOM   4122  H HH21 . ARG A  1 289 ? 81.516  -11.761  -34.608  1.00 144.25 ? 429 ARG A HH21 1 
ATOM   4123  H HH22 . ARG A  1 289 ? 80.919  -12.507  -33.465  1.00 144.25 ? 429 ARG A HH22 1 
ATOM   4124  N N    . VAL A  1 290 ? 82.799  -5.509   -29.992  1.00 130.17 ? 430 VAL A N    1 
ATOM   4125  C CA   . VAL A  1 290 ? 82.613  -4.589   -28.884  1.00 132.21 ? 430 VAL A CA   1 
ATOM   4126  C C    . VAL A  1 290 ? 81.205  -4.797   -28.347  1.00 131.71 ? 430 VAL A C    1 
ATOM   4127  O O    . VAL A  1 290 ? 80.226  -4.547   -29.048  1.00 132.55 ? 430 VAL A O    1 
ATOM   4128  C CB   . VAL A  1 290 ? 82.813  -3.128   -29.304  1.00 136.37 ? 430 VAL A CB   1 
ATOM   4129  C CG1  . VAL A  1 290 ? 82.646  -2.199   -28.108  1.00 139.26 ? 430 VAL A CG1  1 
ATOM   4130  C CG2  . VAL A  1 290 ? 84.180  -2.947   -29.918  1.00 137.12 ? 430 VAL A CG2  1 
ATOM   4131  H H    . VAL A  1 290 ? 82.806  -5.139   -30.768  1.00 155.78 ? 430 VAL A H    1 
ATOM   4132  H HA   . VAL A  1 290 ? 83.246  -4.797   -28.179  1.00 161.86 ? 430 VAL A HA   1 
ATOM   4133  H HB   . VAL A  1 290 ? 82.147  -2.892   -29.969  1.00 165.87 ? 430 VAL A HB   1 
ATOM   4134  H HG11 . VAL A  1 290 ? 82.777  -1.283   -28.400  1.00 173.14 ? 430 VAL A HG11 1 
ATOM   4135  H HG12 . VAL A  1 290 ? 81.752  -2.307   -27.747  1.00 173.14 ? 430 VAL A HG12 1 
ATOM   4136  H HG13 . VAL A  1 290 ? 83.305  -2.429   -27.435  1.00 173.14 ? 430 VAL A HG13 1 
ATOM   4137  H HG21 . VAL A  1 290 ? 84.289  -2.019   -30.177  1.00 165.12 ? 430 VAL A HG21 1 
ATOM   4138  H HG22 . VAL A  1 290 ? 84.854  -3.190   -29.263  1.00 165.12 ? 430 VAL A HG22 1 
ATOM   4139  H HG23 . VAL A  1 290 ? 84.254  -3.520   -30.697  1.00 165.12 ? 430 VAL A HG23 1 
ATOM   4140  N N    . GLY A  1 291 ? 81.106  -5.285   -27.115  1.00 127.48 ? 431 GLY A N    1 
ATOM   4141  C CA   . GLY A  1 291 ? 79.815  -5.532   -26.502  1.00 127.18 ? 431 GLY A CA   1 
ATOM   4142  C C    . GLY A  1 291 ? 79.924  -6.388   -25.255  1.00 125.90 ? 431 GLY A C    1 
ATOM   4143  O O    . GLY A  1 291 ? 81.026  -6.692   -24.797  1.00 125.56 ? 431 GLY A O    1 
ATOM   4144  H H    . GLY A  1 291 ? 81.777  -5.480   -26.614  1.00 227.27 ? 431 GLY A H    1 
ATOM   4145  H HA2  . GLY A  1 291 ? 79.405  -4.687   -26.259  1.00 231.04 ? 431 GLY A HA2  1 
ATOM   4146  H HA3  . GLY A  1 291 ? 79.237  -5.984   -27.136  1.00 231.04 ? 431 GLY A HA3  1 
ATOM   4147  N N    . GLN A  1 292 ? 78.771  -6.774   -24.711  1.00 124.30 ? 432 GLN A N    1 
ATOM   4148  C CA   . GLN A  1 292 ? 78.704  -7.624   -23.523  1.00 123.85 ? 432 GLN A CA   1 
ATOM   4149  C C    . GLN A  1 292 ? 77.885  -8.877   -23.787  1.00 122.14 ? 432 GLN A C    1 
ATOM   4150  O O    . GLN A  1 292 ? 76.923  -8.857   -24.555  1.00 121.89 ? 432 GLN A O    1 
ATOM   4151  C CB   . GLN A  1 292 ? 78.103  -6.856   -22.349  1.00 126.48 ? 432 GLN A CB   1 
ATOM   4152  C CG   . GLN A  1 292 ? 78.987  -5.744   -21.839  1.00 128.99 ? 432 GLN A CG   1 
ATOM   4153  C CD   . GLN A  1 292 ? 78.375  -5.006   -20.671  1.00 131.90 ? 432 GLN A CD   1 
ATOM   4154  O OE1  . GLN A  1 292 ? 77.151  -4.913   -20.546  1.00 132.52 ? 432 GLN A OE1  1 
ATOM   4155  N NE2  . GLN A  1 292 ? 79.226  -4.484   -19.796  1.00 134.07 ? 432 GLN A NE2  1 
ATOM   4156  H H    . GLN A  1 292 ? 77.999  -6.551   -25.017  1.00 131.86 ? 432 GLN A H    1 
ATOM   4157  H HA   . GLN A  1 292 ? 79.602  -7.897   -23.278  1.00 136.09 ? 432 GLN A HA   1 
ATOM   4158  H HB2  . GLN A  1 292 ? 77.262  -6.463   -22.630  1.00 145.65 ? 432 GLN A HB2  1 
ATOM   4159  H HB3  . GLN A  1 292 ? 77.950  -7.474   -21.617  1.00 145.65 ? 432 GLN A HB3  1 
ATOM   4160  H HG2  . GLN A  1 292 ? 79.832  -6.119   -21.548  1.00 150.06 ? 432 GLN A HG2  1 
ATOM   4161  H HG3  . GLN A  1 292 ? 79.135  -5.105   -22.554  1.00 150.06 ? 432 GLN A HG3  1 
ATOM   4162  H HE21 . GLN A  1 292 ? 78.930  -4.054   -19.113  1.00 166.86 ? 432 GLN A HE21 1 
ATOM   4163  H HE22 . GLN A  1 292 ? 80.073  -4.576   -19.913  1.00 166.86 ? 432 GLN A HE22 1 
ATOM   4164  N N    . ALA A  1 293 ? 78.274  -9.966   -23.136  1.00 122.34 ? 433 ALA A N    1 
ATOM   4165  C CA   . ALA A  1 293 ? 77.595  -11.240  -23.301  1.00 121.43 ? 433 ALA A CA   1 
ATOM   4166  C C    . ALA A  1 293 ? 77.464  -11.937  -21.952  1.00 122.86 ? 433 ALA A C    1 
ATOM   4167  O O    . ALA A  1 293 ? 78.290  -11.736  -21.060  1.00 124.08 ? 433 ALA A O    1 
ATOM   4168  C CB   . ALA A  1 293 ? 78.353  -12.123  -24.313  1.00 119.59 ? 433 ALA A CB   1 
ATOM   4169  H H    . ALA A  1 293 ? 78.936  -9.992   -22.588  1.00 92.69  ? 433 ALA A H    1 
ATOM   4170  H HA   . ALA A  1 293 ? 76.703  -11.082  -23.647  1.00 90.46  ? 433 ALA A HA   1 
ATOM   4171  H HB1  . ALA A  1 293 ? 77.883  -12.967  -24.408  1.00 83.93  ? 433 ALA A HB1  1 
ATOM   4172  H HB2  . ALA A  1 293 ? 78.387  -11.666  -25.167  1.00 83.93  ? 433 ALA A HB2  1 
ATOM   4173  H HB3  . ALA A  1 293 ? 79.252  -12.280  -23.984  1.00 83.93  ? 433 ALA A HB3  1 
ATOM   4174  N N    . ILE A  1 294 ? 76.406  -12.727  -21.796  1.00 113.58 ? 434 ILE A N    1 
ATOM   4175  C CA   . ILE A  1 294 ? 76.203  -13.502  -20.579  1.00 116.25 ? 434 ILE A CA   1 
ATOM   4176  C C    . ILE A  1 294 ? 76.073  -14.994  -20.845  1.00 115.49 ? 434 ILE A C    1 
ATOM   4177  O O    . ILE A  1 294 ? 75.222  -15.428  -21.625  1.00 114.99 ? 434 ILE A O    1 
ATOM   4178  C CB   . ILE A  1 294 ? 74.956  -13.058  -19.849  1.00 119.96 ? 434 ILE A CB   1 
ATOM   4179  C CG1  . ILE A  1 294 ? 75.017  -11.560  -19.575  1.00 121.23 ? 434 ILE A CG1  1 
ATOM   4180  C CG2  . ILE A  1 294 ? 74.821  -13.828  -18.549  1.00 123.06 ? 434 ILE A CG2  1 
ATOM   4181  C CD1  . ILE A  1 294 ? 73.719  -11.003  -19.074  1.00 124.94 ? 434 ILE A CD1  1 
ATOM   4182  H H    . ILE A  1 294 ? 75.788  -12.831  -22.384  1.00 74.68  ? 434 ILE A H    1 
ATOM   4183  H HA   . ILE A  1 294 ? 76.961  -13.368  -19.989  1.00 81.48  ? 434 ILE A HA   1 
ATOM   4184  H HB   . ILE A  1 294 ? 74.183  -13.244  -20.406  1.00 89.00  ? 434 ILE A HB   1 
ATOM   4185  H HG12 . ILE A  1 294 ? 75.695  -11.390  -18.902  1.00 92.36  ? 434 ILE A HG12 1 
ATOM   4186  H HG13 . ILE A  1 294 ? 75.243  -11.098  -20.397  1.00 92.36  ? 434 ILE A HG13 1 
ATOM   4187  H HG21 . ILE A  1 294 ? 74.018  -13.535  -18.091  1.00 96.72  ? 434 ILE A HG21 1 
ATOM   4188  H HG22 . ILE A  1 294 ? 74.761  -14.775  -18.749  1.00 96.72  ? 434 ILE A HG22 1 
ATOM   4189  H HG23 . ILE A  1 294 ? 75.600  -13.655  -17.998  1.00 96.72  ? 434 ILE A HG23 1 
ATOM   4190  H HD11 . ILE A  1 294 ? 73.823  -10.051  -18.919  1.00 99.83  ? 434 ILE A HD11 1 
ATOM   4191  H HD12 . ILE A  1 294 ? 73.032  -11.157  -19.740  1.00 99.83  ? 434 ILE A HD12 1 
ATOM   4192  H HD13 . ILE A  1 294 ? 73.483  -11.450  -18.245  1.00 99.83  ? 434 ILE A HD13 1 
ATOM   4193  N N    . TYR A  1 295 ? 76.896  -15.769  -20.148  1.00 125.97 ? 435 TYR A N    1 
ATOM   4194  C CA   . TYR A  1 295 ? 76.875  -17.220  -20.249  1.00 127.04 ? 435 TYR A CA   1 
ATOM   4195  C C    . TYR A  1 295 ? 76.187  -17.788  -19.019  1.00 129.86 ? 435 TYR A C    1 
ATOM   4196  O O    . TYR A  1 295 ? 75.955  -17.069  -18.047  1.00 130.89 ? 435 TYR A O    1 
ATOM   4197  C CB   . TYR A  1 295 ? 78.291  -17.777  -20.376  1.00 127.39 ? 435 TYR A CB   1 
ATOM   4198  C CG   . TYR A  1 295 ? 78.999  -17.396  -21.659  1.00 124.68 ? 435 TYR A CG   1 
ATOM   4199  C CD1  . TYR A  1 295 ? 79.661  -16.181  -21.779  1.00 123.04 ? 435 TYR A CD1  1 
ATOM   4200  C CD2  . TYR A  1 295 ? 79.013  -18.257  -22.748  1.00 124.27 ? 435 TYR A CD2  1 
ATOM   4201  C CE1  . TYR A  1 295 ? 80.313  -15.830  -22.951  1.00 120.77 ? 435 TYR A CE1  1 
ATOM   4202  C CE2  . TYR A  1 295 ? 79.662  -17.917  -23.924  1.00 122.05 ? 435 TYR A CE2  1 
ATOM   4203  C CZ   . TYR A  1 295 ? 80.312  -16.703  -24.021  1.00 120.16 ? 435 TYR A CZ   1 
ATOM   4204  O OH   . TYR A  1 295 ? 80.959  -16.368  -25.193  1.00 118.36 ? 435 TYR A OH   1 
ATOM   4205  H H    . TYR A  1 295 ? 77.487  -15.471  -19.600  1.00 145.09 ? 435 TYR A H    1 
ATOM   4206  H HA   . TYR A  1 295 ? 76.369  -17.483  -21.034  1.00 146.11 ? 435 TYR A HA   1 
ATOM   4207  H HB2  . TYR A  1 295 ? 78.823  -17.445  -19.636  1.00 142.33 ? 435 TYR A HB2  1 
ATOM   4208  H HB3  . TYR A  1 295 ? 78.249  -18.745  -20.339  1.00 142.33 ? 435 TYR A HB3  1 
ATOM   4209  H HD1  . TYR A  1 295 ? 79.664  -15.591  -21.060  1.00 129.48 ? 435 TYR A HD1  1 
ATOM   4210  H HD2  . TYR A  1 295 ? 78.577  -19.076  -22.687  1.00 130.20 ? 435 TYR A HD2  1 
ATOM   4211  H HE1  . TYR A  1 295 ? 80.751  -15.012  -23.016  1.00 122.32 ? 435 TYR A HE1  1 
ATOM   4212  H HE2  . TYR A  1 295 ? 79.661  -18.505  -24.645  1.00 123.13 ? 435 TYR A HE2  1 
ATOM   4213  H HH   . TYR A  1 295 ? 81.310  -15.608  -25.120  1.00 112.97 ? 435 TYR A HH   1 
ATOM   4214  N N    . ALA A  1 296 ? 75.867  -19.078  -19.059  1.00 135.69 ? 436 ALA A N    1 
ATOM   4215  C CA   . ALA A  1 296 ? 75.154  -19.724  -17.959  1.00 138.39 ? 436 ALA A CA   1 
ATOM   4216  C C    . ALA A  1 296 ? 76.082  -19.916  -16.765  1.00 140.81 ? 436 ALA A C    1 
ATOM   4217  O O    . ALA A  1 296 ? 77.301  -19.816  -16.904  1.00 140.78 ? 436 ALA A O    1 
ATOM   4218  C CB   . ALA A  1 296 ? 74.577  -21.063  -18.411  1.00 139.57 ? 436 ALA A CB   1 
ATOM   4219  H H    . ALA A  1 296 ? 76.052  -19.604  -19.714  1.00 131.03 ? 436 ALA A H    1 
ATOM   4220  H HA   . ALA A  1 296 ? 74.418  -19.157  -17.681  1.00 139.84 ? 436 ALA A HA   1 
ATOM   4221  H HB1  . ALA A  1 296 ? 74.110  -21.472  -17.667  1.00 142.72 ? 436 ALA A HB1  1 
ATOM   4222  H HB2  . ALA A  1 296 ? 73.962  -20.909  -19.145  1.00 142.72 ? 436 ALA A HB2  1 
ATOM   4223  H HB3  . ALA A  1 296 ? 75.303  -21.636  -18.703  1.00 142.72 ? 436 ALA A HB3  1 
ATOM   4224  N N    . PRO A  1 297 ? 75.509  -20.187  -15.582  1.00 144.27 ? 437 PRO A N    1 
ATOM   4225  C CA   . PRO A  1 297 ? 76.324  -20.391  -14.379  1.00 146.94 ? 437 PRO A CA   1 
ATOM   4226  C C    . PRO A  1 297 ? 77.293  -21.559  -14.513  1.00 148.58 ? 437 PRO A C    1 
ATOM   4227  O O    . PRO A  1 297 ? 77.111  -22.408  -15.386  1.00 148.25 ? 437 PRO A O    1 
ATOM   4228  C CB   . PRO A  1 297 ? 75.285  -20.676  -13.293  1.00 149.10 ? 437 PRO A CB   1 
ATOM   4229  C CG   . PRO A  1 297 ? 74.020  -20.092  -13.808  1.00 148.36 ? 437 PRO A CG   1 
ATOM   4230  C CD   . PRO A  1 297 ? 74.069  -20.252  -15.288  1.00 145.10 ? 437 PRO A CD   1 
ATOM   4231  H HA   . PRO A  1 297 ? 76.813  -19.583  -14.157  1.00 145.00 ? 437 PRO A HA   1 
ATOM   4232  H HB2  . PRO A  1 297 ? 75.196  -21.634  -13.169  1.00 155.01 ? 437 PRO A HB2  1 
ATOM   4233  H HB3  . PRO A  1 297 ? 75.550  -20.245  -12.465  1.00 155.01 ? 437 PRO A HB3  1 
ATOM   4234  H HG2  . PRO A  1 297 ? 73.265  -20.576  -13.438  1.00 158.57 ? 437 PRO A HG2  1 
ATOM   4235  H HG3  . PRO A  1 297 ? 73.974  -19.153  -13.568  1.00 158.57 ? 437 PRO A HG3  1 
ATOM   4236  H HD2  . PRO A  1 297 ? 73.708  -21.114  -15.548  1.00 151.63 ? 437 PRO A HD2  1 
ATOM   4237  H HD3  . PRO A  1 297 ? 73.600  -19.523  -15.724  1.00 151.63 ? 437 PRO A HD3  1 
ATOM   4238  N N    . PRO A  1 298 ? 78.318  -21.605  -13.650  1.00 157.76 ? 438 PRO A N    1 
ATOM   4239  C CA   . PRO A  1 298 ? 79.339  -22.653  -13.739  1.00 159.94 ? 438 PRO A CA   1 
ATOM   4240  C C    . PRO A  1 298 ? 78.805  -24.052  -13.427  1.00 161.55 ? 438 PRO A C    1 
ATOM   4241  O O    . PRO A  1 298 ? 77.876  -24.187  -12.627  1.00 162.17 ? 438 PRO A O    1 
ATOM   4242  C CB   . PRO A  1 298 ? 80.371  -22.223  -12.690  1.00 161.97 ? 438 PRO A CB   1 
ATOM   4243  C CG   . PRO A  1 298 ? 79.609  -21.386  -11.724  1.00 161.91 ? 438 PRO A CG   1 
ATOM   4244  C CD   . PRO A  1 298 ? 78.592  -20.662  -12.551  1.00 158.89 ? 438 PRO A CD   1 
ATOM   4245  H HA   . PRO A  1 298 ? 79.751  -22.652  -14.617  1.00 231.22 ? 438 PRO A HA   1 
ATOM   4246  H HB2  . PRO A  1 298 ? 80.738  -23.006  -12.251  1.00 232.29 ? 438 PRO A HB2  1 
ATOM   4247  H HB3  . PRO A  1 298 ? 81.073  -21.705  -13.114  1.00 232.29 ? 438 PRO A HB3  1 
ATOM   4248  H HG2  . PRO A  1 298 ? 79.176  -21.955  -11.069  1.00 236.99 ? 438 PRO A HG2  1 
ATOM   4249  H HG3  . PRO A  1 298 ? 80.209  -20.758  -11.291  1.00 236.99 ? 438 PRO A HG3  1 
ATOM   4250  H HD2  . PRO A  1 298 ? 77.787  -20.502  -12.034  1.00 235.43 ? 438 PRO A HD2  1 
ATOM   4251  H HD3  . PRO A  1 298 ? 78.963  -19.836  -12.898  1.00 235.43 ? 438 PRO A HD3  1 
ATOM   4252  N N    . ILE A  1 299 ? 79.384  -25.074  -14.056  1.00 165.95 ? 439 ILE A N    1 
ATOM   4253  C CA   . ILE A  1 299 ? 79.045  -26.459  -13.737  1.00 167.29 ? 439 ILE A CA   1 
ATOM   4254  C C    . ILE A  1 299 ? 79.532  -26.805  -12.334  1.00 169.49 ? 439 ILE A C    1 
ATOM   4255  O O    . ILE A  1 299 ? 80.361  -26.096  -11.764  1.00 170.22 ? 439 ILE A O    1 
ATOM   4256  C CB   . ILE A  1 299 ? 79.659  -27.461  -14.748  1.00 167.77 ? 439 ILE A CB   1 
ATOM   4257  C CG1  . ILE A  1 299 ? 81.180  -27.286  -14.834  1.00 168.92 ? 439 ILE A CG1  1 
ATOM   4258  C CG2  . ILE A  1 299 ? 79.027  -27.287  -16.121  1.00 165.98 ? 439 ILE A CG2  1 
ATOM   4259  C CD1  . ILE A  1 299 ? 81.901  -28.412  -15.550  1.00 169.70 ? 439 ILE A CD1  1 
ATOM   4260  H H    . ILE A  1 299 ? 79.978  -24.991  -14.673  1.00 210.08 ? 439 ILE A H    1 
ATOM   4261  H HA   . ILE A  1 299 ? 78.081  -26.563  -13.757  1.00 218.54 ? 439 ILE A HA   1 
ATOM   4262  H HB   . ILE A  1 299 ? 79.473  -28.361  -14.437  1.00 216.73 ? 439 ILE A HB   1 
ATOM   4263  H HG12 . ILE A  1 299 ? 81.371  -26.463  -15.312  1.00 212.67 ? 439 ILE A HG12 1 
ATOM   4264  H HG13 . ILE A  1 299 ? 81.538  -27.231  -13.934  1.00 212.67 ? 439 ILE A HG13 1 
ATOM   4265  H HG21 . ILE A  1 299 ? 79.426  -27.923  -16.735  1.00 208.13 ? 439 ILE A HG21 1 
ATOM   4266  H HG22 . ILE A  1 299 ? 78.073  -27.447  -16.051  1.00 208.13 ? 439 ILE A HG22 1 
ATOM   4267  H HG23 . ILE A  1 299 ? 79.188  -26.381  -16.430  1.00 208.13 ? 439 ILE A HG23 1 
ATOM   4268  H HD11 . ILE A  1 299 ? 82.852  -28.222  -15.559  1.00 210.52 ? 439 ILE A HD11 1 
ATOM   4269  H HD12 . ILE A  1 299 ? 81.734  -29.243  -15.078  1.00 210.52 ? 439 ILE A HD12 1 
ATOM   4270  H HD13 . ILE A  1 299 ? 81.567  -28.474  -16.458  1.00 210.52 ? 439 ILE A HD13 1 
ATOM   4271  N N    . GLN A  1 300 ? 79.016  -27.899  -11.783  1.00 177.62 ? 440 GLN A N    1 
ATOM   4272  C CA   . GLN A  1 300 ? 79.428  -28.357  -10.462  1.00 179.70 ? 440 GLN A CA   1 
ATOM   4273  C C    . GLN A  1 300 ? 80.706  -29.181  -10.581  1.00 180.69 ? 440 GLN A C    1 
ATOM   4274  O O    . GLN A  1 300 ? 81.116  -29.537  -11.685  1.00 179.86 ? 440 GLN A O    1 
ATOM   4275  C CB   . GLN A  1 300 ? 78.316  -29.180  -9.809   1.00 180.43 ? 440 GLN A CB   1 
ATOM   4276  C CG   . GLN A  1 300 ? 78.317  -30.662  -10.192  1.00 180.73 ? 440 GLN A CG   1 
ATOM   4277  C CD   . GLN A  1 300 ? 76.926  -31.218  -10.416  1.00 181.10 ? 440 GLN A CD   1 
ATOM   4278  O OE1  . GLN A  1 300 ? 75.951  -30.753  -9.826   1.00 182.65 ? 440 GLN A OE1  1 
ATOM   4279  N NE2  . GLN A  1 300 ? 76.828  -32.216  -11.287  1.00 180.53 ? 440 GLN A NE2  1 
ATOM   4280  H H    . GLN A  1 300 ? 78.422  -28.397  -12.157  1.00 268.44 ? 440 GLN A H    1 
ATOM   4281  H HA   . GLN A  1 300 ? 79.611  -27.589  -9.898   1.00 278.52 ? 440 GLN A HA   1 
ATOM   4282  H HB2  . GLN A  1 300 ? 78.414  -29.125  -8.846   1.00 290.62 ? 440 GLN A HB2  1 
ATOM   4283  H HB3  . GLN A  1 300 ? 77.460  -28.809  -10.072  1.00 290.62 ? 440 GLN A HB3  1 
ATOM   4284  H HG2  . GLN A  1 300 ? 78.820  -30.775  -11.014  1.00 291.93 ? 440 GLN A HG2  1 
ATOM   4285  H HG3  . GLN A  1 300 ? 78.732  -31.172  -9.478   1.00 291.93 ? 440 GLN A HG3  1 
ATOM   4286  H HE21 . GLN A  1 300 ? 76.061  -32.569  -11.451  1.00 281.49 ? 440 GLN A HE21 1 
ATOM   4287  H HE22 . GLN A  1 300 ? 77.531  -32.510  -11.685  1.00 281.49 ? 440 GLN A HE22 1 
ATOM   4288  N N    . GLY A  1 301 ? 81.328  -29.484  -9.446   1.00 178.85 ? 441 GLY A N    1 
ATOM   4289  C CA   . GLY A  1 301 ? 82.502  -30.338  -9.426   1.00 179.74 ? 441 GLY A CA   1 
ATOM   4290  C C    . GLY A  1 301 ? 83.808  -29.585  -9.584   1.00 179.84 ? 441 GLY A C    1 
ATOM   4291  O O    . GLY A  1 301 ? 83.823  -28.359  -9.698   1.00 179.35 ? 441 GLY A O    1 
ATOM   4292  H H    . GLY A  1 301 ? 81.086  -29.203  -8.670   1.00 239.72 ? 441 GLY A H    1 
ATOM   4293  H HA2  . GLY A  1 301 ? 82.531  -30.821  -8.584   1.00 243.86 ? 441 GLY A HA2  1 
ATOM   4294  H HA3  . GLY A  1 301 ? 82.437  -30.986  -10.145  1.00 243.86 ? 441 GLY A HA3  1 
ATOM   4295  N N    . VAL A  1 302 ? 84.911  -30.325  -9.589   1.00 169.22 ? 442 VAL A N    1 
ATOM   4296  C CA   . VAL A  1 302 ? 86.232  -29.722  -9.699   1.00 169.37 ? 442 VAL A CA   1 
ATOM   4297  C C    . VAL A  1 302 ? 86.488  -29.263  -11.128  1.00 167.80 ? 442 VAL A C    1 
ATOM   4298  O O    . VAL A  1 302 ? 86.220  -29.993  -12.084  1.00 166.91 ? 442 VAL A O    1 
ATOM   4299  C CB   . VAL A  1 302 ? 87.346  -30.704  -9.277   1.00 170.33 ? 442 VAL A CB   1 
ATOM   4300  C CG1  . VAL A  1 302 ? 88.703  -30.003  -9.266   1.00 170.28 ? 442 VAL A CG1  1 
ATOM   4301  C CG2  . VAL A  1 302 ? 87.049  -31.303  -7.908   1.00 172.14 ? 442 VAL A CG2  1 
ATOM   4302  H H    . VAL A  1 302 ? 84.921  -31.183  -9.530   1.00 149.65 ? 442 VAL A H    1 
ATOM   4303  H HA   . VAL A  1 302 ? 86.277  -28.946  -9.119   1.00 142.98 ? 442 VAL A HA   1 
ATOM   4304  H HB   . VAL A  1 302 ? 87.389  -31.430  -9.919   1.00 152.65 ? 442 VAL A HB   1 
ATOM   4305  H HG11 . VAL A  1 302 ? 89.384  -30.639  -8.999   1.00 145.69 ? 442 VAL A HG11 1 
ATOM   4306  H HG12 . VAL A  1 302 ? 88.892  -29.670  -10.157  1.00 145.69 ? 442 VAL A HG12 1 
ATOM   4307  H HG13 . VAL A  1 302 ? 88.672  -29.266  -8.637   1.00 145.69 ? 442 VAL A HG13 1 
ATOM   4308  H HG21 . VAL A  1 302 ? 87.763  -31.914  -7.669   1.00 163.85 ? 442 VAL A HG21 1 
ATOM   4309  H HG22 . VAL A  1 302 ? 86.993  -30.587  -7.256   1.00 163.85 ? 442 VAL A HG22 1 
ATOM   4310  H HG23 . VAL A  1 302 ? 86.205  -31.780  -7.950   1.00 163.85 ? 442 VAL A HG23 1 
ATOM   4311  N N    . ILE A  1 303 ? 86.998  -28.044  -11.258  1.00 166.35 ? 443 ILE A N    1 
ATOM   4312  C CA   . ILE A  1 303 ? 87.437  -27.509  -12.541  1.00 165.19 ? 443 ILE A CA   1 
ATOM   4313  C C    . ILE A  1 303 ? 88.916  -27.171  -12.439  1.00 165.00 ? 443 ILE A C    1 
ATOM   4314  O O    . ILE A  1 303 ? 89.320  -26.350  -11.615  1.00 165.87 ? 443 ILE A O    1 
ATOM   4315  C CB   . ILE A  1 303 ? 86.635  -26.270  -12.946  1.00 164.88 ? 443 ILE A CB   1 
ATOM   4316  C CG1  . ILE A  1 303 ? 85.153  -26.628  -13.028  1.00 164.05 ? 443 ILE A CG1  1 
ATOM   4317  C CG2  . ILE A  1 303 ? 87.121  -25.724  -14.288  1.00 163.82 ? 443 ILE A CG2  1 
ATOM   4318  C CD1  . ILE A  1 303 ? 84.264  -25.436  -13.106  1.00 162.77 ? 443 ILE A CD1  1 
ATOM   4319  H H    . ILE A  1 303 ? 87.101  -27.495  -10.604  1.00 237.47 ? 443 ILE A H    1 
ATOM   4320  H HA   . ILE A  1 303 ? 87.324  -28.185  -13.228  1.00 226.52 ? 443 ILE A HA   1 
ATOM   4321  H HB   . ILE A  1 303 ? 86.754  -25.585  -12.268  1.00 218.09 ? 443 ILE A HB   1 
ATOM   4322  H HG12 . ILE A  1 303 ? 85.003  -27.165  -13.822  1.00 221.29 ? 443 ILE A HG12 1 
ATOM   4323  H HG13 . ILE A  1 303 ? 84.907  -27.133  -12.237  1.00 221.29 ? 443 ILE A HG13 1 
ATOM   4324  H HG21 . ILE A  1 303 ? 86.597  -24.941  -14.518  1.00 207.93 ? 443 ILE A HG21 1 
ATOM   4325  H HG22 . ILE A  1 303 ? 88.058  -25.484  -14.210  1.00 207.93 ? 443 ILE A HG22 1 
ATOM   4326  H HG23 . ILE A  1 303 ? 87.010  -26.409  -14.965  1.00 207.93 ? 443 ILE A HG23 1 
ATOM   4327  H HD11 . ILE A  1 303 ? 83.342  -25.734  -13.156  1.00 216.41 ? 443 ILE A HD11 1 
ATOM   4328  H HD12 . ILE A  1 303 ? 84.394  -24.893  -12.313  1.00 216.41 ? 443 ILE A HD12 1 
ATOM   4329  H HD13 . ILE A  1 303 ? 84.490  -24.925  -13.899  1.00 216.41 ? 443 ILE A HD13 1 
ATOM   4330  N N    . ARG A  1 304 ? 89.715  -27.813  -13.283  1.00 169.34 ? 444 ARG A N    1 
ATOM   4331  C CA   . ARG A  1 304 ? 91.166  -27.792  -13.142  1.00 168.35 ? 444 ARG A CA   1 
ATOM   4332  C C    . ARG A  1 304 ? 91.849  -27.877  -14.502  1.00 165.56 ? 444 ARG A C    1 
ATOM   4333  O O    . ARG A  1 304 ? 91.563  -28.778  -15.293  1.00 165.45 ? 444 ARG A O    1 
ATOM   4334  C CB   . ARG A  1 304 ? 91.603  -28.950  -12.238  1.00 169.82 ? 444 ARG A CB   1 
ATOM   4335  C CG   . ARG A  1 304 ? 93.066  -28.968  -11.824  1.00 169.50 ? 444 ARG A CG   1 
ATOM   4336  C CD   . ARG A  1 304 ? 93.288  -30.085  -10.805  1.00 171.78 ? 444 ARG A CD   1 
ATOM   4337  N NE   . ARG A  1 304 ? 94.652  -30.140  -10.285  1.00 172.17 ? 444 ARG A NE   1 
ATOM   4338  C CZ   . ARG A  1 304 ? 95.655  -30.800  -10.858  1.00 171.43 ? 444 ARG A CZ   1 
ATOM   4339  N NH1  . ARG A  1 304 ? 95.466  -31.463  -11.991  1.00 170.34 ? 444 ARG A NH1  1 
ATOM   4340  N NH2  . ARG A  1 304 ? 96.859  -30.793  -10.300  1.00 172.02 ? 444 ARG A NH2  1 
ATOM   4341  H H    . ARG A  1 304 ? 89.438  -28.275  -13.954  1.00 189.29 ? 444 ARG A H    1 
ATOM   4342  H HA   . ARG A  1 304 ? 91.433  -26.960  -12.721  1.00 189.50 ? 444 ARG A HA   1 
ATOM   4343  H HB2  . ARG A  1 304 ? 91.075  -28.917  -11.425  1.00 202.47 ? 444 ARG A HB2  1 
ATOM   4344  H HB3  . ARG A  1 304 ? 91.425  -29.782  -12.703  1.00 202.47 ? 444 ARG A HB3  1 
ATOM   4345  H HG2  . ARG A  1 304 ? 93.623  -29.139  -12.599  1.00 204.72 ? 444 ARG A HG2  1 
ATOM   4346  H HG3  . ARG A  1 304 ? 93.300  -28.121  -11.413  1.00 204.72 ? 444 ARG A HG3  1 
ATOM   4347  H HD2  . ARG A  1 304 ? 92.689  -29.947  -10.054  1.00 219.53 ? 444 ARG A HD2  1 
ATOM   4348  H HD3  . ARG A  1 304 ? 93.096  -30.937  -11.227  1.00 219.53 ? 444 ARG A HD3  1 
ATOM   4349  H HE   . ARG A  1 304 ? 94.819  -29.716  -9.556   1.00 223.24 ? 444 ARG A HE   1 
ATOM   4350  H HH11 . ARG A  1 304 ? 94.688  -31.473  -12.358  1.00 223.81 ? 444 ARG A HH11 1 
ATOM   4351  H HH12 . ARG A  1 304 ? 96.119  -31.886  -12.356  1.00 223.81 ? 444 ARG A HH12 1 
ATOM   4352  H HH21 . ARG A  1 304 ? 96.990  -30.363  -9.566   1.00 229.61 ? 444 ARG A HH21 1 
ATOM   4353  H HH22 . ARG A  1 304 ? 97.509  -31.216  -10.672  1.00 229.61 ? 444 ARG A HH22 1 
ATOM   4354  N N    . CYS A  1 305 ? 92.747  -26.931  -14.766  1.00 157.99 ? 445 CYS A N    1 
ATOM   4355  C CA   . CYS A  1 305 ? 93.469  -26.885  -16.034  1.00 154.51 ? 445 CYS A CA   1 
ATOM   4356  C C    . CYS A  1 305 ? 94.954  -26.621  -15.835  1.00 153.10 ? 445 CYS A C    1 
ATOM   4357  O O    . CYS A  1 305 ? 95.346  -25.701  -15.111  1.00 153.16 ? 445 CYS A O    1 
ATOM   4358  C CB   . CYS A  1 305 ? 92.881  -25.813  -16.947  1.00 151.74 ? 445 CYS A CB   1 
ATOM   4359  S SG   . CYS A  1 305 ? 91.205  -26.171  -17.503  1.00 153.58 ? 445 CYS A SG   1 
ATOM   4360  H H    . CYS A  1 305 ? 92.958  -26.300  -14.222  1.00 190.16 ? 445 CYS A H    1 
ATOM   4361  H HA   . CYS A  1 305 ? 93.376  -27.741  -16.481  1.00 185.23 ? 445 CYS A HA   1 
ATOM   4362  H HB2  . CYS A  1 305 ? 92.860  -24.970  -16.467  1.00 173.78 ? 445 CYS A HB2  1 
ATOM   4363  H HB3  . CYS A  1 305 ? 93.442  -25.729  -17.733  1.00 173.78 ? 445 CYS A HB3  1 
ATOM   4364  N N    . VAL A  1 306 ? 95.766  -27.438  -16.497  1.00 146.23 ? 446 VAL A N    1 
ATOM   4365  C CA   . VAL A  1 306 ? 97.214  -27.295  -16.484  1.00 145.03 ? 446 VAL A CA   1 
ATOM   4366  C C    . VAL A  1 306 ? 97.662  -26.793  -17.852  1.00 141.44 ? 446 VAL A C    1 
ATOM   4367  O O    . VAL A  1 306 ? 97.353  -27.402  -18.878  1.00 140.96 ? 446 VAL A O    1 
ATOM   4368  C CB   . VAL A  1 306 ? 97.921  -28.631  -16.127  1.00 147.34 ? 446 VAL A CB   1 
ATOM   4369  C CG1  . VAL A  1 306 ? 97.359  -29.803  -16.934  1.00 148.31 ? 446 VAL A CG1  1 
ATOM   4370  C CG2  . VAL A  1 306 ? 99.436  -28.519  -16.295  1.00 146.30 ? 446 VAL A CG2  1 
ATOM   4371  H H    . VAL A  1 306 ? 95.493  -28.099  -16.974  1.00 158.30 ? 446 VAL A H    1 
ATOM   4372  H HA   . VAL A  1 306 ? 97.464  -26.632  -15.820  1.00 161.00 ? 446 VAL A HA   1 
ATOM   4373  H HB   . VAL A  1 306 ? 97.751  -28.822  -15.191  1.00 174.51 ? 446 VAL A HB   1 
ATOM   4374  H HG11 . VAL A  1 306 ? 97.827  -30.614  -16.680  1.00 177.09 ? 446 VAL A HG11 1 
ATOM   4375  H HG12 . VAL A  1 306 ? 96.413  -29.893  -16.741  1.00 177.09 ? 446 VAL A HG12 1 
ATOM   4376  H HG13 . VAL A  1 306 ? 97.490  -29.627  -17.879  1.00 177.09 ? 446 VAL A HG13 1 
ATOM   4377  H HG21 . VAL A  1 306 ? 99.843  -29.368  -16.064  1.00 179.09 ? 446 VAL A HG21 1 
ATOM   4378  H HG22 . VAL A  1 306 ? 99.635  -28.295  -17.217  1.00 179.09 ? 446 VAL A HG22 1 
ATOM   4379  H HG23 . VAL A  1 306 ? 99.767  -27.822  -15.706  1.00 179.09 ? 446 VAL A HG23 1 
ATOM   4380  N N    . SER A  1 307 ? 98.367  -25.666  -17.860  1.00 142.25 ? 447 SER A N    1 
ATOM   4381  C CA   . SER A  1 307 ? 98.829  -25.049  -19.099  1.00 138.84 ? 447 SER A CA   1 
ATOM   4382  C C    . SER A  1 307 ? 100.292 -24.631  -19.011  1.00 138.00 ? 447 SER A C    1 
ATOM   4383  O O    . SER A  1 307 ? 100.812 -24.360  -17.927  1.00 139.65 ? 447 SER A O    1 
ATOM   4384  C CB   . SER A  1 307 ? 97.968  -23.833  -19.436  1.00 136.56 ? 447 SER A CB   1 
ATOM   4385  O OG   . SER A  1 307 ? 96.598  -24.182  -19.473  1.00 137.56 ? 447 SER A OG   1 
ATOM   4386  H H    . SER A  1 307 ? 98.594  -25.234  -17.152  1.00 160.03 ? 447 SER A H    1 
ATOM   4387  H HA   . SER A  1 307 ? 98.742  -25.689  -19.823  1.00 152.12 ? 447 SER A HA   1 
ATOM   4388  H HB2  . SER A  1 307 ? 98.103  -23.153  -18.758  1.00 142.45 ? 447 SER A HB2  1 
ATOM   4389  H HB3  . SER A  1 307 ? 98.231  -23.492  -20.305  1.00 142.45 ? 447 SER A HB3  1 
ATOM   4390  H HG   . SER A  1 307 ? 96.135  -23.506  -19.659  1.00 140.21 ? 447 SER A HG   1 
ATOM   4391  N N    . ASN A  1 308 ? 100.947 -24.584  -20.167  1.00 140.44 ? 448 ASN A N    1 
ATOM   4392  C CA   . ASN A  1 308 ? 102.323 -24.114  -20.263  1.00 140.61 ? 448 ASN A CA   1 
ATOM   4393  C C    . ASN A  1 308 ? 102.369 -22.627  -20.586  1.00 138.00 ? 448 ASN A C    1 
ATOM   4394  O O    . ASN A  1 308 ? 101.905 -22.202  -21.644  1.00 134.95 ? 448 ASN A O    1 
ATOM   4395  C CB   . ASN A  1 308 ? 103.089 -24.894  -21.336  1.00 140.43 ? 448 ASN A CB   1 
ATOM   4396  C CG   . ASN A  1 308 ? 103.305 -26.354  -20.965  1.00 143.76 ? 448 ASN A CG   1 
ATOM   4397  O OD1  . ASN A  1 308 ? 103.440 -26.698  -19.791  1.00 146.74 ? 448 ASN A OD1  1 
ATOM   4398  N ND2  . ASN A  1 308 ? 103.348 -27.221  -21.974  1.00 143.61 ? 448 ASN A ND2  1 
ATOM   4399  H H    . ASN A  1 308 ? 100.610 -24.824  -20.921  1.00 96.25  ? 448 ASN A H    1 
ATOM   4400  H HA   . ASN A  1 308 ? 102.767 -24.253  -19.412  1.00 96.88  ? 448 ASN A HA   1 
ATOM   4401  H HB2  . ASN A  1 308 ? 102.587 -24.867  -22.165  1.00 96.27  ? 448 ASN A HB2  1 
ATOM   4402  H HB3  . ASN A  1 308 ? 103.960 -24.486  -21.462  1.00 96.27  ? 448 ASN A HB3  1 
ATOM   4403  H HD21 . ASN A  1 308 ? 103.468 -28.058  -21.818  1.00 115.87 ? 448 ASN A HD21 1 
ATOM   4404  H HD22 . ASN A  1 308 ? 103.256 -26.943  -22.783  1.00 115.87 ? 448 ASN A HD22 1 
ATOM   4405  N N    . ILE A  1 309 ? 102.918 -21.836  -19.670  1.00 144.20 ? 449 ILE A N    1 
ATOM   4406  C CA   . ILE A  1 309 ? 103.156 -20.422  -19.934  1.00 142.58 ? 449 ILE A CA   1 
ATOM   4407  C C    . ILE A  1 309 ? 104.382 -20.299  -20.825  1.00 141.65 ? 449 ILE A C    1 
ATOM   4408  O O    . ILE A  1 309 ? 105.485 -20.682  -20.430  1.00 144.15 ? 449 ILE A O    1 
ATOM   4409  C CB   . ILE A  1 309 ? 103.369 -19.616  -18.638  1.00 144.72 ? 449 ILE A CB   1 
ATOM   4410  C CG1  . ILE A  1 309 ? 102.128 -19.705  -17.748  1.00 146.42 ? 449 ILE A CG1  1 
ATOM   4411  C CG2  . ILE A  1 309 ? 103.665 -18.154  -18.958  1.00 143.59 ? 449 ILE A CG2  1 
ATOM   4412  C CD1  . ILE A  1 309 ? 102.339 -19.183  -16.339  1.00 149.61 ? 449 ILE A CD1  1 
ATOM   4413  H H    . ILE A  1 309 ? 103.162 -22.095  -18.887  1.00 163.10 ? 449 ILE A H    1 
ATOM   4414  H HA   . ILE A  1 309 ? 102.394 -20.050  -20.405  1.00 158.73 ? 449 ILE A HA   1 
ATOM   4415  H HB   . ILE A  1 309 ? 104.125 -19.990  -18.158  1.00 162.96 ? 449 ILE A HB   1 
ATOM   4416  H HG12 . ILE A  1 309 ? 101.416 -19.185  -18.153  1.00 163.09 ? 449 ILE A HG12 1 
ATOM   4417  H HG13 . ILE A  1 309 ? 101.857 -20.634  -17.682  1.00 163.09 ? 449 ILE A HG13 1 
ATOM   4418  H HG21 . ILE A  1 309 ? 103.796 -17.669  -18.128  1.00 159.60 ? 449 ILE A HG21 1 
ATOM   4419  H HG22 . ILE A  1 309 ? 104.469 -18.106  -19.499  1.00 159.60 ? 449 ILE A HG22 1 
ATOM   4420  H HG23 . ILE A  1 309 ? 102.915 -17.779  -19.446  1.00 159.60 ? 449 ILE A HG23 1 
ATOM   4421  H HD11 . ILE A  1 309 ? 101.511 -19.274  -15.841  1.00 167.70 ? 449 ILE A HD11 1 
ATOM   4422  H HD12 . ILE A  1 309 ? 103.040 -19.701  -15.912  1.00 167.70 ? 449 ILE A HD12 1 
ATOM   4423  H HD13 . ILE A  1 309 ? 102.597 -18.249  -16.384  1.00 167.70 ? 449 ILE A HD13 1 
ATOM   4424  N N    . THR A  1 310 ? 104.183 -19.763  -22.026  1.00 139.51 ? 450 THR A N    1 
ATOM   4425  C CA   . THR A  1 310 ? 105.251 -19.673  -23.018  1.00 139.37 ? 450 THR A CA   1 
ATOM   4426  C C    . THR A  1 310 ? 105.521 -18.239  -23.469  1.00 138.37 ? 450 THR A C    1 
ATOM   4427  O O    . THR A  1 310 ? 106.458 -17.994  -24.227  1.00 138.71 ? 450 THR A O    1 
ATOM   4428  C CB   . THR A  1 310 ? 104.927 -20.522  -24.263  1.00 137.94 ? 450 THR A CB   1 
ATOM   4429  O OG1  . THR A  1 310 ? 103.699 -20.075  -24.850  1.00 136.32 ? 450 THR A OG1  1 
ATOM   4430  C CG2  . THR A  1 310 ? 104.810 -21.998  -23.897  1.00 139.77 ? 450 THR A CG2  1 
ATOM   4431  H H    . THR A  1 310 ? 103.431 -19.442  -22.294  1.00 111.32 ? 450 THR A H    1 
ATOM   4432  H HA   . THR A  1 310 ? 106.069 -20.019  -22.627  1.00 111.84 ? 450 THR A HA   1 
ATOM   4433  H HB   . THR A  1 310 ? 105.644 -20.427  -24.910  1.00 108.41 ? 450 THR A HB   1 
ATOM   4434  H HG1  . THR A  1 310 ? 103.767 -19.269  -25.078  1.00 100.38 ? 450 THR A HG1  1 
ATOM   4435  H HG21 . THR A  1 310 ? 104.606 -22.521  -24.688  1.00 114.48 ? 450 THR A HG21 1 
ATOM   4436  H HG22 . THR A  1 310 ? 105.645 -22.313  -23.517  1.00 114.48 ? 450 THR A HG22 1 
ATOM   4437  H HG23 . THR A  1 310 ? 104.101 -22.123  -23.246  1.00 114.48 ? 450 THR A HG23 1 
ATOM   4438  N N    . GLY A  1 311 ? 104.711 -17.290  -23.008  1.00 137.86 ? 451 GLY A N    1 
ATOM   4439  C CA   . GLY A  1 311 ? 104.894 -15.906  -23.410  1.00 137.30 ? 451 GLY A CA   1 
ATOM   4440  C C    . GLY A  1 311 ? 104.049 -14.892  -22.661  1.00 137.75 ? 451 GLY A C    1 
ATOM   4441  O O    . GLY A  1 311 ? 103.112 -15.244  -21.942  1.00 138.26 ? 451 GLY A O    1 
ATOM   4442  H H    . GLY A  1 311 ? 104.056 -17.422  -22.467  1.00 56.85  ? 451 GLY A H    1 
ATOM   4443  H HA2  . GLY A  1 311 ? 105.825 -15.665  -23.286  1.00 55.80  ? 451 GLY A HA2  1 
ATOM   4444  H HA3  . GLY A  1 311 ? 104.688 -15.825  -24.354  1.00 55.80  ? 451 GLY A HA3  1 
ATOM   4445  N N    . LEU A  1 312 ? 104.401 -13.620  -22.841  1.00 140.16 ? 452 LEU A N    1 
ATOM   4446  C CA   . LEU A  1 312 ? 103.688 -12.497  -22.237  1.00 141.46 ? 452 LEU A CA   1 
ATOM   4447  C C    . LEU A  1 312 ? 103.459 -11.395  -23.270  1.00 140.71 ? 452 LEU A C    1 
ATOM   4448  O O    . LEU A  1 312 ? 104.158 -11.330  -24.281  1.00 139.77 ? 452 LEU A O    1 
ATOM   4449  C CB   . LEU A  1 312 ? 104.471 -11.923  -21.049  1.00 144.40 ? 452 LEU A CB   1 
ATOM   4450  C CG   . LEU A  1 312 ? 104.617 -12.753  -19.770  1.00 146.29 ? 452 LEU A CG   1 
ATOM   4451  C CD1  . LEU A  1 312 ? 105.745 -13.769  -19.879  1.00 146.76 ? 452 LEU A CD1  1 
ATOM   4452  C CD2  . LEU A  1 312 ? 104.852 -11.831  -18.582  1.00 149.73 ? 452 LEU A CD2  1 
ATOM   4453  H H    . LEU A  1 312 ? 105.070 -13.377  -23.323  1.00 126.08 ? 452 LEU A H    1 
ATOM   4454  H HA   . LEU A  1 312 ? 102.824 -12.800  -21.916  1.00 126.75 ? 452 LEU A HA   1 
ATOM   4455  H HB2  . LEU A  1 312 ? 105.370 -11.730  -21.357  1.00 133.69 ? 452 LEU A HB2  1 
ATOM   4456  H HB3  . LEU A  1 312 ? 104.044 -11.091  -20.791  1.00 133.69 ? 452 LEU A HB3  1 
ATOM   4457  H HG   . LEU A  1 312 ? 103.791 -13.238  -19.613  1.00 137.79 ? 452 LEU A HG   1 
ATOM   4458  H HD11 . LEU A  1 312 ? 105.800 -14.269  -19.050  1.00 140.19 ? 452 LEU A HD11 1 
ATOM   4459  H HD12 . LEU A  1 312 ? 105.557 -14.370  -20.617  1.00 140.19 ? 452 LEU A HD12 1 
ATOM   4460  H HD13 . LEU A  1 312 ? 106.578 -13.299  -20.038  1.00 140.19 ? 452 LEU A HD13 1 
ATOM   4461  H HD21 . LEU A  1 312 ? 104.943 -12.368  -17.779  1.00 144.40 ? 452 LEU A HD21 1 
ATOM   4462  H HD22 . LEU A  1 312 ? 105.664 -11.323  -18.733  1.00 144.40 ? 452 LEU A HD22 1 
ATOM   4463  H HD23 . LEU A  1 312 ? 104.096 -11.230  -18.494  1.00 144.40 ? 452 LEU A HD23 1 
ATOM   4464  N N    . ILE A  1 313 ? 102.476 -10.537  -23.010  1.00 137.55 ? 453 ILE A N    1 
ATOM   4465  C CA   . ILE A  1 313 ? 102.267 -9.323   -23.796  1.00 137.87 ? 453 ILE A CA   1 
ATOM   4466  C C    . ILE A  1 313 ? 102.444 -8.120   -22.876  1.00 141.23 ? 453 ILE A C    1 
ATOM   4467  O O    . ILE A  1 313 ? 101.775 -8.017   -21.847  1.00 143.11 ? 453 ILE A O    1 
ATOM   4468  C CB   . ILE A  1 313 ? 100.867 -9.290   -24.457  1.00 136.44 ? 453 ILE A CB   1 
ATOM   4469  C CG1  . ILE A  1 313 ? 100.743 -10.422  -25.482  1.00 133.54 ? 453 ILE A CG1  1 
ATOM   4470  C CG2  . ILE A  1 313 ? 100.610 -7.933   -25.122  1.00 137.67 ? 453 ILE A CG2  1 
ATOM   4471  C CD1  . ILE A  1 313 ? 99.390  -10.511  -26.167  1.00 132.14 ? 453 ILE A CD1  1 
ATOM   4472  H H    . ILE A  1 313 ? 101.907 -10.637  -22.373  1.00 82.84  ? 453 ILE A H    1 
ATOM   4473  H HA   . ILE A  1 313 ? 102.937 -9.274   -24.496  1.00 81.35  ? 453 ILE A HA   1 
ATOM   4474  H HB   . ILE A  1 313 ? 100.198 -9.425   -23.768  1.00 77.81  ? 453 ILE A HB   1 
ATOM   4475  H HG12 . ILE A  1 313 ? 101.413 -10.291  -26.171  1.00 73.65  ? 453 ILE A HG12 1 
ATOM   4476  H HG13 . ILE A  1 313 ? 100.900 -11.267  -25.031  1.00 73.65  ? 453 ILE A HG13 1 
ATOM   4477  H HG21 . ILE A  1 313 ? 99.729  -7.941   -25.526  1.00 78.54  ? 453 ILE A HG21 1 
ATOM   4478  H HG22 . ILE A  1 313 ? 100.658 -7.237   -24.447  1.00 78.54  ? 453 ILE A HG22 1 
ATOM   4479  H HG23 . ILE A  1 313 ? 101.285 -7.782   -25.802  1.00 78.54  ? 453 ILE A HG23 1 
ATOM   4480  H HD11 . ILE A  1 313 ? 99.402  -11.251  -26.795  1.00 70.99  ? 453 ILE A HD11 1 
ATOM   4481  H HD12 . ILE A  1 313 ? 98.706  -10.658  -25.495  1.00 70.99  ? 453 ILE A HD12 1 
ATOM   4482  H HD13 . ILE A  1 313 ? 99.220  -9.681   -26.638  1.00 70.99  ? 453 ILE A HD13 1 
ATOM   4483  N N    . LEU A  1 314 ? 103.353 -7.221   -23.245  1.00 145.52 ? 454 LEU A N    1 
ATOM   4484  C CA   . LEU A  1 314 ? 103.673 -6.061   -22.415  1.00 148.98 ? 454 LEU A CA   1 
ATOM   4485  C C    . LEU A  1 314 ? 103.464 -4.731   -23.137  1.00 150.32 ? 454 LEU A C    1 
ATOM   4486  O O    . LEU A  1 314 ? 103.558 -4.650   -24.361  1.00 148.68 ? 454 LEU A O    1 
ATOM   4487  C CB   . LEU A  1 314 ? 105.124 -6.142   -21.932  1.00 149.94 ? 454 LEU A CB   1 
ATOM   4488  C CG   . LEU A  1 314 ? 105.526 -7.353   -21.088  1.00 149.51 ? 454 LEU A CG   1 
ATOM   4489  C CD1  . LEU A  1 314 ? 106.998 -7.258   -20.732  1.00 150.85 ? 454 LEU A CD1  1 
ATOM   4490  C CD2  . LEU A  1 314 ? 104.685 -7.459   -19.831  1.00 151.51 ? 454 LEU A CD2  1 
ATOM   4491  H H    . LEU A  1 314 ? 103.802 -7.260   -23.978  1.00 79.56  ? 454 LEU A H    1 
ATOM   4492  H HA   . LEU A  1 314 ? 103.099 -6.068   -21.633  1.00 85.99  ? 454 LEU A HA   1 
ATOM   4493  H HB2  . LEU A  1 314 ? 105.699 -6.138   -22.713  1.00 90.11  ? 454 LEU A HB2  1 
ATOM   4494  H HB3  . LEU A  1 314 ? 105.306 -5.353   -21.399  1.00 90.11  ? 454 LEU A HB3  1 
ATOM   4495  H HG   . LEU A  1 314 ? 105.393 -8.161   -21.609  1.00 90.70  ? 454 LEU A HG   1 
ATOM   4496  H HD11 . LEU A  1 314 ? 107.244 -8.029   -20.198  1.00 96.02  ? 454 LEU A HD11 1 
ATOM   4497  H HD12 . LEU A  1 314 ? 107.520 -7.242   -21.550  1.00 96.02  ? 454 LEU A HD12 1 
ATOM   4498  H HD13 . LEU A  1 314 ? 107.149 -6.443   -20.227  1.00 96.02  ? 454 LEU A HD13 1 
ATOM   4499  H HD21 . LEU A  1 314 ? 104.970 -8.237   -19.326  1.00 93.13  ? 454 LEU A HD21 1 
ATOM   4500  H HD22 . LEU A  1 314 ? 104.807 -6.656   -19.301  1.00 93.13  ? 454 LEU A HD22 1 
ATOM   4501  H HD23 . LEU A  1 314 ? 103.752 -7.551   -20.082  1.00 93.13  ? 454 LEU A HD23 1 
ATOM   4502  N N    . THR A  1 315 ? 103.166 -3.698   -22.354  1.00 161.58 ? 455 THR A N    1 
ATOM   4503  C CA   . THR A  1 315 ? 103.192 -2.315   -22.820  1.00 163.68 ? 455 THR A CA   1 
ATOM   4504  C C    . THR A  1 315 ? 104.124 -1.533   -21.902  1.00 166.62 ? 455 THR A C    1 
ATOM   4505  O O    . THR A  1 315 ? 104.235 -1.843   -20.714  1.00 168.02 ? 455 THR A O    1 
ATOM   4506  C CB   . THR A  1 315 ? 101.792 -1.670   -22.820  1.00 165.45 ? 455 THR A CB   1 
ATOM   4507  O OG1  . THR A  1 315 ? 100.881 -2.491   -23.562  1.00 162.63 ? 455 THR A OG1  1 
ATOM   4508  C CG2  . THR A  1 315 ? 101.838 -0.276   -23.443  1.00 167.54 ? 455 THR A CG2  1 
ATOM   4509  H H    . THR A  1 315 ? 102.939 -3.776   -21.527  1.00 212.46 ? 455 THR A H    1 
ATOM   4510  H HA   . THR A  1 315 ? 103.547 -2.283   -23.722  1.00 217.40 ? 455 THR A HA   1 
ATOM   4511  H HB   . THR A  1 315 ? 101.478 -1.586   -21.906  1.00 219.30 ? 455 THR A HB   1 
ATOM   4512  H HG1  . THR A  1 315 ? 101.146 -2.571   -24.354  1.00 211.89 ? 455 THR A HG1  1 
ATOM   4513  H HG21 . THR A  1 315 ? 100.952 0.118    -23.437  1.00 226.73 ? 455 THR A HG21 1 
ATOM   4514  H HG22 . THR A  1 315 ? 102.440 0.293    -22.939  1.00 226.73 ? 455 THR A HG22 1 
ATOM   4515  H HG23 . THR A  1 315 ? 102.152 -0.333   -24.359  1.00 226.73 ? 455 THR A HG23 1 
ATOM   4516  N N    . ARG A  1 316 ? 104.791 -0.521   -22.450  1.00 176.83 ? 456 ARG A N    1 
ATOM   4517  C CA   . ARG A  1 316 ? 105.780 0.245    -21.695  1.00 179.31 ? 456 ARG A CA   1 
ATOM   4518  C C    . ARG A  1 316 ? 105.259 1.629    -21.324  1.00 182.62 ? 456 ARG A C    1 
ATOM   4519  O O    . ARG A  1 316 ? 104.699 2.343    -22.158  1.00 182.84 ? 456 ARG A O    1 
ATOM   4520  C CB   . ARG A  1 316 ? 107.077 0.366    -22.500  1.00 178.21 ? 456 ARG A CB   1 
ATOM   4521  C CG   . ARG A  1 316 ? 108.196 1.104    -21.773  1.00 180.62 ? 456 ARG A CG   1 
ATOM   4522  C CD   . ARG A  1 316 ? 109.475 1.128    -22.602  1.00 179.76 ? 456 ARG A CD   1 
ATOM   4523  N NE   . ARG A  1 316 ? 109.278 1.792    -23.888  1.00 179.16 ? 456 ARG A NE   1 
ATOM   4524  C CZ   . ARG A  1 316 ? 109.481 3.087    -24.119  1.00 181.12 ? 456 ARG A CZ   1 
ATOM   4525  N NH1  . ARG A  1 316 ? 109.903 3.893    -23.155  1.00 184.51 ? 456 ARG A NH1  1 
ATOM   4526  N NH2  . ARG A  1 316 ? 109.265 3.580    -25.331  1.00 180.56 ? 456 ARG A NH2  1 
ATOM   4527  H H    . ARG A  1 316 ? 104.688 -0.256   -23.261  1.00 179.94 ? 456 ARG A H    1 
ATOM   4528  H HA   . ARG A  1 316 ? 105.983 -0.228   -20.873  1.00 189.24 ? 456 ARG A HA   1 
ATOM   4529  H HB2  . ARG A  1 316 ? 107.398 -0.525   -22.710  1.00 189.44 ? 456 ARG A HB2  1 
ATOM   4530  H HB3  . ARG A  1 316 ? 106.890 0.849    -23.320  1.00 189.44 ? 456 ARG A HB3  1 
ATOM   4531  H HG2  . ARG A  1 316 ? 107.923 2.019    -21.608  1.00 199.71 ? 456 ARG A HG2  1 
ATOM   4532  H HG3  . ARG A  1 316 ? 108.385 0.653    -20.935  1.00 199.71 ? 456 ARG A HG3  1 
ATOM   4533  H HD2  . ARG A  1 316 ? 110.162 1.609    -22.115  1.00 200.28 ? 456 ARG A HD2  1 
ATOM   4534  H HD3  . ARG A  1 316 ? 109.761 0.217    -22.773  1.00 200.28 ? 456 ARG A HD3  1 
ATOM   4535  H HE   . ARG A  1 316 ? 109.009 1.309    -24.547  1.00 198.68 ? 456 ARG A HE   1 
ATOM   4536  H HH11 . ARG A  1 316 ? 110.045 3.582    -22.366  1.00 218.05 ? 456 ARG A HH11 1 
ATOM   4537  H HH12 . ARG A  1 316 ? 110.032 4.728    -23.317  1.00 218.05 ? 456 ARG A HH12 1 
ATOM   4538  H HH21 . ARG A  1 316 ? 108.993 3.063    -25.963  1.00 205.80 ? 456 ARG A HH21 1 
ATOM   4539  H HH22 . ARG A  1 316 ? 109.398 4.415    -25.486  1.00 205.80 ? 456 ARG A HH22 1 
ATOM   4540  N N    . ASP A  1 317 ? 105.442 1.996    -20.060  1.00 179.55 ? 457 ASP A N    1 
ATOM   4541  C CA   . ASP A  1 317 ? 105.064 3.317    -19.576  1.00 182.91 ? 457 ASP A CA   1 
ATOM   4542  C C    . ASP A  1 317 ? 105.941 4.391    -20.207  1.00 183.45 ? 457 ASP A C    1 
ATOM   4543  O O    . ASP A  1 317 ? 107.153 4.424    -19.987  1.00 183.52 ? 457 ASP A O    1 
ATOM   4544  C CB   . ASP A  1 317 ? 105.175 3.384    -18.052  1.00 185.57 ? 457 ASP A CB   1 
ATOM   4545  C CG   . ASP A  1 317 ? 104.034 2.677    -17.350  1.00 186.25 ? 457 ASP A CG   1 
ATOM   4546  O OD1  . ASP A  1 317 ? 103.362 1.844    -17.993  1.00 184.04 ? 457 ASP A OD1  1 
ATOM   4547  O OD2  . ASP A  1 317 ? 103.812 2.952    -16.150  1.00 189.06 ? 457 ASP A OD2  1 
ATOM   4548  H H    . ASP A  1 317 ? 105.787 1.491    -19.456  1.00 233.60 ? 457 ASP A H    1 
ATOM   4549  H HA   . ASP A  1 317 ? 104.143 3.495    -19.822  1.00 244.90 ? 457 ASP A HA   1 
ATOM   4550  H HB2  . ASP A  1 317 ? 106.004 2.962    -17.777  1.00 253.23 ? 457 ASP A HB2  1 
ATOM   4551  H HB3  . ASP A  1 317 ? 105.168 4.314    -17.775  1.00 253.23 ? 457 ASP A HB3  1 
ATOM   4552  N N    . GLY A  1 318 ? 105.318 5.262    -20.995  1.00 188.67 ? 458 GLY A N    1 
ATOM   4553  C CA   . GLY A  1 318 ? 106.017 6.360    -21.637  1.00 189.37 ? 458 GLY A CA   1 
ATOM   4554  C C    . GLY A  1 318 ? 105.903 7.642    -20.838  1.00 192.90 ? 458 GLY A C    1 
ATOM   4555  O O    . GLY A  1 318 ? 105.785 7.617    -19.612  1.00 194.82 ? 458 GLY A O    1 
ATOM   4556  H H    . GLY A  1 318 ? 104.477 5.234    -21.174  1.00 217.42 ? 458 GLY A H    1 
ATOM   4557  H HA2  . GLY A  1 318 ? 106.956 6.137    -21.731  1.00 226.85 ? 458 GLY A HA2  1 
ATOM   4558  H HA3  . GLY A  1 318 ? 105.644 6.511    -22.519  1.00 226.85 ? 458 GLY A HA3  1 
ATOM   4559  N N    . GLY A  1 319 ? 105.936 8.770    -21.539  1.00 194.72 ? 459 GLY A N    1 
ATOM   4560  C CA   . GLY A  1 319 ? 105.807 10.067   -20.902  1.00 197.99 ? 459 GLY A CA   1 
ATOM   4561  C C    . GLY A  1 319 ? 107.086 10.513   -20.220  1.00 200.29 ? 459 GLY A C    1 
ATOM   4562  O O    . GLY A  1 319 ? 107.797 11.382   -20.725  1.00 202.29 ? 459 GLY A O    1 
ATOM   4563  H H    . GLY A  1 319 ? 106.034 8.807    -22.393  1.00 248.36 ? 459 GLY A H    1 
ATOM   4564  H HA2  . GLY A  1 319 ? 105.568 10.730   -21.568  1.00 265.77 ? 459 GLY A HA2  1 
ATOM   4565  H HA3  . GLY A  1 319 ? 105.102 10.031   -20.238  1.00 265.77 ? 459 GLY A HA3  1 
ATOM   4566  N N    . GLY A  1 320 ? 107.378 9.915    -19.069  1.00 202.34 ? 460 GLY A N    1 
ATOM   4567  C CA   . GLY A  1 320 ? 108.536 10.298   -18.282  1.00 206.12 ? 460 GLY A CA   1 
ATOM   4568  C C    . GLY A  1 320 ? 109.848 10.038   -18.996  1.00 205.75 ? 460 GLY A C    1 
ATOM   4569  O O    . GLY A  1 320 ? 109.945 9.142    -19.835  1.00 202.15 ? 460 GLY A O    1 
ATOM   4570  H H    . GLY A  1 320 ? 106.915 9.279    -18.722  1.00 286.68 ? 460 GLY A H    1 
ATOM   4571  H HA2  . GLY A  1 320 ? 108.484 11.244   -18.073  1.00 298.64 ? 460 GLY A HA2  1 
ATOM   4572  H HA3  . GLY A  1 320 ? 108.537 9.800    -17.449  1.00 298.64 ? 460 GLY A HA3  1 
ATOM   4573  N N    . ASN A  1 321 ? 110.861 10.830   -18.657  1.00 208.73 ? 461 ASN A N    1 
ATOM   4574  C CA   . ASN A  1 321 ? 112.186 10.688   -19.252  1.00 209.84 ? 461 ASN A CA   1 
ATOM   4575  C C    . ASN A  1 321 ? 112.914 9.462    -18.710  1.00 209.69 ? 461 ASN A C    1 
ATOM   4576  O O    . ASN A  1 321 ? 112.313 8.613    -18.050  1.00 207.65 ? 461 ASN A O    1 
ATOM   4577  C CB   . ASN A  1 321 ? 113.018 11.947   -18.996  1.00 216.08 ? 461 ASN A CB   1 
ATOM   4578  C CG   . ASN A  1 321 ? 112.264 13.220   -19.322  1.00 217.13 ? 461 ASN A CG   1 
ATOM   4579  O OD1  . ASN A  1 321 ? 111.393 13.235   -20.192  1.00 213.07 ? 461 ASN A OD1  1 
ATOM   4580  N ND2  . ASN A  1 321 ? 112.596 14.299   -18.622  1.00 223.26 ? 461 ASN A ND2  1 
ATOM   4581  H H    . ASN A  1 321 ? 110.806 11.463   -18.078  1.00 321.42 ? 461 ASN A H    1 
ATOM   4582  H HA   . ASN A  1 321 ? 112.091 10.581   -20.212  1.00 319.59 ? 461 ASN A HA   1 
ATOM   4583  H HB2  . ASN A  1 321 ? 113.267 11.976   -18.059  1.00 325.19 ? 461 ASN A HB2  1 
ATOM   4584  H HB3  . ASN A  1 321 ? 113.814 11.918   -19.550  1.00 325.19 ? 461 ASN A HB3  1 
ATOM   4585  H HD21 . ASN A  1 321 ? 112.197 15.046   -18.769  1.00 333.53 ? 461 ASN A HD21 1 
ATOM   4586  H HD22 . ASN A  1 321 ? 113.209 14.249   -18.021  1.00 333.53 ? 461 ASN A HD22 1 
ATOM   4587  N N    . SER A  1 322 ? 114.211 9.371    -18.992  1.00 210.36 ? 462 SER A N    1 
ATOM   4588  C CA   . SER A  1 322 ? 115.026 8.273    -18.484  1.00 211.27 ? 462 SER A CA   1 
ATOM   4589  C C    . SER A  1 322 ? 115.285 8.454    -16.991  1.00 216.59 ? 462 SER A C    1 
ATOM   4590  O O    . SER A  1 322 ? 116.416 8.711    -16.574  1.00 222.00 ? 462 SER A O    1 
ATOM   4591  C CB   . SER A  1 322 ? 116.354 8.183    -19.245  1.00 213.22 ? 462 SER A CB   1 
ATOM   4592  O OG   . SER A  1 322 ? 117.187 9.295    -18.964  1.00 219.53 ? 462 SER A OG   1 
ATOM   4593  H H    . SER A  1 322 ? 114.643 9.935    -19.476  1.00 367.33 ? 462 SER A H    1 
ATOM   4594  H HA   . SER A  1 322 ? 114.549 7.438    -18.609  1.00 364.19 ? 462 SER A HA   1 
ATOM   4595  H HB2  . SER A  1 322 ? 116.814 7.371    -18.980  1.00 363.84 ? 462 SER A HB2  1 
ATOM   4596  H HB3  . SER A  1 322 ? 116.170 8.162    -20.197  1.00 363.84 ? 462 SER A HB3  1 
ATOM   4597  H HG   . SER A  1 322 ? 116.803 10.006   -19.190  1.00 369.15 ? 462 SER A HG   1 
ATOM   4598  N N    . ASN A  1 323 ? 114.232 8.314    -16.190  1.00 207.34 ? 463 ASN A N    1 
ATOM   4599  C CA   . ASN A  1 323 ? 114.337 8.458    -14.742  1.00 212.36 ? 463 ASN A CA   1 
ATOM   4600  C C    . ASN A  1 323 ? 114.812 7.164    -14.083  1.00 212.59 ? 463 ASN A C    1 
ATOM   4601  O O    . ASN A  1 323 ? 114.300 6.771    -13.034  1.00 213.47 ? 463 ASN A O    1 
ATOM   4602  C CB   . ASN A  1 323 ? 112.988 8.880    -14.148  1.00 211.44 ? 463 ASN A CB   1 
ATOM   4603  C CG   . ASN A  1 323 ? 112.477 10.189   -14.721  1.00 211.82 ? 463 ASN A CG   1 
ATOM   4604  O OD1  . ASN A  1 323 ? 113.255 11.078   -15.066  1.00 215.47 ? 463 ASN A OD1  1 
ATOM   4605  N ND2  . ASN A  1 323 ? 111.157 10.311   -14.825  1.00 208.35 ? 463 ASN A ND2  1 
ATOM   4606  H H    . ASN A  1 323 ? 113.437 8.133    -16.465  1.00 287.26 ? 463 ASN A H    1 
ATOM   4607  H HA   . ASN A  1 323 ? 114.984 9.152    -14.540  1.00 289.72 ? 463 ASN A HA   1 
ATOM   4608  H HB2  . ASN A  1 323 ? 112.330 8.193    -14.338  1.00 287.24 ? 463 ASN A HB2  1 
ATOM   4609  H HB3  . ASN A  1 323 ? 113.085 8.990    -13.190  1.00 287.24 ? 463 ASN A HB3  1 
ATOM   4610  H HD21 . ASN A  1 323 ? 110.816 11.033   -15.143  1.00 294.35 ? 463 ASN A HD21 1 
ATOM   4611  H HD22 . ASN A  1 323 ? 110.645 9.668    -14.573  1.00 294.35 ? 463 ASN A HD22 1 
ATOM   4612  N N    . GLU A  1 324 ? 115.787 6.507    -14.708  1.00 208.06 ? 464 GLU A N    1 
ATOM   4613  C CA   . GLU A  1 324 ? 116.319 5.239    -14.215  1.00 208.40 ? 464 GLU A CA   1 
ATOM   4614  C C    . GLU A  1 324 ? 115.227 4.173    -14.182  1.00 202.74 ? 464 GLU A C    1 
ATOM   4615  O O    . GLU A  1 324 ? 115.305 3.209    -13.420  1.00 203.43 ? 464 GLU A O    1 
ATOM   4616  C CB   . GLU A  1 324 ? 116.936 5.415    -12.825  1.00 215.26 ? 464 GLU A CB   1 
ATOM   4617  C CG   . GLU A  1 324 ? 117.833 6.641    -12.702  1.00 221.50 ? 464 GLU A CG   1 
ATOM   4618  C CD   . GLU A  1 324 ? 118.364 6.840    -11.297  1.00 228.57 ? 464 GLU A CD   1 
ATOM   4619  O OE1  . GLU A  1 324 ? 118.200 5.927    -10.462  1.00 228.81 ? 464 GLU A OE1  1 
ATOM   4620  O OE2  . GLU A  1 324 ? 118.943 7.913    -11.028  1.00 234.17 ? 464 GLU A OE2  1 
ATOM   4621  H H    . GLU A  1 324 ? 116.163 6.781    -15.431  1.00 334.53 ? 464 GLU A H    1 
ATOM   4622  H HA   . GLU A  1 324 ? 117.017 4.934    -14.816  1.00 330.99 ? 464 GLU A HA   1 
ATOM   4623  H HB2  . GLU A  1 324 ? 116.222 5.504    -12.175  1.00 333.09 ? 464 GLU A HB2  1 
ATOM   4624  H HB3  . GLU A  1 324 ? 117.472 4.633    -12.620  1.00 333.09 ? 464 GLU A HB3  1 
ATOM   4625  H HG2  . GLU A  1 324 ? 118.592 6.538    -13.298  1.00 337.45 ? 464 GLU A HG2  1 
ATOM   4626  H HG3  . GLU A  1 324 ? 117.325 7.430    -12.946  1.00 337.45 ? 464 GLU A HG3  1 
ATOM   4627  N N    . ASN A  1 325 ? 114.214 4.357    -15.022  1.00 204.21 ? 465 ASN A N    1 
ATOM   4628  C CA   . ASN A  1 325 ? 113.101 3.424    -15.110  1.00 198.82 ? 465 ASN A CA   1 
ATOM   4629  C C    . ASN A  1 325 ? 112.217 3.714    -16.315  1.00 193.79 ? 465 ASN A C    1 
ATOM   4630  O O    . ASN A  1 325 ? 112.027 4.867    -16.704  1.00 194.64 ? 465 ASN A O    1 
ATOM   4631  C CB   . ASN A  1 325 ? 112.264 3.457    -13.824  1.00 200.46 ? 465 ASN A CB   1 
ATOM   4632  C CG   . ASN A  1 325 ? 111.923 4.869    -13.381  1.00 203.89 ? 465 ASN A CG   1 
ATOM   4633  O OD1  . ASN A  1 325 ? 111.841 5.787    -14.194  1.00 203.20 ? 465 ASN A OD1  1 
ATOM   4634  N ND2  . ASN A  1 325 ? 111.721 5.046    -12.081  1.00 208.03 ? 465 ASN A ND2  1 
ATOM   4635  H H    . ASN A  1 325 ? 114.148 5.026    -15.559  1.00 245.51 ? 465 ASN A H    1 
ATOM   4636  H HA   . ASN A  1 325 ? 113.455 2.526    -15.211  1.00 231.03 ? 465 ASN A HA   1 
ATOM   4637  H HB2  . ASN A  1 325 ? 111.433 2.981    -13.976  1.00 228.78 ? 465 ASN A HB2  1 
ATOM   4638  H HB3  . ASN A  1 325 ? 112.765 3.032    -13.110  1.00 228.78 ? 465 ASN A HB3  1 
ATOM   4639  H HD21 . ASN A  1 325 ? 111.525 5.827    -11.779  1.00 241.41 ? 465 ASN A HD21 1 
ATOM   4640  H HD22 . ASN A  1 325 ? 111.787 4.380    -11.540  1.00 241.41 ? 465 ASN A HD22 1 
ATOM   4641  N N    . GLU A  1 326 ? 111.693 2.648    -16.909  1.00 195.72 ? 466 GLU A N    1 
ATOM   4642  C CA   . GLU A  1 326 ? 110.758 2.759    -18.018  1.00 192.05 ? 466 GLU A CA   1 
ATOM   4643  C C    . GLU A  1 326 ? 109.419 2.161    -17.609  1.00 189.86 ? 466 GLU A C    1 
ATOM   4644  O O    . GLU A  1 326 ? 108.369 2.616    -18.058  1.00 188.57 ? 466 GLU A O    1 
ATOM   4645  C CB   . GLU A  1 326 ? 111.311 2.061    -19.262  1.00 189.21 ? 466 GLU A CB   1 
ATOM   4646  C CG   . GLU A  1 326 ? 112.630 2.644    -19.769  1.00 191.51 ? 466 GLU A CG   1 
ATOM   4647  C CD   . GLU A  1 326 ? 112.490 4.060    -20.305  1.00 192.86 ? 466 GLU A CD   1 
ATOM   4648  O OE1  . GLU A  1 326 ? 111.345 4.524    -20.492  1.00 191.49 ? 466 GLU A OE1  1 
ATOM   4649  O OE2  . GLU A  1 326 ? 113.531 4.709    -20.541  1.00 195.53 ? 466 GLU A OE2  1 
ATOM   4650  H H    . GLU A  1 326 ? 111.867 1.837    -16.682  1.00 278.76 ? 466 GLU A H    1 
ATOM   4651  H HA   . GLU A  1 326 ? 110.622 3.696    -18.230  1.00 271.37 ? 466 GLU A HA   1 
ATOM   4652  H HB2  . GLU A  1 326 ? 111.463 1.126    -19.053  1.00 262.69 ? 466 GLU A HB2  1 
ATOM   4653  H HB3  . GLU A  1 326 ? 110.660 2.136    -19.977  1.00 262.69 ? 466 GLU A HB3  1 
ATOM   4654  H HG2  . GLU A  1 326 ? 113.268 2.663    -19.038  1.00 269.09 ? 466 GLU A HG2  1 
ATOM   4655  H HG3  . GLU A  1 326 ? 112.966 2.085    -20.487  1.00 269.09 ? 466 GLU A HG3  1 
ATOM   4656  N N    . THR A  1 327 ? 109.476 1.152    -16.742  1.00 182.26 ? 467 THR A N    1 
ATOM   4657  C CA   . THR A  1 327 ? 108.290 0.497    -16.181  1.00 180.80 ? 467 THR A CA   1 
ATOM   4658  C C    . THR A  1 327 ? 107.455 -0.229   -17.236  1.00 177.54 ? 467 THR A C    1 
ATOM   4659  O O    . THR A  1 327 ? 107.063 0.348    -18.250  1.00 176.61 ? 467 THR A O    1 
ATOM   4660  C CB   . THR A  1 327 ? 107.386 1.506    -15.435  1.00 183.97 ? 467 THR A CB   1 
ATOM   4661  O OG1  . THR A  1 327 ? 108.122 2.102    -14.358  1.00 187.58 ? 467 THR A OG1  1 
ATOM   4662  C CG2  . THR A  1 327 ? 106.144 0.818    -14.867  1.00 184.28 ? 467 THR A CG2  1 
ATOM   4663  H H    . THR A  1 327 ? 110.213 0.817    -16.454  1.00 247.34 ? 467 THR A H    1 
ATOM   4664  H HA   . THR A  1 327 ? 108.583 -0.165   -15.536  1.00 241.77 ? 467 THR A HA   1 
ATOM   4665  H HB   . THR A  1 327 ? 107.099 2.198    -16.050  1.00 250.32 ? 467 THR A HB   1 
ATOM   4666  H HG1  . THR A  1 327 ? 107.637 2.651    -13.948  1.00 260.76 ? 467 THR A HG1  1 
ATOM   4667  H HG21 . THR A  1 327 ? 105.590 1.465    -14.403  1.00 245.44 ? 467 THR A HG21 1 
ATOM   4668  H HG22 . THR A  1 327 ? 105.628 0.419    -15.586  1.00 245.44 ? 467 THR A HG22 1 
ATOM   4669  H HG23 . THR A  1 327 ? 106.406 0.123    -14.244  1.00 245.44 ? 467 THR A HG23 1 
ATOM   4670  N N    . PHE A  1 328 ? 107.179 -1.502   -16.973  1.00 174.00 ? 468 PHE A N    1 
ATOM   4671  C CA   . PHE A  1 328 ? 106.376 -2.322   -17.871  1.00 170.82 ? 468 PHE A CA   1 
ATOM   4672  C C    . PHE A  1 328 ? 105.178 -2.915   -17.142  1.00 171.46 ? 468 PHE A C    1 
ATOM   4673  O O    . PHE A  1 328 ? 105.286 -3.361   -15.998  1.00 173.23 ? 468 PHE A O    1 
ATOM   4674  C CB   . PHE A  1 328 ? 107.231 -3.434   -18.479  1.00 167.76 ? 468 PHE A CB   1 
ATOM   4675  C CG   . PHE A  1 328 ? 108.384 -2.928   -19.297  1.00 167.29 ? 468 PHE A CG   1 
ATOM   4676  C CD1  . PHE A  1 328 ? 109.581 -2.587   -18.692  1.00 170.56 ? 468 PHE A CD1  1 
ATOM   4677  C CD2  . PHE A  1 328 ? 108.268 -2.790   -20.670  1.00 165.07 ? 468 PHE A CD2  1 
ATOM   4678  C CE1  . PHE A  1 328 ? 110.644 -2.119   -19.439  1.00 171.45 ? 468 PHE A CE1  1 
ATOM   4679  C CE2  . PHE A  1 328 ? 109.328 -2.322   -21.425  1.00 165.46 ? 468 PHE A CE2  1 
ATOM   4680  C CZ   . PHE A  1 328 ? 110.517 -1.986   -20.808  1.00 168.91 ? 468 PHE A CZ   1 
ATOM   4681  H H    . PHE A  1 328 ? 107.448 -1.919   -16.270  1.00 142.84 ? 468 PHE A H    1 
ATOM   4682  H HA   . PHE A  1 328 ? 106.045 -1.768   -18.594  1.00 132.82 ? 468 PHE A HA   1 
ATOM   4683  H HB2  . PHE A  1 328 ? 107.592 -3.979   -17.762  1.00 128.36 ? 468 PHE A HB2  1 
ATOM   4684  H HB3  . PHE A  1 328 ? 106.673 -3.978   -19.056  1.00 128.36 ? 468 PHE A HB3  1 
ATOM   4685  H HD1  . PHE A  1 328 ? 109.671 -2.675   -17.770  1.00 139.92 ? 468 PHE A HD1  1 
ATOM   4686  H HD2  . PHE A  1 328 ? 107.469 -3.015   -21.090  1.00 126.17 ? 468 PHE A HD2  1 
ATOM   4687  H HE1  . PHE A  1 328 ? 111.444 -1.894   -19.021  1.00 143.55 ? 468 PHE A HE1  1 
ATOM   4688  H HE2  . PHE A  1 328 ? 109.240 -2.234   -22.346  1.00 129.43 ? 468 PHE A HE2  1 
ATOM   4689  H HZ   . PHE A  1 328 ? 111.232 -1.672   -21.314  1.00 138.24 ? 468 PHE A HZ   1 
ATOM   4690  N N    . ARG A  1 329 ? 104.034 -2.905   -17.819  1.00 160.21 ? 469 ARG A N    1 
ATOM   4691  C CA   . ARG A  1 329 ? 102.792 -3.430   -17.269  1.00 160.98 ? 469 ARG A CA   1 
ATOM   4692  C C    . ARG A  1 329 ? 102.159 -4.405   -18.254  1.00 157.15 ? 469 ARG A C    1 
ATOM   4693  O O    . ARG A  1 329 ? 102.346 -4.271   -19.462  1.00 154.66 ? 469 ARG A O    1 
ATOM   4694  C CB   . ARG A  1 329 ? 101.823 -2.290   -16.959  1.00 164.50 ? 469 ARG A CB   1 
ATOM   4695  C CG   . ARG A  1 329 ? 102.382 -1.243   -16.013  1.00 168.15 ? 469 ARG A CG   1 
ATOM   4696  C CD   . ARG A  1 329 ? 101.446 -0.052   -15.878  1.00 171.43 ? 469 ARG A CD   1 
ATOM   4697  N NE   . ARG A  1 329 ? 102.087 1.067    -15.193  1.00 174.19 ? 469 ARG A NE   1 
ATOM   4698  C CZ   . ARG A  1 329 ? 102.092 1.252    -13.875  1.00 177.10 ? 469 ARG A CZ   1 
ATOM   4699  N NH1  . ARG A  1 329 ? 101.483 0.396    -13.068  1.00 177.93 ? 469 ARG A NH1  1 
ATOM   4700  N NH2  . ARG A  1 329 ? 102.712 2.306    -13.362  1.00 179.34 ? 469 ARG A NH2  1 
ATOM   4701  H H    . ARG A  1 329 ? 103.952 -2.593   -18.616  1.00 149.88 ? 469 ARG A H    1 
ATOM   4702  H HA   . ARG A  1 329 ? 102.980 -3.905   -16.444  1.00 147.87 ? 469 ARG A HA   1 
ATOM   4703  H HB2  . ARG A  1 329 ? 101.590 -1.845   -17.789  1.00 152.91 ? 469 ARG A HB2  1 
ATOM   4704  H HB3  . ARG A  1 329 ? 101.025 -2.661   -16.551  1.00 152.91 ? 469 ARG A HB3  1 
ATOM   4705  H HG2  . ARG A  1 329 ? 102.502 -1.636   -15.135  1.00 163.39 ? 469 ARG A HG2  1 
ATOM   4706  H HG3  . ARG A  1 329 ? 103.232 -0.923   -16.356  1.00 163.39 ? 469 ARG A HG3  1 
ATOM   4707  H HD2  . ARG A  1 329 ? 101.179 0.247    -16.762  1.00 170.04 ? 469 ARG A HD2  1 
ATOM   4708  H HD3  . ARG A  1 329 ? 100.666 -0.315   -15.364  1.00 170.04 ? 469 ARG A HD3  1 
ATOM   4709  H HE   . ARG A  1 329 ? 102.492 1.651    -15.677  1.00 181.30 ? 469 ARG A HE   1 
ATOM   4710  H HH11 . ARG A  1 329 ? 101.079 -0.290   -13.394  1.00 187.53 ? 469 ARG A HH11 1 
ATOM   4711  H HH12 . ARG A  1 329 ? 101.491 0.526    -12.218  1.00 187.53 ? 469 ARG A HH12 1 
ATOM   4712  H HH21 . ARG A  1 329 ? 103.109 2.866    -13.879  1.00 200.56 ? 469 ARG A HH21 1 
ATOM   4713  H HH22 . ARG A  1 329 ? 102.716 2.430    -12.511  1.00 200.56 ? 469 ARG A HH22 1 
ATOM   4714  N N    . PRO A  1 330 ? 101.402 -5.388   -17.744  1.00 151.81 ? 470 PRO A N    1 
ATOM   4715  C CA   . PRO A  1 330 ? 100.749 -6.352   -18.635  1.00 147.99 ? 470 PRO A CA   1 
ATOM   4716  C C    . PRO A  1 330 ? 99.698  -5.692   -19.525  1.00 147.52 ? 470 PRO A C    1 
ATOM   4717  O O    . PRO A  1 330 ? 99.028  -4.750   -19.095  1.00 151.01 ? 470 PRO A O    1 
ATOM   4718  C CB   . PRO A  1 330 ? 100.108 -7.351   -17.665  1.00 148.76 ? 470 PRO A CB   1 
ATOM   4719  C CG   . PRO A  1 330 ? 99.905  -6.581   -16.412  1.00 153.71 ? 470 PRO A CG   1 
ATOM   4720  C CD   . PRO A  1 330 ? 101.057 -5.622   -16.331  1.00 155.07 ? 470 PRO A CD   1 
ATOM   4721  H HA   . PRO A  1 330 ? 101.405 -6.808   -19.186  1.00 122.44 ? 470 PRO A HA   1 
ATOM   4722  H HB2  . PRO A  1 330 ? 99.260  -7.658   -18.022  1.00 123.05 ? 470 PRO A HB2  1 
ATOM   4723  H HB3  . PRO A  1 330 ? 100.710 -8.097   -17.517  1.00 123.05 ? 470 PRO A HB3  1 
ATOM   4724  H HG2  . PRO A  1 330 ? 99.064  -6.101   -16.458  1.00 129.92 ? 470 PRO A HG2  1 
ATOM   4725  H HG3  . PRO A  1 330 ? 99.911  -7.186   -15.654  1.00 129.92 ? 470 PRO A HG3  1 
ATOM   4726  H HD2  . PRO A  1 330 ? 100.779 -4.794   -15.908  1.00 134.32 ? 470 PRO A HD2  1 
ATOM   4727  H HD3  . PRO A  1 330 ? 101.803 -6.028   -15.863  1.00 134.32 ? 470 PRO A HD3  1 
ATOM   4728  N N    . GLY A  1 331 ? 99.571  -6.181   -20.755  1.00 142.40 ? 471 GLY A N    1 
ATOM   4729  C CA   . GLY A  1 331 ? 98.618  -5.638   -21.706  1.00 141.67 ? 471 GLY A CA   1 
ATOM   4730  C C    . GLY A  1 331 ? 97.817  -6.718   -22.405  1.00 137.71 ? 471 GLY A C    1 
ATOM   4731  O O    . GLY A  1 331 ? 97.337  -7.663   -21.775  1.00 137.04 ? 471 GLY A O    1 
ATOM   4732  H H    . GLY A  1 331 ? 100.034 -6.837   -21.063  1.00 127.14 ? 471 GLY A H    1 
ATOM   4733  H HA2  . GLY A  1 331 ? 98.001  -5.049   -21.245  1.00 125.51 ? 471 GLY A HA2  1 
ATOM   4734  H HA3  . GLY A  1 331 ? 99.091  -5.123   -22.378  1.00 125.51 ? 471 GLY A HA3  1 
ATOM   4735  N N    . GLY A  1 332 ? 97.674  -6.568   -23.718  1.00 133.51 ? 472 GLY A N    1 
ATOM   4736  C CA   . GLY A  1 332 ? 96.904  -7.494   -24.527  1.00 130.02 ? 472 GLY A CA   1 
ATOM   4737  C C    . GLY A  1 332 ? 95.529  -6.926   -24.794  1.00 130.66 ? 472 GLY A C    1 
ATOM   4738  O O    . GLY A  1 332 ? 95.260  -5.765   -24.490  1.00 134.27 ? 472 GLY A O    1 
ATOM   4739  H H    . GLY A  1 332 ? 98.022  -5.923   -24.169  1.00 105.63 ? 472 GLY A H    1 
ATOM   4740  H HA2  . GLY A  1 332 ? 97.353  -7.646   -25.373  1.00 101.16 ? 472 GLY A HA2  1 
ATOM   4741  H HA3  . GLY A  1 332 ? 96.811  -8.340   -24.062  1.00 101.16 ? 472 GLY A HA3  1 
ATOM   4742  N N    . GLY A  1 333 ? 94.663  -7.752   -25.367  1.00 126.63 ? 473 GLY A N    1 
ATOM   4743  C CA   . GLY A  1 333 ? 93.312  -7.350   -25.702  1.00 127.07 ? 473 GLY A CA   1 
ATOM   4744  C C    . GLY A  1 333 ? 93.005  -7.676   -27.146  1.00 124.72 ? 473 GLY A C    1 
ATOM   4745  O O    . GLY A  1 333 ? 92.017  -8.341   -27.451  1.00 123.07 ? 473 GLY A O    1 
ATOM   4746  H H    . GLY A  1 333 ? 94.842  -8.567   -25.575  1.00 90.06  ? 473 GLY A H    1 
ATOM   4747  H HA2  . GLY A  1 333 ? 92.679  -7.816   -25.134  1.00 92.84  ? 473 GLY A HA2  1 
ATOM   4748  H HA3  . GLY A  1 333 ? 93.209  -6.394   -25.568  1.00 92.84  ? 473 GLY A HA3  1 
ATOM   4749  N N    . ASP A  1 334 ? 93.860  -7.201   -28.040  1.00 133.42 ? 474 ASP A N    1 
ATOM   4750  C CA   . ASP A  1 334 ? 93.747  -7.555   -29.441  1.00 132.19 ? 474 ASP A CA   1 
ATOM   4751  C C    . ASP A  1 334 ? 94.279  -8.973   -29.612  1.00 129.57 ? 474 ASP A C    1 
ATOM   4752  O O    . ASP A  1 334 ? 95.488  -9.198   -29.553  1.00 129.27 ? 474 ASP A O    1 
ATOM   4753  C CB   . ASP A  1 334 ? 94.520  -6.564   -30.309  1.00 134.28 ? 474 ASP A CB   1 
ATOM   4754  C CG   . ASP A  1 334 ? 94.212  -6.716   -31.785  1.00 134.33 ? 474 ASP A CG   1 
ATOM   4755  O OD1  . ASP A  1 334 ? 93.614  -7.742   -32.171  1.00 132.67 ? 474 ASP A OD1  1 
ATOM   4756  O OD2  . ASP A  1 334 ? 94.570  -5.805   -32.560  1.00 136.53 ? 474 ASP A OD2  1 
ATOM   4757  H H    . ASP A  1 334 ? 94.514  -6.673   -27.860  1.00 148.17 ? 474 ASP A H    1 
ATOM   4758  H HA   . ASP A  1 334 ? 92.815  -7.539   -29.707  1.00 144.85 ? 474 ASP A HA   1 
ATOM   4759  H HB2  . ASP A  1 334 ? 94.285  -5.662   -30.044  1.00 145.34 ? 474 ASP A HB2  1 
ATOM   4760  H HB3  . ASP A  1 334 ? 95.471  -6.710   -30.184  1.00 145.34 ? 474 ASP A HB3  1 
ATOM   4761  N N    . MET A  1 335 ? 93.374  -9.929   -29.807  1.00 131.80 ? 475 MET A N    1 
ATOM   4762  C CA   . MET A  1 335 ? 93.753  -11.339  -29.895  1.00 130.22 ? 475 MET A CA   1 
ATOM   4763  C C    . MET A  1 335 ? 94.585  -11.650  -31.135  1.00 130.64 ? 475 MET A C    1 
ATOM   4764  O O    . MET A  1 335 ? 95.121  -12.751  -31.271  1.00 130.11 ? 475 MET A O    1 
ATOM   4765  C CB   . MET A  1 335 ? 92.506  -12.220  -29.876  1.00 129.53 ? 475 MET A CB   1 
ATOM   4766  C CG   . MET A  1 335 ? 91.685  -12.053  -28.619  1.00 129.43 ? 475 MET A CG   1 
ATOM   4767  S SD   . MET A  1 335 ? 92.650  -12.377  -27.131  1.00 129.69 ? 475 MET A SD   1 
ATOM   4768  C CE   . MET A  1 335 ? 91.610  -11.604  -25.890  1.00 131.34 ? 475 MET A CE   1 
ATOM   4769  H H    . MET A  1 335 ? 92.530  -9.788   -29.893  1.00 106.15 ? 475 MET A H    1 
ATOM   4770  H HA   . MET A  1 335 ? 94.279  -11.563  -29.111  1.00 100.54 ? 475 MET A HA   1 
ATOM   4771  H HB2  . MET A  1 335 ? 91.946  -11.990  -30.633  1.00 96.96  ? 475 MET A HB2  1 
ATOM   4772  H HB3  . MET A  1 335 ? 92.777  -13.150  -29.935  1.00 96.96  ? 475 MET A HB3  1 
ATOM   4773  H HG2  . MET A  1 335 ? 91.355  -11.142  -28.574  1.00 100.02 ? 475 MET A HG2  1 
ATOM   4774  H HG3  . MET A  1 335 ? 90.942  -12.677  -28.640  1.00 100.02 ? 475 MET A HG3  1 
ATOM   4775  H HE1  . MET A  1 335 ? 92.026  -11.709  -25.020  1.00 108.16 ? 475 MET A HE1  1 
ATOM   4776  H HE2  . MET A  1 335 ? 91.516  -10.662  -26.100  1.00 108.16 ? 475 MET A HE2  1 
ATOM   4777  H HE3  . MET A  1 335 ? 90.740  -12.033  -25.896  1.00 108.16 ? 475 MET A HE3  1 
ATOM   4778  N N    . ARG A  1 336 ? 94.685  -10.682  -32.039  1.00 129.93 ? 476 ARG A N    1 
ATOM   4779  C CA   . ARG A  1 336 ? 95.572  -10.802  -33.186  1.00 131.05 ? 476 ARG A CA   1 
ATOM   4780  C C    . ARG A  1 336 ? 97.006  -10.931  -32.693  1.00 130.46 ? 476 ARG A C    1 
ATOM   4781  O O    . ARG A  1 336 ? 97.820  -11.622  -33.303  1.00 130.74 ? 476 ARG A O    1 
ATOM   4782  C CB   . ARG A  1 336 ? 95.422  -9.597   -34.117  1.00 133.32 ? 476 ARG A CB   1 
ATOM   4783  C CG   . ARG A  1 336 ? 94.070  -9.518   -34.801  1.00 134.45 ? 476 ARG A CG   1 
ATOM   4784  C CD   . ARG A  1 336 ? 93.907  -8.227   -35.582  1.00 136.95 ? 476 ARG A CD   1 
