data_4R54
# 
_entry.id   4R54 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4R54         
RCSB  RCSB086910   
WWPDB D_1000086910 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4R3N . unspecified 
PDB 4R3W . unspecified 
PDB 4R51 . unspecified 
PDB 4R4J . unspecified 
PDB 4R41 . unspecified 
PDB 4R5H . unspecified 
PDB 4R5M . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4R54 
_pdbx_database_status.recvd_initial_deposition_date   2014-08-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pavlovsky, A.G.' 1 
'Viola, R.E.'     2 
# 
_citation.id                        primary 
_citation.title                     
'A cautionary tale of structure-guided inhibitor development against an essential enzyme in the aspartate-biosynthetic pathway.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            70 
_citation.page_first                3244 
_citation.page_last                 3252 
_citation.year                      2014 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25478842 
_citation.pdbx_database_id_DOI      10.1107/S1399004714023979 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pavlovsky, A.G.' 1 
primary 'Thangavelu, B.'  2 
primary 'Bhansali, P.'    3 
primary 'Viola, R.E.'     4 
# 
_cell.entry_id           4R54 
_cell.length_a           59.537 
_cell.length_b           98.806 
_cell.length_c           64.098 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.16 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4R54 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Aspartate-semialdehyde dehydrogenase'             40038.523 2   1.2.1.11 ? ? ? 
2 non-polymer syn 'SODIUM ION'                                       22.990    3   ?        ? ? ? 
3 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 743.405   3   ?        ? ? ? 
4 non-polymer syn 'ACETATE ION'                                      59.044    2   ?        ? ? ? 
5 non-polymer syn '3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid'  238.193   1   ?        ? ? ? 
6 water       nat water                                              18.015    262 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ASA dehydrogenase, ASADH, Aspartate-beta-semialdehyde dehydrogenase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGYTVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTETAFEGVDIALFSAGSSTSAKY
APYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPVRQKWGLDRIIVSTYQAVSGA
GMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQIDVFTDNDYTYEEMKMTKETKKIMEDDSIAVS
ATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMW
VVSDNLLKGAAWNSVQIAETLHERGLVRPTAELKFELKLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGYTVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTETAFEGVDIALFSAGSSTSAKY
APYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPVRQKWGLDRIIVSTYQAVSGA
GMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQIDVFTDNDYTYEEMKMTKETKKIMEDDSIAVS
ATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMW
VVSDNLLKGAAWNSVQIAETLHERGLVRPTAELKFELKLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   TYR n 
1 4   THR n 
1 5   VAL n 
1 6   ALA n 
1 7   VAL n 
1 8   VAL n 
1 9   GLY n 
1 10  ALA n 
1 11  THR n 
1 12  GLY n 
1 13  ALA n 
1 14  VAL n 
1 15  GLY n 
1 16  ALA n 
1 17  GLN n 
1 18  MET n 
1 19  ILE n 
1 20  LYS n 
1 21  MET n 
1 22  LEU n 
1 23  GLU n 
1 24  GLU n 
1 25  SER n 
1 26  THR n 
1 27  LEU n 
1 28  PRO n 
1 29  ILE n 
1 30  ASP n 
1 31  LYS n 
1 32  ILE n 
1 33  ARG n 
1 34  TYR n 
1 35  LEU n 
1 36  ALA n 
1 37  SER n 
1 38  ALA n 
1 39  ARG n 
1 40  SER n 
1 41  ALA n 
1 42  GLY n 
1 43  LYS n 
1 44  SER n 
1 45  LEU n 
1 46  LYS n 
1 47  PHE n 
1 48  LYS n 
1 49  ASP n 
1 50  GLN n 
1 51  ASP n 
1 52  ILE n 
1 53  THR n 
1 54  ILE n 
1 55  GLU n 
1 56  GLU n 
1 57  THR n 
1 58  THR n 
1 59  GLU n 
1 60  THR n 
1 61  ALA n 
1 62  PHE n 
1 63  GLU n 
1 64  GLY n 
1 65  VAL n 
1 66  ASP n 
1 67  ILE n 
1 68  ALA n 
1 69  LEU n 
1 70  PHE n 
1 71  SER n 
1 72  ALA n 
1 73  GLY n 
1 74  SER n 
1 75  SER n 
1 76  THR n 
1 77  SER n 
1 78  ALA n 
1 79  LYS n 
1 80  TYR n 
1 81  ALA n 
1 82  PRO n 
1 83  TYR n 
1 84  ALA n 
1 85  VAL n 
1 86  LYS n 
1 87  ALA n 
1 88  GLY n 
1 89  VAL n 
1 90  VAL n 
1 91  VAL n 
1 92  VAL n 
1 93  ASP n 
1 94  ASN n 
1 95  THR n 
1 96  SER n 
1 97  TYR n 
1 98  PHE n 
1 99  ARG n 
1 100 GLN n 
1 101 ASN n 
1 102 PRO n 
1 103 ASP n 
1 104 VAL n 
1 105 PRO n 
1 106 LEU n 
1 107 VAL n 
1 108 VAL n 
1 109 PRO n 
1 110 GLU n 
1 111 VAL n 
1 112 ASN n 
1 113 ALA n 
1 114 HIS n 
1 115 ALA n 
1 116 LEU n 
1 117 ASP n 
1 118 ALA n 
1 119 HIS n 
1 120 ASN n 
1 121 GLY n 
1 122 ILE n 
1 123 ILE n 
1 124 ALA n 
1 125 CYS n 
1 126 PRO n 
1 127 ASN n 
1 128 CYS n 
1 129 SER n 
1 130 THR n 
1 131 ILE n 
1 132 GLN n 
1 133 MET n 
1 134 MET n 
1 135 VAL n 
1 136 ALA n 
1 137 LEU n 
1 138 GLU n 
1 139 PRO n 
1 140 VAL n 
1 141 ARG n 
1 142 GLN n 
1 143 LYS n 
1 144 TRP n 
1 145 GLY n 
1 146 LEU n 
1 147 ASP n 
1 148 ARG n 
1 149 ILE n 
1 150 ILE n 
1 151 VAL n 
1 152 SER n 
1 153 THR n 
1 154 TYR n 
1 155 GLN n 
1 156 ALA n 
1 157 VAL n 
1 158 SER n 
1 159 GLY n 
1 160 ALA n 
1 161 GLY n 
1 162 MET n 
1 163 GLY n 
1 164 ALA n 
1 165 ILE n 
1 166 LEU n 
1 167 GLU n 
1 168 THR n 
1 169 GLN n 
1 170 ARG n 
1 171 GLU n 
1 172 LEU n 
1 173 ARG n 
1 174 GLU n 
1 175 VAL n 
1 176 LEU n 
1 177 ASN n 
1 178 ASP n 
1 179 GLY n 
1 180 VAL n 
1 181 LYS n 
1 182 PRO n 
1 183 CYS n 
1 184 ASP n 
1 185 LEU n 
1 186 HIS n 
1 187 ALA n 
1 188 GLU n 
1 189 ILE n 
1 190 LEU n 
1 191 PRO n 
1 192 SER n 
1 193 GLY n 
1 194 GLY n 
1 195 ASP n 
1 196 LYS n 
1 197 LYS n 
1 198 HIS n 
1 199 TYR n 
1 200 PRO n 
1 201 ILE n 
1 202 ALA n 
1 203 PHE n 
1 204 ASN n 
1 205 ALA n 
1 206 LEU n 
1 207 PRO n 
1 208 GLN n 
1 209 ILE n 
1 210 ASP n 
1 211 VAL n 
1 212 PHE n 
1 213 THR n 
1 214 ASP n 
1 215 ASN n 
1 216 ASP n 
1 217 TYR n 
1 218 THR n 
1 219 TYR n 
1 220 GLU n 
1 221 GLU n 
1 222 MET n 
1 223 LYS n 
1 224 MET n 
1 225 THR n 
1 226 LYS n 
1 227 GLU n 
1 228 THR n 
1 229 LYS n 
1 230 LYS n 
1 231 ILE n 
1 232 MET n 
1 233 GLU n 
1 234 ASP n 
1 235 ASP n 
1 236 SER n 
1 237 ILE n 
1 238 ALA n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 THR n 
1 243 CYS n 
1 244 VAL n 
1 245 ARG n 
1 246 ILE n 
1 247 PRO n 
1 248 VAL n 
1 249 LEU n 
1 250 SER n 
1 251 ALA n 
1 252 HIS n 
1 253 SER n 
1 254 GLU n 
1 255 SER n 
1 256 VAL n 
1 257 TYR n 
1 258 ILE n 
1 259 GLU n 
1 260 THR n 
1 261 LYS n 
1 262 GLU n 
1 263 VAL n 
1 264 ALA n 
1 265 PRO n 
1 266 ILE n 
1 267 GLU n 
1 268 GLU n 
1 269 VAL n 
1 270 LYS n 
1 271 ALA n 
1 272 ALA n 
1 273 ILE n 
1 274 ALA n 
1 275 ALA n 
1 276 PHE n 
1 277 PRO n 
1 278 GLY n 
1 279 ALA n 
1 280 VAL n 
1 281 LEU n 
1 282 GLU n 
1 283 ASP n 
1 284 ASP n 
1 285 VAL n 
1 286 ALA n 
1 287 HIS n 
1 288 GLN n 
1 289 ILE n 
1 290 TYR n 
1 291 PRO n 
1 292 GLN n 
1 293 ALA n 
1 294 ILE n 
1 295 ASN n 
1 296 ALA n 
1 297 VAL n 
1 298 GLY n 
1 299 SER n 
1 300 ARG n 
1 301 ASP n 
1 302 THR n 
1 303 PHE n 
1 304 VAL n 
1 305 GLY n 
1 306 ARG n 
1 307 ILE n 
1 308 ARG n 
1 309 LYS n 
1 310 ASP n 
1 311 LEU n 
1 312 ASP n 
1 313 ALA n 
1 314 GLU n 
1 315 LYS n 
1 316 GLY n 
1 317 ILE n 
1 318 HIS n 
1 319 MET n 
1 320 TRP n 
1 321 VAL n 
1 322 VAL n 
1 323 SER n 
1 324 ASP n 
1 325 ASN n 
1 326 LEU n 
1 327 LEU n 
1 328 LYS n 
1 329 GLY n 
1 330 ALA n 
1 331 ALA n 
1 332 TRP n 
1 333 ASN n 
1 334 SER n 
1 335 VAL n 
1 336 GLN n 
1 337 ILE n 
1 338 ALA n 
1 339 GLU n 
1 340 THR n 
1 341 LEU n 
1 342 HIS n 
1 343 GLU n 
1 344 ARG n 
1 345 GLY n 
1 346 LEU n 
1 347 VAL n 
1 348 ARG n 
1 349 PRO n 
1 350 THR n 
1 351 ALA n 
1 352 GLU n 
1 353 LEU n 
1 354 LYS n 
1 355 PHE n 
1 356 GLU n 
1 357 LEU n 
1 358 LYS n 
1 359 LEU n 
1 360 GLU n 
1 361 HIS n 
1 362 HIS n 
1 363 HIS n 
1 364 HIS n 
1 365 HIS n 
1 366 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'asd, CGSSp23BS72_03388' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    SP23-BS72 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptococcus pneumoniae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     406563 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A5MTN0_STREE 
_struct_ref.pdbx_db_accession          A5MTN0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MGYTVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTETAFEGVDIALFSAGSSTSAKY
APYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPVRQKWGLDRIIVSTYQAVSGA
GMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQIDVFTDNDYTYEEMKMTKETKKIMEDDSIAVS
ATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMW
VVSDNLLKGAAWNSVQIAETLHERGLVRPTAELKFELK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4R54 A 1 ? 358 ? A5MTN0 1 ? 358 ? 1 358 
2 1 4R54 B 1 ? 358 ? A5MTN0 1 ? 358 ? 1 358 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4R54 LEU A 359 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 359 1  
1 4R54 GLU A 360 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 360 2  
1 4R54 HIS A 361 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 361 3  
1 4R54 HIS A 362 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 362 4  
1 4R54 HIS A 363 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 363 5  
1 4R54 HIS A 364 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 364 6  
1 4R54 HIS A 365 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 365 7  
1 4R54 HIS A 366 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 366 8  
2 4R54 LEU B 359 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 359 9  
2 4R54 GLU B 360 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 360 10 
2 4R54 HIS B 361 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 361 11 
2 4R54 HIS B 362 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 362 12 
2 4R54 HIS B 363 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 363 13 
2 4R54 HIS B 364 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 364 14 
2 4R54 HIS B 365 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 365 15 
2 4R54 HIS B 366 ? UNP A5MTN0 ? ? 'EXPRESSION TAG' 366 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3JM non-polymer         . '3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid'  '3-carboxy-ethyl-phthalic acid'              
'C11 H10 O6'        238.193 
ACT non-polymer         . 'ACETATE ION'                                      ?                                            
'C2 H3 O2 -1'       59.044  
ALA 'L-peptide linking' y ALANINE                                            ?                                            
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                                            
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                                            
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                                            
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                           ?                                            
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                          ?                                            
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                                            
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                                            
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                          ?                                            
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                              ?                                            'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                                            
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                            ?                                            
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                                            
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                                            
'C5 H11 N O2 S'     149.211 
NA  non-polymer         . 'SODIUM ION'                                       ?                                            'Na 1' 
22.990  
NAP non-polymer         . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 
;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE
;
'C21 H28 N7 O17 P3' 743.405 
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                                            
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                                            
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                             ?                                            
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                          ?                                            
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ?                                            
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                           ?                                            
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                             ?                                            
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4R54 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   46.75 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
;15-22% PEG 3350, 0.1 M Na-acetate, 0.1 M MES (pH 6.5), 10 mM TCEP, 3% Ethylene glycol, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2014-04-18 
_diffrn_detector.details                'double crystal monochromator and K-B pair of biomorph mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.033 
# 
_reflns.entry_id                     4R54 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   65575 
_reflns.number_all                   66237 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.12 
_reflns.pdbx_netI_over_sigmaI        26.0 
_reflns.B_iso_Wilson_estimate        29.5 
_reflns.pdbx_redundancy              4.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.81 1.87 97.3 ? 0.808 ? 4.4 ? 6404 ? ? ? ? 1  1 
3.9  50   99.5 ? 0.082 ? 4.5 ? 6711 ? ? ? ? 2  1 
3.09 3.9  99.3 ? 0.113 ? 4.4 ? 6586 ? ? ? ? 3  1 
2.7  3.09 99.3 ? 0.132 ? 4.6 ? 6588 ? ? ? ? 4  1 
2.46 2.7  99.2 ? 0.147 ? 4.7 ? 6555 ? ? ? ? 5  1 
2.28 2.46 99.2 ? 0.182 ? 4.7 ? 6576 ? ? ? ? 6  1 
2.15 2.28 99.3 ? 0.230 ? 4.7 ? 6567 ? ? ? ? 7  1 
2.04 2.15 99.1 ? 0.303 ? 4.7 ? 6546 ? ? ? ? 8  1 
1.95 2.04 98.9 ? 0.406 ? 4.7 ? 6526 ? ? ? ? 9  1 
1.87 1.95 98.6 ? 0.557 ? 4.6 ? 6516 ? ? ? ? 10 1 
# 
_refine.entry_id                                 4R54 
_refine.ls_number_reflns_obs                     62262 
_refine.ls_number_reflns_all                     65575 
_refine.pdbx_ls_sigma_I                          2 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            1.81 
_refine.ls_percent_reflns_obs                    98.68 
_refine.ls_R_factor_obs                          0.18565 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18377 
_refine.ls_R_factor_R_free                       0.21946 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3303 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.967 
_refine.correlation_coeff_Fo_to_Fc_free          0.952 
_refine.B_iso_mean                               38.715 
_refine.aniso_B[1][1]                            1.10 
_refine.aniso_B[2][2]                            1.56 
_refine.aniso_B[3][3]                            -3.22 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            2.05 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      4R3N 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.133 
_refine.pdbx_overall_ESU_R_Free                  0.125 
_refine.overall_SU_ML                            0.113 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.884 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4R54 
_refine_analyze.Luzzati_coordinate_error_obs    0.133 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           6 
_refine_analyze.Luzzati_coordinate_error_free   0.125 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5448 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         172 
_refine_hist.number_atoms_solvent             262 
_refine_hist.number_atoms_total               5882 
_refine_hist.d_res_high                       1.81 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.008  0.019  ? 5769  ? 'X-RAY DIFFRACTION' 
r_bond_other_d         0.001  0.020  ? 5497  ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.377  1.998  ? 7872  ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      0.745  3.000  ? 12688 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 5.972  5.000  ? 726   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 34.096 24.914 ? 232   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 13.021 15.000 ? 963   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 19.531 15.000 ? 28    ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.074  0.200  ? 914   ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.005  0.021  ? 6436  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     0.001  0.020  ? 1211  ? 'X-RAY DIFFRACTION' 
r_mcbond_it            1.829  3.695  ? 2873  ? 'X-RAY DIFFRACTION' 
r_mcbond_other         1.826  3.693  ? 2870  ? 'X-RAY DIFFRACTION' 
r_mcangle_it           2.562  5.533  ? 3590  ? 'X-RAY DIFFRACTION' 
r_mcangle_other        2.562  5.534  ? 3591  ? 'X-RAY DIFFRACTION' 
r_scbond_it            2.401  4.035  ? 2896  ? 'X-RAY DIFFRACTION' 
r_scbond_other         2.400  4.035  ? 2893  ? 'X-RAY DIFFRACTION' 
r_scangle_other        3.717  5.932  ? 4274  ? 'X-RAY DIFFRACTION' 
r_long_range_B_refined 5.024  29.996 ? 6422  ? 'X-RAY DIFFRACTION' 
r_long_range_B_other   5.024  29.999 ? 6423  ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.808 
_refine_ls_shell.d_res_low                        1.855 
_refine_ls_shell.number_reflns_R_work             4316 
_refine_ls_shell.R_factor_R_work                  0.306 
_refine_ls_shell.percent_reflns_obs               93.17 
_refine_ls_shell.R_factor_R_free                  0.332 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             227 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4R54 
_struct.title                     
'Complex crystal structure of sp-Aspartate-Semialdehyde-Dehydrogenase with 3-carboxy-ethyl-phthalic acid' 
_struct.pdbx_descriptor           'Aspartate-semialdehyde dehydrogenase (E.C.1.2.1.11)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4R54 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'Rossmann Fold, Oxidoreductase, NADP' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
L N N 6 ? 
M N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 12  ? GLU A 24  ? GLY A 12  GLU A 24  1 ? 13 
HELX_P HELX_P2  2  GLY A 73  ? GLY A 88  ? GLY A 73  GLY A 88  1 ? 16 
HELX_P HELX_P3  3  VAL A 108 ? ALA A 113 ? VAL A 108 ALA A 113 1 ? 6  
HELX_P HELX_P4  4  HIS A 114 ? HIS A 119 ? HIS A 114 HIS A 119 5 ? 6  
HELX_P HELX_P5  5  ASN A 127 ? GLY A 145 ? ASN A 127 GLY A 145 1 ? 19 
HELX_P HELX_P6  6  ALA A 156 ? ALA A 160 ? ALA A 156 ALA A 160 5 ? 5  
HELX_P HELX_P7  7  GLY A 161 ? GLY A 179 ? GLY A 161 GLY A 179 1 ? 19 
HELX_P HELX_P8  8  LYS A 181 ? LEU A 185 ? LYS A 181 LEU A 185 5 ? 5  
HELX_P HELX_P9  9  THR A 218 ? MET A 232 ? THR A 218 MET A 232 1 ? 15 
HELX_P HELX_P10 10 PRO A 265 ? ALA A 275 ? PRO A 265 ALA A 275 1 ? 11 
HELX_P HELX_P11 11 ASP A 284 ? GLN A 288 ? ASP A 284 GLN A 288 5 ? 5  
HELX_P HELX_P12 12 GLN A 292 ? VAL A 297 ? GLN A 292 VAL A 297 1 ? 6  
HELX_P HELX_P13 13 ALA A 330 ? ARG A 344 ? ALA A 330 ARG A 344 1 ? 15 
HELX_P HELX_P14 14 GLY B 12  ? GLU B 24  ? GLY B 12  GLU B 24  1 ? 13 
HELX_P HELX_P15 15 GLY B 73  ? ALA B 87  ? GLY B 73  ALA B 87  1 ? 15 
HELX_P HELX_P16 16 VAL B 108 ? ALA B 113 ? VAL B 108 ALA B 113 1 ? 6  
HELX_P HELX_P17 17 HIS B 114 ? HIS B 119 ? HIS B 114 HIS B 119 5 ? 6  
HELX_P HELX_P18 18 ASN B 127 ? GLY B 145 ? ASN B 127 GLY B 145 1 ? 19 
HELX_P HELX_P19 19 ALA B 156 ? ALA B 160 ? ALA B 156 ALA B 160 5 ? 5  
HELX_P HELX_P20 20 GLY B 161 ? GLY B 179 ? GLY B 161 GLY B 179 1 ? 19 
HELX_P HELX_P21 21 LYS B 181 ? LEU B 185 ? LYS B 181 LEU B 185 5 ? 5  
HELX_P HELX_P22 22 THR B 218 ? MET B 232 ? THR B 218 MET B 232 1 ? 15 
HELX_P HELX_P23 23 PRO B 265 ? PHE B 276 ? PRO B 265 PHE B 276 1 ? 12 
HELX_P HELX_P24 24 ASP B 284 ? GLN B 288 ? ASP B 284 GLN B 288 5 ? 5  
HELX_P HELX_P25 25 GLN B 292 ? VAL B 297 ? GLN B 292 VAL B 297 1 ? 6  
HELX_P HELX_P26 26 ALA B 330 ? ARG B 344 ? ALA B 330 ARG B 344 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A PHE 276 O   ? ? ? 1_555 C NA  . NA ? ? A PHE 276 A NA  401 1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc2  metalc ? ? A ALA 279 O   ? ? ? 1_555 C NA  . NA ? ? A ALA 279 A NA  401 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc3  metalc ? ? A GLU 343 O   ? ? ? 1_555 D NA  . NA ? ? A GLU 343 A NA  402 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc4  metalc ? ? B SER 236 O   ? ? ? 1_555 H NA  . NA ? ? B SER 236 B NA  401 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc5  metalc ? ? A ALA 274 O   ? ? ? 1_555 C NA  . NA ? ? A ALA 274 A NA  401 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc6  metalc ? ? B ASP 147 OD1 ? ? ? 1_555 H NA  . NA ? ? B ASP 147 B NA  401 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc7  metalc ? ? B ASP 147 O   ? ? ? 1_555 H NA  . NA ? ? B ASP 147 B NA  401 1_555 ? ? ? ? ? ? ? 2.533 ? 
metalc8  metalc ? ? H NA  .   NA  ? ? ? 1_555 M HOH . O  ? ? B NA  401 B HOH 572 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc9  metalc ? ? H NA  .   NA  ? ? ? 1_555 M HOH . O  ? ? B NA  401 B HOH 602 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc10 metalc ? ? H NA  .   NA  ? ? ? 1_555 M HOH . O  ? ? B NA  401 B HOH 524 1_555 ? ? ? ? ? ? ? 2.503 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 190 A . ? LEU 190 A PRO 191 A ? PRO 191 A 1 2.86 
2 LEU 190 B . ? LEU 190 B PRO 191 B ? PRO 191 B 1 3.75 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 6 ? 
C ? 6 ? 
D ? 2 ? 
E ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 44  ? PHE A 47  ? SER A 44  PHE A 47  
A 2 GLN A 50  ? GLU A 56  ? GLN A 50  GLU A 56  
A 3 ILE A 29  ? ALA A 36  ? ILE A 29  ALA A 36  
A 4 TYR A 3   ? VAL A 8   ? TYR A 3   VAL A 8   
A 5 ILE A 67  ? PHE A 70  ? ILE A 67  PHE A 70  
A 6 VAL A 90  ? ASP A 93  ? VAL A 90  ASP A 93  
A 7 ILE A 122 ? ALA A 124 ? ILE A 122 ALA A 124 
B 1 ALA A 238 ? THR A 242 ? ALA A 238 THR A 242 
B 2 ARG A 148 ? TYR A 154 ? ARG A 148 TYR A 154 
B 3 HIS A 252 ? GLU A 259 ? HIS A 252 GLU A 259 
B 4 GLY A 316 ? SER A 323 ? GLY A 316 SER A 323 
B 5 THR A 302 ? LYS A 309 ? THR A 302 LYS A 309 
B 6 ALA A 279 ? LEU A 281 ? ALA A 279 LEU A 281 
C 1 GLU B 55  ? GLU B 56  ? GLU B 55  GLU B 56  
C 2 ILE B 29  ? ALA B 36  ? ILE B 29  ALA B 36  
C 3 TYR B 3   ? VAL B 8   ? TYR B 3   VAL B 8   
C 4 ILE B 67  ? PHE B 70  ? ILE B 67  PHE B 70  
C 5 VAL B 90  ? ASP B 93  ? VAL B 90  ASP B 93  
C 6 ILE B 122 ? ALA B 124 ? ILE B 122 ALA B 124 
D 1 SER B 44  ? PHE B 47  ? SER B 44  PHE B 47  
D 2 GLN B 50  ? THR B 53  ? GLN B 50  THR B 53  
E 1 ALA B 238 ? ARG B 245 ? ALA B 238 ARG B 245 
E 2 ARG B 148 ? GLN B 155 ? ARG B 148 GLN B 155 
E 3 HIS B 252 ? GLU B 259 ? HIS B 252 GLU B 259 
E 4 GLY B 316 ? SER B 323 ? GLY B 316 SER B 323 
E 5 THR B 302 ? LYS B 309 ? THR B 302 LYS B 309 
E 6 ALA B 279 ? LEU B 281 ? ALA B 279 LEU B 281 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 47  ? N PHE A 47  O GLN A 50  ? O GLN A 50  
A 2 3 O GLU A 55  ? O GLU A 55  N TYR A 34  ? N TYR A 34  
A 3 4 O LEU A 35  ? O LEU A 35  N VAL A 7   ? N VAL A 7   
A 4 5 N VAL A 8   ? N VAL A 8   O LEU A 69  ? O LEU A 69  
A 5 6 N ALA A 68  ? N ALA A 68  O VAL A 92  ? O VAL A 92  
A 6 7 N VAL A 91  ? N VAL A 91  O ILE A 123 ? O ILE A 123 
B 1 2 O THR A 242 ? O THR A 242 N THR A 153 ? N THR A 153 
B 2 3 N ILE A 150 ? N ILE A 150 O TYR A 257 ? O TYR A 257 
B 3 4 N ILE A 258 ? N ILE A 258 O ILE A 317 ? O ILE A 317 
B 4 5 O VAL A 322 ? O VAL A 322 N PHE A 303 ? N PHE A 303 
B 5 6 O THR A 302 ? O THR A 302 N VAL A 280 ? N VAL A 280 
C 1 2 O GLU B 55  ? O GLU B 55  N TYR B 34  ? N TYR B 34  
C 2 3 O LEU B 35  ? O LEU B 35  N VAL B 7   ? N VAL B 7   
C 3 4 N ALA B 6   ? N ALA B 6   O LEU B 69  ? O LEU B 69  
C 4 5 N ALA B 68  ? N ALA B 68  O VAL B 92  ? O VAL B 92  
C 5 6 N VAL B 91  ? N VAL B 91  O ILE B 123 ? O ILE B 123 
D 1 2 N PHE B 47  ? N PHE B 47  O GLN B 50  ? O GLN B 50  
E 1 2 O ALA B 238 ? O ALA B 238 N ILE B 149 ? N ILE B 149 
E 2 3 N TYR B 154 ? N TYR B 154 O SER B 253 ? O SER B 253 
E 3 4 N ILE B 258 ? N ILE B 258 O ILE B 317 ? O ILE B 317 
E 4 5 O VAL B 322 ? O VAL B 322 N PHE B 303 ? N PHE B 303 
E 5 6 O THR B 302 ? O THR B 302 N VAL B 280 ? N VAL B 280 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 401'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 402'  
AC3 Software ? ? ? ? 30 'BINDING SITE FOR RESIDUE NAP A 403' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ACT A 404' 
AC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 3JM A 405' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA B 401'  
AC7 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE NAP B 402' 
AC8 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE NAP B 403' 
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT B 404' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  ILE A 273 ? ILE A 273 . ? 1_555 ? 
2   AC1 6  ALA A 274 ? ALA A 274 . ? 1_555 ? 
3   AC1 6  PHE A 276 ? PHE A 276 . ? 1_555 ? 
4   AC1 6  ALA A 279 ? ALA A 279 . ? 1_555 ? 
5   AC1 6  GLU B 343 ? GLU B 343 . ? 1_556 ? 
6   AC1 6  HOH M .   ? HOH B 591 . ? 1_556 ? 
7   AC2 6  GLU A 343 ? GLU A 343 . ? 1_555 ? 
8   AC2 6  ILE B 273 ? ILE B 273 . ? 1_556 ? 
9   AC2 6  ALA B 274 ? ALA B 274 . ? 1_556 ? 
10  AC2 6  PHE B 276 ? PHE B 276 . ? 1_556 ? 
11  AC2 6  ALA B 279 ? ALA B 279 . ? 1_556 ? 
12  AC2 6  HOH M .   ? HOH B 612 . ? 1_556 ? 
13  AC3 30 GLY A 9   ? GLY A 9   . ? 1_555 ? 
14  AC3 30 THR A 11  ? THR A 11  . ? 1_555 ? 
15  AC3 30 GLY A 12  ? GLY A 12  . ? 1_555 ? 
16  AC3 30 ALA A 13  ? ALA A 13  . ? 1_555 ? 
17  AC3 30 VAL A 14  ? VAL A 14  . ? 1_555 ? 
18  AC3 30 ALA A 36  ? ALA A 36  . ? 1_555 ? 
19  AC3 30 SER A 37  ? SER A 37  . ? 1_555 ? 
20  AC3 30 ARG A 39  ? ARG A 39  . ? 1_555 ? 
21  AC3 30 SER A 40  ? SER A 40  . ? 1_555 ? 
22  AC3 30 THR A 57  ? THR A 57  . ? 1_555 ? 
23  AC3 30 SER A 71  ? SER A 71  . ? 1_555 ? 
24  AC3 30 ALA A 72  ? ALA A 72  . ? 1_555 ? 
25  AC3 30 GLY A 73  ? GLY A 73  . ? 1_555 ? 
26  AC3 30 THR A 76  ? THR A 76  . ? 1_555 ? 
27  AC3 30 ASN A 94  ? ASN A 94  . ? 1_555 ? 
28  AC3 30 THR A 95  ? THR A 95  . ? 1_555 ? 
29  AC3 30 ARG A 99  ? ARG A 99  . ? 1_555 ? 
30  AC3 30 PRO A 126 ? PRO A 126 . ? 1_555 ? 
31  AC3 30 ASN A 127 ? ASN A 127 . ? 1_555 ? 
32  AC3 30 CYS A 128 ? CYS A 128 . ? 1_555 ? 
33  AC3 30 GLY A 161 ? GLY A 161 . ? 1_555 ? 
34  AC3 30 MET A 162 ? MET A 162 . ? 1_555 ? 
35  AC3 30 GLY A 329 ? GLY A 329 . ? 1_555 ? 
36  AC3 30 3JM G .   ? 3JM A 405 . ? 1_555 ? 
37  AC3 30 HOH L .   ? HOH A 570 . ? 1_555 ? 
38  AC3 30 HOH L .   ? HOH A 571 . ? 1_555 ? 
39  AC3 30 HOH L .   ? HOH A 585 . ? 1_555 ? 
40  AC3 30 HOH L .   ? HOH A 608 . ? 1_555 ? 
41  AC3 30 HOH L .   ? HOH A 625 . ? 1_555 ? 
42  AC3 30 HOH L .   ? HOH A 633 . ? 1_555 ? 
43  AC4 8  ASN A 127 ? ASN A 127 . ? 1_555 ? 
44  AC4 8  CYS A 128 ? CYS A 128 . ? 1_555 ? 
45  AC4 8  GLN A 155 ? GLN A 155 . ? 1_555 ? 
46  AC4 8  GLY A 159 ? GLY A 159 . ? 1_555 ? 
47  AC4 8  GLU A 220 ? GLU A 220 . ? 1_555 ? 
48  AC4 8  ARG A 245 ? ARG A 245 . ? 1_555 ? 
49  AC4 8  HIS A 252 ? HIS A 252 . ? 1_555 ? 
50  AC4 8  3JM G .   ? 3JM A 405 . ? 1_555 ? 
51  AC5 11 GLY A 73  ? GLY A 73  . ? 1_555 ? 
52  AC5 11 SER A 74  ? SER A 74  . ? 1_555 ? 
53  AC5 11 THR A 95  ? THR A 95  . ? 1_555 ? 
54  AC5 11 SER A 96  ? SER A 96  . ? 1_555 ? 
55  AC5 11 ARG A 99  ? ARG A 99  . ? 1_555 ? 
56  AC5 11 ASN A 127 ? ASN A 127 . ? 1_555 ? 
57  AC5 11 GLY A 159 ? GLY A 159 . ? 1_555 ? 
58  AC5 11 LYS A 223 ? LYS A 223 . ? 1_555 ? 
59  AC5 11 NAP E .   ? NAP A 403 . ? 1_555 ? 
60  AC5 11 ACT F .   ? ACT A 404 . ? 1_555 ? 
61  AC5 11 HOH L .   ? HOH A 552 . ? 1_555 ? 
62  AC6 5  ASP B 147 ? ASP B 147 . ? 1_555 ? 
63  AC6 5  SER B 236 ? SER B 236 . ? 1_555 ? 
64  AC6 5  HOH M .   ? HOH B 524 . ? 1_555 ? 
65  AC6 5  HOH M .   ? HOH B 572 . ? 1_555 ? 
66  AC6 5  HOH M .   ? HOH B 602 . ? 1_555 ? 
67  AC7 15 GLY B 9   ? GLY B 9   . ? 1_555 ? 
68  AC7 15 THR B 11  ? THR B 11  . ? 1_555 ? 
69  AC7 15 GLY B 12  ? GLY B 12  . ? 1_555 ? 
70  AC7 15 ALA B 13  ? ALA B 13  . ? 1_555 ? 
71  AC7 15 ALA B 36  ? ALA B 36  . ? 1_555 ? 
72  AC7 15 SER B 37  ? SER B 37  . ? 1_555 ? 
73  AC7 15 ARG B 39  ? ARG B 39  . ? 1_555 ? 
74  AC7 15 SER B 40  ? SER B 40  . ? 1_555 ? 
75  AC7 15 THR B 57  ? THR B 57  . ? 1_555 ? 
76  AC7 15 ALA B 72  ? ALA B 72  . ? 1_555 ? 
77  AC7 15 THR B 76  ? THR B 76  . ? 1_555 ? 
78  AC7 15 GLY B 161 ? GLY B 161 . ? 1_555 ? 
79  AC7 15 MET B 162 ? MET B 162 . ? 1_555 ? 
80  AC7 15 GLY B 163 ? GLY B 163 . ? 1_555 ? 
81  AC7 15 NAP J .   ? NAP B 403 . ? 1_555 ? 
82  AC8 25 GLY B 9   ? GLY B 9   . ? 1_555 ? 
83  AC8 25 THR B 11  ? THR B 11  . ? 1_555 ? 
84  AC8 25 GLY B 12  ? GLY B 12  . ? 1_555 ? 
85  AC8 25 ALA B 13  ? ALA B 13  . ? 1_555 ? 
86  AC8 25 VAL B 14  ? VAL B 14  . ? 1_555 ? 
87  AC8 25 ALA B 36  ? ALA B 36  . ? 1_555 ? 
88  AC8 25 SER B 37  ? SER B 37  . ? 1_555 ? 
89  AC8 25 SER B 40  ? SER B 40  . ? 1_555 ? 
90  AC8 25 THR B 57  ? THR B 57  . ? 1_555 ? 
91  AC8 25 SER B 71  ? SER B 71  . ? 1_555 ? 
92  AC8 25 ALA B 72  ? ALA B 72  . ? 1_555 ? 
93  AC8 25 GLY B 73  ? GLY B 73  . ? 1_555 ? 
94  AC8 25 THR B 76  ? THR B 76  . ? 1_555 ? 
95  AC8 25 ASN B 94  ? ASN B 94  . ? 1_555 ? 
96  AC8 25 THR B 95  ? THR B 95  . ? 1_555 ? 
97  AC8 25 PRO B 126 ? PRO B 126 . ? 1_555 ? 
98  AC8 25 ASN B 127 ? ASN B 127 . ? 1_555 ? 
99  AC8 25 CYS B 128 ? CYS B 128 . ? 1_555 ? 
100 AC8 25 GLY B 161 ? GLY B 161 . ? 1_555 ? 
101 AC8 25 MET B 162 ? MET B 162 . ? 1_555 ? 
102 AC8 25 GLY B 329 ? GLY B 329 . ? 1_555 ? 
103 AC8 25 NAP I .   ? NAP B 402 . ? 1_555 ? 
104 AC8 25 ACT K .   ? ACT B 404 . ? 1_555 ? 
105 AC8 25 HOH M .   ? HOH B 584 . ? 1_555 ? 
106 AC8 25 HOH M .   ? HOH B 595 . ? 1_555 ? 
107 AC9 4  ARG B 99  ? ARG B 99  . ? 1_555 ? 
108 AC9 4  ASN B 127 ? ASN B 127 . ? 1_555 ? 
109 AC9 4  LYS B 223 ? LYS B 223 . ? 1_555 ? 
110 AC9 4  NAP J .   ? NAP B 403 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4R54 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4R54 
_atom_sites.fract_transf_matrix[1][1]   0.016796 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003312 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010121 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015902 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 2   ? -9.874  -2.381  33.550  1.00 43.99 ? 2   GLY A N   1 
ATOM   2    C  CA  . GLY A 1 2   ? -9.487  -2.787  32.180  1.00 41.52 ? 2   GLY A CA  1 
ATOM   3    C  C   . GLY A 1 2   ? -10.173 -1.902  31.166  1.00 40.18 ? 2   GLY A C   1 
ATOM   4    O  O   . GLY A 1 2   ? -11.042 -1.106  31.534  1.00 40.73 ? 2   GLY A O   1 
ATOM   5    N  N   . TYR A 1 3   ? -9.807  -2.054  29.892  1.00 35.56 ? 3   TYR A N   1 
ATOM   6    C  CA  . TYR A 1 3   ? -10.287 -1.161  28.840  1.00 35.04 ? 3   TYR A CA  1 
ATOM   7    C  C   . TYR A 1 3   ? -11.385 -1.806  28.009  1.00 35.26 ? 3   TYR A C   1 
ATOM   8    O  O   . TYR A 1 3   ? -11.465 -3.037  27.907  1.00 35.60 ? 3   TYR A O   1 
ATOM   9    C  CB  . TYR A 1 3   ? -9.144  -0.742  27.915  1.00 33.38 ? 3   TYR A CB  1 
ATOM   10   C  CG  . TYR A 1 3   ? -8.011  -0.002  28.599  1.00 32.29 ? 3   TYR A CG  1 
ATOM   11   C  CD1 . TYR A 1 3   ? -8.196  1.288   29.108  1.00 33.35 ? 3   TYR A CD1 1 
ATOM   12   C  CD2 . TYR A 1 3   ? -6.756  -0.586  28.736  1.00 34.59 ? 3   TYR A CD2 1 
ATOM   13   C  CE1 . TYR A 1 3   ? -7.159  1.965   29.731  1.00 32.10 ? 3   TYR A CE1 1 
ATOM   14   C  CE2 . TYR A 1 3   ? -5.719  0.082   29.362  1.00 34.19 ? 3   TYR A CE2 1 
ATOM   15   C  CZ  . TYR A 1 3   ? -5.929  1.358   29.845  1.00 34.71 ? 3   TYR A CZ  1 
ATOM   16   O  OH  . TYR A 1 3   ? -4.899  2.017   30.463  1.00 35.10 ? 3   TYR A OH  1 
ATOM   17   N  N   . THR A 1 4   ? -12.240 -0.957  27.446  1.00 33.67 ? 4   THR A N   1 
ATOM   18   C  CA  . THR A 1 4   ? -13.057 -1.340  26.305  1.00 34.53 ? 4   THR A CA  1 
ATOM   19   C  C   . THR A 1 4   ? -12.316 -0.948  25.037  1.00 33.28 ? 4   THR A C   1 
ATOM   20   O  O   . THR A 1 4   ? -12.022 0.238   24.822  1.00 31.72 ? 4   THR A O   1 
ATOM   21   C  CB  . THR A 1 4   ? -14.438 -0.654  26.348  1.00 35.17 ? 4   THR A CB  1 
ATOM   22   O  OG1 . THR A 1 4   ? -15.132 -1.115  27.501  1.00 37.44 ? 4   THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 4   ? -15.245 -0.990  25.111  1.00 37.27 ? 4   THR A CG2 1 
ATOM   24   N  N   . VAL A 1 5   ? -12.005 -1.943  24.203  1.00 32.32 ? 5   VAL A N   1 
ATOM   25   C  CA  . VAL A 1 5   ? -11.241 -1.724  22.992  1.00 33.68 ? 5   VAL A CA  1 
ATOM   26   C  C   . VAL A 1 5   ? -12.074 -2.064  21.755  1.00 35.56 ? 5   VAL A C   1 
ATOM   27   O  O   . VAL A 1 5   ? -12.676 -3.144  21.672  1.00 34.89 ? 5   VAL A O   1 
ATOM   28   C  CB  . VAL A 1 5   ? -9.949  -2.565  22.978  1.00 35.64 ? 5   VAL A CB  1 
ATOM   29   C  CG1 . VAL A 1 5   ? -9.155  -2.313  21.698  1.00 36.19 ? 5   VAL A CG1 1 
ATOM   30   C  CG2 . VAL A 1 5   ? -9.115  -2.267  24.214  1.00 33.91 ? 5   VAL A CG2 1 
ATOM   31   N  N   . ALA A 1 6   ? -12.092 -1.144  20.793  1.00 34.54 ? 6   ALA A N   1 
ATOM   32   C  CA  . ALA A 1 6   ? -12.771 -1.379  19.535  1.00 34.79 ? 6   ALA A CA  1 
ATOM   33   C  C   . ALA A 1 6   ? -11.767 -1.539  18.389  1.00 33.08 ? 6   ALA A C   1 
ATOM   34   O  O   . ALA A 1 6   ? -10.834 -0.773  18.285  1.00 31.92 ? 6   ALA A O   1 
ATOM   35   C  CB  . ALA A 1 6   ? -13.726 -0.235  19.245  1.00 36.88 ? 6   ALA A CB  1 
ATOM   36   N  N   . VAL A 1 7   ? -11.981 -2.527  17.525  1.00 32.37 ? 7   VAL A N   1 
ATOM   37   C  CA  . VAL A 1 7   ? -11.190 -2.691  16.306  1.00 32.39 ? 7   VAL A CA  1 
ATOM   38   C  C   . VAL A 1 7   ? -12.063 -2.297  15.136  1.00 31.14 ? 7   VAL A C   1 
ATOM   39   O  O   . VAL A 1 7   ? -13.034 -2.999  14.845  1.00 34.10 ? 7   VAL A O   1 
ATOM   40   C  CB  . VAL A 1 7   ? -10.757 -4.159  16.115  1.00 34.04 ? 7   VAL A CB  1 
ATOM   41   C  CG1 . VAL A 1 7   ? -9.984  -4.309  14.810  1.00 34.32 ? 7   VAL A CG1 1 
ATOM   42   C  CG2 . VAL A 1 7   ? -9.937  -4.661  17.313  1.00 36.10 ? 7   VAL A CG2 1 
ATOM   43   N  N   . VAL A 1 8   ? -11.741 -1.178  14.487  1.00 30.12 ? 8   VAL A N   1 
ATOM   44   C  CA  . VAL A 1 8   ? -12.486 -0.693  13.331  1.00 32.26 ? 8   VAL A CA  1 
ATOM   45   C  C   . VAL A 1 8   ? -11.831 -1.239  12.067  1.00 33.71 ? 8   VAL A C   1 
ATOM   46   O  O   . VAL A 1 8   ? -10.643 -1.026  11.830  1.00 32.97 ? 8   VAL A O   1 
ATOM   47   C  CB  . VAL A 1 8   ? -12.564 0.848   13.303  1.00 33.46 ? 8   VAL A CB  1 
ATOM   48   C  CG1 . VAL A 1 8   ? -13.344 1.348   12.091  1.00 33.80 ? 8   VAL A CG1 1 
ATOM   49   C  CG2 . VAL A 1 8   ? -13.212 1.348   14.576  1.00 34.91 ? 8   VAL A CG2 1 
ATOM   50   N  N   . GLY A 1 9   ? -12.597 -1.990  11.287  1.00 31.27 ? 9   GLY A N   1 
ATOM   51   C  CA  . GLY A 1 9   ? -12.051 -2.797  10.183  1.00 32.68 ? 9   GLY A CA  1 
ATOM   52   C  C   . GLY A 1 9   ? -11.506 -4.138  10.668  1.00 34.04 ? 9   GLY A C   1 
ATOM   53   O  O   . GLY A 1 9   ? -10.375 -4.512  10.332  1.00 33.84 ? 9   GLY A O   1 
ATOM   54   N  N   . ALA A 1 10  ? -12.308 -4.851  11.472  1.00 32.86 ? 10  ALA A N   1 
ATOM   55   C  CA  . ALA A 1 10  ? -11.899 -6.078  12.141  1.00 31.07 ? 10  ALA A CA  1 
ATOM   56   C  C   . ALA A 1 10  ? -11.813 -7.297  11.217  1.00 33.27 ? 10  ALA A C   1 
ATOM   57   O  O   . ALA A 1 10  ? -11.161 -8.278  11.568  1.00 33.10 ? 10  ALA A O   1 
ATOM   58   C  CB  . ALA A 1 10  ? -12.852 -6.382  13.281  1.00 32.43 ? 10  ALA A CB  1 
ATOM   59   N  N   . THR A 1 11  ? -12.477 -7.216  10.061  1.00 34.08 ? 11  THR A N   1 
ATOM   60   C  CA  . THR A 1 11  ? -12.651 -8.335  9.134   1.00 36.28 ? 11  THR A CA  1 
ATOM   61   C  C   . THR A 1 11  ? -11.637 -8.417  8.005   1.00 37.39 ? 11  THR A C   1 
ATOM   62   O  O   . THR A 1 11  ? -11.646 -9.376  7.249   1.00 36.65 ? 11  THR A O   1 
ATOM   63   C  CB  . THR A 1 11  ? -14.030 -8.234  8.429   1.00 38.04 ? 11  THR A CB  1 
ATOM   64   O  OG1 . THR A 1 11  ? -14.242 -6.885  7.987   1.00 38.15 ? 11  THR A OG1 1 
ATOM   65   C  CG2 . THR A 1 11  ? -15.139 -8.620  9.368   1.00 39.23 ? 11  THR A CG2 1 
ATOM   66   N  N   . GLY A 1 12  ? -10.794 -7.407  7.841   1.00 39.01 ? 12  GLY A N   1 
ATOM   67   C  CA  . GLY A 1 12  ? -9.845  -7.404  6.724   1.00 39.68 ? 12  GLY A CA  1 
ATOM   68   C  C   . GLY A 1 12  ? -8.500  -8.033  7.084   1.00 37.65 ? 12  GLY A C   1 
ATOM   69   O  O   . GLY A 1 12  ? -8.357  -8.688  8.113   1.00 35.25 ? 12  GLY A O   1 
ATOM   70   N  N   . ALA A 1 13  ? -7.521  -7.816  6.218   1.00 36.17 ? 13  ALA A N   1 
ATOM   71   C  CA  . ALA A 1 13  ? -6.201  -8.410  6.374   1.00 35.88 ? 13  ALA A CA  1 
ATOM   72   C  C   . ALA A 1 13  ? -5.519  -7.889  7.640   1.00 32.91 ? 13  ALA A C   1 
ATOM   73   O  O   . ALA A 1 13  ? -5.027  -8.679  8.441   1.00 34.95 ? 13  ALA A O   1 
ATOM   74   C  CB  . ALA A 1 13  ? -5.355  -8.135  5.144   1.00 36.35 ? 13  ALA A CB  1 
ATOM   75   N  N   . VAL A 1 14  ? -5.520  -6.569  7.828   1.00 32.68 ? 14  VAL A N   1 
ATOM   76   C  CA  . VAL A 1 14  ? -4.928  -5.963  9.004   1.00 32.91 ? 14  VAL A CA  1 
ATOM   77   C  C   . VAL A 1 14  ? -5.737  -6.319  10.235  1.00 32.59 ? 14  VAL A C   1 
ATOM   78   O  O   . VAL A 1 14  ? -5.178  -6.623  11.272  1.00 31.15 ? 14  VAL A O   1 
ATOM   79   C  CB  . VAL A 1 14  ? -4.808  -4.426  8.879   1.00 35.58 ? 14  VAL A CB  1 
ATOM   80   C  CG1 . VAL A 1 14  ? -4.363  -3.810  10.197  1.00 34.87 ? 14  VAL A CG1 1 
ATOM   81   C  CG2 . VAL A 1 14  ? -3.825  -4.045  7.776   1.00 35.76 ? 14  VAL A CG2 1 
ATOM   82   N  N   . GLY A 1 15  ? -7.064  -6.276  10.115  1.00 31.17 ? 15  GLY A N   1 
ATOM   83   C  CA  . GLY A 1 15  ? -7.918  -6.531  11.244  1.00 31.51 ? 15  GLY A CA  1 
ATOM   84   C  C   . GLY A 1 15  ? -7.771  -7.899  11.853  1.00 31.36 ? 15  GLY A C   1 
ATOM   85   O  O   . GLY A 1 15  ? -7.865  -8.040  13.057  1.00 30.31 ? 15  GLY A O   1 
ATOM   86   N  N   . ALA A 1 16  ? -7.546  -8.918  11.027  1.00 31.06 ? 16  ALA A N   1 
ATOM   87   C  CA  . ALA A 1 16  ? -7.305  -10.247 11.545  1.00 32.27 ? 16  ALA A CA  1 
ATOM   88   C  C   . ALA A 1 16  ? -6.030  -10.284 12.400  1.00 30.64 ? 16  ALA A C   1 
ATOM   89   O  O   . ALA A 1 16  ? -5.953  -11.014 13.402  1.00 31.35 ? 16  ALA A O   1 
ATOM   90   C  CB  . ALA A 1 16  ? -7.185  -11.263 10.401  1.00 33.21 ? 16  ALA A CB  1 
ATOM   91   N  N   . GLN A 1 17  ? -5.018  -9.543  11.985  1.00 30.10 ? 17  GLN A N   1 
ATOM   92   C  CA  . GLN A 1 17  ? -3.780  -9.485  12.777  1.00 30.47 ? 17  GLN A CA  1 
ATOM   93   C  C   . GLN A 1 17  ? -3.943  -8.564  13.992  1.00 29.13 ? 17  GLN A C   1 
ATOM   94   O  O   . GLN A 1 17  ? -3.323  -8.789  15.030  1.00 29.35 ? 17  GLN A O   1 
ATOM   95   C  CB  . GLN A 1 17  ? -2.611  -9.061  11.901  1.00 31.80 ? 17  GLN A CB  1 
ATOM   96   C  CG  . GLN A 1 17  ? -2.343  -10.003 10.739  1.00 33.34 ? 17  GLN A CG  1 
ATOM   97   C  CD  . GLN A 1 17  ? -2.252  -11.452 11.162  1.00 34.64 ? 17  GLN A CD  1 
ATOM   98   O  OE1 . GLN A 1 17  ? -1.751  -11.771 12.233  1.00 34.56 ? 17  GLN A OE1 1 
ATOM   99   N  NE2 . GLN A 1 17  ? -2.762  -12.334 10.329  1.00 37.21 ? 17  GLN A NE2 1 
ATOM   100  N  N   . MET A 1 18  ? -4.794  -7.544  13.890  1.00 30.43 ? 18  MET A N   1 
ATOM   101  C  CA  A MET A 1 18  ? -5.080  -6.706  15.058  0.50 30.35 ? 18  MET A CA  1 
ATOM   102  C  CA  B MET A 1 18  ? -5.118  -6.710  15.061  0.50 30.85 ? 18  MET A CA  1 
ATOM   103  C  C   . MET A 1 18  ? -5.686  -7.578  16.160  1.00 30.97 ? 18  MET A C   1 
ATOM   104  O  O   . MET A 1 18  ? -5.314  -7.451  17.318  1.00 31.42 ? 18  MET A O   1 
ATOM   105  C  CB  A MET A 1 18  ? -5.989  -5.529  14.698  0.50 31.84 ? 18  MET A CB  1 
ATOM   106  C  CB  B MET A 1 18  ? -6.143  -5.646  14.723  0.50 32.90 ? 18  MET A CB  1 
ATOM   107  C  CG  A MET A 1 18  ? -5.305  -4.487  13.816  0.50 34.71 ? 18  MET A CG  1 
ATOM   108  C  CG  B MET A 1 18  ? -5.538  -4.412  14.122  0.50 36.32 ? 18  MET A CG  1 
ATOM   109  S  SD  A MET A 1 18  ? -6.152  -2.890  13.723  0.50 35.42 ? 18  MET A SD  1 
ATOM   110  S  SD  B MET A 1 18  ? -4.519  -3.501  15.295  0.50 37.67 ? 18  MET A SD  1 
ATOM   111  C  CE  A MET A 1 18  ? -4.788  -1.846  13.231  0.50 36.46 ? 18  MET A CE  1 
ATOM   112  C  CE  B MET A 1 18  ? -4.267  -2.099  14.219  0.50 35.66 ? 18  MET A CE  1 
ATOM   113  N  N   . ILE A 1 19  ? -6.591  -8.477  15.769  1.00 32.84 ? 19  ILE A N   1 
ATOM   114  C  CA  . ILE A 1 19  ? -7.234  -9.412  16.692  1.00 32.22 ? 19  ILE A CA  1 
ATOM   115  C  C   . ILE A 1 19  ? -6.209  -10.329 17.328  1.00 34.82 ? 19  ILE A C   1 
ATOM   116  O  O   . ILE A 1 19  ? -6.204  -10.508 18.549  1.00 36.28 ? 19  ILE A O   1 
ATOM   117  C  CB  . ILE A 1 19  ? -8.353  -10.224 15.986  1.00 31.09 ? 19  ILE A CB  1 
ATOM   118  C  CG1 . ILE A 1 19  ? -9.523  -9.295  15.672  1.00 31.49 ? 19  ILE A CG1 1 
ATOM   119  C  CG2 . ILE A 1 19  ? -8.822  -11.384 16.857  1.00 32.15 ? 19  ILE A CG2 1 
ATOM   120  C  CD1 . ILE A 1 19  ? -10.555 -9.835  14.704  1.00 32.29 ? 19  ILE A CD1 1 
ATOM   121  N  N   . LYS A 1 20  ? -5.348  -10.923 16.516  1.00 35.76 ? 20  LYS A N   1 
ATOM   122  C  CA  . LYS A 1 20  ? -4.285  -11.791 17.056  1.00 37.49 ? 20  LYS A CA  1 
ATOM   123  C  C   . LYS A 1 20  ? -3.329  -11.034 18.015  1.00 34.87 ? 20  LYS A C   1 
ATOM   124  O  O   . LYS A 1 20  ? -2.989  -11.511 19.110  1.00 31.83 ? 20  LYS A O   1 
ATOM   125  C  CB  . LYS A 1 20  ? -3.520  -12.409 15.896  1.00 40.85 ? 20  LYS A CB  1 
ATOM   126  C  CG  . LYS A 1 20  ? -2.612  -13.574 16.255  1.00 47.07 ? 20  LYS A CG  1 
ATOM   127  C  CD  . LYS A 1 20  ? -1.946  -14.158 15.007  1.00 52.86 ? 20  LYS A CD  1 
ATOM   128  C  CE  . LYS A 1 20  ? -2.962  -14.686 13.992  1.00 58.72 ? 20  LYS A CE  1 
ATOM   129  N  NZ  . LYS A 1 20  ? -2.342  -15.213 12.739  1.00 61.60 ? 20  LYS A NZ  1 
ATOM   130  N  N   . MET A 1 21  ? -2.905  -9.843  17.622  1.00 31.30 ? 21  MET A N   1 
ATOM   131  C  CA  . MET A 1 21  ? -1.982  -9.057  18.474  1.00 30.95 ? 21  MET A CA  1 
ATOM   132  C  C   . MET A 1 21  ? -2.655  -8.626  19.778  1.00 30.57 ? 21  MET A C   1 
ATOM   133  O  O   . MET A 1 21  ? -2.013  -8.562  20.810  1.00 32.36 ? 21  MET A O   1 
ATOM   134  C  CB  . MET A 1 21  ? -1.457  -7.817  17.717  1.00 31.94 ? 21  MET A CB  1 
ATOM   135  C  CG  . MET A 1 21  ? -0.589  -8.147  16.496  1.00 31.39 ? 21  MET A CG  1 
ATOM   136  S  SD  . MET A 1 21  ? 0.949   -9.018  16.926  1.00 32.16 ? 21  MET A SD  1 
ATOM   137  C  CE  . MET A 1 21  ? 0.523   -10.730 16.591  1.00 32.16 ? 21  MET A CE  1 
ATOM   138  N  N   . LEU A 1 22  ? -3.965  -8.357  19.733  1.00 30.68 ? 22  LEU A N   1 
ATOM   139  C  CA  . LEU A 1 22  ? -4.714  -8.007  20.936  1.00 32.37 ? 22  LEU A CA  1 
ATOM   140  C  C   . LEU A 1 22  ? -4.904  -9.234  21.821  1.00 31.88 ? 22  LEU A C   1 
ATOM   141  O  O   . LEU A 1 22  ? -4.756  -9.161  23.048  1.00 31.57 ? 22  LEU A O   1 
ATOM   142  C  CB  . LEU A 1 22  ? -6.075  -7.371  20.570  1.00 33.34 ? 22  LEU A CB  1 
ATOM   143  C  CG  . LEU A 1 22  ? -6.014  -5.920  20.082  1.00 33.86 ? 22  LEU A CG  1 
ATOM   144  C  CD1 . LEU A 1 22  ? -7.335  -5.507  19.439  1.00 34.78 ? 22  LEU A CD1 1 
ATOM   145  C  CD2 . LEU A 1 22  ? -5.675  -4.983  21.232  1.00 34.95 ? 22  LEU A CD2 1 
ATOM   146  N  N   . GLU A 1 23  ? -5.197  -10.366 21.194  1.00 33.69 ? 23  GLU A N   1 
ATOM   147  C  CA  . GLU A 1 23  ? -5.314  -11.626 21.918  1.00 35.07 ? 23  GLU A CA  1 
ATOM   148  C  C   . GLU A 1 23  ? -4.021  -11.922 22.690  1.00 36.47 ? 23  GLU A C   1 
ATOM   149  O  O   . GLU A 1 23  ? -4.057  -12.470 23.784  1.00 36.89 ? 23  GLU A O   1 
ATOM   150  C  CB  . GLU A 1 23  ? -5.651  -12.768 20.958  1.00 36.66 ? 23  GLU A CB  1 
ATOM   151  C  CG  . GLU A 1 23  ? -7.116  -12.802 20.525  1.00 38.88 ? 23  GLU A CG  1 
ATOM   152  C  CD  . GLU A 1 23  ? -7.373  -13.797 19.407  1.00 41.25 ? 23  GLU A CD  1 
ATOM   153  O  OE1 . GLU A 1 23  ? -6.399  -14.245 18.772  1.00 45.17 ? 23  GLU A OE1 1 
ATOM   154  O  OE2 . GLU A 1 23  ? -8.555  -14.124 19.146  1.00 43.92 ? 23  GLU A OE2 1 
ATOM   155  N  N   . GLU A 1 24  ? -2.894  -11.499 22.135  1.00 35.03 ? 24  GLU A N   1 
ATOM   156  C  CA  . GLU A 1 24  ? -1.572  -11.777 22.701  1.00 35.24 ? 24  GLU A CA  1 
ATOM   157  C  C   . GLU A 1 24  ? -0.981  -10.597 23.461  1.00 36.14 ? 24  GLU A C   1 
ATOM   158  O  O   . GLU A 1 24  ? 0.165   -10.648 23.913  1.00 36.20 ? 24  GLU A O   1 
ATOM   159  C  CB  . GLU A 1 24  ? -0.635  -12.225 21.586  1.00 35.43 ? 24  GLU A CB  1 
ATOM   160  C  CG  . GLU A 1 24  ? -1.081  -13.537 20.943  1.00 36.90 ? 24  GLU A CG  1 
ATOM   161  C  CD  . GLU A 1 24  ? -0.254  -13.958 19.730  1.00 40.76 ? 24  GLU A CD  1 
ATOM   162  O  OE1 . GLU A 1 24  ? 0.765   -13.301 19.425  1.00 42.30 ? 24  GLU A OE1 1 
ATOM   163  O  OE2 . GLU A 1 24  ? -0.629  -14.957 19.069  1.00 43.09 ? 24  GLU A OE2 1 
ATOM   164  N  N   . SER A 1 25  ? -1.774  -9.549  23.632  1.00 34.29 ? 25  SER A N   1 
ATOM   165  C  CA  . SER A 1 25  ? -1.298  -8.305  24.211  1.00 35.06 ? 25  SER A CA  1 
ATOM   166  C  C   . SER A 1 25  ? -1.313  -8.339  25.735  1.00 36.85 ? 25  SER A C   1 
ATOM   167  O  O   . SER A 1 25  ? -1.980  -9.186  26.330  1.00 38.33 ? 25  SER A O   1 
ATOM   168  C  CB  . SER A 1 25  ? -2.195  -7.172  23.723  1.00 36.45 ? 25  SER A CB  1 
ATOM   169  O  OG  . SER A 1 25  ? -1.840  -5.936  24.278  1.00 38.35 ? 25  SER A OG  1 
ATOM   170  N  N   . THR A 1 26  ? -0.555  -7.425  26.343  1.00 36.38 ? 26  THR A N   1 
ATOM   171  C  CA  . THR A 1 26  ? -0.569  -7.209  27.793  1.00 37.08 ? 26  THR A CA  1 
ATOM   172  C  C   . THR A 1 26  ? -1.617  -6.182  28.233  1.00 38.36 ? 26  THR A C   1 
ATOM   173  O  O   . THR A 1 26  ? -1.817  -5.973  29.416  1.00 42.71 ? 26  THR A O   1 
ATOM   174  C  CB  . THR A 1 26  ? 0.814   -6.749  28.319  1.00 35.91 ? 26  THR A CB  1 
ATOM   175  O  OG1 . THR A 1 26  ? 1.231   -5.557  27.646  1.00 35.74 ? 26  THR A OG1 1 
ATOM   176  C  CG2 . THR A 1 26  ? 1.840   -7.834  28.101  1.00 36.86 ? 26  THR A CG2 1 
ATOM   177  N  N   . LEU A 1 27  ? -2.270  -5.526  27.285  1.00 37.58 ? 27  LEU A N   1 
ATOM   178  C  CA  . LEU A 1 27  ? -3.380  -4.607  27.589  1.00 38.64 ? 27  LEU A CA  1 
ATOM   179  C  C   . LEU A 1 27  ? -4.465  -5.305  28.443  1.00 37.12 ? 27  LEU A C   1 
ATOM   180  O  O   . LEU A 1 27  ? -4.890  -6.406  28.107  1.00 36.13 ? 27  LEU A O   1 
ATOM   181  C  CB  . LEU A 1 27  ? -3.986  -4.141  26.270  1.00 40.14 ? 27  LEU A CB  1 
ATOM   182  C  CG  . LEU A 1 27  ? -4.236  -2.676  25.984  1.00 43.37 ? 27  LEU A CG  1 
ATOM   183  C  CD1 . LEU A 1 27  ? -3.119  -1.788  26.495  1.00 43.63 ? 27  LEU A CD1 1 
ATOM   184  C  CD2 . LEU A 1 27  ? -4.443  -2.511  24.482  1.00 44.21 ? 27  LEU A CD2 1 
ATOM   185  N  N   . PRO A 1 28  ? -4.897  -4.683  29.562  1.00 36.85 ? 28  PRO A N   1 
ATOM   186  C  CA  . PRO A 1 28  ? -6.003  -5.258  30.316  1.00 38.06 ? 28  PRO A CA  1 
ATOM   187  C  C   . PRO A 1 28  ? -7.320  -4.937  29.608  1.00 37.21 ? 28  PRO A C   1 
ATOM   188  O  O   . PRO A 1 28  ? -7.776  -3.801  29.619  1.00 39.13 ? 28  PRO A O   1 
ATOM   189  C  CB  . PRO A 1 28  ? -5.915  -4.543  31.659  1.00 35.65 ? 28  PRO A CB  1 
ATOM   190  C  CG  . PRO A 1 28  ? -5.365  -3.210  31.315  1.00 35.88 ? 28  PRO A CG  1 
ATOM   191  C  CD  . PRO A 1 28  ? -4.449  -3.412  30.146  1.00 36.85 ? 28  PRO A CD  1 
ATOM   192  N  N   . ILE A 1 29  ? -7.903  -5.929  28.974  1.00 36.71 ? 29  ILE A N   1 
ATOM   193  C  CA  . ILE A 1 29  ? -9.091  -5.703  28.157  1.00 38.71 ? 29  ILE A CA  1 
ATOM   194  C  C   . ILE A 1 29  ? -10.308 -6.327  28.836  1.00 40.00 ? 29  ILE A C   1 
ATOM   195  O  O   . ILE A 1 29  ? -10.353 -7.547  29.022  1.00 38.05 ? 29  ILE A O   1 
ATOM   196  C  CB  . ILE A 1 29  ? -8.900  -6.321  26.762  1.00 37.00 ? 29  ILE A CB  1 
ATOM   197  C  CG1 . ILE A 1 29  ? -7.661  -5.704  26.074  1.00 36.97 ? 29  ILE A CG1 1 
ATOM   198  C  CG2 . ILE A 1 29  ? -10.165 -6.156  25.917  1.00 37.06 ? 29  ILE A CG2 1 
ATOM   199  C  CD1 . ILE A 1 29  ? -7.216  -6.449  24.823  1.00 38.28 ? 29  ILE A CD1 1 
ATOM   200  N  N   . ASP A 1 30  ? -11.274 -5.489  29.212  1.00 40.30 ? 30  ASP A N   1 
ATOM   201  C  CA  . ASP A 1 30  ? -12.525 -5.953  29.824  1.00 41.35 ? 30  ASP A CA  1 
ATOM   202  C  C   . ASP A 1 30  ? -13.574 -6.256  28.758  1.00 41.08 ? 30  ASP A C   1 
ATOM   203  O  O   . ASP A 1 30  ? -14.373 -7.169  28.924  1.00 41.16 ? 30  ASP A O   1 
ATOM   204  C  CB  . ASP A 1 30  ? -13.119 -4.897  30.759  1.00 43.55 ? 30  ASP A CB  1 
ATOM   205  C  CG  . ASP A 1 30  ? -12.351 -4.738  32.049  1.00 46.73 ? 30  ASP A CG  1 
ATOM   206  O  OD1 . ASP A 1 30  ? -11.594 -5.645  32.453  1.00 46.63 ? 30  ASP A OD1 1 
ATOM   207  O  OD2 . ASP A 1 30  ? -12.508 -3.666  32.660  1.00 51.83 ? 30  ASP A OD2 1 
ATOM   208  N  N   . LYS A 1 31  ? -13.583 -5.474  27.680  1.00 37.29 ? 31  LYS A N   1 
ATOM   209  C  CA  . LYS A 1 31  ? -14.535 -5.679  26.598  1.00 38.90 ? 31  LYS A CA  1 
ATOM   210  C  C   . LYS A 1 31  ? -13.920 -5.390  25.225  1.00 38.25 ? 31  LYS A C   1 
ATOM   211  O  O   . LYS A 1 31  ? -13.236 -4.385  25.050  1.00 34.73 ? 31  LYS A O   1 
ATOM   212  C  CB  . LYS A 1 31  ? -15.754 -4.775  26.813  1.00 41.22 ? 31  LYS A CB  1 
ATOM   213  C  CG  . LYS A 1 31  ? -16.763 -4.831  25.677  1.00 45.26 ? 31  LYS A CG  1 
ATOM   214  C  CD  . LYS A 1 31  ? -18.069 -4.165  26.039  1.00 49.35 ? 31  LYS A CD  1 
ATOM   215  C  CE  . LYS A 1 31  ? -19.135 -4.440  24.991  1.00 54.42 ? 31  LYS A CE  1 
ATOM   216  N  NZ  . LYS A 1 31  ? -20.482 -3.995  25.460  1.00 58.56 ? 31  LYS A NZ  1 
ATOM   217  N  N   . ILE A 1 32  ? -14.189 -6.282  24.273  1.00 38.98 ? 32  ILE A N   1 
ATOM   218  C  CA  . ILE A 1 32  ? -13.820 -6.122  22.858  1.00 37.76 ? 32  ILE A CA  1 
ATOM   219  C  C   . ILE A 1 32  ? -15.048 -5.856  21.985  1.00 37.75 ? 32  ILE A C   1 
ATOM   220  O  O   . ILE A 1 32  ? -16.064 -6.555  22.091  1.00 35.53 ? 32  ILE A O   1 
ATOM   221  C  CB  . ILE A 1 32  ? -13.099 -7.387  22.355  1.00 40.62 ? 32  ILE A CB  1 
ATOM   222  C  CG1 . ILE A 1 32  ? -11.632 -7.356  22.796  1.00 44.03 ? 32  ILE A CG1 1 
ATOM   223  C  CG2 . ILE A 1 32  ? -13.156 -7.522  20.843  1.00 43.42 ? 32  ILE A CG2 1 
ATOM   224  C  CD1 . ILE A 1 32  ? -10.761 -6.437  21.962  1.00 44.81 ? 32  ILE A CD1 1 
ATOM   225  N  N   . ARG A 1 33  ? -14.940 -4.855  21.107  1.00 35.88 ? 33  ARG A N   1 
ATOM   226  C  CA  . ARG A 1 33  ? -15.964 -4.604  20.104  1.00 35.75 ? 33  ARG A CA  1 
ATOM   227  C  C   . ARG A 1 33  ? -15.313 -4.669  18.725  1.00 36.08 ? 33  ARG A C   1 
ATOM   228  O  O   . ARG A 1 33  ? -14.168 -4.205  18.536  1.00 32.20 ? 33  ARG A O   1 
ATOM   229  C  CB  . ARG A 1 33  ? -16.642 -3.243  20.356  1.00 37.12 ? 33  ARG A CB  1 
ATOM   230  C  CG  . ARG A 1 33  ? -17.479 -3.247  21.636  1.00 36.61 ? 33  ARG A CG  1 
ATOM   231  C  CD  . ARG A 1 33  ? -18.212 -1.955  21.917  1.00 40.50 ? 33  ARG A CD  1 
ATOM   232  N  NE  . ARG A 1 33  ? -19.071 -1.542  20.812  1.00 40.46 ? 33  ARG A NE  1 
ATOM   233  C  CZ  . ARG A 1 33  ? -19.512 -0.298  20.619  1.00 47.57 ? 33  ARG A CZ  1 
ATOM   234  N  NH1 . ARG A 1 33  ? -19.203 0.690   21.466  1.00 48.14 ? 33  ARG A NH1 1 
ATOM   235  N  NH2 . ARG A 1 33  ? -20.279 -0.030  19.564  1.00 50.30 ? 33  ARG A NH2 1 
ATOM   236  N  N   . TYR A 1 34  ? -16.019 -5.286  17.785  1.00 32.24 ? 34  TYR A N   1 
ATOM   237  C  CA  . TYR A 1 34  ? -15.584 -5.371  16.381  1.00 31.10 ? 34  TYR A CA  1 
ATOM   238  C  C   . TYR A 1 34  ? -16.474 -4.546  15.463  1.00 32.33 ? 34  TYR A C   1 
ATOM   239  O  O   . TYR A 1 34  ? -17.715 -4.767  15.390  1.00 30.67 ? 34  TYR A O   1 
ATOM   240  C  CB  . TYR A 1 34  ? -15.592 -6.822  15.910  1.00 30.86 ? 34  TYR A CB  1 
ATOM   241  C  CG  . TYR A 1 34  ? -14.556 -7.747  16.509  1.00 31.89 ? 34  TYR A CG  1 
ATOM   242  C  CD1 . TYR A 1 34  ? -13.361 -7.276  17.065  1.00 31.32 ? 34  TYR A CD1 1 
ATOM   243  C  CD2 . TYR A 1 34  ? -14.755 -9.128  16.478  1.00 32.12 ? 34  TYR A CD2 1 
ATOM   244  C  CE1 . TYR A 1 34  ? -12.418 -8.158  17.579  1.00 31.55 ? 34  TYR A CE1 1 
ATOM   245  C  CE2 . TYR A 1 34  ? -13.822 -10.002 16.982  1.00 31.94 ? 34  TYR A CE2 1 
ATOM   246  C  CZ  . TYR A 1 34  ? -12.654 -9.516  17.530  1.00 30.84 ? 34  TYR A CZ  1 
ATOM   247  O  OH  . TYR A 1 34  ? -11.749 -10.414 18.027  1.00 33.65 ? 34  TYR A OH  1 
ATOM   248  N  N   . LEU A 1 35  ? -15.854 -3.610  14.737  1.00 32.29 ? 35  LEU A N   1 
ATOM   249  C  CA  . LEU A 1 35  ? -16.571 -2.738  13.810  1.00 33.33 ? 35  LEU A CA  1 
ATOM   250  C  C   . LEU A 1 35  ? -16.015 -2.907  12.400  1.00 34.20 ? 35  LEU A C   1 
ATOM   251  O  O   . LEU A 1 35  ? -14.807 -3.115  12.198  1.00 33.53 ? 35  LEU A O   1 
ATOM   252  C  CB  . LEU A 1 35  ? -16.486 -1.270  14.234  1.00 35.11 ? 35  LEU A CB  1 
ATOM   253  C  CG  . LEU A 1 35  ? -17.333 -0.743  15.403  1.00 36.52 ? 35  LEU A CG  1 
ATOM   254  C  CD1 . LEU A 1 35  ? -17.206 -1.595  16.649  1.00 37.32 ? 35  LEU A CD1 1 
ATOM   255  C  CD2 . LEU A 1 35  ? -16.941 0.697   15.729  1.00 35.84 ? 35  LEU A CD2 1 
ATOM   256  N  N   . ALA A 1 36  ? -16.917 -2.863  11.434  1.00 32.07 ? 36  ALA A N   1 
ATOM   257  C  CA  . ALA A 1 36  ? -16.587 -2.999  10.025  1.00 33.67 ? 36  ALA A CA  1 
ATOM   258  C  C   . ALA A 1 36  ? -17.648 -2.225  9.235   1.00 35.46 ? 36  ALA A C   1 
ATOM   259  O  O   . ALA A 1 36  ? -18.136 -1.223  9.723   1.00 36.41 ? 36  ALA A O   1 
ATOM   260  C  CB  . ALA A 1 36  ? -16.533 -4.458  9.640   1.00 32.70 ? 36  ALA A CB  1 
ATOM   261  N  N   . SER A 1 37  ? -17.977 -2.646  8.024   1.00 35.27 ? 37  SER A N   1 
ATOM   262  C  CA  . SER A 1 37  ? -18.952 -1.917  7.214   1.00 36.44 ? 37  SER A CA  1 
ATOM   263  C  C   . SER A 1 37  ? -20.334 -2.525  7.394   1.00 34.35 ? 37  SER A C   1 
ATOM   264  O  O   . SER A 1 37  ? -20.490 -3.557  8.049   1.00 32.96 ? 37  SER A O   1 
ATOM   265  C  CB  . SER A 1 37  ? -18.549 -1.948  5.725   1.00 37.48 ? 37  SER A CB  1 