ATOM   4785  N NE   . ARG A  1 336 ? 92.563  -8.101   -36.138  1.00 138.16 ? 476 ARG A NE   1 
ATOM   4786  C CZ   . ARG A  1 336 ? 91.501  -7.689   -35.453  1.00 137.99 ? 476 ARG A CZ   1 
ATOM   4787  N NH1  . ARG A  1 336 ? 91.614  -7.360   -34.172  1.00 136.87 ? 476 ARG A NH1  1 
ATOM   4788  N NH2  . ARG A  1 336 ? 90.318  -7.610   -36.047  1.00 139.25 ? 476 ARG A NH2  1 
ATOM   4789  H H    . ARG A  1 336 ? 94.248  -9.942   -32.009  1.00 103.52 ? 476 ARG A H    1 
ATOM   4790  H HA   . ARG A  1 336 ? 95.346  -11.603  -33.685  1.00 101.38 ? 476 ARG A HA   1 
ATOM   4791  H HB2  . ARG A  1 336 ? 95.541  -8.786   -33.599  1.00 103.61 ? 476 ARG A HB2  1 
ATOM   4792  H HB3  . ARG A  1 336 ? 96.102  -9.649   -34.807  1.00 103.61 ? 476 ARG A HB3  1 
ATOM   4793  H HG2  . ARG A  1 336 ? 93.983  -10.260  -35.420  1.00 99.11  ? 476 ARG A HG2  1 
ATOM   4794  H HG3  . ARG A  1 336 ? 93.371  -9.557   -34.131  1.00 99.11  ? 476 ARG A HG3  1 
ATOM   4795  H HD2  . ARG A  1 336 ? 94.062  -7.474   -34.991  1.00 102.09 ? 476 ARG A HD2  1 
ATOM   4796  H HD3  . ARG A  1 336 ? 94.541  -8.214   -36.315  1.00 102.09 ? 476 ARG A HD3  1 
ATOM   4797  H HE   . ARG A  1 336 ? 92.451  -8.307   -36.965  1.00 96.95  ? 476 ARG A HE   1 
ATOM   4798  H HH11 . ARG A  1 336 ? 92.378  -7.410   -33.781  1.00 100.52 ? 476 ARG A HH11 1 
ATOM   4799  H HH12 . ARG A  1 336 ? 90.923  -7.094   -33.734  1.00 100.52 ? 476 ARG A HH12 1 
ATOM   4800  H HH21 . ARG A  1 336 ? 90.239  -7.822   -36.877  1.00 93.68  ? 476 ARG A HH21 1 
ATOM   4801  H HH22 . ARG A  1 336 ? 89.631  -7.344   -35.604  1.00 93.68  ? 476 ARG A HH22 1 
ATOM   4802  N N    . ASP A  1 337 ? 97.305  -10.271  -31.576  1.00 132.79 ? 477 ASP A N    1 
ATOM   4803  C CA   . ASP A  1 337 ? 98.632  -10.343  -30.972  1.00 132.81 ? 477 ASP A CA   1 
ATOM   4804  C C    . ASP A  1 337 ? 98.943  -11.757  -30.488  1.00 131.55 ? 477 ASP A C    1 
ATOM   4805  O O    . ASP A  1 337 ? 100.091 -12.191  -30.537  1.00 131.75 ? 477 ASP A O    1 
ATOM   4806  C CB   . ASP A  1 337 ? 98.752  -9.357   -29.806  1.00 133.95 ? 477 ASP A CB   1 
ATOM   4807  C CG   . ASP A  1 337 ? 98.753  -7.908   -30.259  1.00 136.06 ? 477 ASP A CG   1 
ATOM   4808  O OD1  . ASP A  1 337 ? 99.259  -7.621   -31.365  1.00 136.71 ? 477 ASP A OD1  1 
ATOM   4809  O OD2  . ASP A  1 337 ? 98.249  -7.052   -29.501  1.00 137.56 ? 477 ASP A OD2  1 
ATOM   4810  H H    . ASP A  1 337 ? 96.752  -9.772   -31.146  1.00 133.16 ? 477 ASP A H    1 
ATOM   4811  H HA   . ASP A  1 337 ? 99.295  -10.102  -31.638  1.00 134.60 ? 477 ASP A HA   1 
ATOM   4812  H HB2  . ASP A  1 337 ? 98.001  -9.484   -29.206  1.00 137.58 ? 477 ASP A HB2  1 
ATOM   4813  H HB3  . ASP A  1 337 ? 99.584  -9.525   -29.336  1.00 137.58 ? 477 ASP A HB3  1 
ATOM   4814  N N    . ASN A  1 338 ? 97.926  -12.470  -30.012  1.00 133.63 ? 478 ASN A N    1 
ATOM   4815  C CA   . ASN A  1 338 ? 98.102  -13.865  -29.617  1.00 133.08 ? 478 ASN A CA   1 
ATOM   4816  C C    . ASN A  1 338 ? 98.417  -14.736  -30.822  1.00 133.45 ? 478 ASN A C    1 
ATOM   4817  O O    . ASN A  1 338 ? 99.260  -15.629  -30.750  1.00 133.86 ? 478 ASN A O    1 
ATOM   4818  C CB   . ASN A  1 338 ? 96.858  -14.402  -28.918  1.00 132.52 ? 478 ASN A CB   1 
ATOM   4819  C CG   . ASN A  1 338 ? 96.584  -13.706  -27.607  1.00 132.96 ? 478 ASN A CG   1 
ATOM   4820  O OD1  . ASN A  1 338 ? 96.706  -12.487  -27.498  1.00 133.70 ? 478 ASN A OD1  1 
ATOM   4821  N ND2  . ASN A  1 338 ? 96.219  -14.482  -26.594  1.00 133.24 ? 478 ASN A ND2  1 
ATOM   4822  H H    . ASN A  1 338 ? 97.126  -12.170  -29.907  1.00 146.76 ? 478 ASN A H    1 
ATOM   4823  H HA   . ASN A  1 338 ? 98.846  -13.927  -28.998  1.00 144.03 ? 478 ASN A HA   1 
ATOM   4824  H HB2  . ASN A  1 338 ? 96.089  -14.270  -29.494  1.00 142.51 ? 478 ASN A HB2  1 
ATOM   4825  H HB3  . ASN A  1 338 ? 96.980  -15.347  -28.736  1.00 142.51 ? 478 ASN A HB3  1 
ATOM   4826  H HD21 . ASN A  1 338 ? 96.051  -14.134  -25.825  1.00 150.43 ? 478 ASN A HD21 1 
ATOM   4827  H HD22 . ASN A  1 338 ? 96.150  -15.332  -26.706  1.00 150.43 ? 478 ASN A HD22 1 
ATOM   4828  N N    . TRP A  1 339 ? 97.726  -14.476  -31.929  1.00 130.91 ? 479 TRP A N    1 
ATOM   4829  C CA   . TRP A  1 339 ? 97.951  -15.225  -33.161  1.00 132.64 ? 479 TRP A CA   1 
ATOM   4830  C C    . TRP A  1 339 ? 99.284  -14.832  -33.796  1.00 133.55 ? 479 TRP A C    1 
ATOM   4831  O O    . TRP A  1 339 ? 100.015 -15.684  -34.304  1.00 134.73 ? 479 TRP A O    1 
ATOM   4832  C CB   . TRP A  1 339 ? 96.814  -14.993  -34.161  1.00 134.11 ? 479 TRP A CB   1 
ATOM   4833  C CG   . TRP A  1 339 ? 95.440  -15.007  -33.558  1.00 133.17 ? 479 TRP A CG   1 
ATOM   4834  C CD1  . TRP A  1 339 ? 94.402  -14.175  -33.866  1.00 133.52 ? 479 TRP A CD1  1 
ATOM   4835  C CD2  . TRP A  1 339 ? 94.955  -15.891  -32.541  1.00 132.09 ? 479 TRP A CD2  1 
ATOM   4836  N NE1  . TRP A  1 339 ? 93.303  -14.488  -33.108  1.00 132.46 ? 479 TRP A NE1  1 
ATOM   4837  C CE2  . TRP A  1 339 ? 93.615  -15.537  -32.285  1.00 131.63 ? 479 TRP A CE2  1 
ATOM   4838  C CE3  . TRP A  1 339 ? 95.523  -16.948  -31.822  1.00 131.86 ? 479 TRP A CE3  1 
ATOM   4839  C CZ2  . TRP A  1 339 ? 92.833  -16.203  -31.342  1.00 130.93 ? 479 TRP A CZ2  1 
ATOM   4840  C CZ3  . TRP A  1 339 ? 94.746  -17.607  -30.886  1.00 131.49 ? 479 TRP A CZ3  1 
ATOM   4841  C CH2  . TRP A  1 339 ? 93.415  -17.232  -30.655  1.00 131.01 ? 479 TRP A CH2  1 
ATOM   4842  H H    . TRP A  1 339 ? 97.120  -13.869  -31.992  1.00 120.03 ? 479 TRP A H    1 
ATOM   4843  H HA   . TRP A  1 339 ? 97.982  -16.172  -32.956  1.00 117.64 ? 479 TRP A HA   1 
ATOM   4844  H HB2  . TRP A  1 339 ? 96.942  -14.127  -34.581  1.00 115.20 ? 479 TRP A HB2  1 
ATOM   4845  H HB3  . TRP A  1 339 ? 96.846  -15.690  -34.835  1.00 115.20 ? 479 TRP A HB3  1 
ATOM   4846  H HD1  . TRP A  1 339 ? 94.436  -13.496  -34.501  1.00 115.22 ? 479 TRP A HD1  1 
ATOM   4847  H HE1  . TRP A  1 339 ? 92.542  -14.089  -33.143  1.00 115.02 ? 479 TRP A HE1  1 
ATOM   4848  H HE3  . TRP A  1 339 ? 96.405  -17.203  -31.971  1.00 115.45 ? 479 TRP A HE3  1 
ATOM   4849  H HZ2  . TRP A  1 339 ? 91.950  -15.956  -31.186  1.00 115.34 ? 479 TRP A HZ2  1 
ATOM   4850  H HZ3  . TRP A  1 339 ? 95.112  -18.312  -30.402  1.00 116.25 ? 479 TRP A HZ3  1 
ATOM   4851  H HH2  . TRP A  1 339 ? 92.916  -17.693  -30.019  1.00 115.94 ? 479 TRP A HH2  1 
ATOM   4852  N N    . ARG A  1 340 ? 99.590  -13.538  -33.764  1.00 133.40 ? 480 ARG A N    1 
ATOM   4853  C CA   . ARG A  1 340 ? 100.814 -13.015  -34.359  1.00 134.42 ? 480 ARG A CA   1 
ATOM   4854  C C    . ARG A  1 340 ? 102.064 -13.595  -33.690  1.00 133.84 ? 480 ARG A C    1 
ATOM   4855  O O    . ARG A  1 340 ? 103.103 -13.749  -34.330  1.00 134.90 ? 480 ARG A O    1 
ATOM   4856  C CB   . ARG A  1 340 ? 100.833 -11.487  -34.264  1.00 134.82 ? 480 ARG A CB   1 
ATOM   4857  C CG   . ARG A  1 340 ? 101.584 -10.802  -35.388  1.00 136.80 ? 480 ARG A CG   1 
ATOM   4858  C CD   . ARG A  1 340 ? 101.678 -9.304   -35.159  1.00 137.62 ? 480 ARG A CD   1 
ATOM   4859  N NE   . ARG A  1 340 ? 100.378 -8.691   -34.897  1.00 137.75 ? 480 ARG A NE   1 
ATOM   4860  C CZ   . ARG A  1 340 ? 99.460  -8.438   -35.826  1.00 139.06 ? 480 ARG A CZ   1 
ATOM   4861  N NH1  . ARG A  1 340 ? 99.684  -8.754   -37.094  1.00 140.47 ? 480 ARG A NH1  1 
ATOM   4862  N NH2  . ARG A  1 340 ? 98.309  -7.872   -35.484  1.00 139.24 ? 480 ARG A NH2  1 
ATOM   4863  H H    . ARG A  1 340 ? 99.098  -12.936  -33.397  1.00 100.00 ? 480 ARG A H    1 
ATOM   4864  H HA   . ARG A  1 340 ? 100.837 -13.257  -35.298  1.00 103.16 ? 480 ARG A HA   1 
ATOM   4865  H HB2  . ARG A  1 340 ? 99.919  -11.163  -34.280  1.00 107.67 ? 480 ARG A HB2  1 
ATOM   4866  H HB3  . ARG A  1 340 ? 101.256 -11.232  -33.429  1.00 107.67 ? 480 ARG A HB3  1 
ATOM   4867  H HG2  . ARG A  1 340 ? 102.484 -11.160  -35.436  1.00 108.85 ? 480 ARG A HG2  1 
ATOM   4868  H HG3  . ARG A  1 340 ? 101.116 -10.954  -36.224  1.00 108.85 ? 480 ARG A HG3  1 
ATOM   4869  H HD2  . ARG A  1 340 ? 102.249 -9.136   -34.393  1.00 109.89 ? 480 ARG A HD2  1 
ATOM   4870  H HD3  . ARG A  1 340 ? 102.052 -8.886   -35.951  1.00 109.89 ? 480 ARG A HD3  1 
ATOM   4871  H HE   . ARG A  1 340 ? 100.192 -8.479   -34.084  1.00 109.24 ? 480 ARG A HE   1 
ATOM   4872  H HH11 . ARG A  1 340 ? 100.428 -9.120   -37.321  1.00 106.63 ? 480 ARG A HH11 1 
ATOM   4873  H HH12 . ARG A  1 340 ? 99.086  -8.590   -37.690  1.00 106.63 ? 480 ARG A HH12 1 
ATOM   4874  H HH21 . ARG A  1 340 ? 98.158  -7.668   -34.663  1.00 108.98 ? 480 ARG A HH21 1 
ATOM   4875  H HH22 . ARG A  1 340 ? 97.714  -7.712   -36.084  1.00 108.98 ? 480 ARG A HH22 1 
ATOM   4876  N N    . SER A  1 341 ? 101.950 -13.921  -32.406  1.00 131.49 ? 481 SER A N    1 
ATOM   4877  C CA   . SER A  1 341 ? 103.084 -14.405  -31.621  1.00 131.62 ? 481 SER A CA   1 
ATOM   4878  C C    . SER A  1 341 ? 103.552 -15.785  -32.067  1.00 132.27 ? 481 SER A C    1 
ATOM   4879  O O    . SER A  1 341 ? 104.669 -16.201  -31.753  1.00 132.89 ? 481 SER A O    1 
ATOM   4880  C CB   . SER A  1 341 ? 102.717 -14.454  -30.139  1.00 130.93 ? 481 SER A CB   1 
ATOM   4881  O OG   . SER A  1 341 ? 101.773 -15.482  -29.894  1.00 130.30 ? 481 SER A OG   1 
ATOM   4882  H H    . SER A  1 341 ? 101.217 -13.869  -31.959  1.00 146.35 ? 481 SER A H    1 
ATOM   4883  H HA   . SER A  1 341 ? 103.826 -13.789  -31.726  1.00 149.99 ? 481 SER A HA   1 
ATOM   4884  H HB2  . SER A  1 341 ? 103.517 -14.629  -29.620  1.00 151.44 ? 481 SER A HB2  1 
ATOM   4885  H HB3  . SER A  1 341 ? 102.332 -13.602  -29.880  1.00 151.44 ? 481 SER A HB3  1 
ATOM   4886  H HG   . SER A  1 341 ? 101.576 -15.502  -29.078  1.00 148.38 ? 481 SER A HG   1 
ATOM   4887  N N    . GLU A  1 342 ? 102.688 -16.495  -32.787  1.00 137.91 ? 482 GLU A N    1 
ATOM   4888  C CA   . GLU A  1 342 ? 102.986 -17.849  -33.245  1.00 139.31 ? 482 GLU A CA   1 
ATOM   4889  C C    . GLU A  1 342 ? 103.183 -17.910  -34.752  1.00 141.33 ? 482 GLU A C    1 
ATOM   4890  O O    . GLU A  1 342 ? 103.884 -18.784  -35.258  1.00 143.07 ? 482 GLU A O    1 
ATOM   4891  C CB   . GLU A  1 342 ? 101.863 -18.804  -32.843  1.00 139.38 ? 482 GLU A CB   1 
ATOM   4892  C CG   . GLU A  1 342 ? 101.729 -19.014  -31.341  1.00 138.24 ? 482 GLU A CG   1 
ATOM   4893  C CD   . GLU A  1 342 ? 102.943 -19.702  -30.731  1.00 139.18 ? 482 GLU A CD   1 
ATOM   4894  O OE1  . GLU A  1 342 ? 103.001 -20.952  -30.760  1.00 140.76 ? 482 GLU A OE1  1 
ATOM   4895  O OE2  . GLU A  1 342 ? 103.838 -18.992  -30.222  1.00 138.76 ? 482 GLU A OE2  1 
ATOM   4896  H H    . GLU A  1 342 ? 101.912 -16.211  -33.027  1.00 217.03 ? 482 GLU A H    1 
ATOM   4897  H HA   . GLU A  1 342 ? 103.805 -18.152  -32.822  1.00 218.54 ? 482 GLU A HA   1 
ATOM   4898  H HB2  . GLU A  1 342 ? 101.021 -18.448  -33.167  1.00 218.05 ? 482 GLU A HB2  1 
ATOM   4899  H HB3  . GLU A  1 342 ? 102.030 -19.669  -33.247  1.00 218.05 ? 482 GLU A HB3  1 
ATOM   4900  H HG2  . GLU A  1 342 ? 101.625 -18.151  -30.910  1.00 221.22 ? 482 GLU A HG2  1 
ATOM   4901  H HG3  . GLU A  1 342 ? 100.952 -19.567  -31.167  1.00 221.22 ? 482 GLU A HG3  1 
ATOM   4902  N N    . LEU A  1 343 ? 102.561 -16.977  -35.461  1.00 135.13 ? 483 LEU A N    1 
ATOM   4903  C CA   . LEU A  1 343 ? 102.518 -17.010  -36.918  1.00 137.71 ? 483 LEU A CA   1 
ATOM   4904  C C    . LEU A  1 343 ? 103.596 -16.131  -37.566  1.00 138.07 ? 483 LEU A C    1 
ATOM   4905  O O    . LEU A  1 343 ? 103.647 -15.998  -38.790  1.00 140.09 ? 483 LEU A O    1 
ATOM   4906  C CB   . LEU A  1 343 ? 101.126 -16.575  -37.378  1.00 138.43 ? 483 LEU A CB   1 
ATOM   4907  C CG   . LEU A  1 343 ? 100.749 -16.645  -38.857  1.00 141.63 ? 483 LEU A CG   1 
ATOM   4908  C CD1  . LEU A  1 343 ? 101.140 -17.969  -39.488  1.00 144.36 ? 483 LEU A CD1  1 
ATOM   4909  C CD2  . LEU A  1 343 ? 99.259  -16.424  -38.977  1.00 142.20 ? 483 LEU A CD2  1 
ATOM   4910  H H    . LEU A  1 343 ? 102.151 -16.304  -35.118  1.00 98.68  ? 483 LEU A H    1 
ATOM   4911  H HA   . LEU A  1 343 ? 102.659 -17.923  -37.215  1.00 97.22  ? 483 LEU A HA   1 
ATOM   4912  H HB2  . LEU A  1 343 ? 100.480 -17.123  -36.904  1.00 93.47  ? 483 LEU A HB2  1 
ATOM   4913  H HB3  . LEU A  1 343 ? 101.007 -15.651  -37.108  1.00 93.47  ? 483 LEU A HB3  1 
ATOM   4914  H HG   . LEU A  1 343 ? 101.202 -15.934  -39.337  1.00 93.20  ? 483 LEU A HG   1 
ATOM   4915  H HD11 . LEU A  1 343 ? 100.880 -17.962  -40.423  1.00 93.99  ? 483 LEU A HD11 1 
ATOM   4916  H HD12 . LEU A  1 343 ? 102.100 -18.084  -39.412  1.00 93.99  ? 483 LEU A HD12 1 
ATOM   4917  H HD13 . LEU A  1 343 ? 100.683 -18.687  -39.023  1.00 93.99  ? 483 LEU A HD13 1 
ATOM   4918  H HD21 . LEU A  1 343 ? 99.008  -16.467  -39.913  1.00 90.85  ? 483 LEU A HD21 1 
ATOM   4919  H HD22 . LEU A  1 343 ? 98.796  -17.116  -38.478  1.00 90.85  ? 483 LEU A HD22 1 
ATOM   4920  H HD23 . LEU A  1 343 ? 99.039  -15.552  -38.614  1.00 90.85  ? 483 LEU A HD23 1 
ATOM   4921  N N    . TYR A  1 344 ? 104.470 -15.557  -36.743  1.00 139.05 ? 484 TYR A N    1 
ATOM   4922  C CA   . TYR A  1 344 ? 105.440 -14.562  -37.201  1.00 139.48 ? 484 TYR A CA   1 
ATOM   4923  C C    . TYR A  1 344 ? 106.430 -15.103  -38.233  1.00 141.21 ? 484 TYR A C    1 
ATOM   4924  O O    . TYR A  1 344 ? 106.850 -14.376  -39.133  1.00 142.24 ? 484 TYR A O    1 
ATOM   4925  C CB   . TYR A  1 344 ? 106.213 -14.003  -36.004  1.00 138.40 ? 484 TYR A CB   1 
ATOM   4926  C CG   . TYR A  1 344 ? 107.155 -14.999  -35.370  1.00 138.45 ? 484 TYR A CG   1 
ATOM   4927  C CD1  . TYR A  1 344 ? 106.702 -15.909  -34.425  1.00 137.55 ? 484 TYR A CD1  1 
ATOM   4928  C CD2  . TYR A  1 344 ? 108.496 -15.029  -35.718  1.00 139.68 ? 484 TYR A CD2  1 
ATOM   4929  C CE1  . TYR A  1 344 ? 107.559 -16.821  -33.846  1.00 138.05 ? 484 TYR A CE1  1 
ATOM   4930  C CE2  . TYR A  1 344 ? 109.361 -15.936  -35.145  1.00 140.07 ? 484 TYR A CE2  1 
ATOM   4931  C CZ   . TYR A  1 344 ? 108.887 -16.829  -34.209  1.00 139.34 ? 484 TYR A CZ   1 
ATOM   4932  O OH   . TYR A  1 344 ? 109.744 -17.737  -33.632  1.00 140.16 ? 484 TYR A OH   1 
ATOM   4933  H H    . TYR A  1 344 ? 104.522 -15.728  -35.901  1.00 193.99 ? 484 TYR A H    1 
ATOM   4934  H HA   . TYR A  1 344 ? 104.959 -13.827  -37.612  1.00 198.32 ? 484 TYR A HA   1 
ATOM   4935  H HB2  . TYR A  1 344 ? 106.739 -13.243  -36.298  1.00 203.12 ? 484 TYR A HB2  1 
ATOM   4936  H HB3  . TYR A  1 344 ? 105.579 -13.721  -35.326  1.00 203.12 ? 484 TYR A HB3  1 
ATOM   4937  H HD1  . TYR A  1 344 ? 105.805 -15.905  -34.179  1.00 209.69 ? 484 TYR A HD1  1 
ATOM   4938  H HD2  . TYR A  1 344 ? 108.818 -14.427  -36.350  1.00 203.78 ? 484 TYR A HD2  1 
ATOM   4939  H HE1  . TYR A  1 344 ? 107.242 -17.425  -33.214  1.00 213.51 ? 484 TYR A HE1  1 
ATOM   4940  H HE2  . TYR A  1 344 ? 110.258 -15.944  -35.388  1.00 207.41 ? 484 TYR A HE2  1 
ATOM   4941  H HH   . TYR A  1 344 ? 109.327 -18.218  -33.084  1.00 218.14 ? 484 TYR A HH   1 
ATOM   4942  N N    . LYS A  1 345 ? 106.798 -16.374  -38.109  1.00 138.66 ? 485 LYS A N    1 
ATOM   4943  C CA   . LYS A  1 345 ? 107.875 -16.930  -38.923  1.00 140.43 ? 485 LYS A CA   1 
ATOM   4944  C C    . LYS A  1 345 ? 107.382 -17.526  -40.241  1.00 142.82 ? 485 LYS A C    1 
ATOM   4945  O O    . LYS A  1 345 ? 108.114 -18.273  -40.894  1.00 144.43 ? 485 LYS A O    1 
ATOM   4946  C CB   . LYS A  1 345 ? 108.634 -17.998  -38.134  1.00 140.71 ? 485 LYS A CB   1 
ATOM   4947  C CG   . LYS A  1 345 ? 107.789 -19.190  -37.717  1.00 140.98 ? 485 LYS A CG   1 
ATOM   4948  C CD   . LYS A  1 345 ? 108.661 -20.263  -37.082  1.00 141.90 ? 485 LYS A CD   1 
ATOM   4949  C CE   . LYS A  1 345 ? 107.851 -21.462  -36.593  1.00 142.51 ? 485 LYS A CE   1 
ATOM   4950  N NZ   . LYS A  1 345 ? 108.729 -22.568  -36.076  1.00 143.98 ? 485 LYS A NZ   1 
ATOM   4951  H H    . LYS A  1 345 ? 106.442 -16.934  -37.562  1.00 108.43 ? 485 LYS A H    1 
ATOM   4952  H HA   . LYS A  1 345 ? 108.501 -16.221  -39.136  1.00 113.10 ? 485 LYS A HA   1 
ATOM   4953  H HB2  . LYS A  1 345 ? 109.362 -18.330  -38.682  1.00 118.28 ? 485 LYS A HB2  1 
ATOM   4954  H HB3  . LYS A  1 345 ? 108.990 -17.593  -37.328  1.00 118.28 ? 485 LYS A HB3  1 
ATOM   4955  H HG2  . LYS A  1 345 ? 107.128 -18.906  -37.067  1.00 116.49 ? 485 LYS A HG2  1 
ATOM   4956  H HG3  . LYS A  1 345 ? 107.356 -19.569  -38.499  1.00 116.49 ? 485 LYS A HG3  1 
ATOM   4957  H HD2  . LYS A  1 345 ? 109.302 -20.580  -37.738  1.00 123.81 ? 485 LYS A HD2  1 
ATOM   4958  H HD3  . LYS A  1 345 ? 109.125 -19.883  -36.320  1.00 123.81 ? 485 LYS A HD3  1 
ATOM   4959  H HE2  . LYS A  1 345 ? 107.267 -21.179  -35.873  1.00 123.52 ? 485 LYS A HE2  1 
ATOM   4960  H HE3  . LYS A  1 345 ? 107.327 -21.813  -37.330  1.00 123.52 ? 485 LYS A HE3  1 
ATOM   4961  H HZ1  . LYS A  1 345 ? 108.228 -23.250  -35.800  1.00 132.44 ? 485 LYS A HZ1  1 
ATOM   4962  H HZ2  . LYS A  1 345 ? 109.273 -22.851  -36.721  1.00 132.44 ? 485 LYS A HZ2  1 
ATOM   4963  H HZ3  . LYS A  1 345 ? 109.218 -22.273  -35.393  1.00 132.44 ? 485 LYS A HZ3  1 
ATOM   4964  N N    . TYR A  1 346 ? 106.153 -17.194  -40.633  1.00 133.39 ? 486 TYR A N    1 
ATOM   4965  C CA   . TYR A  1 346 ? 105.585 -17.704  -41.879  1.00 136.00 ? 486 TYR A CA   1 
ATOM   4966  C C    . TYR A  1 346 ? 105.167 -16.587  -42.836  1.00 136.55 ? 486 TYR A C    1 
ATOM   4967  O O    . TYR A  1 346 ? 104.877 -15.466  -42.417  1.00 135.26 ? 486 TYR A O    1 
ATOM   4968  C CB   . TYR A  1 346 ? 104.377 -18.591  -41.591  1.00 137.08 ? 486 TYR A CB   1 
ATOM   4969  C CG   . TYR A  1 346 ? 104.662 -19.794  -40.727  1.00 137.29 ? 486 TYR A CG   1 
ATOM   4970  C CD1  . TYR A  1 346 ? 104.611 -19.708  -39.344  1.00 134.72 ? 486 TYR A CD1  1 
ATOM   4971  C CD2  . TYR A  1 346 ? 104.964 -21.021  -41.295  1.00 140.25 ? 486 TYR A CD2  1 
ATOM   4972  C CE1  . TYR A  1 346 ? 104.859 -20.807  -38.551  1.00 135.00 ? 486 TYR A CE1  1 
ATOM   4973  C CE2  . TYR A  1 346 ? 105.214 -22.129  -40.509  1.00 141.12 ? 486 TYR A CE2  1 
ATOM   4974  C CZ   . TYR A  1 346 ? 105.158 -22.013  -39.136  1.00 138.37 ? 486 TYR A CZ   1 
ATOM   4975  O OH   . TYR A  1 346 ? 105.404 -23.101  -38.333  1.00 138.76 ? 486 TYR A OH   1 
ATOM   4976  H H    . TYR A  1 346 ? 105.627 -16.674  -40.194  1.00 80.84  ? 486 TYR A H    1 
ATOM   4977  H HA   . TYR A  1 346 ? 106.252 -18.246  -42.329  1.00 79.51  ? 486 TYR A HA   1 
ATOM   4978  H HB2  . TYR A  1 346 ? 103.704 -18.059  -41.139  1.00 76.17  ? 486 TYR A HB2  1 
ATOM   4979  H HB3  . TYR A  1 346 ? 104.023 -18.914  -42.434  1.00 76.17  ? 486 TYR A HB3  1 
ATOM   4980  H HD1  . TYR A  1 346 ? 104.406 -18.893  -38.944  1.00 85.64  ? 486 TYR A HD1  1 
ATOM   4981  H HD2  . TYR A  1 346 ? 104.999 -21.100  -42.221  1.00 78.26  ? 486 TYR A HD2  1 
ATOM   4982  H HE1  . TYR A  1 346 ? 104.823 -20.733  -37.625  1.00 90.86  ? 486 TYR A HE1  1 
ATOM   4983  H HE2  . TYR A  1 346 ? 105.418 -22.947  -40.903  1.00 82.76  ? 486 TYR A HE2  1 
ATOM   4984  H HH   . TYR A  1 346 ? 105.337 -22.882  -37.525  1.00 95.87  ? 486 TYR A HH   1 
ATOM   4985  N N    . LYS A  1 347 ? 105.126 -16.921  -44.124  1.00 141.44 ? 487 LYS A N    1 
ATOM   4986  C CA   . LYS A  1 347 ? 104.705 -15.996  -45.173  1.00 142.43 ? 487 LYS A CA   1 
ATOM   4987  C C    . LYS A  1 347 ? 104.237 -16.769  -46.403  1.00 144.84 ? 487 LYS A C    1 
ATOM   4988  O O    . LYS A  1 347 ? 104.798 -17.813  -46.735  1.00 145.96 ? 487 LYS A O    1 
ATOM   4989  C CB   . LYS A  1 347 ? 105.849 -15.054  -45.551  1.00 141.92 ? 487 LYS A CB   1 
ATOM   4990  C CG   . LYS A  1 347 ? 105.526 -14.092  -46.692  1.00 142.91 ? 487 LYS A CG   1 
ATOM   4991  C CD   . LYS A  1 347 ? 106.744 -13.246  -47.062  1.00 142.60 ? 487 LYS A CD   1 
ATOM   4992  C CE   . LYS A  1 347 ? 106.448 -12.269  -48.199  1.00 143.39 ? 487 LYS A CE   1 
ATOM   4993  N NZ   . LYS A  1 347 ? 107.672 -11.532  -48.637  1.00 143.33 ? 487 LYS A NZ   1 
ATOM   4994  H H    . LYS A  1 347 ? 105.344 -17.698  -44.422  1.00 102.19 ? 487 LYS A H    1 
ATOM   4995  H HA   . LYS A  1 347 ? 103.963 -15.460  -44.849  1.00 101.98 ? 487 LYS A HA   1 
ATOM   4996  H HB2  . LYS A  1 347 ? 106.083 -14.523  -44.774  1.00 106.76 ? 487 LYS A HB2  1 
ATOM   4997  H HB3  . LYS A  1 347 ? 106.612 -15.588  -45.824  1.00 106.76 ? 487 LYS A HB3  1 
ATOM   4998  H HG2  . LYS A  1 347 ? 105.257 -14.599  -47.474  1.00 105.86 ? 487 LYS A HG2  1 
ATOM   4999  H HG3  . LYS A  1 347 ? 104.813 -13.495  -46.416  1.00 105.86 ? 487 LYS A HG3  1 
ATOM   5000  H HD2  . LYS A  1 347 ? 107.021 -12.732  -46.288  1.00 110.43 ? 487 LYS A HD2  1 
ATOM   5001  H HD3  . LYS A  1 347 ? 107.462 -13.832  -47.348  1.00 110.43 ? 487 LYS A HD3  1 
ATOM   5002  H HE2  . LYS A  1 347 ? 106.103 -12.761  -48.960  1.00 110.83 ? 487 LYS A HE2  1 
ATOM   5003  H HE3  . LYS A  1 347 ? 105.795 -11.618  -47.898  1.00 110.83 ? 487 LYS A HE3  1 
ATOM   5004  H HZ1  . LYS A  1 347 ? 108.007 -11.067  -47.956  1.00 115.19 ? 487 LYS A HZ1  1 
ATOM   5005  H HZ2  . LYS A  1 347 ? 108.287 -12.108  -48.924  1.00 115.19 ? 487 LYS A HZ2  1 
ATOM   5006  H HZ3  . LYS A  1 347 ? 107.469 -10.972  -49.298  1.00 115.19 ? 487 LYS A HZ3  1 
ATOM   5007  N N    . VAL A  1 348 ? 103.220 -16.246  -47.081  1.00 130.99 ? 488 VAL A N    1 
ATOM   5008  C CA   . VAL A  1 348 ? 102.673 -16.887  -48.273  1.00 133.05 ? 488 VAL A CA   1 
ATOM   5009  C C    . VAL A  1 348 ? 103.267 -16.264  -49.522  1.00 133.22 ? 488 VAL A C    1 
ATOM   5010  O O    . VAL A  1 348 ? 103.377 -15.043  -49.612  1.00 132.27 ? 488 VAL A O    1 
ATOM   5011  C CB   . VAL A  1 348 ? 101.144 -16.761  -48.330  1.00 133.74 ? 488 VAL A CB   1 
ATOM   5012  C CG1  . VAL A  1 348 ? 100.592 -17.368  -49.624  1.00 135.56 ? 488 VAL A CG1  1 
ATOM   5013  C CG2  . VAL A  1 348 ? 100.517 -17.421  -47.110  1.00 133.81 ? 488 VAL A CG2  1 
ATOM   5014  H H    . VAL A  1 348 ? 102.826 -15.512  -46.869  1.00 72.78  ? 488 VAL A H    1 
ATOM   5015  H HA   . VAL A  1 348 ? 102.902 -17.830  -48.264  1.00 73.24  ? 488 VAL A HA   1 
ATOM   5016  H HB   . VAL A  1 348 ? 100.905 -15.821  -48.316  1.00 69.34  ? 488 VAL A HB   1 
ATOM   5017  H HG11 . VAL A  1 348 ? 99.627  -17.273  -49.630  1.00 70.90  ? 488 VAL A HG11 1 
ATOM   5018  H HG12 . VAL A  1 348 ? 100.976 -16.898  -50.381  1.00 70.90  ? 488 VAL A HG12 1 
ATOM   5019  H HG13 . VAL A  1 348 ? 100.833 -18.307  -49.660  1.00 70.90  ? 488 VAL A HG13 1 
ATOM   5020  H HG21 . VAL A  1 348 ? 99.553  -17.332  -47.164  1.00 66.73  ? 488 VAL A HG21 1 
ATOM   5021  H HG22 . VAL A  1 348 ? 100.763 -18.360  -47.099  1.00 66.73  ? 488 VAL A HG22 1 
ATOM   5022  H HG23 . VAL A  1 348 ? 100.847 -16.983  -46.310  1.00 66.73  ? 488 VAL A HG23 1 
ATOM   5023  N N    . VAL A  1 349 ? 103.639 -17.103  -50.484  1.00 134.00 ? 489 VAL A N    1 
ATOM   5024  C CA   . VAL A  1 349 ? 104.235 -16.626  -51.727  1.00 134.14 ? 489 VAL A CA   1 
ATOM   5025  C C    . VAL A  1 349 ? 103.596 -17.236  -52.969  1.00 135.66 ? 489 VAL A C    1 
ATOM   5026  O O    . VAL A  1 349 ? 103.027 -18.325  -52.929  1.00 137.09 ? 489 VAL A O    1 
ATOM   5027  C CB   . VAL A  1 349 ? 105.745 -16.917  -51.775  1.00 133.87 ? 489 VAL A CB   1 
ATOM   5028  C CG1  . VAL A  1 349 ? 106.469 -16.202  -50.637  1.00 132.23 ? 489 VAL A CG1  1 
ATOM   5029  C CG2  . VAL A  1 349 ? 106.012 -18.414  -51.735  1.00 135.15 ? 489 VAL A CG2  1 
ATOM   5030  H H    . VAL A  1 349 ? 103.557 -17.958  -50.441  1.00 59.82  ? 489 VAL A H    1 
ATOM   5031  H HA   . VAL A  1 349 ? 104.118 -15.664  -51.777  1.00 61.96  ? 489 VAL A HA   1 
ATOM   5032  H HB   . VAL A  1 349 ? 106.101 -16.576  -52.611  1.00 66.85  ? 489 VAL A HB   1 
ATOM   5033  H HG11 . VAL A  1 349 ? 107.417 -16.402  -50.692  1.00 65.65  ? 489 VAL A HG11 1 
ATOM   5034  H HG12 . VAL A  1 349 ? 106.327 -15.246  -50.724  1.00 65.65  ? 489 VAL A HG12 1 
ATOM   5035  H HG13 . VAL A  1 349 ? 106.113 -16.514  -49.791  1.00 65.65  ? 489 VAL A HG13 1 
ATOM   5036  H HG21 . VAL A  1 349 ? 106.969 -18.565  -51.767  1.00 72.14  ? 489 VAL A HG21 1 
ATOM   5037  H HG22 . VAL A  1 349 ? 105.646 -18.778  -50.913  1.00 72.14  ? 489 VAL A HG22 1 
ATOM   5038  H HG23 . VAL A  1 349 ? 105.585 -18.831  -52.500  1.00 72.14  ? 489 VAL A HG23 1 
ATOM   5039  N N    . LYS A  1 350 ? 103.719 -16.508  -54.073  1.00 154.80 ? 490 LYS A N    1 
ATOM   5040  C CA   . LYS A  1 350 ? 103.223 -16.929  -55.377  1.00 155.75 ? 490 LYS A CA   1 
ATOM   5041  C C    . LYS A  1 350 ? 104.368 -17.482  -56.221  1.00 156.52 ? 490 LYS A C    1 
ATOM   5042  O O    . LYS A  1 350 ? 105.429 -16.862  -56.312  1.00 155.67 ? 490 LYS A O    1 
ATOM   5043  C CB   . LYS A  1 350 ? 102.556 -15.752  -56.095  1.00 154.41 ? 490 LYS A CB   1 
ATOM   5044  C CG   . LYS A  1 350 ? 103.431 -14.491  -56.169  1.00 153.16 ? 490 LYS A CG   1 
ATOM   5045  C CD   . LYS A  1 350 ? 102.703 -13.303  -56.774  1.00 151.74 ? 490 LYS A CD   1 
ATOM   5046  C CE   . LYS A  1 350 ? 103.601 -12.074  -56.808  1.00 150.73 ? 490 LYS A CE   1 
ATOM   5047  N NZ   . LYS A  1 350 ? 103.050 -11.000  -57.679  1.00 149.24 ? 490 LYS A NZ   1 
ATOM   5048  H H    . LYS A  1 350 ? 104.102 -15.738  -54.091  1.00 260.11 ? 490 LYS A H    1 
ATOM   5049  H HA   . LYS A  1 350 ? 102.562 -17.630  -55.259  1.00 263.37 ? 490 LYS A HA   1 
ATOM   5050  H HB2  . LYS A  1 350 ? 102.345 -16.019  -57.003  1.00 261.83 ? 490 LYS A HB2  1 
ATOM   5051  H HB3  . LYS A  1 350 ? 101.741 -15.519  -55.623  1.00 261.83 ? 490 LYS A HB3  1 
ATOM   5052  H HG2  . LYS A  1 350 ? 103.710 -14.247  -55.273  1.00 263.48 ? 490 LYS A HG2  1 
ATOM   5053  H HG3  . LYS A  1 350 ? 104.208 -14.678  -56.719  1.00 263.48 ? 490 LYS A HG3  1 
ATOM   5054  H HD2  . LYS A  1 350 ? 102.441 -13.516  -57.683  1.00 261.22 ? 490 LYS A HD2  1 
ATOM   5055  H HD3  . LYS A  1 350 ? 101.922 -13.096  -56.237  1.00 261.22 ? 490 LYS A HD3  1 
ATOM   5056  H HE2  . LYS A  1 350 ? 103.689 -11.720  -55.909  1.00 261.79 ? 490 LYS A HE2  1 
ATOM   5057  H HE3  . LYS A  1 350 ? 104.472 -12.327  -57.154  1.00 261.79 ? 490 LYS A HE3  1 
ATOM   5058  H HZ1  . LYS A  1 350 ? 103.597 -10.297  -57.677  1.00 261.16 ? 490 LYS A HZ1  1 
ATOM   5059  H HZ2  . LYS A  1 350 ? 102.965 -11.298  -58.513  1.00 261.16 ? 490 LYS A HZ2  1 
ATOM   5060  H HZ3  . LYS A  1 350 ? 102.252 -10.745  -57.379  1.00 261.16 ? 490 LYS A HZ3  1 
ATOM   5061  N N    . ILE A  1 351 ? 104.159 -18.644  -56.833  1.00 161.08 ? 491 ILE A N    1 
ATOM   5062  C CA   . ILE A  1 351 ? 105.189 -19.243  -57.677  1.00 161.82 ? 491 ILE A CA   1 
ATOM   5063  C C    . ILE A  1 351 ? 105.242 -18.526  -59.017  1.00 161.39 ? 491 ILE A C    1 
ATOM   5064  O O    . ILE A  1 351 ? 104.261 -18.511  -59.762  1.00 161.79 ? 491 ILE A O    1 
ATOM   5065  C CB   . ILE A  1 351 ? 104.949 -20.750  -57.917  1.00 164.00 ? 491 ILE A CB   1 
ATOM   5066  C CG1  . ILE A  1 351 ? 105.075 -21.532  -56.605  1.00 164.53 ? 491 ILE A CG1  1 
ATOM   5067  C CG2  . ILE A  1 351 ? 105.950 -21.306  -58.923  1.00 164.75 ? 491 ILE A CG2  1 
ATOM   5068  C CD1  . ILE A  1 351 ? 103.784 -21.651  -55.821  1.00 165.17 ? 491 ILE A CD1  1 
ATOM   5069  H H    . ILE A  1 351 ? 103.434 -19.103  -56.777  1.00 239.80 ? 491 ILE A H    1 
ATOM   5070  H HA   . ILE A  1 351 ? 106.052 -19.141  -57.246  1.00 247.51 ? 491 ILE A HA   1 
ATOM   5071  H HB   . ILE A  1 351 ? 104.053 -20.871  -58.268  1.00 254.60 ? 491 ILE A HB   1 
ATOM   5072  H HG12 . ILE A  1 351 ? 105.381 -22.430  -56.808  1.00 255.87 ? 491 ILE A HG12 1 
ATOM   5073  H HG13 . ILE A  1 351 ? 105.724 -21.086  -56.039  1.00 255.87 ? 491 ILE A HG13 1 
ATOM   5074  H HG21 . ILE A  1 351 ? 105.775 -22.251  -59.053  1.00 262.72 ? 491 ILE A HG21 1 
ATOM   5075  H HG22 . ILE A  1 351 ? 105.850 -20.832  -59.764  1.00 262.72 ? 491 ILE A HG22 1 
ATOM   5076  H HG23 . ILE A  1 351 ? 106.848 -21.180  -58.577  1.00 262.72 ? 491 ILE A HG23 1 
ATOM   5077  H HD11 . ILE A  1 351 ? 103.952 -22.158  -55.011  1.00 248.35 ? 491 ILE A HD11 1 
ATOM   5078  H HD12 . ILE A  1 351 ? 103.468 -20.762  -55.596  1.00 248.35 ? 491 ILE A HD12 1 
ATOM   5079  H HD13 . ILE A  1 351 ? 103.124 -22.109  -56.367  1.00 248.35 ? 491 ILE A HD13 1 
ATOM   5080  N N    . GLU A  1 352 ? 106.394 -17.935  -59.317  1.00 171.08 ? 492 GLU A N    1 
ATOM   5081  C CA   . GLU A  1 352 ? 106.590 -17.209  -60.566  1.00 171.20 ? 492 GLU A CA   1 
ATOM   5082  C C    . GLU A  1 352 ? 108.025 -17.363  -61.065  1.00 172.06 ? 492 GLU A C    1 
ATOM   5083  O O    . GLU A  1 352 ? 108.627 -18.433  -60.946  1.00 173.49 ? 492 GLU A O    1 
ATOM   5084  C CB   . GLU A  1 352 ? 106.251 -15.724  -60.380  1.00 169.52 ? 492 GLU A CB   1 
ATOM   5085  C CG   . GLU A  1 352 ? 104.764 -15.441  -60.153  1.00 168.56 ? 492 GLU A CG   1 
ATOM   5086  C CD   . GLU A  1 352 ? 104.458 -13.963  -59.961  1.00 166.83 ? 492 GLU A CD   1 
ATOM   5087  O OE1  . GLU A  1 352 ? 105.274 -13.259  -59.331  1.00 166.35 ? 492 GLU A OE1  1 
ATOM   5088  O OE2  . GLU A  1 352 ? 103.398 -13.505  -60.442  1.00 165.92 ? 492 GLU A OE2  1 
ATOM   5089  H H    . GLU A  1 352 ? 107.086 -17.942  -58.806  1.00 347.85 ? 492 GLU A H    1 
ATOM   5090  H HA   . GLU A  1 352 ? 105.995 -17.572  -61.241  1.00 349.92 ? 492 GLU A HA   1 
ATOM   5091  H HB2  . GLU A  1 352 ? 106.736 -15.389  -59.611  1.00 344.81 ? 492 GLU A HB2  1 
ATOM   5092  H HB3  . GLU A  1 352 ? 106.525 -15.242  -61.176  1.00 344.81 ? 492 GLU A HB3  1 
ATOM   5093  H HG2  . GLU A  1 352 ? 104.263 -15.753  -60.923  1.00 345.66 ? 492 GLU A HG2  1 
ATOM   5094  H HG3  . GLU A  1 352 ? 104.472 -15.912  -59.356  1.00 345.66 ? 492 GLU A HG3  1 
ATOM   5095  N N    . TRP B  1 2   ? 34.588  -11.865  14.884   1.00 195.06 ? 45  TRP B N    1 
ATOM   5096  C CA   . TRP B  1 2   ? 34.621  -13.221  15.419   1.00 193.28 ? 45  TRP B CA   1 
ATOM   5097  C C    . TRP B  1 2   ? 34.506  -14.258  14.308   1.00 191.64 ? 45  TRP B C    1 
ATOM   5098  O O    . TRP B  1 2   ? 34.714  -13.953  13.135   1.00 191.26 ? 45  TRP B O    1 
ATOM   5099  C CB   . TRP B  1 2   ? 33.495  -13.419  16.437   1.00 197.17 ? 45  TRP B CB   1 
ATOM   5100  C CG   . TRP B  1 2   ? 33.601  -12.521  17.628   1.00 200.04 ? 45  TRP B CG   1 
ATOM   5101  C CD1  . TRP B  1 2   ? 33.116  -11.251  17.742   1.00 200.69 ? 45  TRP B CD1  1 
ATOM   5102  C CD2  . TRP B  1 2   ? 34.232  -12.826  18.877   1.00 203.23 ? 45  TRP B CD2  1 
ATOM   5103  N NE1  . TRP B  1 2   ? 33.408  -10.744  18.985   1.00 204.04 ? 45  TRP B NE1  1 
ATOM   5104  C CE2  . TRP B  1 2   ? 34.091  -11.691  19.702   1.00 205.69 ? 45  TRP B CE2  1 
ATOM   5105  C CE3  . TRP B  1 2   ? 34.902  -13.947  19.379   1.00 204.71 ? 45  TRP B CE3  1 
ATOM   5106  C CZ2  . TRP B  1 2   ? 34.595  -11.646  21.001   1.00 209.60 ? 45  TRP B CZ2  1 
ATOM   5107  C CZ3  . TRP B  1 2   ? 35.401  -13.900  20.668   1.00 208.60 ? 45  TRP B CZ3  1 
ATOM   5108  C CH2  . TRP B  1 2   ? 35.245  -12.757  21.465   1.00 211.01 ? 45  TRP B CH2  1 
ATOM   5109  N N    . LYS B  1 3   ? 34.185  -15.488  14.691   1.00 204.15 ? 46  LYS B N    1 
ATOM   5110  C CA   . LYS B  1 3   ? 33.897  -16.546  13.729   1.00 203.47 ? 46  LYS B CA   1 
ATOM   5111  C C    . LYS B  1 3   ? 35.122  -16.947  12.902   1.00 199.66 ? 46  LYS B C    1 
ATOM   5112  O O    . LYS B  1 3   ? 35.635  -18.059  13.041   1.00 198.04 ? 46  LYS B O    1 
ATOM   5113  C CB   . LYS B  1 3   ? 32.756  -16.108  12.805   1.00 204.79 ? 46  LYS B CB   1 
ATOM   5114  C CG   . LYS B  1 3   ? 31.542  -15.573  13.552   1.00 209.45 ? 46  LYS B CG   1 
ATOM   5115  C CD   . LYS B  1 3   ? 30.468  -15.073  12.601   1.00 210.52 ? 46  LYS B CD   1 
ATOM   5116  C CE   . LYS B  1 3   ? 29.309  -14.450  13.368   1.00 215.29 ? 46  LYS B CE   1 
ATOM   5117  N NZ   . LYS B  1 3   ? 28.227  -13.960  12.468   1.00 216.60 ? 46  LYS B NZ   1 
ATOM   5118  N N    . ASP B  1 4   ? 35.583  -16.042  12.045   1.00 184.14 ? 47  ASP B N    1 
ATOM   5119  C CA   . ASP B  1 4   ? 36.695  -16.328  11.145   1.00 182.08 ? 47  ASP B CA   1 
ATOM   5120  C C    . ASP B  1 4   ? 37.060  -15.070  10.375   1.00 183.14 ? 47  ASP B C    1 
ATOM   5121  O O    . ASP B  1 4   ? 36.642  -13.982  10.758   1.00 185.64 ? 47  ASP B O    1 
ATOM   5122  C CB   . ASP B  1 4   ? 36.334  -17.462  10.185   1.00 179.85 ? 47  ASP B CB   1 
ATOM   5123  C CG   . ASP B  1 4   ? 35.077  -17.170  9.389    1.00 180.12 ? 47  ASP B CG   1 
ATOM   5124  O OD1  . ASP B  1 4   ? 34.291  -16.301  9.821    1.00 182.44 ? 47  ASP B OD1  1 
ATOM   5125  O OD2  . ASP B  1 4   ? 34.873  -17.809  8.335    1.00 177.71 ? 47  ASP B OD2  1 
ATOM   5126  N N    . ALA B  1 5   ? 37.829  -15.213  9.298    1.00 162.11 ? 48  ALA B N    1 
ATOM   5127  C CA   . ALA B  1 5   ? 38.203  -14.060  8.481    1.00 163.96 ? 48  ALA B CA   1 
ATOM   5128  C C    . ALA B  1 5   ? 39.048  -14.435  7.273    1.00 161.87 ? 48  ALA B C    1 
ATOM   5129  O O    . ALA B  1 5   ? 39.913  -15.308  7.352    1.00 160.27 ? 48  ALA B O    1 
ATOM   5130  C CB   . ALA B  1 5   ? 38.943  -13.040  9.322    1.00 167.35 ? 48  ALA B CB   1 
ATOM   5131  N N    . ASN B  1 6   ? 38.787  -13.766  6.154    1.00 163.36 ? 49  ASN B N    1 
ATOM   5132  C CA   . ASN B  1 6   ? 39.635  -13.868  4.971    1.00 161.37 ? 49  ASN B CA   1 
ATOM   5133  C C    . ASN B  1 6   ? 39.227  -12.849  3.911    1.00 159.60 ? 49  ASN B C    1 
ATOM   5134  O O    . ASN B  1 6   ? 38.319  -13.091  3.113    1.00 154.91 ? 49  ASN B O    1 
ATOM   5135  C CB   . ASN B  1 6   ? 39.593  -15.281  4.390    1.00 157.19 ? 49  ASN B CB   1 
ATOM   5136  C CG   . ASN B  1 6   ? 40.967  -15.902  4.295    1.00 157.10 ? 49  ASN B CG   1 
ATOM   5137  O OD1  . ASN B  1 6   ? 41.527  -16.038  3.208    1.00 154.99 ? 49  ASN B OD1  1 
ATOM   5138  N ND2  . ASN B  1 6   ? 41.533  -16.257  5.441    1.00 158.70 ? 49  ASN B ND2  1 
ATOM   5139  H HA   . ASN B  1 6   ? 40.552  -13.680  5.226    1.00 172.40 ? 49  ASN B HA   1 
ATOM   5140  H HB2  . ASN B  1 6   ? 39.047  -15.844  4.962    1.00 171.33 ? 49  ASN B HB2  1 
ATOM   5141  H HB3  . ASN B  1 6   ? 39.215  -15.247  3.497    1.00 171.33 ? 49  ASN B HB3  1 
ATOM   5142  H HD21 . ASN B  1 6   ? 41.117  -16.129  6.183    1.00 173.04 ? 49  ASN B HD21 1 
ATOM   5143  H HD22 . ASN B  1 6   ? 42.315  -16.614  5.442    1.00 173.04 ? 49  ASN B HD22 1 
ATOM   5144  N N    . THR B  1 7   ? 39.909  -11.706  3.917    1.00 151.40 ? 50  THR B N    1 
ATOM   5145  C CA   . THR B  1 7   ? 39.592  -10.597  3.022    1.00 148.40 ? 50  THR B CA   1 
ATOM   5146  C C    . THR B  1 7   ? 40.840  -9.751   2.819    1.00 150.66 ? 50  THR B C    1 
ATOM   5147  O O    . THR B  1 7   ? 41.716  -9.706   3.682    1.00 156.50 ? 50  THR B O    1 
ATOM   5148  C CB   . THR B  1 7   ? 38.447  -9.709   3.577    1.00 149.41 ? 50  THR B CB   1 
ATOM   5149  O OG1  . THR B  1 7   ? 37.303  -10.518  3.876    1.00 147.92 ? 50  THR B OG1  1 
ATOM   5150  C CG2  . THR B  1 7   ? 38.036  -8.642   2.575    1.00 143.52 ? 50  THR B CG2  1 
ATOM   5151  H H    . THR B  1 7   ? 40.572  -11.546  4.440    1.00 198.87 ? 50  THR B H    1 
ATOM   5152  H HA   . THR B  1 7   ? 39.316  -10.947  2.160    1.00 192.99 ? 50  THR B HA   1 
ATOM   5153  H HB   . THR B  1 7   ? 38.747  -9.267   4.386    1.00 190.46 ? 50  THR B HB   1 
ATOM   5154  H HG1  . THR B  1 7   ? 37.035  -10.905  3.181    1.00 191.97 ? 50  THR B HG1  1 
ATOM   5155  H HG21 . THR B  1 7   ? 37.320  -8.100   2.943    1.00 183.37 ? 50  THR B HG21 1 
ATOM   5156  H HG22 . THR B  1 7   ? 38.792  -8.069   2.372    1.00 183.37 ? 50  THR B HG22 1 
ATOM   5157  H HG23 . THR B  1 7   ? 37.726  -9.058   1.756    1.00 183.37 ? 50  THR B HG23 1 
ATOM   5158  N N    . THR B  1 8   ? 40.911  -9.081   1.674    1.00 151.87 ? 51  THR B N    1 
ATOM   5159  C CA   . THR B  1 8   ? 42.068  -8.266   1.318    1.00 151.62 ? 51  THR B CA   1 
ATOM   5160  C C    . THR B  1 8   ? 42.140  -6.967   2.123    1.00 156.28 ? 51  THR B C    1 
ATOM   5161  O O    . THR B  1 8   ? 41.122  -6.319   2.367    1.00 155.14 ? 51  THR B O    1 
ATOM   5162  C CB   . THR B  1 8   ? 42.045  -7.923   -0.179   1.00 139.02 ? 51  THR B CB   1 
ATOM   5163  O OG1  . THR B  1 8   ? 40.777  -7.346   -0.516   1.00 132.88 ? 51  THR B OG1  1 
ATOM   5164  C CG2  . THR B  1 8   ? 42.275  -9.180   -1.024   1.00 134.76 ? 51  THR B CG2  1 
ATOM   5165  H H    . THR B  1 8   ? 40.293  -9.083   1.077    1.00 144.88 ? 51  THR B H    1 
ATOM   5166  H HA   . THR B  1 8   ? 42.875  -8.773   1.497    1.00 141.30 ? 51  THR B HA   1 
ATOM   5167  H HB   . THR B  1 8   ? 42.751  -7.288   -0.375   1.00 137.27 ? 51  THR B HB   1 
ATOM   5168  H HG1  . THR B  1 8   ? 40.652  -6.646   -0.069   1.00 135.37 ? 51  THR B HG1  1 
ATOM   5169  H HG21 . THR B  1 8   ? 42.259  -8.953   -1.967   1.00 140.25 ? 51  THR B HG21 1 
ATOM   5170  H HG22 . THR B  1 8   ? 43.136  -9.572   -0.809   1.00 140.25 ? 51  THR B HG22 1 
ATOM   5171  H HG23 . THR B  1 8   ? 41.579  -9.832   -0.845   1.00 140.25 ? 51  THR B HG23 1 
ATOM   5172  N N    . LEU B  1 9   ? 43.354  -6.589   2.515    1.00 142.26 ? 52  LEU B N    1 
ATOM   5173  C CA   . LEU B  1 9   ? 43.589  -5.389   3.318    1.00 146.05 ? 52  LEU B CA   1 
ATOM   5174  C C    . LEU B  1 9   ? 44.041  -4.204   2.469    1.00 136.98 ? 52  LEU B C    1 
ATOM   5175  O O    . LEU B  1 9   ? 44.256  -4.336   1.265    1.00 126.63 ? 52  LEU B O    1 
ATOM   5176  C CB   . LEU B  1 9   ? 44.651  -5.670   4.386    1.00 153.59 ? 52  LEU B CB   1 
ATOM   5177  C CG   . LEU B  1 9   ? 44.240  -6.386   5.673    1.00 157.73 ? 52  LEU B CG   1 
ATOM   5178  C CD1  . LEU B  1 9   ? 43.627  -7.752   5.409    1.00 155.89 ? 52  LEU B CD1  1 
ATOM   5179  C CD2  . LEU B  1 9   ? 45.459  -6.510   6.575    1.00 158.31 ? 52  LEU B CD2  1 
ATOM   5180  H H    . LEU B  1 9   ? 44.074  -7.020   2.325    1.00 134.02 ? 52  LEU B H    1 
ATOM   5181  H HA   . LEU B  1 9   ? 42.766  -5.141   3.767    1.00 134.81 ? 52  LEU B HA   1 
ATOM   5182  H HB2  . LEU B  1 9   ? 45.344  -6.211   3.976    1.00 141.04 ? 52  LEU B HB2  1 
ATOM   5183  H HB3  . LEU B  1 9   ? 45.033  -4.819   4.651    1.00 141.04 ? 52  LEU B HB3  1 
ATOM   5184  H HG   . LEU B  1 9   ? 43.580  -5.847   6.136    1.00 146.31 ? 52  LEU B HG   1 
ATOM   5185  H HD11 . LEU B  1 9   ? 43.386  -8.159   6.256    1.00 146.31 ? 52  LEU B HD11 1 
ATOM   5186  H HD12 . LEU B  1 9   ? 42.836  -7.641   4.858    1.00 146.31 ? 52  LEU B HD12 1 
ATOM   5187  H HD13 . LEU B  1 9   ? 44.276  -8.305   4.948    1.00 146.31 ? 52  LEU B HD13 1 
ATOM   5188  H HD21 . LEU B  1 9   ? 45.201  -6.964   7.393    1.00 151.03 ? 52  LEU B HD21 1 
ATOM   5189  H HD22 . LEU B  1 9   ? 46.142  -7.021   6.114    1.00 151.03 ? 52  LEU B HD22 1 
ATOM   5190  H HD23 . LEU B  1 9   ? 45.791  -5.622   6.780    1.00 151.03 ? 52  LEU B HD23 1 
ATOM   5191  N N    . PHE B  1 10  ? 44.168  -3.043   3.109    1.00 143.38 ? 53  PHE B N    1 
ATOM   5192  C CA   . PHE B  1 10  ? 44.950  -1.943   2.560    1.00 134.79 ? 53  PHE B CA   1 
ATOM   5193  C C    . PHE B  1 10  ? 46.286  -1.935   3.281    1.00 139.85 ? 53  PHE B C    1 
ATOM   5194  O O    . PHE B  1 10  ? 46.577  -2.828   4.077    1.00 148.58 ? 53  PHE B O    1 
ATOM   5195  C CB   . PHE B  1 10  ? 44.279  -0.575   2.744    1.00 132.24 ? 53  PHE B CB   1 
ATOM   5196  C CG   . PHE B  1 10  ? 42.790  -0.577   2.554    1.00 131.05 ? 53  PHE B CG   1 
ATOM   5197  C CD1  . PHE B  1 10  ? 41.946  -0.714   3.642    1.00 140.70 ? 53  PHE B CD1  1 
ATOM   5198  C CD2  . PHE B  1 10  ? 42.233  -0.399   1.299    1.00 118.76 ? 53  PHE B CD2  1 
ATOM   5199  C CE1  . PHE B  1 10  ? 40.578  -0.701   3.479    1.00 138.64 ? 53  PHE B CE1  1 
ATOM   5200  C CE2  . PHE B  1 10  ? 40.861  -0.385   1.131    1.00 117.50 ? 53  PHE B CE2  1 
ATOM   5201  C CZ   . PHE B  1 10  ? 40.034  -0.536   2.224    1.00 127.39 ? 53  PHE B CZ   1 
ATOM   5202  H H    . PHE B  1 10  ? 43.806  -2.868   3.869    1.00 136.60 ? 53  PHE B H    1 
ATOM   5203  H HA   . PHE B  1 10  ? 45.106  -2.090   1.614    1.00 133.88 ? 53  PHE B HA   1 
ATOM   5204  H HB2  . PHE B  1 10  ? 44.460  -0.260   3.643    1.00 131.77 ? 53  PHE B HB2  1 
ATOM   5205  H HB3  . PHE B  1 10  ? 44.656  0.044    2.099    1.00 131.77 ? 53  PHE B HB3  1 
ATOM   5206  H HD1  . PHE B  1 10  ? 42.306  -0.828   4.492    1.00 131.34 ? 53  PHE B HD1  1 
ATOM   5207  H HD2  . PHE B  1 10  ? 42.788  -0.299   0.559    1.00 138.09 ? 53  PHE B HD2  1 
ATOM   5208  H HE1  . PHE B  1 10  ? 40.022  -0.802   4.218    1.00 133.34 ? 53  PHE B HE1  1 
ATOM   5209  H HE2  . PHE B  1 10  ? 40.497  -0.273   0.283    1.00 140.74 ? 53  PHE B HE2  1 
ATOM   5210  H HZ   . PHE B  1 10  ? 39.110  -0.527   2.114    1.00 138.02 ? 53  PHE B HZ   1 
ATOM   5211  N N    . CYS B  1 11  ? 47.085  -0.910   3.009    1.00 148.40 ? 54  CYS B N    1 
ATOM   5212  C CA   . CYS B  1 11  ? 48.308  -0.657   3.760    1.00 150.13 ? 54  CYS B CA   1 
ATOM   5213  C C    . CYS B  1 11  ? 48.457  0.845    3.969    1.00 146.72 ? 54  CYS B C    1 
ATOM   5214  O O    . CYS B  1 11  ? 48.036  1.636    3.126    1.00 139.00 ? 54  CYS B O    1 
ATOM   5215  C CB   . CYS B  1 11  ? 49.535  -1.229   3.041    1.00 140.24 ? 54  CYS B CB   1 
ATOM   5216  S SG   . CYS B  1 11  ? 49.971  -0.414   1.480    1.00 120.97 ? 54  CYS B SG   1 
ATOM   5217  H H    . CYS B  1 11  ? 46.938  -0.337   2.384    1.00 157.01 ? 54  CYS B H    1 
ATOM   5218  H HA   . CYS B  1 11  ? 48.242  -1.080   4.631    1.00 161.85 ? 54  CYS B HA   1 
ATOM   5219  H HB2  . CYS B  1 11  ? 50.300  -1.154   3.632    1.00 160.57 ? 54  CYS B HB2  1 
ATOM   5220  H HB3  . CYS B  1 11  ? 49.368  -2.164   2.844    1.00 160.57 ? 54  CYS B HB3  1 
ATOM   5221  N N    . ALA B  1 12  ? 49.047  1.229    5.098    1.00 142.85 ? 55  ALA B N    1 
ATOM   5222  C CA   . ALA B  1 12  ? 49.210  2.636    5.442    1.00 141.97 ? 55  ALA B CA   1 
ATOM   5223  C C    . ALA B  1 12  ? 50.679  3.014    5.582    1.00 134.48 ? 55  ALA B C    1 
ATOM   5224  O O    . ALA B  1 12  ? 51.484  2.227    6.073    1.00 134.31 ? 55  ALA B O    1 
ATOM   5225  C CB   . ALA B  1 12  ? 48.465  2.951    6.722    1.00 154.39 ? 55  ALA B CB   1 
ATOM   5226  H H    . ALA B  1 12  ? 49.364  0.687    5.686    1.00 200.10 ? 55  ALA B H    1 
ATOM   5227  H HA   . ALA B  1 12  ? 48.829  3.178    4.734    1.00 204.19 ? 55  ALA B HA   1 
ATOM   5228  H HB1  . ALA B  1 12  ? 48.585  3.890    6.935    1.00 211.32 ? 55  ALA B HB1  1 
ATOM   5229  H HB2  . ALA B  1 12  ? 47.523  2.758    6.594    1.00 211.32 ? 55  ALA B HB2  1 
ATOM   5230  H HB3  . ALA B  1 12  ? 48.821  2.401    7.438    1.00 211.32 ? 55  ALA B HB3  1 
ATOM   5231  N N    . SER B  1 13  ? 51.020  4.229    5.162    1.00 148.70 ? 56  SER B N    1 
ATOM   5232  C CA   . SER B  1 13  ? 52.407  4.675    5.170    1.00 139.47 ? 56  SER B CA   1 
ATOM   5233  C C    . SER B  1 13  ? 52.522  6.188    5.216    1.00 139.34 ? 56  SER B C    1 
ATOM   5234  O O    . SER B  1 13  ? 51.868  6.891    4.445    1.00 137.31 ? 56  SER B O    1 
ATOM   5235  C CB   . SER B  1 13  ? 53.130  4.161    3.930    1.00 125.35 ? 56  SER B CB   1 
ATOM   5236  O OG   . SER B  1 13  ? 52.665  4.841    2.778    1.00 119.28 ? 56  SER B OG   1 
ATOM   5237  H H    . SER B  1 13  ? 50.464  4.816    4.868    1.00 96.83  ? 56  SER B H    1 
ATOM   5238  H HA   . SER B  1 13  ? 52.853  4.314    5.952    1.00 100.92 ? 56  SER B HA   1 
ATOM   5239  H HB2  . SER B  1 13  ? 54.082  4.318    4.029    1.00 95.63  ? 56  SER B HB2  1 
ATOM   5240  H HB3  . SER B  1 13  ? 52.957  3.212    3.831    1.00 95.63  ? 56  SER B HB3  1 
ATOM   5241  H HG   . SER B  1 13  ? 51.840  4.714    2.683    1.00 89.96  ? 56  SER B HG   1 
ATOM   5242  N N    . ASP B  1 14  ? 53.373  6.686    6.106    1.00 140.96 ? 57  ASP B N    1 
ATOM   5243  C CA   . ASP B  1 14  ? 53.669  8.112    6.166    1.00 141.78 ? 57  ASP B CA   1 
ATOM   5244  C C    . ASP B  1 14  ? 54.715  8.464    5.110    1.00 127.48 ? 57  ASP B C    1 
ATOM   5245  O O    . ASP B  1 14  ? 55.784  8.985    5.429    1.00 124.06 ? 57  ASP B O    1 
ATOM   5246  C CB   . ASP B  1 14  ? 54.161  8.508    7.565    1.00 150.35 ? 57  ASP B CB   1 
ATOM   5247  C CG   . ASP B  1 14  ? 53.046  8.516    8.601    1.00 168.35 ? 57  ASP B CG   1 
ATOM   5248  O OD1  . ASP B  1 14  ? 51.915  8.930    8.265    1.00 173.99 ? 57  ASP B OD1  1 
ATOM   5249  O OD2  . ASP B  1 14  ? 53.305  8.115    9.756    1.00 174.17 ? 57  ASP B OD2  1 
ATOM   5250  H H    . ASP B  1 14  ? 53.795  6.215    6.690    1.00 274.61 ? 57  ASP B H    1 
ATOM   5251  H HA   . ASP B  1 14  ? 52.862  8.614    5.974    1.00 279.91 ? 57  ASP B HA   1 
ATOM   5252  H HB2  . ASP B  1 14  ? 54.834  7.873    7.854    1.00 288.85 ? 57  ASP B HB2  1 
ATOM   5253  H HB3  . ASP B  1 14  ? 54.540  9.400    7.525    1.00 288.85 ? 57  ASP B HB3  1 
ATOM   5254  N N    . ALA B  1 15  ? 54.393  8.177    3.852    1.00 141.87 ? 58  ALA B N    1 
ATOM   5255  C CA   . ALA B  1 15  ? 55.319  8.394    2.744    1.00 129.01 ? 58  ALA B CA   1 
ATOM   5256  C C    . ALA B  1 15  ? 55.129  9.766    2.102    1.00 129.87 ? 58  ALA B C    1 
ATOM   5257  O O    . ALA B  1 15  ? 54.002  10.191   1.846    1.00 132.57 ? 58  ALA B O    1 
ATOM   5258  C CB   . ALA B  1 15  ? 55.145  7.300    1.701    1.00 122.60 ? 58  ALA B CB   1 
ATOM   5259  H H    . ALA B  1 15  ? 53.635  7.851    3.611    1.00 194.39 ? 58  ALA B H    1 
ATOM   5260  H HA   . ALA B  1 15  ? 56.227  8.345    3.080    1.00 190.41 ? 58  ALA B HA   1 
ATOM   5261  H HB1  . ALA B  1 15  ? 55.766  7.457    0.972    1.00 182.90 ? 58  ALA B HB1  1 
ATOM   5262  H HB2  . ALA B  1 15  ? 55.328  6.440    2.112    1.00 182.90 ? 58  ALA B HB2  1 
ATOM   5263  H HB3  . ALA B  1 15  ? 54.234  7.322    1.370    1.00 182.90 ? 58  ALA B HB3  1 
ATOM   5264  N N    . LYS B  1 16  ? 56.239  10.451   1.841    1.00 134.19 ? 59  LYS B N    1 
ATOM   5265  C CA   . LYS B  1 16  ? 56.199  11.726   1.136    1.00 134.89 ? 59  LYS B CA   1 
ATOM   5266  C C    . LYS B  1 16  ? 56.040  11.477   -0.359   1.00 128.13 ? 59  LYS B C    1 
ATOM   5267  O O    . LYS B  1 16  ? 56.531  10.480   -0.884   1.00 122.58 ? 59  LYS B O    1 
ATOM   5268  C CB   . LYS B  1 16  ? 57.462  12.541   1.412    1.00 135.54 ? 59  LYS B CB   1 
ATOM   5269  C CG   . LYS B  1 16  ? 57.759  12.727   2.889    1.00 141.79 ? 59  LYS B CG   1 
ATOM   5270  C CD   . LYS B  1 16  ? 58.851  13.760   3.110    1.00 143.26 ? 59  LYS B CD   1 
ATOM   5271  C CE   . LYS B  1 16  ? 59.270  13.825   4.571    1.00 148.48 ? 59  LYS B CE   1 
ATOM   5272  N NZ   . LYS B  1 16  ? 58.119  14.109   5.478    1.00 157.09 ? 59  LYS B NZ   1 
ATOM   5273  H H    . LYS B  1 16  ? 57.030  10.198   2.064    1.00 230.96 ? 59  LYS B H    1 
ATOM   5274  H HA   . LYS B  1 16  ? 55.434  12.238   1.442    1.00 235.34 ? 59  LYS B HA   1 
ATOM   5275  H HB2  . LYS B  1 16  ? 58.220  12.087   1.012    1.00 243.07 ? 59  LYS B HB2  1 
ATOM   5276  H HB3  . LYS B  1 16  ? 57.359  13.421   1.017    1.00 243.07 ? 59  LYS B HB3  1 
ATOM   5277  H HG2  . LYS B  1 16  ? 56.956  13.031   3.342    1.00 249.05 ? 59  LYS B HG2  1 
ATOM   5278  H HG3  . LYS B  1 16  ? 58.057  11.884   3.265    1.00 249.05 ? 59  LYS B HG3  1 
ATOM   5279  H HD2  . LYS B  1 16  ? 59.628  13.522   2.581    1.00 257.55 ? 59  LYS B HD2  1 
ATOM   5280  H HD3  . LYS B  1 16  ? 58.522  14.634   2.849    1.00 257.55 ? 59  LYS B HD3  1 
ATOM   5281  H HE2  . LYS B  1 16  ? 59.654  12.972   4.829    1.00 265.44 ? 59  LYS B HE2  1 
ATOM   5282  H HE3  . LYS B  1 16  ? 59.924  14.533   4.682    1.00 265.44 ? 59  LYS B HE3  1 
ATOM   5283  H HZ1  . LYS B  1 16  ? 58.398  14.141   6.323    1.00 270.10 ? 59  LYS B HZ1  1 
ATOM   5284  H HZ2  . LYS B  1 16  ? 57.751  14.891   5.266    1.00 270.10 ? 59  LYS B HZ2  1 
ATOM   5285  H HZ3  . LYS B  1 16  ? 57.505  13.470   5.400    1.00 270.10 ? 59  LYS B HZ3  1 
ATOM   5286  N N    . ALA B  1 17  ? 55.352  12.389   -1.039   1.00 137.83 ? 60  ALA B N    1 
ATOM   5287  C CA   . ALA B  1 17  ? 55.035  12.212   -2.453   1.00 132.25 ? 60  ALA B CA   1 
ATOM   5288  C C    . ALA B  1 17  ? 56.208  12.580   -3.352   1.00 129.69 ? 60  ALA B C    1 
ATOM   5289  O O    . ALA B  1 17  ? 56.392  11.983   -4.413   1.00 127.26 ? 60  ALA B O    1 
ATOM   5290  C CB   . ALA B  1 17  ? 53.815  13.038   -2.823   1.00 135.96 ? 60  ALA B CB   1 
ATOM   5291  H H    . ALA B  1 17  ? 55.056  13.123   -0.703   1.00 161.73 ? 60  ALA B H    1 
ATOM   5292  H HA   . ALA B  1 17  ? 54.821  11.279   -2.611   1.00 160.19 ? 60  ALA B HA   1 
ATOM   5293  H HB1  . ALA B  1 17  ? 53.619  12.908   -3.764   1.00 160.20 ? 60  ALA B HB1  1 
ATOM   5294  H HB2  . ALA B  1 17  ? 53.062  12.747   -2.285   1.00 160.20 ? 60  ALA B HB2  1 
ATOM   5295  H HB3  . ALA B  1 17  ? 54.003  13.974   -2.650   1.00 160.20 ? 60  ALA B HB3  1 
ATOM   5296  N N    . TYR B  1 18  ? 56.996  13.563   -2.929   1.00 146.34 ? 61  TYR B N    1 
ATOM   5297  C CA   . TYR B  1 18  ? 58.133  14.025   -3.719   1.00 143.94 ? 61  TYR B CA   1 
ATOM   5298  C C    . TYR B  1 18  ? 59.304  13.059   -3.657   1.00 140.66 ? 61  TYR B C    1 
ATOM   5299  O O    . TYR B  1 18  ? 59.784  12.593   -4.692   1.00 137.29 ? 61  TYR B O    1 
ATOM   5300  C CB   . TYR B  1 18  ? 58.594  15.397   -3.232   1.00 149.07 ? 61  TYR B CB   1 
ATOM   5301  C CG   . TYR B  1 18  ? 59.876  15.917   -3.876   1.00 147.91 ? 61  TYR B CG   1 
ATOM   5302  C CD1  . TYR B  1 18  ? 61.122  15.414   -3.510   1.00 146.45 ? 61  TYR B CD1  1 
ATOM   5303  C CD2  . TYR B  1 18  ? 59.843  16.941   -4.818   1.00 149.45 ? 61  TYR B CD2  1 
ATOM   5304  C CE1  . TYR B  1 18  ? 62.290  15.890   -4.084   1.00 146.39 ? 61  TYR B CE1  1 
ATOM   5305  C CE2  . TYR B  1 18  ? 61.008  17.427   -5.394   1.00 149.44 ? 61  TYR B CE2  1 
ATOM   5306  C CZ   . TYR B  1 18  ? 62.227  16.900   -5.023   1.00 147.89 ? 61  TYR B CZ   1 
ATOM   5307  O OH   . TYR B  1 18  ? 63.386  17.380   -5.592   1.00 148.29 ? 61  TYR B OH   1 
ATOM   5308  H H    . TYR B  1 18  ? 56.893  13.981   -2.185   1.00 245.65 ? 61  TYR B H    1 
ATOM   5309  H HA   . TYR B  1 18  ? 57.862  14.110   -4.646   1.00 251.61 ? 61  TYR B HA   1 
ATOM   5310  H HB2  . TYR B  1 18  ? 57.893  16.041   -3.417   1.00 260.28 ? 61  TYR B HB2  1 
ATOM   5311  H HB3  . TYR B  1 18  ? 58.747  15.349   -2.275   1.00 260.28 ? 61  TYR B HB3  1 
ATOM   5312  H HD1  . TYR B  1 18  ? 61.170  14.732   -2.879   1.00 271.83 ? 61  TYR B HD1  1 
ATOM   5313  H HD2  . TYR B  1 18  ? 59.024  17.299   -5.073   1.00 271.89 ? 61  TYR B HD2  1 
ATOM   5314  H HE1  . TYR B  1 18  ? 63.113  15.536   -3.832   1.00 280.09 ? 61  TYR B HE1  1 
ATOM   5315  H HE2  . TYR B  1 18  ? 60.967  18.106   -6.028   1.00 279.37 ? 61  TYR B HE2  1 
ATOM   5316  H HH   . TYR B  1 18  ? 64.051  16.972   -5.279   1.00 290.72 ? 61  TYR B HH   1 
ATOM   5317  N N    . ASP B  1 19  ? 59.771  12.796   -2.436   1.00 145.04 ? 62  ASP B N    1 
ATOM   5318  C CA   . ASP B  1 19  ? 61.007  12.047   -2.205   1.00 143.11 ? 62  ASP B CA   1 
ATOM   5319  C C    . ASP B  1 19  ? 61.056  10.790   -3.061   1.00 138.56 ? 62  ASP B C    1 
ATOM   5320  O O    . ASP B  1 19  ? 60.280  9.854    -2.863   1.00 137.40 ? 62  ASP B O    1 
ATOM   5321  C CB   . ASP B  1 19  ? 61.147  11.684   -0.722   1.00 145.55 ? 62  ASP B CB   1 
ATOM   5322  C CG   . ASP B  1 19  ? 62.579  11.350   -0.330   1.00 145.25 ? 62  ASP B CG   1 
ATOM   5323  O OD1  . ASP B  1 19  ? 63.328  10.810   -1.172   1.00 142.05 ? 62  ASP B OD1  1 
ATOM   5324  O OD2  . ASP B  1 19  ? 62.956  11.629   0.828    1.00 148.61 ? 62  ASP B OD2  1 
ATOM   5325  H H    . ASP B  1 19  ? 59.381  13.045   -1.711   1.00 227.11 ? 62  ASP B H    1 
ATOM   5326  H HA   . ASP B  1 19  ? 61.763  12.604   -2.449   1.00 227.21 ? 62  ASP B HA   1 
ATOM   5327  H HB2  . ASP B  1 19  ? 60.856  12.436   -0.184   1.00 225.74 ? 62  ASP B HB2  1 
ATOM   5328  H HB3  . ASP B  1 19  ? 60.596  10.908   -0.534   1.00 225.74 ? 62  ASP B HB3  1 
ATOM   5329  N N    . THR B  1 20  ? 61.976  10.791   -4.021   1.00 141.24 ? 63  THR B N    1 
ATOM   5330  C CA   . THR B  1 20  ? 62.046  9.738    -5.023   1.00 137.47 ? 63  THR B CA   1 
ATOM   5331  C C    . THR B  1 20  ? 62.998  8.621    -4.607   1.00 136.26 ? 63  THR B C    1 
ATOM   5332  O O    . THR B  1 20  ? 64.041  8.420    -5.226   1.00 136.36 ? 63  THR B O    1 
ATOM   5333  C CB   . THR B  1 20  ? 62.491  10.304   -6.390   1.00 137.31 ? 63  THR B CB   1 
ATOM   5334  O OG1  . THR B  1 20  ? 61.758  11.503   -6.674   1.00 138.77 ? 63  THR B OG1  1 
ATOM   5335  C CG2  . THR B  1 20  ? 62.242  9.293    -7.505   1.00 135.33 ? 63  THR B CG2  1 
ATOM   5336  H H    . THR B  1 20  ? 62.577  11.399   -4.113   1.00 197.75 ? 63  THR B H    1 
ATOM   5337  H HA   . THR B  1 20  ? 61.163  9.352    -5.133   1.00 192.63 ? 63  THR B HA   1 
ATOM   5338  H HB   . THR B  1 20  ? 63.439  10.505   -6.364   1.00 196.87 ? 63  THR B HB   1 
ATOM   5339  H HG1  . THR B  1 20  ? 61.996  11.816   -7.417   1.00 202.93 ? 63  THR B HG1  1 
ATOM   5340  H HG21 . THR B  1 20  ? 62.526  9.662    -8.356   1.00 193.09 ? 63  THR B HG21 1 
ATOM   5341  H HG22 . THR B  1 20  ? 62.742  8.480    -7.332   1.00 193.09 ? 63  THR B HG22 1 
ATOM   5342  H HG23 . THR B  1 20  ? 61.298  9.079    -7.553   1.00 193.09 ? 63  THR B HG23 1 
ATOM   5343  N N    . GLU B  1 21  ? 62.641  7.907    -3.543   1.00 126.90 ? 64  GLU B N    1 
ATOM   5344  C CA   . GLU B  1 21  ? 63.270  6.626    -3.249   1.00 125.69 ? 64  GLU B CA   1 
ATOM   5345  C C    . GLU B  1 21  ? 62.249  5.541    -3.543   1.00 123.92 ? 64  GLU B C    1 
ATOM   5346  O O    . GLU B  1 21  ? 61.046  5.758    -3.406   1.00 124.55 ? 64  GLU B O    1 
ATOM   5347  C CB   . GLU B  1 21  ? 63.774  6.547    -1.801   1.00 128.39 ? 64  GLU B CB   1 
ATOM   5348  C CG   . GLU B  1 21  ? 62.721  6.212    -0.743   1.00 130.20 ? 64  GLU B CG   1 
ATOM   5349  C CD   . GLU B  1 21  ? 63.332  5.720    0.553    1.00 132.48 ? 64  GLU B CD   1 
ATOM   5350  O OE1  . GLU B  1 21  ? 64.072  4.716    0.509    1.00 131.31 ? 64  GLU B OE1  1 
ATOM   5351  O OE2  . GLU B  1 21  ? 63.069  6.330    1.610    1.00 135.84 ? 64  GLU B OE2  1 
ATOM   5352  H H    . GLU B  1 21  ? 62.039  8.144    -2.976   1.00 169.18 ? 64  GLU B H    1 
ATOM   5353  H HA   . GLU B  1 21  ? 64.028  6.499    -3.841   1.00 166.88 ? 64  GLU B HA   1 
ATOM   5354  H HB2  . GLU B  1 21  ? 64.459  5.863    -1.754   1.00 170.63 ? 64  GLU B HB2  1 
ATOM   5355  H HB3  . GLU B  1 21  ? 64.158  7.406    -1.565   1.00 170.63 ? 64  GLU B HB3  1 
ATOM   5356  H HG2  . GLU B  1 21  ? 62.204  7.009    -0.548   1.00 166.85 ? 64  GLU B HG2  1 
ATOM   5357  H HG3  . GLU B  1 21  ? 62.140  5.515    -1.085   1.00 166.85 ? 64  GLU B HG3  1 
ATOM   5358  N N    . VAL B  1 22  ? 62.744  4.384    -3.965   1.00 126.52 ? 65  VAL B N    1 
ATOM   5359  C CA   . VAL B  1 22  ? 61.901  3.267    -4.375   1.00 125.07 ? 65  VAL B CA   1 
ATOM   5360  C C    . VAL B  1 22  ? 60.757  2.958    -3.413   1.00 126.79 ? 65  VAL B C    1 
ATOM   5361  O O    . VAL B  1 22  ? 59.679  2.539    -3.838   1.00 126.16 ? 65  VAL B O    1 
ATOM   5362  C CB   . VAL B  1 22  ? 62.738  1.992    -4.541   1.00 124.34 ? 65  VAL B CB   1 
ATOM   5363  C CG1  . VAL B  1 22  ? 63.618  2.090    -5.777   1.00 122.76 ? 65  VAL B CG1  1 
ATOM   5364  C CG2  . VAL B  1 22  ? 63.575  1.730    -3.304   1.00 126.22 ? 65  VAL B CG2  1 
ATOM   5365  H H    . VAL B  1 22  ? 63.585  4.218    -4.024   1.00 184.40 ? 65  VAL B H    1 
ATOM   5366  H HA   . VAL B  1 22  ? 61.509  3.476    -5.238   1.00 179.98 ? 65  VAL B HA   1 
ATOM   5367  H HB   . VAL B  1 22  ? 62.140  1.238    -4.661   1.00 180.75 ? 65  VAL B HB   1 
ATOM   5368  H HG11 . VAL B  1 22  ? 64.136  1.274    -5.860   1.00 182.38 ? 65  VAL B HG11 1 
ATOM   5369  H HG12 . VAL B  1 22  ? 63.053  2.204    -6.558   1.00 182.38 ? 65  VAL B HG12 1 
ATOM   5370  H HG13 . VAL B  1 22  ? 64.211  2.851    -5.683   1.00 182.38 ? 65  VAL B HG13 1 
ATOM   5371  H HG21 . VAL B  1 22  ? 64.092  0.921    -3.439   1.00 184.60 ? 65  VAL B HG21 1 
ATOM   5372  H HG22 . VAL B  1 22  ? 64.170  2.483    -3.161   1.00 184.60 ? 65  VAL B HG22 1 
ATOM   5373  H HG23 . VAL B  1 22  ? 62.986  1.624    -2.541   1.00 184.60 ? 65  VAL B HG23 1 
ATOM   5374  N N    . HIS B  1 23  ? 60.992  3.173    -2.122   1.00 118.51 ? 66  HIS B N    1 
ATOM   5375  C CA   . HIS B  1 23  ? 60.014  2.817    -1.101   1.00 120.78 ? 66  HIS B CA   1 
ATOM   5376  C C    . HIS B  1 23  ? 58.970  3.912    -0.885   1.00 122.62 ? 66  HIS B C    1 
ATOM   5377  O O    . HIS B  1 23  ? 57.817  3.619    -0.566   1.00 123.95 ? 66  HIS B O    1 
ATOM   5378  C CB   . HIS B  1 23  ? 60.728  2.499    0.219    1.00 123.12 ? 66  HIS B CB   1 
ATOM   5379  C CG   . HIS B  1 23  ? 61.256  1.097    0.303    1.00 122.49 ? 66  HIS B CG   1 
ATOM   5380  N ND1  . HIS B  1 23  ? 62.225  0.719    1.208    1.00 124.19 ? 66  HIS B ND1  1 
ATOM   5381  C CD2  . HIS B  1 23  ? 60.942  -0.019   -0.395   1.00 120.88 ? 66  HIS B CD2  1 
ATOM   5382  C CE1  . HIS B  1 23  ? 62.488  -0.567   1.059    1.00 123.62 ? 66  HIS B CE1  1 
ATOM   5383  N NE2  . HIS B  1 23  ? 61.723  -1.038   0.092    1.00 121.66 ? 66  HIS B NE2  1 
ATOM   5384  H H    . HIS B  1 23  ? 61.712  3.525    -1.812   1.00 162.19 ? 66  HIS B H    1 
ATOM   5385  H HA   . HIS B  1 23  ? 59.546  2.016    -1.384   1.00 158.57 ? 66  HIS B HA   1 
ATOM   5386  H HB2  . HIS B  1 23  ? 61.478  3.105    0.322    1.00 161.35 ? 66  HIS B HB2  1 
ATOM   5387  H HB3  . HIS B  1 23  ? 60.102  2.624    0.950    1.00 161.35 ? 66  HIS B HB3  1 
ATOM   5388  H HD1  . HIS B  1 23  ? 62.601  1.240    1.779    1.00 167.75 ? 66  HIS B HD1  1 
ATOM   5389  H HD2  . HIS B  1 23  ? 60.316  -0.083   -1.080   1.00 160.81 ? 66  HIS B HD2  1 
ATOM   5390  H HE1  . HIS B  1 23  ? 63.107  -1.056   1.551    1.00 168.67 ? 66  HIS B HE1  1 
ATOM   5391  H HE2  . HIS B  1 23  ? 61.715  -1.852   -0.187   1.00 164.64 ? 66  HIS B HE2  1 
ATOM   5392  N N    . ASN B  1 24  ? 59.363  5.167    -1.069   1.00 112.50 ? 67  ASN B N    1 
ATOM   5393  C CA   . ASN B  1 24  ? 58.449  6.280    -0.853   1.00 114.87 ? 67  ASN B CA   1 
ATOM   5394  C C    . ASN B  1 24  ? 57.522  6.505    -2.043   1.00 113.14 ? 67  ASN B C    1 
ATOM   5395  O O    . ASN B  1 24  ? 56.462  7.108    -1.898   1.00 115.18 ? 67  ASN B O    1 
ATOM   5396  C CB   . ASN B  1 24  ? 59.231  7.562    -0.550   1.00 116.83 ? 67  ASN B CB   1 
ATOM   5397  C CG   . ASN B  1 24  ? 59.519  7.736    0.933    1.00 120.68 ? 67  ASN B CG   1 
ATOM   5398  O OD1  . ASN B  1 24  ? 58.682  7.429    1.779    1.00 124.62 ? 67  ASN B OD1  1 
ATOM   5399  N ND2  . ASN B  1 24  ? 60.707  8.233    1.252    1.00 121.63 ? 67  ASN B ND2  1 
ATOM   5400  H H    . ASN B  1 24  ? 60.153  5.400    -1.318   1.00 104.26 ? 67  ASN B H    1 
ATOM   5401  H HA   . ASN B  1 24  ? 57.895  6.083    -0.082   1.00 104.72 ? 67  ASN B HA   1 
ATOM   5402  H HB2  . ASN B  1 24  ? 60.079  7.533    -1.020   1.00 111.02 ? 67  ASN B HB2  1 
ATOM   5403  H HB3  . ASN B  1 24  ? 58.712  8.326    -0.847   1.00 111.02 ? 67  ASN B HB3  1 
ATOM   5404  H HD21 . ASN B  1 24  ? 60.917  8.350    2.078    1.00 121.16 ? 67  ASN B HD21 1 
ATOM   5405  H HD22 . ASN B  1 24  ? 61.268  8.438    0.633    1.00 121.16 ? 67  ASN B HD22 1 
ATOM   5406  N N    . VAL B  1 25  ? 57.909  6.007    -3.212   1.00 107.08 ? 68  VAL B N    1 
ATOM   5407  C CA   . VAL B  1 25  ? 57.130  6.241    -4.424   1.00 105.62 ? 68  VAL B CA   1 
ATOM   5408  C C    . VAL B  1 25  ? 56.018  5.218    -4.586   1.00 105.14 ? 68  VAL B C    1 
ATOM   5409  O O    . VAL B  1 25  ? 54.864  5.583    -4.789   1.00 106.27 ? 68  VAL B O    1 
ATOM   5410  C CB   . VAL B  1 25  ? 58.012  6.211    -5.679   1.00 104.19 ? 68  VAL B CB   1 
ATOM   5411  C CG1  . VAL B  1 25  ? 57.161  6.371    -6.946   1.00 104.01 ? 68  VAL B CG1  1 
ATOM   5412  C CG2  . VAL B  1 25  ? 59.070  7.309    -5.608   1.00 105.41 ? 68  VAL B CG2  1 
ATOM   5413  H H    . VAL B  1 25  ? 58.616  5.532    -3.331   1.00 68.90  ? 68  VAL B H    1 
ATOM   5414  H HA   . VAL B  1 25  ? 56.721  7.119    -4.369   1.00 68.82  ? 68  VAL B HA   1 
ATOM   5415  H HB   . VAL B  1 25  ? 58.467  5.355    -5.728   1.00 70.72  ? 68  VAL B HB   1 
ATOM   5416  H HG11 . VAL B  1 25  ? 57.743  6.348    -7.721   1.00 69.07  ? 68  VAL B HG11 1 
ATOM   5417  H HG12 . VAL B  1 25  ? 56.521  5.644    -6.990   1.00 69.07  ? 68  VAL B HG12 1 
ATOM   5418  H HG13 . VAL B  1 25  ? 56.694  7.221    -6.906   1.00 69.07  ? 68  VAL B HG13 1 
ATOM   5419  H HG21 . VAL B  1 25  ? 59.616  7.273    -6.409   1.00 76.34  ? 68  VAL B HG21 1 
ATOM   5420  H HG22 . VAL B  1 25  ? 58.627  8.170    -5.547   1.00 76.34  ? 68  VAL B HG22 1 
ATOM   5421  H HG23 . VAL B  1 25  ? 59.622  7.164    -4.824   1.00 76.34  ? 68  VAL B HG23 1 
ATOM   5422  N N    . TRP B  1 26  ? 56.367  3.939    -4.517   1.00 101.54 ? 69  TRP B N    1 
ATOM   5423  C CA   . TRP B  1 26  ? 55.374  2.883    -4.638   1.00 101.54 ? 69  TRP B CA   1 
ATOM   5424  C C    . TRP B  1 26  ? 54.303  3.052    -3.562   1.00 104.87 ? 69  TRP B C    1 
ATOM   5425  O O    . TRP B  1 26  ? 53.124  2.767    -3.790   1.00 105.74 ? 69  TRP B O    1 
ATOM   5426  C CB   . TRP B  1 26  ? 56.034  1.503    -4.534   1.00 100.61 ? 69  TRP B CB   1 
ATOM   5427  C CG   . TRP B  1 26  ? 55.048  0.369    -4.529   1.00 101.53 ? 69  TRP B CG   1 
ATOM   5428  C CD1  . TRP B  1 26  ? 54.501  -0.248   -5.618   1.00 100.30 ? 69  TRP B CD1  1 
ATOM   5429  C CD2  . TRP B  1 26  ? 54.487  -0.279   -3.377   1.00 105.36 ? 69  TRP B CD2  1 
ATOM   5430  N NE1  . TRP B  1 26  ? 53.634  -1.238   -5.215   1.00 102.32 ? 69  TRP B NE1  1 
ATOM   5431  C CE2  . TRP B  1 26  ? 53.608  -1.277   -3.846   1.00 106.35 ? 69  TRP B CE2  1 
ATOM   5432  C CE3  . TRP B  1 26  ? 54.640  -0.111   -1.998   1.00 110.56 ? 69  TRP B CE3  1 
ATOM   5433  C CZ2  . TRP B  1 26  ? 52.890  -2.101   -2.986   1.00 116.39 ? 69  TRP B CZ2  1 
ATOM   5434  C CZ3  . TRP B  1 26  ? 53.926  -0.932   -1.146   1.00 121.87 ? 69  TRP B CZ3  1 
ATOM   5435  C CH2  . TRP B  1 26  ? 53.061  -1.913   -1.643   1.00 125.15 ? 69  TRP B CH2  1 
ATOM   5436  H H    . TRP B  1 26  ? 57.172  3.658    -4.400   1.00 121.26 ? 69  TRP B H    1 
ATOM   5437  H HA   . TRP B  1 26  ? 54.944  2.948    -5.505   1.00 117.16 ? 69  TRP B HA   1 
ATOM   5438  H HB2  . TRP B  1 26  ? 56.625  1.380    -5.293   1.00 117.73 ? 69  TRP B HB2  1 
ATOM   5439  H HB3  . TRP B  1 26  ? 56.543  1.459    -3.710   1.00 117.73 ? 69  TRP B HB3  1 
ATOM   5440  H HD1  . TRP B  1 26  ? 54.686  -0.029   -6.502   1.00 115.77 ? 69  TRP B HD1  1 
ATOM   5441  H HE1  . TRP B  1 26  ? 53.183  -1.751   -5.739   1.00 113.40 ? 69  TRP B HE1  1 
ATOM   5442  H HE3  . TRP B  1 26  ? 55.211  0.541    -1.660   1.00 111.37 ? 69  TRP B HE3  1 
ATOM   5443  H HZ2  . TRP B  1 26  ? 52.316  -2.756   -3.313   1.00 108.66 ? 69  TRP B HZ2  1 
ATOM   5444  H HZ3  . TRP B  1 26  ? 54.020  -0.829   -0.227   1.00 109.93 ? 69  TRP B HZ3  1 
ATOM   5445  H HH2  . TRP B  1 26  ? 52.595  -2.451   -1.046   1.00 108.34 ? 69  TRP B HH2  1 
ATOM   5446  N N    . ALA B  1 27  ? 54.719  3.551    -2.402   1.00 111.19 ? 70  ALA B N    1 
ATOM   5447  C CA   . ALA B  1 27  ? 53.822  3.712    -1.265   1.00 117.69 ? 70  ALA B CA   1 