ATOM   266  O  OG  . SER A 1 37  ? -18.876 -3.197  5.119   1.00 38.11 ? 37  SER A OG  1 
ATOM   267  N  N   . ALA A 1 38  ? -21.351 -1.910  6.790   1.00 36.51 ? 38  ALA A N   1 
ATOM   268  C  CA  . ALA A 1 38  ? -22.654 -2.557  6.729   1.00 39.52 ? 38  ALA A CA  1 
ATOM   269  C  C   . ALA A 1 38  ? -22.566 -4.017  6.233   1.00 43.60 ? 38  ALA A C   1 
ATOM   270  O  O   . ALA A 1 38  ? -23.312 -4.869  6.704   1.00 45.68 ? 38  ALA A O   1 
ATOM   271  C  CB  . ALA A 1 38  ? -23.611 -1.739  5.864   1.00 41.22 ? 38  ALA A CB  1 
ATOM   272  N  N   . ARG A 1 39  ? -21.644 -4.316  5.312   1.00 46.77 ? 39  ARG A N   1 
ATOM   273  C  CA  . ARG A 1 39  ? -21.538 -5.673  4.737   1.00 48.49 ? 39  ARG A CA  1 
ATOM   274  C  C   . ARG A 1 39  ? -21.295 -6.776  5.760   1.00 47.11 ? 39  ARG A C   1 
ATOM   275  O  O   . ARG A 1 39  ? -21.917 -7.832  5.679   1.00 49.05 ? 39  ARG A O   1 
ATOM   276  C  CB  . ARG A 1 39  ? -20.453 -5.736  3.664   1.00 53.17 ? 39  ARG A CB  1 
ATOM   277  C  CG  . ARG A 1 39  ? -20.798 -4.945  2.410   1.00 59.26 ? 39  ARG A CG  1 
ATOM   278  C  CD  . ARG A 1 39  ? -19.689 -5.024  1.371   1.00 63.24 ? 39  ARG A CD  1 
ATOM   279  N  NE  . ARG A 1 39  ? -18.419 -4.491  1.869   1.00 64.72 ? 39  ARG A NE  1 
ATOM   280  C  CZ  . ARG A 1 39  ? -18.140 -3.197  2.018   1.00 64.09 ? 39  ARG A CZ  1 
ATOM   281  N  NH1 . ARG A 1 39  ? -19.040 -2.263  1.717   1.00 67.13 ? 39  ARG A NH1 1 
ATOM   282  N  NH2 . ARG A 1 39  ? -16.950 -2.831  2.479   1.00 62.89 ? 39  ARG A NH2 1 
ATOM   283  N  N   . SER A 1 40  ? -20.397 -6.535  6.712   1.00 42.99 ? 40  SER A N   1 
ATOM   284  C  CA  . SER A 1 40  ? -20.075 -7.530  7.739   1.00 42.69 ? 40  SER A CA  1 
ATOM   285  C  C   . SER A 1 40  ? -20.930 -7.440  8.997   1.00 41.03 ? 40  SER A C   1 
ATOM   286  O  O   . SER A 1 40  ? -20.889 -8.345  9.819   1.00 40.31 ? 40  SER A O   1 
ATOM   287  C  CB  . SER A 1 40  ? -18.601 -7.419  8.156   1.00 42.25 ? 40  SER A CB  1 
ATOM   288  O  OG  . SER A 1 40  ? -17.764 -7.479  7.036   1.00 45.40 ? 40  SER A OG  1 
ATOM   289  N  N   . ALA A 1 41  ? -21.672 -6.341  9.157   1.00 42.09 ? 41  ALA A N   1 
ATOM   290  C  CA  . ALA A 1 41  ? -22.486 -6.104  10.347  1.00 43.64 ? 41  ALA A CA  1 
ATOM   291  C  C   . ALA A 1 41  ? -23.471 -7.240  10.549  1.00 43.94 ? 41  ALA A C   1 
ATOM   292  O  O   . ALA A 1 41  ? -24.187 -7.624  9.620   1.00 42.17 ? 41  ALA A O   1 
ATOM   293  C  CB  . ALA A 1 41  ? -23.213 -4.771  10.236  1.00 42.85 ? 41  ALA A CB  1 
ATOM   294  N  N   . GLY A 1 42  ? -23.469 -7.806  11.755  1.00 43.85 ? 42  GLY A N   1 
ATOM   295  C  CA  . GLY A 1 42  ? -24.304 -8.949  12.072  1.00 42.85 ? 42  GLY A CA  1 
ATOM   296  C  C   . GLY A 1 42  ? -23.565 -10.272 12.026  1.00 45.18 ? 42  GLY A C   1 
ATOM   297  O  O   . GLY A 1 42  ? -23.975 -11.227 12.682  1.00 48.36 ? 42  GLY A O   1 
ATOM   298  N  N   . LYS A 1 43  ? -22.477 -10.361 11.267  1.00 43.58 ? 43  LYS A N   1 
ATOM   299  C  CA  . LYS A 1 43  ? -21.674 -11.593 11.275  1.00 45.85 ? 43  LYS A CA  1 
ATOM   300  C  C   . LYS A 1 43  ? -20.923 -11.702 12.604  1.00 42.93 ? 43  LYS A C   1 
ATOM   301  O  O   . LYS A 1 43  ? -20.944 -10.765 13.397  1.00 39.11 ? 43  LYS A O   1 
ATOM   302  C  CB  . LYS A 1 43  ? -20.722 -11.642 10.077  1.00 50.20 ? 43  LYS A CB  1 
ATOM   303  C  CG  . LYS A 1 43  ? -21.449 -11.738 8.739   1.00 53.64 ? 43  LYS A CG  1 
ATOM   304  C  CD  . LYS A 1 43  ? -20.594 -11.238 7.586   1.00 58.12 ? 43  LYS A CD  1 
ATOM   305  C  CE  . LYS A 1 43  ? -20.867 -11.982 6.282   1.00 61.80 ? 43  LYS A CE  1 
ATOM   306  N  NZ  . LYS A 1 43  ? -20.033 -13.217 6.176   1.00 65.97 ? 43  LYS A NZ  1 
ATOM   307  N  N   . SER A 1 44  ? -20.306 -12.854 12.854  1.00 43.62 ? 44  SER A N   1 
ATOM   308  C  CA  . SER A 1 44  ? -19.633 -13.126 14.120  1.00 46.68 ? 44  SER A CA  1 
ATOM   309  C  C   . SER A 1 44  ? -18.165 -13.459 13.915  1.00 45.24 ? 44  SER A C   1 
ATOM   310  O  O   . SER A 1 44  ? -17.777 -13.988 12.882  1.00 42.08 ? 44  SER A O   1 
ATOM   311  C  CB  . SER A 1 44  ? -20.306 -14.296 14.836  1.00 48.55 ? 44  SER A CB  1 
ATOM   312  O  OG  . SER A 1 44  ? -19.677 -14.553 16.075  1.00 52.46 ? 44  SER A OG  1 
ATOM   313  N  N   . LEU A 1 45  ? -17.360 -13.182 14.930  1.00 45.59 ? 45  LEU A N   1 
ATOM   314  C  CA  . LEU A 1 45  ? -15.911 -13.390 14.849  1.00 43.84 ? 45  LEU A CA  1 
ATOM   315  C  C   . LEU A 1 45  ? -15.389 -13.629 16.258  1.00 42.55 ? 45  LEU A C   1 
ATOM   316  O  O   . LEU A 1 45  ? -15.854 -13.002 17.204  1.00 44.36 ? 45  LEU A O   1 
ATOM   317  C  CB  . LEU A 1 45  ? -15.264 -12.150 14.213  1.00 46.38 ? 45  LEU A CB  1 
ATOM   318  C  CG  . LEU A 1 45  ? -13.979 -12.207 13.385  1.00 46.64 ? 45  LEU A CG  1 
ATOM   319  C  CD1 . LEU A 1 45  ? -13.966 -13.313 12.330  1.00 45.79 ? 45  LEU A CD1 1 
ATOM   320  C  CD2 . LEU A 1 45  ? -13.768 -10.853 12.715  1.00 44.96 ? 45  LEU A CD2 1 
ATOM   321  N  N   . LYS A 1 46  ? -14.422 -14.521 16.401  1.00 41.55 ? 46  LYS A N   1 
ATOM   322  C  CA  . LYS A 1 46  ? -13.850 -14.833 17.715  1.00 44.30 ? 46  LYS A CA  1 
ATOM   323  C  C   . LYS A 1 46  ? -12.922 -13.757 18.274  1.00 41.81 ? 46  LYS A C   1 
ATOM   324  O  O   . LYS A 1 46  ? -12.183 -13.106 17.539  1.00 44.04 ? 46  LYS A O   1 
ATOM   325  C  CB  . LYS A 1 46  ? -13.066 -16.143 17.651  1.00 46.81 ? 46  LYS A CB  1 
ATOM   326  C  CG  . LYS A 1 46  ? -13.891 -17.359 17.248  1.00 49.29 ? 46  LYS A CG  1 
ATOM   327  C  CD  . LYS A 1 46  ? -14.695 -17.891 18.421  1.00 51.87 ? 46  LYS A CD  1 
ATOM   328  C  CE  . LYS A 1 46  ? -15.422 -19.166 18.026  1.00 52.94 ? 46  LYS A CE  1 
ATOM   329  N  NZ  . LYS A 1 46  ? -16.379 -19.585 19.077  1.00 54.71 ? 46  LYS A NZ  1 
ATOM   330  N  N   . PHE A 1 47  ? -12.991 -13.559 19.582  1.00 41.69 ? 47  PHE A N   1 
ATOM   331  C  CA  . PHE A 1 47  ? -11.869 -13.039 20.352  1.00 40.90 ? 47  PHE A CA  1 
ATOM   332  C  C   . PHE A 1 47  ? -11.575 -14.125 21.371  1.00 44.46 ? 47  PHE A C   1 
ATOM   333  O  O   . PHE A 1 47  ? -12.394 -14.388 22.266  1.00 45.72 ? 47  PHE A O   1 
ATOM   334  C  CB  . PHE A 1 47  ? -12.190 -11.725 21.063  1.00 40.80 ? 47  PHE A CB  1 
ATOM   335  C  CG  . PHE A 1 47  ? -10.998 -11.124 21.772  1.00 41.46 ? 47  PHE A CG  1 
ATOM   336  C  CD1 . PHE A 1 47  ? -10.109 -10.308 21.088  1.00 42.68 ? 47  PHE A CD1 1 
ATOM   337  C  CD2 . PHE A 1 47  ? -10.757 -11.390 23.110  1.00 41.19 ? 47  PHE A CD2 1 
ATOM   338  C  CE1 . PHE A 1 47  ? -9.004  -9.765  21.728  1.00 43.47 ? 47  PHE A CE1 1 
ATOM   339  C  CE2 . PHE A 1 47  ? -9.661  -10.843 23.758  1.00 44.37 ? 47  PHE A CE2 1 
ATOM   340  C  CZ  . PHE A 1 47  ? -8.780  -10.028 23.063  1.00 43.47 ? 47  PHE A CZ  1 
ATOM   341  N  N   . LYS A 1 48  ? -10.416 -14.754 21.224  1.00 44.91 ? 48  LYS A N   1 
ATOM   342  C  CA  . LYS A 1 48  ? -10.084 -15.961 21.955  1.00 48.48 ? 48  LYS A CA  1 
ATOM   343  C  C   . LYS A 1 48  ? -11.220 -16.966 21.745  1.00 48.09 ? 48  LYS A C   1 
ATOM   344  O  O   . LYS A 1 48  ? -11.453 -17.375 20.615  1.00 45.41 ? 48  LYS A O   1 
ATOM   345  C  CB  . LYS A 1 48  ? -9.789  -15.638 23.420  1.00 50.06 ? 48  LYS A CB  1 
ATOM   346  C  CG  . LYS A 1 48  ? -8.595  -14.721 23.554  1.00 52.25 ? 48  LYS A CG  1 
ATOM   347  C  CD  . LYS A 1 48  ? -8.238  -14.415 24.991  1.00 54.95 ? 48  LYS A CD  1 
ATOM   348  C  CE  . LYS A 1 48  ? -6.890  -13.711 25.045  1.00 57.52 ? 48  LYS A CE  1 
ATOM   349  N  NZ  . LYS A 1 48  ? -6.664  -13.015 26.336  1.00 60.14 ? 48  LYS A NZ  1 
ATOM   350  N  N   . ASP A 1 49  ? -11.947 -17.330 22.798  1.00 52.63 ? 49  ASP A N   1 
ATOM   351  C  CA  . ASP A 1 49  ? -13.054 -18.296 22.673  1.00 56.11 ? 49  ASP A CA  1 
ATOM   352  C  C   . ASP A 1 49  ? -14.427 -17.614 22.535  1.00 54.14 ? 49  ASP A C   1 
ATOM   353  O  O   . ASP A 1 49  ? -15.410 -18.272 22.194  1.00 53.75 ? 49  ASP A O   1 
ATOM   354  C  CB  . ASP A 1 49  ? -13.059 -19.264 23.866  1.00 61.90 ? 49  ASP A CB  1 
ATOM   355  C  CG  . ASP A 1 49  ? -12.936 -18.550 25.218  1.00 67.66 ? 49  ASP A CG  1 
ATOM   356  O  OD1 . ASP A 1 49  ? -12.673 -17.324 25.253  1.00 73.83 ? 49  ASP A OD1 1 
ATOM   357  O  OD2 . ASP A 1 49  ? -13.087 -19.225 26.256  1.00 74.67 ? 49  ASP A OD2 1 
ATOM   358  N  N   . GLN A 1 50  ? -14.482 -16.302 22.773  1.00 49.81 ? 50  GLN A N   1 
ATOM   359  C  CA  . GLN A 1 50  ? -15.743 -15.558 22.760  1.00 51.83 ? 50  GLN A CA  1 
ATOM   360  C  C   . GLN A 1 50  ? -16.160 -15.203 21.342  1.00 48.51 ? 50  GLN A C   1 
ATOM   361  O  O   . GLN A 1 50  ? -15.334 -14.773 20.537  1.00 46.73 ? 50  GLN A O   1 
ATOM   362  C  CB  . GLN A 1 50  ? -15.636 -14.250 23.557  1.00 54.80 ? 50  GLN A CB  1 
ATOM   363  C  CG  . GLN A 1 50  ? -15.027 -14.352 24.948  1.00 61.66 ? 50  GLN A CG  1 
ATOM   364  C  CD  . GLN A 1 50  ? -15.741 -15.338 25.851  1.00 68.53 ? 50  GLN A CD  1 
ATOM   365  O  OE1 . GLN A 1 50  ? -15.102 -16.120 26.562  1.00 71.97 ? 50  GLN A OE1 1 
ATOM   366  N  NE2 . GLN A 1 50  ? -17.073 -15.306 25.832  1.00 72.96 ? 50  GLN A NE2 1 
ATOM   367  N  N   . ASP A 1 51  ? -17.448 -15.372 21.050  1.00 46.71 ? 51  ASP A N   1 
ATOM   368  C  CA  . ASP A 1 51  ? -18.046 -14.883 19.814  1.00 45.95 ? 51  ASP A CA  1 
ATOM   369  C  C   . ASP A 1 51  ? -18.363 -13.400 19.966  1.00 43.21 ? 51  ASP A C   1 
ATOM   370  O  O   . ASP A 1 51  ? -18.934 -12.971 20.964  1.00 42.64 ? 51  ASP A O   1 
ATOM   371  C  CB  . ASP A 1 51  ? -19.343 -15.639 19.490  1.00 50.96 ? 51  ASP A CB  1 
ATOM   372  C  CG  . ASP A 1 51  ? -19.120 -17.118 19.227  1.00 53.34 ? 51  ASP A CG  1 
ATOM   373  O  OD1 . ASP A 1 51  ? -18.131 -17.486 18.553  1.00 56.54 ? 51  ASP A OD1 1 
ATOM   374  O  OD2 . ASP A 1 51  ? -19.951 -17.924 19.685  1.00 59.30 ? 51  ASP A OD2 1 
ATOM   375  N  N   . ILE A 1 52  ? -17.987 -12.614 18.974  1.00 38.96 ? 52  ILE A N   1 
ATOM   376  C  CA  . ILE A 1 52  ? -18.211 -11.179 19.000  1.00 39.13 ? 52  ILE A CA  1 
ATOM   377  C  C   . ILE A 1 52  ? -18.983 -10.833 17.752  1.00 39.58 ? 52  ILE A C   1 
ATOM   378  O  O   . ILE A 1 52  ? -18.558 -11.175 16.646  1.00 41.19 ? 52  ILE A O   1 
ATOM   379  C  CB  . ILE A 1 52  ? -16.887 -10.387 18.977  1.00 39.13 ? 52  ILE A CB  1 
ATOM   380  C  CG1 . ILE A 1 52  ? -15.938 -10.862 20.083  1.00 39.50 ? 52  ILE A CG1 1 
ATOM   381  C  CG2 . ILE A 1 52  ? -17.151 -8.890  19.091  1.00 38.82 ? 52  ILE A CG2 1 
ATOM   382  C  CD1 . ILE A 1 52  ? -16.329 -10.416 21.479  1.00 40.06 ? 52  ILE A CD1 1 
ATOM   383  N  N   . THR A 1 53  ? -20.110 -10.155 17.918  1.00 38.98 ? 53  THR A N   1 
ATOM   384  C  CA  . THR A 1 53  ? -20.900 -9.727  16.768  1.00 38.81 ? 53  THR A CA  1 
ATOM   385  C  C   . THR A 1 53  ? -20.330 -8.445  16.180  1.00 35.52 ? 53  THR A C   1 
ATOM   386  O  O   . THR A 1 53  ? -20.144 -7.448  16.884  1.00 35.57 ? 53  THR A O   1 
ATOM   387  C  CB  . THR A 1 53  ? -22.364 -9.486  17.167  1.00 40.33 ? 53  THR A CB  1 
ATOM   388  O  OG1 . THR A 1 53  ? -22.865 -10.670 17.774  1.00 41.72 ? 53  THR A OG1 1 
ATOM   389  C  CG2 . THR A 1 53  ? -23.222 -9.136  15.946  1.00 41.86 ? 53  THR A CG2 1 
ATOM   390  N  N   . ILE A 1 54  ? -20.098 -8.463  14.880  1.00 33.34 ? 54  ILE A N   1 
ATOM   391  C  CA  . ILE A 1 54  ? -19.574 -7.297  14.182  1.00 32.95 ? 54  ILE A CA  1 
ATOM   392  C  C   . ILE A 1 54  ? -20.629 -6.202  14.061  1.00 35.72 ? 54  ILE A C   1 
ATOM   393  O  O   . ILE A 1 54  ? -21.788 -6.489  13.748  1.00 36.68 ? 54  ILE A O   1 
ATOM   394  C  CB  . ILE A 1 54  ? -19.077 -7.698  12.791  1.00 32.50 ? 54  ILE A CB  1 
ATOM   395  C  CG1 . ILE A 1 54  ? -17.911 -8.687  12.924  1.00 33.85 ? 54  ILE A CG1 1 
ATOM   396  C  CG2 . ILE A 1 54  ? -18.633 -6.479  11.993  1.00 33.16 ? 54  ILE A CG2 1 
ATOM   397  C  CD1 . ILE A 1 54  ? -17.730 -9.551  11.708  1.00 34.36 ? 54  ILE A CD1 1 
ATOM   398  N  N   . GLU A 1 55  ? -20.219 -4.950  14.278  1.00 34.14 ? 55  GLU A N   1 
ATOM   399  C  CA  . GLU A 1 55  ? -21.114 -3.810  14.194  1.00 36.77 ? 55  GLU A CA  1 
ATOM   400  C  C   . GLU A 1 55  ? -20.730 -2.891  13.045  1.00 36.93 ? 55  GLU A C   1 
ATOM   401  O  O   . GLU A 1 55  ? -19.556 -2.753  12.743  1.00 37.17 ? 55  GLU A O   1 
ATOM   402  C  CB  . GLU A 1 55  ? -21.042 -3.015  15.495  1.00 38.16 ? 55  GLU A CB  1 
ATOM   403  C  CG  . GLU A 1 55  ? -21.106 -3.874  16.750  1.00 41.46 ? 55  GLU A CG  1 
ATOM   404  C  CD  . GLU A 1 55  ? -20.895 -3.044  18.008  1.00 43.75 ? 55  GLU A CD  1 
ATOM   405  O  OE1 . GLU A 1 55  ? -19.944 -3.318  18.773  1.00 39.87 ? 55  GLU A OE1 1 
ATOM   406  O  OE2 . GLU A 1 55  ? -21.670 -2.091  18.211  1.00 45.04 ? 55  GLU A OE2 1 
ATOM   407  N  N   . GLU A 1 56  ? -21.713 -2.230  12.442  1.00 35.27 ? 56  GLU A N   1 
ATOM   408  C  CA  . GLU A 1 56  ? -21.459 -1.174  11.459  1.00 36.20 ? 56  GLU A CA  1 
ATOM   409  C  C   . GLU A 1 56  ? -20.742 -0.001  12.119  1.00 36.36 ? 56  GLU A C   1 
ATOM   410  O  O   . GLU A 1 56  ? -21.065 0.372   13.241  1.00 37.54 ? 56  GLU A O   1 
ATOM   411  C  CB  . GLU A 1 56  ? -22.775 -0.677  10.846  1.00 37.23 ? 56  GLU A CB  1 
ATOM   412  C  CG  . GLU A 1 56  ? -22.576 0.299   9.696   1.00 38.21 ? 56  GLU A CG  1 
ATOM   413  C  CD  . GLU A 1 56  ? -23.871 0.667   8.978   1.00 42.22 ? 56  GLU A CD  1 
ATOM   414  O  OE1 . GLU A 1 56  ? -24.910 -0.007  9.172   1.00 46.49 ? 56  GLU A OE1 1 
ATOM   415  O  OE2 . GLU A 1 56  ? -23.841 1.647   8.208   1.00 46.42 ? 56  GLU A OE2 1 
ATOM   416  N  N   . THR A 1 57  ? -19.791 0.608   11.426  1.00 36.46 ? 57  THR A N   1 
ATOM   417  C  CA  . THR A 1 57  ? -19.113 1.757   11.988  1.00 36.46 ? 57  THR A CA  1 
ATOM   418  C  C   . THR A 1 57  ? -19.955 2.992   11.692  1.00 39.73 ? 57  THR A C   1 
ATOM   419  O  O   . THR A 1 57  ? -20.300 3.234   10.538  1.00 39.88 ? 57  THR A O   1 
ATOM   420  C  CB  . THR A 1 57  ? -17.693 1.918   11.395  1.00 38.07 ? 57  THR A CB  1 
ATOM   421  O  OG1 . THR A 1 57  ? -16.962 0.682   11.512  1.00 33.86 ? 57  THR A OG1 1 
ATOM   422  C  CG2 . THR A 1 57  ? -16.954 3.020   12.093  1.00 37.00 ? 57  THR A CG2 1 
ATOM   423  N  N   . THR A 1 58  ? -20.284 3.758   12.732  1.00 41.71 ? 58  THR A N   1 
ATOM   424  C  CA  . THR A 1 58  ? -21.052 4.996   12.600  1.00 44.60 ? 58  THR A CA  1 
ATOM   425  C  C   . THR A 1 58  ? -20.566 6.035   13.601  1.00 43.82 ? 58  THR A C   1 
ATOM   426  O  O   . THR A 1 58  ? -19.775 5.732   14.491  1.00 43.90 ? 58  THR A O   1 
ATOM   427  C  CB  . THR A 1 58  ? -22.557 4.757   12.866  1.00 45.83 ? 58  THR A CB  1 
ATOM   428  O  OG1 . THR A 1 58  ? -22.723 4.174   14.162  1.00 49.13 ? 58  THR A OG1 1 
ATOM   429  C  CG2 . THR A 1 58  ? -23.142 3.831   11.822  1.00 50.51 ? 58  THR A CG2 1 
ATOM   430  N  N   . GLU A 1 59  ? -21.078 7.254   13.461  1.00 45.59 ? 59  GLU A N   1 
ATOM   431  C  CA  . GLU A 1 59  ? -20.784 8.357   14.380  1.00 47.19 ? 59  GLU A CA  1 
ATOM   432  C  C   . GLU A 1 59  ? -21.096 8.034   15.833  1.00 45.98 ? 59  GLU A C   1 
ATOM   433  O  O   . GLU A 1 59  ? -20.470 8.614   16.716  1.00 46.87 ? 59  GLU A O   1 
ATOM   434  C  CB  . GLU A 1 59  ? -21.575 9.618   14.020  1.00 51.62 ? 59  GLU A CB  1 
ATOM   435  C  CG  . GLU A 1 59  ? -21.394 10.131  12.604  1.00 54.89 ? 59  GLU A CG  1 
ATOM   436  C  CD  . GLU A 1 59  ? -22.502 9.671   11.678  1.00 60.51 ? 59  GLU A CD  1 
ATOM   437  O  OE1 . GLU A 1 59  ? -22.713 8.432   11.564  1.00 57.86 ? 59  GLU A OE1 1 
ATOM   438  O  OE2 . GLU A 1 59  ? -23.156 10.549  11.068  1.00 60.40 ? 59  GLU A OE2 1 
ATOM   439  N  N   . THR A 1 60  ? -22.054 7.134   16.077  1.00 44.16 ? 60  THR A N   1 
ATOM   440  C  CA  . THR A 1 60  ? -22.533 6.838   17.438  1.00 44.46 ? 60  THR A CA  1 
ATOM   441  C  C   . THR A 1 60  ? -22.042 5.522   18.011  1.00 43.98 ? 60  THR A C   1 
ATOM   442  O  O   . THR A 1 60  ? -22.473 5.121   19.084  1.00 44.31 ? 60  THR A O   1 
ATOM   443  C  CB  . THR A 1 60  ? -24.094 6.860   17.508  1.00 45.99 ? 60  THR A CB  1 
ATOM   444  O  OG1 . THR A 1 60  ? -24.660 5.902   16.597  1.00 43.52 ? 60  THR A OG1 1 
ATOM   445  C  CG2 . THR A 1 60  ? -24.617 8.244   17.184  1.00 44.76 ? 60  THR A CG2 1 
ATOM   446  N  N   . ALA A 1 61  ? -21.108 4.862   17.333  1.00 45.73 ? 61  ALA A N   1 
ATOM   447  C  CA  . ALA A 1 61  ? -20.706 3.516   17.717  1.00 43.06 ? 61  ALA A CA  1 
ATOM   448  C  C   . ALA A 1 61  ? -19.679 3.467   18.856  1.00 45.77 ? 61  ALA A C   1 
ATOM   449  O  O   . ALA A 1 61  ? -19.313 2.373   19.282  1.00 48.30 ? 61  ALA A O   1 
ATOM   450  C  CB  . ALA A 1 61  ? -20.177 2.770   16.504  1.00 44.11 ? 61  ALA A CB  1 
ATOM   451  N  N   . PHE A 1 62  ? -19.258 4.624   19.383  1.00 43.93 ? 62  PHE A N   1 
ATOM   452  C  CA  . PHE A 1 62  ? -18.055 4.689   20.228  1.00 43.47 ? 62  PHE A CA  1 
ATOM   453  C  C   . PHE A 1 62  ? -18.283 4.969   21.701  1.00 44.77 ? 62  PHE A C   1 
ATOM   454  O  O   . PHE A 1 62  ? -17.325 5.109   22.459  1.00 41.45 ? 62  PHE A O   1 
ATOM   455  C  CB  . PHE A 1 62  ? -17.072 5.701   19.629  1.00 41.76 ? 62  PHE A CB  1 
ATOM   456  C  CG  . PHE A 1 62  ? -16.548 5.271   18.293  1.00 40.42 ? 62  PHE A CG  1 
ATOM   457  C  CD1 . PHE A 1 62  ? -15.572 4.282   18.208  1.00 38.15 ? 62  PHE A CD1 1 
ATOM   458  C  CD2 . PHE A 1 62  ? -17.073 5.797   17.115  1.00 39.24 ? 62  PHE A CD2 1 
ATOM   459  C  CE1 . PHE A 1 62  ? -15.107 3.849   16.972  1.00 36.79 ? 62  PHE A CE1 1 
ATOM   460  C  CE2 . PHE A 1 62  ? -16.612 5.373   15.880  1.00 37.83 ? 62  PHE A CE2 1 
ATOM   461  C  CZ  . PHE A 1 62  ? -15.627 4.391   15.804  1.00 36.58 ? 62  PHE A CZ  1 
ATOM   462  N  N   . GLU A 1 63  ? -19.540 5.022   22.125  1.00 46.37 ? 63  GLU A N   1 
ATOM   463  C  CA  . GLU A 1 63  ? -19.833 5.298   23.528  1.00 47.72 ? 63  GLU A CA  1 
ATOM   464  C  C   . GLU A 1 63  ? -19.266 4.188   24.400  1.00 43.77 ? 63  GLU A C   1 
ATOM   465  O  O   . GLU A 1 63  ? -19.392 3.022   24.079  1.00 41.97 ? 63  GLU A O   1 
ATOM   466  C  CB  . GLU A 1 63  ? -21.340 5.457   23.761  1.00 53.43 ? 63  GLU A CB  1 
ATOM   467  C  CG  . GLU A 1 63  ? -21.961 6.652   23.037  1.00 58.26 ? 63  GLU A CG  1 
ATOM   468  C  CD  . GLU A 1 63  ? -21.106 7.927   23.076  1.00 62.21 ? 63  GLU A CD  1 
ATOM   469  O  OE1 . GLU A 1 63  ? -20.802 8.436   24.190  1.00 63.58 ? 63  GLU A OE1 1 
ATOM   470  O  OE2 . GLU A 1 63  ? -20.746 8.428   21.977  1.00 63.26 ? 63  GLU A OE2 1 
ATOM   471  N  N   . GLY A 1 64  ? -18.585 4.571   25.473  1.00 43.84 ? 64  GLY A N   1 
ATOM   472  C  CA  . GLY A 1 64  ? -17.988 3.611   26.386  1.00 41.68 ? 64  GLY A CA  1 
ATOM   473  C  C   . GLY A 1 64  ? -16.629 3.077   25.956  1.00 40.58 ? 64  GLY A C   1 
ATOM   474  O  O   . GLY A 1 64  ? -16.000 2.353   26.717  1.00 37.26 ? 64  GLY A O   1 
ATOM   475  N  N   . VAL A 1 65  ? -16.168 3.419   24.752  1.00 37.80 ? 65  VAL A N   1 
ATOM   476  C  CA  . VAL A 1 65  ? -14.903 2.874   24.250  1.00 37.78 ? 65  VAL A CA  1 
ATOM   477  C  C   . VAL A 1 65  ? -13.713 3.686   24.761  1.00 33.98 ? 65  VAL A C   1 
ATOM   478  O  O   . VAL A 1 65  ? -13.720 4.899   24.668  1.00 36.32 ? 65  VAL A O   1 
ATOM   479  C  CB  . VAL A 1 65  ? -14.880 2.848   22.706  1.00 38.04 ? 65  VAL A CB  1 
ATOM   480  C  CG1 . VAL A 1 65  ? -13.519 2.377   22.200  1.00 37.58 ? 65  VAL A CG1 1 
ATOM   481  C  CG2 . VAL A 1 65  ? -15.990 1.952   22.182  1.00 39.57 ? 65  VAL A CG2 1 
ATOM   482  N  N   . ASP A 1 66  ? -12.675 3.009   25.245  1.00 33.52 ? 66  ASP A N   1 
ATOM   483  C  CA  . ASP A 1 66  ? -11.459 3.683   25.732  1.00 32.87 ? 66  ASP A CA  1 
ATOM   484  C  C   . ASP A 1 66  ? -10.418 3.864   24.636  1.00 32.62 ? 66  ASP A C   1 
ATOM   485  O  O   . ASP A 1 66  ? -9.803  4.931   24.493  1.00 33.75 ? 66  ASP A O   1 
ATOM   486  C  CB  . ASP A 1 66  ? -10.864 2.890   26.879  1.00 33.77 ? 66  ASP A CB  1 
ATOM   487  C  CG  . ASP A 1 66  ? -11.820 2.772   28.076  1.00 36.10 ? 66  ASP A CG  1 
ATOM   488  O  OD1 . ASP A 1 66  ? -12.319 3.822   28.560  1.00 36.65 ? 66  ASP A OD1 1 
ATOM   489  O  OD2 . ASP A 1 66  ? -12.059 1.635   28.536  1.00 33.14 ? 66  ASP A OD2 1 
ATOM   490  N  N   . ILE A 1 67  ? -10.242 2.812   23.847  1.00 32.43 ? 67  ILE A N   1 
ATOM   491  C  CA  . ILE A 1 67  ? -9.237  2.759   22.814  1.00 33.64 ? 67  ILE A CA  1 
ATOM   492  C  C   . ILE A 1 67  ? -9.859  2.175   21.558  1.00 30.27 ? 67  ILE A C   1 
ATOM   493  O  O   . ILE A 1 67  ? -10.493 1.138   21.624  1.00 30.87 ? 67  ILE A O   1 
ATOM   494  C  CB  . ILE A 1 67  ? -8.079  1.820   23.236  1.00 34.28 ? 67  ILE A CB  1 
ATOM   495  C  CG1 . ILE A 1 67  ? -7.428  2.333   24.513  1.00 34.89 ? 67  ILE A CG1 1 
ATOM   496  C  CG2 . ILE A 1 67  ? -7.055  1.708   22.115  1.00 35.78 ? 67  ILE A CG2 1 
ATOM   497  C  CD1 . ILE A 1 67  ? -6.396  1.396   25.092  1.00 36.86 ? 67  ILE A CD1 1 
ATOM   498  N  N   . ALA A 1 68  ? -9.702  2.859   20.434  1.00 30.59 ? 68  ALA A N   1 
ATOM   499  C  CA  . ALA A 1 68  ? -10.110 2.313   19.135  1.00 32.20 ? 68  ALA A CA  1 
ATOM   500  C  C   . ALA A 1 68  ? -8.932  2.226   18.167  1.00 33.56 ? 68  ALA A C   1 
ATOM   501  O  O   . ALA A 1 68  ? -8.234  3.224   17.938  1.00 31.50 ? 68  ALA A O   1 
ATOM   502  C  CB  . ALA A 1 68  ? -11.223 3.143   18.522  1.00 31.84 ? 68  ALA A CB  1 
ATOM   503  N  N   . LEU A 1 69  ? -8.740  1.040   17.590  1.00 31.87 ? 69  LEU A N   1 
ATOM   504  C  CA  . LEU A 1 69  ? -7.731  0.814   16.565  1.00 34.66 ? 69  LEU A CA  1 
ATOM   505  C  C   . LEU A 1 69  ? -8.405  0.844   15.205  1.00 34.46 ? 69  LEU A C   1 
ATOM   506  O  O   . LEU A 1 69  ? -9.278  0.020   14.933  1.00 35.31 ? 69  LEU A O   1 
ATOM   507  C  CB  . LEU A 1 69  ? -7.026  -0.523  16.762  1.00 36.16 ? 69  LEU A CB  1 
ATOM   508  C  CG  . LEU A 1 69  ? -6.458  -0.812  18.159  1.00 41.27 ? 69  LEU A CG  1 
ATOM   509  C  CD1 . LEU A 1 69  ? -5.767  -2.168  18.201  1.00 43.30 ? 69  LEU A CD1 1 
ATOM   510  C  CD2 . LEU A 1 69  ? -5.496  0.264   18.601  1.00 40.04 ? 69  LEU A CD2 1 
ATOM   511  N  N   . PHE A 1 70  ? -8.016  1.805   14.368  1.00 32.22 ? 70  PHE A N   1 
ATOM   512  C  CA  . PHE A 1 70  ? -8.666  2.027   13.090  1.00 34.18 ? 70  PHE A CA  1 
ATOM   513  C  C   . PHE A 1 70  ? -7.830  1.417   11.975  1.00 33.68 ? 70  PHE A C   1 
ATOM   514  O  O   . PHE A 1 70  ? -6.676  1.770   11.800  1.00 36.03 ? 70  PHE A O   1 
ATOM   515  C  CB  . PHE A 1 70  ? -8.842  3.529   12.812  1.00 33.02 ? 70  PHE A CB  1 
ATOM   516  C  CG  . PHE A 1 70  ? -10.144 4.106   13.273  1.00 33.48 ? 70  PHE A CG  1 
ATOM   517  C  CD1 . PHE A 1 70  ? -10.394 4.332   14.623  1.00 33.65 ? 70  PHE A CD1 1 
ATOM   518  C  CD2 . PHE A 1 70  ? -11.114 4.470   12.353  1.00 34.51 ? 70  PHE A CD2 1 
ATOM   519  C  CE1 . PHE A 1 70  ? -11.584 4.898   15.037  1.00 33.18 ? 70  PHE A CE1 1 
ATOM   520  C  CE2 . PHE A 1 70  ? -12.306 5.028   12.757  1.00 34.18 ? 70  PHE A CE2 1 
ATOM   521  C  CZ  . PHE A 1 70  ? -12.549 5.242   14.097  1.00 33.73 ? 70  PHE A CZ  1 
ATOM   522  N  N   . SER A 1 71  ? -8.410  0.493   11.227  1.00 35.53 ? 71  SER A N   1 
ATOM   523  C  CA  . SER A 1 71  ? -7.773  0.014   10.007  1.00 36.41 ? 71  SER A CA  1 
ATOM   524  C  C   . SER A 1 71  ? -8.776  -0.371  8.952   1.00 36.56 ? 71  SER A C   1 
ATOM   525  O  O   . SER A 1 71  ? -8.825  -1.531  8.521   1.00 33.35 ? 71  SER A O   1 
ATOM   526  C  CB  . SER A 1 71  ? -6.854  -1.161  10.299  1.00 39.37 ? 71  SER A CB  1 
ATOM   527  O  OG  . SER A 1 71  ? -6.165  -1.497  9.109   1.00 46.51 ? 71  SER A OG  1 
ATOM   528  N  N   . ALA A 1 72  ? -9.549  0.616   8.518   1.00 35.34 ? 72  ALA A N   1 
ATOM   529  C  CA  . ALA A 1 72  ? -10.644 0.398   7.589   1.00 36.19 ? 72  ALA A CA  1 
ATOM   530  C  C   . ALA A 1 72  ? -10.617 1.372   6.419   1.00 36.90 ? 72  ALA A C   1 
ATOM   531  O  O   . ALA A 1 72  ? -11.640 1.573   5.749   1.00 37.79 ? 72  ALA A O   1 
ATOM   532  C  CB  . ALA A 1 72  ? -11.967 0.508   8.330   1.00 36.89 ? 72  ALA A CB  1 
ATOM   533  N  N   . GLY A 1 73  ? -9.462  1.982   6.185   1.00 33.63 ? 73  GLY A N   1 
ATOM   534  C  CA  . GLY A 1 73  ? -9.267  2.878   5.053   1.00 34.93 ? 73  GLY A CA  1 
ATOM   535  C  C   . GLY A 1 73  ? -9.344  4.328   5.481   1.00 35.11 ? 73  GLY A C   1 
ATOM   536  O  O   . GLY A 1 73  ? -9.998  4.647   6.473   1.00 35.03 ? 73  GLY A O   1 
ATOM   537  N  N   . SER A 1 74  ? -8.658  5.193   4.731   1.00 35.93 ? 74  SER A N   1 
ATOM   538  C  CA  . SER A 1 74  ? -8.538  6.617   5.035   1.00 38.12 ? 74  SER A CA  1 
ATOM   539  C  C   . SER A 1 74  ? -9.870  7.317   5.175   1.00 39.24 ? 74  SER A C   1 
ATOM   540  O  O   . SER A 1 74  ? -10.060 8.109   6.099   1.00 38.33 ? 74  SER A O   1 
ATOM   541  C  CB  . SER A 1 74  ? -7.729  7.329   3.952   1.00 41.15 ? 74  SER A CB  1 
ATOM   542  O  OG  . SER A 1 74  ? -6.354  7.106   4.184   1.00 51.70 ? 74  SER A OG  1 
ATOM   543  N  N   A SER A 1 75  ? -10.775 7.031   4.245   0.50 38.44 ? 75  SER A N   1 
ATOM   544  N  N   B SER A 1 75  ? -10.788 7.035   4.252   0.50 37.68 ? 75  SER A N   1 
ATOM   545  C  CA  A SER A 1 75  ? -12.120 7.594   4.263   0.50 38.94 ? 75  SER A CA  1 
ATOM   546  C  CA  B SER A 1 75  ? -12.125 7.632   4.287   0.50 37.54 ? 75  SER A CA  1 
ATOM   547  C  C   A SER A 1 75  ? -12.844 7.307   5.580   0.50 37.80 ? 75  SER A C   1 
ATOM   548  C  C   B SER A 1 75  ? -12.860 7.310   5.589   0.50 37.06 ? 75  SER A C   1 
ATOM   549  O  O   A SER A 1 75  ? -13.379 8.217   6.205   0.50 37.28 ? 75  SER A O   1 
ATOM   550  O  O   B SER A 1 75  ? -13.421 8.203   6.216   0.50 36.72 ? 75  SER A O   1 
ATOM   551  C  CB  A SER A 1 75  ? -12.924 7.041   3.087   0.50 40.06 ? 75  SER A CB  1 
ATOM   552  C  CB  B SER A 1 75  ? -12.958 7.185   3.078   0.50 37.68 ? 75  SER A CB  1 
ATOM   553  O  OG  A SER A 1 75  ? -14.276 7.425   3.174   0.50 41.67 ? 75  SER A OG  1 
ATOM   554  O  OG  B SER A 1 75  ? -13.004 5.771   2.968   0.50 37.50 ? 75  SER A OG  1 
ATOM   555  N  N   . THR A 1 76  ? -12.837 6.045   6.003   1.00 36.70 ? 76  THR A N   1 
ATOM   556  C  CA  . THR A 1 76  ? -13.448 5.651   7.268   1.00 36.41 ? 76  THR A CA  1 
ATOM   557  C  C   . THR A 1 76  ? -12.804 6.381   8.467   1.00 33.61 ? 76  THR A C   1 
ATOM   558  O  O   . THR A 1 76  ? -13.501 6.852   9.361   1.00 31.75 ? 76  THR A O   1 
ATOM   559  C  CB  . THR A 1 76  ? -13.405 4.114   7.441   1.00 39.24 ? 76  THR A CB  1 
ATOM   560  O  OG1 . THR A 1 76  ? -14.143 3.492   6.379   1.00 42.12 ? 76  THR A OG1 1 
ATOM   561  C  CG2 . THR A 1 76  ? -13.998 3.671   8.761   1.00 39.28 ? 76  THR A CG2 1 
ATOM   562  N  N   . SER A 1 77  ? -11.481 6.509   8.488   1.00 32.95 ? 77  SER A N   1 
ATOM   563  C  CA  . SER A 1 77  ? -10.846 7.243   9.578   1.00 31.29 ? 77  SER A CA  1 
ATOM   564  C  C   . SER A 1 77  ? -11.218 8.728   9.521   1.00 32.02 ? 77  SER A C   1 
ATOM   565  O  O   . SER A 1 77  ? -11.513 9.359   10.544  1.00 32.19 ? 77  SER A O   1 
ATOM   566  C  CB  . SER A 1 77  ? -9.321  7.070   9.535   1.00 31.86 ? 77  SER A CB  1 
ATOM   567  O  OG  . SER A 1 77  ? -8.981  5.768   9.941   1.00 33.68 ? 77  SER A OG  1 
ATOM   568  N  N   . ALA A 1 78  ? -11.194 9.287   8.320   1.00 33.72 ? 78  ALA A N   1 
ATOM   569  C  CA  . ALA A 1 78  ? -11.542 10.687  8.138   1.00 35.42 ? 78  ALA A CA  1 
ATOM   570  C  C   . ALA A 1 78  ? -12.951 10.968  8.658   1.00 36.66 ? 78  ALA A C   1 
ATOM   571  O  O   . ALA A 1 78  ? -13.188 11.992  9.319   1.00 36.23 ? 78  ALA A O   1 
ATOM   572  C  CB  . ALA A 1 78  ? -11.442 11.073  6.674   1.00 37.58 ? 78  ALA A CB  1 
ATOM   573  N  N   . LYS A 1 79  ? -13.870 10.060  8.365   1.00 36.72 ? 79  LYS A N   1 
ATOM   574  C  CA  . LYS A 1 79  ? -15.278 10.260  8.721   1.00 43.17 ? 79  LYS A CA  1 
ATOM   575  C  C   . LYS A 1 79  ? -15.605 9.990   10.186  1.00 43.04 ? 79  LYS A C   1 
ATOM   576  O  O   . LYS A 1 79  ? -16.446 10.687  10.767  1.00 41.88 ? 79  LYS A O   1 
ATOM   577  C  CB  . LYS A 1 79  ? -16.186 9.407   7.845   1.00 45.95 ? 79  LYS A CB  1 
ATOM   578  C  CG  . LYS A 1 79  ? -16.350 9.973   6.438   1.00 52.68 ? 79  LYS A CG  1 
ATOM   579  C  CD  . LYS A 1 79  ? -17.346 9.169   5.607   1.00 58.40 ? 79  LYS A CD  1 
ATOM   580  C  CE  . LYS A 1 79  ? -16.702 7.912   5.048   1.00 62.73 ? 79  LYS A CE  1 
ATOM   581  N  NZ  . LYS A 1 79  ? -17.688 6.947   4.488   1.00 66.87 ? 79  LYS A NZ  1 
ATOM   582  N  N   . TYR A 1 80  ? -14.953 8.993   10.781  1.00 38.67 ? 80  TYR A N   1 
ATOM   583  C  CA  . TYR A 1 80  ? -15.369 8.518   12.091  1.00 36.47 ? 80  TYR A CA  1 
ATOM   584  C  C   . TYR A 1 80  ? -14.393 8.734   13.243  1.00 34.92 ? 80  TYR A C   1 
ATOM   585  O  O   . TYR A 1 80  ? -14.821 8.837   14.390  1.00 34.93 ? 80  TYR A O   1 
ATOM   586  C  CB  . TYR A 1 80  ? -15.738 7.057   11.991  1.00 36.94 ? 80  TYR A CB  1 
ATOM   587  C  CG  . TYR A 1 80  ? -16.893 6.803   11.038  1.00 39.78 ? 80  TYR A CG  1 
ATOM   588  C  CD1 . TYR A 1 80  ? -18.153 7.355   11.265  1.00 40.78 ? 80  TYR A CD1 1 
ATOM   589  C  CD2 . TYR A 1 80  ? -16.723 6.013   9.915   1.00 40.08 ? 80  TYR A CD2 1 
ATOM   590  C  CE1 . TYR A 1 80  ? -19.205 7.126   10.392  1.00 42.62 ? 80  TYR A CE1 1 
ATOM   591  C  CE2 . TYR A 1 80  ? -17.768 5.760   9.052   1.00 41.68 ? 80  TYR A CE2 1 
ATOM   592  C  CZ  . TYR A 1 80  ? -19.000 6.327   9.289   1.00 43.18 ? 80  TYR A CZ  1 
ATOM   593  O  OH  . TYR A 1 80  ? -20.019 6.080   8.415   1.00 46.61 ? 80  TYR A OH  1 
ATOM   594  N  N   . ALA A 1 81  ? -13.095 8.811   12.969  1.00 34.69 ? 81  ALA A N   1 
ATOM   595  C  CA  . ALA A 1 81  ? -12.141 8.947   14.072  1.00 32.53 ? 81  ALA A CA  1 
ATOM   596  C  C   . ALA A 1 81  ? -12.404 10.227  14.889  1.00 31.90 ? 81  ALA A C   1 
ATOM   597  O  O   . ALA A 1 81  ? -12.343 10.177  16.106  1.00 31.16 ? 81  ALA A O   1 
ATOM   598  C  CB  . ALA A 1 81  ? -10.705 8.880   13.584  1.00 31.65 ? 81  ALA A CB  1 
ATOM   599  N  N   . PRO A 1 82  ? -12.758 11.358  14.232  1.00 33.05 ? 82  PRO A N   1 
ATOM   600  C  CA  . PRO A 1 82  ? -13.030 12.562  15.052  1.00 33.20 ? 82  PRO A CA  1 
ATOM   601  C  C   . PRO A 1 82  ? -14.252 12.447  15.969  1.00 33.92 ? 82  PRO A C   1 
ATOM   602  O  O   . PRO A 1 82  ? -14.279 13.038  17.069  1.00 34.69 ? 82  PRO A O   1 
ATOM   603  C  CB  . PRO A 1 82  ? -13.220 13.672  14.005  1.00 32.78 ? 82  PRO A CB  1 
ATOM   604  C  CG  . PRO A 1 82  ? -12.587 13.158  12.773  1.00 33.51 ? 82  PRO A CG  1 
ATOM   605  C  CD  . PRO A 1 82  ? -12.764 11.677  12.795  1.00 31.68 ? 82  PRO A CD  1 
ATOM   606  N  N   . TYR A 1 83  ? -15.251 11.689  15.537  1.00 37.20 ? 83  TYR A N   1 
ATOM   607  C  CA  . TYR A 1 83  ? -16.379 11.375  16.395  1.00 39.27 ? 83  TYR A CA  1 
ATOM   608  C  C   . TYR A 1 83  ? -15.972 10.488  17.564  1.00 38.03 ? 83  TYR A C   1 
ATOM   609  O  O   . TYR A 1 83  ? -16.436 10.702  18.687  1.00 38.50 ? 83  TYR A O   1 
ATOM   610  C  CB  . TYR A 1 83  ? -17.528 10.746  15.604  1.00 40.16 ? 83  TYR A CB  1 
ATOM   611  C  CG  . TYR A 1 83  ? -18.174 11.735  14.680  1.00 40.67 ? 83  TYR A CG  1 
ATOM   612  C  CD1 . TYR A 1 83  ? -19.004 12.738  15.177  1.00 42.84 ? 83  TYR A CD1 1 
ATOM   613  C  CD2 . TYR A 1 83  ? -17.937 11.700  13.314  1.00 39.80 ? 83  TYR A CD2 1 
ATOM   614  C  CE1 . TYR A 1 83  ? -19.591 13.669  14.336  1.00 42.72 ? 83  TYR A CE1 1 
ATOM   615  C  CE2 . TYR A 1 83  ? -18.528 12.622  12.463  1.00 44.14 ? 83  TYR A CE2 1 
ATOM   616  C  CZ  . TYR A 1 83  ? -19.354 13.608  12.980  1.00 44.79 ? 83  TYR A CZ  1 
ATOM   617  O  OH  . TYR A 1 83  ? -19.924 14.535  12.137  1.00 46.40 ? 83  TYR A OH  1 
ATOM   618  N  N   . ALA A 1 84  ? -15.094 9.517   17.327  1.00 36.02 ? 84  ALA A N   1 
ATOM   619  C  CA  . ALA A 1 84  ? -14.565 8.717   18.439  1.00 37.25 ? 84  ALA A CA  1 
ATOM   620  C  C   . ALA A 1 84  ? -13.814 9.623   19.425  1.00 36.08 ? 84  ALA A C   1 
ATOM   621  O  O   . ALA A 1 84  ? -14.000 9.514   20.644  1.00 38.02 ? 84  ALA A O   1 
ATOM   622  C  CB  . ALA A 1 84  ? -13.664 7.593   17.941  1.00 37.32 ? 84  ALA A CB  1 
ATOM   623  N  N   . VAL A 1 85  ? -13.003 10.540  18.908  1.00 36.89 ? 85  VAL A N   1 
ATOM   624  C  CA  . VAL A 1 85  ? -12.270 11.468  19.782  1.00 35.80 ? 85  VAL A CA  1 
ATOM   625  C  C   . VAL A 1 85  ? -13.243 12.350  20.573  1.00 39.62 ? 85  VAL A C   1 
ATOM   626  O  O   . VAL A 1 85  ? -13.089 12.532  21.788  1.00 36.73 ? 85  VAL A O   1 
ATOM   627  C  CB  . VAL A 1 85  ? -11.312 12.375  18.986  1.00 37.62 ? 85  VAL A CB  1 
ATOM   628  C  CG1 . VAL A 1 85  ? -10.697 13.448  19.889  1.00 36.27 ? 85  VAL A CG1 1 
ATOM   629  C  CG2 . VAL A 1 85  ? -10.217 11.547  18.322  1.00 37.31 ? 85  VAL A CG2 1 
ATOM   630  N  N   . LYS A 1 86  ? -14.255 12.884  19.886  1.00 40.20 ? 86  LYS A N   1 
ATOM   631  C  CA  . LYS A 1 86  ? -15.272 13.695  20.545  1.00 43.26 ? 86  LYS A CA  1 
ATOM   632  C  C   . LYS A 1 86  ? -15.970 12.920  21.675  1.00 40.21 ? 86  LYS A C   1 
ATOM   633  O  O   . LYS A 1 86  ? -16.208 13.461  22.752  1.00 43.97 ? 86  LYS A O   1 
ATOM   634  C  CB  . LYS A 1 86  ? -16.291 14.232  19.533  1.00 46.87 ? 86  LYS A CB  1 
ATOM   635  C  CG  . LYS A 1 86  ? -17.154 15.342  20.111  1.00 50.01 ? 86  LYS A CG  1 
ATOM   636  C  CD  . LYS A 1 86  ? -18.132 15.927  19.106  1.00 55.83 ? 86  LYS A CD  1 
ATOM   637  C  CE  . LYS A 1 86  ? -18.486 17.378  19.453  1.00 61.44 ? 86  LYS A CE  1 
ATOM   638  N  NZ  . LYS A 1 86  ? -18.885 17.606  20.875  1.00 61.62 ? 86  LYS A NZ  1 
ATOM   639  N  N   . ALA A 1 87  ? -16.253 11.646  21.437  1.00 38.22 ? 87  ALA A N   1 
ATOM   640  C  CA  . ALA A 1 87  ? -16.832 10.759  22.432  1.00 37.15 ? 87  ALA A CA  1 
ATOM   641  C  C   . ALA A 1 87  ? -15.898 10.453  23.610  1.00 39.33 ? 87  ALA A C   1 
ATOM   642  O  O   . ALA A 1 87  ? -16.359 9.980   24.634  1.00 44.16 ? 87  ALA A O   1 
ATOM   643  C  CB  . ALA A 1 87  ? -17.245 9.459   21.767  1.00 38.14 ? 87  ALA A CB  1 
ATOM   644  N  N   . GLY A 1 88  ? -14.594 10.690  23.449  1.00 37.83 ? 88  GLY A N   1 
ATOM   645  C  CA  . GLY A 1 88  ? -13.595 10.520  24.526  1.00 36.97 ? 88  GLY A CA  1 
ATOM   646  C  C   . GLY A 1 88  ? -12.622 9.358   24.323  1.00 36.27 ? 88  GLY A C   1 
ATOM   647  O  O   . GLY A 1 88  ? -11.886 8.998   25.245  1.00 37.21 ? 88  GLY A O   1 
ATOM   648  N  N   . VAL A 1 89  ? -12.601 8.804   23.109  1.00 34.54 ? 89  VAL A N   1 
ATOM   649  C  CA  . VAL A 1 89  ? -11.796 7.642   22.761  1.00 32.85 ? 89  VAL A CA  1 
ATOM   650  C  C   . VAL A 1 89  ? -10.359 8.102   22.516  1.00 34.17 ? 89  VAL A C   1 
ATOM   651  O  O   . VAL A 1 89  ? -10.110 9.240   22.079  1.00 33.46 ? 89  VAL A O   1 
ATOM   652  C  CB  . VAL A 1 89  ? -12.341 6.957   21.485  1.00 33.76 ? 89  VAL A CB  1 
ATOM   653  C  CG1 . VAL A 1 89  ? -11.542 5.723   21.107  1.00 34.57 ? 89  VAL A CG1 1 
ATOM   654  C  CG2 . VAL A 1 89  ? -13.806 6.569   21.656  1.00 34.84 ? 89  VAL A CG2 1 
ATOM   655  N  N   . VAL A 1 90  ? -9.406  7.215   22.780  1.00 32.75 ? 90  VAL A N   1 
ATOM   656  C  CA  . VAL A 1 90  ? -8.080  7.406   22.227  1.00 31.08 ? 90  VAL A CA  1 
ATOM   657  C  C   . VAL A 1 90  ? -7.983  6.523   20.971  1.00 29.35 ? 90  VAL A C   1 
ATOM   658  O  O   . VAL A 1 90  ? -8.186  5.331   21.043  1.00 31.88 ? 90  VAL A O   1 
ATOM   659  C  CB  . VAL A 1 90  ? -6.966  7.119   23.242  1.00 33.34 ? 90  VAL A CB  1 
ATOM   660  C  CG1 . VAL A 1 90  ? -5.627  7.405   22.599  1.00 33.64 ? 90  VAL A CG1 1 
ATOM   661  C  CG2 . VAL A 1 90  ? -7.136  8.001   24.469  1.00 36.03 ? 90  VAL A CG2 1 
ATOM   662  N  N   . VAL A 1 91  ? -7.719  7.147   19.828  1.00 29.16 ? 91  VAL A N   1 
ATOM   663  C  CA  . VAL A 1 91  ? -7.691  6.473   18.532  1.00 31.15 ? 91  VAL A CA  1 
ATOM   664  C  C   . VAL A 1 91  ? -6.254  6.200   18.116  1.00 32.67 ? 91  VAL A C   1 
ATOM   665  O  O   . VAL A 1 91  ? -5.410  7.095   18.165  1.00 31.95 ? 91  VAL A O   1 
ATOM   666  C  CB  . VAL A 1 91  ? -8.345  7.350   17.455  1.00 31.85 ? 91  VAL A CB  1 
ATOM   667  C  CG1 . VAL A 1 91  ? -8.102  6.786   16.047  1.00 31.74 ? 91  VAL A CG1 1 
ATOM   668  C  CG2 . VAL A 1 91  ? -9.836  7.466   17.732  1.00 32.96 ? 91  VAL A CG2 1 
ATOM   669  N  N   . VAL A 1 92  ? -5.994  4.966   17.695  1.00 31.83 ? 92  VAL A N   1 
ATOM   670  C  CA  . VAL A 1 92  ? -4.746  4.632   17.040  1.00 33.39 ? 92  VAL A CA  1 
ATOM   671  C  C   . VAL A 1 92  ? -5.136  4.336   15.598  1.00 32.83 ? 92  VAL A C   1 
ATOM   672  O  O   . VAL A 1 92  ? -5.776  3.327   15.334  1.00 32.17 ? 92  VAL A O   1 
ATOM   673  C  CB  . VAL A 1 92  ? -4.054  3.435   17.713  1.00 34.59 ? 92  VAL A CB  1 
ATOM   674  C  CG1 . VAL A 1 92  ? -2.737  3.091   17.019  1.00 35.47 ? 92  VAL A CG1 1 
ATOM   675  C  CG2 . VAL A 1 92  ? -3.818  3.741   19.188  1.00 36.19 ? 92  VAL A CG2 1 
ATOM   676  N  N   . ASP A 1 93  ? -4.777  5.251   14.694  1.00 33.97 ? 93  ASP A N   1 
ATOM   677  C  CA  . ASP A 1 93  ? -5.164  5.174   13.297  1.00 36.29 ? 93  ASP A CA  1 
ATOM   678  C  C   . ASP A 1 93  ? -4.071  4.594   12.441  1.00 37.11 ? 93  ASP A C   1 
ATOM   679  O  O   . ASP A 1 93  ? -2.956  5.143   12.337  1.00 33.44 ? 93  ASP A O   1 
ATOM   680  C  CB  . ASP A 1 93  ? -5.520  6.544   12.726  1.00 39.02 ? 93  ASP A CB  1 
ATOM   681  C  CG  . ASP A 1 93  ? -6.174  6.447   11.337  1.00 42.15 ? 93  ASP A CG  1 
ATOM   682  O  OD1 . ASP A 1 93  ? -6.781  5.401   11.016  1.00 49.72 ? 93  ASP A OD1 1 
ATOM   683  O  OD2 . ASP A 1 93  ? -6.106  7.412   10.561  1.00 40.08 ? 93  ASP A OD2 1 
ATOM   684  N  N   . ASN A 1 94  ? -4.417  3.506   11.770  1.00 36.83 ? 94  ASN A N   1 
ATOM   685  C  CA  . ASN A 1 94  ? -3.491  2.830   10.912  1.00 39.83 ? 94  ASN A CA  1 
ATOM   686  C  C   . ASN A 1 94  ? -3.464  3.346   9.469   1.00 40.59 ? 94  ASN A C   1 
ATOM   687  O  O   . ASN A 1 94  ? -2.679  2.849   8.664   1.00 50.85 ? 94  ASN A O   1 
ATOM   688  C  CB  . ASN A 1 94  ? -3.799  1.337   10.941  1.00 44.42 ? 94  ASN A CB  1 
ATOM   689  C  CG  . ASN A 1 94  ? -2.647  0.506   10.458  1.00 49.73 ? 94  ASN A CG  1 
ATOM   690  O  OD1 . ASN A 1 94  ? -1.502  0.746   10.843  1.00 52.17 ? 94  ASN A OD1 1 
ATOM   691  N  ND2 . ASN A 1 94  ? -2.933  -0.473  9.599   1.00 48.98 ? 94  ASN A ND2 1 
ATOM   692  N  N   . THR A 1 95  ? -4.253  4.359   9.141   1.00 34.95 ? 95  THR A N   1 
ATOM   693  C  CA  . THR A 1 95  ? -4.306  4.883   7.779   1.00 34.49 ? 95  THR A CA  1 
ATOM   694  C  C   . THR A 1 95  ? -3.396  6.074   7.593   1.00 34.22 ? 95  THR A C   1 
ATOM   695  O  O   . THR A 1 95  ? -2.864  6.613   8.559   1.00 32.60 ? 95  THR A O   1 
ATOM   696  C  CB  . THR A 1 95  ? -5.722  5.339   7.391   1.00 33.11 ? 95  THR A CB  1 
ATOM   697  O  OG1 . THR A 1 95  ? -6.001  6.626   7.985   1.00 32.10 ? 95  THR A OG1 1 
ATOM   698  C  CG2 . THR A 1 95  ? -6.725  4.318   7.828   1.00 33.60 ? 95  THR A CG2 1 
ATOM   699  N  N   . SER A 1 96  ? -3.295  6.540   6.349   1.00 34.87 ? 96  SER A N   1 
ATOM   700  C  CA  . SER A 1 96  ? -2.483  7.701   6.030   1.00 35.31 ? 96  SER A CA  1 
ATOM   701  C  C   . SER A 1 96  ? -3.120  9.041   6.400   1.00 36.28 ? 96  SER A C   1 
ATOM   702  O  O   . SER A 1 96  ? -2.432  10.057  6.400   1.00 34.68 ? 96  SER A O   1 
ATOM   703  C  CB  . SER A 1 96  ? -2.155  7.723   4.528   1.00 36.53 ? 96  SER A CB  1 
ATOM   704  O  OG  . SER A 1 96  ? -3.350  7.795   3.751   1.00 38.12 ? 96  SER A OG  1 
ATOM   705  N  N   . TYR A 1 97  ? -4.417  9.053   6.701   1.00 34.71 ? 97  TYR A N   1 
ATOM   706  C  CA  . TYR A 1 97  ? -5.182  10.291  6.675   1.00 35.57 ? 97  TYR A CA  1 
ATOM   707  C  C   . TYR A 1 97  ? -4.669  11.405  7.593   1.00 34.20 ? 97  TYR A C   1 
ATOM   708  O  O   . TYR A 1 97  ? -4.534  12.536  7.159   1.00 35.01 ? 97  TYR A O   1 
ATOM   709  C  CB  . TYR A 1 97  ? -6.674  10.030  6.946   1.00 36.08 ? 97  TYR A CB  1 
ATOM   710  C  CG  . TYR A 1 97  ? -7.515  11.232  6.619   1.00 38.89 ? 97  TYR A CG  1 
ATOM   711  C  CD1 . TYR A 1 97  ? -7.837  11.544  5.297   1.00 40.66 ? 97  TYR A CD1 1 
ATOM   712  C  CD2 . TYR A 1 97  ? -7.952  12.091  7.626   1.00 39.51 ? 97  TYR A CD2 1 
ATOM   713  C  CE1 . TYR A 1 97  ? -8.590  12.672  4.995   1.00 42.69 ? 97  TYR A CE1 1 
ATOM   714  C  CE2 . TYR A 1 97  ? -8.690  13.220  7.335   1.00 41.08 ? 97  TYR A CE2 1 
ATOM   715  C  CZ  . TYR A 1 97  ? -9.014  13.500  6.021   1.00 42.23 ? 97  TYR A CZ  1 
ATOM   716  O  OH  . TYR A 1 97  ? -9.754  14.618  5.752   1.00 43.40 ? 97  TYR A OH  1 
ATOM   717  N  N   . PHE A 1 98  ? -4.374  11.083  8.842   1.00 32.82 ? 98  PHE A N   1 
ATOM   718  C  CA  . PHE A 1 98  ? -3.989  12.081  9.833   1.00 31.87 ? 98  PHE A CA  1 
ATOM   719  C  C   . PHE A 1 98  ? -2.459  12.187  10.035  1.00 32.28 ? 98  PHE A C   1 
ATOM   720  O  O   . PHE A 1 98  ? -2.002  12.967  10.878  1.00 32.88 ? 98  PHE A O   1 
ATOM   721  C  CB  . PHE A 1 98  ? -4.645  11.743  11.175  1.00 31.70 ? 98  PHE A CB  1 
ATOM   722  C  CG  . PHE A 1 98  ? -6.141  11.829  11.158  1.00 31.61 ? 98  PHE A CG  1 
ATOM   723  C  CD1 . PHE A 1 98  ? -6.774  13.065  11.263  1.00 31.95 ? 98  PHE A CD1 1 
ATOM   724  C  CD2 . PHE A 1 98  ? -6.916  10.677  11.093  1.00 30.74 ? 98  PHE A CD2 1 
ATOM   725  C  CE1 . PHE A 1 98  ? -8.165  13.151  11.242  1.00 33.16 ? 98  PHE A CE1 1 
ATOM   726  C  CE2 . PHE A 1 98  ? -8.298  10.756  11.079  1.00 33.09 ? 98  PHE A CE2 1 
ATOM   727  C  CZ  . PHE A 1 98  ? -8.920  11.995  11.167  1.00 32.47 ? 98  PHE A CZ  1 
ATOM   728  N  N   . ARG A 1 99  ? -1.686  11.434  9.262   1.00 30.80 ? 99  ARG A N   1 
ATOM   729  C  CA  . ARG A 1 99  ? -0.241  11.291  9.544   1.00 32.35 ? 99  ARG A CA  1 
ATOM   730  C  C   . ARG A 1 99  ? 0.551   12.589  9.496   1.00 33.55 ? 99  ARG A C   1 
ATOM   731  O  O   . ARG A 1 99  ? 1.540   12.721  10.217  1.00 32.29 ? 99  ARG A O   1 
ATOM   732  C  CB  . ARG A 1 99  ? 0.392   10.288  8.593   1.00 30.25 ? 99  ARG A CB  1 
ATOM   733  C  CG  . ARG A 1 99  ? -0.069  8.857   8.814   1.00 29.82 ? 99  ARG A CG  1 
ATOM   734  C  CD  . ARG A 1 99  ? 0.690   7.926   7.916   1.00 29.26 ? 99  ARG A CD  1 
ATOM   735  N  NE  . ARG A 1 99  ? 0.318   6.535   8.132   1.00 30.41 ? 99  ARG A NE  1 
ATOM   736  C  CZ  . ARG A 1 99  ? 0.230   5.633   7.162   1.00 31.10 ? 99  ARG A CZ  1 
ATOM   737  N  NH1 . ARG A 1 99  ? 0.510   5.969   5.907   1.00 31.80 ? 99  ARG A NH1 1 
ATOM   738  N  NH2 . ARG A 1 99  ? -0.137  4.395   7.453   1.00 32.15 ? 99  ARG A NH2 1 
ATOM   739  N  N   . GLN A 1 100 ? 0.144   13.519  8.624   1.00 33.92 ? 100 GLN A N   1 
ATOM   740  C  CA  . GLN A 1 100 ? 0.863   14.780  8.429   1.00 36.08 ? 100 GLN A CA  1 
ATOM   741  C  C   . GLN A 1 100 ? 0.181   15.974  9.111   1.00 36.16 ? 100 GLN A C   1 
ATOM   742  O  O   . GLN A 1 100 ? 0.497   17.129  8.828   1.00 38.03 ? 100 GLN A O   1 
ATOM   743  C  CB  . GLN A 1 100 ? 1.065   15.048  6.927   1.00 36.32 ? 100 GLN A CB  1 
ATOM   744  C  CG  . GLN A 1 100 ? 1.823   13.931  6.197   1.00 37.33 ? 100 GLN A CG  1 
ATOM   745  C  CD  . GLN A 1 100 ? 3.185   13.611  6.826   1.00 40.12 ? 100 GLN A CD  1 
ATOM   746  O  OE1 . GLN A 1 100 ? 3.969   14.512  7.132   1.00 42.47 ? 100 GLN A OE1 1 
ATOM   747  N  NE2 . GLN A 1 100 ? 3.467   12.325  7.024   1.00 39.18 ? 100 GLN A NE2 1 
ATOM   748  N  N   . ASN A 1 101 ? -0.744  15.690  10.019  1.00 34.47 ? 101 ASN A N   1 
ATOM   749  C  CA  . ASN A 1 101 ? -1.381  16.726  10.829  1.00 33.24 ? 101 ASN A CA  1 
ATOM   750  C  C   . ASN A 1 101 ? -0.505  17.024  12.029  1.00 33.37 ? 101 ASN A C   1 
ATOM   751  O  O   . ASN A 1 101 ? -0.172  16.097  12.767  1.00 31.27 ? 101 ASN A O   1 
ATOM   752  C  CB  . ASN A 1 101 ? -2.757  16.200  11.266  1.00 34.67 ? 101 ASN A CB  1 
ATOM   753  C  CG  . ASN A 1 101 ? -3.549  17.186  12.094  1.00 35.40 ? 101 ASN A CG  1 
ATOM   754  O  OD1 . ASN A 1 101 ? -3.029  17.810  13.014  1.00 35.43 ? 101 ASN A OD1 1 
ATOM   755  N  ND2 . ASN A 1 101 ? -4.843  17.294  11.801  1.00 35.90 ? 101 ASN A ND2 1 
ATOM   756  N  N   . PRO A 1 102 ? -0.154  18.314  12.270  1.00 34.84 ? 102 PRO A N   1 
ATOM   757  C  CA  . PRO A 1 102 ? 0.803   18.615  13.361  1.00 36.05 ? 102 PRO A CA  1 
ATOM   758  C  C   . PRO A 1 102 ? 0.257   18.361  14.774  1.00 36.07 ? 102 PRO A C   1 
ATOM   759  O  O   . PRO A 1 102 ? 1.027   18.357  15.728  1.00 31.86 ? 102 PRO A O   1 
ATOM   760  C  CB  . PRO A 1 102 ? 1.133   20.100  13.156  1.00 36.92 ? 102 PRO A CB  1 
ATOM   761  C  CG  . PRO A 1 102 ? -0.036  20.644  12.406  1.00 36.37 ? 102 PRO A CG  1 
ATOM   762  C  CD  . PRO A 1 102 ? -0.511  19.529  11.511  1.00 35.92 ? 102 PRO A CD  1 
ATOM   763  N  N   . ASP A 1 103 ? -1.052  18.127  14.892  1.00 32.62 ? 103 ASP A N   1 
ATOM   764  C  CA  . ASP A 1 103 ? -1.684  17.763  16.177  1.00 34.74 ? 103 ASP A CA  1 
ATOM   765  C  C   . ASP A 1 103 ? -1.670  16.264  16.454  1.00 32.17 ? 103 ASP A C   1 
ATOM   766  O  O   . ASP A 1 103 ? -2.161  15.821  17.502  1.00 33.15 ? 103 ASP A O   1 
ATOM   767  C  CB  . ASP A 1 103 ? -3.135  18.260  16.210  1.00 37.13 ? 103 ASP A CB  1 
ATOM   768  C  CG  . ASP A 1 103 ? -3.236  19.771  16.156  1.00 40.10 ? 103 ASP A CG  1 
ATOM   769  O  OD1 . ASP A 1 103 ? -2.402  20.430  16.807  1.00 40.63 ? 103 ASP A OD1 1 
ATOM   770  O  OD2 . ASP A 1 103 ? -4.148  20.295  15.473  1.00 42.14 ? 103 ASP A OD2 1 
ATOM   771  N  N   . VAL A 1 104 ? -1.109  15.494  15.526  1.00 33.05 ? 104 VAL A N   1 
ATOM   772  C  CA  . VAL A 1 104 ? -1.146  14.037  15.568  1.00 32.26 ? 104 VAL A CA  1 
ATOM   773  C  C   . VAL A 1 104 ? 0.282   13.469  15.625  1.00 33.31 ? 104 VAL A C   1 
ATOM   774  O  O   . VAL A 1 104 ? 1.064   13.681  14.703  1.00 33.62 ? 104 VAL A O   1 
ATOM   775  C  CB  . VAL A 1 104 ? -1.860  13.490  14.336  1.00 31.80 ? 104 VAL A CB  1 
ATOM   776  C  CG1 . VAL A 1 104 ? -1.796  11.960  14.292  1.00 32.33 ? 104 VAL A CG1 1 
ATOM   777  C  CG2 . VAL A 1 104 ? -3.314  13.959  14.324  1.00 31.38 ? 104 VAL A CG2 1 
ATOM   778  N  N   . PRO A 1 105 ? 0.624   12.774  16.721  1.00 32.41 ? 105 PRO A N   1 
ATOM   779  C  CA  . PRO A 1 105 ? 1.881   12.028  16.792  1.00 32.34 ? 105 PRO A CA  1 
ATOM   780  C  C   . PRO A 1 105 ? 1.877   10.866  15.771  1.00 30.86 ? 105 PRO A C   1 
ATOM   781  O  O   . PRO A 1 105 ? 0.844   10.213  15.586  1.00 31.77 ? 105 PRO A O   1 
ATOM   782  C  CB  . PRO A 1 105 ? 1.901   11.510  18.234  1.00 33.40 ? 105 PRO A CB  1 
ATOM   783  C  CG  . PRO A 1 105 ? 0.996   12.428  18.989  1.00 33.18 ? 105 PRO A CG  1 
ATOM   784  C  CD  . PRO A 1 105 ? -0.087  12.761  18.014  1.00 33.86 ? 105 PRO A CD  1 
ATOM   785  N  N   . LEU A 1 106 ? 3.005   10.673  15.097  1.00 28.67 ? 106 LEU A N   1 
ATOM   786  C  CA  . LEU A 1 106 ? 3.196   9.631   14.061  1.00 27.58 ? 106 LEU A CA  1 
ATOM   787  C  C   . LEU A 1 106 ? 4.278   8.742   14.603  1.00 28.74 ? 106 LEU A C   1 
ATOM   788  O  O   . LEU A 1 106 ? 5.468   9.105   14.592  1.00 28.91 ? 106 LEU A O   1 
ATOM   789  C  CB  . LEU A 1 106 ? 3.601   10.282  12.730  1.00 28.37 ? 106 LEU A CB  1 
ATOM   790  C  CG  . LEU A 1 106 ? 3.909   9.345   11.558  1.00 27.46 ? 106 LEU A CG  1 
ATOM   791  C  CD1 . LEU A 1 106 ? 2.668   8.539   11.214  1.00 29.98 ? 106 LEU A CD1 1 
ATOM   792  C  CD2 . LEU A 1 106 ? 4.387   10.137  10.349  1.00 28.49 ? 106 LEU A CD2 1 
ATOM   793  N  N   . VAL A 1 107 ? 3.878   7.609   15.172  1.00 28.93 ? 107 VAL A N   1 
ATOM   794  C  CA  . VAL A 1 107 ? 4.759   6.930   16.115  1.00 30.01 ? 107 VAL A CA  1 
ATOM   795  C  C   . VAL A 1 107 ? 5.190   5.502   15.780  1.00 32.31 ? 107 VAL A C   1 
ATOM   796  O  O   . VAL A 1 107 ? 4.378   4.648   15.408  1.00 29.81 ? 107 VAL A O   1 
ATOM   797  C  CB  . VAL A 1 107 ? 4.116   6.966   17.511  1.00 30.03 ? 107 VAL A CB  1 
ATOM   798  C  CG1 . VAL A 1 107 ? 4.842   6.058   18.498  1.00 31.10 ? 107 VAL A CG1 1 
ATOM   799  C  CG2 . VAL A 1 107 ? 4.091   8.410   18.015  1.00 30.41 ? 107 VAL A CG2 1 
ATOM   800  N  N   . VAL A 1 108 ? 6.499   5.272   15.940  1.00 30.49 ? 108 VAL A N   1 
ATOM   801  C  CA  . VAL A 1 108 ? 7.066   3.948   16.070  1.00 31.28 ? 108 VAL A CA  1 
ATOM   802  C  C   . VAL A 1 108 ? 7.654   3.929   17.489  1.00 32.15 ? 108 VAL A C   1 
ATOM   803  O  O   . VAL A 1 108 ? 8.627   4.640   17.756  1.00 31.45 ? 108 VAL A O   1 
ATOM   804  C  CB  . VAL A 1 108 ? 8.200   3.698   15.048  1.00 31.15 ? 108 VAL A CB  1 
ATOM   805  C  CG1 . VAL A 1 108 ? 8.646   2.231   15.077  1.00 32.28 ? 108 VAL A CG1 1 
ATOM   806  C  CG2 . VAL A 1 108 ? 7.773   4.109   13.640  1.00 31.96 ? 108 VAL A CG2 1 
ATOM   807  N  N   . PRO A 1 109 ? 7.099   3.099   18.397  1.00 30.79 ? 109 PRO A N   1 
ATOM   808  C  CA  . PRO A 1 109 ? 7.432   3.273   19.803  1.00 30.83 ? 109 PRO A CA  1 
ATOM   809  C  C   . PRO A 1 109 ? 8.928   3.208   20.155  1.00 30.98 ? 109 PRO A C   1 
ATOM   810  O  O   . PRO A 1 109 ? 9.341   3.876   21.085  1.00 31.76 ? 109 PRO A O   1 
ATOM   811  C  CB  . PRO A 1 109 ? 6.678   2.138   20.475  1.00 31.88 ? 109 PRO A CB  1 
ATOM   812  C  CG  . PRO A 1 109 ? 5.473   1.974   19.610  1.00 31.33 ? 109 PRO A CG  1 
ATOM   813  C  CD  . PRO A 1 109 ? 5.994   2.140   18.221  1.00 30.24 ? 109 PRO A CD  1 
ATOM   814  N  N   . GLU A 1 110 ? 9.716   2.437   19.412  1.00 31.05 ? 110 GLU A N   1 
ATOM   815  C  CA  . GLU A 1 110 ? 11.165  2.312   19.706  1.00 31.21 ? 110 GLU A CA  1 
ATOM   816  C  C   . GLU A 1 110 ? 11.902  3.588   19.321  1.00 31.21 ? 110 GLU A C   1 
ATOM   817  O  O   . GLU A 1 110 ? 13.017  3.863   19.800  1.00 32.07 ? 110 GLU A O   1 
ATOM   818  C  CB  . GLU A 1 110 ? 11.748  1.112   18.948  1.00 31.33 ? 110 GLU A CB  1 
ATOM   819  C  CG  . GLU A 1 110 ? 11.166  -0.234  19.377  1.00 33.94 ? 110 GLU A CG  1 
ATOM   820  C  CD  . GLU A 1 110 ? 9.984   -0.687  18.520  1.00 35.49 ? 110 GLU A CD  1 
ATOM   821  O  OE1 . GLU A 1 110 ? 9.391   0.137   17.796  1.00 34.51 ? 110 GLU A OE1 1 
ATOM   822  O  OE2 . GLU A 1 110 ? 9.669   -1.886  18.549  1.00 37.23 ? 110 GLU A OE2 1 
ATOM   823  N  N   . VAL A 1 111 ? 11.290  4.370   18.436  1.00 29.93 ? 111 VAL A N   1 
ATOM   824  C  CA  . VAL A 1 111 ? 11.940  5.531   17.856  1.00 32.07 ? 111 VAL A CA  1 
ATOM   825  C  C   . VAL A 1 111 ? 11.507  6.816   18.546  1.00 31.72 ? 111 VAL A C   1 
ATOM   826  O  O   . VAL A 1 111 ? 12.346  7.566   19.041  1.00 33.54 ? 111 VAL A O   1 
ATOM   827  C  CB  . VAL A 1 111 ? 11.662  5.601   16.349  1.00 31.03 ? 111 VAL A CB  1 
ATOM   828  C  CG1 . VAL A 1 111 ? 12.323  6.807   15.731  1.00 31.14 ? 111 VAL A CG1 1 
ATOM   829  C  CG2 . VAL A 1 111 ? 12.145  4.334   15.666  1.00 32.49 ? 111 VAL A CG2 1 
ATOM   830  N  N   . ASN A 1 112 ? 10.201  7.063   18.600  1.00 29.85 ? 112 ASN A N   1 
ATOM   831  C  CA  . ASN A 1 112 ? 9.689   8.326   19.113  1.00 33.10 ? 112 ASN A CA  1 
ATOM   832  C  C   . ASN A 1 112 ? 8.461   8.214   20.033  1.00 33.98 ? 112 ASN A C   1 
ATOM   833  O  O   . ASN A 1 112 ? 7.490   8.965   19.890  1.00 37.01 ? 112 ASN A O   1 
ATOM   834  C  CB  . ASN A 1 112 ? 9.419   9.259   17.932  1.00 33.78 ? 112 ASN A CB  1 
ATOM   835  C  CG  . ASN A 1 112 ? 8.299   8.753   17.029  1.00 34.53 ? 112 ASN A CG  1 
ATOM   836  O  OD1 . ASN A 1 112 ? 7.947   7.568   17.053  1.00 33.84 ? 112 ASN A OD1 1 
ATOM   837  N  ND2 . ASN A 1 112 ? 7.731   9.658   16.241  1.00 32.41 ? 112 ASN A ND2 1 
ATOM   838  N  N   . ALA A 1 113 ? 8.528   7.294   20.999  1.00 35.33 ? 113 ALA A N   1 
ATOM   839  C  CA  . ALA A 1 113 ? 7.479   7.128   21.984  1.00 34.27 ? 113 ALA A CA  1 
ATOM   840  C  C   . ALA A 1 113 ? 7.157   8.423   22.730  1.00 35.54 ? 113 ALA A C   1 
ATOM   841  O  O   . ALA A 1 113 ? 5.995   8.681   23.058  1.00 37.34 ? 113 ALA A O   1 
ATOM   842  C  CB  . ALA A 1 113 ? 7.842   6.036   22.974  1.00 35.67 ? 113 ALA A CB  1 
ATOM   843  N  N   . HIS A 1 114 ? 8.166   9.250   22.970  1.00 35.90 ? 114 HIS A N   1 
ATOM   844  C  CA  . HIS A 1 114 ? 7.944   10.552  23.625  1.00 38.73 ? 114 HIS A CA  1 
ATOM   845  C  C   . HIS A 1 114 ? 6.835   11.414  22.963  1.00 36.83 ? 114 HIS A C   1 
ATOM   846  O  O   . HIS A 1 114 ? 6.142   12.179  23.649  1.00 37.11 ? 114 HIS A O   1 
ATOM   847  C  CB  . HIS A 1 114 ? 9.261   11.345  23.663  1.00 42.40 ? 114 HIS A CB  1 
ATOM   848  C  CG  . HIS A 1 114 ? 9.763   11.730  22.304  1.00 47.56 ? 114 HIS A CG  1 
ATOM   849  N  ND1 . HIS A 1 114 ? 9.416   12.918  21.691  1.00 52.12 ? 114 HIS A ND1 1 
ATOM   850  C  CD2 . HIS A 1 114 ? 10.557  11.071  21.424  1.00 49.11 ? 114 HIS A CD2 1 
ATOM   851  C  CE1 . HIS A 1 114 ? 9.981   12.978  20.499  1.00 48.95 ? 114 HIS A CE1 1 
ATOM   852  N  NE2 . HIS A 1 114 ? 10.681  11.872  20.315  1.00 51.76 ? 114 HIS A NE2 1 
ATOM   853  N  N   . ALA A 1 115 ? 6.683   11.321  21.637  1.00 36.17 ? 115 ALA A N   1 
ATOM   854  C  CA  . ALA A 1 115 ? 5.684   12.141  20.911  1.00 33.93 ? 115 ALA A CA  1 
ATOM   855  C  C   . ALA A 1 115 ? 4.261   11.797  21.324  1.00 33.08 ? 115 ALA A C   1 
ATOM   856  O  O   . ALA A 1 115 ? 3.351   12.626  21.170  1.00 35.28 ? 115 ALA A O   1 
ATOM   857  C  CB  . ALA A 1 115 ? 5.836   11.990  19.401  1.00 33.73 ? 115 ALA A CB  1 
ATOM   858  N  N   . LEU A 1 116 ? 4.069   10.589  21.863  1.00 32.22 ? 116 LEU A N   1 
ATOM   859  C  CA  . LEU A 1 116 ? 2.763   10.174  22.418  1.00 35.02 ? 116 LEU A CA  1 
ATOM   860  C  C   . LEU A 1 116 ? 2.242   11.112  23.522  1.00 33.20 ? 116 LEU A C   1 
ATOM   861  O  O   . LEU A 1 116 ? 1.033   11.287  23.670  1.00 32.67 ? 116 LEU A O   1 
ATOM   862  C  CB  . LEU A 1 116 ? 2.833   8.749   22.995  1.00 33.80 ? 116 LEU A CB  1 
ATOM   863  C  CG  . LEU A 1 116 ? 3.114   7.606   22.015  1.00 34.94 ? 116 LEU A CG  1 
ATOM   864  C  CD1 . LEU A 1 116 ? 3.291   6.275   22.732  1.00 36.36 ? 116 LEU A CD1 1 
ATOM   865  C  CD2 . LEU A 1 116 ? 1.987   7.497   21.003  1.00 36.28 ? 116 LEU A CD2 1 
ATOM   866  N  N   . ASP A 1 117 ? 3.150   11.685  24.299  1.00 34.27 ? 117 ASP A N   1 
ATOM   867  C  CA  . ASP A 1 117 ? 2.762   12.474  25.486  1.00 35.79 ? 117 ASP A CA  1 
ATOM   868  C  C   . ASP A 1 117 ? 1.841   13.653  25.167  1.00 38.77 ? 117 ASP A C   1 
ATOM   869  O  O   . ASP A 1 117 ? 0.987   14.010  25.977  1.00 38.46 ? 117 ASP A O   1 
ATOM   870  C  CB  . ASP A 1 117 ? 3.990   13.005  26.214  1.00 38.59 ? 117 ASP A CB  1 
ATOM   871  C  CG  . ASP A 1 117 ? 4.835   11.911  26.817  1.00 41.09 ? 117 ASP A CG  1 
ATOM   872  O  OD1 . ASP A 1 117 ? 4.364   10.751  26.946  1.00 44.32 ? 117 ASP A OD1 1 
ATOM   873  O  OD2 . ASP A 1 117 ? 5.993   12.212  27.163  1.00 47.79 ? 117 ASP A OD2 1 
ATOM   874  N  N   . ALA A 1 118 ? 2.005   14.244  23.989  1.00 37.67 ? 118 ALA A N   1 
ATOM   875  C  CA  . ALA A 1 118 ? 1.260   15.445  23.625  1.00 41.55 ? 118 ALA A CA  1 
ATOM   876  C  C   . ALA A 1 118 ? 0.054   15.157  22.727  1.00 39.13 ? 118 ALA A C   1 