ATOM   5448  C C    . ALA B  1 27  ? 52.795  4.805    -1.524   1.00 119.58 ? 70  ALA B C    1 
ATOM   5449  O O    . ALA B  1 27  ? 51.593  4.571    -1.409   1.00 122.54 ? 70  ALA B O    1 
ATOM   5450  C CB   . ALA B  1 27  ? 54.619  4.027    -0.008   1.00 121.06 ? 70  ALA B CB   1 
ATOM   5451  H H    . ALA B  1 27  ? 55.526  3.805    -2.248   1.00 112.74 ? 70  ALA B H    1 
ATOM   5452  H HA   . ALA B  1 27  ? 53.345  2.881    -1.118   1.00 111.31 ? 70  ALA B HA   1 
ATOM   5453  H HB1  . ALA B  1 27  ? 54.006  4.130    0.736    1.00 115.24 ? 70  ALA B HB1  1 
ATOM   5454  H HB2  . ALA B  1 27  ? 55.233  3.296    0.167    1.00 115.24 ? 70  ALA B HB2  1 
ATOM   5455  H HB3  . ALA B  1 27  ? 55.115  4.849    -0.147   1.00 115.24 ? 70  ALA B HB3  1 
ATOM   5456  N N    . THR B  1 28  ? 53.275  5.995    -1.877   1.00 118.57 ? 71  THR B N    1 
ATOM   5457  C CA   . THR B  1 28  ? 52.409  7.158    -2.041   1.00 121.34 ? 71  THR B CA   1 
ATOM   5458  C C    . THR B  1 28  ? 51.297  6.891    -3.048   1.00 119.24 ? 71  THR B C    1 
ATOM   5459  O O    . THR B  1 28  ? 50.173  7.363    -2.876   1.00 123.01 ? 71  THR B O    1 
ATOM   5460  C CB   . THR B  1 28  ? 53.207  8.398    -2.492   1.00 120.06 ? 71  THR B CB   1 
ATOM   5461  O OG1  . THR B  1 28  ? 54.308  8.611    -1.601   1.00 121.78 ? 71  THR B OG1  1 
ATOM   5462  C CG2  . THR B  1 28  ? 52.326  9.642    -2.494   1.00 124.54 ? 71  THR B CG2  1 
ATOM   5463  H H    . THR B  1 28  ? 54.106  6.155    -2.028   1.00 98.25  ? 71  THR B H    1 
ATOM   5464  H HA   . THR B  1 28  ? 51.996  7.364    -1.188   1.00 98.83  ? 71  THR B HA   1 
ATOM   5465  H HB   . THR B  1 28  ? 53.542  8.258    -3.391   1.00 103.78 ? 71  THR B HB   1 
ATOM   5466  H HG1  . THR B  1 28  ? 54.747  9.285    -1.842   1.00 107.59 ? 71  THR B HG1  1 
ATOM   5467  H HG21 . THR B  1 28  ? 52.841  10.412   -2.780   1.00 105.37 ? 71  THR B HG21 1 
ATOM   5468  H HG22 . THR B  1 28  ? 51.580  9.518    -3.102   1.00 105.37 ? 71  THR B HG22 1 
ATOM   5469  H HG23 . THR B  1 28  ? 51.982  9.805    -1.602   1.00 105.37 ? 71  THR B HG23 1 
ATOM   5470  N N    . HIS B  1 29  ? 51.602  6.132    -4.094   1.00 127.79 ? 72  HIS B N    1 
ATOM   5471  C CA   . HIS B  1 29  ? 50.595  5.809    -5.093   1.00 127.31 ? 72  HIS B CA   1 
ATOM   5472  C C    . HIS B  1 29  ? 49.589  4.770    -4.594   1.00 128.98 ? 72  HIS B C    1 
ATOM   5473  O O    . HIS B  1 29  ? 48.430  4.773    -5.019   1.00 130.58 ? 72  HIS B O    1 
ATOM   5474  C CB   . HIS B  1 29  ? 51.246  5.293    -6.376   1.00 123.63 ? 72  HIS B CB   1 
ATOM   5475  C CG   . HIS B  1 29  ? 50.316  4.490    -7.232   1.00 123.30 ? 72  HIS B CG   1 
ATOM   5476  N ND1  . HIS B  1 29  ? 50.347  3.112    -7.278   1.00 122.13 ? 72  HIS B ND1  1 
ATOM   5477  C CD2  . HIS B  1 29  ? 49.300  4.869    -8.044   1.00 124.64 ? 72  HIS B CD2  1 
ATOM   5478  C CE1  . HIS B  1 29  ? 49.404  2.678    -8.095   1.00 122.67 ? 72  HIS B CE1  1 
ATOM   5479  N NE2  . HIS B  1 29  ? 48.753  3.724    -8.573   1.00 124.20 ? 72  HIS B NE2  1 
ATOM   5480  H H    . HIS B  1 29  ? 52.378  5.794    -4.246   1.00 221.35 ? 72  HIS B H    1 
ATOM   5481  H HA   . HIS B  1 29  ? 50.103  6.616    -5.314   1.00 219.72 ? 72  HIS B HA   1 
ATOM   5482  H HB2  . HIS B  1 29  ? 51.554  6.050    -6.899   1.00 222.74 ? 72  HIS B HB2  1 
ATOM   5483  H HB3  . HIS B  1 29  ? 51.998  4.727    -6.141   1.00 222.74 ? 72  HIS B HB3  1 
ATOM   5484  H HD1  . HIS B  1 29  ? 50.899  2.613    -6.847   1.00 222.08 ? 72  HIS B HD1  1 
ATOM   5485  H HD2  . HIS B  1 29  ? 49.028  5.742    -8.218   1.00 218.74 ? 72  HIS B HD2  1 
ATOM   5486  H HE1  . HIS B  1 29  ? 49.228  1.788    -8.300   1.00 221.27 ? 72  HIS B HE1  1 
ATOM   5487  H HE2  . HIS B  1 29  ? 48.097  3.694    -9.127   1.00 218.98 ? 72  HIS B HE2  1 
ATOM   5488  N N    . ALA B  1 30  ? 50.026  3.893    -3.691   1.00 118.52 ? 73  ALA B N    1 
ATOM   5489  C CA   . ALA B  1 30  ? 49.253  2.697    -3.346   1.00 121.38 ? 73  ALA B CA   1 
ATOM   5490  C C    . ALA B  1 30  ? 48.846  2.578    -1.867   1.00 131.64 ? 73  ALA B C    1 
ATOM   5491  O O    . ALA B  1 30  ? 48.279  1.558    -1.466   1.00 138.85 ? 73  ALA B O    1 
ATOM   5492  C CB   . ALA B  1 30  ? 50.045  1.476    -3.752   1.00 118.11 ? 73  ALA B CB   1 
ATOM   5493  H H    . ALA B  1 30  ? 50.768  3.966    -3.263   1.00 110.00 ? 73  ALA B H    1 
ATOM   5494  H HA   . ALA B  1 30  ? 48.437  2.700    -3.870   1.00 107.71 ? 73  ALA B HA   1 
ATOM   5495  H HB1  . ALA B  1 30  ? 49.538  0.681    -3.525   1.00 108.70 ? 73  ALA B HB1  1 
ATOM   5496  H HB2  . ALA B  1 30  ? 50.203  1.507    -4.709   1.00 108.70 ? 73  ALA B HB2  1 
ATOM   5497  H HB3  . ALA B  1 30  ? 50.891  1.476    -3.276   1.00 108.70 ? 73  ALA B HB3  1 
ATOM   5498  N N    . CYS B  1 31  ? 49.118  3.608    -1.067   1.00 120.08 ? 74  CYS B N    1 
ATOM   5499  C CA   . CYS B  1 31  ? 48.814  3.566    0.367    1.00 133.96 ? 74  CYS B CA   1 
ATOM   5500  C C    . CYS B  1 31  ? 48.275  4.886    0.916    1.00 139.07 ? 74  CYS B C    1 
ATOM   5501  O O    . CYS B  1 31  ? 48.389  5.938    0.286    1.00 132.46 ? 74  CYS B O    1 
ATOM   5502  C CB   . CYS B  1 31  ? 50.058  3.162    1.154    1.00 137.13 ? 74  CYS B CB   1 
ATOM   5503  S SG   . CYS B  1 31  ? 50.553  1.445    0.887    1.00 136.02 ? 74  CYS B SG   1 
ATOM   5504  H H    . CYS B  1 31  ? 49.478  4.344    -1.328   1.00 185.82 ? 74  CYS B H    1 
ATOM   5505  H HA   . CYS B  1 31  ? 48.137  2.888    0.519    1.00 188.09 ? 74  CYS B HA   1 
ATOM   5506  H HB2  . CYS B  1 31  ? 50.797  3.730    0.886    1.00 191.49 ? 74  CYS B HB2  1 
ATOM   5507  H HB3  . CYS B  1 31  ? 49.881  3.276    2.101    1.00 191.49 ? 74  CYS B HB3  1 
ATOM   5508  N N    . VAL B  1 32  ? 47.694  4.799    2.110    1.00 121.84 ? 75  VAL B N    1 
ATOM   5509  C CA   . VAL B  1 32  ? 47.016  5.914    2.766    1.00 128.56 ? 75  VAL B CA   1 
ATOM   5510  C C    . VAL B  1 32  ? 47.791  6.306    4.029    1.00 138.17 ? 75  VAL B C    1 
ATOM   5511  O O    . VAL B  1 32  ? 48.371  5.448    4.678    1.00 143.05 ? 75  VAL B O    1 
ATOM   5512  C CB   . VAL B  1 32  ? 45.571  5.529    3.115    1.00 135.43 ? 75  VAL B CB   1 
ATOM   5513  C CG1  . VAL B  1 32  ? 44.851  6.663    3.796    1.00 142.14 ? 75  VAL B CG1  1 
ATOM   5514  C CG2  . VAL B  1 32  ? 44.827  5.111    1.853    1.00 125.70 ? 75  VAL B CG2  1 
ATOM   5515  H H    . VAL B  1 32  ? 47.681  4.077    2.577    1.00 197.13 ? 75  VAL B H    1 
ATOM   5516  H HA   . VAL B  1 32  ? 46.996  6.678    2.168    1.00 201.25 ? 75  VAL B HA   1 
ATOM   5517  H HB   . VAL B  1 32  ? 45.582  4.773    3.722    1.00 200.02 ? 75  VAL B HB   1 
ATOM   5518  H HG11 . VAL B  1 32  ? 43.944  6.384    4.000    1.00 206.58 ? 75  VAL B HG11 1 
ATOM   5519  H HG12 . VAL B  1 32  ? 45.320  6.889    4.614    1.00 206.58 ? 75  VAL B HG12 1 
ATOM   5520  H HG13 . VAL B  1 32  ? 44.835  7.430    3.201    1.00 206.58 ? 75  VAL B HG13 1 
ATOM   5521  H HG21 . VAL B  1 32  ? 43.917  4.871    2.089    1.00 194.52 ? 75  VAL B HG21 1 
ATOM   5522  H HG22 . VAL B  1 32  ? 44.823  5.853    1.229    1.00 194.52 ? 75  VAL B HG22 1 
ATOM   5523  H HG23 . VAL B  1 32  ? 45.280  4.349    1.459    1.00 194.52 ? 75  VAL B HG23 1 
ATOM   5524  N N    . PRO B  1 33  ? 47.810  7.598    4.384    1.00 127.40 ? 76  PRO B N    1 
ATOM   5525  C CA   . PRO B  1 33  ? 48.726  8.028    5.452    1.00 134.48 ? 76  PRO B CA   1 
ATOM   5526  C C    . PRO B  1 33  ? 48.543  7.379    6.831    1.00 147.02 ? 76  PRO B C    1 
ATOM   5527  O O    . PRO B  1 33  ? 49.441  6.663    7.268    1.00 147.42 ? 76  PRO B O    1 
ATOM   5528  C CB   . PRO B  1 33  ? 48.454  9.531    5.543    1.00 137.26 ? 76  PRO B CB   1 
ATOM   5529  C CG   . PRO B  1 33  ? 48.000  9.906    4.184    1.00 126.14 ? 76  PRO B CG   1 
ATOM   5530  C CD   . PRO B  1 33  ? 47.168  8.748    3.727    1.00 123.25 ? 76  PRO B CD   1 
ATOM   5531  H HA   . PRO B  1 33  ? 49.644  7.895    5.168    1.00 97.62  ? 76  PRO B HA   1 
ATOM   5532  H HB2  . PRO B  1 33  ? 47.759  9.701    6.198    1.00 101.88 ? 76  PRO B HB2  1 
ATOM   5533  H HB3  . PRO B  1 33  ? 49.271  10.000   5.775    1.00 101.88 ? 76  PRO B HB3  1 
ATOM   5534  H HG2  . PRO B  1 33  ? 47.468  10.716   4.228    1.00 94.45  ? 76  PRO B HG2  1 
ATOM   5535  H HG3  . PRO B  1 33  ? 48.768  10.028   3.604    1.00 94.45  ? 76  PRO B HG3  1 
ATOM   5536  H HD2  . PRO B  1 33  ? 46.253  8.847    4.034    1.00 86.71  ? 76  PRO B HD2  1 
ATOM   5537  H HD3  . PRO B  1 33  ? 47.214  8.657    2.763    1.00 86.71  ? 76  PRO B HD3  1 
ATOM   5538  N N    . THR B  1 34  ? 47.429  7.636    7.510    1.00 141.18 ? 77  THR B N    1 
ATOM   5539  C CA   . THR B  1 34  ? 47.291  7.246    8.913    1.00 149.38 ? 77  THR B CA   1 
ATOM   5540  C C    . THR B  1 34  ? 45.848  6.895    9.270    1.00 152.89 ? 77  THR B C    1 
ATOM   5541  O O    . THR B  1 34  ? 44.913  7.222    8.539    1.00 150.58 ? 77  THR B O    1 
ATOM   5542  C CB   . THR B  1 34  ? 47.787  8.380    9.844    1.00 153.70 ? 77  THR B CB   1 
ATOM   5543  O OG1  . THR B  1 34  ? 48.930  9.015    9.258    1.00 150.43 ? 77  THR B OG1  1 
ATOM   5544  C CG2  . THR B  1 34  ? 48.181  7.853    11.215   1.00 156.79 ? 77  THR B CG2  1 
ATOM   5545  H H    . THR B  1 34  ? 46.740  8.035    7.184    1.00 359.67 ? 77  THR B H    1 
ATOM   5546  H HA   . THR B  1 34  ? 47.839  6.463    9.078    1.00 367.49 ? 77  THR B HA   1 
ATOM   5547  H HB   . THR B  1 34  ? 47.080  9.034    9.960    1.00 367.84 ? 77  THR B HB   1 
ATOM   5548  H HG1  . THR B  1 34  ? 48.726  9.340    8.510    1.00 368.45 ? 77  THR B HG1  1 
ATOM   5549  H HG21 . THR B  1 34  ? 48.487  8.584    11.776   1.00 357.96 ? 77  THR B HG21 1 
ATOM   5550  H HG22 . THR B  1 34  ? 47.418  7.429    11.639   1.00 357.96 ? 77  THR B HG22 1 
ATOM   5551  H HG23 . THR B  1 34  ? 48.895  7.203    11.128   1.00 357.96 ? 77  THR B HG23 1 
ATOM   5552  N N    . ASP B  1 35  ? 45.678  6.212    10.396   1.00 176.54 ? 78  ASP B N    1 
ATOM   5553  C CA   . ASP B  1 35  ? 44.363  5.805    10.876   1.00 178.99 ? 78  ASP B CA   1 
ATOM   5554  C C    . ASP B  1 35  ? 43.937  6.629    12.088   1.00 181.93 ? 78  ASP B C    1 
ATOM   5555  O O    . ASP B  1 35  ? 44.742  7.378    12.641   1.00 182.72 ? 78  ASP B O    1 
ATOM   5556  C CB   . ASP B  1 35  ? 44.385  4.314    11.205   1.00 178.18 ? 78  ASP B CB   1 
ATOM   5557  C CG   . ASP B  1 35  ? 44.288  3.452    9.963    1.00 175.83 ? 78  ASP B CG   1 
ATOM   5558  O OD1  . ASP B  1 35  ? 43.403  3.725    9.123    1.00 174.06 ? 78  ASP B OD1  1 
ATOM   5559  O OD2  . ASP B  1 35  ? 45.107  2.515    9.818    1.00 174.03 ? 78  ASP B OD2  1 
ATOM   5560  H H    . ASP B  1 35  ? 46.323  5.967    10.910   1.00 326.45 ? 78  ASP B H    1 
ATOM   5561  H HA   . ASP B  1 35  ? 43.712  5.948    10.172   1.00 326.89 ? 78  ASP B HA   1 
ATOM   5562  H HB2  . ASP B  1 35  ? 45.217  4.101    11.656   1.00 324.58 ? 78  ASP B HB2  1 
ATOM   5563  H HB3  . ASP B  1 35  ? 43.631  4.104    11.778   1.00 324.58 ? 78  ASP B HB3  1 
ATOM   5564  N N    . PRO B  1 36  ? 42.662  6.508    12.500   1.00 215.30 ? 79  PRO B N    1 
ATOM   5565  C CA   . PRO B  1 36  ? 42.140  7.305    13.621   1.00 217.28 ? 79  PRO B CA   1 
ATOM   5566  C C    . PRO B  1 36  ? 42.741  6.957    14.982   1.00 217.59 ? 79  PRO B C    1 
ATOM   5567  O O    . PRO B  1 36  ? 42.986  5.789    15.294   1.00 215.29 ? 79  PRO B O    1 
ATOM   5568  C CB   . PRO B  1 36  ? 40.637  6.986    13.613   1.00 215.80 ? 79  PRO B CB   1 
ATOM   5569  C CG   . PRO B  1 36  ? 40.353  6.442    12.262   1.00 213.03 ? 79  PRO B CG   1 
ATOM   5570  C CD   . PRO B  1 36  ? 41.596  5.721    11.856   1.00 212.85 ? 79  PRO B CD   1 
ATOM   5571  H HA   . PRO B  1 36  ? 42.267  8.251    13.447   1.00 346.66 ? 79  PRO B HA   1 
ATOM   5572  H HB2  . PRO B  1 36  ? 40.440  6.326    14.295   1.00 344.68 ? 79  PRO B HB2  1 
ATOM   5573  H HB3  . PRO B  1 36  ? 40.131  7.800    13.767   1.00 344.68 ? 79  PRO B HB3  1 
ATOM   5574  H HG2  . PRO B  1 36  ? 39.601  5.830    12.308   1.00 329.90 ? 79  PRO B HG2  1 
ATOM   5575  H HG3  . PRO B  1 36  ? 40.164  7.170    11.649   1.00 329.90 ? 79  PRO B HG3  1 
ATOM   5576  H HD2  . PRO B  1 36  ? 41.589  4.814    12.200   1.00 322.78 ? 79  PRO B HD2  1 
ATOM   5577  H HD3  . PRO B  1 36  ? 41.698  5.737    10.892   1.00 322.78 ? 79  PRO B HD3  1 
ATOM   5578  N N    . SER B  1 37  ? 42.958  7.992    15.788   1.00 235.89 ? 80  SER B N    1 
ATOM   5579  C CA   . SER B  1 37  ? 43.423  7.845    17.163   1.00 235.10 ? 80  SER B CA   1 
ATOM   5580  C C    . SER B  1 37  ? 42.350  7.175    18.021   1.00 234.06 ? 80  SER B C    1 
ATOM   5581  O O    . SER B  1 37  ? 41.239  6.947    17.544   1.00 234.09 ? 80  SER B O    1 
ATOM   5582  C CB   . SER B  1 37  ? 43.787  9.221    17.731   1.00 237.67 ? 80  SER B CB   1 
ATOM   5583  O OG   . SER B  1 37  ? 42.761  10.161   17.471   1.00 240.34 ? 80  SER B OG   1 
ATOM   5584  H H    . SER B  1 37  ? 42.839  8.811    15.554   1.00 275.99 ? 80  SER B H    1 
ATOM   5585  H HA   . SER B  1 37  ? 44.217  7.289    17.177   1.00 287.34 ? 80  SER B HA   1 
ATOM   5586  H HB2  . SER B  1 37  ? 43.909  9.145    18.690   1.00 294.21 ? 80  SER B HB2  1 
ATOM   5587  H HB3  . SER B  1 37  ? 44.609  9.527    17.316   1.00 294.21 ? 80  SER B HB3  1 
ATOM   5588  H HG   . SER B  1 37  ? 42.971  10.911   17.786   1.00 297.62 ? 80  SER B HG   1 
ATOM   5589  N N    . PRO B  1 38  ? 42.669  6.847    19.289   1.00 235.72 ? 81  PRO B N    1 
ATOM   5590  C CA   . PRO B  1 38  ? 43.971  6.911    19.957   1.00 234.25 ? 81  PRO B CA   1 
ATOM   5591  C C    . PRO B  1 38  ? 44.491  5.562    20.459   1.00 230.07 ? 81  PRO B C    1 
ATOM   5592  O O    . PRO B  1 38  ? 45.435  5.011    19.888   1.00 227.65 ? 81  PRO B O    1 
ATOM   5593  C CB   . PRO B  1 38  ? 43.684  7.844    21.138   1.00 236.16 ? 81  PRO B CB   1 
ATOM   5594  C CG   . PRO B  1 38  ? 42.173  7.644    21.432   1.00 236.91 ? 81  PRO B CG   1 
ATOM   5595  C CD   . PRO B  1 38  ? 41.596  6.810    20.296   1.00 235.92 ? 81  PRO B CD   1 
ATOM   5596  H HA   . PRO B  1 38  ? 44.632  7.318    19.375   1.00 298.24 ? 81  PRO B HA   1 
ATOM   5597  H HB2  . PRO B  1 38  ? 44.222  7.583    21.902   1.00 315.80 ? 81  PRO B HB2  1 
ATOM   5598  H HB3  . PRO B  1 38  ? 43.868  8.762    20.884   1.00 315.80 ? 81  PRO B HB3  1 
ATOM   5599  H HG2  . PRO B  1 38  ? 42.069  7.179    22.277   1.00 320.64 ? 81  PRO B HG2  1 
ATOM   5600  H HG3  . PRO B  1 38  ? 41.736  8.510    21.468   1.00 320.64 ? 81  PRO B HG3  1 
ATOM   5601  H HD2  . PRO B  1 38  ? 41.437  5.899    20.590   1.00 308.22 ? 81  PRO B HD2  1 
ATOM   5602  H HD3  . PRO B  1 38  ? 40.789  7.220    19.948   1.00 308.22 ? 81  PRO B HD3  1 
ATOM   5603  N N    . GLN B  1 39  ? 43.871  5.045    21.515   1.00 213.38 ? 82  GLN B N    1 
ATOM   5604  C CA   . GLN B  1 39  ? 44.411  3.921    22.275   1.00 209.48 ? 82  GLN B CA   1 
ATOM   5605  C C    . GLN B  1 39  ? 43.855  2.576    21.828   1.00 207.59 ? 82  GLN B C    1 
ATOM   5606  O O    . GLN B  1 39  ? 42.775  2.496    21.240   1.00 209.37 ? 82  GLN B O    1 
ATOM   5607  C CB   . GLN B  1 39  ? 44.119  4.122    23.764   1.00 209.54 ? 82  GLN B CB   1 
ATOM   5608  C CG   . GLN B  1 39  ? 44.792  5.352    24.362   1.00 211.18 ? 82  GLN B CG   1 
ATOM   5609  C CD   . GLN B  1 39  ? 44.145  5.824    25.656   1.00 215.78 ? 82  GLN B CD   1 
ATOM   5610  O OE1  . GLN B  1 39  ? 43.186  5.224    26.145   1.00 218.94 ? 82  GLN B OE1  1 
ATOM   5611  N NE2  . GLN B  1 39  ? 44.670  6.911    26.215   1.00 218.71 ? 82  GLN B NE2  1 
ATOM   5612  H H    . GLN B  1 39  ? 43.119  5.334    21.818   1.00 279.96 ? 82  GLN B H    1 
ATOM   5613  H HA   . GLN B  1 39  ? 45.373  3.898    22.159   1.00 282.01 ? 82  GLN B HA   1 
ATOM   5614  H HB2  . GLN B  1 39  ? 43.162  4.220    23.885   1.00 295.53 ? 82  GLN B HB2  1 
ATOM   5615  H HB3  . GLN B  1 39  ? 44.434  3.345    24.252   1.00 295.53 ? 82  GLN B HB3  1 
ATOM   5616  H HG2  . GLN B  1 39  ? 45.720  5.141    24.553   1.00 310.75 ? 82  GLN B HG2  1 
ATOM   5617  H HG3  . GLN B  1 39  ? 44.744  6.079    23.722   1.00 310.75 ? 82  GLN B HG3  1 
ATOM   5618  H HE21 . GLN B  1 39  ? 44.341  7.219    26.947   1.00 311.67 ? 82  GLN B HE21 1 
ATOM   5619  H HE22 . GLN B  1 39  ? 45.338  7.305    25.844   1.00 311.67 ? 82  GLN B HE22 1 
ATOM   5620  N N    . GLU B  1 40  ? 44.608  1.519    22.126   1.00 202.01 ? 83  GLU B N    1 
ATOM   5621  C CA   . GLU B  1 40  ? 44.187  0.154    21.839   1.00 200.01 ? 83  GLU B CA   1 
ATOM   5622  C C    . GLU B  1 40  ? 42.880  -0.162   22.555   1.00 201.05 ? 83  GLU B C    1 
ATOM   5623  O O    . GLU B  1 40  ? 42.626  0.325    23.659   1.00 201.98 ? 83  GLU B O    1 
ATOM   5624  C CB   . GLU B  1 40  ? 45.272  -0.845   22.256   1.00 195.50 ? 83  GLU B CB   1 
ATOM   5625  C CG   . GLU B  1 40  ? 46.461  -0.910   21.303   1.00 193.64 ? 83  GLU B CG   1 
ATOM   5626  C CD   . GLU B  1 40  ? 47.547  -1.865   21.771   1.00 188.68 ? 83  GLU B CD   1 
ATOM   5627  O OE1  . GLU B  1 40  ? 47.390  -2.470   22.853   1.00 188.47 ? 83  GLU B OE1  1 
ATOM   5628  O OE2  . GLU B  1 40  ? 48.560  -2.010   21.055   1.00 186.39 ? 83  GLU B OE2  1 
ATOM   5629  H H    . GLU B  1 40  ? 45.380  1.571    22.501   1.00 273.13 ? 83  GLU B H    1 
ATOM   5630  H HA   . GLU B  1 40  ? 44.039  0.059    20.885   1.00 259.27 ? 83  GLU B HA   1 
ATOM   5631  H HB2  . GLU B  1 40  ? 45.608  -0.593   23.130   1.00 254.53 ? 83  GLU B HB2  1 
ATOM   5632  H HB3  . GLU B  1 40  ? 44.880  -1.731   22.300   1.00 254.53 ? 83  GLU B HB3  1 
ATOM   5633  H HG2  . GLU B  1 40  ? 46.152  -1.212   20.434   1.00 255.37 ? 83  GLU B HG2  1 
ATOM   5634  H HG3  . GLU B  1 40  ? 46.853  -0.026   21.227   1.00 255.37 ? 83  GLU B HG3  1 
ATOM   5635  N N    . LEU B  1 41  ? 42.056  -0.979   21.909   1.00 193.22 ? 84  LEU B N    1 
ATOM   5636  C CA   . LEU B  1 41  ? 40.766  -1.374   22.458   1.00 195.86 ? 84  LEU B CA   1 
ATOM   5637  C C    . LEU B  1 41  ? 40.919  -2.714   23.175   1.00 196.21 ? 84  LEU B C    1 
ATOM   5638  O O    . LEU B  1 41  ? 41.136  -3.746   22.538   1.00 193.49 ? 84  LEU B O    1 
ATOM   5639  C CB   . LEU B  1 41  ? 39.719  -1.458   21.347   1.00 196.25 ? 84  LEU B CB   1 
ATOM   5640  C CG   . LEU B  1 41  ? 39.776  -0.357   20.277   1.00 198.82 ? 84  LEU B CG   1 
ATOM   5641  C CD1  . LEU B  1 41  ? 38.919  -0.724   19.074   1.00 200.27 ? 84  LEU B CD1  1 
ATOM   5642  C CD2  . LEU B  1 41  ? 39.343  0.981    20.857   1.00 201.04 ? 84  LEU B CD2  1 
ATOM   5643  H H    . LEU B  1 41  ? 42.224  -1.323   21.139   1.00 286.65 ? 84  LEU B H    1 
ATOM   5644  H HA   . LEU B  1 41  ? 40.475  -0.713   23.105   1.00 285.93 ? 84  LEU B HA   1 
ATOM   5645  H HB2  . LEU B  1 41  ? 39.825  -2.308   20.892   1.00 278.68 ? 84  LEU B HB2  1 
ATOM   5646  H HB3  . LEU B  1 41  ? 38.840  -1.418   21.754   1.00 278.68 ? 84  LEU B HB3  1 
ATOM   5647  H HG   . LEU B  1 41  ? 40.692  -0.266   19.971   1.00 282.31 ? 84  LEU B HG   1 
ATOM   5648  H HD11 . LEU B  1 41  ? 38.975  -0.012   18.418   1.00 274.59 ? 84  LEU B HD11 1 
ATOM   5649  H HD12 . LEU B  1 41  ? 39.248  -1.553   18.693   1.00 274.59 ? 84  LEU B HD12 1 
ATOM   5650  H HD13 . LEU B  1 41  ? 38.000  -0.835   19.364   1.00 274.59 ? 84  LEU B HD13 1 
ATOM   5651  H HD21 . LEU B  1 41  ? 39.388  1.655    20.161   1.00 293.52 ? 84  LEU B HD21 1 
ATOM   5652  H HD22 . LEU B  1 41  ? 38.432  0.903    21.183   1.00 293.52 ? 84  LEU B HD22 1 
ATOM   5653  H HD23 . LEU B  1 41  ? 39.937  1.216    21.586   1.00 293.52 ? 84  LEU B HD23 1 
ATOM   5654  N N    . LYS B  1 42  ? 40.804  -2.686   24.501   1.00 195.41 ? 85  LYS B N    1 
ATOM   5655  C CA   . LYS B  1 42  ? 41.154  -3.833   25.336   1.00 199.15 ? 85  LYS B CA   1 
ATOM   5656  C C    . LYS B  1 42  ? 39.947  -4.678   25.746   1.00 204.53 ? 85  LYS B C    1 
ATOM   5657  O O    . LYS B  1 42  ? 38.859  -4.151   25.982   1.00 208.57 ? 85  LYS B O    1 
ATOM   5658  C CB   . LYS B  1 42  ? 41.896  -3.348   26.582   1.00 204.36 ? 85  LYS B CB   1 
ATOM   5659  C CG   . LYS B  1 42  ? 43.234  -2.688   26.275   1.00 199.81 ? 85  LYS B CG   1 
ATOM   5660  C CD   . LYS B  1 42  ? 43.859  -2.074   27.517   1.00 205.84 ? 85  LYS B CD   1 
ATOM   5661  C CE   . LYS B  1 42  ? 45.268  -1.576   27.252   1.00 201.92 ? 85  LYS B CE   1 
ATOM   5662  N NZ   . LYS B  1 42  ? 45.877  -0.986   28.478   1.00 208.46 ? 85  LYS B NZ   1 
ATOM   5663  H H    . LYS B  1 42  ? 40.522  -2.006   24.946   1.00 260.09 ? 85  LYS B H    1 
ATOM   5664  H HA   . LYS B  1 42  ? 41.758  -4.406   24.838   1.00 259.18 ? 85  LYS B HA   1 
ATOM   5665  H HB2  . LYS B  1 42  ? 41.343  -2.698   27.043   1.00 270.10 ? 85  LYS B HB2  1 
ATOM   5666  H HB3  . LYS B  1 42  ? 42.065  -4.107   27.162   1.00 270.10 ? 85  LYS B HB3  1 
ATOM   5667  H HG2  . LYS B  1 42  ? 43.846  -3.355   25.926   1.00 275.40 ? 85  LYS B HG2  1 
ATOM   5668  H HG3  . LYS B  1 42  ? 43.100  -1.982   25.623   1.00 275.40 ? 85  LYS B HG3  1 
ATOM   5669  H HD2  . LYS B  1 42  ? 43.321  -1.321   27.806   1.00 287.71 ? 85  LYS B HD2  1 
ATOM   5670  H HD3  . LYS B  1 42  ? 43.901  -2.744   28.217   1.00 287.71 ? 85  LYS B HD3  1 
ATOM   5671  H HE2  . LYS B  1 42  ? 45.822  -2.319   26.966   1.00 294.72 ? 85  LYS B HE2  1 
ATOM   5672  H HE3  . LYS B  1 42  ? 45.243  -0.892   26.565   1.00 294.72 ? 85  LYS B HE3  1 
ATOM   5673  H HZ1  . LYS B  1 42  ? 46.701  -0.700   28.301   1.00 308.23 ? 85  LYS B HZ1  1 
ATOM   5674  H HZ2  . LYS B  1 42  ? 45.387  -0.298   28.759   1.00 308.23 ? 85  LYS B HZ2  1 
ATOM   5675  H HZ3  . LYS B  1 42  ? 45.914  -1.597   29.124   1.00 308.23 ? 85  LYS B HZ3  1 
ATOM   5676  N N    . MET B  1 43  ? 40.164  -5.992   25.827   1.00 198.61 ? 86  MET B N    1 
ATOM   5677  C CA   . MET B  1 43  ? 39.131  -6.956   26.219   1.00 203.96 ? 86  MET B CA   1 
ATOM   5678  C C    . MET B  1 43  ? 39.426  -7.544   27.597   1.00 211.40 ? 86  MET B C    1 
ATOM   5679  O O    . MET B  1 43  ? 40.570  -7.520   28.057   1.00 211.28 ? 86  MET B O    1 
ATOM   5680  C CB   . MET B  1 43  ? 39.036  -8.087   25.193   1.00 199.39 ? 86  MET B CB   1 
ATOM   5681  C CG   . MET B  1 43  ? 38.683  -7.643   23.779   1.00 192.58 ? 86  MET B CG   1 
ATOM   5682  S SD   . MET B  1 43  ? 36.993  -7.057   23.572   1.00 196.10 ? 86  MET B SD   1 
ATOM   5683  C CE   . MET B  1 43  ? 36.045  -8.519   23.985   1.00 202.24 ? 86  MET B CE   1 
ATOM   5684  H H    . MET B  1 43  ? 40.922  -6.360   25.655   1.00 173.61 ? 86  MET B H    1 
ATOM   5685  H HA   . MET B  1 43  ? 38.273  -6.504   26.246   1.00 171.83 ? 86  MET B HA   1 
ATOM   5686  H HB2  . MET B  1 43  ? 39.892  -8.540   25.152   1.00 163.05 ? 86  MET B HB2  1 
ATOM   5687  H HB3  . MET B  1 43  ? 38.351  -8.710   25.483   1.00 163.05 ? 86  MET B HB3  1 
ATOM   5688  H HG2  . MET B  1 43  ? 39.277  -6.919   23.524   1.00 157.81 ? 86  MET B HG2  1 
ATOM   5689  H HG3  . MET B  1 43  ? 38.809  -8.394   23.178   1.00 157.81 ? 86  MET B HG3  1 
ATOM   5690  H HE1  . MET B  1 43  ? 35.100  -8.314   23.906   1.00 160.77 ? 86  MET B HE1  1 
ATOM   5691  H HE2  . MET B  1 43  ? 36.282  -9.232   23.372   1.00 160.77 ? 86  MET B HE2  1 
ATOM   5692  H HE3  . MET B  1 43  ? 36.252  -8.782   24.895   1.00 160.77 ? 86  MET B HE3  1 
ATOM   5693  N N    . GLU B  1 44  ? 38.394  -8.084   28.243   1.00 218.29 ? 87  GLU B N    1 
ATOM   5694  C CA   . GLU B  1 44  ? 38.531  -8.662   29.578   1.00 226.40 ? 87  GLU B CA   1 
ATOM   5695  C C    . GLU B  1 44  ? 37.821  -10.006  29.697   1.00 230.35 ? 87  GLU B C    1 
ATOM   5696  O O    . GLU B  1 44  ? 36.715  -10.184  29.184   1.00 230.60 ? 87  GLU B O    1 
ATOM   5697  C CB   . GLU B  1 44  ? 37.981  -7.704   30.633   1.00 233.64 ? 87  GLU B CB   1 
ATOM   5698  C CG   . GLU B  1 44  ? 38.737  -6.398   30.739   1.00 231.49 ? 87  GLU B CG   1 
ATOM   5699  C CD   . GLU B  1 44  ? 38.321  -5.595   31.950   1.00 239.96 ? 87  GLU B CD   1 
ATOM   5700  O OE1  . GLU B  1 44  ? 37.315  -5.964   32.589   1.00 247.03 ? 87  GLU B OE1  1 
ATOM   5701  O OE2  . GLU B  1 44  ? 39.003  -4.601   32.269   1.00 239.95 ? 87  GLU B OE2  1 
ATOM   5702  H H    . GLU B  1 44  ? 37.596  -8.127   27.925   1.00 271.33 ? 87  GLU B H    1 
ATOM   5703  H HA   . GLU B  1 44  ? 39.472  -8.804   29.765   1.00 277.90 ? 87  GLU B HA   1 
ATOM   5704  H HB2  . GLU B  1 44  ? 37.060  -7.495   30.414   1.00 286.61 ? 87  GLU B HB2  1 
ATOM   5705  H HB3  . GLU B  1 44  ? 38.021  -8.139   31.499   1.00 286.61 ? 87  GLU B HB3  1 
ATOM   5706  H HG2  . GLU B  1 44  ? 39.686  -6.585   30.812   1.00 292.51 ? 87  GLU B HG2  1 
ATOM   5707  H HG3  . GLU B  1 44  ? 38.562  -5.865   29.948   1.00 292.51 ? 87  GLU B HG3  1 
ATOM   5708  N N    . ASN B  1 45  ? 38.471  -10.946  30.379   1.00 233.90 ? 88  ASN B N    1 
ATOM   5709  C CA   . ASN B  1 45  ? 37.904  -12.267  30.638   1.00 238.76 ? 88  ASN B CA   1 
ATOM   5710  C C    . ASN B  1 45  ? 37.539  -13.003  29.353   1.00 232.93 ? 88  ASN B C    1 
ATOM   5711  O O    . ASN B  1 45  ? 36.728  -13.931  29.367   1.00 236.80 ? 88  ASN B O    1 
ATOM   5712  C CB   . ASN B  1 45  ? 36.670  -12.154  31.538   1.00 247.73 ? 88  ASN B CB   1 
ATOM   5713  C CG   . ASN B  1 45  ? 36.969  -11.465  32.857   1.00 254.54 ? 88  ASN B CG   1 
ATOM   5714  O OD1  . ASN B  1 45  ? 37.966  -10.755  32.985   1.00 251.81 ? 88  ASN B OD1  1 
ATOM   5715  N ND2  . ASN B  1 45  ? 36.104  -11.670  33.846   1.00 263.89 ? 88  ASN B ND2  1 
ATOM   5716  H H    . ASN B  1 45  ? 39.258  -10.839  30.709   1.00 320.55 ? 88  ASN B H    1 
ATOM   5717  H HA   . ASN B  1 45  ? 38.564  -12.802  31.106   1.00 319.31 ? 88  ASN B HA   1 
ATOM   5718  H HB2  . ASN B  1 45  ? 35.988  -11.639  31.078   1.00 321.47 ? 88  ASN B HB2  1 
ATOM   5719  H HB3  . ASN B  1 45  ? 36.338  -13.045  31.733   1.00 321.47 ? 88  ASN B HB3  1 
ATOM   5720  H HD21 . ASN B  1 45  ? 36.231  -11.300  34.612   1.00 326.30 ? 88  ASN B HD21 1 
ATOM   5721  H HD22 . ASN B  1 45  ? 35.418  -12.172  33.719   1.00 326.30 ? 88  ASN B HD22 1 
ATOM   5722  N N    . VAL B  1 46  ? 38.140  -12.578  28.247   1.00 224.06 ? 89  VAL B N    1 
ATOM   5723  C CA   . VAL B  1 46  ? 37.939  -13.220  26.956   1.00 218.14 ? 89  VAL B CA   1 
ATOM   5724  C C    . VAL B  1 46  ? 39.160  -14.059  26.623   1.00 214.37 ? 89  VAL B C    1 
ATOM   5725  O O    . VAL B  1 46  ? 40.294  -13.630  26.833   1.00 212.05 ? 89  VAL B O    1 
ATOM   5726  C CB   . VAL B  1 46  ? 37.690  -12.184  25.840   1.00 211.11 ? 89  VAL B CB   1 
ATOM   5727  C CG1  . VAL B  1 46  ? 37.880  -12.796  24.450   1.00 204.02 ? 89  VAL B CG1  1 
ATOM   5728  C CG2  . VAL B  1 46  ? 36.297  -11.602  25.968   1.00 215.17 ? 89  VAL B CG2  1 
ATOM   5729  H H    . VAL B  1 46  ? 38.679  -11.909  28.219   1.00 224.10 ? 89  VAL B H    1 
ATOM   5730  H HA   . VAL B  1 46  ? 37.169  -13.807  27.006   1.00 217.21 ? 89  VAL B HA   1 
ATOM   5731  H HB   . VAL B  1 46  ? 38.326  -11.459  25.936   1.00 211.51 ? 89  VAL B HB   1 
ATOM   5732  H HG11 . VAL B  1 46  ? 37.715  -12.115  23.780   1.00 204.94 ? 89  VAL B HG11 1 
ATOM   5733  H HG12 . VAL B  1 46  ? 38.789  -13.124  24.372   1.00 204.94 ? 89  VAL B HG12 1 
ATOM   5734  H HG13 . VAL B  1 46  ? 37.253  -13.528  24.340   1.00 204.94 ? 89  VAL B HG13 1 
ATOM   5735  H HG21 . VAL B  1 46  ? 36.159  -10.954  25.259   1.00 214.91 ? 89  VAL B HG21 1 
ATOM   5736  H HG22 . VAL B  1 46  ? 35.647  -12.319  25.893   1.00 214.91 ? 89  VAL B HG22 1 
ATOM   5737  H HG23 . VAL B  1 46  ? 36.214  -11.169  26.832   1.00 214.91 ? 89  VAL B HG23 1 
ATOM   5738  N N    . THR B  1 47  ? 38.915  -15.262  26.119   1.00 223.06 ? 90  THR B N    1 
ATOM   5739  C CA   . THR B  1 47  ? 39.981  -16.147  25.671   1.00 219.64 ? 90  THR B CA   1 
ATOM   5740  C C    . THR B  1 47  ? 39.830  -16.432  24.180   1.00 212.59 ? 90  THR B C    1 
ATOM   5741  O O    . THR B  1 47  ? 38.739  -16.757  23.709   1.00 213.66 ? 90  THR B O    1 
ATOM   5742  C CB   . THR B  1 47  ? 39.980  -17.470  26.454   1.00 226.81 ? 90  THR B CB   1 
ATOM   5743  O OG1  . THR B  1 47  ? 40.081  -17.199  27.859   1.00 234.04 ? 90  THR B OG1  1 
ATOM   5744  C CG2  . THR B  1 47  ? 41.149  -18.336  26.035   1.00 223.77 ? 90  THR B CG2  1 
ATOM   5745  H H    . THR B  1 47  ? 38.127  -15.594  26.025   1.00 280.25 ? 90  THR B H    1 
ATOM   5746  H HA   . THR B  1 47  ? 40.837  -15.712  25.811   1.00 278.56 ? 90  THR B HA   1 
ATOM   5747  H HB   . THR B  1 47  ? 39.159  -17.953  26.275   1.00 285.41 ? 90  THR B HB   1 
ATOM   5748  H HG1  . THR B  1 47  ? 40.081  -17.920  28.291   1.00 290.45 ? 90  THR B HG1  1 
ATOM   5749  H HG21 . THR B  1 47  ? 41.141  -19.168  26.534   1.00 284.62 ? 90  THR B HG21 1 
ATOM   5750  H HG22 . THR B  1 47  ? 41.090  -18.536  25.088   1.00 284.62 ? 90  THR B HG22 1 
ATOM   5751  H HG23 . THR B  1 47  ? 41.983  -17.872  26.208   1.00 284.62 ? 90  THR B HG23 1 
ATOM   5752  N N    . GLU B  1 48  ? 40.932  -16.303  23.447   1.00 218.90 ? 91  GLU B N    1 
ATOM   5753  C CA   . GLU B  1 48  ? 40.934  -16.484  22.000   1.00 212.78 ? 91  GLU B CA   1 
ATOM   5754  C C    . GLU B  1 48  ? 42.179  -17.248  21.560   1.00 209.48 ? 91  GLU B C    1 
ATOM   5755  O O    . GLU B  1 48  ? 43.278  -16.993  22.054   1.00 209.00 ? 91  GLU B O    1 
ATOM   5756  C CB   . GLU B  1 48  ? 40.868  -15.125  21.299   1.00 208.12 ? 91  GLU B CB   1 
ATOM   5757  C CG   . GLU B  1 48  ? 40.875  -15.188  19.776   1.00 204.01 ? 91  GLU B CG   1 
ATOM   5758  C CD   . GLU B  1 48  ? 39.569  -15.695  19.195   1.00 206.23 ? 91  GLU B CD   1 
ATOM   5759  O OE1  . GLU B  1 48  ? 38.599  -15.877  19.963   1.00 210.51 ? 91  GLU B OE1  1 
ATOM   5760  O OE2  . GLU B  1 48  ? 39.513  -15.909  17.965   1.00 203.97 ? 91  GLU B OE2  1 
ATOM   5761  H H    . GLU B  1 48  ? 41.704  -16.106  23.771   1.00 332.78 ? 91  GLU B H    1 
ATOM   5762  H HA   . GLU B  1 48  ? 40.154  -16.999  21.740   1.00 330.84 ? 91  GLU B HA   1 
ATOM   5763  H HB2  . GLU B  1 48  ? 40.052  -14.677  21.570   1.00 329.00 ? 91  GLU B HB2  1 
ATOM   5764  H HB3  . GLU B  1 48  ? 41.636  -14.599  21.574   1.00 329.00 ? 91  GLU B HB3  1 
ATOM   5765  H HG2  . GLU B  1 48  ? 41.033  -14.298  19.425   1.00 326.71 ? 91  GLU B HG2  1 
ATOM   5766  H HG3  . GLU B  1 48  ? 41.582  -15.787  19.489   1.00 326.71 ? 91  GLU B HG3  1 
ATOM   5767  N N    . GLU B  1 49  ? 42.002  -18.181  20.628   1.00 211.61 ? 92  GLU B N    1 
ATOM   5768  C CA   . GLU B  1 49  ? 43.114  -18.963  20.087   1.00 208.73 ? 92  GLU B CA   1 
ATOM   5769  C C    . GLU B  1 49  ? 43.825  -18.240  18.949   1.00 201.62 ? 92  GLU B C    1 
ATOM   5770  O O    . GLU B  1 49  ? 43.183  -17.645  18.084   1.00 200.23 ? 92  GLU B O    1 
ATOM   5771  C CB   . GLU B  1 49  ? 42.621  -20.321  19.585   1.00 210.59 ? 92  GLU B CB   1 
ATOM   5772  C CG   . GLU B  1 49  ? 42.230  -21.291  20.687   1.00 218.25 ? 92  GLU B CG   1 
ATOM   5773  C CD   . GLU B  1 49  ? 41.776  -22.635  20.152   1.00 220.60 ? 92  GLU B CD   1 
ATOM   5774  O OE1  . GLU B  1 49  ? 42.038  -22.924  18.963   1.00 215.72 ? 92  GLU B OE1  1 
ATOM   5775  O OE2  . GLU B  1 49  ? 41.159  -23.403  20.921   1.00 227.85 ? 92  GLU B OE2  1 
ATOM   5776  H H    . GLU B  1 49  ? 41.238  -18.383  20.288   1.00 218.43 ? 92  GLU B H    1 
ATOM   5777  H HA   . GLU B  1 49  ? 43.761  -19.121  20.793   1.00 218.21 ? 92  GLU B HA   1 
ATOM   5778  H HB2  . GLU B  1 49  ? 41.842  -20.181  19.025   1.00 221.41 ? 92  GLU B HB2  1 
ATOM   5779  H HB3  . GLU B  1 49  ? 43.328  -20.735  19.065   1.00 221.41 ? 92  GLU B HB3  1 
ATOM   5780  H HG2  . GLU B  1 49  ? 42.996  -21.441  21.263   1.00 230.00 ? 92  GLU B HG2  1 
ATOM   5781  H HG3  . GLU B  1 49  ? 41.499  -20.910  21.199   1.00 230.00 ? 92  GLU B HG3  1 
ATOM   5782  N N    . PHE B  1 50  ? 45.153  -18.310  18.951   1.00 186.23 ? 93  PHE B N    1 
ATOM   5783  C CA   . PHE B  1 50  ? 45.960  -17.755  17.874   1.00 180.84 ? 93  PHE B CA   1 
ATOM   5784  C C    . PHE B  1 50  ? 46.838  -18.844  17.285   1.00 178.87 ? 93  PHE B C    1 
ATOM   5785  O O    . PHE B  1 50  ? 47.077  -19.868  17.920   1.00 182.67 ? 93  PHE B O    1 
ATOM   5786  C CB   . PHE B  1 50  ? 46.826  -16.599  18.375   1.00 179.45 ? 93  PHE B CB   1 
ATOM   5787  C CG   . PHE B  1 50  ? 46.073  -15.310  18.573   1.00 180.87 ? 93  PHE B CG   1 
ATOM   5788  C CD1  . PHE B  1 50  ? 45.212  -15.149  19.646   1.00 184.74 ? 93  PHE B CD1  1 
ATOM   5789  C CD2  . PHE B  1 50  ? 46.238  -14.254  17.691   1.00 181.36 ? 93  PHE B CD2  1 
ATOM   5790  C CE1  . PHE B  1 50  ? 44.524  -13.964  19.828   1.00 186.08 ? 93  PHE B CE1  1 
ATOM   5791  C CE2  . PHE B  1 50  ? 45.553  -13.068  17.871   1.00 183.99 ? 93  PHE B CE2  1 
ATOM   5792  C CZ   . PHE B  1 50  ? 44.696  -12.924  18.940   1.00 185.79 ? 93  PHE B CZ   1 
ATOM   5793  H H    . PHE B  1 50  ? 45.614  -18.681  19.575   1.00 182.43 ? 93  PHE B H    1 
ATOM   5794  H HA   . PHE B  1 50  ? 45.377  -17.419  17.175   1.00 177.79 ? 93  PHE B HA   1 
ATOM   5795  H HB2  . PHE B  1 50  ? 47.215  -16.848  19.228   1.00 178.98 ? 93  PHE B HB2  1 
ATOM   5796  H HB3  . PHE B  1 50  ? 47.531  -16.434  17.729   1.00 178.98 ? 93  PHE B HB3  1 
ATOM   5797  H HD1  . PHE B  1 50  ? 45.091  -15.848  20.248   1.00 180.93 ? 93  PHE B HD1  1 
ATOM   5798  H HD2  . PHE B  1 50  ? 46.815  -14.346  16.967   1.00 173.94 ? 93  PHE B HD2  1 
ATOM   5799  H HE1  . PHE B  1 50  ? 43.946  -13.868  20.551   1.00 180.56 ? 93  PHE B HE1  1 
ATOM   5800  H HE2  . PHE B  1 50  ? 45.670  -12.367  17.270   1.00 173.91 ? 93  PHE B HE2  1 
ATOM   5801  H HZ   . PHE B  1 50  ? 44.234  -12.126  19.063   1.00 177.23 ? 93  PHE B HZ   1 
ATOM   5802  N N    . ASN B  1 51  ? 47.312  -18.622  16.065   1.00 184.60 ? 94  ASN B N    1 
ATOM   5803  C CA   . ASN B  1 51  ? 48.231  -19.554  15.425   1.00 182.76 ? 94  ASN B CA   1 
ATOM   5804  C C    . ASN B  1 51  ? 49.090  -18.835  14.392   1.00 181.37 ? 94  ASN B C    1 
ATOM   5805  O O    . ASN B  1 51  ? 48.687  -18.664  13.243   1.00 182.31 ? 94  ASN B O    1 
ATOM   5806  C CB   . ASN B  1 51  ? 47.462  -20.705  14.775   1.00 183.90 ? 94  ASN B CB   1 
ATOM   5807  C CG   . ASN B  1 51  ? 48.380  -21.798  14.256   1.00 182.73 ? 94  ASN B CG   1 
ATOM   5808  O OD1  . ASN B  1 51  ? 49.602  -21.706  14.374   1.00 181.17 ? 94  ASN B OD1  1 
ATOM   5809  N ND2  . ASN B  1 51  ? 47.793  -22.847  13.690   1.00 183.64 ? 94  ASN B ND2  1 
ATOM   5810  H H    . ASN B  1 51  ? 47.115  -17.937  15.584   1.00 292.30 ? 94  ASN B H    1 
ATOM   5811  H HA   . ASN B  1 51  ? 48.821  -19.928  16.098   1.00 292.14 ? 94  ASN B HA   1 
ATOM   5812  H HB2  . ASN B  1 51  ? 46.867  -21.099  15.432   1.00 290.45 ? 94  ASN B HB2  1 
ATOM   5813  H HB3  . ASN B  1 51  ? 46.950  -20.362  14.026   1.00 290.45 ? 94  ASN B HB3  1 
ATOM   5814  H HD21 . ASN B  1 51  ? 48.271  -23.492  13.381   1.00 286.92 ? 94  ASN B HD21 1 
ATOM   5815  H HD22 . ASN B  1 51  ? 46.936  -22.881  13.633   1.00 286.92 ? 94  ASN B HD22 1 
ATOM   5816  N N    . MET B  1 52  ? 50.283  -18.426  14.813   1.00 164.30 ? 95  MET B N    1 
ATOM   5817  C CA   . MET B  1 52  ? 51.142  -17.574  13.996   1.00 162.85 ? 95  MET B CA   1 
ATOM   5818  C C    . MET B  1 52  ? 51.595  -18.255  12.710   1.00 162.68 ? 95  MET B C    1 
ATOM   5819  O O    . MET B  1 52  ? 51.952  -17.589  11.740   1.00 163.00 ? 95  MET B O    1 
ATOM   5820  C CB   . MET B  1 52  ? 52.366  -17.142  14.806   1.00 160.21 ? 95  MET B CB   1 
ATOM   5821  C CG   . MET B  1 52  ? 53.245  -18.291  15.265   1.00 159.14 ? 95  MET B CG   1 
ATOM   5822  S SD   . MET B  1 52  ? 54.676  -17.734  16.209   1.00 157.91 ? 95  MET B SD   1 
ATOM   5823  C CE   . MET B  1 52  ? 55.677  -17.013  14.912   1.00 154.08 ? 95  MET B CE   1 
ATOM   5824  H H    . MET B  1 52  ? 50.621  -18.630  15.577   1.00 174.38 ? 95  MET B H    1 
ATOM   5825  H HA   . MET B  1 52  ? 50.648  -16.773  13.763   1.00 169.90 ? 95  MET B HA   1 
ATOM   5826  H HB2  . MET B  1 52  ? 52.910  -16.554  14.258   1.00 175.33 ? 95  MET B HB2  1 
ATOM   5827  H HB3  . MET B  1 52  ? 52.065  -16.667  15.596   1.00 175.33 ? 95  MET B HB3  1 
ATOM   5828  H HG2  . MET B  1 52  ? 52.724  -18.882  15.830   1.00 177.20 ? 95  MET B HG2  1 
ATOM   5829  H HG3  . MET B  1 52  ? 53.567  -18.773  14.487   1.00 177.20 ? 95  MET B HG3  1 
ATOM   5830  H HE1  . MET B  1 52  ? 56.496  -16.668  15.301   1.00 178.94 ? 95  MET B HE1  1 
ATOM   5831  H HE2  . MET B  1 52  ? 55.884  -17.697  14.256   1.00 178.94 ? 95  MET B HE2  1 
ATOM   5832  H HE3  . MET B  1 52  ? 55.180  -16.292  14.494   1.00 178.94 ? 95  MET B HE3  1 
ATOM   5833  N N    . TRP B  1 53  ? 51.573  -19.581  12.705   1.00 172.41 ? 96  TRP B N    1 
ATOM   5834  C CA   . TRP B  1 53  ? 52.103  -20.348  11.585   1.00 172.41 ? 96  TRP B CA   1 
ATOM   5835  C C    . TRP B  1 53  ? 51.058  -20.577  10.495   1.00 174.94 ? 96  TRP B C    1 
ATOM   5836  O O    . TRP B  1 53  ? 51.371  -21.106  9.429    1.00 175.52 ? 96  TRP B O    1 
ATOM   5837  C CB   . TRP B  1 53  ? 52.644  -21.681  12.089   1.00 172.43 ? 96  TRP B CB   1 
ATOM   5838  C CG   . TRP B  1 53  ? 53.600  -21.522  13.235   1.00 171.11 ? 96  TRP B CG   1 
ATOM   5839  C CD1  . TRP B  1 53  ? 53.346  -21.761  14.553   1.00 172.34 ? 96  TRP B CD1  1 
ATOM   5840  C CD2  . TRP B  1 53  ? 54.961  -21.074  13.164   1.00 169.12 ? 96  TRP B CD2  1 
ATOM   5841  N NE1  . TRP B  1 53  ? 54.465  -21.500  15.308   1.00 173.23 ? 96  TRP B NE1  1 
ATOM   5842  C CE2  . TRP B  1 53  ? 55.471  -21.078  14.479   1.00 169.92 ? 96  TRP B CE2  1 
ATOM   5843  C CE3  . TRP B  1 53  ? 55.801  -20.681  12.116   1.00 167.73 ? 96  TRP B CE3  1 
ATOM   5844  C CZ2  . TRP B  1 53  ? 56.780  -20.699  14.774   1.00 169.10 ? 96  TRP B CZ2  1 
ATOM   5845  C CZ3  . TRP B  1 53  ? 57.103  -20.306  12.411   1.00 165.74 ? 96  TRP B CZ3  1 
ATOM   5846  C CH2  . TRP B  1 53  ? 57.578  -20.317  13.730   1.00 166.64 ? 96  TRP B CH2  1 
ATOM   5847  H H    . TRP B  1 53  ? 51.254  -20.064  13.341   1.00 230.88 ? 96  TRP B H    1 
ATOM   5848  H HA   . TRP B  1 53  ? 52.841  -19.857  11.191   1.00 226.38 ? 96  TRP B HA   1 
ATOM   5849  H HB2  . TRP B  1 53  ? 51.903  -22.229  12.391   1.00 229.81 ? 96  TRP B HB2  1 
ATOM   5850  H HB3  . TRP B  1 53  ? 53.113  -22.126  11.366   1.00 229.81 ? 96  TRP B HB3  1 
ATOM   5851  H HD1  . TRP B  1 53  ? 52.533  -22.061  14.893   1.00 241.36 ? 96  TRP B HD1  1 
ATOM   5852  H HE1  . TRP B  1 53  ? 54.523  -21.586  16.161   1.00 246.10 ? 96  TRP B HE1  1 
ATOM   5853  H HE3  . TRP B  1 53  ? 55.493  -20.673  11.239   1.00 232.50 ? 96  TRP B HE3  1 
ATOM   5854  H HZ2  . TRP B  1 53  ? 57.099  -20.705  15.648   1.00 246.44 ? 96  TRP B HZ2  1 
ATOM   5855  H HZ3  . TRP B  1 53  ? 57.669  -20.041  11.723   1.00 236.31 ? 96  TRP B HZ3  1 
ATOM   5856  H HH2  . TRP B  1 53  ? 58.456  -20.059  13.898   1.00 243.16 ? 96  TRP B HH2  1 
ATOM   5857  N N    . LYS B  1 54  ? 49.820  -20.183  10.775   1.00 165.29 ? 97  LYS B N    1 
ATOM   5858  C CA   . LYS B  1 54  ? 48.752  -20.215  9.783    1.00 167.67 ? 97  LYS B CA   1 
ATOM   5859  C C    . LYS B  1 54  ? 48.010  -18.882  9.826    1.00 170.08 ? 97  LYS B C    1 
ATOM   5860  O O    . LYS B  1 54  ? 46.968  -18.757  10.471   1.00 171.31 ? 97  LYS B O    1 
ATOM   5861  C CB   . LYS B  1 54  ? 47.801  -21.385  10.046   1.00 167.94 ? 97  LYS B CB   1 
ATOM   5862  C CG   . LYS B  1 54  ? 46.702  -21.555  9.009    1.00 169.74 ? 97  LYS B CG   1 
ATOM   5863  C CD   . LYS B  1 54  ? 47.265  -21.878  7.637    1.00 169.52 ? 97  LYS B CD   1 
ATOM   5864  C CE   . LYS B  1 54  ? 46.162  -22.276  6.670    1.00 170.48 ? 97  LYS B CE   1 
ATOM   5865  N NZ   . LYS B  1 54  ? 46.685  -22.551  5.303    1.00 170.13 ? 97  LYS B NZ   1 
ATOM   5866  H H    . LYS B  1 54  ? 49.570  -19.889  11.543   1.00 290.22 ? 97  LYS B H    1 
ATOM   5867  H HA   . LYS B  1 54  ? 49.135  -20.324  8.899    1.00 287.47 ? 97  LYS B HA   1 
ATOM   5868  H HB2  . LYS B  1 54  ? 48.318  -22.206  10.063   1.00 289.60 ? 97  LYS B HB2  1 
ATOM   5869  H HB3  . LYS B  1 54  ? 47.375  -21.251  10.907   1.00 289.60 ? 97  LYS B HB3  1 
ATOM   5870  H HG2  . LYS B  1 54  ? 46.120  -22.283  9.277    1.00 287.39 ? 97  LYS B HG2  1 
ATOM   5871  H HG3  . LYS B  1 54  ? 46.197  -20.729  8.942    1.00 287.39 ? 97  LYS B HG3  1 
ATOM   5872  H HD2  . LYS B  1 54  ? 47.715  -21.096  7.281    1.00 281.33 ? 97  LYS B HD2  1 
ATOM   5873  H HD3  . LYS B  1 54  ? 47.887  -22.619  7.711    1.00 281.33 ? 97  LYS B HD3  1 
ATOM   5874  H HE2  . LYS B  1 54  ? 45.729  -23.081  6.995    1.00 279.40 ? 97  LYS B HE2  1 
ATOM   5875  H HE3  . LYS B  1 54  ? 45.518  -21.553  6.607    1.00 279.40 ? 97  LYS B HE3  1 
ATOM   5876  H HZ1  . LYS B  1 54  ? 47.083  -21.825  4.978    1.00 281.76 ? 97  LYS B HZ1  1 
ATOM   5877  H HZ2  . LYS B  1 54  ? 47.275  -23.217  5.332    1.00 281.76 ? 97  LYS B HZ2  1 
ATOM   5878  H HZ3  . LYS B  1 54  ? 46.017  -22.781  4.762    1.00 281.76 ? 97  LYS B HZ3  1 
ATOM   5879  N N    . ASN B  1 55  ? 48.567  -17.891  9.135    1.00 152.15 ? 98  ASN B N    1 
ATOM   5880  C CA   . ASN B  1 55  ? 48.093  -16.512  9.213    1.00 155.06 ? 98  ASN B CA   1 
ATOM   5881  C C    . ASN B  1 55  ? 48.122  -15.841  7.842    1.00 157.69 ? 98  ASN B C    1 
ATOM   5882  O O    . ASN B  1 55  ? 49.185  -15.480  7.340    1.00 156.46 ? 98  ASN B O    1 
ATOM   5883  C CB   . ASN B  1 55  ? 48.948  -15.735  10.216   1.00 153.15 ? 98  ASN B CB   1 
ATOM   5884  C CG   . ASN B  1 55  ? 48.525  -14.289  10.365   1.00 156.38 ? 98  ASN B CG   1 
ATOM   5885  O OD1  . ASN B  1 55  ? 47.465  -13.879  9.894    1.00 160.66 ? 98  ASN B OD1  1 
ATOM   5886  N ND2  . ASN B  1 55  ? 49.356  -13.509  11.042   1.00 154.39 ? 98  ASN B ND2  1 
ATOM   5887  H H    . ASN B  1 55  ? 49.236  -17.994  8.603    1.00 151.76 ? 98  ASN B H    1 
ATOM   5888  H HA   . ASN B  1 55  ? 47.176  -16.509  9.531    1.00 149.48 ? 98  ASN B HA   1 
ATOM   5889  H HB2  . ASN B  1 55  ? 48.876  -16.159  11.086   1.00 154.02 ? 98  ASN B HB2  1 
ATOM   5890  H HB3  . ASN B  1 55  ? 49.872  -15.747  9.919    1.00 154.02 ? 98  ASN B HB3  1 
ATOM   5891  H HD21 . ASN B  1 55  ? 49.168  -12.678  11.159   1.00 157.71 ? 98  ASN B HD21 1 
ATOM   5892  H HD22 . ASN B  1 55  ? 50.084  -13.834  11.365   1.00 157.71 ? 98  ASN B HD22 1 
ATOM   5893  N N    . ASN B  1 56  ? 46.946  -15.667  7.247    1.00 143.98 ? 99  ASN B N    1 
ATOM   5894  C CA   . ASN B  1 56  ? 46.838  -15.195  5.870    1.00 146.32 ? 99  ASN B CA   1 
ATOM   5895  C C    . ASN B  1 56  ? 47.463  -13.819  5.647    1.00 148.72 ? 99  ASN B C    1 
ATOM   5896  O O    . ASN B  1 56  ? 47.822  -13.473  4.523    1.00 149.69 ? 99  ASN B O    1 
ATOM   5897  C CB   . ASN B  1 56  ? 45.368  -15.171  5.448    1.00 148.05 ? 99  ASN B CB   1 
ATOM   5898  C CG   . ASN B  1 56  ? 45.167  -14.608  4.054    1.00 149.11 ? 99  ASN B CG   1 
ATOM   5899  O OD1  . ASN B  1 56  ? 44.763  -13.457  3.889    1.00 151.70 ? 99  ASN B OD1  1 
ATOM   5900  N ND2  . ASN B  1 56  ? 45.456  -15.417  3.041    1.00 146.46 ? 99  ASN B ND2  1 
ATOM   5901  H H    . ASN B  1 56  ? 46.188  -15.818  7.623    1.00 161.18 ? 99  ASN B H    1 
ATOM   5902  H HA   . ASN B  1 56  ? 47.299  -15.823  5.292    1.00 157.83 ? 99  ASN B HA   1 
ATOM   5903  H HB2  . ASN B  1 56  ? 45.021  -16.077  5.459    1.00 155.98 ? 99  ASN B HB2  1 
ATOM   5904  H HB3  . ASN B  1 56  ? 44.870  -14.617  6.070    1.00 155.98 ? 99  ASN B HB3  1 
ATOM   5905  H HD21 . ASN B  1 56  ? 45.359  -15.144  2.231    1.00 150.05 ? 99  ASN B HD21 1 
ATOM   5906  H HD22 . ASN B  1 56  ? 45.740  -16.214  3.194    1.00 150.05 ? 99  ASN B HD22 1 
ATOM   5907  N N    . MET B  1 57  ? 47.605  -13.040  6.715    1.00 150.48 ? 100 MET B N    1 
ATOM   5908  C CA   . MET B  1 57  ? 48.167  -11.698  6.600    1.00 152.40 ? 100 MET B CA   1 
ATOM   5909  C C    . MET B  1 57  ? 49.621  -11.731  6.133    1.00 148.39 ? 100 MET B C    1 
ATOM   5910  O O    . MET B  1 57  ? 50.092  -10.789  5.496    1.00 149.50 ? 100 MET B O    1 
ATOM   5911  C CB   . MET B  1 57  ? 48.070  -10.957  7.931    1.00 152.61 ? 100 MET B CB   1 
ATOM   5912  C CG   . MET B  1 57  ? 46.651  -10.567  8.317    1.00 156.70 ? 100 MET B CG   1 
ATOM   5913  S SD   . MET B  1 57  ? 46.557  -9.648   9.867    1.00 156.41 ? 100 MET B SD   1 
ATOM   5914  C CE   . MET B  1 57  ? 46.863  -10.967  11.038   1.00 150.60 ? 100 MET B CE   1 
ATOM   5915  H H    . MET B  1 57  ? 47.383  -13.264  7.516    1.00 228.77 ? 100 MET B H    1 
ATOM   5916  H HA   . MET B  1 57  ? 47.646  -11.201  5.950    1.00 225.53 ? 100 MET B HA   1 
ATOM   5917  H HB2  . MET B  1 57  ? 48.421  -11.527  8.633    1.00 228.65 ? 100 MET B HB2  1 
ATOM   5918  H HB3  . MET B  1 57  ? 48.595  -10.144  7.875    1.00 228.65 ? 100 MET B HB3  1 
ATOM   5919  H HG2  . MET B  1 57  ? 46.277  -10.010  7.616    1.00 229.21 ? 100 MET B HG2  1 
ATOM   5920  H HG3  . MET B  1 57  ? 46.120  -11.373  8.415    1.00 229.21 ? 100 MET B HG3  1 
ATOM   5921  H HE1  . MET B  1 57  ? 46.840  -10.603  11.937   1.00 245.15 ? 100 MET B HE1  1 
ATOM   5922  H HE2  . MET B  1 57  ? 46.176  -11.644  10.938   1.00 245.15 ? 100 MET B HE2  1 
ATOM   5923  H HE3  . MET B  1 57  ? 47.735  -11.352  10.859   1.00 245.15 ? 100 MET B HE3  1 
ATOM   5924  N N    . VAL B  1 58  ? 50.331  -12.809  6.456    1.00 149.06 ? 101 VAL B N    1 
ATOM   5925  C CA   . VAL B  1 58  ? 51.697  -13.000  5.971    1.00 144.47 ? 101 VAL B CA   1 
ATOM   5926  C C    . VAL B  1 58  ? 51.697  -13.171  4.454    1.00 146.33 ? 101 VAL B C    1 
ATOM   5927  O O    . VAL B  1 58  ? 52.525  -12.589  3.755    1.00 144.49 ? 101 VAL B O    1 
ATOM   5928  C CB   . VAL B  1 58  ? 52.369  -14.228  6.624    1.00 139.76 ? 101 VAL B CB   1 
ATOM   5929  C CG1  . VAL B  1 58  ? 53.718  -14.529  5.983    1.00 135.79 ? 101 VAL B CG1  1 
ATOM   5930  C CG2  . VAL B  1 58  ? 52.550  -14.006  8.113    1.00 137.41 ? 101 VAL B CG2  1 
ATOM   5931  H H    . VAL B  1 58  ? 50.044  -13.447  6.957    1.00 75.35  ? 101 VAL B H    1 
ATOM   5932  H HA   . VAL B  1 58  ? 52.224  -12.215  6.188    1.00 77.26  ? 101 VAL B HA   1 
ATOM   5933  H HB   . VAL B  1 58  ? 51.799  -15.003  6.503    1.00 83.42  ? 101 VAL B HB   1 
ATOM   5934  H HG11 . VAL B  1 58  ? 54.108  -15.303  6.418    1.00 84.81  ? 101 VAL B HG11 1 
ATOM   5935  H HG12 . VAL B  1 58  ? 53.586  -14.710  5.040    1.00 84.81  ? 101 VAL B HG12 1 
ATOM   5936  H HG13 . VAL B  1 58  ? 54.299  -13.760  6.094    1.00 84.81  ? 101 VAL B HG13 1 
ATOM   5937  H HG21 . VAL B  1 58  ? 52.972  -14.788  8.499    1.00 87.92  ? 101 VAL B HG21 1 
ATOM   5938  H HG22 . VAL B  1 58  ? 53.109  -13.225  8.249    1.00 87.92  ? 101 VAL B HG22 1 
ATOM   5939  H HG23 . VAL B  1 58  ? 51.680  -13.865  8.518    1.00 87.92  ? 101 VAL B HG23 1 
ATOM   5940  N N    . GLU B  1 59  ? 50.762  -13.977  3.958    1.00 140.25 ? 102 GLU B N    1 
ATOM   5941  C CA   . GLU B  1 59  ? 50.653  -14.258  2.529    1.00 141.74 ? 102 GLU B CA   1 
ATOM   5942  C C    . GLU B  1 59  ? 50.392  -12.996  1.718    1.00 144.88 ? 102 GLU B C    1 
ATOM   5943  O O    . GLU B  1 59  ? 51.002  -12.783  0.670    1.00 143.59 ? 102 GLU B O    1 
ATOM   5944  C CB   . GLU B  1 59  ? 49.539  -15.278  2.279    1.00 142.41 ? 102 GLU B CB   1 
ATOM   5945  C CG   . GLU B  1 59  ? 49.001  -15.318  0.850    1.00 143.08 ? 102 GLU B CG   1 
ATOM   5946  C CD   . GLU B  1 59  ? 50.077  -15.613  -0.180   1.00 141.56 ? 102 GLU B CD   1 
ATOM   5947  O OE1  . GLU B  1 59  ? 50.818  -16.602  0.007    1.00 139.49 ? 102 GLU B OE1  1 
ATOM   5948  O OE2  . GLU B  1 59  ? 50.180  -14.859  -1.172   1.00 140.53 ? 102 GLU B OE2  1 
ATOM   5949  H H    . GLU B  1 59  ? 50.171  -14.379  4.436    1.00 127.07 ? 102 GLU B H    1 
ATOM   5950  H HA   . GLU B  1 59  ? 51.487  -14.645  2.220    1.00 126.15 ? 102 GLU B HA   1 
ATOM   5951  H HB2  . GLU B  1 59  ? 49.879  -16.163  2.488    1.00 127.27 ? 102 GLU B HB2  1 
ATOM   5952  H HB3  . GLU B  1 59  ? 48.795  -15.071  2.866    1.00 127.27 ? 102 GLU B HB3  1 
ATOM   5953  H HG2  . GLU B  1 59  ? 48.327  -16.013  0.786    1.00 125.10 ? 102 GLU B HG2  1 
ATOM   5954  H HG3  . GLU B  1 59  ? 48.610  -14.456  0.636    1.00 125.10 ? 102 GLU B HG3  1 
ATOM   5955  N N    . GLN B  1 60  ? 49.477  -12.166  2.203    1.00 146.35 ? 103 GLN B N    1 
ATOM   5956  C CA   . GLN B  1 60  ? 49.114  -10.937  1.509    1.00 147.97 ? 103 GLN B CA   1 
ATOM   5957  C C    . GLN B  1 60  ? 50.252  -9.931   1.548    1.00 145.40 ? 103 GLN B C    1 
ATOM   5958  O O    . GLN B  1 60  ? 50.458  -9.181   0.599    1.00 140.80 ? 103 GLN B O    1 
ATOM   5959  C CB   . GLN B  1 60  ? 47.858  -10.328  2.125    1.00 151.63 ? 103 GLN B CB   1 
ATOM   5960  C CG   . GLN B  1 60  ? 46.627  -11.200  1.968    1.00 150.11 ? 103 GLN B CG   1 
ATOM   5961  C CD   . GLN B  1 60  ? 45.366  -10.522  2.456    1.00 151.49 ? 103 GLN B CD   1 
ATOM   5962  O OE1  . GLN B  1 60  ? 45.422  -9.582   3.248    1.00 155.38 ? 103 GLN B OE1  1 
ATOM   5963  N NE2  . GLN B  1 60  ? 44.218  -10.990  1.979    1.00 147.41 ? 103 GLN B NE2  1 
ATOM   5964  H H    . GLN B  1 60  ? 49.049  -12.293  2.938    1.00 154.55 ? 103 GLN B H    1 
ATOM   5965  H HA   . GLN B  1 60  ? 48.925  -11.142  0.580    1.00 151.43 ? 103 GLN B HA   1 
ATOM   5966  H HB2  . GLN B  1 60  ? 48.007  -10.193  3.074    1.00 149.35 ? 103 GLN B HB2  1 
ATOM   5967  H HB3  . GLN B  1 60  ? 47.677  -9.478   1.695    1.00 149.35 ? 103 GLN B HB3  1 
ATOM   5968  H HG2  . GLN B  1 60  ? 46.509  -11.415  1.030    1.00 149.92 ? 103 GLN B HG2  1 
ATOM   5969  H HG3  . GLN B  1 60  ? 46.748  -12.014  2.482    1.00 149.92 ? 103 GLN B HG3  1 
ATOM   5970  H HE21 . GLN B  1 60  ? 43.474  -10.637  2.226    1.00 150.47 ? 103 GLN B HE21 1 
ATOM   5971  H HE22 . GLN B  1 60  ? 44.219  -11.646  1.423    1.00 150.47 ? 103 GLN B HE22 1 
ATOM   5972  N N    . MET B  1 61  ? 50.984  -9.912   2.656    1.00 146.86 ? 104 MET B N    1 
ATOM   5973  C CA   . MET B  1 61  ? 52.161  -9.066   2.768    1.00 139.41 ? 104 MET B CA   1 
ATOM   5974  C C    . MET B  1 61  ? 53.222  -9.511   1.772    1.00 131.50 ? 104 MET B C    1 
ATOM   5975  O O    . MET B  1 61  ? 53.831  -8.686   1.091    1.00 121.99 ? 104 MET B O    1 
ATOM   5976  C CB   . MET B  1 61  ? 52.715  -9.106   4.189    1.00 136.39 ? 104 MET B CB   1 
ATOM   5977  C CG   . MET B  1 61  ? 53.919  -8.199   4.414    1.00 126.39 ? 104 MET B CG   1 
ATOM   5978  S SD   . MET B  1 61  ? 54.521  -8.226   6.111    1.00 123.66 ? 104 MET B SD   1 
ATOM   5979  C CE   . MET B  1 61  ? 53.053  -7.721   7.009    1.00 134.55 ? 104 MET B CE   1 
ATOM   5980  H H    . MET B  1 61  ? 50.819  -10.382  3.357    1.00 95.89  ? 104 MET B H    1 
ATOM   5981  H HA   . MET B  1 61  ? 51.910  -8.150   2.571    1.00 97.02  ? 104 MET B HA   1 
ATOM   5982  H HB2  . MET B  1 61  ? 52.018  -8.829   4.803    1.00 100.40 ? 104 MET B HB2  1 
ATOM   5983  H HB3  . MET B  1 61  ? 52.988  -10.015  4.391    1.00 100.40 ? 104 MET B HB3  1 
ATOM   5984  H HG2  . MET B  1 61  ? 54.642  -8.488   3.835    1.00 102.37 ? 104 MET B HG2  1 
ATOM   5985  H HG3  . MET B  1 61  ? 53.669  -7.287   4.200    1.00 102.37 ? 104 MET B HG3  1 
ATOM   5986  H HE1  . MET B  1 61  ? 53.256  -7.697   7.957    1.00 107.60 ? 104 MET B HE1  1 
ATOM   5987  H HE2  . MET B  1 61  ? 52.785  -6.840   6.705    1.00 107.60 ? 104 MET B HE2  1 
ATOM   5988  H HE3  . MET B  1 61  ? 52.344  -8.360   6.838    1.00 107.60 ? 104 MET B HE3  1 
ATOM   5989  N N    . HIS B  1 62  ? 53.423  -10.823  1.688    1.00 147.27 ? 105 HIS B N    1 
ATOM   5990  C CA   . HIS B  1 62  ? 54.441  -11.408  0.822    1.00 141.92 ? 105 HIS B CA   1 
ATOM   5991  C C    . HIS B  1 62  ? 54.312  -10.929  -0.619   1.00 138.94 ? 105 HIS B C    1 
ATOM   5992  O O    . HIS B  1 62  ? 55.286  -10.483  -1.220   1.00 128.33 ? 105 HIS B O    1 
ATOM   5993  C CB   . HIS B  1 62  ? 54.350  -12.930  0.867    1.00 145.37 ? 105 HIS B CB   1 
ATOM   5994  C CG   . HIS B  1 62  ? 55.518  -13.622  0.241    1.00 141.30 ? 105 HIS B CG   1 
ATOM   5995  N ND1  . HIS B  1 62  ? 56.786  -13.569  0.777    1.00 134.53 ? 105 HIS B ND1  1 
ATOM   5996  C CD2  . HIS B  1 62  ? 55.610  -14.383  -0.873   1.00 143.43 ? 105 HIS B CD2  1 
ATOM   5997  C CE1  . HIS B  1 62  ? 57.610  -14.270  0.020    1.00 133.37 ? 105 HIS B CE1  1 
ATOM   5998  N NE2  . HIS B  1 62  ? 56.922  -14.774  -0.988   1.00 138.83 ? 105 HIS B NE2  1 
ATOM   5999  H H    . HIS B  1 62  ? 52.973  -11.406  2.132    1.00 107.41 ? 105 HIS B H    1 
ATOM   6000  H HA   . HIS B  1 62  ? 55.318  -11.149  1.146    1.00 111.35 ? 105 HIS B HA   1 
ATOM   6001  H HB2  . HIS B  1 62  ? 54.300  -13.213  1.793    1.00 114.07 ? 105 HIS B HB2  1 
ATOM   6002  H HB3  . HIS B  1 62  ? 53.551  -13.210  0.393    1.00 114.07 ? 105 HIS B HB3  1 
ATOM   6003  H HD1  . HIS B  1 62  ? 57.006  -13.148  1.494    1.00 122.81 ? 105 HIS B HD1  1 
ATOM   6004  H HD2  . HIS B  1 62  ? 54.916  -14.602  -1.452   1.00 121.90 ? 105 HIS B HD2  1 
ATOM   6005  H HE1  . HIS B  1 62  ? 58.520  -14.387  0.170    1.00 127.59 ? 105 HIS B HE1  1 
ATOM   6006  H HE2  . HIS B  1 62  ? 57.243  -15.267  -1.616   1.00 127.37 ? 105 HIS B HE2  1 
ATOM   6007  N N    . THR B  1 63  ? 53.104  -11.023  -1.166   1.00 142.91 ? 106 THR B N    1 
ATOM   6008  C CA   . THR B  1 63  ? 52.855  -10.622  -2.546   1.00 134.74 ? 106 THR B CA   1 
ATOM   6009  C C    . THR B  1 63  ? 53.090  -9.126   -2.764   1.00 119.45 ? 106 THR B C    1 
ATOM   6010  O O    . THR B  1 63  ? 53.564  -8.720   -3.824   1.00 105.28 ? 106 THR B O    1 
ATOM   6011  C CB   . THR B  1 63  ? 51.419  -10.969  -2.980   1.00 136.84 ? 106 THR B CB   1 
ATOM   6012  O OG1  . THR B  1 63  ? 50.492  -10.506  -1.992   1.00 143.55 ? 106 THR B OG1  1 
ATOM   6013  C CG2  . THR B  1 63  ? 51.254  -12.470  -3.150   1.00 142.14 ? 106 THR B CG2  1 
ATOM   6014  H H    . THR B  1 63  ? 52.408  -11.318  -0.756   1.00 118.50 ? 106 THR B H    1 
ATOM   6015  H HA   . THR B  1 63  ? 53.465  -11.105  -3.126   1.00 117.14 ? 106 THR B HA   1 
ATOM   6016  H HB   . THR B  1 63  ? 51.226  -10.541  -3.829   1.00 115.36 ? 106 THR B HB   1 
ATOM   6017  H HG1  . THR B  1 63  ? 50.653  -10.872  -1.253   1.00 110.45 ? 106 THR B HG1  1 
ATOM   6018  H HG21 . THR B  1 63  ? 50.346  -12.675  -3.423   1.00 117.05 ? 106 THR B HG21 1 
ATOM   6019  H HG22 . THR B  1 63  ? 51.868  -12.796  -3.826   1.00 117.05 ? 106 THR B HG22 1 
ATOM   6020  H HG23 . THR B  1 63  ? 51.440  -12.921  -2.311   1.00 117.05 ? 106 THR B HG23 1 
ATOM   6021  N N    . ASP B  1 64  ? 52.766  -8.311   -1.764   1.00 136.71 ? 107 ASP B N    1 
ATOM   6022  C CA   . ASP B  1 64  ? 52.904  -6.861   -1.887   1.00 124.15 ? 107 ASP B CA   1 
ATOM   6023  C C    . ASP B  1 64  ? 54.367  -6.430   -1.939   1.00 113.49 ? 107 ASP B C    1 
ATOM   6024  O O    . ASP B  1 64  ? 54.737  -5.582   -2.750   1.00 101.82 ? 107 ASP B O    1 
ATOM   6025  C CB   . ASP B  1 64  ? 52.197  -6.145   -0.728   1.00 132.54 ? 107 ASP B CB   1 
ATOM   6026  C CG   . ASP B  1 64  ? 50.680  -6.096   -0.895   1.00 137.69 ? 107 ASP B CG   1 
ATOM   6027  O OD1  . ASP B  1 64  ? 50.187  -6.308   -2.025   1.00 129.68 ? 107 ASP B OD1  1 
ATOM   6028  O OD2  . ASP B  1 64  ? 49.979  -5.828   0.107    1.00 148.19 ? 107 ASP B OD2  1 
ATOM   6029  H H    . ASP B  1 64  ? 52.464  -8.573   -1.002   1.00 152.15 ? 107 ASP B H    1 
ATOM   6030  H HA   . ASP B  1 64  ? 52.482  -6.577   -2.713   1.00 148.72 ? 107 ASP B HA   1 
ATOM   6031  H HB2  . ASP B  1 64  ? 52.392  -6.613   0.099    1.00 146.51 ? 107 ASP B HB2  1 
ATOM   6032  H HB3  . ASP B  1 64  ? 52.522  -5.232   -0.676   1.00 146.51 ? 107 ASP B HB3  1 
ATOM   6033  N N    . ILE B  1 65  ? 55.198  -7.003   -1.075   1.00 128.68 ? 108 ILE B N    1 
ATOM   6034  C CA   . ILE B  1 65  ? 56.614  -6.648   -1.053   1.00 118.11 ? 108 ILE B CA   1 
ATOM   6035  C C    . ILE B  1 65  ? 57.306  -7.139   -2.324   1.00 111.74 ? 108 ILE B C    1 
ATOM   6036  O O    . ILE B  1 65  ? 58.252  -6.512   -2.806   1.00 102.32 ? 108 ILE B O    1 
ATOM   6037  C CB   . ILE B  1 65  ? 57.324  -7.228   0.190    1.00 122.64 ? 108 ILE B CB   1 
ATOM   6038  C CG1  . ILE B  1 65  ? 56.597  -6.807   1.470    1.00 129.87 ? 108 ILE B CG1  1 
ATOM   6039  C CG2  . ILE B  1 65  ? 58.781  -6.779   0.250    1.00 111.80 ? 108 ILE B CG2  1 
ATOM   6040  C CD1  . ILE B  1 65  ? 56.401  -5.331   1.621    1.00 124.75 ? 108 ILE B CD1  1 
ATOM   6041  H H    . ILE B  1 65  ? 54.971  -7.596   -0.495   1.00 106.06 ? 108 ILE B H    1 
ATOM   6042  H HA   . ILE B  1 65  ? 56.696  -5.682   -1.020   1.00 109.30 ? 108 ILE B HA   1 
ATOM   6043  H HB   . ILE B  1 65  ? 57.304  -8.196   0.131    1.00 113.37 ? 108 ILE B HB   1 
ATOM   6044  H HG12 . ILE B  1 65  ? 55.721  -7.222   1.479    1.00 111.59 ? 108 ILE B HG12 1 
ATOM   6045  H HG13 . ILE B  1 65  ? 57.111  -7.114   2.233    1.00 111.59 ? 108 ILE B HG13 1 
ATOM   6046  H HG21 . ILE B  1 65  ? 59.196  -7.159   1.040    1.00 116.66 ? 108 ILE B HG21 1 
ATOM   6047  H HG22 . ILE B  1 65  ? 59.239  -7.088   -0.546   1.00 116.66 ? 108 ILE B HG22 1 
ATOM   6048  H HG23 . ILE B  1 65  ? 58.810  -5.810   0.295    1.00 116.66 ? 108 ILE B HG23 1 
ATOM   6049  H HD11 . ILE B  1 65  ? 55.935  -5.159   2.454    1.00 107.35 ? 108 ILE B HD11 1 
ATOM   6050  H HD12 . ILE B  1 65  ? 57.268  -4.897   1.629    1.00 107.35 ? 108 ILE B HD12 1 
ATOM   6051  H HD13 . ILE B  1 65  ? 55.874  -5.005   0.874    1.00 107.35 ? 108 ILE B HD13 1 
ATOM   6052  N N    . ILE B  1 66  ? 56.828  -8.255   -2.868   1.00 125.98 ? 109 ILE B N    1 
ATOM   6053  C CA   . ILE B  1 66  ? 57.347  -8.776   -4.130   1.00 121.01 ? 109 ILE B CA   1 
ATOM   6054  C C    . ILE B  1 66  ? 57.091  -7.774   -5.251   1.00 109.62 ? 109 ILE B C    1 
ATOM   6055  O O    . ILE B  1 66  ? 57.993  -7.448   -6.024   1.00 101.02 ? 109 ILE B O    1 
ATOM   6056  C CB   . ILE B  1 66  ? 56.711  -10.144  -4.488   1.00 132.09 ? 109 ILE B CB   1 
ATOM   6057  C CG1  . ILE B  1 66  ? 57.314  -11.246  -3.613   1.00 143.30 ? 109 ILE B CG1  1 
ATOM   6058  C CG2  . ILE B  1 66  ? 56.929  -10.492  -5.961   1.00 125.36 ? 109 ILE B CG2  1 
ATOM   6059  C CD1  . ILE B  1 66  ? 56.624  -12.598  -3.737   1.00 156.31 ? 109 ILE B CD1  1 
ATOM   6060  H H    . ILE B  1 66  ? 56.200  -8.732   -2.524   1.00 88.28  ? 109 ILE B H    1 
ATOM   6061  H HA   . ILE B  1 66  ? 58.306  -8.902   -4.051   1.00 93.71  ? 109 ILE B HA   1 
ATOM   6062  H HB   . ILE B  1 66  ? 55.757  -10.097  -4.317   1.00 97.29  ? 109 ILE B HB   1 
ATOM   6063  H HG12 . ILE B  1 66  ? 58.244  -11.367  -3.862   1.00 101.89 ? 109 ILE B HG12 1 
ATOM   6064  H HG13 . ILE B  1 66  ? 57.258  -10.971  -2.684   1.00 101.89 ? 109 ILE B HG13 1 
ATOM   6065  H HG21 . ILE B  1 66  ? 56.518  -11.351  -6.145   1.00 103.24 ? 109 ILE B HG21 1 
ATOM   6066  H HG22 . ILE B  1 66  ? 56.521  -9.805   -6.511   1.00 103.24 ? 109 ILE B HG22 1 
ATOM   6067  H HG23 . ILE B  1 66  ? 57.882  -10.536  -6.137   1.00 103.24 ? 109 ILE B HG23 1 
ATOM   6068  H HD11 . ILE B  1 66  ? 57.068  -13.233  -3.153   1.00 102.71 ? 109 ILE B HD11 1 
ATOM   6069  H HD12 . ILE B  1 66  ? 55.695  -12.502  -3.478   1.00 102.71 ? 109 ILE B HD12 1 
ATOM   6070  H HD13 . ILE B  1 66  ? 56.682  -12.898  -4.658   1.00 102.71 ? 109 ILE B HD13 1 
ATOM   6071  N N    . SER B  1 67  ? 55.860  -7.283   -5.330   1.00 122.72 ? 110 SER B N    1 
ATOM   6072  C CA   . SER B  1 67  ? 55.487  -6.333   -6.368   1.00 111.43 ? 110 SER B CA   1 
ATOM   6073  C C    . SER B  1 67  ? 56.278  -5.036   -6.259   1.00 106.26 ? 110 SER B C    1 
ATOM   6074  O O    . SER B  1 67  ? 56.558  -4.387   -7.267   1.00 103.90 ? 110 SER B O    1 
ATOM   6075  C CB   . SER B  1 67  ? 53.996  -6.035   -6.297   0.99 113.75 ? 110 SER B CB   1 
ATOM   6076  O OG   . SER B  1 67  ? 53.247  -7.135   -6.778   0.99 118.55 ? 110 SER B OG   1 
ATOM   6077  H H    . SER B  1 67  ? 55.220  -7.484   -4.791   1.00 139.86 ? 110 SER B H    1 
ATOM   6078  H HA   . SER B  1 67  ? 55.673  -6.725   -7.236   1.00 136.25 ? 110 SER B HA   1 
ATOM   6079  H HB2  . SER B  1 67  ? 53.751  -5.864   -5.374   0.99 131.56 ? 110 SER B HB2  1 
ATOM   6080  H HB3  . SER B  1 67  ? 53.802  -5.257   -6.843   0.99 131.56 ? 110 SER B HB3  1 
ATOM   6081  H HG   . SER B  1 67  ? 53.452  -7.294   -7.577   0.99 133.45 ? 110 SER B HG   1 
ATOM   6082  N N    . LEU B  1 68  ? 56.628  -4.659   -5.033   1.00 114.86 ? 111 LEU B N    1 
ATOM   6083  C CA   . LEU B  1 68  ? 57.448  -3.476   -4.805   1.00 113.48 ? 111 LEU B CA   1 
ATOM   6084  C C    . LEU B  1 68  ? 58.808  -3.640   -5.475   1.00 111.65 ? 111 LEU B C    1 
ATOM   6085  O O    . LEU B  1 68  ? 59.246  -2.772   -6.231   1.00 109.66 ? 111 LEU B O    1 
ATOM   6086  C CB   . LEU B  1 68  ? 57.626  -3.220   -3.302   1.00 115.90 ? 111 LEU B CB   1 
ATOM   6087  C CG   . LEU B  1 68  ? 58.285  -1.900   -2.882   1.00 115.53 ? 111 LEU B CG   1 
ATOM   6088  C CD1  . LEU B  1 68  ? 57.889  -1.545   -1.452   1.00 118.77 ? 111 LEU B CD1  1 
ATOM   6089  C CD2  . LEU B  1 68  ? 59.812  -1.947   -3.005   1.00 114.32 ? 111 LEU B CD2  1 
ATOM   6090  H H    . LEU B  1 68  ? 56.402  -5.073   -4.314   1.00 109.84 ? 111 LEU B H    1 
ATOM   6091  H HA   . LEU B  1 68  ? 57.010  -2.703   -5.194   1.00 109.42 ? 111 LEU B HA   1 
ATOM   6092  H HB2  . LEU B  1 68  ? 56.749  -3.244   -2.889   1.00 107.81 ? 111 LEU B HB2  1 
ATOM   6093  H HB3  . LEU B  1 68  ? 58.169  -3.937   -2.938   1.00 107.81 ? 111 LEU B HB3  1 
ATOM   6094  H HG   . LEU B  1 68  ? 57.963  -1.192   -3.462   1.00 107.83 ? 111 LEU B HG   1 
ATOM   6095  H HD11 . LEU B  1 68  ? 58.314  -0.709   -1.205   1.00 106.23 ? 111 LEU B HD11 1 
ATOM   6096  H HD12 . LEU B  1 68  ? 56.925  -1.452   -1.406   1.00 106.23 ? 111 LEU B HD12 1 
ATOM   6097  H HD13 . LEU B  1 68  ? 58.182  -2.254   -0.858   1.00 106.23 ? 111 LEU B HD13 1 
ATOM   6098  H HD21 . LEU B  1 68  ? 60.177  -1.092   -2.729   1.00 113.13 ? 111 LEU B HD21 1 
ATOM   6099  H HD22 . LEU B  1 68  ? 60.152  -2.653   -2.434   1.00 113.13 ? 111 LEU B HD22 1 
ATOM   6100  H HD23 . LEU B  1 68  ? 60.048  -2.125   -3.929   1.00 113.13 ? 111 LEU B HD23 1 
ATOM   6101  N N    . TRP B  1 69  ? 59.470  -4.756   -5.186   1.00 115.61 ? 112 TRP B N    1 
ATOM   6102  C CA   . TRP B  1 69  ? 60.815  -5.016   -5.696   1.00 114.69 ? 112 TRP B CA   1 
ATOM   6103  C C    . TRP B  1 69  ? 60.850  -5.253   -7.203   1.00 112.93 ? 112 TRP B C    1 
ATOM   6104  O O    . TRP B  1 69  ? 61.825  -4.901   -7.870   1.00 111.67 ? 112 TRP B O    1 
ATOM   6105  C CB   . TRP B  1 69  ? 61.420  -6.218   -4.978   1.00 116.99 ? 112 TRP B CB   1 
ATOM   6106  C CG   . TRP B  1 69  ? 62.020  -5.867   -3.661   1.00 118.26 ? 112 TRP B CG   1 
ATOM   6107  C CD1  . TRP B  1 69  ? 61.408  -5.226   -2.624   1.00 119.22 ? 112 TRP B CD1  1 
ATOM   6108  C CD2  . TRP B  1 69  ? 63.357  -6.135   -3.235   1.00 119.16 ? 112 TRP B CD2  1 
ATOM   6109  N NE1  . TRP B  1 69  ? 62.284  -5.078   -1.576   1.00 120.61 ? 112 TRP B NE1  1 
ATOM   6110  C CE2  . TRP B  1 69  ? 63.488  -5.630   -1.926   1.00 120.58 ? 112 TRP B CE2  1 