ATOM   877  O  O   . ALA A 1 118 ? -0.426  16.049  22.022  1.00 37.16 ? 118 ALA A O   1 
ATOM   878  C  CB  . ALA A 1 118 ? 2.191   16.417  22.922  1.00 41.68 ? 118 ALA A CB  1 
ATOM   879  N  N   . HIS A 1 119 ? -0.429  13.925  22.728  1.00 35.09 ? 119 HIS A N   1 
ATOM   880  C  CA  . HIS A 1 119 ? -1.490  13.554  21.784  1.00 34.50 ? 119 HIS A CA  1 
ATOM   881  C  C   . HIS A 1 119 ? -2.788  14.267  22.110  1.00 34.09 ? 119 HIS A C   1 
ATOM   882  O  O   . HIS A 1 119 ? -3.027  14.677  23.254  1.00 34.44 ? 119 HIS A O   1 
ATOM   883  C  CB  . HIS A 1 119 ? -1.679  12.034  21.702  1.00 33.46 ? 119 HIS A CB  1 
ATOM   884  C  CG  . HIS A 1 119 ? -2.456  11.436  22.839  1.00 33.51 ? 119 HIS A CG  1 
ATOM   885  N  ND1 . HIS A 1 119 ? -3.834  11.462  22.896  1.00 32.04 ? 119 HIS A ND1 1 
ATOM   886  C  CD2 . HIS A 1 119 ? -2.056  10.740  23.928  1.00 32.84 ? 119 HIS A CD2 1 
ATOM   887  C  CE1 . HIS A 1 119 ? -4.246  10.827  23.975  1.00 32.08 ? 119 HIS A CE1 1 
ATOM   888  N  NE2 . HIS A 1 119 ? -3.184  10.383  24.622  1.00 32.44 ? 119 HIS A NE2 1 
ATOM   889  N  N   . ASN A 1 120 ? -3.617  14.403  21.084  1.00 35.55 ? 120 ASN A N   1 
ATOM   890  C  CA  . ASN A 1 120 ? -4.918  15.038  21.174  1.00 34.10 ? 120 ASN A CA  1 
ATOM   891  C  C   . ASN A 1 120 ? -6.053  14.088  20.809  1.00 34.23 ? 120 ASN A C   1 
ATOM   892  O  O   . ASN A 1 120 ? -7.104  14.505  20.321  1.00 36.14 ? 120 ASN A O   1 
ATOM   893  C  CB  . ASN A 1 120 ? -4.924  16.240  20.241  1.00 36.60 ? 120 ASN A CB  1 
ATOM   894  C  CG  . ASN A 1 120 ? -3.916  17.281  20.651  1.00 36.90 ? 120 ASN A CG  1 
ATOM   895  O  OD1 . ASN A 1 120 ? -4.144  18.035  21.602  1.00 37.49 ? 120 ASN A OD1 1 
ATOM   896  N  ND2 . ASN A 1 120 ? -2.807  17.345  19.937  1.00 35.51 ? 120 ASN A ND2 1 
ATOM   897  N  N   . GLY A 1 121 ? -5.829  12.795  21.016  1.00 34.54 ? 121 GLY A N   1 
ATOM   898  C  CA  . GLY A 1 121 ? -6.871  11.797  20.876  1.00 34.85 ? 121 GLY A CA  1 
ATOM   899  C  C   . GLY A 1 121 ? -6.625  10.886  19.674  1.00 34.27 ? 121 GLY A C   1 
ATOM   900  O  O   . GLY A 1 121 ? -7.209  9.806   19.596  1.00 35.10 ? 121 GLY A O   1 
ATOM   901  N  N   . ILE A 1 122 ? -5.772  11.316  18.747  1.00 33.25 ? 122 ILE A N   1 
ATOM   902  C  CA  . ILE A 1 122 ? -5.358  10.455  17.625  1.00 31.51 ? 122 ILE A CA  1 
ATOM   903  C  C   . ILE A 1 122 ? -3.829  10.260  17.543  1.00 32.20 ? 122 ILE A C   1 
ATOM   904  O  O   . ILE A 1 122 ? -3.062  11.220  17.507  1.00 30.34 ? 122 ILE A O   1 
ATOM   905  C  CB  . ILE A 1 122 ? -5.848  10.974  16.274  1.00 31.25 ? 122 ILE A CB  1 
ATOM   906  C  CG1 . ILE A 1 122 ? -7.386  11.090  16.258  1.00 31.06 ? 122 ILE A CG1 1 
ATOM   907  C  CG2 . ILE A 1 122 ? -5.418  10.008  15.167  1.00 31.60 ? 122 ILE A CG2 1 
ATOM   908  C  CD1 . ILE A 1 122 ? -7.926  11.841  15.061  1.00 32.50 ? 122 ILE A CD1 1 
ATOM   909  N  N   . ILE A 1 123 ? -3.415  8.998   17.497  1.00 30.48 ? 123 ILE A N   1 
ATOM   910  C  CA  . ILE A 1 123 ? -2.035  8.634   17.278  1.00 31.24 ? 123 ILE A CA  1 
ATOM   911  C  C   . ILE A 1 123 ? -2.025  7.872   15.956  1.00 29.79 ? 123 ILE A C   1 
ATOM   912  O  O   . ILE A 1 123 ? -2.793  6.935   15.774  1.00 30.97 ? 123 ILE A O   1 
ATOM   913  C  CB  . ILE A 1 123 ? -1.464  7.755   18.404  1.00 33.40 ? 123 ILE A CB  1 
ATOM   914  C  CG1 . ILE A 1 123 ? -1.458  8.499   19.751  1.00 36.03 ? 123 ILE A CG1 1 
ATOM   915  C  CG2 . ILE A 1 123 ? -0.047  7.348   18.063  1.00 33.50 ? 123 ILE A CG2 1 
ATOM   916  C  CD1 . ILE A 1 123 ? -2.777  8.462   20.485  1.00 36.67 ? 123 ILE A CD1 1 
ATOM   917  N  N   . ALA A 1 124 ? -1.221  8.339   15.008  1.00 28.26 ? 124 ALA A N   1 
ATOM   918  C  CA  . ALA A 1 124 ? -1.099  7.677   13.701  1.00 27.76 ? 124 ALA A CA  1 
ATOM   919  C  C   . ALA A 1 124 ? 0.022   6.658   13.682  1.00 29.94 ? 124 ALA A C   1 
ATOM   920  O  O   . ALA A 1 124 ? 1.146   6.924   14.143  1.00 29.27 ? 124 ALA A O   1 
ATOM   921  C  CB  . ALA A 1 124 ? -0.899  8.715   12.599  1.00 28.58 ? 124 ALA A CB  1 
ATOM   922  N  N   . CYS A 1 125 ? -0.308  5.476   13.171  1.00 31.45 ? 125 CYS A N   1 
ATOM   923  C  CA  . CYS A 1 125 ? 0.668   4.456   12.837  1.00 32.67 ? 125 CYS A CA  1 
ATOM   924  C  C   . CYS A 1 125 ? 1.167   4.775   11.401  1.00 32.50 ? 125 CYS A C   1 
ATOM   925  O  O   . CYS A 1 125 ? 0.355   5.037   10.503  1.00 31.34 ? 125 CYS A O   1 
ATOM   926  C  CB  . CYS A 1 125 ? 0.018   3.067   13.013  1.00 34.98 ? 125 CYS A CB  1 
ATOM   927  S  SG  . CYS A 1 125 ? 0.943   1.627   12.456  1.00 40.06 ? 125 CYS A SG  1 
ATOM   928  N  N   . PRO A 1 126 ? 2.504   4.838   11.194  1.00 29.99 ? 126 PRO A N   1 
ATOM   929  C  CA  . PRO A 1 126 ? 3.007   5.143   9.844   1.00 29.82 ? 126 PRO A CA  1 
ATOM   930  C  C   . PRO A 1 126 ? 2.757   3.996   8.869   1.00 28.72 ? 126 PRO A C   1 
ATOM   931  O  O   . PRO A 1 126 ? 2.324   2.915   9.272   1.00 27.26 ? 126 PRO A O   1 
ATOM   932  C  CB  . PRO A 1 126 ? 4.516   5.353   10.043  1.00 30.24 ? 126 PRO A CB  1 
ATOM   933  C  CG  . PRO A 1 126 ? 4.741   5.397   11.519  1.00 30.74 ? 126 PRO A CG  1 
ATOM   934  C  CD  . PRO A 1 126 ? 3.587   4.707   12.182  1.00 29.87 ? 126 PRO A CD  1 
ATOM   935  N  N   . ASN A 1 127 ? 3.048   4.252   7.607   1.00 30.21 ? 127 ASN A N   1 
ATOM   936  C  CA  . ASN A 1 127 ? 3.070   3.222   6.569   1.00 32.36 ? 127 ASN A CA  1 
ATOM   937  C  C   . ASN A 1 127 ? 4.066   2.104   6.880   1.00 31.45 ? 127 ASN A C   1 
ATOM   938  O  O   . ASN A 1 127 ? 5.162   2.365   7.397   1.00 28.56 ? 127 ASN A O   1 
ATOM   939  C  CB  . ASN A 1 127 ? 3.420   3.896   5.244   1.00 37.06 ? 127 ASN A CB  1 
ATOM   940  C  CG  . ASN A 1 127 ? 3.635   2.906   4.136   1.00 42.44 ? 127 ASN A CG  1 
ATOM   941  O  OD1 . ASN A 1 127 ? 4.766   2.590   3.804   1.00 48.95 ? 127 ASN A OD1 1 
ATOM   942  N  ND2 . ASN A 1 127 ? 2.547   2.372   3.592   1.00 48.08 ? 127 ASN A ND2 1 
ATOM   943  N  N   . CYS A 1 128 ? 3.696   0.862   6.535   1.00 32.52 ? 128 CYS A N   1 
ATOM   944  C  CA  . CYS A 1 128 ? 4.507   -0.326  6.824   1.00 32.36 ? 128 CYS A CA  1 
ATOM   945  C  C   . CYS A 1 128 ? 5.954   -0.203  6.378   1.00 33.17 ? 128 CYS A C   1 
ATOM   946  O  O   . CYS A 1 128 ? 6.900   -0.481  7.152   1.00 32.20 ? 128 CYS A O   1 
ATOM   947  C  CB  . CYS A 1 128 ? 3.864   -1.575  6.188   1.00 36.01 ? 128 CYS A CB  1 
ATOM   948  S  SG  . CYS A 1 128 ? 3.155   -1.321  4.541   1.00 42.56 ? 128 CYS A SG  1 
ATOM   949  N  N   . SER A 1 129 ? 6.134   0.241   5.133   1.00 32.76 ? 129 SER A N   1 
ATOM   950  C  CA  . SER A 1 129 ? 7.449   0.372   4.553   1.00 32.26 ? 129 SER A CA  1 
ATOM   951  C  C   . SER A 1 129 ? 8.299   1.360   5.318   1.00 31.11 ? 129 SER A C   1 
ATOM   952  O  O   . SER A 1 129 ? 9.481   1.132   5.556   1.00 32.32 ? 129 SER A O   1 
ATOM   953  C  CB  . SER A 1 129 ? 7.334   0.806   3.087   1.00 33.62 ? 129 SER A CB  1 
ATOM   954  O  OG  . SER A 1 129 ? 6.662   -0.179  2.325   1.00 37.46 ? 129 SER A OG  1 
ATOM   955  N  N   . THR A 1 130 ? 7.691   2.467   5.709   1.00 32.37 ? 130 THR A N   1 
ATOM   956  C  CA  . THR A 1 130 ? 8.356   3.442   6.548   1.00 32.85 ? 130 THR A CA  1 
ATOM   957  C  C   . THR A 1 130 ? 8.734   2.858   7.901   1.00 31.84 ? 130 THR A C   1 
ATOM   958  O  O   . THR A 1 130 ? 9.876   3.024   8.374   1.00 31.13 ? 130 THR A O   1 
ATOM   959  C  CB  . THR A 1 130 ? 7.468   4.660   6.782   1.00 34.37 ? 130 THR A CB  1 
ATOM   960  O  OG1 . THR A 1 130 ? 7.039   5.171   5.516   1.00 33.97 ? 130 THR A OG1 1 
ATOM   961  C  CG2 . THR A 1 130 ? 8.233   5.735   7.566   1.00 35.58 ? 130 THR A CG2 1 
ATOM   962  N  N   . ILE A 1 131 ? 7.795   2.152   8.512   1.00 29.90 ? 131 ILE A N   1 
ATOM   963  C  CA  . ILE A 1 131 ? 8.019   1.655   9.874   1.00 29.22 ? 131 ILE A CA  1 
ATOM   964  C  C   . ILE A 1 131 ? 9.281   0.814   9.957   1.00 30.08 ? 131 ILE A C   1 
ATOM   965  O  O   . ILE A 1 131 ? 10.161  1.108   10.778  1.00 29.62 ? 131 ILE A O   1 
ATOM   966  C  CB  . ILE A 1 131 ? 6.826   0.873   10.420  1.00 29.00 ? 131 ILE A CB  1 
ATOM   967  C  CG1 . ILE A 1 131 ? 5.622   1.797   10.601  1.00 31.87 ? 131 ILE A CG1 1 
ATOM   968  C  CG2 . ILE A 1 131 ? 7.171   0.241   11.752  1.00 30.17 ? 131 ILE A CG2 1 
ATOM   969  C  CD1 . ILE A 1 131 ? 4.326   1.047   10.874  1.00 31.98 ? 131 ILE A CD1 1 
ATOM   970  N  N   . GLN A 1 132 ? 9.387   -0.222  9.110   1.00 27.64 ? 132 GLN A N   1 
ATOM   971  C  CA  . GLN A 1 132 ? 10.521  -1.114  9.201   1.00 28.73 ? 132 GLN A CA  1 
ATOM   972  C  C   . GLN A 1 132 ? 11.849  -0.410  8.906   1.00 29.22 ? 132 GLN A C   1 
ATOM   973  O  O   . GLN A 1 132 ? 12.870  -0.720  9.522   1.00 31.31 ? 132 GLN A O   1 
ATOM   974  C  CB  . GLN A 1 132 ? 10.321  -2.347  8.301   1.00 28.78 ? 132 GLN A CB  1 
ATOM   975  C  CG  . GLN A 1 132 ? 10.297  -2.104  6.807   1.00 29.63 ? 132 GLN A CG  1 
ATOM   976  C  CD  . GLN A 1 132 ? 9.995   -3.393  6.070   1.00 31.79 ? 132 GLN A CD  1 
ATOM   977  O  OE1 . GLN A 1 132 ? 8.886   -3.938  6.181   1.00 34.10 ? 132 GLN A OE1 1 
ATOM   978  N  NE2 . GLN A 1 132 ? 10.970  -3.908  5.343   1.00 32.74 ? 132 GLN A NE2 1 
ATOM   979  N  N   . MET A 1 133 ? 11.838  0.552   7.982   1.00 30.29 ? 133 MET A N   1 
ATOM   980  C  CA  . MET A 1 133 ? 13.031  1.321   7.670   1.00 30.23 ? 133 MET A CA  1 
ATOM   981  C  C   . MET A 1 133 ? 13.482  2.158   8.870   1.00 31.52 ? 133 MET A C   1 
ATOM   982  O  O   . MET A 1 133 ? 14.690  2.274   9.170   1.00 33.34 ? 133 MET A O   1 
ATOM   983  C  CB  . MET A 1 133 ? 12.781  2.206   6.447   1.00 30.48 ? 133 MET A CB  1 
ATOM   984  C  CG  . MET A 1 133 ? 14.027  2.855   5.920   1.00 31.34 ? 133 MET A CG  1 
ATOM   985  S  SD  . MET A 1 133 ? 13.808  3.665   4.334   1.00 32.57 ? 133 MET A SD  1 
ATOM   986  C  CE  . MET A 1 133 ? 12.729  5.002   4.813   1.00 33.86 ? 133 MET A CE  1 
ATOM   987  N  N   . MET A 1 134 ? 12.511  2.713   9.570   1.00 31.59 ? 134 MET A N   1 
ATOM   988  C  CA  . MET A 1 134 ? 12.769  3.522   10.768  1.00 32.51 ? 134 MET A CA  1 
ATOM   989  C  C   . MET A 1 134 ? 13.396  2.705   11.889  1.00 33.40 ? 134 MET A C   1 
ATOM   990  O  O   . MET A 1 134 ? 14.322  3.179   12.569  1.00 30.46 ? 134 MET A O   1 
ATOM   991  C  CB  . MET A 1 134 ? 11.488  4.187   11.244  1.00 33.94 ? 134 MET A CB  1 
ATOM   992  C  CG  . MET A 1 134 ? 10.975  5.283   10.337  1.00 35.10 ? 134 MET A CG  1 
ATOM   993  S  SD  . MET A 1 134 ? 12.146  6.649   10.076  1.00 36.71 ? 134 MET A SD  1 
ATOM   994  C  CE  . MET A 1 134 ? 12.808  6.138   8.495   1.00 36.06 ? 134 MET A CE  1 
ATOM   995  N  N   . VAL A 1 135 ? 12.943  1.463   12.051  1.00 30.74 ? 135 VAL A N   1 
ATOM   996  C  CA  . VAL A 1 135 ? 13.507  0.592   13.072  1.00 31.33 ? 135 VAL A CA  1 
ATOM   997  C  C   . VAL A 1 135 ? 14.974  0.227   12.741  1.00 32.16 ? 135 VAL A C   1 
ATOM   998  O  O   . VAL A 1 135 ? 15.815  0.156   13.644  1.00 33.99 ? 135 VAL A O   1 
ATOM   999  C  CB  . VAL A 1 135 ? 12.666  -0.693  13.265  1.00 31.43 ? 135 VAL A CB  1 
ATOM   1000 C  CG1 . VAL A 1 135 ? 13.379  -1.669  14.184  1.00 32.21 ? 135 VAL A CG1 1 
ATOM   1001 C  CG2 . VAL A 1 135 ? 11.277  -0.363  13.815  1.00 30.71 ? 135 VAL A CG2 1 
ATOM   1002 N  N   . ALA A 1 136 ? 15.269  -0.019  11.461  1.00 31.32 ? 136 ALA A N   1 
ATOM   1003 C  CA  . ALA A 1 136 ? 16.620  -0.333  11.041  1.00 30.67 ? 136 ALA A CA  1 
ATOM   1004 C  C   . ALA A 1 136 ? 17.550  0.873   11.166  1.00 31.49 ? 136 ALA A C   1 
ATOM   1005 O  O   . ALA A 1 136 ? 18.692  0.723   11.587  1.00 29.81 ? 136 ALA A O   1 
ATOM   1006 C  CB  . ALA A 1 136 ? 16.643  -0.874  9.612   1.00 30.25 ? 136 ALA A CB  1 
ATOM   1007 N  N   . LEU A 1 137 ? 17.065  2.054   10.804  1.00 30.35 ? 137 LEU A N   1 
ATOM   1008 C  CA  . LEU A 1 137 ? 17.918  3.236   10.674  1.00 31.91 ? 137 LEU A CA  1 
ATOM   1009 C  C   . LEU A 1 137 ? 18.047  4.110   11.921  1.00 33.89 ? 137 LEU A C   1 
ATOM   1010 O  O   . LEU A 1 137 ? 19.060  4.814   12.076  1.00 33.10 ? 137 LEU A O   1 
ATOM   1011 C  CB  . LEU A 1 137 ? 17.459  4.100   9.501   1.00 31.76 ? 137 LEU A CB  1 
ATOM   1012 C  CG  . LEU A 1 137 ? 17.534  3.423   8.129   1.00 30.47 ? 137 LEU A CG  1 
ATOM   1013 C  CD1 . LEU A 1 137 ? 17.145  4.409   7.040   1.00 31.50 ? 137 LEU A CD1 1 
ATOM   1014 C  CD2 . LEU A 1 137 ? 18.920  2.857   7.850   1.00 31.99 ? 137 LEU A CD2 1 
ATOM   1015 N  N   . GLU A 1 138 ? 17.064  4.080   12.805  1.00 32.52 ? 138 GLU A N   1 
ATOM   1016 C  CA  . GLU A 1 138 ? 17.146  4.947   13.986  1.00 32.87 ? 138 GLU A CA  1 
ATOM   1017 C  C   . GLU A 1 138 ? 18.437  4.721   14.808  1.00 31.00 ? 138 GLU A C   1 
ATOM   1018 O  O   . GLU A 1 138 ? 19.044  5.675   15.231  1.00 32.74 ? 138 GLU A O   1 
ATOM   1019 C  CB  . GLU A 1 138 ? 15.938  4.787   14.870  1.00 33.59 ? 138 GLU A CB  1 
ATOM   1020 C  CG  . GLU A 1 138 ? 15.998  5.543   16.200  1.00 34.31 ? 138 GLU A CG  1 
ATOM   1021 C  CD  . GLU A 1 138 ? 16.182  7.045   16.091  1.00 36.61 ? 138 GLU A CD  1 
ATOM   1022 O  OE1 . GLU A 1 138 ? 16.054  7.658   14.997  1.00 36.51 ? 138 GLU A OE1 1 
ATOM   1023 O  OE2 . GLU A 1 138 ? 16.474  7.623   17.157  1.00 42.86 ? 138 GLU A OE2 1 
ATOM   1024 N  N   . PRO A 1 139 ? 18.819  3.462   15.064  1.00 33.34 ? 139 PRO A N   1 
ATOM   1025 C  CA  . PRO A 1 139 ? 20.080  3.249   15.793  1.00 33.80 ? 139 PRO A CA  1 
ATOM   1026 C  C   . PRO A 1 139 ? 21.306  3.768   15.071  1.00 34.96 ? 139 PRO A C   1 
ATOM   1027 O  O   . PRO A 1 139 ? 22.313  4.090   15.725  1.00 36.03 ? 139 PRO A O   1 
ATOM   1028 C  CB  . PRO A 1 139 ? 20.172  1.727   15.913  1.00 32.93 ? 139 PRO A CB  1 
ATOM   1029 C  CG  . PRO A 1 139 ? 19.215  1.197   14.890  1.00 34.62 ? 139 PRO A CG  1 
ATOM   1030 C  CD  . PRO A 1 139 ? 18.094  2.195   14.909  1.00 33.25 ? 139 PRO A CD  1 
ATOM   1031 N  N   . VAL A 1 140 ? 21.249  3.810   13.740  1.00 34.49 ? 140 VAL A N   1 
ATOM   1032 C  CA  . VAL A 1 140 ? 22.332  4.396   12.961  1.00 34.04 ? 140 VAL A CA  1 
ATOM   1033 C  C   . VAL A 1 140 ? 22.341  5.900   13.117  1.00 33.90 ? 140 VAL A C   1 
ATOM   1034 O  O   . VAL A 1 140 ? 23.397  6.488   13.371  1.00 34.46 ? 140 VAL A O   1 
ATOM   1035 C  CB  . VAL A 1 140 ? 22.245  4.030   11.464  1.00 33.36 ? 140 VAL A CB  1 
ATOM   1036 C  CG1 . VAL A 1 140 ? 23.348  4.729   10.683  1.00 36.49 ? 140 VAL A CG1 1 
ATOM   1037 C  CG2 . VAL A 1 140 ? 22.314  2.519   11.289  1.00 31.40 ? 140 VAL A CG2 1 
ATOM   1038 N  N   . ARG A 1 141 ? 21.174  6.522   12.960  1.00 31.66 ? 141 ARG A N   1 
ATOM   1039 C  CA  . ARG A 1 141 ? 21.041  7.967   13.054  1.00 34.00 ? 141 ARG A CA  1 
ATOM   1040 C  C   . ARG A 1 141 ? 21.467  8.507   14.423  1.00 35.87 ? 141 ARG A C   1 
ATOM   1041 O  O   . ARG A 1 141 ? 22.035  9.597   14.520  1.00 34.78 ? 141 ARG A O   1 
ATOM   1042 C  CB  . ARG A 1 141 ? 19.587  8.384   12.793  1.00 35.82 ? 141 ARG A CB  1 
ATOM   1043 C  CG  . ARG A 1 141 ? 19.378  9.888   12.661  1.00 39.04 ? 141 ARG A CG  1 
ATOM   1044 C  CD  . ARG A 1 141 ? 17.922  10.294  12.810  1.00 41.59 ? 141 ARG A CD  1 
ATOM   1045 N  NE  . ARG A 1 141 ? 17.465  10.084  14.183  1.00 45.94 ? 141 ARG A NE  1 
ATOM   1046 C  CZ  . ARG A 1 141 ? 17.660  10.923  15.197  1.00 51.86 ? 141 ARG A CZ  1 
ATOM   1047 N  NH1 . ARG A 1 141 ? 18.309  12.073  15.028  1.00 53.05 ? 141 ARG A NH1 1 
ATOM   1048 N  NH2 . ARG A 1 141 ? 17.211  10.601  16.407  1.00 54.87 ? 141 ARG A NH2 1 
ATOM   1049 N  N   . GLN A 1 142 ? 21.146  7.769   15.478  1.00 34.28 ? 142 GLN A N   1 
ATOM   1050 C  CA  . GLN A 1 142 ? 21.529  8.148   16.834  1.00 37.63 ? 142 GLN A CA  1 
ATOM   1051 C  C   . GLN A 1 142 ? 23.036  8.337   17.002  1.00 35.55 ? 142 GLN A C   1 
ATOM   1052 O  O   . GLN A 1 142 ? 23.457  9.196   17.746  1.00 38.76 ? 142 GLN A O   1 
ATOM   1053 C  CB  . GLN A 1 142 ? 21.085  7.065   17.844  1.00 38.16 ? 142 GLN A CB  1 
ATOM   1054 C  CG  . GLN A 1 142 ? 19.611  7.098   18.166  1.00 41.66 ? 142 GLN A CG  1 
ATOM   1055 C  CD  . GLN A 1 142 ? 19.164  5.955   19.072  1.00 45.54 ? 142 GLN A CD  1 
ATOM   1056 O  OE1 . GLN A 1 142 ? 19.955  5.100   19.487  1.00 48.01 ? 142 GLN A OE1 1 
ATOM   1057 N  NE2 . GLN A 1 142 ? 17.883  5.941   19.376  1.00 46.81 ? 142 GLN A NE2 1 
ATOM   1058 N  N   . LYS A 1 143 ? 23.832  7.502   16.362  1.00 38.03 ? 143 LYS A N   1 
ATOM   1059 C  CA  . LYS A 1 143 ? 25.279  7.516   16.592  1.00 40.05 ? 143 LYS A CA  1 
ATOM   1060 C  C   . LYS A 1 143 ? 26.032  8.297   15.533  1.00 40.85 ? 143 LYS A C   1 
ATOM   1061 O  O   . LYS A 1 143 ? 27.053  8.912   15.838  1.00 42.24 ? 143 LYS A O   1 
ATOM   1062 C  CB  . LYS A 1 143 ? 25.820  6.098   16.642  1.00 43.21 ? 143 LYS A CB  1 
ATOM   1063 C  CG  . LYS A 1 143 ? 25.343  5.335   17.861  1.00 46.91 ? 143 LYS A CG  1 
ATOM   1064 C  CD  . LYS A 1 143 ? 26.067  4.018   18.025  1.00 51.44 ? 143 LYS A CD  1 
ATOM   1065 C  CE  . LYS A 1 143 ? 25.768  3.437   19.401  1.00 56.63 ? 143 LYS A CE  1 
ATOM   1066 N  NZ  . LYS A 1 143 ? 26.334  2.074   19.551  1.00 60.97 ? 143 LYS A NZ  1 
ATOM   1067 N  N   . TRP A 1 144 ? 25.549  8.256   14.294  1.00 38.21 ? 144 TRP A N   1 
ATOM   1068 C  CA  . TRP A 1 144 ? 26.302  8.798   13.169  1.00 36.96 ? 144 TRP A CA  1 
ATOM   1069 C  C   . TRP A 1 144 ? 25.537  9.753   12.275  1.00 37.69 ? 144 TRP A C   1 
ATOM   1070 O  O   . TRP A 1 144 ? 26.091  10.225  11.290  1.00 37.76 ? 144 TRP A O   1 
ATOM   1071 C  CB  . TRP A 1 144 ? 26.861  7.658   12.325  1.00 35.97 ? 144 TRP A CB  1 
ATOM   1072 C  CG  . TRP A 1 144 ? 27.764  6.752   13.082  1.00 35.67 ? 144 TRP A CG  1 
ATOM   1073 C  CD1 . TRP A 1 144 ? 29.063  6.996   13.448  1.00 36.15 ? 144 TRP A CD1 1 
ATOM   1074 C  CD2 . TRP A 1 144 ? 27.449  5.456   13.575  1.00 34.62 ? 144 TRP A CD2 1 
ATOM   1075 N  NE1 . TRP A 1 144 ? 29.562  5.934   14.158  1.00 36.00 ? 144 TRP A NE1 1 
ATOM   1076 C  CE2 . TRP A 1 144 ? 28.598  4.969   14.241  1.00 35.76 ? 144 TRP A CE2 1 
ATOM   1077 C  CE3 . TRP A 1 144 ? 26.311  4.646   13.512  1.00 33.89 ? 144 TRP A CE3 1 
ATOM   1078 C  CZ2 . TRP A 1 144 ? 28.640  3.710   14.838  1.00 35.93 ? 144 TRP A CZ2 1 
ATOM   1079 C  CZ3 . TRP A 1 144 ? 26.352  3.393   14.112  1.00 33.90 ? 144 TRP A CZ3 1 
ATOM   1080 C  CH2 . TRP A 1 144 ? 27.508  2.942   14.771  1.00 35.39 ? 144 TRP A CH2 1 
ATOM   1081 N  N   . GLY A 1 145 ? 24.282  10.041  12.606  1.00 38.17 ? 145 GLY A N   1 
ATOM   1082 C  CA  . GLY A 1 145 ? 23.444  10.923  11.813  1.00 36.29 ? 145 GLY A CA  1 
ATOM   1083 C  C   . GLY A 1 145 ? 23.008  10.297  10.501  1.00 36.15 ? 145 GLY A C   1 
ATOM   1084 O  O   . GLY A 1 145 ? 23.550  9.280   10.083  1.00 35.03 ? 145 GLY A O   1 
ATOM   1085 N  N   . LEU A 1 146 ? 22.009  10.894  9.861   1.00 37.05 ? 146 LEU A N   1 
ATOM   1086 C  CA  . LEU A 1 146 ? 21.632  10.500  8.500   1.00 38.21 ? 146 LEU A CA  1 
ATOM   1087 C  C   . LEU A 1 146 ? 21.538  11.731  7.642   1.00 35.76 ? 146 LEU A C   1 
ATOM   1088 O  O   . LEU A 1 146 ? 20.862  12.689  8.015   1.00 38.44 ? 146 LEU A O   1 
ATOM   1089 C  CB  . LEU A 1 146 ? 20.264  9.830   8.472   1.00 39.44 ? 146 LEU A CB  1 
ATOM   1090 C  CG  . LEU A 1 146 ? 20.158  8.412   9.005   1.00 41.20 ? 146 LEU A CG  1 
ATOM   1091 C  CD1 . LEU A 1 146 ? 18.682  8.048   9.087   1.00 41.62 ? 146 LEU A CD1 1 
ATOM   1092 C  CD2 . LEU A 1 146 ? 20.914  7.416   8.131   1.00 42.78 ? 146 LEU A CD2 1 
ATOM   1093 N  N   . ASP A 1 147 ? 22.168  11.694  6.478   1.00 35.03 ? 147 ASP A N   1 
ATOM   1094 C  CA  . ASP A 1 147 ? 22.067  12.797  5.532   1.00 34.74 ? 147 ASP A CA  1 
ATOM   1095 C  C   . ASP A 1 147 ? 21.018  12.544  4.458   1.00 33.54 ? 147 ASP A C   1 
ATOM   1096 O  O   . ASP A 1 147 ? 20.193  13.400  4.186   1.00 33.62 ? 147 ASP A O   1 
ATOM   1097 C  CB  . ASP A 1 147 ? 23.401  13.049  4.876   1.00 35.81 ? 147 ASP A CB  1 
ATOM   1098 C  CG  . ASP A 1 147 ? 23.436  14.367  4.160   1.00 40.32 ? 147 ASP A CG  1 
ATOM   1099 O  OD1 . ASP A 1 147 ? 22.837  15.340  4.667   1.00 43.17 ? 147 ASP A OD1 1 
ATOM   1100 O  OD2 . ASP A 1 147 ? 24.041  14.437  3.082   1.00 49.46 ? 147 ASP A OD2 1 
ATOM   1101 N  N   . ARG A 1 148 ? 21.073  11.368  3.839   1.00 34.61 ? 148 ARG A N   1 
ATOM   1102 C  CA  . ARG A 1 148 ? 20.081  11.000  2.850   1.00 36.69 ? 148 ARG A CA  1 
ATOM   1103 C  C   . ARG A 1 148 ? 19.768  9.497   2.886   1.00 33.80 ? 148 ARG A C   1 
ATOM   1104 O  O   . ARG A 1 148 ? 20.533  8.699   3.420   1.00 30.30 ? 148 ARG A O   1 
ATOM   1105 C  CB  . ARG A 1 148 ? 20.563  11.404  1.448   1.00 38.40 ? 148 ARG A CB  1 
ATOM   1106 C  CG  . ARG A 1 148 ? 21.644  10.511  0.874   1.00 38.07 ? 148 ARG A CG  1 
ATOM   1107 C  CD  . ARG A 1 148 ? 22.114  10.978  -0.506  1.00 37.66 ? 148 ARG A CD  1 
ATOM   1108 N  NE  . ARG A 1 148 ? 21.053  10.934  -1.522  1.00 37.46 ? 148 ARG A NE  1 
ATOM   1109 C  CZ  . ARG A 1 148 ? 21.231  11.230  -2.814  1.00 36.50 ? 148 ARG A CZ  1 
ATOM   1110 N  NH1 . ARG A 1 148 ? 22.433  11.580  -3.273  1.00 35.28 ? 148 ARG A NH1 1 
ATOM   1111 N  NH2 . ARG A 1 148 ? 20.208  11.166  -3.659  1.00 35.35 ? 148 ARG A NH2 1 
ATOM   1112 N  N   . ILE A 1 149 ? 18.627  9.151   2.306   1.00 31.73 ? 149 ILE A N   1 
ATOM   1113 C  CA  . ILE A 1 149 ? 18.200  7.765   2.109   1.00 32.52 ? 149 ILE A CA  1 
ATOM   1114 C  C   . ILE A 1 149 ? 17.756  7.591   0.647   1.00 31.11 ? 149 ILE A C   1 
ATOM   1115 O  O   . ILE A 1 149 ? 16.998  8.412   0.137   1.00 32.67 ? 149 ILE A O   1 
ATOM   1116 C  CB  . ILE A 1 149 ? 17.006  7.419   3.056   1.00 32.85 ? 149 ILE A CB  1 
ATOM   1117 C  CG1 . ILE A 1 149 ? 17.375  7.679   4.521   1.00 34.05 ? 149 ILE A CG1 1 
ATOM   1118 C  CG2 . ILE A 1 149 ? 16.529  5.972   2.878   1.00 33.06 ? 149 ILE A CG2 1 
ATOM   1119 C  CD1 . ILE A 1 149 ? 16.245  7.477   5.513   1.00 36.67 ? 149 ILE A CD1 1 
ATOM   1120 N  N   . ILE A 1 150 ? 18.223  6.542   -0.026  1.00 30.88 ? 150 ILE A N   1 
ATOM   1121 C  CA  . ILE A 1 150 ? 17.581  6.083   -1.251  1.00 32.37 ? 150 ILE A CA  1 
ATOM   1122 C  C   . ILE A 1 150 ? 17.107  4.660   -1.012  1.00 31.96 ? 150 ILE A C   1 
ATOM   1123 O  O   . ILE A 1 150 ? 17.890  3.823   -0.614  1.00 29.95 ? 150 ILE A O   1 
ATOM   1124 C  CB  . ILE A 1 150 ? 18.519  6.077   -2.464  1.00 34.29 ? 150 ILE A CB  1 
ATOM   1125 C  CG1 . ILE A 1 150 ? 19.054  7.490   -2.728  1.00 34.81 ? 150 ILE A CG1 1 
ATOM   1126 C  CG2 . ILE A 1 150 ? 17.791  5.518   -3.691  1.00 34.83 ? 150 ILE A CG2 1 
ATOM   1127 C  CD1 . ILE A 1 150 ? 20.235  7.519   -3.689  1.00 36.96 ? 150 ILE A CD1 1 
ATOM   1128 N  N   . VAL A 1 151 ? 15.828  4.394   -1.274  1.00 28.09 ? 151 VAL A N   1 
ATOM   1129 C  CA  . VAL A 1 151 ? 15.252  3.085   -0.987  1.00 30.22 ? 151 VAL A CA  1 
ATOM   1130 C  C   . VAL A 1 151 ? 14.405  2.572   -2.139  1.00 29.43 ? 151 VAL A C   1 
ATOM   1131 O  O   . VAL A 1 151 ? 13.648  3.324   -2.747  1.00 30.89 ? 151 VAL A O   1 
ATOM   1132 C  CB  . VAL A 1 151 ? 14.465  3.100   0.337   1.00 29.25 ? 151 VAL A CB  1 
ATOM   1133 C  CG1 . VAL A 1 151 ? 13.393  4.184   0.359   1.00 31.23 ? 151 VAL A CG1 1 
ATOM   1134 C  CG2 . VAL A 1 151 ? 13.872  1.738   0.627   1.00 29.68 ? 151 VAL A CG2 1 
ATOM   1135 N  N   . SER A 1 152 ? 14.604  1.301   -2.472  1.00 28.37 ? 152 SER A N   1 
ATOM   1136 C  CA  . SER A 1 152 ? 13.774  0.586   -3.426  1.00 28.41 ? 152 SER A CA  1 
ATOM   1137 C  C   . SER A 1 152 ? 13.106  -0.551  -2.659  1.00 28.10 ? 152 SER A C   1 
ATOM   1138 O  O   . SER A 1 152 ? 13.791  -1.309  -1.979  1.00 28.08 ? 152 SER A O   1 
ATOM   1139 C  CB  . SER A 1 152 ? 14.642  0.019   -4.561  1.00 27.22 ? 152 SER A CB  1 
ATOM   1140 O  OG  . SER A 1 152 ? 15.242  1.067   -5.340  1.00 26.83 ? 152 SER A OG  1 
ATOM   1141 N  N   . THR A 1 153 ? 11.772  -0.649  -2.743  1.00 27.25 ? 153 THR A N   1 
ATOM   1142 C  CA  . THR A 1 153 ? 11.035  -1.621  -1.953  1.00 27.55 ? 153 THR A CA  1 
ATOM   1143 C  C   . THR A 1 153 ? 10.614  -2.823  -2.772  1.00 26.70 ? 153 THR A C   1 
ATOM   1144 O  O   . THR A 1 153 ? 10.564  -2.778  -3.982  1.00 27.98 ? 153 THR A O   1 
ATOM   1145 C  CB  . THR A 1 153 ? 9.793   -1.037  -1.286  1.00 29.59 ? 153 THR A CB  1 
ATOM   1146 O  OG1 . THR A 1 153 ? 8.778   -0.811  -2.262  1.00 29.48 ? 153 THR A OG1 1 
ATOM   1147 C  CG2 . THR A 1 153 ? 10.122  0.271   -0.561  1.00 31.33 ? 153 THR A CG2 1 
ATOM   1148 N  N   . TYR A 1 154 ? 10.314  -3.892  -2.054  1.00 26.22 ? 154 TYR A N   1 
ATOM   1149 C  CA  . TYR A 1 154 ? 9.917   -5.154  -2.615  1.00 29.14 ? 154 TYR A CA  1 
ATOM   1150 C  C   . TYR A 1 154 ? 8.702   -5.579  -1.773  1.00 29.58 ? 154 TYR A C   1 
ATOM   1151 O  O   . TYR A 1 154 ? 8.836   -6.271  -0.763  1.00 30.20 ? 154 TYR A O   1 
ATOM   1152 C  CB  . TYR A 1 154 ? 11.067  -6.174  -2.506  1.00 28.29 ? 154 TYR A CB  1 
ATOM   1153 C  CG  . TYR A 1 154 ? 12.347  -5.875  -3.279  1.00 29.11 ? 154 TYR A CG  1 
ATOM   1154 C  CD1 . TYR A 1 154 ? 13.176  -4.813  -2.919  1.00 29.68 ? 154 TYR A CD1 1 
ATOM   1155 C  CD2 . TYR A 1 154 ? 12.778  -6.719  -4.325  1.00 30.27 ? 154 TYR A CD2 1 
ATOM   1156 C  CE1 . TYR A 1 154 ? 14.364  -4.565  -3.595  1.00 29.70 ? 154 TYR A CE1 1 
ATOM   1157 C  CE2 . TYR A 1 154 ? 13.969  -6.475  -5.000  1.00 29.20 ? 154 TYR A CE2 1 
ATOM   1158 C  CZ  . TYR A 1 154 ? 14.754  -5.385  -4.621  1.00 30.64 ? 154 TYR A CZ  1 
ATOM   1159 O  OH  . TYR A 1 154 ? 15.938  -5.084  -5.246  1.00 30.45 ? 154 TYR A OH  1 
ATOM   1160 N  N   . GLN A 1 155 ? 7.513   -5.119  -2.160  1.00 30.83 ? 155 GLN A N   1 
ATOM   1161 C  CA  . GLN A 1 155 ? 6.385   -5.150  -1.233  1.00 31.01 ? 155 GLN A CA  1 
ATOM   1162 C  C   . GLN A 1 155 ? 5.401   -6.276  -1.545  1.00 29.10 ? 155 GLN A C   1 
ATOM   1163 O  O   . GLN A 1 155 ? 5.072   -6.503  -2.694  1.00 28.30 ? 155 GLN A O   1 
ATOM   1164 C  CB  . GLN A 1 155 ? 5.689   -3.769  -1.160  1.00 31.51 ? 155 GLN A CB  1 
ATOM   1165 C  CG  . GLN A 1 155 ? 6.525   -2.708  -0.458  1.00 31.23 ? 155 GLN A CG  1 
ATOM   1166 C  CD  . GLN A 1 155 ? 5.880   -1.328  -0.434  1.00 32.12 ? 155 GLN A CD  1 
ATOM   1167 O  OE1 . GLN A 1 155 ? 6.483   -0.327  -0.844  1.00 33.67 ? 155 GLN A OE1 1 
ATOM   1168 N  NE2 . GLN A 1 155 ? 4.632   -1.268  0.013   1.00 32.59 ? 155 GLN A NE2 1 
ATOM   1169 N  N   . ALA A 1 156 ? 4.999   -6.989  -0.487  1.00 26.69 ? 156 ALA A N   1 
ATOM   1170 C  CA  . ALA A 1 156 ? 4.057   -8.088  -0.536  1.00 26.48 ? 156 ALA A CA  1 
ATOM   1171 C  C   . ALA A 1 156 ? 2.661   -7.586  -0.808  1.00 26.34 ? 156 ALA A C   1 
ATOM   1172 O  O   . ALA A 1 156 ? 2.317   -6.448  -0.453  1.00 27.25 ? 156 ALA A O   1 
ATOM   1173 C  CB  . ALA A 1 156 ? 4.089   -8.871  0.763   1.00 25.90 ? 156 ALA A CB  1 
ATOM   1174 N  N   . VAL A 1 157 ? 1.858   -8.450  -1.416  1.00 28.54 ? 157 VAL A N   1 
ATOM   1175 C  CA  . VAL A 1 157 ? 0.465   -8.126  -1.813  1.00 30.37 ? 157 VAL A CA  1 
ATOM   1176 C  C   . VAL A 1 157 ? -0.536  -7.913  -0.666  1.00 32.00 ? 157 VAL A C   1 
ATOM   1177 O  O   . VAL A 1 157 ? -1.493  -7.147  -0.824  1.00 34.46 ? 157 VAL A O   1 
ATOM   1178 C  CB  . VAL A 1 157 ? -0.104  -9.180  -2.807  1.00 31.25 ? 157 VAL A CB  1 
ATOM   1179 C  CG1 . VAL A 1 157 ? 0.700   -9.186  -4.100  1.00 33.35 ? 157 VAL A CG1 1 
ATOM   1180 C  CG2 . VAL A 1 157 ? -0.121  -10.572 -2.212  1.00 31.51 ? 157 VAL A CG2 1 
ATOM   1181 N  N   . SER A 1 158 ? -0.314  -8.541  0.491   1.00 33.94 ? 158 SER A N   1 
ATOM   1182 C  CA  . SER A 1 158 ? -1.215  -8.378  1.646   1.00 32.54 ? 158 SER A CA  1 
ATOM   1183 C  C   . SER A 1 158 ? -1.341  -6.938  2.109   1.00 37.25 ? 158 SER A C   1 
ATOM   1184 O  O   . SER A 1 158 ? -2.339  -6.572  2.740   1.00 37.14 ? 158 SER A O   1 
ATOM   1185 C  CB  . SER A 1 158 ? -0.787  -9.267  2.813   1.00 32.82 ? 158 SER A CB  1 
ATOM   1186 O  OG  . SER A 1 158 ? 0.549   -8.991  3.255   1.00 33.92 ? 158 SER A OG  1 
ATOM   1187 N  N   . GLY A 1 159 ? -0.333  -6.123  1.785   1.00 37.68 ? 159 GLY A N   1 
ATOM   1188 C  CA  . GLY A 1 159 ? -0.366  -4.695  2.025   1.00 35.93 ? 159 GLY A CA  1 
ATOM   1189 C  C   . GLY A 1 159 ? -1.501  -3.992  1.309   1.00 36.27 ? 159 GLY A C   1 
ATOM   1190 O  O   . GLY A 1 159 ? -1.917  -2.931  1.738   1.00 33.70 ? 159 GLY A O   1 
ATOM   1191 N  N   . ALA A 1 160 ? -2.020  -4.591  0.237   1.00 34.93 ? 160 ALA A N   1 
ATOM   1192 C  CA  . ALA A 1 160 ? -3.151  -4.027  -0.484  1.00 34.20 ? 160 ALA A CA  1 
ATOM   1193 C  C   . ALA A 1 160 ? -4.479  -4.720  -0.164  1.00 34.33 ? 160 ALA A C   1 
ATOM   1194 O  O   . ALA A 1 160 ? -5.465  -4.468  -0.846  1.00 35.67 ? 160 ALA A O   1 
ATOM   1195 C  CB  . ALA A 1 160 ? -2.883  -4.024  -1.999  1.00 34.63 ? 160 ALA A CB  1 
ATOM   1196 N  N   . GLY A 1 161 ? -4.509  -5.573  0.867   1.00 36.12 ? 161 GLY A N   1 
ATOM   1197 C  CA  . GLY A 1 161 ? -5.768  -6.112  1.409   1.00 35.70 ? 161 GLY A CA  1 
ATOM   1198 C  C   . GLY A 1 161 ? -6.139  -7.542  1.052   1.00 37.84 ? 161 GLY A C   1 
ATOM   1199 O  O   . GLY A 1 161 ? -5.503  -8.185  0.203   1.00 33.73 ? 161 GLY A O   1 
ATOM   1200 N  N   . MET A 1 162 ? -7.198  -8.044  1.683   1.00 36.33 ? 162 MET A N   1 
ATOM   1201 C  CA  . MET A 1 162 ? -7.598  -9.436  1.456   1.00 38.56 ? 162 MET A CA  1 
ATOM   1202 C  C   . MET A 1 162 ? -7.863  -9.693  -0.019  1.00 36.04 ? 162 MET A C   1 
ATOM   1203 O  O   . MET A 1 162 ? -7.516  -10.748 -0.531  1.00 34.62 ? 162 MET A O   1 
ATOM   1204 C  CB  . MET A 1 162 ? -8.834  -9.820  2.276   1.00 42.68 ? 162 MET A CB  1 
ATOM   1205 C  CG  . MET A 1 162 ? -8.533  -10.253 3.705   1.00 50.21 ? 162 MET A CG  1 
ATOM   1206 S  SD  . MET A 1 162 ? -7.471  -11.706 3.889   1.00 56.74 ? 162 MET A SD  1 
ATOM   1207 C  CE  . MET A 1 162 ? -7.833  -12.659 2.418   1.00 46.97 ? 162 MET A CE  1 
ATOM   1208 N  N   . GLY A 1 163 ? -8.475  -8.736  -0.703  1.00 34.48 ? 163 GLY A N   1 
ATOM   1209 C  CA  . GLY A 1 163 ? -8.771  -8.929  -2.125  1.00 37.34 ? 163 GLY A CA  1 
ATOM   1210 C  C   . GLY A 1 163 ? -7.519  -9.132  -2.972  1.00 36.34 ? 163 GLY A C   1 
ATOM   1211 O  O   . GLY A 1 163 ? -7.491  -9.960  -3.906  1.00 33.66 ? 163 GLY A O   1 
ATOM   1212 N  N   . ALA A 1 164 ? -6.493  -8.340  -2.664  1.00 35.95 ? 164 ALA A N   1 
ATOM   1213 C  CA  . ALA A 1 164 ? -5.230  -8.408  -3.374  1.00 36.54 ? 164 ALA A CA  1 
ATOM   1214 C  C   . ALA A 1 164 ? -4.628  -9.781  -3.175  1.00 33.61 ? 164 ALA A C   1 
ATOM   1215 O  O   . ALA A 1 164 ? -4.128  -10.373 -4.108  1.00 34.83 ? 164 ALA A O   1 
ATOM   1216 C  CB  . ALA A 1 164 ? -4.270  -7.323  -2.879  1.00 36.54 ? 164 ALA A CB  1 
ATOM   1217 N  N   . ILE A 1 165 ? -4.678  -10.280 -1.942  1.00 32.82 ? 165 ILE A N   1 
ATOM   1218 C  CA  . ILE A 1 165 ? -4.168  -11.614 -1.628  1.00 31.68 ? 165 ILE A CA  1 
ATOM   1219 C  C   . ILE A 1 165 ? -4.883  -12.670 -2.452  1.00 32.82 ? 165 ILE A C   1 
ATOM   1220 O  O   . ILE A 1 165 ? -4.235  -13.486 -3.115  1.00 33.36 ? 165 ILE A O   1 
ATOM   1221 C  CB  . ILE A 1 165 ? -4.287  -11.947 -0.136  1.00 31.85 ? 165 ILE A CB  1 
ATOM   1222 C  CG1 . ILE A 1 165 ? -3.403  -10.998 0.700   1.00 33.02 ? 165 ILE A CG1 1 
ATOM   1223 C  CG2 . ILE A 1 165 ? -3.885  -13.402 0.107   1.00 34.12 ? 165 ILE A CG2 1 
ATOM   1224 C  CD1 . ILE A 1 165 ? -3.648  -11.047 2.195   1.00 33.36 ? 165 ILE A CD1 1 
ATOM   1225 N  N   . LEU A 1 166 ? -6.219  -12.632 -2.462  1.00 34.06 ? 166 LEU A N   1 
ATOM   1226 C  CA  . LEU A 1 166 ? -6.974  -13.632 -3.213  1.00 34.91 ? 166 LEU A CA  1 
ATOM   1227 C  C   . LEU A 1 166 ? -6.675  -13.562 -4.699  1.00 32.74 ? 166 LEU A C   1 
ATOM   1228 O  O   . LEU A 1 166 ? -6.504  -14.587 -5.339  1.00 32.29 ? 166 LEU A O   1 
ATOM   1229 C  CB  . LEU A 1 166 ? -8.478  -13.488 -2.959  1.00 35.74 ? 166 LEU A CB  1 
ATOM   1230 C  CG  . LEU A 1 166 ? -8.886  -13.834 -1.513  1.00 38.52 ? 166 LEU A CG  1 
ATOM   1231 C  CD1 . LEU A 1 166 ? -10.319 -13.372 -1.253  1.00 39.94 ? 166 LEU A CD1 1 
ATOM   1232 C  CD2 . LEU A 1 166 ? -8.725  -15.311 -1.197  1.00 40.31 ? 166 LEU A CD2 1 
ATOM   1233 N  N   . GLU A 1 167 ? -6.591  -12.341 -5.233  1.00 34.47 ? 167 GLU A N   1 
ATOM   1234 C  CA  . GLU A 1 167 ? -6.275  -12.109 -6.641  1.00 32.83 ? 167 GLU A CA  1 
ATOM   1235 C  C   . GLU A 1 167 ? -4.933  -12.706 -7.008  1.00 31.90 ? 167 GLU A C   1 
ATOM   1236 O  O   . GLU A 1 167 ? -4.784  -13.347 -8.044  1.00 32.46 ? 167 GLU A O   1 
ATOM   1237 C  CB  . GLU A 1 167 ? -6.242  -10.610 -6.926  1.00 35.78 ? 167 GLU A CB  1 
ATOM   1238 C  CG  . GLU A 1 167 ? -5.781  -10.235 -8.322  1.00 36.01 ? 167 GLU A CG  1 
ATOM   1239 C  CD  . GLU A 1 167 ? -6.107  -8.788  -8.677  1.00 38.28 ? 167 GLU A CD  1 
ATOM   1240 O  OE1 . GLU A 1 167 ? -7.287  -8.484  -8.959  1.00 37.94 ? 167 GLU A OE1 1 
ATOM   1241 O  OE2 . GLU A 1 167 ? -5.190  -7.943  -8.689  1.00 37.91 ? 167 GLU A OE2 1 
ATOM   1242 N  N   . THR A 1 168 ? -3.942  -12.498 -6.156  1.00 30.80 ? 168 THR A N   1 
ATOM   1243 C  CA  . THR A 1 168 ? -2.625  -13.051 -6.404  1.00 30.28 ? 168 THR A CA  1 
ATOM   1244 C  C   . THR A 1 168 ? -2.617  -14.585 -6.472  1.00 30.99 ? 168 THR A C   1 
ATOM   1245 O  O   . THR A 1 168 ? -2.109  -15.190 -7.431  1.00 31.04 ? 168 THR A O   1 
ATOM   1246 C  CB  . THR A 1 168 ? -1.663  -12.545 -5.328  1.00 29.57 ? 168 THR A CB  1 
ATOM   1247 O  OG1 . THR A 1 168 ? -1.655  -11.120 -5.365  1.00 30.19 ? 168 THR A OG1 1 
ATOM   1248 C  CG2 . THR A 1 168 ? -0.250  -13.075 -5.566  1.00 30.70 ? 168 THR A CG2 1 
ATOM   1249 N  N   . GLN A 1 169 ? -3.207  -15.210 -5.465  1.00 32.50 ? 169 GLN A N   1 
ATOM   1250 C  CA  . GLN A 1 169 ? -3.327  -16.666 -5.431  1.00 34.03 ? 169 GLN A CA  1 
ATOM   1251 C  C   . GLN A 1 169 ? -4.054  -17.231 -6.651  1.00 35.34 ? 169 GLN A C   1 
ATOM   1252 O  O   . GLN A 1 169 ? -3.655  -18.254 -7.219  1.00 34.51 ? 169 GLN A O   1 
ATOM   1253 C  CB  . GLN A 1 169 ? -4.028  -17.082 -4.148  1.00 35.96 ? 169 GLN A CB  1 
ATOM   1254 C  CG  . GLN A 1 169 ? -3.187  -16.763 -2.912  1.00 39.64 ? 169 GLN A CG  1 
ATOM   1255 C  CD  . GLN A 1 169 ? -3.935  -16.996 -1.612  1.00 42.12 ? 169 GLN A CD  1 
ATOM   1256 O  OE1 . GLN A 1 169 ? -5.126  -16.691 -1.498  1.00 42.54 ? 169 GLN A OE1 1 
ATOM   1257 N  NE2 . GLN A 1 169 ? -3.241  -17.535 -0.625  1.00 40.08 ? 169 GLN A NE2 1 
ATOM   1258 N  N   . ARG A 1 170 ? -5.122  -16.560 -7.048  1.00 34.53 ? 170 ARG A N   1 
ATOM   1259 C  CA  . ARG A 1 170 ? -5.919  -17.004 -8.174  1.00 36.71 ? 170 ARG A CA  1 
ATOM   1260 C  C   . ARG A 1 170 ? -5.107  -16.928 -9.475  1.00 36.13 ? 170 ARG A C   1 
ATOM   1261 O  O   . ARG A 1 170 ? -5.073  -17.889 -10.250 1.00 34.47 ? 170 ARG A O   1 
ATOM   1262 C  CB  . ARG A 1 170 ? -7.178  -16.143 -8.266  1.00 36.71 ? 170 ARG A CB  1 
ATOM   1263 C  CG  . ARG A 1 170 ? -8.202  -16.630 -9.273  1.00 39.82 ? 170 ARG A CG  1 
ATOM   1264 C  CD  . ARG A 1 170 ? -8.207  -15.811 -10.532 1.00 42.43 ? 170 ARG A CD  1 
ATOM   1265 N  NE  . ARG A 1 170 ? -8.388  -14.371 -10.321 1.00 41.72 ? 170 ARG A NE  1 
ATOM   1266 C  CZ  . ARG A 1 170 ? -8.084  -13.454 -11.237 1.00 40.38 ? 170 ARG A CZ  1 
ATOM   1267 N  NH1 . ARG A 1 170 ? -7.612  -13.819 -12.413 1.00 42.30 ? 170 ARG A NH1 1 
ATOM   1268 N  NH2 . ARG A 1 170 ? -8.249  -12.165 -10.985 1.00 42.01 ? 170 ARG A NH2 1 
ATOM   1269 N  N   . GLU A 1 171 ? -4.427  -15.797 -9.681  1.00 36.36 ? 171 GLU A N   1 
ATOM   1270 C  CA  . GLU A 1 171 ? -3.567  -15.607 -10.843 1.00 33.77 ? 171 GLU A CA  1 
ATOM   1271 C  C   . GLU A 1 171 ? -2.475  -16.670 -10.908 1.00 33.14 ? 171 GLU A C   1 
ATOM   1272 O  O   . GLU A 1 171 ? -2.252  -17.276 -11.959 1.00 31.52 ? 171 GLU A O   1 
ATOM   1273 C  CB  . GLU A 1 171 ? -2.950  -14.197 -10.854 1.00 34.76 ? 171 GLU A CB  1 
ATOM   1274 C  CG  . GLU A 1 171 ? -3.940  -13.096 -11.193 1.00 35.23 ? 171 GLU A CG  1 
ATOM   1275 C  CD  . GLU A 1 171 ? -3.343  -11.693 -11.117 1.00 35.92 ? 171 GLU A CD  1 
ATOM   1276 O  OE1 . GLU A 1 171 ? -2.091  -11.573 -10.990 1.00 35.36 ? 171 GLU A OE1 1 
ATOM   1277 O  OE2 . GLU A 1 171 ? -4.133  -10.714 -11.176 1.00 34.98 ? 171 GLU A OE2 1 
ATOM   1278 N  N   . LEU A 1 172 ? -1.784  -16.907 -9.800  1.00 34.93 ? 172 LEU A N   1 
ATOM   1279 C  CA  . LEU A 1 172 ? -0.722  -17.918 -9.819  1.00 36.11 ? 172 LEU A CA  1 
ATOM   1280 C  C   . LEU A 1 172 ? -1.260  -19.318 -10.138 1.00 35.49 ? 172 LEU A C   1 
ATOM   1281 O  O   . LEU A 1 172 ? -0.632  -20.075 -10.890 1.00 35.65 ? 172 LEU A O   1 
ATOM   1282 C  CB  . LEU A 1 172 ? 0.041   -17.940 -8.505  1.00 35.83 ? 172 LEU A CB  1 
ATOM   1283 C  CG  . LEU A 1 172 ? 0.932   -16.712 -8.336  1.00 35.15 ? 172 LEU A CG  1 
ATOM   1284 C  CD1 . LEU A 1 172 ? 1.276   -16.481 -6.877  1.00 36.92 ? 172 LEU A CD1 1 
ATOM   1285 C  CD2 . LEU A 1 172 ? 2.197   -16.837 -9.158  1.00 37.07 ? 172 LEU A CD2 1 
ATOM   1286 N  N   . ARG A 1 173 ? -2.409  -19.660 -9.566  1.00 37.73 ? 173 ARG A N   1 
ATOM   1287 C  CA  . ARG A 1 173 ? -3.033  -20.959 -9.846  1.00 37.62 ? 173 ARG A CA  1 
ATOM   1288 C  C   . ARG A 1 173 ? -3.373  -21.077 -11.333 1.00 38.35 ? 173 ARG A C   1 
ATOM   1289 O  O   . ARG A 1 173 ? -3.121  -22.117 -11.946 1.00 37.39 ? 173 ARG A O   1 
ATOM   1290 C  CB  . ARG A 1 173 ? -4.273  -21.188 -8.971  1.00 38.93 ? 173 ARG A CB  1 
ATOM   1291 C  CG  . ARG A 1 173 ? -3.912  -21.568 -7.538  1.00 39.63 ? 173 ARG A CG  1 
ATOM   1292 C  CD  . ARG A 1 173 ? -5.130  -21.735 -6.643  1.00 41.50 ? 173 ARG A CD  1 
ATOM   1293 N  NE  . ARG A 1 173 ? -4.742  -22.204 -5.309  1.00 41.16 ? 173 ARG A NE  1 
ATOM   1294 C  CZ  . ARG A 1 173 ? -4.945  -21.556 -4.156  1.00 42.24 ? 173 ARG A CZ  1 
ATOM   1295 N  NH1 . ARG A 1 173 ? -5.579  -20.388 -4.116  1.00 42.64 ? 173 ARG A NH1 1 
ATOM   1296 N  NH2 . ARG A 1 173 ? -4.518  -22.097 -3.018  1.00 40.45 ? 173 ARG A NH2 1 
ATOM   1297 N  N   . GLU A 1 174 ? -3.911  -20.008 -11.914 1.00 37.71 ? 174 GLU A N   1 
ATOM   1298 C  CA  . GLU A 1 174 ? -4.254  -20.006 -13.344 1.00 40.45 ? 174 GLU A CA  1 
ATOM   1299 C  C   . GLU A 1 174 ? -3.043  -20.275 -14.227 1.00 40.25 ? 174 GLU A C   1 
ATOM   1300 O  O   . GLU A 1 174 ? -3.120  -21.024 -15.204 1.00 37.10 ? 174 GLU A O   1 
ATOM   1301 C  CB  . GLU A 1 174 ? -4.938  -18.695 -13.743 1.00 43.09 ? 174 GLU A CB  1 
ATOM   1302 C  CG  . GLU A 1 174 ? -6.388  -18.635 -13.289 1.00 44.51 ? 174 GLU A CG  1 
ATOM   1303 C  CD  . GLU A 1 174 ? -7.082  -17.326 -13.604 1.00 47.63 ? 174 GLU A CD  1 
ATOM   1304 O  OE1 . GLU A 1 174 ? -8.195  -17.124 -13.098 1.00 59.20 ? 174 GLU A OE1 1 
ATOM   1305 O  OE2 . GLU A 1 174 ? -6.557  -16.492 -14.358 1.00 52.15 ? 174 GLU A OE2 1 
ATOM   1306 N  N   . VAL A 1 175 ? -1.913  -19.674 -13.870 1.00 37.91 ? 175 VAL A N   1 
ATOM   1307 C  CA  . VAL A 1 175 ? -0.689  -19.879 -14.618 1.00 37.17 ? 175 VAL A CA  1 
ATOM   1308 C  C   . VAL A 1 175 ? -0.160  -21.286 -14.403 1.00 38.47 ? 175 VAL A C   1 
ATOM   1309 O  O   . VAL A 1 175 ? 0.132   -22.001 -15.364 1.00 37.23 ? 175 VAL A O   1 
ATOM   1310 C  CB  . VAL A 1 175 ? 0.402   -18.863 -14.204 1.00 36.25 ? 175 VAL A CB  1 
ATOM   1311 C  CG1 . VAL A 1 175 ? 1.751   -19.211 -14.824 1.00 36.19 ? 175 VAL A CG1 1 
ATOM   1312 C  CG2 . VAL A 1 175 ? -0.005  -17.450 -14.587 1.00 34.32 ? 175 VAL A CG2 1 
ATOM   1313 N  N   . LEU A 1 176 ? -0.042  -21.668 -13.138 1.00 37.06 ? 176 LEU A N   1 
ATOM   1314 C  CA  . LEU A 1 176 ? 0.700   -22.867 -12.763 1.00 39.49 ? 176 LEU A CA  1 
ATOM   1315 C  C   . LEU A 1 176 ? -0.074  -24.159 -12.966 1.00 41.02 ? 176 LEU A C   1 
ATOM   1316 O  O   . LEU A 1 176 ? 0.529   -25.184 -13.241 1.00 41.38 ? 176 LEU A O   1 
ATOM   1317 C  CB  . LEU A 1 176 ? 1.134   -22.772 -11.303 1.00 40.60 ? 176 LEU A CB  1 
ATOM   1318 C  CG  . LEU A 1 176 ? 2.224   -21.728 -11.041 1.00 39.99 ? 176 LEU A CG  1 
ATOM   1319 C  CD1 . LEU A 1 176 ? 2.240   -21.350 -9.578  1.00 41.35 ? 176 LEU A CD1 1 
ATOM   1320 C  CD2 . LEU A 1 176 ? 3.574   -22.282 -11.456 1.00 39.86 ? 176 LEU A CD2 1 
ATOM   1321 N  N   . ASN A 1 177 ? -1.396  -24.110 -12.803 1.00 40.14 ? 177 ASN A N   1 
ATOM   1322 C  CA  . ASN A 1 177 ? -2.248  -25.294 -12.941 1.00 42.64 ? 177 ASN A CA  1 
ATOM   1323 C  C   . ASN A 1 177 ? -3.005  -25.341 -14.253 1.00 44.02 ? 177 ASN A C   1 
ATOM   1324 O  O   . ASN A 1 177 ? -3.236  -26.429 -14.772 1.00 43.78 ? 177 ASN A O   1 
ATOM   1325 C  CB  . ASN A 1 177 ? -3.238  -25.398 -11.784 1.00 40.78 ? 177 ASN A CB  1 
ATOM   1326 C  CG  . ASN A 1 177 ? -2.552  -25.456 -10.441 1.00 42.00 ? 177 ASN A CG  1 
ATOM   1327 O  OD1 . ASN A 1 177 ? -1.449  -25.987 -10.314 1.00 43.20 ? 177 ASN A OD1 1 
ATOM   1328 N  ND2 . ASN A 1 177 ? -3.197  -24.900 -9.425  1.00 44.68 ? 177 ASN A ND2 1 
ATOM   1329 N  N   . ASP A 1 178 ? -3.378  -24.184 -14.799 1.00 41.24 ? 178 ASP A N   1 
ATOM   1330 C  CA  . ASP A 1 178 ? -4.143  -24.154 -16.055 1.00 45.45 ? 178 ASP A CA  1 
ATOM   1331 C  C   . ASP A 1 178 ? -3.335  -23.735 -17.283 1.00 44.04 ? 178 ASP A C   1 
ATOM   1332 O  O   . ASP A 1 178 ? -3.839  -23.806 -18.394 1.00 44.96 ? 178 ASP A O   1 
ATOM   1333 C  CB  . ASP A 1 178 ? -5.374  -23.249 -15.922 1.00 47.43 ? 178 ASP A CB  1 
ATOM   1334 C  CG  . ASP A 1 178 ? -6.256  -23.627 -14.751 1.00 49.52 ? 178 ASP A CG  1 
ATOM   1335 O  OD1 . ASP A 1 178 ? -6.210  -24.797 -14.322 1.00 50.77 ? 178 ASP A OD1 1 
ATOM   1336 O  OD2 . ASP A 1 178 ? -7.000  -22.750 -14.264 1.00 50.16 ? 178 ASP A OD2 1 
ATOM   1337 N  N   . GLY A 1 179 ? -2.095  -23.292 -17.089 1.00 42.15 ? 179 GLY A N   1 
ATOM   1338 C  CA  . GLY A 1 179 ? -1.250  -22.907 -18.199 1.00 41.78 ? 179 GLY A CA  1 
ATOM   1339 C  C   . GLY A 1 179 ? -1.613  -21.573 -18.844 1.00 42.69 ? 179 GLY A C   1 
ATOM   1340 O  O   . GLY A 1 179 ? -1.312  -21.353 -20.004 1.00 41.85 ? 179 GLY A O   1 
ATOM   1341 N  N   . VAL A 1 180 ? -2.247  -20.666 -18.108 1.00 42.59 ? 180 VAL A N   1 
ATOM   1342 C  CA  . VAL A 1 180 ? -2.506  -19.328 -18.653 1.00 41.62 ? 180 VAL A CA  1 
ATOM   1343 C  C   . VAL A 1 180 ? -1.175  -18.540 -18.688 1.00 42.90 ? 180 VAL A C   1 
ATOM   1344 O  O   . VAL A 1 180 ? -0.367  -18.649 -17.767 1.00 40.37 ? 180 VAL A O   1 
ATOM   1345 C  CB  . VAL A 1 180 ? -3.579  -18.600 -17.823 1.00 43.10 ? 180 VAL A CB  1 
ATOM   1346 C  CG1 . VAL A 1 180 ? -3.788  -17.171 -18.319 1.00 42.41 ? 180 VAL A CG1 1 
ATOM   1347 C  CG2 . VAL A 1 180 ? -4.891  -19.385 -17.865 1.00 44.35 ? 180 VAL A CG2 1 
ATOM   1348 N  N   . LYS A 1 181 ? -0.918  -17.794 -19.765 1.00 41.84 ? 181 LYS A N   1 
ATOM   1349 C  CA  . LYS A 1 181 ? 0.253   -16.907 -19.819 1.00 42.81 ? 181 LYS A CA  1 
ATOM   1350 C  C   . LYS A 1 181 ? 0.001   -15.701 -18.899 1.00 39.83 ? 181 LYS A C   1 
ATOM   1351 O  O   . LYS A 1 181 ? -1.119  -15.192 -18.854 1.00 36.38 ? 181 LYS A O   1 
ATOM   1352 C  CB  . LYS A 1 181 ? 0.507   -16.409 -21.244 1.00 47.74 ? 181 LYS A CB  1 
ATOM   1353 C  CG  . LYS A 1 181 ? 0.968   -17.501 -22.202 1.00 53.17 ? 181 LYS A CG  1 
ATOM   1354 C  CD  . LYS A 1 181 ? 0.945   -17.049 -23.660 1.00 55.48 ? 181 LYS A CD  1 
ATOM   1355 C  CE  . LYS A 1 181 ? 0.698   -18.238 -24.580 1.00 61.18 ? 181 LYS A CE  1 
ATOM   1356 N  NZ  . LYS A 1 181 ? 1.065   -17.956 -25.992 1.00 64.03 ? 181 LYS A NZ  1 
ATOM   1357 N  N   . PRO A 1 182 ? 1.027   -15.259 -18.154 1.00 35.11 ? 182 PRO A N   1 
ATOM   1358 C  CA  . PRO A 1 182 ? 0.779   -14.158 -17.226 1.00 35.72 ? 182 PRO A CA  1 
ATOM   1359 C  C   . PRO A 1 182 ? 0.269   -12.867 -17.865 1.00 35.96 ? 182 PRO A C   1 
ATOM   1360 O  O   . PRO A 1 182 ? -0.534  -12.180 -17.252 1.00 39.87 ? 182 PRO A O   1 
ATOM   1361 C  CB  . PRO A 1 182 ? 2.139   -13.941 -16.565 1.00 35.46 ? 182 PRO A CB  1 
ATOM   1362 C  CG  . PRO A 1 182 ? 2.794   -15.272 -16.628 1.00 36.31 ? 182 PRO A CG  1 
ATOM   1363 C  CD  . PRO A 1 182 ? 2.326   -15.911 -17.904 1.00 34.96 ? 182 PRO A CD  1 
ATOM   1364 N  N   . CYS A 1 183 ? 0.710   -12.541 -19.084 1.00 39.34 ? 183 CYS A N   1 
ATOM   1365 C  CA  . CYS A 1 183 ? 0.253   -11.327 -19.756 1.00 41.62 ? 183 CYS A CA  1 
ATOM   1366 C  C   . CYS A 1 183 ? -1.200  -11.454 -20.237 1.00 43.91 ? 183 CYS A C   1 
ATOM   1367 O  O   . CYS A 1 183 ? -1.796  -10.470 -20.665 1.00 44.34 ? 183 CYS A O   1 
ATOM   1368 C  CB  . CYS A 1 183 ? 1.179   -10.961 -20.924 1.00 45.09 ? 183 CYS A CB  1 
ATOM   1369 S  SG  . CYS A 1 183 ? 1.281   -12.255 -22.183 1.00 51.68 ? 183 CYS A SG  1 
ATOM   1370 N  N   . ASP A 1 184 ? -1.760  -12.661 -20.153 1.00 43.28 ? 184 ASP A N   1 
ATOM   1371 C  CA  . ASP A 1 184 ? -3.154  -12.920 -20.504 1.00 44.13 ? 184 ASP A CA  1 
ATOM   1372 C  C   . ASP A 1 184 ? -4.077  -12.920 -19.293 1.00 41.44 ? 184 ASP A C   1 
ATOM   1373 O  O   . ASP A 1 184 ? -5.283  -13.059 -19.447 1.00 42.78 ? 184 ASP A O   1 
ATOM   1374 C  CB  . ASP A 1 184 ? -3.265  -14.275 -21.228 1.00 46.20 ? 184 ASP A CB  1 
ATOM   1375 C  CG  . ASP A 1 184 ? -2.659  -14.253 -22.628 1.00 49.66 ? 184 ASP A CG  1 
ATOM   1376 O  OD1 . ASP A 1 184 ? -2.442  -13.156 -23.187 1.00 49.46 ? 184 ASP A OD1 1 
ATOM   1377 O  OD2 . ASP A 1 184 ? -2.408  -15.345 -23.181 1.00 50.34 ? 184 ASP A OD2 1 
ATOM   1378 N  N   . LEU A 1 185 ? -3.532  -12.741 -18.094 1.00 37.62 ? 185 LEU A N   1 
ATOM   1379 C  CA  . LEU A 1 185 ? -4.344  -12.764 -16.875 1.00 40.13 ? 185 LEU A CA  1 
ATOM   1380 C  C   . LEU A 1 185 ? -5.237  -11.534 -16.766 1.00 40.74 ? 185 LEU A C   1 
ATOM   1381 O  O   . LEU A 1 185 ? -4.853  -10.447 -17.187 1.00 40.68 ? 185 LEU A O   1 
ATOM   1382 C  CB  . LEU A 1 185 ? -3.451  -12.830 -15.636 1.00 38.87 ? 185 LEU A CB  1 
ATOM   1383 C  CG  . LEU A 1 185 ? -2.703  -14.143 -15.431 1.00 38.51 ? 185 LEU A CG  1 
ATOM   1384 C  CD1 . LEU A 1 185 ? -1.552  -13.931 -14.466 1.00 37.39 ? 185 LEU A CD1 1 
ATOM   1385 C  CD2 . LEU A 1 185 ? -3.647  -15.231 -14.927 1.00 38.20 ? 185 LEU A CD2 1 
ATOM   1386 N  N   . HIS A 1 186 ? -6.430  -11.718 -16.214 1.00 42.09 ? 186 HIS A N   1 
ATOM   1387 C  CA  . HIS A 1 186 ? -7.323  -10.602 -15.903 1.00 42.88 ? 186 HIS A CA  1 
ATOM   1388 C  C   . HIS A 1 186 ? -7.143  -10.209 -14.437 1.00 39.25 ? 186 HIS A C   1 
ATOM   1389 O  O   . HIS A 1 186 ? -7.211  -11.042 -13.549 1.00 44.89 ? 186 HIS A O   1 
ATOM   1390 C  CB  . HIS A 1 186 ? -8.783  -10.977 -16.177 1.00 48.44 ? 186 HIS A CB  1 
ATOM   1391 C  CG  . HIS A 1 186 ? -9.773  -9.933  -15.746 1.00 55.14 ? 186 HIS A CG  1 
ATOM   1392 N  ND1 . HIS A 1 186 ? -9.892  -8.708  -16.373 1.00 61.25 ? 186 HIS A ND1 1 
ATOM   1393 C  CD2 . HIS A 1 186 ? -10.705 -9.940  -14.761 1.00 59.96 ? 186 HIS A CD2 1 
ATOM   1394 C  CE1 . HIS A 1 186 ? -10.848 -8.005  -15.790 1.00 58.86 ? 186 HIS A CE1 1 
ATOM   1395 N  NE2 . HIS A 1 186 ? -11.358 -8.729  -14.810 1.00 59.86 ? 186 HIS A NE2 1 
ATOM   1396 N  N   . ALA A 1 187 ? -6.902  -8.933  -14.206 1.00 37.83 ? 187 ALA A N   1 
ATOM   1397 C  CA  . ALA A 1 187 ? -6.745  -8.385  -12.869 1.00 37.70 ? 187 ALA A CA  1 
ATOM   1398 C  C   . ALA A 1 187 ? -7.810  -7.326  -12.607 1.00 36.00 ? 187 ALA A C   1 
ATOM   1399 O  O   . ALA A 1 187 ? -8.160  -6.573  -13.509 1.00 37.15 ? 187 ALA A O   1 
ATOM   1400 C  CB  . ALA A 1 187 ? -5.363  -7.762  -12.739 1.00 38.83 ? 187 ALA A CB  1 
ATOM   1401 N  N   . GLU A 1 188 ? -8.262  -7.233  -11.354 1.00 37.11 ? 188 GLU A N   1 
ATOM   1402 C  CA  . GLU A 1 188 ? -9.221  -6.210  -10.942 1.00 39.74 ? 188 GLU A CA  1 
ATOM   1403 C  C   . GLU A 1 188 ? -8.760  -5.281  -9.815  1.00 37.56 ? 188 GLU A C   1 
ATOM   1404 O  O   . GLU A 1 188 ? -9.391  -4.260  -9.590  1.00 35.08 ? 188 GLU A O   1 
ATOM   1405 C  CB  . GLU A 1 188 ? -10.532 -6.883  -10.530 1.00 45.50 ? 188 GLU A CB  1 
ATOM   1406 C  CG  . GLU A 1 188 ? -11.100 -7.785  -11.612 1.00 49.54 ? 188 GLU A CG  1 
ATOM   1407 C  CD  . GLU A 1 188 ? -12.615 -7.885  -11.560 1.00 59.32 ? 188 GLU A CD  1 
ATOM   1408 O  OE1 . GLU A 1 188 ? -13.146 -8.293  -10.501 1.00 61.92 ? 188 GLU A OE1 1 
ATOM   1409 O  OE2 . GLU A 1 188 ? -13.268 -7.562  -12.586 1.00 62.46 ? 188 GLU A OE2 1 
ATOM   1410 N  N   . ILE A 1 189 ? -7.669  -5.597  -9.110  1.00 35.23 ? 189 ILE A N   1 
ATOM   1411 C  CA  . ILE A 1 189 ? -7.295  -4.776  -7.945  1.00 34.42 ? 189 ILE A CA  1 
ATOM   1412 C  C   . ILE A 1 189 ? -5.910  -4.155  -8.099  1.00 32.93 ? 189 ILE A C   1 
ATOM   1413 O  O   . ILE A 1 189 ? -5.769  -2.930  -8.120  1.00 34.96 ? 189 ILE A O   1 
ATOM   1414 C  CB  . ILE A 1 189 ? -7.369  -5.573  -6.618  1.00 35.87 ? 189 ILE A CB  1 
ATOM   1415 C  CG1 . ILE A 1 189 ? -8.785  -6.140  -6.415  1.00 36.46 ? 189 ILE A CG1 1 
ATOM   1416 C  CG2 . ILE A 1 189 ? -6.975  -4.685  -5.436  1.00 36.37 ? 189 ILE A CG2 1 
ATOM   1417 C  CD1 . ILE A 1 189 ? -8.908  -7.154  -5.299  1.00 37.68 ? 189 ILE A CD1 1 
ATOM   1418 N  N   . LEU A 1 190 ? -4.890  -4.989  -8.208  1.00 32.13 ? 190 LEU A N   1 
ATOM   1419 C  CA  . LEU A 1 190 ? -3.517  -4.474  -8.233  1.00 30.92 ? 190 LEU A CA  1 
ATOM   1420 C  C   . LEU A 1 190 ? -3.236  -3.751  -9.559  1.00 30.85 ? 190 LEU A C   1 
ATOM   1421 O  O   . LEU A 1 190 ? -3.863  -4.056  -10.568 1.00 33.39 ? 190 LEU A O   1 
ATOM   1422 C  CB  . LEU A 1 190 ? -2.541  -5.603  -7.977  1.00 31.54 ? 190 LEU A CB  1 
ATOM   1423 C  CG  . LEU A 1 190 ? -2.617  -6.148  -6.553  1.00 33.84 ? 190 LEU A CG  1 
ATOM   1424 C  CD1 . LEU A 1 190 ? -1.920  -7.494  -6.462  1.00 35.34 ? 190 LEU A CD1 1 
ATOM   1425 C  CD2 . LEU A 1 190 ? -2.017  -5.161  -5.549  1.00 33.71 ? 190 LEU A CD2 1 
ATOM   1426 N  N   . PRO A 1 191 ? -2.314  -2.772  -9.566  1.00 32.63 ? 191 PRO A N   1 
ATOM   1427 C  CA  . PRO A 1 191 ? -1.457  -2.299  -8.474  1.00 33.57 ? 191 PRO A CA  1 
ATOM   1428 C  C   . PRO A 1 191 ? -2.207  -1.510  -7.395  1.00 35.07 ? 191 PRO A C   1 
ATOM   1429 O  O   . PRO A 1 191 ? -1.794  -1.551  -6.238  1.00 31.40 ? 191 PRO A O   1 
ATOM   1430 C  CB  . PRO A 1 191 ? -0.430  -1.402  -9.191  1.00 33.54 ? 191 PRO A CB  1 
ATOM   1431 C  CG  . PRO A 1 191 ? -1.145  -0.951  -10.417 1.00 33.32 ? 191 PRO A CG  1 
ATOM   1432 C  CD  . PRO A 1 191 ? -1.972  -2.123  -10.841 1.00 31.85 ? 191 PRO A CD  1 
ATOM   1433 N  N   . SER A 1 192 ? -3.324  -0.859  -7.755  1.00 33.90 ? 192 SER A N   1 
ATOM   1434 C  CA  . SER A 1 192 ? -4.075  -0.012  -6.817  1.00 35.18 ? 192 SER A CA  1 
ATOM   1435 C  C   . SER A 1 192 ? -5.602  -0.055  -7.053  1.00 34.54 ? 192 SER A C   1 
ATOM   1436 O  O   . SER A 1 192 ? -6.051  0.318   -8.109  1.00 34.29 ? 192 SER A O   1 
ATOM   1437 C  CB  . SER A 1 192 ? -3.619  1.433   -6.953  1.00 37.90 ? 192 SER A CB  1 
ATOM   1438 O  OG  . SER A 1 192 ? -4.377  2.266   -6.079  1.00 44.35 ? 192 SER A OG  1 
ATOM   1439 N  N   . GLY A 1 193 ? -6.357  -0.499  -6.053  1.00 37.13 ? 193 GLY A N   1 
ATOM   1440 C  CA  . GLY A 1 193 ? -7.819  -0.613  -6.134  1.00 41.62 ? 193 GLY A CA  1 
ATOM   1441 C  C   . GLY A 1 193 ? -8.477  0.660   -6.639  1.00 42.80 ? 193 GLY A C   1 
ATOM   1442 O  O   . GLY A 1 193 ? -9.291  0.618   -7.547  1.00 49.66 ? 193 GLY A O   1 
ATOM   1443 N  N   . GLY A 1 194 ? -8.067  1.796   -6.090  1.00 45.24 ? 194 GLY A N   1 
ATOM   1444 C  CA  . GLY A 1 194 ? -8.616  3.091   -6.482  1.00 47.57 ? 194 GLY A CA  1 
ATOM   1445 C  C   . GLY A 1 194 ? -7.984  3.768   -7.689  1.00 47.91 ? 194 GLY A C   1 
ATOM   1446 O  O   . GLY A 1 194 ? -8.121  4.977   -7.842  1.00 49.91 ? 194 GLY A O   1 
ATOM   1447 N  N   . ASP A 1 195 ? -7.283  3.029   -8.553  1.00 43.56 ? 195 ASP A N   1 
ATOM   1448 C  CA  . ASP A 1 195 ? -6.793  3.626   -9.794  1.00 40.88 ? 195 ASP A CA  1 
ATOM   1449 C  C   . ASP A 1 195 ? -7.558  3.003   -10.953 1.00 38.57 ? 195 ASP A C   1 
ATOM   1450 O  O   . ASP A 1 195 ? -8.283  2.033   -10.777 1.00 38.88 ? 195 ASP A O   1 
ATOM   1451 C  CB  . ASP A 1 195 ? -5.261  3.470   -9.940  1.00 40.60 ? 195 ASP A CB  1 
ATOM   1452 C  CG  . ASP A 1 195 ? -4.597  4.659   -10.666 1.00 40.12 ? 195 ASP A CG  1 
ATOM   1453 O  OD1 . ASP A 1 195 ? -5.291  5.381   -11.407 1.00 38.22 ? 195 ASP A OD1 1 
ATOM   1454 O  OD2 . ASP A 1 195 ? -3.364  4.865   -10.523 1.00 36.29 ? 195 ASP A OD2 1 
ATOM   1455 N  N   . LYS A 1 196 ? -7.395  3.582   -12.128 1.00 38.85 ? 196 LYS A N   1 
ATOM   1456 C  CA  . LYS A 1 196 ? -8.210  3.261   -13.289 1.00 41.22 ? 196 LYS A CA  1 
ATOM   1457 C  C   . LYS A 1 196 ? -7.905  1.906   -13.922 1.00 41.48 ? 196 LYS A C   1 
ATOM   1458 O  O   . LYS A 1 196 ? -8.816  1.212   -14.376 1.00 40.19 ? 196 LYS A O   1 
ATOM   1459 C  CB  . LYS A 1 196 ? -8.022  4.344   -14.353 1.00 43.80 ? 196 LYS A CB  1 
ATOM   1460 C  CG  . LYS A 1 196 ? -8.365  5.757   -13.893 1.00 46.57 ? 196 LYS A CG  1 
ATOM   1461 C  CD  . LYS A 1 196 ? -8.288  6.730   -15.060 1.00 49.22 ? 196 LYS A CD  1 
ATOM   1462 C  CE  . LYS A 1 196 ? -8.562  8.165   -14.624 1.00 52.81 ? 196 LYS A CE  1 
ATOM   1463 N  NZ  . LYS A 1 196 ? -7.510  8.682   -13.707 1.00 54.04 ? 196 LYS A NZ  1 
ATOM   1464 N  N   . LYS A 1 197 ? -6.632  1.524   -13.963 1.00 38.74 ? 197 LYS A N   1 
ATOM   1465 C  CA  . LYS A 1 197 ? -6.235  0.319   -14.697 1.00 38.72 ? 197 LYS A CA  1 
ATOM   1466 C  C   . LYS A 1 197 ? -5.590  -0.714  -13.779 1.00 37.55 ? 197 LYS A C   1 
ATOM   1467 O  O   . LYS A 1 197 ? -4.930  -0.372  -12.795 1.00 38.11 ? 197 LYS A O   1 
ATOM   1468 C  CB  . LYS A 1 197 ? -5.276  0.703   -15.823 1.00 41.17 ? 197 LYS A CB  1 
ATOM   1469 C  CG  . LYS A 1 197 ? -5.922  1.533   -16.928 1.00 43.00 ? 197 LYS A CG  1 
ATOM   1470 C  CD  . LYS A 1 197 ? -4.890  2.182   -17.833 1.00 43.85 ? 197 LYS A CD  1 
ATOM   1471 C  CE  . LYS A 1 197 ? -4.132  1.149   -18.635 1.00 44.42 ? 197 LYS A CE  1 
ATOM   1472 N  NZ  . LYS A 1 197 ? -3.127  1.796   -19.505 1.00 44.74 ? 197 LYS A NZ  1 
ATOM   1473 N  N   . HIS A 1 198 ? -5.770  -1.985  -14.104 1.00 36.49 ? 198 HIS A N   1 
ATOM   1474 C  CA  . HIS A 1 198 ? -5.294  -3.057  -13.226 1.00 35.45 ? 198 HIS A CA  1 
ATOM   1475 C  C   . HIS A 1 198 ? -4.455  -4.045  -14.005 1.00 36.67 ? 198 HIS A C   1 
ATOM   1476 O  O   . HIS A 1 198 ? -4.773  -4.384  -15.148 1.00 34.73 ? 198 HIS A O   1 
ATOM   1477 C  CB  . HIS A 1 198 ? -6.468  -3.718  -12.525 1.00 36.13 ? 198 HIS A CB  1 
ATOM   1478 C  CG  . HIS A 1 198 ? -7.353  -2.731  -11.846 1.00 38.43 ? 198 HIS A CG  1 
ATOM   1479 N  ND1 . HIS A 1 198 ? -7.045  -2.182  -10.620 1.00 40.41 ? 198 HIS A ND1 1 
ATOM   1480 C  CD2 . HIS A 1 198 ? -8.496  -2.129  -12.254 1.00 39.16 ? 198 HIS A CD2 1 
ATOM   1481 C  CE1 . HIS A 1 198 ? -7.979  -1.309  -10.287 1.00 40.68 ? 198 HIS A CE1 1 
ATOM   1482 N  NE2 . HIS A 1 198 ? -8.867  -1.255  -11.263 1.00 39.26 ? 198 HIS A NE2 1 
ATOM   1483 N  N   . TYR A 1 199 ? -3.351  -4.462  -13.385 1.00 34.66 ? 199 TYR A N   1 
ATOM   1484 C  CA  . TYR A 1 199 ? -2.390  -5.326  -14.038 1.00 31.70 ? 199 TYR A CA  1 
ATOM   1485 C  C   . TYR A 1 199 ? -2.149  -6.579  -13.214 1.00 28.73 ? 199 TYR A C   1 
ATOM   1486 O  O   . TYR A 1 199 ? -2.295  -6.571  -12.002 1.00 28.35 ? 199 TYR A O   1 
ATOM   1487 C  CB  . TYR A 1 199 ? -1.058  -4.596  -14.208 1.00 32.31 ? 199 TYR A CB  1 
ATOM   1488 C  CG  . TYR A 1 199 ? -1.137  -3.323  -15.002 1.00 31.52 ? 199 TYR A CG  1 
ATOM   1489 C  CD1 . TYR A 1 199 ? -1.683  -3.301  -16.303 1.00 32.07 ? 199 TYR A CD1 1 
ATOM   1490 C  CD2 . TYR A 1 199 ? -0.648  -2.127  -14.474 1.00 31.33 ? 199 TYR A CD2 1 
ATOM   1491 C  CE1 . TYR A 1 199 ? -1.715  -2.121  -17.044 1.00 29.63 ? 199 TYR A CE1 1 
ATOM   1492 C  CE2 . TYR A 1 199 ? -0.696  -0.955  -15.205 1.00 29.27 ? 199 TYR A CE2 1 
ATOM   1493 C  CZ  . TYR A 1 199 ? -1.232  -0.944  -16.477 1.00 28.47 ? 199 TYR A CZ  1 
ATOM   1494 O  OH  . TYR A 1 199 ? -1.260  0.261   -17.168 1.00 29.82 ? 199 TYR A OH  1 
ATOM   1495 N  N   . PRO A 1 200 ? -1.742  -7.664  -13.874 1.00 29.38 ? 200 PRO A N   1 
ATOM   1496 C  CA  . PRO A 1 200 ? -1.422  -8.886  -13.164 1.00 29.66 ? 200 PRO A CA  1 
ATOM   1497 C  C   . PRO A 1 200 ? -0.165  -8.744  -12.339 1.00 29.92 ? 200 PRO A C   1 
ATOM   1498 O  O   . PRO A 1 200 ? 0.760   -8.038  -12.743 1.00 30.74 ? 200 PRO A O   1 
ATOM   1499 C  CB  . PRO A 1 200 ? -1.181  -9.896  -14.296 1.00 32.02 ? 200 PRO A CB  1 
ATOM   1500 C  CG  . PRO A 1 200 ? -1.912  -9.329  -15.459 1.00 32.65 ? 200 PRO A CG  1 
ATOM   1501 C  CD  . PRO A 1 200 ? -1.703  -7.853  -15.335 1.00 30.47 ? 200 PRO A CD  1 
ATOM   1502 N  N   . ILE A 1 201 ? -0.140  -9.402  -11.185 1.00 31.26 ? 201 ILE A N   1 
ATOM   1503 C  CA  . ILE A 1 201 ? 1.070   -9.431  -10.337 1.00 31.53 ? 201 ILE A CA  1 
ATOM   1504 C  C   . ILE A 1 201 ? 1.798   -10.761 -10.467 1.00 32.73 ? 201 ILE A C   1 
ATOM   1505 O  O   . ILE A 1 201 ? 2.982   -10.841 -10.174 1.00 30.98 ? 201 ILE A O   1 
ATOM   1506 C  CB  . ILE A 1 201 ? 0.733   -9.140  -8.848  1.00 32.31 ? 201 ILE A CB  1 
ATOM   1507 C  CG1 . ILE A 1 201 ? 2.000   -8.998  -7.977  1.00 31.50 ? 201 ILE A CG1 1 
ATOM   1508 C  CG2 . ILE A 1 201 ? -0.127  -10.251 -8.245  1.00 33.10 ? 201 ILE A CG2 1 
ATOM   1509 C  CD1 . ILE A 1 201 ? 2.958   -7.913  -8.413  1.00 31.65 ? 201 ILE A CD1 1 
ATOM   1510 N  N   . ALA A 1 202 ? 1.085   -11.815 -10.866 1.00 32.64 ? 202 ALA A N   1 
ATOM   1511 C  CA  . ALA A 1 202 ? 1.712   -13.137 -11.005 1.00 34.84 ? 202 ALA A CA  1 
ATOM   1512 C  C   . ALA A 1 202 ? 2.959   -13.079 -11.902 1.00 34.23 ? 202 ALA A C   1 
ATOM   1513 O  O   . ALA A 1 202 ? 2.876   -12.644 -13.028 1.00 33.63 ? 202 ALA A O   1 
ATOM   1514 C  CB  . ALA A 1 202 ? 0.715   -14.131 -11.561 1.00 35.48 ? 202 ALA A CB  1 
ATOM   1515 N  N   . PHE A 1 203 ? 4.112   -13.501 -11.378 1.00 34.32 ? 203 PHE A N   1 
ATOM   1516 C  CA  . PHE A 1 203 ? 5.377   -13.477 -12.116 1.00 32.91 ? 203 PHE A CA  1 
ATOM   1517 C  C   . PHE A 1 203 ? 5.705   -12.108 -12.711 1.00 32.28 ? 203 PHE A C   1 
ATOM   1518 O  O   . PHE A 1 203 ? 6.279   -12.002 -13.807 1.00 32.04 ? 203 PHE A O   1 
ATOM   1519 C  CB  . PHE A 1 203 ? 5.366   -14.560 -13.204 1.00 35.27 ? 203 PHE A CB  1 
ATOM   1520 C  CG  . PHE A 1 203 ? 5.114   -15.933 -12.654 1.00 36.17 ? 203 PHE A CG  1 
ATOM   1521 C  CD1 . PHE A 1 203 ? 6.112   -16.592 -11.950 1.00 35.64 ? 203 PHE A CD1 1 
ATOM   1522 C  CD2 . PHE A 1 203 ? 3.872   -16.527 -12.771 1.00 36.63 ? 203 PHE A CD2 1 
ATOM   1523 C  CE1 . PHE A 1 203 ? 5.887   -17.853 -11.412 1.00 37.45 ? 203 PHE A CE1 1 
ATOM   1524 C  CE2 . PHE A 1 203 ? 3.634   -17.790 -12.240 1.00 38.04 ? 203 PHE A CE2 1 
ATOM   1525 C  CZ  . PHE A 1 203 ? 4.639   -18.451 -11.556 1.00 38.62 ? 203 PHE A CZ  1 
ATOM   1526 N  N   . ASN A 1 204 ? 5.370   -11.061 -11.965 1.00 28.40 ? 204 ASN A N   1 
ATOM   1527 C  CA  . ASN A 1 204 ? 5.580   -9.704  -12.417 1.00 28.51 ? 204 ASN A CA  1 
ATOM   1528 C  C   . ASN A 1 204 ? 6.135   -8.866  -11.284 1.00 28.03 ? 204 ASN A C   1 
ATOM   1529 O  O   . ASN A 1 204 ? 6.134   -9.292  -10.123 1.00 26.77 ? 204 ASN A O   1 
ATOM   1530 C  CB  . ASN A 1 204 ? 4.235   -9.120  -12.856 1.00 27.93 ? 204 ASN A CB  1 
ATOM   1531 C  CG  . ASN A 1 204 ? 4.368   -7.991  -13.858 1.00 29.45 ? 204 ASN A CG  1 
ATOM   1532 O  OD1 . ASN A 1 204 ? 5.438   -7.755  -14.421 1.00 30.18 ? 204 ASN A OD1 1 
ATOM   1533 N  ND2 . ASN A 1 204 ? 3.259   -7.293  -14.106 1.00 29.96 ? 204 ASN A ND2 1 
ATOM   1534 N  N   . ALA A 1 205 ? 6.608   -7.672  -11.628 1.00 27.31 ? 205 ALA A N   1 
ATOM   1535 C  CA  . ALA A 1 205 ? 6.987   -6.693  -10.637 1.00 27.58 ? 205 ALA A CA  1 
ATOM   1536 C  C   . ALA A 1 205 ? 6.370   -5.387  -11.060 1.00 28.52 ? 205 ALA A C   1 
ATOM   1537 O  O   . ALA A 1 205 ? 6.654   -4.899  -12.144 1.00 30.26 ? 205 ALA A O   1 
ATOM   1538 C  CB  . ALA A 1 205 ? 8.504   -6.599  -10.527 1.00 28.14 ? 205 ALA A CB  1 
ATOM   1539 N  N   . LEU A 1 206 ? 5.514   -4.812  -10.216 1.00 29.07 ? 206 LEU A N   1 
ATOM   1540 C  CA  . LEU A 1 206 ? 4.804   -3.595  -10.583 1.00 28.73 ? 206 LEU A CA  1 
ATOM   1541 C  C   . LEU A 1 206 ? 5.341   -2.415  -9.825  1.00 28.61 ? 206 LEU A C   1 
ATOM   1542 O  O   . LEU A 1 206 ? 5.163   -2.334  -8.609  1.00 27.89 ? 206 LEU A O   1 
ATOM   1543 C  CB  . LEU A 1 206 ? 3.301   -3.713  -10.311 1.00 30.74 ? 206 LEU A CB  1 
ATOM   1544 C  CG  . LEU A 1 206 ? 2.511   -4.700  -11.163 1.00 32.88 ? 206 LEU A CG  1 
ATOM   1545 C  CD1 . LEU A 1 206 ? 1.147   -4.960  -10.539 1.00 31.92 ? 206 LEU A CD1 1 
ATOM   1546 C  CD2 . LEU A 1 206 ? 2.356   -4.190  -12.593 1.00 32.82 ? 206 LEU A CD2 1 
ATOM   1547 N  N   . PRO A 1 207 ? 5.960   -1.460  -10.537 1.00 29.38 ? 207 PRO A N   1 
ATOM   1548 C  CA  . PRO A 1 207 ? 6.562   -0.274  -9.919  1.00 30.22 ? 207 PRO A CA  1 
ATOM   1549 C  C   . PRO A 1 207 ? 5.522   0.832   -9.661  1.00 31.21 ? 207 PRO A C   1 
ATOM   1550 O  O   . PRO A 1 207 ? 5.720   1.998   -10.037 1.00 31.01 ? 207 PRO A O   1 
ATOM   1551 C  CB  . PRO A 1 207 ? 7.578   0.152   -10.969 1.00 31.50 ? 207 PRO A CB  1 
ATOM   1552 C  CG  . PRO A 1 207 ? 6.874   -0.175  -12.253 1.00 32.41 ? 207 PRO A CG  1 
ATOM   1553 C  CD  . PRO A 1 207 ? 6.244   -1.515  -11.985 1.00 30.86 ? 207 PRO A CD  1 
ATOM   1554 N  N   . GLN A 1 208 ? 4.406   0.444   -9.060  1.00 30.41 ? 208 GLN A N   1 
ATOM   1555 C  CA  . GLN A 1 208 ? 3.341   1.377   -8.650  1.00 31.72 ? 208 GLN A CA  1 
ATOM   1556 C  C   . GLN A 1 208 ? 2.706   0.844   -7.381  1.00 32.76 ? 208 GLN A C   1 
ATOM   1557 O  O   . GLN A 1 208 ? 2.182   -0.278  -7.365  1.00 31.48 ? 208 GLN A O   1 
ATOM   1558 C  CB  . GLN A 1 208 ? 2.244   1.535   -9.729  1.00 31.94 ? 208 GLN A CB  1 
ATOM   1559 C  CG  . GLN A 1 208 ? 1.289   2.667   -9.369  1.00 31.25 ? 208 GLN A CG  1 
ATOM   1560 C  CD  . GLN A 1 208 ? 0.007   2.738   -10.197 1.00 30.88 ? 208 GLN A CD  1 
ATOM   1561 O  OE1 . GLN A 1 208 ? -0.105  2.203   -11.309 1.00 29.32 ? 208 GLN A OE1 1 
ATOM   1562 N  NE2 . GLN A 1 208 ? -0.962  3.447   -9.653  1.00 29.75 ? 208 GLN A NE2 1 
ATOM   1563 N  N   . ILE A 1 209 ? 2.750   1.654   -6.320  1.00 30.50 ? 209 ILE A N   1 
ATOM   1564 C  CA  . ILE A 1 209 ? 2.009   1.373   -5.105  1.00 31.96 ? 209 ILE A CA  1 
ATOM   1565 C  C   . ILE A 1 209 ? 1.298   2.679   -4.752  1.00 33.03 ? 209 ILE A C   1 
ATOM   1566 O  O   . ILE A 1 209 ? 1.919   3.735   -4.697  1.00 33.72 ? 209 ILE A O   1 
ATOM   1567 C  CB  . ILE A 1 209 ? 2.917   0.844   -3.986  1.00 33.71 ? 209 ILE A CB  1 
ATOM   1568 C  CG1 . ILE A 1 209 ? 3.520   -0.507  -4.432  1.00 34.38 ? 209 ILE A CG1 1 
ATOM   1569 C  CG2 . ILE A 1 209 ? 2.166   0.755   -2.659  1.00 34.11 ? 209 ILE A CG2 1 
ATOM   1570 C  CD1 . ILE A 1 209 ? 4.275   -1.271  -3.381  1.00 34.77 ? 209 ILE A CD1 1 
ATOM   1571 N  N   . ASP A 1 210 ? -0.021  2.590   -4.576  1.00 32.57 ? 210 ASP A N   1 
ATOM   1572 C  CA  . ASP A 1 210 ? -0.907  3.752   -4.450  1.00 34.64 ? 210 ASP A CA  1 
ATOM   1573 C  C   . ASP A 1 210 ? -0.964  4.518   -5.768  1.00 33.26 ? 210 ASP A C   1 
ATOM   1574 O  O   . ASP A 1 210 ? -0.430  4.078   -6.779  1.00 31.26 ? 210 ASP A O   1 
ATOM   1575 C  CB  . ASP A 1 210 ? -0.478  4.659   -3.294  1.00 35.69 ? 210 ASP A CB  1 
ATOM   1576 C  CG  . ASP A 1 210 ? -1.662  5.232   -2.506  1.00 43.74 ? 210 ASP A CG  1 
ATOM   1577 O  OD1 . ASP A 1 210 ? -2.562  5.888   -3.090  1.00 48.82 ? 210 ASP A OD1 1 
ATOM   1578 O  OD2 . ASP A 1 210 ? -1.690  5.037   -1.278  1.00 48.96 ? 210 ASP A OD2 1 
ATOM   1579 N  N   . VAL A 1 211 ? -1.636  5.665   -5.762  1.00 33.44 ? 211 VAL A N   1 
ATOM   1580 C  CA  . VAL A 1 211 ? -1.857  6.406   -6.994  1.00 32.63 ? 211 VAL A CA  1 
ATOM   1581 C  C   . VAL A 1 211 ? -0.678  7.323   -7.196  1.00 32.26 ? 211 VAL A C   1 
ATOM   1582 O  O   . VAL A 1 211 ? 0.115   7.501   -6.277  1.00 34.98 ? 211 VAL A O   1 
ATOM   1583 C  CB  . VAL A 1 211 ? -3.206  7.162   -6.969  1.00 35.17 ? 211 VAL A CB  1 
ATOM   1584 C  CG1 . VAL A 1 211 ? -4.356  6.180   -6.745  1.00 36.69 ? 211 VAL A CG1 1 
ATOM   1585 C  CG2 . VAL A 1 211 ? -3.218  8.245   -5.894  1.00 36.72 ? 211 VAL A CG2 1 
ATOM   1586 N  N   . PHE A 1 212 ? -0.544  7.891   -8.397  1.00 31.28 ? 212 PHE A N   1 
ATOM   1587 C  CA  . PHE A 1 212 ? 0.544   8.829   -8.686  1.00 33.28 ? 212 PHE A CA  1 
ATOM   1588 C  C   . PHE A 1 212 ? 0.238   10.213  -8.152  1.00 34.35 ? 212 PHE A C   1 
ATOM   1589 O  O   . PHE A 1 212 ? -0.929  10.613  -8.133  1.00 32.74 ? 212 PHE A O   1 
ATOM   1590 C  CB  . PHE A 1 212 ? 0.834   8.893   -10.183 1.00 32.41 ? 212 PHE A CB  1 
ATOM   1591 C  CG  . PHE A 1 212 ? 1.659   7.730   -10.675 1.00 33.08 ? 212 PHE A CG  1 
ATOM   1592 C  CD1 . PHE A 1 212 ? 3.043   7.740   -10.542 1.00 33.22 ? 212 PHE A CD1 1 
ATOM   1593 C  CD2 . PHE A 1 212 ? 1.053   6.605   -11.208 1.00 33.02 ? 212 PHE A CD2 1 
ATOM   1594 C  CE1 . PHE A 1 212 ? 3.799   6.669   -10.958 1.00 32.55 ? 212 PHE A CE1 1 
ATOM   1595 C  CE2 . PHE A 1 212 ? 1.806   5.526   -11.633 1.00 30.93 ? 212 PHE A CE2 1 
ATOM   1596 C  CZ  . PHE A 1 212 ? 3.185   5.560   -11.497 1.00 32.60 ? 212 PHE A CZ  1 
ATOM   1597 N  N   . THR A 1 213 ? 1.270   10.926  -7.694  1.00 32.98 ? 213 THR A N   1 
ATOM   1598 C  CA  . THR A 1 213 ? 1.097   12.318  -7.269  1.00 34.66 ? 213 THR A CA  1 
ATOM   1599 C  C   . THR A 1 213 ? 1.579   13.188  -8.425  1.00 35.29 ? 213 THR A C   1 
ATOM   1600 O  O   . THR A 1 213 ? 2.130   12.665  -9.407  1.00 35.08 ? 213 THR A O   1 
ATOM   1601 C  CB  . THR A 1 213 ? 1.917   12.692  -6.031  1.00 34.34 ? 213 THR A CB  1 
ATOM   1602 O  OG1 . THR A 1 213 ? 3.304   12.762  -6.378  1.00 33.89 ? 213 THR A OG1 1 
ATOM   1603 C  CG2 . THR A 1 213 ? 1.699   11.711  -4.891  1.00 35.45 ? 213 THR A CG2 1 
ATOM   1604 N  N   . ASP A 1 214 ? 1.398   14.500  -8.300  1.00 36.89 ? 214 ASP A N   1 
ATOM   1605 C  CA  . ASP A 1 214 ? 1.758   15.437  -9.374  1.00 40.72 ? 214 ASP A CA  1 
ATOM   1606 C  C   . ASP A 1 214 ? 3.252   15.625  -9.627  1.00 39.94 ? 214 ASP A C   1 
ATOM   1607 O  O   . ASP A 1 214 ? 3.610   16.276  -10.600 1.00 42.95 ? 214 ASP A O   1 
ATOM   1608 C  CB  . ASP A 1 214 ? 1.050   16.806  -9.212  1.00 46.45 ? 214 ASP A CB  1 
ATOM   1609 C  CG  . ASP A 1 214 ? 1.433   17.557  -7.937  1.00 50.06 ? 214 ASP A CG  1 
ATOM   1610 O  OD1 . ASP A 1 214 ? 2.457   17.247  -7.281  1.00 55.63 ? 214 ASP A OD1 1 
ATOM   1611 O  OD2 . ASP A 1 214 ? 0.684   18.498  -7.590  1.00 55.56 ? 214 ASP A OD2 1 
ATOM   1612 N  N   . ASN A 1 215 ? 4.122   15.075  -8.780  1.00 34.72 ? 215 ASN A N   1 
ATOM   1613 C  CA  . ASN A 1 215 ? 5.561   15.118  -9.041  1.00 34.36 ? 215 ASN A CA  1 
ATOM   1614 C  C   . ASN A 1 215 ? 6.124   13.826  -9.662  1.00 33.63 ? 215 ASN A C   1 
ATOM   1615 O  O   . ASN A 1 215 ? 7.339   13.611  -9.671  1.00 31.37 ? 215 ASN A O   1 
ATOM   1616 C  CB  . ASN A 1 215 ? 6.323   15.463  -7.763  1.00 33.33 ? 215 ASN A CB  1 
ATOM   1617 C  CG  . ASN A 1 215 ? 6.399   14.307  -6.763  1.00 34.90 ? 215 ASN A CG  1 
ATOM   1618 O  OD1 . ASN A 1 215 ? 5.791   13.249  -6.930  1.00 32.75 ? 215 ASN A OD1 1 
ATOM   1619 N  ND2 . ASN A 1 215 ? 7.179   14.511  -5.720  1.00 34.39 ? 215 ASN A ND2 1 
ATOM   1620 N  N   . ASP A 1 216 ? 5.224   12.959  -10.113 1.00 33.74 ? 216 ASP A N   1 
ATOM   1621 C  CA  . ASP A 1 216 ? 5.555   11.670  -10.740 1.00 32.82 ? 216 ASP A CA  1 
ATOM   1622 C  C   . ASP A 1 216 ? 6.094   10.568  -9.805  1.00 33.27 ? 216 ASP A C   1 
ATOM   1623 O  O   . ASP A 1 216 ? 6.378   9.443   -10.257 1.00 33.18 ? 216 ASP A O   1 
ATOM   1624 C  CB  . ASP A 1 216 ? 6.483   11.869  -11.943 1.00 35.25 ? 216 ASP A CB  1 
ATOM   1625 C  CG  . ASP A 1 216 ? 5.827   12.663  -13.048 1.00 36.95 ? 216 ASP A CG  1 
ATOM   1626 O  OD1 . ASP A 1 216 ? 4.572   12.706  -13.081 1.00 37.87 ? 216 ASP A OD1 1 
ATOM   1627 O  OD2 . ASP A 1 216 ? 6.562   13.211  -13.891 1.00 37.70 ? 216 ASP A OD2 1 
ATOM   1628 N  N   . TYR A 1 217 ? 6.218   10.866  -8.520  1.00 31.27 ? 217 TYR A N   1 
ATOM   1629 C  CA  . TYR A 1 217 ? 6.322   9.808   -7.531  1.00 30.36 ? 217 TYR A CA  1 
ATOM   1630 C  C   . TYR A 1 217 ? 4.939   9.369   -7.136  1.00 30.57 ? 217 TYR A C   1 
ATOM   1631 O  O   . TYR A 1 217 ? 3.996   10.149  -7.188  1.00 31.22 ? 217 TYR A O   1 
ATOM   1632 C  CB  . TYR A 1 217 ? 7.056   10.267  -6.297  1.00 29.94 ? 217 TYR A CB  1 
ATOM   1633 C  CG  . TYR A 1 217 ? 8.526   10.500  -6.488  1.00 28.57 ? 217 TYR A CG  1 
ATOM   1634 C  CD1 . TYR A 1 217 ? 8.997   11.575  -7.249  1.00 28.46 ? 217 TYR A CD1 1 
ATOM   1635 C  CD2 . TYR A 1 217 ? 9.456   9.688   -5.865  1.00 28.01 ? 217 TYR A CD2 1 
ATOM   1636 C  CE1 . TYR A 1 217 ? 10.366  11.804  -7.390  1.00 28.15 ? 217 TYR A CE1 1 
ATOM   1637 C  CE2 . TYR A 1 217 ? 10.818  9.907   -6.007  1.00 28.43 ? 217 TYR A CE2 1 
ATOM   1638 C  CZ  . TYR A 1 217 ? 11.264  10.964  -6.777  1.00 28.07 ? 217 TYR A CZ  1 
ATOM   1639 O  OH  . TYR A 1 217 ? 12.629  11.176  -6.883  1.00 29.73 ? 217 TYR A OH  1 
ATOM   1640 N  N   . THR A 1 218 ? 4.813   8.117   -6.707  1.00 30.82 ? 218 THR A N   1 
ATOM   1641 C  CA  . THR A 1 218 ? 3.541   7.672   -6.158  1.00 32.40 ? 218 THR A CA  1 
ATOM   1642 C  C   . THR A 1 218 ? 3.334   8.167   -4.732  1.00 32.93 ? 218 THR A C   1 
ATOM   1643 O  O   . THR A 1 218 ? 4.266   8.609   -4.052  1.00 29.88 ? 218 THR A O   1 
ATOM   1644 C  CB  . THR A 1 218 ? 3.390   6.154   -6.127  1.00 31.99 ? 218 THR A CB  1 
ATOM   1645 O  OG1 . THR A 1 218 ? 4.387   5.596   -5.259  1.00 31.41 ? 218 THR A OG1 1 
ATOM   1646 C  CG2 . THR A 1 218 ? 3.482   5.568   -7.528  1.00 31.41 ? 218 THR A CG2 1 
ATOM   1647 N  N   . TYR A 1 219 ? 2.097   8.066   -4.288  1.00 32.11 ? 219 TYR A N   1 
ATOM   1648 C  CA  . TYR A 1 219 ? 1.760   8.408   -2.899  1.00 34.59 ? 219 TYR A CA  1 
ATOM   1649 C  C   . TYR A 1 219 ? 2.521   7.557   -1.912  1.00 31.34 ? 219 TYR A C   1 
ATOM   1650 O  O   . TYR A 1 219 ? 2.840   8.035   -0.839  1.00 33.41 ? 219 TYR A O   1 
ATOM   1651 C  CB  . TYR A 1 219 ? 0.260   8.294   -2.608  1.00 39.47 ? 219 TYR A CB  1 
ATOM   1652 C  CG  . TYR A 1 219 ? -0.495  9.594   -2.761  1.00 50.21 ? 219 TYR A CG  1 
ATOM   1653 C  CD1 . TYR A 1 219 ? -0.559  10.533  -1.723  1.00 54.03 ? 219 TYR A CD1 1 
ATOM   1654 C  CD2 . TYR A 1 219 ? -1.149  9.896   -3.963  1.00 57.46 ? 219 TYR A CD2 1 
ATOM   1655 C  CE1 . TYR A 1 219 ? -1.259  11.741  -1.893  1.00 59.93 ? 219 TYR A CE1 1 
ATOM   1656 C  CE2 . TYR A 1 219 ? -1.850  11.086  -4.139  1.00 59.29 ? 219 TYR A CE2 1 
ATOM   1657 C  CZ  . TYR A 1 219 ? -1.904  12.004  -3.111  1.00 61.66 ? 219 TYR A CZ  1 
ATOM   1658 O  OH  . TYR A 1 219 ? -2.602  13.168  -3.331  1.00 63.60 ? 219 TYR A OH  1 
ATOM   1659 N  N   . GLU A 1 220 ? 2.802   6.302   -2.256  1.00 29.39 ? 220 GLU A N   1 
ATOM   1660 C  CA  . GLU A 1 220 ? 3.530   5.399   -1.363  1.00 29.69 ? 220 GLU A CA  1 
ATOM   1661 C  C   . GLU A 1 220 ? 4.983   5.892   -1.195  1.00 29.66 ? 220 GLU A C   1 
ATOM   1662 O  O   . GLU A 1 220 ? 5.514   5.922   -0.093  1.00 28.59 ? 220 GLU A O   1 
ATOM   1663 C  CB  . GLU A 1 220 ? 3.519   3.964   -1.907  1.00 31.53 ? 220 GLU A CB  1 
ATOM   1664 C  CG  . GLU A 1 220 ? 4.285   2.922   -1.076  1.00 34.77 ? 220 GLU A CG  1 
ATOM   1665 C  CD  . GLU A 1 220 ? 3.699   2.660   0.307   1.00 42.36 ? 220 GLU A CD  1 
ATOM   1666 O  OE1 . GLU A 1 220 ? 2.617   3.199   0.607   1.00 46.41 ? 220 GLU A OE1 1 
ATOM   1667 O  OE2 . GLU A 1 220 ? 4.312   1.898   1.096   1.00 43.45 ? 220 GLU A OE2 1 
ATOM   1668 N  N   . GLU A 1 221 ? 5.584   6.308   -2.299  1.00 27.61 ? 221 GLU A N   1 
ATOM   1669 C  CA  . GLU A 1 221 ? 6.944   6.832   -2.299  1.00 29.25 ? 221 GLU A CA  1 
ATOM   1670 C  C   . GLU A 1 221 ? 7.004   8.140   -1.490  1.00 30.41 ? 221 GLU A C   1 
ATOM   1671 O  O   . GLU A 1 221 ? 7.909   8.326   -0.681  1.00 28.34 ? 221 GLU A O   1 
ATOM   1672 C  CB  . GLU A 1 221 ? 7.423   7.017   -3.746  1.00 29.49 ? 221 GLU A CB  1 
ATOM   1673 C  CG  . GLU A 1 221 ? 7.577   5.666   -4.456  1.00 27.95 ? 221 GLU A CG  1 
ATOM   1674 C  CD  . GLU A 1 221 ? 7.534   5.713   -5.976  1.00 28.26 ? 221 GLU A CD  1 
ATOM   1675 O  OE1 . GLU A 1 221 ? 7.377   6.800   -6.593  1.00 27.82 ? 221 GLU A OE1 1 
ATOM   1676 O  OE2 . GLU A 1 221 ? 7.680   4.616   -6.572  1.00 28.79 ? 221 GLU A OE2 1 
ATOM   1677 N  N   . MET A 1 222 ? 6.024   9.015   -1.688  1.00 28.82 ? 222 MET A N   1 
ATOM   1678 C  CA  . MET A 1 222 ? 5.997   10.300  -0.969  1.00 30.24 ? 222 MET A CA  1 
ATOM   1679 C  C   . MET A 1 222 ? 5.697   10.122  0.535   1.00 31.69 ? 222 MET A C   1 
ATOM   1680 O  O   . MET A 1 222 ? 6.241   10.853  1.361   1.00 33.91 ? 222 MET A O   1 
ATOM   1681 C  CB  . MET A 1 222 ? 5.025   11.272  -1.645  1.00 32.17 ? 222 MET A CB  1 
ATOM   1682 C  CG  . MET A 1 222 ? 5.465   11.724  -3.060  1.00 30.91 ? 222 MET A CG  1 
ATOM   1683 S  SD  . MET A 1 222 ? 7.210   12.231  -3.182  1.00 33.05 ? 222 MET A SD  1 
ATOM   1684 C  CE  . MET A 1 222 ? 7.179   13.558  -1.968  1.00 33.37 ? 222 MET A CE  1 
ATOM   1685 N  N   . LYS A 1 223 ? 4.862   9.142   0.895   1.00 30.27 ? 223 LYS A N   1 
ATOM   1686 C  CA  . LYS A 1 223 ? 4.654   8.803   2.299   1.00 31.83 ? 223 LYS A CA  1 
ATOM   1687 C  C   . LYS A 1 223 ? 5.977   8.420   2.947   1.00 29.80 ? 223 LYS A C   1 
ATOM   1688 O  O   . LYS A 1 223 ? 6.273   8.890   4.030   1.00 30.43 ? 223 LYS A O   1 
ATOM   1689 C  CB  . LYS A 1 223 ? 3.645   7.677   2.481   1.00 32.45 ? 223 LYS A CB  1 
ATOM   1690 C  CG  . LYS A 1 223 ? 2.206   8.066   2.169   1.00 36.10 ? 223 LYS A CG  1 
ATOM   1691 C  CD  . LYS A 1 223 ? 1.275   6.915   2.554   1.00 39.04 ? 223 LYS A CD  1 
ATOM   1692 C  CE  . LYS A 1 223 ? 0.243   6.577   1.498   1.00 42.22 ? 223 LYS A CE  1 
ATOM   1693 N  NZ  . LYS A 1 223 ? 0.088   5.098   1.436   1.00 41.43 ? 223 LYS A NZ  1 
ATOM   1694 N  N   . MET A 1 224 ? 6.775   7.604   2.281   1.00 28.20 ? 224 MET A N   1 
ATOM   1695 C  CA  . MET A 1 224 ? 8.079   7.210   2.846   1.00 29.19 ? 224 MET A CA  1 
ATOM   1696 C  C   . MET A 1 224 ? 8.935   8.423   3.144   1.00 30.62 ? 224 MET A C   1 
ATOM   1697 O  O   . MET A 1 224 ? 9.448   8.544   4.259   1.00 31.84 ? 224 MET A O   1 
ATOM   1698 C  CB  . MET A 1 224 ? 8.818   6.227   1.950   1.00 29.74 ? 224 MET A CB  1 
ATOM   1699 C  CG  . MET A 1 224 ? 8.184   4.836   1.974   1.00 32.16 ? 224 MET A CG  1 
ATOM   1700 S  SD  . MET A 1 224 ? 9.090   3.563   1.080   1.00 33.43 ? 224 MET A SD  1 
ATOM   1701 C  CE  . MET A 1 224 ? 10.385  3.187   2.267   1.00 35.25 ? 224 MET A CE  1 
ATOM   1702 N  N   . THR A 1 225 ? 9.028   9.329   2.160   1.00 29.14 ? 225 THR A N   1 
ATOM   1703 C  CA  . THR A 1 225 ? 9.724   10.592  2.305   1.00 31.66 ? 225 THR A CA  1 
ATOM   1704 C  C   . THR A 1 225 ? 9.213   11.447  3.466   1.00 30.80 ? 225 THR A C   1 
ATOM   1705 O  O   . THR A 1 225 ? 9.995   11.846  4.339   1.00 31.10 ? 225 THR A O   1 
ATOM   1706 C  CB  . THR A 1 225 ? 9.633   11.398  0.998   1.00 30.34 ? 225 THR A CB  1 
ATOM   1707 O  OG1 . THR A 1 225 ? 10.269  10.661  -0.043  1.00 29.70 ? 225 THR A OG1 1 
ATOM   1708 C  CG2 . THR A 1 225 ? 10.269  12.774  1.130   1.00 32.36 ? 225 THR A CG2 1 
ATOM   1709 N  N   . LYS A 1 226 ? 7.915   11.738  3.473   1.00 30.06 ? 226 LYS A N   1 
ATOM   1710 C  CA  . LYS A 1 226 ? 7.355   12.668  4.455   1.00 32.27 ? 226 LYS A CA  1 
ATOM   1711 C  C   . LYS A 1 226 ? 7.277   12.076  5.851   1.00 30.54 ? 226 LYS A C   1 
ATOM   1712 O  O   . LYS A 1 226 ? 7.514   12.770  6.849   1.00 29.93 ? 226 LYS A O   1 
ATOM   1713 C  CB  . LYS A 1 226 ? 5.973   13.170  3.998   1.00 37.48 ? 226 LYS A CB  1 
ATOM   1714 C  CG  . LYS A 1 226 ? 6.042   14.038  2.741   1.00 40.75 ? 226 LYS A CG  1 
ATOM   1715 C  CD  . LYS A 1 226 ? 4.671   14.509  2.261   1.00 49.24 ? 226 LYS A CD  1 
ATOM   1716 C  CE  . LYS A 1 226 ? 3.746   13.348  1.888   1.00 56.53 ? 226 LYS A CE  1 
ATOM   1717 N  NZ  . LYS A 1 226 ? 2.546   13.776  1.105   1.00 59.78 ? 226 LYS A NZ  1 
ATOM   1718 N  N   . GLU A 1 227 ? 6.992   10.785  5.930   1.00 29.59 ? 227 GLU A N   1 
ATOM   1719 C  CA  . GLU A 1 227 ? 6.842   10.145  7.221   1.00 29.73 ? 227 GLU A CA  1 
ATOM   1720 C  C   . GLU A 1 227 ? 8.201   10.029  7.908   1.00 31.90 ? 227 GLU A C   1 
ATOM   1721 O  O   . GLU A 1 227 ? 8.298   10.278  9.117   1.00 34.41 ? 227 GLU A O   1 
ATOM   1722 C  CB  . GLU A 1 227 ? 6.123   8.804   7.086   1.00 30.39 ? 227 GLU A CB  1 
ATOM   1723 C  CG  . GLU A 1 227 ? 4.646   8.996   6.680   1.00 29.26 ? 227 GLU A CG  1 
ATOM   1724 C  CD  . GLU A 1 227 ? 3.924   7.699   6.326   1.00 33.00 ? 227 GLU A CD  1 
ATOM   1725 O  OE1 . GLU A 1 227 ? 4.411   6.615   6.712   1.00 34.12 ? 227 GLU A OE1 1 
ATOM   1726 O  OE2 . GLU A 1 227 ? 2.834   7.756   5.685   1.00 31.00 ? 227 GLU A OE2 1 
ATOM   1727 N  N   . THR A 1 228 ? 9.233   9.704   7.139   1.00 31.68 ? 228 THR A N   1 
ATOM   1728 C  CA  . THR A 1 228 ? 10.618  9.637   7.663   1.00 31.54 ? 228 THR A CA  1 
ATOM   1729 C  C   . THR A 1 228 ? 11.001  10.944  8.359   1.00 33.07 ? 228 THR A C   1 
ATOM   1730 O  O   . THR A 1 228 ? 11.458  10.938  9.514   1.00 32.05 ? 228 THR A O   1 
ATOM   1731 C  CB  . THR A 1 228 ? 11.620  9.353   6.550   1.00 31.83 ? 228 THR A CB  1 
ATOM   1732 O  OG1 . THR A 1 228 ? 11.384  8.045   6.006   1.00 30.94 ? 228 THR A OG1 1 
ATOM   1733 C  CG2 . THR A 1 228 ? 13.083  9.421   7.070   1.00 30.99 ? 228 THR A CG2 1 
ATOM   1734 N  N   . LYS A 1 229 ? 10.778  12.063  7.669   1.00 33.07 ? 229 LYS A N   1 
ATOM   1735 C  CA  . LYS A 1 229 ? 11.172  13.363  8.196   1.00 35.64 ? 229 LYS A CA  1 
ATOM   1736 C  C   . LYS A 1 229 ? 10.457  13.686  9.525   1.00 35.50 ? 229 LYS A C   1 
ATOM   1737 O  O   . LYS A 1 229 ? 11.065  14.198  10.477  1.00 32.07 ? 229 LYS A O   1 
ATOM   1738 C  CB  . LYS A 1 229 ? 10.904  14.461  7.157   1.00 35.23 ? 229 LYS A CB  1 
ATOM   1739 C  CG  . LYS A 1 229 ? 11.725  14.360  5.870   1.00 34.42 ? 229 LYS A CG  1 
ATOM   1740 C  CD  . LYS A 1 229 ? 11.147  15.292  4.811   1.00 36.67 ? 229 LYS A CD  1 
ATOM   1741 C  CE  . LYS A 1 229 ? 11.860  15.220  3.465   1.00 40.55 ? 229 LYS A CE  1 
ATOM   1742 N  NZ  . LYS A 1 229 ? 13.119  16.013  3.431   1.00 44.19 ? 229 LYS A NZ  1 
ATOM   1743 N  N   . LYS A 1 230 ? 9.167   13.374  9.598   1.00 33.76 ? 230 LYS A N   1 
ATOM   1744 C  CA  . LYS A 1 230 ? 8.374   13.657  10.786  1.00 34.06 ? 230 LYS A CA  1 
ATOM   1745 C  C   . LYS A 1 230 ? 8.727   12.730  11.944  1.00 33.36 ? 230 LYS A C   1 
ATOM   1746 O  O   . LYS A 1 230 ? 8.846   13.182  13.082  1.00 32.24 ? 230 LYS A O   1 
ATOM   1747 C  CB  . LYS A 1 230 ? 6.860   13.559  10.471  1.00 34.83 ? 230 LYS A CB  1 
ATOM   1748 C  CG  . LYS A 1 230 ? 5.971   13.902  11.659  1.00 33.93 ? 230 LYS A CG  1 
ATOM   1749 C  CD  . LYS A 1 230 ? 4.490   13.891  11.291  1.00 33.96 ? 230 LYS A CD  1 
ATOM   1750 C  CE  . LYS A 1 230 ? 3.640   14.106  12.530  1.00 33.97 ? 230 LYS A CE  1 
ATOM   1751 N  NZ  . LYS A 1 230 ? 2.219   14.449  12.186  1.00 33.91 ? 230 LYS A NZ  1 
ATOM   1752 N  N   . ILE A 1 231 ? 8.884   11.437  11.659  1.00 29.99 ? 231 ILE A N   1 
ATOM   1753 C  CA  . ILE A 1 231 ? 9.220   10.454  12.678  1.00 29.90 ? 231 ILE A CA  1 
ATOM   1754 C  C   . ILE A 1 231 ? 10.597  10.755  13.267  1.00 31.18 ? 231 ILE A C   1 
ATOM   1755 O  O   . ILE A 1 231 ? 10.783  10.694  14.483  1.00 31.30 ? 231 ILE A O   1 
ATOM   1756 C  CB  . ILE A 1 231 ? 9.202   9.010   12.117  1.00 29.32 ? 231 ILE A CB  1 
ATOM   1757 C  CG1 . ILE A 1 231 ? 7.752   8.578   11.789  1.00 27.49 ? 231 ILE A CG1 1 
ATOM   1758 C  CG2 . ILE A 1 231 ? 9.799   8.016   13.113  1.00 29.31 ? 231 ILE A CG2 1 
ATOM   1759 C  CD1 . ILE A 1 231 ? 7.712   7.422   10.822  1.00 27.86 ? 231 ILE A CD1 1 
ATOM   1760 N  N   . MET A 1 232 ? 11.539  11.127  12.414  1.00 31.64 ? 232 MET A N   1 
ATOM   1761 C  CA  . MET A 1 232 ? 12.897  11.416  12.875  1.00 35.21 ? 232 MET A CA  1 
ATOM   1762 C  C   . MET A 1 232 ? 13.042  12.890  13.244  1.00 37.66 ? 232 MET A C   1 
ATOM   1763 O  O   . MET A 1 232 ? 14.108  13.318  13.661  1.00 40.32 ? 232 MET A O   1 
ATOM   1764 C  CB  . MET A 1 232 ? 13.922  10.987  11.825  1.00 37.19 ? 232 MET A CB  1 
ATOM   1765 C  CG  . MET A 1 232 ? 14.262  9.511   11.959  1.00 38.36 ? 232 MET A CG  1 
ATOM   1766 S  SD  . MET A 1 232 ? 15.172  8.837   10.568  1.00 40.96 ? 232 MET A SD  1 
ATOM   1767 C  CE  . MET A 1 232 ? 15.644  7.259   11.258  1.00 38.93 ? 232 MET A CE  1 
ATOM   1768 N  N   . GLU A 1 233 ? 11.966  13.658  13.086  1.00 38.26 ? 233 GLU A N   1 
ATOM   1769 C  CA  . GLU A 1 233 ? 11.938  15.051  13.516  1.00 41.52 ? 233 GLU A CA  1 
ATOM   1770 C  C   . GLU A 1 233 ? 13.082  15.825  12.873  1.00 42.08 ? 233 GLU A C   1 
ATOM   1771 O  O   . GLU A 1 233 ? 13.732  16.637  13.517  1.00 39.40 ? 233 GLU A O   1 
ATOM   1772 C  CB  . GLU A 1 233 ? 11.977  15.129  15.055  1.00 42.63 ? 233 GLU A CB  1 
ATOM   1773 C  CG  . GLU A 1 233 ? 10.928  14.216  15.684  1.00 45.11 ? 233 GLU A CG  1 
ATOM   1774 C  CD  . GLU A 1 233 ? 10.618  14.520  17.139  1.00 50.05 ? 233 GLU A CD  1 
ATOM   1775 O  OE1 . GLU A 1 233 ? 11.466  15.118  17.829  1.00 49.56 ? 233 GLU A OE1 1 
ATOM   1776 O  OE2 . GLU A 1 233 ? 9.515   14.147  17.593  1.00 47.91 ? 233 GLU A OE2 1 
ATOM   1777 N  N   . ASP A 1 234 ? 13.313  15.554  11.590  1.00 40.21 ? 234 ASP A N   1 
ATOM   1778 C  CA  . ASP A 1 234 ? 14.404  16.175  10.855  1.00 40.59 ? 234 ASP A CA  1 
ATOM   1779 C  C   . ASP A 1 234 ? 14.062  16.293  9.378   1.00 40.19 ? 234 ASP A C   1 
ATOM   1780 O  O   . ASP A 1 234 ? 14.200  15.336  8.614   1.00 34.97 ? 234 ASP A O   1 
ATOM   1781 C  CB  . ASP A 1 234 ? 15.699  15.380  11.031  1.00 39.72 ? 234 ASP A CB  1 
ATOM   1782 C  CG  . ASP A 1 234 ? 16.897  16.099  10.480  1.00 39.57 ? 234 ASP A CG  1 
ATOM   1783 O  OD1 . ASP A 1 234 ? 16.716  17.083  9.747   1.00 42.26 ? 234 ASP A OD1 1 
ATOM   1784 O  OD2 . ASP A 1 234 ? 18.026  15.679  10.779  1.00 41.14 ? 234 ASP A OD2 1 
ATOM   1785 N  N   . ASP A 1 235 ? 13.651  17.498  8.997   1.00 42.68 ? 235 ASP A N   1 
ATOM   1786 C  CA  . ASP A 1 235 ? 13.357  17.843  7.616   1.00 46.23 ? 235 ASP A CA  1 
ATOM   1787 C  C   . ASP A 1 235 ? 14.569  17.892  6.714   1.00 42.26 ? 235 ASP A C   1 
ATOM   1788 O  O   . ASP A 1 235 ? 14.400  17.965  5.507   1.00 42.17 ? 235 ASP A O   1 
ATOM   1789 C  CB  . ASP A 1 235 ? 12.655  19.205  7.534   1.00 52.43 ? 235 ASP A CB  1 
ATOM   1790 C  CG  . ASP A 1 235 ? 11.224  19.159  8.019   1.00 59.58 ? 235 ASP A CG  1 
ATOM   1791 O  OD1 . ASP A 1 235 ? 10.610  18.069  7.988   1.00 64.65 ? 235 ASP A OD1 1 
ATOM   1792 O  OD2 . ASP A 1 235 ? 10.706  20.222  8.428   1.00 63.72 ? 235 ASP A OD2 1 
ATOM   1793 N  N   . SER A 1 236 ? 15.783  17.893  7.261   1.00 41.54 ? 236 SER A N   1 
ATOM   1794 C  CA  . SER A 1 236 ? 16.958  17.969  6.404   1.00 40.56 ? 236 SER A CA  1 
ATOM   1795 C  C   . SER A 1 236 ? 17.335  16.600  5.810   1.00 39.09 ? 236 SER A C   1 
ATOM   1796 O  O   . SER A 1 236 ? 18.140  16.535  4.895   1.00 39.15 ? 236 SER A O   1 
ATOM   1797 C  CB  . SER A 1 236 ? 18.148  18.603  7.147   1.00 39.91 ? 236 SER A CB  1 
ATOM   1798 O  OG  . SER A 1 236 ? 18.854  17.650  7.920   1.00 40.23 ? 236 SER A OG  1 
ATOM   1799 N  N   . ILE A 1 237 ? 16.761  15.504  6.327   1.00 37.81 ? 237 ILE A N   1 
ATOM   1800 C  CA  . ILE A 1 237 ? 17.064  14.180  5.786   1.00 35.92 ? 237 ILE A CA  1 
ATOM   1801 C  C   . ILE A 1 237 ? 16.448  14.043  4.397   1.00 36.96 ? 237 ILE A C   1 
ATOM   1802 O  O   . ILE A 1 237 ? 15.209  14.082  4.246   1.00 35.84 ? 237 ILE A O   1 
ATOM   1803 C  CB  . ILE A 1 237 ? 16.539  13.033  6.680   1.00 36.26 ? 237 ILE A CB  1 
ATOM   1804 C  CG1 . ILE A 1 237 ? 17.143  13.131  8.080   1.00 38.08 ? 237 ILE A CG1 1 
ATOM   1805 C  CG2 . ILE A 1 237 ? 16.882  11.678  6.065   1.00 37.14 ? 237 ILE A CG2 1 
ATOM   1806 C  CD1 . ILE A 1 237 ? 16.591  12.123  9.067   1.00 39.39 ? 237 ILE A CD1 1 
ATOM   1807 N  N   . ALA A 1 238 ? 17.306  13.873  3.393   1.00 35.64 ? 238 ALA A N   1 
ATOM   1808 C  CA  . ALA A 1 238 ? 16.840  13.711  2.013   1.00 36.24 ? 238 ALA A CA  1 
ATOM   1809 C  C   . ALA A 1 238 ? 16.397  12.271  1.823   1.00 33.91 ? 238 ALA A C   1 
ATOM   1810 O  O   . ALA A 1 238 ? 17.126  11.365  2.166   1.00 34.23 ? 238 ALA A O   1 
ATOM   1811 C  CB  . ALA A 1 238 ? 17.936  14.061  1.036   1.00 35.48 ? 238 ALA A CB  1 
ATOM   1812 N  N   . VAL A 1 239 ? 15.186  12.072  1.309   1.00 33.37 ? 239 VAL A N   1 
ATOM   1813 C  CA  . VAL A 1 239 ? 14.645  10.742  1.095   1.00 32.17 ? 239 VAL A CA  1 
ATOM   1814 C  C   . VAL A 1 239 ? 13.919  10.665  -0.241  1.00 30.41 ? 239 VAL A C   1 
ATOM   1815 O  O   . VAL A 1 239 ? 13.004  11.438  -0.492  1.00 32.63 ? 239 VAL A O   1 
ATOM   1816 C  CB  . VAL A 1 239 ? 13.644  10.359  2.200   1.00 35.60 ? 239 VAL A CB  1 
ATOM   1817 C  CG1 . VAL A 1 239 ? 13.150  8.921   2.023   1.00 36.34 ? 239 VAL A CG1 1 
ATOM   1818 C  CG2 . VAL A 1 239 ? 14.249  10.561  3.584   1.00 34.77 ? 239 VAL A CG2 1 
ATOM   1819 N  N   . SER A 1 240 ? 14.335  9.726   -1.086  1.00 31.62 ? 240 SER A N   1 
ATOM   1820 C  CA  . SER A 1 240 ? 13.639  9.407   -2.334  1.00 31.26 ? 240 SER A CA  1 
ATOM   1821 C  C   . SER A 1 240 ? 13.471  7.882   -2.414  1.00 30.34 ? 240 SER A C   1 
ATOM   1822 O  O   . SER A 1 240 ? 14.401  7.115   -2.072  1.00 29.30 ? 240 SER A O   1 
ATOM   1823 C  CB  . SER A 1 240 ? 14.405  9.944   -3.544  1.00 30.83 ? 240 SER A CB  1 
ATOM   1824 O  OG  . SER A 1 240 ? 14.367  11.374  -3.554  1.00 31.90 ? 240 SER A OG  1 
ATOM   1825 N  N   . ALA A 1 241 ? 12.289  7.447   -2.856  1.00 26.71 ? 241 ALA A N   1 
ATOM   1826 C  CA  . ALA A 1 241 ? 11.950  6.030   -2.867  1.00 28.14 ? 241 ALA A CA  1 
ATOM   1827 C  C   . ALA A 1 241 ? 11.382  5.594   -4.206  1.00 31.15 ? 241 ALA A C   1 
ATOM   1828 O  O   . ALA A 1 241 ? 10.818  6.397   -4.940  1.00 31.01 ? 241 ALA A O   1 
ATOM   1829 C  CB  . ALA A 1 241 ? 10.956  5.717   -1.750  1.00 28.76 ? 241 ALA A CB  1 
ATOM   1830 N  N   . THR A 1 242 ? 11.575  4.308   -4.501  1.00 33.47 ? 242 THR A N   1 
ATOM   1831 C  CA  . THR A 1 242 ? 10.863  3.586   -5.541  1.00 32.24 ? 242 THR A CA  1 
ATOM   1832 C  C   . THR A 1 242 ? 10.163  2.391   -4.870  1.00 31.54 ? 242 THR A C   1 
ATOM   1833 O  O   . THR A 1 242 ? 10.814  1.544   -4.264  1.00 29.11 ? 242 THR A O   1 
ATOM   1834 C  CB  . THR A 1 242 ? 11.820  3.086   -6.635  1.00 32.97 ? 242 THR A CB  1 
ATOM   1835 O  OG1 . THR A 1 242 ? 12.509  4.201   -7.209  1.00 33.76 ? 242 THR A OG1 1 
ATOM   1836 C  CG2 . THR A 1 242 ? 11.075  2.349   -7.746  1.00 35.43 ? 242 THR A CG2 1 
ATOM   1837 N  N   . CYS A 1 243 ? 8.840   2.322   -5.016  1.00 28.83 ? 243 CYS A N   1 
ATOM   1838 C  CA  . CYS A 1 243 ? 8.038   1.310   -4.361  1.00 31.60 ? 243 CYS A CA  1 
ATOM   1839 C  C   . CYS A 1 243 ? 7.405   0.342   -5.375  1.00 32.31 ? 243 CYS A C   1 
ATOM   1840 O  O   . CYS A 1 243 ? 6.688   0.734   -6.296  1.00 31.37 ? 243 CYS A O   1 
ATOM   1841 C  CB  . CYS A 1 243 ? 7.007   1.980   -3.473  1.00 32.15 ? 243 CYS A CB  1 
ATOM   1842 S  SG  . CYS A 1 243 ? 7.768   2.986   -2.164  1.00 33.11 ? 243 CYS A SG  1 
ATOM   1843 N  N   . VAL A 1 244 ? 7.702   -0.936  -5.195  1.00 30.05 ? 244 VAL A N   1 
ATOM   1844 C  CA  . VAL A 1 244 ? 7.426   -1.955  -6.206  1.00 28.64 ? 244 VAL A CA  1 
ATOM   1845 C  C   . VAL A 1 244 ? 6.715   -3.136  -5.524  1.00 30.70 ? 244 VAL A C   1 
ATOM   1846 O  O   . VAL A 1 244 ? 7.194   -3.661  -4.512  1.00 28.32 ? 244 VAL A O   1 
ATOM   1847 C  CB  . VAL A 1 244 ? 8.719   -2.463  -6.865  1.00 30.82 ? 244 VAL A CB  1 
ATOM   1848 C  CG1 . VAL A 1 244 ? 8.395   -3.427  -8.006  1.00 29.86 ? 244 VAL A CG1 1 
ATOM   1849 C  CG2 . VAL A 1 244 ? 9.607   -1.307  -7.340  1.00 28.89 ? 244 VAL A CG2 1 
ATOM   1850 N  N   . ARG A 1 245 ? 5.549   -3.503  -6.063  1.00 27.92 ? 245 ARG A N   1 
ATOM   1851 C  CA  . ARG A 1 245 ? 4.867   -4.724  -5.675  1.00 25.76 ? 245 ARG A CA  1 
ATOM   1852 C  C   . ARG A 1 245 ? 5.446   -5.951  -6.369  1.00 24.77 ? 245 ARG A C   1 
ATOM   1853 O  O   . ARG A 1 245 ? 5.656   -5.927  -7.576  1.00 24.94 ? 245 ARG A O   1 
ATOM   1854 C  CB  . ARG A 1 245 ? 3.375   -4.627  -6.058  1.00 27.11 ? 245 ARG A CB  1 
ATOM   1855 C  CG  . ARG A 1 245 ? 2.520   -5.647  -5.323  1.00 27.57 ? 245 ARG A CG  1 
ATOM   1856 C  CD  . ARG A 1 245 ? 2.287   -5.256  -3.866  1.00 28.86 ? 245 ARG A CD  1 
ATOM   1857 N  NE  . ARG A 1 245 ? 1.464   -4.066  -3.747  1.00 29.49 ? 245 ARG A NE  1 
ATOM   1858 C  CZ  . ARG A 1 245 ? 1.175   -3.443  -2.606  1.00 30.61 ? 245 ARG A CZ  1 
ATOM   1859 N  NH1 . ARG A 1 245 ? 1.624   -3.897  -1.439  1.00 32.73 ? 245 ARG A NH1 1 
ATOM   1860 N  NH2 . ARG A 1 245 ? 0.432   -2.349  -2.638  1.00 32.47 ? 245 ARG A NH2 1 
ATOM   1861 N  N   . ILE A 1 246 ? 5.659   -7.036  -5.611  1.00 25.83 ? 246 ILE A N   1 
ATOM   1862 C  CA  . ILE A 1 246 ? 6.195   -8.283  -6.175  1.00 27.21 ? 246 ILE A CA  1 
ATOM   1863 C  C   . ILE A 1 246 ? 5.344   -9.455  -5.693  1.00 28.70 ? 246 ILE A C   1 
ATOM   1864 O  O   . ILE A 1 246 ? 4.524   -9.258  -4.804  1.00 29.24 ? 246 ILE A O   1 
ATOM   1865 C  CB  . ILE A 1 246 ? 7.695   -8.494  -5.816  1.00 27.41 ? 246 ILE A CB  1 
ATOM   1866 C  CG1 . ILE A 1 246 ? 7.901   -8.645  -4.302  1.00 28.02 ? 246 ILE A CG1 1 
ATOM   1867 C  CG2 . ILE A 1 246 ? 8.537   -7.358  -6.378  1.00 29.12 ? 246 ILE A CG2 1 
ATOM   1868 C  CD1 . ILE A 1 246 ? 9.249   -9.208  -3.914  1.00 28.64 ? 246 ILE A CD1 1 
ATOM   1869 N  N   . PRO A 1 247 ? 5.497   -10.657 -6.300  1.00 30.44 ? 247 PRO A N   1 
ATOM   1870 C  CA  . PRO A 1 247 ? 4.673   -11.822 -5.928  1.00 32.69 ? 247 PRO A CA  1 
ATOM   1871 C  C   . PRO A 1 247 ? 5.056   -12.499 -4.600  1.00 31.79 ? 247 PRO A C   1 
ATOM   1872 O  O   . PRO A 1 247 ? 5.438   -13.671 -4.570  1.00 33.61 ? 247 PRO A O   1 
ATOM   1873 C  CB  . PRO A 1 247 ? 4.861   -12.788 -7.124  1.00 33.59 ? 247 PRO A CB  1 
ATOM   1874 C  CG  . PRO A 1 247 ? 5.396   -11.946 -8.216  1.00 34.20 ? 247 PRO A CG  1 
ATOM   1875 C  CD  . PRO A 1 247 ? 6.263   -10.939 -7.518  1.00 32.54 ? 247 PRO A CD  1 
ATOM   1876 N  N   . VAL A 1 248 ? 4.930   -11.742 -3.520  1.00 32.18 ? 248 VAL A N   1 
ATOM   1877 C  CA  . VAL A 1 248 ? 5.081   -12.220 -2.148  1.00 32.04 ? 248 VAL A CA  1 
ATOM   1878 C  C   . VAL A 1 248 ? 3.751   -11.998 -1.425  1.00 33.20 ? 248 VAL A C   1 
ATOM   1879 O  O   . VAL A 1 248 ? 3.103   -10.966 -1.613  1.00 32.70 ? 248 VAL A O   1 
ATOM   1880 C  CB  . VAL A 1 248 ? 6.217   -11.441 -1.446  1.00 32.40 ? 248 VAL A CB  1 
ATOM   1881 C  CG1 . VAL A 1 248 ? 6.283   -11.727 0.052   1.00 32.00 ? 248 VAL A CG1 1 
ATOM   1882 C  CG2 . VAL A 1 248 ? 7.546   -11.751 -2.116  1.00 32.68 ? 248 VAL A CG2 1 
ATOM   1883 N  N   . LEU A 1 249 ? 3.300   -12.960 -0.611  1.00 36.15 ? 249 LEU A N   1 
ATOM   1884 C  CA  . LEU A 1 249 ? 2.031   -12.754 0.097   1.00 37.66 ? 249 LEU A CA  1 
ATOM   1885 C  C   . LEU A 1 249 ? 2.186   -11.844 1.304   1.00 35.52 ? 249 LEU A C   1 
ATOM   1886 O  O   . LEU A 1 249 ? 1.367   -10.951 1.485   1.00 33.05 ? 249 LEU A O   1 
ATOM   1887 C  CB  . LEU A 1 249 ? 1.363   -14.074 0.515   1.00 44.85 ? 249 LEU A CB  1 
ATOM   1888 C  CG  . LEU A 1 249 ? 0.812   -14.942 -0.621  1.00 47.99 ? 249 LEU A CG  1 
ATOM   1889 C  CD1 . LEU A 1 249 ? -0.122  -16.001 -0.056  1.00 50.48 ? 249 LEU A CD1 1 
ATOM   1890 C  CD2 . LEU A 1 249 ? 0.091   -14.119 -1.686  1.00 48.74 ? 249 LEU A CD2 1 
ATOM   1891 N  N   . SER A 1 250 ? 3.228   -12.063 2.116   1.00 31.60 ? 250 SER A N   1 
ATOM   1892 C  CA  . SER A 1 250 ? 3.452   -11.262 3.320   1.00 33.95 ? 250 SER A CA  1 
ATOM   1893 C  C   . SER A 1 250 ? 4.956   -11.070 3.580   1.00 29.77 ? 250 SER A C   1 
ATOM   1894 O  O   . SER A 1 250 ? 5.763   -11.936 3.228   1.00 30.37 ? 250 SER A O   1 
ATOM   1895 C  CB  . SER A 1 250 ? 2.791   -11.919 4.539   1.00 39.47 ? 250 SER A CB  1 
ATOM   1896 O  OG  . SER A 1 250 ? 1.395   -11.637 4.565   1.00 47.18 ? 250 SER A OG  1 
ATOM   1897 N  N   . ALA A 1 251 ? 5.262   -9.931  4.189   1.00 28.31 ? 251 ALA A N   1 
ATOM   1898 C  CA  . ALA A 1 251 ? 6.616   -9.429  4.493   1.00 27.26 ? 251 ALA A CA  1 
ATOM   1899 C  C   . ALA A 1 251 ? 7.164   -8.558  3.367   1.00 26.54 ? 251 ALA A C   1 
ATOM   1900 O  O   . ALA A 1 251 ? 7.291   -9.016  2.219   1.00 27.85 ? 251 ALA A O   1 
ATOM   1901 C  CB  . ALA A 1 251 ? 7.567   -10.556 4.851   1.00 26.25 ? 251 ALA A CB  1 
ATOM   1902 N  N   . HIS A 1 252 ? 7.444   -7.295  3.707   1.00 26.20 ? 252 HIS A N   1 
ATOM   1903 C  CA  . HIS A 1 252 ? 8.012   -6.322  2.782   1.00 26.44 ? 252 HIS A CA  1 
ATOM   1904 C  C   . HIS A 1 252 ? 9.533   -6.435  2.941   1.00 26.48 ? 252 HIS A C   1 
ATOM   1905 O  O   . HIS A 1 252 ? 10.017  -6.681  4.050   1.00 26.39 ? 252 HIS A O   1 
ATOM   1906 C  CB  . HIS A 1 252 ? 7.608   -4.898  3.161   1.00 27.51 ? 252 HIS A CB  1 
ATOM   1907 C  CG  . HIS A 1 252 ? 6.186   -4.532  2.829   1.00 28.32 ? 252 HIS A CG  1 
ATOM   1908 N  ND1 . HIS A 1 252 ? 5.355   -5.333  2.088   1.00 28.43 ? 252 HIS A ND1 1 
ATOM   1909 C  CD2 . HIS A 1 252 ? 5.482   -3.405  3.090   1.00 30.51 ? 252 HIS A CD2 1 
ATOM   1910 C  CE1 . HIS A 1 252 ? 4.183   -4.739  1.928   1.00 28.55 ? 252 HIS A CE1 1 
ATOM   1911 N  NE2 . HIS A 1 252 ? 4.233   -3.562  2.527   1.00 30.66 ? 252 HIS A NE2 1 
ATOM   1912 N  N   . SER A 1 253 ? 10.268  -6.303  1.845   1.00 25.98 ? 253 SER A N   1 
ATOM   1913 C  CA  . SER A 1 253 ? 11.733  -6.251  1.894   1.00 26.36 ? 253 SER A CA  1 
ATOM   1914 C  C   . SER A 1 253 ? 12.123  -4.926  1.280   1.00 26.59 ? 253 SER A C   1 
ATOM   1915 O  O   . SER A 1 253 ? 11.371  -4.379  0.470   1.00 26.29 ? 253 SER A O   1 
ATOM   1916 C  CB  . SER A 1 253 ? 12.353  -7.417  1.117   1.00 26.23 ? 253 SER A CB  1 
ATOM   1917 O  OG  . SER A 1 253 ? 11.725  -8.647  1.435   1.00 28.53 ? 253 SER A OG  1 
ATOM   1918 N  N   . GLU A 1 254 ? 13.302  -4.419  1.653   1.00 25.19 ? 254 GLU A N   1 
ATOM   1919 C  CA  . GLU A 1 254 ? 13.741  -3.127  1.194   1.00 26.45 ? 254 GLU A CA  1 
ATOM   1920 C  C   . GLU A 1 254 ? 15.241  -3.116  1.006   1.00 26.93 ? 254 GLU A C   1 
ATOM   1921 O  O   . GLU A 1 254 ? 15.964  -3.568  1.892   1.00 24.61 ? 254 GLU A O   1 
ATOM   1922 C  CB  . GLU A 1 254 ? 13.385  -2.037  2.232   1.00 28.32 ? 254 GLU A CB  1 
ATOM   1923 C  CG  . GLU A 1 254 ? 11.899  -1.823  2.441   1.00 28.68 ? 254 GLU A CG  1 
ATOM   1924 C  CD  . GLU A 1 254 ? 11.561  -0.869  3.590   1.00 31.37 ? 254 GLU A CD  1 
ATOM   1925 O  OE1 . GLU A 1 254 ? 12.405  -0.641  4.504   1.00 33.39 ? 254 GLU A OE1 1 
ATOM   1926 O  OE2 . GLU A 1 254 ? 10.408  -0.362  3.582   1.00 31.26 ? 254 GLU A OE2 1 
ATOM   1927 N  N   . SER A 1 255 ? 15.675  -2.602  -0.149  1.00 26.94 ? 255 SER A N   1 
ATOM   1928 C  CA  . SER A 1 255 ? 17.074  -2.310  -0.416  1.00 29.79 ? 255 SER A CA  1 
ATOM   1929 C  C   . SER A 1 255 ? 17.267  -0.842  -0.056  1.00 31.08 ? 255 SER A C   1 
ATOM   1930 O  O   . SER A 1 255 ? 16.729  0.045   -0.720  1.00 31.12 ? 255 SER A O   1 
ATOM   1931 C  CB  . SER A 1 255 ? 17.418  -2.537  -1.888  1.00 31.24 ? 255 SER A CB  1 
ATOM   1932 O  OG  . SER A 1 255 ? 18.777  -2.176  -2.139  1.00 31.14 ? 255 SER A OG  1 
ATOM   1933 N  N   . VAL A 1 256 ? 17.993  -0.609  1.038   1.00 28.92 ? 256 VAL A N   1 
ATOM   1934 C  CA  . VAL A 1 256 ? 18.117  0.709   1.640   1.00 27.58 ? 256 VAL A CA  1 
ATOM   1935 C  C   . VAL A 1 256 ? 19.550  1.191   1.479   1.00 30.24 ? 256 VAL A C   1 
ATOM   1936 O  O   . VAL A 1 256 ? 20.495  0.488   1.838   1.00 29.42 ? 256 VAL A O   1 
ATOM   1937 C  CB  . VAL A 1 256 ? 17.772  0.671   3.146   1.00 28.05 ? 256 VAL A CB  1 
ATOM   1938 C  CG1 . VAL A 1 256 ? 17.952  2.040   3.779   1.00 28.47 ? 256 VAL A CG1 1 
ATOM   1939 C  CG2 . VAL A 1 256 ? 16.337  0.172   3.353   1.00 28.44 ? 256 VAL A CG2 1 
ATOM   1940 N  N   . TYR A 1 257 ? 19.691  2.381   0.918   1.00 29.63 ? 257 TYR A N   1 
ATOM   1941 C  CA  . TYR A 1 257 ? 20.971  3.053   0.858   1.00 30.37 ? 257 TYR A CA  1 
ATOM   1942 C  C   . TYR A 1 257 ? 20.899  4.284   1.719   1.00 30.37 ? 257 TYR A C   1 
ATOM   1943 O  O   . TYR A 1 257 ? 19.920  5.021   1.659   1.00 30.09 ? 257 TYR A O   1 
ATOM   1944 C  CB  . TYR A 1 257 ? 21.309  3.464   -0.572  1.00 29.10 ? 257 TYR A CB  1 
ATOM   1945 C  CG  . TYR A 1 257 ? 22.588  4.291   -0.666  1.00 30.23 ? 257 TYR A CG  1 
ATOM   1946 C  CD1 . TYR A 1 257 ? 23.819  3.687   -0.507  1.00 31.49 ? 257 TYR A CD1 1 
ATOM   1947 C  CD2 . TYR A 1 257 ? 22.557  5.674   -0.903  1.00 30.68 ? 257 TYR A CD2 1 
ATOM   1948 C  CE1 . TYR A 1 257 ? 24.991  4.410   -0.586  1.00 31.42 ? 257 TYR A CE1 1 
ATOM   1949 C  CE2 . TYR A 1 257 ? 23.741  6.416   -0.993  1.00 31.51 ? 257 TYR A CE2 1 
ATOM   1950 C  CZ  . TYR A 1 257 ? 24.947  5.774   -0.832  1.00 31.43 ? 257 TYR A CZ  1 
ATOM   1951 O  OH  . TYR A 1 257 ? 26.141  6.459   -0.925  1.00 32.35 ? 257 TYR A OH  1 
ATOM   1952 N  N   . ILE A 1 258 ? 21.932  4.510   2.524   1.00 28.40 ? 258 ILE A N   1 
ATOM   1953 C  CA  . ILE A 1 258 ? 21.992  5.735   3.313   1.00 29.43 ? 258 ILE A CA  1 
ATOM   1954 C  C   . ILE A 1 258 ? 23.368  6.359   3.198   1.00 31.40 ? 258 ILE A C   1 
ATOM   1955 O  O   . ILE A 1 258 ? 24.345  5.661   2.927   1.00 30.84 ? 258 ILE A O   1 
ATOM   1956 C  CB  . ILE A 1 258 ? 21.719  5.476   4.822   1.00 30.49 ? 258 ILE A CB  1 
ATOM   1957 C  CG1 . ILE A 1 258 ? 22.728  4.476   5.394   1.00 31.84 ? 258 ILE A CG1 1 
ATOM   1958 C  CG2 . ILE A 1 258 ? 20.282  4.985   5.045   1.00 31.07 ? 258 ILE A CG2 1 
ATOM   1959 C  CD1 . ILE A 1 258 ? 22.635  4.310   6.895   1.00 34.63 ? 258 ILE A CD1 1 
ATOM   1960 N  N   . GLU A 1 259 ? 23.436  7.660   3.460   1.00 32.78 ? 259 GLU A N   1 
ATOM   1961 C  CA  . GLU A 1 259 ? 24.709  8.309   3.743   1.00 33.02 ? 259 GLU A CA  1 
ATOM   1962 C  C   . GLU A 1 259 ? 24.571  8.953   5.111   1.00 33.36 ? 259 GLU A C   1 
ATOM   1963 O  O   . GLU A 1 259 ? 23.626  9.689   5.371   1.00 32.41 ? 259 GLU A O   1 
ATOM   1964 C  CB  . GLU A 1 259 ? 25.068  9.327   2.639   1.00 33.44 ? 259 GLU A CB  1 
ATOM   1965 C  CG  . GLU A 1 259 ? 25.574  8.615   1.393   1.00 32.43 ? 259 GLU A CG  1 
ATOM   1966 C  CD  . GLU A 1 259 ? 25.734  9.484   0.161   1.00 33.95 ? 259 GLU A CD  1 
ATOM   1967 O  OE1 . GLU A 1 259 ? 25.558  10.722  0.242   1.00 35.56 ? 259 GLU A OE1 1 
ATOM   1968 O  OE2 . GLU A 1 259 ? 26.019  8.896   -0.907  1.00 31.68 ? 259 GLU A OE2 1 
ATOM   1969 N  N   . THR A 1 260 ? 25.503  8.623   5.994   1.00 32.25 ? 260 THR A N   1 
ATOM   1970 C  CA  . THR A 1 260 ? 25.486  9.114   7.355   1.00 32.75 ? 260 THR A CA  1 
ATOM   1971 C  C   . THR A 1 260 ? 26.147  10.490  7.413   1.00 36.91 ? 260 THR A C   1 
ATOM   1972 O  O   . THR A 1 260 ? 26.689  10.946  6.410   1.00 34.05 ? 260 THR A O   1 
ATOM   1973 C  CB  . THR A 1 260 ? 26.217  8.124   8.259   1.00 35.46 ? 260 THR A CB  1 
ATOM   1974 O  OG1 . THR A 1 260 ? 27.504  7.834   7.707   1.00 34.62 ? 260 THR A OG1 1 
ATOM   1975 C  CG2 . THR A 1 260 ? 25.412  6.814   8.344   1.00 35.61 ? 260 THR A CG2 1 
ATOM   1976 N  N   . LYS A 1 261 ? 26.068  11.157  8.568   1.00 38.81 ? 261 LYS A N   1 
ATOM   1977 C  CA  . LYS A 1 261 ? 26.703  12.461  8.762   1.00 43.43 ? 261 LYS A CA  1 
ATOM   1978 C  C   . LYS A 1 261 ? 28.189  12.272  9.069   1.00 43.99 ? 261 LYS A C   1 
ATOM   1979 O  O   . LYS A 1 261 ? 29.022  13.001  8.567   1.00 44.73 ? 261 LYS A O   1 
ATOM   1980 C  CB  . LYS A 1 261 ? 26.047  13.239  9.898   1.00 45.17 ? 261 LYS A CB  1 
ATOM   1981 C  CG  . LYS A 1 261 ? 24.635  13.725  9.616   1.00 49.16 ? 261 LYS A CG  1 
ATOM   1982 C  CD  . LYS A 1 261 ? 24.659  15.060  8.909   1.00 51.22 ? 261 LYS A CD  1 
ATOM   1983 C  CE  . LYS A 1 261 ? 23.268  15.560  8.577   1.00 52.59 ? 261 LYS A CE  1 
ATOM   1984 N  NZ  . LYS A 1 261 ? 23.319  16.460  7.390   1.00 52.75 ? 261 LYS A NZ  1 
ATOM   1985 N  N   . GLU A 1 262 ? 28.503  11.278  9.888   1.00 44.59 ? 262 GLU A N   1 
ATOM   1986 C  CA  . GLU A 1 262 ? 29.876  10.918  10.197  1.00 48.00 ? 262 GLU A CA  1 
ATOM   1987 C  C   . GLU A 1 262 ? 30.091  9.523   9.658   1.00 45.73 ? 262 GLU A C   1 
ATOM   1988 O  O   . GLU A 1 262 ? 29.139  8.756   9.526   1.00 45.03 ? 262 GLU A O   1 
ATOM   1989 C  CB  . GLU A 1 262 ? 30.107  10.923  11.713  1.00 51.56 ? 262 GLU A CB  1 
ATOM   1990 C  CG  . GLU A 1 262 ? 29.783  12.241  12.408  1.00 57.47 ? 262 GLU A CG  1 
ATOM   1991 C  CD  . GLU A 1 262 ? 30.820  13.329  12.144  1.00 64.19 ? 262 GLU A CD  1 
ATOM   1992 O  OE1 . GLU A 1 262 ? 32.010  13.104  12.454  1.00 67.63 ? 262 GLU A OE1 1 
ATOM   1993 O  OE2 . GLU A 1 262 ? 30.452  14.417  11.640  1.00 66.04 ? 262 GLU A OE2 1 
ATOM   1994 N  N   . VAL A 1 263 ? 31.334  9.175   9.357   1.00 41.91 ? 263 VAL A N   1 
ATOM   1995 C  CA  . VAL A 1 263 ? 31.632  7.815   8.908   1.00 44.43 ? 263 VAL A CA  1 
ATOM   1996 C  C   . VAL A 1 263 ? 31.204  6.836   10.008  1.00 43.95 ? 263 VAL A C   1 
ATOM   1997 O  O   . VAL A 1 263 ? 31.474  7.076   11.182  1.00 44.40 ? 263 VAL A O   1 
ATOM   1998 C  CB  . VAL A 1 263 ? 33.124  7.627   8.559   1.00 45.15 ? 263 VAL A CB  1 
ATOM   1999 C  CG1 . VAL A 1 263 ? 33.424  6.179   8.203   1.00 45.23 ? 263 VAL A CG1 1 
ATOM   2000 C  CG2 . VAL A 1 263 ? 33.511  8.532   7.403   1.00 46.05 ? 263 VAL A CG2 1 
ATOM   2001 N  N   . ALA A 1 264 ? 30.516  5.763   9.617   1.00 41.44 ? 264 ALA A N   1 
ATOM   2002 C  CA  . ALA A 1 264 ? 29.952  4.791   10.553  1.00 41.25 ? 264 ALA A CA  1 
ATOM   2003 C  C   . ALA A 1 264 ? 30.589  3.452   10.279  1.00 40.96 ? 264 ALA A C   1 
ATOM   2004 O  O   . ALA A 1 264 ? 30.206  2.774   9.326   1.00 43.60 ? 264 ALA A O   1 
ATOM   2005 C  CB  . ALA A 1 264 ? 28.433  4.695   10.382  1.00 41.51 ? 264 ALA A CB  1 
ATOM   2006 N  N   . PRO A 1 265 ? 31.560  3.052   11.114  1.00 43.07 ? 265 PRO A N   1 
ATOM   2007 C  CA  . PRO A 1 265 ? 32.258  1.781   10.918  1.00 46.34 ? 265 PRO A CA  1 
ATOM   2008 C  C   . PRO A 1 265 ? 31.280  0.624   10.803  1.00 45.23 ? 265 PRO A C   1 
ATOM   2009 O  O   . PRO A 1 265 ? 30.401  0.449   11.652  1.00 50.09 ? 265 PRO A O   1 
ATOM   2010 C  CB  . PRO A 1 265 ? 33.117  1.629   12.186  1.00 45.40 ? 265 PRO A CB  1 
ATOM   2011 C  CG  . PRO A 1 265 ? 33.138  2.982   12.802  1.00 47.29 ? 265 PRO A CG  1 
ATOM   2012 C  CD  . PRO A 1 265 ? 31.870  3.657   12.416  1.00 44.19 ? 265 PRO A CD  1 
ATOM   2013 N  N   . ILE A 1 266 ? 31.464  -0.170  9.766   1.00 44.02 ? 266 ILE A N   1 
ATOM   2014 C  CA  . ILE A 1 266 ? 30.460  -1.105  9.324   1.00 42.63 ? 266 ILE A CA  1 
ATOM   2015 C  C   . ILE A 1 266 ? 30.113  -2.162  10.401  1.00 42.61 ? 266 ILE A C   1 
ATOM   2016 O  O   . ILE A 1 266 ? 28.936  -2.487  10.624  1.00 34.89 ? 266 ILE A O   1 
ATOM   2017 C  CB  . ILE A 1 266 ? 30.903  -1.681  7.966   1.00 46.49 ? 266 ILE A CB  1 
ATOM   2018 C  CG1 . ILE A 1 266 ? 29.697  -2.025  7.109   1.00 46.40 ? 266 ILE A CG1 1 
ATOM   2019 C  CG2 . ILE A 1 266 ? 31.926  -2.791  8.145   1.00 50.32 ? 266 ILE A CG2 1 
ATOM   2020 C  CD1 . ILE A 1 266 ? 28.888  -0.790  6.727   1.00 43.65 ? 266 ILE A CD1 1 
ATOM   2021 N  N   . GLU A 1 267 ? 31.120  -2.645  11.120  1.00 37.36 ? 267 GLU A N   1 
ATOM   2022 C  CA  . GLU A 1 267 ? 30.881  -3.580  12.225  1.00 37.26 ? 267 GLU A CA  1 
ATOM   2023 C  C   . GLU A 1 267 ? 30.195  -2.952  13.438  1.00 35.84 ? 267 GLU A C   1 
ATOM   2024 O  O   . GLU A 1 267 ? 29.459  -3.636  14.159  1.00 37.29 ? 267 GLU A O   1 
ATOM   2025 C  CB  . GLU A 1 267 ? 32.194  -4.269  12.635  1.00 40.97 ? 267 GLU A CB  1 
ATOM   2026 C  CG  . GLU A 1 267 ? 32.787  -5.151  11.534  1.00 40.98 ? 267 GLU A CG  1 
ATOM   2027 C  CD  . GLU A 1 267 ? 31.975  -6.411  11.229  1.00 42.68 ? 267 GLU A CD  1 
ATOM   2028 O  OE1 . GLU A 1 267 ? 31.601  -7.134  12.171  1.00 44.78 ? 267 GLU A OE1 1 
ATOM   2029 O  OE2 . GLU A 1 267 ? 31.729  -6.706  10.046  1.00 39.91 ? 267 GLU A OE2 1 
ATOM   2030 N  N   . GLU A 1 268 ? 30.403  -1.659  13.670  1.00 33.70 ? 268 GLU A N   1 
ATOM   2031 C  CA  . GLU A 1 268 ? 29.675  -0.969  14.705  1.00 34.53 ? 268 GLU A CA  1 
ATOM   2032 C  C   . GLU A 1 268 ? 28.207  -0.721  14.317  1.00 35.29 ? 268 GLU A C   1 
ATOM   2033 O  O   . GLU A 1 268 ? 27.323  -0.764  15.173  1.00 32.44 ? 268 GLU A O   1 
ATOM   2034 C  CB  . GLU A 1 268 ? 30.338  0.353   15.041  1.00 38.66 ? 268 GLU A CB  1 
ATOM   2035 C  CG  . GLU A 1 268 ? 31.714  0.164   15.657  1.00 43.14 ? 268 GLU A CG  1 
ATOM   2036 C  CD  . GLU A 1 268 ? 32.444  1.468   15.815  1.00 44.39 ? 268 GLU A CD  1 
ATOM   2037 O  OE1 . GLU A 1 268 ? 31.797  2.483   16.160  1.00 45.86 ? 268 GLU A OE1 1 
ATOM   2038 O  OE2 . GLU A 1 268 ? 33.669  1.474   15.565  1.00 49.92 ? 268 GLU A OE2 1 
ATOM   2039 N  N   . VAL A 1 269 ? 27.964  -0.457  13.038  1.00 33.36 ? 269 VAL A N   1 
ATOM   2040 C  CA  . VAL A 1 269 ? 26.581  -0.334  12.537  1.00 32.92 ? 269 VAL A CA  1 
ATOM   2041 C  C   . VAL A 1 269 ? 25.830  -1.621  12.837  1.00 33.31 ? 269 VAL A C   1 
ATOM   2042 O  O   . VAL A 1 269 ? 24.723  -1.568  13.334  1.00 35.90 ? 269 VAL A O   1 
ATOM   2043 C  CB  . VAL A 1 269 ? 26.529  -0.024  11.025  1.00 31.56 ? 269 VAL A CB  1 
ATOM   2044 C  CG1 . VAL A 1 269 ? 25.070  0.012   10.511  1.00 31.60 ? 269 VAL A CG1 1 
ATOM   2045 C  CG2 . VAL A 1 269 ? 27.198  1.309   10.766  1.00 32.15 ? 269 VAL A CG2 1 
ATOM   2046 N  N   . LYS A 1 270 ? 26.441  -2.765  12.527  1.00 32.04 ? 270 LYS A N   1 
ATOM   2047 C  CA  . LYS A 1 270 ? 25.848  -4.059  12.786  1.00 34.71 ? 270 LYS A CA  1 
ATOM   2048 C  C   . LYS A 1 270 ? 25.496  -4.211  14.274  1.00 34.77 ? 270 LYS A C   1 
ATOM   2049 O  O   . LYS A 1 270 ? 24.384  -4.619  14.620  1.00 33.53 ? 270 LYS A O   1 
ATOM   2050 C  CB  . LYS A 1 270 ? 26.792  -5.181  12.372  1.00 34.72 ? 270 LYS A CB  1 
ATOM   2051 C  CG  . LYS A 1 270 ? 26.984  -5.357  10.861  1.00 36.00 ? 270 LYS A CG  1 
ATOM   2052 C  CD  . LYS A 1 270 ? 27.978  -6.476  10.607  1.00 39.19 ? 270 LYS A CD  1 
ATOM   2053 C  CE  . LYS A 1 270 ? 28.236  -6.754  9.136   1.00 39.97 ? 270 LYS A CE  1 
ATOM   2054 N  NZ  . LYS A 1 270 ? 29.072  -7.982  8.995   1.00 43.15 ? 270 LYS A NZ  1 
ATOM   2055 N  N   . ALA A 1 271 ? 26.454  -3.891  15.138  1.00 33.86 ? 271 ALA A N   1 
ATOM   2056 C  CA  . ALA A 1 271 ? 26.253  -3.945  16.601  1.00 35.78 ? 271 ALA A CA  1 
ATOM   2057 C  C   . ALA A 1 271 ? 25.146  -3.008  17.080  1.00 33.04 ? 271 ALA A C   1 
ATOM   2058 O  O   . ALA A 1 271 ? 24.350  -3.364  17.929  1.00 34.06 ? 271 ALA A O   1 
ATOM   2059 C  CB  . ALA A 1 271 ? 27.562  -3.619  17.326  1.00 37.45 ? 271 ALA A CB  1 
ATOM   2060 N  N   . ALA A 1 272 ? 25.114  -1.802  16.550  1.00 30.52 ? 272 ALA A N   1 
ATOM   2061 C  CA  . ALA A 1 272 ? 24.140  -0.807  16.953  1.00 31.28 ? 272 ALA A CA  1 
ATOM   2062 C  C   . ALA A 1 272 ? 22.716  -1.253  16.589  1.00 30.39 ? 272 ALA A C   1 
ATOM   2063 O  O   . ALA A 1 272 ? 21.778  -0.968  17.342  1.00 32.12 ? 272 ALA A O   1 
ATOM   2064 C  CB  . ALA A 1 272 ? 24.441  0.544   16.309  1.00 30.18 ? 272 ALA A CB  1 
ATOM   2065 N  N   . ILE A 1 273 ? 22.581  -1.911  15.435  1.00 29.63 ? 273 ILE A N   1 
ATOM   2066 C  CA  . ILE A 1 273 ? 21.278  -2.420  14.977  1.00 32.00 ? 273 ILE A CA  1 
ATOM   2067 C  C   . ILE A 1 273 ? 20.884  -3.630  15.842  1.00 32.40 ? 273 ILE A C   1 
ATOM   2068 O  O   . ILE A 1 273 ? 19.750  -3.710  16.289  1.00 29.39 ? 273 ILE A O   1 
ATOM   2069 C  CB  . ILE A 1 273 ? 21.308  -2.799  13.484  1.00 32.43 ? 273 ILE A CB  1 
ATOM   2070 C  CG1 . ILE A 1 273 ? 21.352  -1.525  12.632  1.00 32.52 ? 273 ILE A CG1 1 
ATOM   2071 C  CG2 . ILE A 1 273 ? 20.083  -3.597  13.091  1.00 33.91 ? 273 ILE A CG2 1 
ATOM   2072 C  CD1 . ILE A 1 273 ? 21.719  -1.781  11.187  1.00 31.98 ? 273 ILE A CD1 1 
ATOM   2073 N  N   . ALA A 1 274 ? 21.830  -4.538  16.095  1.00 30.92 ? 274 ALA A N   1 
ATOM   2074 C  CA  . ALA A 1 274 ? 21.578  -5.673  16.967  1.00 31.77 ? 274 ALA A CA  1 
ATOM   2075 C  C   . ALA A 1 274 ? 21.119  -5.192  18.354  1.00 32.77 ? 274 ALA A C   1 
ATOM   2076 O  O   . ALA A 1 274 ? 20.242  -5.816  18.986  1.00 31.92 ? 274 ALA A O   1 
ATOM   2077 C  CB  . ALA A 1 274 ? 22.829  -6.552  17.093  1.00 31.58 ? 274 ALA A CB  1 
ATOM   2078 N  N   . ALA A 1 275 ? 21.704  -4.103  18.838  1.00 32.44 ? 275 ALA A N   1 
ATOM   2079 C  CA  . ALA A 1 275 ? 21.363  -3.570  20.171  1.00 33.83 ? 275 ALA A CA  1 
ATOM   2080 C  C   . ALA A 1 275 ? 20.040  -2.787  20.240  1.00 31.75 ? 275 ALA A C   1 
ATOM   2081 O  O   . ALA A 1 275 ? 19.576  -2.468  21.322  1.00 33.26 ? 275 ALA A O   1 
ATOM   2082 C  CB  . ALA A 1 275 ? 22.497  -2.714  20.701  1.00 33.69 ? 275 ALA A CB  1 
ATOM   2083 N  N   . PHE A 1 276 ? 19.431  -2.502  19.094  1.00 30.42 ? 276 PHE A N   1 
ATOM   2084 C  CA  . PHE A 1 276 ? 18.249  -1.660  19.044  1.00 30.39 ? 276 PHE A CA  1 
ATOM   2085 C  C   . PHE A 1 276 ? 16.997  -2.513  19.218  1.00 29.34 ? 276 PHE A C   1 
ATOM   2086 O  O   . PHE A 1 276 ? 16.845  -3.531  18.525  1.00 30.20 ? 276 PHE A O   1 
ATOM   2087 C  CB  . PHE A 1 276 ? 18.199  -0.896  17.724  1.00 31.60 ? 276 PHE A CB  1 
ATOM   2088 C  CG  . PHE A 1 276 ? 17.195  0.209   17.719  1.00 31.13 ? 276 PHE A CG  1 
ATOM   2089 C  CD1 . PHE A 1 276 ? 17.423  1.350   18.439  1.00 30.94 ? 276 PHE A CD1 1 
ATOM   2090 C  CD2 . PHE A 1 276 ? 15.993  0.068   17.044  1.00 30.56 ? 276 PHE A CD2 1 
ATOM   2091 C  CE1 . PHE A 1 276 ? 16.500  2.368   18.470  1.00 32.94 ? 276 PHE A CE1 1 
ATOM   2092 C  CE2 . PHE A 1 276 ? 15.063  1.086   17.051  1.00 31.32 ? 276 PHE A CE2 1 
ATOM   2093 C  CZ  . PHE A 1 276 ? 15.304  2.236   17.773  1.00 30.68 ? 276 PHE A CZ  1 
ATOM   2094 N  N   . PRO A 1 277 ? 16.133  -2.160  20.179  1.00 30.83 ? 277 PRO A N   1 
ATOM   2095 C  CA  . PRO A 1 277 ? 14.968  -3.023  20.409  1.00 33.17 ? 277 PRO A CA  1 
ATOM   2096 C  C   . PRO A 1 277 ? 14.046  -3.031  19.192  1.00 32.95 ? 277 PRO A C   1 
ATOM   2097 O  O   . PRO A 1 277 ? 13.803  -1.997  18.599  1.00 31.84 ? 277 PRO A O   1 