ATOM   6111  C CE3  . TRP B  1 69  ? 64.456  -6.755   -3.832   1.00 119.40 ? 112 TRP B CE3  1 
ATOM   6112  C CZ2  . TRP B  1 69  ? 64.675  -5.726   -1.206   1.00 122.15 ? 112 TRP B CZ2  1 
ATOM   6113  C CZ3  . TRP B  1 69  ? 65.632  -6.850   -3.116   1.00 121.01 ? 112 TRP B CZ3  1 
ATOM   6114  C CH2  . TRP B  1 69  ? 65.734  -6.338   -1.817   1.00 122.33 ? 112 TRP B CH2  1 
ATOM   6115  H H    . TRP B  1 69  ? 59.159  -5.387   -4.691   1.00 101.45 ? 112 TRP B H    1 
ATOM   6116  H HA   . TRP B  1 69  ? 61.374  -4.246   -5.506   1.00 105.98 ? 112 TRP B HA   1 
ATOM   6117  H HB2  . TRP B  1 69  ? 60.724  -6.876   -4.824   1.00 111.15 ? 112 TRP B HB2  1 
ATOM   6118  H HB3  . TRP B  1 69  ? 62.118  -6.599   -5.533   1.00 111.15 ? 112 TRP B HB3  1 
ATOM   6119  H HD1  . TRP B  1 69  ? 60.526  -4.930   -2.626   1.00 108.79 ? 112 TRP B HD1  1 
ATOM   6120  H HE1  . TRP B  1 69  ? 62.106  -4.703   -0.823   1.00 111.39 ? 112 TRP B HE1  1 
ATOM   6121  H HE3  . TRP B  1 69  ? 64.397  -7.098   -4.694   1.00 122.97 ? 112 TRP B HE3  1 
ATOM   6122  H HZ2  . TRP B  1 69  ? 64.746  -5.387   -0.343   1.00 122.86 ? 112 TRP B HZ2  1 
ATOM   6123  H HZ3  . TRP B  1 69  ? 66.371  -7.261   -3.504   1.00 127.77 ? 112 TRP B HZ3  1 
ATOM   6124  H HH2  . TRP B  1 69  ? 66.539  -6.416   -1.359   1.00 127.96 ? 112 TRP B HH2  1 
ATOM   6125  N N    . ASP B  1 70  ? 59.798  -5.865   -7.735   1.00 122.47 ? 113 ASP B N    1 
ATOM   6126  C CA   . ASP B  1 70  ? 59.694  -6.084   -9.173   1.00 121.28 ? 113 ASP B CA   1 
ATOM   6127  C C    . ASP B  1 70  ? 59.545  -4.776   -9.943   1.00 119.08 ? 113 ASP B C    1 
ATOM   6128  O O    . ASP B  1 70  ? 60.059  -4.639   -11.053  1.00 118.08 ? 113 ASP B O    1 
ATOM   6129  C CB   . ASP B  1 70  ? 58.513  -6.997   -9.485   1.00 122.76 ? 113 ASP B CB   1 
ATOM   6130  C CG   . ASP B  1 70  ? 58.758  -8.419   -9.055   1.00 125.52 ? 113 ASP B CG   1 
ATOM   6131  O OD1  . ASP B  1 70  ? 59.748  -8.652   -8.327   1.00 127.84 ? 113 ASP B OD1  1 
ATOM   6132  O OD2  . ASP B  1 70  ? 57.964  -9.302   -9.440   1.00 128.68 ? 113 ASP B OD2  1 
ATOM   6133  H H    . ASP B  1 70  ? 59.129  -6.164   -7.284   1.00 169.41 ? 113 ASP B H    1 
ATOM   6134  H HA   . ASP B  1 70  ? 60.501  -6.523   -9.484   1.00 172.78 ? 113 ASP B HA   1 
ATOM   6135  H HB2  . ASP B  1 70  ? 57.728  -6.671   -9.017   1.00 173.68 ? 113 ASP B HB2  1 
ATOM   6136  H HB3  . ASP B  1 70  ? 58.354  -6.995   -10.442  1.00 173.68 ? 113 ASP B HB3  1 
ATOM   6137  N N    . GLN B  1 71  ? 58.843  -3.819   -9.345   1.00 127.39 ? 114 GLN B N    1 
ATOM   6138  C CA   . GLN B  1 71  ? 58.555  -2.549   -10.002  1.00 126.04 ? 114 GLN B CA   1 
ATOM   6139  C C    . GLN B  1 71  ? 59.620  -1.494   -9.717   1.00 125.46 ? 114 GLN B C    1 
ATOM   6140  O O    . GLN B  1 71  ? 59.760  -0.524   -10.465  1.00 125.37 ? 114 GLN B O    1 
ATOM   6141  C CB   . GLN B  1 71  ? 57.186  -2.026   -9.556   1.00 126.91 ? 114 GLN B CB   1 
ATOM   6142  C CG   . GLN B  1 71  ? 56.632  -0.904   -10.428  1.00 126.51 ? 114 GLN B CG   1 
ATOM   6143  C CD   . GLN B  1 71  ? 56.435  -1.339   -11.873  1.00 126.75 ? 114 GLN B CD   1 
ATOM   6144  O OE1  . GLN B  1 71  ? 56.179  -2.514   -12.147  1.00 127.13 ? 114 GLN B OE1  1 
ATOM   6145  N NE2  . GLN B  1 71  ? 56.569  -0.397   -12.803  1.00 127.95 ? 114 GLN B NE2  1 
ATOM   6146  H H    . GLN B  1 71  ? 58.519  -3.881   -8.551   1.00 199.47 ? 114 GLN B H    1 
ATOM   6147  H HA   . GLN B  1 71  ? 58.523  -2.690   -10.962  1.00 198.55 ? 114 GLN B HA   1 
ATOM   6148  H HB2  . GLN B  1 71  ? 56.550  -2.759   -9.578   1.00 194.10 ? 114 GLN B HB2  1 
ATOM   6149  H HB3  . GLN B  1 71  ? 57.262  -1.686   -8.650   1.00 194.10 ? 114 GLN B HB3  1 
ATOM   6150  H HG2  . GLN B  1 71  ? 55.772  -0.624   -10.078  1.00 194.10 ? 114 GLN B HG2  1 
ATOM   6151  H HG3  . GLN B  1 71  ? 57.254  -0.160   -10.420  1.00 194.10 ? 114 GLN B HG3  1 
ATOM   6152  H HE21 . GLN B  1 71  ? 56.467  -0.596   -13.634  1.00 204.38 ? 114 GLN B HE21 1 
ATOM   6153  H HE22 . GLN B  1 71  ? 56.758  0.410    -12.574  1.00 204.38 ? 114 GLN B HE22 1 
ATOM   6154  N N    . SER B  1 72  ? 60.373  -1.691   -8.639   1.00 118.84 ? 115 SER B N    1 
ATOM   6155  C CA   . SER B  1 72  ? 61.309  -0.677   -8.158   1.00 118.94 ? 115 SER B CA   1 
ATOM   6156  C C    . SER B  1 72  ? 62.758  -0.959   -8.560   1.00 118.99 ? 115 SER B C    1 
ATOM   6157  O O    . SER B  1 72  ? 63.413  -0.103   -9.155   1.00 119.70 ? 115 SER B O    1 
ATOM   6158  C CB   . SER B  1 72  ? 61.208  -0.558   -6.641   1.00 120.76 ? 115 SER B CB   1 
ATOM   6159  O OG   . SER B  1 72  ? 59.893  -0.207   -6.247   1.00 121.47 ? 115 SER B OG   1 
ATOM   6160  H H    . SER B  1 72  ? 60.361  -2.409   -8.165   1.00 160.33 ? 115 SER B H    1 
ATOM   6161  H HA   . SER B  1 72  ? 61.060  0.180    -8.539   1.00 160.69 ? 115 SER B HA   1 
ATOM   6162  H HB2  . SER B  1 72  ? 61.440  -1.412   -6.241   1.00 158.32 ? 115 SER B HB2  1 
ATOM   6163  H HB3  . SER B  1 72  ? 61.822  0.128    -6.336   1.00 158.32 ? 115 SER B HB3  1 
ATOM   6164  H HG   . SER B  1 72  ? 59.850  -0.145   -5.410   1.00 154.03 ? 115 SER B HG   1 
ATOM   6165  N N    . LEU B  1 73  ? 63.253  -2.149   -8.227   1.00 116.95 ? 116 LEU B N    1 
ATOM   6166  C CA   . LEU B  1 73  ? 64.619  -2.545   -8.567   1.00 117.60 ? 116 LEU B CA   1 
ATOM   6167  C C    . LEU B  1 73  ? 64.625  -3.440   -9.796   1.00 117.40 ? 116 LEU B C    1 
ATOM   6168  O O    . LEU B  1 73  ? 64.498  -4.656   -9.693   1.00 118.31 ? 116 LEU B O    1 
ATOM   6169  C CB   . LEU B  1 73  ? 65.286  -3.266   -7.392   1.00 119.53 ? 116 LEU B CB   1 
ATOM   6170  C CG   . LEU B  1 73  ? 65.871  -2.396   -6.277   1.00 120.53 ? 116 LEU B CG   1 
ATOM   6171  C CD1  . LEU B  1 73  ? 66.359  -3.265   -5.132   1.00 122.72 ? 116 LEU B CD1  1 
ATOM   6172  C CD2  . LEU B  1 73  ? 67.006  -1.535   -6.795   1.00 120.91 ? 116 LEU B CD2  1 
ATOM   6173  H H    . LEU B  1 73  ? 62.813  -2.752   -7.799   1.00 118.48 ? 116 LEU B H    1 
ATOM   6174  H HA   . LEU B  1 73  ? 65.139  -1.751   -8.769   1.00 124.11 ? 116 LEU B HA   1 
ATOM   6175  H HB2  . LEU B  1 73  ? 64.627  -3.848   -6.983   1.00 124.87 ? 116 LEU B HB2  1 
ATOM   6176  H HB3  . LEU B  1 73  ? 66.013  -3.805   -7.743   1.00 124.87 ? 116 LEU B HB3  1 
ATOM   6177  H HG   . LEU B  1 73  ? 65.178  -1.808   -5.936   1.00 122.77 ? 116 LEU B HG   1 
ATOM   6178  H HD11 . LEU B  1 73  ? 66.725  -2.696   -4.438   1.00 125.46 ? 116 LEU B HD11 1 
ATOM   6179  H HD12 . LEU B  1 73  ? 65.612  -3.775   -4.783   1.00 125.46 ? 116 LEU B HD12 1 
ATOM   6180  H HD13 . LEU B  1 73  ? 67.045  -3.866   -5.463   1.00 125.46 ? 116 LEU B HD13 1 
ATOM   6181  H HD21 . LEU B  1 73  ? 67.353  -0.998   -6.065   1.00 125.01 ? 116 LEU B HD21 1 
ATOM   6182  H HD22 . LEU B  1 73  ? 67.705  -2.111   -7.143   1.00 125.01 ? 116 LEU B HD22 1 
ATOM   6183  H HD23 . LEU B  1 73  ? 66.670  -0.960   -7.499   1.00 125.01 ? 116 LEU B HD23 1 
ATOM   6184  N N    . LYS B  1 74  ? 64.778  -2.825   -10.961  1.00 117.42 ? 117 LYS B N    1 
ATOM   6185  C CA   . LYS B  1 74  ? 64.771  -3.552   -12.222  1.00 117.71 ? 117 LYS B CA   1 
ATOM   6186  C C    . LYS B  1 74  ? 66.159  -4.093   -12.547  1.00 119.20 ? 117 LYS B C    1 
ATOM   6187  O O    . LYS B  1 74  ? 67.087  -3.316   -12.754  1.00 119.85 ? 117 LYS B O    1 
ATOM   6188  C CB   . LYS B  1 74  ? 64.301  -2.647   -13.359  1.00 118.16 ? 117 LYS B CB   1 
ATOM   6189  C CG   . LYS B  1 74  ? 62.926  -2.035   -13.159  1.00 117.64 ? 117 LYS B CG   1 
ATOM   6190  C CD   . LYS B  1 74  ? 61.816  -3.047   -13.362  1.00 116.79 ? 117 LYS B CD   1 
ATOM   6191  C CE   . LYS B  1 74  ? 60.453  -2.371   -13.299  1.00 116.86 ? 117 LYS B CE   1 
ATOM   6192  N NZ   . LYS B  1 74  ? 59.321  -3.334   -13.425  1.00 116.54 ? 117 LYS B NZ   1 
ATOM   6193  H H    . LYS B  1 74  ? 64.890  -1.976   -11.049  1.00 120.75 ? 117 LYS B H    1 
ATOM   6194  H HA   . LYS B  1 74  ? 64.159  -4.302   -12.156  1.00 127.65 ? 117 LYS B HA   1 
ATOM   6195  H HB2  . LYS B  1 74  ? 64.934  -1.919   -13.457  1.00 129.22 ? 117 LYS B HB2  1 
ATOM   6196  H HB3  . LYS B  1 74  ? 64.274  -3.167   -14.178  1.00 129.22 ? 117 LYS B HB3  1 
ATOM   6197  H HG2  . LYS B  1 74  ? 62.859  -1.691   -12.254  1.00 122.98 ? 117 LYS B HG2  1 
ATOM   6198  H HG3  . LYS B  1 74  ? 62.800  -1.317   -13.799  1.00 122.98 ? 117 LYS B HG3  1 
ATOM   6199  H HD2  . LYS B  1 74  ? 61.913  -3.462   -14.233  1.00 123.26 ? 117 LYS B HD2  1 
ATOM   6200  H HD3  . LYS B  1 74  ? 61.858  -3.717   -12.661  1.00 123.26 ? 117 LYS B HD3  1 
ATOM   6201  H HE2  . LYS B  1 74  ? 60.365  -1.916   -12.448  1.00 117.92 ? 117 LYS B HE2  1 
ATOM   6202  H HE3  . LYS B  1 74  ? 60.384  -1.732   -14.026  1.00 117.92 ? 117 LYS B HE3  1 
ATOM   6203  H HZ1  . LYS B  1 74  ? 58.545  -2.899   -13.384  1.00 117.71 ? 117 LYS B HZ1  1 
ATOM   6204  H HZ2  . LYS B  1 74  ? 59.371  -3.762   -14.204  1.00 117.71 ? 117 LYS B HZ2  1 
ATOM   6205  H HZ3  . LYS B  1 74  ? 59.354  -3.930   -12.765  1.00 117.71 ? 117 LYS B HZ3  1 
ATOM   6206  N N    . PRO B  1 75  ? 66.313  -5.425   -12.594  1.00 115.88 ? 118 PRO B N    1 
ATOM   6207  C CA   . PRO B  1 75  ? 67.609  -5.949   -13.030  1.00 117.84 ? 118 PRO B CA   1 
ATOM   6208  C C    . PRO B  1 75  ? 67.786  -5.799   -14.535  1.00 118.42 ? 118 PRO B C    1 
ATOM   6209  O O    . PRO B  1 75  ? 66.797  -5.726   -15.263  1.00 117.59 ? 118 PRO B O    1 
ATOM   6210  C CB   . PRO B  1 75  ? 67.549  -7.421   -12.614  1.00 119.50 ? 118 PRO B CB   1 
ATOM   6211  C CG   . PRO B  1 75  ? 66.100  -7.751   -12.637  1.00 118.53 ? 118 PRO B CG   1 
ATOM   6212  C CD   . PRO B  1 75  ? 65.388  -6.503   -12.203  1.00 116.01 ? 118 PRO B CD   1 
ATOM   6213  H HA   . PRO B  1 75  ? 68.335  -5.504   -12.565  1.00 102.62 ? 118 PRO B HA   1 
ATOM   6214  H HB2  . PRO B  1 75  ? 68.037  -7.964   -13.253  1.00 106.50 ? 118 PRO B HB2  1 
ATOM   6215  H HB3  . PRO B  1 75  ? 67.913  -7.526   -11.721  1.00 106.50 ? 118 PRO B HB3  1 
ATOM   6216  H HG2  . PRO B  1 75  ? 65.838  -7.998   -13.537  1.00 98.08  ? 118 PRO B HG2  1 
ATOM   6217  H HG3  . PRO B  1 75  ? 65.923  -8.477   -12.018  1.00 98.08  ? 118 PRO B HG3  1 
ATOM   6218  H HD2  . PRO B  1 75  ? 64.545  -6.414   -12.676  1.00 91.44  ? 118 PRO B HD2  1 
ATOM   6219  H HD3  . PRO B  1 75  ? 65.257  -6.505   -11.242  1.00 91.44  ? 118 PRO B HD3  1 
ATOM   6220  N N    . CYS B  1 76  ? 69.031  -5.740   -14.991  1.00 118.08 ? 119 CYS B N    1 
ATOM   6221  C CA   . CYS B  1 76  ? 69.309  -5.642   -16.416  1.00 119.26 ? 119 CYS B CA   1 
ATOM   6222  C C    . CYS B  1 76  ? 68.926  -6.938   -17.123  1.00 120.47 ? 119 CYS B C    1 
ATOM   6223  O O    . CYS B  1 76  ? 68.453  -6.919   -18.261  1.00 120.88 ? 119 CYS B O    1 
ATOM   6224  C CB   . CYS B  1 76  ? 70.787  -5.327   -16.653  1.00 121.53 ? 119 CYS B CB   1 
ATOM   6225  S SG   . CYS B  1 76  ? 71.402  -3.898   -15.725  1.00 121.06 ? 119 CYS B SG   1 
ATOM   6226  H H    . CYS B  1 76  ? 69.733  -5.754   -14.495  1.00 175.18 ? 119 CYS B H    1 
ATOM   6227  H HA   . CYS B  1 76  ? 68.781  -4.922   -16.795  1.00 185.24 ? 119 CYS B HA   1 
ATOM   6228  H HB2  . CYS B  1 76  ? 71.315  -6.097   -16.392  1.00 191.62 ? 119 CYS B HB2  1 
ATOM   6229  H HB3  . CYS B  1 76  ? 70.918  -5.144   -17.596  1.00 191.62 ? 119 CYS B HB3  1 
ATOM   6230  N N    . VAL B  1 77  ? 69.134  -8.056   -16.433  1.00 116.41 ? 120 VAL B N    1 
ATOM   6231  C CA   . VAL B  1 77  ? 68.877  -9.384   -16.982  1.00 118.45 ? 120 VAL B CA   1 
ATOM   6232  C C    . VAL B  1 77  ? 68.270  -10.294  -15.920  1.00 119.16 ? 120 VAL B C    1 
ATOM   6233  O O    . VAL B  1 77  ? 68.619  -10.205  -14.745  1.00 119.25 ? 120 VAL B O    1 
ATOM   6234  C CB   . VAL B  1 77  ? 70.169  -10.025  -17.523  1.00 122.18 ? 120 VAL B CB   1 
ATOM   6235  C CG1  . VAL B  1 77  ? 69.892  -11.387  -18.140  1.00 125.32 ? 120 VAL B CG1  1 
ATOM   6236  C CG2  . VAL B  1 77  ? 70.815  -9.115   -18.547  1.00 122.53 ? 120 VAL B CG2  1 
ATOM   6237  H H    . VAL B  1 77  ? 69.431  -8.071   -15.626  1.00 69.59  ? 120 VAL B H    1 
ATOM   6238  H HA   . VAL B  1 77  ? 68.245  -9.309   -17.715  1.00 76.62  ? 120 VAL B HA   1 
ATOM   6239  H HB   . VAL B  1 77  ? 70.794  -10.147  -16.791  1.00 85.58  ? 120 VAL B HB   1 
ATOM   6240  H HG11 . VAL B  1 77  ? 70.725  -11.760  -18.469  1.00 95.71  ? 120 VAL B HG11 1 
ATOM   6241  H HG12 . VAL B  1 77  ? 69.513  -11.969  -17.463  1.00 95.71  ? 120 VAL B HG12 1 
ATOM   6242  H HG13 . VAL B  1 77  ? 69.265  -11.280  -18.873  1.00 95.71  ? 120 VAL B HG13 1 
ATOM   6243  H HG21 . VAL B  1 77  ? 71.625  -9.534   -18.876  1.00 93.34  ? 120 VAL B HG21 1 
ATOM   6244  H HG22 . VAL B  1 77  ? 70.194  -8.974   -19.280  1.00 93.34  ? 120 VAL B HG22 1 
ATOM   6245  H HG23 . VAL B  1 77  ? 71.028  -8.267   -18.126  1.00 93.34  ? 120 VAL B HG23 1 
ATOM   6246  N N    . GLN B  1 78  ? 67.364  -11.168  -16.348  1.00 120.86 ? 121 GLN B N    1 
ATOM   6247  C CA   . GLN B  1 78  ? 66.679  -12.090  -15.448  1.00 123.12 ? 121 GLN B CA   1 
ATOM   6248  C C    . GLN B  1 78  ? 66.518  -13.452  -16.112  1.00 130.34 ? 121 GLN B C    1 
ATOM   6249  O O    . GLN B  1 78  ? 66.074  -13.537  -17.258  1.00 127.58 ? 121 GLN B O    1 
ATOM   6250  C CB   . GLN B  1 78  ? 65.311  -11.532  -15.054  1.00 119.35 ? 121 GLN B CB   1 
ATOM   6251  C CG   . GLN B  1 78  ? 65.020  -11.554  -13.557  1.00 120.25 ? 121 GLN B CG   1 
ATOM   6252  C CD   . GLN B  1 78  ? 63.761  -10.777  -13.194  1.00 116.28 ? 121 GLN B CD   1 
ATOM   6253  O OE1  . GLN B  1 78  ? 62.997  -10.371  -14.069  1.00 114.75 ? 121 GLN B OE1  1 
ATOM   6254  N NE2  . GLN B  1 78  ? 63.546  -10.561  -11.898  1.00 116.21 ? 121 GLN B NE2  1 
ATOM   6255  H H    . GLN B  1 78  ? 67.124  -11.247  -17.170  1.00 165.11 ? 121 GLN B H    1 
ATOM   6256  H HA   . GLN B  1 78  ? 67.207  -12.203  -14.642  1.00 161.79 ? 121 GLN B HA   1 
ATOM   6257  H HB2  . GLN B  1 78  ? 65.256  -10.610  -15.350  1.00 151.09 ? 121 GLN B HB2  1 
ATOM   6258  H HB3  . GLN B  1 78  ? 64.624  -12.057  -15.494  1.00 151.09 ? 121 GLN B HB3  1 
ATOM   6259  H HG2  . GLN B  1 78  ? 64.898  -12.473  -13.272  1.00 139.57 ? 121 GLN B HG2  1 
ATOM   6260  H HG3  . GLN B  1 78  ? 65.767  -11.156  -13.084  1.00 139.57 ? 121 GLN B HG3  1 
ATOM   6261  H HE21 . GLN B  1 78  ? 62.848  -10.127  -11.645  1.00 120.69 ? 121 GLN B HE21 1 
ATOM   6262  H HE22 . GLN B  1 78  ? 64.104  -10.856  -11.315  1.00 120.69 ? 121 GLN B HE22 1 
ATOM   6263  N N    . LEU B  1 79  ? 66.875  -14.511  -15.390  1.00 128.88 ? 122 LEU B N    1 
ATOM   6264  C CA   . LEU B  1 79  ? 66.784  -15.875  -15.911  1.00 138.13 ? 122 LEU B CA   1 
ATOM   6265  C C    . LEU B  1 79  ? 65.835  -16.735  -15.085  1.00 144.65 ? 122 LEU B C    1 
ATOM   6266  O O    . LEU B  1 79  ? 66.059  -16.951  -13.895  1.00 149.94 ? 122 LEU B O    1 
ATOM   6267  C CB   . LEU B  1 79  ? 68.167  -16.529  -15.944  1.00 146.92 ? 122 LEU B CB   1 
ATOM   6268  C CG   . LEU B  1 79  ? 68.188  -18.020  -16.307  1.00 156.09 ? 122 LEU B CG   1 
ATOM   6269  C CD1  . LEU B  1 79  ? 67.610  -18.252  -17.698  1.00 152.47 ? 122 LEU B CD1  1 
ATOM   6270  C CD2  . LEU B  1 79  ? 69.600  -18.589  -16.212  1.00 164.70 ? 122 LEU B CD2  1 
ATOM   6271  H H    . LEU B  1 79  ? 67.177  -14.467  -14.586  1.00 156.14 ? 122 LEU B H    1 
ATOM   6272  H HA   . LEU B  1 79  ? 66.445  -15.843  -16.819  1.00 158.37 ? 122 LEU B HA   1 
ATOM   6273  H HB2  . LEU B  1 79  ? 68.711  -16.063  -16.599  1.00 169.52 ? 122 LEU B HB2  1 
ATOM   6274  H HB3  . LEU B  1 79  ? 68.570  -16.438  -15.066  1.00 169.52 ? 122 LEU B HB3  1 
ATOM   6275  H HG   . LEU B  1 79  ? 67.633  -18.502  -15.673  1.00 173.85 ? 122 LEU B HG   1 
ATOM   6276  H HD11 . LEU B  1 79  ? 67.637  -19.201  -17.897  1.00 174.66 ? 122 LEU B HD11 1 
ATOM   6277  H HD12 . LEU B  1 79  ? 66.693  -17.936  -17.714  1.00 174.66 ? 122 LEU B HD12 1 
ATOM   6278  H HD13 . LEU B  1 79  ? 68.141  -17.762  -18.345  1.00 174.66 ? 122 LEU B HD13 1 
ATOM   6279  H HD21 . LEU B  1 79  ? 69.577  -19.530  -16.447  1.00 185.05 ? 122 LEU B HD21 1 
ATOM   6280  H HD22 . LEU B  1 79  ? 70.175  -18.108  -16.827  1.00 185.05 ? 122 LEU B HD22 1 
ATOM   6281  H HD23 . LEU B  1 79  ? 69.922  -18.482  -15.303  1.00 185.05 ? 122 LEU B HD23 1 
ATOM   6282  N N    . THR B  1 80  ? 64.779  -17.226  -15.725  1.00 147.79 ? 123 THR B N    1 
ATOM   6283  C CA   . THR B  1 80  ? 63.872  -18.181  -15.099  1.00 154.90 ? 123 THR B CA   1 
ATOM   6284  C C    . THR B  1 80  ? 63.383  -19.190  -16.133  1.00 157.38 ? 123 THR B C    1 
ATOM   6285  O O    . THR B  1 80  ? 62.877  -18.813  -17.190  1.00 149.83 ? 123 THR B O    1 
ATOM   6286  C CB   . THR B  1 80  ? 62.659  -17.478  -14.432  1.00 150.51 ? 123 THR B CB   1 
ATOM   6287  O OG1  . THR B  1 80  ? 61.718  -18.458  -13.971  1.00 158.21 ? 123 THR B OG1  1 
ATOM   6288  C CG2  . THR B  1 80  ? 61.964  -16.526  -15.398  1.00 138.02 ? 123 THR B CG2  1 
ATOM   6289  H H    . THR B  1 80  ? 64.564  -17.019  -16.532  1.00 320.72 ? 123 THR B H    1 
ATOM   6290  H HA   . THR B  1 80  ? 64.353  -18.666  -14.410  1.00 316.49 ? 123 THR B HA   1 
ATOM   6291  H HB   . THR B  1 80  ? 62.971  -16.960  -13.674  1.00 306.54 ? 123 THR B HB   1 
ATOM   6292  H HG1  . THR B  1 80  ? 61.061  -18.079  -13.610  1.00 301.87 ? 123 THR B HG1  1 
ATOM   6293  H HG21 . THR B  1 80  ? 61.211  -16.100  -14.960  1.00 304.55 ? 123 THR B HG21 1 
ATOM   6294  H HG22 . THR B  1 80  ? 62.586  -15.842  -15.693  1.00 304.55 ? 123 THR B HG22 1 
ATOM   6295  H HG23 . THR B  1 80  ? 61.643  -17.015  -16.172  1.00 304.55 ? 123 THR B HG23 1 
ATOM   6296  N N    . GLY B  1 81  ? 63.563  -20.472  -15.827  1.00 151.21 ? 124 GLY B N    1 
ATOM   6297  C CA   . GLY B  1 81  ? 63.070  -21.549  -16.669  1.00 153.52 ? 124 GLY B CA   1 
ATOM   6298  C C    . GLY B  1 81  ? 63.487  -21.422  -18.121  1.00 149.13 ? 124 GLY B C    1 
ATOM   6299  O O    . GLY B  1 81  ? 62.659  -21.532  -19.025  1.00 144.77 ? 124 GLY B O    1 
ATOM   6300  H H    . GLY B  1 81  ? 63.976  -20.745  -15.124  1.00 235.16 ? 124 GLY B H    1 
ATOM   6301  H HA2  . GLY B  1 81  ? 63.402  -22.395  -16.331  1.00 237.63 ? 124 GLY B HA2  1 
ATOM   6302  H HA3  . GLY B  1 81  ? 62.101  -21.565  -16.632  1.00 237.63 ? 124 GLY B HA3  1 
ATOM   6303  N N    . GLY B  1 82  ? 64.771  -21.169  -18.348  1.00 153.56 ? 198 GLY B N    1 
ATOM   6304  C CA   . GLY B  1 82  ? 65.301  -21.121  -19.698  1.00 150.42 ? 198 GLY B CA   1 
ATOM   6305  C C    . GLY B  1 82  ? 64.830  -19.914  -20.486  1.00 139.34 ? 198 GLY B C    1 
ATOM   6306  O O    . GLY B  1 82  ? 65.150  -19.781  -21.668  1.00 135.58 ? 198 GLY B O    1 
ATOM   6307  H H    . GLY B  1 82  ? 65.355  -21.021  -17.734  1.00 138.69 ? 198 GLY B H    1 
ATOM   6308  H HA2  . GLY B  1 82  ? 66.270  -21.101  -19.660  1.00 144.04 ? 198 GLY B HA2  1 
ATOM   6309  H HA3  . GLY B  1 82  ? 65.031  -21.921  -20.176  1.00 144.04 ? 198 GLY B HA3  1 
ATOM   6310  N N    . SER B  1 83  ? 64.069  -19.037  -19.836  1.00 147.74 ? 199 SER B N    1 
ATOM   6311  C CA   . SER B  1 83  ? 63.577  -17.818  -20.469  1.00 134.88 ? 199 SER B CA   1 
ATOM   6312  C C    . SER B  1 83  ? 64.385  -16.612  -20.008  1.00 130.65 ? 199 SER B C    1 
ATOM   6313  O O    . SER B  1 83  ? 64.661  -16.459  -18.817  1.00 134.19 ? 199 SER B O    1 
ATOM   6314  C CB   . SER B  1 83  ? 62.096  -17.613  -20.154  1.00 130.69 ? 199 SER B CB   1 
ATOM   6315  O OG   . SER B  1 83  ? 61.324  -18.698  -20.641  1.00 134.12 ? 199 SER B OG   1 
ATOM   6316  H H    . SER B  1 83  ? 63.821  -19.128  -19.018  1.00 187.42 ? 199 SER B H    1 
ATOM   6317  H HA   . SER B  1 83  ? 63.674  -17.897  -21.431  1.00 182.74 ? 199 SER B HA   1 
ATOM   6318  H HB2  . SER B  1 83  ? 61.983  -17.551  -19.193  1.00 172.74 ? 199 SER B HB2  1 
ATOM   6319  H HB3  . SER B  1 83  ? 61.793  -16.795  -20.578  1.00 172.74 ? 199 SER B HB3  1 
ATOM   6320  H HG   . SER B  1 83  ? 61.414  -18.763  -21.473  1.00 170.94 ? 199 SER B HG   1 
ATOM   6321  N N    . ALA B  1 84  ? 64.756  -15.758  -20.957  1.00 122.05 ? 200 ALA B N    1 
ATOM   6322  C CA   . ALA B  1 84  ? 65.576  -14.587  -20.668  1.00 119.14 ? 200 ALA B CA   1 
ATOM   6323  C C    . ALA B  1 84  ? 64.766  -13.302  -20.795  1.00 114.82 ? 200 ALA B C    1 
ATOM   6324  O O    . ALA B  1 84  ? 63.955  -13.155  -21.711  1.00 115.22 ? 200 ALA B O    1 
ATOM   6325  C CB   . ALA B  1 84  ? 66.772  -14.548  -21.592  1.00 121.32 ? 200 ALA B CB   1 
ATOM   6326  H H    . ALA B  1 84  ? 64.542  -15.836  -21.787  1.00 144.80 ? 200 ALA B H    1 
ATOM   6327  H HA   . ALA B  1 84  ? 65.903  -14.647  -19.757  1.00 146.54 ? 200 ALA B HA   1 
ATOM   6328  H HB1  . ALA B  1 84  ? 67.305  -13.764  -21.385  1.00 157.81 ? 200 ALA B HB1  1 
ATOM   6329  H HB2  . ALA B  1 84  ? 67.299  -15.351  -21.459  1.00 157.81 ? 200 ALA B HB2  1 
ATOM   6330  H HB3  . ALA B  1 84  ? 66.461  -14.504  -22.509  1.00 157.81 ? 200 ALA B HB3  1 
ATOM   6331  N N    . LEU B  1 85  ? 64.994  -12.380  -19.863  1.00 122.06 ? 201 LEU B N    1 
ATOM   6332  C CA   . LEU B  1 85  ? 64.282  -11.108  -19.822  1.00 118.94 ? 201 LEU B CA   1 
ATOM   6333  C C    . LEU B  1 85  ? 65.273  -9.958   -19.663  1.00 117.56 ? 201 LEU B C    1 
ATOM   6334  O O    . LEU B  1 85  ? 66.146  -10.004  -18.797  1.00 117.33 ? 201 LEU B O    1 
ATOM   6335  C CB   . LEU B  1 85  ? 63.271  -11.110  -18.672  1.00 117.04 ? 201 LEU B CB   1 
ATOM   6336  C CG   . LEU B  1 85  ? 61.992  -10.287  -18.841  1.00 115.44 ? 201 LEU B CG   1 
ATOM   6337  C CD1  . LEU B  1 85  ? 60.984  -10.651  -17.753  1.00 114.77 ? 201 LEU B CD1  1 
ATOM   6338  C CD2  . LEU B  1 85  ? 62.282  -8.792   -18.819  1.00 113.41 ? 201 LEU B CD2  1 
ATOM   6339  H H    . LEU B  1 85  ? 65.569  -12.472  -19.230  1.00 106.69 ? 201 LEU B H    1 
ATOM   6340  H HA   . LEU B  1 85  ? 63.799  -10.983  -20.654  1.00 102.38 ? 201 LEU B HA   1 
ATOM   6341  H HB2  . LEU B  1 85  ? 62.998  -12.028  -18.516  1.00 91.96  ? 201 LEU B HB2  1 
ATOM   6342  H HB3  . LEU B  1 85  ? 63.720  -10.775  -17.880  1.00 91.96  ? 201 LEU B HB3  1 
ATOM   6343  H HG   . LEU B  1 85  ? 61.594  -10.500  -19.700  1.00 87.21  ? 201 LEU B HG   1 
ATOM   6344  H HD11 . LEU B  1 85  ? 60.181  -10.121  -17.876  1.00 78.44  ? 201 LEU B HD11 1 
ATOM   6345  H HD12 . LEU B  1 85  ? 60.771  -11.595  -17.823  1.00 78.44  ? 201 LEU B HD12 1 
ATOM   6346  H HD13 . LEU B  1 85  ? 61.375  -10.464  -16.885  1.00 78.44  ? 201 LEU B HD13 1 
ATOM   6347  H HD21 . LEU B  1 85  ? 61.449  -8.308   -18.929  1.00 88.37  ? 201 LEU B HD21 1 
ATOM   6348  H HD22 . LEU B  1 85  ? 62.689  -8.562   -17.969  1.00 88.37  ? 201 LEU B HD22 1 
ATOM   6349  H HD23 . LEU B  1 85  ? 62.888  -8.577   -19.545  1.00 88.37  ? 201 LEU B HD23 1 
ATOM   6350  N N    . THR B  1 86  ? 65.135  -8.936   -20.504  1.00 120.90 ? 202 THR B N    1 
ATOM   6351  C CA   . THR B  1 86  ? 66.015  -7.767   -20.464  1.00 120.09 ? 202 THR B CA   1 
ATOM   6352  C C    . THR B  1 86  ? 65.213  -6.474   -20.374  1.00 118.04 ? 202 THR B C    1 
ATOM   6353  O O    . THR B  1 86  ? 64.100  -6.381   -20.896  1.00 118.18 ? 202 THR B O    1 
ATOM   6354  C CB   . THR B  1 86  ? 66.927  -7.696   -21.706  1.00 122.75 ? 202 THR B CB   1 
ATOM   6355  O OG1  . THR B  1 86  ? 66.137  -7.466   -22.880  1.00 123.91 ? 202 THR B OG1  1 
ATOM   6356  C CG2  . THR B  1 86  ? 67.724  -8.987   -21.866  1.00 125.41 ? 202 THR B CG2  1 
ATOM   6357  H H    . THR B  1 86  ? 64.532  -8.894   -21.116  1.00 185.56 ? 202 THR B H    1 
ATOM   6358  H HA   . THR B  1 86  ? 66.581  -7.825   -19.678  1.00 185.86 ? 202 THR B HA   1 
ATOM   6359  H HB   . THR B  1 86  ? 67.556  -6.965   -21.597  1.00 196.62 ? 202 THR B HB   1 
ATOM   6360  H HG1  . THR B  1 86  ? 66.633  -7.427   -23.557  1.00 199.10 ? 202 THR B HG1  1 
ATOM   6361  H HG21 . THR B  1 86  ? 68.293  -8.930   -22.650  1.00 204.87 ? 202 THR B HG21 1 
ATOM   6362  H HG22 . THR B  1 86  ? 68.278  -9.134   -21.084  1.00 204.87 ? 202 THR B HG22 1 
ATOM   6363  H HG23 . THR B  1 86  ? 67.119  -9.739   -21.970  1.00 204.87 ? 202 THR B HG23 1 
ATOM   6364  N N    . GLN B  1 87  ? 65.791  -5.476   -19.713  1.00 121.79 ? 203 GLN B N    1 
ATOM   6365  C CA   . GLN B  1 87  ? 65.120  -4.196   -19.514  1.00 121.66 ? 203 GLN B CA   1 
ATOM   6366  C C    . GLN B  1 87  ? 66.113  -3.125   -19.061  1.00 121.94 ? 203 GLN B C    1 
ATOM   6367  O O    . GLN B  1 87  ? 67.264  -3.431   -18.740  1.00 121.96 ? 203 GLN B O    1 
ATOM   6368  C CB   . GLN B  1 87  ? 63.996  -4.345   -18.487  1.00 119.64 ? 203 GLN B CB   1 
ATOM   6369  C CG   . GLN B  1 87  ? 64.483  -4.714   -17.096  1.00 117.69 ? 203 GLN B CG   1 
ATOM   6370  C CD   . GLN B  1 87  ? 63.373  -5.211   -16.198  1.00 116.37 ? 203 GLN B CD   1 
ATOM   6371  O OE1  . GLN B  1 87  ? 62.214  -5.286   -16.603  1.00 116.40 ? 203 GLN B OE1  1 
ATOM   6372  N NE2  . GLN B  1 87  ? 63.724  -5.559   -14.968  1.00 115.92 ? 203 GLN B NE2  1 
ATOM   6373  H H    . GLN B  1 87  ? 66.577  -5.516   -19.367  1.00 161.17 ? 203 GLN B H    1 
ATOM   6374  H HA   . GLN B  1 87  ? 64.728  -3.908   -20.353  1.00 155.32 ? 203 GLN B HA   1 
ATOM   6375  H HB2  . GLN B  1 87  ? 63.520  -3.502   -18.421  1.00 146.12 ? 203 GLN B HB2  1 
ATOM   6376  H HB3  . GLN B  1 87  ? 63.391  -5.042   -18.785  1.00 146.12 ? 203 GLN B HB3  1 
ATOM   6377  H HG2  . GLN B  1 87  ? 65.146  -5.417   -17.170  1.00 143.11 ? 203 GLN B HG2  1 
ATOM   6378  H HG3  . GLN B  1 87  ? 64.876  -3.930   -16.681  1.00 143.11 ? 203 GLN B HG3  1 
ATOM   6379  H HE21 . GLN B  1 87  ? 63.131  -5.849   -14.417  1.00 131.40 ? 203 GLN B HE21 1 
ATOM   6380  H HE22 . GLN B  1 87  ? 64.546  -5.496   -14.721  1.00 131.40 ? 203 GLN B HE22 1 
ATOM   6381  N N    . ALA B  1 88  ? 65.666  -1.871   -19.044  1.00 125.22 ? 204 ALA B N    1 
ATOM   6382  C CA   . ALA B  1 88  ? 66.484  -0.764   -18.550  1.00 125.78 ? 204 ALA B CA   1 
ATOM   6383  C C    . ALA B  1 88  ? 66.748  -0.932   -17.059  1.00 123.96 ? 204 ALA B C    1 
ATOM   6384  O O    . ALA B  1 88  ? 65.873  -1.381   -16.318  1.00 122.15 ? 204 ALA B O    1 
ATOM   6385  C CB   . ALA B  1 88  ? 65.804  0.566    -18.817  1.00 126.87 ? 204 ALA B CB   1 
ATOM   6386  H H    . ALA B  1 88  ? 64.885  -1.633   -19.316  1.00 198.47 ? 204 ALA B H    1 
ATOM   6387  H HA   . ALA B  1 88  ? 67.337  -0.767   -19.012  1.00 197.14 ? 204 ALA B HA   1 
ATOM   6388  H HB1  . ALA B  1 88  ? 66.367  1.281    -18.481  1.00 195.71 ? 204 ALA B HB1  1 
ATOM   6389  H HB2  . ALA B  1 88  ? 65.675  0.667    -19.773  1.00 195.71 ? 204 ALA B HB2  1 
ATOM   6390  H HB3  . ALA B  1 88  ? 64.947  0.578    -18.364  1.00 195.71 ? 204 ALA B HB3  1 
ATOM   6391  N N    . CYS B  1 89  ? 67.947  -0.559   -16.621  1.00 128.67 ? 205 CYS B N    1 
ATOM   6392  C CA   . CYS B  1 89  ? 68.364  -0.791   -15.241  1.00 127.64 ? 205 CYS B CA   1 
ATOM   6393  C C    . CYS B  1 89  ? 69.129  0.391    -14.662  1.00 129.19 ? 205 CYS B C    1 
ATOM   6394  O O    . CYS B  1 89  ? 70.328  0.293    -14.398  1.00 130.53 ? 205 CYS B O    1 
ATOM   6395  C CB   . CYS B  1 89  ? 69.225  -2.055   -15.153  1.00 127.55 ? 205 CYS B CB   1 
ATOM   6396  S SG   . CYS B  1 89  ? 70.657  -2.083   -16.265  1.00 130.11 ? 205 CYS B SG   1 
ATOM   6397  H H    . CYS B  1 89  ? 68.540  -0.167   -17.105  1.00 351.25 ? 205 CYS B H    1 
ATOM   6398  H HA   . CYS B  1 89  ? 67.574  -0.930   -14.695  1.00 344.26 ? 205 CYS B HA   1 
ATOM   6399  H HB2  . CYS B  1 89  ? 69.557  -2.140   -14.246  1.00 349.00 ? 205 CYS B HB2  1 
ATOM   6400  H HB3  . CYS B  1 89  ? 68.671  -2.822   -15.370  1.00 349.00 ? 205 CYS B HB3  1 
ATOM   6401  N N    . PRO B  1 90  ? 68.432  1.515    -14.451  1.00 122.08 ? 206 PRO B N    1 
ATOM   6402  C CA   . PRO B  1 90  ? 69.060  2.665    -13.797  1.00 123.70 ? 206 PRO B CA   1 
ATOM   6403  C C    . PRO B  1 90  ? 69.257  2.434    -12.306  1.00 123.07 ? 206 PRO B C    1 
ATOM   6404  O O    . PRO B  1 90  ? 68.366  1.876    -11.663  1.00 121.00 ? 206 PRO B O    1 
ATOM   6405  C CB   . PRO B  1 90  ? 68.057  3.786    -14.035  1.00 123.87 ? 206 PRO B CB   1 
ATOM   6406  C CG   . PRO B  1 90  ? 66.748  3.084    -14.099  1.00 121.67 ? 206 PRO B CG   1 
ATOM   6407  C CD   . PRO B  1 90  ? 67.017  1.771    -14.772  1.00 121.05 ? 206 PRO B CD   1 
ATOM   6408  H HA   . PRO B  1 90  ? 69.907  2.884    -14.215  1.00 187.87 ? 206 PRO B HA   1 
ATOM   6409  H HB2  . PRO B  1 90  ? 68.079  4.412    -13.294  1.00 185.69 ? 206 PRO B HB2  1 
ATOM   6410  H HB3  . PRO B  1 90  ? 68.253  4.232    -14.873  1.00 185.69 ? 206 PRO B HB3  1 
ATOM   6411  H HG2  . PRO B  1 90  ? 66.411  2.943    -13.201  1.00 180.96 ? 206 PRO B HG2  1 
ATOM   6412  H HG3  . PRO B  1 90  ? 66.122  3.611    -14.620  1.00 180.96 ? 206 PRO B HG3  1 
ATOM   6413  H HD2  . PRO B  1 90  ? 66.453  1.076    -14.398  1.00 185.75 ? 206 PRO B HD2  1 
ATOM   6414  H HD3  . PRO B  1 90  ? 66.896  1.850    -15.731  1.00 185.75 ? 206 PRO B HD3  1 
ATOM   6415  N N    . LYS B  1 91  ? 70.392  2.863    -11.761  1.00 135.18 ? 207 LYS B N    1 
ATOM   6416  C CA   . LYS B  1 91  ? 70.644  2.712    -10.333  1.00 135.31 ? 207 LYS B CA   1 
ATOM   6417  C C    . LYS B  1 91  ? 69.720  3.644    -9.557   1.00 134.82 ? 207 LYS B C    1 
ATOM   6418  O O    . LYS B  1 91  ? 69.406  4.746    -10.013  1.00 135.64 ? 207 LYS B O    1 
ATOM   6419  C CB   . LYS B  1 91  ? 72.115  2.994    -9.997   1.00 138.44 ? 207 LYS B CB   1 
ATOM   6420  C CG   . LYS B  1 91  ? 73.113  2.001    -10.613  1.00 139.23 ? 207 LYS B CG   1 
ATOM   6421  C CD   . LYS B  1 91  ? 72.940  0.566    -10.087  1.00 137.41 ? 207 LYS B CD   1 
ATOM   6422  C CE   . LYS B  1 91  ? 73.409  0.415    -8.645   1.00 138.77 ? 207 LYS B CE   1 
ATOM   6423  N NZ   . LYS B  1 91  ? 73.194  -0.968   -8.127   1.00 137.35 ? 207 LYS B NZ   1 
ATOM   6424  H H    . LYS B  1 91  ? 71.029  3.243    -12.196  1.00 250.10 ? 207 LYS B H    1 
ATOM   6425  H HA   . LYS B  1 91  ? 70.444  1.800    -10.069  1.00 246.05 ? 207 LYS B HA   1 
ATOM   6426  H HB2  . LYS B  1 91  ? 72.343  3.879    -10.322  1.00 250.84 ? 207 LYS B HB2  1 
ATOM   6427  H HB3  . LYS B  1 91  ? 72.225  2.962    -9.034   1.00 250.84 ? 207 LYS B HB3  1 
ATOM   6428  H HG2  . LYS B  1 91  ? 72.986  1.984    -11.575  1.00 257.94 ? 207 LYS B HG2  1 
ATOM   6429  H HG3  . LYS B  1 91  ? 74.014  2.290    -10.403  1.00 257.94 ? 207 LYS B HG3  1 
ATOM   6430  H HD2  . LYS B  1 91  ? 72.001  0.326    -10.125  1.00 258.07 ? 207 LYS B HD2  1 
ATOM   6431  H HD3  . LYS B  1 91  ? 73.461  -0.038   -10.638  1.00 258.07 ? 207 LYS B HD3  1 
ATOM   6432  H HE2  . LYS B  1 91  ? 74.357  0.613    -8.597   1.00 256.77 ? 207 LYS B HE2  1 
ATOM   6433  H HE3  . LYS B  1 91  ? 72.911  1.029    -8.083   1.00 256.77 ? 207 LYS B HE3  1 
ATOM   6434  H HZ1  . LYS B  1 91  ? 73.478  -1.024   -7.285   1.00 258.55 ? 207 LYS B HZ1  1 
ATOM   6435  H HZ2  . LYS B  1 91  ? 72.329  -1.172   -8.155   1.00 258.55 ? 207 LYS B HZ2  1 
ATOM   6436  H HZ3  . LYS B  1 91  ? 73.646  -1.552   -8.623   1.00 258.55 ? 207 LYS B HZ3  1 
ATOM   6437  N N    . VAL B  1 92  ? 69.278  3.187    -8.389   1.00 128.65 ? 208 VAL B N    1 
ATOM   6438  C CA   . VAL B  1 92  ? 68.315  3.925    -7.584   1.00 128.14 ? 208 VAL B CA   1 
ATOM   6439  C C    . VAL B  1 92  ? 68.759  4.017    -6.131   1.00 129.54 ? 208 VAL B C    1 
ATOM   6440  O O    . VAL B  1 92  ? 69.686  3.323    -5.705   1.00 130.67 ? 208 VAL B O    1 
ATOM   6441  C CB   . VAL B  1 92  ? 66.925  3.268    -7.637   1.00 125.29 ? 208 VAL B CB   1 
ATOM   6442  C CG1  . VAL B  1 92  ? 66.414  3.221    -9.067   1.00 124.40 ? 208 VAL B CG1  1 
ATOM   6443  C CG2  . VAL B  1 92  ? 66.972  1.866    -7.039   1.00 124.09 ? 208 VAL B CG2  1 
ATOM   6444  H H    . VAL B  1 92  ? 69.525  2.442    -8.038   1.00 228.24 ? 208 VAL B H    1 
ATOM   6445  H HA   . VAL B  1 92  ? 68.235  4.827    -7.933   1.00 223.60 ? 208 VAL B HA   1 
ATOM   6446  H HB   . VAL B  1 92  ? 66.304  3.797    -7.113   1.00 218.67 ? 208 VAL B HB   1 
ATOM   6447  H HG11 . VAL B  1 92  ? 65.539  2.804    -9.076   1.00 221.20 ? 208 VAL B HG11 1 
ATOM   6448  H HG12 . VAL B  1 92  ? 66.352  4.127    -9.410   1.00 221.20 ? 208 VAL B HG12 1 
ATOM   6449  H HG13 . VAL B  1 92  ? 67.033  2.705    -9.607   1.00 221.20 ? 208 VAL B HG13 1 
ATOM   6450  H HG21 . VAL B  1 92  ? 66.085  1.474    -7.084   1.00 216.39 ? 208 VAL B HG21 1 
ATOM   6451  H HG22 . VAL B  1 92  ? 67.598  1.327    -7.546   1.00 216.39 ? 208 VAL B HG22 1 
ATOM   6452  H HG23 . VAL B  1 92  ? 67.260  1.927    -6.115   1.00 216.39 ? 208 VAL B HG23 1 
ATOM   6453  N N    . THR B  1 93  ? 68.088  4.882    -5.379   1.00 137.76 ? 209 THR B N    1 
ATOM   6454  C CA   . THR B  1 93  ? 68.307  4.991    -3.942   1.00 139.22 ? 209 THR B CA   1 
ATOM   6455  C C    . THR B  1 93  ? 67.300  4.102    -3.211   1.00 136.97 ? 209 THR B C    1 
ATOM   6456  O O    . THR B  1 93  ? 66.120  4.060    -3.567   1.00 134.89 ? 209 THR B O    1 
ATOM   6457  C CB   . THR B  1 93  ? 68.188  6.446    -3.453   1.00 141.20 ? 209 THR B CB   1 
ATOM   6458  O OG1  . THR B  1 93  ? 68.362  6.487    -2.031   1.00 142.88 ? 209 THR B OG1  1 
ATOM   6459  C CG2  . THR B  1 93  ? 66.834  7.042    -3.816   1.00 139.44 ? 209 THR B CG2  1 
ATOM   6460  H H    . THR B  1 93  ? 67.492  5.424    -5.681   1.00 306.10 ? 209 THR B H    1 
ATOM   6461  H HA   . THR B  1 93  ? 69.199  4.673    -3.732   1.00 306.47 ? 209 THR B HA   1 
ATOM   6462  H HB   . THR B  1 93  ? 68.878  6.982    -3.874   1.00 306.71 ? 209 THR B HB   1 
ATOM   6463  H HG1  . THR B  1 93  ? 69.119  6.188    -1.825   1.00 303.56 ? 209 THR B HG1  1 
ATOM   6464  H HG21 . THR B  1 93  ? 66.779  7.957    -3.500   1.00 305.34 ? 209 THR B HG21 1 
ATOM   6465  H HG22 . THR B  1 93  ? 66.716  7.034    -4.779   1.00 305.34 ? 209 THR B HG22 1 
ATOM   6466  H HG23 . THR B  1 93  ? 66.123  6.524    -3.407   1.00 305.34 ? 209 THR B HG23 1 
ATOM   6467  N N    . PHE B  1 94  ? 67.776  3.398    -2.187   1.00 139.50 ? 210 PHE B N    1 
ATOM   6468  C CA   . PHE B  1 94  ? 67.004  2.339    -1.542   1.00 138.94 ? 210 PHE B CA   1 
ATOM   6469  C C    . PHE B  1 94  ? 67.181  2.390    -0.028   1.00 141.94 ? 210 PHE B C    1 
ATOM   6470  O O    . PHE B  1 94  ? 68.305  2.449    0.470    1.00 144.56 ? 210 PHE B O    1 
ATOM   6471  C CB   . PHE B  1 94  ? 67.443  0.978    -2.096   1.00 138.03 ? 210 PHE B CB   1 
ATOM   6472  C CG   . PHE B  1 94  ? 66.648  -0.191   -1.583   1.00 137.83 ? 210 PHE B CG   1 
ATOM   6473  C CD1  . PHE B  1 94  ? 66.880  -0.704   -0.318   1.00 140.41 ? 210 PHE B CD1  1 
ATOM   6474  C CD2  . PHE B  1 94  ? 65.700  -0.806   -2.384   1.00 135.91 ? 210 PHE B CD2  1 
ATOM   6475  C CE1  . PHE B  1 94  ? 66.163  -1.787   0.150    1.00 141.06 ? 210 PHE B CE1  1 
ATOM   6476  C CE2  . PHE B  1 94  ? 64.977  -1.890   -1.923   1.00 136.60 ? 210 PHE B CE2  1 
ATOM   6477  C CZ   . PHE B  1 94  ? 65.211  -2.383   -0.654   1.00 139.19 ? 210 PHE B CZ   1 
ATOM   6478  H H    . PHE B  1 94  ? 68.555  3.517    -1.843   1.00 159.03 ? 210 PHE B H    1 
ATOM   6479  H HA   . PHE B  1 94  ? 66.063  2.460    -1.743   1.00 157.27 ? 210 PHE B HA   1 
ATOM   6480  H HB2  . PHE B  1 94  ? 67.353  0.993    -3.062   1.00 157.89 ? 210 PHE B HB2  1 
ATOM   6481  H HB3  . PHE B  1 94  ? 68.371  0.831    -1.857   1.00 157.89 ? 210 PHE B HB3  1 
ATOM   6482  H HD1  . PHE B  1 94  ? 67.519  -0.305   0.228    1.00 153.61 ? 210 PHE B HD1  1 
ATOM   6483  H HD2  . PHE B  1 94  ? 65.538  -0.476   -3.238   1.00 162.73 ? 210 PHE B HD2  1 
ATOM   6484  H HE1  . PHE B  1 94  ? 66.322  -2.117   1.005    1.00 154.54 ? 210 PHE B HE1  1 
ATOM   6485  H HE2  . PHE B  1 94  ? 64.337  -2.288   -2.467   1.00 163.96 ? 210 PHE B HE2  1 
ATOM   6486  H HZ   . PHE B  1 94  ? 64.726  -3.113   -0.341   1.00 159.41 ? 210 PHE B HZ   1 
ATOM   6487  N N    . GLU B  1 95  ? 66.066  2.362    0.698    1.00 138.95 ? 211 GLU B N    1 
ATOM   6488  C CA   . GLU B  1 95  ? 66.094  2.425    2.158    1.00 142.43 ? 211 GLU B CA   1 
ATOM   6489  C C    . GLU B  1 95  ? 64.733  2.013    2.731    1.00 143.22 ? 211 GLU B C    1 
ATOM   6490  O O    . GLU B  1 95  ? 63.702  2.476    2.247    1.00 142.11 ? 211 GLU B O    1 
ATOM   6491  C CB   . GLU B  1 95  ? 66.465  3.837    2.624    1.00 144.79 ? 211 GLU B CB   1 
ATOM   6492  C CG   . GLU B  1 95  ? 66.671  3.986    4.128    1.00 149.08 ? 211 GLU B CG   1 
ATOM   6493  C CD   . GLU B  1 95  ? 68.039  3.511    4.596    1.00 151.02 ? 211 GLU B CD   1 
ATOM   6494  O OE1  . GLU B  1 95  ? 68.663  2.682    3.900    1.00 149.61 ? 211 GLU B OE1  1 
ATOM   6495  O OE2  . GLU B  1 95  ? 68.490  3.974    5.665    1.00 155.12 ? 211 GLU B OE2  1 
ATOM   6496  H H    . GLU B  1 95  ? 65.274  2.307    0.366    1.00 247.71 ? 211 GLU B H    1 
ATOM   6497  H HA   . GLU B  1 95  ? 66.764  1.808    2.492    1.00 250.32 ? 211 GLU B HA   1 
ATOM   6498  H HB2  . GLU B  1 95  ? 67.291  4.098    2.187    1.00 255.36 ? 211 GLU B HB2  1 
ATOM   6499  H HB3  . GLU B  1 95  ? 65.754  4.444    2.364    1.00 255.36 ? 211 GLU B HB3  1 
ATOM   6500  H HG2  . GLU B  1 95  ? 66.583  4.923    4.366    1.00 261.60 ? 211 GLU B HG2  1 
ATOM   6501  H HG3  . GLU B  1 95  ? 65.999  3.463    4.592    1.00 261.60 ? 211 GLU B HG3  1 
ATOM   6502  N N    . PRO B  1 96  ? 64.722  1.142    3.761    1.00 141.96 ? 212 PRO B N    1 
ATOM   6503  C CA   . PRO B  1 96  ? 63.453  0.640    4.311    1.00 143.21 ? 212 PRO B CA   1 
ATOM   6504  C C    . PRO B  1 96  ? 62.559  1.728    4.906    1.00 145.57 ? 212 PRO B C    1 
ATOM   6505  O O    . PRO B  1 96  ? 63.055  2.759    5.357    1.00 147.50 ? 212 PRO B O    1 
ATOM   6506  C CB   . PRO B  1 96  ? 63.905  -0.338   5.400    1.00 146.06 ? 212 PRO B CB   1 
ATOM   6507  C CG   . PRO B  1 96  ? 65.274  0.095    5.763    1.00 147.48 ? 212 PRO B CG   1 
ATOM   6508  C CD   . PRO B  1 96  ? 65.880  0.600    4.492    1.00 144.16 ? 212 PRO B CD   1 
ATOM   6509  H HA   . PRO B  1 96  ? 62.960  0.156    3.630    1.00 293.04 ? 212 PRO B HA   1 
ATOM   6510  H HB2  . PRO B  1 96  ? 63.311  -0.273   6.165    1.00 300.01 ? 212 PRO B HB2  1 
ATOM   6511  H HB3  . PRO B  1 96  ? 63.913  -1.241   5.047    1.00 300.01 ? 212 PRO B HB3  1 
ATOM   6512  H HG2  . PRO B  1 96  ? 65.228  0.802    6.425    1.00 306.74 ? 212 PRO B HG2  1 
ATOM   6513  H HG3  . PRO B  1 96  ? 65.775  -0.662   6.104    1.00 306.74 ? 212 PRO B HG3  1 
ATOM   6514  H HD2  . PRO B  1 96  ? 66.522  1.302    4.679    1.00 303.02 ? 212 PRO B HD2  1 
ATOM   6515  H HD3  . PRO B  1 96  ? 66.283  -0.130   3.995    1.00 303.02 ? 212 PRO B HD3  1 
ATOM   6516  N N    . ILE B  1 97  ? 61.252  1.474    4.905    1.00 134.12 ? 213 ILE B N    1 
ATOM   6517  C CA   . ILE B  1 97  ? 60.257  2.430    5.389    1.00 137.20 ? 213 ILE B CA   1 
ATOM   6518  C C    . ILE B  1 97  ? 59.152  1.684    6.139    1.00 142.59 ? 213 ILE B C    1 
ATOM   6519  O O    . ILE B  1 97  ? 58.684  0.656    5.662    1.00 143.76 ? 213 ILE B O    1 
ATOM   6520  C CB   . ILE B  1 97  ? 59.632  3.235    4.226    1.00 135.30 ? 213 ILE B CB   1 
ATOM   6521  C CG1  . ILE B  1 97  ? 60.694  4.087    3.516    1.00 132.35 ? 213 ILE B CG1  1 
ATOM   6522  C CG2  . ILE B  1 97  ? 58.484  4.116    4.715    1.00 141.24 ? 213 ILE B CG2  1 
ATOM   6523  C CD1  . ILE B  1 97  ? 61.279  5.214    4.362    1.00 135.77 ? 213 ILE B CD1  1 
ATOM   6524  H H    . ILE B  1 97  ? 60.909  0.738    4.622    1.00 231.84 ? 213 ILE B H    1 
ATOM   6525  H HA   . ILE B  1 97  ? 60.679  3.053    6.002    1.00 230.72 ? 213 ILE B HA   1 
ATOM   6526  H HB   . ILE B  1 97  ? 59.273  2.604    3.582    1.00 224.69 ? 213 ILE B HB   1 
ATOM   6527  H HG12 . ILE B  1 97  ? 61.426  3.509    3.251    1.00 226.75 ? 213 ILE B HG12 1 
ATOM   6528  H HG13 . ILE B  1 97  ? 60.294  4.488    2.729    1.00 226.75 ? 213 ILE B HG13 1 
ATOM   6529  H HG21 . ILE B  1 97  ? 58.118  4.604    3.962    1.00 224.24 ? 213 ILE B HG21 1 
ATOM   6530  H HG22 . ILE B  1 97  ? 57.800  3.552    5.109    1.00 224.24 ? 213 ILE B HG22 1 
ATOM   6531  H HG23 . ILE B  1 97  ? 58.824  4.737    5.379    1.00 224.24 ? 213 ILE B HG23 1 
ATOM   6532  H HD11 . ILE B  1 97  ? 61.937  5.694    3.835    1.00 233.88 ? 213 ILE B HD11 1 
ATOM   6533  H HD12 . ILE B  1 97  ? 60.564  5.814    4.626    1.00 233.88 ? 213 ILE B HD12 1 
ATOM   6534  H HD13 . ILE B  1 97  ? 61.699  4.833    5.149    1.00 233.88 ? 213 ILE B HD13 1 
ATOM   6535  N N    . PRO B  1 98  ? 58.724  2.197    7.309    1.00 130.84 ? 214 PRO B N    1 
ATOM   6536  C CA   . PRO B  1 98  ? 57.647  1.530    8.059    1.00 141.86 ? 214 PRO B CA   1 
ATOM   6537  C C    . PRO B  1 98  ? 56.334  1.400    7.281    1.00 147.51 ? 214 PRO B C    1 
ATOM   6538  O O    . PRO B  1 98  ? 55.981  2.298    6.517    1.00 145.89 ? 214 PRO B O    1 
ATOM   6539  C CB   . PRO B  1 98  ? 57.454  2.440    9.278    1.00 149.48 ? 214 PRO B CB   1 
ATOM   6540  C CG   . PRO B  1 98  ? 58.738  3.164    9.426    1.00 141.27 ? 214 PRO B CG   1 
ATOM   6541  C CD   . PRO B  1 98  ? 59.255  3.363    8.037    1.00 131.25 ? 214 PRO B CD   1 
ATOM   6542  H HA   . PRO B  1 98  ? 57.935  0.653    8.354    1.00 415.73 ? 214 PRO B HA   1 
ATOM   6543  H HB2  . PRO B  1 98  ? 56.727  3.060    9.112    1.00 417.56 ? 214 PRO B HB2  1 
ATOM   6544  H HB3  . PRO B  1 98  ? 57.272  1.900    10.063   1.00 417.56 ? 214 PRO B HB3  1 
ATOM   6545  H HG2  . PRO B  1 98  ? 58.581  4.019    9.858    1.00 418.19 ? 214 PRO B HG2  1 
ATOM   6546  H HG3  . PRO B  1 98  ? 59.356  2.627    9.947    1.00 418.19 ? 214 PRO B HG3  1 
ATOM   6547  H HD2  . PRO B  1 98  ? 58.905  4.186    7.660    1.00 416.27 ? 214 PRO B HD2  1 
ATOM   6548  H HD3  . PRO B  1 98  ? 60.225  3.353    8.032    1.00 416.27 ? 214 PRO B HD3  1 
ATOM   6549  N N    . ILE B  1 99  ? 55.626  0.293    7.494    1.00 129.11 ? 215 ILE B N    1 
ATOM   6550  C CA   . ILE B  1 99  ? 54.335  0.039    6.857    1.00 136.83 ? 215 ILE B CA   1 
ATOM   6551  C C    . ILE B  1 99  ? 53.338  -0.431   7.915    1.00 151.94 ? 215 ILE B C    1 
ATOM   6552  O O    . ILE B  1 99  ? 53.729  -1.024   8.921    1.00 153.06 ? 215 ILE B O    1 
ATOM   6553  C CB   . ILE B  1 99  ? 54.439  -1.029   5.740    1.00 130.76 ? 215 ILE B CB   1 
ATOM   6554  C CG1  . ILE B  1 99  ? 55.521  -0.656   4.718    1.00 115.06 ? 215 ILE B CG1  1 
ATOM   6555  C CG2  . ILE B  1 99  ? 53.091  -1.234   5.044    1.00 138.01 ? 215 ILE B CG2  1 
ATOM   6556  C CD1  . ILE B  1 99  ? 55.197  0.552    3.855    1.00 110.59 ? 215 ILE B CD1  1 
ATOM   6557  H H    . ILE B  1 99  ? 55.880  -0.342   8.016    1.00 133.98 ? 215 ILE B H    1 
ATOM   6558  H HA   . ILE B  1 99  ? 54.001  0.861    6.465    1.00 129.72 ? 215 ILE B HA   1 
ATOM   6559  H HB   . ILE B  1 99  ? 54.694  -1.870   6.152    1.00 120.94 ? 215 ILE B HB   1 
ATOM   6560  H HG12 . ILE B  1 99  ? 56.343  -0.463   5.196    1.00 118.94 ? 215 ILE B HG12 1 
ATOM   6561  H HG13 . ILE B  1 99  ? 55.659  -1.411   4.125    1.00 118.94 ? 215 ILE B HG13 1 
ATOM   6562  H HG21 . ILE B  1 99  ? 53.192  -1.907   4.352    1.00 116.82 ? 215 ILE B HG21 1 
ATOM   6563  H HG22 . ILE B  1 99  ? 52.439  -1.528   5.699    1.00 116.82 ? 215 ILE B HG22 1 
ATOM   6564  H HG23 . ILE B  1 99  ? 52.809  -0.394   4.650    1.00 116.82 ? 215 ILE B HG23 1 
ATOM   6565  H HD11 . ILE B  1 99  ? 55.934  0.710    3.244    1.00 115.36 ? 215 ILE B HD11 1 
ATOM   6566  H HD12 . ILE B  1 99  ? 54.385  0.373    3.356    1.00 115.36 ? 215 ILE B HD12 1 
ATOM   6567  H HD13 . ILE B  1 99  ? 55.070  1.324    4.429    1.00 115.36 ? 215 ILE B HD13 1 
ATOM   6568  N N    . HIS B  1 100 ? 52.056  -0.155   7.688    1.00 135.37 ? 216 HIS B N    1 
ATOM   6569  C CA   . HIS B  1 100 ? 50.991  -0.576   8.599    1.00 148.09 ? 216 HIS B CA   1 
ATOM   6570  C C    . HIS B  1 100 ? 49.832  -1.203   7.822    1.00 150.64 ? 216 HIS B C    1 
ATOM   6571  O O    . HIS B  1 100 ? 49.352  -0.629   6.844    1.00 147.55 ? 216 HIS B O    1 
ATOM   6572  C CB   . HIS B  1 100 ? 50.481  0.611    9.423    1.00 153.15 ? 216 HIS B CB   1 
ATOM   6573  C CG   . HIS B  1 100 ? 51.567  1.477    9.984    1.00 149.95 ? 216 HIS B CG   1 
ATOM   6574  N ND1  . HIS B  1 100 ? 52.058  1.322    11.263   1.00 147.26 ? 216 HIS B ND1  1 
ATOM   6575  C CD2  . HIS B  1 100 ? 52.250  2.514    9.442    1.00 144.36 ? 216 HIS B CD2  1 
ATOM   6576  C CE1  . HIS B  1 100 ? 52.999  2.223    11.483   1.00 142.75 ? 216 HIS B CE1  1 
ATOM   6577  N NE2  . HIS B  1 100 ? 53.136  2.958    10.394   1.00 140.73 ? 216 HIS B NE2  1 
ATOM   6578  H H    . HIS B  1 100 ? 51.772  0.282    7.004    1.00 121.41 ? 216 HIS B H    1 
ATOM   6579  H HA   . HIS B  1 100 ? 51.340  -1.243   9.211    1.00 124.04 ? 216 HIS B HA   1 
ATOM   6580  H HB2  . HIS B  1 100 ? 49.923  1.167    8.857    1.00 128.63 ? 216 HIS B HB2  1 
ATOM   6581  H HB3  . HIS B  1 100 ? 49.959  0.273    10.167   1.00 128.63 ? 216 HIS B HB3  1 
ATOM   6582  H HD1  . HIS B  1 100 ? 51.794  0.731    11.828   1.00 145.84 ? 216 HIS B HD1  1 
ATOM   6583  H HD2  . HIS B  1 100 ? 52.142  2.859    8.585    1.00 136.13 ? 216 HIS B HD2  1 
ATOM   6584  H HE1  . HIS B  1 100 ? 53.484  2.322    12.271   1.00 151.84 ? 216 HIS B HE1  1 
ATOM   6585  H HE2  . HIS B  1 100 ? 53.689  3.610    10.297   1.00 145.75 ? 216 HIS B HE2  1 
ATOM   6586  N N    . TYR B  1 101 ? 49.378  -2.372   8.268    1.00 136.90 ? 217 TYR B N    1 
ATOM   6587  C CA   . TYR B  1 101 ? 48.301  -3.092   7.591    1.00 139.38 ? 217 TYR B CA   1 
ATOM   6588  C C    . TYR B  1 101 ? 46.976  -2.937   8.327    1.00 142.70 ? 217 TYR B C    1 
ATOM   6589  O O    . TYR B  1 101 ? 46.766  -3.536   9.382    1.00 142.34 ? 217 TYR B O    1 
ATOM   6590  C CB   . TYR B  1 101 ? 48.663  -4.575   7.446    1.00 138.54 ? 217 TYR B CB   1 
ATOM   6591  C CG   . TYR B  1 101 ? 49.418  -4.879   6.171    1.00 133.93 ? 217 TYR B CG   1 
ATOM   6592  C CD1  . TYR B  1 101 ? 50.786  -4.655   6.081    1.00 126.51 ? 217 TYR B CD1  1 
ATOM   6593  C CD2  . TYR B  1 101 ? 48.760  -5.375   5.053    1.00 135.07 ? 217 TYR B CD2  1 
ATOM   6594  C CE1  . TYR B  1 101 ? 51.477  -4.919   4.915    1.00 117.94 ? 217 TYR B CE1  1 
ATOM   6595  C CE2  . TYR B  1 101 ? 49.443  -5.642   3.883    1.00 129.32 ? 217 TYR B CE2  1 
ATOM   6596  C CZ   . TYR B  1 101 ? 50.800  -5.411   3.821    1.00 120.08 ? 217 TYR B CZ   1 
ATOM   6597  O OH   . TYR B  1 101 ? 51.486  -5.672   2.661    1.00 109.74 ? 217 TYR B OH   1 
ATOM   6598  H H    . TYR B  1 101 ? 49.680  -2.773   8.966    1.00 138.03 ? 217 TYR B H    1 
ATOM   6599  H HA   . TYR B  1 101 ? 48.190  -2.725   6.700    1.00 133.92 ? 217 TYR B HA   1 
ATOM   6600  H HB2  . TYR B  1 101 ? 49.222  -4.838   8.194    1.00 133.64 ? 217 TYR B HB2  1 
ATOM   6601  H HB3  . TYR B  1 101 ? 47.847  -5.100   7.442    1.00 133.64 ? 217 TYR B HB3  1 
ATOM   6602  H HD1  . TYR B  1 101 ? 51.244  -4.320   6.817    1.00 132.40 ? 217 TYR B HD1  1 
ATOM   6603  H HD2  . TYR B  1 101 ? 47.843  -5.528   5.092    1.00 125.34 ? 217 TYR B HD2  1 
ATOM   6604  H HE1  . TYR B  1 101 ? 52.393  -4.764   4.869    1.00 130.36 ? 217 TYR B HE1  1 
ATOM   6605  H HE2  . TYR B  1 101 ? 48.991  -5.974   3.142    1.00 123.08 ? 217 TYR B HE2  1 
ATOM   6606  H HH   . TYR B  1 101 ? 50.959  -5.966   2.076    1.00 124.15 ? 217 TYR B HH   1 
ATOM   6607  N N    . CYS B  1 102 ? 46.089  -2.125   7.754    1.00 139.33 ? 218 CYS B N    1 
ATOM   6608  C CA   . CYS B  1 102 ? 44.774  -1.874   8.349    1.00 141.52 ? 218 CYS B CA   1 
ATOM   6609  C C    . CYS B  1 102 ? 43.725  -2.789   7.730    1.00 141.64 ? 218 CYS B C    1 
ATOM   6610  O O    . CYS B  1 102 ? 44.000  -3.497   6.763    1.00 140.20 ? 218 CYS B O    1 
ATOM   6611  C CB   . CYS B  1 102 ? 44.362  -0.386   8.217    1.00 141.26 ? 218 CYS B CB   1 
ATOM   6612  S SG   . CYS B  1 102 ? 44.140  0.350    6.557    1.00 135.26 ? 218 CYS B SG   1 
ATOM   6613  H H    . CYS B  1 102 ? 46.223  -1.705   7.016    1.00 188.52 ? 218 CYS B H    1 
ATOM   6614  H HA   . CYS B  1 102 ? 44.820  -2.080   9.296    1.00 192.26 ? 218 CYS B HA   1 
ATOM   6615  H HB2  . CYS B  1 102 ? 43.519  -0.275   8.683    1.00 190.57 ? 218 CYS B HB2  1 
ATOM   6616  H HB3  . CYS B  1 102 ? 45.039  0.145    8.665    1.00 190.57 ? 218 CYS B HB3  1 
ATOM   6617  N N    . ALA B  1 103 ? 42.534  -2.787   8.318    1.00 137.09 ? 219 ALA B N    1 
ATOM   6618  C CA   . ALA B  1 103 ? 41.460  -3.671   7.886    1.00 136.39 ? 219 ALA B CA   1 
ATOM   6619  C C    . ALA B  1 103 ? 40.349  -2.906   7.174    1.00 133.68 ? 219 ALA B C    1 
ATOM   6620  O O    . ALA B  1 103 ? 40.050  -1.777   7.550    1.00 133.90 ? 219 ALA B O    1 
ATOM   6621  C CB   . ALA B  1 103 ? 40.896  -4.401   9.069    1.00 137.47 ? 219 ALA B CB   1 
ATOM   6622  H H    . ALA B  1 103 ? 42.321  -2.277   8.977    1.00 55.57  ? 219 ALA B H    1 
ATOM   6623  H HA   . ALA B  1 103 ? 41.818  -4.327   7.268    1.00 53.89  ? 219 ALA B HA   1 
ATOM   6624  H HB1  . ALA B  1 103 ? 40.182  -4.985   8.768    1.00 62.47  ? 219 ALA B HB1  1 
ATOM   6625  H HB2  . ALA B  1 103 ? 41.600  -4.924   9.482    1.00 62.47  ? 219 ALA B HB2  1 
ATOM   6626  H HB3  . ALA B  1 103 ? 40.549  -3.754   9.703    1.00 62.47  ? 219 ALA B HB3  1 
ATOM   6627  N N    . PRO B  1 104 ? 39.725  -3.521   6.153    1.00 141.18 ? 220 PRO B N    1 
ATOM   6628  C CA   . PRO B  1 104 ? 38.571  -2.896   5.493    1.00 135.95 ? 220 PRO B CA   1 
ATOM   6629  C C    . PRO B  1 104 ? 37.343  -2.772   6.397    1.00 138.66 ? 220 PRO B C    1 
ATOM   6630  O O    . PRO B  1 104 ? 37.259  -3.432   7.434    1.00 142.99 ? 220 PRO B O    1 
ATOM   6631  C CB   . PRO B  1 104 ? 38.286  -3.835   4.310    1.00 129.42 ? 220 PRO B CB   1 
ATOM   6632  C CG   . PRO B  1 104 ? 38.940  -5.093   4.639    1.00 133.36 ? 220 PRO B CG   1 
ATOM   6633  C CD   . PRO B  1 104 ? 40.137  -4.753   5.463    1.00 139.42 ? 220 PRO B CD   1 
ATOM   6634  H HA   . PRO B  1 104 ? 38.811  -2.019   5.156    1.00 122.47 ? 220 PRO B HA   1 
ATOM   6635  H HB2  . PRO B  1 104 ? 37.328  -3.961   4.219    1.00 114.78 ? 220 PRO B HB2  1 
ATOM   6636  H HB3  . PRO B  1 104 ? 38.660  -3.458   3.499    1.00 114.78 ? 220 PRO B HB3  1 
ATOM   6637  H HG2  . PRO B  1 104 ? 38.329  -5.652   5.145    1.00 116.79 ? 220 PRO B HG2  1 
ATOM   6638  H HG3  . PRO B  1 104 ? 39.208  -5.540   3.821    1.00 116.79 ? 220 PRO B HG3  1 
ATOM   6639  H HD2  . PRO B  1 104 ? 40.319  -5.457   6.105    1.00 122.36 ? 220 PRO B HD2  1 
ATOM   6640  H HD3  . PRO B  1 104 ? 40.904  -4.582   4.894    1.00 122.36 ? 220 PRO B HD3  1 
ATOM   6641  N N    . ALA B  1 105 ? 36.402  -1.922   5.995    1.00 151.77 ? 221 ALA B N    1 
ATOM   6642  C CA   . ALA B  1 105 ? 35.192  -1.684   6.769    1.00 153.96 ? 221 ALA B CA   1 
ATOM   6643  C C    . ALA B  1 105 ? 34.285  -2.913   6.768    1.00 153.10 ? 221 ALA B C    1 
ATOM   6644  O O    . ALA B  1 105 ? 33.548  -3.152   5.809    1.00 149.16 ? 221 ALA B O    1 
ATOM   6645  C CB   . ALA B  1 105 ? 34.449  -0.483   6.221    1.00 149.87 ? 221 ALA B CB   1 
ATOM   6646  H H    . ALA B  1 105 ? 36.445  -1.465   5.267    1.00 148.65 ? 221 ALA B H    1 
ATOM   6647  H HA   . ALA B  1 105 ? 35.437  -1.492   7.688    1.00 151.20 ? 221 ALA B HA   1 
ATOM   6648  H HB1  . ALA B  1 105 ? 33.648  -0.341   6.749    1.00 147.02 ? 221 ALA B HB1  1 
ATOM   6649  H HB2  . ALA B  1 105 ? 35.025  0.296    6.277    1.00 147.02 ? 221 ALA B HB2  1 
ATOM   6650  H HB3  . ALA B  1 105 ? 34.212  -0.654   5.297    1.00 147.02 ? 221 ALA B HB3  1 
ATOM   6651  N N    . GLY B  1 106 ? 34.338  -3.675   7.859    1.00 153.59 ? 222 GLY B N    1 
ATOM   6652  C CA   . GLY B  1 106 ? 33.604  -4.925   7.985    1.00 154.78 ? 222 GLY B CA   1 
ATOM   6653  C C    . GLY B  1 106 ? 34.390  -5.977   8.750    1.00 155.43 ? 222 GLY B C    1 
ATOM   6654  O O    . GLY B  1 106 ? 33.873  -7.051   9.053    1.00 156.79 ? 222 GLY B O    1 
ATOM   6655  H H    . GLY B  1 106 ? 34.806  -3.481   8.554    1.00 94.44  ? 222 GLY B H    1 
ATOM   6656  H HA2  . GLY B  1 106 ? 32.769  -4.764   8.451    1.00 96.06  ? 222 GLY B HA2  1 
ATOM   6657  H HA3  . GLY B  1 106 ? 33.402  -5.273   7.102    1.00 96.06  ? 222 GLY B HA3  1 
ATOM   6658  N N    . TYR B  1 107 ? 35.647  -5.667   9.053    1.00 156.80 ? 223 TYR B N    1 
ATOM   6659  C CA   . TYR B  1 107 ? 36.530  -6.571   9.782    1.00 158.04 ? 223 TYR B CA   1 
ATOM   6660  C C    . TYR B  1 107 ? 37.429  -5.764   10.713   1.00 160.24 ? 223 TYR B C    1 
ATOM   6661  O O    . TYR B  1 107 ? 37.512  -4.541   10.596   1.00 161.19 ? 223 TYR B O    1 
ATOM   6662  C CB   . TYR B  1 107 ? 37.377  -7.394   8.807    1.00 156.17 ? 223 TYR B CB   1 
ATOM   6663  C CG   . TYR B  1 107 ? 36.608  -7.898   7.606    1.00 151.95 ? 223 TYR B CG   1 
ATOM   6664  C CD1  . TYR B  1 107 ? 36.499  -7.127   6.459    1.00 148.81 ? 223 TYR B CD1  1 
ATOM   6665  C CD2  . TYR B  1 107 ? 35.983  -9.136   7.621    1.00 149.55 ? 223 TYR B CD2  1 
ATOM   6666  C CE1  . TYR B  1 107 ? 35.795  -7.577   5.355    1.00 143.19 ? 223 TYR B CE1  1 
ATOM   6667  C CE2  . TYR B  1 107 ? 35.273  -9.592   6.523    1.00 147.35 ? 223 TYR B CE2  1 
ATOM   6668  C CZ   . TYR B  1 107 ? 35.183  -8.814   5.397    1.00 144.16 ? 223 TYR B CZ   1 
ATOM   6669  O OH   . TYR B  1 107 ? 34.475  -9.281   4.311    1.00 141.83 ? 223 TYR B OH   1 
ATOM   6670  H H    . TYR B  1 107 ? 36.020  -4.921   8.842    1.00 147.96 ? 223 TYR B H    1 
ATOM   6671  H HA   . TYR B  1 107 ? 35.999  -7.180   10.318   1.00 154.23 ? 223 TYR B HA   1 
ATOM   6672  H HB2  . TYR B  1 107 ? 38.105  -6.842   8.483    1.00 149.25 ? 223 TYR B HB2  1 
ATOM   6673  H HB3  . TYR B  1 107 ? 37.733  -8.165   9.276    1.00 149.25 ? 223 TYR B HB3  1 
ATOM   6674  H HD1  . TYR B  1 107 ? 36.911  -6.294   6.429    1.00 149.29 ? 223 TYR B HD1  1 
ATOM   6675  H HD2  . TYR B  1 107 ? 36.040  -9.668   8.381    1.00 136.76 ? 223 TYR B HD2  1 
ATOM   6676  H HE1  . TYR B  1 107 ? 35.732  -7.049   4.592    1.00 148.14 ? 223 TYR B HE1  1 
ATOM   6677  H HE2  . TYR B  1 107 ? 34.861  -10.425  6.547    1.00 134.23 ? 223 TYR B HE2  1 
ATOM   6678  H HH   . TYR B  1 107 ? 34.495  -8.715   3.691    1.00 139.62 ? 223 TYR B HH   1 
ATOM   6679  N N    . ALA B  1 108 ? 38.108  -6.447   11.629   1.00 147.94 ? 224 ALA B N    1 
ATOM   6680  C CA   . ALA B  1 108 ? 39.008  -5.789   12.570   1.00 148.14 ? 224 ALA B CA   1 
ATOM   6681  C C    . ALA B  1 108 ? 40.257  -6.629   12.756   1.00 145.76 ? 224 ALA B C    1 
ATOM   6682  O O    . ALA B  1 108 ? 40.477  -7.586   12.016   1.00 143.92 ? 224 ALA B O    1 
ATOM   6683  C CB   . ALA B  1 108 ? 38.316  -5.559   13.895   1.00 151.72 ? 224 ALA B CB   1 
ATOM   6684  H H    . ALA B  1 108 ? 38.065  -7.300   11.727   1.00 99.07  ? 224 ALA B H    1 
ATOM   6685  H HA   . ALA B  1 108 ? 39.272  -4.927   12.212   1.00 103.77 ? 224 ALA B HA   1 
ATOM   6686  H HB1  . ALA B  1 108 ? 38.934  -5.122   14.502   1.00 108.48 ? 224 ALA B HB1  1 
ATOM   6687  H HB2  . ALA B  1 108 ? 37.538  -4.997   13.752   1.00 108.48 ? 224 ALA B HB2  1 
ATOM   6688  H HB3  . ALA B  1 108 ? 38.043  -6.415   14.261   1.00 108.48 ? 224 ALA B HB3  1 
ATOM   6689  N N    . ILE B  1 109 ? 41.075  -6.267   13.739   1.00 158.49 ? 225 ILE B N    1 
ATOM   6690  C CA   . ILE B  1 109 ? 42.303  -7.001   14.027   1.00 155.01 ? 225 ILE B CA   1 
ATOM   6691  C C    . ILE B  1 109 ? 42.485  -7.225   15.524   1.00 153.05 ? 225 ILE B C    1 
ATOM   6692  O O    . ILE B  1 109 ? 42.683  -6.279   16.288   1.00 154.18 ? 225 ILE B O    1 
ATOM   6693  C CB   . ILE B  1 109 ? 43.541  -6.265   13.476   1.00 154.89 ? 225 ILE B CB   1 
ATOM   6694  C CG1  . ILE B  1 109 ? 43.467  -6.190   11.949   1.00 157.62 ? 225 ILE B CG1  1 
ATOM   6695  C CG2  . ILE B  1 109 ? 44.833  -6.972   13.900   1.00 150.24 ? 225 ILE B CG2  1 
ATOM   6696  C CD1  . ILE B  1 109 ? 44.575  -5.364   11.300   1.00 158.00 ? 225 ILE B CD1  1 
ATOM   6697  H H    . ILE B  1 109 ? 40.940  -5.595   14.258   1.00 120.05 ? 225 ILE B H    1 
ATOM   6698  H HA   . ILE B  1 109 ? 42.257  -7.870   13.598   1.00 121.17 ? 225 ILE B HA   1 
ATOM   6699  H HB   . ILE B  1 109 ? 43.550  -5.362   13.831   1.00 121.26 ? 225 ILE B HB   1 
ATOM   6700  H HG12 . ILE B  1 109 ? 43.523  -7.090   11.592   1.00 112.24 ? 225 ILE B HG12 1 
ATOM   6701  H HG13 . ILE B  1 109 ? 42.618  -5.792   11.699   1.00 112.24 ? 225 ILE B HG13 1 
ATOM   6702  H HG21 . ILE B  1 109 ? 45.591  -6.487   13.539   1.00 124.28 ? 225 ILE B HG21 1 
ATOM   6703  H HG22 . ILE B  1 109 ? 44.880  -6.987   14.869   1.00 124.28 ? 225 ILE B HG22 1 
ATOM   6704  H HG23 . ILE B  1 109 ? 44.825  -7.878   13.554   1.00 124.28 ? 225 ILE B HG23 1 
ATOM   6705  H HD11 . ILE B  1 109 ? 44.452  -5.371   10.338   1.00 106.48 ? 225 ILE B HD11 1 
ATOM   6706  H HD12 . ILE B  1 109 ? 44.528  -4.455   11.634   1.00 106.48 ? 225 ILE B HD12 1 
ATOM   6707  H HD13 . ILE B  1 109 ? 45.434  -5.755   11.526   1.00 106.48 ? 225 ILE B HD13 1 
ATOM   6708  N N    . LEU B  1 110 ? 42.415  -8.490   15.927   1.00 166.31 ? 226 LEU B N    1 
ATOM   6709  C CA   . LEU B  1 110 ? 42.714  -8.891   17.297   1.00 163.13 ? 226 LEU B CA   1 
ATOM   6710  C C    . LEU B  1 110 ? 44.221  -8.898   17.502   1.00 160.10 ? 226 LEU B C    1 
ATOM   6711  O O    . LEU B  1 110 ? 44.961  -9.355   16.631   1.00 158.42 ? 226 LEU B O    1 
ATOM   6712  C CB   . LEU B  1 110 ? 42.147  -10.276  17.600   1.00 164.43 ? 226 LEU B CB   1 
ATOM   6713  C CG   . LEU B  1 110 ? 40.630  -10.453  17.684   1.00 167.78 ? 226 LEU B CG   1 
ATOM   6714  C CD1  . LEU B  1 110 ? 39.883  -9.726   16.580   1.00 167.97 ? 226 LEU B CD1  1 
ATOM   6715  C CD2  . LEU B  1 110 ? 40.310  -11.940  17.645   1.00 168.47 ? 226 LEU B CD2  1 
ATOM   6716  H H    . LEU B  1 110 ? 42.193  -9.146   15.417   1.00 171.22 ? 226 LEU B H    1 
ATOM   6717  H HA   . LEU B  1 110 ? 42.322  -8.254   17.914   1.00 176.43 ? 226 LEU B HA   1 
ATOM   6718  H HB2  . LEU B  1 110 ? 42.461  -10.880  16.909   1.00 174.73 ? 226 LEU B HB2  1 
ATOM   6719  H HB3  . LEU B  1 110 ? 42.508  -10.561  18.454   1.00 174.73 ? 226 LEU B HB3  1 
ATOM   6720  H HG   . LEU B  1 110 ? 40.320  -10.104  18.534   1.00 175.74 ? 226 LEU B HG   1 
ATOM   6721  H HD11 . LEU B  1 110 ? 38.931  -9.878   16.690   1.00 174.84 ? 226 LEU B HD11 1 
ATOM   6722  H HD12 . LEU B  1 110 ? 40.075  -8.777   16.642   1.00 174.84 ? 226 LEU B HD12 1 
ATOM   6723  H HD13 . LEU B  1 110 ? 40.176  -10.068  15.722   1.00 174.84 ? 226 LEU B HD13 1 
ATOM   6724  H HD21 . LEU B  1 110 ? 39.348  -12.057  17.698   1.00 173.46 ? 226 LEU B HD21 1 
ATOM   6725  H HD22 . LEU B  1 110 ? 40.644  -12.313  16.814   1.00 173.46 ? 226 LEU B HD22 1 
ATOM   6726  H HD23 . LEU B  1 110 ? 40.738  -12.375  18.399   1.00 173.46 ? 226 LEU B HD23 1 
ATOM   6727  N N    . LYS B  1 111 ? 44.669  -8.408   18.653   1.00 167.17 ? 227 LYS B N    1 
ATOM   6728  C CA   . LYS B  1 111 ? 46.095  -8.331   18.950   1.00 163.67 ? 227 LYS B CA   1 
ATOM   6729  C C    . LYS B  1 111 ? 46.417  -9.071   20.237   1.00 165.75 ? 227 LYS B C    1 
ATOM   6730  O O    . LYS B  1 111 ? 45.860  -8.775   21.294   1.00 169.22 ? 227 LYS B O    1 
ATOM   6731  C CB   . LYS B  1 111 ? 46.543  -6.875   19.054   1.00 165.08 ? 227 LYS B CB   1 
ATOM   6732  C CG   . LYS B  1 111 ? 48.040  -6.700   19.266   1.00 161.29 ? 227 LYS B CG   1 
ATOM   6733  C CD   . LYS B  1 111 ? 48.411  -5.229   19.339   1.00 163.05 ? 227 LYS B CD   1 
ATOM   6734  C CE   . LYS B  1 111 ? 49.916  -5.028   19.424   1.00 159.25 ? 227 LYS B CE   1 
ATOM   6735  N NZ   . LYS B  1 111 ? 50.265  -3.605   19.694   1.00 160.68 ? 227 LYS B NZ   1 
ATOM   6736  H H    . LYS B  1 111 ? 44.164  -8.110   19.282   1.00 96.65  ? 227 LYS B H    1 
ATOM   6737  H HA   . LYS B  1 111 ? 46.592  -8.749   18.230   1.00 102.01 ? 227 LYS B HA   1 
ATOM   6738  H HB2  . LYS B  1 111 ? 46.305  -6.417   18.233   1.00 108.76 ? 227 LYS B HB2  1 
ATOM   6739  H HB3  . LYS B  1 111 ? 46.087  -6.462   19.804   1.00 108.76 ? 227 LYS B HB3  1 
ATOM   6740  H HG2  . LYS B  1 111 ? 48.297  -7.122   20.101   1.00 116.78 ? 227 LYS B HG2  1 
ATOM   6741  H HG3  . LYS B  1 111 ? 48.519  -7.100   18.524   1.00 116.78 ? 227 LYS B HG3  1 
ATOM   6742  H HD2  . LYS B  1 111 ? 48.090  -4.780   18.542   1.00 124.99 ? 227 LYS B HD2  1 
ATOM   6743  H HD3  . LYS B  1 111 ? 48.008  -4.837   20.129   1.00 124.99 ? 227 LYS B HD3  1 
ATOM   6744  H HE2  . LYS B  1 111 ? 50.270  -5.569   20.146   1.00 129.75 ? 227 LYS B HE2  1 
ATOM   6745  H HE3  . LYS B  1 111 ? 50.321  -5.285   18.581   1.00 129.75 ? 227 LYS B HE3  1 
ATOM   6746  H HZ1  . LYS B  1 111 ? 51.149  -3.512   19.739   1.00 137.04 ? 227 LYS B HZ1  1 
ATOM   6747  H HZ2  . LYS B  1 111 ? 49.953  -3.086   19.041   1.00 137.04 ? 227 LYS B HZ2  1 
ATOM   6748  H HZ3  . LYS B  1 111 ? 49.907  -3.345   20.466   1.00 137.04 ? 227 LYS B HZ3  1 
ATOM   6749  N N    . CYS B  1 112 ? 47.322  -10.038  20.136   1.00 178.16 ? 228 CYS B N    1 
ATOM   6750  C CA   . CYS B  1 112 ? 47.730  -10.826  21.290   1.00 178.14 ? 228 CYS B CA   1 
ATOM   6751  C C    . CYS B  1 112 ? 48.841  -10.123  22.062   1.00 178.49 ? 228 CYS B C    1 
ATOM   6752  O O    . CYS B  1 112 ? 49.966  -9.997   21.573   1.00 174.94 ? 228 CYS B O    1 
ATOM   6753  C CB   . CYS B  1 112 ? 48.193  -12.214  20.858   1.00 176.34 ? 228 CYS B CB   1 
ATOM   6754  S SG   . CYS B  1 112 ? 48.538  -13.296  22.259   1.00 184.36 ? 228 CYS B SG   1 
ATOM   6755  H H    . CYS B  1 112 ? 47.717  -10.258  19.405   1.00 275.61 ? 228 CYS B H    1 
ATOM   6756  H HA   . CYS B  1 112 ? 46.971  -10.933  21.885   1.00 280.17 ? 228 CYS B HA   1 
ATOM   6757  H HB2  . CYS B  1 112 ? 47.497  -12.628  20.323   1.00 276.26 ? 228 CYS B HB2  1 
ATOM   6758  H HB3  . CYS B  1 112 ? 49.006  -12.129  20.336   1.00 276.26 ? 228 CYS B HB3  1 
ATOM   6759  N N    . ASN B  1 113 ? 48.516  -9.681   23.274   1.00 180.22 ? 229 ASN B N    1 
ATOM   6760  C CA   . ASN B  1 113 ? 49.444  -8.921   24.105   1.00 183.00 ? 229 ASN B CA   1 
ATOM   6761  C C    . ASN B  1 113 ? 49.985  -9.729   25.279   1.00 189.99 ? 229 ASN B C    1 
ATOM   6762  O O    . ASN B  1 113 ? 50.649  -9.181   26.161   1.00 194.03 ? 229 ASN B O    1 
ATOM   6763  C CB   . ASN B  1 113 ? 48.759  -7.662   24.626   1.00 185.37 ? 229 ASN B CB   1 
ATOM   6764  C CG   . ASN B  1 113 ? 48.239  -6.783   23.510   1.00 179.18 ? 229 ASN B CG   1 
ATOM   6765  O OD1  . ASN B  1 113 ? 47.033  -6.593   23.365   1.00 179.78 ? 229 ASN B OD1  1 
ATOM   6766  N ND2  . ASN B  1 113 ? 49.150  -6.249   22.707   1.00 173.62 ? 229 ASN B ND2  1 
ATOM   6767  H H    . ASN B  1 113 ? 47.749  -9.810   23.642   1.00 241.09 ? 229 ASN B H    1 
ATOM   6768  H HA   . ASN B  1 113 ? 50.198  -8.647   23.560   1.00 248.86 ? 229 ASN B HA   1 
ATOM   6769  H HB2  . ASN B  1 113 ? 48.007  -7.917   25.183   1.00 255.71 ? 229 ASN B HB2  1 
ATOM   6770  H HB3  . ASN B  1 113 ? 49.396  -7.145   25.143   1.00 255.71 ? 229 ASN B HB3  1 
ATOM   6771  H HD21 . ASN B  1 113 ? 48.906  -5.742   22.057   1.00 254.78 ? 229 ASN B HD21 1 
ATOM   6772  H HD22 . ASN B  1 113 ? 49.985  -6.410   22.837   1.00 254.78 ? 229 ASN B HD22 1 
ATOM   6773  N N    . ASP B  1 114 ? 49.694  -11.027  25.293   1.00 194.44 ? 230 ASP B N    1 
ATOM   6774  C CA   . ASP B  1 114 ? 50.180  -11.905  26.352   1.00 201.45 ? 230 ASP B CA   1 
ATOM   6775  C C    . ASP B  1 114 ? 51.703  -11.925  26.371   1.00 200.78 ? 230 ASP B C    1 
ATOM   6776  O O    . ASP B  1 114 ? 52.350  -11.920  25.322   1.00 194.41 ? 230 ASP B O    1 
ATOM   6777  C CB   . ASP B  1 114 ? 49.636  -13.328  26.180   1.00 203.08 ? 230 ASP B CB   1 
ATOM   6778  C CG   . ASP B  1 114 ? 48.238  -13.490  26.743   1.00 207.87 ? 230 ASP B CG   1 
ATOM   6779  O OD1  . ASP B  1 114 ? 47.484  -12.493  26.765   1.00 207.17 ? 230 ASP B OD1  1 
ATOM   6780  O OD2  . ASP B  1 114 ? 47.892  -14.616  27.164   1.00 212.71 ? 230 ASP B OD2  1 
ATOM   6781  H H    . ASP B  1 114 ? 49.215  -11.424  24.698   1.00 277.67 ? 230 ASP B H    1 
ATOM   6782  H HA   . ASP B  1 114 ? 49.874  -11.568  27.208   1.00 280.99 ? 230 ASP B HA   1 
ATOM   6783  H HB2  . ASP B  1 114 ? 49.606  -13.543  25.235   1.00 276.71 ? 230 ASP B HB2  1 
ATOM   6784  H HB3  . ASP B  1 114 ? 50.220  -13.948  26.644   1.00 276.71 ? 230 ASP B HB3  1 
ATOM   6785  N N    . LYS B  1 115 ? 52.265  -11.947  27.574   1.00 206.05 ? 231 LYS B N    1 
ATOM   6786  C CA   . LYS B  1 115 ? 53.708  -11.869  27.755   1.00 206.85 ? 231 LYS B CA   1 
ATOM   6787  C C    . LYS B  1 115 ? 54.421  -13.187  27.448   1.00 207.10 ? 231 LYS B C    1 
ATOM   6788  O O    . LYS B  1 115 ? 55.616  -13.178  27.154   1.00 205.53 ? 231 LYS B O    1 
ATOM   6789  C CB   . LYS B  1 115 ? 54.035  -11.443  29.190   1.00 215.33 ? 231 LYS B CB   1 
ATOM   6790  C CG   . LYS B  1 115 ? 53.339  -10.172  29.654   1.00 216.62 ? 231 LYS B CG   1 
ATOM   6791  C CD   . LYS B  1 115 ? 53.594  -9.013   28.707   1.00 209.17 ? 231 LYS B CD   1 
ATOM   6792  C CE   . LYS B  1 115 ? 53.171  -7.691   29.324   1.00 211.88 ? 231 LYS B CE   1 
ATOM   6793  N NZ   . LYS B  1 115 ? 51.753  -7.706   29.776   1.00 215.13 ? 231 LYS B NZ   1 
ATOM   6794  H H    . LYS B  1 115 ? 51.825  -12.007  28.311   1.00 299.64 ? 231 LYS B H    1 
ATOM   6795  H HA   . LYS B  1 115 ? 54.062  -11.193  27.156   1.00 302.25 ? 231 LYS B HA   1 
ATOM   6796  H HB2  . LYS B  1 115 ? 53.772  -12.157  29.792   1.00 306.61 ? 231 LYS B HB2  1 
ATOM   6797  H HB3  . LYS B  1 115 ? 54.991  -11.295  29.258   1.00 306.61 ? 231 LYS B HB3  1 
ATOM   6798  H HG2  . LYS B  1 115 ? 52.383  -10.328  29.692   1.00 309.30 ? 231 LYS B HG2  1 
ATOM   6799  H HG3  . LYS B  1 115 ? 53.674  -9.927   30.531   1.00 309.30 ? 231 LYS B HG3  1 
ATOM   6800  H HD2  . LYS B  1 115 ? 54.542  -8.966   28.507   1.00 312.19 ? 231 LYS B HD2  1 
ATOM   6801  H HD3  . LYS B  1 115 ? 53.084  -9.146   27.893   1.00 312.19 ? 231 LYS B HD3  1 
ATOM   6802  H HE2  . LYS B  1 115 ? 53.731  -7.506   30.094   1.00 314.35 ? 231 LYS B HE2  1 
ATOM   6803  H HE3  . LYS B  1 115 ? 53.270  -6.987   28.664   1.00 314.35 ? 231 LYS B HE3  1 
ATOM   6804  H HZ1  . LYS B  1 115 ? 51.539  -6.919   30.131   1.00 309.64 ? 231 LYS B HZ1  1 
ATOM   6805  H HZ2  . LYS B  1 115 ? 51.216  -7.868   29.085   1.00 309.64 ? 231 LYS B HZ2  1 
ATOM   6806  H HZ3  . LYS B  1 115 ? 51.636  -8.341   30.388   1.00 309.64 ? 231 LYS B HZ3  1 
ATOM   6807  N N    . GLU B  1 116 ? 53.681  -14.298  27.511   1.00 207.41 ? 232 GLU B N    1 
ATOM   6808  C CA   . GLU B  1 116 ? 54.256  -15.652  27.529   1.00 210.24 ? 232 GLU B CA   1 
ATOM   6809  C C    . GLU B  1 116 ? 55.495  -15.807  26.610   1.00 205.19 ? 232 GLU B C    1 
ATOM   6810  O O    . GLU B  1 116 ? 56.604  -15.803  27.151   1.00 208.95 ? 232 GLU B O    1 
ATOM   6811  C CB   . GLU B  1 116 ? 53.163  -16.681  27.214   1.00 210.50 ? 232 GLU B CB   1 
ATOM   6812  C CG   . GLU B  1 116 ? 52.211  -16.945  28.372   1.00 218.40 ? 232 GLU B CG   1 
ATOM   6813  C CD   . GLU B  1 116 ? 51.144  -17.967  28.025   1.00 218.95 ? 232 GLU B CD   1 
ATOM   6814  O OE1  . GLU B  1 116 ? 51.419  -18.857  27.191   1.00 215.95 ? 232 GLU B OE1  1 
ATOM   6815  O OE2  . GLU B  1 116 ? 50.026  -17.874  28.579   1.00 222.72 ? 232 GLU B OE2  1 
ATOM   6816  H H    . GLU B  1 116 ? 52.822  -14.294  27.544   1.00 304.33 ? 232 GLU B H    1 
ATOM   6817  H HA   . GLU B  1 116 ? 54.557  -15.832  28.434   1.00 301.45 ? 232 GLU B HA   1 
ATOM   6818  H HB2  . GLU B  1 116 ? 52.637  -16.358  26.466   1.00 298.31 ? 232 GLU B HB2  1 
ATOM   6819  H HB3  . GLU B  1 116 ? 53.585  -17.522  26.979   1.00 298.31 ? 232 GLU B HB3  1 
ATOM   6820  H HG2  . GLU B  1 116 ? 52.717  -17.283  29.127   1.00 299.44 ? 232 GLU B HG2  1 
ATOM   6821  H HG3  . GLU B  1 116 ? 51.768  -16.116  28.613   1.00 299.44 ? 232 GLU B HG3  1 
ATOM   6822  N N    . PHE B  1 117 ? 55.407  -15.951  25.281   1.00 199.58 ? 233 PHE B N    1 
ATOM   6823  C CA   . PHE B  1 117 ? 54.264  -16.381  24.479   1.00 195.72 ? 233 PHE B CA   1 
ATOM   6824  C C    . PHE B  1 117 ? 54.821  -16.957  23.182   1.00 189.82 ? 233 PHE B C    1 
ATOM   6825  O O    . PHE B  1 117 ? 55.572  -16.294  22.466   1.00 184.57 ? 233 PHE B O    1 
ATOM   6826  C CB   . PHE B  1 117 ? 53.288  -15.247  24.173   1.00 191.66 ? 233 PHE B CB   1 
ATOM   6827  C CG   . PHE B  1 117 ? 52.115  -15.684  23.340   1.00 188.27 ? 233 PHE B CG   1 
ATOM   6828  C CD1  . PHE B  1 117 ? 51.245  -16.654  23.806   1.00 193.27 ? 233 PHE B CD1  1 
ATOM   6829  C CD2  . PHE B  1 117 ? 51.893  -15.142  22.085   1.00 180.58 ? 233 PHE B CD2  1 
ATOM   6830  C CE1  . PHE B  1 117 ? 50.172  -17.071  23.044   1.00 190.73 ? 233 PHE B CE1  1 
ATOM   6831  C CE2  . PHE B  1 117 ? 50.819  -15.556  21.317   1.00 178.07 ? 233 PHE B CE2  1 
ATOM   6832  C CZ   . PHE B  1 117 ? 49.959  -16.522  21.799   1.00 183.17 ? 233 PHE B CZ   1 
ATOM   6833  H H    . PHE B  1 117 ? 56.082  -15.782  24.775   1.00 203.50 ? 233 PHE B H    1 
ATOM   6834  H HA   . PHE B  1 117 ? 53.785  -17.083  24.947   1.00 197.87 ? 233 PHE B HA   1 
ATOM   6835  H HB2  . PHE B  1 117 ? 52.945  -14.894  25.009   1.00 195.02 ? 233 PHE B HB2  1 
ATOM   6836  H HB3  . PHE B  1 117 ? 53.757  -14.551  23.687   1.00 195.02 ? 233 PHE B HB3  1 
ATOM   6837  H HD1  . PHE B  1 117 ? 51.385  -17.030  24.646   1.00 189.76 ? 233 PHE B HD1  1 
ATOM   6838  H HD2  . PHE B  1 117 ? 52.471  -14.492  21.756   1.00 184.06 ? 233 PHE B HD2  1 
ATOM   6839  H HE1  . PHE B  1 117 ? 49.593  -17.721  23.371   1.00 186.26 ? 233 PHE B HE1  1 
ATOM   6840  H HE2  . PHE B  1 117 ? 50.677  -15.183  20.477   1.00 179.55 ? 233 PHE B HE2  1 
ATOM   6841  H HZ   . PHE B  1 117 ? 49.236  -16.799  21.285   1.00 180.96 ? 233 PHE B HZ   1 
ATOM   6842  N N    . ASN B  1 118 ? 54.445  -18.196  22.887   1.00 204.82 ? 234 ASN B N    1 
ATOM   6843  C CA   . ASN B  1 118 ? 55.063  -18.941  21.799   1.00 201.09 ? 234 ASN B CA   1 
ATOM   6844  C C    . ASN B  1 118 ? 54.337  -18.788  20.461   1.00 194.55 ? 234 ASN B C    1 
ATOM   6845  O O    . ASN B  1 118 ? 54.757  -19.366  19.457   1.00 191.34 ? 234 ASN B O    1 
ATOM   6846  C CB   . ASN B  1 118 ? 55.169  -20.426  22.182   1.00 206.95 ? 234 ASN B CB   1 
ATOM   6847  C CG   . ASN B  1 118 ? 53.813  -21.099  22.339   1.00 209.62 ? 234 ASN B CG   1 
ATOM   6848  O OD1  . ASN B  1 118 ? 52.790  -20.435  22.512   1.00 208.82 ? 234 ASN B OD1  1 
ATOM   6849  N ND2  . ASN B  1 118 ? 53.806  -22.431  22.297   1.00 213.42 ? 234 ASN B ND2  1 
ATOM   6850  H H    . ASN B  1 118 ? 53.831  -18.629  23.305   1.00 208.02 ? 234 ASN B H    1 
ATOM   6851  H HA   . ASN B  1 118 ? 55.966  -18.609  21.677   1.00 205.53 ? 234 ASN B HA   1 
ATOM   6852  H HB2  . ASN B  1 118 ? 55.657  -20.896  21.489   1.00 208.66 ? 234 ASN B HB2  1 
ATOM   6853  H HB3  . ASN B  1 118 ? 55.639  -20.500  23.027   1.00 208.66 ? 234 ASN B HB3  1 
ATOM   6854  H HD21 . ASN B  1 118 ? 53.065  -22.860  22.381   1.00 213.44 ? 234 ASN B HD21 1 
ATOM   6855  H HD22 . ASN B  1 118 ? 54.542  -22.861  22.186   1.00 213.44 ? 234 ASN B HD22 1 
ATOM   6856  N N    . GLY B  1 119 ? 53.259  -18.007  20.440   1.00 187.64 ? 235 GLY B N    1 
ATOM   6857  C CA   . GLY B  1 119 ? 52.581  -17.686  19.195   1.00 181.84 ? 235 GLY B CA   1 
ATOM   6858  C C    . GLY B  1 119 ? 51.411  -18.586  18.844   1.00 182.96 ? 235 GLY B C    1 
ATOM   6859  O O    . GLY B  1 119 ? 50.716  -18.347  17.856   1.00 179.14 ? 235 GLY B O    1 
ATOM   6860  H H    . GLY B  1 119 ? 52.903  -17.651  21.137   1.00 152.50 ? 235 GLY B H    1 
ATOM   6861  H HA2  . GLY B  1 119 ? 52.252  -16.775  19.244   1.00 147.33 ? 235 GLY B HA2  1 
ATOM   6862  H HA3  . GLY B  1 119 ? 53.222  -17.733  18.468   1.00 147.33 ? 235 GLY B HA3  1 
ATOM   6863  N N    . THR B  1 120 ? 51.199  -19.628  19.642   1.00 195.17 ? 236 THR B N    1 
ATOM   6864  C CA   . THR B  1 120 ? 50.064  -20.529  19.452   1.00 197.36 ? 236 THR B CA   1 
ATOM   6865  C C    . THR B  1 120 ? 49.328  -20.751  20.764   1.00 204.28 ? 236 THR B C    1 
ATOM   6866  O O    . THR B  1 120 ? 49.923  -20.685  21.842   1.00 208.56 ? 236 THR B O    1 
ATOM   6867  C CB   . THR B  1 120 ? 50.500  -21.895  18.893   1.00 198.15 ? 236 THR B CB   1 
ATOM   6868  O OG1  . THR B  1 120 ? 51.495  -22.471  19.749   1.00 202.76 ? 236 THR B OG1  1 
ATOM   6869  C CG2  . THR B  1 120 ? 51.061  -21.747  17.489   1.00 191.65 ? 236 THR B CG2  1 
ATOM   6870  H H    . THR B  1 120 ? 51.702  -19.838  20.307   1.00 283.68 ? 236 THR B H    1 
ATOM   6871  H HA   . THR B  1 120 ? 49.444  -20.130  18.822   1.00 286.00 ? 236 THR B HA   1 
ATOM   6872  H HB   . THR B  1 120 ? 49.732  -22.485  18.854   1.00 287.25 ? 236 THR B HB   1 
ATOM   6873  H HG1  . THR B  1 120 ? 51.183  -22.578  20.522   1.00 291.50 ? 236 THR B HG1  1 
ATOM   6874  H HG21 . THR B  1 120 ? 51.333  -22.614  17.147   1.00 280.26 ? 236 THR B HG21 1 
ATOM   6875  H HG22 . THR B  1 120 ? 50.387  -21.374  16.900   1.00 280.26 ? 236 THR B HG22 1 
ATOM   6876  H HG23 . THR B  1 120 ? 51.831  -21.157  17.500   1.00 280.26 ? 236 THR B HG23 1 
ATOM   6877  N N    . GLY B  1 121 ? 48.030  -21.015  20.662   1.00 199.12 ? 237 GLY B N    1 
ATOM   6878  C CA   . GLY B  1 121 ? 47.203  -21.274  21.824   1.00 206.11 ? 237 GLY B CA   1 
ATOM   6879  C C    . GLY B  1 121 ? 46.454  -20.048  22.302   1.00 206.14 ? 237 GLY B C    1 
ATOM   6880  O O    . GLY B  1 121 ? 46.255  -19.087  21.557   1.00 200.74 ? 237 GLY B O    1 
ATOM   6881  H H    . GLY B  1 121 ? 47.602  -21.048  19.917   1.00 227.17 ? 237 GLY B H    1 
ATOM   6882  H HA2  . GLY B  1 121 ? 46.555  -21.963  21.610   1.00 234.65 ? 237 GLY B HA2  1 
ATOM   6883  H HA3  . GLY B  1 121 ? 47.760  -21.594  22.551   1.00 234.65 ? 237 GLY B HA3  1 
ATOM   6884  N N    . LEU B  1 122 ? 46.047  -20.086  23.566   1.00 204.11 ? 238 LEU B N    1 
ATOM   6885  C CA   . LEU B  1 122 ? 45.168  -19.070  24.132   1.00 205.77 ? 238 LEU B CA   1 
ATOM   6886  C C    . LEU B  1 122 ? 45.894  -17.785  24.507   1.00 203.62 ? 238 LEU B C    1 
ATOM   6887  O O    . LEU B  1 122 ? 47.021  -17.808  25.005   1.00 204.95 ? 238 LEU B O    1 
ATOM   6888  C CB   . LEU B  1 122 ? 44.462  -19.629  25.367   1.00 215.07 ? 238 LEU B CB   1 
ATOM   6889  C CG   . LEU B  1 122 ? 43.769  -20.974  25.168   1.00 218.76 ? 238 LEU B CG   1 
ATOM   6890  C CD1  . LEU B  1 122 ? 43.094  -21.406  26.442   1.00 228.32 ? 238 LEU B CD1  1 
ATOM   6891  C CD2  . LEU B  1 122 ? 42.767  -20.928  24.029   1.00 214.32 ? 238 LEU B CD2  1 
ATOM   6892  H H    . LEU B  1 122 ? 46.271  -20.700  24.125   1.00 188.73 ? 238 LEU B H    1 
ATOM   6893  H HA   . LEU B  1 122 ? 44.488  -18.846  23.478   1.00 187.05 ? 238 LEU B HA   1 
ATOM   6894  H HB2  . LEU B  1 122 ? 45.118  -19.740  26.072   1.00 193.68 ? 238 LEU B HB2  1 
ATOM   6895  H HB3  . LEU B  1 122 ? 43.787  -18.992  25.650   1.00 193.68 ? 238 LEU B HB3  1 
ATOM   6896  H HG   . LEU B  1 122 ? 44.438  -21.640  24.946   1.00 195.75 ? 238 LEU B HG   1 
ATOM   6897  H HD11 . LEU B  1 122 ? 42.661  -22.261  26.294   1.00 204.37 ? 238 LEU B HD11 1 
ATOM   6898  H HD12 . LEU B  1 122 ? 43.763  -21.489  27.140   1.00 204.37 ? 238 LEU B HD12 1 
ATOM   6899  H HD13 . LEU B  1 122 ? 42.436  -20.739  26.692   1.00 204.37 ? 238 LEU B HD13 1 
ATOM   6900  H HD21 . LEU B  1 122 ? 42.352  -21.800  23.938   1.00 189.15 ? 238 LEU B HD21 1 
ATOM   6901  H HD22 . LEU B  1 122 ? 42.093  -20.259  24.229   1.00 189.15 ? 238 LEU B HD22 1 
ATOM   6902  H HD23 . LEU B  1 122 ? 43.231  -20.695  23.210   1.00 189.15 ? 238 LEU B HD23 1 
ATOM   6903  N N    . CYS B  1 123 ? 45.218  -16.668  24.264   1.00 208.46 ? 239 CYS B N    1 
ATOM   6904  C CA   . CYS B  1 123 ? 45.693  -15.350  24.659   1.00 207.18 ? 239 CYS B CA   1 
ATOM   6905  C C    . CYS B  1 123 ? 44.651  -14.734  25.588   1.00 212.76 ? 239 CYS B C    1 
ATOM   6906  O O    . CYS B  1 123 ? 43.474  -14.653  25.235   1.00 212.68 ? 239 CYS B O    1 
ATOM   6907  C CB   . CYS B  1 123 ? 45.927  -14.470  23.428   1.00 199.44 ? 239 CYS B CB   1 
ATOM   6908  S SG   . CYS B  1 123 ? 47.083  -13.097  23.667   1.00 197.07 ? 239 CYS B SG   1 
ATOM   6909  H H    . CYS B  1 123 ? 44.459  -16.649  23.859   1.00 184.20 ? 239 CYS B H    1 
ATOM   6910  H HA   . CYS B  1 123 ? 46.529  -15.436  25.143   1.00 185.97 ? 239 CYS B HA   1 
ATOM   6911  H HB2  . CYS B  1 123 ? 46.279  -15.026  22.715   1.00 180.09 ? 239 CYS B HB2  1 
ATOM   6912  H HB3  . CYS B  1 123 ? 45.077  -14.091  23.155   1.00 180.09 ? 239 CYS B HB3  1 
ATOM   6913  N N    . LYS B  1 124 ? 45.084  -14.317  26.775   1.00 208.24 ? 240 LYS B N    1 
ATOM   6914  C CA   . LYS B  1 124 ? 44.167  -13.836  27.811   1.00 214.95 ? 240 LYS B CA   1 
ATOM   6915  C C    . LYS B  1 124 ? 44.101  -12.307  27.913   1.00 213.23 ? 240 LYS B C    1 
ATOM   6916  O O    . LYS B  1 124 ? 43.222  -11.768  28.588   1.00 218.06 ? 240 LYS B O    1 
ATOM   6917  C CB   . LYS B  1 124 ? 44.565  -14.434  29.162   1.00 223.59 ? 240 LYS B CB   1 
ATOM   6918  C CG   . LYS B  1 124 ? 44.481  -15.954  29.192   1.00 226.83 ? 240 LYS B CG   1 
ATOM   6919  C CD   . LYS B  1 124 ? 44.678  -16.511  30.590   1.00 236.54 ? 240 LYS B CD   1 
ATOM   6920  C CE   . LYS B  1 124 ? 44.477  -18.020  30.610   1.00 240.35 ? 240 LYS B CE   1 
ATOM   6921  N NZ   . LYS B  1 124 ? 44.599  -18.588  31.980   1.00 250.52 ? 240 LYS B NZ   1 
ATOM   6922  H H    . LYS B  1 124 ? 45.911  -14.301  27.009   1.00 330.08 ? 240 LYS B H    1 
ATOM   6923  H HA   . LYS B  1 124 ? 43.274  -14.153  27.602   1.00 331.35 ? 240 LYS B HA   1 
ATOM   6924  H HB2  . LYS B  1 124 ? 45.480  -14.182  29.360   1.00 334.12 ? 240 LYS B HB2  1 
ATOM   6925  H HB3  . LYS B  1 124 ? 43.971  -14.089  29.846   1.00 334.12 ? 240 LYS B HB3  1 
ATOM   6926  H HG2  . LYS B  1 124 ? 43.605  -16.230  28.877   1.00 333.71 ? 240 LYS B HG2  1 
ATOM   6927  H HG3  . LYS B  1 124 ? 45.172  -16.322  28.620   1.00 333.71 ? 240 LYS B HG3  1 
ATOM   6928  H HD2  . LYS B  1 124 ? 45.580  -16.319  30.888   1.00 336.69 ? 240 LYS B HD2  1 
ATOM   6929  H HD3  . LYS B  1 124 ? 44.031  -16.109  31.191   1.00 336.69 ? 240 LYS B HD3  1 
ATOM   6930  H HE2  . LYS B  1 124 ? 43.590  -18.227  30.276   1.00 337.02 ? 240 LYS B HE2  1 
ATOM   6931  H HE3  . LYS B  1 124 ? 45.150  -18.437  30.050   1.00 337.02 ? 240 LYS B HE3  1 
ATOM   6932  H HZ1  . LYS B  1 124 ? 45.408  -18.418  32.309   1.00 339.24 ? 240 LYS B HZ1  1 
ATOM   6933  H HZ2  . LYS B  1 124 ? 43.987  -18.226  32.515   1.00 339.24 ? 240 LYS B HZ2  1 
ATOM   6934  H HZ3  . LYS B  1 124 ? 44.476  -19.469  31.956   1.00 339.24 ? 240 LYS B HZ3  1 
ATOM   6935  N N    . ASN B  1 125 ? 45.033  -11.620  27.254   1.00 202.49 ? 241 ASN B N    1 
ATOM   6936  C CA   . ASN B  1 125 ? 44.988  -10.164  27.117   1.00 199.90 ? 241 ASN B CA   1 
ATOM   6937  C C    . ASN B  1 125 ? 44.856  -9.801   25.646   1.00 191.25 ? 241 ASN B C    1 
ATOM   6938  O O    . ASN B  1 125 ? 45.836  -9.450   24.986   1.00 185.66 ? 241 ASN B O    1 
ATOM   6939  C CB   . ASN B  1 125 ? 46.238  -9.508   27.724   1.00 200.95 ? 241 ASN B CB   1 
ATOM   6940  C CG   . ASN B  1 125 ? 46.055  -9.118   29.181   1.00 209.71 ? 241 ASN B CG   1 
ATOM   6941  O OD1  . ASN B  1 125 ? 44.936  -8.916   29.649   1.00 214.04 ? 241 ASN B OD1  1 
ATOM   6942  N ND2  . ASN B  1 125 ? 47.165  -8.991   29.900   1.00 212.76 ? 241 ASN B ND2  1 
ATOM   6943  H H    . ASN B  1 125 ? 45.713  -11.980  26.871   1.00 223.59 ? 241 ASN B H    1 
ATOM   6944  H HA   . ASN B  1 125 ? 44.210  -9.823   27.585   1.00 225.33 ? 241 ASN B HA   1 
ATOM   6945  H HB2  . ASN B  1 125 ? 46.978  -10.132  27.671   1.00 234.95 ? 241 ASN B HB2  1 
ATOM   6946  H HB3  . ASN B  1 125 ? 46.446  -8.704   27.223   1.00 234.95 ? 241 ASN B HB3  1 
ATOM   6947  H HD21 . ASN B  1 125 ? 47.117  -8.772   30.730   1.00 250.63 ? 241 ASN B HD21 1 
ATOM   6948  H HD22 . ASN B  1 125 ? 47.932  -9.127   29.535   1.00 250.63 ? 241 ASN B HD22 1 
ATOM   6949  N N    . VAL B  1 126 ? 43.631  -9.892   25.139   1.00 199.40 ? 242 VAL B N    1 
ATOM   6950  C CA   . VAL B  1 126 ? 43.362  -9.696   23.720   1.00 192.06 ? 242 VAL B CA   1 
ATOM   6951  C C    . VAL B  1 126 ? 42.771  -8.318   23.441   1.00 190.47 ? 242 VAL B C    1 
ATOM   6952  O O    . VAL B  1 126 ? 41.556  -8.175   23.318   1.00 192.36 ? 242 VAL B O    1 
ATOM   6953  C CB   . VAL B  1 126 ? 42.392  -10.774  23.182   1.00 192.49 ? 242 VAL B CB   1 
ATOM   6954  C CG1  . VAL B  1 126 ? 42.262  -10.672  21.665   1.00 185.04 ? 242 VAL B CG1  1 
ATOM   6955  C CG2  . VAL B  1 126 ? 42.872  -12.157  23.568   1.00 195.34 ? 242 VAL B CG2  1 
ATOM   6956  H H    . VAL B  1 126 ? 42.929  -10.069  25.604   1.00 170.16 ? 242 VAL B H    1 
ATOM   6957  H HA   . VAL B  1 126 ? 44.195  -9.769   23.229   1.00 162.29 ? 242 VAL B HA   1 
ATOM   6958  H HB   . VAL B  1 126 ? 41.515  -10.638  23.572   1.00 156.21 ? 242 VAL B HB   1 
ATOM   6959  H HG11 . VAL B  1 126 ? 41.650  -11.357  21.354   1.00 148.89 ? 242 VAL B HG11 1 
ATOM   6960  H HG12 . VAL B  1 126 ? 41.920  -9.793   21.436   1.00 148.89 ? 242 VAL B HG12 1 
ATOM   6961  H HG13 . VAL B  1 126 ? 43.136  -10.801  21.264   1.00 148.89 ? 242 VAL B HG13 1 
ATOM   6962  H HG21 . VAL B  1 126 ? 42.249  -12.815  23.221   1.00 156.53 ? 242 VAL B HG21 1 
ATOM   6963  H HG22 . VAL B  1 126 ? 43.753  -12.302  23.190   1.00 156.53 ? 242 VAL B HG22 1 
ATOM   6964  H HG23 . VAL B  1 126 ? 42.912  -12.218  24.535   1.00 156.53 ? 242 VAL B HG23 1 
ATOM   6965  N N    . SER B  1 127 ? 43.623  -7.303   23.344   1.00 188.90 ? 243 SER B N    1 
ATOM   6966  C CA   . SER B  1 127 ? 43.171  -5.996   22.881   1.00 186.62 ? 243 SER B CA   1 
ATOM   6967  C C    . SER B  1 127 ? 43.049  -6.057   21.363   1.00 184.42 ? 243 SER B C    1 
ATOM   6968  O O    . SER B  1 127 ? 43.610  -6.958   20.731   1.00 182.23 ? 243 SER B O    1 
ATOM   6969  C CB   . SER B  1 127 ? 44.132  -4.881   23.311   1.00 186.49 ? 243 SER B CB   1 
ATOM   6970  O OG   . SER B  1 127 ? 45.037  -4.554   22.272   1.00 182.59 ? 243 SER B OG   1 
ATOM   6971  H H    . SER B  1 127 ? 44.460  -7.343   23.538   1.00 175.22 ? 243 SER B H    1 
ATOM   6972  H HA   . SER B  1 127 ? 42.295  -5.806   23.252   1.00 176.65 ? 243 SER B HA   1 
ATOM   6973  H HB2  . SER B  1 127 ? 43.616  -4.092   23.539   1.00 185.54 ? 243 SER B HB2  1 
ATOM   6974  H HB3  . SER B  1 127 ? 44.635  -5.181   24.084   1.00 185.54 ? 243 SER B HB3  1 
ATOM   6975  H HG   . SER B  1 127 ? 45.556  -3.943   22.525   1.00 184.84 ? 243 SER B HG   1 
ATOM   6976  N N    . THR B  1 128 ? 42.314  -5.114   20.779   1.00 176.07 ? 244 THR B N    1 
ATOM   6977  C CA   . THR B  1 128 ? 42.100  -5.101   19.335   1.00 175.08 ? 244 THR B CA   1 
ATOM   6978  C C    . THR B  1 128 ? 42.354  -3.719   18.743   1.00 177.67 ? 244 THR B C    1 
ATOM   6979  O O    . THR B  1 128 ? 42.147  -2.696   19.401   1.00 179.11 ? 244 THR B O    1 
ATOM   6980  C CB   . THR B  1 128 ? 40.670  -5.555   18.971   1.00 177.27 ? 244 THR B CB   1 
ATOM   6981  O OG1  . THR B  1 128 ? 40.497  -5.502   17.549   1.00 179.34 ? 244 THR B OG1  1 
ATOM   6982  C CG2  . THR B  1 128 ? 39.630  -4.672   19.638   1.00 179.66 ? 244 THR B CG2  1 
ATOM   6983  H H    . THR B  1 128 ? 41.928  -4.470   21.197   1.00 232.67 ? 244 THR B H    1 
ATOM   6984  H HA   . THR B  1 128 ? 42.722  -5.720   18.921   1.00 226.16 ? 244 THR B HA   1 
ATOM   6985  H HB   . THR B  1 128 ? 40.536  -6.466   19.276   1.00 222.31 ? 244 THR B HB   1 
ATOM   6986  H HG1  . THR B  1 128 ? 41.051  -6.009   17.173   1.00 216.42 ? 244 THR B HG1  1 
ATOM   6987  H HG21 . THR B  1 128 ? 38.739  -4.971   19.398   1.00 228.95 ? 244 THR B HG21 1 
ATOM   6988  H HG22 . THR B  1 128 ? 39.728  -4.714   20.602   1.00 228.95 ? 244 THR B HG22 1 
ATOM   6989  H HG23 . THR B  1 128 ? 39.742  -3.752   19.349   1.00 228.95 ? 244 THR B HG23 1 
ATOM   6990  N N    . VAL B  1 129 ? 42.807  -3.711   17.492   1.00 155.81 ? 245 VAL B N    1 
ATOM   6991  C CA   . VAL B  1 129 ? 43.129  -2.482   16.776   1.00 156.78 ? 245 VAL B CA   1 
ATOM   6992  C C    . VAL B  1 129 ? 42.571  -2.522   15.357   1.00 159.35 ? 245 VAL B C    1 
ATOM   6993  O O    . VAL B  1 129 ? 42.020  -3.538   14.923   1.00 159.19 ? 245 VAL B O    1 
ATOM   6994  C CB   . VAL B  1 129 ? 44.653  -2.251   16.704   1.00 154.51 ? 245 VAL B CB   1 
ATOM   6995  C CG1  . VAL B  1 129 ? 45.214  -1.924   18.076   1.00 153.42 ? 245 VAL B CG1  1 
ATOM   6996  C CG2  . VAL B  1 129 ? 45.349  -3.468   16.108   1.00 151.64 ? 245 VAL B CG2  1 
ATOM   6997  H H    . VAL B  1 129 ? 42.940  -4.422   17.027   1.00 152.86 ? 245 VAL B H    1 
ATOM   6998  H HA   . VAL B  1 129 ? 42.730  -1.728   17.238   1.00 155.05 ? 245 VAL B HA   1 
ATOM   6999  H HB   . VAL B  1 129 ? 44.828  -1.494   16.123   1.00 156.05 ? 245 VAL B HB   1 
ATOM   7000  H HG11 . VAL B  1 129 ? 46.171  -1.784   18.000   1.00 168.75 ? 245 VAL B HG11 1 
ATOM   7001  H HG12 . VAL B  1 129 ? 44.786  -1.119   18.408   1.00 168.75 ? 245 VAL B HG12 1 
ATOM   7002  H HG13 . VAL B  1 129 ? 45.034  -2.666   18.675   1.00 168.75 ? 245 VAL B HG13 1 
ATOM   7003  H HG21 . VAL B  1 129 ? 46.304  -3.299   16.073   1.00 148.36 ? 245 VAL B HG21 1 
ATOM   7004  H HG22 . VAL B  1 129 ? 45.169  -4.239   16.669   1.00 148.36 ? 245 VAL B HG22 1 
ATOM   7005  H HG23 . VAL B  1 129 ? 45.007  -3.621   15.214   1.00 148.36 ? 245 VAL B HG23 1 
ATOM   7006  N N    . GLN B  1 130 ? 42.726  -1.410   14.642   1.00 143.22 ? 246 GLN B N    1 
ATOM   7007  C CA   . GLN B  1 130 ? 42.273  -1.303   13.260   1.00 142.10 ? 246 GLN B CA   1 
ATOM   7008  C C    . GLN B  1 130 ? 43.438  -1.526   12.302   1.00 141.04 ? 246 GLN B C    1 
ATOM   7009  O O    . GLN B  1 130 ? 43.233  -1.813   11.122   1.00 141.77 ? 246 GLN B O    1 
ATOM   7010  C CB   . GLN B  1 130 ? 41.632  0.067    13.010   1.00 143.93 ? 246 GLN B CB   1 
ATOM   7011  C CG   . GLN B  1 130 ? 40.718  0.110    11.794   1.00 144.31 ? 246 GLN B CG   1 
ATOM   7012  C CD   . GLN B  1 130 ? 39.461  -0.718   11.979   1.00 145.36 ? 246 GLN B CD   1 
ATOM   7013  O OE1  . GLN B  1 130 ? 38.859  -0.720   13.053   1.00 148.35 ? 246 GLN B OE1  1 
ATOM   7014  N NE2  . GLN B  1 130 ? 39.064  -1.436   10.934   1.00 143.71 ? 246 GLN B NE2  1 
ATOM   7015  H H    . GLN B  1 130 ? 43.096  -0.694   14.941   1.00 117.52 ? 246 GLN B H    1 
ATOM   7016  H HA   . GLN B  1 130 ? 41.605  -1.986   13.089   1.00 107.23 ? 246 GLN B HA   1 
ATOM   7017  H HB2  . GLN B  1 130 ? 41.103  0.310    13.787   1.00 107.06 ? 246 GLN B HB2  1 
ATOM   7018  H HB3  . GLN B  1 130 ? 42.335  0.720    12.875   1.00 107.06 ? 246 GLN B HB3  1 
ATOM   7019  H HG2  . GLN B  1 130 ? 40.451  1.028    11.632   1.00 109.02 ? 246 GLN B HG2  1 
ATOM   7020  H HG3  . GLN B  1 130 ? 41.196  -0.238   11.026   1.00 109.02 ? 246 GLN B HG3  1 
ATOM   7021  H HE21 . GLN B  1 130 ? 38.356  -1.922   10.990   1.00 106.78 ? 246 GLN B HE21 1 
ATOM   7022  H HE22 . GLN B  1 130 ? 39.513  -1.414   10.201   1.00 106.78 ? 246 GLN B HE22 1 
ATOM   7023  N N    . CYS B  1 131 ? 44.660  -1.399   12.817   1.00 146.37 ? 247 CYS B N    1 
ATOM   7024  C CA   . CYS B  1 131 ? 45.856  -1.528   11.992   1.00 145.04 ? 247 CYS B CA   1 
ATOM   7025  C C    . CYS B  1 131 ? 47.078  -1.977   12.794   1.00 140.85 ? 247 CYS B C    1 
ATOM   7026  O O    . CYS B  1 131 ? 47.134  -1.809   14.012   1.00 139.33 ? 247 CYS B O    1 
ATOM   7027  C CB   . CYS B  1 131 ? 46.152  -0.196   11.296   1.00 146.58 ? 247 CYS B CB   1 
ATOM   7028  S SG   . CYS B  1 131 ? 46.602  1.161    12.407   1.00 146.82 ? 247 CYS B SG   1 
ATOM   7029  H H    . CYS B  1 131 ? 44.822  -1.237   13.646   1.00 101.11 ? 247 CYS B H    1 
ATOM   7030  H HA   . CYS B  1 131 ? 45.692  -2.192   11.304   1.00 93.80  ? 247 CYS B HA   1 
ATOM   7031  H HB2  . CYS B  1 131 ? 46.890  -0.327   10.680   1.00 88.66  ? 247 CYS B HB2  1 
ATOM   7032  H HB3  . CYS B  1 131 ? 45.362  0.078    10.804   1.00 88.66  ? 247 CYS B HB3  1 
ATOM   7033  N N    . THR B  1 132 ? 48.057  -2.546   12.097   1.00 147.51 ? 248 THR B N    1 
ATOM   7034  C CA   . THR B  1 132 ? 49.266  -3.064   12.733   1.00 141.96 ? 248 THR B CA   1 
ATOM   7035  C C    . THR B  1 132 ? 50.282  -1.962   13.015   1.00 140.26 ? 248 THR B C    1 
ATOM   7036  O O    . THR B  1 132 ? 50.056  -0.799   12.689   1.00 143.82 ? 248 THR B O    1 
ATOM   7037  C CB   . THR B  1 132 ? 49.940  -4.130   11.855   1.00 139.00 ? 248 THR B CB   1 
ATOM   7038  O OG1  . THR B  1 132 ? 50.225  -3.566   10.568   1.00 141.03 ? 248 THR B OG1  1 
ATOM   7039  C CG2  . THR B  1 132 ? 49.038  -5.354   11.690   1.00 140.04 ? 248 THR B CG2  1 
ATOM   7040  H H    . THR B  1 132 ? 48.046  -2.645   11.243   1.00 96.70  ? 248 THR B H    1 
ATOM   7041  H HA   . THR B  1 132 ? 49.027  -3.476   13.578   1.00 102.84 ? 248 THR B HA   1 
ATOM   7042  H HB   . THR B  1 132 ? 50.768  -4.414   12.272   1.00 95.88  ? 248 THR B HB   1 
ATOM   7043  H HG1  . THR B  1 132 ? 50.594  -4.140   10.079   1.00 87.70  ? 248 THR B HG1  1 
ATOM   7044  H HG21 . THR B  1 132 ? 49.477  -6.016   11.134   1.00 91.90  ? 248 THR B HG21 1 
ATOM   7045  H HG22 . THR B  1 132 ? 48.849  -5.745   12.557   1.00 91.90  ? 248 THR B HG22 1 
ATOM   7046  H HG23 . THR B  1 132 ? 48.202  -5.096   11.272   1.00 91.90  ? 248 THR B HG23 1 
ATOM   7047  N N    . HIS B  1 133 ? 51.408  -2.341   13.613   1.00 159.42 ? 249 HIS B N    1 
ATOM   7048  C CA   . HIS B  1 133 ? 52.480  -1.400   13.921   1.00 156.30 ? 249 HIS B CA   1 
ATOM   7049  C C    . HIS B  1 133 ? 53.364  -1.163   12.704   1.00 153.07 ? 249 HIS B C    1 
ATOM   7050  O O    . HIS B  1 133 ? 53.110  -1.705   11.630   1.00 153.96 ? 249 HIS B O    1 
ATOM   7051  C CB   . HIS B  1 133 ? 53.321  -1.914   15.095   1.00 149.88 ? 249 HIS B CB   1 
ATOM   7052  C CG   . HIS B  1 133 ? 52.989  -1.263   16.401   1.00 151.65 ? 249 HIS B CG   1 
ATOM   7053  N ND1  . HIS B  1 133 ? 53.560  -0.075   16.807   1.00 151.25 ? 249 HIS B ND1  1 
ATOM   7054  C CD2  . HIS B  1 133 ? 52.141  -1.631   17.390   1.00 153.51 ? 249 HIS B CD2  1 
ATOM   7055  C CE1  . HIS B  1 133 ? 53.078  0.259    17.991   1.00 153.30 ? 249 HIS B CE1  1 
ATOM   7056  N NE2  . HIS B  1 133 ? 52.215  -0.667   18.367   1.00 154.46 ? 249 HIS B NE2  1 
ATOM   7057  H H    . HIS B  1 133 ? 51.576  -3.150   13.853   1.00 183.62 ? 249 HIS B H    1 
ATOM   7058  H HA   . HIS B  1 133 ? 52.091  -0.550   14.180   1.00 187.08 ? 249 HIS B HA   1 
ATOM   7059  H HB2  . HIS B  1 133 ? 53.173  -2.868   15.192   1.00 195.92 ? 249 HIS B HB2  1 
ATOM   7060  H HB3  . HIS B  1 133 ? 54.257  -1.744   14.907   1.00 195.92 ? 249 HIS B HB3  1 
ATOM   7061  H HD1  . HIS B  1 133 ? 54.139  0.377    16.360   1.00 219.82 ? 249 HIS B HD1  1 
ATOM   7062  H HD2  . HIS B  1 133 ? 51.608  -2.392   17.405   1.00 216.47 ? 249 HIS B HD2  1 
ATOM   7063  H HE1  . HIS B  1 133 ? 53.308  1.018    18.477   1.00 229.98 ? 249 HIS B HE1  1 
ATOM   7064  H HE2  . HIS B  1 133 ? 51.773  -0.668   19.104   1.00 228.26 ? 249 HIS B HE2  1 
ATOM   7065  N N    . GLY B  1 134 ? 54.399  -0.346   12.875   1.00 161.59 ? 250 GLY B N    1 
ATOM   7066  C CA   . GLY B  1 134 ? 55.327  -0.053   11.799   1.00 153.97 ? 250 GLY B CA   1 
ATOM   7067  C C    . GLY B  1 134 ? 56.208  -1.241   11.463   1.00 144.95 ? 250 GLY B C    1 
ATOM   7068  O O    . GLY B  1 134 ? 57.078  -1.619   12.248   1.00 139.05 ? 250 GLY B O    1 
ATOM   7069  H H    . GLY B  1 134 ? 54.583  0.054    13.614   1.00 151.50 ? 250 GLY B H    1 
ATOM   7070  H HA2  . GLY B  1 134 ? 54.832  0.198    11.003   1.00 143.11 ? 250 GLY B HA2  1 
ATOM   7071  H HA3  . GLY B  1 134 ? 55.896  0.690    12.055   1.00 143.11 ? 250 GLY B HA3  1 
ATOM   7072  N N    . ILE B  1 135 ? 55.978  -1.824   10.289   1.00 153.32 ? 251 ILE B N    1 
ATOM   7073  C CA   . ILE B  1 135 ? 56.732  -2.987   9.825    1.00 145.71 ? 251 ILE B CA   1 
ATOM   7074  C C    . ILE B  1 135 ? 57.788  -2.584   8.798    1.00 134.02 ? 251 ILE B C    1 
ATOM   7075  O O    . ILE B  1 135 ? 57.458  -2.057   7.739    1.00 132.35 ? 251 ILE B O    1 
ATOM   7076  C CB   . ILE B  1 135 ? 55.799  -4.042   9.194    1.00 151.97 ? 251 ILE B CB   1 
ATOM   7077  C CG1  . ILE B  1 135 ? 54.742  -4.487   10.205   1.00 161.43 ? 251 ILE B CG1  1 
ATOM   7078  C CG2  . ILE B  1 135 ? 56.598  -5.249   8.707    1.00 145.27 ? 251 ILE B CG2  1 
ATOM   7079  C CD1  . ILE B  1 135 ? 53.599  -5.255   9.593    1.00 168.71 ? 251 ILE B CD1  1 
ATOM   7080  H H    . ILE B  1 135 ? 55.378  -1.560   9.733    1.00 184.25 ? 251 ILE B H    1 
ATOM   7081  H HA   . ILE B  1 135 ? 57.184  -3.396   10.580   1.00 184.71 ? 251 ILE B HA   1 
ATOM   7082  H HB   . ILE B  1 135 ? 55.350  -3.642   8.433    1.00 180.24 ? 251 ILE B HB   1 
ATOM   7083  H HG12 . ILE B  1 135 ? 55.163  -5.059   10.866   1.00 185.42 ? 251 ILE B HG12 1 
ATOM   7084  H HG13 . ILE B  1 135 ? 54.373  -3.701   10.638   1.00 185.42 ? 251 ILE B HG13 1 
ATOM   7085  H HG21 . ILE B  1 135 ? 55.989  -5.894   8.316    1.00 180.79 ? 251 ILE B HG21 1 
ATOM   7086  H HG22 . ILE B  1 135 ? 57.241  -4.955   8.042    1.00 180.79 ? 251 ILE B HG22 1 
ATOM   7087  H HG23 . ILE B  1 135 ? 57.061  -5.646   9.462    1.00 180.79 ? 251 ILE B HG23 1 
ATOM   7088  H HD11 . ILE B  1 135 ? 52.974  -5.501   10.293   1.00 181.29 ? 251 ILE B HD11 1 
ATOM   7089  H HD12 . ILE B  1 135 ? 53.158  -4.693   8.937    1.00 181.29 ? 251 ILE B HD12 1 
ATOM   7090  H HD13 . ILE B  1 135 ? 53.949  -6.052   9.165    1.00 181.29 ? 251 ILE B HD13 1 
ATOM   7091  N N    . ARG B  1 136 ? 59.054  -2.843   9.113    1.00 155.29 ? 252 ARG B N    1 
ATOM   7092  C CA   . ARG B  1 136 ? 60.151  -2.577   8.185    1.00 145.77 ? 252 ARG B CA   1 
ATOM   7093  C C    . ARG B  1 136 ? 60.294  -3.724   7.173    1.00 143.30 ? 252 ARG B C    1 
ATOM   7094  O O    . ARG B  1 136 ? 60.649  -4.834   7.560    1.00 144.32 ? 252 ARG B O    1 
ATOM   7095  C CB   . ARG B  1 136 ? 61.464  -2.394   8.952    1.00 143.86 ? 252 ARG B CB   1 
ATOM   7096  C CG   . ARG B  1 136 ? 61.468  -1.240   9.948    1.00 147.32 ? 252 ARG B CG   1 
ATOM   7097  C CD   . ARG B  1 136 ? 61.910  0.076    9.319    1.00 145.47 ? 252 ARG B CD   1 
ATOM   7098  N NE   . ARG B  1 136 ? 62.277  1.049    10.343   1.00 149.44 ? 252 ARG B NE   1 
ATOM   7099  C CZ   . ARG B  1 136 ? 62.598  2.317    10.104   1.00 149.55 ? 252 ARG B CZ   1 
ATOM   7100  N NH1  . ARG B  1 136 ? 62.595  2.791    8.865    1.00 145.74 ? 252 ARG B NH1  1 
ATOM   7101  N NH2  . ARG B  1 136 ? 62.919  3.117    11.112   1.00 153.80 ? 252 ARG B NH2  1 
ATOM   7102  H H    . ARG B  1 136 ? 59.306  -3.176   9.865    1.00 288.69 ? 252 ARG B H    1 
ATOM   7103  H HA   . ARG B  1 136 ? 59.967  -1.760   7.696    1.00 286.02 ? 252 ARG B HA   1 
ATOM   7104  H HB2  . ARG B  1 136 ? 61.650  -3.208   9.445    1.00 293.36 ? 252 ARG B HB2  1 
ATOM   7105  H HB3  . ARG B  1 136 ? 62.175  -2.231   8.312    1.00 293.36 ? 252 ARG B HB3  1 
ATOM   7106  H HG2  . ARG B  1 136 ? 60.571  -1.120   10.297   1.00 302.09 ? 252 ARG B HG2  1 
ATOM   7107  H HG3  . ARG B  1 136 ? 62.080  -1.448   10.671   1.00 302.09 ? 252 ARG B HG3  1 
ATOM   7108  H HD2  . ARG B  1 136 ? 62.683  -0.081   8.755    1.00 299.02 ? 252 ARG B HD2  1 
ATOM   7109  H HD3  . ARG B  1 136 ? 61.180  0.443    8.796    1.00 299.02 ? 252 ARG B HD3  1 
ATOM   7110  H HE   . ARG B  1 136 ? 62.287  0.783    11.161   1.00 305.71 ? 252 ARG B HE   1 
ATOM   7111  H HH11 . ARG B  1 136 ? 62.388  2.276    8.208    1.00 320.50 ? 252 ARG B HH11 1 
ATOM   7112  H HH12 . ARG B  1 136 ? 62.803  3.612    8.719    1.00 320.50 ? 252 ARG B HH12 1 
ATOM   7113  H HH21 . ARG B  1 136 ? 62.921  2.815    11.917   1.00 322.63 ? 252 ARG B HH21 1 
ATOM   7114  H HH22 . ARG B  1 136 ? 63.125  3.938    10.960   1.00 322.63 ? 252 ARG B HH22 1 
ATOM   7115  N N    . PRO B  1 137 ? 60.024  -3.467   5.879    1.00 138.11 ? 253 PRO B N    1 
ATOM   7116  C CA   . PRO B  1 137 ? 60.111  -4.561   4.901    1.00 137.02 ? 253 PRO B CA   1 
ATOM   7117  C C    . PRO B  1 137 ? 61.553  -4.951   4.561    1.00 130.91 ? 253 PRO B C    1 
ATOM   7118  O O    . PRO B  1 137 ? 61.960  -4.893   3.399    1.00 126.46 ? 253 PRO B O    1 
ATOM   7119  C CB   . PRO B  1 137 ? 59.378  -3.992   3.668    1.00 135.69 ? 253 PRO B CB   1 
ATOM   7120  C CG   . PRO B  1 137 ? 58.676  -2.770   4.145    1.00 138.40 ? 253 PRO B CG   1 
ATOM   7121  C CD   . PRO B  1 137 ? 59.502  -2.241   5.261    1.00 136.80 ? 253 PRO B CD   1 
ATOM   7122  H HA   . PRO B  1 137 ? 59.635  -5.341   5.226    1.00 132.35 ? 253 PRO B HA   1 
ATOM   7123  H HB2  . PRO B  1 137 ? 60.024  -3.768   2.980    1.00 125.19 ? 253 PRO B HB2  1 
ATOM   7124  H HB3  . PRO B  1 137 ? 58.741  -4.645   3.339    1.00 125.19 ? 253 PRO B HB3  1 
ATOM   7125  H HG2  . PRO B  1 137 ? 58.623  -2.123   3.424    1.00 122.58 ? 253 PRO B HG2  1 
ATOM   7126  H HG3  . PRO B  1 137 ? 57.789  -3.005   4.460    1.00 122.58 ? 253 PRO B HG3  1 
ATOM   7127  H HD2  . PRO B  1 137 ? 60.228  -1.696   4.919    1.00 128.44 ? 253 PRO B HD2  1 
ATOM   7128  H HD3  . PRO B  1 137 ? 58.951  -1.750   5.890    1.00 128.44 ? 253 PRO B HD3  1 
ATOM   7129  N N    . VAL B  1 138 ? 62.315  -5.364   5.568    1.00 137.78 ? 254 VAL B N    1 
ATOM   7130  C CA   . VAL B  1 138 ? 63.704  -5.750   5.355    1.00 137.43 ? 254 VAL B CA   1 
ATOM   7131  C C    . VAL B  1 138 ? 63.799  -7.157   4.774    1.00 137.17 ? 254 VAL B C    1 
ATOM   7132  O O    . VAL B  1 138 ? 63.358  -8.128   5.395    1.00 141.74 ? 254 VAL B O    1 
ATOM   7133  C CB   . VAL B  1 138 ? 64.517  -5.702   6.659    1.00 141.20 ? 254 VAL B CB   1 
ATOM   7134  C CG1  . VAL B  1 138 ? 65.984  -6.010   6.372    1.00 141.31 ? 254 VAL B CG1  1 
ATOM   7135  C CG2  . VAL B  1 138 ? 64.379  -4.346   7.335    1.00 142.37 ? 254 VAL B CG2  1 
ATOM   7136  H H    . VAL B  1 138 ? 62.051  -5.430   6.384    1.00 263.91 ? 254 VAL B H    1 
ATOM   7137  H HA   . VAL B  1 138 ? 64.110  -5.135   4.724    1.00 269.52 ? 254 VAL B HA   1 
ATOM   7138  H HB   . VAL B  1 138 ? 64.181  -6.379   7.268    1.00 278.33 ? 254 VAL B HB   1 
ATOM   7139  H HG11 . VAL B  1 138 ? 66.482  -5.976   7.203    1.00 284.21 ? 254 VAL B HG11 1 
ATOM   7140  H HG12 . VAL B  1 138 ? 66.050  -6.896   5.982    1.00 284.21 ? 254 VAL B HG12 1 
ATOM   7141  H HG13 . VAL B  1 138 ? 66.329  -5.348   5.752    1.00 284.21 ? 254 VAL B HG13 1 
ATOM   7142  H HG21 . VAL B  1 138 ? 64.901  -4.346   8.152    1.00 279.04 ? 254 VAL B HG21 1 
ATOM   7143  H HG22 . VAL B  1 138 ? 64.706  -3.659   6.733    1.00 279.04 ? 254 VAL B HG22 1 
ATOM   7144  H HG23 . VAL B  1 138 ? 63.444  -4.189   7.540    1.00 279.04 ? 254 VAL B HG23 1 
ATOM   7145  N N    . VAL B  1 139 ? 64.387  -7.259   3.586    1.00 136.45 ? 255 VAL B N    1 
ATOM   7146  C CA   . VAL B  1 139 ? 64.637  -8.551   2.951    1.00 138.18 ? 255 VAL B CA   1 
ATOM   7147  C C    . VAL B  1 139 ? 66.034  -9.032   3.315    1.00 139.03 ? 255 VAL B C    1 
ATOM   7148  O O    . VAL B  1 139 ? 67.029  -8.400   2.960    1.00 138.09 ? 255 VAL B O    1 
ATOM   7149  C CB   . VAL B  1 139 ? 64.503  -8.472   1.415    1.00 135.65 ? 255 VAL B CB   1 
ATOM   7150  C CG1  . VAL B  1 139 ? 64.719  -9.844   0.779    1.00 140.02 ? 255 VAL B CG1  1 
ATOM   7151  C CG2  . VAL B  1 139 ? 63.139  -7.920   1.033    1.00 135.54 ? 255 VAL B CG2  1 
ATOM   7152  H H    . VAL B  1 139 ? 64.654  -6.586   3.121    1.00 187.27 ? 255 VAL B H    1 
ATOM   7153  H HA   . VAL B  1 139 ? 63.995  -9.200   3.280    1.00 190.28 ? 255 VAL B HA   1 
ATOM   7154  H HB   . VAL B  1 139 ? 65.180  -7.870   1.068    1.00 186.68 ? 255 VAL B HB   1 
ATOM   7155  H HG11 . VAL B  1 139 ? 64.628  -9.764   -0.183   1.00 192.05 ? 255 VAL B HG11 1 
ATOM   7156  H HG12 . VAL B  1 139 ? 65.608  -10.159  1.004    1.00 192.05 ? 255 VAL B HG12 1 
ATOM   7157  H HG13 . VAL B  1 139 ? 64.053  -10.460  1.124    1.00 192.05 ? 255 VAL B HG13 1 
ATOM   7158  H HG21 . VAL B  1 139 ? 63.075  -7.878   0.065    1.00 179.37 ? 255 VAL B HG21 1 
ATOM   7159  H HG22 . VAL B  1 139 ? 62.451  -8.506   1.385    1.00 179.37 ? 255 VAL B HG22 1 
ATOM   7160  H HG23 . VAL B  1 139 ? 63.041  -7.031   1.409    1.00 179.37 ? 255 VAL B HG23 1 
ATOM   7161  N N    . SER B  1 140 ? 66.107  -10.150  4.030    1.00 138.96 ? 256 SER B N    1 
ATOM   7162  C CA   . SER B  1 140 ? 67.387  -10.663  4.499    1.00 141.09 ? 256 SER B CA   1 
ATOM   7163  C C    . SER B  1 140 ? 67.309  -12.132  4.896    1.00 146.45 ? 256 SER B C    1 
ATOM   7164  O O    . SER B  1 140 ? 66.221  -12.697  5.032    1.00 149.62 ? 256 SER B O    1 
ATOM   7165  C CB   . SER B  1 140 ? 67.884  -9.830   5.687    1.00 143.30 ? 256 SER B CB   1 
ATOM   7166  O OG   . SER B  1 140 ? 67.027  -9.969   6.808    1.00 145.53 ? 256 SER B OG   1 
ATOM   7167  H H    . SER B  1 140 ? 65.429  -10.629  4.257    1.00 149.55 ? 256 SER B H    1 
ATOM   7168  H HA   . SER B  1 140 ? 68.038  -10.581  3.785    1.00 158.09 ? 256 SER B HA   1 
ATOM   7169  H HB2  . SER B  1 140 ? 68.773  -10.132  5.932    1.00 161.55 ? 256 SER B HB2  1 
ATOM   7170  H HB3  . SER B  1 140 ? 67.912  -8.897   5.426    1.00 161.55 ? 256 SER B HB3  1 
ATOM   7171  H HG   . SER B  1 140 ? 67.314  -9.507   7.448    1.00 164.48 ? 256 SER B HG   1 
ATOM   7172  N N    . THR B  1 141 ? 68.480  -12.740  5.072    1.00 146.77 ? 257 THR B N    1 
ATOM   7173  C CA   . THR B  1 141 ? 68.586  -14.125  5.516    1.00 152.86 ? 257 THR B CA   1 
ATOM   7174  C C    . THR B  1 141 ? 69.384  -14.199  6.809    1.00 155.12 ? 257 THR B C    1 
ATOM   7175  O O    . THR B  1 141 ? 70.179  -13.305  7.113    1.00 155.53 ? 257 THR B O    1 
ATOM   7176  C CB   . THR B  1 141 ? 69.262  -15.019  4.458    1.00 156.36 ? 257 THR B CB   1 
ATOM   7177  O OG1  . THR B  1 141 ? 70.607  -14.577  4.243    1.00 154.48 ? 257 THR B OG1  1 
ATOM   7178  C CG2  . THR B  1 141 ? 68.503  -14.977  3.141    1.00 155.87 ? 257 THR B CG2  1 
ATOM   7179  H H    . THR B  1 141 ? 69.241  -12.362  4.937    1.00 176.87 ? 257 THR B H    1 
ATOM   7180  H HA   . THR B  1 141 ? 67.697  -14.474  5.686    1.00 184.32 ? 257 THR B HA   1 
ATOM   7181  H HB   . THR B  1 141 ? 69.273  -15.936  4.774    1.00 190.28 ? 257 THR B HB   1 
ATOM   7182  H HG1  . THR B  1 141 ? 70.608  -13.782  3.972    1.00 193.88 ? 257 THR B HG1  1 
ATOM   7183  H HG21 . THR B  1 141 ? 68.941  -15.545  2.488    1.00 184.09 ? 257 THR B HG21 1 
ATOM   7184  H HG22 . THR B  1 141 ? 67.594  -15.291  3.273    1.00 184.09 ? 257 THR B HG22 1 
ATOM   7185  H HG23 . THR B  1 141 ? 68.476  -14.069  2.803    1.00 184.09 ? 257 THR B HG23 1 
ATOM   7186  N N    . GLN B  1 142 ? 69.149  -15.263  7.569    1.00 157.56 ? 258 GLN B N    1 
ATOM   7187  C CA   . GLN B  1 142 ? 69.858  -15.525  8.819    1.00 163.21 ? 258 GLN B CA   1 
ATOM   7188  C C    . GLN B  1 142 ? 69.572  -14.479  9.897    1.00 163.76 ? 258 GLN B C    1 
ATOM   7189  O O    . GLN B  1 142 ? 69.087  -14.821  10.977   1.00 167.26 ? 258 GLN B O    1 
ATOM   7190  C CB   . GLN B  1 142 ? 71.366  -15.618  8.571    1.00 165.76 ? 258 GLN B CB   1 
ATOM   7191  C CG   . GLN B  1 142 ? 71.744  -16.640  7.509    1.00 166.01 ? 258 GLN B CG   1 
ATOM   7192  C CD   . GLN B  1 142 ? 73.215  -17.016  7.544    1.00 170.61 ? 258 GLN B CD   1 
ATOM   7193  O OE1  . GLN B  1 142 ? 74.014  -16.394  8.242    1.00 173.28 ? 258 GLN B OE1  1 
ATOM   7194  N NE2  . GLN B  1 142 ? 73.575  -18.056  6.800    1.00 172.30 ? 258 GLN B NE2  1 
ATOM   7195  H H    . GLN B  1 142 ? 68.566  -15.866  7.376    1.00 106.44 ? 258 GLN B H    1 
ATOM   7196  H HA   . GLN B  1 142 ? 69.566  -16.384  9.163    1.00 116.43 ? 258 GLN B HA   1 
ATOM   7197  H HB2  . GLN B  1 142 ? 71.689  -14.751  8.279    1.00 126.36 ? 258 GLN B HB2  1 
ATOM   7198  H HB3  . GLN B  1 142 ? 71.805  -15.872  9.398    1.00 126.36 ? 258 GLN B HB3  1 
ATOM   7199  H HG2  . GLN B  1 142 ? 71.226  -17.448  7.650    1.00 128.79 ? 258 GLN B HG2  1 
ATOM   7200  H HG3  . GLN B  1 142 ? 71.551  -16.271  6.633    1.00 128.79 ? 258 GLN B HG3  1 
ATOM   7201  H HE21 . GLN B  1 142 ? 74.396  -18.310  6.784    1.00 145.03 ? 258 GLN B HE21 1 
ATOM   7202  H HE22 . GLN B  1 142 ? 72.986  -18.475  6.333    1.00 145.03 ? 258 GLN B HE22 1 
ATOM   7203  N N    . LEU B  1 143 ? 69.876  -13.215  9.611    1.00 166.43 ? 259 LEU B N    1 
ATOM   7204  C CA   . LEU B  1 143 ? 69.667  -12.133  10.575   1.00 167.26 ? 259 LEU B CA   1 
ATOM   7205  C C    . LEU B  1 143 ? 68.440  -11.280  10.240   1.00 162.53 ? 259 LEU B C    1 
ATOM   7206  O O    . LEU B  1 143 ? 68.215  -10.925  9.081    1.00 157.75 ? 259 LEU B O    1 
ATOM   7207  C CB   . LEU B  1 143 ? 70.907  -11.237  10.641   1.00 168.80 ? 259 LEU B CB   1 
ATOM   7208  C CG   . LEU B  1 143 ? 72.237  -11.915  10.975   1.00 174.56 ? 259 LEU B CG   1 
ATOM   7209  C CD1  . LEU B  1 143 ? 73.343  -10.878  11.029   1.00 176.14 ? 259 LEU B CD1  1 
ATOM   7210  C CD2  . LEU B  1 143 ? 72.152  -12.678  12.290   1.00 180.84 ? 259 LEU B CD2  1 
ATOM   7211  H H    . LEU B  1 143 ? 70.207  -12.954  8.861    1.00 187.11 ? 259 LEU B H    1 
ATOM   7212  H HA   . LEU B  1 143 ? 69.531  -12.518  11.454   1.00 188.69 ? 259 LEU B HA   1 
ATOM   7213  H HB2  . LEU B  1 143 ? 71.015  -10.806  9.779    1.00 196.70 ? 259 LEU B HB2  1 
ATOM   7214  H HB3  . LEU B  1 143 ? 70.754  -10.560  11.319   1.00 196.70 ? 259 LEU B HB3  1 
ATOM   7215  H HG   . LEU B  1 143 ? 72.453  -12.549  10.273   1.00 209.42 ? 259 LEU B HG   1 
ATOM   7216  H HD11 . LEU B  1 143 ? 74.180  -11.321  11.241   1.00 212.49 ? 259 LEU B HD11 1 
ATOM   7217  H HD12 . LEU B  1 143 ? 73.409  -10.442  10.165   1.00 212.49 ? 259 LEU B HD12 1 
ATOM   7218  H HD13 . LEU B  1 143 ? 73.130  -10.226  11.714   1.00 212.49 ? 259 LEU B HD13 1 
ATOM   7219  H HD21 . LEU B  1 143 ? 73.010  -13.094  12.469   1.00 218.40 ? 259 LEU B HD21 1 
ATOM   7220  H HD22 . LEU B  1 143 ? 71.931  -12.057  13.002   1.00 218.40 ? 259 LEU B HD22 1 
ATOM   7221  H HD23 . LEU B  1 143 ? 71.464  -13.357  12.217   1.00 218.40 ? 259 LEU B HD23 1 
ATOM   7222  N N    . LEU B  1 144 ? 67.652  -10.959  11.265   1.00 160.33 ? 260 LEU B N    1 
ATOM   7223  C CA   . LEU B  1 144 ? 66.520  -10.043  11.133   1.00 156.98 ? 260 LEU B CA   1 
ATOM   7224  C C    . LEU B  1 144 ? 66.945  -8.642   11.557   1.00 157.27 ? 260 LEU B C    1 
ATOM   7225  O O    . LEU B  1 144 ? 67.483  -8.459   12.649   1.00 161.85 ? 260 LEU B O    1 
ATOM   7226  C CB   . LEU B  1 144 ? 65.335  -10.517  11.977   1.00 159.27 ? 260 LEU B CB   1 
ATOM   7227  C CG   . LEU B  1 144 ? 64.735  -11.871  11.595   1.00 159.31 ? 260 LEU B CG   1 
ATOM   7228  C CD1  . LEU B  1 144 ? 63.750  -12.342  12.651   1.00 162.93 ? 260 LEU B CD1  1 
ATOM   7229  C CD2  . LEU B  1 144 ? 64.061  -11.797  10.234   1.00 154.26 ? 260 LEU B CD2  1 
ATOM   7230  H H    . LEU B  1 144 ? 67.756  -11.265  12.062   1.00 183.48 ? 260 LEU B H    1 
ATOM   7231  H HA   . LEU B  1 144 ? 66.240  -10.010  10.205   1.00 174.23 ? 260 LEU B HA   1 
ATOM   7232  H HB2  . LEU B  1 144 ? 65.625  -10.580  12.901   1.00 173.38 ? 260 LEU B HB2  1 
ATOM   7233  H HB3  . LEU B  1 144 ? 64.627  -9.857   11.906   1.00 173.38 ? 260 LEU B HB3  1 
ATOM   7234  H HG   . LEU B  1 144 ? 65.449  -12.527  11.540   1.00 169.76 ? 260 LEU B HG   1 
ATOM   7235  H HD11 . LEU B  1 144 ? 63.387  -13.201  12.383   1.00 169.99 ? 260 LEU B HD11 1 
ATOM   7236  H HD12 . LEU B  1 144 ? 64.213  -12.429  13.499   1.00 169.99 ? 260 LEU B HD12 1 
ATOM   7237  H HD13 . LEU B  1 144 ? 63.036  -11.690  12.729   1.00 169.99 ? 260 LEU B HD13 1 
ATOM   7238  H HD21 . LEU B  1 144 ? 63.691  -12.667  10.018   1.00 158.49 ? 260 LEU B HD21 1 
ATOM   7239  H HD22 . LEU B  1 144 ? 63.353  -11.135  10.269   1.00 158.49 ? 260 LEU B HD22 1 
ATOM   7240  H HD23 . LEU B  1 144 ? 64.720  -11.543  9.569    1.00 158.49 ? 260 LEU B HD23 1 
ATOM   7241  N N    . LEU B  1 145 ? 66.700  -7.659   10.695   1.00 163.53 ? 261 LEU B N    1 
ATOM   7242  C CA   . LEU B  1 145 ? 67.164  -6.295   10.937   1.00 163.71 ? 261 LEU B CA   1 
ATOM   7243  C C    . LEU B  1 145 ? 66.012  -5.310   11.118   1.00 162.38 ? 261 LEU B C    1 
ATOM   7244  O O    . LEU B  1 145 ? 64.960  -5.444   10.493   1.00 159.60 ? 261 LEU B O    1 
ATOM   7245  C CB   . LEU B  1 145 ? 68.059  -5.832   9.788    1.00 160.49 ? 261 LEU B CB   1 
ATOM   7246  C CG   . LEU B  1 145 ? 69.205  -6.769   9.402    1.00 161.68 ? 261 LEU B CG   1 
ATOM   7247  C CD1  . LEU B  1 145 ? 69.925  -6.245   8.171    1.00 158.49 ? 261 LEU B CD1  1 
ATOM   7248  C CD2  . LEU B  1 145 ? 70.176  -6.937   10.558   1.00 168.06 ? 261 LEU B CD2  1 
ATOM   7249  H H    . LEU B  1 145 ? 66.265  -7.756   9.959    1.00 130.74 ? 261 LEU B H    1 
ATOM   7250  H HA   . LEU B  1 145 ? 67.694  -6.285   11.749   1.00 132.89 ? 261 LEU B HA   1 
ATOM   7251  H HB2  . LEU B  1 145 ? 67.505  -5.713   9.001    1.00 127.52 ? 261 LEU B HB2  1 
ATOM   7252  H HB3  . LEU B  1 145 ? 68.453  -4.980   10.035   1.00 127.52 ? 261 LEU B HB3  1 
ATOM   7253  H HG   . LEU B  1 145 ? 68.840  -7.642   9.187    1.00 132.16 ? 261 LEU B HG   1 
ATOM   7254  H HD11 . LEU B  1 145 ? 70.646  -6.854   7.945    1.00 127.24 ? 261 LEU B HD11 1 
ATOM   7255  H HD12 . LEU B  1 145 ? 69.295  -6.191   7.436    1.00 127.24 ? 261 LEU B HD12 1 
ATOM   7256  H HD13 . LEU B  1 145 ? 70.284  -5.365   8.366    1.00 127.24 ? 261 LEU B HD13 1 
ATOM   7257  H HD21 . LEU B  1 145 ? 70.890  -7.534   10.285   1.00 144.74 ? 261 LEU B HD21 1 
ATOM   7258  H HD22 . LEU B  1 145 ? 70.541  -6.069   10.792   1.00 144.74 ? 261 LEU B HD22 1 
ATOM   7259  H HD23 . LEU B  1 145 ? 69.701  -7.312   11.316   1.00 144.74 ? 261 LEU B HD23 1 
ATOM   7260  N N    . ASN B  1 146 ? 66.227  -4.323   11.985   1.00 171.59 ? 262 ASN B N    1 
ATOM   7261  C CA   . ASN B  1 146 ? 65.278  -3.231   12.191   1.00 171.34 ? 262 ASN B CA   1 
ATOM   7262  C C    . ASN B  1 146 ? 63.877  -3.697   12.593   1.00 172.40 ? 262 ASN B C    1 
ATOM   7263  O O    . ASN B  1 146 ? 62.883  -3.031   12.301   1.00 171.14 ? 262 ASN B O    1 
ATOM   7264  C CB   . ASN B  1 146 ? 65.195  -2.372   10.921   1.00 166.60 ? 262 ASN B CB   1 
ATOM   7265  C CG   . ASN B  1 146 ? 66.462  -1.567   10.673   1.00 166.36 ? 262 ASN B CG   1 
ATOM   7266  O OD1  . ASN B  1 146 ? 67.309  -1.427   11.557   1.00 170.53 ? 262 ASN B OD1  1 
ATOM   7267  N ND2  . ASN B  1 146 ? 66.591  -1.026   9.465    1.00 162.25 ? 262 ASN B ND2  1 
ATOM   7268  H H    . ASN B  1 146 ? 66.931  -4.263   12.476   1.00 194.91 ? 262 ASN B H    1 
ATOM   7269  H HA   . ASN B  1 146 ? 65.611  -2.665   12.904   1.00 192.02 ? 262 ASN B HA   1 
ATOM   7270  H HB2  . ASN B  1 146 ? 65.053  -2.952   10.156   1.00 181.17 ? 262 ASN B HB2  1 
ATOM   7271  H HB3  . ASN B  1 146 ? 64.456  -1.750   11.007   1.00 181.17 ? 262 ASN B HB3  1 
ATOM   7272  N N    . GLY B  1 147 ? 63.802  -4.830   13.283   1.00 167.66 ? 263 GLY B N    1 
ATOM   7273  C CA   . GLY B  1 147 ? 62.527  -5.370   13.723   1.00 169.22 ? 263 GLY B CA   1 
ATOM   7274  C C    . GLY B  1 147 ? 62.114  -4.835   15.083   1.00 174.10 ? 263 GLY B C    1 
ATOM   7275  O O    . GLY B  1 147 ? 62.664  -3.845   15.566   1.00 175.88 ? 263 GLY B O    1 
ATOM   7276  H H    . GLY B  1 147 ? 64.481  -5.306   13.510   1.00 185.17 ? 263 GLY B H    1 
ATOM   7277  H HA2  . GLY B  1 147 ? 61.839  -5.139   13.080   1.00 182.37 ? 263 GLY B HA2  1 
ATOM   7278  H HA3  . GLY B  1 147 ? 62.587  -6.336   13.778   1.00 182.37 ? 263 GLY B HA3  1 
ATOM   7279  N N    . SER B  1 148 ? 61.132  -5.495   15.692   1.00 166.42 ? 264 SER B N    1 
ATOM   7280  C CA   . SER B  1 148 ? 60.670  -5.159   17.037   1.00 171.62 ? 264 SER B CA   1 
ATOM   7281  C C    . SER B  1 148 ? 61.271  -6.107   18.064   1.00 176.18 ? 264 SER B C    1 
ATOM   7282  O O    . SER B  1 148 ? 61.453  -7.294   17.795   1.00 175.64 ? 264 SER B O    1 
ATOM   7283  C CB   . SER B  1 148 ? 59.147  -5.219   17.118   1.00 172.02 ? 264 SER B CB   1 
ATOM   7284  O OG   . SER B  1 148 ? 58.552  -4.397   16.131   1.00 169.10 ? 264 SER B OG   1 
ATOM   7285  H H    . SER B  1 148 ? 60.709  -6.156   15.340   1.00 304.61 ? 264 SER B H    1 
ATOM   7286  H HA   . SER B  1 148 ? 60.950  -4.256   17.255   1.00 316.22 ? 264 SER B HA   1 
ATOM   7287  H HB2  . SER B  1 148 ? 58.860  -6.135   16.979   1.00 309.13 ? 264 SER B HB2  1 
ATOM   7288  H HB3  . SER B  1 148 ? 58.865  -4.913   17.994   1.00 309.13 ? 264 SER B HB3  1 
ATOM   7289  H HG   . SER B  1 148 ? 57.715  -4.441   16.188   1.00 301.60 ? 264 SER B HG   1 
ATOM   7290  N N    . LEU B  1 149 ? 61.559  -5.580   19.248   1.00 183.12 ? 265 LEU B N    1 
ATOM   7291  C CA   . LEU B  1 149 ? 62.194  -6.362   20.298   1.00 188.79 ? 265 LEU B CA   1 
ATOM   7292  C C    . LEU B  1 149 ? 61.168  -7.065   21.171   1.00 192.72 ? 265 LEU B C    1 
ATOM   7293  O O    . LEU B  1 149 ? 60.038  -6.597   21.316   1.00 192.54 ? 265 LEU B O    1 
ATOM   7294  C CB   . LEU B  1 149 ? 63.074  -5.467   21.167   1.00 193.31 ? 265 LEU B CB   1 
ATOM   7295  C CG   . LEU B  1 149 ? 64.275  -4.825   20.472   1.00 190.79 ? 265 LEU B CG   1 
ATOM   7296  C CD1  . LEU B  1 149 ? 64.882  -3.754   21.360   1.00 195.65 ? 265 LEU B CD1  1 
ATOM   7297  C CD2  . LEU B  1 149 ? 65.314  -5.879   20.115   1.00 190.85 ? 265 LEU B CD2  1 
ATOM   7298  H H    . LEU B  1 149 ? 61.396  -4.765   19.468   1.00 222.66 ? 265 LEU B H    1 
ATOM   7299  H HA   . LEU B  1 149 ? 62.759  -7.039   19.893   1.00 232.82 ? 265 LEU B HA   1 
ATOM   7300  H HB2  . LEU B  1 149 ? 62.525  -4.748   21.518   1.00 248.57 ? 265 LEU B HB2  1 
ATOM   7301  H HB3  . LEU B  1 149 ? 63.417  -5.998   21.902   1.00 248.57 ? 265 LEU B HB3  1 
ATOM   7302  H HG   . LEU B  1 149 ? 63.978  -4.403   19.650   1.00 251.91 ? 265 LEU B HG   1 
ATOM   7303  H HD11 . LEU B  1 149 ? 65.641  -3.358   20.904   1.00 268.28 ? 265 LEU B HD11 1 
ATOM   7304  H HD12 . LEU B  1 149 ? 64.212  -3.075   21.539   1.00 268.28 ? 265 LEU B HD12 1 
ATOM   7305  H HD13 . LEU B  1 149 ? 65.171  -4.161   22.192   1.00 268.28 ? 265 LEU B HD13 1 
ATOM   7306  H HD21 . LEU B  1 149 ? 66.063  -5.446   19.676   1.00 251.60 ? 265 LEU B HD21 1 
ATOM   7307  H HD22 . LEU B  1 149 ? 65.613  -6.315   20.928   1.00 251.60 ? 265 LEU B HD22 1 
ATOM   7308  H HD23 . LEU B  1 149 ? 64.911  -6.529   19.518   1.00 251.60 ? 265 LEU B HD23 1 
ATOM   7309  N N    . ALA B  1 150 ? 61.569  -8.193   21.749   1.00 192.80 ? 266 ALA B N    1 
ATOM   7310  C CA   . ALA B  1 150 ? 60.756  -8.855   22.757   1.00 197.86 ? 266 ALA B CA   1 
ATOM   7311  C C    . ALA B  1 150 ? 60.625  -7.928   23.961   1.00 203.28 ? 266 ALA B C    1 
ATOM   7312  O O    . ALA B  1 150 ? 61.594  -7.284   24.364   1.00 205.96 ? 266 ALA B O    1 
ATOM   7313  C CB   . ALA B  1 150 ? 61.367  -10.185  23.158   1.00 201.90 ? 266 ALA B CB   1 
ATOM   7314  H H    . ALA B  1 150 ? 62.309  -8.594   21.572   1.00 204.96 ? 266 ALA B H    1 
ATOM   7315  H HA   . ALA B  1 150 ? 59.870  -9.020   22.399   1.00 205.62 ? 266 ALA B HA   1 
ATOM   7316  H HB1  . ALA B  1 150 ? 60.804  -10.601  23.830   1.00 205.26 ? 266 ALA B HB1  1 
ATOM   7317  H HB2  . ALA B  1 150 ? 61.424  -10.754  22.375   1.00 205.26 ? 266 ALA B HB2  1 
ATOM   7318  H HB3  . ALA B  1 150 ? 62.253  -10.028  23.520   1.00 205.26 ? 266 ALA B HB3  1 
ATOM   7319  N N    . GLU B  1 151 ? 59.425  -7.856   24.526   1.00 208.90 ? 267 GLU B N    1 
ATOM   7320  C CA   . GLU B  1 151 ? 59.134  -6.889   25.580   1.00 213.86 ? 267 GLU B CA   1 
ATOM   7321  C C    . GLU B  1 151 ? 59.911  -7.171   26.862   1.00 222.35 ? 267 GLU B C    1 
ATOM   7322  O O    . GLU B  1 151 ? 60.456  -6.255   27.481   1.00 226.05 ? 267 GLU B O    1 
ATOM   7323  C CB   . GLU B  1 151 ? 57.633  -6.872   25.875   1.00 214.88 ? 267 GLU B CB   1 
ATOM   7324  C CG   . GLU B  1 151 ? 56.791  -6.261   24.761   1.00 208.38 ? 267 GLU B CG   1 
ATOM   7325  C CD   . GLU B  1 151 ? 56.911  -4.745   24.686   1.00 207.55 ? 267 GLU B CD   1 
ATOM   7326  O OE1  . GLU B  1 151 ? 57.702  -4.164   25.459   1.00 211.68 ? 267 GLU B OE1  1 
ATOM   7327  O OE2  . GLU B  1 151 ? 56.208  -4.134   23.853   1.00 203.33 ? 267 GLU B OE2  1 
ATOM   7328  H H    . GLU B  1 151 ? 58.759  -8.358   24.317   1.00 282.31 ? 267 GLU B H    1 
ATOM   7329  H HA   . GLU B  1 151 ? 59.386  -6.005   25.270   1.00 290.50 ? 267 GLU B HA   1 
ATOM   7330  H HB2  . GLU B  1 151 ? 57.330  -7.784   26.008   1.00 281.32 ? 267 GLU B HB2  1 
ATOM   7331  H HB3  . GLU B  1 151 ? 57.479  -6.354   26.681   1.00 281.32 ? 267 GLU B HB3  1 
ATOM   7332  H HG2  . GLU B  1 151 ? 57.080  -6.626   23.911   1.00 273.09 ? 267 GLU B HG2  1 
ATOM   7333  H HG3  . GLU B  1 151 ? 55.858  -6.479   24.916   1.00 273.09 ? 267 GLU B HG3  1 
ATOM   7334  N N    . GLY B  1 152 ? 59.953  -8.439   27.257   1.00 211.60 ? 268 GLY B N    1 
ATOM   7335  C CA   . GLY B  1 152 ? 60.671  -8.852   28.450   1.00 220.48 ? 268 GLY B CA   1 
ATOM   7336  C C    . GLY B  1 152 ? 61.922  -9.634   28.096   1.00 220.73 ? 268 GLY B C    1 
ATOM   7337  O O    . GLY B  1 152 ? 62.997  -9.057   27.928   1.00 220.56 ? 268 GLY B O    1 
ATOM   7338  H H    . GLY B  1 152 ? 59.568  -9.087   26.843   1.00 305.73 ? 268 GLY B H    1 
ATOM   7339  H HA2  . GLY B  1 152 ? 60.928  -8.071   28.965   1.00 309.66 ? 268 GLY B HA2  1 
ATOM   7340  H HA3  . GLY B  1 152 ? 60.099  -9.412   28.999   1.00 309.66 ? 268 GLY B HA3  1 
ATOM   7341  N N    . LYS B  1 153 ? 61.771  -10.950  27.975   1.00 214.06 ? 269 LYS B N    1 
ATOM   7342  C CA   . LYS B  1 153 ? 62.886  -11.825  27.646   1.00 214.92 ? 269 LYS B CA   1 
ATOM   7343  C C    . LYS B  1 153 ? 62.904  -12.169  26.164   1.00 206.14 ? 269 LYS B C    1 
ATOM   7344  O O    . LYS B  1 153 ? 61.891  -12.054  25.481   1.00 200.30 ? 269 LYS B O    1 
ATOM   7345  C CB   . LYS B  1 153 ? 62.828  -13.114  28.462   1.00 222.31 ? 269 LYS B CB   1 
ATOM   7346  C CG   . LYS B  1 153 ? 64.106  -13.925  28.361   1.00 225.35 ? 269 LYS B CG   1 
ATOM   7347  C CD   . LYS B  1 153 ? 64.325  -14.917  29.501   1.00 235.38 ? 269 LYS B CD   1 
ATOM   7348  C CE   . LYS B  1 153 ? 63.493  -16.157  29.344   1.00 235.46 ? 269 LYS B CE   1 
ATOM   7349  N NZ   . LYS B  1 153 ? 63.939  -17.192  30.307   1.00 245.27 ? 269 LYS B NZ   1 
ATOM   7350  H H    . LYS B  1 153 ? 61.024  -11.363  28.081   1.00 187.88 ? 269 LYS B H    1 
ATOM   7351  H HA   . LYS B  1 153 ? 63.716  -11.371  27.859   1.00 189.73 ? 269 LYS B HA   1 
ATOM   7352  H HB2  . LYS B  1 153 ? 62.685  -12.892  29.395   1.00 189.04 ? 269 LYS B HB2  1 
ATOM   7353  H HB3  . LYS B  1 153 ? 62.098  -13.663  28.135   1.00 189.04 ? 269 LYS B HB3  1 
ATOM   7354  H HG2  . LYS B  1 153 ? 64.089  -14.429  27.533   1.00 200.49 ? 269 LYS B HG2  1 
ATOM   7355  H HG3  . LYS B  1 153 ? 64.860  -13.314  28.355   1.00 200.49 ? 269 LYS B HG3  1 
ATOM   7356  H HD2  . LYS B  1 153 ? 65.258  -15.181  29.519   1.00 199.90 ? 269 LYS B HD2  1 
ATOM   7357  H HD3  . LYS B  1 153 ? 64.082  -14.496  30.340   1.00 199.90 ? 269 LYS B HD3  1 
ATOM   7358  H HE2  . LYS B  1 153 ? 62.562  -15.949  29.523   1.00 211.22 ? 269 LYS B HE2  1 
ATOM   7359  H HE3  . LYS B  1 153 ? 63.596  -16.506  28.445   1.00 211.22 ? 269 LYS B HE3  1 
ATOM   7360  H HZ1  . LYS B  1 153 ? 63.446  -17.927  30.214   1.00 210.96 ? 269 LYS B HZ1  1 
ATOM   7361  H HZ2  . LYS B  1 153 ? 64.793  -17.396  30.160   1.00 210.96 ? 269 LYS B HZ2  1 
ATOM   7362  H HZ3  . LYS B  1 153 ? 63.853  -16.890  31.140   1.00 210.96 ? 269 LYS B HZ3  1 
ATOM   7363  N N    . VAL B  1 154 ? 64.071  -12.581  25.674   1.00 215.51 ? 270 VAL B N    1 
ATOM   7364  C CA   . VAL B  1 154 ? 64.163  -13.173  24.348   1.00 208.71 ? 270 VAL B CA   1 
ATOM   7365  C C    . VAL B  1 154 ? 63.186  -14.339  24.305   1.00 209.04 ? 270 VAL B C    1 
ATOM   7366  O O    . VAL B  1 154 ? 63.063  -15.080  25.279   1.00 216.16 ? 270 VAL B O    1 
ATOM   7367  C CB   . VAL B  1 154 ? 65.595  -13.662  24.009   1.00 210.27 ? 270 VAL B CB   1 
ATOM   7368  C CG1  . VAL B  1 154 ? 65.636  -14.379  22.656   1.00 203.91 ? 270 VAL B CG1  1 
ATOM   7369  C CG2  . VAL B  1 154 ? 66.587  -12.512  24.060   1.00 210.54 ? 270 VAL B CG2  1 
ATOM   7370  H H    . VAL B  1 154 ? 64.821  -12.529  26.090   1.00 354.10 ? 270 VAL B H    1 
ATOM   7371  H HA   . VAL B  1 154 ? 63.895  -12.521  23.682   1.00 350.31 ? 270 VAL B HA   1 
ATOM   7372  H HB   . VAL B  1 154 ? 65.864  -14.305  24.684   1.00 353.63 ? 270 VAL B HB   1 
ATOM   7373  H HG11 . VAL B  1 154 ? 66.545  -14.669  22.480   1.00 349.21 ? 270 VAL B HG11 1 
ATOM   7374  H HG12 . VAL B  1 154 ? 65.044  -15.146  22.688   1.00 349.21 ? 270 VAL B HG12 1 
ATOM   7375  H HG13 . VAL B  1 154 ? 65.344  -13.764  21.965   1.00 349.21 ? 270 VAL B HG13 1 
ATOM   7376  H HG21 . VAL B  1 154 ? 67.471  -12.848  23.845   1.00 364.01 ? 270 VAL B HG21 1 
ATOM   7377  H HG22 . VAL B  1 154 ? 66.322  -11.838  23.414   1.00 364.01 ? 270 VAL B HG22 1 
ATOM   7378  H HG23 . VAL B  1 154 ? 66.585  -12.133  24.953   1.00 364.01 ? 270 VAL B HG23 1 
ATOM   7379  N N    . MET B  1 155 ? 62.477  -14.481  23.189   1.00 202.10 ? 271 MET B N    1 
ATOM   7380  C CA   . MET B  1 155 ? 61.496  -15.551  23.037   1.00 202.13 ? 271 MET B CA   1 
ATOM   7381  C C    . MET B  1 155 ? 61.730  -16.322  21.750   1.00 197.01 ? 271 MET B C    1 
ATOM   7382  O O    . MET B  1 155 ? 61.953  -15.733  20.690   1.00 190.33 ? 271 MET B O    1 
ATOM   7383  C CB   . MET B  1 155 ? 60.076  -14.983  23.058   1.00 199.46 ? 271 MET B CB   1 
ATOM   7384  C CG   . MET B  1 155 ? 59.528  -14.677  24.448   1.00 206.25 ? 271 MET B CG   1 
ATOM   7385  S SD   . MET B  1 155 ? 59.519  -16.094  25.569   1.00 215.83 ? 271 MET B SD   1 
ATOM   7386  C CE   . MET B  1 155 ? 58.642  -17.314  24.593   1.00 212.07 ? 271 MET B CE   1 
ATOM   7387  H H    . MET B  1 155 ? 62.545  -13.968  22.502   1.00 233.03 ? 271 MET B H    1 
ATOM   7388  H HA   . MET B  1 155 ? 61.581  -16.160  23.787   1.00 222.50 ? 271 MET B HA   1 
ATOM   7389  H HB2  . MET B  1 155 ? 60.066  -14.157  22.550   1.00 216.44 ? 271 MET B HB2  1 
ATOM   7390  H HB3  . MET B  1 155 ? 59.480  -15.627  22.643   1.00 216.44 ? 271 MET B HB3  1 
ATOM   7391  H HG2  . MET B  1 155 ? 60.074  -13.984  24.853   1.00 220.83 ? 271 MET B HG2  1 
ATOM   7392  H HG3  . MET B  1 155 ? 58.614  -14.364  24.361   1.00 220.83 ? 271 MET B HG3  1 
ATOM   7393  H HE1  . MET B  1 155 ? 58.574  -18.136  25.103   1.00 212.05 ? 271 MET B HE1  1 
ATOM   7394  H HE2  . MET B  1 155 ? 57.755  -16.977  24.389   1.00 212.05 ? 271 MET B HE2  1 
ATOM   7395  H HE3  . MET B  1 155 ? 59.133  -17.473  23.772   1.00 212.05 ? 271 MET B HE3  1 
ATOM   7396  N N    . ILE B  1 156 ? 61.673  -17.646  21.857   1.00 193.61 ? 272 ILE B N    1 
ATOM   7397  C CA   . ILE B  1 156 ? 61.855  -18.533  20.714   1.00 189.98 ? 272 ILE B CA   1 
ATOM   7398  C C    . ILE B  1 156 ? 60.554  -19.271  20.412   1.00 188.84 ? 272 ILE B C    1 
ATOM   7399  O O    . ILE B  1 156 ? 59.833  -19.681  21.324   1.00 194.00 ? 272 ILE B O    1 
ATOM   7400  C CB   . ILE B  1 156 ? 62.989  -19.547  20.960   1.00 195.57 ? 272 ILE B CB   1 
ATOM   7401  C CG1  . ILE B  1 156 ? 62.725  -20.362  22.230   1.00 204.37 ? 272 ILE B CG1  1 
ATOM   7402  C CG2  . ILE B  1 156 ? 64.315  -18.815  21.080   1.00 196.36 ? 272 ILE B CG2  1 
ATOM   7403  C CD1  . ILE B  1 156 ? 63.676  -21.523  22.421   1.00 210.40 ? 272 ILE B CD1  1 
ATOM   7404  H H    . ILE B  1 156 ? 61.528  -18.062  22.596   1.00 267.03 ? 272 ILE B H    1 
ATOM   7405  H HA   . ILE B  1 156 ? 62.088  -18.003  19.935   1.00 262.93 ? 272 ILE B HA   1 
ATOM   7406  H HB   . ILE B  1 156 ? 63.034  -20.153  20.204   1.00 268.12 ? 272 ILE B HB   1 
ATOM   7407  H HG12 . ILE B  1 156 ? 62.812  -19.778  23.000   1.00 268.78 ? 272 ILE B HG12 1 
ATOM   7408  H HG13 . ILE B  1 156 ? 61.825  -20.721  22.190   1.00 268.78 ? 272 ILE B HG13 1 
ATOM   7409  H HG21 . ILE B  1 156 ? 65.020  -19.463  21.234   1.00 277.87 ? 272 ILE B HG21 1 
ATOM   7410  H HG22 . ILE B  1 156 ? 64.485  -18.332  20.256   1.00 277.87 ? 272 ILE B HG22 1 
ATOM   7411  H HG23 . ILE B  1 156 ? 64.267  -18.194  21.823   1.00 277.87 ? 272 ILE B HG23 1 
ATOM   7412  H HD11 . ILE B  1 156 ? 63.446  -21.987  23.241   1.00 273.59 ? 272 ILE B HD11 1 
ATOM   7413  H HD12 . ILE B  1 156 ? 63.594  -22.125  21.666   1.00 273.59 ? 272 ILE B HD12 1 
ATOM   7414  H HD13 . ILE B  1 156 ? 64.583  -21.182  22.476   1.00 273.59 ? 272 ILE B HD13 1 
ATOM   7415  N N    . ARG B  1 157 ? 60.258  -19.424  19.125   1.00 185.59 ? 273 ARG B N    1 
ATOM   7416  C CA   . ARG B  1 157 ? 58.986  -19.986  18.683   1.00 183.90 ? 273 ARG B CA   1 
ATOM   7417  C C    . ARG B  1 157 ? 59.201  -20.920  17.504   1.00 181.15 ? 273 ARG B C    1 
ATOM   7418  O O    . ARG B  1 157 ? 60.033  -20.651  16.638   1.00 177.07 ? 273 ARG B O    1 
ATOM   7419  C CB   . ARG B  1 157 ? 58.011  -18.874  18.289   1.00 178.37 ? 273 ARG B CB   1 
ATOM   7420  C CG   . ARG B  1 157 ? 58.269  -17.527  18.957   1.00 178.34 ? 273 ARG B CG   1 
ATOM   7421  C CD   . ARG B  1 157 ? 57.268  -16.480  18.499   1.00 173.21 ? 273 ARG B CD   1 
ATOM   7422  N NE   . ARG B  1 157 ? 57.554  -15.165  19.067   1.00 173.25 ? 273 ARG B NE   1 
ATOM   7423  C CZ   . ARG B  1 157 ? 56.780  -14.511  19.932   1.00 175.90 ? 273 ARG B CZ   1 
ATOM   7424  N NH1  . ARG B  1 157 ? 55.637  -15.030  20.353   1.00 178.74 ? 273 ARG B NH1  1 
ATOM   7425  N NH2  . ARG B  1 157 ? 57.152  -13.317  20.377   1.00 176.06 ? 273 ARG B NH2  1 
ATOM   7426  H H    . ARG B  1 157 ? 60.784  -19.208  18.480   1.00 291.73 ? 273 ARG B H    1 
ATOM   7427  H HA   . ARG B  1 157 ? 58.591  -20.496  19.408   1.00 285.28 ? 273 ARG B HA   1 
ATOM   7428  H HB2  . ARG B  1 157 ? 58.065  -18.740  17.330   1.00 281.05 ? 273 ARG B HB2  1 
ATOM   7429  H HB3  . ARG B  1 157 ? 57.113  -19.151  18.529   1.00 281.05 ? 273 ARG B HB3  1 
ATOM   7430  H HG2  . ARG B  1 157 ? 58.189  -17.626  19.919   1.00 283.54 ? 273 ARG B HG2  1 
ATOM   7431  H HG3  . ARG B  1 157 ? 59.159  -17.220  18.724   1.00 283.54 ? 273 ARG B HG3  1 
ATOM   7432  H HD2  . ARG B  1 157 ? 57.303  -16.407  17.533   1.00 280.10 ? 273 ARG B HD2  1 
ATOM   7433  H HD3  . ARG B  1 157 ? 56.378  -16.745  18.782   1.00 280.10 ? 273 ARG B HD3  1 
ATOM   7434  H HE   . ARG B  1 157 ? 58.283  -14.780  18.822   1.00 283.83 ? 273 ARG B HE   1 
ATOM   7435  H HH11 . ARG B  1 157 ? 55.386  -15.803  20.072   1.00 278.22 ? 273 ARG B HH11 1 
ATOM   7436  H HH12 . ARG B  1 157 ? 55.147  -14.596  20.911   1.00 278.22 ? 273 ARG B HH12 1 
ATOM   7437  H HH21 . ARG B  1 157 ? 57.892  -12.969  20.109   1.00 287.56 ? 273 ARG B HH21 1 