ATOM   2098 C  CB  . PRO A 1 277 ? 14.267  -2.390  21.633  1.00 34.86 ? 277 PRO A CB  1 
ATOM   2099 C  CG  . PRO A 1 277 ? 15.252  -1.408  22.206  1.00 35.85 ? 277 PRO A CG  1 
ATOM   2100 C  CD  . PRO A 1 277 ? 16.110  -0.964  21.044  1.00 32.84 ? 277 PRO A CD  1 
ATOM   2101 N  N   . GLY A 1 278 ? 13.593  -4.212  18.792  1.00 32.70 ? 278 GLY A N   1 
ATOM   2102 C  CA  . GLY A 1 278 ? 12.714  -4.340  17.640  1.00 34.21 ? 278 GLY A CA  1 
ATOM   2103 C  C   . GLY A 1 278 ? 13.446  -4.686  16.361  1.00 32.94 ? 278 GLY A C   1 
ATOM   2104 O  O   . GLY A 1 278 ? 12.812  -5.092  15.394  1.00 31.95 ? 278 GLY A O   1 
ATOM   2105 N  N   . ALA A 1 279 ? 14.779  -4.525  16.369  1.00 32.55 ? 279 ALA A N   1 
ATOM   2106 C  CA  . ALA A 1 279 ? 15.648  -4.864  15.249  1.00 34.20 ? 279 ALA A CA  1 
ATOM   2107 C  C   . ALA A 1 279 ? 16.505  -6.087  15.571  1.00 34.65 ? 279 ALA A C   1 
ATOM   2108 O  O   . ALA A 1 279 ? 17.115  -6.162  16.643  1.00 37.84 ? 279 ALA A O   1 
ATOM   2109 C  CB  . ALA A 1 279 ? 16.551  -3.675  14.913  1.00 34.91 ? 279 ALA A CB  1 
ATOM   2110 N  N   . VAL A 1 280 ? 16.563  -7.027  14.638  1.00 32.42 ? 280 VAL A N   1 
ATOM   2111 C  CA  A VAL A 1 280 ? 17.386  -8.218  14.778  0.50 34.66 ? 280 VAL A CA  1 
ATOM   2112 C  CA  B VAL A 1 280 ? 17.386  -8.218  14.778  0.50 34.67 ? 280 VAL A CA  1 
ATOM   2113 C  C   . VAL A 1 280 ? 18.391  -8.254  13.640  1.00 34.94 ? 280 VAL A C   1 
ATOM   2114 O  O   . VAL A 1 280 ? 18.012  -8.161  12.458  1.00 33.00 ? 280 VAL A O   1 
ATOM   2115 C  CB  A VAL A 1 280 ? 16.520  -9.494  14.756  0.50 34.95 ? 280 VAL A CB  1 
ATOM   2116 C  CB  B VAL A 1 280 ? 16.520  -9.495  14.757  0.50 34.96 ? 280 VAL A CB  1 
ATOM   2117 C  CG1 A VAL A 1 280 ? 17.379  -10.754 14.731  0.50 35.19 ? 280 VAL A CG1 1 
ATOM   2118 C  CG1 B VAL A 1 280 ? 17.379  -10.753 14.730  0.50 35.19 ? 280 VAL A CG1 1 
ATOM   2119 C  CG2 A VAL A 1 280 ? 15.590  -9.509  15.959  0.50 35.58 ? 280 VAL A CG2 1 
ATOM   2120 C  CG2 B VAL A 1 280 ? 15.592  -9.510  15.961  0.50 35.58 ? 280 VAL A CG2 1 
ATOM   2121 N  N   . LEU A 1 281 ? 19.673  -8.370  13.999  1.00 34.58 ? 281 LEU A N   1 
ATOM   2122 C  CA  . LEU A 1 281 ? 20.734  -8.526  13.034  1.00 33.43 ? 281 LEU A CA  1 
ATOM   2123 C  C   . LEU A 1 281 ? 20.742  -9.947  12.498  1.00 33.64 ? 281 LEU A C   1 
ATOM   2124 O  O   . LEU A 1 281 ? 20.876  -10.902 13.264  1.00 31.12 ? 281 LEU A O   1 
ATOM   2125 C  CB  . LEU A 1 281 ? 22.092  -8.203  13.673  1.00 35.52 ? 281 LEU A CB  1 
ATOM   2126 C  CG  . LEU A 1 281 ? 23.286  -8.246  12.724  1.00 35.52 ? 281 LEU A CG  1 
ATOM   2127 C  CD1 . LEU A 1 281 ? 23.240  -7.070  11.768  1.00 34.82 ? 281 LEU A CD1 1 
ATOM   2128 C  CD2 . LEU A 1 281 ? 24.592  -8.262  13.516  1.00 36.57 ? 281 LEU A CD2 1 
ATOM   2129 N  N   . GLU A 1 282 ? 20.585  -10.079 11.183  1.00 32.50 ? 282 GLU A N   1 
ATOM   2130 C  CA  . GLU A 1 282 ? 20.695  -11.366 10.500  1.00 34.70 ? 282 GLU A CA  1 
ATOM   2131 C  C   . GLU A 1 282 ? 21.660  -11.173 9.358   1.00 34.61 ? 282 GLU A C   1 
ATOM   2132 O  O   . GLU A 1 282 ? 21.262  -10.829 8.237   1.00 33.70 ? 282 GLU A O   1 
ATOM   2133 C  CB  . GLU A 1 282 ? 19.340  -11.843 9.959   1.00 38.84 ? 282 GLU A CB  1 
ATOM   2134 C  CG  . GLU A 1 282 ? 18.610  -12.771 10.899  1.00 42.58 ? 282 GLU A CG  1 
ATOM   2135 C  CD  . GLU A 1 282 ? 17.217  -13.126 10.410  1.00 46.75 ? 282 GLU A CD  1 
ATOM   2136 O  OE1 . GLU A 1 282 ? 16.821  -12.676 9.310   1.00 46.93 ? 282 GLU A OE1 1 
ATOM   2137 O  OE2 . GLU A 1 282 ? 16.528  -13.863 11.138  1.00 45.70 ? 282 GLU A OE2 1 
ATOM   2138 N  N   . ASP A 1 283 ? 22.947  -11.364 9.652   1.00 33.80 ? 283 ASP A N   1 
ATOM   2139 C  CA  . ASP A 1 283 ? 23.988  -10.938 8.747   1.00 33.35 ? 283 ASP A CA  1 
ATOM   2140 C  C   . ASP A 1 283 ? 25.234  -11.768 9.023   1.00 35.44 ? 283 ASP A C   1 
ATOM   2141 O  O   . ASP A 1 283 ? 25.992  -11.472 9.928   1.00 37.17 ? 283 ASP A O   1 
ATOM   2142 C  CB  . ASP A 1 283 ? 24.268  -9.445  8.947   1.00 34.28 ? 283 ASP A CB  1 
ATOM   2143 C  CG  . ASP A 1 283 ? 24.941  -8.785  7.732   1.00 34.18 ? 283 ASP A CG  1 
ATOM   2144 O  OD1 . ASP A 1 283 ? 25.559  -9.503  6.910   1.00 37.65 ? 283 ASP A OD1 1 
ATOM   2145 O  OD2 . ASP A 1 283 ? 24.817  -7.537  7.602   1.00 32.10 ? 283 ASP A OD2 1 
ATOM   2146 N  N   . ASP A 1 284 ? 25.390  -12.827 8.241   1.00 36.00 ? 284 ASP A N   1 
ATOM   2147 C  CA  . ASP A 1 284 ? 26.546  -13.703 8.297   1.00 37.39 ? 284 ASP A CA  1 
ATOM   2148 C  C   . ASP A 1 284 ? 26.697  -14.288 6.908   1.00 35.69 ? 284 ASP A C   1 
ATOM   2149 O  O   . ASP A 1 284 ? 26.230  -15.402 6.642   1.00 34.82 ? 284 ASP A O   1 
ATOM   2150 C  CB  . ASP A 1 284 ? 26.300  -14.811 9.337   1.00 39.54 ? 284 ASP A CB  1 
ATOM   2151 C  CG  . ASP A 1 284 ? 27.463  -15.784 9.455   1.00 41.51 ? 284 ASP A CG  1 
ATOM   2152 O  OD1 . ASP A 1 284 ? 28.419  -15.656 8.689   1.00 40.32 ? 284 ASP A OD1 1 
ATOM   2153 O  OD2 . ASP A 1 284 ? 27.395  -16.700 10.300  1.00 42.32 ? 284 ASP A OD2 1 
ATOM   2154 N  N   . VAL A 1 285 ? 27.334  -13.533 6.009   1.00 35.44 ? 285 VAL A N   1 
ATOM   2155 C  CA  . VAL A 1 285 ? 27.384  -13.935 4.600   1.00 36.38 ? 285 VAL A CA  1 
ATOM   2156 C  C   . VAL A 1 285 ? 28.191  -15.203 4.382   1.00 36.93 ? 285 VAL A C   1 
ATOM   2157 O  O   . VAL A 1 285 ? 27.909  -15.947 3.464   1.00 33.10 ? 285 VAL A O   1 
ATOM   2158 C  CB  . VAL A 1 285 ? 27.888  -12.812 3.667   1.00 37.99 ? 285 VAL A CB  1 
ATOM   2159 C  CG1 . VAL A 1 285 ? 26.914  -11.648 3.692   1.00 39.21 ? 285 VAL A CG1 1 
ATOM   2160 C  CG2 . VAL A 1 285 ? 29.304  -12.362 4.030   1.00 40.12 ? 285 VAL A CG2 1 
ATOM   2161 N  N   . ALA A 1 286 ? 29.180  -15.460 5.236   1.00 38.32 ? 286 ALA A N   1 
ATOM   2162 C  CA  . ALA A 1 286 ? 29.903  -16.739 5.194   1.00 39.44 ? 286 ALA A CA  1 
ATOM   2163 C  C   . ALA A 1 286 ? 28.956  -17.929 5.212   1.00 38.75 ? 286 ALA A C   1 
ATOM   2164 O  O   . ALA A 1 286 ? 29.257  -18.955 4.604   1.00 38.89 ? 286 ALA A O   1 
ATOM   2165 C  CB  . ALA A 1 286 ? 30.911  -16.847 6.342   1.00 39.58 ? 286 ALA A CB  1 
ATOM   2166 N  N   . HIS A 1 287 ? 27.816  -17.797 5.901   1.00 38.15 ? 287 HIS A N   1 
ATOM   2167 C  CA  . HIS A 1 287 ? 26.824  -18.883 5.996   1.00 37.59 ? 287 HIS A CA  1 
ATOM   2168 C  C   . HIS A 1 287 ? 25.499  -18.512 5.310   1.00 37.61 ? 287 HIS A C   1 
ATOM   2169 O  O   . HIS A 1 287 ? 24.446  -19.084 5.592   1.00 36.78 ? 287 HIS A O   1 
ATOM   2170 C  CB  . HIS A 1 287 ? 26.623  -19.280 7.464   1.00 41.22 ? 287 HIS A CB  1 
ATOM   2171 C  CG  . HIS A 1 287 ? 27.887  -19.741 8.124   1.00 42.56 ? 287 HIS A CG  1 
ATOM   2172 N  ND1 . HIS A 1 287 ? 28.441  -20.980 7.878   1.00 46.54 ? 287 HIS A ND1 1 
ATOM   2173 C  CD2 . HIS A 1 287 ? 28.730  -19.119 8.980   1.00 45.57 ? 287 HIS A CD2 1 
ATOM   2174 C  CE1 . HIS A 1 287 ? 29.561  -21.107 8.566   1.00 45.59 ? 287 HIS A CE1 1 
ATOM   2175 N  NE2 . HIS A 1 287 ? 29.768  -19.985 9.232   1.00 46.69 ? 287 HIS A NE2 1 
ATOM   2176 N  N   . GLN A 1 288 ? 25.583  -17.575 4.371   1.00 34.17 ? 288 GLN A N   1 
ATOM   2177 C  CA  . GLN A 1 288 ? 24.438  -17.134 3.589   1.00 34.90 ? 288 GLN A CA  1 
ATOM   2178 C  C   . GLN A 1 288 ? 23.262  -16.738 4.455   1.00 31.89 ? 288 GLN A C   1 
ATOM   2179 O  O   . GLN A 1 288 ? 22.130  -17.058 4.120   1.00 32.66 ? 288 GLN A O   1 
ATOM   2180 C  CB  . GLN A 1 288 ? 24.016  -18.204 2.587   1.00 34.40 ? 288 GLN A CB  1 
ATOM   2181 C  CG  . GLN A 1 288 ? 25.127  -18.651 1.655   1.00 36.78 ? 288 GLN A CG  1 
ATOM   2182 C  CD  . GLN A 1 288 ? 24.721  -19.837 0.837   1.00 37.65 ? 288 GLN A CD  1 
ATOM   2183 O  OE1 . GLN A 1 288 ? 25.161  -20.962 1.093   1.00 38.27 ? 288 GLN A OE1 1 
ATOM   2184 N  NE2 . GLN A 1 288 ? 23.829  -19.611 -0.131  1.00 39.04 ? 288 GLN A NE2 1 
ATOM   2185 N  N   . ILE A 1 289 ? 23.540  -16.052 5.563   1.00 32.06 ? 289 ILE A N   1 
ATOM   2186 C  CA  . ILE A 1 289 ? 22.496  -15.547 6.457   1.00 33.52 ? 289 ILE A CA  1 
ATOM   2187 C  C   . ILE A 1 289 ? 22.148  -14.082 6.151   1.00 31.90 ? 289 ILE A C   1 
ATOM   2188 O  O   . ILE A 1 289 ? 22.992  -13.187 6.256   1.00 29.14 ? 289 ILE A O   1 
ATOM   2189 C  CB  . ILE A 1 289 ? 22.933  -15.613 7.937   1.00 36.05 ? 289 ILE A CB  1 
ATOM   2190 C  CG1 . ILE A 1 289 ? 23.291  -17.044 8.364   1.00 37.87 ? 289 ILE A CG1 1 
ATOM   2191 C  CG2 . ILE A 1 289 ? 21.867  -15.004 8.856   1.00 37.50 ? 289 ILE A CG2 1 
ATOM   2192 C  CD1 . ILE A 1 289 ? 22.218  -18.082 8.153   1.00 40.96 ? 289 ILE A CD1 1 
ATOM   2193 N  N   . TYR A 1 290 ? 20.870  -13.847 5.850   1.00 29.18 ? 290 TYR A N   1 
ATOM   2194 C  CA  . TYR A 1 290 ? 20.371  -12.526 5.600   1.00 29.05 ? 290 TYR A CA  1 
ATOM   2195 C  C   . TYR A 1 290 ? 18.841  -12.562 5.774   1.00 27.94 ? 290 TYR A C   1 
ATOM   2196 O  O   . TYR A 1 290 ? 18.246  -13.628 5.690   1.00 26.80 ? 290 TYR A O   1 
ATOM   2197 C  CB  . TYR A 1 290 ? 20.747  -12.063 4.174   1.00 29.06 ? 290 TYR A CB  1 
ATOM   2198 C  CG  . TYR A 1 290 ? 20.793  -13.174 3.159   1.00 30.00 ? 290 TYR A CG  1 
ATOM   2199 C  CD1 . TYR A 1 290 ? 19.629  -13.786 2.703   1.00 30.61 ? 290 TYR A CD1 1 
ATOM   2200 C  CD2 . TYR A 1 290 ? 22.003  -13.632 2.657   1.00 30.34 ? 290 TYR A CD2 1 
ATOM   2201 C  CE1 . TYR A 1 290 ? 19.676  -14.817 1.784   1.00 30.69 ? 290 TYR A CE1 1 
ATOM   2202 C  CE2 . TYR A 1 290 ? 22.048  -14.670 1.737   1.00 30.60 ? 290 TYR A CE2 1 
ATOM   2203 C  CZ  . TYR A 1 290 ? 20.884  -15.246 1.295   1.00 30.86 ? 290 TYR A CZ  1 
ATOM   2204 O  OH  . TYR A 1 290 ? 20.919  -16.275 0.366   1.00 33.13 ? 290 TYR A OH  1 
ATOM   2205 N  N   . PRO A 1 291 ? 18.215  -11.406 6.037   1.00 29.37 ? 291 PRO A N   1 
ATOM   2206 C  CA  . PRO A 1 291 ? 16.742  -11.414 6.161   1.00 29.99 ? 291 PRO A CA  1 
ATOM   2207 C  C   . PRO A 1 291 ? 16.036  -11.980 4.934   1.00 30.18 ? 291 PRO A C   1 
ATOM   2208 O  O   . PRO A 1 291 ? 16.424  -11.688 3.775   1.00 29.89 ? 291 PRO A O   1 
ATOM   2209 C  CB  . PRO A 1 291 ? 16.407  -9.943  6.350   1.00 30.81 ? 291 PRO A CB  1 
ATOM   2210 C  CG  . PRO A 1 291 ? 17.629  -9.362  6.958   1.00 29.44 ? 291 PRO A CG  1 
ATOM   2211 C  CD  . PRO A 1 291 ? 18.763  -10.068 6.275   1.00 29.53 ? 291 PRO A CD  1 
ATOM   2212 N  N   . GLN A 1 292 ? 14.993  -12.768 5.175   1.00 31.05 ? 292 GLN A N   1 
ATOM   2213 C  CA  . GLN A 1 292 ? 14.154  -13.285 4.116   1.00 30.14 ? 292 GLN A CA  1 
ATOM   2214 C  C   . GLN A 1 292 ? 12.682  -13.138 4.473   1.00 28.95 ? 292 GLN A C   1 
ATOM   2215 O  O   . GLN A 1 292 ? 12.258  -13.519 5.583   1.00 28.80 ? 292 GLN A O   1 
ATOM   2216 C  CB  . GLN A 1 292 ? 14.425  -14.774 3.892   1.00 31.04 ? 292 GLN A CB  1 
ATOM   2217 C  CG  . GLN A 1 292 ? 15.813  -15.104 3.414   1.00 31.18 ? 292 GLN A CG  1 
ATOM   2218 C  CD  . GLN A 1 292 ? 15.996  -16.585 3.177   1.00 30.31 ? 292 GLN A CD  1 
ATOM   2219 O  OE1 . GLN A 1 292 ? 15.091  -17.257 2.686   1.00 30.99 ? 292 GLN A OE1 1 
ATOM   2220 N  NE2 . GLN A 1 292 ? 17.193  -17.106 3.513   1.00 28.88 ? 292 GLN A NE2 1 
ATOM   2221 N  N   . ALA A 1 293 ? 11.913  -12.629 3.523   1.00 27.44 ? 293 ALA A N   1 
ATOM   2222 C  CA  . ALA A 1 293 ? 10.466  -12.445 3.693   1.00 26.84 ? 293 ALA A CA  1 
ATOM   2223 C  C   . ALA A 1 293 ? 9.801   -13.653 4.321   1.00 27.67 ? 293 ALA A C   1 
ATOM   2224 O  O   . ALA A 1 293 ? 9.091   -13.517 5.311   1.00 30.09 ? 293 ALA A O   1 
ATOM   2225 C  CB  . ALA A 1 293 ? 9.804   -12.142 2.380   1.00 26.96 ? 293 ALA A CB  1 
ATOM   2226 N  N   . ILE A 1 294 ? 10.010  -14.827 3.737   1.00 29.07 ? 294 ILE A N   1 
ATOM   2227 C  CA  . ILE A 1 294 ? 9.338   -16.035 4.242   1.00 31.01 ? 294 ILE A CA  1 
ATOM   2228 C  C   . ILE A 1 294 ? 9.680   -16.401 5.687   1.00 32.89 ? 294 ILE A C   1 
ATOM   2229 O  O   . ILE A 1 294 ? 8.854   -17.015 6.343   1.00 32.53 ? 294 ILE A O   1 
ATOM   2230 C  CB  . ILE A 1 294 ? 9.533   -17.279 3.343   1.00 30.77 ? 294 ILE A CB  1 
ATOM   2231 C  CG1 . ILE A 1 294 ? 11.005  -17.732 3.325   1.00 32.18 ? 294 ILE A CG1 1 
ATOM   2232 C  CG2 . ILE A 1 294 ? 9.008   -17.017 1.953   1.00 32.28 ? 294 ILE A CG2 1 
ATOM   2233 C  CD1 . ILE A 1 294 ? 11.265  -18.916 2.403   1.00 32.92 ? 294 ILE A CD1 1 
ATOM   2234 N  N   . ASN A 1 295 ? 10.878  -16.048 6.174   1.00 30.47 ? 295 ASN A N   1 
ATOM   2235 C  CA  . ASN A 1 295 ? 11.256  -16.317 7.552   1.00 30.48 ? 295 ASN A CA  1 
ATOM   2236 C  C   . ASN A 1 295 ? 10.740  -15.249 8.536   1.00 29.49 ? 295 ASN A C   1 
ATOM   2237 O  O   . ASN A 1 295 ? 10.670  -15.477 9.730   1.00 28.69 ? 295 ASN A O   1 
ATOM   2238 C  CB  . ASN A 1 295 ? 12.798  -16.445 7.679   1.00 32.57 ? 295 ASN A CB  1 
ATOM   2239 C  CG  . ASN A 1 295 ? 13.336  -17.665 6.961   1.00 35.87 ? 295 ASN A CG  1 
ATOM   2240 O  OD1 . ASN A 1 295 ? 12.607  -18.629 6.713   1.00 38.34 ? 295 ASN A OD1 1 
ATOM   2241 N  ND2 . ASN A 1 295 ? 14.621  -17.651 6.661   1.00 37.78 ? 295 ASN A ND2 1 
ATOM   2242 N  N   . ALA A 1 296 ? 10.390  -14.086 8.022   1.00 28.21 ? 296 ALA A N   1 
ATOM   2243 C  CA  . ALA A 1 296 ? 9.965   -12.963 8.836   1.00 27.52 ? 296 ALA A CA  1 
ATOM   2244 C  C   . ALA A 1 296 ? 8.468   -13.037 9.157   1.00 28.11 ? 296 ALA A C   1 
ATOM   2245 O  O   . ALA A 1 296 ? 8.005   -12.452 10.138  1.00 29.10 ? 296 ALA A O   1 
ATOM   2246 C  CB  . ALA A 1 296 ? 10.228  -11.679 8.076   1.00 28.99 ? 296 ALA A CB  1 
ATOM   2247 N  N   . VAL A 1 297 ? 7.719   -13.703 8.294   1.00 29.56 ? 297 VAL A N   1 
ATOM   2248 C  CA  . VAL A 1 297 ? 6.257   -13.805 8.463   1.00 30.25 ? 297 VAL A CA  1 
ATOM   2249 C  C   . VAL A 1 297 ? 5.929   -14.374 9.839   1.00 31.60 ? 297 VAL A C   1 
ATOM   2250 O  O   . VAL A 1 297 ? 6.456   -15.407 10.220  1.00 31.32 ? 297 VAL A O   1 
ATOM   2251 C  CB  . VAL A 1 297 ? 5.634   -14.662 7.356   1.00 30.12 ? 297 VAL A CB  1 
ATOM   2252 C  CG1 . VAL A 1 297 ? 4.192   -15.060 7.697   1.00 33.33 ? 297 VAL A CG1 1 
ATOM   2253 C  CG2 . VAL A 1 297 ? 5.680   -13.901 6.046   1.00 31.87 ? 297 VAL A CG2 1 
ATOM   2254 N  N   . GLY A 1 298 ? 5.091   -13.667 10.586  1.00 32.64 ? 298 GLY A N   1 
ATOM   2255 C  CA  . GLY A 1 298 ? 4.666   -14.103 11.909  1.00 35.00 ? 298 GLY A CA  1 
ATOM   2256 C  C   . GLY A 1 298 ? 5.493   -13.572 13.060  1.00 35.13 ? 298 GLY A C   1 
ATOM   2257 O  O   . GLY A 1 298 ? 5.106   -13.786 14.216  1.00 34.55 ? 298 GLY A O   1 
ATOM   2258 N  N   . SER A 1 299 ? 6.626   -12.904 12.772  1.00 30.31 ? 299 SER A N   1 
ATOM   2259 C  CA  . SER A 1 299 ? 7.415   -12.258 13.808  1.00 28.61 ? 299 SER A CA  1 
ATOM   2260 C  C   . SER A 1 299 ? 7.168   -10.761 13.881  1.00 28.89 ? 299 SER A C   1 
ATOM   2261 O  O   . SER A 1 299 ? 7.059   -10.070 12.860  1.00 28.28 ? 299 SER A O   1 
ATOM   2262 C  CB  . SER A 1 299 ? 8.920   -12.530 13.603  1.00 29.49 ? 299 SER A CB  1 
ATOM   2263 O  OG  . SER A 1 299 ? 9.699   -11.650 14.394  1.00 29.40 ? 299 SER A OG  1 
ATOM   2264 N  N   . ARG A 1 300 ? 7.113   -10.247 15.103  1.00 27.55 ? 300 ARG A N   1 
ATOM   2265 C  CA  . ARG A 1 300 ? 7.045   -8.817  15.346  1.00 29.05 ? 300 ARG A CA  1 
ATOM   2266 C  C   . ARG A 1 300 ? 8.366   -8.077  15.104  1.00 29.52 ? 300 ARG A C   1 
ATOM   2267 O  O   . ARG A 1 300 ? 8.374   -6.844  15.065  1.00 28.28 ? 300 ARG A O   1 
ATOM   2268 C  CB  . ARG A 1 300 ? 6.631   -8.554  16.809  1.00 29.93 ? 300 ARG A CB  1 
ATOM   2269 C  CG  . ARG A 1 300 ? 5.257   -9.048  17.205  1.00 30.16 ? 300 ARG A CG  1 
ATOM   2270 C  CD  . ARG A 1 300 ? 5.102   -9.014  18.724  1.00 32.26 ? 300 ARG A CD  1 
ATOM   2271 N  NE  . ARG A 1 300 ? 3.759   -9.404  19.181  1.00 33.61 ? 300 ARG A NE  1 
ATOM   2272 C  CZ  . ARG A 1 300 ? 3.330   -10.658 19.290  1.00 36.43 ? 300 ARG A CZ  1 
ATOM   2273 N  NH1 . ARG A 1 300 ? 4.122   -11.675 18.956  1.00 37.09 ? 300 ARG A NH1 1 
ATOM   2274 N  NH2 . ARG A 1 300 ? 2.103   -10.903 19.726  1.00 37.04 ? 300 ARG A NH2 1 
ATOM   2275 N  N   . ASP A 1 301 ? 9.484   -8.807  15.014  1.00 30.04 ? 301 ASP A N   1 
ATOM   2276 C  CA  . ASP A 1 301 ? 10.787  -8.173  14.819  1.00 31.07 ? 301 ASP A CA  1 
ATOM   2277 C  C   . ASP A 1 301 ? 10.994  -7.685  13.381  1.00 30.02 ? 301 ASP A C   1 
ATOM   2278 O  O   . ASP A 1 301 ? 10.264  -8.073  12.460  1.00 32.95 ? 301 ASP A O   1 
ATOM   2279 C  CB  . ASP A 1 301 ? 11.926  -9.113  15.240  1.00 32.90 ? 301 ASP A CB  1 
ATOM   2280 C  CG  . ASP A 1 301 ? 12.110  -9.170  16.760  1.00 35.60 ? 301 ASP A CG  1 
ATOM   2281 O  OD1 . ASP A 1 301 ? 11.959  -8.119  17.429  1.00 38.18 ? 301 ASP A OD1 1 
ATOM   2282 O  OD2 . ASP A 1 301 ? 12.447  -10.253 17.277  1.00 37.16 ? 301 ASP A OD2 1 
ATOM   2283 N  N   . THR A 1 302 ? 11.980  -6.807  13.218  1.00 29.57 ? 302 THR A N   1 
ATOM   2284 C  CA  . THR A 1 302 ? 12.415  -6.288  11.917  1.00 29.35 ? 302 THR A CA  1 
ATOM   2285 C  C   . THR A 1 302 ? 13.840  -6.785  11.700  1.00 29.46 ? 302 THR A C   1 
ATOM   2286 O  O   . THR A 1 302 ? 14.679  -6.635  12.600  1.00 32.60 ? 302 THR A O   1 
ATOM   2287 C  CB  . THR A 1 302 ? 12.386  -4.745  11.900  1.00 31.67 ? 302 THR A CB  1 
ATOM   2288 O  OG1 . THR A 1 302 ? 11.034  -4.293  12.018  1.00 32.30 ? 302 THR A OG1 1 
ATOM   2289 C  CG2 . THR A 1 302 ? 12.961  -4.192  10.594  1.00 31.87 ? 302 THR A CG2 1 
ATOM   2290 N  N   . PHE A 1 303 ? 14.103  -7.438  10.572  1.00 28.17 ? 303 PHE A N   1 
ATOM   2291 C  CA  . PHE A 1 303 ? 15.385  -8.114  10.358  1.00 27.79 ? 303 PHE A CA  1 
ATOM   2292 C  C   . PHE A 1 303 ? 16.253  -7.348  9.367   1.00 29.61 ? 303 PHE A C   1 
ATOM   2293 O  O   . PHE A 1 303 ? 15.781  -6.889  8.322   1.00 28.71 ? 303 PHE A O   1 
ATOM   2294 C  CB  . PHE A 1 303 ? 15.161  -9.549  9.892   1.00 30.05 ? 303 PHE A CB  1 
ATOM   2295 C  CG  . PHE A 1 303 ? 14.311  -10.344 10.828  1.00 29.71 ? 303 PHE A CG  1 
ATOM   2296 C  CD1 . PHE A 1 303 ? 14.872  -10.996 11.899  1.00 30.31 ? 303 PHE A CD1 1 
ATOM   2297 C  CD2 . PHE A 1 303 ? 12.926  -10.390 10.665  1.00 30.46 ? 303 PHE A CD2 1 
ATOM   2298 C  CE1 . PHE A 1 303 ? 14.096  -11.710 12.784  1.00 30.26 ? 303 PHE A CE1 1 
ATOM   2299 C  CE2 . PHE A 1 303 ? 12.134  -11.123 11.543  1.00 30.98 ? 303 PHE A CE2 1 
ATOM   2300 C  CZ  . PHE A 1 303 ? 12.718  -11.769 12.604  1.00 29.60 ? 303 PHE A CZ  1 
ATOM   2301 N  N   . VAL A 1 304 ? 17.544  -7.219  9.691   1.00 30.29 ? 304 VAL A N   1 
ATOM   2302 C  CA  . VAL A 1 304 ? 18.456  -6.393  8.904   1.00 28.64 ? 304 VAL A CA  1 
ATOM   2303 C  C   . VAL A 1 304 ? 19.757  -7.128  8.633   1.00 33.14 ? 304 VAL A C   1 
ATOM   2304 O  O   . VAL A 1 304 ? 20.324  -7.752  9.531   1.00 31.13 ? 304 VAL A O   1 
ATOM   2305 C  CB  . VAL A 1 304 ? 18.807  -5.091  9.640   1.00 30.22 ? 304 VAL A CB  1 
ATOM   2306 C  CG1 . VAL A 1 304 ? 19.567  -4.145  8.709   1.00 28.66 ? 304 VAL A CG1 1 
ATOM   2307 C  CG2 . VAL A 1 304 ? 17.548  -4.441  10.180  1.00 30.78 ? 304 VAL A CG2 1 
ATOM   2308 N  N   . GLY A 1 305 ? 20.183  -7.099  7.376   1.00 31.12 ? 305 GLY A N   1 
ATOM   2309 C  CA  . GLY A 1 305 ? 21.450  -7.693  6.969   1.00 33.72 ? 305 GLY A CA  1 
ATOM   2310 C  C   . GLY A 1 305 ? 21.913  -7.146  5.641   1.00 32.40 ? 305 GLY A C   1 
ATOM   2311 O  O   . GLY A 1 305 ? 21.537  -6.030  5.251   1.00 32.63 ? 305 GLY A O   1 
ATOM   2312 N  N   . ARG A 1 306 ? 22.727  -7.945  4.942   1.00 33.77 ? 306 ARG A N   1 
ATOM   2313 C  CA  . ARG A 1 306 ? 23.496  -7.473  3.786   1.00 33.82 ? 306 ARG A CA  1 
ATOM   2314 C  C   . ARG A 1 306 ? 24.156  -6.116  4.050   1.00 31.79 ? 306 ARG A C   1 
ATOM   2315 O  O   . ARG A 1 306 ? 24.307  -5.321  3.131   1.00 31.75 ? 306 ARG A O   1 
ATOM   2316 C  CB  . ARG A 1 306 ? 22.608  -7.367  2.532   1.00 33.23 ? 306 ARG A CB  1 
ATOM   2317 C  CG  . ARG A 1 306 ? 22.012  -8.669  2.007   1.00 35.08 ? 306 ARG A CG  1 
ATOM   2318 C  CD  . ARG A 1 306 ? 23.042  -9.694  1.537   1.00 35.16 ? 306 ARG A CD  1 
ATOM   2319 N  NE  . ARG A 1 306 ? 24.237  -9.085  0.953   1.00 34.01 ? 306 ARG A NE  1 
ATOM   2320 C  CZ  . ARG A 1 306 ? 24.354  -8.643  -0.303  1.00 34.12 ? 306 ARG A CZ  1 
ATOM   2321 N  NH1 . ARG A 1 306 ? 23.352  -8.736  -1.174  1.00 31.86 ? 306 ARG A NH1 1 
ATOM   2322 N  NH2 . ARG A 1 306 ? 25.509  -8.117  -0.703  1.00 32.50 ? 306 ARG A NH2 1 
ATOM   2323 N  N   . ILE A 1 307 ? 24.518  -5.829  5.300   1.00 32.44 ? 307 ILE A N   1 
ATOM   2324 C  CA  . ILE A 1 307 ? 25.014  -4.501  5.650   1.00 34.64 ? 307 ILE A CA  1 
ATOM   2325 C  C   . ILE A 1 307 ? 26.469  -4.388  5.147   1.00 37.36 ? 307 ILE A C   1 
ATOM   2326 O  O   . ILE A 1 307 ? 27.311  -5.243  5.483   1.00 36.18 ? 307 ILE A O   1 
ATOM   2327 C  CB  . ILE A 1 307 ? 24.944  -4.252  7.176   1.00 34.97 ? 307 ILE A CB  1 
ATOM   2328 C  CG1 . ILE A 1 307 ? 23.501  -4.299  7.671   1.00 35.01 ? 307 ILE A CG1 1 
ATOM   2329 C  CG2 . ILE A 1 307 ? 25.522  -2.885  7.543   1.00 36.21 ? 307 ILE A CG2 1 
ATOM   2330 C  CD1 . ILE A 1 307 ? 23.383  -4.377  9.181   1.00 36.75 ? 307 ILE A CD1 1 
ATOM   2331 N  N   . ARG A 1 308 ? 26.742  -3.359  4.339   1.00 35.88 ? 308 ARG A N   1 
ATOM   2332 C  CA  . ARG A 1 308 ? 28.056  -3.166  3.707   1.00 33.78 ? 308 ARG A CA  1 
ATOM   2333 C  C   . ARG A 1 308 ? 28.263  -1.700  3.267   1.00 35.38 ? 308 ARG A C   1 
ATOM   2334 O  O   . ARG A 1 308 ? 27.309  -0.958  3.013   1.00 31.05 ? 308 ARG A O   1 
ATOM   2335 C  CB  . ARG A 1 308 ? 28.208  -4.085  2.499   1.00 32.72 ? 308 ARG A CB  1 
ATOM   2336 C  CG  . ARG A 1 308 ? 27.105  -3.918  1.461   1.00 31.73 ? 308 ARG A CG  1 
ATOM   2337 C  CD  . ARG A 1 308 ? 26.967  -5.152  0.588   1.00 30.49 ? 308 ARG A CD  1 
ATOM   2338 N  NE  . ARG A 1 308 ? 26.234  -4.884  -0.632  1.00 33.64 ? 308 ARG A NE  1 
ATOM   2339 C  CZ  . ARG A 1 308 ? 24.922  -4.645  -0.709  1.00 30.92 ? 308 ARG A CZ  1 
ATOM   2340 N  NH1 . ARG A 1 308 ? 24.160  -4.631  0.370   1.00 32.29 ? 308 ARG A NH1 1 
ATOM   2341 N  NH2 . ARG A 1 308 ? 24.376  -4.393  -1.895  1.00 32.27 ? 308 ARG A NH2 1 
ATOM   2342 N  N   . LYS A 1 309 ? 29.528  -1.291  3.195   1.00 33.86 ? 309 LYS A N   1 
ATOM   2343 C  CA  . LYS A 1 309 ? 29.885  0.044   2.754   1.00 34.42 ? 309 LYS A CA  1 
ATOM   2344 C  C   . LYS A 1 309 ? 29.617  0.156   1.287   1.00 30.65 ? 309 LYS A C   1 
ATOM   2345 O  O   . LYS A 1 309 ? 29.748  -0.813  0.547   1.00 32.99 ? 309 LYS A O   1 
ATOM   2346 C  CB  . LYS A 1 309 ? 31.385  0.306   2.965   1.00 39.44 ? 309 LYS A CB  1 
ATOM   2347 C  CG  . LYS A 1 309 ? 31.842  0.282   4.414   1.00 45.72 ? 309 LYS A CG  1 
ATOM   2348 C  CD  . LYS A 1 309 ? 33.351  0.553   4.516   1.00 50.40 ? 309 LYS A CD  1 
ATOM   2349 C  CE  . LYS A 1 309 ? 33.663  1.929   5.093   1.00 54.98 ? 309 LYS A CE  1 
ATOM   2350 N  NZ  . LYS A 1 309 ? 33.418  2.048   6.566   1.00 55.29 ? 309 LYS A NZ  1 
ATOM   2351 N  N   . ASP A 1 310 ? 29.273  1.354   0.853   1.00 34.35 ? 310 ASP A N   1 
ATOM   2352 C  CA  . ASP A 1 310 ? 29.243  1.660   -0.580  1.00 36.34 ? 310 ASP A CA  1 
ATOM   2353 C  C   . ASP A 1 310 ? 30.674  1.526   -1.104  1.00 37.79 ? 310 ASP A C   1 
ATOM   2354 O  O   . ASP A 1 310 ? 31.621  1.739   -0.347  1.00 34.96 ? 310 ASP A O   1 
ATOM   2355 C  CB  . ASP A 1 310 ? 28.739  3.080   -0.777  1.00 36.21 ? 310 ASP A CB  1 
ATOM   2356 C  CG  . ASP A 1 310 ? 28.558  3.436   -2.231  1.00 38.62 ? 310 ASP A CG  1 
ATOM   2357 O  OD1 . ASP A 1 310 ? 27.469  3.148   -2.776  1.00 35.67 ? 310 ASP A OD1 1 
ATOM   2358 O  OD2 . ASP A 1 310 ? 29.509  4.010   -2.820  1.00 35.88 ? 310 ASP A OD2 1 
ATOM   2359 N  N   . LEU A 1 311 ? 30.833  1.142   -2.372  1.00 38.56 ? 311 LEU A N   1 
ATOM   2360 C  CA  . LEU A 1 311 ? 32.165  0.948   -2.945  1.00 39.22 ? 311 LEU A CA  1 
ATOM   2361 C  C   . LEU A 1 311 ? 32.938  2.248   -3.154  1.00 38.53 ? 311 LEU A C   1 
ATOM   2362 O  O   . LEU A 1 311 ? 34.152  2.201   -3.285  1.00 41.35 ? 311 LEU A O   1 
ATOM   2363 C  CB  . LEU A 1 311 ? 32.086  0.181   -4.268  1.00 38.81 ? 311 LEU A CB  1 
ATOM   2364 C  CG  . LEU A 1 311 ? 31.501  -1.225  -4.132  1.00 38.17 ? 311 LEU A CG  1 
ATOM   2365 C  CD1 . LEU A 1 311 ? 31.360  -1.881  -5.489  1.00 37.84 ? 311 LEU A CD1 1 
ATOM   2366 C  CD2 . LEU A 1 311 ? 32.353  -2.065  -3.189  1.00 40.31 ? 311 LEU A CD2 1 
ATOM   2367 N  N   . ASP A 1 312 ? 32.251  3.391   -3.162  1.00 37.92 ? 312 ASP A N   1 
ATOM   2368 C  CA  . ASP A 1 312 ? 32.885  4.691   -3.457  1.00 38.76 ? 312 ASP A CA  1 
ATOM   2369 C  C   . ASP A 1 312 ? 32.564  5.797   -2.466  1.00 38.33 ? 312 ASP A C   1 
ATOM   2370 O  O   . ASP A 1 312 ? 33.467  6.486   -2.024  1.00 40.24 ? 312 ASP A O   1 
ATOM   2371 C  CB  . ASP A 1 312 ? 32.497  5.140   -4.857  1.00 39.14 ? 312 ASP A CB  1 
ATOM   2372 C  CG  . ASP A 1 312 ? 32.897  4.142   -5.893  1.00 39.99 ? 312 ASP A CG  1 
ATOM   2373 O  OD1 . ASP A 1 312 ? 34.059  4.201   -6.340  1.00 42.50 ? 312 ASP A OD1 1 
ATOM   2374 O  OD2 . ASP A 1 312 ? 32.068  3.285   -6.259  1.00 36.30 ? 312 ASP A OD2 1 
ATOM   2375 N  N   . ALA A 1 313 ? 31.290  5.981   -2.124  1.00 39.07 ? 313 ALA A N   1 
ATOM   2376 C  CA  . ALA A 1 313 ? 30.888  7.021   -1.185  1.00 37.69 ? 313 ALA A CA  1 
ATOM   2377 C  C   . ALA A 1 313 ? 31.349  6.664   0.217   1.00 39.65 ? 313 ALA A C   1 
ATOM   2378 O  O   . ALA A 1 313 ? 30.910  5.668   0.786   1.00 35.83 ? 313 ALA A O   1 
ATOM   2379 C  CB  . ALA A 1 313 ? 29.368  7.216   -1.204  1.00 38.14 ? 313 ALA A CB  1 
ATOM   2380 N  N   . GLU A 1 314 ? 32.230  7.489   0.779   1.00 41.12 ? 314 GLU A N   1 
ATOM   2381 C  CA  . GLU A 1 314 ? 32.823  7.222   2.098   1.00 44.21 ? 314 GLU A CA  1 
ATOM   2382 C  C   . GLU A 1 314 ? 31.794  6.981   3.205   1.00 40.08 ? 314 GLU A C   1 
ATOM   2383 O  O   . GLU A 1 314 ? 31.974  6.105   4.045   1.00 37.27 ? 314 GLU A O   1 
ATOM   2384 C  CB  . GLU A 1 314 ? 33.724  8.395   2.513   1.00 51.05 ? 314 GLU A CB  1 
ATOM   2385 C  CG  . GLU A 1 314 ? 34.529  8.150   3.783   1.00 57.44 ? 314 GLU A CG  1 
ATOM   2386 C  CD  . GLU A 1 314 ? 35.574  9.231   4.017   1.00 66.50 ? 314 GLU A CD  1 
ATOM   2387 O  OE1 . GLU A 1 314 ? 35.219  10.436  3.940   1.00 67.93 ? 314 GLU A OE1 1 
ATOM   2388 O  OE2 . GLU A 1 314 ? 36.745  8.873   4.283   1.00 68.92 ? 314 GLU A OE2 1 
ATOM   2389 N  N   . LYS A 1 315 ? 30.734  7.780   3.200   1.00 37.45 ? 315 LYS A N   1 
ATOM   2390 C  CA  . LYS A 1 315 ? 29.708  7.730   4.229   1.00 38.75 ? 315 LYS A CA  1 
ATOM   2391 C  C   . LYS A 1 315 ? 28.487  6.903   3.803   1.00 35.73 ? 315 LYS A C   1 
ATOM   2392 O  O   . LYS A 1 315 ? 27.480  6.914   4.492   1.00 33.30 ? 315 LYS A O   1 
ATOM   2393 C  CB  . LYS A 1 315 ? 29.276  9.155   4.591   1.00 38.47 ? 315 LYS A CB  1 
ATOM   2394 C  CG  . LYS A 1 315 ? 30.345  9.918   5.359   1.00 42.53 ? 315 LYS A CG  1 
ATOM   2395 C  CD  . LYS A 1 315 ? 30.003  11.385  5.513   1.00 44.55 ? 315 LYS A CD  1 
ATOM   2396 C  CE  . LYS A 1 315 ? 31.230  12.183  5.938   1.00 48.56 ? 315 LYS A CE  1 
ATOM   2397 N  NZ  . LYS A 1 315 ? 30.821  13.533  6.422   1.00 50.92 ? 315 LYS A NZ  1 
ATOM   2398 N  N   . GLY A 1 316 ? 28.605  6.163   2.700   1.00 33.96 ? 316 GLY A N   1 
ATOM   2399 C  CA  . GLY A 1 316 ? 27.495  5.385   2.151   1.00 34.45 ? 316 GLY A CA  1 
ATOM   2400 C  C   . GLY A 1 316 ? 27.433  3.965   2.668   1.00 33.96 ? 316 GLY A C   1 
ATOM   2401 O  O   . GLY A 1 316 ? 28.467  3.306   2.841   1.00 33.31 ? 316 GLY A O   1 
ATOM   2402 N  N   . ILE A 1 317 ? 26.210  3.480   2.893   1.00 30.00 ? 317 ILE A N   1 
ATOM   2403 C  CA  . ILE A 1 317 ? 25.991  2.155   3.446   1.00 31.17 ? 317 ILE A CA  1 
ATOM   2404 C  C   . ILE A 1 317 ? 24.740  1.542   2.777   1.00 30.35 ? 317 ILE A C   1 
ATOM   2405 O  O   . ILE A 1 317 ? 23.753  2.240   2.575   1.00 31.91 ? 317 ILE A O   1 
ATOM   2406 C  CB  . ILE A 1 317 ? 25.800  2.226   4.977   1.00 32.04 ? 317 ILE A CB  1 
ATOM   2407 C  CG1 . ILE A 1 317 ? 27.097  2.696   5.669   1.00 34.90 ? 317 ILE A CG1 1 
ATOM   2408 C  CG2 . ILE A 1 317 ? 25.374  0.861   5.502   1.00 32.50 ? 317 ILE A CG2 1 
ATOM   2409 C  CD1 . ILE A 1 317 ? 26.972  3.026   7.145   1.00 36.80 ? 317 ILE A CD1 1 
ATOM   2410 N  N   . HIS A 1 318 ? 24.824  0.271   2.392   1.00 29.74 ? 318 HIS A N   1 
ATOM   2411 C  CA  . HIS A 1 318 ? 23.688  -0.481  1.843   1.00 29.56 ? 318 HIS A CA  1 
ATOM   2412 C  C   . HIS A 1 318 ? 23.259  -1.549  2.824   1.00 29.54 ? 318 HIS A C   1 
ATOM   2413 O  O   . HIS A 1 318 ? 24.090  -2.060  3.565   1.00 28.30 ? 318 HIS A O   1 
ATOM   2414 C  CB  . HIS A 1 318 ? 24.076  -1.168  0.544   1.00 30.05 ? 318 HIS A CB  1 
ATOM   2415 C  CG  . HIS A 1 318 ? 24.547  -0.225  -0.518  1.00 33.31 ? 318 HIS A CG  1 
ATOM   2416 N  ND1 . HIS A 1 318 ? 23.753  0.160   -1.577  1.00 34.17 ? 318 HIS A ND1 1 
ATOM   2417 C  CD2 . HIS A 1 318 ? 25.716  0.446   -0.657  1.00 32.91 ? 318 HIS A CD2 1 
ATOM   2418 C  CE1 . HIS A 1 318 ? 24.425  1.001   -2.341  1.00 34.99 ? 318 HIS A CE1 1 
ATOM   2419 N  NE2 . HIS A 1 318 ? 25.621  1.192   -1.806  1.00 34.32 ? 318 HIS A NE2 1 
ATOM   2420 N  N   . MET A 1 319 ? 21.970  -1.900  2.823   1.00 24.74 ? 319 MET A N   1 
ATOM   2421 C  CA  . MET A 1 319 ? 21.483  -2.944  3.695   1.00 26.57 ? 319 MET A CA  1 
ATOM   2422 C  C   . MET A 1 319 ? 20.140  -3.439  3.158   1.00 28.00 ? 319 MET A C   1 
ATOM   2423 O  O   . MET A 1 319 ? 19.571  -2.829  2.256   1.00 28.22 ? 319 MET A O   1 
ATOM   2424 C  CB  . MET A 1 319 ? 21.320  -2.445  5.130   1.00 26.41 ? 319 MET A CB  1 
ATOM   2425 C  CG  . MET A 1 319 ? 20.376  -1.283  5.293   1.00 28.29 ? 319 MET A CG  1 
ATOM   2426 S  SD  . MET A 1 319 ? 20.126  -0.704  6.972   1.00 33.51 ? 319 MET A SD  1 
ATOM   2427 C  CE  . MET A 1 319 ? 21.637  0.231   7.275   1.00 34.96 ? 319 MET A CE  1 
ATOM   2428 N  N   . TRP A 1 320 ? 19.683  -4.529  3.753   1.00 28.87 ? 320 TRP A N   1 
ATOM   2429 C  CA  . TRP A 1 320 ? 18.474  -5.229  3.390   1.00 28.84 ? 320 TRP A CA  1 
ATOM   2430 C  C   . TRP A 1 320 ? 17.640  -5.371  4.651   1.00 30.66 ? 320 TRP A C   1 
ATOM   2431 O  O   . TRP A 1 320 ? 18.126  -5.853  5.687   1.00 26.92 ? 320 TRP A O   1 
ATOM   2432 C  CB  . TRP A 1 320 ? 18.877  -6.593  2.821   1.00 27.93 ? 320 TRP A CB  1 
ATOM   2433 C  CG  . TRP A 1 320 ? 17.788  -7.471  2.303   1.00 29.20 ? 320 TRP A CG  1 
ATOM   2434 C  CD1 . TRP A 1 320 ? 17.348  -8.653  2.849   1.00 28.26 ? 320 TRP A CD1 1 
ATOM   2435 C  CD2 . TRP A 1 320 ? 17.034  -7.273  1.109   1.00 29.10 ? 320 TRP A CD2 1 
ATOM   2436 N  NE1 . TRP A 1 320 ? 16.350  -9.189  2.065   1.00 31.00 ? 320 TRP A NE1 1 
ATOM   2437 C  CE2 . TRP A 1 320 ? 16.143  -8.365  0.988   1.00 29.77 ? 320 TRP A CE2 1 
ATOM   2438 C  CE3 . TRP A 1 320 ? 17.020  -6.274  0.125   1.00 29.11 ? 320 TRP A CE3 1 
ATOM   2439 C  CZ2 . TRP A 1 320 ? 15.256  -8.486  -0.067  1.00 30.52 ? 320 TRP A CZ2 1 
ATOM   2440 C  CZ3 . TRP A 1 320 ? 16.104  -6.385  -0.915  1.00 29.29 ? 320 TRP A CZ3 1 
ATOM   2441 C  CH2 . TRP A 1 320 ? 15.251  -7.482  -1.009  1.00 30.41 ? 320 TRP A CH2 1 
ATOM   2442 N  N   . VAL A 1 321 ? 16.373  -4.942  4.565   1.00 29.78 ? 321 VAL A N   1 
ATOM   2443 C  CA  . VAL A 1 321 ? 15.532  -4.812  5.713   1.00 28.86 ? 321 VAL A CA  1 
ATOM   2444 C  C   . VAL A 1 321 ? 14.216  -5.523  5.410   1.00 29.81 ? 321 VAL A C   1 
ATOM   2445 O  O   . VAL A 1 321 ? 13.597  -5.244  4.397   1.00 26.49 ? 321 VAL A O   1 
ATOM   2446 C  CB  . VAL A 1 321 ? 15.238  -3.328  6.041   1.00 29.19 ? 321 VAL A CB  1 
ATOM   2447 C  CG1 . VAL A 1 321 ? 14.389  -3.215  7.300   1.00 30.89 ? 321 VAL A CG1 1 
ATOM   2448 C  CG2 . VAL A 1 321 ? 16.527  -2.527  6.222   1.00 31.64 ? 321 VAL A CG2 1 
ATOM   2449 N  N   . VAL A 1 322 ? 13.824  -6.443  6.283   1.00 26.74 ? 322 VAL A N   1 
ATOM   2450 C  CA  . VAL A 1 322 ? 12.602  -7.227  6.108   1.00 29.74 ? 322 VAL A CA  1 
ATOM   2451 C  C   . VAL A 1 322 ? 11.726  -7.239  7.363   1.00 28.45 ? 322 VAL A C   1 
ATOM   2452 O  O   . VAL A 1 322 ? 12.218  -7.406  8.476   1.00 28.73 ? 322 VAL A O   1 
ATOM   2453 C  CB  . VAL A 1 322 ? 12.950  -8.683  5.710   1.00 29.95 ? 322 VAL A CB  1 
ATOM   2454 C  CG1 . VAL A 1 322 ? 11.688  -9.518  5.599   1.00 32.54 ? 322 VAL A CG1 1 
ATOM   2455 C  CG2 . VAL A 1 322 ? 13.703  -8.698  4.391   1.00 29.65 ? 322 VAL A CG2 1 
ATOM   2456 N  N   . SER A 1 323 ? 10.405  -7.079  7.189   1.00 26.96 ? 323 SER A N   1 
ATOM   2457 C  CA  . SER A 1 323 ? 9.497   -7.230  8.280   1.00 27.20 ? 323 SER A CA  1 
ATOM   2458 C  C   . SER A 1 323 ? 8.132   -7.608  7.755   1.00 26.11 ? 323 SER A C   1 
ATOM   2459 O  O   . SER A 1 323 ? 7.788   -7.236  6.658   1.00 26.71 ? 323 SER A O   1 
ATOM   2460 C  CB  . SER A 1 323 ? 9.352   -5.934  9.081   1.00 27.46 ? 323 SER A CB  1 
ATOM   2461 O  OG  . SER A 1 323 ? 8.849   -6.270  10.352  1.00 29.36 ? 323 SER A OG  1 
ATOM   2462 N  N   . ASP A 1 324 ? 7.389   -8.337  8.560   1.00 26.01 ? 324 ASP A N   1 
ATOM   2463 C  CA  . ASP A 1 324 ? 5.968   -8.692  8.261   1.00 26.65 ? 324 ASP A CA  1 
ATOM   2464 C  C   . ASP A 1 324 ? 5.140   -7.409  8.214   1.00 27.65 ? 324 ASP A C   1 
ATOM   2465 O  O   . ASP A 1 324 ? 4.947   -6.723  9.213   1.00 26.63 ? 324 ASP A O   1 
ATOM   2466 C  CB  . ASP A 1 324 ? 5.469   -9.662  9.336   1.00 26.67 ? 324 ASP A CB  1 
ATOM   2467 C  CG  . ASP A 1 324 ? 4.083   -10.236 9.051   1.00 29.08 ? 324 ASP A CG  1 
ATOM   2468 O  OD1 . ASP A 1 324 ? 3.235   -9.543  8.482   1.00 29.71 ? 324 ASP A OD1 1 
ATOM   2469 O  OD2 . ASP A 1 324 ? 3.838   -11.386 9.456   1.00 29.47 ? 324 ASP A OD2 1 
ATOM   2470 N  N   . ASN A 1 325 ? 4.665   -7.069  7.031   1.00 30.87 ? 325 ASN A N   1 
ATOM   2471 C  CA  . ASN A 1 325 ? 3.967   -5.815  6.835   1.00 32.55 ? 325 ASN A CA  1 
ATOM   2472 C  C   . ASN A 1 325 ? 2.628   -5.695  7.560   1.00 32.94 ? 325 ASN A C   1 
ATOM   2473 O  O   . ASN A 1 325 ? 2.112   -4.597  7.671   1.00 32.00 ? 325 ASN A O   1 
ATOM   2474 C  CB  . ASN A 1 325 ? 3.749   -5.583  5.338   1.00 32.18 ? 325 ASN A CB  1 
ATOM   2475 C  CG  . ASN A 1 325 ? 2.951   -6.686  4.708   1.00 30.95 ? 325 ASN A CG  1 
ATOM   2476 O  OD1 . ASN A 1 325 ? 3.404   -7.829  4.654   1.00 33.03 ? 325 ASN A OD1 1 
ATOM   2477 N  ND2 . ASN A 1 325 ? 1.733   -6.369  4.266   1.00 31.00 ? 325 ASN A ND2 1 
ATOM   2478 N  N   . LEU A 1 326 ? 2.059   -6.810  8.031   1.00 34.16 ? 326 LEU A N   1 
ATOM   2479 C  CA  . LEU A 1 326 ? 0.801   -6.760  8.791   1.00 33.21 ? 326 LEU A CA  1 
ATOM   2480 C  C   . LEU A 1 326 ? 1.052   -6.752  10.282  1.00 31.04 ? 326 LEU A C   1 
ATOM   2481 O  O   . LEU A 1 326 ? 0.170   -6.426  11.027  1.00 29.94 ? 326 LEU A O   1 
ATOM   2482 C  CB  . LEU A 1 326 ? -0.106  -7.942  8.449   1.00 33.29 ? 326 LEU A CB  1 
ATOM   2483 C  CG  . LEU A 1 326 ? -0.456  -8.138  6.982   1.00 33.97 ? 326 LEU A CG  1 
ATOM   2484 C  CD1 . LEU A 1 326 ? -1.400  -9.315  6.855   1.00 35.64 ? 326 LEU A CD1 1 
ATOM   2485 C  CD2 . LEU A 1 326 ? -1.068  -6.892  6.381   1.00 34.70 ? 326 LEU A CD2 1 
ATOM   2486 N  N   . LEU A 1 327 ? 2.263   -7.113  10.718  1.00 29.01 ? 327 LEU A N   1 
ATOM   2487 C  CA  . LEU A 1 327 ? 2.582   -7.086  12.120  1.00 28.99 ? 327 LEU A CA  1 
ATOM   2488 C  C   . LEU A 1 327 ? 3.281   -5.774  12.451  1.00 28.55 ? 327 LEU A C   1 
ATOM   2489 O  O   . LEU A 1 327 ? 2.601   -4.786  12.688  1.00 27.46 ? 327 LEU A O   1 
ATOM   2490 C  CB  . LEU A 1 327 ? 3.355   -8.346  12.551  1.00 29.81 ? 327 LEU A CB  1 
ATOM   2491 C  CG  . LEU A 1 327 ? 2.615   -9.679  12.341  1.00 31.57 ? 327 LEU A CG  1 
ATOM   2492 C  CD1 . LEU A 1 327 ? 3.395   -10.837 12.934  1.00 32.56 ? 327 LEU A CD1 1 
ATOM   2493 C  CD2 . LEU A 1 327 ? 1.194   -9.674  12.908  1.00 32.34 ? 327 LEU A CD2 1 
ATOM   2494 N  N   . LYS A 1 328 ? 4.616   -5.715  12.465  1.00 26.89 ? 328 LYS A N   1 
ATOM   2495 C  CA  . LYS A 1 328 ? 5.251   -4.447  12.757  1.00 27.59 ? 328 LYS A CA  1 
ATOM   2496 C  C   . LYS A 1 328 ? 4.829   -3.354  11.769  1.00 28.24 ? 328 LYS A C   1 
ATOM   2497 O  O   . LYS A 1 328 ? 4.743   -2.186  12.136  1.00 26.91 ? 328 LYS A O   1 
ATOM   2498 C  CB  . LYS A 1 328 ? 6.784   -4.577  12.794  1.00 29.29 ? 328 LYS A CB  1 
ATOM   2499 C  CG  . LYS A 1 328 ? 7.509   -3.294  13.178  1.00 28.59 ? 328 LYS A CG  1 
ATOM   2500 C  CD  . LYS A 1 328 ? 7.124   -2.823  14.570  1.00 29.90 ? 328 LYS A CD  1 
ATOM   2501 C  CE  . LYS A 1 328 ? 7.984   -1.663  15.025  1.00 30.74 ? 328 LYS A CE  1 
ATOM   2502 N  NZ  . LYS A 1 328 ? 7.433   -1.057  16.270  1.00 31.24 ? 328 LYS A NZ  1 
ATOM   2503 N  N   . GLY A 1 329 ? 4.550   -3.739  10.529  1.00 27.85 ? 329 GLY A N   1 
ATOM   2504 C  CA  . GLY A 1 329 ? 4.119   -2.790  9.523   1.00 29.72 ? 329 GLY A CA  1 
ATOM   2505 C  C   . GLY A 1 329 ? 2.700   -2.261  9.746   1.00 30.33 ? 329 GLY A C   1 
ATOM   2506 O  O   . GLY A 1 329 ? 2.325   -1.278  9.134   1.00 31.73 ? 329 GLY A O   1 
ATOM   2507 N  N   . ALA A 1 330 ? 1.928   -2.881  10.640  1.00 28.00 ? 330 ALA A N   1 
ATOM   2508 C  CA  . ALA A 1 330 ? 0.536   -2.422  10.880  1.00 29.22 ? 330 ALA A CA  1 
ATOM   2509 C  C   . ALA A 1 330 ? -0.014  -2.801  12.259  1.00 28.85 ? 330 ALA A C   1 
ATOM   2510 O  O   . ALA A 1 330 ? 0.007   -1.974  13.176  1.00 29.98 ? 330 ALA A O   1 
ATOM   2511 C  CB  . ALA A 1 330 ? -0.383  -2.906  9.765   1.00 28.42 ? 330 ALA A CB  1 
ATOM   2512 N  N   . ALA A 1 331 ? -0.496  -4.037  12.401  1.00 28.98 ? 331 ALA A N   1 
ATOM   2513 C  CA  . ALA A 1 331 ? -1.240  -4.470  13.601  1.00 29.89 ? 331 ALA A CA  1 
ATOM   2514 C  C   . ALA A 1 331 ? -0.391  -4.447  14.866  1.00 30.66 ? 331 ALA A C   1 
ATOM   2515 O  O   . ALA A 1 331 ? -0.814  -3.908  15.904  1.00 31.37 ? 331 ALA A O   1 
ATOM   2516 C  CB  . ALA A 1 331 ? -1.804  -5.856  13.391  1.00 30.44 ? 331 ALA A CB  1 
ATOM   2517 N  N   . TRP A 1 332 ? 0.814   -5.005  14.781  1.00 28.72 ? 332 TRP A N   1 
ATOM   2518 C  CA  . TRP A 1 332 ? 1.722   -4.978  15.928  1.00 29.00 ? 332 TRP A CA  1 
ATOM   2519 C  C   . TRP A 1 332 ? 2.179   -3.572  16.282  1.00 27.32 ? 332 TRP A C   1 
ATOM   2520 O  O   . TRP A 1 332 ? 2.120   -3.201  17.447  1.00 29.97 ? 332 TRP A O   1 
ATOM   2521 C  CB  . TRP A 1 332 ? 2.891   -5.948  15.795  1.00 28.92 ? 332 TRP A CB  1 
ATOM   2522 C  CG  . TRP A 1 332 ? 3.984   -5.669  16.784  1.00 31.28 ? 332 TRP A CG  1 
ATOM   2523 C  CD1 . TRP A 1 332 ? 5.261   -5.323  16.495  1.00 31.61 ? 332 TRP A CD1 1 
ATOM   2524 C  CD2 . TRP A 1 332 ? 3.881   -5.658  18.224  1.00 32.26 ? 332 TRP A CD2 1 
ATOM   2525 N  NE1 . TRP A 1 332 ? 5.969   -5.103  17.649  1.00 32.98 ? 332 TRP A NE1 1 
ATOM   2526 C  CE2 . TRP A 1 332 ? 5.150   -5.303  18.727  1.00 32.42 ? 332 TRP A CE2 1 
ATOM   2527 C  CE3 . TRP A 1 332 ? 2.851   -5.931  19.127  1.00 33.10 ? 332 TRP A CE3 1 
ATOM   2528 C  CZ2 . TRP A 1 332 ? 5.418   -5.206  20.102  1.00 34.56 ? 332 TRP A CZ2 1 
ATOM   2529 C  CZ3 . TRP A 1 332 ? 3.118   -5.838  20.505  1.00 33.81 ? 332 TRP A CZ3 1 
ATOM   2530 C  CH2 . TRP A 1 332 ? 4.394   -5.471  20.973  1.00 34.11 ? 332 TRP A CH2 1 
ATOM   2531 N  N   . ASN A 1 333 ? 2.579   -2.742  15.315  1.00 28.62 ? 333 ASN A N   1 
ATOM   2532 C  CA  . ASN A 1 333 ? 2.894   -1.365  15.673  1.00 27.84 ? 333 ASN A CA  1 
ATOM   2533 C  C   . ASN A 1 333 ? 1.739   -0.683  16.385  1.00 27.46 ? 333 ASN A C   1 
ATOM   2534 O  O   . ASN A 1 333 ? 1.955   0.032   17.356  1.00 27.09 ? 333 ASN A O   1 
ATOM   2535 C  CB  . ASN A 1 333 ? 3.323   -0.529  14.466  1.00 28.59 ? 333 ASN A CB  1 
ATOM   2536 C  CG  . ASN A 1 333 ? 4.117   0.715   14.865  1.00 30.33 ? 333 ASN A CG  1 
ATOM   2537 O  OD1 . ASN A 1 333 ? 5.274   0.627   15.352  1.00 30.62 ? 333 ASN A OD1 1 
ATOM   2538 N  ND2 . ASN A 1 333 ? 3.526   1.876   14.640  1.00 30.49 ? 333 ASN A ND2 1 
ATOM   2539 N  N   . SER A 1 334 ? 0.511   -0.872  15.882  1.00 27.87 ? 334 SER A N   1 
ATOM   2540 C  CA  . SER A 1 334 ? -0.668  -0.255  16.485  1.00 30.44 ? 334 SER A CA  1 
ATOM   2541 C  C   . SER A 1 334 ? -0.907  -0.746  17.916  1.00 30.50 ? 334 SER A C   1 
ATOM   2542 O  O   . SER A 1 334 ? -1.123  0.043   18.847  1.00 31.24 ? 334 SER A O   1 
ATOM   2543 C  CB  . SER A 1 334 ? -1.916  -0.521  15.622  1.00 30.82 ? 334 SER A CB  1 
ATOM   2544 O  OG  . SER A 1 334 ? -1.841  0.164   14.363  1.00 31.23 ? 334 SER A OG  1 
ATOM   2545 N  N   . VAL A 1 335 ? -0.869  -2.049  18.101  1.00 28.15 ? 335 VAL A N   1 
ATOM   2546 C  CA  . VAL A 1 335 ? -1.067  -2.585  19.432  1.00 30.40 ? 335 VAL A CA  1 
ATOM   2547 C  C   . VAL A 1 335 ? 0.077   -2.163  20.366  1.00 31.29 ? 335 VAL A C   1 
ATOM   2548 O  O   . VAL A 1 335 ? -0.158  -1.821  21.545  1.00 31.63 ? 335 VAL A O   1 
ATOM   2549 C  CB  . VAL A 1 335 ? -1.275  -4.105  19.391  1.00 29.33 ? 335 VAL A CB  1 
ATOM   2550 C  CG1 . VAL A 1 335 ? -1.221  -4.710  20.784  1.00 30.62 ? 335 VAL A CG1 1 
ATOM   2551 C  CG2 . VAL A 1 335 ? -2.624  -4.412  18.721  1.00 30.73 ? 335 VAL A CG2 1 
ATOM   2552 N  N   . GLN A 1 336 ? 1.295   -2.137  19.840  1.00 31.06 ? 336 GLN A N   1 
ATOM   2553 C  CA  . GLN A 1 336 ? 2.431   -1.662  20.639  1.00 31.20 ? 336 GLN A CA  1 
ATOM   2554 C  C   . GLN A 1 336 ? 2.218   -0.195  21.065  1.00 31.80 ? 336 GLN A C   1 
ATOM   2555 O  O   . GLN A 1 336 ? 2.531   0.182   22.197  1.00 31.63 ? 336 GLN A O   1 
ATOM   2556 C  CB  . GLN A 1 336 ? 3.729   -1.853  19.879  1.00 31.25 ? 336 GLN A CB  1 
ATOM   2557 C  CG  . GLN A 1 336 ? 4.991   -1.637  20.695  1.00 31.29 ? 336 GLN A CG  1 
ATOM   2558 C  CD  . GLN A 1 336 ? 6.247   -1.746  19.862  1.00 34.13 ? 336 GLN A CD  1 
ATOM   2559 O  OE1 . GLN A 1 336 ? 6.207   -1.660  18.630  1.00 36.94 ? 336 GLN A OE1 1 
ATOM   2560 N  NE2 . GLN A 1 336 ? 7.391   -1.964  20.530  1.00 34.22 ? 336 GLN A NE2 1 
ATOM   2561 N  N   . ILE A 1 337 ? 1.651   0.628   20.182  1.00 31.41 ? 337 ILE A N   1 
ATOM   2562 C  CA  . ILE A 1 337 ? 1.292   2.004   20.563  1.00 31.91 ? 337 ILE A CA  1 
ATOM   2563 C  C   . ILE A 1 337 ? 0.279   2.000   21.723  1.00 33.13 ? 337 ILE A C   1 
ATOM   2564 O  O   . ILE A 1 337 ? 0.451   2.701   22.727  1.00 30.52 ? 337 ILE A O   1 
ATOM   2565 C  CB  . ILE A 1 337 ? 0.743   2.803   19.360  1.00 31.69 ? 337 ILE A CB  1 
ATOM   2566 C  CG1 . ILE A 1 337 ? 1.875   3.097   18.366  1.00 34.05 ? 337 ILE A CG1 1 
ATOM   2567 C  CG2 . ILE A 1 337 ? 0.095   4.104   19.831  1.00 32.59 ? 337 ILE A CG2 1 
ATOM   2568 C  CD1 . ILE A 1 337 ? 1.413   3.561   16.994  1.00 31.45 ? 337 ILE A CD1 1 
ATOM   2569 N  N   . ALA A 1 338 ? -0.769  1.190   21.598  1.00 35.22 ? 338 ALA A N   1 
ATOM   2570 C  CA  . ALA A 1 338 ? -1.770  1.078   22.662  1.00 34.95 ? 338 ALA A CA  1 
ATOM   2571 C  C   . ALA A 1 338 ? -1.147  0.646   23.993  1.00 34.20 ? 338 ALA A C   1 
ATOM   2572 O  O   . ALA A 1 338 ? -1.439  1.238   25.034  1.00 32.76 ? 338 ALA A O   1 
ATOM   2573 C  CB  . ALA A 1 338 ? -2.882  0.125   22.269  1.00 35.38 ? 338 ALA A CB  1 
ATOM   2574 N  N   . GLU A 1 339 ? -0.283  -0.365  23.961  1.00 32.46 ? 339 GLU A N   1 
ATOM   2575 C  CA  . GLU A 1 339 ? 0.407   -0.787  25.181  1.00 33.79 ? 339 GLU A CA  1 
ATOM   2576 C  C   . GLU A 1 339 ? 1.206   0.356   25.755  1.00 33.36 ? 339 GLU A C   1 
ATOM   2577 O  O   . GLU A 1 339 ? 1.200   0.574   26.969  1.00 35.28 ? 339 GLU A O   1 
ATOM   2578 C  CB  . GLU A 1 339 ? 1.286   -2.008  24.935  1.00 33.25 ? 339 GLU A CB  1 
ATOM   2579 C  CG  . GLU A 1 339 ? 0.445   -3.237  24.651  1.00 34.80 ? 339 GLU A CG  1 
ATOM   2580 C  CD  . GLU A 1 339 ? 1.249   -4.450  24.250  1.00 35.13 ? 339 GLU A CD  1 
ATOM   2581 O  OE1 . GLU A 1 339 ? 2.453   -4.312  23.981  1.00 35.72 ? 339 GLU A OE1 1 
ATOM   2582 O  OE2 . GLU A 1 339 ? 0.664   -5.545  24.239  1.00 36.43 ? 339 GLU A OE2 1 
ATOM   2583 N  N   . THR A 1 340 ? 1.869   1.102   24.884  1.00 33.34 ? 340 THR A N   1 
ATOM   2584 C  CA  . THR A 1 340 ? 2.708   2.206   25.327  1.00 34.39 ? 340 THR A CA  1 
ATOM   2585 C  C   . THR A 1 340 ? 1.844   3.340   25.923  1.00 33.43 ? 340 THR A C   1 
ATOM   2586 O  O   . THR A 1 340 ? 2.206   3.917   26.933  1.00 32.42 ? 340 THR A O   1 
ATOM   2587 C  CB  . THR A 1 340 ? 3.628   2.711   24.193  1.00 33.70 ? 340 THR A CB  1 
ATOM   2588 O  OG1 . THR A 1 340 ? 4.328   1.601   23.587  1.00 34.03 ? 340 THR A OG1 1 
ATOM   2589 C  CG2 . THR A 1 340 ? 4.633   3.682   24.719  1.00 34.53 ? 340 THR A CG2 1 
ATOM   2590 N  N   . LEU A 1 341 ? 0.683   3.625   25.323  1.00 32.32 ? 341 LEU A N   1 
ATOM   2591 C  CA  . LEU A 1 341 ? -0.265  4.582   25.906  1.00 32.33 ? 341 LEU A CA  1 
ATOM   2592 C  C   . LEU A 1 341 ? -0.711  4.156   27.314  1.00 30.68 ? 341 LEU A C   1 
ATOM   2593 O  O   . LEU A 1 341 ? -0.757  4.971   28.246  1.00 30.26 ? 341 LEU A O   1 
ATOM   2594 C  CB  . LEU A 1 341 ? -1.502  4.731   24.990  1.00 32.95 ? 341 LEU A CB  1 
ATOM   2595 C  CG  . LEU A 1 341 ? -1.205  5.375   23.641  1.00 33.78 ? 341 LEU A CG  1 
ATOM   2596 C  CD1 . LEU A 1 341 ? -2.355  5.150   22.673  1.00 35.65 ? 341 LEU A CD1 1 
ATOM   2597 C  CD2 . LEU A 1 341 ? -0.930  6.863   23.827  1.00 36.04 ? 341 LEU A CD2 1 
ATOM   2598 N  N   . HIS A 1 342 ? -1.052  2.880   27.459  1.00 29.88 ? 342 HIS A N   1 
ATOM   2599 C  CA  . HIS A 1 342 ? -1.474  2.351   28.745  1.00 32.74 ? 342 HIS A CA  1 
ATOM   2600 C  C   . HIS A 1 342 ? -0.357  2.514   29.780  1.00 34.65 ? 342 HIS A C   1 
ATOM   2601 O  O   . HIS A 1 342 ? -0.573  3.073   30.877  1.00 34.88 ? 342 HIS A O   1 
ATOM   2602 C  CB  . HIS A 1 342 ? -1.864  0.883   28.618  1.00 33.18 ? 342 HIS A CB  1 
ATOM   2603 C  CG  . HIS A 1 342 ? -1.820  0.136   29.910  1.00 34.67 ? 342 HIS A CG  1 
ATOM   2604 N  ND1 . HIS A 1 342 ? -2.704  0.378   30.935  1.00 36.10 ? 342 HIS A ND1 1 
ATOM   2605 C  CD2 . HIS A 1 342 ? -1.000  -0.851  30.341  1.00 35.10 ? 342 HIS A CD2 1 
ATOM   2606 C  CE1 . HIS A 1 342 ? -2.429  -0.428  31.948  1.00 34.58 ? 342 HIS A CE1 1 
ATOM   2607 N  NE2 . HIS A 1 342 ? -1.398  -1.181  31.613  1.00 36.08 ? 342 HIS A NE2 1 
ATOM   2608 N  N   . GLU A 1 343 ? 0.833   2.061   29.409  1.00 33.94 ? 343 GLU A N   1 
ATOM   2609 C  CA  . GLU A 1 343 ? 2.003   2.107   30.299  1.00 36.53 ? 343 GLU A CA  1 
ATOM   2610 C  C   . GLU A 1 343 ? 2.384   3.522   30.757  1.00 37.43 ? 343 GLU A C   1 
ATOM   2611 O  O   . GLU A 1 343 ? 2.935   3.689   31.850  1.00 37.74 ? 343 GLU A O   1 
ATOM   2612 C  CB  . GLU A 1 343 ? 3.208   1.445   29.630  1.00 39.23 ? 343 GLU A CB  1 
ATOM   2613 C  CG  . GLU A 1 343 ? 3.082   -0.064  29.462  1.00 44.59 ? 343 GLU A CG  1 
ATOM   2614 C  CD  . GLU A 1 343 ? 4.005   -0.633  28.382  1.00 52.48 ? 343 GLU A CD  1 
ATOM   2615 O  OE1 . GLU A 1 343 ? 4.997   0.046   27.989  1.00 52.37 ? 343 GLU A OE1 1 
ATOM   2616 O  OE2 . GLU A 1 343 ? 3.730   -1.775  27.925  1.00 54.26 ? 343 GLU A OE2 1 
ATOM   2617 N  N   . ARG A 1 344 ? 2.133   4.531   29.924  1.00 37.81 ? 344 ARG A N   1 
ATOM   2618 C  CA  . ARG A 1 344 ? 2.470   5.915   30.266  1.00 38.61 ? 344 ARG A CA  1 
ATOM   2619 C  C   . ARG A 1 344 ? 1.296   6.758   30.762  1.00 36.35 ? 344 ARG A C   1 
ATOM   2620 O  O   . ARG A 1 344 ? 1.410   7.986   30.861  1.00 35.00 ? 344 ARG A O   1 
ATOM   2621 C  CB  . ARG A 1 344 ? 3.123   6.590   29.062  1.00 42.13 ? 344 ARG A CB  1 
ATOM   2622 C  CG  . ARG A 1 344 ? 4.219   5.719   28.513  1.00 45.95 ? 344 ARG A CG  1 
ATOM   2623 C  CD  . ARG A 1 344 ? 5.293   6.438   27.757  1.00 48.55 ? 344 ARG A CD  1 
ATOM   2624 N  NE  . ARG A 1 344 ? 6.394   5.491   27.594  1.00 51.65 ? 344 ARG A NE  1 
ATOM   2625 C  CZ  . ARG A 1 344 ? 7.525   5.757   26.959  1.00 49.80 ? 344 ARG A CZ  1 
ATOM   2626 N  NH1 . ARG A 1 344 ? 7.736   6.955   26.424  1.00 45.99 ? 344 ARG A NH1 1 
ATOM   2627 N  NH2 . ARG A 1 344 ? 8.446   4.812   26.869  1.00 54.50 ? 344 ARG A NH2 1 
ATOM   2628 N  N   . GLY A 1 345 ? 0.184   6.106   31.081  1.00 35.60 ? 345 GLY A N   1 
ATOM   2629 C  CA  . GLY A 1 345 ? -0.993  6.792   31.620  1.00 36.22 ? 345 GLY A CA  1 
ATOM   2630 C  C   . GLY A 1 345 ? -1.622  7.784   30.658  1.00 35.51 ? 345 GLY A C   1 
ATOM   2631 O  O   . GLY A 1 345 ? -2.158  8.817   31.078  1.00 33.75 ? 345 GLY A O   1 
ATOM   2632 N  N   . LEU A 1 346 ? -1.593  7.459   29.367  1.00 33.11 ? 346 LEU A N   1 
ATOM   2633 C  CA  . LEU A 1 346 ? -2.045  8.389   28.334  1.00 34.59 ? 346 LEU A CA  1 
ATOM   2634 C  C   . LEU A 1 346 ? -3.412  8.008   27.747  1.00 33.74 ? 346 LEU A C   1 
ATOM   2635 O  O   . LEU A 1 346 ? -3.888  8.657   26.805  1.00 32.60 ? 346 LEU A O   1 
ATOM   2636 C  CB  . LEU A 1 346 ? -0.997  8.495   27.234  1.00 34.66 ? 346 LEU A CB  1 
ATOM   2637 C  CG  . LEU A 1 346 ? 0.341   9.076   27.713  1.00 35.88 ? 346 LEU A CG  1 
ATOM   2638 C  CD1 . LEU A 1 346 ? 1.392   8.947   26.625  1.00 37.61 ? 346 LEU A CD1 1 
ATOM   2639 C  CD2 . LEU A 1 346 ? 0.199   10.526  28.147  1.00 36.58 ? 346 LEU A CD2 1 
ATOM   2640 N  N   . VAL A 1 347 ? -4.027  6.960   28.289  1.00 33.01 ? 347 VAL A N   1 
ATOM   2641 C  CA  . VAL A 1 347 ? -5.361  6.545   27.826  1.00 34.20 ? 347 VAL A CA  1 
ATOM   2642 C  C   . VAL A 1 347 ? -6.416  7.300   28.631  1.00 38.33 ? 347 VAL A C   1 
ATOM   2643 O  O   . VAL A 1 347 ? -6.825  6.850   29.709  1.00 37.34 ? 347 VAL A O   1 
ATOM   2644 C  CB  . VAL A 1 347 ? -5.595  5.037   27.931  1.00 33.83 ? 347 VAL A CB  1 
ATOM   2645 C  CG1 . VAL A 1 347 ? -6.964  4.667   27.335  1.00 35.95 ? 347 VAL A CG1 1 
ATOM   2646 C  CG2 . VAL A 1 347 ? -4.508  4.259   27.220  1.00 35.11 ? 347 VAL A CG2 1 
ATOM   2647 N  N   . ARG A 1 348 ? -6.810  8.461   28.103  1.00 40.45 ? 348 ARG A N   1 
ATOM   2648 C  CA  A ARG A 1 348 ? -7.808  9.336   28.726  0.50 42.51 ? 348 ARG A CA  1 
ATOM   2649 C  CA  B ARG A 1 348 ? -7.859  9.283   28.702  0.50 43.13 ? 348 ARG A CA  1 
ATOM   2650 C  C   . ARG A 1 348 ? -8.457  10.218  27.666  1.00 43.51 ? 348 ARG A C   1 
ATOM   2651 O  O   . ARG A 1 348 ? -7.828  10.505  26.648  1.00 39.36 ? 348 ARG A O   1 
ATOM   2652 C  CB  A ARG A 1 348 ? -7.180  10.220  29.822  0.50 43.51 ? 348 ARG A CB  1 
ATOM   2653 C  CB  B ARG A 1 348 ? -7.343  10.086  29.903  0.50 45.58 ? 348 ARG A CB  1 
ATOM   2654 C  CG  A ARG A 1 348 ? -5.697  10.542  29.671  0.50 44.25 ? 348 ARG A CG  1 
ATOM   2655 C  CG  B ARG A 1 348 ? -6.035  10.823  29.688  0.50 46.70 ? 348 ARG A CG  1 
ATOM   2656 C  CD  A ARG A 1 348 ? -5.422  11.487  28.515  0.50 45.61 ? 348 ARG A CD  1 
ATOM   2657 C  CD  B ARG A 1 348 ? -5.275  10.913  31.004  0.50 49.34 ? 348 ARG A CD  1 
ATOM   2658 N  NE  A ARG A 1 348 ? -4.045  11.973  28.494  0.50 42.11 ? 348 ARG A NE  1 
ATOM   2659 N  NE  B ARG A 1 348 ? -3.826  10.974  30.825  0.50 50.40 ? 348 ARG A NE  1 
ATOM   2660 C  CZ  A ARG A 1 348 ? -3.599  12.831  27.589  0.50 41.92 ? 348 ARG A CZ  1 
ATOM   2661 C  CZ  B ARG A 1 348 ? -3.038  11.850  31.441  0.50 50.34 ? 348 ARG A CZ  1 
ATOM   2662 N  NH1 A ARG A 1 348 ? -2.344  13.235  27.607  0.50 42.54 ? 348 ARG A NH1 1 
ATOM   2663 N  NH1 B ARG A 1 348 ? -1.729  11.840  31.228  0.50 50.16 ? 348 ARG A NH1 1 
ATOM   2664 N  NH2 A ARG A 1 348 ? -4.428  13.289  26.664  0.50 45.33 ? 348 ARG A NH2 1 
ATOM   2665 N  NH2 B ARG A 1 348 ? -3.560  12.728  32.283  0.50 50.85 ? 348 ARG A NH2 1 
ATOM   2666 N  N   . PRO A 1 349 ? -9.704  10.669  27.908  1.00 43.47 ? 349 PRO A N   1 
ATOM   2667 C  CA  . PRO A 1 349 ? -10.310 11.543  26.921  1.00 45.29 ? 349 PRO A CA  1 
ATOM   2668 C  C   . PRO A 1 349 ? -9.519  12.812  26.779  1.00 46.46 ? 349 PRO A C   1 
ATOM   2669 O  O   . PRO A 1 349 ? -8.791  13.209  27.696  1.00 46.66 ? 349 PRO A O   1 
ATOM   2670 C  CB  . PRO A 1 349 ? -11.703 11.838  27.496  1.00 44.30 ? 349 PRO A CB  1 
ATOM   2671 C  CG  . PRO A 1 349 ? -11.972 10.719  28.425  1.00 46.46 ? 349 PRO A CG  1 
ATOM   2672 C  CD  . PRO A 1 349 ? -10.637 10.370  29.012  1.00 45.64 ? 349 PRO A CD  1 
ATOM   2673 N  N   . THR A 1 350 ? -9.659  13.426  25.617  1.00 45.53 ? 350 THR A N   1 
ATOM   2674 C  CA  . THR A 1 350 ? -9.000  14.670  25.310  1.00 47.53 ? 350 THR A CA  1 
ATOM   2675 C  C   . THR A 1 350 ? -9.952  15.822  25.602  1.00 47.73 ? 350 THR A C   1 
ATOM   2676 O  O   . THR A 1 350 ? -11.139 15.759  25.283  1.00 48.69 ? 350 THR A O   1 
ATOM   2677 C  CB  . THR A 1 350 ? -8.586  14.667  23.830  1.00 48.47 ? 350 THR A CB  1 
ATOM   2678 O  OG1 . THR A 1 350 ? -7.761  13.519  23.594  1.00 53.75 ? 350 THR A OG1 1 
ATOM   2679 C  CG2 . THR A 1 350 ? -7.831  15.920  23.464  1.00 46.15 ? 350 THR A CG2 1 
ATOM   2680 N  N   . ALA A 1 351 ? -9.428  16.882  26.196  1.00 52.07 ? 351 ALA A N   1 
ATOM   2681 C  CA  . ALA A 1 351 ? -10.247 18.050  26.510  1.00 55.38 ? 351 ALA A CA  1 
ATOM   2682 C  C   . ALA A 1 351 ? -10.718 18.705  25.212  1.00 53.15 ? 351 ALA A C   1 
ATOM   2683 O  O   . ALA A 1 351 ? -11.902 18.645  24.869  1.00 55.84 ? 351 ALA A O   1 
ATOM   2684 C  CB  . ALA A 1 351 ? -9.465  19.038  27.370  1.00 57.38 ? 351 ALA A CB  1 
ATOM   2685 N  N   . GLU A 1 352 ? -9.777  19.267  24.464  1.00 50.54 ? 352 GLU A N   1 
ATOM   2686 C  CA  . GLU A 1 352 ? -10.099 20.073  23.288  1.00 49.34 ? 352 GLU A CA  1 
ATOM   2687 C  C   . GLU A 1 352 ? -10.154 19.232  21.999  1.00 45.62 ? 352 GLU A C   1 
ATOM   2688 O  O   . GLU A 1 352 ? -9.202  18.533  21.678  1.00 43.38 ? 352 GLU A O   1 
ATOM   2689 C  CB  . GLU A 1 352 ? -9.064  21.184  23.140  1.00 51.06 ? 352 GLU A CB  1 
ATOM   2690 C  CG  . GLU A 1 352 ? -9.447  22.267  22.135  1.00 57.40 ? 352 GLU A CG  1 
ATOM   2691 C  CD  . GLU A 1 352 ? -8.255  23.084  21.651  1.00 63.52 ? 352 GLU A CD  1 
ATOM   2692 O  OE1 . GLU A 1 352 ? -7.278  23.242  22.421  1.00 66.13 ? 352 GLU A OE1 1 
ATOM   2693 O  OE2 . GLU A 1 352 ? -8.297  23.563  20.491  1.00 67.85 ? 352 GLU A OE2 1 
ATOM   2694 N  N   . LEU A 1 353 ? -11.263 19.326  21.268  1.00 41.36 ? 353 LEU A N   1 
ATOM   2695 C  CA  . LEU A 1 353 ? -11.383 18.713  19.945  1.00 42.06 ? 353 LEU A CA  1 
ATOM   2696 C  C   . LEU A 1 353 ? -10.575 19.484  18.885  1.00 42.74 ? 353 LEU A C   1 
ATOM   2697 O  O   . LEU A 1 353 ? -10.759 20.691  18.698  1.00 40.42 ? 353 LEU A O   1 
ATOM   2698 C  CB  . LEU A 1 353 ? -12.846 18.635  19.529  1.00 43.41 ? 353 LEU A CB  1 
ATOM   2699 C  CG  . LEU A 1 353 ? -13.116 18.025  18.146  1.00 45.20 ? 353 LEU A CG  1 
ATOM   2700 C  CD1 . LEU A 1 353 ? -12.601 16.593  18.033  1.00 44.93 ? 353 LEU A CD1 1 
ATOM   2701 C  CD2 . LEU A 1 353 ? -14.606 18.084  17.853  1.00 47.01 ? 353 LEU A CD2 1 
ATOM   2702 N  N   . LYS A 1 354 ? -9.689  18.785  18.180  1.00 38.00 ? 354 LYS A N   1 
ATOM   2703 C  CA  . LYS A 1 354 ? -8.837  19.428  17.189  1.00 39.47 ? 354 LYS A CA  1 
ATOM   2704 C  C   . LYS A 1 354 ? -9.059  18.902  15.779  1.00 37.74 ? 354 LYS A C   1 
ATOM   2705 O  O   . LYS A 1 354 ? -8.369  19.326  14.857  1.00 39.96 ? 354 LYS A O   1 
ATOM   2706 C  CB  . LYS A 1 354 ? -7.358  19.312  17.605  1.00 38.94 ? 354 LYS A CB  1 
ATOM   2707 C  CG  . LYS A 1 354 ? -7.115  19.996  18.950  1.00 41.82 ? 354 LYS A CG  1 
ATOM   2708 C  CD  . LYS A 1 354 ? -5.665  20.291  19.258  1.00 43.75 ? 354 LYS A CD  1 