ATOM   7438  H HH22 . ARG B  1 157 ? 56.654  -12.891  20.934   1.00 287.56 ? 273 ARG B HH22 1 
ATOM   7439  N N    . SER B  1 158 ? 58.441  -22.010  17.469   1.00 186.97 ? 274 SER B N    1 
ATOM   7440  C CA   . SER B  1 158 ? 58.554  -22.982  16.387   1.00 185.23 ? 274 SER B CA   1 
ATOM   7441  C C    . SER B  1 158 ? 57.240  -23.718  16.151   1.00 185.93 ? 274 SER B C    1 
ATOM   7442  O O    . SER B  1 158 ? 56.408  -23.833  17.051   1.00 190.02 ? 274 SER B O    1 
ATOM   7443  C CB   . SER B  1 158 ? 59.667  -23.990  16.690   1.00 190.76 ? 274 SER B CB   1 
ATOM   7444  O OG   . SER B  1 158 ? 59.312  -24.840  17.768   1.00 198.38 ? 274 SER B OG   1 
ATOM   7445  H H    . SER B  1 158 ? 57.850  -22.210  18.061   1.00 257.45 ? 274 SER B H    1 
ATOM   7446  H HA   . SER B  1 158 ? 58.787  -22.517  15.568   1.00 253.73 ? 274 SER B HA   1 
ATOM   7447  H HB2  . SER B  1 158 ? 59.824  -24.532  15.901   1.00 259.18 ? 274 SER B HB2  1 
ATOM   7448  H HB3  . SER B  1 158 ? 60.474  -23.506  16.925   1.00 259.18 ? 274 SER B HB3  1 
ATOM   7449  H HG   . SER B  1 158 ? 59.173  -24.385  18.460   1.00 265.24 ? 274 SER B HG   1 
ATOM   7450  N N    . GLU B  1 159 ? 57.063  -24.210  14.929   1.00 187.95 ? 275 GLU B N    1 
ATOM   7451  C CA   . GLU B  1 159 ? 55.888  -24.998  14.569   1.00 188.93 ? 275 GLU B CA   1 
ATOM   7452  C C    . GLU B  1 159 ? 55.852  -26.307  15.341   1.00 196.22 ? 275 GLU B C    1 
ATOM   7453  O O    . GLU B  1 159 ? 54.788  -26.781  15.737   1.00 199.33 ? 275 GLU B O    1 
ATOM   7454  C CB   . GLU B  1 159 ? 55.879  -25.294  13.070   1.00 185.48 ? 275 GLU B CB   1 
ATOM   7455  C CG   . GLU B  1 159 ? 55.967  -24.067  12.192   1.00 181.52 ? 275 GLU B CG   1 
ATOM   7456  C CD   . GLU B  1 159 ? 56.025  -24.409  10.720   1.00 182.52 ? 275 GLU B CD   1 
ATOM   7457  O OE1  . GLU B  1 159 ? 55.807  -25.591  10.376   1.00 185.05 ? 275 GLU B OE1  1 
ATOM   7458  O OE2  . GLU B  1 159 ? 56.288  -23.500  9.907    1.00 181.03 ? 275 GLU B OE2  1 
ATOM   7459  H H    . GLU B  1 159 ? 57.617  -24.100  14.280   1.00 346.39 ? 275 GLU B H    1 
ATOM   7460  H HA   . GLU B  1 159 ? 55.087  -24.495  14.785   1.00 344.33 ? 275 GLU B HA   1 
ATOM   7461  H HB2  . GLU B  1 159 ? 56.637  -25.861  12.861   1.00 341.08 ? 275 GLU B HB2  1 
ATOM   7462  H HB3  . GLU B  1 159 ? 55.054  -25.755  12.849   1.00 341.08 ? 275 GLU B HB3  1 
ATOM   7463  H HG2  . GLU B  1 159 ? 55.185  -23.513  12.341   1.00 339.63 ? 275 GLU B HG2  1 
ATOM   7464  H HG3  . GLU B  1 159 ? 56.771  -23.573  12.417   1.00 339.63 ? 275 GLU B HG3  1 
ATOM   7465  N N    . ASN B  1 160 ? 57.028  -26.889  15.544   1.00 197.69 ? 276 ASN B N    1 
ATOM   7466  C CA   . ASN B  1 160 ? 57.147  -28.178  16.206   1.00 205.66 ? 276 ASN B CA   1 
ATOM   7467  C C    . ASN B  1 160 ? 58.582  -28.383  16.669   1.00 209.35 ? 276 ASN B C    1 
ATOM   7468  O O    . ASN B  1 160 ? 59.462  -28.692  15.867   1.00 207.73 ? 276 ASN B O    1 
ATOM   7469  C CB   . ASN B  1 160 ? 56.714  -29.302  15.262   1.00 206.06 ? 276 ASN B CB   1 
ATOM   7470  C CG   . ASN B  1 160 ? 56.600  -30.647  15.959   1.00 214.77 ? 276 ASN B CG   1 
ATOM   7471  O OD1  . ASN B  1 160 ? 57.079  -30.825  17.079   1.00 220.69 ? 276 ASN B OD1  1 
ATOM   7472  N ND2  . ASN B  1 160 ? 55.967  -31.605  15.291   1.00 216.02 ? 276 ASN B ND2  1 
ATOM   7473  H H    . ASN B  1 160 ? 57.781  -26.551  15.303   1.00 314.23 ? 276 ASN B H    1 
ATOM   7474  H HA   . ASN B  1 160 ? 56.569  -28.193  16.985   1.00 316.31 ? 276 ASN B HA   1 
ATOM   7475  H HB2  . ASN B  1 160 ? 55.846  -29.084  14.888   1.00 313.89 ? 276 ASN B HB2  1 
ATOM   7476  H HB3  . ASN B  1 160 ? 57.369  -29.388  14.552   1.00 313.89 ? 276 ASN B HB3  1 
ATOM   7477  H HD21 . ASN B  1 160 ? 56.356  -32.357  15.145   1.00 310.59 ? 276 ASN B HD21 1 
ATOM   7478  N N    . ILE B  1 161 ? 58.814  -28.198  17.965   1.00 205.63 ? 277 ILE B N    1 
ATOM   7479  C CA   . ILE B  1 161 ? 60.154  -28.312  18.529   1.00 209.99 ? 277 ILE B CA   1 
ATOM   7480  C C    . ILE B  1 161 ? 60.727  -29.711  18.305   1.00 215.37 ? 277 ILE B C    1 
ATOM   7481  O O    . ILE B  1 161 ? 61.937  -29.878  18.153   1.00 216.85 ? 277 ILE B O    1 
ATOM   7482  C CB   . ILE B  1 161 ? 60.152  -27.986  20.043   1.00 216.19 ? 277 ILE B CB   1 
ATOM   7483  C CG1  . ILE B  1 161 ? 59.679  -26.549  20.266   1.00 211.23 ? 277 ILE B CG1  1 
ATOM   7484  C CG2  . ILE B  1 161 ? 61.544  -28.174  20.646   1.00 221.71 ? 277 ILE B CG2  1 
ATOM   7485  C CD1  . ILE B  1 161 ? 59.512  -26.161  21.721   1.00 217.22 ? 277 ILE B CD1  1 
ATOM   7486  H H    . ILE B  1 161 ? 58.207  -28.004  18.543   1.00 222.46 ? 277 ILE B H    1 
ATOM   7487  H HA   . ILE B  1 161 ? 60.737  -27.675  18.087   1.00 229.36 ? 277 ILE B HA   1 
ATOM   7488  H HB   . ILE B  1 161 ? 59.537  -28.589  20.489   1.00 235.49 ? 277 ILE B HB   1 
ATOM   7489  H HG12 . ILE B  1 161 ? 60.327  -25.944  19.873   1.00 230.30 ? 277 ILE B HG12 1 
ATOM   7490  H HG13 . ILE B  1 161 ? 58.820  -26.434  19.831   1.00 230.30 ? 277 ILE B HG13 1 
ATOM   7491  H HG21 . ILE B  1 161 ? 61.508  -27.963  21.592   1.00 241.16 ? 277 ILE B HG21 1 
ATOM   7492  H HG22 . ILE B  1 161 ? 61.819  -29.096  20.523   1.00 241.16 ? 277 ILE B HG22 1 
ATOM   7493  H HG23 . ILE B  1 161 ? 62.165  -27.580  20.197   1.00 241.16 ? 277 ILE B HG23 1 
ATOM   7494  H HD11 . ILE B  1 161 ? 59.211  -25.240  21.769   1.00 233.19 ? 277 ILE B HD11 1 
ATOM   7495  H HD12 . ILE B  1 161 ? 58.855  -26.746  22.129   1.00 233.19 ? 277 ILE B HD12 1 
ATOM   7496  H HD13 . ILE B  1 161 ? 60.366  -26.255  22.172   1.00 233.19 ? 277 ILE B HD13 1 
ATOM   7497  N N    . THR B  1 162 ? 59.851  -30.709  18.263   1.00 221.78 ? 278 THR B N    1 
ATOM   7498  C CA   . THR B  1 162 ? 60.282  -32.100  18.165   1.00 228.08 ? 278 THR B CA   1 
ATOM   7499  C C    . THR B  1 162 ? 60.738  -32.472  16.751   1.00 223.71 ? 278 THR B C    1 
ATOM   7500  O O    . THR B  1 162 ? 61.414  -33.483  16.560   1.00 228.48 ? 278 THR B O    1 
ATOM   7501  C CB   . THR B  1 162 ? 59.154  -33.061  18.604   1.00 233.62 ? 278 THR B CB   1 
ATOM   7502  O OG1  . THR B  1 162 ? 58.078  -33.013  17.658   1.00 228.06 ? 278 THR B OG1  1 
ATOM   7503  C CG2  . THR B  1 162 ? 58.632  -32.680  19.988   1.00 238.19 ? 278 THR B CG2  1 
ATOM   7504  H H    . THR B  1 162 ? 58.997  -30.608  18.289   1.00 276.15 ? 278 THR B H    1 
ATOM   7505  H HA   . THR B  1 162 ? 61.034  -32.235  18.763   1.00 279.13 ? 278 THR B HA   1 
ATOM   7506  H HB   . THR B  1 162 ? 59.502  -33.965  18.648   1.00 281.97 ? 278 THR B HB   1 
ATOM   7507  H HG1  . THR B  1 162 ? 57.464  -33.534  17.895   1.00 274.34 ? 278 THR B HG1  1 
ATOM   7508  H HG21 . THR B  1 162 ? 57.925  -33.288  20.254   1.00 286.52 ? 278 THR B HG21 1 
ATOM   7509  H HG22 . THR B  1 162 ? 59.351  -32.729  20.637   1.00 286.52 ? 278 THR B HG22 1 
ATOM   7510  H HG23 . THR B  1 162 ? 58.281  -31.776  19.973   1.00 286.52 ? 278 THR B HG23 1 
ATOM   7511  N N    . ASN B  1 163 ? 60.372  -31.652  15.769   1.00 225.80 ? 279 ASN B N    1 
ATOM   7512  C CA   . ASN B  1 163 ? 60.781  -31.870  14.382   1.00 221.30 ? 279 ASN B CA   1 
ATOM   7513  C C    . ASN B  1 163 ? 62.039  -31.058  14.062   1.00 217.71 ? 279 ASN B C    1 
ATOM   7514  O O    . ASN B  1 163 ? 62.413  -30.171  14.830   1.00 217.49 ? 279 ASN B O    1 
ATOM   7515  C CB   . ASN B  1 163 ? 59.639  -31.501  13.436   1.00 214.70 ? 279 ASN B CB   1 
ATOM   7516  C CG   . ASN B  1 163 ? 59.922  -31.886  11.997   1.00 211.15 ? 279 ASN B CG   1 
ATOM   7517  O OD1  . ASN B  1 163 ? 60.638  -31.183  11.284   1.00 207.23 ? 279 ASN B OD1  1 
ATOM   7518  N ND2  . ASN B  1 163 ? 59.358  -33.008  11.562   1.00 214.36 ? 279 ASN B ND2  1 
ATOM   7519  H H    . ASN B  1 163 ? 59.881  -30.955  15.880   1.00 354.25 ? 279 ASN B H    1 
ATOM   7520  H HA   . ASN B  1 163 ? 60.987  -32.809  14.255   1.00 352.45 ? 279 ASN B HA   1 
ATOM   7521  H HB2  . ASN B  1 163 ? 58.833  -31.962  13.717   1.00 348.60 ? 279 ASN B HB2  1 
ATOM   7522  H HB3  . ASN B  1 163 ? 59.499  -30.541  13.467   1.00 348.60 ? 279 ASN B HB3  1 
ATOM   7523  H HD21 . ASN B  1 163 ? 59.489  -33.269  10.753   1.00 345.44 ? 279 ASN B HD21 1 
ATOM   7524  H HD22 . ASN B  1 163 ? 58.863  -33.473  12.089   1.00 345.44 ? 279 ASN B HD22 1 
ATOM   7525  N N    . ASN B  1 164 ? 62.686  -31.359  12.935   1.00 219.17 ? 280 ASN B N    1 
ATOM   7526  C CA   . ASN B  1 164 ? 63.971  -30.744  12.590   1.00 216.88 ? 280 ASN B CA   1 
ATOM   7527  C C    . ASN B  1 164 ? 63.973  -29.929  11.297   1.00 210.24 ? 280 ASN B C    1 
ATOM   7528  O O    . ASN B  1 164 ? 64.905  -29.162  11.048   1.00 208.23 ? 280 ASN B O    1 
ATOM   7529  C CB   . ASN B  1 164 ? 65.041  -31.825  12.488   1.00 223.18 ? 280 ASN B CB   1 
ATOM   7530  C CG   . ASN B  1 164 ? 65.260  -32.543  13.799   1.00 232.29 ? 280 ASN B CG   1 
ATOM   7531  O OD1  . ASN B  1 164 ? 66.029  -32.091  14.646   1.00 235.22 ? 280 ASN B OD1  1 
ATOM   7532  N ND2  . ASN B  1 164 ? 64.578  -33.667  13.979   1.00 237.28 ? 280 ASN B ND2  1 
ATOM   7533  H H    . ASN B  1 164 ? 62.401  -31.921  12.350   1.00 292.70 ? 280 ASN B H    1 
ATOM   7534  H HA   . ASN B  1 164 ? 64.227  -30.147  13.310   1.00 295.72 ? 280 ASN B HA   1 
ATOM   7535  H HB2  . ASN B  1 164 ? 64.767  -32.481  11.828   1.00 302.80 ? 280 ASN B HB2  1 
ATOM   7536  H HB3  . ASN B  1 164 ? 65.880  -31.417  12.224   1.00 302.80 ? 280 ASN B HB3  1 
ATOM   7537  H HD21 . ASN B  1 164 ? 64.668  -34.113  14.709   1.00 309.15 ? 280 ASN B HD21 1 
ATOM   7538  H HD22 . ASN B  1 164 ? 64.045  -33.949  13.365   1.00 309.15 ? 280 ASN B HD22 1 
ATOM   7539  N N    . VAL B  1 165 ? 62.943  -30.097  10.475   1.00 218.36 ? 281 VAL B N    1 
ATOM   7540  C CA   . VAL B  1 165 ? 62.867  -29.402  9.191    1.00 216.86 ? 281 VAL B CA   1 
ATOM   7541  C C    . VAL B  1 165 ? 62.361  -27.966  9.363    1.00 211.36 ? 281 VAL B C    1 
ATOM   7542  O O    . VAL B  1 165 ? 62.570  -27.116  8.495    1.00 210.49 ? 281 VAL B O    1 
ATOM   7543  C CB   . VAL B  1 165 ? 61.943  -30.153  8.200    1.00 220.06 ? 281 VAL B CB   1 
ATOM   7544  C CG1  . VAL B  1 165 ? 62.048  -29.561  6.789    1.00 221.95 ? 281 VAL B CG1  1 
ATOM   7545  C CG2  . VAL B  1 165 ? 62.286  -31.640  8.170    1.00 224.94 ? 281 VAL B CG2  1 
ATOM   7546  H H    . VAL B  1 165 ? 62.271  -30.610  10.637   1.00 347.16 ? 281 VAL B H    1 
ATOM   7547  H HA   . VAL B  1 165 ? 63.754  -29.362  8.801    1.00 345.95 ? 281 VAL B HA   1 
ATOM   7548  H HB   . VAL B  1 165 ? 61.023  -30.063  8.495    1.00 343.81 ? 281 VAL B HB   1 
ATOM   7549  H HG11 . VAL B  1 165 ? 61.459  -30.052  6.196    1.00 343.28 ? 281 VAL B HG11 1 
ATOM   7550  H HG12 . VAL B  1 165 ? 61.785  -28.627  6.818    1.00 343.28 ? 281 VAL B HG12 1 
ATOM   7551  H HG13 . VAL B  1 165 ? 62.965  -29.637  6.483    1.00 343.28 ? 281 VAL B HG13 1 
ATOM   7552  H HG21 . VAL B  1 165 ? 61.696  -32.088  7.544    1.00 346.54 ? 281 VAL B HG21 1 
ATOM   7553  H HG22 . VAL B  1 165 ? 63.209  -31.745  7.888    1.00 346.54 ? 281 VAL B HG22 1 
ATOM   7554  H HG23 . VAL B  1 165 ? 62.168  -32.009  9.059    1.00 346.54 ? 281 VAL B HG23 1 
ATOM   7555  N N    . LYS B  1 166 ? 61.715  -27.697  10.494   1.00 202.51 ? 282 LYS B N    1 
ATOM   7556  C CA   . LYS B  1 166 ? 61.069  -26.409  10.725   1.00 197.67 ? 282 LYS B CA   1 
ATOM   7557  C C    . LYS B  1 166 ? 62.012  -25.384  11.347   1.00 195.50 ? 282 LYS B C    1 
ATOM   7558  O O    . LYS B  1 166 ? 62.767  -25.690  12.270   1.00 197.80 ? 282 LYS B O    1 
ATOM   7559  C CB   . LYS B  1 166 ? 59.841  -26.604  11.612   1.00 197.88 ? 282 LYS B CB   1 
ATOM   7560  C CG   . LYS B  1 166 ? 58.727  -27.359  10.909   1.00 198.76 ? 282 LYS B CG   1 
ATOM   7561  C CD   . LYS B  1 166 ? 58.148  -28.457  11.776   1.00 202.42 ? 282 LYS B CD   1 
ATOM   7562  C CE   . LYS B  1 166 ? 57.202  -29.343  10.980   1.00 203.67 ? 282 LYS B CE   1 
ATOM   7563  N NZ   . LYS B  1 166 ? 56.732  -30.514  11.768   1.00 208.35 ? 282 LYS B NZ   1 
ATOM   7564  H H    . LYS B  1 166 ? 61.637  -28.249  11.149   1.00 329.03 ? 282 LYS B H    1 
ATOM   7565  H HA   . LYS B  1 166 ? 60.767  -26.055  9.874    1.00 327.25 ? 282 LYS B HA   1 
ATOM   7566  H HB2  . LYS B  1 166 ? 60.096  -27.110  12.399   1.00 325.65 ? 282 LYS B HB2  1 
ATOM   7567  H HB3  . LYS B  1 166 ? 59.498  -25.735  11.872   1.00 325.65 ? 282 LYS B HB3  1 
ATOM   7568  H HG2  . LYS B  1 166 ? 58.013  -26.741  10.688   1.00 322.99 ? 282 LYS B HG2  1 
ATOM   7569  H HG3  . LYS B  1 166 ? 59.078  -27.766  10.101   1.00 322.99 ? 282 LYS B HG3  1 
ATOM   7570  H HD2  . LYS B  1 166 ? 58.868  -29.010  12.119   1.00 322.72 ? 282 LYS B HD2  1 
ATOM   7571  H HD3  . LYS B  1 166 ? 57.650  -28.060  12.508   1.00 322.72 ? 282 LYS B HD3  1 
ATOM   7572  H HE2  . LYS B  1 166 ? 56.426  -28.824  10.717   1.00 320.98 ? 282 LYS B HE2  1 
ATOM   7573  H HE3  . LYS B  1 166 ? 57.663  -29.674  10.193   1.00 320.98 ? 282 LYS B HE3  1 
ATOM   7574  H HZ3  . LYS B  1 166 ? 56.182  -31.011  11.276   1.00 321.81 ? 282 LYS B HZ3  1 
ATOM   7575  N N    . ASN B  1 167 ? 61.952  -24.161  10.831   1.00 189.89 ? 283 ASN B N    1 
ATOM   7576  C CA   . ASN B  1 167 ? 62.837  -23.088  11.266   1.00 187.29 ? 283 ASN B CA   1 
ATOM   7577  C C    . ASN B  1 167 ? 62.510  -22.575  12.663   1.00 186.81 ? 283 ASN B C    1 
ATOM   7578  O O    . ASN B  1 167 ? 61.350  -22.557  13.074   1.00 186.75 ? 283 ASN B O    1 
ATOM   7579  C CB   . ASN B  1 167 ? 62.772  -21.932  10.270   1.00 182.91 ? 283 ASN B CB   1 
ATOM   7580  C CG   . ASN B  1 167 ? 63.290  -22.318  8.905    1.00 185.09 ? 283 ASN B CG   1 
ATOM   7581  O OD1  . ASN B  1 167 ? 63.520  -23.494  8.623    1.00 189.89 ? 283 ASN B OD1  1 
ATOM   7582  N ND2  . ASN B  1 167 ? 63.472  -21.327  8.044    1.00 182.81 ? 283 ASN B ND2  1 
ATOM   7583  H H    . ASN B  1 167 ? 61.397  -23.924  10.218   1.00 241.99 ? 283 ASN B H    1 
ATOM   7584  H HA   . ASN B  1 167 ? 63.748  -23.420  11.278   1.00 246.63 ? 283 ASN B HA   1 
ATOM   7585  H HB2  . ASN B  1 167 ? 61.850  -21.648  10.174   1.00 242.73 ? 283 ASN B HB2  1 
ATOM   7586  H HB3  . ASN B  1 167 ? 63.314  -21.198  10.601   1.00 242.73 ? 283 ASN B HB3  1 
ATOM   7587  H HD21 . ASN B  1 167 ? 63.765  -21.493  7.253    1.00 239.38 ? 283 ASN B HD21 1 
ATOM   7588  H HD22 . ASN B  1 167 ? 63.298  -20.517  8.276    1.00 239.38 ? 283 ASN B HD22 1 
ATOM   7589  N N    . ILE B  1 168 ? 63.548  -22.160  13.383   1.00 181.82 ? 284 ILE B N    1 
ATOM   7590  C CA   . ILE B  1 168 ? 63.398  -21.542  14.697   1.00 184.66 ? 284 ILE B CA   1 
ATOM   7591  C C    . ILE B  1 168 ? 63.575  -20.028  14.577   1.00 180.09 ? 284 ILE B C    1 
ATOM   7592  O O    . ILE B  1 168 ? 64.606  -19.556  14.095   1.00 178.20 ? 284 ILE B O    1 
ATOM   7593  C CB   . ILE B  1 168 ? 64.423  -22.107  15.706   1.00 191.60 ? 284 ILE B CB   1 
ATOM   7594  C CG1  . ILE B  1 168 ? 64.239  -23.618  15.861   1.00 196.74 ? 284 ILE B CG1  1 
ATOM   7595  C CG2  . ILE B  1 168 ? 64.291  -21.412  17.064   1.00 195.10 ? 284 ILE B CG2  1 
ATOM   7596  C CD1  . ILE B  1 168 ? 65.369  -24.300  16.598   1.00 204.19 ? 284 ILE B CD1  1 
ATOM   7597  H H    . ILE B  1 168 ? 64.366  -22.227  13.126   1.00 240.75 ? 284 ILE B H    1 
ATOM   7598  H HA   . ILE B  1 168 ? 62.507  -21.719  15.036   1.00 244.08 ? 284 ILE B HA   1 
ATOM   7599  H HB   . ILE B  1 168 ? 65.315  -21.940  15.362   1.00 253.38 ? 284 ILE B HB   1 
ATOM   7600  H HG12 . ILE B  1 168 ? 63.421  -23.783  16.355   1.00 254.13 ? 284 ILE B HG12 1 
ATOM   7601  H HG13 . ILE B  1 168 ? 64.177  -24.017  14.979   1.00 254.13 ? 284 ILE B HG13 1 
ATOM   7602  H HG21 . ILE B  1 168 ? 64.945  -21.786  17.675   1.00 258.51 ? 284 ILE B HG21 1 
ATOM   7603  H HG22 . ILE B  1 168 ? 64.451  -20.462  16.949   1.00 258.51 ? 284 ILE B HG22 1 
ATOM   7604  H HG23 . ILE B  1 168 ? 63.396  -21.558  17.407   1.00 258.51 ? 284 ILE B HG23 1 
ATOM   7605  H HD11 . ILE B  1 168 ? 65.180  -25.249  16.655   1.00 263.57 ? 284 ILE B HD11 1 
ATOM   7606  H HD12 . ILE B  1 168 ? 66.195  -24.155  16.111   1.00 263.57 ? 284 ILE B HD12 1 
ATOM   7607  H HD13 . ILE B  1 168 ? 65.438  -23.921  17.488   1.00 263.57 ? 284 ILE B HD13 1 
ATOM   7608  N N    . ILE B  1 169 ? 62.570  -19.272  15.014   1.00 169.37 ? 285 ILE B N    1 
ATOM   7609  C CA   . ILE B  1 169 ? 62.613  -17.813  14.947   1.00 165.51 ? 285 ILE B CA   1 
ATOM   7610  C C    . ILE B  1 169 ? 62.897  -17.233  16.333   1.00 170.00 ? 285 ILE B C    1 
ATOM   7611  O O    . ILE B  1 169 ? 62.137  -17.454  17.276   1.00 173.77 ? 285 ILE B O    1 
ATOM   7612  C CB   . ILE B  1 169 ? 61.292  -17.238  14.385   1.00 160.97 ? 285 ILE B CB   1 
ATOM   7613  C CG1  . ILE B  1 169 ? 61.017  -17.824  12.994   1.00 158.94 ? 285 ILE B CG1  1 
ATOM   7614  C CG2  . ILE B  1 169 ? 61.352  -15.711  14.324   1.00 157.55 ? 285 ILE B CG2  1 
ATOM   7615  C CD1  . ILE B  1 169 ? 59.700  -17.402  12.375   1.00 158.02 ? 285 ILE B CD1  1 
ATOM   7616  H H    . ILE B  1 169 ? 61.845  -19.583  15.357   1.00 178.92 ? 285 ILE B H    1 
ATOM   7617  H HA   . ILE B  1 169 ? 63.333  -17.545  14.355   1.00 179.59 ? 285 ILE B HA   1 
ATOM   7618  H HB   . ILE B  1 169 ? 60.567  -17.495  14.977   1.00 171.66 ? 285 ILE B HB   1 
ATOM   7619  H HG12 . ILE B  1 169 ? 61.726  -17.542  12.395   1.00 164.86 ? 285 ILE B HG12 1 
ATOM   7620  H HG13 . ILE B  1 169 ? 61.013  -18.791  13.061   1.00 164.86 ? 285 ILE B HG13 1 
ATOM   7621  H HG21 . ILE B  1 169 ? 60.513  -15.376  13.969   1.00 173.77 ? 285 ILE B HG21 1 
ATOM   7622  H HG22 . ILE B  1 169 ? 61.494  -15.365  15.219   1.00 173.77 ? 285 ILE B HG22 1 
ATOM   7623  H HG23 . ILE B  1 169 ? 62.085  -15.447  13.746   1.00 173.77 ? 285 ILE B HG23 1 
ATOM   7624  H HD11 . ILE B  1 169 ? 59.613  -17.818  11.503   1.00 156.81 ? 285 ILE B HD11 1 
ATOM   7625  H HD12 . ILE B  1 169 ? 58.975  -17.689  12.952   1.00 156.81 ? 285 ILE B HD12 1 
ATOM   7626  H HD13 . ILE B  1 169 ? 59.689  -16.437  12.284   1.00 156.81 ? 285 ILE B HD13 1 
ATOM   7627  N N    . VAL B  1 170 ? 64.010  -16.510  16.447   1.00 170.15 ? 286 VAL B N    1 
ATOM   7628  C CA   . VAL B  1 170 ? 64.416  -15.871  17.700   1.00 175.23 ? 286 VAL B CA   1 
ATOM   7629  C C    . VAL B  1 170 ? 64.104  -14.371  17.678   1.00 171.48 ? 286 VAL B C    1 
ATOM   7630  O O    . VAL B  1 170 ? 64.340  -13.697  16.675   1.00 165.81 ? 286 VAL B O    1 
ATOM   7631  C CB   . VAL B  1 170 ? 65.926  -16.073  17.964   1.00 179.62 ? 286 VAL B CB   1 
ATOM   7632  C CG1  . VAL B  1 170 ? 66.337  -15.462  19.299   1.00 185.77 ? 286 VAL B CG1  1 
ATOM   7633  C CG2  . VAL B  1 170 ? 66.285  -17.552  17.929   1.00 183.66 ? 286 VAL B CG2  1 
ATOM   7634  H H    . VAL B  1 170 ? 64.558  -16.372  15.799   1.00 154.47 ? 286 VAL B H    1 
ATOM   7635  H HA   . VAL B  1 170 ? 63.925  -16.272  18.434   1.00 164.07 ? 286 VAL B HA   1 
ATOM   7636  H HB   . VAL B  1 170 ? 66.429  -15.628  17.264   1.00 174.71 ? 286 VAL B HB   1 
ATOM   7637  H HG11 . VAL B  1 170 ? 67.287  -15.606  19.433   1.00 185.91 ? 286 VAL B HG11 1 
ATOM   7638  H HG12 . VAL B  1 170 ? 66.145  -14.511  19.283   1.00 185.91 ? 286 VAL B HG12 1 
ATOM   7639  H HG13 . VAL B  1 170 ? 65.833  -15.889  20.010   1.00 185.91 ? 286 VAL B HG13 1 
ATOM   7640  H HG21 . VAL B  1 170 ? 67.235  -17.650  18.097   1.00 174.72 ? 286 VAL B HG21 1 
ATOM   7641  H HG22 . VAL B  1 170 ? 65.777  -18.016  18.613   1.00 174.72 ? 286 VAL B HG22 1 
ATOM   7642  H HG23 . VAL B  1 170 ? 66.064  -17.909  17.054   1.00 174.72 ? 286 VAL B HG23 1 
ATOM   7643  N N    . GLN B  1 171 ? 63.571  -13.861  18.788   1.00 183.52 ? 287 GLN B N    1 
ATOM   7644  C CA   . GLN B  1 171 ? 63.285  -12.433  18.945   1.00 181.57 ? 287 GLN B CA   1 
ATOM   7645  C C    . GLN B  1 171 ? 64.006  -11.858  20.165   1.00 187.45 ? 287 GLN B C    1 
ATOM   7646  O O    . GLN B  1 171 ? 63.688  -12.209  21.298   1.00 193.43 ? 287 GLN B O    1 
ATOM   7647  C CB   . GLN B  1 171 ? 61.778  -12.200  19.080   1.00 180.46 ? 287 GLN B CB   1 
ATOM   7648  C CG   . GLN B  1 171 ? 61.011  -12.203  17.762   1.00 174.05 ? 287 GLN B CG   1 
ATOM   7649  C CD   . GLN B  1 171 ? 59.546  -11.827  17.934   1.00 173.61 ? 287 GLN B CD   1 
ATOM   7650  O OE1  . GLN B  1 171 ? 59.175  -11.129  18.880   1.00 176.73 ? 287 GLN B OE1  1 
ATOM   7651  N NE2  . GLN B  1 171 ? 58.705  -12.295  17.017   1.00 170.36 ? 287 GLN B NE2  1 
ATOM   7652  H H    . GLN B  1 171 ? 63.362  -14.331  19.477   1.00 255.26 ? 287 GLN B H    1 
ATOM   7653  H HA   . GLN B  1 171 ? 63.595  -11.958  18.159   1.00 258.51 ? 287 GLN B HA   1 
ATOM   7654  H HB2  . GLN B  1 171 ? 61.406  -12.901  19.637   1.00 252.20 ? 287 GLN B HB2  1 
ATOM   7655  H HB3  . GLN B  1 171 ? 61.635  -11.338  19.500   1.00 252.20 ? 287 GLN B HB3  1 
ATOM   7656  H HG2  . GLN B  1 171 ? 61.417  -11.561  17.158   1.00 240.11 ? 287 GLN B HG2  1 
ATOM   7657  H HG3  . GLN B  1 171 ? 61.050  -13.092  17.376   1.00 240.11 ? 287 GLN B HG3  1 
ATOM   7658  H HE21 . GLN B  1 171 ? 57.867  -12.111  17.069   1.00 227.23 ? 287 GLN B HE21 1 
ATOM   7659  H HE22 . GLN B  1 171 ? 59.000  -12.781  16.372   1.00 227.23 ? 287 GLN B HE22 1 
ATOM   7660  N N    . LEU B  1 172 ? 64.954  -10.953  19.929   1.00 187.69 ? 288 LEU B N    1 
ATOM   7661  C CA   . LEU B  1 172 ? 65.807  -10.405  20.992   1.00 194.09 ? 288 LEU B CA   1 
ATOM   7662  C C    . LEU B  1 172 ? 65.105  -9.346   21.862   1.00 196.17 ? 288 LEU B C    1 
ATOM   7663  O O    . LEU B  1 172 ? 64.165  -8.701   21.397   1.00 191.26 ? 288 LEU B O    1 
ATOM   7664  C CB   . LEU B  1 172 ? 67.072  -9.801   20.370   1.00 192.47 ? 288 LEU B CB   1 
ATOM   7665  C CG   . LEU B  1 172 ? 67.945  -10.725  19.513   1.00 191.13 ? 288 LEU B CG   1 
ATOM   7666  C CD1  . LEU B  1 172 ? 69.173  -9.982   18.997   1.00 190.28 ? 288 LEU B CD1  1 
ATOM   7667  C CD2  . LEU B  1 172 ? 68.365  -11.971  20.283   1.00 198.11 ? 288 LEU B CD2  1 
ATOM   7668  H H    . LEU B  1 172 ? 65.128  -10.633  19.150   1.00 214.18 ? 288 LEU B H    1 
ATOM   7669  H HA   . LEU B  1 172 ? 66.081  -11.131  21.575   1.00 229.00 ? 288 LEU B HA   1 
ATOM   7670  H HB2  . LEU B  1 172 ? 66.804  -9.059   19.805   1.00 237.79 ? 288 LEU B HB2  1 
ATOM   7671  H HB3  . LEU B  1 172 ? 67.631  -9.468   21.089   1.00 237.79 ? 288 LEU B HB3  1 
ATOM   7672  H HG   . LEU B  1 172 ? 67.430  -11.014  18.744   1.00 237.80 ? 288 LEU B HG   1 
ATOM   7673  H HD11 . LEU B  1 172 ? 69.706  -10.588  18.459   1.00 247.44 ? 288 LEU B HD11 1 
ATOM   7674  H HD12 . LEU B  1 172 ? 68.882  -9.230   18.457   1.00 247.44 ? 288 LEU B HD12 1 
ATOM   7675  H HD13 . LEU B  1 172 ? 69.692  -9.666   19.753   1.00 247.44 ? 288 LEU B HD13 1 
ATOM   7676  H HD21 . LEU B  1 172 ? 68.914  -12.527  19.708   1.00 244.40 ? 288 LEU B HD21 1 
ATOM   7677  H HD22 . LEU B  1 172 ? 68.872  -11.703  21.065   1.00 244.40 ? 288 LEU B HD22 1 
ATOM   7678  H HD23 . LEU B  1 172 ? 67.571  -12.457  20.554   1.00 244.40 ? 288 LEU B HD23 1 
ATOM   7679  N N    . ASN B  1 173 ? 65.553  -9.165   23.114   1.00 195.28 ? 289 ASN B N    1 
ATOM   7680  C CA   . ASN B  1 173 ? 65.082  -8.033   23.939   1.00 197.94 ? 289 ASN B CA   1 
ATOM   7681  C C    . ASN B  1 173 ? 66.112  -6.910   24.020   1.00 199.33 ? 289 ASN B C    1 
ATOM   7682  O O    . ASN B  1 173 ? 65.958  -5.972   24.802   1.00 202.96 ? 289 ASN B O    1 
ATOM   7683  C CB   . ASN B  1 173 ? 64.665  -8.472   25.365   1.00 206.19 ? 289 ASN B CB   1 
ATOM   7684  C CG   . ASN B  1 173 ? 65.807  -9.054   26.219   1.00 214.33 ? 289 ASN B CG   1 
ATOM   7685  O OD1  . ASN B  1 173 ? 66.842  -9.488   25.711   1.00 213.88 ? 289 ASN B OD1  1 
ATOM   7686  N ND2  . ASN B  1 173 ? 65.583  -9.063   27.554   1.00 222.42 ? 289 ASN B ND2  1 
ATOM   7687  H H    . ASN B  1 173 ? 66.123  -9.676   23.507   1.00 258.68 ? 289 ASN B H    1 
ATOM   7688  H HA   . ASN B  1 173 ? 64.293  -7.663   23.515   1.00 267.76 ? 289 ASN B HA   1 
ATOM   7689  H HB2  . ASN B  1 173 ? 64.310  -7.701   25.835   1.00 275.57 ? 289 ASN B HB2  1 
ATOM   7690  H HB3  . ASN B  1 173 ? 63.977  -9.152   25.291   1.00 275.57 ? 289 ASN B HB3  1 
ATOM   7691  N N    . GLU B  1 174 ? 67.147  -7.002   23.190   1.00 200.03 ? 290 GLU B N    1 
ATOM   7692  C CA   . GLU B  1 174 ? 68.099  -5.909   23.018   1.00 200.28 ? 290 GLU B CA   1 
ATOM   7693  C C    . GLU B  1 174 ? 68.638  -5.870   21.593   1.00 193.40 ? 290 GLU B C    1 
ATOM   7694  O O    . GLU B  1 174 ? 69.092  -6.884   21.059   1.00 192.35 ? 290 GLU B O    1 
ATOM   7695  C CB   . GLU B  1 174 ? 69.265  -6.034   23.995   1.00 208.98 ? 290 GLU B CB   1 
ATOM   7696  C CG   . GLU B  1 174 ? 68.872  -6.040   25.454   1.00 216.91 ? 290 GLU B CG   1 
ATOM   7697  C CD   . GLU B  1 174 ? 70.048  -5.725   26.349   1.00 225.44 ? 290 GLU B CD   1 
ATOM   7698  O OE1  . GLU B  1 174 ? 71.063  -6.452   26.273   1.00 228.39 ? 290 GLU B OE1  1 
ATOM   7699  O OE2  . GLU B  1 174 ? 69.968  -4.735   27.103   1.00 229.46 ? 290 GLU B OE2  1 
ATOM   7700  H H    . GLU B  1 174 ? 67.322  -7.694   22.710   1.00 303.56 ? 290 GLU B H    1 
ATOM   7701  H HA   . GLU B  1 174 ? 67.650  -5.067   23.193   1.00 311.28 ? 290 GLU B HA   1 
ATOM   7702  H HB2  . GLU B  1 174 ? 69.732  -6.864   23.814   1.00 317.78 ? 290 GLU B HB2  1 
ATOM   7703  H HB3  . GLU B  1 174 ? 69.866  -5.285   23.856   1.00 317.78 ? 290 GLU B HB3  1 
ATOM   7704  H HG2  . GLU B  1 174 ? 68.188  -5.368   25.604   1.00 316.61 ? 290 GLU B HG2  1 
ATOM   7705  H HG3  . GLU B  1 174 ? 68.536  -6.919   25.692   1.00 316.61 ? 290 GLU B HG3  1 
ATOM   7706  N N    . SER B  1 175 ? 68.588  -4.688   20.987   1.00 201.42 ? 291 SER B N    1 
ATOM   7707  C CA   . SER B  1 175 ? 69.101  -4.494   19.638   1.00 195.27 ? 291 SER B CA   1 
ATOM   7708  C C    . SER B  1 175 ? 70.623  -4.542   19.623   1.00 199.06 ? 291 SER B C    1 
ATOM   7709  O O    . SER B  1 175 ? 71.278  -4.068   20.552   1.00 205.60 ? 291 SER B O    1 
ATOM   7710  C CB   . SER B  1 175 ? 68.620  -3.156   19.064   1.00 190.60 ? 291 SER B CB   1 
ATOM   7711  O OG   . SER B  1 175 ? 69.119  -2.063   19.817   1.00 195.44 ? 291 SER B OG   1 
ATOM   7712  H H    . SER B  1 175 ? 68.259  -3.977   21.341   1.00 202.15 ? 291 SER B H    1 
ATOM   7713  H HA   . SER B  1 175 ? 68.770  -5.204   19.066   1.00 188.42 ? 291 SER B HA   1 
ATOM   7714  H HB2  . SER B  1 175 ? 68.931  -3.076   18.149   1.00 175.47 ? 291 SER B HB2  1 
ATOM   7715  H HB3  . SER B  1 175 ? 67.650  -3.136   19.086   1.00 175.47 ? 291 SER B HB3  1 
ATOM   7716  H HG   . SER B  1 175 ? 68.846  -1.339   19.489   1.00 185.78 ? 291 SER B HG   1 
ATOM   7717  N N    . VAL B  1 176 ? 71.174  -5.127   18.564   1.00 194.61 ? 292 VAL B N    1 
ATOM   7718  C CA   . VAL B  1 176 ? 72.612  -5.122   18.332   1.00 197.50 ? 292 VAL B CA   1 
ATOM   7719  C C    . VAL B  1 176 ? 72.899  -4.358   17.047   1.00 191.43 ? 292 VAL B C    1 
ATOM   7720  O O    . VAL B  1 176 ? 72.562  -4.813   15.954   1.00 185.42 ? 292 VAL B O    1 
ATOM   7721  C CB   . VAL B  1 176 ? 73.184  -6.550   18.233   1.00 199.81 ? 292 VAL B CB   1 
ATOM   7722  C CG1  . VAL B  1 176 ? 74.681  -6.516   17.940   1.00 203.08 ? 292 VAL B CG1  1 
ATOM   7723  C CG2  . VAL B  1 176 ? 72.907  -7.323   19.515   1.00 206.41 ? 292 VAL B CG2  1 
ATOM   7724  H H    . VAL B  1 176 ? 70.727  -5.540   17.957   1.00 308.40 ? 292 VAL B H    1 
ATOM   7725  H HA   . VAL B  1 176 ? 73.055  -4.666   19.065   1.00 312.70 ? 292 VAL B HA   1 
ATOM   7726  H HB   . VAL B  1 176 ? 72.746  -7.015   17.503   1.00 316.84 ? 292 VAL B HB   1 
ATOM   7727  H HG11 . VAL B  1 176 ? 75.012  -7.426   17.883   1.00 319.54 ? 292 VAL B HG11 1 
ATOM   7728  H HG12 . VAL B  1 176 ? 74.827  -6.057   17.098   1.00 319.54 ? 292 VAL B HG12 1 
ATOM   7729  H HG13 . VAL B  1 176 ? 75.132  -6.043   18.658   1.00 319.54 ? 292 VAL B HG13 1 
ATOM   7730  H HG21 . VAL B  1 176 ? 73.275  -8.217   19.430   1.00 333.19 ? 292 VAL B HG21 1 
ATOM   7731  H HG22 . VAL B  1 176 ? 73.326  -6.862   20.258   1.00 333.19 ? 292 VAL B HG22 1 
ATOM   7732  H HG23 . VAL B  1 176 ? 71.948  -7.371   19.654   1.00 333.19 ? 292 VAL B HG23 1 
ATOM   7733  N N    . THR B  1 177 ? 73.512  -3.189   17.184   1.00 198.29 ? 293 THR B N    1 
ATOM   7734  C CA   . THR B  1 177 ? 73.823  -2.356   16.031   1.00 193.37 ? 293 THR B CA   1 
ATOM   7735  C C    . THR B  1 177 ? 74.959  -2.960   15.214   1.00 193.30 ? 293 THR B C    1 
ATOM   7736  O O    . THR B  1 177 ? 76.001  -3.326   15.761   1.00 199.54 ? 293 THR B O    1 
ATOM   7737  C CB   . THR B  1 177 ? 74.212  -0.931   16.455   1.00 196.44 ? 293 THR B CB   1 
ATOM   7738  O OG1  . THR B  1 177 ? 75.359  -0.981   17.312   1.00 204.44 ? 293 THR B OG1  1 
ATOM   7739  C CG2  . THR B  1 177 ? 73.060  -0.255   17.185   1.00 196.52 ? 293 THR B CG2  1 
ATOM   7740  H H    . THR B  1 177 ? 73.759  -2.854   17.937   1.00 246.78 ? 293 THR B H    1 
ATOM   7741  H HA   . THR B  1 177 ? 73.039  -2.298   15.462   1.00 234.00 ? 293 THR B HA   1 
ATOM   7742  H HB   . THR B  1 177 ? 74.422  -0.407   15.666   1.00 240.43 ? 293 THR B HB   1 
ATOM   7743  H HG1  . THR B  1 177 ? 76.005  -1.334   16.907   1.00 255.61 ? 293 THR B HG1  1 
ATOM   7744  H HG21 . THR B  1 177 ? 73.316  0.643    17.447   1.00 246.67 ? 293 THR B HG21 1 
ATOM   7745  H HG22 . THR B  1 177 ? 72.284  -0.205   16.605   1.00 246.67 ? 293 THR B HG22 1 
ATOM   7746  H HG23 . THR B  1 177 ? 72.828  -0.762   17.979   1.00 246.67 ? 293 THR B HG23 1 
ATOM   7747  N N    . ILE B  1 178 ? 74.748  -3.061   13.904   1.00 200.07 ? 294 ILE B N    1 
ATOM   7748  C CA   . ILE B  1 178 ? 75.759  -3.575   12.986   1.00 199.56 ? 294 ILE B CA   1 
ATOM   7749  C C    . ILE B  1 178 ? 76.041  -2.551   11.889   1.00 195.49 ? 294 ILE B C    1 
ATOM   7750  O O    . ILE B  1 178 ? 75.119  -2.025   11.263   1.00 189.77 ? 294 ILE B O    1 
ATOM   7751  C CB   . ILE B  1 178 ? 75.325  -4.922   12.355   1.00 196.16 ? 294 ILE B CB   1 
ATOM   7752  C CG1  . ILE B  1 178 ? 76.384  -5.416   11.367   1.00 195.97 ? 294 ILE B CG1  1 
ATOM   7753  C CG2  . ILE B  1 178 ? 73.962  -4.803   11.673   1.00 188.98 ? 294 ILE B CG2  1 
ATOM   7754  C CD1  . ILE B  1 178 ? 76.197  -6.857   10.933   1.00 194.79 ? 294 ILE B CD1  1 
ATOM   7755  H H    . ILE B  1 178 ? 74.014  -2.834   13.517   1.00 280.36 ? 294 ILE B H    1 
ATOM   7756  H HA   . ILE B  1 178 ? 76.583  -3.725   13.476   1.00 277.29 ? 294 ILE B HA   1 
ATOM   7757  H HB   . ILE B  1 178 ? 75.249  -5.577   13.067   1.00 271.63 ? 294 ILE B HB   1 
ATOM   7758  H HG12 . ILE B  1 178 ? 76.353  -4.861   10.573   1.00 269.78 ? 294 ILE B HG12 1 
ATOM   7759  H HG13 . ILE B  1 178 ? 77.257  -5.344   11.784   1.00 269.78 ? 294 ILE B HG13 1 
ATOM   7760  H HG21 . ILE B  1 178 ? 73.724  -5.663   11.292   1.00 259.13 ? 294 ILE B HG21 1 
ATOM   7761  H HG22 . ILE B  1 178 ? 73.301  -4.539   12.333   1.00 259.13 ? 294 ILE B HG22 1 
ATOM   7762  H HG23 . ILE B  1 178 ? 74.017  -4.134   10.973   1.00 259.13 ? 294 ILE B HG23 1 
ATOM   7763  H HD11 . ILE B  1 178 ? 76.903  -7.093   10.311   1.00 268.77 ? 294 ILE B HD11 1 
ATOM   7764  H HD12 . ILE B  1 178 ? 76.238  -7.430   11.714   1.00 268.77 ? 294 ILE B HD12 1 
ATOM   7765  H HD13 . ILE B  1 178 ? 75.333  -6.946   10.501   1.00 268.77 ? 294 ILE B HD13 1 
ATOM   7766  N N    . ASN B  1 179 ? 77.323  -2.260   11.678   1.00 200.45 ? 295 ASN B N    1 
ATOM   7767  C CA   . ASN B  1 179 ? 77.752  -1.286   10.678   1.00 197.74 ? 295 ASN B CA   1 
ATOM   7768  C C    . ASN B  1 179 ? 78.614  -1.921   9.592    1.00 196.77 ? 295 ASN B C    1 
ATOM   7769  O O    . ASN B  1 179 ? 79.725  -2.381   9.861    1.00 202.22 ? 295 ASN B O    1 
ATOM   7770  C CB   . ASN B  1 179 ? 78.533  -0.147   11.342   1.00 203.29 ? 295 ASN B CB   1 
ATOM   7771  C CG   . ASN B  1 179 ? 77.680  0.679    12.292   1.00 204.22 ? 295 ASN B CG   1 
ATOM   7772  O OD1  . ASN B  1 179 ? 76.460  0.754    12.148   1.00 199.32 ? 295 ASN B OD1  1 
ATOM   7773  N ND2  . ASN B  1 179 ? 78.327  1.312    13.267   1.00 211.00 ? 295 ASN B ND2  1 
ATOM   7774  H H    . ASN B  1 179 ? 77.974  -2.620   12.110   1.00 387.46 ? 295 ASN B H    1 
ATOM   7775  H HA   . ASN B  1 179 ? 76.968  -0.904   10.253   1.00 384.01 ? 295 ASN B HA   1 
ATOM   7776  H HB2  . ASN B  1 179 ? 79.269  -0.523   11.850   1.00 389.21 ? 295 ASN B HB2  1 
ATOM   7777  H HB3  . ASN B  1 179 ? 78.873  0.446    10.654   1.00 389.21 ? 295 ASN B HB3  1 
ATOM   7778  H HD21 . ASN B  1 179 ? 77.891  1.792    13.831   1.00 396.53 ? 295 ASN B HD21 1 
ATOM   7779  H HD22 . ASN B  1 179 ? 79.182  1.241    13.333   1.00 396.53 ? 295 ASN B HD22 1 
ATOM   7780  N N    . CYS B  1 180 ? 78.092  -1.941   8.368    1.00 193.43 ? 296 CYS B N    1 
ATOM   7781  C CA   . CYS B  1 180 ? 78.841  -2.423   7.211    1.00 192.24 ? 296 CYS B CA   1 
ATOM   7782  C C    . CYS B  1 180 ? 79.182  -1.248   6.306    1.00 190.21 ? 296 CYS B C    1 
ATOM   7783  O O    . CYS B  1 180 ? 78.341  -0.381   6.059    1.00 186.27 ? 296 CYS B O    1 
ATOM   7784  C CB   . CYS B  1 180 ? 78.045  -3.481   6.440    1.00 187.13 ? 296 CYS B CB   1 
ATOM   7785  S SG   . CYS B  1 180 ? 77.901  -5.089   7.271    1.00 190.32 ? 296 CYS B SG   1 
ATOM   7786  H H    . CYS B  1 180 ? 77.296  -1.677   8.180    1.00 232.58 ? 296 CYS B H    1 
ATOM   7787  H HA   . CYS B  1 180 ? 79.670  -2.826   7.512    1.00 228.11 ? 296 CYS B HA   1 
ATOM   7788  H HB2  . CYS B  1 180 ? 77.147  -3.146   6.294    1.00 220.72 ? 296 CYS B HB2  1 
ATOM   7789  H HB3  . CYS B  1 180 ? 78.479  -3.631   5.586    1.00 220.72 ? 296 CYS B HB3  1 
ATOM   7790  N N    . THR B  1 181 ? 80.418  -1.225   5.816    1.00 186.87 ? 297 THR B N    1 
ATOM   7791  C CA   . THR B  1 181 ? 80.908  -0.112   5.011    1.00 186.20 ? 297 THR B CA   1 
ATOM   7792  C C    . THR B  1 181 ? 81.780  -0.577   3.850    1.00 186.22 ? 297 THR B C    1 
ATOM   7793  O O    . THR B  1 181 ? 82.591  -1.493   3.993    1.00 190.17 ? 297 THR B O    1 
ATOM   7794  C CB   . THR B  1 181 ? 81.720  0.883    5.868    1.00 192.38 ? 297 THR B CB   1 
ATOM   7795  O OG1  . THR B  1 181 ? 82.296  1.888    5.024    1.00 192.79 ? 297 THR B OG1  1 
ATOM   7796  C CG2  . THR B  1 181 ? 82.830  0.170    6.636    1.00 199.63 ? 297 THR B CG2  1 
ATOM   7797  H H    . THR B  1 181 ? 80.997  -1.849   5.937    1.00 393.55 ? 297 THR B H    1 
ATOM   7798  H HA   . THR B  1 181 ? 80.148  0.364    4.641    1.00 392.56 ? 297 THR B HA   1 
ATOM   7799  H HB   . THR B  1 181 ? 81.130  1.306    6.512    1.00 398.48 ? 297 THR B HB   1 
ATOM   7800  H HG1  . THR B  1 181 ? 82.739  2.432    5.486    1.00 397.99 ? 297 THR B HG1  1 
ATOM   7801  H HG21 . THR B  1 181 ? 83.329  0.810    7.168    1.00 401.90 ? 297 THR B HG21 1 
ATOM   7802  H HG22 . THR B  1 181 ? 82.449  -0.500   7.224    1.00 401.90 ? 297 THR B HG22 1 
ATOM   7803  H HG23 . THR B  1 181 ? 83.436  -0.263   6.015    1.00 401.90 ? 297 THR B HG23 1 
ATOM   7804  N N    . ARG B  1 182 ? 81.600  0.071    2.703    1.00 183.72 ? 298 ARG B N    1 
ATOM   7805  C CA   . ARG B  1 182 ? 82.415  -0.184   1.520    1.00 183.92 ? 298 ARG B CA   1 
ATOM   7806  C C    . ARG B  1 182 ? 83.271  1.045    1.203    1.00 187.23 ? 298 ARG B C    1 
ATOM   7807  O O    . ARG B  1 182 ? 82.759  2.024    0.662    1.00 184.74 ? 298 ARG B O    1 
ATOM   7808  C CB   . ARG B  1 182 ? 81.531  -0.533   0.326    1.00 177.36 ? 298 ARG B CB   1 
ATOM   7809  C CG   . ARG B  1 182 ? 82.300  -1.034   -0.880   1.00 177.78 ? 298 ARG B CG   1 
ATOM   7810  C CD   . ARG B  1 182 ? 81.719  -0.482   -2.160   1.00 172.76 ? 298 ARG B CD   1 
ATOM   7811  N NE   . ARG B  1 182 ? 82.214  0.857    -2.457   1.00 174.70 ? 298 ARG B NE   1 
ATOM   7812  C CZ   . ARG B  1 182 ? 81.939  1.528    -3.570   1.00 172.35 ? 298 ARG B CZ   1 
ATOM   7813  N NH1  . ARG B  1 182 ? 81.168  0.985    -4.501   1.00 167.40 ? 298 ARG B NH1  1 
ATOM   7814  N NH2  . ARG B  1 182 ? 82.436  2.743    -3.754   1.00 175.32 ? 298 ARG B NH2  1 
ATOM   7815  H H    . ARG B  1 182 ? 81.000  0.675    2.584    1.00 191.63 ? 298 ARG B H    1 
ATOM   7816  H HA   . ARG B  1 182 ? 83.007  -0.933   1.692    1.00 192.52 ? 298 ARG B HA   1 
ATOM   7817  H HB2  . ARG B  1 182 ? 80.908  -1.228   0.591    1.00 185.87 ? 298 ARG B HB2  1 
ATOM   7818  H HB3  . ARG B  1 182 ? 81.043  0.261    0.057    1.00 185.87 ? 298 ARG B HB3  1 
ATOM   7819  H HG2  . ARG B  1 182 ? 83.224  -0.747   -0.814   1.00 188.50 ? 298 ARG B HG2  1 
ATOM   7820  H HG3  . ARG B  1 182 ? 82.250  -2.002   -0.914   1.00 188.50 ? 298 ARG B HG3  1 
ATOM   7821  H HD2  . ARG B  1 182 ? 81.963  -1.063   -2.897   1.00 185.11 ? 298 ARG B HD2  1 
ATOM   7822  H HD3  . ARG B  1 182 ? 80.754  -0.435   -2.077   1.00 185.11 ? 298 ARG B HD3  1 
ATOM   7823  H HE   . ARG B  1 182 ? 82.717  1.238    -1.873   1.00 186.92 ? 298 ARG B HE   1 
ATOM   7824  H HH11 . ARG B  1 182 ? 80.844  0.196    -4.385   1.00 182.51 ? 298 ARG B HH11 1 
ATOM   7825  H HH12 . ARG B  1 182 ? 80.991  1.420    -5.221   1.00 182.51 ? 298 ARG B HH12 1 
ATOM   7826  H HH21 . ARG B  1 182 ? 82.937  3.098    -3.152   1.00 188.70 ? 298 ARG B HH21 1 
ATOM   7827  H HH22 . ARG B  1 182 ? 82.257  3.176    -4.475   1.00 188.70 ? 298 ARG B HH22 1 
ATOM   7828  N N    . PRO B  1 183 ? 84.573  1.004    1.534    1.00 185.76 ? 299 PRO B N    1 
ATOM   7829  C CA   . PRO B  1 183 ? 85.407  2.199    1.333    1.00 190.19 ? 299 PRO B CA   1 
ATOM   7830  C C    . PRO B  1 183 ? 85.561  2.602    -0.138   1.00 187.67 ? 299 PRO B C    1 
ATOM   7831  O O    . PRO B  1 183 ? 85.205  1.833    -1.032   1.00 183.15 ? 299 PRO B O    1 
ATOM   7832  C CB   . PRO B  1 183 ? 86.759  1.795    1.941    1.00 197.78 ? 299 PRO B CB   1 
ATOM   7833  C CG   . PRO B  1 183 ? 86.748  0.309    1.995    1.00 197.00 ? 299 PRO B CG   1 
ATOM   7834  C CD   . PRO B  1 183 ? 85.323  -0.104   2.151    1.00 190.56 ? 299 PRO B CD   1 
ATOM   7835  H HA   . PRO B  1 183 ? 85.045  2.948    1.833    1.00 342.91 ? 299 PRO B HA   1 
ATOM   7836  H HB2  . PRO B  1 183 ? 87.479  2.110    1.373    1.00 350.79 ? 299 PRO B HB2  1 
ATOM   7837  H HB3  . PRO B  1 183 ? 86.839  2.168    2.833    1.00 350.79 ? 299 PRO B HB3  1 
ATOM   7838  H HG2  . PRO B  1 183 ? 87.114  -0.046   1.169    1.00 351.70 ? 299 PRO B HG2  1 
ATOM   7839  H HG3  . PRO B  1 183 ? 87.272  0.010    2.754    1.00 351.70 ? 299 PRO B HG3  1 
ATOM   7840  H HD2  . PRO B  1 183 ? 85.157  -0.931   1.674    1.00 343.42 ? 299 PRO B HD2  1 
ATOM   7841  H HD3  . PRO B  1 183 ? 85.096  -0.183   3.091    1.00 343.42 ? 299 PRO B HD3  1 
ATOM   7842  N N    . ASN B  1 184 ? 86.084  3.804    -0.372   1.00 192.54 ? 300 ASN B N    1 
ATOM   7843  C CA   . ASN B  1 184 ? 86.204  4.367    -1.719   1.00 190.77 ? 300 ASN B CA   1 
ATOM   7844  C C    . ASN B  1 184 ? 87.369  3.814    -2.546   1.00 193.65 ? 300 ASN B C    1 
ATOM   7845  O O    . ASN B  1 184 ? 87.844  4.473    -3.474   1.00 194.87 ? 300 ASN B O    1 
ATOM   7846  C CB   . ASN B  1 184 ? 86.344  5.890    -1.622   1.00 193.75 ? 300 ASN B CB   1 
ATOM   7847  C CG   . ASN B  1 184 ? 85.063  6.566    -1.197   1.00 189.91 ? 300 ASN B CG   1 
ATOM   7848  O OD1  . ASN B  1 184 ? 84.215  5.961    -0.544   1.00 186.71 ? 300 ASN B OD1  1 
ATOM   7849  N ND2  . ASN B  1 184 ? 84.911  7.828    -1.575   1.00 190.44 ? 300 ASN B ND2  1 
ATOM   7850  H H    . ASN B  1 184 ? 86.384  4.323    0.244    1.00 311.24 ? 300 ASN B H    1 
ATOM   7851  H HA   . ASN B  1 184 ? 85.386  4.178    -2.205   1.00 310.29 ? 300 ASN B HA   1 
ATOM   7852  H HB2  . ASN B  1 184 ? 87.028  6.104    -0.968   1.00 310.89 ? 300 ASN B HB2  1 
ATOM   7853  H HB3  . ASN B  1 184 ? 86.594  6.240    -2.491   1.00 310.89 ? 300 ASN B HB3  1 
ATOM   7854  H HD21 . ASN B  1 184 ? 84.199  8.259    -1.359   1.00 305.40 ? 300 ASN B HD21 1 
ATOM   7855  H HD22 . ASN B  1 184 ? 85.524  8.216    -2.037   1.00 305.40 ? 300 ASN B HD22 1 
ATOM   7856  N N    . ASN B  1 185 ? 87.828  2.610    -2.219   1.00 194.72 ? 301 ASN B N    1 
ATOM   7857  C CA   . ASN B  1 185 ? 88.933  1.991    -2.948   1.00 197.78 ? 301 ASN B CA   1 
ATOM   7858  C C    . ASN B  1 185 ? 88.595  1.762    -4.418   1.00 193.23 ? 301 ASN B C    1 
ATOM   7859  O O    . ASN B  1 185 ? 88.047  0.723    -4.788   1.00 189.66 ? 301 ASN B O    1 
ATOM   7860  C CB   . ASN B  1 185 ? 89.322  0.665    -2.294   1.00 200.93 ? 301 ASN B CB   1 
ATOM   7861  C CG   . ASN B  1 185 ? 89.837  0.840    -0.877   1.00 206.89 ? 301 ASN B CG   1 
ATOM   7862  O OD1  . ASN B  1 185 ? 89.797  1.937    -0.319   1.00 208.36 ? 301 ASN B OD1  1 
ATOM   7863  N ND2  . ASN B  1 185 ? 90.320  -0.247   -0.284   1.00 210.95 ? 301 ASN B ND2  1 
ATOM   7864  H H    . ASN B  1 185 ? 87.516  2.129    -1.579   1.00 216.32 ? 301 ASN B H    1 
ATOM   7865  H HA   . ASN B  1 185 ? 89.703  2.580    -2.908   1.00 223.11 ? 301 ASN B HA   1 
ATOM   7866  H HB2  . ASN B  1 185 ? 88.543  0.088    -2.261   1.00 226.34 ? 301 ASN B HB2  1 
ATOM   7867  H HB3  . ASN B  1 185 ? 90.023  0.247    -2.819   1.00 226.34 ? 301 ASN B HB3  1 
ATOM   7868  H HD21 . ASN B  1 185 ? 90.624  -0.200   0.520    1.00 231.49 ? 301 ASN B HD21 1 
ATOM   7869  H HD22 . ASN B  1 185 ? 90.328  -0.998   -0.703   1.00 231.49 ? 301 ASN B HD22 1 
ATOM   7870  N N    . SER B  1 190 ? 93.218  4.701    -3.377   1.00 223.12 ? 322 SER B N    1 
ATOM   7871  C CA   . SER B  1 190 ? 93.548  3.524    -2.583   1.00 225.28 ? 322 SER B CA   1 
ATOM   7872  C C    . SER B  1 190 ? 93.523  2.264    -3.439   1.00 222.75 ? 322 SER B C    1 
ATOM   7873  O O    . SER B  1 190 ? 92.505  1.937    -4.051   1.00 215.48 ? 322 SER B O    1 
ATOM   7874  C CB   . SER B  1 190 ? 92.575  3.377    -1.411   1.00 222.52 ? 322 SER B CB   1 
ATOM   7875  O OG   . SER B  1 190 ? 92.878  2.227    -0.639   1.00 225.27 ? 322 SER B OG   1 
ATOM   7876  H HA   . SER B  1 190 ? 94.442  3.625    -2.221   1.00 268.66 ? 322 SER B HA   1 
ATOM   7877  H HB2  . SER B  1 190 ? 92.642  4.162    -0.847   1.00 266.93 ? 322 SER B HB2  1 
ATOM   7878  H HB3  . SER B  1 190 ? 91.674  3.294    -1.759   1.00 266.93 ? 322 SER B HB3  1 
ATOM   7879  H HG   . SER B  1 190 ? 92.337  2.160    0.000    1.00 267.32 ? 322 SER B HG   1 
ATOM   7880  N N    . GLY B  1 191 ? 94.651  1.564    -3.480   1.00 216.44 ? 323 GLY B N    1 
ATOM   7881  C CA   . GLY B  1 191 ? 94.753  0.326    -4.229   1.00 215.47 ? 323 GLY B CA   1 
ATOM   7882  C C    . GLY B  1 191 ? 93.927  -0.779   -3.600   1.00 211.80 ? 323 GLY B C    1 
ATOM   7883  O O    . GLY B  1 191 ? 94.438  -1.584   -2.821   1.00 216.76 ? 323 GLY B O    1 
ATOM   7884  H H    . GLY B  1 191 ? 95.377  1.790    -3.077   1.00 374.05 ? 323 GLY B H    1 
ATOM   7885  H HA2  . GLY B  1 191 ? 94.442  0.468    -5.137   1.00 374.69 ? 323 GLY B HA2  1 
ATOM   7886  H HA3  . GLY B  1 191 ? 95.680  0.040    -4.261   1.00 374.69 ? 323 GLY B HA3  1 
ATOM   7887  N N    . GLY B  1 192 ? 92.643  -0.813   -3.942   1.00 211.74 ? 324 GLY B N    1 
ATOM   7888  C CA   . GLY B  1 192 ? 91.733  -1.809   -3.407   1.00 207.81 ? 324 GLY B CA   1 
ATOM   7889  C C    . GLY B  1 192 ? 90.565  -2.052   -4.342   1.00 199.59 ? 324 GLY B C    1 
ATOM   7890  O O    . GLY B  1 192 ? 90.229  -1.202   -5.167   1.00 196.10 ? 324 GLY B O    1 
ATOM   7891  H H    . GLY B  1 192 ? 92.273  -0.262   -4.489   1.00 241.19 ? 324 GLY B H    1 
ATOM   7892  H HA2  . GLY B  1 192 ? 92.205  -2.646   -3.276   1.00 237.11 ? 324 GLY B HA2  1 
ATOM   7893  H HA3  . GLY B  1 192 ? 91.388  -1.510   -2.551   1.00 237.11 ? 324 GLY B HA3  1 
ATOM   7894  N N    . ASP B  1 193 ? 89.945  -3.220   -4.211   1.00 204.16 ? 325 ASP B N    1 
ATOM   7895  C CA   . ASP B  1 193 ? 88.830  -3.595   -5.072   1.00 197.01 ? 325 ASP B CA   1 
ATOM   7896  C C    . ASP B  1 193 ? 87.564  -2.833   -4.689   1.00 190.87 ? 325 ASP B C    1 
ATOM   7897  O O    . ASP B  1 193 ? 87.300  -2.604   -3.508   1.00 191.57 ? 325 ASP B O    1 
ATOM   7898  C CB   . ASP B  1 193 ? 88.582  -5.103   -4.994   1.00 196.88 ? 325 ASP B CB   1 
ATOM   7899  C CG   . ASP B  1 193 ? 87.526  -5.575   -5.977   1.00 190.44 ? 325 ASP B CG   1 
ATOM   7900  O OD1  . ASP B  1 193 ? 87.381  -4.948   -7.049   1.00 187.76 ? 325 ASP B OD1  1 
ATOM   7901  O OD2  . ASP B  1 193 ? 86.841  -6.578   -5.680   1.00 188.48 ? 325 ASP B OD2  1 
ATOM   7902  H H    . ASP B  1 193 ? 90.152  -3.816   -3.627   1.00 220.03 ? 325 ASP B H    1 
ATOM   7903  H HA   . ASP B  1 193 ? 89.049  -3.373   -5.990   1.00 215.04 ? 325 ASP B HA   1 
ATOM   7904  H HB2  . ASP B  1 193 ? 89.408  -5.570   -5.193   1.00 216.83 ? 325 ASP B HB2  1 
ATOM   7905  H HB3  . ASP B  1 193 ? 88.281  -5.328   -4.099   1.00 216.83 ? 325 ASP B HB3  1 
ATOM   7906  N N    . ILE B  1 194 ? 86.784  -2.445   -5.694   1.00 189.93 ? 326 ILE B N    1 
ATOM   7907  C CA   . ILE B  1 194 ? 85.567  -1.672   -5.468   1.00 184.36 ? 326 ILE B CA   1 
ATOM   7908  C C    . ILE B  1 194 ? 84.447  -2.502   -4.841   1.00 180.57 ? 326 ILE B C    1 
ATOM   7909  O O    . ILE B  1 194 ? 83.392  -1.965   -4.514   1.00 176.38 ? 326 ILE B O    1 
ATOM   7910  C CB   . ILE B  1 194 ? 85.037  -1.056   -6.785   1.00 180.05 ? 326 ILE B CB   1 
ATOM   7911  C CG1  . ILE B  1 194 ? 84.664  -2.158   -7.783   1.00 177.51 ? 326 ILE B CG1  1 
ATOM   7912  C CG2  . ILE B  1 194 ? 86.071  -0.109   -7.381   1.00 183.90 ? 326 ILE B CG2  1 
ATOM   7913  C CD1  . ILE B  1 194 ? 83.914  -1.662   -9.002   1.00 173.01 ? 326 ILE B CD1  1 
ATOM   7914  H H    . ILE B  1 194 ? 86.938  -2.619   -6.522   1.00 169.49 ? 326 ILE B H    1 
ATOM   7915  H HA   . ILE B  1 194 ? 85.770  -0.943   -4.862   1.00 161.87 ? 326 ILE B HA   1 
ATOM   7916  H HB   . ILE B  1 194 ? 84.237  -0.545   -6.582   1.00 160.93 ? 326 ILE B HB   1 
ATOM   7917  H HG12 . ILE B  1 194 ? 85.477  -2.588   -8.090   1.00 160.82 ? 326 ILE B HG12 1 
ATOM   7918  H HG13 . ILE B  1 194 ? 84.100  -2.807   -7.333   1.00 160.82 ? 326 ILE B HG13 1 
ATOM   7919  H HG21 . ILE B  1 194 ? 85.719  0.265    -8.204   1.00 167.94 ? 326 ILE B HG21 1 
ATOM   7920  H HG22 . ILE B  1 194 ? 86.252  0.601    -6.745   1.00 167.94 ? 326 ILE B HG22 1 
ATOM   7921  H HG23 . ILE B  1 194 ? 86.884  -0.605   -7.563   1.00 167.94 ? 326 ILE B HG23 1 
ATOM   7922  H HD11 . ILE B  1 194 ? 83.717  -2.416   -9.579   1.00 160.61 ? 326 ILE B HD11 1 
ATOM   7923  H HD12 . ILE B  1 194 ? 83.089  -1.240   -8.715   1.00 160.61 ? 326 ILE B HD12 1 
ATOM   7924  H HD13 . ILE B  1 194 ? 84.468  -1.020   -9.473   1.00 160.61 ? 326 ILE B HD13 1 
ATOM   7925  N N    . ARG B  1 195 ? 84.673  -3.804   -4.685   1.00 179.63 ? 327 ARG B N    1 
ATOM   7926  C CA   . ARG B  1 195 ? 83.661  -4.704   -4.133   1.00 176.68 ? 327 ARG B CA   1 
ATOM   7927  C C    . ARG B  1 195 ? 84.039  -5.220   -2.747   1.00 181.18 ? 327 ARG B C    1 
ATOM   7928  O O    . ARG B  1 195 ? 83.301  -6.005   -2.146   1.00 179.80 ? 327 ARG B O    1 
ATOM   7929  C CB   . ARG B  1 195 ? 83.431  -5.879   -5.083   1.00 175.12 ? 327 ARG B CB   1 
ATOM   7930  C CG   . ARG B  1 195 ? 82.783  -5.467   -6.389   1.00 170.29 ? 327 ARG B CG   1 
ATOM   7931  C CD   . ARG B  1 195 ? 82.626  -6.629   -7.345   1.00 169.76 ? 327 ARG B CD   1 
ATOM   7932  N NE   . ARG B  1 195 ? 82.007  -6.197   -8.593   1.00 165.70 ? 327 ARG B NE   1 
ATOM   7933  C CZ   . ARG B  1 195 ? 82.659  -5.604   -9.589   1.00 166.90 ? 327 ARG B CZ   1 
ATOM   7934  N NH1  . ARG B  1 195 ? 83.961  -5.367   -9.496   1.00 172.01 ? 327 ARG B NH1  1 
ATOM   7935  N NH2  . ARG B  1 195 ? 82.004  -5.244   -10.683  1.00 163.40 ? 327 ARG B NH2  1 
ATOM   7936  H H    . ARG B  1 195 ? 85.410  -4.195   -4.894   1.00 170.60 ? 327 ARG B H    1 
ATOM   7937  H HA   . ARG B  1 195 ? 82.824  -4.220   -4.051   1.00 166.99 ? 327 ARG B HA   1 
ATOM   7938  H HB2  . ARG B  1 195 ? 84.285  -6.289   -5.289   1.00 169.81 ? 327 ARG B HB2  1 
ATOM   7939  H HB3  . ARG B  1 195 ? 82.849  -6.524   -4.652   1.00 169.81 ? 327 ARG B HB3  1 
ATOM   7940  H HG2  . ARG B  1 195 ? 81.902  -5.105   -6.206   1.00 167.51 ? 327 ARG B HG2  1 
ATOM   7941  H HG3  . ARG B  1 195 ? 83.336  -4.795   -6.819   1.00 167.51 ? 327 ARG B HG3  1 
ATOM   7942  H HD2  . ARG B  1 195 ? 83.500  -6.999   -7.548   1.00 172.68 ? 327 ARG B HD2  1 
ATOM   7943  H HD3  . ARG B  1 195 ? 82.060  -7.304   -6.940   1.00 172.68 ? 327 ARG B HD3  1 
ATOM   7944  H HE   . ARG B  1 195 ? 81.164  -6.336   -8.691   1.00 173.13 ? 327 ARG B HE   1 
ATOM   7945  H HH11 . ARG B  1 195 ? 84.391  -5.597   -8.788   1.00 183.93 ? 327 ARG B HH11 1 
ATOM   7946  H HH12 . ARG B  1 195 ? 84.376  -4.983   -10.145  1.00 183.93 ? 327 ARG B HH12 1 
ATOM   7947  H HH21 . ARG B  1 195 ? 81.160  -5.396   -10.749  1.00 180.28 ? 327 ARG B HH21 1 
ATOM   7948  H HH22 . ARG B  1 195 ? 82.424  -4.862   -11.329  1.00 180.28 ? 327 ARG B HH22 1 
ATOM   7949  N N    . GLN B  1 196 ? 85.185  -4.775   -2.241   1.00 182.82 ? 328 GLN B N    1 
ATOM   7950  C CA   . GLN B  1 196 ? 85.637  -5.169   -0.912   1.00 188.07 ? 328 GLN B CA   1 
ATOM   7951  C C    . GLN B  1 196 ? 84.959  -4.332   0.164    1.00 186.83 ? 328 GLN B C    1 
ATOM   7952  O O    . GLN B  1 196 ? 84.999  -3.101   0.129    1.00 186.24 ? 328 GLN B O    1 
ATOM   7953  C CB   . GLN B  1 196 ? 87.157  -5.041   -0.799   1.00 195.61 ? 328 GLN B CB   1 
ATOM   7954  C CG   . GLN B  1 196 ? 87.914  -6.213   -1.401   1.00 199.07 ? 328 GLN B CG   1 
ATOM   7955  C CD   . GLN B  1 196 ? 89.415  -6.000   -1.419   1.00 206.71 ? 328 GLN B CD   1 
ATOM   7956  O OE1  . GLN B  1 196 ? 89.926  -5.042   -0.839   1.00 210.00 ? 328 GLN B OE1  1 
ATOM   7957  N NE2  . GLN B  1 196 ? 90.131  -6.897   -2.089   1.00 210.02 ? 328 GLN B NE2  1 
ATOM   7958  H H    . GLN B  1 196 ? 85.721  -4.241   -2.650   1.00 265.39 ? 328 GLN B H    1 
ATOM   7959  H HA   . GLN B  1 196 ? 85.402  -6.098   -0.761   1.00 269.54 ? 328 GLN B HA   1 
ATOM   7960  H HB2  . GLN B  1 196 ? 87.439  -4.237   -1.262   1.00 277.82 ? 328 GLN B HB2  1 
ATOM   7961  H HB3  . GLN B  1 196 ? 87.398  -4.983   0.139    1.00 277.82 ? 328 GLN B HB3  1 
ATOM   7962  H HG2  . GLN B  1 196 ? 87.730  -7.009   -0.878   1.00 283.67 ? 328 GLN B HG2  1 
ATOM   7963  H HG3  . GLN B  1 196 ? 87.619  -6.342   -2.316   1.00 283.67 ? 328 GLN B HG3  1 
ATOM   7964  H HE21 . GLN B  1 196 ? 90.987  -6.820   -2.129   1.00 299.16 ? 328 GLN B HE21 1 
ATOM   7965  H HE22 . GLN B  1 196 ? 89.739  -7.553   -2.482   1.00 299.16 ? 328 GLN B HE22 1 
ATOM   7966  N N    . ALA B  1 197 ? 84.335  -5.017   1.115    1.00 189.31 ? 329 ALA B N    1 
ATOM   7967  C CA   . ALA B  1 197 ? 83.666  -4.368   2.234    1.00 188.81 ? 329 ALA B CA   1 
ATOM   7968  C C    . ALA B  1 197 ? 83.854  -5.192   3.501    1.00 193.84 ? 329 ALA B C    1 
ATOM   7969  O O    . ALA B  1 197 ? 84.390  -6.299   3.457    1.00 197.11 ? 329 ALA B O    1 
ATOM   7970  C CB   . ALA B  1 197 ? 82.189  -4.184   1.934    1.00 181.50 ? 329 ALA B CB   1 
ATOM   7971  H H    . ALA B  1 197 ? 84.285  -5.875   1.134    1.00 206.99 ? 329 ALA B H    1 
ATOM   7972  H HA   . ALA B  1 197 ? 84.058  -3.493   2.378    1.00 205.25 ? 329 ALA B HA   1 
ATOM   7973  H HB1  . ALA B  1 197 ? 81.766  -3.751   2.692    1.00 196.81 ? 329 ALA B HB1  1 
ATOM   7974  H HB2  . ALA B  1 197 ? 82.095  -3.632   1.142    1.00 196.81 ? 329 ALA B HB2  1 
ATOM   7975  H HB3  . ALA B  1 197 ? 81.787  -5.053   1.782    1.00 196.81 ? 329 ALA B HB3  1 
ATOM   7976  N N    . HIS B  1 198 ? 83.412  -4.643   4.627    1.00 189.65 ? 330 HIS B N    1 
ATOM   7977  C CA   . HIS B  1 198 ? 83.490  -5.330   5.911    1.00 194.67 ? 330 HIS B CA   1 
ATOM   7978  C C    . HIS B  1 198 ? 82.308  -4.928   6.784    1.00 192.09 ? 330 HIS B C    1 
ATOM   7979  O O    . HIS B  1 198 ? 81.723  -3.863   6.590    1.00 188.24 ? 330 HIS B O    1 
ATOM   7980  C CB   . HIS B  1 198 ? 84.803  -5.004   6.629    1.00 202.99 ? 330 HIS B CB   1 
ATOM   7981  C CG   . HIS B  1 198 ? 86.026  -5.495   5.917    1.00 206.88 ? 330 HIS B CG   1 
ATOM   7982  N ND1  . HIS B  1 198 ? 86.554  -6.751   6.123    1.00 211.42 ? 330 HIS B ND1  1 
ATOM   7983  C CD2  . HIS B  1 198 ? 86.830  -4.894   5.007    1.00 207.40 ? 330 HIS B CD2  1 
ATOM   7984  C CE1  . HIS B  1 198 ? 87.628  -6.905   5.368    1.00 214.55 ? 330 HIS B CE1  1 
ATOM   7985  N NE2  . HIS B  1 198 ? 87.817  -5.793   4.681    1.00 212.19 ? 330 HIS B NE2  1 
ATOM   7986  H H    . HIS B  1 198 ? 83.057  -3.861   4.674    1.00 196.07 ? 330 HIS B H    1 
ATOM   7987  H HA   . HIS B  1 198 ? 83.451  -6.288   5.766    1.00 203.80 ? 330 HIS B HA   1 
ATOM   7988  H HB2  . HIS B  1 198 ? 84.879  -4.041   6.718    1.00 213.28 ? 330 HIS B HB2  1 
ATOM   7989  H HB3  . HIS B  1 198 ? 84.788  -5.415   7.508    1.00 213.28 ? 330 HIS B HB3  1 
ATOM   7990  H HD1  . HIS B  1 198 ? 86.234  -7.344   6.658    1.00 219.44 ? 330 HIS B HD1  1 
ATOM   7991  H HD2  . HIS B  1 198 ? 86.731  -4.035   4.666    1.00 216.29 ? 330 HIS B HD2  1 
ATOM   7992  H HE1  . HIS B  1 198 ? 88.160  -7.667   5.327    1.00 222.06 ? 330 HIS B HE1  1 
ATOM   7993  H HE2  . HIS B  1 198 ? 88.454  -5.654   4.121    1.00 220.06 ? 330 HIS B HE2  1 
ATOM   7994  N N    . CYS B  1 199 ? 81.963  -5.788   7.740    1.00 203.11 ? 331 CYS B N    1 
ATOM   7995  C CA   . CYS B  1 199 ? 80.898  -5.507   8.700    1.00 201.91 ? 331 CYS B CA   1 
ATOM   7996  C C    . CYS B  1 199 ? 81.460  -5.569   10.119   1.00 209.83 ? 331 CYS B C    1 
ATOM   7997  O O    . CYS B  1 199 ? 82.218  -6.481   10.452   1.00 215.28 ? 331 CYS B O    1 
ATOM   7998  C CB   . CYS B  1 199 ? 79.739  -6.497   8.538    1.00 197.45 ? 331 CYS B CB   1 
ATOM   7999  S SG   . CYS B  1 199 ? 79.097  -6.680   6.843    1.00 189.13 ? 331 CYS B SG   1 
ATOM   8000  H HA   . CYS B  1 199 ? 80.556  -4.612   8.547    1.00 275.45 ? 331 CYS B HA   1 
ATOM   8001  H HB2  . CYS B  1 199 ? 80.039  -7.371   8.832    1.00 273.03 ? 331 CYS B HB2  1 
ATOM   8002  H HB3  . CYS B  1 199 ? 79.003  -6.202   9.097    1.00 273.03 ? 331 CYS B HB3  1 
ATOM   8003  N N    . ASN B  1 200 ? 81.087  -4.593   10.945   1.00 200.23 ? 332 ASN B N    1 
ATOM   8004  C CA   . ASN B  1 200 ? 81.623  -4.466   12.301   1.00 208.22 ? 332 ASN B CA   1 
ATOM   8005  C C    . ASN B  1 200 ? 80.547  -4.488   13.384   1.00 208.43 ? 332 ASN B C    1 
ATOM   8006  O O    . ASN B  1 200 ? 79.507  -3.840   13.256   1.00 203.20 ? 332 ASN B O    1 
ATOM   8007  C CB   . ASN B  1 200 ? 82.429  -3.171   12.419   1.00 211.61 ? 332 ASN B CB   1 
ATOM   8008  C CG   . ASN B  1 200 ? 83.736  -3.224   11.656   1.00 214.33 ? 332 ASN B CG   1 
ATOM   8009  O OD1  . ASN B  1 200 ? 84.429  -4.240   11.658   1.00 218.20 ? 332 ASN B OD1  1 
ATOM   8010  N ND2  . ASN B  1 200 ? 84.081  -2.123   10.996   1.00 212.72 ? 332 ASN B ND2  1 
ATOM   8011  H H    . ASN B  1 200 ? 80.517  -3.983   10.741   1.00 267.35 ? 332 ASN B H    1 
ATOM   8012  H HA   . ASN B  1 200 ? 82.226  -5.207   12.468   1.00 280.62 ? 332 ASN B HA   1 
ATOM   8013  H HB2  . ASN B  1 200 ? 81.903  -2.437   12.064   1.00 283.79 ? 332 ASN B HB2  1 
ATOM   8014  H HB3  . ASN B  1 200 ? 82.633  -3.010   13.354   1.00 283.79 ? 332 ASN B HB3  1 
ATOM   8015  H HD21 . ASN B  1 200 ? 84.814  -2.103   10.547   1.00 303.07 ? 332 ASN B HD21 1 
ATOM   8016  H HD22 . ASN B  1 200 ? 83.570  -1.432   11.018   1.00 303.07 ? 332 ASN B HD22 1 
ATOM   8017  N N    . VAL B  1 201 ? 80.811  -5.241   14.449   1.00 210.81 ? 333 VAL B N    1 
ATOM   8018  C CA   . VAL B  1 201 ? 79.940  -5.270   15.623   1.00 212.78 ? 333 VAL B CA   1 
ATOM   8019  C C    . VAL B  1 201 ? 80.783  -5.463   16.884   1.00 222.82 ? 333 VAL B C    1 
ATOM   8020  O O    . VAL B  1 201 ? 81.854  -6.071   16.839   1.00 227.87 ? 333 VAL B O    1 
ATOM   8021  C CB   . VAL B  1 201 ? 78.882  -6.396   15.544   1.00 208.98 ? 333 VAL B CB   1 
ATOM   8022  C CG1  . VAL B  1 201 ? 77.799  -6.176   16.596   1.00 209.73 ? 333 VAL B CG1  1 
ATOM   8023  C CG2  . VAL B  1 201 ? 78.251  -6.465   14.161   1.00 200.05 ? 333 VAL B CG2  1 
ATOM   8024  H H    . VAL B  1 201 ? 81.499  -5.753   14.517   1.00 410.75 ? 333 VAL B H    1 
ATOM   8025  H HA   . VAL B  1 201 ? 79.475  -4.422   15.695   1.00 412.60 ? 333 VAL B HA   1 
ATOM   8026  H HB   . VAL B  1 201 ? 79.310  -7.248   15.724   1.00 411.79 ? 333 VAL B HB   1 
ATOM   8027  H HG11 . VAL B  1 201 ? 77.147  -6.891   16.531   1.00 413.57 ? 333 VAL B HG11 1 
ATOM   8028  H HG12 . VAL B  1 201 ? 78.208  -6.180   17.476   1.00 413.57 ? 333 VAL B HG12 1 
ATOM   8029  H HG13 . VAL B  1 201 ? 77.371  -5.321   16.434   1.00 413.57 ? 333 VAL B HG13 1 
ATOM   8030  H HG21 . VAL B  1 201 ? 77.595  -7.179   14.149   1.00 407.76 ? 333 VAL B HG21 1 
ATOM   8031  H HG22 . VAL B  1 201 ? 77.821  -5.617   13.969   1.00 407.76 ? 333 VAL B HG22 1 
ATOM   8032  H HG23 . VAL B  1 201 ? 78.945  -6.640   13.506   1.00 407.76 ? 333 VAL B HG23 1 
ATOM   8033  N N    . SER B  1 202 ? 80.291  -4.945   18.006   1.00 219.51 ? 334 SER B N    1 
ATOM   8034  C CA   . SER B  1 202 ? 80.999  -5.041   19.281   1.00 229.57 ? 334 SER B CA   1 
ATOM   8035  C C    . SER B  1 202 ? 81.131  -6.487   19.746   1.00 233.95 ? 334 SER B C    1 
ATOM   8036  O O    . SER B  1 202 ? 80.145  -7.218   19.827   1.00 230.77 ? 334 SER B O    1 
ATOM   8037  C CB   . SER B  1 202 ? 80.283  -4.217   20.356   1.00 231.91 ? 334 SER B CB   1 
ATOM   8038  O OG   . SER B  1 202 ? 78.876  -4.296   20.217   1.00 225.22 ? 334 SER B OG   1 
ATOM   8039  H H    . SER B  1 202 ? 79.541  -4.528   18.057   1.00 366.86 ? 334 SER B H    1 
ATOM   8040  H HA   . SER B  1 202 ? 81.892  -4.679   19.172   1.00 371.07 ? 334 SER B HA   1 
ATOM   8041  H HB2  . SER B  1 202 ? 80.532  -4.557   21.229   1.00 372.31 ? 334 SER B HB2  1 
ATOM   8042  H HB3  . SER B  1 202 ? 80.555  -3.289   20.273   1.00 372.31 ? 334 SER B HB3  1 
ATOM   8043  H HG   . SER B  1 202 ? 78.502  -3.839   20.814   1.00 371.37 ? 334 SER B HG   1 
ATOM   8044  N N    . GLY B  1 203 ? 82.360  -6.886   20.058   1.00 231.11 ? 335 GLY B N    1 
ATOM   8045  C CA   . GLY B  1 203 ? 82.632  -8.230   20.530   1.00 236.62 ? 335 GLY B CA   1 
ATOM   8046  C C    . GLY B  1 203 ? 82.027  -8.492   21.895   1.00 242.09 ? 335 GLY B C    1 
ATOM   8047  O O    . GLY B  1 203 ? 81.463  -9.557   22.138   1.00 242.32 ? 335 GLY B O    1 
ATOM   8048  H H    . GLY B  1 203 ? 83.058  -6.388   20.003   1.00 366.61 ? 335 GLY B H    1 
ATOM   8049  H HA2  . GLY B  1 203 ? 82.267  -8.873   19.902   1.00 366.86 ? 335 GLY B HA2  1 
ATOM   8050  H HA3  . GLY B  1 203 ? 83.591  -8.365   20.587   1.00 366.86 ? 335 GLY B HA3  1 
ATOM   8051  N N    . SER B  1 204 ? 82.142  -7.514   22.788   1.00 236.51 ? 336 SER B N    1 
ATOM   8052  C CA   . SER B  1 204 ? 81.634  -7.653   24.147   1.00 242.75 ? 336 SER B CA   1 
ATOM   8053  C C    . SER B  1 204 ? 80.113  -7.788   24.171   1.00 236.07 ? 336 SER B C    1 
ATOM   8054  O O    . SER B  1 204 ? 79.563  -8.516   24.997   1.00 239.77 ? 336 SER B O    1 
ATOM   8055  C CB   . SER B  1 204 ? 82.061  -6.456   24.999   1.00 249.03 ? 336 SER B CB   1 
ATOM   8056  O OG   . SER B  1 204 ? 81.640  -5.239   24.409   1.00 242.18 ? 336 SER B OG   1 
ATOM   8057  H H    . SER B  1 204 ? 82.514  -6.755   22.630   1.00 224.01 ? 336 SER B H    1 
ATOM   8058  H HA   . SER B  1 204 ? 82.011  -8.453   24.545   1.00 225.39 ? 336 SER B HA   1 
ATOM   8059  H HB2  . SER B  1 204 ? 81.660  -6.536   25.878   1.00 225.18 ? 336 SER B HB2  1 
ATOM   8060  H HB3  . SER B  1 204 ? 83.028  -6.452   25.074   1.00 225.18 ? 336 SER B HB3  1 
ATOM   8061  H HG   . SER B  1 204 ? 81.881  -4.590   24.886   1.00 223.70 ? 336 SER B HG   1 
ATOM   8062  N N    . GLN B  1 205 ? 79.440  -7.085   23.265   1.00 242.98 ? 337 GLN B N    1 
ATOM   8063  C CA   . GLN B  1 205 ? 77.983  -7.117   23.201   1.00 236.52 ? 337 GLN B CA   1 
ATOM   8064  C C    . GLN B  1 205 ? 77.476  -8.502   22.803   1.00 233.61 ? 337 GLN B C    1 
ATOM   8065  O O    . GLN B  1 205 ? 76.462  -8.969   23.321   1.00 233.38 ? 337 GLN B O    1 
ATOM   8066  C CB   . GLN B  1 205 ? 77.465  -6.071   22.209   1.00 227.51 ? 337 GLN B CB   1 
ATOM   8067  C CG   . GLN B  1 205 ? 75.945  -5.915   22.209   1.00 221.61 ? 337 GLN B CG   1 
ATOM   8068  C CD   . GLN B  1 205 ? 75.435  -4.849   21.246   1.00 213.42 ? 337 GLN B CD   1 
ATOM   8069  O OE1  . GLN B  1 205 ? 74.307  -4.375   21.384   1.00 210.05 ? 337 GLN B OE1  1 
ATOM   8070  N NE2  . GLN B  1 205 ? 76.250  -4.479   20.262   1.00 210.59 ? 337 GLN B NE2  1 
ATOM   8071  H H    . GLN B  1 205 ? 79.806  -6.579   22.674   1.00 322.99 ? 337 GLN B H    1 
ATOM   8072  H HA   . GLN B  1 205 ? 77.623  -6.905   24.076   1.00 322.03 ? 337 GLN B HA   1 
ATOM   8073  H HB2  . GLN B  1 205 ? 77.850  -5.210   22.435   1.00 322.27 ? 337 GLN B HB2  1 
ATOM   8074  H HB3  . GLN B  1 205 ? 77.736  -6.328   21.314   1.00 322.27 ? 337 GLN B HB3  1 
ATOM   8075  H HG2  . GLN B  1 205 ? 75.544  -6.761   21.955   1.00 320.36 ? 337 GLN B HG2  1 
ATOM   8076  H HG3  . GLN B  1 205 ? 75.656  -5.670   23.102   1.00 320.36 ? 337 GLN B HG3  1 
ATOM   8077  H HE21 . GLN B  1 205 ? 75.999  -3.880   19.698   1.00 307.37 ? 337 GLN B HE21 1 
ATOM   8078  H HE22 . GLN B  1 205 ? 77.029  -4.837   20.190   1.00 307.37 ? 337 GLN B HE22 1 
ATOM   8079  N N    . TRP B  1 206 ? 78.180  -9.149   21.878   1.00 237.37 ? 338 TRP B N    1 
ATOM   8080  C CA   . TRP B  1 206 ? 77.798  -10.481  21.416   1.00 235.02 ? 338 TRP B CA   1 
ATOM   8081  C C    . TRP B  1 206 ? 77.920  -11.519  22.528   1.00 243.73 ? 338 TRP B C    1 
ATOM   8082  O O    . TRP B  1 206 ? 77.100  -12.433  22.624   1.00 242.61 ? 338 TRP B O    1 
ATOM   8083  C CB   . TRP B  1 206 ? 78.656  -10.910  20.222   1.00 232.35 ? 338 TRP B CB   1 
ATOM   8084  C CG   . TRP B  1 206 ? 78.116  -10.465  18.900   1.00 222.19 ? 338 TRP B CG   1 
ATOM   8085  C CD1  . TRP B  1 206 ? 78.555  -9.416   18.147   1.00 218.43 ? 338 TRP B CD1  1 
ATOM   8086  C CD2  . TRP B  1 206 ? 77.033  -11.058  18.171   1.00 215.03 ? 338 TRP B CD2  1 
ATOM   8087  N NE1  . TRP B  1 206 ? 77.814  -9.318   16.995   1.00 209.41 ? 338 TRP B NE1  1 
ATOM   8088  C CE2  . TRP B  1 206 ? 76.872  -10.313  16.986   1.00 207.19 ? 338 TRP B CE2  1 
ATOM   8089  C CE3  . TRP B  1 206 ? 76.184  -12.145  18.406   1.00 214.92 ? 338 TRP B CE3  1 
ATOM   8090  C CZ2  . TRP B  1 206 ? 75.897  -10.619  16.038   1.00 199.43 ? 338 TRP B CZ2  1 
ATOM   8091  C CZ3  . TRP B  1 206 ? 75.216  -12.448  17.462   1.00 207.14 ? 338 TRP B CZ3  1 
ATOM   8092  C CH2  . TRP B  1 206 ? 75.082  -11.687  16.293   1.00 199.55 ? 338 TRP B CH2  1 
ATOM   8093  H H    . TRP B  1 206 ? 78.886  -8.836   21.499   1.00 421.79 ? 338 TRP B H    1 
ATOM   8094  H HA   . TRP B  1 206 ? 76.873  -10.461  21.127   1.00 421.81 ? 338 TRP B HA   1 
ATOM   8095  H HB2  . TRP B  1 206 ? 79.543  -10.532  20.323   1.00 421.89 ? 338 TRP B HB2  1 
ATOM   8096  H HB3  . TRP B  1 206 ? 78.711  -11.879  20.209   1.00 421.89 ? 338 TRP B HB3  1 
ATOM   8097  H HD1  . TRP B  1 206 ? 79.255  -8.850   18.380   1.00 418.95 ? 338 TRP B HD1  1 
ATOM   8098  H HE1  . TRP B  1 206 ? 77.922  -8.727   16.380   1.00 414.88 ? 338 TRP B HE1  1 
ATOM   8099  H HE3  . TRP B  1 206 ? 76.267  -12.653  19.180   1.00 414.31 ? 338 TRP B HE3  1 
ATOM   8100  H HZ2  . TRP B  1 206 ? 75.806  -10.117  15.260   1.00 408.90 ? 338 TRP B HZ2  1 
ATOM   8101  H HZ3  . TRP B  1 206 ? 74.645  -13.167  17.607   1.00 410.42 ? 338 TRP B HZ3  1 
ATOM   8102  H HH2  . TRP B  1 206 ? 74.423  -11.914  15.677   1.00 406.73 ? 338 TRP B HH2  1 
ATOM   8103  N N    . ASN B  1 207 ? 78.939  -11.368  23.370   1.00 238.85 ? 339 ASN B N    1 
ATOM   8104  C CA   . ASN B  1 207 ? 79.212  -12.330  24.437   1.00 248.38 ? 339 ASN B CA   1 
ATOM   8105  C C    . ASN B  1 207 ? 78.207  -12.265  25.593   1.00 251.39 ? 339 ASN B C    1 
ATOM   8106  O O    . ASN B  1 207 ? 78.424  -12.872  26.644   1.00 260.37 ? 339 ASN B O    1 
ATOM   8107  C CB   . ASN B  1 207 ? 80.633  -12.119  24.980   1.00 257.85 ? 339 ASN B CB   1 
ATOM   8108  C CG   . ASN B  1 207 ? 81.704  -12.660  24.047   1.00 257.90 ? 339 ASN B CG   1 
ATOM   8109  O OD1  . ASN B  1 207 ? 82.215  -13.764  24.244   1.00 263.81 ? 339 ASN B OD1  1 
ATOM   8110  N ND2  . ASN B  1 207 ? 82.052  -11.882  23.030   1.00 251.77 ? 339 ASN B ND2  1 
ATOM   8111  H H    . ASN B  1 207 ? 79.492  -10.711  23.345   1.00 406.62 ? 339 ASN B H    1 
ATOM   8112  H HA   . ASN B  1 207 ? 79.170  -13.225  24.064   1.00 406.32 ? 339 ASN B HA   1 
ATOM   8113  H HB2  . ASN B  1 207 ? 80.789  -11.169  25.096   1.00 405.68 ? 339 ASN B HB2  1 
ATOM   8114  H HB3  . ASN B  1 207 ? 80.717  -12.576  25.831   1.00 405.68 ? 339 ASN B HB3  1 
ATOM   8115  H HD21 . ASN B  1 207 ? 82.654  -12.143  22.474   1.00 406.16 ? 339 ASN B HD21 1 
ATOM   8116  H HD22 . ASN B  1 207 ? 81.675  -11.116  22.926   1.00 406.16 ? 339 ASN B HD22 1 
ATOM   8117  N N    . LYS B  1 208 ? 77.113  -11.531  25.399   1.00 234.43 ? 340 LYS B N    1 
ATOM   8118  C CA   . LYS B  1 208 ? 76.062  -11.420  26.407   1.00 236.69 ? 340 LYS B CA   1 
ATOM   8119  C C    . LYS B  1 208 ? 74.694  -11.721  25.804   1.00 228.17 ? 340 LYS B C    1 
ATOM   8120  O O    . LYS B  1 208 ? 73.858  -12.367  26.436   1.00 230.43 ? 340 LYS B O    1 
ATOM   8121  C CB   . LYS B  1 208 ? 76.076  -10.026  27.031   1.00 238.74 ? 340 LYS B CB   1 
ATOM   8122  C CG   . LYS B  1 208 ? 77.357  -9.713   27.785   1.00 248.50 ? 340 LYS B CG   1 
ATOM   8123  C CD   . LYS B  1 208 ? 77.453  -8.242   28.133   1.00 249.40 ? 340 LYS B CD   1 
ATOM   8124  C CE   . LYS B  1 208 ? 78.802  -7.911   28.744   1.00 258.99 ? 340 LYS B CE   1 
ATOM   8125  N NZ   . LYS B  1 208 ? 78.954  -6.453   28.989   1.00 259.90 ? 340 LYS B NZ   1 
ATOM   8126  H H    . LYS B  1 208 ? 76.954  -11.083  24.683   1.00 263.68 ? 340 LYS B H    1 
ATOM   8127  H HA   . LYS B  1 208 ? 76.229  -12.066  27.111   1.00 261.92 ? 340 LYS B HA   1 
ATOM   8128  H HB2  . LYS B  1 208 ? 75.977  -9.367   26.326   1.00 263.33 ? 340 LYS B HB2  1 
ATOM   8129  H HB3  . LYS B  1 208 ? 75.337  -9.954   27.656   1.00 263.33 ? 340 LYS B HB3  1 
ATOM   8130  H HG2  . LYS B  1 208 ? 77.375  -10.223  28.610   1.00 266.78 ? 340 LYS B HG2  1 
ATOM   8131  H HG3  . LYS B  1 208 ? 78.119  -9.945   27.231   1.00 266.78 ? 340 LYS B HG3  1 
ATOM   8132  H HD2  . LYS B  1 208 ? 77.344  -7.713   27.327   1.00 268.05 ? 340 LYS B HD2  1 
ATOM   8133  H HD3  . LYS B  1 208 ? 76.763  -8.019   28.778   1.00 268.05 ? 340 LYS B HD3  1 
ATOM   8134  H HE2  . LYS B  1 208 ? 78.890  -8.371   29.593   1.00 269.10 ? 340 LYS B HE2  1 
ATOM   8135  H HE3  . LYS B  1 208 ? 79.504  -8.190   28.136   1.00 269.10 ? 340 LYS B HE3  1 
ATOM   8136  H HZ1  . LYS B  1 208 ? 79.751  -6.286   29.346   1.00 268.57 ? 340 LYS B HZ1  1 
ATOM   8137  H HZ2  . LYS B  1 208 ? 78.881  -6.006   28.222   1.00 268.57 ? 340 LYS B HZ2  1 
ATOM   8138  H HZ3  . LYS B  1 208 ? 78.321  -6.171   29.548   1.00 268.57 ? 340 LYS B HZ3  1 
ATOM   8139  N N    . THR B  1 209 ? 74.468  -11.247  24.583   1.00 232.62 ? 341 THR B N    1 
ATOM   8140  C CA   . THR B  1 209 ? 73.228  -11.539  23.874   1.00 224.50 ? 341 THR B CA   1 
ATOM   8141  C C    . THR B  1 209 ? 73.098  -13.036  23.635   1.00 225.25 ? 341 THR B C    1 
ATOM   8142  O O    . THR B  1 209 ? 72.037  -13.619  23.853   1.00 224.30 ? 341 THR B O    1 
ATOM   8143  C CB   . THR B  1 209 ? 73.156  -10.806  22.522   1.00 215.03 ? 341 THR B CB   1 
ATOM   8144  O OG1  . THR B  1 209 ? 74.396  -10.967  21.822   1.00 215.33 ? 341 THR B OG1  1 
ATOM   8145  C CG2  . THR B  1 209 ? 72.875  -9.323   22.723   1.00 213.21 ? 341 THR B CG2  1 
ATOM   8146  H H    . THR B  1 209 ? 75.018  -10.755  24.142   1.00 402.28 ? 341 THR B H    1 
ATOM   8147  H HA   . THR B  1 209 ? 72.476  -11.251  24.415   1.00 396.99 ? 341 THR B HA   1 
ATOM   8148  H HB   . THR B  1 209 ? 72.437  -11.183  21.991   1.00 398.82 ? 341 THR B HB   1 
ATOM   8149  H HG1  . THR B  1 209 ? 74.363  -10.570  21.083   1.00 402.59 ? 341 THR B HG1  1 
ATOM   8150  H HG21 . THR B  1 209 ? 72.833  -8.874   21.864   1.00 403.28 ? 341 THR B HG21 1 
ATOM   8151  H HG22 . THR B  1 209 ? 72.029  -9.205   23.182   1.00 403.28 ? 341 THR B HG22 1 
ATOM   8152  H HG23 . THR B  1 209 ? 73.581  -8.921   23.254   1.00 403.28 ? 341 THR B HG23 1 
ATOM   8153  N N    . LEU B  1 210 ? 74.186  -13.651  23.187   1.00 221.62 ? 342 LEU B N    1 
ATOM   8154  C CA   . LEU B  1 210 ? 74.200  -15.081  22.908   1.00 222.97 ? 342 LEU B CA   1 
ATOM   8155  C C    . LEU B  1 210 ? 73.958  -15.899  24.177   1.00 231.66 ? 342 LEU B C    1 
ATOM   8156  O O    . LEU B  1 210 ? 73.297  -16.935  24.133   1.00 231.61 ? 342 LEU B O    1 
ATOM   8157  C CB   . LEU B  1 210 ? 75.531  -15.482  22.260   1.00 224.79 ? 342 LEU B CB   1 
ATOM   8158  C CG   . LEU B  1 210 ? 75.816  -14.904  20.868   1.00 216.52 ? 342 LEU B CG   1 
ATOM   8159  C CD1  . LEU B  1 210 ? 77.210  -15.291  20.403   1.00 220.07 ? 342 LEU B CD1  1 
ATOM   8160  C CD2  . LEU B  1 210 ? 74.779  -15.363  19.854   1.00 208.18 ? 342 LEU B CD2  1 
ATOM   8161  H H    . LEU B  1 210 ? 74.937  -13.259  23.036   1.00 369.97 ? 342 LEU B H    1 
ATOM   8162  H HA   . LEU B  1 210 ? 73.488  -15.286  22.281   1.00 366.63 ? 342 LEU B HA   1 
ATOM   8163  H HB2  . LEU B  1 210 ? 76.250  -15.195  22.843   1.00 371.09 ? 342 LEU B HB2  1 
ATOM   8164  H HB3  . LEU B  1 210 ? 75.550  -16.448  22.179   1.00 371.09 ? 342 LEU B HB3  1 
ATOM   8165  H HG   . LEU B  1 210 ? 75.777  -13.936  20.916   1.00 374.30 ? 342 LEU B HG   1 
ATOM   8166  H HD11 . LEU B  1 210 ? 77.365  -14.914  19.523   1.00 379.69 ? 342 LEU B HD11 1 
ATOM   8167  H HD12 . LEU B  1 210 ? 77.861  -14.942  21.032   1.00 379.69 ? 342 LEU B HD12 1 
ATOM   8168  H HD13 . LEU B  1 210 ? 77.272  -16.259  20.365   1.00 379.69 ? 342 LEU B HD13 1 
ATOM   8169  H HD21 . LEU B  1 210 ? 74.992  -14.979  18.989   1.00 367.61 ? 342 LEU B HD21 1 
ATOM   8170  H HD22 . LEU B  1 210 ? 74.798  -16.332  19.800   1.00 367.61 ? 342 LEU B HD22 1 
ATOM   8171  H HD23 . LEU B  1 210 ? 73.902  -15.064  20.142   1.00 367.61 ? 342 LEU B HD23 1 
ATOM   8172  N N    . HIS B  1 211 ? 74.483  -15.426  25.304   1.00 227.19 ? 343 HIS B N    1 
ATOM   8173  C CA   . HIS B  1 211 ? 74.333  -16.129  26.579   1.00 236.51 ? 343 HIS B CA   1 
ATOM   8174  C C    . HIS B  1 211 ? 72.868  -16.351  26.949   1.00 234.38 ? 343 HIS B C    1 
ATOM   8175  O O    . HIS B  1 211 ? 72.490  -17.438  27.389   1.00 238.71 ? 343 HIS B O    1 
ATOM   8176  C CB   . HIS B  1 211 ? 75.024  -15.355  27.706   1.00 244.80 ? 343 HIS B CB   1 
ATOM   8177  C CG   . HIS B  1 211 ? 76.516  -15.477  27.704   1.00 250.84 ? 343 HIS B CG   1 
ATOM   8178  N ND1  . HIS B  1 211 ? 77.216  -16.057  26.668   1.00 248.03 ? 343 HIS B ND1  1 
ATOM   8179  C CD2  . HIS B  1 211 ? 77.441  -15.097  28.617   1.00 260.08 ? 343 HIS B CD2  1 
ATOM   8180  C CE1  . HIS B  1 211 ? 78.508  -16.026  26.941   1.00 255.24 ? 343 HIS B CE1  1 
ATOM   8181  N NE2  . HIS B  1 211 ? 78.672  -15.449  28.118   1.00 262.67 ? 343 HIS B NE2  1 
ATOM   8182  H H    . HIS B  1 211 ? 74.934  -14.696  25.359   1.00 357.40 ? 343 HIS B H    1 
ATOM   8183  H HA   . HIS B  1 211 ? 74.758  -16.998  26.509   1.00 355.23 ? 343 HIS B HA   1 
ATOM   8184  H HB2  . HIS B  1 211 ? 74.805  -14.414  27.618   1.00 359.40 ? 343 HIS B HB2  1 
ATOM   8185  H HB3  . HIS B  1 211 ? 74.701  -15.689  28.557   1.00 359.40 ? 343 HIS B HB3  1 
ATOM   8186  H HD2  . HIS B  1 211 ? 77.275  -14.675  29.428   1.00 369.39 ? 343 HIS B HD2  1 
ATOM   8187  H HE1  . HIS B  1 211 ? 79.187  -16.356  26.398   1.00 368.84 ? 343 HIS B HE1  1 
ATOM   8188  H HE2  . HIS B  1 211 ? 79.426  -15.315  28.508   1.00 371.38 ? 343 HIS B HE2  1 
ATOM   8189  N N    . GLN B  1 212 ? 72.051  -15.317  26.770   1.00 240.03 ? 344 GLN B N    1 
ATOM   8190  C CA   . GLN B  1 212 ? 70.654  -15.361  27.196   1.00 238.62 ? 344 GLN B CA   1 
ATOM   8191  C C    . GLN B  1 212 ? 69.795  -16.234  26.283   1.00 232.19 ? 344 GLN B C    1 
ATOM   8192  O O    . GLN B  1 212 ? 68.853  -16.878  26.745   1.00 234.12 ? 344 GLN B O    1 
ATOM   8193  C CB   . GLN B  1 212 ? 70.077  -13.943  27.262   1.00 234.41 ? 344 GLN B CB   1 
ATOM   8194  C CG   . GLN B  1 212 ? 70.694  -13.074  28.352   1.00 241.82 ? 344 GLN B CG   1 
ATOM   8195  C CD   . GLN B  1 212 ? 70.509  -13.657  29.741   1.00 251.94 ? 344 GLN B CD   1 
ATOM   8196  O OE1  . GLN B  1 212 ? 69.423  -14.118  30.094   1.00 252.17 ? 344 GLN B OE1  1 
ATOM   8197  N NE2  . GLN B  1 212 ? 71.575  -13.647  30.534   1.00 260.84 ? 344 GLN B NE2  1 
ATOM   8198  H H    . GLN B  1 212 ? 72.282  -14.575  26.403   1.00 339.78 ? 344 GLN B H    1 
ATOM   8199  H HA   . GLN B  1 212 ? 70.613  -15.738  28.089   1.00 334.31 ? 344 GLN B HA   1 
ATOM   8200  H HB2  . GLN B  1 212 ? 70.231  -13.503  26.411   1.00 336.32 ? 344 GLN B HB2  1 
ATOM   8201  H HB3  . GLN B  1 212 ? 69.124  -14.001  27.434   1.00 336.32 ? 344 GLN B HB3  1 
ATOM   8202  H HG2  . GLN B  1 212 ? 71.646  -12.989  28.187   1.00 339.76 ? 344 GLN B HG2  1 
ATOM   8203  H HG3  . GLN B  1 212 ? 70.274  -12.200  28.335   1.00 339.76 ? 344 GLN B HG3  1 
ATOM   8204  H HE21 . GLN B  1 212 ? 71.521  -13.966  31.330   1.00 340.63 ? 344 GLN B HE21 1 
ATOM   8205  H HE22 . GLN B  1 212 ? 72.319  -13.322  30.250   1.00 340.63 ? 344 GLN B HE22 1 
ATOM   8206  N N    . VAL B  1 213 ? 70.114  -16.257  24.992   1.00 232.34 ? 345 VAL B N    1 
ATOM   8207  C CA   . VAL B  1 213 ? 69.380  -17.102  24.054   1.00 226.62 ? 345 VAL B CA   1 
ATOM   8208  C C    . VAL B  1 213 ? 69.633  -18.568  24.382   1.00 233.04 ? 345 VAL B C    1 
ATOM   8209  O O    . VAL B  1 213 ? 68.705  -19.376  24.400   1.00 232.89 ? 345 VAL B O    1 
ATOM   8210  C CB   . VAL B  1 213 ? 69.781  -16.831  22.589   1.00 218.39 ? 345 VAL B CB   1 
ATOM   8211  C CG1  . VAL B  1 213 ? 68.952  -17.690  21.639   1.00 212.94 ? 345 VAL B CG1  1 
ATOM   8212  C CG2  . VAL B  1 213 ? 69.606  -15.361  22.251   1.00 212.60 ? 345 VAL B CG2  1 
ATOM   8213  H H    . VAL B  1 213 ? 70.747  -15.797  24.635   1.00 300.63 ? 345 VAL B H    1 
ATOM   8214  H HA   . VAL B  1 213 ? 68.430  -16.929  24.145   1.00 291.69 ? 345 VAL B HA   1 
ATOM   8215  H HB   . VAL B  1 213 ? 70.716  -17.060  22.467   1.00 290.91 ? 345 VAL B HB   1 
ATOM   8216  H HG11 . VAL B  1 213 ? 69.223  -17.502  20.727   1.00 277.58 ? 345 VAL B HG11 1 
ATOM   8217  H HG12 . VAL B  1 213 ? 69.107  -18.625  21.844   1.00 277.58 ? 345 VAL B HG12 1 
ATOM   8218  H HG13 . VAL B  1 213 ? 68.014  -17.476  21.758   1.00 277.58 ? 345 VAL B HG13 1 
ATOM   8219  H HG21 . VAL B  1 213 ? 69.864  -15.217  21.327   1.00 293.07 ? 345 VAL B HG21 1 
ATOM   8220  H HG22 . VAL B  1 213 ? 68.676  -15.117  22.377   1.00 293.07 ? 345 VAL B HG22 1 
ATOM   8221  H HG23 . VAL B  1 213 ? 70.170  -14.833  22.839   1.00 293.07 ? 345 VAL B HG23 1 
ATOM   8222  N N    . VAL B  1 214 ? 70.895  -18.897  24.643   1.00 235.68 ? 346 VAL B N    1 
ATOM   8223  C CA   . VAL B  1 214 ? 71.298  -20.268  24.948   1.00 242.68 ? 346 VAL B CA   1 
ATOM   8224  C C    . VAL B  1 214 ? 70.580  -20.796  26.189   1.00 249.93 ? 346 VAL B C    1 
ATOM   8225  O O    . VAL B  1 214 ? 70.213  -21.971  26.246   1.00 252.87 ? 346 VAL B O    1 
ATOM   8226  C CB   . VAL B  1 214 ? 72.834  -20.369  25.151   1.00 249.17 ? 346 VAL B CB   1 
ATOM   8227  C CG1  . VAL B  1 214 ? 73.239  -21.721  25.743   1.00 258.48 ? 346 VAL B CG1  1 
ATOM   8228  C CG2  . VAL B  1 214 ? 73.558  -20.149  23.828   1.00 242.77 ? 346 VAL B CG2  1 
ATOM   8229  H H    . VAL B  1 214 ? 71.546  -18.336  24.651   1.00 407.83 ? 346 VAL B H    1 
ATOM   8230  H HA   . VAL B  1 214 ? 71.059  -20.838  24.200   1.00 405.61 ? 346 VAL B HA   1 
ATOM   8231  H HB   . VAL B  1 214 ? 73.117  -19.675  25.767   1.00 411.11 ? 346 VAL B HB   1 
ATOM   8232  H HG11 . VAL B  1 214 ? 74.203  -21.740  25.853   1.00 409.94 ? 346 VAL B HG11 1 
ATOM   8233  H HG12 . VAL B  1 214 ? 72.805  -21.831  26.603   1.00 409.94 ? 346 VAL B HG12 1 
ATOM   8234  H HG13 . VAL B  1 214 ? 72.960  -22.426  25.138   1.00 409.94 ? 346 VAL B HG13 1 
ATOM   8235  H HG21 . VAL B  1 214 ? 74.514  -20.215  23.977   1.00 413.71 ? 346 VAL B HG21 1 
ATOM   8236  H HG22 . VAL B  1 214 ? 73.273  -20.827  23.196   1.00 413.71 ? 346 VAL B HG22 1 
ATOM   8237  H HG23 . VAL B  1 214 ? 73.336  -19.267  23.490   1.00 413.71 ? 346 VAL B HG23 1 
ATOM   8238  N N    . GLU B  1 215 ? 70.379  -19.928  27.176   1.00 242.15 ? 347 GLU B N    1 
ATOM   8239  C CA   . GLU B  1 215 ? 69.662  -20.304  28.390   1.00 249.24 ? 347 GLU B CA   1 
ATOM   8240  C C    . GLU B  1 215 ? 68.243  -20.755  28.058   1.00 244.46 ? 347 GLU B C    1 
ATOM   8241  O O    . GLU B  1 215 ? 67.721  -21.693  28.660   1.00 250.02 ? 347 GLU B O    1 
ATOM   8242  C CB   . GLU B  1 215 ? 69.631  -19.132  29.374   1.00 252.53 ? 347 GLU B CB   1 
ATOM   8243  C CG   . GLU B  1 215 ? 68.767  -19.350  30.615   1.00 259.40 ? 347 GLU B CG   1 
ATOM   8244  C CD   . GLU B  1 215 ? 69.300  -20.437  31.530   1.00 270.61 ? 347 GLU B CD   1 
ATOM   8245  O OE1  . GLU B  1 215 ? 70.427  -20.920  31.294   1.00 273.71 ? 347 GLU B OE1  1 
ATOM   8246  O OE2  . GLU B  1 215 ? 68.591  -20.805  32.490   1.00 276.74 ? 347 GLU B OE2  1 
ATOM   8247  H H    . GLU B  1 215 ? 70.650  -19.112  27.167   1.00 316.65 ? 347 GLU B H    1 
ATOM   8248  H HA   . GLU B  1 215 ? 70.122  -21.044  28.815   1.00 313.29 ? 347 GLU B HA   1 
ATOM   8249  H HB2  . GLU B  1 215 ? 70.536  -18.958  29.676   1.00 318.20 ? 347 GLU B HB2  1 
ATOM   8250  H HB3  . GLU B  1 215 ? 69.287  -18.351  28.913   1.00 318.20 ? 347 GLU B HB3  1 
ATOM   8251  H HG2  . GLU B  1 215 ? 68.731  -18.524  31.122   1.00 315.89 ? 347 GLU B HG2  1 
ATOM   8252  H HG3  . GLU B  1 215 ? 67.874  -19.606  30.336   1.00 315.89 ? 347 GLU B HG3  1 
ATOM   8253  N N    . GLN B  1 216 ? 67.628  -20.077  27.096   1.00 246.46 ? 348 GLN B N    1 
ATOM   8254  C CA   . GLN B  1 216 ? 66.259  -20.373  26.692   1.00 241.50 ? 348 GLN B CA   1 
ATOM   8255  C C    . GLN B  1 216 ? 66.176  -21.591  25.782   1.00 239.25 ? 348 GLN B C    1 
ATOM   8256  O O    . GLN B  1 216 ? 65.175  -22.308  25.785   1.00 239.42 ? 348 GLN B O    1 
ATOM   8257  C CB   . GLN B  1 216 ? 65.657  -19.165  25.989   1.00 232.35 ? 348 GLN B CB   1 
ATOM   8258  C CG   . GLN B  1 216 ? 65.544  -17.964  26.888   1.00 234.63 ? 348 GLN B CG   1 
ATOM   8259  C CD   . GLN B  1 216 ? 65.571  -16.667  26.125   1.00 226.68 ? 348 GLN B CD   1 
ATOM   8260  O OE1  . GLN B  1 216 ? 65.269  -16.622  24.934   1.00 218.63 ? 348 GLN B OE1  1 
ATOM   8261  N NE2  . GLN B  1 216 ? 65.950  -15.601  26.810   1.00 229.38 ? 348 GLN B NE2  1 
ATOM   8262  H H    . GLN B  1 216 ? 67.988  -19.432  26.655   1.00 327.83 ? 348 GLN B H    1 
ATOM   8263  H HA   . GLN B  1 216 ? 65.728  -20.555  27.484   1.00 321.01 ? 348 GLN B HA   1 
ATOM   8264  H HB2  . GLN B  1 216 ? 66.220  -18.925  25.237   1.00 320.54 ? 348 GLN B HB2  1 
ATOM   8265  H HB3  . GLN B  1 216 ? 64.766  -19.392  25.678   1.00 320.54 ? 348 GLN B HB3  1 
ATOM   8266  H HG2  . GLN B  1 216 ? 64.705  -18.009  27.374   1.00 324.16 ? 348 GLN B HG2  1 
ATOM   8267  H HG3  . GLN B  1 216 ? 66.289  -17.962  27.510   1.00 324.16 ? 348 GLN B HG3  1 
ATOM   8268  H HE21 . GLN B  1 216 ? 65.984  -14.833  26.426   1.00 325.81 ? 348 GLN B HE21 1 
ATOM   8269  H HE22 . GLN B  1 216 ? 66.161  -15.677  27.640   1.00 325.81 ? 348 GLN B HE22 1 
ATOM   8270  N N    . LEU B  1 217 ? 67.220  -21.806  24.987   1.00 246.67 ? 349 LEU B N    1 
ATOM   8271  C CA   . LEU B  1 217 ? 67.297  -22.986  24.131   1.00 245.50 ? 349 LEU B CA   1 
ATOM   8272  C C    . LEU B  1 217 ? 67.315  -24.238  24.999   1.00 255.08 ? 349 LEU B C    1 
ATOM   8273  O O    . LEU B  1 217 ? 66.752  -25.269  24.632   1.00 255.23 ? 349 LEU B O    1 
ATOM   8274  C CB   . LEU B  1 217 ? 68.536  -22.928  23.232   1.00 243.04 ? 349 LEU B CB   1 
ATOM   8275  C CG   . LEU B  1 217 ? 68.540  -21.849  22.143   1.00 233.27 ? 349 LEU B CG   1 
ATOM   8276  C CD1  . LEU B  1 217 ? 69.896  -21.790  21.454   1.00 232.76 ? 349 LEU B CD1  1 
ATOM   8277  C CD2  . LEU B  1 217 ? 67.438  -22.088  21.120   1.00 225.67 ? 349 LEU B CD2  1 
ATOM   8278  H H    . LEU B  1 217 ? 67.899  -21.283  24.924   1.00 360.11 ? 349 LEU B H    1 
ATOM   8279  H HA   . LEU B  1 217 ? 66.511  -23.021  23.564   1.00 357.76 ? 349 LEU B HA   1 
ATOM   8280  H HB2  . LEU B  1 217 ? 69.312  -22.773  23.793   1.00 361.62 ? 349 LEU B HB2  1 
ATOM   8281  H HB3  . LEU B  1 217 ? 68.628  -23.786  22.788   1.00 361.62 ? 349 LEU B HB3  1 
ATOM   8282  H HG   . LEU B  1 217 ? 68.379  -20.987  22.556   1.00 361.97 ? 349 LEU B HG   1 
ATOM   8283  H HD11 . LEU B  1 217 ? 69.873  -21.101  20.771   1.00 367.27 ? 349 LEU B HD11 1 
ATOM   8284  H HD12 . LEU B  1 217 ? 70.576  -21.580  22.114   1.00 367.27 ? 349 LEU B HD12 1 
ATOM   8285  H HD13 . LEU B  1 217 ? 70.083  -22.652  21.050   1.00 367.27 ? 349 LEU B HD13 1 
ATOM   8286  H HD21 . LEU B  1 217 ? 67.473  -21.388  20.450   1.00 355.88 ? 349 LEU B HD21 1 
ATOM   8287  H HD22 . LEU B  1 217 ? 67.577  -22.953  20.703   1.00 355.88 ? 349 LEU B HD22 1 
ATOM   8288  H HD23 . LEU B  1 217 ? 66.580  -22.072  21.571   1.00 355.88 ? 349 LEU B HD23 1 
ATOM   8289  N N    . ARG B  1 218 ? 67.958  -24.133  26.158   1.00 245.43 ? 350 ARG B N    1 
ATOM   8290  C CA   . ARG B  1 218 ? 67.907  -25.188  27.162   1.00 255.53 ? 350 ARG B CA   1 
ATOM   8291  C C    . ARG B  1 218 ? 66.508  -25.239  27.772   1.00 256.26 ? 350 ARG B C    1 
ATOM   8292  O O    . ARG B  1 218 ? 65.608  -24.541  27.311   1.00 248.70 ? 350 ARG B O    1 
ATOM   8293  C CB   . ARG B  1 218 ? 68.962  -24.957  28.247   1.00 264.69 ? 350 ARG B CB   1 
ATOM   8294  C CG   . ARG B  1 218 ? 70.386  -25.218  27.789   1.00 266.72 ? 350 ARG B CG   1 
ATOM   8295  C CD   . ARG B  1 218 ? 71.362  -25.153  28.952   1.00 277.42 ? 350 ARG B CD   1 
ATOM   8296  N NE   . ARG B  1 218 ? 72.722  -25.496  28.546   1.00 280.46 ? 350 ARG B NE   1 
ATOM   8297  C CZ   . ARG B  1 218 ? 73.736  -25.664  29.390   1.00 284.49 ? 350 ARG B CZ   1 
ATOM   8298  N NH1  . ARG B  1 218 ? 73.550  -25.528  30.696   1.00 287.19 ? 350 ARG B NH1  1 
ATOM   8299  N NH2  . ARG B  1 218 ? 74.939  -25.973  28.927   1.00 285.47 ? 350 ARG B NH2  1 
ATOM   8300  H H    . ARG B  1 218 ? 68.435  -23.455  26.388   1.00 337.19 ? 350 ARG B H    1 
ATOM   8301  H HA   . ARG B  1 218 ? 68.087  -26.042  26.740   1.00 336.15 ? 350 ARG B HA   1 
ATOM   8302  H HB2  . ARG B  1 218 ? 68.910  -24.034  28.541   1.00 341.10 ? 350 ARG B HB2  1 
ATOM   8303  H HB3  . ARG B  1 218 ? 68.778  -25.549  28.993   1.00 341.10 ? 350 ARG B HB3  1 
ATOM   8304  H HG2  . ARG B  1 218 ? 70.439  -26.103  27.396   1.00 345.58 ? 350 ARG B HG2  1 
ATOM   8305  H HG3  . ARG B  1 218 ? 70.642  -24.545  27.139   1.00 345.58 ? 350 ARG B HG3  1 
ATOM   8306  H HD2  . ARG B  1 218 ? 71.371  -24.252  29.310   1.00 351.53 ? 350 ARG B HD2  1 
ATOM   8307  H HD3  . ARG B  1 218 ? 71.083  -25.782  29.636   1.00 351.53 ? 350 ARG B HD3  1 
ATOM   8308  H HE   . ARG B  1 218 ? 72.877  -25.596  27.707   1.00 356.58 ? 350 ARG B HE   1 
ATOM   8309  H HH11 . ARG B  1 218 ? 72.772  -25.327  31.001   1.00 365.90 ? 350 ARG B HH11 1 
ATOM   8310  H HH12 . ARG B  1 218 ? 74.209  -25.638  31.238   1.00 365.90 ? 350 ARG B HH12 1 
ATOM   8311  H HH21 . ARG B  1 218 ? 75.064  -26.064  28.081   1.00 368.27 ? 350 ARG B HH21 1 
ATOM   8312  H HH22 . ARG B  1 218 ? 75.594  -26.083  29.473   1.00 368.27 ? 350 ARG B HH22 1 
ATOM   8313  N N    . LYS B  1 219 ? 66.331  -26.073  28.793   1.00 267.69 ? 351 LYS B N    1 
ATOM   8314  C CA   . LYS B  1 219 ? 65.042  -26.264  29.468   1.00 270.08 ? 351 LYS B CA   1 
ATOM   8315  C C    . LYS B  1 219 ? 64.077  -27.077  28.598   1.00 265.39 ? 351 LYS B C    1 
ATOM   8316  O O    . LYS B  1 219 ? 63.422  -27.998  29.088   1.00 271.08 ? 351 LYS B O    1 
ATOM   8317  C CB   . LYS B  1 219 ? 64.407  -24.921  29.859   1.00 266.45 ? 351 LYS B CB   1 
ATOM   8318  C CG   . LYS B  1 219 ? 65.354  -23.968  30.580   1.00 270.09 ? 351 LYS B CG   1 
ATOM   8319  C CD   . LYS B  1 219 ? 64.698  -22.627  30.858   1.00 266.13 ? 351 LYS B CD   1 
ATOM   8320  C CE   . LYS B  1 219 ? 65.654  -21.680  31.564   1.00 270.22 ? 351 LYS B CE   1 
ATOM   8321  N NZ   . LYS B  1 219 ? 65.083  -20.313  31.702   1.00 265.83 ? 351 LYS B NZ   1 
ATOM   8322  H H    . LYS B  1 219 ? 66.961  -26.556  29.126   1.00 283.69 ? 351 LYS B H    1 
ATOM   8323  H HA   . LYS B  1 219 ? 65.193  -26.765  30.284   1.00 280.63 ? 351 LYS B HA   1 
ATOM   8324  H HB2  . LYS B  1 219 ? 64.097  -24.477  29.055   1.00 281.62 ? 351 LYS B HB2  1 
ATOM   8325  H HB3  . LYS B  1 219 ? 63.655  -25.092  30.449   1.00 281.62 ? 351 LYS B HB3  1 
ATOM   8326  H HG2  . LYS B  1 219 ? 65.616  -24.359  31.428   1.00 285.81 ? 351 LYS B HG2  1 
ATOM   8327  H HG3  . LYS B  1 219 ? 66.135  -23.815  30.025   1.00 285.81 ? 351 LYS B HG3  1 
ATOM   8328  H HD2  . LYS B  1 219 ? 64.431  -22.221  30.019   1.00 287.88 ? 351 LYS B HD2  1 
ATOM   8329  H HD3  . LYS B  1 219 ? 63.925  -22.761  31.428   1.00 287.88 ? 351 LYS B HD3  1 
ATOM   8330  H HE2  . LYS B  1 219 ? 65.841  -22.021  32.453   1.00 293.37 ? 351 LYS B HE2  1 
ATOM   8331  H HE3  . LYS B  1 219 ? 66.475  -21.614  31.052   1.00 293.37 ? 351 LYS B HE3  1 
ATOM   8332  H HZ1  . LYS B  1 219 ? 65.663  -19.782  32.118   1.00 296.63 ? 351 LYS B HZ1  1 
ATOM   8333  H HZ2  . LYS B  1 219 ? 64.906  -19.975  30.898   1.00 296.63 ? 351 LYS B HZ2  1 
ATOM   8334  H HZ3  . LYS B  1 219 ? 64.329  -20.345  32.175   1.00 296.63 ? 351 LYS B HZ3  1 
ATOM   8335  N N    . TYR B  1 220 ? 63.993  -26.740  27.314   1.00 266.47 ? 352 TYR B N    1 
ATOM   8336  C CA   . TYR B  1 220 ? 63.222  -27.530  26.358   1.00 262.11 ? 352 TYR B CA   1 
ATOM   8337  C C    . TYR B  1 220 ? 63.968  -28.822  26.039   1.00 266.77 ? 352 TYR B C    1 
ATOM   8338  O O    . TYR B  1 220 ? 63.371  -29.897  25.958   1.00 269.75 ? 352 TYR B O    1 
ATOM   8339  C CB   . TYR B  1 220 ? 62.974  -26.746  25.065   1.00 250.69 ? 352 TYR B CB   1 
ATOM   8340  C CG   . TYR B  1 220 ? 62.207  -25.454  25.244   1.00 245.67 ? 352 TYR B CG   1 
ATOM   8341  C CD1  . TYR B  1 220 ? 62.807  -24.340  25.815   1.00 246.11 ? 352 TYR B CD1  1 
ATOM   8342  C CD2  . TYR B  1 220 ? 60.890  -25.342  24.821   1.00 240.88 ? 352 TYR B CD2  1 
ATOM   8343  C CE1  . TYR B  1 220 ? 62.114  -23.156  25.974   1.00 241.97 ? 352 TYR B CE1  1 
ATOM   8344  C CE2  . TYR B  1 220 ? 60.187  -24.160  24.975   1.00 236.75 ? 352 TYR B CE2  1 
ATOM   8345  C CZ   . TYR B  1 220 ? 60.804  -23.070  25.552   1.00 237.29 ? 352 TYR B CZ   1 
ATOM   8346  O OH   . TYR B  1 220 ? 60.112  -21.889  25.708   1.00 233.63 ? 352 TYR B OH   1 
ATOM   8347  H H    . TYR B  1 220 ? 64.376  -26.052  26.969   1.00 326.11 ? 352 TYR B H    1 
ATOM   8348  H HA   . TYR B  1 220 ? 62.364  -27.760  26.747   1.00 323.17 ? 352 TYR B HA   1 
ATOM   8349  H HB2  . TYR B  1 220 ? 63.830  -26.526  24.668   1.00 321.29 ? 352 TYR B HB2  1 
ATOM   8350  H HB3  . TYR B  1 220 ? 62.466  -27.306  24.457   1.00 321.29 ? 352 TYR B HB3  1 
ATOM   8351  H HD1  . TYR B  1 220 ? 63.690  -24.394  26.102   1.00 316.84 ? 352 TYR B HD1  1 
ATOM   8352  H HD2  . TYR B  1 220 ? 60.471  -26.076  24.433   1.00 322.44 ? 352 TYR B HD2  1 
ATOM   8353  H HE1  . TYR B  1 220 ? 62.529  -22.420  26.362   1.00 315.97 ? 352 TYR B HE1  1 
ATOM   8354  H HE2  . TYR B  1 220 ? 59.303  -24.101  24.691   1.00 321.93 ? 352 TYR B HE2  1 
ATOM   8355  H HH   . TYR B  1 220 ? 60.605  -21.313  26.071   1.00 318.34 ? 352 TYR B HH   1 
ATOM   8356  N N    . TRP B  1 221 ? 65.281  -28.697  25.863   1.00 264.84 ? 353 TRP B N    1 
ATOM   8357  C CA   . TRP B  1 221 ? 66.134  -29.814  25.468   1.00 269.03 ? 353 TRP B CA   1 
ATOM   8358  C C    . TRP B  1 221 ? 67.022  -30.280  26.617   1.00 280.39 ? 353 TRP B C    1 
ATOM   8359  O O    . TRP B  1 221 ? 68.207  -30.555  26.423   1.00 283.41 ? 353 TRP B O    1 
ATOM   8360  C CB   . TRP B  1 221 ? 66.999  -29.415  24.271   1.00 262.04 ? 353 TRP B CB   1 
ATOM   8361  C CG   . TRP B  1 221 ? 66.214  -29.207  23.022   1.00 252.00 ? 353 TRP B CG   1 
ATOM   8362  C CD1  . TRP B  1 221 ? 65.874  -28.015  22.454   1.00 243.05 ? 353 TRP B CD1  1 
ATOM   8363  C CD2  . TRP B  1 221 ? 65.663  -30.225  22.181   1.00 250.46 ? 353 TRP B CD2  1 
ATOM   8364  N NE1  . TRP B  1 221 ? 65.146  -28.227  21.310   1.00 236.08 ? 353 TRP B NE1  1 
ATOM   8365  C CE2  . TRP B  1 221 ? 65.002  -29.577  21.120   1.00 240.45 ? 353 TRP B CE2  1 
ATOM   8366  C CE3  . TRP B  1 221 ? 65.665  -31.623  22.222   1.00 257.02 ? 353 TRP B CE3  1 
ATOM   8367  C CZ2  . TRP B  1 221 ? 64.350  -30.277  20.110   1.00 236.91 ? 353 TRP B CZ2  1 
ATOM   8368  C CZ3  . TRP B  1 221 ? 65.017  -32.317  21.218   1.00 253.41 ? 353 TRP B CZ3  1 
ATOM   8369  C CH2  . TRP B  1 221 ? 64.368  -31.643  20.176   1.00 243.46 ? 353 TRP B CH2  1 
ATOM   8370  H H    . TRP B  1 221 ? 65.709  -27.959  25.969   1.00 321.28 ? 353 TRP B H    1 
ATOM   8371  H HA   . TRP B  1 221 ? 65.574  -30.559  25.200   1.00 323.66 ? 353 TRP B HA   1 
ATOM   8372  H HB2  . TRP B  1 221 ? 67.457  -28.585  24.477   1.00 325.09 ? 353 TRP B HB2  1 
ATOM   8373  H HB3  . TRP B  1 221 ? 67.646  -30.117  24.103   1.00 325.09 ? 353 TRP B HB3  1 
ATOM   8374  H HD1  . TRP B  1 221 ? 66.103  -27.179  22.793   1.00 319.68 ? 353 TRP B HD1  1 
ATOM   8375  H HE1  . TRP B  1 221 ? 64.831  -27.614  20.796   1.00 317.21 ? 353 TRP B HE1  1 
ATOM   8376  H HE3  . TRP B  1 221 ? 66.094  -32.077  22.912   1.00 323.59 ? 353 TRP B HE3  1 
ATOM   8377  H HZ2  . TRP B  1 221 ? 63.918  -29.833  19.416   1.00 317.36 ? 353 TRP B HZ2  1 
ATOM   8378  H HZ3  . TRP B  1 221 ? 65.011  -33.247  21.235   1.00 323.25 ? 353 TRP B HZ3  1 
ATOM   8379  H HH2  . TRP B  1 221 ? 63.940  -32.136  19.514   1.00 318.80 ? 353 TRP B HH2  1 
ATOM   8380  N N    . ASN B  1 222 ? 66.445  -30.361  27.812   1.00 277.71 ? 354 ASN B N    1 
ATOM   8381  C CA   . ASN B  1 222 ? 67.167  -30.828  28.990   1.00 282.45 ? 354 ASN B CA   1 
ATOM   8382  C C    . ASN B  1 222 ? 68.400  -29.966  29.267   1.00 283.22 ? 354 ASN B C    1 
ATOM   8383  O O    . ASN B  1 222 ? 68.465  -28.811  28.839   1.00 281.05 ? 354 ASN B O    1 
ATOM   8384  C CB   . ASN B  1 222 ? 67.567  -32.301  28.820   1.00 284.33 ? 354 ASN B CB   1 
ATOM   8385  C CG   . ASN B  1 222 ? 66.386  -33.192  28.474   1.00 283.66 ? 354 ASN B CG   1 
ATOM   8386  O OD1  . ASN B  1 222 ? 65.296  -33.036  29.023   1.00 283.60 ? 354 ASN B OD1  1 
ATOM   8387  N ND2  . ASN B  1 222 ? 66.600  -34.133  27.560   1.00 283.35 ? 354 ASN B ND2  1 
ATOM   8388  H H    . ASN B  1 222 ? 65.626  -30.149  27.968   1.00 310.96 ? 354 ASN B H    1 
ATOM   8389  H HA   . ASN B  1 222 ? 66.582  -30.766  29.762   1.00 312.70 ? 354 ASN B HA   1 
ATOM   8390  H HB2  . ASN B  1 222 ? 68.216  -32.372  28.102   1.00 314.21 ? 354 ASN B HB2  1 
ATOM   8391  H HB3  . ASN B  1 222 ? 67.952  -32.623  29.650   1.00 314.21 ? 354 ASN B HB3  1 
ATOM   8392  H HD21 . ASN B  1 222 ? 65.963  -34.662  27.330   1.00 314.42 ? 354 ASN B HD21 1 
ATOM   8393  H HD22 . ASN B  1 222 ? 67.376  -34.212  27.198   1.00 314.42 ? 354 ASN B HD22 1 
ATOM   8394  N N    . ASN B  1 223 ? 69.373  -30.528  29.981   1.00 288.54 ? 355 ASN B N    1 
ATOM   8395  C CA   . ASN B  1 223 ? 70.608  -29.819  30.305   1.00 289.85 ? 355 ASN B CA   1 
ATOM   8396  C C    . ASN B  1 223 ? 71.731  -30.149  29.324   1.00 289.48 ? 355 ASN B C    1 
ATOM   8397  O O    . ASN B  1 223 ? 72.892  -30.285  29.715   1.00 292.09 ? 355 ASN B O    1 
ATOM   8398  C CB   . ASN B  1 223 ? 71.046  -30.151  31.734   1.00 294.14 ? 355 ASN B CB   1 
ATOM   8399  C CG   . ASN B  1 223 ? 70.066  -29.647  32.776   1.00 294.86 ? 355 ASN B CG   1 
ATOM   8400  O OD1  . ASN B  1 223 ? 69.590  -30.408  33.619   1.00 297.28 ? 355 ASN B OD1  1 
ATOM   8401  N ND2  . ASN B  1 223 ? 69.758  -28.356  32.720   1.00 292.91 ? 355 ASN B ND2  1 
ATOM   8402  H H    . ASN B  1 223 ? 69.340  -31.328  30.294   1.00 339.60 ? 355 ASN B H    1 
ATOM   8403  H HA   . ASN B  1 223 ? 70.443  -28.864  30.258   1.00 344.32 ? 355 ASN B HA   1 
ATOM   8404  H HB2  . ASN B  1 223 ? 71.115  -31.114  31.828   1.00 347.19 ? 355 ASN B HB2  1 
ATOM   8405  H HB3  . ASN B  1 223 ? 71.906  -29.737  31.906   1.00 347.19 ? 355 ASN B HB3  1 
ATOM   8406  H HD21 . ASN B  1 223 ? 69.206  -28.021  33.289   1.00 342.21 ? 355 ASN B HD21 1 
ATOM   8407  H HD22 . ASN B  1 223 ? 70.109  -27.855  32.116   1.00 342.21 ? 355 ASN B HD22 1 
ATOM   8408  N N    . ASN B  1 224 ? 71.376  -30.283  28.050   1.00 288.29 ? 357 ASN B N    1 
ATOM   8409  C CA   . ASN B  1 224 ? 72.363  -30.498  26.997   1.00 287.68 ? 357 ASN B CA   1 
ATOM   8410  C C    . ASN B  1 224 ? 73.090  -29.198  26.671   1.00 286.31 ? 357 ASN B C    1 
ATOM   8411  O O    . ASN B  1 224 ? 72.498  -28.118  26.730   1.00 282.32 ? 357 ASN B O    1 
ATOM   8412  C CB   . ASN B  1 224 ? 71.695  -31.056  25.737   1.00 285.15 ? 357 ASN B CB   1 
ATOM   8413  C CG   . ASN B  1 224 ? 70.915  -32.331  26.000   1.00 286.43 ? 357 ASN B CG   1 
ATOM   8414  O OD1  . ASN B  1 224 ? 71.185  -33.052  26.961   1.00 289.60 ? 357 ASN B OD1  1 
ATOM   8415  N ND2  . ASN B  1 224 ? 69.943  -32.617  25.140   1.00 284.15 ? 357 ASN B ND2  1 
ATOM   8416  H H    . ASN B  1 224 ? 70.565  -30.252  27.767   1.00 315.31 ? 357 ASN B H    1 
ATOM   8417  H HA   . ASN B  1 224 ? 73.019  -31.144  27.303   1.00 318.04 ? 357 ASN B HA   1 
ATOM   8418  H HB2  . ASN B  1 224 ? 71.078  -30.394  25.387   1.00 314.96 ? 357 ASN B HB2  1 
ATOM   8419  H HB3  . ASN B  1 224 ? 72.379  -31.253  25.078   1.00 314.96 ? 357 ASN B HB3  1 
ATOM   8420  H HD21 . ASN B  1 224 ? 69.471  -33.329  25.245   1.00 311.20 ? 357 ASN B HD21 1 
ATOM   8421  H HD22 . ASN B  1 224 ? 69.785  -32.091  24.478   1.00 311.20 ? 357 ASN B HD22 1 
ATOM   8422  N N    . THR B  1 225 ? 74.371  -29.303  26.328   1.00 277.27 ? 358 THR B N    1 
ATOM   8423  C CA   . THR B  1 225 ? 75.173  -28.130  25.982   1.00 276.23 ? 358 THR B CA   1 
ATOM   8424  C C    . THR B  1 225 ? 75.045  -27.809  24.500   1.00 265.62 ? 358 THR B C    1 
ATOM   8425  O O    . THR B  1 225 ? 75.012  -28.706  23.657   1.00 264.06 ? 358 THR B O    1 
ATOM   8426  C CB   . THR B  1 225 ? 76.659  -28.334  26.333   1.00 279.49 ? 358 THR B CB   1 
ATOM   8427  O OG1  . THR B  1 225 ? 76.795  -28.496  27.751   1.00 282.92 ? 358 THR B OG1  1 
ATOM   8428  C CG2  . THR B  1 225 ? 77.501  -27.136  25.884   1.00 278.40 ? 358 THR B CG2  1 
ATOM   8429  H H    . THR B  1 225 ? 74.802  -30.046  26.287   1.00 311.95 ? 358 THR B H    1 
ATOM   8430  H HA   . THR B  1 225 ? 74.848  -27.366  26.484   1.00 317.22 ? 358 THR B HA   1 
ATOM   8431  H HB   . THR B  1 225 ? 76.991  -29.127  25.884   1.00 324.00 ? 358 THR B HB   1 
ATOM   8432  H HG1  . THR B  1 225 ? 77.603  -28.607  27.951   1.00 326.18 ? 358 THR B HG1  1 
ATOM   8433  H HG21 . THR B  1 225 ? 78.432  -27.282  26.113   1.00 330.49 ? 358 THR B HG21 1 
ATOM   8434  H HG22 . THR B  1 225 ? 77.426  -27.021  24.924   1.00 330.49 ? 358 THR B HG22 1 
ATOM   8435  H HG23 . THR B  1 225 ? 77.190  -26.330  26.324   1.00 330.49 ? 358 THR B HG23 1 
ATOM   8436  N N    . ILE B  1 226 ? 74.980  -26.517  24.199   1.00 267.14 ? 359 ILE B N    1 
ATOM   8437  C CA   . ILE B  1 226 ? 74.775  -26.048  22.838   1.00 256.28 ? 359 ILE B CA   1 
ATOM   8438  C C    . ILE B  1 226 ? 76.094  -25.559  22.248   1.00 255.88 ? 359 ILE B C    1 
ATOM   8439  O O    . ILE B  1 226 ? 76.865  -24.859  22.907   1.00 260.22 ? 359 ILE B O    1 
ATOM   8440  C CB   . ILE B  1 226 ? 73.717  -24.913  22.786   1.00 247.91 ? 359 ILE B CB   1 
ATOM   8441  C CG1  . ILE B  1 226 ? 72.354  -25.424  23.267   1.00 248.08 ? 359 ILE B CG1  1 
ATOM   8442  C CG2  . ILE B  1 226 ? 73.572  -24.360  21.369   1.00 237.17 ? 359 ILE B CG2  1 
ATOM   8443  C CD1  . ILE B  1 226 ? 72.168  -25.426  24.774   1.00 256.66 ? 359 ILE B CD1  1 
ATOM   8444  H H    . ILE B  1 226 ? 75.052  -25.884  24.776   1.00 363.91 ? 359 ILE B H    1 
ATOM   8445  H HA   . ILE B  1 226 ? 74.455  -26.784  22.294   1.00 362.73 ? 359 ILE B HA   1 
ATOM   8446  H HB   . ILE B  1 226 ? 74.004  -24.195  23.371   1.00 360.09 ? 359 ILE B HB   1 
ATOM   8447  H HG12 . ILE B  1 226 ? 71.661  -24.861  22.886   1.00 352.41 ? 359 ILE B HG12 1 
ATOM   8448  H HG13 . ILE B  1 226 ? 72.239  -26.336  22.956   1.00 352.41 ? 359 ILE B HG13 1 
ATOM   8449  H HG21 . ILE B  1 226 ? 72.906  -23.655  21.372   1.00 362.84 ? 359 ILE B HG21 1 
ATOM   8450  H HG22 . ILE B  1 226 ? 74.428  -24.005  21.080   1.00 362.84 ? 359 ILE B HG22 1 
ATOM   8451  H HG23 . ILE B  1 226 ? 73.294  -25.076  20.778   1.00 362.84 ? 359 ILE B HG23 1 
ATOM   8452  H HD11 . ILE B  1 226 ? 71.282  -25.762  24.982   1.00 349.90 ? 359 ILE B HD11 1 
ATOM   8453  H HD12 . ILE B  1 226 ? 72.842  -25.997  25.175   1.00 349.90 ? 359 ILE B HD12 1 
ATOM   8454  H HD13 . ILE B  1 226 ? 72.263  -24.519  25.105   1.00 349.90 ? 359 ILE B HD13 1 
ATOM   8455  N N    . ILE B  1 227 ? 76.352  -25.968  21.011   1.00 243.13 ? 360 ILE B N    1 
ATOM   8456  C CA   . ILE B  1 227 ? 77.485  -25.478  20.237   1.00 241.39 ? 360 ILE B CA   1 
ATOM   8457  C C    . ILE B  1 227 ? 76.982  -24.925  18.909   1.00 230.02 ? 360 ILE B C    1 
ATOM   8458  O O    . ILE B  1 227 ? 76.111  -25.519  18.277   1.00 225.55 ? 360 ILE B O    1 
ATOM   8459  C CB   . ILE B  1 227 ? 78.519  -26.586  19.978   1.00 248.56 ? 360 ILE B CB   1 
ATOM   8460  C CG1  . ILE B  1 227 ? 77.822  -27.850  19.467   1.00 247.97 ? 360 ILE B CG1  1 
ATOM   8461  C CG2  . ILE B  1 227 ? 79.302  -26.875  21.249   1.00 260.35 ? 360 ILE B CG2  1 
ATOM   8462  C CD1  . ILE B  1 227 ? 78.763  -28.955  19.045   1.00 254.33 ? 360 ILE B CD1  1 
ATOM   8463  H H    . ILE B  1 227 ? 75.872  -26.543  20.588   1.00 178.54 ? 360 ILE B H    1 
ATOM   8464  H HA   . ILE B  1 227 ? 77.921  -24.760  20.722   1.00 187.65 ? 360 ILE B HA   1 
ATOM   8465  H HB   . ILE B  1 227 ? 79.138  -26.278  19.297   1.00 195.04 ? 360 ILE B HB   1 
ATOM   8466  H HG12 . ILE B  1 227 ? 77.255  -28.199  20.173   1.00 186.78 ? 360 ILE B HG12 1 
ATOM   8467  H HG13 . ILE B  1 227 ? 77.278  -27.616  18.698   1.00 186.78 ? 360 ILE B HG13 1 
ATOM   8468  H HG21 . ILE B  1 227 ? 79.949  -27.575  21.069   1.00 200.25 ? 360 ILE B HG21 1 
ATOM   8469  H HG22 . ILE B  1 227 ? 79.759  -26.067  21.529   1.00 200.25 ? 360 ILE B HG22 1 
ATOM   8470  H HG23 . ILE B  1 227 ? 78.686  -27.164  21.940   1.00 200.25 ? 360 ILE B HG23 1 
ATOM   8471  H HD11 . ILE B  1 227 ? 78.241  -29.712  18.737   1.00 194.12 ? 360 ILE B HD11 1 
ATOM   8472  H HD12 . ILE B  1 227 ? 79.329  -28.629  18.328   1.00 194.12 ? 360 ILE B HD12 1 
ATOM   8473  H HD13 . ILE B  1 227 ? 79.306  -29.214  19.805   1.00 194.12 ? 360 ILE B HD13 1 
ATOM   8474  N N    . PHE B  1 228 ? 77.520  -23.784  18.496   1.00 231.80 ? 361 PHE B N    1 
ATOM   8475  C CA   . PHE B  1 228 ? 77.115  -23.160  17.242   1.00 221.50 ? 361 PHE B CA   1 
ATOM   8476  C C    . PHE B  1 228 ? 78.196  -23.303  16.182   1.00 220.99 ? 361 PHE B C    1 
ATOM   8477  O O    . PHE B  1 228 ? 79.381  -23.115  16.459   1.00 226.65 ? 361 PHE B O    1 
ATOM   8478  C CB   . PHE B  1 228 ? 76.793  -21.684  17.457   1.00 216.43 ? 361 PHE B CB   1 
ATOM   8479  C CG   . PHE B  1 228 ? 75.552  -21.448  18.273   1.00 215.25 ? 361 PHE B CG   1 
ATOM   8480  C CD1  . PHE B  1 228 ? 74.311  -21.369  17.662   1.00 207.49 ? 361 PHE B CD1  1 
ATOM   8481  C CD2  . PHE B  1 228 ? 75.625  -21.307  19.648   1.00 222.40 ? 361 PHE B CD2  1 
ATOM   8482  C CE1  . PHE B  1 228 ? 73.165  -21.151  18.408   1.00 206.84 ? 361 PHE B CE1  1 
ATOM   8483  C CE2  . PHE B  1 228 ? 74.483  -21.090  20.400   1.00 221.75 ? 361 PHE B CE2  1 
ATOM   8484  C CZ   . PHE B  1 228 ? 73.252  -21.013  19.778   1.00 213.94 ? 361 PHE B CZ   1 
ATOM   8485  H H    . PHE B  1 228 ? 78.124  -23.348  18.926   1.00 218.55 ? 361 PHE B H    1 
ATOM   8486  H HA   . PHE B  1 228 ? 76.314  -23.598  16.915   1.00 214.40 ? 361 PHE B HA   1 
ATOM   8487  H HB2  . PHE B  1 228 ? 77.536  -21.266  17.920   1.00 216.33 ? 361 PHE B HB2  1 
ATOM   8488  H HB3  . PHE B  1 228 ? 76.664  -21.263  16.593   1.00 216.33 ? 361 PHE B HB3  1 
ATOM   8489  H HD1  . PHE B  1 228 ? 74.247  -21.462  16.739   1.00 214.15 ? 361 PHE B HD1  1 
ATOM   8490  H HD2  . PHE B  1 228 ? 76.452  -21.358  20.072   1.00 193.06 ? 361 PHE B HD2  1 
ATOM   8491  H HE1  . PHE B  1 228 ? 72.338  -21.100  17.986   1.00 206.45 ? 361 PHE B HE1  1 
ATOM   8492  H HE2  . PHE B  1 228 ? 74.545  -20.996  21.323   1.00 186.60 ? 361 PHE B HE2  1 
ATOM   8493  H HZ   . PHE B  1 228 ? 72.484  -20.866  20.281   1.00 193.16 ? 361 PHE B HZ   1 
ATOM   8494  N N    . ASN B  1 229 ? 77.770  -23.648  14.972   1.00 218.08 ? 362 ASN B N    1 
ATOM   8495  C CA   . ASN B  1 229 ? 78.660  -23.760  13.823   1.00 216.73 ? 362 ASN B CA   1 
ATOM   8496  C C    . ASN B  1 229 ? 78.057  -23.019  12.641   1.00 206.47 ? 362 ASN B C    1 
ATOM   8497  O O    . ASN B  1 229 ? 76.866  -22.703  12.639   1.00 200.83 ? 362 ASN B O    1 
ATOM   8498  C CB   . ASN B  1 229 ? 78.910  -25.228  13.457   1.00 221.48 ? 362 ASN B CB   1 
ATOM   8499  C CG   . ASN B  1 229 ? 80.039  -25.858  14.265   1.00 232.38 ? 362 ASN B CG   1 
ATOM   8500  O OD1  . ASN B  1 229 ? 79.826  -26.345  15.376   1.00 238.65 ? 362 ASN B OD1  1 
ATOM   8501  N ND2  . ASN B  1 229 ? 81.243  -25.866  13.699   1.00 235.15 ? 362 ASN B ND2  1 
ATOM   8502  H H    . ASN B  1 229 ? 76.949  -23.827  14.787   1.00 264.90 ? 362 ASN B H    1 
ATOM   8503  H HA   . ASN B  1 229 ? 79.513  -23.350  14.037   1.00 272.44 ? 362 ASN B HA   1 
ATOM   8504  H HB2  . ASN B  1 229 ? 78.102  -25.737  13.625   1.00 270.27 ? 362 ASN B HB2  1 
ATOM   8505  H HB3  . ASN B  1 229 ? 79.148  -25.283  12.518   1.00 270.27 ? 362 ASN B HB3  1 
ATOM   8506  H HD21 . ASN B  1 229 ? 81.912  -26.210  14.116   1.00 286.97 ? 362 ASN B HD21 1 
ATOM   8507  H HD22 . ASN B  1 229 ? 81.352  -25.527  12.917   1.00 286.97 ? 362 ASN B HD22 1 
ATOM   8508  N N    . SER B  1 230 ? 78.883  -22.739  11.639   1.00 209.46 ? 363 SER B N    1 
ATOM   8509  C CA   . SER B  1 230 ? 78.434  -22.016  10.455   1.00 200.42 ? 363 SER B CA   1 
ATOM   8510  C C    . SER B  1 230 ? 77.477  -22.863  9.624    1.00 196.34 ? 363 SER B C    1 
ATOM   8511  O O    . SER B  1 230 ? 77.271  -24.043  9.908    1.00 200.78 ? 363 SER B O    1 
ATOM   8512  C CB   . SER B  1 230 ? 79.631  -21.593  9.603    1.00 200.52 ? 363 SER B CB   1 
ATOM   8513  O OG   . SER B  1 230 ? 80.384  -22.721  9.189    1.00 205.82 ? 363 SER B OG   1 
ATOM   8514  H H    . SER B  1 230 ? 79.714  -22.958  11.620   1.00 301.97 ? 363 SER B H    1 
ATOM   8515  H HA   . SER B  1 230 ? 77.963  -21.214  10.733   1.00 296.51 ? 363 SER B HA   1 
ATOM   8516  H HB2  . SER B  1 230 ? 79.308  -21.123  8.818    1.00 305.06 ? 363 SER B HB2  1 
ATOM   8517  H HB3  . SER B  1 230 ? 80.200  -21.008  10.128   1.00 305.06 ? 363 SER B HB3  1 
ATOM   8518  H HG   . SER B  1 230 ? 81.037  -22.475  8.723    1.00 311.84 ? 363 SER B HG   1 
ATOM   8519  N N    . SER B  1 231 ? 76.898  -22.245  8.599    1.00 193.62 ? 364 SER B N    1 
ATOM   8520  C CA   . SER B  1 231 ? 75.960  -22.922  7.709    1.00 189.43 ? 364 SER B CA   1 
ATOM   8521  C C    . SER B  1 231 ? 76.577  -24.177  7.099    1.00 193.90 ? 364 SER B C    1 
ATOM   8522  O O    . SER B  1 231 ? 77.782  -24.233  6.858    1.00 197.67 ? 364 SER B O    1 
ATOM   8523  C CB   . SER B  1 231 ? 75.503  -21.971  6.602    1.00 181.01 ? 364 SER B CB   1 
ATOM   8524  O OG   . SER B  1 231 ? 76.609  -21.335  5.986    1.00 180.76 ? 364 SER B OG   1 
ATOM   8525  H H    . SER B  1 231 ? 77.034  -21.421  8.395    1.00 335.66 ? 364 SER B H    1 
ATOM   8526  H HA   . SER B  1 231 ? 75.179  -23.189  8.218    1.00 329.72 ? 364 SER B HA   1 
ATOM   8527  H HB2  . SER B  1 231 ? 75.018  -22.477  5.932    1.00 324.95 ? 364 SER B HB2  1 
ATOM   8528  H HB3  . SER B  1 231 ? 74.925  -21.294  6.988    1.00 324.95 ? 364 SER B HB3  1 
ATOM   8529  H HG   . SER B  1 231 ? 77.039  -20.891  6.556    1.00 335.21 ? 364 SER B HG   1 
ATOM   8530  N N    . SER B  1 232 ? 75.740  -25.179  6.851    1.00 191.75 ? 365 SER B N    1 
ATOM   8531  C CA   . SER B  1 232 ? 76.209  -26.456  6.326    1.00 196.55 ? 365 SER B CA   1 
ATOM   8532  C C    . SER B  1 232 ? 76.417  -26.422  4.812    1.00 194.77 ? 365 SER B C    1 
ATOM   8533  O O    . SER B  1 232 ? 77.056  -27.317  4.252    1.00 198.29 ? 365 SER B O    1 
ATOM   8534  C CB   . SER B  1 232 ? 75.225  -27.567  6.692    1.00 198.87 ? 365 SER B CB   1 
ATOM   8535  O OG   . SER B  1 232 ? 73.889  -27.132  6.522    1.00 195.09 ? 365 SER B OG   1 
ATOM   8536  H H    . SER B  1 232 ? 74.891  -25.145  6.979    1.00 258.02 ? 365 SER B H    1 
ATOM   8537  H HA   . SER B  1 232 ? 77.062  -26.668  6.737    1.00 262.31 ? 365 SER B HA   1 
ATOM   8538  H HB2  . SER B  1 232 ? 75.384  -28.331  6.117    1.00 253.02 ? 365 SER B HB2  1 
ATOM   8539  H HB3  . SER B  1 232 ? 75.360  -27.815  7.620    1.00 253.02 ? 365 SER B HB3  1 
ATOM   8540  H HG   . SER B  1 232 ? 73.358  -27.749  6.726    1.00 240.79 ? 365 SER B HG   1 
ATOM   8541  N N    . GLY B  1 233 ? 75.877  -25.397  4.155    1.00 186.08 ? 366 GLY B N    1 
ATOM   8542  C CA   . GLY B  1 233 ? 76.065  -25.218  2.725    1.00 187.08 ? 366 GLY B CA   1 
ATOM   8543  C C    . GLY B  1 233 ? 74.786  -24.892  1.979    1.00 188.40 ? 366 GLY B C    1 
ATOM   8544  O O    . GLY B  1 233 ? 73.702  -24.843  2.562    1.00 187.38 ? 366 GLY B O    1 
ATOM   8545  H H    . GLY B  1 233 ? 75.394  -24.787  4.522    1.00 307.73 ? 366 GLY B H    1 
ATOM   8546  H HA2  . GLY B  1 233 ? 76.696  -24.498  2.574    1.00 311.43 ? 366 GLY B HA2  1 
ATOM   8547  H HA3  . GLY B  1 233 ? 76.437  -26.031  2.349    1.00 311.43 ? 366 GLY B HA3  1 
ATOM   8548  N N    . GLY B  1 234 ? 74.926  -24.678  0.673    1.00 181.59 ? 367 GLY B N    1 
ATOM   8549  C CA   . GLY B  1 234 ? 73.816  -24.311  -0.191   1.00 183.58 ? 367 GLY B CA   1 
ATOM   8550  C C    . GLY B  1 234 ? 74.213  -23.137  -1.062   1.00 181.67 ? 367 GLY B C    1 
ATOM   8551  O O    . GLY B  1 234 ? 75.397  -22.933  -1.329   1.00 181.15 ? 367 GLY B O    1 
ATOM   8552  H H    . GLY B  1 234 ? 75.676  -24.741  0.257    1.00 148.65 ? 367 GLY B H    1 
ATOM   8553  H HA2  . GLY B  1 234 ? 73.577  -25.060  -0.759   1.00 138.53 ? 367 GLY B HA2  1 
ATOM   8554  H HA3  . GLY B  1 234 ? 73.047  -24.062  0.344    1.00 138.53 ? 367 GLY B HA3  1 
ATOM   8555  N N    . ASP B  1 235 ? 73.229  -22.364  -1.510   1.00 179.63 ? 368 ASP B N    1 
ATOM   8556  C CA   . ASP B  1 235 ? 73.510  -21.126  -2.227   1.00 176.03 ? 368 ASP B CA   1 
ATOM   8557  C C    . ASP B  1 235 ? 74.291  -20.183  -1.322   1.00 168.41 ? 368 ASP B C    1 
ATOM   8558  O O    . ASP B  1 235 ? 74.169  -20.244  -0.101   1.00 164.66 ? 368 ASP B O    1 
ATOM   8559  C CB   . ASP B  1 235 ? 72.219  -20.457  -2.701   1.00 172.67 ? 368 ASP B CB   1 
ATOM   8560  C CG   . ASP B  1 235 ? 71.638  -21.119  -3.934   1.00 176.50 ? 368 ASP B CG   1 
ATOM   8561  O OD1  . ASP B  1 235 ? 71.054  -22.213  -3.806   1.00 179.00 ? 368 ASP B OD1  1 
ATOM   8562  O OD2  . ASP B  1 235 ? 71.763  -20.540  -5.034   1.00 174.75 ? 368 ASP B OD2  1 
ATOM   8563  H H    . ASP B  1 235 ? 72.391  -22.533  -1.412   1.00 180.31 ? 368 ASP B H    1 
ATOM   8564  H HA   . ASP B  1 235 ? 74.055  -21.322  -3.005   1.00 177.70 ? 368 ASP B HA   1 
ATOM   8565  H HB2  . ASP B  1 235 ? 71.557  -20.509  -1.993   1.00 166.21 ? 368 ASP B HB2  1 
ATOM   8566  H HB3  . ASP B  1 235 ? 72.403  -19.530  -2.917   1.00 166.21 ? 368 ASP B HB3  1 
ATOM   8567  N N    . LEU B  1 236 ? 75.093  -19.313  -1.926   1.00 185.74 ? 369 LEU B N    1 
ATOM   8568  C CA   . LEU B  1 236 ? 75.897  -18.359  -1.171   1.00 175.96 ? 369 LEU B CA   1 
ATOM   8569  C C    . LEU B  1 236 ? 75.005  -17.452  -0.338   1.00 167.17 ? 369 LEU B C    1 
ATOM   8570  O O    . LEU B  1 236 ? 75.437  -16.881  0.661    1.00 161.73 ? 369 LEU B O    1 
ATOM   8571  C CB   . LEU B  1 236 ? 76.756  -17.506  -2.104   1.00 173.11 ? 369 LEU B CB   1 
ATOM   8572  C CG   . LEU B  1 236 ? 77.397  -18.197  -3.313   1.00 181.75 ? 369 LEU B CG   1 
ATOM   8573  C CD1  . LEU B  1 236 ? 78.124  -17.175  -4.176   1.00 177.97 ? 369 LEU B CD1  1 
ATOM   8574  C CD2  . LEU B  1 236 ? 78.342  -19.307  -2.871   1.00 187.03 ? 369 LEU B CD2  1 
ATOM   8575  H H    . LEU B  1 236 ? 75.189  -19.254  -2.779   1.00 235.90 ? 369 LEU B H    1 
ATOM   8576  H HA   . LEU B  1 236 ? 76.487  -18.841  -0.570   1.00 231.13 ? 369 LEU B HA   1 
ATOM   8577  H HB2  . LEU B  1 236 ? 76.200  -16.790  -2.450   1.00 227.91 ? 369 LEU B HB2  1 
ATOM   8578  H HB3  . LEU B  1 236 ? 77.477  -17.124  -1.581   1.00 227.91 ? 369 LEU B HB3  1 
ATOM   8579  H HG   . LEU B  1 236 ? 76.698  -18.598  -3.853   1.00 239.00 ? 369 LEU B HG   1 
ATOM   8580  H HD11 . LEU B  1 236 ? 78.523  -17.630  -4.935   1.00 235.45 ? 369 LEU B HD11 1 
ATOM   8581  H HD12 . LEU B  1 236 ? 77.486  -16.513  -4.485   1.00 235.45 ? 369 LEU B HD12 1 
ATOM   8582  H HD13 . LEU B  1 236 ? 78.815  -16.749  -3.645   1.00 235.45 ? 369 LEU B HD13 1 
ATOM   8583  H HD21 . LEU B  1 236 ? 78.730  -19.722  -3.657   1.00 248.33 ? 369 LEU B HD21 1 
ATOM   8584  H HD22 . LEU B  1 236 ? 79.042  -18.924  -2.319   1.00 248.33 ? 369 LEU B HD22 1 
ATOM   8585  H HD23 . LEU B  1 236 ? 77.841  -19.964  -2.363   1.00 248.33 ? 369 LEU B HD23 1 
ATOM   8586  N N    . GLU B  1 237 ? 73.752  -17.335  -0.758   1.00 171.84 ? 370 GLU B N    1 
ATOM   8587  C CA   . GLU B  1 237 ? 72.839  -16.355  -0.193   1.00 162.80 ? 370 GLU B CA   1 
ATOM   8588  C C    . GLU B  1 237 ? 72.188  -16.794  1.119    1.00 163.00 ? 370 GLU B C    1 
ATOM   8589  O O    . GLU B  1 237 ? 71.722  -15.952  1.889    1.00 157.17 ? 370 GLU B O    1 
ATOM   8590  C CB   . GLU B  1 237 ? 71.768  -16.023  -1.232   1.00 161.96 ? 370 GLU B CB   1 
ATOM   8591  C CG   . GLU B  1 237 ? 72.309  -15.176  -2.376   1.00 157.53 ? 370 GLU B CG   1 
ATOM   8592  C CD   . GLU B  1 237 ? 71.594  -15.418  -3.685   1.00 160.81 ? 370 GLU B CD   1 
ATOM   8593  O OE1  . GLU B  1 237 ? 70.419  -15.012  -3.791   1.00 156.53 ? 370 GLU B OE1  1 
ATOM   8594  O OE2  . GLU B  1 237 ? 72.206  -16.006  -4.602   1.00 168.45 ? 370 GLU B OE2  1 
ATOM   8595  H H    . GLU B  1 237 ? 73.403  -17.819  -1.377   1.00 310.80 ? 370 GLU B H    1 
ATOM   8596  H HA   . GLU B  1 237 ? 73.335  -15.540  -0.013   1.00 300.22 ? 370 GLU B HA   1 
ATOM   8597  H HB2  . GLU B  1 237 ? 71.422  -16.848  -1.605   1.00 293.09 ? 370 GLU B HB2  1 
ATOM   8598  H HB3  . GLU B  1 237 ? 71.054  -15.527  -0.803   1.00 293.09 ? 370 GLU B HB3  1 
ATOM   8599  H HG2  . GLU B  1 237 ? 72.208  -14.239  -2.150   1.00 288.59 ? 370 GLU B HG2  1 
ATOM   8600  H HG3  . GLU B  1 237 ? 73.247  -15.386  -2.506   1.00 288.59 ? 370 GLU B HG3  1 
ATOM   8601  N N    . ILE B  1 238 ? 72.152  -18.102  1.370    1.00 158.39 ? 371 ILE B N    1 
ATOM   8602  C CA   . ILE B  1 238 ? 71.631  -18.626  2.635    1.00 158.78 ? 371 ILE B CA   1 
ATOM   8603  C C    . ILE B  1 238 ? 72.754  -19.092  3.560    1.00 159.79 ? 371 ILE B C    1 
ATOM   8604  O O    . ILE B  1 238 ? 72.533  -19.304  4.751    1.00 159.69 ? 371 ILE B O    1 
ATOM   8605  C CB   . ILE B  1 238 ? 70.641  -19.795  2.421    1.00 168.35 ? 371 ILE B CB   1 
ATOM   8606  C CG1  . ILE B  1 238 ? 71.282  -20.932  1.628    1.00 178.10 ? 371 ILE B CG1  1 
ATOM   8607  C CG2  . ILE B  1 238 ? 69.377  -19.311  1.738    1.00 167.05 ? 371 ILE B CG2  1 
ATOM   8608  C CD1  . ILE B  1 238 ? 71.679  -22.112  2.482    1.00 180.71 ? 371 ILE B CD1  1 
ATOM   8609  H H    . ILE B  1 238 ? 72.423  -18.709  0.824    1.00 140.73 ? 371 ILE B H    1 
ATOM   8610  H HA   . ILE B  1 238 ? 71.152  -17.915  3.090    1.00 139.54 ? 371 ILE B HA   1 
ATOM   8611  H HB   . ILE B  1 238 ? 70.396  -20.141  3.294    1.00 135.72 ? 371 ILE B HB   1 
ATOM   8612  H HG12 . ILE B  1 238 ? 70.649  -21.245  0.964    1.00 144.23 ? 371 ILE B HG12 1 
ATOM   8613  H HG13 . ILE B  1 238 ? 72.081  -20.598  1.191    1.00 144.23 ? 371 ILE B HG13 1 
ATOM   8614  H HG21 . ILE B  1 238 ? 68.776  -20.064  1.617    1.00 125.02 ? 371 ILE B HG21 1 
ATOM   8615  H HG22 . ILE B  1 238 ? 68.956  -18.637  2.294    1.00 125.02 ? 371 ILE B HG22 1 
ATOM   8616  H HG23 . ILE B  1 238 ? 69.609  -18.932  0.876    1.00 125.02 ? 371 ILE B HG23 1 
ATOM   8617  H HD11 . ILE B  1 238 ? 72.077  -22.791  1.915    1.00 150.44 ? 371 ILE B HD11 1 
ATOM   8618  H HD12 . ILE B  1 238 ? 72.321  -21.818  3.147    1.00 150.44 ? 371 ILE B HD12 1 
ATOM   8619  H HD13 . ILE B  1 238 ? 70.889  -22.465  2.919    1.00 150.44 ? 371 ILE B HD13 1 
ATOM   8620  N N    . THR B  1 239 ? 73.955  -19.250  3.014    1.00 165.68 ? 372 THR B N    1 
ATOM   8621  C CA   . THR B  1 239 ? 75.122  -19.570  3.830    1.00 167.08 ? 372 THR B CA   1 
ATOM   8622  C C    . THR B  1 239 ? 75.690  -18.315  4.489    1.00 161.37 ? 372 THR B C    1 
ATOM   8623  O O    . THR B  1 239 ? 76.309  -18.385  5.552    1.00 164.85 ? 372 THR B O    1 
ATOM   8624  C CB   . THR B  1 239 ? 76.230  -20.234  2.998    1.00 171.54 ? 372 THR B CB   1 
ATOM   8625  O OG1  . THR B  1 239 ? 76.567  -19.389  1.891    1.00 169.15 ? 372 THR B OG1  1 
ATOM   8626  C CG2  . THR B  1 239 ? 75.781  -21.598  2.486    1.00 178.77 ? 372 THR B CG2  1 
ATOM   8627  H H    . THR B  1 239 ? 74.121  -19.178  2.173    1.00 205.89 ? 372 THR B H    1 
ATOM   8628  H HA   . THR B  1 239 ? 74.860  -20.187  4.531    1.00 217.16 ? 372 THR B HA   1 
ATOM   8629  H HB   . THR B  1 239 ? 77.015  -20.361  3.554    1.00 227.86 ? 372 THR B HB   1 
ATOM   8630  H HG1  . THR B  1 239 ? 77.173  -19.746  1.431    1.00 223.00 ? 372 THR B HG1  1 
ATOM   8631  H HG21 . THR B  1 239 ? 76.490  -22.005  1.963    1.00 227.77 ? 372 THR B HG21 1 
ATOM   8632  H HG22 . THR B  1 239 ? 75.567  -22.179  3.233    1.00 227.77 ? 372 THR B HG22 1 
ATOM   8633  H HG23 . THR B  1 239 ? 74.994  -21.500  1.928    1.00 227.77 ? 372 THR B HG23 1 
ATOM   8634  N N    . THR B  1 240 ? 75.479  -17.172  3.840    1.00 173.96 ? 373 THR B N    1 
ATOM   8635  C CA   . THR B  1 240 ? 75.963  -15.880  4.327    1.00 171.70 ? 373 THR B CA   1 
ATOM   8636  C C    . THR B  1 240 ? 74.818  -14.985  4.785    1.00 167.34 ? 373 THR B C    1 
ATOM   8637  O O    . THR B  1 240 ? 73.657  -15.241  4.466    1.00 164.18 ? 373 THR B O    1 
ATOM   8638  C CB   . THR B  1 240 ? 76.734  -15.124  3.236    1.00 169.40 ? 373 THR B CB   1 
ATOM   8639  O OG1  . THR B  1 240 ? 75.828  -14.739  2.193    1.00 163.49 ? 373 THR B OG1  1 
ATOM   8640  C CG2  . THR B  1 240 ? 77.849  -15.984  2.659    1.00 173.84 ? 373 THR B CG2  1 
ATOM   8641  H H    . THR B  1 240 ? 75.048  -17.118  3.098    1.00 243.57 ? 373 THR B H    1 
ATOM   8642  H HA   . THR B  1 240 ? 76.559  -16.023  5.079    1.00 239.95 ? 373 THR B HA   1 
ATOM   8643  H HB   . THR B  1 240 ? 77.133  -14.328  3.621    1.00 236.97 ? 373 THR B HB   1 
ATOM   8644  H HG1  . THR B  1 240 ? 76.241  -14.324  1.591    1.00 228.16 ? 373 THR B HG1  1 
ATOM   8645  H HG21 . THR B  1 240 ? 78.326  -15.491  1.973    1.00 244.92 ? 373 THR B HG21 1 
ATOM   8646  H HG22 . THR B  1 240 ? 78.473  -16.231  3.360    1.00 244.92 ? 373 THR B HG22 1 
ATOM   8647  H HG23 . THR B  1 240 ? 77.478  -16.790  2.269    1.00 244.92 ? 373 THR B HG23 1 
ATOM   8648  N N    . HIS B  1 241 ? 75.148  -13.925  5.522    1.00 178.01 ? 374 HIS B N    1 
ATOM   8649  C CA   . HIS B  1 241 ? 74.165  -12.892  5.834    1.00 173.96 ? 374 HIS B CA   1 
ATOM   8650  C C    . HIS B  1 241 ? 73.967  -12.051  4.585    1.00 168.22 ? 374 HIS B C    1 
ATOM   8651  O O    . HIS B  1 241 ? 74.870  -11.318  4.176    1.00 168.43 ? 374 HIS B O    1 
ATOM   8652  C CB   . HIS B  1 241 ? 74.604  -11.994  6.997    1.00 177.23 ? 374 HIS B CB   1 
ATOM   8653  C CG   . HIS B  1 241 ? 75.273  -12.721  8.122    1.00 184.34 ? 374 HIS B CG   1 
ATOM   8654  N ND1  . HIS B  1 241 ? 74.612  -13.626  8.925    1.00 186.82 ? 374 HIS B ND1  1 
ATOM   8655  C CD2  . HIS B  1 241 ? 76.539  -12.653  8.597    1.00 189.98 ? 374 HIS B CD2  1 
ATOM   8656  C CE1  . HIS B  1 241 ? 75.447  -14.096  9.835    1.00 193.70 ? 374 HIS B CE1  1 
ATOM   8657  N NE2  . HIS B  1 241 ? 76.622  -13.520  9.658    1.00 195.84 ? 374 HIS B NE2  1 
ATOM   8658  H H    . HIS B  1 241 ? 75.930  -13.782  5.850    1.00 369.54 ? 374 HIS B H    1 
ATOM   8659  H HA   . HIS B  1 241 ? 73.320  -13.307  6.065    1.00 364.32 ? 374 HIS B HA   1 
ATOM   8660  H HB2  . HIS B  1 241 ? 75.230  -11.333  6.661    1.00 366.54 ? 374 HIS B HB2  1 
ATOM   8661  H HB3  . HIS B  1 241 ? 73.822  -11.548  7.358    1.00 366.54 ? 374 HIS B HB3  1 
ATOM   8662  H HD1  . HIS B  1 241 ? 73.787  -13.856  8.841    1.00 371.16 ? 374 HIS B HD1  1 
ATOM   8663  H HD2  . HIS B  1 241 ? 77.226  -12.123  8.262    1.00 378.25 ? 374 HIS B HD2  1 
ATOM   8664  H HE1  . HIS B  1 241 ? 75.241  -14.724  10.490   1.00 377.40 ? 374 HIS B HE1  1 
ATOM   8665  H HE2  . HIS B  1 241 ? 77.326  -13.666  10.131   1.00 381.77 ? 374 HIS B HE2  1 
ATOM   8666  N N    . SER B  1 242 ? 72.792  -12.164  3.978    1.00 161.22 ? 375 SER B N    1 
ATOM   8667  C CA   . SER B  1 242 ? 72.488  -11.432  2.757    1.00 156.20 ? 375 SER B CA   1 
ATOM   8668  C C    . SER B  1 242 ? 71.427  -10.383  3.033    1.00 152.68 ? 375 SER B C    1 
ATOM   8669  O O    . SER B  1 242 ? 70.515  -10.607  3.826    1.00 153.24 ? 375 SER B O    1 
ATOM   8670  C CB   . SER B  1 242 ? 72.025  -12.387  1.659    1.00 154.81 ? 375 SER B CB   1 
ATOM   8671  O OG   . SER B  1 242 ? 72.971  -13.420  1.453    1.00 160.52 ? 375 SER B OG   1 
ATOM   8672  H H    . SER B  1 242 ? 72.149  -12.663  4.257    1.00 156.37 ? 375 SER B H    1 
ATOM   8673  H HA   . SER B  1 242 ? 73.289  -10.980  2.448    1.00 149.48 ? 375 SER B HA   1 
ATOM   8674  H HB2  . SER B  1 242 ? 71.178  -12.782  1.921    1.00 149.97 ? 375 SER B HB2  1 
ATOM   8675  H HB3  . SER B  1 242 ? 71.916  -11.889  0.834    1.00 149.97 ? 375 SER B HB3  1 
ATOM   8676  H HG   . SER B  1 242 ? 72.704  -13.938  0.847    1.00 159.94 ? 375 SER B HG   1 
ATOM   8677  N N    . PHE B  1 243 ? 71.564  -9.236   2.376    1.00 146.89 ? 376 PHE B N    1 
ATOM   8678  C CA   . PHE B  1 243 ? 70.626  -8.127   2.530    1.00 143.83 ? 376 PHE B CA   1 
ATOM   8679  C C    . PHE B  1 243 ? 70.891  -7.053   1.480    1.00 140.59 ? 376 PHE B C    1 
ATOM   8680  O O    . PHE B  1 243 ? 71.930  -7.063   0.819    1.00 141.31 ? 376 PHE B O    1 
ATOM   8681  C CB   . PHE B  1 243 ? 70.728  -7.523   3.932    1.00 146.58 ? 376 PHE B CB   1 
ATOM   8682  C CG   . PHE B  1 243 ? 72.107  -7.046   4.291    1.00 150.16 ? 376 PHE B CG   1 
ATOM   8683  C CD1  . PHE B  1 243 ? 73.052  -7.927   4.789    1.00 154.85 ? 376 PHE B CD1  1 
ATOM   8684  C CD2  . PHE B  1 243 ? 72.454  -5.714   4.137    1.00 149.41 ? 376 PHE B CD2  1 
ATOM   8685  C CE1  . PHE B  1 243 ? 74.320  -7.491   5.122    1.00 158.78 ? 376 PHE B CE1  1 
ATOM   8686  C CE2  . PHE B  1 243 ? 73.720  -5.271   4.469    1.00 153.26 ? 376 PHE B CE2  1 
ATOM   8687  C CZ   . PHE B  1 243 ? 74.655  -6.161   4.962    1.00 157.98 ? 376 PHE B CZ   1 
ATOM   8688  H H    . PHE B  1 243 ? 72.204  -9.072   1.824    1.00 160.00 ? 376 PHE B H    1 
ATOM   8689  H HA   . PHE B  1 243 ? 69.722  -8.455   2.406    1.00 151.68 ? 376 PHE B HA   1 
ATOM   8690  H HB2  . PHE B  1 243 ? 70.127  -6.763   3.989    1.00 151.37 ? 376 PHE B HB2  1 
ATOM   8691  H HB3  . PHE B  1 243 ? 70.469  -8.195   4.581    1.00 151.37 ? 376 PHE B HB3  1 
ATOM   8692  H HD1  . PHE B  1 243 ? 72.832  -8.824   4.898    1.00 155.37 ? 376 PHE B HD1  1 
ATOM   8693  H HD2  . PHE B  1 243 ? 71.829  -5.111   3.805    1.00 166.28 ? 376 PHE B HD2  1 
ATOM   8694  H HE1  . PHE B  1 243 ? 74.947  -8.092   5.454    1.00 161.93 ? 376 PHE B HE1  1 
ATOM   8695  H HE2  . PHE B  1 243 ? 73.943  -4.375   4.360    1.00 172.80 ? 376 PHE B HE2  1 
ATOM   8696  H HZ   . PHE B  1 243 ? 75.508  -5.865   5.186    1.00 170.64 ? 376 PHE B HZ   1 
ATOM   8697  N N    . ASN B  1 244 ? 69.948  -6.128   1.338    1.00 146.08 ? 377 ASN B N    1 
ATOM   8698  C CA   . ASN B  1 244 ? 70.073  -5.040   0.375    1.00 143.23 ? 377 ASN B CA   1 
ATOM   8699  C C    . ASN B  1 244 ? 70.410  -3.727   1.068    1.00 144.61 ? 377 ASN B C    1 
ATOM   8700  O O    . ASN B  1 244 ? 69.709  -3.302   1.987    1.00 145.13 ? 377 ASN B O    1 
ATOM   8701  C CB   . ASN B  1 244 ? 68.782  -4.889   -0.429   1.00 139.56 ? 377 ASN B CB   1 
ATOM   8702  C CG   . ASN B  1 244 ? 68.941  -3.955   -1.612   1.00 136.87 ? 377 ASN B CG   1 
ATOM   8703  O OD1  . ASN B  1 244 ? 69.045  -2.739   -1.449   1.00 136.78 ? 377 ASN B OD1  1 
ATOM   8704  N ND2  . ASN B  1 244 ? 68.963  -4.521   -2.812   1.00 135.43 ? 377 ASN B ND2  1 
ATOM   8705  H H    . ASN B  1 244 ? 69.219  -6.108   1.793    1.00 136.98 ? 377 ASN B H    1 
ATOM   8706  H HA   . ASN B  1 244 ? 70.790  -5.246   -0.244   1.00 132.45 ? 377 ASN B HA   1 
ATOM   8707  H HB2  . ASN B  1 244 ? 68.514  -5.758   -0.766   1.00 125.59 ? 377 ASN B HB2  1 
ATOM   8708  H HB3  . ASN B  1 244 ? 68.090  -4.528   0.148    1.00 125.59 ? 377 ASN B HB3  1 
ATOM   8709  H HD21 . ASN B  1 244 ? 69.052  -4.035   -3.515   1.00 118.70 ? 377 ASN B HD21 1 
ATOM   8710  H HD22 . ASN B  1 244 ? 68.889  -5.375   -2.886   1.00 118.70 ? 377 ASN B HD22 1 
ATOM   8711  N N    . CYS B  1 245 ? 71.491  -3.093   0.623    1.00 146.04 ? 378 CYS B N    1 
ATOM   8712  C CA   . CYS B  1 245 ? 71.929  -1.818   1.180    1.00 147.86 ? 378 CYS B CA   1 
ATOM   8713  C C    . CYS B  1 245 ? 72.135  -0.772   0.089    1.00 145.89 ? 378 CYS B C    1 
ATOM   8714  O O    . CYS B  1 245 ? 73.030  -0.899   -0.747   1.00 146.29 ? 378 CYS B O    1 
ATOM   8715  C CB   . CYS B  1 245 ? 73.223  -2.003   1.973    1.00 152.82 ? 378 CYS B CB   1 
ATOM   8716  S SG   . CYS B  1 245 ? 73.937  -0.460   2.594    1.00 156.02 ? 378 CYS B SG   1 
ATOM   8717  H H    . CYS B  1 245 ? 71.994  -3.385   -0.010   1.00 172.02 ? 378 CYS B H    1 
ATOM   8718  H HA   . CYS B  1 245 ? 71.249  -1.488   1.788    1.00 173.45 ? 378 CYS B HA   1 
ATOM   8719  H HB2  . CYS B  1 245 ? 73.043  -2.573   2.736    1.00 181.36 ? 378 CYS B HB2  1 
ATOM   8720  H HB3  . CYS B  1 245 ? 73.883  -2.423   1.398    1.00 181.36 ? 378 CYS B HB3  1 
ATOM   8721  N N    . GLY B  1 246 ? 71.300  0.260    0.106    1.00 144.97 ? 379 GLY B N    1 
ATOM   8722  C CA   . GLY B  1 246 ? 71.434  1.373    -0.818   1.00 143.68 ? 379 GLY B CA   1 
ATOM   8723  C C    . GLY B  1 246 ? 71.208  1.000    -2.271   1.00 140.61 ? 379 GLY B C    1 
ATOM   8724  O O    . GLY B  1 246 ? 71.677  1.695    -3.175   1.00 141.24 ? 379 GLY B O    1 
ATOM   8725  H H    . GLY B  1 246 ? 70.639  0.338    0.650    1.00 130.41 ? 379 GLY B H    1 
ATOM   8726  H HA2  . GLY B  1 246 ? 70.794  2.062    -0.580   1.00 129.31 ? 379 GLY B HA2  1 
ATOM   8727  H HA3  . GLY B  1 246 ? 72.325  1.747    -0.737   1.00 129.31 ? 379 GLY B HA3  1 
ATOM   8728  N N    . GLY B  1 247 ? 70.487  -0.095   -2.497   1.00 140.86 ? 380 GLY B N    1 
ATOM   8729  C CA   . GLY B  1 247 ? 70.146  -0.528   -3.839   1.00 138.22 ? 380 GLY B CA   1 
ATOM   8730  C C    . GLY B  1 247 ? 71.098  -1.586   -4.357   1.00 139.41 ? 380 GLY B C    1 
ATOM   8731  O O    . GLY B  1 247 ? 70.895  -2.140   -5.439   1.00 137.82 ? 380 GLY B O    1 
ATOM   8732  H H    . GLY B  1 247 ? 70.183  -0.608   -1.878   1.00 207.64 ? 380 GLY B H    1 
ATOM   8733  H HA2  . GLY B  1 247 ? 69.247  -0.894   -3.843   1.00 205.76 ? 380 GLY B HA2  1 
ATOM   8734  H HA3  . GLY B  1 247 ? 70.172  0.231    -4.442   1.00 205.76 ? 380 GLY B HA3  1 
ATOM   8735  N N    . GLU B  1 248 ? 72.140  -1.864   -3.579   1.00 142.74 ? 381 GLU B N    1 
ATOM   8736  C CA   . GLU B  1 248 ? 73.127  -2.879   -3.928   1.00 144.79 ? 381 GLU B CA   1 
ATOM   8737  C C    . GLU B  1 248 ? 72.886  -4.156   -3.127   1.00 146.02 ? 381 GLU B C    1 
ATOM   8738  O O    . GLU B  1 248 ? 71.776  -4.390   -2.651   1.00 144.41 ? 381 GLU B O    1 
ATOM   8739  C CB   . GLU B  1 248 ? 74.534  -2.342   -3.689   1.00 148.44 ? 381 GLU B CB   1 
ATOM   8740  C CG   . GLU B  1 248 ? 74.783  -1.019   -4.390   1.00 147.81 ? 381 GLU B CG   1 
ATOM   8741  C CD   . GLU B  1 248 ? 76.250  -0.690   -4.505   1.00 151.74 ? 381 GLU B CD   1 
ATOM   8742  O OE1  . GLU B  1 248 ? 77.052  -1.300   -3.770   1.00 155.28 ? 381 GLU B OE1  1 
ATOM   8743  O OE2  . GLU B  1 248 ? 76.605  0.172    -5.335   1.00 152.43 ? 381 GLU B OE2  1 
ATOM   8744  H H    . GLU B  1 248 ? 72.300  -1.470   -2.832   1.00 287.95 ? 381 GLU B H    1 
ATOM   8745  H HA   . GLU B  1 248 ? 73.042  -3.094   -4.870   1.00 293.23 ? 381 GLU B HA   1 
ATOM   8746  H HB2  . GLU B  1 248 ? 74.664  -2.206   -2.738   1.00 298.27 ? 381 GLU B HB2  1 
ATOM   8747  H HB3  . GLU B  1 248 ? 75.179  -2.984   -4.024   1.00 298.27 ? 381 GLU B HB3  1 
ATOM   8748  H HG2  . GLU B  1 248 ? 74.413  -1.061   -5.286   1.00 298.60 ? 381 GLU B HG2  1 
ATOM   8749  H HG3  . GLU B  1 248 ? 74.354  -0.309   -3.886   1.00 298.60 ? 381 GLU B HG3  1 
ATOM   8750  N N    . PHE B  1 249 ? 73.914  -4.987   -2.985   1.00 136.78 ? 382 PHE B N    1 
ATOM   8751  C CA   . PHE B  1 249 ? 73.762  -6.282   -2.331   1.00 138.51 ? 382 PHE B CA   1 
ATOM   8752  C C    . PHE B  1 249 ? 75.016  -6.667   -1.551   1.00 143.60 ? 382 PHE B C    1 
ATOM   8753  O O    . PHE B  1 249 ? 76.085  -6.850   -2.131   1.00 145.85 ? 382 PHE B O    1 
ATOM   8754  C CB   . PHE B  1 249 ? 73.442  -7.358   -3.372   1.00 137.15 ? 382 PHE B CB   1 
ATOM   8755  C CG   . PHE B  1 249 ? 72.130  -7.152   -4.076   1.00 132.95 ? 382 PHE B CG   1 
ATOM   8756  C CD1  . PHE B  1 249 ? 72.050  -6.364   -5.214   1.00 130.49 ? 382 PHE B CD1  1 
ATOM   8757  C CD2  . PHE B  1 249 ? 70.979  -7.753   -3.603   1.00 132.34 ? 382 PHE B CD2  1 
ATOM   8758  C CE1  . PHE B  1 249 ? 70.845  -6.178   -5.860   1.00 127.21 ? 382 PHE B CE1  1 
ATOM   8759  C CE2  . PHE B  1 249 ? 69.773  -7.570   -4.247   1.00 129.38 ? 382 PHE B CE2  1 
ATOM   8760  C CZ   . PHE B  1 249 ? 69.706  -6.783   -5.376   1.00 126.81 ? 382 PHE B CZ   1 
ATOM   8761  H H    . PHE B  1 249 ? 74.712  -4.823   -3.260   1.00 181.07 ? 382 PHE B H    1 
ATOM   8762  H HA   . PHE B  1 249 ? 73.021  -6.238   -1.707   1.00 184.49 ? 382 PHE B HA   1 
ATOM   8763  H HB2  . PHE B  1 249 ? 74.142  -7.360   -4.044   1.00 189.00 ? 382 PHE B HB2  1 