ATOM   2709 C  CE  . LYS A 1 354 ? -5.518  20.821  20.681  1.00 44.66 ? 354 LYS A CE  1 
ATOM   2710 N  NZ  . LYS A 1 354 ? -4.103  20.788  21.168  1.00 47.45 ? 354 LYS A NZ  1 
ATOM   2711 N  N   . PHE A 1 355 ? -10.055 18.035  15.607  1.00 35.60 ? 355 PHE A N   1 
ATOM   2712 C  CA  . PHE A 1 355 ? -10.301 17.384  14.325  1.00 35.67 ? 355 PHE A CA  1 
ATOM   2713 C  C   . PHE A 1 355 ? -11.694 17.658  13.779  1.00 36.93 ? 355 PHE A C   1 
ATOM   2714 O  O   . PHE A 1 355 ? -12.700 17.459  14.445  1.00 38.63 ? 355 PHE A O   1 
ATOM   2715 C  CB  . PHE A 1 355 ? -10.029 15.880  14.465  1.00 34.06 ? 355 PHE A CB  1 
ATOM   2716 C  CG  . PHE A 1 355 ? -8.677  15.601  15.048  1.00 33.09 ? 355 PHE A CG  1 
ATOM   2717 C  CD1 . PHE A 1 355 ? -7.544  15.909  14.330  1.00 33.64 ? 355 PHE A CD1 1 
ATOM   2718 C  CD2 . PHE A 1 355 ? -8.543  15.142  16.344  1.00 34.26 ? 355 PHE A CD2 1 
ATOM   2719 C  CE1 . PHE A 1 355 ? -6.277  15.698  14.861  1.00 33.84 ? 355 PHE A CE1 1 
ATOM   2720 C  CE2 . PHE A 1 355 ? -7.289  14.926  16.884  1.00 34.84 ? 355 PHE A CE2 1 
ATOM   2721 C  CZ  . PHE A 1 355 ? -6.158  15.213  16.147  1.00 35.41 ? 355 PHE A CZ  1 
ATOM   2722 N  N   . GLU A 1 356 ? -11.698 18.156  12.553  1.00 39.37 ? 356 GLU A N   1 
ATOM   2723 C  CA  . GLU A 1 356 ? -12.889 18.485  11.795  1.00 42.46 ? 356 GLU A CA  1 
ATOM   2724 C  C   . GLU A 1 356 ? -13.852 17.316  11.808  1.00 41.54 ? 356 GLU A C   1 
ATOM   2725 O  O   . GLU A 1 356 ? -13.455 16.194  11.520  1.00 41.03 ? 356 GLU A O   1 
ATOM   2726 C  CB  . GLU A 1 356 ? -12.433 18.774  10.359  1.00 44.81 ? 356 GLU A CB  1 
ATOM   2727 C  CG  . GLU A 1 356 ? -13.318 19.669  9.528   1.00 49.89 ? 356 GLU A CG  1 
ATOM   2728 C  CD  . GLU A 1 356 ? -12.651 20.047  8.217   1.00 51.57 ? 356 GLU A CD  1 
ATOM   2729 O  OE1 . GLU A 1 356 ? -13.335 20.560  7.312   1.00 57.53 ? 356 GLU A OE1 1 
ATOM   2730 O  OE2 . GLU A 1 356 ? -11.428 19.825  8.091   1.00 56.67 ? 356 GLU A OE2 1 
ATOM   2731 N  N   . LEU A 1 357 ? -15.110 17.565  12.152  1.00 40.29 ? 357 LEU A N   1 
ATOM   2732 C  CA  . LEU A 1 357 ? -16.156 16.563  12.014  1.00 44.04 ? 357 LEU A CA  1 
ATOM   2733 C  C   . LEU A 1 357 ? -16.778 16.675  10.628  1.00 48.02 ? 357 LEU A C   1 
ATOM   2734 O  O   . LEU A 1 357 ? -17.250 17.741  10.255  1.00 47.66 ? 357 LEU A O   1 
ATOM   2735 C  CB  . LEU A 1 357 ? -17.237 16.770  13.069  1.00 46.85 ? 357 LEU A CB  1 
ATOM   2736 C  CG  . LEU A 1 357 ? -16.716 16.815  14.511  1.00 48.14 ? 357 LEU A CG  1 
ATOM   2737 C  CD1 . LEU A 1 357 ? -17.666 17.579  15.423  1.00 50.41 ? 357 LEU A CD1 1 
ATOM   2738 C  CD2 . LEU A 1 357 ? -16.463 15.413  15.030  1.00 47.73 ? 357 LEU A CD2 1 
ATOM   2739 N  N   . LYS A 1 358 ? -16.809 15.573  9.882   1.00 51.27 ? 358 LYS A N   1 
ATOM   2740 C  CA  . LYS A 1 358 ? -17.256 15.597  8.483   1.00 53.95 ? 358 LYS A CA  1 
ATOM   2741 C  C   . LYS A 1 358 ? -18.749 15.317  8.306   1.00 49.16 ? 358 LYS A C   1 
ATOM   2742 O  O   . LYS A 1 358 ? -19.392 14.697  9.162   1.00 46.65 ? 358 LYS A O   1 
ATOM   2743 C  CB  . LYS A 1 358 ? -16.424 14.610  7.663   1.00 57.44 ? 358 LYS A CB  1 
ATOM   2744 C  CG  . LYS A 1 358 ? -14.938 14.948  7.634   1.00 60.85 ? 358 LYS A CG  1 
ATOM   2745 C  CD  . LYS A 1 358 ? -14.639 16.087  6.669   1.00 65.87 ? 358 LYS A CD  1 
ATOM   2746 C  CE  . LYS A 1 358 ? -13.365 16.827  7.041   1.00 67.99 ? 358 LYS A CE  1 
ATOM   2747 N  NZ  . LYS A 1 358 ? -12.177 15.933  7.114   1.00 69.75 ? 358 LYS A NZ  1 
ATOM   2748 N  N   . GLY B 1 2   ? 27.791  -19.086 -46.783 1.00 51.25 ? 2   GLY B N   1 
ATOM   2749 C  CA  . GLY B 1 2   ? 27.359  -18.754 -45.399 1.00 48.56 ? 2   GLY B CA  1 
ATOM   2750 C  C   . GLY B 1 2   ? 28.311  -19.333 -44.378 1.00 48.80 ? 2   GLY B C   1 
ATOM   2751 O  O   . GLY B 1 2   ? 29.407  -19.784 -44.724 1.00 48.55 ? 2   GLY B O   1 
ATOM   2752 N  N   . TYR B 1 3   ? 27.882  -19.334 -43.121 1.00 45.27 ? 3   TYR B N   1 
ATOM   2753 C  CA  . TYR B 1 3   ? 28.711  -19.796 -42.020 1.00 42.25 ? 3   TYR B CA  1 
ATOM   2754 C  C   . TYR B 1 3   ? 28.290  -21.152 -41.459 1.00 40.78 ? 3   TYR B C   1 
ATOM   2755 O  O   . TYR B 1 3   ? 27.134  -21.579 -41.576 1.00 39.74 ? 3   TYR B O   1 
ATOM   2756 C  CB  . TYR B 1 3   ? 28.661  -18.797 -40.865 1.00 42.62 ? 3   TYR B CB  1 
ATOM   2757 C  CG  . TYR B 1 3   ? 29.155  -17.419 -41.187 1.00 42.11 ? 3   TYR B CG  1 
ATOM   2758 C  CD1 . TYR B 1 3   ? 30.501  -17.180 -41.439 1.00 41.16 ? 3   TYR B CD1 1 
ATOM   2759 C  CD2 . TYR B 1 3   ? 28.277  -16.336 -41.202 1.00 41.91 ? 3   TYR B CD2 1 
ATOM   2760 C  CE1 . TYR B 1 3   ? 30.955  -15.904 -41.728 1.00 42.48 ? 3   TYR B CE1 1 
ATOM   2761 C  CE2 . TYR B 1 3   ? 28.720  -15.058 -41.477 1.00 41.33 ? 3   TYR B CE2 1 
ATOM   2762 C  CZ  . TYR B 1 3   ? 30.055  -14.844 -41.740 1.00 42.81 ? 3   TYR B CZ  1 
ATOM   2763 O  OH  . TYR B 1 3   ? 30.481  -13.568 -42.013 1.00 44.88 ? 3   TYR B OH  1 
ATOM   2764 N  N   . THR B 1 4   ? 29.264  -21.815 -40.846 1.00 40.56 ? 4   THR B N   1 
ATOM   2765 C  CA  . THR B 1 4   ? 29.018  -22.954 -39.971 1.00 41.46 ? 4   THR B CA  1 
ATOM   2766 C  C   . THR B 1 4   ? 28.986  -22.405 -38.557 1.00 38.48 ? 4   THR B C   1 
ATOM   2767 O  O   . THR B 1 4   ? 29.992  -21.883 -38.078 1.00 37.02 ? 4   THR B O   1 
ATOM   2768 C  CB  . THR B 1 4   ? 30.140  -23.999 -40.071 1.00 42.40 ? 4   THR B CB  1 
ATOM   2769 O  OG1 . THR B 1 4   ? 30.138  -24.551 -41.386 1.00 43.56 ? 4   THR B OG1 1 
ATOM   2770 C  CG2 . THR B 1 4   ? 29.939  -25.129 -39.039 1.00 43.83 ? 4   THR B CG2 1 
ATOM   2771 N  N   . VAL B 1 5   ? 27.836  -22.530 -37.902 1.00 39.57 ? 5   VAL B N   1 
ATOM   2772 C  CA  . VAL B 1 5   ? 27.628  -21.961 -36.563 1.00 39.12 ? 5   VAL B CA  1 
ATOM   2773 C  C   . VAL B 1 5   ? 27.329  -23.055 -35.536 1.00 39.36 ? 5   VAL B C   1 
ATOM   2774 O  O   . VAL B 1 5   ? 26.443  -23.880 -35.729 1.00 42.95 ? 5   VAL B O   1 
ATOM   2775 C  CB  . VAL B 1 5   ? 26.462  -20.961 -36.545 1.00 38.88 ? 5   VAL B CB  1 
ATOM   2776 C  CG1 . VAL B 1 5   ? 26.252  -20.415 -35.132 1.00 40.80 ? 5   VAL B CG1 1 
ATOM   2777 C  CG2 . VAL B 1 5   ? 26.717  -19.826 -37.526 1.00 38.66 ? 5   VAL B CG2 1 
ATOM   2778 N  N   . ALA B 1 6   ? 28.059  -23.022 -34.434 1.00 39.87 ? 6   ALA B N   1 
ATOM   2779 C  CA  . ALA B 1 6   ? 27.859  -23.964 -33.344 1.00 41.82 ? 6   ALA B CA  1 
ATOM   2780 C  C   . ALA B 1 6   ? 27.298  -23.260 -32.109 1.00 39.51 ? 6   ALA B C   1 
ATOM   2781 O  O   . ALA B 1 6   ? 27.774  -22.188 -31.732 1.00 40.90 ? 6   ALA B O   1 
ATOM   2782 C  CB  . ALA B 1 6   ? 29.181  -24.636 -33.001 1.00 42.01 ? 6   ALA B CB  1 
ATOM   2783 N  N   . VAL B 1 7   ? 26.300  -23.887 -31.488 1.00 40.30 ? 7   VAL B N   1 
ATOM   2784 C  CA  . VAL B 1 7   ? 25.769  -23.451 -30.204 1.00 39.53 ? 7   VAL B CA  1 
ATOM   2785 C  C   . VAL B 1 7   ? 26.215  -24.460 -29.158 1.00 40.05 ? 7   VAL B C   1 
ATOM   2786 O  O   . VAL B 1 7   ? 25.801  -25.608 -29.193 1.00 40.57 ? 7   VAL B O   1 
ATOM   2787 C  CB  . VAL B 1 7   ? 24.234  -23.420 -30.200 1.00 42.17 ? 7   VAL B CB  1 
ATOM   2788 C  CG1 . VAL B 1 7   ? 23.720  -22.900 -28.855 1.00 44.25 ? 7   VAL B CG1 1 
ATOM   2789 C  CG2 . VAL B 1 7   ? 23.713  -22.577 -31.357 1.00 42.68 ? 7   VAL B CG2 1 
ATOM   2790 N  N   . VAL B 1 8   ? 27.075  -24.023 -28.252 1.00 38.93 ? 8   VAL B N   1 
ATOM   2791 C  CA  . VAL B 1 8   ? 27.535  -24.845 -27.154 1.00 40.14 ? 8   VAL B CA  1 
ATOM   2792 C  C   . VAL B 1 8   ? 26.639  -24.573 -25.949 1.00 41.30 ? 8   VAL B C   1 
ATOM   2793 O  O   . VAL B 1 8   ? 26.573  -23.435 -25.455 1.00 41.27 ? 8   VAL B O   1 
ATOM   2794 C  CB  . VAL B 1 8   ? 28.988  -24.523 -26.795 1.00 40.38 ? 8   VAL B CB  1 
ATOM   2795 C  CG1 . VAL B 1 8   ? 29.536  -25.524 -25.786 1.00 42.46 ? 8   VAL B CG1 1 
ATOM   2796 C  CG2 . VAL B 1 8   ? 29.832  -24.517 -28.053 1.00 42.89 ? 8   VAL B CG2 1 
ATOM   2797 N  N   . GLY B 1 9   ? 25.960  -25.624 -25.486 1.00 41.47 ? 9   GLY B N   1 
ATOM   2798 C  CA  . GLY B 1 9   ? 24.920  -25.508 -24.462 1.00 40.47 ? 9   GLY B CA  1 
ATOM   2799 C  C   . GLY B 1 9   ? 23.537  -25.348 -25.064 1.00 39.95 ? 9   GLY B C   1 
ATOM   2800 O  O   . GLY B 1 9   ? 22.705  -24.628 -24.531 1.00 38.65 ? 9   GLY B O   1 
ATOM   2801 N  N   . ALA B 1 10  ? 23.292  -26.042 -26.169 1.00 40.24 ? 10  ALA B N   1 
ATOM   2802 C  CA  . ALA B 1 10  ? 22.066  -25.906 -26.950 1.00 41.48 ? 10  ALA B CA  1 
ATOM   2803 C  C   . ALA B 1 10  ? 20.806  -26.336 -26.227 1.00 41.76 ? 10  ALA B C   1 
ATOM   2804 O  O   . ALA B 1 10  ? 19.713  -25.938 -26.612 1.00 41.83 ? 10  ALA B O   1 
ATOM   2805 C  CB  . ALA B 1 10  ? 22.193  -26.704 -28.239 1.00 42.76 ? 10  ALA B CB  1 
ATOM   2806 N  N   . THR B 1 11  ? 20.963  -27.175 -25.208 1.00 42.18 ? 11  THR B N   1 
ATOM   2807 C  CA  . THR B 1 11  ? 19.848  -27.802 -24.515 1.00 43.49 ? 11  THR B CA  1 
ATOM   2808 C  C   . THR B 1 11  ? 19.329  -27.010 -23.308 1.00 44.33 ? 11  THR B C   1 
ATOM   2809 O  O   . THR B 1 11  ? 18.253  -27.314 -22.789 1.00 49.66 ? 11  THR B O   1 
ATOM   2810 C  CB  . THR B 1 11  ? 20.284  -29.192 -24.013 1.00 46.02 ? 11  THR B CB  1 
ATOM   2811 O  OG1 . THR B 1 11  ? 21.550  -29.085 -23.340 1.00 44.90 ? 11  THR B OG1 1 
ATOM   2812 C  CG2 . THR B 1 11  ? 20.418  -30.156 -25.187 1.00 46.28 ? 11  THR B CG2 1 
ATOM   2813 N  N   . GLY B 1 12  ? 20.085  -26.018 -22.850 1.00 42.00 ? 12  GLY B N   1 
ATOM   2814 C  CA  . GLY B 1 12  ? 19.709  -25.233 -21.659 1.00 41.63 ? 12  GLY B CA  1 
ATOM   2815 C  C   . GLY B 1 12  ? 18.741  -24.084 -21.913 1.00 38.99 ? 12  GLY B C   1 
ATOM   2816 O  O   . GLY B 1 12  ? 18.236  -23.906 -23.023 1.00 37.90 ? 12  GLY B O   1 
ATOM   2817 N  N   . ALA B 1 13  ? 18.514  -23.272 -20.881 1.00 37.12 ? 13  ALA B N   1 
ATOM   2818 C  CA  . ALA B 1 13  ? 17.564  -22.175 -20.970 1.00 35.73 ? 13  ALA B CA  1 
ATOM   2819 C  C   . ALA B 1 13  ? 18.012  -21.130 -21.995 1.00 36.06 ? 13  ALA B C   1 
ATOM   2820 O  O   . ALA B 1 13  ? 17.205  -20.680 -22.824 1.00 34.61 ? 13  ALA B O   1 
ATOM   2821 C  CB  . ALA B 1 13  ? 17.378  -21.530 -19.612 1.00 38.60 ? 13  ALA B CB  1 
ATOM   2822 N  N   . VAL B 1 14  ? 19.286  -20.736 -21.930 1.00 34.79 ? 14  VAL B N   1 
ATOM   2823 C  CA  . VAL B 1 14  ? 19.830  -19.759 -22.882 1.00 35.79 ? 14  VAL B CA  1 
ATOM   2824 C  C   . VAL B 1 14  ? 19.950  -20.430 -24.251 1.00 36.33 ? 14  VAL B C   1 
ATOM   2825 O  O   . VAL B 1 14  ? 19.535  -19.873 -25.271 1.00 37.48 ? 14  VAL B O   1 
ATOM   2826 C  CB  . VAL B 1 14  ? 21.193  -19.186 -22.410 1.00 38.44 ? 14  VAL B CB  1 
ATOM   2827 C  CG1 . VAL B 1 14  ? 21.858  -18.380 -23.528 1.00 37.42 ? 14  VAL B CG1 1 
ATOM   2828 C  CG2 . VAL B 1 14  ? 20.995  -18.290 -21.193 1.00 36.85 ? 14  VAL B CG2 1 
ATOM   2829 N  N   . GLY B 1 15  ? 20.492  -21.647 -24.261 1.00 34.44 ? 15  GLY B N   1 
ATOM   2830 C  CA  . GLY B 1 15  ? 20.581  -22.457 -25.476 1.00 34.16 ? 15  GLY B CA  1 
ATOM   2831 C  C   . GLY B 1 15  ? 19.347  -22.391 -26.346 1.00 35.28 ? 15  GLY B C   1 
ATOM   2832 O  O   . GLY B 1 15  ? 19.444  -22.059 -27.537 1.00 37.33 ? 15  GLY B O   1 
ATOM   2833 N  N   . ALA B 1 16  ? 18.191  -22.686 -25.756 1.00 34.73 ? 16  ALA B N   1 
ATOM   2834 C  CA  . ALA B 1 16  ? 16.900  -22.636 -26.456 1.00 35.53 ? 16  ALA B CA  1 
ATOM   2835 C  C   . ALA B 1 16  ? 16.642  -21.294 -27.149 1.00 35.73 ? 16  ALA B C   1 
ATOM   2836 O  O   . ALA B 1 16  ? 16.156  -21.256 -28.283 1.00 36.87 ? 16  ALA B O   1 
ATOM   2837 C  CB  . ALA B 1 16  ? 15.770  -22.934 -25.488 1.00 37.23 ? 16  ALA B CB  1 
ATOM   2838 N  N   . GLN B 1 17  ? 16.938  -20.198 -26.453 1.00 36.59 ? 17  GLN B N   1 
ATOM   2839 C  CA  . GLN B 1 17  ? 16.729  -18.860 -27.023 1.00 36.94 ? 17  GLN B CA  1 
ATOM   2840 C  C   . GLN B 1 17  ? 17.796  -18.506 -28.042 1.00 36.41 ? 17  GLN B C   1 
ATOM   2841 O  O   . GLN B 1 17  ? 17.544  -17.757 -28.974 1.00 36.69 ? 17  GLN B O   1 
ATOM   2842 C  CB  . GLN B 1 17  ? 16.657  -17.798 -25.931 1.00 34.51 ? 17  GLN B CB  1 
ATOM   2843 C  CG  . GLN B 1 17  ? 15.525  -18.020 -24.959 1.00 37.23 ? 17  GLN B CG  1 
ATOM   2844 C  CD  . GLN B 1 17  ? 14.190  -18.216 -25.652 1.00 38.02 ? 17  GLN B CD  1 
ATOM   2845 O  OE1 . GLN B 1 17  ? 13.887  -17.553 -26.639 1.00 37.91 ? 17  GLN B OE1 1 
ATOM   2846 N  NE2 . GLN B 1 17  ? 13.400  -19.159 -25.154 1.00 40.35 ? 17  GLN B NE2 1 
ATOM   2847 N  N   . MET B 1 18  ? 18.995  -19.040 -27.872 1.00 37.87 ? 18  MET B N   1 
ATOM   2848 C  CA  . MET B 1 18  ? 20.002  -18.858 -28.884 1.00 41.70 ? 18  MET B CA  1 
ATOM   2849 C  C   . MET B 1 18  ? 19.515  -19.429 -30.199 1.00 38.07 ? 18  MET B C   1 
ATOM   2850 O  O   . MET B 1 18  ? 19.584  -18.778 -31.223 1.00 38.22 ? 18  MET B O   1 
ATOM   2851 C  CB  . MET B 1 18  ? 21.308  -19.519 -28.488 1.00 47.08 ? 18  MET B CB  1 
ATOM   2852 C  CG  . MET B 1 18  ? 22.491  -18.757 -29.034 1.00 54.11 ? 18  MET B CG  1 
ATOM   2853 S  SD  . MET B 1 18  ? 23.159  -17.710 -27.746 1.00 64.73 ? 18  MET B SD  1 
ATOM   2854 C  CE  . MET B 1 18  ? 23.965  -18.987 -26.785 1.00 52.02 ? 18  MET B CE  1 
ATOM   2855 N  N   . ILE B 1 19  ? 18.990  -20.642 -30.147 1.00 38.76 ? 19  ILE B N   1 
ATOM   2856 C  CA  . ILE B 1 19  ? 18.421  -21.311 -31.306 1.00 37.75 ? 19  ILE B CA  1 
ATOM   2857 C  C   . ILE B 1 19  ? 17.337  -20.447 -31.916 1.00 38.17 ? 19  ILE B C   1 
ATOM   2858 O  O   . ILE B 1 19  ? 17.343  -20.215 -33.119 1.00 35.85 ? 19  ILE B O   1 
ATOM   2859 C  CB  . ILE B 1 19  ? 17.857  -22.701 -30.906 1.00 40.72 ? 19  ILE B CB  1 
ATOM   2860 C  CG1 . ILE B 1 19  ? 19.019  -23.674 -30.679 1.00 39.34 ? 19  ILE B CG1 1 
ATOM   2861 C  CG2 . ILE B 1 19  ? 16.866  -23.237 -31.940 1.00 41.28 ? 19  ILE B CG2 1 
ATOM   2862 C  CD1 . ILE B 1 19  ? 18.618  -24.948 -29.962 1.00 42.31 ? 19  ILE B CD1 1 
ATOM   2863 N  N   . LYS B 1 20  ? 16.425  -19.951 -31.085 1.00 38.92 ? 20  LYS B N   1 
ATOM   2864 C  CA  . LYS B 1 20  ? 15.325  -19.098 -31.567 1.00 39.52 ? 20  LYS B CA  1 
ATOM   2865 C  C   . LYS B 1 20  ? 15.867  -17.821 -32.219 1.00 36.96 ? 20  LYS B C   1 
ATOM   2866 O  O   . LYS B 1 20  ? 15.437  -17.422 -33.307 1.00 36.73 ? 20  LYS B O   1 
ATOM   2867 C  CB  . LYS B 1 20  ? 14.381  -18.742 -30.411 1.00 42.89 ? 20  LYS B CB  1 
ATOM   2868 C  CG  . LYS B 1 20  ? 13.023  -18.214 -30.839 1.00 47.23 ? 20  LYS B CG  1 
ATOM   2869 C  CD  . LYS B 1 20  ? 12.126  -18.002 -29.624 1.00 52.23 ? 20  LYS B CD  1 
ATOM   2870 C  CE  . LYS B 1 20  ? 10.665  -17.763 -30.005 1.00 57.82 ? 20  LYS B CE  1 
ATOM   2871 N  NZ  . LYS B 1 20  ? 10.441  -16.407 -30.582 1.00 58.00 ? 20  LYS B NZ  1 
ATOM   2872 N  N   . MET B 1 21  ? 16.827  -17.187 -31.559 1.00 36.60 ? 21  MET B N   1 
ATOM   2873 C  CA  . MET B 1 21  ? 17.419  -15.971 -32.100 1.00 36.10 ? 21  MET B CA  1 
ATOM   2874 C  C   . MET B 1 21  ? 18.161  -16.251 -33.412 1.00 38.39 ? 21  MET B C   1 
ATOM   2875 O  O   . MET B 1 21  ? 18.048  -15.474 -34.358 1.00 36.50 ? 21  MET B O   1 
ATOM   2876 C  CB  . MET B 1 21  ? 18.343  -15.323 -31.079 1.00 35.95 ? 21  MET B CB  1 
ATOM   2877 C  CG  . MET B 1 21  ? 17.629  -14.752 -29.844 1.00 35.01 ? 21  MET B CG  1 
ATOM   2878 S  SD  . MET B 1 21  ? 16.356  -13.512 -30.177 1.00 35.00 ? 21  MET B SD  1 
ATOM   2879 C  CE  . MET B 1 21  ? 14.858  -14.492 -30.330 1.00 35.12 ? 21  MET B CE  1 
ATOM   2880 N  N   . LEU B 1 22  ? 18.899  -17.358 -33.468 1.00 37.80 ? 22  LEU B N   1 
ATOM   2881 C  CA  . LEU B 1 22  ? 19.565  -17.783 -34.712 1.00 39.53 ? 22  LEU B CA  1 
ATOM   2882 C  C   . LEU B 1 22  ? 18.579  -18.067 -35.827 1.00 38.65 ? 22  LEU B C   1 
ATOM   2883 O  O   . LEU B 1 22  ? 18.810  -17.649 -36.959 1.00 38.51 ? 22  LEU B O   1 
ATOM   2884 C  CB  . LEU B 1 22  ? 20.446  -19.012 -34.484 1.00 38.63 ? 22  LEU B CB  1 
ATOM   2885 C  CG  . LEU B 1 22  ? 21.753  -18.704 -33.747 1.00 39.18 ? 22  LEU B CG  1 
ATOM   2886 C  CD1 . LEU B 1 22  ? 22.472  -19.988 -33.368 1.00 39.12 ? 22  LEU B CD1 1 
ATOM   2887 C  CD2 . LEU B 1 22  ? 22.670  -17.795 -34.571 1.00 38.39 ? 22  LEU B CD2 1 
ATOM   2888 N  N   . GLU B 1 23  ? 17.487  -18.764 -35.519 1.00 38.45 ? 23  GLU B N   1 
ATOM   2889 C  CA  . GLU B 1 23  ? 16.423  -19.003 -36.502 1.00 40.09 ? 23  GLU B CA  1 
ATOM   2890 C  C   . GLU B 1 23  ? 15.882  -17.712 -37.109 1.00 42.30 ? 23  GLU B C   1 
ATOM   2891 O  O   . GLU B 1 23  ? 15.507  -17.675 -38.284 1.00 41.36 ? 23  GLU B O   1 
ATOM   2892 C  CB  . GLU B 1 23  ? 15.262  -19.774 -35.882 1.00 42.87 ? 23  GLU B CB  1 
ATOM   2893 C  CG  . GLU B 1 23  ? 15.542  -21.248 -35.646 1.00 45.93 ? 23  GLU B CG  1 
ATOM   2894 C  CD  . GLU B 1 23  ? 14.488  -21.932 -34.789 1.00 48.49 ? 23  GLU B CD  1 
ATOM   2895 O  OE1 . GLU B 1 23  ? 13.741  -21.241 -34.063 1.00 48.72 ? 23  GLU B OE1 1 
ATOM   2896 O  OE2 . GLU B 1 23  ? 14.424  -23.176 -34.827 1.00 49.17 ? 23  GLU B OE2 1 
ATOM   2897 N  N   . GLU B 1 24  ? 15.842  -16.651 -36.309 1.00 43.16 ? 24  GLU B N   1 
ATOM   2898 C  CA  . GLU B 1 24  ? 15.308  -15.369 -36.763 1.00 43.48 ? 24  GLU B CA  1 
ATOM   2899 C  C   . GLU B 1 24  ? 16.407  -14.382 -37.144 1.00 39.85 ? 24  GLU B C   1 
ATOM   2900 O  O   . GLU B 1 24  ? 16.124  -13.209 -37.362 1.00 40.31 ? 24  GLU B O   1 
ATOM   2901 C  CB  . GLU B 1 24  ? 14.428  -14.769 -35.649 1.00 43.94 ? 24  GLU B CB  1 
ATOM   2902 C  CG  . GLU B 1 24  ? 13.156  -15.554 -35.394 1.00 43.95 ? 24  GLU B CG  1 
ATOM   2903 C  CD  . GLU B 1 24  ? 12.509  -15.240 -34.055 1.00 44.17 ? 24  GLU B CD  1 
ATOM   2904 O  OE1 . GLU B 1 24  ? 12.801  -14.186 -33.461 1.00 43.17 ? 24  GLU B OE1 1 
ATOM   2905 O  OE2 . GLU B 1 24  ? 11.702  -16.067 -33.590 1.00 44.25 ? 24  GLU B OE2 1 
ATOM   2906 N  N   . SER B 1 25  ? 17.659  -14.843 -37.223 1.00 36.90 ? 25  SER B N   1 
ATOM   2907 C  CA  A SER B 1 25  ? 18.791  -13.966 -37.484 0.50 35.73 ? 25  SER B CA  1 
ATOM   2908 C  CA  B SER B 1 25  ? 18.795  -13.957 -37.486 0.50 37.29 ? 25  SER B CA  1 
ATOM   2909 C  C   . SER B 1 25  ? 18.992  -13.674 -38.976 1.00 36.93 ? 25  SER B C   1 
ATOM   2910 O  O   . SER B 1 25  ? 18.526  -14.408 -39.829 1.00 38.95 ? 25  SER B O   1 
ATOM   2911 C  CB  A SER B 1 25  ? 20.061  -14.594 -36.914 0.50 34.37 ? 25  SER B CB  1 
ATOM   2912 C  CB  B SER B 1 25  ? 20.089  -14.563 -36.938 0.50 37.46 ? 25  SER B CB  1 
ATOM   2913 O  OG  A SER B 1 25  ? 21.183  -13.793 -37.190 0.50 31.72 ? 25  SER B OG  1 
ATOM   2914 O  OG  B SER B 1 25  ? 20.665  -15.447 -37.883 0.50 38.82 ? 25  SER B OG  1 
ATOM   2915 N  N   . THR B 1 26  ? 19.702  -12.593 -39.268 1.00 37.12 ? 26  THR B N   1 
ATOM   2916 C  CA  . THR B 1 26  ? 20.128  -12.280 -40.632 1.00 38.08 ? 26  THR B CA  1 
ATOM   2917 C  C   . THR B 1 26  ? 21.523  -12.883 -40.958 1.00 39.44 ? 26  THR B C   1 
ATOM   2918 O  O   . THR B 1 26  ? 22.088  -12.649 -42.016 1.00 36.32 ? 26  THR B O   1 
ATOM   2919 C  CB  . THR B 1 26  ? 20.167  -10.766 -40.825 1.00 35.10 ? 26  THR B CB  1 
ATOM   2920 O  OG1 . THR B 1 26  ? 20.982  -10.184 -39.811 1.00 37.62 ? 26  THR B OG1 1 
ATOM   2921 C  CG2 . THR B 1 26  ? 18.761  -10.191 -40.761 1.00 36.29 ? 26  THR B CG2 1 
ATOM   2922 N  N   . LEU B 1 27  ? 22.071  -13.675 -40.045 1.00 39.01 ? 27  LEU B N   1 
ATOM   2923 C  CA  . LEU B 1 27  ? 23.342  -14.342 -40.275 1.00 41.56 ? 27  LEU B CA  1 
ATOM   2924 C  C   . LEU B 1 27  ? 23.109  -15.379 -41.381 1.00 41.73 ? 27  LEU B C   1 
ATOM   2925 O  O   . LEU B 1 27  ? 22.111  -16.090 -41.348 1.00 41.54 ? 27  LEU B O   1 
ATOM   2926 C  CB  . LEU B 1 27  ? 23.783  -15.032 -38.982 1.00 44.54 ? 27  LEU B CB  1 
ATOM   2927 C  CG  . LEU B 1 27  ? 25.195  -14.932 -38.428 1.00 47.32 ? 27  LEU B CG  1 
ATOM   2928 C  CD1 . LEU B 1 27  ? 25.839  -13.576 -38.652 1.00 45.45 ? 27  LEU B CD1 1 
ATOM   2929 C  CD2 . LEU B 1 27  ? 25.131  -15.271 -36.940 1.00 47.97 ? 27  LEU B CD2 1 
ATOM   2930 N  N   . PRO B 1 28  ? 23.980  -15.416 -42.405 1.00 42.51 ? 28  PRO B N   1 
ATOM   2931 C  CA  . PRO B 1 28  ? 23.832  -16.458 -43.444 1.00 43.13 ? 28  PRO B CA  1 
ATOM   2932 C  C   . PRO B 1 28  ? 24.412  -17.774 -42.936 1.00 42.22 ? 28  PRO B C   1 
ATOM   2933 O  O   . PRO B 1 28  ? 25.624  -17.889 -42.761 1.00 44.54 ? 28  PRO B O   1 
ATOM   2934 C  CB  . PRO B 1 28  ? 24.637  -15.901 -44.619 1.00 42.74 ? 28  PRO B CB  1 
ATOM   2935 C  CG  . PRO B 1 28  ? 25.659  -15.018 -43.994 1.00 43.13 ? 28  PRO B CG  1 
ATOM   2936 C  CD  . PRO B 1 28  ? 25.052  -14.460 -42.731 1.00 41.75 ? 28  PRO B CD  1 
ATOM   2937 N  N   . ILE B 1 29  ? 23.541  -18.732 -42.659 1.00 42.13 ? 29  ILE B N   1 
ATOM   2938 C  CA  . ILE B 1 29  ? 23.940  -19.957 -41.969 1.00 42.99 ? 29  ILE B CA  1 
ATOM   2939 C  C   . ILE B 1 29  ? 23.860  -21.118 -42.950 1.00 41.35 ? 29  ILE B C   1 
ATOM   2940 O  O   . ILE B 1 29  ? 22.786  -21.438 -43.441 1.00 43.80 ? 29  ILE B O   1 
ATOM   2941 C  CB  . ILE B 1 29  ? 23.061  -20.214 -40.729 1.00 42.54 ? 29  ILE B CB  1 
ATOM   2942 C  CG1 . ILE B 1 29  ? 23.227  -19.056 -39.730 1.00 43.95 ? 29  ILE B CG1 1 
ATOM   2943 C  CG2 . ILE B 1 29  ? 23.426  -21.537 -40.061 1.00 42.24 ? 29  ILE B CG2 1 
ATOM   2944 C  CD1 . ILE B 1 29  ? 22.491  -19.247 -38.414 1.00 44.94 ? 29  ILE B CD1 1 
ATOM   2945 N  N   . ASP B 1 30  ? 25.013  -21.707 -43.255 1.00 43.50 ? 30  ASP B N   1 
ATOM   2946 C  CA  . ASP B 1 30  ? 25.101  -22.851 -44.176 1.00 44.24 ? 30  ASP B CA  1 
ATOM   2947 C  C   . ASP B 1 30  ? 24.946  -24.151 -43.424 1.00 46.34 ? 30  ASP B C   1 
ATOM   2948 O  O   . ASP B 1 30  ? 24.361  -25.101 -43.941 1.00 49.50 ? 30  ASP B O   1 
ATOM   2949 C  CB  . ASP B 1 30  ? 26.451  -22.878 -44.878 1.00 46.50 ? 30  ASP B CB  1 
ATOM   2950 C  CG  . ASP B 1 30  ? 26.514  -21.946 -46.051 1.00 51.65 ? 30  ASP B CG  1 
ATOM   2951 O  OD1 . ASP B 1 30  ? 25.447  -21.586 -46.608 1.00 54.68 ? 30  ASP B OD1 1 
ATOM   2952 O  OD2 . ASP B 1 30  ? 27.640  -21.579 -46.424 1.00 55.66 ? 30  ASP B OD2 1 
ATOM   2953 N  N   . LYS B 1 31  ? 25.503  -24.197 -42.218 1.00 44.69 ? 31  LYS B N   1 
ATOM   2954 C  CA  . LYS B 1 31  ? 25.380  -25.362 -41.359 1.00 48.24 ? 31  LYS B CA  1 
ATOM   2955 C  C   . LYS B 1 31  ? 25.248  -24.936 -39.889 1.00 46.87 ? 31  LYS B C   1 
ATOM   2956 O  O   . LYS B 1 31  ? 25.950  -24.035 -39.425 1.00 45.70 ? 31  LYS B O   1 
ATOM   2957 C  CB  . LYS B 1 31  ? 26.595  -26.283 -41.548 1.00 47.95 ? 31  LYS B CB  1 
ATOM   2958 C  CG  . LYS B 1 31  ? 26.438  -27.652 -40.917 1.00 51.07 ? 31  LYS B CG  1 
ATOM   2959 C  CD  . LYS B 1 31  ? 27.695  -28.496 -41.048 1.00 56.25 ? 31  LYS B CD  1 
ATOM   2960 C  CE  . LYS B 1 31  ? 27.527  -29.814 -40.298 1.00 60.37 ? 31  LYS B CE  1 
ATOM   2961 N  NZ  . LYS B 1 31  ? 28.467  -30.864 -40.778 1.00 65.08 ? 31  LYS B NZ  1 
ATOM   2962 N  N   . ILE B 1 32  ? 24.342  -25.601 -39.176 1.00 48.02 ? 32  ILE B N   1 
ATOM   2963 C  CA  . ILE B 1 32  ? 24.144  -25.391 -37.742 1.00 50.72 ? 32  ILE B CA  1 
ATOM   2964 C  C   . ILE B 1 32  ? 24.540  -26.676 -37.003 1.00 48.34 ? 32  ILE B C   1 
ATOM   2965 O  O   . ILE B 1 32  ? 24.142  -27.772 -37.405 1.00 45.10 ? 32  ILE B O   1 
ATOM   2966 C  CB  . ILE B 1 32  ? 22.673  -25.006 -37.425 1.00 55.61 ? 32  ILE B CB  1 
ATOM   2967 C  CG1 . ILE B 1 32  ? 22.533  -24.469 -35.995 1.00 59.69 ? 32  ILE B CG1 1 
ATOM   2968 C  CG2 . ILE B 1 32  ? 21.715  -26.181 -37.632 1.00 59.10 ? 32  ILE B CG2 1 
ATOM   2969 C  CD1 . ILE B 1 32  ? 22.934  -23.017 -35.846 1.00 59.39 ? 32  ILE B CD1 1 
ATOM   2970 N  N   . ARG B 1 33  ? 25.348  -26.536 -35.955 1.00 43.85 ? 33  ARG B N   1 
ATOM   2971 C  CA  . ARG B 1 33  ? 25.699  -27.657 -35.094 1.00 45.88 ? 33  ARG B CA  1 
ATOM   2972 C  C   . ARG B 1 33  ? 25.389  -27.357 -33.623 1.00 47.02 ? 33  ARG B C   1 
ATOM   2973 O  O   . ARG B 1 33  ? 25.737  -26.292 -33.108 1.00 44.30 ? 33  ARG B O   1 
ATOM   2974 C  CB  . ARG B 1 33  ? 27.181  -27.993 -35.253 1.00 47.62 ? 33  ARG B CB  1 
ATOM   2975 C  CG  . ARG B 1 33  ? 27.498  -28.724 -36.550 1.00 46.95 ? 33  ARG B CG  1 
ATOM   2976 C  CD  . ARG B 1 33  ? 28.989  -28.886 -36.739 1.00 47.53 ? 33  ARG B CD  1 
ATOM   2977 N  NE  . ARG B 1 33  ? 29.571  -29.706 -35.682 1.00 48.18 ? 33  ARG B NE  1 
ATOM   2978 C  CZ  . ARG B 1 33  ? 30.845  -29.669 -35.302 1.00 50.38 ? 33  ARG B CZ  1 
ATOM   2979 N  NH1 . ARG B 1 33  ? 31.719  -28.856 -35.890 1.00 51.34 ? 33  ARG B NH1 1 
ATOM   2980 N  NH2 . ARG B 1 33  ? 31.250  -30.450 -34.309 1.00 50.34 ? 33  ARG B NH2 1 
ATOM   2981 N  N   . TYR B 1 34  ? 24.756  -28.322 -32.954 1.00 45.68 ? 34  TYR B N   1 
ATOM   2982 C  CA  . TYR B 1 34  ? 24.382  -28.199 -31.544 1.00 43.26 ? 34  TYR B CA  1 
ATOM   2983 C  C   . TYR B 1 34  ? 25.290  -29.036 -30.665 1.00 42.72 ? 34  TYR B C   1 
ATOM   2984 O  O   . TYR B 1 34  ? 25.408  -30.240 -30.860 1.00 44.84 ? 34  TYR B O   1 
ATOM   2985 C  CB  . TYR B 1 34  ? 22.938  -28.658 -31.339 1.00 41.04 ? 34  TYR B CB  1 
ATOM   2986 C  CG  . TYR B 1 34  ? 21.852  -27.809 -31.977 1.00 40.51 ? 34  TYR B CG  1 
ATOM   2987 C  CD1 . TYR B 1 34  ? 22.052  -26.470 -32.293 1.00 40.61 ? 34  TYR B CD1 1 
ATOM   2988 C  CD2 . TYR B 1 34  ? 20.599  -28.349 -32.215 1.00 41.98 ? 34  TYR B CD2 1 
ATOM   2989 C  CE1 . TYR B 1 34  ? 21.038  -25.710 -32.841 1.00 38.94 ? 34  TYR B CE1 1 
ATOM   2990 C  CE2 . TYR B 1 34  ? 19.579  -27.599 -32.766 1.00 42.38 ? 34  TYR B CE2 1 
ATOM   2991 C  CZ  . TYR B 1 34  ? 19.805  -26.274 -33.072 1.00 40.59 ? 34  TYR B CZ  1 
ATOM   2992 O  OH  . TYR B 1 34  ? 18.784  -25.534 -33.621 1.00 41.30 ? 34  TYR B OH  1 
ATOM   2993 N  N   . LEU B 1 35  ? 25.928  -28.392 -29.696 1.00 43.42 ? 35  LEU B N   1 
ATOM   2994 C  CA  . LEU B 1 35  ? 26.824  -29.058 -28.764 1.00 45.34 ? 35  LEU B CA  1 
ATOM   2995 C  C   . LEU B 1 35  ? 26.301  -28.935 -27.332 1.00 46.92 ? 35  LEU B C   1 
ATOM   2996 O  O   . LEU B 1 35  ? 25.691  -27.919 -26.962 1.00 44.86 ? 35  LEU B O   1 
ATOM   2997 C  CB  . LEU B 1 35  ? 28.223  -28.446 -28.829 1.00 47.71 ? 35  LEU B CB  1 
ATOM   2998 C  CG  . LEU B 1 35  ? 29.183  -28.993 -29.875 1.00 48.58 ? 35  LEU B CG  1 
ATOM   2999 C  CD1 . LEU B 1 35  ? 28.603  -28.859 -31.265 1.00 49.05 ? 35  LEU B CD1 1 
ATOM   3000 C  CD2 . LEU B 1 35  ? 30.514  -28.260 -29.789 1.00 49.55 ? 35  LEU B CD2 1 
ATOM   3001 N  N   . ALA B 1 36  ? 26.537  -29.977 -26.539 1.00 44.93 ? 36  ALA B N   1 
ATOM   3002 C  CA  . ALA B 1 36  ? 26.207  -29.969 -25.109 1.00 45.43 ? 36  ALA B CA  1 
ATOM   3003 C  C   . ALA B 1 36  ? 27.133  -30.957 -24.390 1.00 49.01 ? 36  ALA B C   1 
ATOM   3004 O  O   . ALA B 1 36  ? 28.269  -31.148 -24.833 1.00 46.34 ? 36  ALA B O   1 
ATOM   3005 C  CB  . ALA B 1 36  ? 24.736  -30.313 -24.906 1.00 46.15 ? 36  ALA B CB  1 
ATOM   3006 N  N   . SER B 1 37  ? 26.674  -31.568 -23.292 1.00 49.45 ? 37  SER B N   1 
ATOM   3007 C  CA  . SER B 1 37  ? 27.493  -32.527 -22.551 1.00 49.31 ? 37  SER B CA  1 
ATOM   3008 C  C   . SER B 1 37  ? 27.279  -33.955 -23.050 1.00 50.62 ? 37  SER B C   1 
ATOM   3009 O  O   . SER B 1 37  ? 26.398  -34.230 -23.880 1.00 49.15 ? 37  SER B O   1 
ATOM   3010 C  CB  . SER B 1 37  ? 27.191  -32.454 -21.050 1.00 50.08 ? 37  SER B CB  1 
ATOM   3011 O  OG  . SER B 1 37  ? 25.946  -33.059 -20.741 1.00 47.27 ? 37  SER B OG  1 
ATOM   3012 N  N   . ALA B 1 38  ? 28.087  -34.864 -22.516 1.00 51.07 ? 38  ALA B N   1 
ATOM   3013 C  CA  . ALA B 1 38  ? 27.962  -36.290 -22.816 1.00 55.48 ? 38  ALA B CA  1 
ATOM   3014 C  C   . ALA B 1 38  ? 26.512  -36.798 -22.779 1.00 56.82 ? 38  ALA B C   1 
ATOM   3015 O  O   . ALA B 1 38  ? 26.093  -37.552 -23.657 1.00 59.72 ? 38  ALA B O   1 
ATOM   3016 C  CB  . ALA B 1 38  ? 28.829  -37.101 -21.857 1.00 55.08 ? 38  ALA B CB  1 
ATOM   3017 N  N   . ARG B 1 39  ? 25.741  -36.366 -21.788 1.00 57.92 ? 39  ARG B N   1 
ATOM   3018 C  CA  . ARG B 1 39  ? 24.397  -36.935 -21.585 1.00 60.05 ? 39  ARG B CA  1 
ATOM   3019 C  C   . ARG B 1 39  ? 23.334  -36.494 -22.587 1.00 58.18 ? 39  ARG B C   1 
ATOM   3020 O  O   . ARG B 1 39  ? 22.307  -37.167 -22.717 1.00 55.33 ? 39  ARG B O   1 
ATOM   3021 C  CB  . ARG B 1 39  ? 23.894  -36.748 -20.143 1.00 64.66 ? 39  ARG B CB  1 
ATOM   3022 C  CG  . ARG B 1 39  ? 24.130  -35.397 -19.493 1.00 70.40 ? 39  ARG B CG  1 
ATOM   3023 C  CD  . ARG B 1 39  ? 23.702  -35.442 -18.036 1.00 78.45 ? 39  ARG B CD  1 
ATOM   3024 N  NE  . ARG B 1 39  ? 24.564  -36.283 -17.197 1.00 84.35 ? 39  ARG B NE  1 
ATOM   3025 C  CZ  . ARG B 1 39  ? 24.193  -36.881 -16.059 1.00 84.46 ? 39  ARG B CZ  1 
ATOM   3026 N  NH1 . ARG B 1 39  ? 22.949  -36.779 -15.588 1.00 80.35 ? 39  ARG B NH1 1 
ATOM   3027 N  NH2 . ARG B 1 39  ? 25.078  -37.607 -15.387 1.00 84.73 ? 39  ARG B NH2 1 
ATOM   3028 N  N   . SER B 1 40  ? 23.568  -35.391 -23.299 1.00 54.17 ? 40  SER B N   1 
ATOM   3029 C  CA  . SER B 1 40  ? 22.642  -34.956 -24.350 1.00 52.32 ? 40  SER B CA  1 
ATOM   3030 C  C   . SER B 1 40  ? 23.019  -35.512 -25.732 1.00 51.58 ? 40  SER B C   1 
ATOM   3031 O  O   . SER B 1 40  ? 22.181  -35.548 -26.638 1.00 50.60 ? 40  SER B O   1 
ATOM   3032 C  CB  . SER B 1 40  ? 22.569  -33.429 -24.409 1.00 51.21 ? 40  SER B CB  1 
ATOM   3033 O  OG  . SER B 1 40  ? 22.022  -32.880 -23.218 1.00 49.78 ? 40  SER B OG  1 
ATOM   3034 N  N   . ALA B 1 41  ? 24.271  -35.946 -25.886 1.00 52.15 ? 41  ALA B N   1 
ATOM   3035 C  CA  . ALA B 1 41  ? 24.791  -36.409 -27.173 1.00 52.67 ? 41  ALA B CA  1 
ATOM   3036 C  C   . ALA B 1 41  ? 23.956  -37.547 -27.746 1.00 51.42 ? 41  ALA B C   1 
ATOM   3037 O  O   . ALA B 1 41  ? 23.772  -38.565 -27.097 1.00 55.25 ? 41  ALA B O   1 
ATOM   3038 C  CB  . ALA B 1 41  ? 26.243  -36.846 -27.024 1.00 54.17 ? 41  ALA B CB  1 
ATOM   3039 N  N   . GLY B 1 42  ? 23.435  -37.360 -28.952 1.00 52.73 ? 42  GLY B N   1 
ATOM   3040 C  CA  . GLY B 1 42  ? 22.599  -38.367 -29.602 1.00 49.30 ? 42  GLY B CA  1 
ATOM   3041 C  C   . GLY B 1 42  ? 21.151  -37.950 -29.702 1.00 49.41 ? 42  GLY B C   1 
ATOM   3042 O  O   . GLY B 1 42  ? 20.447  -38.402 -30.599 1.00 49.53 ? 42  GLY B O   1 
ATOM   3043 N  N   . LYS B 1 43  ? 20.693  -37.092 -28.790 1.00 50.58 ? 43  LYS B N   1 
ATOM   3044 C  CA  . LYS B 1 43  ? 19.343  -36.532 -28.894 1.00 55.24 ? 43  LYS B CA  1 
ATOM   3045 C  C   . LYS B 1 43  ? 19.255  -35.595 -30.086 1.00 53.02 ? 43  LYS B C   1 
ATOM   3046 O  O   . LYS B 1 43  ? 20.274  -35.159 -30.616 1.00 49.01 ? 43  LYS B O   1 
ATOM   3047 C  CB  . LYS B 1 43  ? 18.956  -35.748 -27.634 1.00 61.02 ? 43  LYS B CB  1 
ATOM   3048 C  CG  . LYS B 1 43  ? 18.704  -36.597 -26.397 1.00 64.39 ? 43  LYS B CG  1 
ATOM   3049 C  CD  . LYS B 1 43  ? 18.784  -35.761 -25.126 1.00 66.78 ? 43  LYS B CD  1 
ATOM   3050 C  CE  . LYS B 1 43  ? 17.796  -34.601 -25.121 1.00 68.08 ? 43  LYS B CE  1 
ATOM   3051 N  NZ  . LYS B 1 43  ? 17.845  -33.851 -23.834 1.00 71.37 ? 43  LYS B NZ  1 
ATOM   3052 N  N   . SER B 1 44  ? 18.028  -35.284 -30.480 1.00 53.20 ? 44  SER B N   1 
ATOM   3053 C  CA  . SER B 1 44  ? 17.761  -34.418 -31.621 1.00 57.52 ? 44  SER B CA  1 
ATOM   3054 C  C   . SER B 1 44  ? 16.984  -33.168 -31.203 1.00 57.82 ? 44  SER B C   1 
ATOM   3055 O  O   . SER B 1 44  ? 16.021  -33.238 -30.437 1.00 56.04 ? 44  SER B O   1 
ATOM   3056 C  CB  . SER B 1 44  ? 16.971  -35.179 -32.689 1.00 57.81 ? 44  SER B CB  1 
ATOM   3057 O  OG  . SER B 1 44  ? 16.864  -34.419 -33.877 1.00 64.77 ? 44  SER B OG  1 
ATOM   3058 N  N   . LEU B 1 45  ? 17.422  -32.026 -31.714 1.00 56.63 ? 45  LEU B N   1 
ATOM   3059 C  CA  . LEU B 1 45  ? 16.750  -30.749 -31.517 1.00 52.01 ? 45  LEU B CA  1 
ATOM   3060 C  C   . LEU B 1 45  ? 16.501  -30.146 -32.890 1.00 50.95 ? 45  LEU B C   1 
ATOM   3061 O  O   . LEU B 1 45  ? 17.278  -30.358 -33.821 1.00 46.63 ? 45  LEU B O   1 
ATOM   3062 C  CB  . LEU B 1 45  ? 17.630  -29.818 -30.677 1.00 56.35 ? 45  LEU B CB  1 
ATOM   3063 C  CG  . LEU B 1 45  ? 17.188  -29.420 -29.267 1.00 58.71 ? 45  LEU B CG  1 
ATOM   3064 C  CD1 . LEU B 1 45  ? 16.820  -30.620 -28.409 1.00 60.82 ? 45  LEU B CD1 1 
ATOM   3065 C  CD2 . LEU B 1 45  ? 18.299  -28.616 -28.613 1.00 59.37 ? 45  LEU B CD2 1 
ATOM   3066 N  N   . LYS B 1 46  ? 15.414  -29.399 -33.023 1.00 50.48 ? 46  LYS B N   1 
ATOM   3067 C  CA  . LYS B 1 46  ? 15.100  -28.746 -34.280 1.00 51.84 ? 46  LYS B CA  1 
ATOM   3068 C  C   . LYS B 1 46  ? 15.996  -27.531 -34.517 1.00 49.95 ? 46  LYS B C   1 
ATOM   3069 O  O   . LYS B 1 46  ? 16.412  -26.872 -33.570 1.00 51.98 ? 46  LYS B O   1 
ATOM   3070 C  CB  . LYS B 1 46  ? 13.639  -28.302 -34.291 1.00 53.57 ? 46  LYS B CB  1 
ATOM   3071 C  CG  . LYS B 1 46  ? 12.632  -29.439 -34.320 1.00 56.90 ? 46  LYS B CG  1 
ATOM   3072 C  CD  . LYS B 1 46  ? 12.529  -30.060 -35.705 1.00 59.37 ? 46  LYS B CD  1 
ATOM   3073 C  CE  . LYS B 1 46  ? 11.573  -31.243 -35.702 1.00 62.39 ? 46  LYS B CE  1 
ATOM   3074 N  NZ  . LYS B 1 46  ? 11.448  -31.864 -37.051 1.00 63.25 ? 46  LYS B NZ  1 
ATOM   3075 N  N   . PHE B 1 47  ? 16.325  -27.283 -35.783 1.00 49.76 ? 47  PHE B N   1 
ATOM   3076 C  CA  . PHE B 1 47  ? 16.640  -25.942 -36.281 1.00 49.06 ? 47  PHE B CA  1 
ATOM   3077 C  C   . PHE B 1 47  ? 15.676  -25.715 -37.421 1.00 50.74 ? 47  PHE B C   1 
ATOM   3078 O  O   . PHE B 1 47  ? 15.776  -26.375 -38.465 1.00 51.13 ? 47  PHE B O   1 
ATOM   3079 C  CB  . PHE B 1 47  ? 18.076  -25.795 -36.792 1.00 48.23 ? 47  PHE B CB  1 
ATOM   3080 C  CG  . PHE B 1 47  ? 18.407  -24.391 -37.245 1.00 47.44 ? 47  PHE B CG  1 
ATOM   3081 C  CD1 . PHE B 1 47  ? 18.777  -23.417 -36.325 1.00 47.97 ? 47  PHE B CD1 1 
ATOM   3082 C  CD2 . PHE B 1 47  ? 18.313  -24.037 -38.584 1.00 46.32 ? 47  PHE B CD2 1 
ATOM   3083 C  CE1 . PHE B 1 47  ? 19.061  -22.122 -36.734 1.00 49.93 ? 47  PHE B CE1 1 
ATOM   3084 C  CE2 . PHE B 1 47  ? 18.600  -22.753 -39.003 1.00 48.47 ? 47  PHE B CE2 1 
ATOM   3085 C  CZ  . PHE B 1 47  ? 18.976  -21.789 -38.077 1.00 51.03 ? 47  PHE B CZ  1 
ATOM   3086 N  N   . LYS B 1 48  ? 14.747  -24.783 -37.217 1.00 53.15 ? 48  LYS B N   1 
ATOM   3087 C  CA  . LYS B 1 48  ? 13.585  -24.616 -38.079 1.00 55.30 ? 48  LYS B CA  1 
ATOM   3088 C  C   . LYS B 1 48  ? 12.914  -25.984 -38.232 1.00 58.26 ? 48  LYS B C   1 
ATOM   3089 O  O   . LYS B 1 48  ? 12.591  -26.607 -37.224 1.00 58.19 ? 48  LYS B O   1 
ATOM   3090 C  CB  . LYS B 1 48  ? 13.981  -23.968 -39.407 1.00 55.99 ? 48  LYS B CB  1 
ATOM   3091 C  CG  . LYS B 1 48  ? 14.785  -22.691 -39.225 1.00 56.84 ? 48  LYS B CG  1 
ATOM   3092 C  CD  . LYS B 1 48  ? 14.723  -21.791 -40.447 1.00 56.98 ? 48  LYS B CD  1 
ATOM   3093 C  CE  . LYS B 1 48  ? 15.563  -20.547 -40.238 1.00 58.31 ? 48  LYS B CE  1 
ATOM   3094 N  NZ  . LYS B 1 48  ? 15.494  -19.652 -41.420 1.00 60.11 ? 48  LYS B NZ  1 
ATOM   3095 N  N   . ASP B 1 49  ? 12.724  -26.469 -39.453 1.00 61.24 ? 49  ASP B N   1 
ATOM   3096 C  CA  . ASP B 1 49  ? 12.129  -27.790 -39.650 1.00 65.39 ? 49  ASP B CA  1 
ATOM   3097 C  C   . ASP B 1 49  ? 13.182  -28.896 -39.752 1.00 63.23 ? 49  ASP B C   1 
ATOM   3098 O  O   . ASP B 1 49  ? 12.845  -30.077 -39.772 1.00 62.78 ? 49  ASP B O   1 
ATOM   3099 C  CB  . ASP B 1 49  ? 11.224  -27.776 -40.881 1.00 70.24 ? 49  ASP B CB  1 
ATOM   3100 C  CG  . ASP B 1 49  ? 10.038  -26.824 -40.723 1.00 76.49 ? 49  ASP B CG  1 
ATOM   3101 O  OD1 . ASP B 1 49  ? 9.528   -26.671 -39.589 1.00 80.19 ? 49  ASP B OD1 1 
ATOM   3102 O  OD2 . ASP B 1 49  ? 9.611   -26.224 -41.734 1.00 83.80 ? 49  ASP B OD2 1 
ATOM   3103 N  N   . GLN B 1 50  ? 14.453  -28.512 -39.789 1.00 63.36 ? 50  GLN B N   1 
ATOM   3104 C  CA  . GLN B 1 50  ? 15.554  -29.464 -39.883 1.00 63.29 ? 50  GLN B CA  1 
ATOM   3105 C  C   . GLN B 1 50  ? 15.848  -30.094 -38.520 1.00 62.95 ? 50  GLN B C   1 
ATOM   3106 O  O   . GLN B 1 50  ? 15.861  -29.403 -37.497 1.00 60.46 ? 50  GLN B O   1 
ATOM   3107 C  CB  . GLN B 1 50  ? 16.806  -28.756 -40.417 1.00 67.90 ? 50  GLN B CB  1 
ATOM   3108 C  CG  . GLN B 1 50  ? 17.909  -29.688 -40.901 1.00 74.78 ? 50  GLN B CG  1 
ATOM   3109 C  CD  . GLN B 1 50  ? 17.862  -29.965 -42.399 1.00 77.72 ? 50  GLN B CD  1 
ATOM   3110 O  OE1 . GLN B 1 50  ? 16.801  -30.229 -42.967 1.00 80.93 ? 50  GLN B OE1 1 
ATOM   3111 N  NE2 . GLN B 1 50  ? 19.024  -29.918 -43.042 1.00 78.17 ? 50  GLN B NE2 1 
ATOM   3112 N  N   . ASP B 1 51  ? 16.084  -31.404 -38.516 1.00 60.17 ? 51  ASP B N   1 
ATOM   3113 C  CA  . ASP B 1 51  ? 16.449  -32.133 -37.306 1.00 60.04 ? 51  ASP B CA  1 
ATOM   3114 C  C   . ASP B 1 51  ? 17.961  -32.119 -37.163 1.00 56.70 ? 51  ASP B C   1 
ATOM   3115 O  O   . ASP B 1 51  ? 18.670  -32.478 -38.098 1.00 57.43 ? 51  ASP B O   1 
ATOM   3116 C  CB  . ASP B 1 51  ? 15.945  -33.581 -37.371 1.00 63.85 ? 51  ASP B CB  1 
ATOM   3117 C  CG  . ASP B 1 51  ? 14.429  -33.669 -37.450 1.00 66.12 ? 51  ASP B CG  1 
ATOM   3118 O  OD1 . ASP B 1 51  ? 13.763  -33.273 -36.475 1.00 68.91 ? 51  ASP B OD1 1 
ATOM   3119 O  OD2 . ASP B 1 51  ? 13.901  -34.126 -38.486 1.00 70.75 ? 51  ASP B OD2 1 
ATOM   3120 N  N   . ILE B 1 52  ? 18.447  -31.705 -35.995 1.00 50.10 ? 52  ILE B N   1 
ATOM   3121 C  CA  . ILE B 1 52  ? 19.877  -31.610 -35.726 1.00 48.08 ? 52  ILE B CA  1 
ATOM   3122 C  C   . ILE B 1 52  ? 20.212  -32.569 -34.590 1.00 51.68 ? 52  ILE B C   1 
ATOM   3123 O  O   . ILE B 1 52  ? 19.433  -32.694 -33.646 1.00 52.42 ? 52  ILE B O   1 
ATOM   3124 C  CB  . ILE B 1 52  ? 20.286  -30.179 -35.303 1.00 46.20 ? 52  ILE B CB  1 
ATOM   3125 C  CG1 . ILE B 1 52  ? 19.784  -29.131 -36.316 1.00 45.40 ? 52  ILE B CG1 1 
ATOM   3126 C  CG2 . ILE B 1 52  ? 21.789  -30.101 -35.088 1.00 45.41 ? 52  ILE B CG2 1 
ATOM   3127 C  CD1 . ILE B 1 52  ? 20.305  -29.279 -37.739 1.00 44.52 ? 52  ILE B CD1 1 
ATOM   3128 N  N   . THR B 1 53  ? 21.366  -33.231 -34.674 1.00 51.77 ? 53  THR B N   1 
ATOM   3129 C  CA  . THR B 1 53  ? 21.764  -34.237 -33.684 1.00 51.74 ? 53  THR B CA  1 
ATOM   3130 C  C   . THR B 1 53  ? 22.737  -33.601 -32.734 1.00 51.76 ? 53  THR B C   1 
ATOM   3131 O  O   . THR B 1 53  ? 23.798  -33.141 -33.155 1.00 51.19 ? 53  THR B O   1 
ATOM   3132 C  CB  . THR B 1 53  ? 22.461  -35.455 -34.339 1.00 53.40 ? 53  THR B CB  1 
ATOM   3133 O  OG1 . THR B 1 53  ? 21.513  -36.175 -35.135 1.00 55.99 ? 53  THR B OG1 1 
ATOM   3134 C  CG2 . THR B 1 53  ? 23.044  -36.398 -33.278 1.00 53.98 ? 53  THR B CG2 1 
ATOM   3135 N  N   . ILE B 1 54  ? 22.408  -33.608 -31.447 1.00 50.29 ? 54  ILE B N   1 
ATOM   3136 C  CA  . ILE B 1 54  ? 23.273  -32.975 -30.465 1.00 50.58 ? 54  ILE B CA  1 
ATOM   3137 C  C   . ILE B 1 54  ? 24.573  -33.766 -30.312 1.00 51.62 ? 54  ILE B C   1 
ATOM   3138 O  O   . ILE B 1 54  ? 24.551  -34.987 -30.209 1.00 50.99 ? 54  ILE B O   1 
ATOM   3139 C  CB  . ILE B 1 54  ? 22.576  -32.819 -29.103 1.00 50.76 ? 54  ILE B CB  1 
ATOM   3140 C  CG1 . ILE B 1 54  ? 21.317  -31.949 -29.258 1.00 52.89 ? 54  ILE B CG1 1 
ATOM   3141 C  CG2 . ILE B 1 54  ? 23.532  -32.210 -28.086 1.00 48.83 ? 54  ILE B CG2 1 
ATOM   3142 C  CD1 . ILE B 1 54  ? 20.280  -32.162 -28.174 1.00 54.00 ? 54  ILE B CD1 1 
ATOM   3143 N  N   . GLU B 1 55  ? 25.694  -33.049 -30.305 1.00 51.33 ? 55  GLU B N   1 
ATOM   3144 C  CA  . GLU B 1 55  ? 27.016  -33.645 -30.194 1.00 51.13 ? 55  GLU B CA  1 
ATOM   3145 C  C   . GLU B 1 55  ? 27.618  -33.294 -28.858 1.00 51.42 ? 55  GLU B C   1 
ATOM   3146 O  O   . GLU B 1 55  ? 27.289  -32.263 -28.268 1.00 50.39 ? 55  GLU B O   1 
ATOM   3147 C  CB  . GLU B 1 55  ? 27.935  -33.114 -31.297 1.00 51.35 ? 55  GLU B CB  1 
ATOM   3148 C  CG  . GLU B 1 55  ? 27.380  -33.245 -32.708 1.00 54.03 ? 55  GLU B CG  1 
ATOM   3149 C  CD  . GLU B 1 55  ? 28.230  -32.512 -33.738 1.00 54.64 ? 55  GLU B CD  1 
ATOM   3150 O  OE1 . GLU B 1 55  ? 27.679  -31.703 -34.513 1.00 54.26 ? 55  GLU B OE1 1 
ATOM   3151 O  OE2 . GLU B 1 55  ? 29.458  -32.728 -33.765 1.00 55.86 ? 55  GLU B OE2 1 
ATOM   3152 N  N   . GLU B 1 56  ? 28.519  -34.141 -28.383 1.00 52.83 ? 56  GLU B N   1 
ATOM   3153 C  CA  . GLU B 1 56  ? 29.230  -33.863 -27.156 1.00 52.89 ? 56  GLU B CA  1 
ATOM   3154 C  C   . GLU B 1 56  ? 30.315  -32.837 -27.422 1.00 51.53 ? 56  GLU B C   1 
ATOM   3155 O  O   . GLU B 1 56  ? 31.005  -32.906 -28.429 1.00 51.52 ? 56  GLU B O   1 
ATOM   3156 C  CB  . GLU B 1 56  ? 29.860  -35.131 -26.594 1.00 56.70 ? 56  GLU B CB  1 
ATOM   3157 C  CG  . GLU B 1 56  ? 30.528  -34.922 -25.242 1.00 59.67 ? 56  GLU B CG  1 
ATOM   3158 C  CD  . GLU B 1 56  ? 31.257  -36.154 -24.751 1.00 63.09 ? 56  GLU B CD  1 
ATOM   3159 O  OE1 . GLU B 1 56  ? 31.033  -37.247 -25.314 1.00 62.85 ? 56  GLU B OE1 1 
ATOM   3160 O  OE2 . GLU B 1 56  ? 32.054  -36.019 -23.802 1.00 61.50 ? 56  GLU B OE2 1 
ATOM   3161 N  N   . THR B 1 57  ? 30.477  -31.905 -26.494 1.00 47.77 ? 57  THR B N   1 
ATOM   3162 C  CA  . THR B 1 57  ? 31.509  -30.899 -26.590 1.00 47.66 ? 57  THR B CA  1 
ATOM   3163 C  C   . THR B 1 57  ? 32.883  -31.492 -26.266 1.00 52.58 ? 57  THR B C   1 
ATOM   3164 O  O   . THR B 1 57  ? 33.101  -31.980 -25.163 1.00 51.04 ? 57  THR B O   1 
ATOM   3165 C  CB  . THR B 1 57  ? 31.208  -29.726 -25.631 1.00 47.03 ? 57  THR B CB  1 
ATOM   3166 O  OG1 . THR B 1 57  ? 29.924  -29.165 -25.952 1.00 46.24 ? 57  THR B OG1 1 
ATOM   3167 C  CG2 . THR B 1 57  ? 32.262  -28.648 -25.746 1.00 45.25 ? 57  THR B CG2 1 
ATOM   3168 N  N   . THR B 1 58  ? 33.798  -31.446 -27.237 1.00 57.00 ? 58  THR B N   1 
ATOM   3169 C  CA  . THR B 1 58  ? 35.177  -31.921 -27.052 1.00 59.25 ? 58  THR B CA  1 
ATOM   3170 C  C   . THR B 1 58  ? 36.169  -30.954 -27.685 1.00 59.34 ? 58  THR B C   1 
ATOM   3171 O  O   . THR B 1 58  ? 35.772  -30.052 -28.428 1.00 56.44 ? 58  THR B O   1 
ATOM   3172 C  CB  . THR B 1 58  ? 35.412  -33.318 -27.677 1.00 58.45 ? 58  THR B CB  1 
ATOM   3173 O  OG1 . THR B 1 58  ? 35.479  -33.212 -29.106 1.00 59.32 ? 58  THR B OG1 1 
ATOM   3174 C  CG2 . THR B 1 58  ? 34.300  -34.285 -27.289 1.00 58.53 ? 58  THR B CG2 1 
ATOM   3175 N  N   . GLU B 1 59  ? 37.456  -31.195 -27.412 1.00 60.89 ? 59  GLU B N   1 
ATOM   3176 C  CA  . GLU B 1 59  ? 38.579  -30.378 -27.913 1.00 60.80 ? 59  GLU B CA  1 
ATOM   3177 C  C   . GLU B 1 59  ? 38.676  -30.392 -29.433 1.00 58.10 ? 59  GLU B C   1 
ATOM   3178 O  O   . GLU B 1 59  ? 39.197  -29.464 -30.030 1.00 56.27 ? 59  GLU B O   1 
ATOM   3179 C  CB  . GLU B 1 59  ? 39.925  -30.885 -27.358 1.00 63.81 ? 59  GLU B CB  1 
ATOM   3180 C  CG  . GLU B 1 59  ? 40.105  -30.785 -25.849 1.00 67.53 ? 59  GLU B CG  1 
ATOM   3181 C  CD  . GLU B 1 59  ? 39.428  -31.910 -25.076 1.00 70.03 ? 59  GLU B CD  1 
ATOM   3182 O  OE1 . GLU B 1 59  ? 38.699  -32.726 -25.685 1.00 69.27 ? 59  GLU B OE1 1 
ATOM   3183 O  OE2 . GLU B 1 59  ? 39.616  -31.972 -23.844 1.00 76.35 ? 59  GLU B OE2 1 
ATOM   3184 N  N   . THR B 1 60  ? 38.185  -31.461 -30.046 1.00 58.62 ? 60  THR B N   1 
ATOM   3185 C  CA  . THR B 1 60  ? 38.320  -31.685 -31.473 1.00 60.07 ? 60  THR B CA  1 
ATOM   3186 C  C   . THR B 1 60  ? 37.008  -31.472 -32.220 1.00 57.24 ? 60  THR B C   1 
ATOM   3187 O  O   . THR B 1 60  ? 36.892  -31.832 -33.385 1.00 62.03 ? 60  THR B O   1 
ATOM   3188 C  CB  . THR B 1 60  ? 38.780  -33.132 -31.706 1.00 60.73 ? 60  THR B CB  1 
ATOM   3189 O  OG1 . THR B 1 60  ? 37.853  -34.025 -31.073 1.00 61.19 ? 60  THR B OG1 1 
ATOM   3190 C  CG2 . THR B 1 60  ? 40.176  -33.347 -31.117 1.00 60.08 ? 60  THR B CG2 1 
ATOM   3191 N  N   . ALA B 1 61  ? 36.026  -30.870 -31.558 1.00 56.37 ? 61  ALA B N   1 
ATOM   3192 C  CA  . ALA B 1 61  ? 34.698  -30.722 -32.138 1.00 53.63 ? 61  ALA B CA  1 
ATOM   3193 C  C   . ALA B 1 61  ? 34.535  -29.453 -32.998 1.00 51.98 ? 61  ALA B C   1 
ATOM   3194 O  O   . ALA B 1 61  ? 33.546  -29.321 -33.730 1.00 53.53 ? 61  ALA B O   1 
ATOM   3195 C  CB  . ALA B 1 61  ? 33.659  -30.744 -31.027 1.00 53.98 ? 61  ALA B CB  1 
ATOM   3196 N  N   . PHE B 1 62  ? 35.501  -28.544 -32.936 1.00 50.08 ? 62  PHE B N   1 
ATOM   3197 C  CA  . PHE B 1 62  ? 35.343  -27.207 -33.527 1.00 52.91 ? 62  PHE B CA  1 
ATOM   3198 C  C   . PHE B 1 62  ? 35.968  -27.002 -34.902 1.00 53.49 ? 62  PHE B C   1 
ATOM   3199 O  O   . PHE B 1 62  ? 35.996  -25.872 -35.404 1.00 51.82 ? 62  PHE B O   1 
ATOM   3200 C  CB  . PHE B 1 62  ? 35.864  -26.147 -32.551 1.00 53.58 ? 62  PHE B CB  1 
ATOM   3201 C  CG  . PHE B 1 62  ? 35.060  -26.072 -31.289 1.00 56.40 ? 62  PHE B CG  1 
ATOM   3202 C  CD1 . PHE B 1 62  ? 33.905  -25.295 -31.230 1.00 56.54 ? 62  PHE B CD1 1 
ATOM   3203 C  CD2 . PHE B 1 62  ? 35.423  -26.817 -30.175 1.00 55.83 ? 62  PHE B CD2 1 
ATOM   3204 C  CE1 . PHE B 1 62  ? 33.147  -25.251 -30.072 1.00 57.14 ? 62  PHE B CE1 1 
ATOM   3205 C  CE2 . PHE B 1 62  ? 34.671  -26.773 -29.014 1.00 55.86 ? 62  PHE B CE2 1 
ATOM   3206 C  CZ  . PHE B 1 62  ? 33.533  -25.990 -28.960 1.00 54.97 ? 62  PHE B CZ  1 
ATOM   3207 N  N   . GLU B 1 63  ? 36.441  -28.077 -35.530 1.00 54.11 ? 63  GLU B N   1 
ATOM   3208 C  CA  . GLU B 1 63  ? 37.002  -27.962 -36.871 1.00 52.27 ? 63  GLU B CA  1 
ATOM   3209 C  C   . GLU B 1 63  ? 35.895  -27.622 -37.848 1.00 49.56 ? 63  GLU B C   1 
ATOM   3210 O  O   . GLU B 1 63  ? 34.811  -28.203 -37.800 1.00 47.27 ? 63  GLU B O   1 
ATOM   3211 C  CB  . GLU B 1 63  ? 37.721  -29.251 -37.292 1.00 58.12 ? 63  GLU B CB  1 
ATOM   3212 C  CG  . GLU B 1 63  ? 38.934  -29.605 -36.434 1.00 62.74 ? 63  GLU B CG  1 
ATOM   3213 C  CD  . GLU B 1 63  ? 39.946  -28.472 -36.315 1.00 69.11 ? 63  GLU B CD  1 
ATOM   3214 O  OE1 . GLU B 1 63  ? 40.079  -27.674 -37.271 1.00 74.85 ? 63  GLU B OE1 1 
ATOM   3215 O  OE2 . GLU B 1 63  ? 40.613  -28.370 -35.259 1.00 72.97 ? 63  GLU B OE2 1 
ATOM   3216 N  N   . GLY B 1 64  ? 36.162  -26.650 -38.717 1.00 50.13 ? 64  GLY B N   1 
ATOM   3217 C  CA  . GLY B 1 64  ? 35.196  -26.234 -39.728 1.00 49.78 ? 64  GLY B CA  1 
ATOM   3218 C  C   . GLY B 1 64  ? 34.216  -25.180 -39.244 1.00 48.95 ? 64  GLY B C   1 
ATOM   3219 O  O   . GLY B 1 64  ? 33.439  -24.639 -40.032 1.00 50.44 ? 64  GLY B O   1 
ATOM   3220 N  N   . VAL B 1 65  ? 34.248  -24.869 -37.955 1.00 50.11 ? 65  VAL B N   1 
ATOM   3221 C  CA  . VAL B 1 65  ? 33.271  -23.944 -37.390 1.00 47.74 ? 65  VAL B CA  1 
ATOM   3222 C  C   . VAL B 1 65  ? 33.731  -22.510 -37.582 1.00 44.31 ? 65  VAL B C   1 
ATOM   3223 O  O   . VAL B 1 65  ? 34.881  -22.180 -37.331 1.00 43.09 ? 65  VAL B O   1 
ATOM   3224 C  CB  . VAL B 1 65  ? 33.021  -24.232 -35.904 1.00 45.89 ? 65  VAL B CB  1 
ATOM   3225 C  CG1 . VAL B 1 65  ? 32.127  -23.158 -35.294 1.00 46.24 ? 65  VAL B CG1 1 
ATOM   3226 C  CG2 . VAL B 1 65  ? 32.391  -25.604 -35.749 1.00 44.47 ? 65  VAL B CG2 1 
ATOM   3227 N  N   . ASP B 1 66  ? 32.816  -21.656 -38.026 1.00 42.82 ? 66  ASP B N   1 
ATOM   3228 C  CA  . ASP B 1 66  ? 33.128  -20.250 -38.216 1.00 40.72 ? 66  ASP B CA  1 
ATOM   3229 C  C   . ASP B 1 66  ? 32.814  -19.476 -36.945 1.00 38.87 ? 66  ASP B C   1 
ATOM   3230 O  O   . ASP B 1 66  ? 33.631  -18.717 -36.458 1.00 38.92 ? 66  ASP B O   1 
ATOM   3231 C  CB  . ASP B 1 66  ? 32.332  -19.685 -39.385 1.00 40.90 ? 66  ASP B CB  1 
ATOM   3232 C  CG  . ASP B 1 66  ? 32.662  -20.370 -40.705 1.00 41.55 ? 66  ASP B CG  1 
ATOM   3233 O  OD1 . ASP B 1 66  ? 33.841  -20.377 -41.084 1.00 42.27 ? 66  ASP B OD1 1 
ATOM   3234 O  OD2 . ASP B 1 66  ? 31.737  -20.885 -41.360 1.00 42.17 ? 66  ASP B OD2 1 
ATOM   3235 N  N   . ILE B 1 67  ? 31.617  -19.681 -36.415 1.00 38.19 ? 67  ILE B N   1 
ATOM   3236 C  CA  . ILE B 1 67  ? 31.169  -18.948 -35.220 1.00 39.30 ? 67  ILE B CA  1 
ATOM   3237 C  C   . ILE B 1 67  ? 30.621  -19.949 -34.209 1.00 35.89 ? 67  ILE B C   1 
ATOM   3238 O  O   . ILE B 1 67  ? 29.863  -20.822 -34.570 1.00 39.51 ? 67  ILE B O   1 
ATOM   3239 C  CB  . ILE B 1 67  ? 30.084  -17.916 -35.585 1.00 39.62 ? 67  ILE B CB  1 
ATOM   3240 C  CG1 . ILE B 1 67  ? 30.624  -16.938 -36.633 1.00 41.16 ? 67  ILE B CG1 1 
ATOM   3241 C  CG2 . ILE B 1 67  ? 29.610  -17.147 -34.352 1.00 41.50 ? 67  ILE B CG2 1 
ATOM   3242 C  CD1 . ILE B 1 67  ? 29.588  -15.970 -37.154 1.00 43.62 ? 67  ILE B CD1 1 
ATOM   3243 N  N   . ALA B 1 68  ? 31.024  -19.803 -32.953 1.00 38.51 ? 68  ALA B N   1 
ATOM   3244 C  CA  . ALA B 1 68  ? 30.508  -20.623 -31.867 1.00 38.69 ? 68  ALA B CA  1 
ATOM   3245 C  C   . ALA B 1 68  ? 30.005  -19.699 -30.758 1.00 37.77 ? 68  ALA B C   1 
ATOM   3246 O  O   . ALA B 1 68  ? 30.721  -18.817 -30.306 1.00 38.69 ? 68  ALA B O   1 
ATOM   3247 C  CB  . ALA B 1 68  ? 31.579  -21.559 -31.327 1.00 37.80 ? 68  ALA B CB  1 
ATOM   3248 N  N   . LEU B 1 69  ? 28.758  -19.916 -30.361 1.00 39.94 ? 69  LEU B N   1 
ATOM   3249 C  CA  . LEU B 1 69  ? 28.129  -19.185 -29.273 1.00 42.95 ? 69  LEU B CA  1 
ATOM   3250 C  C   . LEU B 1 69  ? 28.144  -20.105 -28.055 1.00 41.75 ? 69  LEU B C   1 
ATOM   3251 O  O   . LEU B 1 69  ? 27.535  -21.182 -28.084 1.00 41.07 ? 69  LEU B O   1 
ATOM   3252 C  CB  . LEU B 1 69  ? 26.693  -18.833 -29.655 1.00 44.58 ? 69  LEU B CB  1 
ATOM   3253 C  CG  . LEU B 1 69  ? 26.575  -18.132 -31.015 1.00 48.40 ? 69  LEU B CG  1 
ATOM   3254 C  CD1 . LEU B 1 69  ? 25.162  -18.207 -31.563 1.00 51.48 ? 69  LEU B CD1 1 
ATOM   3255 C  CD2 . LEU B 1 69  ? 27.043  -16.687 -30.917 1.00 47.71 ? 69  LEU B CD2 1 
ATOM   3256 N  N   . PHE B 1 70  ? 28.833  -19.668 -27.003 1.00 39.95 ? 70  PHE B N   1 
ATOM   3257 C  CA  . PHE B 1 70  ? 28.998  -20.449 -25.783 1.00 39.21 ? 70  PHE B CA  1 
ATOM   3258 C  C   . PHE B 1 70  ? 28.037  -20.007 -24.700 1.00 40.03 ? 70  PHE B C   1 
ATOM   3259 O  O   . PHE B 1 70  ? 28.092  -18.866 -24.239 1.00 39.69 ? 70  PHE B O   1 
ATOM   3260 C  CB  . PHE B 1 70  ? 30.421  -20.292 -25.238 1.00 39.67 ? 70  PHE B CB  1 
ATOM   3261 C  CG  . PHE B 1 70  ? 31.406  -21.262 -25.821 1.00 43.10 ? 70  PHE B CG  1 
ATOM   3262 C  CD1 . PHE B 1 70  ? 31.750  -21.194 -27.167 1.00 40.96 ? 70  PHE B CD1 1 
ATOM   3263 C  CD2 . PHE B 1 70  ? 32.013  -22.230 -25.019 1.00 42.96 ? 70  PHE B CD2 1 
ATOM   3264 C  CE1 . PHE B 1 70  ? 32.666  -22.080 -27.704 1.00 43.57 ? 70  PHE B CE1 1 
ATOM   3265 C  CE2 . PHE B 1 70  ? 32.933  -23.122 -25.555 1.00 44.25 ? 70  PHE B CE2 1 
ATOM   3266 C  CZ  . PHE B 1 70  ? 33.257  -23.046 -26.900 1.00 42.88 ? 70  PHE B CZ  1 
ATOM   3267 N  N   . SER B 1 71  ? 27.182  -20.927 -24.275 1.00 41.99 ? 71  SER B N   1 
ATOM   3268 C  CA  . SER B 1 71  ? 26.362  -20.721 -23.096 1.00 43.58 ? 71  SER B CA  1 
ATOM   3269 C  C   . SER B 1 71  ? 26.201  -22.054 -22.374 1.00 41.68 ? 71  SER B C   1 
ATOM   3270 O  O   . SER B 1 71  ? 25.100  -22.597 -22.251 1.00 39.63 ? 71  SER B O   1 
ATOM   3271 C  CB  . SER B 1 71  ? 25.004  -20.132 -23.472 1.00 45.97 ? 71  SER B CB  1 
ATOM   3272 O  OG  . SER B 1 71  ? 24.359  -19.691 -22.288 1.00 54.19 ? 71  SER B OG  1 
ATOM   3273 N  N   . ALA B 1 72  ? 27.330  -22.574 -21.911 1.00 41.75 ? 72  ALA B N   1 
ATOM   3274 C  CA  . ALA B 1 72  ? 27.376  -23.871 -21.264 1.00 42.75 ? 72  ALA B CA  1 
ATOM   3275 C  C   . ALA B 1 72  ? 27.996  -23.815 -19.865 1.00 43.71 ? 72  ALA B C   1 
ATOM   3276 O  O   . ALA B 1 72  ? 28.298  -24.854 -19.278 1.00 49.18 ? 72  ALA B O   1 
ATOM   3277 C  CB  . ALA B 1 72  ? 28.142  -24.844 -22.146 1.00 42.55 ? 72  ALA B CB  1 
ATOM   3278 N  N   . GLY B 1 73  ? 28.183  -22.610 -19.341 1.00 43.19 ? 73  GLY B N   1 
ATOM   3279 C  CA  . GLY B 1 73  ? 28.716  -22.415 -18.009 1.00 44.25 ? 73  GLY B CA  1 
ATOM   3280 C  C   . GLY B 1 73  ? 30.194  -22.086 -18.075 1.00 45.46 ? 73  GLY B C   1 
ATOM   3281 O  O   . GLY B 1 73  ? 30.888  -22.470 -19.018 1.00 43.45 ? 73  GLY B O   1 
ATOM   3282 N  N   . SER B 1 74  ? 30.650  -21.362 -17.062 1.00 45.19 ? 74  SER B N   1 
ATOM   3283 C  CA  . SER B 1 74  ? 31.994  -20.802 -17.007 1.00 47.67 ? 74  SER B CA  1 
ATOM   3284 C  C   . SER B 1 74  ? 33.074  -21.846 -17.257 1.00 47.94 ? 74  SER B C   1 
ATOM   3285 O  O   . SER B 1 74  ? 34.043  -21.586 -17.964 1.00 46.26 ? 74  SER B O   1 
ATOM   3286 C  CB  . SER B 1 74  ? 32.214  -20.125 -15.640 1.00 50.21 ? 74  SER B CB  1 
ATOM   3287 O  OG  . SER B 1 74  ? 33.295  -19.205 -15.678 1.00 54.60 ? 74  SER B OG  1 
ATOM   3288 N  N   . SER B 1 75  ? 32.888  -23.030 -16.681 1.00 50.41 ? 75  SER B N   1 
ATOM   3289 C  CA  . SER B 1 75  ? 33.868  -24.118 -16.771 1.00 52.11 ? 75  SER B CA  1 
ATOM   3290 C  C   . SER B 1 75  ? 34.036  -24.653 -18.194 1.00 48.41 ? 75  SER B C   1 
ATOM   3291 O  O   . SER B 1 75  ? 35.149  -24.932 -18.637 1.00 45.62 ? 75  SER B O   1 
ATOM   3292 C  CB  . SER B 1 75  ? 33.461  -25.258 -15.828 1.00 54.48 ? 75  SER B CB  1 
ATOM   3293 O  OG  . SER B 1 75  ? 34.366  -26.341 -15.922 1.00 60.21 ? 75  SER B OG  1 
ATOM   3294 N  N   . THR B 1 76  ? 32.925  -24.801 -18.900 1.00 46.44 ? 76  THR B N   1 
ATOM   3295 C  CA  . THR B 1 76  ? 32.934  -25.260 -20.282 1.00 45.83 ? 76  THR B CA  1 
ATOM   3296 C  C   . THR B 1 76  ? 33.643  -24.255 -21.228 1.00 45.10 ? 76  THR B C   1 
ATOM   3297 O  O   . THR B 1 76  ? 34.382  -24.660 -22.121 1.00 44.05 ? 76  THR B O   1 
ATOM   3298 C  CB  . THR B 1 76  ? 31.492  -25.523 -20.774 1.00 45.48 ? 76  THR B CB  1 
ATOM   3299 O  OG1 . THR B 1 76  ? 30.844  -26.452 -19.900 1.00 48.43 ? 76  THR B OG1 1 
ATOM   3300 C  CG2 . THR B 1 76  ? 31.476  -26.111 -22.186 1.00 45.72 ? 76  THR B CG2 1 
ATOM   3301 N  N   . SER B 1 77  ? 33.424  -22.958 -21.029 1.00 42.80 ? 77  SER B N   1 
ATOM   3302 C  CA  . SER B 1 77  ? 34.083  -21.948 -21.860 1.00 45.36 ? 77  SER B CA  1 
ATOM   3303 C  C   . SER B 1 77  ? 35.590  -21.899 -21.559 1.00 47.45 ? 77  SER B C   1 
ATOM   3304 O  O   . SER B 1 77  ? 36.404  -21.869 -22.478 1.00 44.69 ? 77  SER B O   1 
ATOM   3305 C  CB  . SER B 1 77  ? 33.430  -20.568 -21.680 1.00 43.78 ? 77  SER B CB  1 
ATOM   3306 O  OG  . SER B 1 77  ? 32.082  -20.614 -22.132 1.00 42.88 ? 77  SER B OG  1 
ATOM   3307 N  N   . ALA B 1 78  ? 35.944  -21.933 -20.277 1.00 46.15 ? 78  ALA B N   1 
ATOM   3308 C  CA  . ALA B 1 78  ? 37.345  -21.970 -19.850 1.00 47.12 ? 78  ALA B CA  1 
ATOM   3309 C  C   . ALA B 1 78  ? 38.130  -23.092 -20.519 1.00 48.37 ? 78  ALA B C   1 
ATOM   3310 O  O   . ALA B 1 78  ? 39.254  -22.877 -20.964 1.00 48.85 ? 78  ALA B O   1 
ATOM   3311 C  CB  . ALA B 1 78  ? 37.432  -22.112 -18.337 1.00 47.16 ? 78  ALA B CB  1 
ATOM   3312 N  N   . LYS B 1 79  ? 37.521  -24.268 -20.606 1.00 47.92 ? 79  LYS B N   1 
ATOM   3313 C  CA  . LYS B 1 79  ? 38.177  -25.456 -21.146 1.00 53.06 ? 79  LYS B CA  1 
ATOM   3314 C  C   . LYS B 1 79  ? 38.202  -25.535 -22.674 1.00 55.36 ? 79  LYS B C   1 
ATOM   3315 O  O   . LYS B 1 79  ? 39.229  -25.878 -23.241 1.00 54.03 ? 79  LYS B O   1 
ATOM   3316 C  CB  . LYS B 1 79  ? 37.519  -26.730 -20.592 1.00 58.38 ? 79  LYS B CB  1 
ATOM   3317 C  CG  . LYS B 1 79  ? 37.898  -27.044 -19.152 1.00 61.42 ? 79  LYS B CG  1 
ATOM   3318 C  CD  . LYS B 1 79  ? 37.425  -28.429 -18.722 1.00 67.83 ? 79  LYS B CD  1 
ATOM   3319 C  CE  . LYS B 1 79  ? 35.953  -28.438 -18.333 1.00 73.94 ? 79  LYS B CE  1 