ATOM   8764  H HB3  . PHE B  1 249 ? 73.409  -8.220   -2.930   1.00 189.00 ? 382 PHE B HB3  1 
ATOM   8765  H HD1  . PHE B  1 249 ? 72.816  -5.953   -5.545   1.00 189.64 ? 382 PHE B HD1  1 
ATOM   8766  H HD2  . PHE B  1 249 ? 71.018  -8.285   -2.842   1.00 178.62 ? 382 PHE B HD2  1 
ATOM   8767  H HE1  . PHE B  1 249 ? 70.802  -5.646   -6.622   1.00 187.27 ? 382 PHE B HE1  1 
ATOM   8768  H HE2  . PHE B  1 249 ? 69.005  -7.979   -3.918   1.00 175.93 ? 382 PHE B HE2  1 
ATOM   8769  H HZ   . PHE B  1 249 ? 68.893  -6.659   -5.809   1.00 180.21 ? 382 PHE B HZ   1 
ATOM   8770  N N    . PHE B  1 250 ? 74.873  -6.792   -0.236   1.00 149.99 ? 383 PHE B N    1 
ATOM   8771  C CA   . PHE B  1 250 ? 75.985  -7.147   0.644    1.00 155.47 ? 383 PHE B CA   1 
ATOM   8772  C C    . PHE B  1 250 ? 75.935  -8.621   1.057    1.00 157.98 ? 383 PHE B C    1 
ATOM   8773  O O    . PHE B  1 250 ? 74.856  -9.172   1.282    1.00 156.04 ? 383 PHE B O    1 
ATOM   8774  C CB   . PHE B  1 250 ? 75.972  -6.252   1.885    1.00 157.42 ? 383 PHE B CB   1 
ATOM   8775  C CG   . PHE B  1 250 ? 76.588  -4.899   1.665    1.00 157.69 ? 383 PHE B CG   1 
ATOM   8776  C CD1  . PHE B  1 250 ? 76.065  -4.029   0.722    1.00 153.33 ? 383 PHE B CD1  1 
ATOM   8777  C CD2  . PHE B  1 250 ? 77.684  -4.494   2.408    1.00 162.93 ? 383 PHE B CD2  1 
ATOM   8778  C CE1  . PHE B  1 250 ? 76.630  -2.783   0.519    1.00 154.07 ? 383 PHE B CE1  1 
ATOM   8779  C CE2  . PHE B  1 250 ? 78.252  -3.249   2.211    1.00 163.75 ? 383 PHE B CE2  1 
ATOM   8780  C CZ   . PHE B  1 250 ? 77.725  -2.393   1.266    1.00 159.27 ? 383 PHE B CZ   1 
ATOM   8781  H H    . PHE B  1 250 ? 74.129  -6.674   0.180    1.00 182.30 ? 383 PHE B H    1 
ATOM   8782  H HA   . PHE B  1 250 ? 76.820  -6.997   0.174    1.00 188.84 ? 383 PHE B HA   1 
ATOM   8783  H HB2  . PHE B  1 250 ? 75.053  -6.118   2.164    1.00 187.11 ? 383 PHE B HB2  1 
ATOM   8784  H HB3  . PHE B  1 250 ? 76.469  -6.692   2.593    1.00 187.11 ? 383 PHE B HB3  1 
ATOM   8785  H HD1  . PHE B  1 250 ? 75.329  -4.287   0.216    1.00 189.52 ? 383 PHE B HD1  1 
ATOM   8786  H HD2  . PHE B  1 250 ? 78.043  -5.067   3.045    1.00 178.45 ? 383 PHE B HD2  1 
ATOM   8787  H HE1  . PHE B  1 250 ? 76.272  -2.207   -0.118   1.00 188.40 ? 383 PHE B HE1  1 
ATOM   8788  H HE2  . PHE B  1 250 ? 78.989  -2.989   2.715    1.00 177.63 ? 383 PHE B HE2  1 
ATOM   8789  H HZ   . PHE B  1 250 ? 78.105  -1.555   1.132    1.00 182.73 ? 383 PHE B HZ   1 
ATOM   8790  N N    . TYR B  1 251 ? 77.107  -9.247   1.148    1.00 156.72 ? 384 TYR B N    1 
ATOM   8791  C CA   . TYR B  1 251 ? 77.227  -10.653  1.541    1.00 160.15 ? 384 TYR B CA   1 
ATOM   8792  C C    . TYR B  1 251 ? 78.287  -10.831  2.628    1.00 166.73 ? 384 TYR B C    1 
ATOM   8793  O O    . TYR B  1 251 ? 79.481  -10.818  2.331    1.00 170.26 ? 384 TYR B O    1 
ATOM   8794  C CB   . TYR B  1 251 ? 77.592  -11.520  0.333    1.00 160.08 ? 384 TYR B CB   1 
ATOM   8795  C CG   . TYR B  1 251 ? 76.497  -11.677  -0.695   1.00 154.95 ? 384 TYR B CG   1 
ATOM   8796  C CD1  . TYR B  1 251 ? 75.450  -12.565  -0.491   1.00 154.38 ? 384 TYR B CD1  1 
ATOM   8797  C CD2  . TYR B  1 251 ? 76.522  -10.955  -1.881   1.00 151.53 ? 384 TYR B CD2  1 
ATOM   8798  C CE1  . TYR B  1 251 ? 74.452  -12.719  -1.431   1.00 153.56 ? 384 TYR B CE1  1 
ATOM   8799  C CE2  . TYR B  1 251 ? 75.528  -11.102  -2.828   1.00 147.78 ? 384 TYR B CE2  1 
ATOM   8800  C CZ   . TYR B  1 251 ? 74.496  -11.986  -2.599   1.00 149.63 ? 384 TYR B CZ   1 
ATOM   8801  O OH   . TYR B  1 251 ? 73.506  -12.133  -3.543   1.00 149.55 ? 384 TYR B OH   1 
ATOM   8802  H H    . TYR B  1 251 ? 77.863  -8.872   0.984    1.00 219.20 ? 384 TYR B H    1 
ATOM   8803  H HA   . TYR B  1 251 ? 76.377  -10.961  1.892    1.00 228.06 ? 384 TYR B HA   1 
ATOM   8804  H HB2  . TYR B  1 251 ? 78.356  -11.122  -0.112   1.00 231.85 ? 384 TYR B HB2  1 
ATOM   8805  H HB3  . TYR B  1 251 ? 77.826  -12.406  0.649    1.00 231.85 ? 384 TYR B HB3  1 
ATOM   8806  H HD1  . TYR B  1 251 ? 75.417  -13.061  0.296    1.00 226.73 ? 384 TYR B HD1  1 
ATOM   8807  H HD2  . TYR B  1 251 ? 77.218  -10.358  -2.037   1.00 221.34 ? 384 TYR B HD2  1 
ATOM   8808  H HE1  . TYR B  1 251 ? 73.755  -13.315  -1.279   1.00 222.27 ? 384 TYR B HE1  1 
ATOM   8809  H HE2  . TYR B  1 251 ? 75.556  -10.609  -3.616   1.00 217.29 ? 384 TYR B HE2  1 
ATOM   8810  H HH   . TYR B  1 251 ? 72.942  -12.698  -3.282   1.00 214.24 ? 384 TYR B HH   1 
ATOM   8811  N N    . CYS B  1 252 ? 77.854  -11.023  3.873    1.00 178.92 ? 385 CYS B N    1 
ATOM   8812  C CA   . CYS B  1 252 ? 78.776  -11.099  5.011    1.00 185.61 ? 385 CYS B CA   1 
ATOM   8813  C C    . CYS B  1 252 ? 79.077  -12.532  5.462    1.00 190.65 ? 385 CYS B C    1 
ATOM   8814  O O    . CYS B  1 252 ? 78.168  -13.333  5.679    1.00 189.55 ? 385 CYS B O    1 
ATOM   8815  C CB   . CYS B  1 252 ? 78.215  -10.304  6.192    1.00 186.01 ? 385 CYS B CB   1 
ATOM   8816  S SG   . CYS B  1 252 ? 78.613  -8.535   6.155    1.00 184.95 ? 385 CYS B SG   1 
ATOM   8817  H H    . CYS B  1 252 ? 77.026  -11.112  4.088    1.00 255.90 ? 385 CYS B H    1 
ATOM   8818  H HA   . CYS B  1 252 ? 79.617  -10.690  4.754    1.00 263.74 ? 385 CYS B HA   1 
ATOM   8819  H HB2  . CYS B  1 252 ? 77.249  -10.389  6.194    1.00 261.69 ? 385 CYS B HB2  1 
ATOM   8820  H HB3  . CYS B  1 252 ? 78.577  -10.671  7.014    1.00 261.69 ? 385 CYS B HB3  1 
ATOM   8821  N N    . ASN B  1 253 ? 80.366  -12.831  5.618    1.00 192.04 ? 386 ASN B N    1 
ATOM   8822  C CA   . ASN B  1 253 ? 80.837  -14.148  6.057    1.00 198.04 ? 386 ASN B CA   1 
ATOM   8823  C C    . ASN B  1 253 ? 80.591  -14.378  7.548    1.00 202.61 ? 386 ASN B C    1 
ATOM   8824  O O    . ASN B  1 253 ? 80.910  -13.519  8.372    1.00 205.15 ? 386 ASN B O    1 
ATOM   8825  C CB   . ASN B  1 253 ? 82.330  -14.290  5.744    1.00 203.71 ? 386 ASN B CB   1 
ATOM   8826  C CG   . ASN B  1 253 ? 82.884  -15.659  6.104    1.00 210.46 ? 386 ASN B CG   1 
ATOM   8827  O OD1  . ASN B  1 253 ? 82.149  -16.645  6.169    1.00 209.79 ? 386 ASN B OD1  1 
ATOM   8828  N ND2  . ASN B  1 253 ? 84.192  -15.724  6.333    1.00 217.47 ? 386 ASN B ND2  1 
ATOM   8829  H H    . ASN B  1 253 ? 81.004  -12.274  5.472    1.00 353.29 ? 386 ASN B H    1 
ATOM   8830  H HA   . ASN B  1 253 ? 80.360  -14.834  5.564    1.00 361.51 ? 386 ASN B HA   1 
ATOM   8831  H HB2  . ASN B  1 253 ? 82.468  -14.152  4.794    1.00 365.69 ? 386 ASN B HB2  1 
ATOM   8832  H HB3  . ASN B  1 253 ? 82.822  -13.625  6.251    1.00 365.69 ? 386 ASN B HB3  1 
ATOM   8833  H HD22 . ASN B  1 253 ? 84.675  -15.015  6.274    1.00 376.60 ? 386 ASN B HD22 1 
ATOM   8834  N N    . THR B  1 254 ? 80.047  -15.545  7.891    1.00 196.15 ? 387 THR B N    1 
ATOM   8835  C CA   . THR B  1 254 ? 79.558  -15.801  9.247    1.00 199.77 ? 387 THR B CA   1 
ATOM   8836  C C    . THR B  1 254 ? 80.333  -16.861  10.027   1.00 208.58 ? 387 THR B C    1 
ATOM   8837  O O    . THR B  1 254 ? 79.864  -17.317  11.071   1.00 212.00 ? 387 THR B O    1 
ATOM   8838  C CB   . THR B  1 254 ? 78.088  -16.259  9.235    1.00 195.07 ? 387 THR B CB   1 
ATOM   8839  O OG1  . THR B  1 254 ? 78.020  -17.661  9.518    1.00 199.40 ? 387 THR B OG1  1 
ATOM   8840  C CG2  . THR B  1 254 ? 77.427  -15.987  7.893    1.00 187.21 ? 387 THR B CG2  1 
ATOM   8841  H H    . THR B  1 254 ? 79.948  -16.209  7.354    1.00 326.59 ? 387 THR B H    1 
ATOM   8842  H HA   . THR B  1 254 ? 79.605  -14.974  9.752    1.00 329.99 ? 387 THR B HA   1 
ATOM   8843  H HB   . THR B  1 254 ? 77.598  -15.773  9.917    1.00 321.80 ? 387 THR B HB   1 
ATOM   8844  H HG1  . THR B  1 254 ? 77.219  -17.916  9.513    1.00 323.16 ? 387 THR B HG1  1 
ATOM   8845  H HG21 . THR B  1 254 ? 76.504  -16.284  7.912    1.00 308.17 ? 387 THR B HG21 1 
ATOM   8846  H HG22 . THR B  1 254 ? 77.448  -15.037  7.700    1.00 308.17 ? 387 THR B HG22 1 
ATOM   8847  H HG23 . THR B  1 254 ? 77.897  -16.462  7.190    1.00 308.17 ? 387 THR B HG23 1 
ATOM   8848  N N    . SER B  1 255 ? 81.499  -17.264  9.537    1.00 205.21 ? 388 SER B N    1 
ATOM   8849  C CA   . SER B  1 255 ? 82.273  -18.284  10.237   1.00 214.19 ? 388 SER B CA   1 
ATOM   8850  C C    . SER B  1 255 ? 82.667  -17.793  11.628   1.00 220.46 ? 388 SER B C    1 
ATOM   8851  O O    . SER B  1 255 ? 82.724  -18.573  12.580   1.00 227.03 ? 388 SER B O    1 
ATOM   8852  C CB   . SER B  1 255 ? 83.525  -18.670  9.440    1.00 217.91 ? 388 SER B CB   1 
ATOM   8853  O OG   . SER B  1 255 ? 84.395  -17.564  9.271    1.00 218.42 ? 388 SER B OG   1 
ATOM   8854  H HA   . SER B  1 255 ? 81.727  -19.078  10.342   1.00 262.28 ? 388 SER B HA   1 
ATOM   8855  H HB2  . SER B  1 255 ? 83.996  -19.370  9.916    1.00 268.08 ? 388 SER B HB2  1 
ATOM   8856  H HB3  . SER B  1 255 ? 83.253  -18.991  8.566    1.00 268.08 ? 388 SER B HB3  1 
ATOM   8857  H HG   . SER B  1 255 ? 84.001  -16.948  8.858    1.00 267.37 ? 388 SER B HG   1 
ATOM   8858  N N    . GLY B  1 256 ? 82.923  -16.492  11.736   1.00 207.38 ? 389 GLY B N    1 
ATOM   8859  C CA   . GLY B  1 256 ? 83.355  -15.894  12.986   1.00 213.51 ? 389 GLY B CA   1 
ATOM   8860  C C    . GLY B  1 256 ? 82.216  -15.559  13.930   1.00 211.68 ? 389 GLY B C    1 
ATOM   8861  O O    . GLY B  1 256 ? 82.429  -15.383  15.130   1.00 217.99 ? 389 GLY B O    1 
ATOM   8862  H H    . GLY B  1 256 ? 82.851  -15.930  11.089   1.00 223.60 ? 389 GLY B H    1 
ATOM   8863  H HA2  . GLY B  1 256 ? 83.954  -16.506  13.441   1.00 234.19 ? 389 GLY B HA2  1 
ATOM   8864  H HA3  . GLY B  1 256 ? 83.842  -15.077  12.797   1.00 234.19 ? 389 GLY B HA3  1 
ATOM   8865  N N    . LEU B  1 257 ? 81.003  -15.466  13.395   1.00 207.40 ? 390 LEU B N    1 
ATOM   8866  C CA   . LEU B  1 257 ? 79.851  -15.091  14.203   1.00 205.29 ? 390 LEU B CA   1 
ATOM   8867  C C    . LEU B  1 257 ? 79.317  -16.282  14.995   1.00 209.55 ? 390 LEU B C    1 
ATOM   8868  O O    . LEU B  1 257 ? 78.745  -16.114  16.072   1.00 212.01 ? 390 LEU B O    1 
ATOM   8869  C CB   . LEU B  1 257 ? 78.745  -14.508  13.318   1.00 195.44 ? 390 LEU B CB   1 
ATOM   8870  C CG   . LEU B  1 257 ? 77.835  -13.477  13.989   1.00 192.77 ? 390 LEU B CG   1 
ATOM   8871  C CD1  . LEU B  1 257 ? 78.611  -12.207  14.315   1.00 194.92 ? 390 LEU B CD1  1 
ATOM   8872  C CD2  . LEU B  1 257 ? 76.633  -13.161  13.112   1.00 183.77 ? 390 LEU B CD2  1 
ATOM   8873  H H    . LEU B  1 257 ? 80.822  -15.615  12.567   1.00 315.43 ? 390 LEU B H    1 
ATOM   8874  H HA   . LEU B  1 257 ? 80.120  -14.407  14.836   1.00 312.63 ? 390 LEU B HA   1 
ATOM   8875  H HB2  . LEU B  1 257 ? 79.159  -14.076  12.555   1.00 295.87 ? 390 LEU B HB2  1 
ATOM   8876  H HB3  . LEU B  1 257 ? 78.182  -15.236  13.011   1.00 295.87 ? 390 LEU B HB3  1 
ATOM   8877  H HG   . LEU B  1 257 ? 77.505  -13.846  14.823   1.00 291.20 ? 390 LEU B HG   1 
ATOM   8878  H HD11 . LEU B  1 257 ? 78.012  -11.572  14.739   1.00 295.94 ? 390 LEU B HD11 1 
ATOM   8879  H HD12 . LEU B  1 257 ? 79.339  -12.428  14.917   1.00 295.94 ? 390 LEU B HD12 1 
ATOM   8880  H HD13 . LEU B  1 257 ? 78.962  -11.833  13.492   1.00 295.94 ? 390 LEU B HD13 1 
ATOM   8881  H HD21 . LEU B  1 257 ? 76.076  -12.507  13.563   1.00 274.92 ? 390 LEU B HD21 1 
ATOM   8882  H HD22 . LEU B  1 257 ? 76.945  -12.803  12.266   1.00 274.92 ? 390 LEU B HD22 1 
ATOM   8883  H HD23 . LEU B  1 257 ? 76.130  -13.977  12.961   1.00 274.92 ? 390 LEU B HD23 1 
ATOM   8884  N N    . PHE B  1 258 ? 79.518  -17.483  14.459   1.00 202.79 ? 391 PHE B N    1 
ATOM   8885  C CA   . PHE B  1 258 ? 79.024  -18.707  15.081   1.00 206.98 ? 391 PHE B CA   1 
ATOM   8886  C C    . PHE B  1 258 ? 80.182  -19.600  15.517   1.00 216.55 ? 391 PHE B C    1 
ATOM   8887  O O    . PHE B  1 258 ? 80.164  -20.810  15.301   1.00 219.08 ? 391 PHE B O    1 
ATOM   8888  C CB   . PHE B  1 258 ? 78.105  -19.456  14.113   1.00 200.87 ? 391 PHE B CB   1 
ATOM   8889  C CG   . PHE B  1 258 ? 76.896  -18.665  13.689   1.00 192.08 ? 391 PHE B CG   1 
ATOM   8890  C CD1  . PHE B  1 258 ? 76.966  -17.775  12.628   1.00 185.28 ? 391 PHE B CD1  1 
ATOM   8891  C CD2  . PHE B  1 258 ? 75.690  -18.813  14.351   1.00 191.10 ? 391 PHE B CD2  1 
ATOM   8892  C CE1  . PHE B  1 258 ? 75.855  -17.048  12.239   1.00 177.78 ? 391 PHE B CE1  1 
ATOM   8893  C CE2  . PHE B  1 258 ? 74.578  -18.088  13.965   1.00 183.59 ? 391 PHE B CE2  1 
ATOM   8894  C CZ   . PHE B  1 258 ? 74.662  -17.206  12.908   1.00 176.97 ? 391 PHE B CZ   1 
ATOM   8895  H H    . PHE B  1 258 ? 79.944  -17.616  13.724   1.00 278.74 ? 391 PHE B H    1 
ATOM   8896  H HA   . PHE B  1 258 ? 78.508  -18.476  15.869   1.00 282.67 ? 391 PHE B HA   1 
ATOM   8897  H HB2  . PHE B  1 258 ? 78.608  -19.681  13.315   1.00 270.70 ? 391 PHE B HB2  1 
ATOM   8898  H HB3  . PHE B  1 258 ? 77.793  -20.268  14.544   1.00 270.70 ? 391 PHE B HB3  1 
ATOM   8899  H HD1  . PHE B  1 258 ? 77.770  -17.665  12.173   1.00 246.93 ? 391 PHE B HD1  1 
ATOM   8900  H HD2  . PHE B  1 258 ? 75.627  -19.406  15.064   1.00 248.96 ? 391 PHE B HD2  1 
ATOM   8901  H HE1  . PHE B  1 258 ? 75.914  -16.453  11.526   1.00 234.24 ? 391 PHE B HE1  1 
ATOM   8902  H HE2  . PHE B  1 258 ? 73.772  -18.196  14.418   1.00 236.89 ? 391 PHE B HE2  1 
ATOM   8903  H HZ   . PHE B  1 258 ? 73.914  -16.718  12.648   1.00 230.42 ? 391 PHE B HZ   1 
ATOM   8904  N N    . ASN B  1 259 ? 81.193  -18.988  16.126   1.00 211.33 ? 392 ASN B N    1 
ATOM   8905  C CA   . ASN B  1 259 ? 82.341  -19.721  16.643   1.00 221.42 ? 392 ASN B CA   1 
ATOM   8906  C C    . ASN B  1 259 ? 81.936  -20.602  17.822   1.00 228.33 ? 392 ASN B C    1 
ATOM   8907  O O    . ASN B  1 259 ? 82.097  -20.223  18.983   1.00 234.21 ? 392 ASN B O    1 
ATOM   8908  C CB   . ASN B  1 259 ? 83.448  -18.744  17.052   1.00 226.08 ? 392 ASN B CB   1 
ATOM   8909  C CG   . ASN B  1 259 ? 84.763  -19.436  17.354   1.00 236.35 ? 392 ASN B CG   1 
ATOM   8910  O OD1  . ASN B  1 259 ? 84.794  -20.530  17.917   1.00 242.85 ? 392 ASN B OD1  1 
ATOM   8911  N ND2  . ASN B  1 259 ? 85.863  -18.796  16.977   1.00 238.31 ? 392 ASN B ND2  1 
ATOM   8912  H H    . ASN B  1 259 ? 81.236  -18.138  16.254   1.00 369.63 ? 392 ASN B H    1 
ATOM   8913  H HA   . ASN B  1 259 ? 82.691  -20.296  15.944   1.00 371.57 ? 392 ASN B HA   1 
ATOM   8914  H HB2  . ASN B  1 259 ? 83.599  -18.116  16.328   1.00 373.05 ? 392 ASN B HB2  1 
ATOM   8915  H HB3  . ASN B  1 259 ? 83.170  -18.268  17.851   1.00 373.05 ? 392 ASN B HB3  1 
ATOM   8916  H HD21 . ASN B  1 259 ? 86.635  -19.144  17.125   1.00 375.31 ? 392 ASN B HD21 1 
ATOM   8917  H HD22 . ASN B  1 259 ? 85.803  -18.032  16.585   1.00 375.31 ? 392 ASN B HD22 1 
ATOM   8918  N N    . GLY B  1 265 ? 81.764  -13.089  28.218   1.00 272.74 ? 405 GLY B N    1 
ATOM   8919  C CA   . GLY B  1 265 ? 83.075  -13.203  27.608   1.00 275.27 ? 405 GLY B CA   1 
ATOM   8920  C C    . GLY B  1 265 ? 84.189  -13.151  28.635   1.00 282.75 ? 405 GLY B C    1 
ATOM   8921  O O    . GLY B  1 265 ? 84.101  -12.416  29.619   1.00 284.96 ? 405 GLY B O    1 
ATOM   8922  H HA2  . GLY B  1 265 ? 83.137  -14.044  27.128   1.00 318.25 ? 405 GLY B HA2  1 
ATOM   8923  H HA3  . GLY B  1 265 ? 83.204  -12.478  26.976   1.00 318.25 ? 405 GLY B HA3  1 
ATOM   8924  N N    . THR B  1 266 ? 85.238  -13.937  28.406   1.00 284.74 ? 406 THR B N    1 
ATOM   8925  C CA   . THR B  1 266 ? 86.397  -13.964  29.295   1.00 289.76 ? 406 THR B CA   1 
ATOM   8926  C C    . THR B  1 266 ? 87.678  -14.202  28.507   1.00 290.70 ? 406 THR B C    1 
ATOM   8927  O O    . THR B  1 266 ? 88.670  -13.495  28.687   1.00 293.18 ? 406 THR B O    1 
ATOM   8928  C CB   . THR B  1 266 ? 86.268  -15.061  30.371   1.00 293.14 ? 406 THR B CB   1 
ATOM   8929  O OG1  . THR B  1 266 ? 85.058  -14.869  31.114   1.00 292.46 ? 406 THR B OG1  1 
ATOM   8930  C CG2  . THR B  1 266 ? 87.459  -15.026  31.329   1.00 298.73 ? 406 THR B CG2  1 
ATOM   8931  H H    . THR B  1 266 ? 85.303  -14.471  27.735   1.00 319.02 ? 406 THR B H    1 
ATOM   8932  H HA   . THR B  1 266 ? 86.473  -13.108  29.744   1.00 318.17 ? 406 THR B HA   1 
ATOM   8933  H HB   . THR B  1 266 ? 86.247  -15.930  29.942   1.00 316.46 ? 406 THR B HB   1 
ATOM   8934  H HG1  . THR B  1 266 ? 84.984  -15.464  31.701   1.00 315.47 ? 406 THR B HG1  1 
ATOM   8935  H HG21 . THR B  1 266 ? 87.365  -15.721  32.000   1.00 315.68 ? 406 THR B HG21 1 
ATOM   8936  H HG22 . THR B  1 266 ? 88.283  -15.172  30.839   1.00 315.68 ? 406 THR B HG22 1 
ATOM   8937  H HG23 . THR B  1 266 ? 87.504  -14.164  31.772   1.00 315.68 ? 406 THR B HG23 1 
ATOM   8938  N N    . ALA B  1 267 ? 87.650  -15.207  27.639   1.00 288.96 ? 407 ALA B N    1 
ATOM   8939  C CA   . ALA B  1 267 ? 88.820  -15.576  26.851   1.00 290.01 ? 407 ALA B CA   1 
ATOM   8940  C C    . ALA B  1 267 ? 89.254  -14.437  25.933   1.00 287.91 ? 407 ALA B C    1 
ATOM   8941  O O    . ALA B  1 267 ? 88.511  -13.477  25.725   1.00 284.93 ? 407 ALA B O    1 
ATOM   8942  C CB   . ALA B  1 267 ? 88.529  -16.826  26.037   1.00 288.25 ? 407 ALA B CB   1 
ATOM   8943  H H    . ALA B  1 267 ? 86.959  -15.695  27.486   1.00 317.87 ? 407 ALA B H    1 
ATOM   8944  H HA   . ALA B  1 267 ? 89.556  -15.773  27.452   1.00 319.00 ? 407 ALA B HA   1 
ATOM   8945  H HB1  . ALA B  1 267 ? 89.317  -17.056  25.521   1.00 320.11 ? 407 ALA B HB1  1 
ATOM   8946  H HB2  . ALA B  1 267 ? 88.306  -17.551  26.642   1.00 320.11 ? 407 ALA B HB2  1 
ATOM   8947  H HB3  . ALA B  1 267 ? 87.783  -16.649  25.443   1.00 320.11 ? 407 ALA B HB3  1 
ATOM   8948  N N    . SER B  1 268 ? 90.459  -14.554  25.384   1.00 289.68 ? 408 SER B N    1 
ATOM   8949  C CA   . SER B  1 268 ? 90.979  -13.564  24.446   1.00 287.99 ? 408 SER B CA   1 
ATOM   8950  C C    . SER B  1 268 ? 90.135  -13.537  23.174   1.00 282.80 ? 408 SER B C    1 
ATOM   8951  O O    . SER B  1 268 ? 89.208  -14.332  23.023   1.00 280.75 ? 408 SER B O    1 
ATOM   8952  C CB   . SER B  1 268 ? 92.440  -13.864  24.102   1.00 291.28 ? 408 SER B CB   1 
ATOM   8953  O OG   . SER B  1 268 ? 92.570  -15.135  23.490   1.00 291.21 ? 408 SER B OG   1 
ATOM   8954  H H    . SER B  1 268 ? 91.001  -15.204  25.540   1.00 341.45 ? 408 SER B H    1 
ATOM   8955  H HA   . SER B  1 268 ? 90.939  -12.686  24.855   1.00 342.48 ? 408 SER B HA   1 
ATOM   8956  H HB2  . SER B  1 268 ? 92.765  -13.185  23.490   1.00 343.02 ? 408 SER B HB2  1 
ATOM   8957  H HB3  . SER B  1 268 ? 92.965  -13.852  24.918   1.00 343.02 ? 408 SER B HB3  1 
ATOM   8958  H HG   . SER B  1 268 ? 92.292  -15.734  24.010   1.00 343.88 ? 408 SER B HG   1 
ATOM   8959  N N    . ILE B  1 269 ? 90.450  -12.605  22.277   1.00 291.09 ? 409 ILE B N    1 
ATOM   8960  C CA   . ILE B  1 269 ? 89.740  -12.436  21.004   1.00 278.52 ? 409 ILE B CA   1 
ATOM   8961  C C    . ILE B  1 269 ? 88.334  -11.851  21.191   1.00 270.15 ? 409 ILE B C    1 
ATOM   8962  O O    . ILE B  1 269 ? 87.891  -11.025  20.391   1.00 261.34 ? 409 ILE B O    1 
ATOM   8963  C CB   . ILE B  1 269 ? 89.632  -13.775  20.218   1.00 275.88 ? 409 ILE B CB   1 
ATOM   8964  C CG1  . ILE B  1 269 ? 91.019  -14.417  20.077   1.00 285.04 ? 409 ILE B CG1  1 
ATOM   8965  C CG2  . ILE B  1 269 ? 88.998  -13.543  18.850   1.00 263.65 ? 409 ILE B CG2  1 
ATOM   8966  C CD1  . ILE B  1 269 ? 91.023  -15.773  19.394   1.00 284.24 ? 409 ILE B CD1  1 
ATOM   8967  H H    . ILE B  1 269 ? 91.090  -12.041  22.384   1.00 327.56 ? 409 ILE B H    1 
ATOM   8968  H HA   . ILE B  1 269 ? 90.242  -11.815  20.453   1.00 328.85 ? 409 ILE B HA   1 
ATOM   8969  H HB   . ILE B  1 269 ? 89.064  -14.380  20.721   1.00 329.90 ? 409 ILE B HB   1 
ATOM   8970  H HG12 . ILE B  1 269 ? 91.583  -13.825  19.556   1.00 330.39 ? 409 ILE B HG12 1 
ATOM   8971  H HG13 . ILE B  1 269 ? 91.398  -14.533  20.962   1.00 330.39 ? 409 ILE B HG13 1 
ATOM   8972  H HG21 . ILE B  1 269 ? 88.941  -14.390  18.381   1.00 331.15 ? 409 ILE B HG21 1 
ATOM   8973  H HG22 . ILE B  1 269 ? 88.110  -13.173  18.973   1.00 331.15 ? 409 ILE B HG22 1 
ATOM   8974  H HG23 . ILE B  1 269 ? 89.549  -12.922  18.348   1.00 331.15 ? 409 ILE B HG23 1 
ATOM   8975  H HD11 . ILE B  1 269 ? 91.935  -16.100  19.349   1.00 331.21 ? 409 ILE B HD11 1 
ATOM   8976  H HD12 . ILE B  1 269 ? 90.476  -16.387  19.909   1.00 331.21 ? 409 ILE B HD12 1 
ATOM   8977  H HD13 . ILE B  1 269 ? 90.661  -15.677  18.500   1.00 331.21 ? 409 ILE B HD13 1 
ATOM   8978  N N    . GLU B  1 270 ? 87.638  -12.273  22.241   1.00 270.28 ? 410 GLU B N    1 
ATOM   8979  C CA   . GLU B  1 270 ? 86.286  -11.799  22.514   1.00 263.46 ? 410 GLU B CA   1 
ATOM   8980  C C    . GLU B  1 270 ? 86.300  -10.369  23.057   1.00 264.52 ? 410 GLU B C    1 
ATOM   8981  O O    . GLU B  1 270 ? 85.341  -9.618   22.871   1.00 256.98 ? 410 GLU B O    1 
ATOM   8982  C CB   . GLU B  1 270 ? 85.588  -12.738  23.502   1.00 267.60 ? 410 GLU B CB   1 
ATOM   8983  C CG   . GLU B  1 270 ? 85.624  -14.206  23.084   1.00 268.16 ? 410 GLU B CG   1 
ATOM   8984  C CD   . GLU B  1 270 ? 85.054  -15.135  24.139   1.00 273.86 ? 410 GLU B CD   1 
ATOM   8985  O OE1  . GLU B  1 270 ? 84.736  -14.657  25.247   1.00 278.32 ? 410 GLU B OE1  1 
ATOM   8986  O OE2  . GLU B  1 270 ? 84.926  -16.344  23.859   1.00 274.27 ? 410 GLU B OE2  1 
ATOM   8987  H H    . GLU B  1 270 ? 87.931  -12.840  22.818   1.00 396.38 ? 410 GLU B H    1 
ATOM   8988  H HA   . GLU B  1 270 ? 85.778  -11.801  21.688   1.00 396.23 ? 410 GLU B HA   1 
ATOM   8989  H HB2  . GLU B  1 270 ? 86.025  -12.665  24.365   1.00 395.30 ? 410 GLU B HB2  1 
ATOM   8990  H HB3  . GLU B  1 270 ? 84.658  -12.475  23.581   1.00 395.30 ? 410 GLU B HB3  1 
ATOM   8991  H HG2  . GLU B  1 270 ? 85.101  -14.316  22.274   1.00 396.17 ? 410 GLU B HG2  1 
ATOM   8992  H HG3  . GLU B  1 270 ? 86.544  -14.465  22.922   1.00 396.17 ? 410 GLU B HG3  1 
ATOM   8993  N N    . ASN B  1 271 ? 87.387  -10.000  23.731   1.00 267.01 ? 411 ASN B N    1 
ATOM   8994  C CA   . ASN B  1 271 ? 87.560  -8.633   24.216   1.00 269.19 ? 411 ASN B CA   1 
ATOM   8995  C C    . ASN B  1 271 ? 88.089  -7.748   23.094   1.00 263.90 ? 411 ASN B C    1 
ATOM   8996  O O    . ASN B  1 271 ? 89.278  -7.430   23.041   1.00 270.23 ? 411 ASN B O    1 
ATOM   8997  C CB   . ASN B  1 271 ? 88.506  -8.593   25.420   1.00 281.86 ? 411 ASN B CB   1 
ATOM   8998  C CG   . ASN B  1 271 ? 88.523  -7.235   26.109   1.00 283.41 ? 411 ASN B CG   1 
ATOM   8999  O OD1  . ASN B  1 271 ? 87.986  -6.255   25.593   1.00 278.09 ? 411 ASN B OD1  1 
ATOM   9000  N ND2  . ASN B  1 271 ? 89.146  -7.174   27.280   1.00 288.08 ? 411 ASN B ND2  1 
ATOM   9001  H H    . ASN B  1 271 ? 88.041  -10.524  23.922   1.00 271.56 ? 411 ASN B H    1 
ATOM   9002  H HA   . ASN B  1 271 ? 86.700  -8.284   24.496   1.00 270.64 ? 411 ASN B HA   1 
ATOM   9003  H HB2  . ASN B  1 271 ? 88.221  -9.255   26.069   1.00 272.31 ? 411 ASN B HB2  1 
ATOM   9004  H HB3  . ASN B  1 271 ? 89.408  -8.789   25.121   1.00 272.31 ? 411 ASN B HB3  1 
ATOM   9005  H HD21 . ASN B  1 271 ? 89.183  -6.429   27.709   1.00 273.57 ? 411 ASN B HD21 1 
ATOM   9006  H HD22 . ASN B  1 271 ? 89.512  -7.878   27.610   1.00 273.57 ? 411 ASN B HD22 1 
ATOM   9007  N N    . GLY B  1 272 ? 87.192  -7.355   22.198   1.00 259.67 ? 412 GLY B N    1 
ATOM   9008  C CA   . GLY B  1 272 ? 87.557  -6.546   21.051   1.00 253.88 ? 412 GLY B CA   1 
ATOM   9009  C C    . GLY B  1 272 ? 86.377  -6.383   20.114   1.00 241.63 ? 412 GLY B C    1 
ATOM   9010  O O    . GLY B  1 272 ? 85.234  -6.280   20.561   1.00 238.04 ? 412 GLY B O    1 
ATOM   9011  H H    . GLY B  1 272 ? 86.355  -7.549   22.235   1.00 348.66 ? 412 GLY B H    1 
ATOM   9012  H HA2  . GLY B  1 272 ? 87.846  -5.669   21.346   1.00 349.37 ? 412 GLY B HA2  1 
ATOM   9013  H HA3  . GLY B  1 272 ? 88.284  -6.970   20.568   1.00 349.37 ? 412 GLY B HA3  1 
ATOM   9014  N N    . THR B  1 273 ? 86.657  -6.366   18.815   1.00 239.09 ? 413 THR B N    1 
ATOM   9015  C CA   . THR B  1 273 ? 85.622  -6.217   17.796   1.00 227.81 ? 413 THR B CA   1 
ATOM   9016  C C    . THR B  1 273 ? 85.581  -7.430   16.878   1.00 223.97 ? 413 THR B C    1 
ATOM   9017  O O    . THR B  1 273 ? 86.621  -7.988   16.523   1.00 228.28 ? 413 THR B O    1 
ATOM   9018  C CB   . THR B  1 273 ? 85.852  -4.952   16.942   1.00 223.39 ? 413 THR B CB   1 
ATOM   9019  O OG1  . THR B  1 273 ? 85.736  -3.787   17.769   1.00 226.42 ? 413 THR B OG1  1 
ATOM   9020  C CG2  . THR B  1 273 ? 84.837  -4.857   15.805   1.00 212.24 ? 413 THR B CG2  1 
ATOM   9021  H H    . THR B  1 273 ? 87.451  -6.440   18.493   1.00 227.75 ? 413 THR B H    1 
ATOM   9022  H HA   . THR B  1 273 ? 84.758  -6.137   18.229   1.00 223.61 ? 413 THR B HA   1 
ATOM   9023  H HB   . THR B  1 273 ? 86.741  -4.983   16.555   1.00 217.46 ? 413 THR B HB   1 
ATOM   9024  H HG1  . THR B  1 273 ? 85.860  -3.095   17.309   1.00 219.62 ? 413 THR B HG1  1 
ATOM   9025  H HG21 . THR B  1 273 ? 84.999  -4.056   15.282   1.00 205.48 ? 413 THR B HG21 1 
ATOM   9026  H HG22 . THR B  1 273 ? 84.914  -5.632   15.227   1.00 205.48 ? 413 THR B HG22 1 
ATOM   9027  H HG23 . THR B  1 273 ? 83.938  -4.821   16.166   1.00 205.48 ? 413 THR B HG23 1 
ATOM   9028  N N    . ILE B  1 274 ? 84.373  -7.840   16.507   1.00 226.66 ? 414 ILE B N    1 
ATOM   9029  C CA   . ILE B  1 274 ? 84.186  -8.828   15.451   1.00 221.61 ? 414 ILE B CA   1 
ATOM   9030  C C    . ILE B  1 274 ? 84.082  -8.100   14.118   1.00 213.71 ? 414 ILE B C    1 
ATOM   9031  O O    . ILE B  1 274 ? 83.204  -7.256   13.932   1.00 207.65 ? 414 ILE B O    1 
ATOM   9032  C CB   . ILE B  1 274 ? 82.921  -9.689   15.671   1.00 217.77 ? 414 ILE B CB   1 
ATOM   9033  C CG1  . ILE B  1 274 ? 83.067  -10.536  16.938   1.00 226.19 ? 414 ILE B CG1  1 
ATOM   9034  C CG2  . ILE B  1 274 ? 82.673  -10.598  14.463   1.00 212.10 ? 414 ILE B CG2  1 
ATOM   9035  C CD1  . ILE B  1 274 ? 81.806  -11.274  17.337   1.00 223.54 ? 414 ILE B CD1  1 
ATOM   9036  H H    . ILE B  1 274 ? 83.638  -7.558   16.855   1.00 378.47 ? 414 ILE B H    1 
ATOM   9037  H HA   . ILE B  1 274 ? 84.956  -9.416   15.421   1.00 374.17 ? 414 ILE B HA   1 
ATOM   9038  H HB   . ILE B  1 274 ? 82.159  -9.099   15.778   1.00 374.67 ? 414 ILE B HB   1 
ATOM   9039  H HG12 . ILE B  1 274 ? 83.763  -11.196  16.792   1.00 383.05 ? 414 ILE B HG12 1 
ATOM   9040  H HG13 . ILE B  1 274 ? 83.315  -9.955   17.674   1.00 383.05 ? 414 ILE B HG13 1 
ATOM   9041  H HG21 . ILE B  1 274 ? 81.876  -11.127  14.625   1.00 371.53 ? 414 ILE B HG21 1 
ATOM   9042  H HG22 . ILE B  1 274 ? 82.551  -10.048  13.674   1.00 371.53 ? 414 ILE B HG22 1 
ATOM   9043  H HG23 . ILE B  1 274 ? 83.439  -11.182  14.345   1.00 371.53 ? 414 ILE B HG23 1 
ATOM   9044  H HD11 . ILE B  1 274 ? 81.981  -11.784  18.144   1.00 383.46 ? 414 ILE B HD11 1 
ATOM   9045  H HD12 . ILE B  1 274 ? 81.100  -10.629  17.500   1.00 383.46 ? 414 ILE B HD12 1 
ATOM   9046  H HD13 . ILE B  1 274 ? 81.549  -11.872  16.617   1.00 383.46 ? 414 ILE B HD13 1 
ATOM   9047  N N    . THR B  1 275 ? 84.987  -8.421   13.199   1.00 213.84 ? 415 THR B N    1 
ATOM   9048  C CA   . THR B  1 275 ? 84.959  -7.857   11.855   1.00 206.96 ? 415 THR B CA   1 
ATOM   9049  C C    . THR B  1 275 ? 84.591  -8.935   10.844   1.00 202.16 ? 415 THR B C    1 
ATOM   9050  O O    . THR B  1 275 ? 85.367  -9.856   10.599   1.00 206.30 ? 415 THR B O    1 
ATOM   9051  C CB   . THR B  1 275 ? 86.315  -7.239   11.467   1.00 211.45 ? 415 THR B CB   1 
ATOM   9052  O OG1  . THR B  1 275 ? 86.708  -6.282   12.458   1.00 216.93 ? 415 THR B OG1  1 
ATOM   9053  C CG2  . THR B  1 275 ? 86.225  -6.549   10.108   1.00 204.50 ? 415 THR B CG2  1 
ATOM   9054  H H    . THR B  1 275 ? 85.636  -8.971   13.332   1.00 252.80 ? 415 THR B H    1 
ATOM   9055  H HA   . THR B  1 275 ? 84.285  -7.161   11.815   1.00 239.59 ? 415 THR B HA   1 
ATOM   9056  H HB   . THR B  1 275 ? 86.984  -7.939   11.411   1.00 240.66 ? 415 THR B HB   1 
ATOM   9057  H HG1  . THR B  1 275 ? 87.447  -5.941   12.252   1.00 246.39 ? 415 THR B HG1  1 
ATOM   9058  H HG21 . THR B  1 275 ? 87.084  -6.164   9.875    1.00 228.28 ? 415 THR B HG21 1 
ATOM   9059  H HG22 . THR B  1 275 ? 85.972  -7.192   9.427    1.00 228.28 ? 415 THR B HG22 1 
ATOM   9060  H HG23 . THR B  1 275 ? 85.560  -5.844   10.138   1.00 228.28 ? 415 THR B HG23 1 
ATOM   9061  N N    . LEU B  1 276 ? 83.403  -8.811   10.262   1.00 204.92 ? 416 LEU B N    1 
ATOM   9062  C CA   . LEU B  1 276 ? 82.946  -9.750   9.246    1.00 200.06 ? 416 LEU B CA   1 
ATOM   9063  C C    . LEU B  1 276 ? 83.254  -9.198   7.856    1.00 195.43 ? 416 LEU B C    1 
ATOM   9064  O O    . LEU B  1 276 ? 82.890  -8.066   7.555    1.00 191.23 ? 416 LEU B O    1 
ATOM   9065  C CB   . LEU B  1 276 ? 81.448  -10.013  9.382    1.00 194.33 ? 416 LEU B CB   1 
ATOM   9066  C CG   . LEU B  1 276 ? 80.935  -10.363  10.780   1.00 198.23 ? 416 LEU B CG   1 
ATOM   9067  C CD1  . LEU B  1 276 ? 79.428  -10.543  10.745   1.00 192.13 ? 416 LEU B CD1  1 
ATOM   9068  C CD2  . LEU B  1 276 ? 81.616  -11.612  11.316   1.00 205.44 ? 416 LEU B CD2  1 
ATOM   9069  H H    . LEU B  1 276 ? 82.839  -8.187   10.441   1.00 296.32 ? 416 LEU B H    1 
ATOM   9070  H HA   . LEU B  1 276 ? 83.414  -10.593  9.351    1.00 292.26 ? 416 LEU B HA   1 
ATOM   9071  H HB2  . LEU B  1 276 ? 80.974  -9.217   9.094    1.00 286.54 ? 416 LEU B HB2  1 
ATOM   9072  H HB3  . LEU B  1 276 ? 81.216  -10.752  8.798    1.00 286.54 ? 416 LEU B HB3  1 
ATOM   9073  H HG   . LEU B  1 276 ? 81.136  -9.630   11.382   1.00 294.40 ? 416 LEU B HG   1 
ATOM   9074  H HD11 . LEU B  1 276 ? 79.116  -10.764  11.636   1.00 287.28 ? 416 LEU B HD11 1 
ATOM   9075  H HD12 . LEU B  1 276 ? 79.018  -9.715   10.447   1.00 287.28 ? 416 LEU B HD12 1 
ATOM   9076  H HD13 . LEU B  1 276 ? 79.210  -11.260  10.130   1.00 287.28 ? 416 LEU B HD13 1 
ATOM   9077  H HD21 . LEU B  1 276 ? 81.269  -11.805  12.201   1.00 307.21 ? 416 LEU B HD21 1 
ATOM   9078  H HD22 . LEU B  1 276 ? 81.431  -12.353  10.719   1.00 307.21 ? 416 LEU B HD22 1 
ATOM   9079  H HD23 . LEU B  1 276 ? 82.573  -11.454  11.362   1.00 307.21 ? 416 LEU B HD23 1 
ATOM   9080  N N    . PRO B  1 277 ? 83.928  -9.991   7.005    1.00 201.87 ? 417 PRO B N    1 
ATOM   9081  C CA   . PRO B  1 277 ? 84.211  -9.516   5.646    1.00 197.84 ? 417 PRO B CA   1 
ATOM   9082  C C    . PRO B  1 277 ? 82.981  -9.575   4.746    1.00 189.39 ? 417 PRO B C    1 
ATOM   9083  O O    . PRO B  1 277 ? 82.254  -10.568  4.779    1.00 187.78 ? 417 PRO B O    1 
ATOM   9084  C CB   . PRO B  1 277 ? 85.291  -10.480  5.157    1.00 202.84 ? 417 PRO B CB   1 
ATOM   9085  C CG   . PRO B  1 277 ? 85.018  -11.739  5.895    1.00 206.09 ? 417 PRO B CG   1 
ATOM   9086  C CD   . PRO B  1 277 ? 84.477  -11.337  7.240    1.00 207.47 ? 417 PRO B CD   1 
ATOM   9087  H HA   . PRO B  1 277 ? 84.562  -8.612   5.664    1.00 240.28 ? 417 PRO B HA   1 
ATOM   9088  H HB2  . PRO B  1 277 ? 85.204  -10.615  4.200    1.00 248.27 ? 417 PRO B HB2  1 
ATOM   9089  H HB3  . PRO B  1 277 ? 86.168  -10.132  5.379    1.00 248.27 ? 417 PRO B HB3  1 
ATOM   9090  H HG2  . PRO B  1 277 ? 84.363  -12.263  5.408    1.00 257.02 ? 417 PRO B HG2  1 
ATOM   9091  H HG3  . PRO B  1 277 ? 85.843  -12.238  5.997    1.00 257.02 ? 417 PRO B HG3  1 
ATOM   9092  H HD2  . PRO B  1 277 ? 83.774  -11.946  7.516    1.00 258.48 ? 417 PRO B HD2  1 
ATOM   9093  H HD3  . PRO B  1 277 ? 85.192  -11.301  7.894    1.00 258.48 ? 417 PRO B HD3  1 
ATOM   9094  N N    . CYS B  1 278 ? 82.762  -8.526   3.956    1.00 195.84 ? 418 CYS B N    1 
ATOM   9095  C CA   . CYS B  1 278 ? 81.600  -8.451   3.078    1.00 188.22 ? 418 CYS B CA   1 
ATOM   9096  C C    . CYS B  1 278 ? 82.013  -8.242   1.623    1.00 185.76 ? 418 CYS B C    1 
ATOM   9097  O O    . CYS B  1 278 ? 83.053  -7.647   1.339    1.00 188.76 ? 418 CYS B O    1 
ATOM   9098  C CB   . CYS B  1 278 ? 80.662  -7.327   3.529    1.00 184.39 ? 418 CYS B CB   1 
ATOM   9099  S SG   . CYS B  1 278 ? 80.087  -7.469   5.248    1.00 187.43 ? 418 CYS B SG   1 
ATOM   9100  H H    . CYS B  1 278 ? 83.278  -7.839   3.911    1.00 278.05 ? 418 CYS B H    1 
ATOM   9101  H HA   . CYS B  1 278 ? 81.111  -9.287   3.132    1.00 269.63 ? 418 CYS B HA   1 
ATOM   9102  H HB2  . CYS B  1 278 ? 81.129  -6.481   3.444    1.00 262.18 ? 418 CYS B HB2  1 
ATOM   9103  H HB3  . CYS B  1 278 ? 79.880  -7.327   2.955    1.00 262.18 ? 418 CYS B HB3  1 
ATOM   9104  N N    . ARG B  1 279 ? 81.187  -8.743   0.709    1.00 181.47 ? 419 ARG B N    1 
ATOM   9105  C CA   . ARG B  1 279 ? 81.418  -8.593   -0.725   1.00 178.98 ? 419 ARG B CA   1 
ATOM   9106  C C    . ARG B  1 279 ? 80.167  -8.094   -1.429   1.00 172.10 ? 419 ARG B C    1 
ATOM   9107  O O    . ARG B  1 279 ? 79.055  -8.532   -1.126   1.00 169.25 ? 419 ARG B O    1 
ATOM   9108  C CB   . ARG B  1 279 ? 81.857  -9.921   -1.343   1.00 181.41 ? 419 ARG B CB   1 
ATOM   9109  C CG   . ARG B  1 279 ? 81.814  -9.949   -2.874   1.00 178.42 ? 419 ARG B CG   1 
ATOM   9110  C CD   . ARG B  1 279 ? 82.171  -11.325  -3.416   1.00 181.28 ? 419 ARG B CD   1 
ATOM   9111  N NE   . ARG B  1 279 ? 81.996  -11.413  -4.864   1.00 178.53 ? 419 ARG B NE   1 
ATOM   9112  C CZ   . ARG B  1 279 ? 82.228  -12.507  -5.586   1.00 181.44 ? 419 ARG B CZ   1 
ATOM   9113  N NH1  . ARG B  1 279 ? 82.654  -13.622  -5.005   1.00 188.05 ? 419 ARG B NH1  1 
ATOM   9114  N NH2  . ARG B  1 279 ? 82.035  -12.487  -6.898   1.00 182.95 ? 419 ARG B NH2  1 
ATOM   9115  H H    . ARG B  1 279 ? 80.473  -9.183   0.898    1.00 245.93 ? 419 ARG B H    1 
ATOM   9116  H HA   . ARG B  1 279 ? 82.126  -7.944   -0.867   1.00 242.80 ? 419 ARG B HA   1 
ATOM   9117  H HB2  . ARG B  1 279 ? 82.770  -10.105  -1.070   1.00 248.47 ? 419 ARG B HB2  1 
ATOM   9118  H HB3  . ARG B  1 279 ? 81.271  -10.623  -1.018   1.00 248.47 ? 419 ARG B HB3  1 
ATOM   9119  H HG2  . ARG B  1 279 ? 80.918  -9.728   -3.173   1.00 248.43 ? 419 ARG B HG2  1 
ATOM   9120  H HG3  . ARG B  1 279 ? 82.453  -9.309   -3.224   1.00 248.43 ? 419 ARG B HG3  1 
ATOM   9121  H HD2  . ARG B  1 279 ? 83.101  -11.515  -3.213   1.00 256.32 ? 419 ARG B HD2  1 
ATOM   9122  H HD3  . ARG B  1 279 ? 81.598  -11.989  -3.001   1.00 256.32 ? 419 ARG B HD3  1 
ATOM   9123  H HE   . ARG B  1 279 ? 81.724  -10.710  -5.277   1.00 258.18 ? 419 ARG B HE   1 
ATOM   9124  H HH11 . ARG B  1 279 ? 82.780  -13.643  -4.155   1.00 274.30 ? 419 ARG B HH11 1 
ATOM   9125  H HH12 . ARG B  1 279 ? 82.802  -14.324  -5.479   1.00 274.30 ? 419 ARG B HH12 1 
ATOM   9126  H HH21 . ARG B  1 279 ? 81.760  -11.767  -7.281   1.00 269.80 ? 419 ARG B HH21 1 
ATOM   9127  H HH22 . ARG B  1 279 ? 82.186  -13.192  -7.366   1.00 269.80 ? 419 ARG B HH22 1 
ATOM   9128  N N    . ILE B  1 280 ? 80.360  -7.180   -2.374   1.00 170.84 ? 420 ILE B N    1 
ATOM   9129  C CA   . ILE B  1 280 ? 79.273  -6.711   -3.227   1.00 164.95 ? 420 ILE B CA   1 
ATOM   9130  C C    . ILE B  1 280 ? 79.258  -7.525   -4.512   1.00 163.83 ? 420 ILE B C    1 
ATOM   9131  O O    . ILE B  1 280 ? 80.263  -7.596   -5.220   1.00 166.51 ? 420 ILE B O    1 
ATOM   9132  C CB   . ILE B  1 280 ? 79.409  -5.211   -3.564   1.00 163.46 ? 420 ILE B CB   1 
ATOM   9133  C CG1  . ILE B  1 280 ? 79.348  -4.374   -2.283   1.00 164.89 ? 420 ILE B CG1  1 
ATOM   9134  C CG2  . ILE B  1 280 ? 78.311  -4.775   -4.543   1.00 157.92 ? 420 ILE B CG2  1 
ATOM   9135  C CD1  . ILE B  1 280 ? 79.666  -2.907   -2.488   1.00 164.94 ? 420 ILE B CD1  1 
ATOM   9136  H H    . ILE B  1 280 ? 81.118  -6.812   -2.544   1.00 228.70 ? 420 ILE B H    1 
ATOM   9137  H HA   . ILE B  1 280 ? 78.428  -6.845   -2.771   1.00 221.51 ? 420 ILE B HA   1 
ATOM   9138  H HB   . ILE B  1 280 ? 80.271  -5.068   -3.985   1.00 217.46 ? 420 ILE B HB   1 
ATOM   9139  H HG12 . ILE B  1 280 ? 78.453  -4.433   -1.914   1.00 215.80 ? 420 ILE B HG12 1 
ATOM   9140  H HG13 . ILE B  1 280 ? 79.989  -4.729   -1.647   1.00 215.80 ? 420 ILE B HG13 1 
ATOM   9141  H HG21 . ILE B  1 280 ? 78.419  -3.831   -4.738   1.00 211.63 ? 420 ILE B HG21 1 
ATOM   9142  H HG22 . ILE B  1 280 ? 78.391  -5.293   -5.359   1.00 211.63 ? 420 ILE B HG22 1 
ATOM   9143  H HG23 . ILE B  1 280 ? 77.445  -4.932   -4.135   1.00 211.63 ? 420 ILE B HG23 1 
ATOM   9144  H HD11 . ILE B  1 280 ? 79.606  -2.449   -1.635   1.00 213.95 ? 420 ILE B HD11 1 
ATOM   9145  H HD12 . ILE B  1 280 ? 80.564  -2.826   -2.845   1.00 213.95 ? 420 ILE B HD12 1 
ATOM   9146  H HD13 . ILE B  1 280 ? 79.026  -2.530   -3.112   1.00 213.95 ? 420 ILE B HD13 1 
ATOM   9147  N N    . LYS B  1 281 ? 78.114  -8.136   -4.806   1.00 143.99 ? 421 LYS B N    1 
ATOM   9148  C CA   . LYS B  1 281 ? 77.969  -8.959   -5.999   1.00 143.15 ? 421 LYS B CA   1 
ATOM   9149  C C    . LYS B  1 281 ? 76.975  -8.342   -6.976   1.00 138.16 ? 421 LYS B C    1 
ATOM   9150  O O    . LYS B  1 281 ? 76.063  -7.619   -6.580   1.00 134.95 ? 421 LYS B O    1 
ATOM   9151  C CB   . LYS B  1 281 ? 77.529  -10.376  -5.626   1.00 144.90 ? 421 LYS B CB   1 
ATOM   9152  C CG   . LYS B  1 281 ? 77.919  -11.402  -6.670   1.00 150.84 ? 421 LYS B CG   1 
ATOM   9153  C CD   . LYS B  1 281 ? 77.528  -12.813  -6.282   1.00 159.49 ? 421 LYS B CD   1 
ATOM   9154  C CE   . LYS B  1 281 ? 77.731  -13.763  -7.451   1.00 170.45 ? 421 LYS B CE   1 
ATOM   9155  N NZ   . LYS B  1 281 ? 79.043  -13.550  -8.127   1.00 172.58 ? 421 LYS B NZ   1 
ATOM   9156  H H    . LYS B  1 281 ? 77.402  -8.089   -4.326   1.00 257.92 ? 421 LYS B H    1 
ATOM   9157  H HA   . LYS B  1 281 ? 78.828  -9.020   -6.446   1.00 262.42 ? 421 LYS B HA   1 
ATOM   9158  H HB2  . LYS B  1 281 ? 77.948  -10.626  -4.788   1.00 269.42 ? 421 LYS B HB2  1 
ATOM   9159  H HB3  . LYS B  1 281 ? 76.564  -10.393  -5.533   1.00 269.42 ? 421 LYS B HB3  1 
ATOM   9160  H HG2  . LYS B  1 281 ? 77.474  -11.187  -7.505   1.00 276.25 ? 421 LYS B HG2  1 
ATOM   9161  H HG3  . LYS B  1 281 ? 78.881  -11.380  -6.792   1.00 276.25 ? 421 LYS B HG3  1 
ATOM   9162  H HD2  . LYS B  1 281 ? 78.083  -13.111  -5.544   1.00 283.31 ? 421 LYS B HD2  1 
ATOM   9163  H HD3  . LYS B  1 281 ? 76.592  -12.831  -6.030   1.00 283.31 ? 421 LYS B HD3  1 
ATOM   9164  H HE2  . LYS B  1 281 ? 77.703  -14.677  -7.126   1.00 292.21 ? 421 LYS B HE2  1 
ATOM   9165  H HE3  . LYS B  1 281 ? 77.028  -13.619  -8.103   1.00 292.21 ? 421 LYS B HE3  1 
ATOM   9166  H HZ1  . LYS B  1 281 ? 79.132  -14.120  -8.805   1.00 300.83 ? 421 LYS B HZ1  1 
ATOM   9167  H HZ2  . LYS B  1 281 ? 79.093  -12.718  -8.440   1.00 300.83 ? 421 LYS B HZ2  1 
ATOM   9168  H HZ3  . LYS B  1 281 ? 79.708  -13.682  -7.550   1.00 300.83 ? 421 LYS B HZ3  1 
ATOM   9169  N N    . GLN B  1 282 ? 77.174  -8.632   -8.258   1.00 141.73 ? 422 GLN B N    1 
ATOM   9170  C CA   . GLN B  1 282 ? 76.300  -8.153   -9.323   1.00 137.85 ? 422 GLN B CA   1 
ATOM   9171  C C    . GLN B  1 282 ? 75.221  -9.172   -9.666   1.00 136.87 ? 422 GLN B C    1 
ATOM   9172  O O    . GLN B  1 282 ? 74.128  -8.808   -10.099  1.00 133.29 ? 422 GLN B O    1 
ATOM   9173  C CB   . GLN B  1 282 ? 77.120  -7.845   -10.574  1.00 139.29 ? 422 GLN B CB   1 
ATOM   9174  C CG   . GLN B  1 282 ? 78.027  -6.638   -10.457  1.00 140.59 ? 422 GLN B CG   1 
ATOM   9175  C CD   . GLN B  1 282 ? 78.933  -6.487   -11.664  1.00 142.92 ? 422 GLN B CD   1 
ATOM   9176  O OE1  . GLN B  1 282 ? 80.149  -6.653   -11.569  1.00 147.22 ? 422 GLN B OE1  1 
ATOM   9177  N NE2  . GLN B  1 282 ? 78.340  -6.178   -12.812  1.00 140.55 ? 422 GLN B NE2  1 
ATOM   9178  H H    . GLN B  1 282 ? 77.825  -9.117   -8.542   1.00 144.47 ? 422 GLN B H    1 
ATOM   9179  H HA   . GLN B  1 282 ? 75.865  -7.336   -9.036   1.00 140.55 ? 422 GLN B HA   1 
ATOM   9180  H HB2  . GLN B  1 282 ? 77.677  -8.613   -10.775  1.00 146.04 ? 422 GLN B HB2  1 
ATOM   9181  H HB3  . GLN B  1 282 ? 76.510  -7.683   -11.311  1.00 146.04 ? 422 GLN B HB3  1 
ATOM   9182  H HG2  . GLN B  1 282 ? 77.484  -5.837   -10.385  1.00 143.88 ? 422 GLN B HG2  1 
ATOM   9183  H HG3  . GLN B  1 282 ? 78.586  -6.735   -9.670   1.00 143.88 ? 422 GLN B HG3  1 
ATOM   9184  H HE21 . GLN B  1 282 ? 78.809  -6.081   -13.526  1.00 156.02 ? 422 GLN B HE21 1 
ATOM   9185  H HE22 . GLN B  1 282 ? 77.486  -6.074   -12.840  1.00 156.02 ? 422 GLN B HE22 1 
ATOM   9186  N N    . ILE B  1 283 ? 75.545  -10.447  -9.479   1.00 131.66 ? 423 ILE B N    1 
ATOM   9187  C CA   . ILE B  1 283 ? 74.654  -11.547  -9.833   1.00 137.32 ? 423 ILE B CA   1 
ATOM   9188  C C    . ILE B  1 283 ? 74.039  -12.171  -8.582   1.00 140.15 ? 423 ILE B C    1 
ATOM   9189  O O    . ILE B  1 283 ? 74.757  -12.607  -7.684   1.00 145.04 ? 423 ILE B O    1 
ATOM   9190  C CB   . ILE B  1 283 ? 75.408  -12.622  -10.634  1.00 149.78 ? 423 ILE B CB   1 
ATOM   9191  C CG1  . ILE B  1 283 ? 76.034  -11.991  -11.880  1.00 146.79 ? 423 ILE B CG1  1 
ATOM   9192  C CG2  . ILE B  1 283 ? 74.477  -13.776  -11.005  1.00 158.00 ? 423 ILE B CG2  1 
ATOM   9193  C CD1  . ILE B  1 283 ? 76.858  -12.942  -12.735  1.00 160.37 ? 423 ILE B CD1  1 
ATOM   9194  H H    . ILE B  1 283 ? 76.292  -10.707  -9.140   1.00 192.43 ? 423 ILE B H    1 
ATOM   9195  H HA   . ILE B  1 283 ? 73.934  -11.207  -10.387  1.00 196.70 ? 423 ILE B HA   1 
ATOM   9196  H HB   . ILE B  1 283 ? 76.122  -12.973  -10.078  1.00 209.53 ? 423 ILE B HB   1 
ATOM   9197  H HG12 . ILE B  1 283 ? 75.322  -11.638  -12.437  1.00 213.66 ? 423 ILE B HG12 1 
ATOM   9198  H HG13 . ILE B  1 283 ? 76.617  -11.268  -11.600  1.00 213.66 ? 423 ILE B HG13 1 
ATOM   9199  H HG21 . ILE B  1 283 ? 74.978  -14.437  -11.507  1.00 215.08 ? 423 ILE B HG21 1 
ATOM   9200  H HG22 . ILE B  1 283 ? 74.127  -14.173  -10.192  1.00 215.08 ? 423 ILE B HG22 1 
ATOM   9201  H HG23 . ILE B  1 283 ? 73.749  -13.431  -11.545  1.00 215.08 ? 423 ILE B HG23 1 
ATOM   9202  H HD11 . ILE B  1 283 ? 77.212  -12.456  -13.496  1.00 227.35 ? 423 ILE B HD11 1 
ATOM   9203  H HD12 . ILE B  1 283 ? 77.587  -13.296  -12.200  1.00 227.35 ? 423 ILE B HD12 1 
ATOM   9204  H HD13 . ILE B  1 283 ? 76.289  -13.666  -13.039  1.00 227.35 ? 423 ILE B HD13 1 
ATOM   9205  N N    . ILE B  1 284 ? 72.709  -12.215  -8.538   1.00 148.74 ? 424 ILE B N    1 
ATOM   9206  C CA   . ILE B  1 284 ? 71.975  -12.709  -7.371   1.00 151.35 ? 424 ILE B CA   1 
ATOM   9207  C C    . ILE B  1 284 ? 70.866  -13.685  -7.769   1.00 158.19 ? 424 ILE B C    1 
ATOM   9208  O O    . ILE B  1 284 ? 70.230  -13.520  -8.810   1.00 155.76 ? 424 ILE B O    1 
ATOM   9209  C CB   . ILE B  1 284 ? 71.339  -11.541  -6.572   1.00 141.77 ? 424 ILE B CB   1 
ATOM   9210  C CG1  . ILE B  1 284 ? 72.405  -10.532  -6.143   1.00 136.86 ? 424 ILE B CG1  1 
ATOM   9211  C CG2  . ILE B  1 284 ? 70.596  -12.048  -5.342   1.00 144.46 ? 424 ILE B CG2  1 
ATOM   9212  C CD1  . ILE B  1 284 ? 72.616  -9.403   -7.130   1.00 131.88 ? 424 ILE B CD1  1 
ATOM   9213  H H    . ILE B  1 284 ? 72.199  -11.961  -9.183   1.00 301.55 ? 424 ILE B H    1 
ATOM   9214  H HA   . ILE B  1 284 ? 72.590  -13.175  -6.784   1.00 298.03 ? 424 ILE B HA   1 
ATOM   9215  H HB   . ILE B  1 284 ? 70.703  -11.088  -7.148   1.00 286.86 ? 424 ILE B HB   1 
ATOM   9216  H HG12 . ILE B  1 284 ? 72.141  -10.140  -5.297   1.00 283.85 ? 424 ILE B HG12 1 
ATOM   9217  H HG13 . ILE B  1 284 ? 73.250  -10.997  -6.041   1.00 283.85 ? 424 ILE B HG13 1 
ATOM   9218  H HG21 . ILE B  1 284 ? 70.214  -11.292  -4.870   1.00 284.70 ? 424 ILE B HG21 1 
ATOM   9219  H HG22 . ILE B  1 284 ? 69.891  -12.652  -5.626   1.00 284.70 ? 424 ILE B HG22 1 
ATOM   9220  H HG23 . ILE B  1 284 ? 71.221  -12.516  -4.766   1.00 284.70 ? 424 ILE B HG23 1 
ATOM   9221  H HD11 . ILE B  1 284 ? 73.303  -8.809   -6.788   1.00 282.48 ? 424 ILE B HD11 1 
ATOM   9222  H HD12 . ILE B  1 284 ? 72.893  -9.775   -7.981   1.00 282.48 ? 424 ILE B HD12 1 
ATOM   9223  H HD13 . ILE B  1 284 ? 71.782  -8.918   -7.236   1.00 282.48 ? 424 ILE B HD13 1 
ATOM   9224  N N    . ASN B  1 285 ? 70.647  -14.702  -6.937   1.00 144.97 ? 425 ASN B N    1 
ATOM   9225  C CA   . ASN B  1 285 ? 69.484  -15.576  -7.077   1.00 151.88 ? 425 ASN B CA   1 
ATOM   9226  C C    . ASN B  1 285 ? 68.247  -14.907  -6.478   1.00 145.26 ? 425 ASN B C    1 
ATOM   9227  O O    . ASN B  1 285 ? 68.262  -14.472  -5.328   1.00 141.13 ? 425 ASN B O    1 
ATOM   9228  C CB   . ASN B  1 285 ? 69.719  -16.931  -6.401   1.00 163.38 ? 425 ASN B CB   1 
ATOM   9229  C CG   . ASN B  1 285 ? 70.836  -17.731  -7.050   1.00 171.53 ? 425 ASN B CG   1 
ATOM   9230  O OD1  . ASN B  1 285 ? 70.671  -18.266  -8.146   1.00 175.24 ? 425 ASN B OD1  1 
ATOM   9231  N ND2  . ASN B  1 285 ? 71.966  -17.842  -6.363   1.00 174.30 ? 425 ASN B ND2  1 
ATOM   9232  H H    . ASN B  1 285 ? 71.161  -14.909  -6.279   1.00 216.99 ? 425 ASN B H    1 
ATOM   9233  H HA   . ASN B  1 285 ? 69.316  -15.734  -8.019   1.00 219.55 ? 425 ASN B HA   1 
ATOM   9234  H HB2  . ASN B  1 285 ? 69.959  -16.783  -5.472   1.00 229.88 ? 425 ASN B HB2  1 
ATOM   9235  H HB3  . ASN B  1 285 ? 68.905  -17.456  -6.453   1.00 229.88 ? 425 ASN B HB3  1 
ATOM   9236  H HD21 . ASN B  1 285 ? 72.626  -18.285  -6.691   1.00 246.99 ? 425 ASN B HD21 1 
ATOM   9237  H HD22 . ASN B  1 285 ? 72.038  -17.470  -5.591   1.00 246.99 ? 425 ASN B HD22 1 
ATOM   9238  N N    . MET B  1 286 ? 67.172  -14.831  -7.252   1.00 147.11 ? 426 MET B N    1 
ATOM   9239  C CA   . MET B  1 286 ? 65.993  -14.086  -6.828   1.00 141.23 ? 426 MET B CA   1 
ATOM   9240  C C    . MET B  1 286 ? 65.239  -14.778  -5.694   1.00 149.08 ? 426 MET B C    1 
ATOM   9241  O O    . MET B  1 286 ? 65.125  -16.004  -5.666   1.00 158.98 ? 426 MET B O    1 
ATOM   9242  C CB   . MET B  1 286 ? 65.061  -13.874  -8.018   1.00 137.94 ? 426 MET B CB   1 
ATOM   9243  C CG   . MET B  1 286 ? 65.640  -12.972  -9.097   1.00 128.44 ? 426 MET B CG   1 
ATOM   9244  S SD   . MET B  1 286 ? 64.471  -12.619  -10.425  1.00 122.04 ? 426 MET B SD   1 
ATOM   9245  C CE   . MET B  1 286 ? 64.108  -14.266  -11.033  1.00 133.64 ? 426 MET B CE   1 
ATOM   9246  H H    . MET B  1 286 ? 67.099  -15.200  -8.025   1.00 110.22 ? 426 MET B H    1 
ATOM   9247  H HA   . MET B  1 286 ? 66.277  -13.211  -6.520   1.00 100.02 ? 426 MET B HA   1 
ATOM   9248  H HB2  . MET B  1 286 ? 64.869  -14.735  -8.422   1.00 97.31  ? 426 MET B HB2  1 
ATOM   9249  H HB3  . MET B  1 286 ? 64.238  -13.468  -7.703   1.00 97.31  ? 426 MET B HB3  1 
ATOM   9250  H HG2  . MET B  1 286 ? 65.901  -12.129  -8.696   1.00 96.46  ? 426 MET B HG2  1 
ATOM   9251  H HG3  . MET B  1 286 ? 66.414  -13.406  -9.488   1.00 96.46  ? 426 MET B HG3  1 
ATOM   9252  H HE1  . MET B  1 286 ? 63.475  -14.200  -11.766  1.00 104.74 ? 426 MET B HE1  1 
ATOM   9253  H HE2  . MET B  1 286 ? 64.930  -14.677  -11.342  1.00 104.74 ? 426 MET B HE2  1 
ATOM   9254  H HE3  . MET B  1 286 ? 63.726  -14.791  -10.313  1.00 104.74 ? 426 MET B HE3  1 
ATOM   9255  N N    . TRP B  1 287 ? 64.726  -13.977  -4.762   1.00 143.74 ? 427 TRP B N    1 
ATOM   9256  C CA   . TRP B  1 287 ? 63.892  -14.480  -3.674   1.00 149.74 ? 427 TRP B CA   1 
ATOM   9257  C C    . TRP B  1 287 ? 62.413  -14.391  -4.048   1.00 152.93 ? 427 TRP B C    1 
ATOM   9258  O O    . TRP B  1 287 ? 61.579  -15.112  -3.497   1.00 160.41 ? 427 TRP B O    1 
ATOM   9259  C CB   . TRP B  1 287 ? 64.164  -13.702  -2.385   1.00 143.35 ? 427 TRP B CB   1 
ATOM   9260  C CG   . TRP B  1 287 ? 63.749  -12.264  -2.435   1.00 133.80 ? 427 TRP B CG   1 
ATOM   9261  C CD1  . TRP B  1 287 ? 64.504  -11.207  -2.851   1.00 124.15 ? 427 TRP B CD1  1 
ATOM   9262  C CD2  . TRP B  1 287 ? 62.481  -11.722  -2.047   1.00 134.39 ? 427 TRP B CD2  1 
ATOM   9263  N NE1  . TRP B  1 287 ? 63.784  -10.041  -2.751   1.00 118.44 ? 427 TRP B NE1  1 
ATOM   9264  C CE2  . TRP B  1 287 ? 62.539  -10.331  -2.258   1.00 124.22 ? 427 TRP B CE2  1 
ATOM   9265  C CE3  . TRP B  1 287 ? 61.302  -12.278  -1.544   1.00 143.36 ? 427 TRP B CE3  1 
ATOM   9266  C CZ2  . TRP B  1 287 ? 61.465  -9.490   -1.987   1.00 123.12 ? 427 TRP B CZ2  1 
ATOM   9267  C CZ3  . TRP B  1 287 ? 60.237  -11.442  -1.274   1.00 142.84 ? 427 TRP B CZ3  1 
ATOM   9268  C CH2  . TRP B  1 287 ? 60.325  -10.063  -1.496   1.00 132.74 ? 427 TRP B CH2  1 
ATOM   9269  H H    . TRP B  1 287 ? 64.849  -13.126  -4.739   1.00 148.91 ? 427 TRP B H    1 
ATOM   9270  H HA   . TRP B  1 287 ? 64.107  -15.412  -3.514   1.00 143.75 ? 427 TRP B HA   1 
ATOM   9271  H HB2  . TRP B  1 287 ? 63.679  -14.124  -1.659   1.00 138.66 ? 427 TRP B HB2  1 
ATOM   9272  H HB3  . TRP B  1 287 ? 65.116  -13.728  -2.201   1.00 138.66 ? 427 TRP B HB3  1 
ATOM   9273  H HD1  . TRP B  1 287 ? 65.380  -11.267  -3.160   1.00 128.70 ? 427 TRP B HD1  1 
ATOM   9274  H HE1  . TRP B  1 287 ? 64.069  -9.257   -2.961   1.00 120.67 ? 427 TRP B HE1  1 
ATOM   9275  H HE3  . TRP B  1 287 ? 61.236  -13.194  -1.395   1.00 119.55 ? 427 TRP B HE3  1 
ATOM   9276  H HZ2  . TRP B  1 287 ? 61.520  -8.573   -2.132   1.00 108.51 ? 427 TRP B HZ2  1 
ATOM   9277  H HZ3  . TRP B  1 287 ? 59.448  -11.801  -0.939   1.00 111.69 ? 427 TRP B HZ3  1 
ATOM   9278  H HH2  . TRP B  1 287 ? 59.592  -9.524   -1.304   1.00 106.26 ? 427 TRP B HH2  1 
ATOM   9279  N N    . GLN B  1 288 ? 62.098  -13.505  -4.990   1.00 145.86 ? 428 GLN B N    1 
ATOM   9280  C CA   . GLN B  1 288 ? 60.726  -13.324  -5.454   1.00 147.15 ? 428 GLN B CA   1 
ATOM   9281  C C    . GLN B  1 288 ? 60.259  -14.543  -6.232   1.00 156.26 ? 428 GLN B C    1 
ATOM   9282  O O    . GLN B  1 288 ? 59.075  -14.875  -6.247   1.00 161.90 ? 428 GLN B O    1 
ATOM   9283  C CB   . GLN B  1 288 ? 60.608  -12.079  -6.340   1.00 133.32 ? 428 GLN B CB   1 
ATOM   9284  C CG   . GLN B  1 288 ? 61.223  -10.822  -5.752   1.00 123.92 ? 428 GLN B CG   1 
ATOM   9285  C CD   . GLN B  1 288 ? 62.619  -10.557  -6.274   1.00 117.81 ? 428 GLN B CD   1 
ATOM   9286  O OE1  . GLN B  1 288 ? 63.502  -11.403  -6.164   1.00 122.84 ? 428 GLN B OE1  1 
ATOM   9287  N NE2  . GLN B  1 288 ? 62.824  -9.379   -6.852   1.00 107.77 ? 428 GLN B NE2  1 
ATOM   9288  H H    . GLN B  1 288 ? 62.667  -12.992  -5.380   1.00 136.49 ? 428 GLN B H    1 
ATOM   9289  H HA   . GLN B  1 288 ? 60.141  -13.209  -4.689   1.00 130.52 ? 428 GLN B HA   1 
ATOM   9290  H HB2  . GLN B  1 288 ? 61.053  -12.256  -7.184   1.00 127.46 ? 428 GLN B HB2  1 
ATOM   9291  H HB3  . GLN B  1 288 ? 59.669  -11.900  -6.499   1.00 127.46 ? 428 GLN B HB3  1 
ATOM   9292  H HG2  . GLN B  1 288 ? 60.667  -10.061  -5.981   1.00 120.64 ? 428 GLN B HG2  1 
ATOM   9293  H HG3  . GLN B  1 288 ? 61.276  -10.917  -4.788   1.00 120.64 ? 428 GLN B HG3  1 
ATOM   9294  H HE21 . GLN B  1 288 ? 63.601  -9.183   -7.164   1.00 118.58 ? 428 GLN B HE21 1 
ATOM   9295  H HE22 . GLN B  1 288 ? 62.180  -8.813   -6.914   1.00 118.58 ? 428 GLN B HE22 1 
ATOM   9296  N N    . ARG B  1 289 ? 61.206  -15.204  -6.883   1.00 157.34 ? 429 ARG B N    1 
ATOM   9297  C CA   . ARG B  1 289 ? 60.900  -16.312  -7.769   1.00 163.98 ? 429 ARG B CA   1 
ATOM   9298  C C    . ARG B  1 289 ? 62.173  -17.107  -8.009   1.00 167.95 ? 429 ARG B C    1 
ATOM   9299  O O    . ARG B  1 289 ? 63.271  -16.571  -7.878   1.00 163.31 ? 429 ARG B O    1 
ATOM   9300  C CB   . ARG B  1 289 ? 60.321  -15.788  -9.085   1.00 155.01 ? 429 ARG B CB   1 
ATOM   9301  C CG   . ARG B  1 289 ? 59.964  -16.853  -10.119  1.00 158.84 ? 429 ARG B CG   1 
ATOM   9302  C CD   . ARG B  1 289 ? 59.592  -16.225  -11.459  1.00 146.28 ? 429 ARG B CD   1 
ATOM   9303  N NE   . ARG B  1 289 ? 58.640  -15.128  -11.302  1.00 138.12 ? 429 ARG B NE   1 
ATOM   9304  C CZ   . ARG B  1 289 ? 58.972  -13.846  -11.163  1.00 128.29 ? 429 ARG B CZ   1 
ATOM   9305  N NH1  . ARG B  1 289 ? 60.243  -13.468  -11.165  1.00 125.15 ? 429 ARG B NH1  1 
ATOM   9306  N NH2  . ARG B  1 289 ? 58.022  -12.932  -11.022  1.00 121.54 ? 429 ARG B NH2  1 
ATOM   9307  H H    . ARG B  1 289 ? 62.046  -15.026  -6.826   1.00 188.96 ? 429 ARG B H    1 
ATOM   9308  H HA   . ARG B  1 289 ? 60.245  -16.893  -7.351   1.00 194.42 ? 429 ARG B HA   1 
ATOM   9309  H HB2  . ARG B  1 289 ? 59.511  -15.291  -8.888   1.00 194.23 ? 429 ARG B HB2  1 
ATOM   9310  H HB3  . ARG B  1 289 ? 60.973  -15.195  -9.492   1.00 194.23 ? 429 ARG B HB3  1 
ATOM   9311  H HG2  . ARG B  1 289 ? 60.729  -17.434  -10.257  1.00 196.72 ? 429 ARG B HG2  1 
ATOM   9312  H HG3  . ARG B  1 289 ? 59.205  -17.366  -9.802   1.00 196.72 ? 429 ARG B HG3  1 
ATOM   9313  H HD2  . ARG B  1 289 ? 60.392  -15.873  -11.880  1.00 193.66 ? 429 ARG B HD2  1 
ATOM   9314  H HD3  . ARG B  1 289 ? 59.185  -16.899  -12.025  1.00 193.66 ? 429 ARG B HD3  1 
ATOM   9315  H HE   . ARG B  1 289 ? 57.803  -15.325  -11.299  1.00 185.72 ? 429 ARG B HE   1 
ATOM   9316  H HH11 . ARG B  1 289 ? 60.866  -14.054  -11.255  1.00 185.38 ? 429 ARG B HH11 1 
ATOM   9317  H HH12 . ARG B  1 289 ? 60.445  -12.636  -11.075  1.00 185.38 ? 429 ARG B HH12 1 
ATOM   9318  H HH21 . ARG B  1 289 ? 57.195  -13.168  -11.021  1.00 176.51 ? 429 ARG B HH21 1 
ATOM   9319  H HH22 . ARG B  1 289 ? 58.232  -12.103  -10.934  1.00 176.51 ? 429 ARG B HH22 1 
ATOM   9320  N N    . VAL B  1 290 ? 62.033  -18.383  -8.348   1.00 155.55 ? 430 VAL B N    1 
ATOM   9321  C CA   . VAL B  1 290 ? 63.198  -19.191  -8.674   1.00 159.03 ? 430 VAL B CA   1 
ATOM   9322  C C    . VAL B  1 290 ? 63.822  -18.670  -9.960   1.00 153.30 ? 430 VAL B C    1 
ATOM   9323  O O    . VAL B  1 290 ? 63.225  -18.757  -11.033  1.00 149.63 ? 430 VAL B O    1 
ATOM   9324  C CB   . VAL B  1 290 ? 62.846  -20.677  -8.836   1.00 164.63 ? 430 VAL B CB   1 
ATOM   9325  C CG1  . VAL B  1 290 ? 64.100  -21.492  -9.159   1.00 167.95 ? 430 VAL B CG1  1 
ATOM   9326  C CG2  . VAL B  1 290 ? 62.182  -21.202  -7.571   1.00 166.97 ? 430 VAL B CG2  1 
ATOM   9327  H H    . VAL B  1 290 ? 61.283  -18.801  -8.395   1.00 155.60 ? 430 VAL B H    1 
ATOM   9328  H HA   . VAL B  1 290 ? 63.853  -19.110  -7.963   1.00 162.96 ? 430 VAL B HA   1 
ATOM   9329  H HB   . VAL B  1 290 ? 62.221  -20.779  -9.570   1.00 162.87 ? 430 VAL B HB   1 
ATOM   9330  H HG11 . VAL B  1 290 ? 63.853  -22.425  -9.257   1.00 171.76 ? 430 VAL B HG11 1 
ATOM   9331  H HG12 . VAL B  1 290 ? 64.485  -21.162  -9.986   1.00 171.76 ? 430 VAL B HG12 1 
ATOM   9332  H HG13 . VAL B  1 290 ? 64.737  -21.391  -8.435   1.00 171.76 ? 430 VAL B HG13 1 
ATOM   9333  H HG21 . VAL B  1 290 ? 61.968  -22.140  -7.694   1.00 157.99 ? 430 VAL B HG21 1 
ATOM   9334  H HG22 . VAL B  1 290 ? 62.795  -21.097  -6.827   1.00 157.99 ? 430 VAL B HG22 1 
ATOM   9335  H HG23 . VAL B  1 290 ? 61.371  -20.696  -7.407   1.00 157.99 ? 430 VAL B HG23 1 
ATOM   9336  N N    . GLY B  1 291 ? 65.023  -18.119  -9.840   1.00 151.11 ? 431 GLY B N    1 
ATOM   9337  C CA   . GLY B  1 291 ? 65.719  -17.566  -10.984  1.00 144.12 ? 431 GLY B CA   1 
ATOM   9338  C C    . GLY B  1 291 ? 66.919  -16.736  -10.574  1.00 139.54 ? 431 GLY B C    1 
ATOM   9339  O O    . GLY B  1 291 ? 67.209  -16.591  -9.384   1.00 140.90 ? 431 GLY B O    1 
ATOM   9340  H H    . GLY B  1 291 ? 65.457  -18.054  -9.101   1.00 108.89 ? 431 GLY B H    1 
ATOM   9341  H HA2  . GLY B  1 291 ? 66.024  -18.286  -11.557  1.00 114.42 ? 431 GLY B HA2  1 
ATOM   9342  H HA3  . GLY B  1 291 ? 65.114  -17.002  -11.491  1.00 114.42 ? 431 GLY B HA3  1 
ATOM   9343  N N    . GLN B  1 292 ? 67.614  -16.194  -11.571  1.00 140.76 ? 432 GLN B N    1 
ATOM   9344  C CA   . GLN B  1 292 ? 68.793  -15.361  -11.353  1.00 135.99 ? 432 GLN B CA   1 
ATOM   9345  C C    . GLN B  1 292 ? 68.597  -13.990  -11.984  1.00 123.68 ? 432 GLN B C    1 
ATOM   9346  O O    . GLN B  1 292 ? 67.904  -13.858  -12.992  1.00 119.24 ? 432 GLN B O    1 
ATOM   9347  C CB   . GLN B  1 292 ? 70.038  -16.031  -11.931  1.00 143.62 ? 432 GLN B CB   1 
ATOM   9348  C CG   . GLN B  1 292 ? 70.414  -17.319  -11.227  1.00 156.82 ? 432 GLN B CG   1 
ATOM   9349  C CD   . GLN B  1 292 ? 71.637  -17.981  -11.823  1.00 164.40 ? 432 GLN B CD   1 
ATOM   9350  O OE1  . GLN B  1 292 ? 71.659  -19.194  -12.032  1.00 172.95 ? 432 GLN B OE1  1 
ATOM   9351  N NE2  . GLN B  1 292 ? 72.668  -17.189  -12.091  1.00 160.76 ? 432 GLN B NE2  1 
ATOM   9352  H H    . GLN B  1 292 ? 67.418  -16.299  -12.402  1.00 154.36 ? 432 GLN B H    1 
ATOM   9353  H HA   . GLN B  1 292 ? 68.927  -15.240  -10.400  1.00 154.15 ? 432 GLN B HA   1 
ATOM   9354  H HB2  . GLN B  1 292 ? 69.877  -16.238  -12.865  1.00 166.75 ? 432 GLN B HB2  1 
ATOM   9355  H HB3  . GLN B  1 292 ? 70.787  -15.420  -11.853  1.00 166.75 ? 432 GLN B HB3  1 
ATOM   9356  H HG2  . GLN B  1 292 ? 70.603  -17.126  -10.295  1.00 175.30 ? 432 GLN B HG2  1 
ATOM   9357  H HG3  . GLN B  1 292 ? 69.674  -17.942  -11.293  1.00 175.30 ? 432 GLN B HG3  1 
ATOM   9358  H HE21 . GLN B  1 292 ? 73.386  -17.518  -12.431  1.00 195.36 ? 432 GLN B HE21 1 
ATOM   9359  H HE22 . GLN B  1 292 ? 72.618  -16.346  -11.925  1.00 195.36 ? 432 GLN B HE22 1 
ATOM   9360  N N    . ALA B  1 293 ? 69.215  -12.976  -11.388  1.00 137.59 ? 433 ALA B N    1 
ATOM   9361  C CA   . ALA B  1 293 ? 69.070  -11.604  -11.856  1.00 125.27 ? 433 ALA B CA   1 
ATOM   9362  C C    . ALA B  1 293 ? 70.401  -10.871  -11.835  1.00 123.13 ? 433 ALA B C    1 
ATOM   9363  O O    . ALA B  1 293 ? 71.237  -11.107  -10.963  1.00 127.14 ? 433 ALA B O    1 
ATOM   9364  C CB   . ALA B  1 293 ? 68.057  -10.866  -11.009  1.00 119.72 ? 433 ALA B CB   1 
ATOM   9365  H H    . ALA B  1 293 ? 69.729  -13.058  -10.703  1.00 98.41  ? 433 ALA B H    1 
ATOM   9366  H HA   . ALA B  1 293 ? 68.747  -11.614  -12.770  1.00 91.08  ? 433 ALA B HA   1 
ATOM   9367  H HB1  . ALA B  1 293 ? 67.975  -9.956   -11.336  1.00 79.28  ? 433 ALA B HB1  1 
ATOM   9368  H HB2  . ALA B  1 293 ? 67.202  -11.319  -11.073  1.00 79.28  ? 433 ALA B HB2  1 
ATOM   9369  H HB3  . ALA B  1 293 ? 68.361  -10.860  -10.088  1.00 79.28  ? 433 ALA B HB3  1 
ATOM   9370  N N    . ILE B  1 294 ? 70.583  -9.975   -12.800  1.00 124.15 ? 434 ILE B N    1 
ATOM   9371  C CA   . ILE B  1 294 ? 71.808  -9.193   -12.917  1.00 124.62 ? 434 ILE B CA   1 
ATOM   9372  C C    . ILE B  1 294 ? 71.522  -7.700   -12.821  1.00 121.10 ? 434 ILE B C    1 
ATOM   9373  O O    . ILE B  1 294 ? 70.677  -7.170   -13.544  1.00 118.90 ? 434 ILE B O    1 
ATOM   9374  C CB   . ILE B  1 294 ? 72.527  -9.476   -14.245  1.00 126.74 ? 434 ILE B CB   1 
ATOM   9375  C CG1  . ILE B  1 294 ? 73.009  -10.926  -14.279  1.00 135.69 ? 434 ILE B CG1  1 
ATOM   9376  C CG2  . ILE B  1 294 ? 73.712  -8.529   -14.433  1.00 127.33 ? 434 ILE B CG2  1 
ATOM   9377  C CD1  . ILE B  1 294 ? 73.333  -11.431  -15.655  1.00 139.75 ? 434 ILE B CD1  1 
ATOM   9378  H H    . ILE B  1 294 ? 70.001  -9.800   -13.409  1.00 107.71 ? 434 ILE B H    1 
ATOM   9379  H HA   . ILE B  1 294 ? 72.407  -9.432   -12.193  1.00 110.24 ? 434 ILE B HA   1 
ATOM   9380  H HB   . ILE B  1 294 ? 71.900  -9.339   -14.973  1.00 122.58 ? 434 ILE B HB   1 
ATOM   9381  H HG12 . ILE B  1 294 ? 73.812  -11.000  -13.740  1.00 131.68 ? 434 ILE B HG12 1 
ATOM   9382  H HG13 . ILE B  1 294 ? 72.314  -11.495  -13.912  1.00 131.68 ? 434 ILE B HG13 1 
ATOM   9383  H HG21 . ILE B  1 294 ? 74.146  -8.730   -15.277  1.00 125.11 ? 434 ILE B HG21 1 
ATOM   9384  H HG22 . ILE B  1 294 ? 73.388  -7.615   -14.437  1.00 125.11 ? 434 ILE B HG22 1 
ATOM   9385  H HG23 . ILE B  1 294 ? 74.336  -8.656   -13.702  1.00 125.11 ? 434 ILE B HG23 1 
ATOM   9386  H HD11 . ILE B  1 294 ? 73.630  -12.352  -15.592  1.00 145.45 ? 434 ILE B HD11 1 
ATOM   9387  H HD12 . ILE B  1 294 ? 72.537  -11.377  -16.207  1.00 145.45 ? 434 ILE B HD12 1 
ATOM   9388  H HD13 . ILE B  1 294 ? 74.037  -10.882  -16.035  1.00 145.45 ? 434 ILE B HD13 1 
ATOM   9389  N N    . TYR B  1 295 ? 72.250  -7.030   -11.932  1.00 128.17 ? 435 TYR B N    1 
ATOM   9390  C CA   . TYR B  1 295 ? 72.146  -5.586   -11.767  1.00 126.51 ? 435 TYR B CA   1 
ATOM   9391  C C    . TYR B  1 295 ? 73.427  -4.937   -12.271  1.00 128.72 ? 435 TYR B C    1 
ATOM   9392  O O    . TYR B  1 295 ? 74.417  -5.623   -12.532  1.00 131.58 ? 435 TYR B O    1 
ATOM   9393  C CB   . TYR B  1 295 ? 71.888  -5.223   -10.302  1.00 126.00 ? 435 TYR B CB   1 
ATOM   9394  C CG   . TYR B  1 295 ? 70.564  -5.732   -9.778   1.00 124.05 ? 435 TYR B CG   1 
ATOM   9395  C CD1  . TYR B  1 295 ? 69.394  -5.021   -9.994   1.00 121.43 ? 435 TYR B CD1  1 
ATOM   9396  C CD2  . TYR B  1 295 ? 70.485  -6.926   -9.072   1.00 125.73 ? 435 TYR B CD2  1 
ATOM   9397  C CE1  . TYR B  1 295 ? 68.179  -5.483   -9.521   1.00 120.19 ? 435 TYR B CE1  1 
ATOM   9398  C CE2  . TYR B  1 295 ? 69.277  -7.397   -8.595   1.00 125.01 ? 435 TYR B CE2  1 
ATOM   9399  C CZ   . TYR B  1 295 ? 68.126  -6.672   -8.822   1.00 122.25 ? 435 TYR B CZ   1 
ATOM   9400  O OH   . TYR B  1 295 ? 66.922  -7.142   -8.346   1.00 122.03 ? 435 TYR B OH   1 
ATOM   9401  H H    . TYR B  1 295 ? 72.821  -7.398   -11.404  1.00 143.96 ? 435 TYR B H    1 
ATOM   9402  H HA   . TYR B  1 295 ? 71.405  -5.255   -12.299  1.00 138.48 ? 435 TYR B HA   1 
ATOM   9403  H HB2  . TYR B  1 295 ? 72.591  -5.606   -9.756   1.00 129.69 ? 435 TYR B HB2  1 
ATOM   9404  H HB3  . TYR B  1 295 ? 71.891  -4.257   -10.214  1.00 129.69 ? 435 TYR B HB3  1 
ATOM   9405  H HD1  . TYR B  1 295 ? 69.426  -4.220   -10.466  1.00 118.79 ? 435 TYR B HD1  1 
ATOM   9406  H HD2  . TYR B  1 295 ? 71.260  -7.417   -8.918   1.00 124.66 ? 435 TYR B HD2  1 
ATOM   9407  H HE1  . TYR B  1 295 ? 67.402  -4.995   -9.674   1.00 113.79 ? 435 TYR B HE1  1 
ATOM   9408  H HE2  . TYR B  1 295 ? 69.240  -8.198   -8.123   1.00 120.23 ? 435 TYR B HE2  1 
ATOM   9409  H HH   . TYR B  1 295 ? 67.037  -7.870   -7.943   1.00 110.19 ? 435 TYR B HH   1 
ATOM   9410  N N    . ALA B  1 296 ? 73.399  -3.616   -12.417  1.00 133.48 ? 436 ALA B N    1 
ATOM   9411  C CA   . ALA B  1 296 ? 74.552  -2.874   -12.915  1.00 135.79 ? 436 ALA B CA   1 
ATOM   9412  C C    . ALA B  1 296 ? 75.648  -2.824   -11.855  1.00 138.61 ? 436 ALA B C    1 
ATOM   9413  O O    . ALA B  1 296 ? 75.391  -3.097   -10.685  1.00 138.35 ? 436 ALA B O    1 
ATOM   9414  C CB   . ALA B  1 296 ? 74.138  -1.469   -13.326  1.00 134.61 ? 436 ALA B CB   1 
ATOM   9415  H H    . ALA B  1 296 ? 72.719  -3.123   -12.233  1.00 267.68 ? 436 ALA B H    1 
ATOM   9416  H HA   . ALA B  1 296 ? 74.908  -3.325   -13.696  1.00 273.24 ? 436 ALA B HA   1 
ATOM   9417  H HB1  . ALA B  1 296 ? 74.917  -0.994   -13.653  1.00 271.70 ? 436 ALA B HB1  1 
ATOM   9418  H HB2  . ALA B  1 296 ? 73.469  -1.530   -14.025  1.00 271.70 ? 436 ALA B HB2  1 
ATOM   9419  H HB3  . ALA B  1 296 ? 73.770  -1.011   -12.554  1.00 271.70 ? 436 ALA B HB3  1 
ATOM   9420  N N    . PRO B  1 297 ? 76.878  -2.481   -12.262  1.00 137.44 ? 437 PRO B N    1 
ATOM   9421  C CA   . PRO B  1 297 ? 77.982  -2.415   -11.299  1.00 140.86 ? 437 PRO B CA   1 
ATOM   9422  C C    . PRO B  1 297 ? 77.709  -1.425   -10.166  1.00 140.23 ? 437 PRO B C    1 
ATOM   9423  O O    . PRO B  1 297 ? 76.854  -0.553   -10.319  1.00 137.80 ? 437 PRO B O    1 
ATOM   9424  C CB   . PRO B  1 297 ? 79.171  -1.962   -12.154  1.00 144.25 ? 437 PRO B CB   1 
ATOM   9425  C CG   . PRO B  1 297 ? 78.808  -2.351   -13.549  1.00 143.09 ? 437 PRO B CG   1 
ATOM   9426  C CD   . PRO B  1 297 ? 77.326  -2.196   -13.636  1.00 138.59 ? 437