ATOM   3320 N  NZ  . LYS B 1 79  ? 35.475  -29.804 -17.972 1.00 76.19 ? 79  LYS B NZ  1 
ATOM   3321 N  N   . TYR B 1 80  ? 37.082  -25.229 -23.333 1.00 53.01 ? 80  TYR B N   1 
ATOM   3322 C  CA  . TYR B 1 80  ? 36.931  -25.504 -24.764 1.00 49.49 ? 80  TYR B CA  1 
ATOM   3323 C  C   . TYR B 1 80  ? 36.998  -24.282 -25.709 1.00 48.77 ? 80  TYR B C   1 
ATOM   3324 O  O   . TYR B 1 80  ? 37.251  -24.444 -26.903 1.00 46.17 ? 80  TYR B O   1 
ATOM   3325 C  CB  . TYR B 1 80  ? 35.638  -26.279 -24.999 1.00 52.67 ? 80  TYR B CB  1 
ATOM   3326 C  CG  . TYR B 1 80  ? 35.639  -27.640 -24.338 1.00 55.69 ? 80  TYR B CG  1 
ATOM   3327 C  CD1 . TYR B 1 80  ? 36.299  -28.722 -24.923 1.00 55.47 ? 80  TYR B CD1 1 
ATOM   3328 C  CD2 . TYR B 1 80  ? 34.990  -27.846 -23.123 1.00 58.94 ? 80  TYR B CD2 1 
ATOM   3329 C  CE1 . TYR B 1 80  ? 36.307  -29.966 -24.313 1.00 58.19 ? 80  TYR B CE1 1 
ATOM   3330 C  CE2 . TYR B 1 80  ? 34.992  -29.087 -22.506 1.00 59.75 ? 80  TYR B CE2 1 
ATOM   3331 C  CZ  . TYR B 1 80  ? 35.653  -30.141 -23.102 1.00 60.06 ? 80  TYR B CZ  1 
ATOM   3332 O  OH  . TYR B 1 80  ? 35.653  -31.365 -22.487 1.00 60.05 ? 80  TYR B OH  1 
ATOM   3333 N  N   . ALA B 1 81  ? 36.774  -23.074 -25.201 1.00 45.37 ? 81  ALA B N   1 
ATOM   3334 C  CA  . ALA B 1 81  ? 36.814  -21.890 -26.065 1.00 47.87 ? 81  ALA B CA  1 
ATOM   3335 C  C   . ALA B 1 81  ? 38.211  -21.652 -26.634 1.00 48.65 ? 81  ALA B C   1 
ATOM   3336 O  O   . ALA B 1 81  ? 38.338  -21.234 -27.782 1.00 52.91 ? 81  ALA B O   1 
ATOM   3337 C  CB  . ALA B 1 81  ? 36.327  -20.648 -25.330 1.00 46.29 ? 81  ALA B CB  1 
ATOM   3338 N  N   . PRO B 1 82  ? 39.263  -21.906 -25.841 1.00 47.98 ? 82  PRO B N   1 
ATOM   3339 C  CA  . PRO B 1 82  ? 40.596  -21.735 -26.418 1.00 49.29 ? 82  PRO B CA  1 
ATOM   3340 C  C   . PRO B 1 82  ? 40.885  -22.681 -27.593 1.00 46.15 ? 82  PRO B C   1 
ATOM   3341 O  O   . PRO B 1 82  ? 41.569  -22.282 -28.534 1.00 46.65 ? 82  PRO B O   1 
ATOM   3342 C  CB  . PRO B 1 82  ? 41.522  -21.996 -25.227 1.00 49.03 ? 82  PRO B CB  1 
ATOM   3343 C  CG  . PRO B 1 82  ? 40.706  -21.578 -24.051 1.00 49.18 ? 82  PRO B CG  1 
ATOM   3344 C  CD  . PRO B 1 82  ? 39.340  -22.103 -24.385 1.00 49.32 ? 82  PRO B CD  1 
ATOM   3345 N  N   . TYR B 1 83  ? 40.340  -23.896 -27.548 1.00 46.53 ? 83  TYR B N   1 
ATOM   3346 C  CA  . TYR B 1 83  ? 40.501  -24.861 -28.630 1.00 46.95 ? 83  TYR B CA  1 
ATOM   3347 C  C   . TYR B 1 83  ? 39.668  -24.434 -29.835 1.00 49.10 ? 83  TYR B C   1 
ATOM   3348 O  O   . TYR B 1 83  ? 40.081  -24.627 -30.978 1.00 47.86 ? 83  TYR B O   1 
ATOM   3349 C  CB  . TYR B 1 83  ? 40.119  -26.275 -28.180 1.00 50.63 ? 83  TYR B CB  1 
ATOM   3350 C  CG  . TYR B 1 83  ? 41.110  -26.888 -27.204 1.00 54.95 ? 83  TYR B CG  1 
ATOM   3351 C  CD1 . TYR B 1 83  ? 41.054  -26.593 -25.845 1.00 58.50 ? 83  TYR B CD1 1 
ATOM   3352 C  CD2 . TYR B 1 83  ? 42.108  -27.756 -27.641 1.00 59.89 ? 83  TYR B CD2 1 
ATOM   3353 C  CE1 . TYR B 1 83  ? 41.957  -27.143 -24.948 1.00 59.27 ? 83  TYR B CE1 1 
ATOM   3354 C  CE2 . TYR B 1 83  ? 43.016  -28.315 -26.749 1.00 60.32 ? 83  TYR B CE2 1 
ATOM   3355 C  CZ  . TYR B 1 83  ? 42.933  -28.006 -25.403 1.00 61.98 ? 83  TYR B CZ  1 
ATOM   3356 O  OH  . TYR B 1 83  ? 43.827  -28.546 -24.506 1.00 61.98 ? 83  TYR B OH  1 
ATOM   3357 N  N   . ALA B 1 84  ? 38.500  -23.840 -29.595 1.00 47.35 ? 84  ALA B N   1 
ATOM   3358 C  CA  . ALA B 1 84  ? 37.723  -23.295 -30.708 1.00 47.57 ? 84  ALA B CA  1 
ATOM   3359 C  C   . ALA B 1 84  ? 38.554  -22.226 -31.428 1.00 45.52 ? 84  ALA B C   1 
ATOM   3360 O  O   . ALA B 1 84  ? 38.677  -22.254 -32.654 1.00 45.47 ? 84  ALA B O   1 
ATOM   3361 C  CB  . ALA B 1 84  ? 36.395  -22.729 -30.228 1.00 47.33 ? 84  ALA B CB  1 
ATOM   3362 N  N   . VAL B 1 85  ? 39.149  -21.317 -30.659 1.00 47.05 ? 85  VAL B N   1 
ATOM   3363 C  CA  . VAL B 1 85  ? 39.961  -20.241 -31.225 1.00 48.66 ? 85  VAL B CA  1 
ATOM   3364 C  C   . VAL B 1 85  ? 41.161  -20.839 -31.965 1.00 54.60 ? 85  VAL B C   1 
ATOM   3365 O  O   . VAL B 1 85  ? 41.533  -20.346 -33.035 1.00 50.70 ? 85  VAL B O   1 
ATOM   3366 C  CB  . VAL B 1 85  ? 40.467  -19.248 -30.157 1.00 49.90 ? 85  VAL B CB  1 
ATOM   3367 C  CG1 . VAL B 1 85  ? 41.389  -18.207 -30.784 1.00 50.84 ? 85  VAL B CG1 1 
ATOM   3368 C  CG2 . VAL B 1 85  ? 39.302  -18.544 -29.460 1.00 49.11 ? 85  VAL B CG2 1 
ATOM   3369 N  N   . LYS B 1 86  ? 41.743  -21.903 -31.397 1.00 53.77 ? 86  LYS B N   1 
ATOM   3370 C  CA  . LYS B 1 86  ? 42.803  -22.675 -32.069 1.00 54.61 ? 86  LYS B CA  1 
ATOM   3371 C  C   . LYS B 1 86  ? 42.325  -23.207 -33.419 1.00 49.38 ? 86  LYS B C   1 
ATOM   3372 O  O   . LYS B 1 86  ? 43.058  -23.168 -34.395 1.00 50.26 ? 86  LYS B O   1 
ATOM   3373 C  CB  . LYS B 1 86  ? 43.269  -23.844 -31.189 1.00 59.12 ? 86  LYS B CB  1 
ATOM   3374 C  CG  . LYS B 1 86  ? 44.575  -24.520 -31.616 1.00 61.94 ? 86  LYS B CG  1 
ATOM   3375 C  CD  . LYS B 1 86  ? 44.714  -25.884 -30.939 1.00 65.17 ? 86  LYS B CD  1 
ATOM   3376 C  CE  . LYS B 1 86  ? 46.152  -26.238 -30.580 1.00 69.00 ? 86  LYS B CE  1 
ATOM   3377 N  NZ  . LYS B 1 86  ? 46.927  -26.755 -31.736 1.00 69.97 ? 86  LYS B NZ  1 
ATOM   3378 N  N   . ALA B 1 87  ? 41.087  -23.684 -33.472 1.00 48.79 ? 87  ALA B N   1 
ATOM   3379 C  CA  . ALA B 1 87  ? 40.501  -24.206 -34.701 1.00 47.30 ? 87  ALA B CA  1 
ATOM   3380 C  C   . ALA B 1 87  ? 40.066  -23.135 -35.709 1.00 46.78 ? 87  ALA B C   1 
ATOM   3381 O  O   . ALA B 1 87  ? 39.516  -23.470 -36.755 1.00 52.07 ? 87  ALA B O   1 
ATOM   3382 C  CB  . ALA B 1 87  ? 39.330  -25.114 -34.368 1.00 47.81 ? 87  ALA B CB  1 
ATOM   3383 N  N   . GLY B 1 88  ? 40.308  -21.861 -35.410 1.00 46.19 ? 88  GLY B N   1 
ATOM   3384 C  CA  . GLY B 1 88  ? 39.951  -20.762 -36.313 1.00 47.40 ? 88  GLY B CA  1 
ATOM   3385 C  C   . GLY B 1 88  ? 38.546  -20.216 -36.102 1.00 46.84 ? 88  GLY B C   1 
ATOM   3386 O  O   . GLY B 1 88  ? 38.024  -19.481 -36.941 1.00 44.05 ? 88  GLY B O   1 
ATOM   3387 N  N   . VAL B 1 89  ? 37.936  -20.555 -34.969 1.00 46.34 ? 89  VAL B N   1 
ATOM   3388 C  CA  . VAL B 1 89  ? 36.573  -20.119 -34.686 1.00 44.95 ? 89  VAL B CA  1 
ATOM   3389 C  C   . VAL B 1 89  ? 36.630  -18.738 -34.068 1.00 41.65 ? 89  VAL B C   1 
ATOM   3390 O  O   . VAL B 1 89  ? 37.622  -18.378 -33.426 1.00 41.32 ? 89  VAL B O   1 
ATOM   3391 C  CB  . VAL B 1 89  ? 35.862  -21.098 -33.724 1.00 45.19 ? 89  VAL B CB  1 
ATOM   3392 C  CG1 . VAL B 1 89  ? 34.440  -20.635 -33.423 1.00 43.75 ? 89  VAL B CG1 1 
ATOM   3393 C  CG2 . VAL B 1 89  ? 35.841  -22.501 -34.316 1.00 44.77 ? 89  VAL B CG2 1 
ATOM   3394 N  N   . VAL B 1 90  ? 35.582  -17.950 -34.289 1.00 41.60 ? 90  VAL B N   1 
ATOM   3395 C  CA  . VAL B 1 90  ? 35.344  -16.760 -33.477 1.00 41.44 ? 90  VAL B CA  1 
ATOM   3396 C  C   . VAL B 1 90  ? 34.244  -17.132 -32.492 1.00 40.01 ? 90  VAL B C   1 
ATOM   3397 O  O   . VAL B 1 90  ? 33.158  -17.582 -32.879 1.00 38.59 ? 90  VAL B O   1 
ATOM   3398 C  CB  . VAL B 1 90  ? 34.901  -15.518 -34.285 1.00 45.74 ? 90  VAL B CB  1 
ATOM   3399 C  CG1 . VAL B 1 90  ? 34.914  -14.279 -33.390 1.00 45.23 ? 90  VAL B CG1 1 
ATOM   3400 C  CG2 . VAL B 1 90  ? 35.803  -15.301 -35.486 1.00 48.59 ? 90  VAL B CG2 1 
ATOM   3401 N  N   . VAL B 1 91  ? 34.545  -16.918 -31.224 1.00 41.18 ? 91  VAL B N   1 
ATOM   3402 C  CA  . VAL B 1 91  ? 33.703  -17.347 -30.121 1.00 41.88 ? 91  VAL B CA  1 
ATOM   3403 C  C   . VAL B 1 91  ? 33.004  -16.148 -29.511 1.00 38.42 ? 91  VAL B C   1 
ATOM   3404 O  O   . VAL B 1 91  ? 33.662  -15.177 -29.134 1.00 42.61 ? 91  VAL B O   1 
ATOM   3405 C  CB  . VAL B 1 91  ? 34.568  -18.003 -29.028 1.00 41.43 ? 91  VAL B CB  1 
ATOM   3406 C  CG1 . VAL B 1 91  ? 33.727  -18.333 -27.793 1.00 41.04 ? 91  VAL B CG1 1 
ATOM   3407 C  CG2 . VAL B 1 91  ? 35.262  -19.239 -29.589 1.00 42.46 ? 91  VAL B CG2 1 
ATOM   3408 N  N   . VAL B 1 92  ? 31.680  -16.210 -29.414 1.00 38.69 ? 92  VAL B N   1 
ATOM   3409 C  CA  . VAL B 1 92  ? 30.951  -15.260 -28.577 1.00 38.15 ? 92  VAL B CA  1 
ATOM   3410 C  C   . VAL B 1 92  ? 30.545  -15.972 -27.281 1.00 38.86 ? 92  VAL B C   1 
ATOM   3411 O  O   . VAL B 1 92  ? 29.725  -16.887 -27.305 1.00 34.90 ? 92  VAL B O   1 
ATOM   3412 C  CB  . VAL B 1 92  ? 29.703  -14.708 -29.280 1.00 40.65 ? 92  VAL B CB  1 
ATOM   3413 C  CG1 . VAL B 1 92  ? 28.992  -13.711 -28.374 1.00 38.91 ? 92  VAL B CG1 1 
ATOM   3414 C  CG2 . VAL B 1 92  ? 30.089  -14.053 -30.605 1.00 40.38 ? 92  VAL B CG2 1 
ATOM   3415 N  N   . ASP B 1 93  ? 31.123  -15.553 -26.160 1.00 40.04 ? 93  ASP B N   1 
ATOM   3416 C  CA  . ASP B 1 93  ? 30.939  -16.265 -24.890 1.00 41.83 ? 93  ASP B CA  1 
ATOM   3417 C  C   . ASP B 1 93  ? 29.932  -15.572 -23.978 1.00 41.45 ? 93  ASP B C   1 
ATOM   3418 O  O   . ASP B 1 93  ? 30.138  -14.427 -23.584 1.00 40.03 ? 93  ASP B O   1 
ATOM   3419 C  CB  . ASP B 1 93  ? 32.275  -16.402 -24.154 1.00 43.57 ? 93  ASP B CB  1 
ATOM   3420 C  CG  . ASP B 1 93  ? 32.182  -17.336 -22.946 1.00 47.41 ? 93  ASP B CG  1 
ATOM   3421 O  OD1 . ASP B 1 93  ? 31.331  -18.261 -22.953 1.00 49.33 ? 93  ASP B OD1 1 
ATOM   3422 O  OD2 . ASP B 1 93  ? 32.948  -17.135 -21.989 1.00 45.00 ? 93  ASP B OD2 1 
ATOM   3423 N  N   . ASN B 1 94  ? 28.868  -16.295 -23.620 1.00 46.18 ? 94  ASN B N   1 
ATOM   3424 C  CA  . ASN B 1 94  ? 27.865  -15.803 -22.665 1.00 47.30 ? 94  ASN B CA  1 
ATOM   3425 C  C   . ASN B 1 94  ? 28.289  -15.815 -21.196 1.00 47.63 ? 94  ASN B C   1 
ATOM   3426 O  O   . ASN B 1 94  ? 27.697  -15.100 -20.384 1.00 52.81 ? 94  ASN B O   1 
ATOM   3427 C  CB  . ASN B 1 94  ? 26.558  -16.593 -22.787 1.00 52.88 ? 94  ASN B CB  1 
ATOM   3428 C  CG  . ASN B 1 94  ? 25.541  -15.902 -23.653 1.00 56.95 ? 94  ASN B CG  1 
ATOM   3429 O  OD1 . ASN B 1 94  ? 25.102  -16.443 -24.672 1.00 65.66 ? 94  ASN B OD1 1 
ATOM   3430 N  ND2 . ASN B 1 94  ? 25.161  -14.697 -23.262 1.00 60.21 ? 94  ASN B ND2 1 
ATOM   3431 N  N   . THR B 1 95  ? 29.319  -16.584 -20.857 1.00 44.94 ? 95  THR B N   1 
ATOM   3432 C  CA  . THR B 1 95  ? 29.730  -16.750 -19.464 1.00 42.37 ? 95  THR B CA  1 
ATOM   3433 C  C   . THR B 1 95  ? 30.574  -15.581 -18.969 1.00 42.36 ? 95  THR B C   1 
ATOM   3434 O  O   . THR B 1 95  ? 30.971  -14.707 -19.738 1.00 42.16 ? 95  THR B O   1 
ATOM   3435 C  CB  . THR B 1 95  ? 30.522  -18.057 -19.231 1.00 43.19 ? 95  THR B CB  1 
ATOM   3436 O  OG1 . THR B 1 95  ? 31.865  -17.902 -19.709 1.00 41.15 ? 95  THR B OG1 1 
ATOM   3437 C  CG2 . THR B 1 95  ? 29.832  -19.277 -19.902 1.00 41.99 ? 95  THR B CG2 1 
ATOM   3438 N  N   . SER B 1 96  ? 30.830  -15.569 -17.667 1.00 38.36 ? 96  SER B N   1 
ATOM   3439 C  CA  . SER B 1 96  ? 31.586  -14.507 -17.035 1.00 39.24 ? 96  SER B CA  1 
ATOM   3440 C  C   . SER B 1 96  ? 33.098  -14.747 -17.089 1.00 38.18 ? 96  SER B C   1 
ATOM   3441 O  O   . SER B 1 96  ? 33.863  -13.856 -16.731 1.00 39.10 ? 96  SER B O   1 
ATOM   3442 C  CB  . SER B 1 96  ? 31.162  -14.371 -15.582 1.00 41.22 ? 96  SER B CB  1 
ATOM   3443 O  OG  . SER B 1 96  ? 31.540  -15.529 -14.861 1.00 44.20 ? 96  SER B OG  1 
ATOM   3444 N  N   . TYR B 1 97  ? 33.523  -15.917 -17.566 1.00 38.87 ? 97  TYR B N   1 
ATOM   3445 C  CA  . TYR B 1 97  ? 34.933  -16.327 -17.463 1.00 40.48 ? 97  TYR B CA  1 
ATOM   3446 C  C   . TYR B 1 97  ? 35.953  -15.365 -18.081 1.00 40.00 ? 97  TYR B C   1 
ATOM   3447 O  O   . TYR B 1 97  ? 36.961  -15.025 -17.456 1.00 41.18 ? 97  TYR B O   1 
ATOM   3448 C  CB  . TYR B 1 97  ? 35.132  -17.706 -18.083 1.00 44.07 ? 97  TYR B CB  1 
ATOM   3449 C  CG  . TYR B 1 97  ? 36.453  -18.312 -17.690 1.00 46.83 ? 97  TYR B CG  1 
ATOM   3450 C  CD1 . TYR B 1 97  ? 36.654  -18.802 -16.400 1.00 48.17 ? 97  TYR B CD1 1 
ATOM   3451 C  CD2 . TYR B 1 97  ? 37.514  -18.367 -18.590 1.00 49.09 ? 97  TYR B CD2 1 
ATOM   3452 C  CE1 . TYR B 1 97  ? 37.872  -19.347 -16.025 1.00 50.66 ? 97  TYR B CE1 1 
ATOM   3453 C  CE2 . TYR B 1 97  ? 38.734  -18.909 -18.225 1.00 51.18 ? 97  TYR B CE2 1 
ATOM   3454 C  CZ  . TYR B 1 97  ? 38.904  -19.399 -16.939 1.00 53.36 ? 97  TYR B CZ  1 
ATOM   3455 O  OH  . TYR B 1 97  ? 40.108  -19.936 -16.562 1.00 58.24 ? 97  TYR B OH  1 
ATOM   3456 N  N   . PHE B 1 98  ? 35.694  -14.941 -19.311 1.00 39.74 ? 98  PHE B N   1 
ATOM   3457 C  CA  . PHE B 1 98  ? 36.639  -14.142 -20.059 1.00 40.45 ? 98  PHE B CA  1 
ATOM   3458 C  C   . PHE B 1 98  ? 36.380  -12.636 -19.978 1.00 43.25 ? 98  PHE B C   1 
ATOM   3459 O  O   . PHE B 1 98  ? 37.112  -11.856 -20.608 1.00 44.81 ? 98  PHE B O   1 
ATOM   3460 C  CB  . PHE B 1 98  ? 36.650  -14.597 -21.529 1.00 40.21 ? 98  PHE B CB  1 
ATOM   3461 C  CG  . PHE B 1 98  ? 37.247  -15.965 -21.745 1.00 38.76 ? 98  PHE B CG  1 
ATOM   3462 C  CD1 . PHE B 1 98  ? 38.627  -16.165 -21.616 1.00 39.84 ? 98  PHE B CD1 1 
ATOM   3463 C  CD2 . PHE B 1 98  ? 36.452  -17.048 -22.088 1.00 37.94 ? 98  PHE B CD2 1 
ATOM   3464 C  CE1 . PHE B 1 98  ? 39.183  -17.415 -21.812 1.00 39.88 ? 98  PHE B CE1 1 
ATOM   3465 C  CE2 . PHE B 1 98  ? 37.008  -18.309 -22.288 1.00 40.30 ? 98  PHE B CE2 1 
ATOM   3466 C  CZ  . PHE B 1 98  ? 38.381  -18.490 -22.150 1.00 39.98 ? 98  PHE B CZ  1 
ATOM   3467 N  N   . ARG B 1 99  ? 35.366  -12.216 -19.209 1.00 42.05 ? 99  ARG B N   1 
ATOM   3468 C  CA  . ARG B 1 99  ? 34.852  -10.840 -19.305 1.00 42.03 ? 99  ARG B CA  1 
ATOM   3469 C  C   . ARG B 1 99  ? 35.844  -9.759  -18.896 1.00 41.76 ? 99  ARG B C   1 
ATOM   3470 O  O   . ARG B 1 99  ? 35.809  -8.653  -19.441 1.00 41.00 ? 99  ARG B O   1 
ATOM   3471 C  CB  . ARG B 1 99  ? 33.567  -10.669 -18.497 1.00 39.65 ? 99  ARG B CB  1 
ATOM   3472 C  CG  . ARG B 1 99  ? 32.373  -11.389 -19.096 1.00 40.39 ? 99  ARG B CG  1 
ATOM   3473 C  CD  . ARG B 1 99  ? 31.071  -10.939 -18.450 1.00 37.97 ? 99  ARG B CD  1 
ATOM   3474 N  NE  . ARG B 1 99  ? 29.940  -11.790 -18.837 1.00 39.52 ? 99  ARG B NE  1 
ATOM   3475 C  CZ  . ARG B 1 99  ? 29.038  -12.329 -18.009 1.00 40.32 ? 99  ARG B CZ  1 
ATOM   3476 N  NH1 . ARG B 1 99  ? 29.052  -12.079 -16.702 1.00 40.31 ? 99  ARG B NH1 1 
ATOM   3477 N  NH2 . ARG B 1 99  ? 28.076  -13.100 -18.509 1.00 41.09 ? 99  ARG B NH2 1 
ATOM   3478 N  N   . GLN B 1 100 ? 36.713  -10.071 -17.940 1.00 40.93 ? 100 GLN B N   1 
ATOM   3479 C  CA  . GLN B 1 100 ? 37.653  -9.093  -17.409 1.00 42.65 ? 100 GLN B CA  1 
ATOM   3480 C  C   . GLN B 1 100 ? 39.069  -9.323  -17.937 1.00 43.97 ? 100 GLN B C   1 
ATOM   3481 O  O   . GLN B 1 100 ? 40.025  -8.791  -17.397 1.00 46.95 ? 100 GLN B O   1 
ATOM   3482 C  CB  . GLN B 1 100 ? 37.617  -9.099  -15.869 1.00 45.71 ? 100 GLN B CB  1 
ATOM   3483 C  CG  . GLN B 1 100 ? 36.247  -8.766  -15.266 1.00 45.27 ? 100 GLN B CG  1 
ATOM   3484 C  CD  . GLN B 1 100 ? 35.673  -7.432  -15.738 1.00 47.16 ? 100 GLN B CD  1 
ATOM   3485 O  OE1 . GLN B 1 100 ? 36.371  -6.415  -15.783 1.00 50.82 ? 100 GLN B OE1 1 
ATOM   3486 N  NE2 . GLN B 1 100 ? 34.398  -7.431  -16.096 1.00 45.67 ? 100 GLN B NE2 1 
ATOM   3487 N  N   . ASN B 1 101 ? 39.182  -10.100 -19.015 1.00 45.48 ? 101 ASN B N   1 
ATOM   3488 C  CA  . ASN B 1 101 ? 40.437  -10.308 -19.720 1.00 44.76 ? 101 ASN B CA  1 
ATOM   3489 C  C   . ASN B 1 101 ? 40.653  -9.160  -20.716 1.00 44.17 ? 101 ASN B C   1 
ATOM   3490 O  O   . ASN B 1 101 ? 39.816  -8.942  -21.602 1.00 38.24 ? 101 ASN B O   1 
ATOM   3491 C  CB  . ASN B 1 101 ? 40.372  -11.651 -20.448 1.00 45.81 ? 101 ASN B CB  1 
ATOM   3492 C  CG  . ASN B 1 101 ? 41.689  -12.050 -21.092 1.00 49.23 ? 101 ASN B CG  1 
ATOM   3493 O  OD1 . ASN B 1 101 ? 42.407  -11.227 -21.661 1.00 48.88 ? 101 ASN B OD1 1 
ATOM   3494 N  ND2 . ASN B 1 101 ? 41.996  -13.333 -21.021 1.00 49.76 ? 101 ASN B ND2 1 
ATOM   3495 N  N   . PRO B 1 102 ? 41.778  -8.424  -20.587 1.00 45.47 ? 102 PRO B N   1 
ATOM   3496 C  CA  . PRO B 1 102 ? 41.986  -7.230  -21.423 1.00 45.28 ? 102 PRO B CA  1 
ATOM   3497 C  C   . PRO B 1 102 ? 42.172  -7.523  -22.923 1.00 44.49 ? 102 PRO B C   1 
ATOM   3498 O  O   . PRO B 1 102 ? 42.058  -6.617  -23.745 1.00 47.00 ? 102 PRO B O   1 
ATOM   3499 C  CB  . PRO B 1 102 ? 43.248  -6.597  -20.819 1.00 49.02 ? 102 PRO B CB  1 
ATOM   3500 C  CG  . PRO B 1 102 ? 43.993  -7.751  -20.226 1.00 48.40 ? 102 PRO B CG  1 
ATOM   3501 C  CD  . PRO B 1 102 ? 42.949  -8.712  -19.732 1.00 46.68 ? 102 PRO B CD  1 
ATOM   3502 N  N   . ASP B 1 103 ? 42.446  -8.772  -23.270 1.00 42.37 ? 103 ASP B N   1 
ATOM   3503 C  CA  . ASP B 1 103 ? 42.442  -9.214  -24.653 1.00 43.70 ? 103 ASP B CA  1 
ATOM   3504 C  C   . ASP B 1 103 ? 41.034  -9.578  -25.176 1.00 43.93 ? 103 ASP B C   1 
ATOM   3505 O  O   . ASP B 1 103 ? 40.904  -10.022 -26.317 1.00 44.80 ? 103 ASP B O   1 
ATOM   3506 C  CB  . ASP B 1 103 ? 43.343  -10.441 -24.797 1.00 47.52 ? 103 ASP B CB  1 
ATOM   3507 C  CG  . ASP B 1 103 ? 44.778  -10.162 -24.388 1.00 50.77 ? 103 ASP B CG  1 
ATOM   3508 O  OD1 . ASP B 1 103 ? 45.268  -9.059  -24.681 1.00 49.29 ? 103 ASP B OD1 1 
ATOM   3509 O  OD2 . ASP B 1 103 ? 45.411  -11.045 -23.777 1.00 57.39 ? 103 ASP B OD2 1 
ATOM   3510 N  N   . VAL B 1 104 ? 39.992  -9.416  -24.357 1.00 41.24 ? 104 VAL B N   1 
ATOM   3511 C  CA  . VAL B 1 104 ? 38.634  -9.816  -24.745 1.00 39.25 ? 104 VAL B CA  1 
ATOM   3512 C  C   . VAL B 1 104 ? 37.676  -8.629  -24.686 1.00 39.02 ? 104 VAL B C   1 
ATOM   3513 O  O   . VAL B 1 104 ? 37.482  -8.043  -23.620 1.00 38.80 ? 104 VAL B O   1 
ATOM   3514 C  CB  . VAL B 1 104 ? 38.118  -10.949 -23.824 1.00 38.99 ? 104 VAL B CB  1 
ATOM   3515 C  CG1 . VAL B 1 104 ? 36.668  -11.302 -24.145 1.00 37.01 ? 104 VAL B CG1 1 
ATOM   3516 C  CG2 . VAL B 1 104 ? 39.005  -12.177 -23.979 1.00 39.50 ? 104 VAL B CG2 1 
ATOM   3517 N  N   . PRO B 1 105 ? 37.097  -8.242  -25.837 1.00 39.16 ? 105 PRO B N   1 
ATOM   3518 C  CA  . PRO B 1 105 ? 36.080  -7.202  -25.796 1.00 37.03 ? 105 PRO B CA  1 
ATOM   3519 C  C   . PRO B 1 105 ? 34.819  -7.679  -25.061 1.00 34.60 ? 105 PRO B C   1 
ATOM   3520 O  O   . PRO B 1 105 ? 34.404  -8.813  -25.249 1.00 32.98 ? 105 PRO B O   1 
ATOM   3521 C  CB  . PRO B 1 105 ? 35.767  -6.940  -27.279 1.00 38.70 ? 105 PRO B CB  1 
ATOM   3522 C  CG  . PRO B 1 105 ? 36.931  -7.494  -28.031 1.00 39.98 ? 105 PRO B CG  1 
ATOM   3523 C  CD  . PRO B 1 105 ? 37.405  -8.656  -27.220 1.00 39.79 ? 105 PRO B CD  1 
ATOM   3524 N  N   . LEU B 1 106 ? 34.263  -6.801  -24.230 1.00 34.28 ? 106 LEU B N   1 
ATOM   3525 C  CA  . LEU B 1 106 ? 33.032  -7.035  -23.485 1.00 37.15 ? 106 LEU B CA  1 
ATOM   3526 C  C   . LEU B 1 106 ? 31.976  -6.117  -24.068 1.00 34.01 ? 106 LEU B C   1 
ATOM   3527 O  O   . LEU B 1 106 ? 31.960  -4.914  -23.785 1.00 35.48 ? 106 LEU B O   1 
ATOM   3528 C  CB  . LEU B 1 106 ? 33.256  -6.691  -22.014 1.00 36.92 ? 106 LEU B CB  1 
ATOM   3529 C  CG  . LEU B 1 106 ? 32.106  -6.891  -21.033 1.00 38.12 ? 106 LEU B CG  1 
ATOM   3530 C  CD1 . LEU B 1 106 ? 31.740  -8.364  -20.966 1.00 38.86 ? 106 LEU B CD1 1 
ATOM   3531 C  CD2 . LEU B 1 106 ? 32.477  -6.336  -19.667 1.00 39.05 ? 106 LEU B CD2 1 
ATOM   3532 N  N   . VAL B 1 107 ? 31.063  -6.678  -24.844 1.00 33.65 ? 107 VAL B N   1 
ATOM   3533 C  CA  . VAL B 1 107 ? 30.308  -5.852  -25.779 1.00 33.60 ? 107 VAL B CA  1 
ATOM   3534 C  C   . VAL B 1 107 ? 28.784  -5.880  -25.650 1.00 33.89 ? 107 VAL B C   1 
ATOM   3535 O  O   . VAL B 1 107 ? 28.167  -6.942  -25.556 1.00 32.40 ? 107 VAL B O   1 
ATOM   3536 C  CB  . VAL B 1 107 ? 30.727  -6.188  -27.231 1.00 33.72 ? 107 VAL B CB  1 
ATOM   3537 C  CG1 . VAL B 1 107 ? 29.889  -5.418  -28.245 1.00 33.88 ? 107 VAL B CG1 1 
ATOM   3538 C  CG2 . VAL B 1 107 ? 32.203  -5.847  -27.414 1.00 34.23 ? 107 VAL B CG2 1 
ATOM   3539 N  N   . VAL B 1 108 ? 28.216  -4.675  -25.660 1.00 32.37 ? 108 VAL B N   1 
ATOM   3540 C  CA  . VAL B 1 108 ? 26.802  -4.437  -25.941 1.00 30.58 ? 108 VAL B CA  1 
ATOM   3541 C  C   . VAL B 1 108 ? 26.810  -3.652  -27.261 1.00 32.50 ? 108 VAL B C   1 
ATOM   3542 O  O   . VAL B 1 108 ? 27.253  -2.517  -27.269 1.00 32.15 ? 108 VAL B O   1 
ATOM   3543 C  CB  . VAL B 1 108 ? 26.174  -3.565  -24.834 1.00 30.96 ? 108 VAL B CB  1 
ATOM   3544 C  CG1 . VAL B 1 108 ? 24.705  -3.298  -25.135 1.00 31.41 ? 108 VAL B CG1 1 
ATOM   3545 C  CG2 . VAL B 1 108 ? 26.327  -4.244  -23.468 1.00 31.90 ? 108 VAL B CG2 1 
ATOM   3546 N  N   . PRO B 1 109 ? 26.350  -4.247  -28.370 1.00 34.37 ? 109 PRO B N   1 
ATOM   3547 C  CA  . PRO B 1 109 ? 26.588  -3.610  -29.687 1.00 33.73 ? 109 PRO B CA  1 
ATOM   3548 C  C   . PRO B 1 109 ? 26.133  -2.150  -29.835 1.00 38.63 ? 109 PRO B C   1 
ATOM   3549 O  O   . PRO B 1 109 ? 26.771  -1.396  -30.570 1.00 39.27 ? 109 PRO B O   1 
ATOM   3550 C  CB  . PRO B 1 109 ? 25.827  -4.516  -30.650 1.00 34.75 ? 109 PRO B CB  1 
ATOM   3551 C  CG  . PRO B 1 109 ? 25.851  -5.849  -29.989 1.00 34.64 ? 109 PRO B CG  1 
ATOM   3552 C  CD  . PRO B 1 109 ? 25.763  -5.582  -28.515 1.00 33.60 ? 109 PRO B CD  1 
ATOM   3553 N  N   . GLU B 1 110 ? 25.077  -1.736  -29.121 1.00 36.76 ? 110 GLU B N   1 
ATOM   3554 C  CA  . GLU B 1 110 ? 24.594  -0.371  -29.219 1.00 36.27 ? 110 GLU B CA  1 
ATOM   3555 C  C   . GLU B 1 110 ? 25.486  0.619   -28.502 1.00 35.82 ? 110 GLU B C   1 
ATOM   3556 O  O   . GLU B 1 110 ? 25.376  1.804   -28.730 1.00 37.98 ? 110 GLU B O   1 
ATOM   3557 C  CB  . GLU B 1 110 ? 23.161  -0.246  -28.679 1.00 35.64 ? 110 GLU B CB  1 
ATOM   3558 C  CG  . GLU B 1 110 ? 22.143  -1.094  -29.432 1.00 36.02 ? 110 GLU B CG  1 
ATOM   3559 C  CD  . GLU B 1 110 ? 21.887  -2.462  -28.800 1.00 35.43 ? 110 GLU B CD  1 
ATOM   3560 O  OE1 . GLU B 1 110 ? 22.747  -2.956  -28.035 1.00 32.92 ? 110 GLU B OE1 1 
ATOM   3561 O  OE2 . GLU B 1 110 ? 20.838  -3.054  -29.113 1.00 34.53 ? 110 GLU B OE2 1 
ATOM   3562 N  N   . VAL B 1 111 ? 26.377  0.139   -27.656 1.00 36.06 ? 111 VAL B N   1 
ATOM   3563 C  CA  . VAL B 1 111 ? 27.163  1.005   -26.790 1.00 38.43 ? 111 VAL B CA  1 
ATOM   3564 C  C   . VAL B 1 111 ? 28.639  1.017   -27.189 1.00 37.29 ? 111 VAL B C   1 
ATOM   3565 O  O   . VAL B 1 111 ? 29.246  2.087   -27.298 1.00 39.50 ? 111 VAL B O   1 
ATOM   3566 C  CB  . VAL B 1 111 ? 27.021  0.548   -25.307 1.00 39.88 ? 111 VAL B CB  1 
ATOM   3567 C  CG1 . VAL B 1 111 ? 27.861  1.409   -24.374 1.00 41.92 ? 111 VAL B CG1 1 
ATOM   3568 C  CG2 . VAL B 1 111 ? 25.551  0.564   -24.894 1.00 39.69 ? 111 VAL B CG2 1 
ATOM   3569 N  N   . ASN B 1 112 ? 29.221  -0.153  -27.401 1.00 33.32 ? 112 ASN B N   1 
ATOM   3570 C  CA  . ASN B 1 112 ? 30.651  -0.233  -27.743 1.00 34.18 ? 112 ASN B CA  1 
ATOM   3571 C  C   . ASN B 1 112 ? 31.003  -1.271  -28.811 1.00 35.11 ? 112 ASN B C   1 
ATOM   3572 O  O   . ASN B 1 112 ? 32.000  -2.015  -28.682 1.00 37.23 ? 112 ASN B O   1 
ATOM   3573 C  CB  . ASN B 1 112 ? 31.455  -0.492  -26.488 1.00 34.30 ? 112 ASN B CB  1 
ATOM   3574 C  CG  . ASN B 1 112 ? 31.102  -1.809  -25.846 1.00 34.87 ? 112 ASN B CG  1 
ATOM   3575 O  OD1 . ASN B 1 112 ? 30.004  -2.343  -26.058 1.00 33.01 ? 112 ASN B OD1 1 
ATOM   3576 N  ND2 . ASN B 1 112 ? 32.025  -2.347  -25.078 1.00 34.90 ? 112 ASN B ND2 1 
ATOM   3577 N  N   . ALA B 1 113 ? 30.210  -1.301  -29.881 1.00 34.10 ? 113 ALA B N   1 
ATOM   3578 C  CA  . ALA B 1 113 ? 30.507  -2.163  -31.026 1.00 35.18 ? 113 ALA B CA  1 
ATOM   3579 C  C   . ALA B 1 113 ? 31.941  -2.002  -31.531 1.00 37.05 ? 113 ALA B C   1 
ATOM   3580 O  O   . ALA B 1 113 ? 32.518  -2.963  -32.013 1.00 36.54 ? 113 ALA B O   1 
ATOM   3581 C  CB  . ALA B 1 113 ? 29.525  -1.921  -32.165 1.00 35.62 ? 113 ALA B CB  1 
ATOM   3582 N  N   . HIS B 1 114 ? 32.486  -0.792  -31.438 1.00 40.44 ? 114 HIS B N   1 
ATOM   3583 C  CA  . HIS B 1 114 ? 33.845  -0.507  -31.909 1.00 45.65 ? 114 HIS B CA  1 
ATOM   3584 C  C   . HIS B 1 114 ? 34.899  -1.414  -31.256 1.00 43.93 ? 114 HIS B C   1 
ATOM   3585 O  O   . HIS B 1 114 ? 35.864  -1.816  -31.904 1.00 40.16 ? 114 HIS B O   1 
ATOM   3586 C  CB  . HIS B 1 114 ? 34.191  0.957   -31.667 1.00 49.11 ? 114 HIS B CB  1 
ATOM   3587 C  CG  . HIS B 1 114 ? 34.342  1.307   -30.218 1.00 58.33 ? 114 HIS B CG  1 
ATOM   3588 N  ND1 . HIS B 1 114 ? 35.522  1.119   -29.528 1.00 62.42 ? 114 HIS B ND1 1 
ATOM   3589 C  CD2 . HIS B 1 114 ? 33.459  1.818   -29.324 1.00 60.51 ? 114 HIS B CD2 1 
ATOM   3590 C  CE1 . HIS B 1 114 ? 35.363  1.509   -28.275 1.00 63.40 ? 114 HIS B CE1 1 
ATOM   3591 N  NE2 . HIS B 1 114 ? 34.120  1.933   -28.123 1.00 60.94 ? 114 HIS B NE2 1 
ATOM   3592 N  N   . ALA B 1 115 ? 34.693  -1.755  -29.982 1.00 41.92 ? 115 ALA B N   1 
ATOM   3593 C  CA  . ALA B 1 115 ? 35.596  -2.652  -29.264 1.00 41.71 ? 115 ALA B CA  1 
ATOM   3594 C  C   . ALA B 1 115 ? 35.770  -4.007  -29.937 1.00 39.45 ? 115 ALA B C   1 
ATOM   3595 O  O   . ALA B 1 115 ? 36.768  -4.679  -29.708 1.00 38.53 ? 115 ALA B O   1 
ATOM   3596 C  CB  . ALA B 1 115 ? 35.117  -2.847  -27.828 1.00 42.32 ? 115 ALA B CB  1 
ATOM   3597 N  N   . LEU B 1 116 ? 34.798  -4.416  -30.753 1.00 37.35 ? 116 LEU B N   1 
ATOM   3598 C  CA  . LEU B 1 116 ? 34.879  -5.673  -31.514 1.00 37.83 ? 116 LEU B CA  1 
ATOM   3599 C  C   . LEU B 1 116 ? 36.060  -5.744  -32.503 1.00 39.40 ? 116 LEU B C   1 
ATOM   3600 O  O   . LEU B 1 116 ? 36.559  -6.843  -32.798 1.00 36.54 ? 116 LEU B O   1 
ATOM   3601 C  CB  . LEU B 1 116 ? 33.591  -5.886  -32.334 1.00 39.40 ? 116 LEU B CB  1 
ATOM   3602 C  CG  . LEU B 1 116 ? 32.250  -6.081  -31.625 1.00 40.46 ? 116 LEU B CG  1 
ATOM   3603 C  CD1 . LEU B 1 116 ? 31.095  -5.977  -32.618 1.00 39.23 ? 116 LEU B CD1 1 
ATOM   3604 C  CD2 . LEU B 1 116 ? 32.193  -7.419  -30.889 1.00 42.00 ? 116 LEU B CD2 1 
ATOM   3605 N  N   . ASP B 1 117 ? 36.468  -4.594  -33.040 1.00 39.31 ? 117 ASP B N   1 
ATOM   3606 C  CA  . ASP B 1 117 ? 37.460  -4.540  -34.125 1.00 42.90 ? 117 ASP B CA  1 
ATOM   3607 C  C   . ASP B 1 117 ? 38.797  -5.170  -33.727 1.00 44.46 ? 117 ASP B C   1 
ATOM   3608 O  O   . ASP B 1 117 ? 39.474  -5.766  -34.564 1.00 43.08 ? 117 ASP B O   1 
ATOM   3609 C  CB  . ASP B 1 117 ? 37.711  -3.093  -34.592 1.00 43.94 ? 117 ASP B CB  1 
ATOM   3610 C  CG  . ASP B 1 117 ? 36.486  -2.447  -35.257 1.00 46.39 ? 117 ASP B CG  1 
ATOM   3611 O  OD1 . ASP B 1 117 ? 35.578  -3.169  -35.726 1.00 42.89 ? 117 ASP B OD1 1 
ATOM   3612 O  OD2 . ASP B 1 117 ? 36.435  -1.195  -35.304 1.00 49.30 ? 117 ASP B OD2 1 
ATOM   3613 N  N   . ALA B 1 118 ? 39.159  -5.054  -32.454 1.00 43.20 ? 118 ALA B N   1 
ATOM   3614 C  CA  . ALA B 1 118 ? 40.445  -5.554  -31.965 1.00 47.00 ? 118 ALA B CA  1 
ATOM   3615 C  C   . ALA B 1 118 ? 40.370  -6.963  -31.341 1.00 47.92 ? 118 ALA B C   1 
ATOM   3616 O  O   . ALA B 1 118 ? 41.292  -7.367  -30.640 1.00 46.60 ? 118 ALA B O   1 
ATOM   3617 C  CB  . ALA B 1 118 ? 41.022  -4.563  -30.956 1.00 44.44 ? 118 ALA B CB  1 
ATOM   3618 N  N   . HIS B 1 119 ? 39.297  -7.713  -31.594 1.00 44.82 ? 119 HIS B N   1 
ATOM   3619 C  CA  . HIS B 1 119 ? 39.147  -9.022  -30.951 1.00 45.97 ? 119 HIS B CA  1 
ATOM   3620 C  C   . HIS B 1 119 ? 40.221  -10.041 -31.337 1.00 46.83 ? 119 HIS B C   1 
ATOM   3621 O  O   . HIS B 1 119 ? 40.746  -10.011 -32.449 1.00 44.57 ? 119 HIS B O   1 
ATOM   3622 C  CB  . HIS B 1 119 ? 37.756  -9.608  -31.197 1.00 46.00 ? 119 HIS B CB  1 
ATOM   3623 C  CG  . HIS B 1 119 ? 37.565  -10.268 -32.531 1.00 43.67 ? 119 HIS B CG  1 
ATOM   3624 N  ND1 . HIS B 1 119 ? 38.016  -11.539 -32.809 1.00 44.45 ? 119 HIS B ND1 1 
ATOM   3625 C  CD2 . HIS B 1 119 ? 36.889  -9.867  -33.633 1.00 43.74 ? 119 HIS B CD2 1 
ATOM   3626 C  CE1 . HIS B 1 119 ? 37.667  -11.877 -34.036 1.00 44.80 ? 119 HIS B CE1 1 
ATOM   3627 N  NE2 . HIS B 1 119 ? 36.976  -10.879 -34.557 1.00 42.86 ? 119 HIS B NE2 1 
ATOM   3628 N  N   . ASN B 1 120 ? 40.514  -10.936 -30.396 1.00 44.90 ? 120 ASN B N   1 
ATOM   3629 C  CA  . ASN B 1 120 ? 41.513  -11.993 -30.554 1.00 43.84 ? 120 ASN B CA  1 
ATOM   3630 C  C   . ASN B 1 120 ? 40.884  -13.381 -30.571 1.00 42.34 ? 120 ASN B C   1 
ATOM   3631 O  O   . ASN B 1 120 ? 41.512  -14.356 -30.183 1.00 46.88 ? 120 ASN B O   1 
ATOM   3632 C  CB  . ASN B 1 120 ? 42.543  -11.890 -29.425 1.00 43.00 ? 120 ASN B CB  1 
ATOM   3633 C  CG  . ASN B 1 120 ? 43.214  -10.527 -29.379 1.00 40.72 ? 120 ASN B CG  1 
ATOM   3634 O  OD1 . ASN B 1 120 ? 44.005  -10.190 -30.255 1.00 42.77 ? 120 ASN B OD1 1 
ATOM   3635 N  ND2 . ASN B 1 120 ? 42.892  -9.732  -28.376 1.00 38.26 ? 120 ASN B ND2 1 
ATOM   3636 N  N   . GLY B 1 121 ? 39.618  -13.456 -30.983 1.00 39.91 ? 121 GLY B N   1 
ATOM   3637 C  CA  . GLY B 1 121 ? 38.923  -14.714 -31.237 1.00 40.28 ? 121 GLY B CA  1 
ATOM   3638 C  C   . GLY B 1 121 ? 37.790  -15.006 -30.255 1.00 39.22 ? 121 GLY B C   1 
ATOM   3639 O  O   . GLY B 1 121 ? 36.962  -15.894 -30.490 1.00 40.83 ? 121 GLY B O   1 
ATOM   3640 N  N   . ILE B 1 122 ? 37.752  -14.246 -29.166 1.00 40.55 ? 122 ILE B N   1 
ATOM   3641 C  CA  . ILE B 1 122 ? 36.716  -14.369 -28.147 1.00 40.08 ? 122 ILE B CA  1 
ATOM   3642 C  C   . ILE B 1 122 ? 36.097  -12.998 -27.892 1.00 37.62 ? 122 ILE B C   1 
ATOM   3643 O  O   . ILE B 1 122 ? 36.794  -12.035 -27.583 1.00 36.43 ? 122 ILE B O   1 
ATOM   3644 C  CB  . ILE B 1 122 ? 37.296  -14.938 -26.833 1.00 41.18 ? 122 ILE B CB  1 
ATOM   3645 C  CG1 . ILE B 1 122 ? 37.825  -16.354 -27.075 1.00 43.47 ? 122 ILE B CG1 1 
ATOM   3646 C  CG2 . ILE B 1 122 ? 36.243  -14.968 -25.733 1.00 41.70 ? 122 ILE B CG2 1 
ATOM   3647 C  CD1 . ILE B 1 122 ? 38.614  -16.925 -25.913 1.00 45.77 ? 122 ILE B CD1 1 
ATOM   3648 N  N   . ILE B 1 123 ? 34.779  -12.914 -28.036 1.00 37.27 ? 123 ILE B N   1 
ATOM   3649 C  CA  . ILE B 1 123 ? 34.029  -11.745 -27.594 1.00 37.91 ? 123 ILE B CA  1 
ATOM   3650 C  C   . ILE B 1 123 ? 33.156  -12.188 -26.425 1.00 35.99 ? 123 ILE B C   1 
ATOM   3651 O  O   . ILE B 1 123 ? 32.472  -13.210 -26.544 1.00 36.67 ? 123 ILE B O   1 
ATOM   3652 C  CB  . ILE B 1 123 ? 33.078  -11.222 -28.687 1.00 40.61 ? 123 ILE B CB  1 
ATOM   3653 C  CG1 . ILE B 1 123 ? 33.821  -11.018 -30.002 1.00 43.73 ? 123 ILE B CG1 1 
ATOM   3654 C  CG2 . ILE B 1 123 ? 32.409  -9.935  -28.227 1.00 39.37 ? 123 ILE B CG2 1 
ATOM   3655 C  CD1 . ILE B 1 123 ? 34.948  -10.038 -29.891 1.00 48.84 ? 123 ILE B CD1 1 
ATOM   3656 N  N   . ALA B 1 124 ? 33.167  -11.429 -25.325 1.00 36.45 ? 124 ALA B N   1 
ATOM   3657 C  CA  . ALA B 1 124 ? 32.303  -11.734 -24.168 1.00 36.65 ? 124 ALA B CA  1 
ATOM   3658 C  C   . ALA B 1 124 ? 31.023  -10.919 -24.182 1.00 37.59 ? 124 ALA B C   1 
ATOM   3659 O  O   . ALA B 1 124 ? 31.043  -9.699  -24.313 1.00 38.10 ? 124 ALA B O   1 
ATOM   3660 C  CB  . ALA B 1 124 ? 33.017  -11.481 -22.865 1.00 37.38 ? 124 ALA B CB  1 
ATOM   3661 N  N   . CYS B 1 125 ? 29.916  -11.620 -24.019 1.00 37.30 ? 125 CYS B N   1 
ATOM   3662 C  CA  . CYS B 1 125 ? 28.647  -11.002 -23.733 1.00 38.73 ? 125 CYS B CA  1 
ATOM   3663 C  C   . CYS B 1 125 ? 28.638  -10.683 -22.237 1.00 37.41 ? 125 CYS B C   1 
ATOM   3664 O  O   . CYS B 1 125 ? 29.071  -11.514 -21.434 1.00 36.52 ? 125 CYS B O   1 
ATOM   3665 C  CB  . CYS B 1 125 ? 27.539  -11.989 -24.102 1.00 41.43 ? 125 CYS B CB  1 
ATOM   3666 S  SG  . CYS B 1 125 ? 25.889  -11.385 -23.770 1.00 44.26 ? 125 CYS B SG  1 
ATOM   3667 N  N   . PRO B 1 126 ? 28.181  -9.473  -21.845 1.00 35.74 ? 126 PRO B N   1 
ATOM   3668 C  CA  . PRO B 1 126 ? 28.150  -9.195  -20.411 1.00 35.30 ? 126 PRO B CA  1 
ATOM   3669 C  C   . PRO B 1 126 ? 27.028  -9.894  -19.652 1.00 35.61 ? 126 PRO B C   1 
ATOM   3670 O  O   . PRO B 1 126 ? 26.208  -10.588 -20.231 1.00 33.54 ? 126 PRO B O   1 
ATOM   3671 C  CB  . PRO B 1 126 ? 27.935  -7.671  -20.332 1.00 36.83 ? 126 PRO B CB  1 
ATOM   3672 C  CG  . PRO B 1 126 ? 28.193  -7.149  -21.725 1.00 36.00 ? 126 PRO B CG  1 
ATOM   3673 C  CD  . PRO B 1 126 ? 27.868  -8.280  -22.651 1.00 34.37 ? 126 PRO B CD  1 
ATOM   3674 N  N   . ASN B 1 127 ? 27.009  -9.645  -18.347 1.00 38.69 ? 127 ASN B N   1 
ATOM   3675 C  CA  . ASN B 1 127 ? 25.936  -10.057 -17.459 1.00 41.06 ? 127 ASN B CA  1 
ATOM   3676 C  C   . ASN B 1 127 ? 24.583  -9.470  -17.902 1.00 36.15 ? 127 ASN B C   1 
ATOM   3677 O  O   . ASN B 1 127 ? 24.516  -8.315  -18.301 1.00 32.83 ? 127 ASN B O   1 
ATOM   3678 C  CB  . ASN B 1 127 ? 26.298  -9.578  -16.049 1.00 45.48 ? 127 ASN B CB  1 
ATOM   3679 C  CG  . ASN B 1 127 ? 25.231  -9.876  -15.049 1.00 50.39 ? 127 ASN B CG  1 
ATOM   3680 O  OD1 . ASN B 1 127 ? 24.398  -9.023  -14.760 1.00 51.13 ? 127 ASN B OD1 1 
ATOM   3681 N  ND2 . ASN B 1 127 ? 25.224  -11.106 -14.530 1.00 52.32 ? 127 ASN B ND2 1 
ATOM   3682 N  N   . CYS B 1 128 ? 23.511  -10.256 -17.819 1.00 34.92 ? 128 CYS B N   1 
ATOM   3683 C  CA  . CYS B 1 128 ? 22.180  -9.783  -18.219 1.00 35.30 ? 128 CYS B CA  1 
ATOM   3684 C  C   . CYS B 1 128 ? 21.793  -8.465  -17.557 1.00 35.17 ? 128 CYS B C   1 
ATOM   3685 O  O   . CYS B 1 128 ? 21.386  -7.510  -18.235 1.00 37.41 ? 128 CYS B O   1 
ATOM   3686 C  CB  . CYS B 1 128 ? 21.111  -10.836 -17.934 1.00 38.45 ? 128 CYS B CB  1 
ATOM   3687 S  SG  . CYS B 1 128 ? 21.284  -11.690 -16.348 1.00 46.95 ? 128 CYS B SG  1 
ATOM   3688 N  N   . SER B 1 129 ? 21.938  -8.397  -16.238 1.00 31.82 ? 129 SER B N   1 
ATOM   3689 C  CA  A SER B 1 129 ? 21.546  -7.200  -15.500 0.50 31.97 ? 129 SER B CA  1 
ATOM   3690 C  CA  B SER B 1 129 ? 21.538  -7.211  -15.501 0.50 33.34 ? 129 SER B CA  1 
ATOM   3691 C  C   . SER B 1 129 ? 22.355  -5.985  -15.930 1.00 33.09 ? 129 SER B C   1 
ATOM   3692 O  O   . SER B 1 129 ? 21.837  -4.857  -15.969 1.00 34.11 ? 129 SER B O   1 
ATOM   3693 C  CB  A SER B 1 129 ? 21.694  -7.406  -13.990 0.50 31.04 ? 129 SER B CB  1 
ATOM   3694 C  CB  B SER B 1 129 ? 21.640  -7.460  -13.986 0.50 33.71 ? 129 SER B CB  1 
ATOM   3695 O  OG  A SER B 1 129 ? 21.039  -8.573  -13.569 0.50 29.40 ? 129 SER B OG  1 
ATOM   3696 O  OG  B SER B 1 129 ? 22.967  -7.791  -13.601 0.50 36.11 ? 129 SER B OG  1 
ATOM   3697 N  N   . THR B 1 130 ? 23.637  -6.195  -16.251 1.00 33.81 ? 130 THR B N   1 
ATOM   3698 C  CA  . THR B 1 130 ? 24.471  -5.088  -16.733 1.00 33.05 ? 130 THR B CA  1 
ATOM   3699 C  C   . THR B 1 130 ? 24.034  -4.591  -18.109 1.00 31.78 ? 130 THR B C   1 
ATOM   3700 O  O   . THR B 1 130 ? 23.999  -3.384  -18.374 1.00 31.68 ? 130 THR B O   1 
ATOM   3701 C  CB  . THR B 1 130 ? 25.946  -5.524  -16.820 1.00 34.51 ? 130 THR B CB  1 
ATOM   3702 O  OG1 . THR B 1 130 ? 26.390  -5.942  -15.524 1.00 32.88 ? 130 THR B OG1 1 
ATOM   3703 C  CG2 . THR B 1 130 ? 26.801  -4.398  -17.327 1.00 35.08 ? 130 THR B CG2 1 
ATOM   3704 N  N   . ILE B 1 131 ? 23.726  -5.523  -18.996 1.00 31.09 ? 131 ILE B N   1 
ATOM   3705 C  CA  . ILE B 1 131 ? 23.425  -5.177  -20.379 1.00 32.53 ? 131 ILE B CA  1 
ATOM   3706 C  C   . ILE B 1 131 ? 22.246  -4.221  -20.450 1.00 33.51 ? 131 ILE B C   1 
ATOM   3707 O  O   . ILE B 1 131 ? 22.328  -3.203  -21.134 1.00 31.68 ? 131 ILE B O   1 
ATOM   3708 C  CB  . ILE B 1 131 ? 23.099  -6.412  -21.249 1.00 32.24 ? 131 ILE B CB  1 
ATOM   3709 C  CG1 . ILE B 1 131 ? 24.336  -7.284  -21.442 1.00 33.79 ? 131 ILE B CG1 1 
ATOM   3710 C  CG2 . ILE B 1 131 ? 22.563  -5.992  -22.610 1.00 34.25 ? 131 ILE B CG2 1 
ATOM   3711 C  CD1 . ILE B 1 131 ? 24.020  -8.628  -22.051 1.00 33.61 ? 131 ILE B CD1 1 
ATOM   3712 N  N   . GLN B 1 132 ? 21.150  -4.549  -19.763 1.00 31.59 ? 132 GLN B N   1 
ATOM   3713 C  CA  . GLN B 1 132 ? 19.947  -3.742  -19.871 1.00 32.84 ? 132 GLN B CA  1 
ATOM   3714 C  C   . GLN B 1 132 ? 20.175  -2.382  -19.216 1.00 33.05 ? 132 GLN B C   1 
ATOM   3715 O  O   . GLN B 1 132 ? 19.675  -1.380  -19.695 1.00 32.63 ? 132 GLN B O   1 
ATOM   3716 C  CB  . GLN B 1 132 ? 18.708  -4.461  -19.303 1.00 32.47 ? 132 GLN B CB  1 
ATOM   3717 C  CG  . GLN B 1 132 ? 18.650  -4.585  -17.793 1.00 33.31 ? 132 GLN B CG  1 
ATOM   3718 C  CD  . GLN B 1 132 ? 17.451  -5.403  -17.337 1.00 31.62 ? 132 GLN B CD  1 
ATOM   3719 O  OE1 . GLN B 1 132 ? 17.282  -6.545  -17.751 1.00 32.37 ? 132 GLN B OE1 1 
ATOM   3720 N  NE2 . GLN B 1 132 ? 16.618  -4.822  -16.490 1.00 32.47 ? 132 GLN B NE2 1 
ATOM   3721 N  N   . MET B 1 133 ? 20.987  -2.338  -18.168 1.00 33.02 ? 133 MET B N   1 
ATOM   3722 C  CA  . MET B 1 133 ? 21.309  -1.061  -17.551 1.00 33.13 ? 133 MET B CA  1 
ATOM   3723 C  C   . MET B 1 133 ? 22.105  -0.169  -18.528 1.00 33.88 ? 133 MET B C   1 
ATOM   3724 O  O   . MET B 1 133 ? 21.839  1.026   -18.637 1.00 32.83 ? 133 MET B O   1 
ATOM   3725 C  CB  . MET B 1 133 ? 22.071  -1.272  -16.252 1.00 34.97 ? 133 MET B CB  1 
ATOM   3726 C  CG  . MET B 1 133 ? 22.224  0.013   -15.458 1.00 36.49 ? 133 MET B CG  1 
ATOM   3727 S  SD  . MET B 1 133 ? 22.812  -0.261  -13.784 1.00 35.51 ? 133 MET B SD  1 
ATOM   3728 C  CE  . MET B 1 133 ? 24.496  -0.780  -14.077 1.00 36.55 ? 133 MET B CE  1 
ATOM   3729 N  N   . MET B 1 134 ? 23.052  -0.769  -19.249 1.00 34.81 ? 134 MET B N   1 
ATOM   3730 C  CA  . MET B 1 134 ? 23.901  -0.038  -20.221 1.00 35.13 ? 134 MET B CA  1 
ATOM   3731 C  C   . MET B 1 134 ? 23.080  0.528   -21.380 1.00 35.31 ? 134 MET B C   1 
ATOM   3732 O  O   . MET B 1 134 ? 23.324  1.647   -21.835 1.00 33.59 ? 134 MET B O   1 
ATOM   3733 C  CB  . MET B 1 134 ? 24.986  -0.950  -20.796 1.00 35.42 ? 134 MET B CB  1 
ATOM   3734 C  CG  . MET B 1 134 ? 26.064  -1.403  -19.811 1.00 36.62 ? 134 MET B CG  1 
ATOM   3735 S  SD  . MET B 1 134 ? 26.954  -0.054  -19.013 1.00 37.57 ? 134 MET B SD  1 
ATOM   3736 C  CE  . MET B 1 134 ? 26.054  0.234   -17.488 1.00 37.98 ? 134 MET B CE  1 
ATOM   3737 N  N   . VAL B 1 135 ? 22.127  -0.252  -21.876 1.00 34.97 ? 135 VAL B N   1 
ATOM   3738 C  CA  . VAL B 1 135 ? 21.239  0.226   -22.949 1.00 33.83 ? 135 VAL B CA  1 
ATOM   3739 C  C   . VAL B 1 135 ? 20.449  1.443   -22.481 1.00 33.51 ? 135 VAL B C   1 
ATOM   3740 O  O   . VAL B 1 135 ? 20.290  2.409   -23.222 1.00 31.67 ? 135 VAL B O   1 
ATOM   3741 C  CB  . VAL B 1 135 ? 20.294  -0.890  -23.429 1.00 33.55 ? 135 VAL B CB  1 
ATOM   3742 C  CG1 . VAL B 1 135 ? 19.210  -0.352  -24.356 1.00 33.86 ? 135 VAL B CG1 1 
ATOM   3743 C  CG2 . VAL B 1 135 ? 21.090  -1.995  -24.131 1.00 34.54 ? 135 VAL B CG2 1 
ATOM   3744 N  N   . ALA B 1 136 ? 19.946  1.397   -21.249 1.00 33.49 ? 136 ALA B N   1 
ATOM   3745 C  CA  . ALA B 1 136 ? 19.189  2.520   -20.676 1.00 32.11 ? 136 ALA B CA  1 
ATOM   3746 C  C   . ALA B 1 136 ? 20.019  3.763   -20.390 1.00 32.02 ? 136 ALA B C   1 
ATOM   3747 O  O   . ALA B 1 136 ? 19.514  4.871   -20.547 1.00 33.46 ? 136 ALA B O   1 
ATOM   3748 C  CB  . ALA B 1 136 ? 18.471  2.078   -19.395 1.00 32.27 ? 136 ALA B CB  1 
ATOM   3749 N  N   . LEU B 1 137 ? 21.264  3.587   -19.937 1.00 30.71 ? 137 LEU B N   1 
ATOM   3750 C  CA  . LEU B 1 137 ? 22.064  4.705   -19.426 1.00 32.51 ? 137 LEU B CA  1 
ATOM   3751 C  C   . LEU B 1 137 ? 23.035  5.343   -20.434 1.00 32.26 ? 137 LEU B C   1 
ATOM   3752 O  O   . LEU B 1 137 ? 23.330  6.520   -20.323 1.00 31.89 ? 137 LEU B O   1 
ATOM   3753 C  CB  . LEU B 1 137 ? 22.866  4.284   -18.195 1.00 32.35 ? 137 LEU B CB  1 
ATOM   3754 C  CG  . LEU B 1 137 ? 22.015  3.919   -16.979 1.00 32.53 ? 137 LEU B CG  1 
ATOM   3755 C  CD1 . LEU B 1 137 ? 22.926  3.494   -15.829 1.00 32.62 ? 137 LEU B CD1 1 
ATOM   3756 C  CD2 . LEU B 1 137 ? 21.083  5.070   -16.591 1.00 32.64 ? 137 LEU B CD2 1 
ATOM   3757 N  N   . GLU B 1 138 ? 23.506  4.573   -21.404 1.00 32.16 ? 138 GLU B N   1 
ATOM   3758 C  CA  . GLU B 1 138 ? 24.420  5.101   -22.418 1.00 33.60 ? 138 GLU B CA  1 
ATOM   3759 C  C   . GLU B 1 138 ? 23.936  6.400   -23.083 1.00 32.59 ? 138 GLU B C   1 
ATOM   3760 O  O   . GLU B 1 138 ? 24.736  7.316   -23.261 1.00 32.51 ? 138 GLU B O   1 
ATOM   3761 C  CB  . GLU B 1 138 ? 24.741  4.013   -23.450 1.00 33.93 ? 138 GLU B CB  1 
ATOM   3762 C  CG  . GLU B 1 138 ? 25.717  4.421   -24.547 1.00 37.03 ? 138 GLU B CG  1 
ATOM   3763 C  CD  . GLU B 1 138 ? 27.057  4.943   -24.027 1.00 38.43 ? 138 GLU B CD  1 
ATOM   3764 O  OE1 . GLU B 1 138 ? 27.410  4.742   -22.836 1.00 39.25 ? 138 GLU B OE1 1 
ATOM   3765 O  OE2 . GLU B 1 138 ? 27.757  5.581   -24.825 1.00 40.04 ? 138 GLU B OE2 1 
ATOM   3766 N  N   . PRO B 1 139 ? 22.639  6.500   -23.464 1.00 30.94 ? 139 PRO B N   1 
ATOM   3767 C  CA  . PRO B 1 139 ? 22.181  7.764   -24.056 1.00 30.69 ? 139 PRO B CA  1 
ATOM   3768 C  C   . PRO B 1 139 ? 22.226  8.951   -23.093 1.00 31.84 ? 139 PRO B C   1 
ATOM   3769 O  O   . PRO B 1 139 ? 22.360  10.086  -23.522 1.00 33.29 ? 139 PRO B O   1 
ATOM   3770 C  CB  . PRO B 1 139 ? 20.714  7.477   -24.466 1.00 31.09 ? 139 PRO B CB  1 
ATOM   3771 C  CG  . PRO B 1 139 ? 20.343  6.222   -23.754 1.00 31.31 ? 139 PRO B CG  1 
ATOM   3772 C  CD  . PRO B 1 139 ? 21.628  5.443   -23.597 1.00 31.34 ? 139 PRO B CD  1 
ATOM   3773 N  N   . VAL B 1 140 ? 22.125  8.693   -21.797 1.00 30.40 ? 140 VAL B N   1 
ATOM   3774 C  CA  . VAL B 1 140 ? 22.199  9.752   -20.797 1.00 30.83 ? 140 VAL B CA  1 
ATOM   3775 C  C   . VAL B 1 140 ? 23.674  10.120  -20.631 1.00 33.00 ? 140 VAL B C   1 
ATOM   3776 O  O   . VAL B 1 140 ? 24.031  11.312  -20.609 1.00 35.52 ? 140 VAL B O   1 
ATOM   3777 C  CB  . VAL B 1 140 ? 21.614  9.286   -19.433 1.00 32.90 ? 140 VAL B CB  1 
ATOM   3778 C  CG1 . VAL B 1 140 ? 21.775  10.371  -18.372 1.00 34.22 ? 140 VAL B CG1 1 
ATOM   3779 C  CG2 . VAL B 1 140 ? 20.148  8.903   -19.591 1.00 33.91 ? 140 VAL B CG2 1 
ATOM   3780 N  N   . ARG B 1 141 ? 24.523  9.109   -20.530 1.00 30.88 ? 141 ARG B N   1 
ATOM   3781 C  CA  . ARG B 1 141 ? 25.959  9.352   -20.369 1.00 34.70 ? 141 ARG B CA  1 
ATOM   3782 C  C   . ARG B 1 141 ? 26.504  10.194  -21.538 1.00 36.31 ? 141 ARG B C   1 
ATOM   3783 O  O   . ARG B 1 141 ? 27.280  11.135  -21.319 1.00 35.39 ? 141 ARG B O   1 
ATOM   3784 C  CB  . ARG B 1 141 ? 26.731  8.062   -20.276 1.00 35.07 ? 141 ARG B CB  1 
ATOM   3785 C  CG  . ARG B 1 141 ? 28.208  8.266   -19.925 1.00 37.65 ? 141 ARG B CG  1 
ATOM   3786 C  CD  . ARG B 1 141 ? 29.015  6.991   -20.093 1.00 40.41 ? 141 ARG B CD  1 
ATOM   3787 N  NE  . ARG B 1 141 ? 29.190  6.651   -21.494 1.00 45.59 ? 141 ARG B NE  1 
ATOM   3788 C  CZ  . ARG B 1 141 ? 30.080  7.204   -22.316 1.00 52.39 ? 141 ARG B CZ  1 
ATOM   3789 N  NH1 . ARG B 1 141 ? 30.928  8.135   -21.891 1.00 55.44 ? 141 ARG B NH1 1 
ATOM   3790 N  NH2 . ARG B 1 141 ? 30.125  6.820   -23.586 1.00 55.99 ? 141 ARG B NH2 1 
ATOM   3791 N  N   . GLN B 1 142 ? 26.083  9.857   -22.760 1.00 36.18 ? 142 GLN B N   1 
ATOM   3792 C  CA  . GLN B 1 142 ? 26.519  10.582  -23.963 1.00 38.68 ? 142 GLN B CA  1 
ATOM   3793 C  C   . GLN B 1 142 ? 26.268  12.088  -23.894 1.00 40.41 ? 142 GLN B C   1 
ATOM   3794 O  O   . GLN B 1 142 ? 27.103  12.865  -24.352 1.00 41.11 ? 142 GLN B O   1 
ATOM   3795 C  CB  . GLN B 1 142 ? 25.848  10.022  -25.212 1.00 39.46 ? 142 GLN B CB  1 
ATOM   3796 C  CG  . GLN B 1 142 ? 26.490  8.766   -25.752 1.00 43.04 ? 142 GLN B CG  1 
ATOM   3797 C  CD  . GLN B 1 142 ? 25.709  8.166   -26.918 1.00 46.94 ? 142 GLN B CD  1 
ATOM   3798 O  OE1 . GLN B 1 142 ? 24.761  8.762   -27.430 1.00 51.54 ? 142 GLN B OE1 1 
ATOM   3799 N  NE2 . GLN B 1 142 ? 26.115  6.982   -27.346 1.00 51.11 ? 142 GLN B NE2 1 
ATOM   3800 N  N   . LYS B 1 143 ? 25.133  12.504  -23.333 1.00 39.89 ? 143 LYS B N   1 
ATOM   3801 C  CA  . LYS B 1 143 ? 24.755  13.912  -23.327 1.00 39.91 ? 143 LYS B CA  1 
ATOM   3802 C  C   . LYS B 1 143 ? 25.072  14.658  -22.041 1.00 40.15 ? 143 LYS B C   1 
ATOM   3803 O  O   . LYS B 1 143 ? 25.364  15.842  -22.088 1.00 38.50 ? 143 LYS B O   1 
ATOM   3804 C  CB  . LYS B 1 143 ? 23.275  14.053  -23.620 1.00 42.18 ? 143 LYS B CB  1 
ATOM   3805 C  CG  . LYS B 1 143 ? 22.910  13.828  -25.072 1.00 43.45 ? 143 LYS B CG  1 
ATOM   3806 C  CD  . LYS B 1 143 ? 21.397  13.894  -25.230 1.00 43.19 ? 143 LYS B CD  1 
ATOM   3807 C  CE  . LYS B 1 143 ? 20.934  13.501  -26.623 1.00 48.26 ? 143 LYS B CE  1 
ATOM   3808 N  NZ  . LYS B 1 143 ? 20.870  14.661  -27.549 1.00 50.70 ? 143 LYS B NZ  1 
ATOM   3809 N  N   . TRP B 1 144 ? 24.991  13.998  -20.886 1.00 36.99 ? 144 TRP B N   1 
ATOM   3810 C  CA  . TRP B 1 144 ? 25.180  14.707  -19.620 1.00 36.37 ? 144 TRP B CA  1 
ATOM   3811 C  C   . TRP B 1 144 ? 26.176  14.049  -18.672 1.00 38.17 ? 144 TRP B C   1 
ATOM   3812 O  O   . TRP B 1 144 ? 26.399  14.560  -17.577 1.00 37.63 ? 144 TRP B O   1 
ATOM   3813 C  CB  . TRP B 1 144 ? 23.849  14.861  -18.901 1.00 36.32 ? 144 TRP B CB  1 
ATOM   3814 C  CG  . TRP B 1 144 ? 22.811  15.574  -19.684 1.00 36.73 ? 144 TRP B CG  1 
ATOM   3815 C  CD1 . TRP B 1 144 ? 22.689  16.921  -19.844 1.00 35.53 ? 144 TRP B CD1 1 
ATOM   3816 C  CD2 . TRP B 1 144 ? 21.721  14.981  -20.411 1.00 35.75 ? 144 TRP B CD2 1 
ATOM   3817 N  NE1 . TRP B 1 144 ? 21.582  17.208  -20.614 1.00 35.55 ? 144 TRP B NE1 1 
ATOM   3818 C  CE2 . TRP B 1 144 ? 20.988  16.036  -20.997 1.00 36.81 ? 144 TRP B CE2 1 
ATOM   3819 C  CE3 . TRP B 1 144 ? 21.315  13.663  -20.646 1.00 37.14 ? 144 TRP B CE3 1 
ATOM   3820 C  CZ2 . TRP B 1 144 ? 19.851  15.820  -21.784 1.00 39.37 ? 144 TRP B CZ2 1 
ATOM   3821 C  CZ3 . TRP B 1 144 ? 20.171  13.441  -21.425 1.00 37.05 ? 144 TRP B CZ3 1 
ATOM   3822 C  CH2 . TRP B 1 144 ? 19.458  14.518  -21.988 1.00 38.27 ? 144 TRP B CH2 1 
ATOM   3823 N  N   . GLY B 1 145 ? 26.744  12.913  -19.077 1.00 37.82 ? 145 GLY B N   1 
ATOM   3824 C  CA  . GLY B 1 145 ? 27.739  12.216  -18.279 1.00 37.93 ? 145 GLY B CA  1 
ATOM   3825 C  C   . GLY B 1 145 ? 27.123  11.377  -17.178 1.00 36.30 ? 145 GLY B C   1 
ATOM   3826 O  O   . GLY B 1 145 ? 25.927  11.462  -16.921 1.00 33.48 ? 145 GLY B O   1 
ATOM   3827 N  N   . LEU B 1 146 ? 27.962  10.553  -16.559 1.00 36.98 ? 146 LEU B N   1 
ATOM   3828 C  CA  . LEU B 1 146 ? 27.566  9.708   -15.427 1.00 39.01 ? 146 LEU B CA  1 
ATOM   3829 C  C   . LEU B 1 146 ? 28.636  9.756   -14.370 1.00 37.18 ? 146 LEU B C   1 
ATOM   3830 O  O   . LEU B 1 146 ? 29.766  9.351   -14.606 1.00 36.66 ? 146 LEU B O   1 
ATOM   3831 C  CB  . LEU B 1 146 ? 27.389  8.257   -15.847 1.00 39.90 ? 146 LEU B CB  1 
ATOM   3832 C  CG  . LEU B 1 146 ? 26.135  7.895   -16.625 1.00 44.65 ? 146 LEU B CG  1 
ATOM   3833 C  CD1 . LEU B 1 146 ? 26.132  6.389   -16.845 1.00 45.00 ? 146 LEU B CD1 1 
ATOM   3834 C  CD2 . LEU B 1 146 ? 24.874  8.362   -15.907 1.00 44.71 ? 146 LEU B CD2 1 
ATOM   3835 N  N   . ASP B 1 147 ? 28.255  10.239  -13.200 1.00 37.66 ? 147 ASP B N   1 
ATOM   3836 C  CA  . ASP B 1 147 ? 29.131  10.312  -12.062 1.00 36.88 ? 147 ASP B CA  1 
ATOM   3837 C  C   . ASP B 1 147 ? 29.017  9.061   -11.211 1.00 36.74 ? 147 ASP B C   1 
ATOM   3838 O  O   . ASP B 1 147 ? 30.031  8.516   -10.765 1.00 29.49 ? 147 ASP B O   1 
ATOM   3839 C  CB  . ASP B 1 147 ? 28.771  11.517  -11.220 1.00 38.84 ? 147 ASP B CB  1 
ATOM   3840 C  CG  . ASP B 1 147 ? 29.891  11.932  -10.298 1.00 43.32 ? 147 ASP B CG  1 
ATOM   3841 O  OD1 . ASP B 1 147 ? 31.024  11.405  -10.428 1.00 46.46 ? 147 ASP B OD1 1 
ATOM   3842 O  OD2 . ASP B 1 147 ? 29.633  12.788  -9.439  1.00 49.64 ? 147 ASP B OD2 1 
ATOM   3843 N  N   . ARG B 1 148 ? 27.783  8.614   -10.967 1.00 32.55 ? 148 ARG B N   1 
ATOM   3844 C  CA  . ARG B 1 148 ? 27.586  7.406   -10.155 1.00 33.12 ? 148 ARG B CA  1 
ATOM   3845 C  C   . ARG B 1 148 ? 26.283  6.691   -10.479 1.00 31.12 ? 148 ARG B C   1 
ATOM   3846 O  O   . ARG B 1 148 ? 25.364  7.306   -11.011 1.00 31.61 ? 148 ARG B O   1 
ATOM   3847 C  CB  . ARG B 1 148 ? 27.668  7.730   -8.654  1.00 34.55 ? 148 ARG B CB  1 
ATOM   3848 C  CG  . ARG B 1 148 ? 26.416  8.302   -8.025  1.00 34.05 ? 148 ARG B CG  1 
ATOM   3849 C  CD  . ARG B 1 148 ? 26.632  8.625   -6.547  1.00 35.66 ? 148 ARG B CD  1 
ATOM   3850 N  NE  . ARG B 1 148 ? 26.798  7.410   -5.732  1.00 34.44 ? 148 ARG B NE  1 
ATOM   3851 C  CZ  . ARG B 1 148 ? 26.721  7.359   -4.406  1.00 32.20 ? 148 ARG B CZ  1 
ATOM   3852 N  NH1 . ARG B 1 148 ? 26.470  8.447   -3.687  1.00 35.57 ? 148 ARG B NH1 1 
ATOM   3853 N  NH2 . ARG B 1 148 ? 26.860  6.191   -3.792  1.00 34.05 ? 148 ARG B NH2 1 
ATOM   3854 N  N   . ILE B 1 149 ? 26.244  5.392   -10.170 1.00 31.96 ? 149 ILE B N   1 
ATOM   3855 C  CA  . ILE B 1 149 ? 25.044  4.577   -10.309 1.00 30.65 ? 149 ILE B CA  1 
ATOM   3856 C  C   . ILE B 1 149 ? 24.833  3.831   -8.990  1.00 30.62 ? 149 ILE B C   1 
ATOM   3857 O  O   . ILE B 1 149 ? 25.792  3.342   -8.374  1.00 30.23 ? 149 ILE B O   1 
ATOM   3858 C  CB  . ILE B 1 149 ? 25.194  3.531   -11.423 1.00 30.51 ? 149 ILE B CB  1 
ATOM   3859 C  CG1 . ILE B 1 149 ? 25.479  4.190   -12.773 1.00 33.62 ? 149 ILE B CG1 1 
ATOM   3860 C  CG2 . ILE B 1 149 ? 23.945  2.650   -11.510 1.00 33.24 ? 149 ILE B CG2 1 
ATOM   3861 C  CD1 . ILE B 1 149 ? 25.943  3.201   -13.826 1.00 32.73 ? 149 ILE B CD1 1 
ATOM   3862 N  N   . ILE B 1 150 ? 23.586  3.739   -8.561  1.00 27.69 ? 150 ILE B N   1 
ATOM   3863 C  CA  . ILE B 1 150 ? 23.207  2.829   -7.482  1.00 28.52 ? 150 ILE B CA  1 
ATOM   3864 C  C   . ILE B 1 150 ? 22.000  2.074   -8.013  1.00 30.76 ? 150 ILE B C   1 
ATOM   3865 O  O   . ILE B 1 150 ? 21.031  2.715   -8.417  1.00 30.86 ? 150 ILE B O   1 
ATOM   3866 C  CB  . ILE B 1 150 ? 22.767  3.567   -6.209  1.00 30.06 ? 150 ILE B CB  1 
ATOM   3867 C  CG1 . ILE B 1 150 ? 23.932  4.351   -5.600  1.00 31.90 ? 150 ILE B CG1 1 
ATOM   3868 C  CG2 . ILE B 1 150 ? 22.184  2.563   -5.207  1.00 32.35 ? 150 ILE B CG2 1 
ATOM   3869 C  CD1 . ILE B 1 150 ? 23.506  5.319   -4.512  1.00 34.11 ? 150 ILE B CD1 1 
ATOM   3870 N  N   . VAL B 1 151 ? 22.060  0.743   -8.004  1.00 30.33 ? 151 VAL B N   1 
ATOM   3871 C  CA  . VAL B 1 151 ? 21.008  -0.070  -8.587  1.00 30.07 ? 151 VAL B CA  1 
ATOM   3872 C  C   . VAL B 1 151 ? 20.582  -1.214  -7.654  1.00 29.68 ? 151 VAL B C   1 
ATOM   3873 O  O   . VAL B 1 151 ? 21.402  -1.819  -6.951  1.00 29.25 ? 151 VAL B O   1 
ATOM   3874 C  CB  . VAL B 1 151 ? 21.445  -0.638  -9.959  1.00 29.73 ? 151 VAL B CB  1 
ATOM   3875 C  CG1 . VAL B 1 151 ? 22.726  -1.465  -9.854  1.00 29.99 ? 151 VAL B CG1 1 
ATOM   3876 C  CG2 . VAL B 1 151 ? 20.317  -1.412  -10.610 1.00 29.22 ? 151 VAL B CG2 1 
ATOM   3877 N  N   . SER B 1 152 ? 19.278  -1.475  -7.637  1.00 26.80 ? 152 SER B N   1 
ATOM   3878 C  CA  . SER B 1 152 ? 18.715  -2.593  -6.894  1.00 27.97 ? 152 SER B CA  1 
ATOM   3879 C  C   . SER B 1 152 ? 17.924  -3.371  -7.929  1.00 28.47 ? 152 SER B C   1 
ATOM   3880 O  O   . SER B 1 152 ? 17.089  -2.796  -8.629  1.00 29.93 ? 152 SER B O   1 
ATOM   3881 C  CB  . SER B 1 152 ? 17.808  -2.111  -5.756  1.00 27.40 ? 152 SER B CB  1 
ATOM   3882 O  OG  . SER B 1 152 ? 18.514  -1.371  -4.786  1.00 28.32 ? 152 SER B OG  1 
ATOM   3883 N  N   . THR B 1 153 ? 18.209  -4.659  -8.058  1.00 30.03 ? 153 THR B N   1 
ATOM   3884 C  CA  . THR B 1 153 ? 17.634  -5.445  -9.118  1.00 30.92 ? 153 THR B CA  1 
ATOM   3885 C  C   . THR B 1 153 ? 16.553  -6.396  -8.589  1.00 31.50 ? 153 THR B C   1 
ATOM   3886 O  O   . THR B 1 153 ? 16.494  -6.729  -7.385  1.00 29.36 ? 153 THR B O   1 
ATOM   3887 C  CB  . THR B 1 153 ? 18.685  -6.272  -9.862  1.00 30.85 ? 153 THR B CB  1 
ATOM   3888 O  OG1 . THR B 1 153 ? 19.036  -7.403  -9.071  1.00 30.21 ? 153 THR B OG1 1 
ATOM   3889 C  CG2 . THR B 1 153 ? 19.937  -5.437  -10.172 1.00 32.45 ? 153 THR B CG2 1 
ATOM   3890 N  N   . TYR B 1 154 ? 15.692  -6.781  -9.523  1.00 29.08 ? 154 TYR B N   1 
ATOM   3891 C  CA  . TYR B 1 154 ? 14.540  -7.633  -9.295  1.00 28.65 ? 154 TYR B CA  1 
ATOM   3892 C  C   . TYR B 1 154 ? 14.617  -8.725  -10.362 1.00 28.84 ? 154 TYR B C   1 
ATOM   3893 O  O   . TYR B 1 154 ? 13.977  -8.631  -11.434 1.00 27.41 ? 154 TYR B O   1 
ATOM   3894 C  CB  . TYR B 1 154 ? 13.254  -6.836  -9.464  1.00 26.66 ? 154 TYR B CB  1 
ATOM   3895 C  CG  . TYR B 1 154 ? 13.049  -5.684  -8.472  1.00 28.74 ? 154 TYR B CG  1 
ATOM   3896 C  CD1 . TYR B 1 154 ? 13.878  -4.573  -8.493  1.00 26.45 ? 154 TYR B CD1 1 
ATOM   3897 C  CD2 . TYR B 1 154 ? 11.989  -5.686  -7.540  1.00 26.86 ? 154 TYR B CD2 1 
ATOM   3898 C  CE1 . TYR B 1 154 ? 13.695  -3.513  -7.609  1.00 28.01 ? 154 TYR B CE1 1 
ATOM   3899 C  CE2 . TYR B 1 154 ? 11.797  -4.623  -6.674  1.00 27.68 ? 154 TYR B CE2 1 
ATOM   3900 C  CZ  . TYR B 1 154 ? 12.665  -3.529  -6.725  1.00 27.34 ? 154 TYR B CZ  1 
ATOM   3901 O  OH  . TYR B 1 154 ? 12.528  -2.446  -5.893  1.00 25.88 ? 154 TYR B OH  1 
ATOM   3902 N  N   . GLN B 1 155 ? 15.429  -9.746  -10.083 1.00 28.83 ? 155 GLN B N   1 
ATOM   3903 C  CA  . GLN B 1 155 ? 15.832  -10.718 -11.111 1.00 28.51 ? 155 GLN B CA  1 
ATOM   3904 C  C   . GLN B 1 155 ? 15.004  -11.984 -11.162 1.00 29.13 ? 155 GLN B C   1 
ATOM   3905 O  O   . GLN B 1 155 ? 14.643  -12.581 -10.125 1.00 28.41 ? 155 GLN B O   1 
ATOM   3906 C  CB  . GLN B 1 155 ? 17.343  -11.048 -10.985 1.00 28.85 ? 155 GLN B CB  1 
ATOM   3907 C  CG  . GLN B 1 155 ? 18.202  -9.847  -11.362 1.00 29.33 ? 155 GLN B CG  1 
ATOM   3908 C  CD  . GLN B 1 155 ? 19.700  -10.080 -11.213 1.00 31.27 ? 155 GLN B CD  1 
ATOM   3909 O  OE1 . GLN B 1 155 ? 20.375  -9.323  -10.535 1.00 32.06 ? 155 GLN B OE1 1 
ATOM   3910 N  NE2 . GLN B 1 155 ? 20.220  -11.114 -11.862 1.00 33.07 ? 155 GLN B NE2 1 
ATOM   3911 N  N   . ALA B 1 156 ? 14.694  -12.372 -12.399 1.00 29.44 ? 156 ALA B N   1 
ATOM   3912 C  CA  . ALA B 1 156 ? 13.911  -13.557 -12.720 1.00 30.73 ? 156 ALA B CA  1 
ATOM   3913 C  C   . ALA B 1 156 ? 14.730  -14.810 -12.479 1.00 30.49 ? 156 ALA B C   1 
ATOM   3914 O  O   . ALA B 1 156 ? 15.970  -14.782 -12.536 1.00 32.30 ? 156 ALA B O   1 
ATOM   3915 C  CB  . ALA B 1 156 ? 13.428  -13.496 -14.164 1.00 32.23 ? 156 ALA B CB  1 
ATOM   3916 N  N   . VAL B 1 157 ? 14.035  -15.896 -12.152 1.00 32.04 ? 157 VAL B N   1 
ATOM   3917 C  CA  . VAL B 1 157 ? 14.701  -17.171 -11.869 1.00 34.60 ? 157 VAL B CA  1 
ATOM   3918 C  C   . VAL B 1 157 ? 15.293  -17.841 -13.123 1.00 35.89 ? 157 VAL B C   1 
ATOM   3919 O  O   . VAL B 1 157 ? 16.275  -18.581 -13.012 1.00 38.09 ? 157 VAL B O   1 
ATOM   3920 C  CB  . VAL B 1 157 ? 13.783  -18.158 -11.110 1.00 34.82 ? 157 VAL B CB  1 
ATOM   3921 C  CG1 . VAL B 1 157 ? 13.269  -17.511 -9.823  1.00 38.53 ? 157 VAL B CG1 1 
ATOM   3922 C  CG2 . VAL B 1 157 ? 12.618  -18.616 -11.970 1.00 33.89 ? 157 VAL B CG2 1 
ATOM   3923 N  N   . SER B 1 158 ? 14.767  -17.552 -14.314 1.00 37.07 ? 158 SER B N   1 
ATOM   3924 C  CA  . SER B 1 158 ? 15.383  -18.145 -15.530 1.00 37.97 ? 158 SER B CA  1 
ATOM   3925 C  C   . SER B 1 158 ? 16.866  -17.789 -15.684 1.00 38.84 ? 158 SER B C   1 
ATOM   3926 O  O   . SER B 1 158 ? 17.603  -18.478 -16.394 1.00 41.26 ? 158 SER B O   1 
ATOM   3927 C  CB  . SER B 1 158 ? 14.631  -17.788 -16.803 1.00 36.68 ? 158 SER B CB  1 
ATOM   3928 O  OG  . SER B 1 158 ? 14.680  -16.402 -17.064 1.00 37.48 ? 158 SER B OG  1 
ATOM   3929 N  N   . GLY B 1 159 ? 17.305  -16.740 -15.004 1.00 38.80 ? 159 GLY B N   1 
ATOM   3930 C  CA  . GLY B 1 159 ? 18.714  -16.352 -15.018 1.00 39.27 ? 159 GLY B CA  1 
ATOM   3931 C  C   . GLY B 1 159 ? 19.647  -17.379 -14.411 1.00 38.46 ? 159 GLY B C   1 
ATOM   3932 O  O   . GLY B 1 159 ? 20.836  -17.396 -14.733 1.00 36.51 ? 159 GLY B O   1 
ATOM   3933 N  N   . ALA B 1 160 ? 19.106  -18.219 -13.523 1.00 38.93 ? 160 ALA B N   1 
ATOM   3934 C  CA  . ALA B 1 160 ? 19.852  -19.279 -12.865 1.00 38.64 ? 160 ALA B CA  1 
ATOM   3935 C  C   . ALA B 1 160 ? 19.732  -20.634 -13.571 1.00 39.28 ? 160 ALA B C   1 
ATOM   3936 O  O   . ALA B 1 160 ? 20.246  -21.625 -13.069 1.00 42.61 ? 160 ALA B O   1 
ATOM   3937 C  CB  . ALA B 1 160 ? 19.384  -19.419 -11.414 1.00 38.67 ? 160 ALA B CB  1 
ATOM   3938 N  N   . GLY B 1 161 ? 19.042  -20.688 -14.702 1.00 40.24 ? 161 GLY B N   1 
ATOM   3939 C  CA  . GLY B 1 161 ? 19.018  -21.894 -15.521 1.00 41.24 ? 161 GLY B CA  1 
ATOM   3940 C  C   . GLY B 1 161 ? 17.712  -22.641 -15.466 1.00 38.85 ? 161 GLY B C   1 
ATOM   3941 O  O   . GLY B 1 161 ? 16.814  -22.302 -14.719 1.00 37.36 ? 161 GLY B O   1 
ATOM   3942 N  N   . MET B 1 162 ? 17.609  -23.671 -16.284 1.00 38.42 ? 162 MET B N   1 
ATOM   3943 C  CA  . MET B 1 162 ? 16.377  -24.399 -16.439 1.00 39.54 ? 162 MET B CA  1 
ATOM   3944 C  C   . MET B 1 162 ? 15.954  -25.033 -15.112 1.00 38.03 ? 162 MET B C   1 
ATOM   3945 O  O   . MET B 1 162 ? 14.772  -25.096 -14.806 1.00 39.26 ? 162 MET B O   1 
ATOM   3946 C  CB  . MET B 1 162 ? 16.555  -25.495 -17.488 1.00 43.91 ? 162 MET B CB  1 
ATOM   3947 C  CG  . MET B 1 162 ? 15.244  -26.139 -17.907 1.00 52.17 ? 162 MET B CG  1 
ATOM   3948 S  SD  . MET B 1 162 ? 14.123  -24.942 -18.655 1.00 60.96 ? 162 MET B SD  1 
ATOM   3949 C  CE  . MET B 1 162 ? 14.992  -24.569 -20.176 1.00 59.72 ? 162 MET B CE  1 
ATOM   3950 N  N   . GLY B 1 163 ? 16.928  -25.487 -14.337 1.00 36.16 ? 163 GLY B N   1 
ATOM   3951 C  CA  . GLY B 1 163 ? 16.656  -26.194 -13.103 1.00 36.96 ? 163 GLY B CA  1 
ATOM   3952 C  C   . GLY B 1 163 ? 16.032  -25.262 -12.074 1.00 40.09 ? 163 GLY B C   1 
ATOM   3953 O  O   . GLY B 1 163 ? 15.156  -25.676 -11.301 1.00 40.36 ? 163 GLY B O   1 
ATOM   3954 N  N   . ALA B 1 164 ? 16.483  -24.006 -12.072 1.00 37.64 ? 164 ALA B N   1 
ATOM   3955 C  CA  . ALA B 1 164 ? 15.913  -22.978 -11.201 1.00 36.12 ? 164 ALA B CA  1 
ATOM   3956 C  C   . ALA B 1 164 ? 14.478  -22.648 -11.581 1.00 35.08 ? 164 ALA B C   1 
ATOM   3957 O  O   . ALA B 1 164 ? 13.656  -22.403 -10.716 1.00 38.87 ? 164 ALA B O   1 
ATOM   3958 C  CB  . ALA B 1 164 ? 16.766  -21.725 -11.240 1.00 37.05 ? 164 ALA B CB  1 
ATOM   3959 N  N   . ILE B 1 165 ? 14.168  -22.619 -12.866 1.00 36.08 ? 165 ILE B N   1 
ATOM   3960 C  CA  . ILE B 1 165 ? 12.787  -22.374 -13.297 1.00 35.21 ? 165 ILE B CA  1 
ATOM   3961 C  C   . ILE B 1 165 ? 11.867  -23.472 -12.771 1.00 37.46 ? 165 ILE B C   1 
ATOM   3962 O  O   . ILE B 1 165 ? 10.769  -23.210 -12.278 1.00 36.78 ? 165 ILE B O   1 
ATOM   3963 C  CB  . ILE B 1 165 ? 12.653  -22.343 -14.829 1.00 35.14 ? 165 ILE B CB  1 
ATOM   3964 C  CG1 . ILE B 1 165 ? 13.443  -21.166 -15.424 1.00 36.08 ? 165 ILE B CG1 1 
ATOM   3965 C  CG2 . ILE B 1 165 ? 11.190  -22.258 -15.230 1.00 33.54 ? 165 ILE B CG2 1 
ATOM   3966 C  CD1 . ILE B 1 165 ? 13.657  -21.269 -16.912 1.00 36.52 ? 165 ILE B CD1 1 
ATOM   3967 N  N   . LEU B 1 166 ? 12.306  -24.713 -12.906 1.00 37.89 ? 166 LEU B N   1 
ATOM   3968 C  CA  . LEU B 1 166 ? 11.450  -25.839 -12.541 1.00 37.78 ? 166 LEU B CA  1 
ATOM   3969 C  C   . LEU B 1 166 ? 11.287  -25.933 -11.025 1.00 38.25 ? 166 LEU B C   1 
ATOM   3970 O  O   . LEU B 1 166 ? 10.208  -26.231 -10.542 1.00 39.14 ? 166 LEU B O   1 
ATOM   3971 C  CB  . LEU B 1 166 ? 12.003  -27.128 -13.127 1.00 38.39 ? 166 LEU B CB  1 
ATOM   3972 C  CG  . LEU B 1 166 ? 11.991  -27.151 -14.662 1.00 38.04 ? 166 LEU B CG  1 
ATOM   3973 C  CD1 . LEU B 1 166 ? 12.821  -28.312 -15.193 1.00 39.32 ? 166 LEU B CD1 1 
ATOM   3974 C  CD2 . LEU B 1 166 ? 10.569  -27.214 -15.194 1.00 37.30 ? 166 LEU B CD2 1 
ATOM   3975 N  N   . GLU B 1 167 ? 12.365  -25.678 -10.289 1.00 37.83 ? 167 GLU B N   1 
ATOM   3976 C  CA  . GLU B 1 167 ? 12.318  -25.626 -8.825  1.00 38.37 ? 167 GLU B CA  1 
ATOM   3977 C  C   . GLU B 1 167 ? 11.349  -24.546 -8.347  1.00 37.75 ? 167 GLU B C   1 
ATOM   3978 O  O   . GLU B 1 167 ? 10.635  -24.745 -7.378  1.00 35.49 ? 167 GLU B O   1 
ATOM   3979 C  CB  . GLU B 1 167 ? 13.714  -25.348 -8.267  1.00 39.11 ? 167 GLU B CB  1 
ATOM   3980 C  CG  . GLU B 1 167 ? 13.749  -24.949 -6.806  1.00 39.80 ? 167 GLU B CG  1 
ATOM   3981 C  CD  . GLU B 1 167 ? 15.159  -24.939 -6.240  1.00 41.93 ? 167 GLU B CD  1 
ATOM   3982 O  OE1 . GLU B 1 167 ? 15.707  -26.031 -5.995  1.00 41.60 ? 167 GLU B OE1 1 
ATOM   3983 O  OE2 . GLU B 1 167 ? 15.722  -23.842 -6.020  1.00 39.57 ? 167 GLU B OE2 1 
ATOM   3984 N  N   . THR B 1 168 ? 11.328  -23.406 -9.035  1.00 35.71 ? 168 THR B N   1 
ATOM   3985 C  CA  . THR B 1 168 ? 10.441  -22.307 -8.676  1.00 35.89 ? 168 THR B CA  1 
ATOM   3986 C  C   . THR B 1 168 ? 8.984   -22.708 -8.885  1.00 36.76 ? 168 THR B C   1 
ATOM   3987 O  O   . THR B 1 168 ? 8.118   -22.448 -8.042  1.00 37.86 ? 168 THR B O   1 
ATOM   3988 C  CB  . THR B 1 168 ? 10.777  -21.052 -9.514  1.00 34.35 ? 168 THR B CB  1 
ATOM   3989 O  OG1 . THR B 1 168 ? 12.102  -20.626 -9.171  1.00 33.31 ? 168 THR B OG1 1 
ATOM   3990 C  CG2 . THR B 1 168 ? 9.792   -19.945 -9.256  1.00 36.98 ? 168 THR B CG2 1 
ATOM   3991 N  N   . GLN B 1 169 ? 8.713   -23.359 -10.006 1.00 34.75 ? 169 GLN B N   1 
ATOM   3992 C  CA  . GLN B 1 169 ? 7.351   -23.775 -10.322 1.00 35.29 ? 169 GLN B CA  1 
ATOM   3993 C  C   . GLN B 1 169 ? 6.854   -24.873 -9.359  1.00 35.14 ? 169 GLN B C   1 
ATOM   3994 O  O   . GLN B 1 169 ? 5.714   -24.855 -8.929  1.00 36.37 ? 169 GLN B O   1 
ATOM   3995 C  CB  . GLN B 1 169 ? 7.288   -24.258 -11.761 1.00 38.67 ? 169 GLN B CB  1 
ATOM   3996 C  CG  . GLN B 1 169 ? 7.437   -23.132 -12.778 1.00 41.77 ? 169 GLN B CG  1 
ATOM   3997 C  CD  . GLN B 1 169 ? 7.536   -23.643 -14.206 1.00 46.33 ? 169 GLN B CD  1 
ATOM   3998 O  OE1 . GLN B 1 169 ? 8.323   -24.542 -14.500 1.00 48.26 ? 169 GLN B OE1 1 
ATOM   3999 N  NE2 . GLN B 1 169 ? 6.742   -23.064 -15.102 1.00 46.97 ? 169 GLN B NE2 1 
ATOM   4000 N  N   . ARG B 1 170 ? 7.724   -25.806 -9.012  1.00 35.03 ? 170 ARG B N   1 
ATOM   4001 C  CA  . ARG B 1 170 ? 7.353   -26.892 -8.106  1.00 35.08 ? 170 ARG B CA  1 
ATOM   4002 C  C   . ARG B 1 170 ? 7.033   -26.310 -6.723  1.00 35.80 ? 170 ARG B C   1 
ATOM   4003 O  O   . ARG B 1 170 ? 6.013   -26.625 -6.136  1.00 35.91 ? 170 ARG B O   1 
ATOM   4004 C  CB  . ARG B 1 170 ? 8.480   -27.907 -8.024  1.00 36.27 ? 170 ARG B CB  1 
ATOM   4005 C  CG  . ARG B 1 170 ? 8.214   -29.103 -7.119  1.00 37.57 ? 170 ARG B CG  1 
ATOM   4006 C  CD  . ARG B 1 170 ? 8.744   -28.862 -5.729  1.00 37.93 ? 170 ARG B CD  1 
ATOM   4007 N  NE  . ARG B 1 170 ? 10.193  -28.718 -5.711  1.00 37.62 ? 170 ARG B NE  1 
ATOM   4008 C  CZ  . ARG B 1 170 ? 10.877  -28.275 -4.667  1.00 40.40 ? 170 ARG B CZ  1 
ATOM   4009 N  NH1 . ARG B 1 170 ? 10.248  -27.930 -3.539  1.00 43.14 ? 170 ARG B NH1 1 
ATOM   4010 N  NH2 . ARG B 1 170 ? 12.196  -28.167 -4.744  1.00 42.60 ? 170 ARG B NH2 1 
ATOM   4011 N  N   . GLU B 1 171 ? 7.912   -25.455 -6.223  1.00 34.13 ? 171 GLU B N   1 
ATOM   4012 C  CA  . GLU B 1 171 ? 7.702   -24.783 -4.926  1.00 35.29 ? 171 GLU B CA  1 
ATOM   4013 C  C   . GLU B 1 171 ? 6.363   -24.076 -4.840  1.00 34.68 ? 171 GLU B C   1 
ATOM   4014 O  O   . GLU B 1 171 ? 5.622   -24.236 -3.865  1.00 34.12 ? 171 GLU B O   1 
ATOM   4015 C  CB  . GLU B 1 171 ? 8.824   -23.782 -4.660  1.00 32.40 ? 171 GLU B CB  1 
ATOM   4016 C  CG  . GLU B 1 171 ? 10.115  -24.466 -4.268  1.00 33.09 ? 171 GLU B CG  1 
ATOM   4017 C  CD  . GLU B 1 171 ? 11.256  -23.509 -4.070  1.00 32.33 ? 171 GLU B CD  1 
ATOM   4018 O  OE1 . GLU B 1 171 ? 10.999  -22.300 -3.933  1.00 33.34 ? 171 GLU B OE1 1 
ATOM   4019 O  OE2 . GLU B 1 171 ? 12.417  -23.986 -3.999  1.00 38.11 ? 171 GLU B OE2 1 
ATOM   4020 N  N   . LEU B 1 172 ? 6.055   -23.280 -5.847  1.00 34.98 ? 172 LEU B N   1 
ATOM   4021 C  CA  . LEU B 1 172 ? 4.806   -22.530 -5.842  1.00 35.99 ? 172 LEU B CA  1 
ATOM   4022 C  C   . LEU B 1 172 ? 3.564   -23.430 -5.849  1.00 37.80 ? 172 LEU B C   1 
ATOM   4023 O  O   . LEU B 1 172 ? 2.548   -23.097 -5.240  1.00 37.48 ? 172 LEU B O   1 
ATOM   4024 C  CB  . LEU B 1 172 ? 4.759   -21.557 -7.029  1.00 38.68 ? 172 LEU B CB  1 
ATOM   4025 C  CG  . LEU B 1 172 ? 5.726   -20.367 -6.940  1.00 39.74 ? 172 LEU B CG  1 
ATOM   4026 C  CD1 . LEU B 1 172 ? 5.843   -19.666 -8.285  1.00 42.04 ? 172 LEU B CD1 1 
ATOM   4027 C  CD2 . LEU B 1 172 ? 5.267   -19.387 -5.869  1.00 43.35 ? 172 LEU B CD2 1 
ATOM   4028 N  N   . ARG B 1 173 ? 3.636   -24.552 -6.556  1.00 37.41 ? 173 ARG B N   1 
ATOM   4029 C  CA  A ARG B 1 173 ? 2.546   -25.526 -6.578  0.50 39.73 ? 173 ARG B CA  1 
ATOM   4030 C  CA  B ARG B 1 173 ? 2.530   -25.500 -6.566  0.50 38.57 ? 173 ARG B CA  1 
ATOM   4031 C  C   . ARG B 1 173 ? 2.381   -26.185 -5.208  1.00 37.92 ? 173 ARG B C   1 
ATOM   4032 O  O   . ARG B 1 173 ? 1.275   -26.489 -4.789  1.00 40.53 ? 173 ARG B O   1 
ATOM   4033 C  CB  A ARG B 1 173 ? 2.794   -26.610 -7.644  0.50 40.67 ? 173 ARG B CB  1 
ATOM   4034 C  CB  B ARG B 1 173 ? 2.719   -26.536 -7.678  0.50 37.93 ? 173 ARG B CB  1 
ATOM   4035 C  CG  A ARG B 1 173 ? 2.606   -26.158 -9.084  0.50 41.02 ? 173 ARG B CG  1 
ATOM   4036 C  CG  B ARG B 1 173 ? 2.528   -25.968 -9.068  0.50 36.79 ? 173 ARG B CG  1 
ATOM   4037 C  CD  A ARG B 1 173 ? 2.574   -27.343 -10.054 0.50 43.39 ? 173 ARG B CD  1 
ATOM   4038 C  CD  B ARG B 1 173 ? 2.971   -26.957 -10.133 0.50 38.14 ? 173 ARG B CD  1 
ATOM   4039 N  NE  A ARG B 1 173 ? 3.767   -28.193 -9.968  0.50 45.01 ? 173 ARG B NE  1 
ATOM   4040 N  NE  B ARG B 1 173 ? 2.659   -26.485 -11.472 0.50 36.88 ? 173 ARG B NE  1 
ATOM   4041 C  CZ  A ARG B 1 173 ? 4.776   -28.162 -10.836 0.50 44.64 ? 173 ARG B CZ  1 
ATOM   4042 C  CZ  B ARG B 1 173 ? 3.182   -26.990 -12.580 0.50 38.27 ? 173 ARG B CZ  1 
ATOM   4043 N  NH1 A ARG B 1 173 ? 4.747   -27.325 -11.863 0.50 46.23 ? 173 ARG B NH1 1 
ATOM   4044 N  NH1 B ARG B 1 173 ? 4.050   -27.994 -12.512 0.50 40.62 ? 173 ARG B NH1 1 
ATOM   4045 N  NH2 A ARG B 1 173 ? 5.821   -28.962 -10.674 0.50 43.53 ? 173 ARG B NH2 1 
ATOM   4046 N  NH2 B ARG B 1 173 ? 2.835   -26.495 -13.751 0.50 36.56 ? 173 ARG B NH2 1 
ATOM   4047 N  N   . GLU B 1 174 ? 3.489   -26.433 -4.513  1.00 38.64 ? 174 GLU B N   1 
ATOM   4048 C  CA  . GLU B 1 174 ? 3.400   -27.061 -3.195  1.00 39.08 ? 174 GLU B CA  1 
ATOM   4049 C  C   . GLU B 1 174 ? 2.713   -26.101 -2.214  1.00 38.88 ? 174 GLU B C   1 
ATOM   4050 O  O   . GLU B 1 174 ? 1.949   -26.525 -1.348  1.00 39.13 ? 174 GLU B O   1 
ATOM   4051 C  CB  . GLU B 1 174 ? 4.787   -27.480 -2.678  1.00 42.47 ? 174 GLU B CB  1 
ATOM   4052 C  CG  . GLU B 1 174 ? 5.405   -28.638 -3.456  1.00 45.14 ? 174 GLU B CG  1 
ATOM   4053 C  CD  . GLU B 1 174 ? 6.657   -29.194 -2.806  1.00 48.83 ? 174 GLU B CD  1 
ATOM   4054 O  OE1 . GLU B 1 174 ? 6.725   -30.421 -2.604  1.00 59.85 ? 174 GLU B OE1 1 
ATOM   4055 O  OE2 . GLU B 1 174 ? 7.576   -28.427 -2.483  1.00 48.43 ? 174 GLU B OE2 1 
ATOM   4056 N  N   . VAL B 1 175 ? 2.958   -24.807 -2.376  1.00 35.07 ? 175 VAL B N   1 
ATOM   4057 C  CA  . VAL B 1 175 ? 2.338   -23.814 -1.505  1.00 36.51 ? 175 VAL B CA  1 
ATOM   4058 C  C   . VAL B 1 175 ? 0.858   -23.674 -1.824  1.00 37.50 ? 175 VAL B C   1 
ATOM   4059 O  O   . VAL B 1 175 ? 0.029   -23.862 -0.952  1.00 38.73 ? 175 VAL B O   1 
ATOM   4060 C  CB  . VAL B 1 175 ? 3.027   -22.453 -1.587  1.00 36.42 ? 175 VAL B CB  1 
ATOM   4061 C  CG1 . VAL B 1 175 ? 2.281   -21.426 -0.739  1.00 38.85 ? 175 VAL B CG1 1 
ATOM   4062 C  CG2 . VAL B 1 175 ? 4.462   -22.574 -1.098  1.00 35.48 ? 175 VAL B CG2 1 
ATOM   4063 N  N   . LEU B 1 176 ? 0.540   -23.361 -3.070  1.00 37.75 ? 176 LEU B N   1 
ATOM   4064 C  CA  . LEU B 1 176 ? -0.841  -23.113 -3.492  1.00 37.60 ? 176 LEU B CA  1 
ATOM   4065 C  C   . LEU B 1 176 ? -1.724  -24.365 -3.567  1.00 39.80 ? 176 LEU B C   1 
ATOM   4066 O  O   . LEU B 1 176 ? -2.948  -24.274 -3.376  1.00 40.29 ? 176 LEU B O   1 
ATOM   4067 C  CB  . LEU B 1 176 ? -0.842  -22.432 -4.866  1.00 38.57 ? 176 LEU B CB  1 
ATOM   4068 C  CG  . LEU B 1 176 ? -0.213  -21.033 -4.920  1.00 40.85 ? 176 LEU B CG  1 
ATOM   4069 C  CD1 . LEU B 1 176 ? 0.113   -20.593 -6.347  1.00 41.07 ? 176 LEU B CD1 1 
ATOM   4070 C  CD2 . LEU B 1 176 ? -1.127  -20.029 -4.243  1.00 40.61 ? 176 LEU B CD2 1 
ATOM   4071 N  N   . ASN B 1 177 ? -1.126  -25.516 -3.882  1.00 40.23 ? 177 ASN B N   1 
ATOM   4072 C  CA  . ASN B 1 177 ? -1.888  -26.760 -4.057  1.00 40.40 ? 177 ASN B CA  1 
ATOM   4073 C  C   . ASN B 1 177 ? -1.876  -27.686 -2.841  1.00 41.67 ? 177 ASN B C   1 
ATOM   4074 O  O   . ASN B 1 177 ? -2.896  -28.283 -2.530  1.00 43.56 ? 177 ASN B O   1 
ATOM   4075 C  CB  . ASN B 1 177 ? -1.411  -27.519 -5.303  1.00 39.23 ? 177 ASN B CB  1 
ATOM   4076 C  CG  . ASN B 1 177 ? -1.630  -26.735 -6.598  1.00 40.81 ? 177 ASN B CG  1 
ATOM   4077 O  OD1 . ASN B 1 177 ? -2.428  -25.803 -6.655  1.00 36.70 ? 177 ASN B OD1 1 
ATOM   4078 N  ND2 . ASN B 1 177 ? -0.938  -27.138 -7.653  1.00 40.82 ? 177 ASN B ND2 1 
ATOM   4079 N  N   . ASP B 1 178 ? -0.732  -27.826 -2.173  1.00 43.85 ? 178 ASP B N   1 
ATOM   4080 C  CA  . ASP B 1 178 ? -0.613  -28.712 -1.007  1.00 43.72 ? 178 ASP B CA  1 
ATOM   4081 C  C   . ASP B 1 178 ? -0.637  -27.971 0.318   1.00 43.53 ? 178 ASP B C   1 
ATOM   4082 O  O   . ASP B 1 178 ? -0.590  -28.603 1.378   1.00 45.05 ? 178 ASP B O   1 
ATOM   4083 C  CB  . ASP B 1 178 ? 0.669   -29.536 -1.091  1.00 46.49 ? 178 ASP B CB  1 
ATOM   4084 C  CG  . ASP B 1 178 ? 0.725   -30.397 -2.344  1.00 49.09 ? 178 ASP B CG  1 
ATOM   4085 O  OD1 . ASP B 1 178 ? -0.347  -30.814 -2.842  1.00 53.19 ? 178 ASP B OD1 1 
ATOM   4086 O  OD2 . ASP B 1 178 ? 1.838   -30.641 -2.838  1.00 48.47 ? 178 ASP B OD2 1 
ATOM   4087 N  N   . GLY B 1 179 ? -0.699  -26.642 0.262   1.00 42.01 ? 179 GLY B N   1 
ATOM   4088 C  CA  . GLY B 1 179 ? -0.769  -25.816 1.466   1.00 42.32 ? 179 GLY B CA  1 
ATOM   4089 C  C   . GLY B 1 179 ? 0.515   -25.764 2.279   1.00 43.21 ? 179 GLY B C   1 
ATOM   4090 O  O   . GLY B 1 179 ? 0.494   -25.367 3.440   1.00 44.31 ? 179 GLY B O   1 
ATOM   4091 N  N   . VAL B 1 180 ? 1.641   -26.140 1.686   1.00 41.55 ? 180 VAL B N   1 
ATOM   4092 C  CA  . VAL B 1 180 ? 2.919   -26.069 2.399   1.00 39.05 ? 180 VAL B CA  1 
ATOM   4093 C  C   . VAL B 1 180 ? 3.263   -24.617 2.706   1.00 40.21 ? 180 VAL B C   1 
ATOM   4094 O  O   . VAL B 1 180 ? 3.087   -23.744 1.857   1.00 40.63 ? 180 VAL B O   1 
ATOM   4095 C  CB  . VAL B 1 180 ? 4.035   -26.712 1.564   1.00 39.94 ? 180 VAL B CB  1 
ATOM   4096 C  CG1 . VAL B 1 180 ? 5.391   -26.567 2.245   1.00 41.21 ? 180 VAL B CG1 1 
ATOM   4097 C  CG2 . VAL B 1 180 ? 3.718   -28.177 1.302   1.00 41.29 ? 180 VAL B CG2 1 
ATOM   4098 N  N   . LYS B 1 181 ? 3.748   -24.337 3.910   1.00 41.19 ? 181 LYS B N   1 
ATOM   4099 C  CA  . LYS B 1 181 ? 4.203   -22.977 4.224   1.00 43.05 ? 181 LYS B CA  1 
ATOM   4100 C  C   . LYS B 1 181 ? 5.523   -22.702 3.497   1.00 39.81 ? 181 LYS B C   1 
ATOM   4101 O  O   . LYS B 1 181 ? 6.395   -23.560 3.488   1.00 38.35 ? 181 LYS B O   1 
ATOM   4102 C  CB  . LYS B 1 181 ? 4.395   -22.802 5.727   1.00 47.44 ? 181 LYS B CB  1 
ATOM   4103 C  CG  . LYS B 1 181 ? 3.107   -22.941 6.534   1.00 52.45 ? 181 LYS B CG  1 
ATOM   4104 C  CD  . LYS B 1 181 ? 3.385   -23.390 7.961   1.00 57.22 ? 181 LYS B CD  1 
ATOM   4105 C  CE  . LYS B 1 181 ? 4.120   -22.313 8.741   1.00 61.94 ? 181 LYS B CE  1 
ATOM   4106 N  NZ  . LYS B 1 181 ? 4.211   -22.655 10.187  1.00 66.21 ? 181 LYS B NZ  1 
ATOM   4107 N  N   . PRO B 1 182 ? 5.679   -21.508 2.879   1.00 37.34 ? 182 PRO B N   1 
ATOM   4108 C  CA  . PRO B 1 182 ? 6.902   -21.270 2.103   1.00 34.97 ? 182 PRO B CA  1 
ATOM   4109 C  C   . PRO B 1 182 ? 8.200   -21.493 2.875   1.00 35.84 ? 182 PRO B C   1 
ATOM   4110 O  O   . PRO B 1 182 ? 9.137   -22.055 2.330   1.00 35.29 ? 182 PRO B O   1 
ATOM   4111 C  CB  . PRO B 1 182 ? 6.760   -19.813 1.672   1.00 35.59 ? 182 PRO B CB  1 
ATOM   4112 C  CG  . PRO B 1 182 ? 5.274   -19.638 1.516   1.00 35.80 ? 182 PRO B CG  1 
ATOM   4113 C  CD  . PRO B 1 182 ? 4.649   -20.491 2.593   1.00 37.42 ? 182 PRO B CD  1 
ATOM   4114 N  N   . CYS B 1 183 ? 8.239   -21.098 4.146   1.00 37.69 ? 183 CYS B N   1 
ATOM   4115 C  CA  . CYS B 1 183 ? 9.432   -21.316 4.948   1.00 38.81 ? 183 CYS B CA  1 
ATOM   4116 C  C   . CYS B 1 183 ? 9.720   -22.809 5.146   1.00 40.50 ? 183 CYS B C   1 
ATOM   4117 O  O   . CYS B 1 183 ? 10.834  -23.159 5.514   1.00 39.10 ? 183 CYS B O   1 
ATOM   4118 C  CB  . CYS B 1 183 ? 9.324   -20.597 6.299   1.00 40.58 ? 183 CYS B CB  1 
ATOM   4119 S  SG  . CYS B 1 183 ? 7.986   -21.229 7.342   1.00 45.22 ? 183 CYS B SG  1 
ATOM   4120 N  N   . ASP B 1 184 ? 8.745   -23.690 4.903   1.00 39.54 ? 184 ASP B N   1 
ATOM   4121 C  CA  . ASP B 1 184 ? 8.981   -25.135 5.060   1.00 42.28 ? 184 ASP B CA  1 
ATOM   4122 C  C   . ASP B 1 184 ? 9.402   -25.866 3.782   1.00 39.94 ? 184 ASP B C   1 
ATOM   4123 O  O   . ASP B 1 184 ? 9.641   -27.067 3.820   1.00 41.79 ? 184 ASP B O   1 
ATOM   4124 C  CB  . ASP B 1 184 ? 7.741   -25.837 5.630   1.00 43.82 ? 184 ASP B CB  1 
ATOM   4125 C  CG  . ASP B 1 184 ? 7.454   -25.447 7.061   1.00 45.05 ? 184 ASP B CG  1 
ATOM   4126 O  OD1 . ASP B 1 184 ? 8.384   -25.031 7.780   1.00 44.60 ? 184 ASP B OD1 1 
ATOM   4127 O  OD2 . ASP B 1 184 ? 6.280   -25.542 7.459   1.00 45.50 ? 184 ASP B OD2 1 
ATOM   4128 N  N   . LEU B 1 185 ? 9.510   -25.150 2.668   1.00 38.49 ? 185 LEU B N   1 
ATOM   4129 C  CA  . LEU B 1 185 ? 9.842   -25.768 1.370   1.00 38.00 ? 185 LEU B CA  1 
ATOM   4130 C  C   . LEU B 1 185 ? 11.255  -26.334 1.287   1.00 39.24 ? 185 LEU B C   1 
ATOM   4131 O  O   . LEU B 1 185 ? 12.198  -25.795 1.872   1.00 40.50 ? 185 LEU B O   1 
ATOM   4132 C  CB  . LEU B 1 185 ? 9.696   -24.726 0.268   1.00 36.18 ? 185 LEU B CB  1 
ATOM   4133 C  CG  . LEU B 1 185 ? 8.275   -24.289 -0.064  1.00 34.69 ? 185 LEU B CG  1 
ATOM   4134 C  CD1 . LEU B 1 185 ? 8.328   -23.010 -0.889  1.00 34.94 ? 185 LEU B CD1 1 
ATOM   4135 C  CD2 . LEU B 1 185 ? 7.533   -25.380 -0.816  1.00 34.77 ? 185 LEU B CD2 1 
ATOM   4136 N  N   . HIS B 1 186 ? 11.405  -27.407 0.523   1.00 42.19 ? 186 HIS B N   1 
ATOM   4137 C  CA  . HIS B 1 186 ? 12.734  -27.955 0.257   1.00 46.12 ? 186 HIS B CA  1 
ATOM   4138 C  C   . HIS B 1 186 ? 13.290  -27.342 -1.035  1.00 41.07 ? 186 HIS B C   1 
ATOM   4139 O  O   . HIS B 1 186 ? 12.592  -27.284 -2.040  1.00 39.17 ? 186 HIS B O   1 
ATOM   4140 C  CB  . HIS B 1 186 ? 12.688  -29.477 0.151   1.00 48.00 ? 186 HIS B CB  1 
ATOM   4141 C  CG  . HIS B 1 186 ? 14.035  -30.089 -0.046  1.00 53.72 ? 186 HIS B CG  1 
ATOM   4142 N  ND1 . HIS B 1 186 ? 14.415  -30.685 -1.230  1.00 56.93 ? 186 HIS B ND1 1 
ATOM   4143 C  CD2 . HIS B 1 186 ? 15.110  -30.155 0.772   1.00 54.89 ? 186 HIS B CD2 1 
ATOM   4144 C  CE1 . HIS B 1 186 ? 15.659  -31.114 -1.124  1.00 55.93 ? 186 HIS B CE1 1 
ATOM   4145 N  NE2 . HIS B 1 186 ? 16.104  -30.802 0.078   1.00 56.87 ? 186 HIS B NE2 1 
ATOM   4146 N  N   . ALA B 1 187 ? 14.530  -26.864 -0.980  1.00 41.42 ? 187 ALA B N   1 
ATOM   4147 C  CA  . ALA B 1 187 ? 15.181  -26.227 -2.124  1.00 42.27 ? 187 ALA B CA  1 
ATOM   4148 C  C   . ALA B 1 187 ? 16.561  -26.848 -2.363  1.00 42.08 ? 187 ALA B C   1 
ATOM   4149 O  O   . ALA B 1 187 ? 17.245  -27.210 -1.414  1.00 39.79 ? 187 ALA B O   1 
ATOM   4150 C  CB  . ALA B 1 187 ? 15.312  -24.729 -1.881  1.00 42.57 ? 187 ALA B CB  1 
ATOM   4151 N  N   . GLU B 1 188 ? 16.946  -26.963 -3.633  1.00 45.60 ? 188 GLU B N   1 
ATOM   4152 C  CA  . GLU B 1 188 ? 18.233  -27.555 -4.043  1.00 46.60 ? 188 GLU B CA  1 
ATOM   4153 C  C   . GLU B 1 188 ? 19.156  -26.637 -4.879  1.00 44.33 ? 188 GLU B C   1 
ATOM   4154 O  O   . GLU B 1 188 ? 20.380  -26.827 -4.890  1.00 43.59 ? 188 GLU B O   1 
ATOM   4155 C  CB  . GLU B 1 188 ? 17.953  -28.834 -4.828  1.00 50.67 ? 188 GLU B CB  1 
ATOM   4156 C  CG  . GLU B 1 188 ? 17.330  -29.930 -3.972  1.00 56.29 ? 188 GLU B CG  1 
ATOM   4157 C  CD  . GLU B 1 188 ? 17.228  -31.263 -4.694  1.00 62.78 ? 188 GLU B CD  1 
ATOM   4158 O  OE1 . GLU B 1 188 ? 18.026  -31.516 -5.624  1.00 66.11 ? 188 GLU B OE1 1 
ATOM   4159 O  OE2 . GLU B 1 188 ? 16.347  -32.065 -4.324  1.00 68.06 ? 188 GLU B OE2 1 
ATOM   4160 N  N   . ILE B 1 189 ? 18.588  -25.639 -5.553  1.00 38.74 ? 189 ILE B N   1 
ATOM   4161 C  CA  . ILE B 1 189 ? 19.356  -24.807 -6.493  1.00 37.84 ? 189 ILE B CA  1 
ATOM   4162 C  C   . ILE B 1 189 ? 19.510  -23.378 -5.987  1.00 34.41 ? 189 ILE B C   1 
ATOM   4163 O  O   . ILE B 1 189 ? 20.620  -22.931 -5.651  1.00 32.80 ? 189 ILE B O   1 
ATOM   4164 C  CB  . ILE B 1 189 ? 18.704  -24.812 -7.886  1.00 38.05 ? 189 ILE B CB  1 
ATOM   4165 C  CG1 . ILE B 1 189 ? 18.843  -26.211 -8.520  1.00 39.35 ? 189 ILE B CG1 1 
ATOM   4166 C  CG2 . ILE B 1 189 ? 19.351  -23.769 -8.796  1.00 38.04 ? 189 ILE B CG2 1 
ATOM   4167 C  CD1 . ILE B 1 189 ? 17.782  -26.521 -9.555  1.00 42.69 ? 189 ILE B CD1 1 
ATOM   4168 N  N   . LEU B 1 190 ? 18.393  -22.669 -5.921  1.00 33.12 ? 190 LEU B N   1 
ATOM   4169 C  CA  . LEU B 1 190 ? 18.428  -21.262 -5.535  1.00 34.07 ? 190 LEU B CA  1 
ATOM   4170 C  C   . LEU B 1 190 ? 18.817  -21.093 -4.074  1.00 34.84 ? 190 LEU B C   1 
ATOM   4171 O  O   . LEU B 1 190 ? 18.522  -21.966 -3.237  1.00 35.22 ? 190 LEU B O   1 
ATOM   4172 C  CB  . LEU B 1 190 ? 17.080  -20.599 -5.819  1.00 33.45 ? 190 LEU B CB  1 
ATOM   4173 C  CG  . LEU B 1 190 ? 16.771  -20.436 -7.308  1.00 35.00 ? 190 LEU B CG  1 
ATOM   4174 C  CD1 . LEU B 1 190 ? 15.303  -20.094 -7.529  1.00 34.98 ? 190 LEU B CD1 1 
ATOM   4175 C  CD2 . LEU B 1 190 ? 17.687  -19.403 -7.967  1.00 35.02 ? 190 LEU B CD2 1 
ATOM   4176 N  N   . PRO B 1 191 ? 19.470  -19.966 -3.740  1.00 34.47 ? 191 PRO B N   1 
ATOM   4177 C  CA  . PRO B 1 191 ? 19.780  -18.834 -4.646  1.00 36.16 ? 191 PRO B CA  1 
ATOM   4178 C  C   . PRO B 1 191 ? 20.948  -19.054 -5.628  1.00 37.03 ? 191 PRO B C   1 
ATOM   4179 O  O   . PRO B 1 191 ? 20.989  -18.406 -6.677  1.00 34.95 ? 191 PRO B O   1 
ATOM   4180 C  CB  . PRO B 1 191 ? 20.109  -17.695 -3.683  1.00 34.13 ? 191 PRO B CB  1 
ATOM   4181 C  CG  . PRO B 1 191 ? 20.595  -18.372 -2.439  1.00 36.56 ? 191 PRO B CG  1 
ATOM   4182 C  CD  . PRO B 1 191 ? 19.822  -19.663 -2.338  1.00 34.80 ? 191 PRO B CD  1 
ATOM   4183 N  N   . SER B 1 192 ? 21.884  -19.938 -5.290  1.00 37.60 ? 192 SER B N   1 
ATOM   4184 C  CA  . SER B 1 192 ? 23.030  -20.237 -6.158  1.00 40.01 ? 192 SER B CA  1 
ATOM   4185 C  C   . SER B 1 192 ? 23.374  -21.730 -6.139  1.00 37.94 ? 192 SER B C   1 
ATOM   4186 O  O   . SER B 1 192 ? 23.691  -22.300 -5.084  1.00 35.02 ? 192 SER B O   1 
ATOM   4187 C  CB  . SER B 1 192 ? 24.252  -19.418 -5.731  1.00 43.12 ? 192 SER B CB  1 
ATOM   4188 O  OG  . SER B 1 192 ? 25.422  -19.905 -6.377  1.00 48.22 ? 192 SER B OG  1 
ATOM   4189 N  N   . GLY B 1 193 ? 23.323  -22.347 -7.317  1.00 39.40 ? 193 GLY B N   1 
ATOM   4190 C  CA  . GLY B 1 193 ? 23.525  -23.790 -7.466  1.00 41.80 ? 193 GLY B CA  1 
ATOM   4191 C  C   . GLY B 1 193 ? 24.855  -24.254 -6.914  1.00 44.22 ? 193 GLY B C   1 
ATOM   4192 O  O   . GLY B 1 193 ? 24.961  -25.369 -6.410  1.00 50.39 ? 193 GLY B O   1 
ATOM   4193 N  N   . GLY B 1 194 ? 25.855  -23.382 -6.981  1.00 44.23 ? 194 GLY B N   1 
ATOM   4194 C  CA  . GLY B 1 194 ? 27.189  -23.685 -6.501  1.00 50.16 ? 194 GLY B CA  1 
ATOM   4195 C  C   . GLY B 1 194 ? 27.491  -23.336 -5.054  1.00 50.47 ? 194 GLY B C   1 
ATOM   4196 O  O   . GLY B 1 194 ? 28.597  -23.603 -4.580  1.00 51.40 ? 194 GLY B O   1 
ATOM   4197 N  N   . ASP B 1 195 ? 26.538  -22.747 -4.336  1.00 45.73 ? 195 ASP B N   1 
ATOM   4198 C  CA  . ASP B 1 195 ? 26.778  -22.408 -2.940  1.00 41.96 ? 195 ASP B CA  1 
ATOM   4199 C  C   . ASP B 1 195 ? 26.284  -23.530 -2.026  1.00 41.18 ? 195 ASP B C   1 
ATOM   4200 O  O   . ASP B 1 195 ? 25.609  -24.445 -2.470  1.00 41.98 ? 195 ASP B O   1 
ATOM   4201 C  CB  . ASP B 1 195 ? 26.139  -21.060 -2.575  1.00 41.74 ? 195 ASP B CB  1 
ATOM   4202 C  CG  . ASP B 1 195 ? 26.992  -20.259 -1.608  1.00 42.80 ? 195 ASP B CG  1 
ATOM   4203 O  OD1 . ASP B 1 195 ? 27.852  -20.870 -0.940  1.00 40.56 ? 195 ASP B OD1 1 
ATOM   4204 O  OD2 . ASP B 1 195 ? 26.823  -19.016 -1.511  1.00 41.92 ? 195 ASP B OD2 1 
ATOM   4205 N  N   . LYS B 1 196 ? 26.624  -23.437 -0.747  1.00 42.44 ? 196 LYS B N   1 
ATOM   4206 C  CA  . LYS B 1 196 ? 26.431  -24.537 0.205   1.00 43.53 ? 196 LYS B CA  1 
ATOM   4207 C  C   . LYS B 1 196 ? 24.983  -24.734 0.636   1.00 44.11 ? 196 LYS B C   1 
ATOM   4208 O  O   . LYS B 1 196 ? 24.525  -25.861 0.745   1.00 45.86 ? 196 LYS B O   1 
ATOM   4209 C  CB  . LYS B 1 196 ? 27.293  -24.310 1.447   1.00 44.85 ? 196 LYS B CB  1 
ATOM   4210 C  CG  . LYS B 1 196 ? 28.774  -24.164 1.154   1.00 45.44 ? 196 LYS B CG  1 
ATOM   4211 C  CD  . LYS B 1 196 ? 29.567  -23.877 2.417   1.00 49.49 ? 196 LYS B CD  1 
ATOM   4212 C  CE  . LYS B 1 196 ? 30.903  -23.244 2.073   1.00 51.99 ? 196 LYS B CE  1 
ATOM   4213 N  NZ  . LYS B 1 196 ? 31.746  -23.082 3.284   1.00 57.05 ? 196 LYS B NZ  1 
ATOM   4214 N  N   . LYS B 1 197 ? 24.271  -23.642 0.902   1.00 43.91 ? 197 LYS B N   1 
ATOM   4215 C  CA  . LYS B 1 197 ? 22.878  -23.713 1.355   1.00 39.25 ? 197 LYS B CA  1 
ATOM   4216 C  C   . LYS B 1 197 ? 21.917  -23.212 0.297   1.00 38.68 ? 197 LYS B C   1 
ATOM   4217 O  O   . LYS B 1 197 ? 22.227  -22.282 -0.456  1.00 37.57 ? 197 LYS B O   1 
ATOM   4218 C  CB  . LYS B 1 197 ? 22.673  -22.850 2.585   1.00 39.66 ? 197 LYS B CB  1 
ATOM   4219 C  CG  . LYS B 1 197 ? 23.516  -23.192 3.796   1.00 41.77 ? 197 LYS B CG  1 
ATOM   4220 C  CD  . LYS B 1 197 ? 22.804  -22.672 5.033   1.00 43.42 ? 197 LYS B CD  1 
ATOM   4221 C  CE  . LYS B 1 197 ? 23.718  -21.937 5.962   1.00 46.05 ? 197 LYS B CE  1 
ATOM   4222 N  NZ  . LYS B 1 197 ? 22.892  -20.976 6.734   1.00 43.09 ? 197 LYS B NZ  1 
ATOM   4223 N  N   . HIS B 1 198 ? 20.722  -23.786 0.289   1.00 38.34 ? 198 HIS B N   1 
ATOM   4224 C  CA  . HIS B 1 198 ? 19.696  -23.447 -0.688  1.00 36.32 ? 198 HIS B CA  1 
ATOM   4225 C  C   . HIS B 1 198 ? 18.426  -23.032 0.029   1.00 36.25 ? 198 HIS B C   1 
ATOM   4226 O  O   . HIS B 1 198 ? 18.124  -23.562 1.097   1.00 35.02 ? 198 HIS B O   1 
ATOM   4227 C  CB  . HIS B 1 198 ? 19.502  -24.625 -1.636  1.00 36.74 ? 198 HIS B CB  1 
ATOM   4228 C  CG  . HIS B 1 198 ? 20.785  -25.046 -2.267  1.00 40.14 ? 198 HIS B CG  1 
ATOM   4229 N  ND1 . HIS B 1 198 ? 21.322  -24.392 -3.356  1.00 39.75 ? 198 HIS B ND1 1 
ATOM   4230 C  CD2 . HIS B 1 198 ? 21.704  -25.967 -1.888  1.00 41.84 ? 198 HIS B CD2 1 
ATOM   4231 C  CE1 . HIS B 1 198 ? 22.487  -24.939 -3.658  1.00 41.76 ? 198 HIS B CE1 1 
ATOM   4232 N  NE2 . HIS B 1 198 ? 22.743  -25.892 -2.779  1.00 41.05 ? 198 HIS B NE2 1 
ATOM   4233 N  N   . TYR B 1 199 ? 17.717  -22.049 -0.535  1.00 33.94 ? 199 TYR B N   1 
ATOM   4234 C  CA  . TYR B 1 199 ? 16.528  -21.476 0.090   1.00 33.83 ? 199 TYR B CA  1 
ATOM   4235 C  C   . TYR B 1 199 ? 15.386  -21.387 -0.914  1.00 33.47 ? 199 TYR B C   1 
ATOM   4236 O  O   . TYR B 1 199 ? 15.622  -21.207 -2.111  1.00 35.63 ? 199 TYR B O   1 
ATOM   4237 C  CB  . TYR B 1 199 ? 16.789  -20.073 0.667   1.00 32.15 ? 199 TYR B CB  1 
ATOM   4238 C  CG  . TYR B 1 199 ? 17.948  -19.951 1.647   1.00 34.07 ? 199 TYR B CG  1 
ATOM   4239 C  CD1 . TYR B 1 199 ? 17.983  -20.698 2.830   1.00 32.95 ? 199 TYR B CD1 1 
ATOM   4240 C  CD2 . TYR B 1 199 ? 18.991  -19.075 1.410   1.00 31.02 ? 199 TYR B CD2 1 
ATOM   4241 C  CE1 . TYR B 1 199 ? 19.034  -20.574 3.719   1.00 32.88 ? 199 TYR B CE1 1 
ATOM   4242 C  CE2 . TYR B 1 199 ? 20.045  -18.945 2.301   1.00 32.13 ? 199 TYR B CE2 1 
ATOM   4243 C  CZ  . TYR B 1 199 ? 20.060  -19.709 3.463   1.00 32.14 ? 199 TYR B CZ  1 
ATOM   4244 O  OH  . TYR B 1 199 ? 21.108  -19.564 4.369   1.00 32.96 ? 199 TYR B OH  1 
ATOM   4245 N  N   . PRO B 1 200 ? 14.141  -21.513 -0.432  1.00 32.67 ? 200 PRO B N   1 
ATOM   4246 C  CA  . PRO B 1 200 ? 12.956  -21.332 -1.263  1.00 31.83 ? 200 PRO B CA  1 
ATOM   4247 C  C   . PRO B 1 200 ? 12.891  -19.937 -1.859  1.00 31.42 ? 200 PRO B C   1 
ATOM   4248 O  O   . PRO B 1 200 ? 13.255  -18.961 -1.193  1.00 32.53 ? 200 PRO B O   1 
ATOM   4249 C  CB  . PRO B 1 200 ? 11.806  -21.522 -0.274  1.00 33.03 ? 200 PRO B CB  1 
ATOM   4250 C  CG  . PRO B 1 200 ? 12.389  -22.377 0.806   1.00 33.84 ? 200 PRO B CG  1 
ATOM   4251 C  CD  . PRO B 1 200 ? 13.784  -21.881 0.954   1.00 34.05 ? 200 PRO B CD  1 
ATOM   4252 N  N   . ILE B 1 201 ? 12.411  -19.855 -3.094  1.00 32.38 ? 201 ILE B N   1 
ATOM   4253 C  CA  . ILE B 1 201 ? 12.171  -18.571 -3.780  1.00 31.80 ? 201 ILE B CA  1 
ATOM   4254 C  C   . ILE B 1 201 ? 10.663  -18.254 -3.807  1.00 32.07 ? 201 ILE B C   1 
ATOM   4255 O  O   . ILE B 1 201 ? 10.275  -17.088 -3.911  1.00 31.75 ? 201 ILE B O   1 
ATOM   4256 C  CB  . ILE B 1 201 ? 12.765  -18.559 -5.212  1.00 30.40 ? 201 ILE B CB  1 
ATOM   4257 C  CG1 . ILE B 1 201 ? 12.632  -17.177 -5.886  1.00 29.68 ? 201 ILE B CG1 1 
ATOM   4258 C  CG2 . ILE B 1 201 ? 12.107  -19.602 -6.097  1.00 32.83 ? 201 ILE B CG2 1 
ATOM   4259 C  CD1 . ILE B 1 201 ? 13.316  -16.052 -5.118  1.00 30.90 ? 201 ILE B CD1 1 
ATOM   4260 N  N   . ALA B 1 202 ? 9.821   -19.269 -3.668  1.00 32.33 ? 202 ALA B N   1 
ATOM   4261 C  CA  . ALA B 1 202 ? 8.373   -19.068 -3.716  1.00 32.49 ? 202 ALA B CA  1 
ATOM   4262 C  C   . ALA B 1 202 ? 7.927   -18.064 -2.651  1.00 33.86 ? 202 ALA B C   1 
ATOM   4263 O  O   . ALA B 1 202 ? 8.261   -18.218 -1.474  1.00 31.58 ? 202 ALA B O   1 
ATOM   4264 C  CB  . ALA B 1 202 ? 7.653   -20.392 -3.509  1.00 37.20 ? 202 ALA B CB  1 
ATOM   4265 N  N   . PHE B 1 203 ? 7.184   -17.038 -3.073  1.00 31.16 ? 203 PHE B N   1 
ATOM   4266 C  CA  . PHE B 1 203 ? 6.728   -15.967 -2.165  1.00 32.40 ? 203 PHE B CA  1 
ATOM   4267 C  C   . PHE B 1 203 ? 7.856   -15.372 -1.323  1.00 29.89 ? 203 PHE B C   1 
ATOM   4268 O  O   . PHE B 1 203 ? 7.623   -14.934 -0.211  1.00 33.58 ? 203 PHE B O   1 
ATOM   4269 C  CB  . PHE B 1 203 ? 5.613   -16.486 -1.250  1.00 35.14 ? 203 PHE B CB  1 
ATOM   4270 C  CG  . PHE B 1 203 ? 4.438   -17.017 -2.007  1.00 36.15 ? 203 PHE B CG  1 
ATOM   4271 C  CD1 . PHE B 1 203 ? 3.533   -16.159 -2.557  1.00 37.06 ? 203 PHE B CD1 1 
ATOM   4272 C  CD2 . PHE B 1 203 ? 4.313   -18.375 -2.256  1.00 42.37 ? 203 PHE B CD2 1 
ATOM   4273 C  CE1 . PHE B 1 203 ? 2.457   -16.630 -3.292  1.00 40.07 ? 203 PHE B CE1 1 
ATOM   4274 C  CE2 . PHE B 1 203 ? 3.245   -18.863 -2.990  1.00 43.99 ? 203 PHE B CE2 1 
ATOM   4275 C  CZ  . PHE B 1 203 ? 2.311   -17.983 -3.504  1.00 41.31 ? 203 PHE B CZ  1 
ATOM   4276 N  N   . ASN B 1 204 ? 9.051   -15.320 -1.888  1.00 29.02 ? 204 ASN B N   1 
ATOM   4277 C  CA  . ASN B 1 204 ? 10.228  -14.819 -1.191  1.00 29.06 ? 204 ASN B CA  1 
ATOM   4278 C  C   . ASN B 1 204 ? 10.971  -13.800 -2.048  1.00 29.42 ? 204 ASN B C   1 
ATOM   4279 O  O   . ASN B 1 204 ? 10.677  -13.638 -3.223  1.00 30.48 ? 204 ASN B O   1 
ATOM   4280 C  CB  . ASN B 1 204 ? 11.124  -15.995 -0.832  1.00 28.99 ? 204 ASN B CB  1 
ATOM   4281 C  CG  . ASN B 1 204 ? 12.056  -15.710 0.328   1.00 30.21 ? 204 ASN B CG  1 
ATOM   4282 O  OD1 . ASN B 1 204 ? 11.885  -14.754 1.102   1.00 28.98 ? 204 ASN B OD1 1 
ATOM   4283 N  ND2 . ASN B 1 204 ? 13.060  -16.566 0.471   1.00 32.24 ? 204 ASN B ND2 1 
ATOM   4284 N  N   . ALA B 1 205 ? 11.931  -13.111 -1.438  1.00 29.05 ? 205 ALA B N   1 
ATOM   4285 C  CA  . ALA B 1 205 ? 12.873  -12.264 -2.137  1.00 28.55 ? 205 ALA B CA  1 
ATOM   4286 C  C   . ALA B 1 205 ? 14.248  -12.598 -1.568  1.00 28.36 ? 205 ALA B C   1 
ATOM   4287 O  O   . ALA B 1 205 ? 14.507  -12.340 -0.414  1.00 31.38 ? 205 ALA B O   1 
ATOM   4288 C  CB  . ALA B 1 205 ? 12.555  -10.798 -1.885  1.00 28.16 ? 205 ALA B CB  1 
ATOM   4289 N  N   . LEU B 1 206 ? 15.110  -13.189 -2.371  1.00 27.56 ? 206 LEU B N   1 
ATOM   4290 C  CA  . LEU B 1 206 ? 16.446  -13.610 -1.887  1.00 28.35 ? 206 LEU B CA  1 
ATOM   4291 C  C   . LEU B 1 206 ? 17.515  -12.616 -2.332  1.00 29.21 ? 206 LEU B C   1 
ATOM   4292 O  O   . LEU B 1 206 ? 17.854  -12.550 -3.524  1.00 29.55 ? 206 LEU B O   1 
ATOM   4293 C  CB  . LEU B 1 206 ? 16.779  -15.008 -2.406  1.00 29.63 ? 206 LEU B CB  1 
ATOM   4294 C  CG  . LEU B 1 206 ? 15.943  -16.188 -1.897  1.00 29.82 ? 206 LEU B CG  1 
ATOM   4295 C  CD1 . LEU B 1 206 ? 16.230  -17.453 -2.705  1.00 31.68 ? 206 LEU B CD1 1 
ATOM   4296 C  CD2 . LEU B 1 206 ? 16.180  -16.451 -0.430  1.00 32.31 ? 206 LEU B CD2 1 
ATOM   4297 N  N   . PRO B 1 207 ? 18.082  -11.862 -1.382  1.00 30.75 ? 207 PRO B N   1 
ATOM   4298 C  CA  . PRO B 1 207 ? 19.142  -10.924 -1.695  1.00 29.08 ? 207 PRO B CA  1 
ATOM   4299 C  C   . PRO B 1 207 ? 20.499  -11.615 -1.887  1.00 29.43 ? 207 PRO B C   1 
ATOM   4300 O  O   . PRO B 1 207 ? 21.498  -11.226 -1.281  1.00 29.58 ? 207 PRO B O   1 
ATOM   4301 C  CB  . PRO B 1 207 ? 19.136  -10.007 -0.462  1.00 30.53 ? 207 PRO B CB  1 
ATOM   4302 C  CG  . PRO B 1 207 ? 18.865  -10.984 0.651   1.00 29.85 ? 207 PRO B CG  1 
ATOM   4303 C  CD  . PRO B 1 207 ? 17.835  -11.923 0.077   1.00 29.62 ? 207 PRO B CD  1 
ATOM   4304 N  N   . GLN B 1 208 ? 20.536  -12.632 -2.736  1.00 29.31 ? 208 GLN B N   1 
ATOM   4305 C  CA  . GLN B 1 208 ? 21.784  -13.261 -3.102  1.00 30.17 ? 208 GLN B CA  1 
ATOM   4306 C  C   . GLN B 1 208 ? 21.642  -13.781 -4.510  1.00 30.98 ? 208 GLN B C   1 
ATOM   4307 O  O   . GLN B 1 208 ? 20.786  -14.617 -4.770  1.00 31.00 ? 208 GLN B O   1 
ATOM   4308 C  CB  . GLN B 1 208 ? 22.137  -14.425 -2.173  1.00 31.49 ? 208 GLN B CB  1 
ATOM   4309 C  CG  . GLN B 1 208 ? 23.573  -14.896 -2.387  1.00 31.96 ? 208 GLN B CG  1 
ATOM   4310 C  CD  . GLN B 1 208 ? 23.887  -16.251 -1.779  1.00 33.61 ? 208 GLN B CD  1 
ATOM   4311 O  OE1 . GLN B 1 208 ? 23.296  -16.661 -0.778  1.00 32.39 ? 208 GLN B OE1 1 
ATOM   4312 N  NE2 . GLN B 1 208 ? 24.860  -16.949 -2.375  1.00 35.48 ? 208 GLN B NE2 1 
ATOM   4313 N  N   . ILE B 1 209 ? 22.463  -13.248 -5.415  1.00 30.73 ? 209 ILE B N   1 
ATOM   4314 C  CA  . ILE B 1 209 ? 22.652  -13.823 -6.746  1.00 30.66 ? 209 ILE B CA  1 
ATOM   4315 C  C   . ILE B 1 209 ? 24.133  -14.145 -6.902  1.00 30.87 ? 209 ILE B C   1 
ATOM   4316 O  O   . ILE B 1 209 ? 24.961  -13.305 -6.601  1.00 31.18 ? 209 ILE B O   1 
ATOM   4317 C  CB  . ILE B 1 209 ? 22.107  -12.893 -7.838  1.00 31.68 ? 209 ILE B CB  1 
ATOM   4318 C  CG1 . ILE B 1 209 ? 20.592  -12.784 -7.619  1.00 34.03 ? 209 ILE B CG1 1 
ATOM   4319 C  CG2 . ILE B 1 209 ? 22.411  -13.468 -9.227  1.00 31.10 ? 209 ILE B CG2 1 
ATOM   4320 C  CD1 . ILE B 1 209 ? 19.857  -11.930 -8.616  1.00 34.39 ? 209 ILE B CD1 1 
ATOM   4321 N  N   . ASP B 1 210 ? 24.443  -15.373 -7.334  1.00 35.59 ? 210 ASP B N   1 
ATOM   4322 C  CA  . ASP B 1 210 ? 25.827  -15.907 -7.341  1.00 36.78 ? 210 ASP B CA  1 
ATOM   4323 C  C   . ASP B 1 210 ? 26.374  -16.034 -5.920  1.00 37.32 ? 210 ASP B C   1 
ATOM   4324 O  O   . ASP B 1 210 ? 25.643  -15.874 -4.935  1.00 37.86 ? 210 ASP B O   1 
ATOM   4325 C  CB  . ASP B 1 210 ? 26.749  -15.027 -8.218  1.00 40.02 ? 210 ASP B CB  1 
ATOM   4326 C  CG  . ASP B 1 210 ? 27.816  -15.845 -8.981  1.00 45.37 ? 210 ASP B CG  1 
ATOM   4327 O  OD1 . ASP B 1 210 ? 28.430  -16.773 -8.396  1.00 43.52 ? 210 ASP B OD1 1 
ATOM   4328 O  OD2 . ASP B 1 210 ? 28.048  -15.543 -10.171 1.00 47.88 ? 210 ASP B OD2 1 
ATOM   4329 N  N   . VAL B 1 211 ? 27.664  -16.315 -5.791  1.00 37.15 ? 211 VAL B N   1 
ATOM   4330 C  CA  . VAL B 1 211 ? 28.272  -16.457 -4.472  1.00 37.76 ? 211 VAL B CA  1 
ATOM   4331 C  C   . VAL B 1 211 ? 28.845  -15.150 -3.972  1.00 36.59 ? 211 VAL B C   1 
ATOM   4332 O  O   . VAL B 1 211 ? 29.012  -14.198 -4.730  1.00 38.28 ? 211 VAL B O   1 
ATOM   4333 C  CB  . VAL B 1 211 ? 29.358  -17.560 -4.464  1.00 40.31 ? 211 VAL B CB  1 
ATOM   4334 C  CG1 . VAL B 1 211 ? 28.750  -18.887 -4.900  1.00 41.00 ? 211 VAL B CG1 1 
ATOM   4335 C  CG2 . VAL B 1 211 ? 30.538  -17.188 -5.348  1.00 40.63 ? 211 VAL B CG2 1 
ATOM   4336 N  N   . PHE B 1 212 ? 29.128  -15.103 -2.682  1.00 35.58 ? 212 PHE B N   1 
ATOM   4337 C  CA  . PHE B 1 212 ? 29.682  -13.920 -2.059  1.00 38.19 ? 212 PHE B CA  1 
ATOM   4338 C  C   . PHE B 1 212 ? 31.169  -13.748 -2.383  1.00 40.66 ? 212 PHE B C   1 
ATOM   4339 O  O   . PHE B 1 212 ? 31.910  -14.730 -2.482  1.00 38.36 ? 212 PHE B O   1 
ATOM   4340 C  CB  . PHE B 1 212 ? 29.438  -13.945 -0.545  1.00 38.93 ? 212 PHE B CB  1 
ATOM   4341 C  CG  . PHE B 1 212 ? 28.027  -13.537 -0.169  1.00 39.58 ? 212 PHE B CG  1 
ATOM   4342 C  CD1 . PHE B 1 212 ? 27.695  -12.193 -0.030  1.00 39.97 ? 212 PHE B CD1 1 
ATOM   4343 C  CD2 . PHE B 1 212 ? 27.031  -14.488 -0.008  1.00 39.22 ? 212 PHE B CD2 1 
ATOM   4344 C  CE1 . PHE B 1 212 ? 26.392  -11.810 0.281   1.00 38.03 ? 212 PHE B CE1 1 
ATOM   4345 C  CE2 . PHE B 1 212 ? 25.728  -14.114 0.306   1.00 39.46 ? 212 PHE B CE2 1 
ATOM   4346 C  CZ  . PHE B 1 212 ? 25.411  -12.773 0.441   1.00 37.28 ? 212 PHE B CZ  1 
ATOM   4347 N  N   . THR B 1 213 ? 31.575  -12.500 -2.584  1.00 39.24 ? 213 THR B N   1 
ATOM   4348 C  CA  . THR B 1 213 ? 32.981  -12.164 -2.732  1.00 42.21 ? 213 THR B CA  1 
ATOM   4349 C  C   . THR B 1 213 ? 33.497  -11.671 -1.411  1.00 43.86 ? 213 THR B C   1 
ATOM   4350 O  O   . THR B 1 213 ? 32.740  -11.294 -0.527  1.00 43.36 ? 213 THR B O   1 
ATOM   4351 C  CB  . THR B 1 213 ? 33.238  -11.020 -3.738  1.00 39.54 ? 213 THR B CB  1 
ATOM   4352 O  OG1 . THR B 1 213 ? 32.916  -9.765  -3.128  1.00 39.11 ? 213 THR B OG1 1 
ATOM   4353 C  CG2 . THR B 1 213 ? 32.444  -11.211 -5.016  1.00 43.36 ? 213 THR B CG2 1 
ATOM   4354 N  N   . ASP B 1 214 ? 34.817  -11.621 -1.318  1.00 48.34 ? 214 ASP B N   1 
ATOM   4355 C  CA  . ASP B 1 214 ? 35.517  -11.190 -0.120  1.00 49.89 ? 214 ASP B CA  1 
ATOM   4356 C  C   . ASP B 1 214 ? 35.058  -9.839  0.468   1.00 46.38 ? 214 ASP B C   1 
ATOM   4357 O  O   . ASP B 1 214 ? 35.239  -9.603  1.656   1.00 45.79 ? 214 ASP B O   1 
ATOM   4358 C  CB  . ASP B 1 214 ? 37.024  -11.146 -0.438  1.00 59.02 ? 214 ASP B CB  1 
ATOM   4359 C  CG  . ASP B 1 214 ? 37.884  -11.141 0.797   1.00 68.63 ? 214 ASP B CG  1 
ATOM   4360 O  OD1 . ASP B 1 214 ? 37.526  -11.830 1.779   1.00 80.05 ? 214 ASP B OD1 1 
ATOM   4361 O  OD2 . ASP B 1 214 ? 38.932  -10.457 0.782   1.00 76.84 ? 214 ASP B OD2 1 
ATOM   4362 N  N   . ASN B 1 215 ? 34.483  -8.944  -0.336  1.00 40.13 ? 215 ASN B N   1 
ATOM   4363 C  CA  . ASN B 1 215 ? 34.043  -7.645  0.191   1.00 38.83 ? 215 ASN B CA  1 
ATOM   4364 C  C   . ASN B 1 215 ? 32.544  -7.575  0.622   1.00 36.93 ? 215 ASN B C   1 
ATOM   4365 O  O   . ASN B 1 215 ? 32.038  -6.493  0.910   1.00 34.77 ? 215 ASN B O   1 
ATOM   4366 C  CB  . ASN B 1 215 ? 34.354  -6.526  -0.821  1.00 38.86 ? 215 ASN B CB  1 
ATOM   4367 C  CG  . ASN B 1 215 ? 33.405  -6.509  -2.013  1.00 40.53 ? 215 ASN B CG  1 
ATOM   4368 O  OD1 . ASN B 1 215 ? 32.537  -7.373  -2.168  1.00 37.50 ? 215 ASN B OD1 1 
ATOM   4369 N  ND2 . ASN B 1 215 ? 33.588  -5.524  -2.882  1.00 39.15 ? 215 ASN B ND2 1 
ATOM   4370 N  N   . ASP B 1 216 ? 31.882  -8.733  0.679   1.00 37.54 ? 216 ASP B N   1 
ATOM   4371 C  CA  . ASP B 1 216 ? 30.481  -8.871  1.131   1.00 35.74 ? 216 ASP B CA  1 
ATOM   4372 C  C   . ASP B 1 216 ? 29.430  -8.417  0.113   1.00 37.15 ? 216 ASP B C   1 
ATOM   4373 O  O   . ASP B 1 216 ? 28.219  -8.455  0.400   1.00 34.23 ? 216 ASP B O   1 
ATOM   4374 C  CB  . ASP B 1 216 ? 30.255  -8.216  2.499   1.00 37.16 ? 216 ASP B CB  1 
ATOM   4375 C  CG  . ASP B 1 216 ? 31.167  -8.804  3.587   1.00 36.21 ? 216 ASP B CG  1 
ATOM   4376 O  OD1 . ASP B 1 216 ? 31.621  -9.950  3.446   1.00 36.67 ? 216 ASP B OD1 1 
ATOM   4377 O  OD2 . ASP B 1 216 ? 31.392  -8.127  4.585   1.00 35.72 ? 216 ASP B OD2 1 
ATOM   4378 N  N   . TYR B 1 217 ? 29.878  -8.023  -1.080  1.00 33.72 ? 217 TYR B N   1 
ATOM   4379 C  CA  . TYR B 1 217 ? 29.003  -7.969  -2.238  1.00 33.98 ? 217 TYR B CA  1 
ATOM   4380 C  C   . TYR B 1 217 ? 29.096  -9.343  -2.890  1.00 33.76 ? 217 TYR B C   1 
ATOM   4381 O  O   . TYR B 1 217 ? 30.126  -10.016 -2.805  1.00 36.46 ? 217 TYR B O   1 
ATOM   4382 C  CB  . TYR B 1 217 ? 29.444  -6.875  -3.226  1.00 32.52 ? 217 TYR B CB  1 
ATOM   4383 C  CG  . TYR B 1 217 ? 29.165  -5.452  -2.786  1.00 31.90 ? 217 TYR B CG  1 
ATOM   4384 C  CD1 . TYR B 1 217 ? 29.921  -4.839  -1.799  1.00 31.39 ? 217 TYR B CD1 1 
ATOM   4385 C  CD2 . TYR B 1 217 ? 28.139  -4.712  -3.373  1.00 33.50 ? 217 TYR B CD2 1 
ATOM   4386 C  CE1 . TYR B 1 217 ? 29.666  -3.529  -1.401  1.00 31.78 ? 217 TYR B CE1 1 
ATOM   4387 C  CE2 . TYR B 1 217 ? 27.873  -3.401  -2.982  1.00 33.00 ? 217 TYR B CE2 1 
ATOM   4388 C  CZ  . TYR B 1 217 ? 28.643  -2.813  -2.012  1.00 30.72 ? 217 TYR B CZ  1 
ATOM   4389 O  OH  . TYR B 1 217 ? 28.372  -1.524  -1.634  1.00 31.21 ? 217 TYR B OH  1 
ATOM   4390 N  N   . THR B 1 218 ? 28.025  -9.759  -3.542  1.00 29.87 ? 218 THR B N   1 
ATOM   4391 C  CA  . THR B 1 218 ? 28.044  -10.987 -4.309  1.00 31.32 ? 218 THR B CA  1 
ATOM   4392 C  C   . THR B 1 218 ? 28.757  -10.781 -5.637  1.00 32.03 ? 218 THR B C   1 
ATOM   4393 O  O   . THR B 1 218 ? 29.000  -9.637  -6.057  1.00 32.22 ? 218 THR B O   1 
ATOM   4394 C  CB  . THR B 1 218 ? 26.628  -11.480 -4.605  1.00 32.77 ? 218 THR B CB  1 
ATOM   4395 O  OG1 . THR B 1 218 ? 25.988  -10.568 -5.508  1.00 30.10 ? 218 THR B OG1 1 
ATOM   4396 C  CG2 . THR B 1 218 ? 25.825  -11.615 -3.323  1.00 32.82 ? 218 THR B CG2 1 
ATOM   4397 N  N   . TYR B 1 219 ? 29.090  -11.887 -6.309  1.00 34.77 ? 219 TYR B N   1 
ATOM   4398 C  CA  . TYR B 1 219 ? 29.750  -11.792 -7.616  1.00 35.88 ? 219 TYR B CA  1 
ATOM   4399 C  C   . TYR B 1 219 ? 28.851  -11.094 -8.622  1.00 34.58 ? 219 TYR B C   1 
ATOM   4400 O  O   . TYR B 1 219 ? 29.350  -10.347 -9.458  1.00 34.28 ? 219 TYR B O   1 
ATOM   4401 C  CB  . TYR B 1 219 ? 30.204  -13.156 -8.148  1.00 39.90 ? 219 TYR B CB  1 
ATOM   4402 C  CG  . TYR B 1 219 ? 31.581  -13.513 -7.654  1.00 47.32 ? 219 TYR B CG  1 
ATOM   4403 C  CD1 . TYR B 1 219 ? 32.728  -12.963 -8.239  1.00 52.29 ? 219 TYR B CD1 1 
ATOM   4404 C  CD2 . TYR B 1 219 ? 31.745  -14.366 -6.571  1.00 51.66 ? 219 TYR B CD2 1 
ATOM   4405 C  CE1 . TYR B 1 219 ? 33.999  -13.274 -7.757  1.00 54.00 ? 219 TYR B CE1 1 
ATOM   4406 C  CE2 . TYR B 1 219 ? 33.005  -14.687 -6.086  1.00 55.44 ? 219 TYR B CE2 1 
ATOM   4407 C  CZ  . TYR B 1 219 ? 34.125  -14.143 -6.678  1.00 57.41 ? 219 TYR B CZ  1 
ATOM   4408 O  OH  . TYR B 1 219 ? 35.357  -14.478 -6.175  1.00 66.64 ? 219 TYR B OH  1 
ATOM   4409 N  N   . GLU B 1 220 ? 27.531  -11.301 -8.529  1.00 32.27 ? 220 GLU B N   1 
ATOM   4410 C  CA  . GLU B 1 220 ? 26.609  -10.628 -9.439  1.00 32.48 ? 220 GLU B CA  1 
ATOM   4411 C  C   . GLU B 1 220 ? 26.739  -9.134  -9.300  1.00 30.90 ? 220 GLU B C   1 
ATOM   4412 O  O   . GLU B 1 220 ? 26.886  -8.432  -10.290 1.00 33.83 ? 220 GLU B O   1 
ATOM   4413 C  CB  . GLU B 1 220 ? 25.155  -11.059 -9.219  1.00 34.91 ? 220 GLU B CB  1 
ATOM   4414 C  CG  . GLU B 1 220 ? 24.167  -10.500 -10.254 1.00 37.45 ? 220 GLU B CG  1 
ATOM   4415 C  CD  . GLU B 1 220 ? 24.113  -11.308 -11.547 1.00 41.75 ? 220 GLU B CD  1 
ATOM   4416 O  OE1 . GLU B 1 220 ? 25.103  -11.962 -11.884 1.00 45.13 ? 220 GLU B OE1 1 
ATOM   4417 O  OE2 . GLU B 1 220 ? 23.066  -11.303 -12.236 1.00 45.28 ? 220 GLU B OE2 1 
ATOM   4418 N  N   . GLU B 1 221 ? 26.712  -8.653  -8.068  1.00 31.49 ? 221 GLU B N   1 
ATOM   4419 C  CA  . GLU B 1 221 ? 26.818  -7.227  -7.797  1.00 31.49 ? 221 GLU B CA  1 
ATOM   4420 C  C   . GLU B 1 221 ? 28.146  -6.629  -8.302  1.00 32.32 ? 221 GLU B C   1 
ATOM   4421 O  O   . GLU B 1 221 ? 28.176  -5.543  -8.910  1.00 32.96 ? 221 GLU B O   1 
ATOM   4422 C  CB  . GLU B 1 221 ? 26.610  -6.959  -6.286  1.00 32.22 ? 221 GLU B CB  1 
ATOM   4423 C  CG  . GLU B 1 221 ? 25.178  -7.287  -5.801  1.00 33.07 ? 221 GLU B CG  1 
ATOM   4424 C  CD  . GLU B 1 221 ? 25.047  -7.618  -4.302  1.00 34.17 ? 221 GLU B CD  1 
ATOM   4425 O  OE1 . GLU B 1 221 ? 26.048  -7.596  -3.543  1.00 30.82 ? 221 GLU B OE1 1 
ATOM   4426 O  OE2 . GLU B 1 221 ? 23.904  -7.905  -3.877  1.00 31.38 ? 221 GLU B OE2 1 
ATOM   4427 N  N   . MET B 1 222 ? 29.243  -7.325  -8.038  1.00 31.98 ? 222 MET B N   1 
ATOM   4428 C  CA  . MET B 1 222 ? 30.551  -6.872  -8.513  1.00 32.36 ? 222 MET B CA  1 
ATOM   4429 C  C   . MET B 1 222 ? 30.709  -6.942  -10.042 1.00 33.38 ? 222 MET B C   1 
ATOM   4430 O  O   . MET B 1 222 ? 31.378  -6.094  -10.636 1.00 35.33 ? 222 MET B O   1 
ATOM   4431 C  CB  . MET B 1 222 ? 31.666  -7.659  -7.828  1.00 32.86 ? 222 MET B CB  1 
ATOM   4432 C  CG  . MET B 1 222 ? 31.764  -7.412  -6.338  1.00 32.38 ? 222 MET B CG  1 
ATOM   4433 S  SD  . MET B 1 222 ? 31.739  -5.684  -5.852  1.00 37.20 ? 222 MET B SD  1 
ATOM   4434 C  CE  . MET B 1 222 ? 33.230  -5.095  -6.679  1.00 40.98 ? 222 MET B CE  1 
ATOM   4435 N  N   . LYS B 1 223 ? 30.089  -7.924  -10.685 1.00 34.43 ? 223 LYS B N   1 
ATOM   4436 C  CA  . LYS B 1 223 ? 30.039  -7.929  -12.142 1.00 35.62 ? 223 LYS B CA  1 
ATOM   4437 C  C   . LYS B 1 223 ? 29.361  -6.662  -12.666 1.00 35.76 ? 223 LYS B C   1 
ATOM   4438 O  O   . LYS B 1 223 ? 29.838  -6.059  -13.633 1.00 32.25 ? 223 LYS B O   1 
ATOM   4439 C  CB  . LYS B 1 223 ? 29.312  -9.155  -12.671 1.00 36.25 ? 223 LYS B CB  1 
ATOM   4440 C  CG  . LYS B 1 223 ? 30.095  -10.457 -12.544 1.00 41.26 ? 223 LYS B CG  1 
ATOM   4441 C  CD  . LYS B 1 223 ? 29.270  -11.598 -13.128 1.00 44.86 ? 223 LYS B CD  1 
ATOM   4442 C  CE  . LYS B 1 223 ? 29.245  -12.842 -12.259 1.00 48.93 ? 223 LYS B CE  1 
ATOM   4443 N  NZ  . LYS B 1 223 ? 28.018  -13.647 -12.537 1.00 49.82 ? 223 LYS B NZ  1 
ATOM   4444 N  N   . MET B 1 224 ? 28.263  -6.243  -12.032 1.00 35.26 ? 224 MET B N   1 
ATOM   4445 C  CA  . MET B 1 224 ? 27.585  -5.020  -12.462 1.00 35.19 ? 224 MET B CA  1 
ATOM   4446 C  C   . MET B 1 224 ? 28.535  -3.816  -12.359 1.00 37.55 ? 224 MET B C   1 
ATOM   4447 O  O   . MET B 1 224 ? 28.608  -2.975  -13.267 1.00 34.58 ? 224 MET B O   1 
ATOM   4448 C  CB  . MET B 1 224 ? 26.299  -4.792  -11.657 1.00 36.47 ? 224 MET B CB  1 
ATOM   4449 C  CG  . MET B 1 224 ? 25.231  -5.841  -11.945 1.00 37.48 ? 224 MET B CG  1 
ATOM   4450 S  SD  . MET B 1 224 ? 23.608  -5.335  -11.344 1.00 36.31 ? 224 MET B SD  1 
ATOM   4451 C  CE  . MET B 1 224 ? 23.119  -4.169  -12.628 1.00 38.08 ? 224 MET B CE  1 
ATOM   4452 N  N   . THR B 1 225 ? 29.298  -3.776  -11.274 1.00 35.73 ? 225 THR B N   1 
ATOM   4453 C  CA  . THR B 1 225 ? 30.285  -2.724  -11.062 1.00 37.81 ? 225 THR B CA  1 
ATOM   4454 C  C   . THR B 1 225 ? 31.402  -2.761  -12.119 1.00 37.60 ? 225 THR B C   1 
ATOM   4455 O  O   . THR B 1 225 ? 31.612  -1.778  -12.845 1.00 35.08 ? 225 THR B O   1 
ATOM   4456 C  CB  . THR B 1 225 ? 30.855  -2.798  -9.635  1.00 37.14 ? 225 THR B CB  1 
ATOM   4457 O  OG1 . THR B 1 225 ? 29.818  -2.454  -8.709  1.00 36.33 ? 225 THR B OG1 1 
ATOM   4458 C  CG2 . THR B 1 225 ? 32.016  -1.821  -9.445  1.00 37.29 ? 225 THR B CG2 1 
ATOM   4459 N  N   . LYS B 1 226 ? 32.071  -3.899  -12.237 1.00 37.13 ? 226 LYS B N   1 
ATOM   4460 C  CA  . LYS B 1 226 ? 33.262  -3.990  -13.092 1.00 38.46 ? 226 LYS B CA  1 
ATOM   4461 C  C   . LYS B 1 226 ? 32.907  -4.006  -14.582 1.00 38.60 ? 226 LYS B C   1 
ATOM   4462 O  O   . LYS B 1 226 ? 33.576  -3.361  -15.389 1.00 36.34 ? 226 LYS B O   1 
ATOM   4463 C  CB  . LYS B 1 226 ? 34.103  -5.199  -12.695 1.00 41.19 ? 226 LYS B CB  1 
ATOM   4464 C  CG  . LYS B 1 226 ? 34.525  -5.143  -11.230 1.00 43.48 ? 226 LYS B CG  1 
ATOM   4465 C  CD  . LYS B 1 226 ? 35.579  -6.178  -10.889 1.00 51.09 ? 226 LYS B CD  1 
ATOM   4466 C  CE  . LYS B 1 226 ? 36.507  -5.644  -9.802  1.00 54.48 ? 226 LYS B CE  1 
ATOM   4467 N  NZ  . LYS B 1 226 ? 37.442  -6.684  -9.306  1.00 59.05 ? 226 LYS B NZ  1 
ATOM   4468 N  N   . GLU B 1 227 ? 31.834  -4.699  -14.947 1.00 34.27 ? 227 GLU B N   1 
ATOM   4469 C  CA  . GLU B 1 227 ? 31.439  -4.740  -16.340 1.00 35.38 ? 227 GLU B CA  1 
ATOM   4470 C  C   . GLU B 1 227 ? 30.987  -3.376  -16.863 1.00 34.96 ? 227 GLU B C   1 
ATOM   4471 O  O   . GLU B 1 227 ? 31.249  -3.038  -18.016 1.00 36.82 ? 227 GLU B O   1 
ATOM   4472 C  CB  . GLU B 1 227 ? 30.382  -5.804  -16.570 1.00 37.23 ? 227 GLU B CB  1 
ATOM   4473 C  CG  . GLU B 1 227 ? 30.919  -7.201  -16.291 1.00 38.35 ? 227 GLU B CG  1 
ATOM   4474 C  CD  . GLU B 1 227 ? 29.870  -8.287  -16.432 1.00 40.92 ? 227 GLU B CD  1 
ATOM   4475 O  OE1 . GLU B 1 227 ? 28.813  -8.013  -17.053 1.00 42.83 ? 227 GLU B OE1 1 
ATOM   4476 O  OE2 . GLU B 1 227 ? 30.114  -9.412  -15.927 1.00 37.16 ? 227 GLU B OE2 1 
ATOM   4477 N  N   . THR B 1 228 ? 30.329  -2.592  -16.017 1.00 33.19 ? 228 THR B N   1 
ATOM   4478 C  CA  . THR B 1 228 ? 29.888  -1.258  -16.394 1.00 34.21 ? 228 THR B CA  1 
ATOM   4479 C  C   . THR B 1 228 ? 31.091  -0.388  -16.752 1.00 35.79 ? 228 THR B C   1 
ATOM   4480 O  O   . THR B 1 228 ? 31.087  0.304   -17.779 1.00 34.73 ? 228 THR B O   1 
ATOM   4481 C  CB  . THR B 1 228 ? 29.066  -0.602  -15.269 1.00 34.80 ? 228 THR B CB  1 
ATOM   4482 O  OG1 . THR B 1 228 ? 27.758  -1.209  -15.211 1.00 35.67 ? 228 THR B OG1 1 
ATOM   4483 C  CG2 . THR B 1 228 ? 28.892  0.873   -15.520 1.00 34.90 ? 228 THR B CG2 1 
ATOM   4484 N  N   . LYS B 1 229 ? 32.119  -0.446  -15.910 1.00 34.01 ? 229 LYS B N   1 
ATOM   4485 C  CA  . LYS B 1 229 ? 33.297  0.385   -16.103 1.00 37.47 ? 229 LYS B CA  1 
ATOM   4486 C  C   . LYS B 1 229 ? 33.995  0.025   -17.409 1.00 36.89 ? 229 LYS B C   1 
ATOM   4487 O  O   . LYS B 1 229 ? 34.400  0.919   -18.164 1.00 39.78 ? 229 LYS B O   1 
ATOM   4488 C  CB  . LYS B 1 229 ? 34.266  0.257   -14.929 1.00 36.74 ? 229 LYS B CB  1 
ATOM   4489 C  CG  . LYS B 1 229 ? 33.805  0.887   -13.618 1.00 36.53 ? 229 LYS B CG  1 
ATOM   4490 C  CD  . LYS B 1 229 ? 34.657  0.368   -12.468 1.00 37.21 ? 229 LYS B CD  1 
ATOM   4491 C  CE  . LYS B 1 229 ? 34.186  0.809   -11.090 1.00 36.68 ? 229 LYS B CE  1 
ATOM   4492 N  NZ  . LYS B 1 229 ? 34.353  2.271   -10.890 1.00 39.97 ? 229 LYS B NZ  1 
ATOM   4493 N  N   . LYS B 1 230 ? 34.117  -1.272  -17.683 1.00 37.47 ? 230 LYS B N   1 
ATOM   4494 C  CA  . LYS B 1 230 ? 34.738  -1.741  -18.922 1.00 38.45 ? 230 LYS B CA  1 
ATOM   4495 C  C   . LYS B 1 230 ? 33.896  -1.399  -20.169 1.00 39.24 ? 230 LYS B C   1 
ATOM   4496 O  O   . LYS B 1 230 ? 34.437  -0.931  -21.171 1.00 40.20 ? 230 LYS B O   1 
ATOM   4497 C  CB  . LYS B 1 230 ? 35.031  -3.243  -18.841 1.00 39.24 ? 230 LYS B CB  1 
ATOM   4498 C  CG  . LYS B 1 230 ? 35.778  -3.792  -20.042 1.00 39.47 ? 230 LYS B CG  1 
ATOM   4499 C  CD  . LYS B 1 230 ? 36.209  -5.234  -19.857 1.00 39.24 ? 230 LYS B CD  1 
ATOM   4500 C  CE  . LYS B 1 230 ? 36.909  -5.727  -21.116 1.00 40.32 ? 230 LYS B CE  1 
ATOM   4501 N  NZ  . LYS B 1 230 ? 37.463  -7.100  -20.984 1.00 41.66 ? 230 LYS B NZ  1 
ATOM   4502 N  N   . ILE B 1 231 ? 32.577  -1.593  -20.105 1.00 37.08 ? 231 ILE B N   1 
ATOM   4503 C  CA  . ILE B 1 231 ? 31.720  -1.330  -21.258 1.00 35.40 ? 231 ILE B CA  1 
ATOM   4504 C  C   . ILE B 1 231 ? 31.737  0.133   -21.663 1.00 35.79 ? 231 ILE B C   1 
ATOM   4505 O  O   . ILE B 1 231 ? 31.922  0.463   -22.831 1.00 36.21 ? 231 ILE B O   1 
ATOM   4506 C  CB  . ILE B 1 231 ? 30.264  -1.796  -21.006 1.00 35.04 ? 231 ILE B CB  1 
ATOM   4507 C  CG1 . ILE B 1 231 ? 30.216  -3.331  -20.940 1.00 36.21 ? 231 ILE B CG1 1 
ATOM   4508 C  CG2 . ILE B 1 231 ? 29.347  -1.338  -22.134 1.00 36.51 ? 231 ILE B CG2 1 
ATOM   4509 C  CD1 . ILE B 1 231 ? 29.042  -3.894  -20.166 1.00 34.37 ? 231 ILE B CD1 1 
ATOM   4510 N  N   . MET B 1 232 ? 31.547  1.015   -20.694 1.00 35.70 ? 232 MET B N   1 
ATOM   4511 C  CA  . MET B 1 232 ? 31.544  2.439   -20.958 1.00 37.60 ? 232 MET B CA  1 
ATOM   4512 C  C   . MET B 1 232 ? 32.956  3.056   -20.957 1.00 39.20 ? 232 MET B C   1 
ATOM   4513 O  O   . MET B 1 232 ? 33.103  4.266   -21.190 1.00 38.38 ? 232 MET B O   1 
ATOM   4514 C  CB  . MET B 1 232 ? 30.645  3.138   -19.940 1.00 38.09 ? 232 MET B CB  1 
ATOM   4515 C  CG  . MET B 1 232 ? 29.161  2.811   -20.111 1.00 38.82 ? 232 MET B CG  1 
ATOM   4516 S  SD  . MET B 1 232 ? 28.173  3.452   -18.750 1.00 38.81 ? 232 MET B SD  1 
ATOM   4517 C  CE  . MET B 1 232 ? 26.555  3.633   -19.520 1.00 38.14 ? 232 MET B CE  1 
ATOM   4518 N  N   . GLU B 1 233 ? 33.968  2.226   -20.697 1.00 39.62 ? 233 GLU B N   1 
ATOM   4519 C  CA  . GLU B 1 233 ? 35.385  2.614   -20.756 1.00 40.43 ? 233 GLU B CA  1 
ATOM   4520 C  C   . GLU B 1 233 ? 35.634  3.847   -19.898 1.00 41.44 ? 233 GLU B C   1 
ATOM   4521 O  O   . GLU B 1 233 ? 36.086  4.871   -20.383 1.00 39.41 ? 233 GLU B O   1 
ATOM   4522 C  CB  . GLU B 1 233 ? 35.824  2.814   -22.233 1.00 40.41 ? 233 GLU B CB  1 
ATOM   4523 C  CG  . GLU B 1 233 ? 35.538  1.583   -23.103 1.00 41.11 ? 233 GLU B CG  1 
ATOM   4524 C  CD  . GLU B 1 233 ? 35.806  1.762   -24.594 1.00 45.67 ? 233 GLU B CD  1 
ATOM   4525 O  OE1 . GLU B 1 233 ? 36.151  2.874   -25.036 1.00 46.51 ? 233 GLU B OE1 1 
ATOM   4526 O  OE2 . GLU B 1 233 ? 35.656  0.774   -25.341 1.00 47.72 ? 233 GLU B OE2 1 
ATOM   4527 N  N   . ASP B 1 234 ? 35.292  3.743   -18.615 1.00 40.87 ? 234 ASP B N   1 
ATOM   4528 C  CA  . ASP B 1 234 ? 35.434  4.841   -17.672 1.00 41.52 ? 234 ASP B CA  1 
ATOM   4529 C  C   . ASP B 1 234 ? 35.360  4.278   -16.248 1.00 44.40 ? 234 ASP B C   1 
ATOM   4530 O  O   . ASP B 1 234 ? 34.269  4.052   -15.718 1.00 40.00 ? 234 ASP B O   1 
ATOM   4531 C  CB  . ASP B 1 234 ? 34.342  5.899   -17.913 1.00 41.52 ? 234 ASP B CB  1 
ATOM   4532 C  CG  . ASP B 1 234 ? 34.473  7.115   -17.008 1.00 42.53 ? 234 ASP B CG  1 
ATOM   4533 O  OD1 . ASP B 1 234 ? 35.426  7.187   -16.196 1.00 42.39 ? 234 ASP B OD1 1 
ATOM   4534 O  OD2 . ASP B 1 234 ? 33.607  8.017   -17.103 1.00 43.95 ? 234 ASP B OD2 1 
ATOM   4535 N  N   . ASP B 1 235 ? 36.530  4.048   -15.650 1.00 43.71 ? 235 ASP B N   1 
ATOM   4536 C  CA  . ASP B 1 235 ? 36.656  3.553   -14.270 1.00 46.45 ? 235 ASP B CA  1 
ATOM   4537 C  C   . ASP B 1 235 ? 36.254  4.564   -13.198 1.00 42.79 ? 235 ASP B C   1 
ATOM   4538 O  O   . ASP B 1 235 ? 36.203  4.232   -12.023 1.00 45.97 ? 235 ASP B O   1 
ATOM   4539 C  CB  . ASP B 1 235 ? 38.100  3.114   -13.981 1.00 50.22 ? 235 ASP B CB  1 
ATOM   4540 C  CG  . ASP B 1 235 ? 38.495  1.847   -14.713 1.00 55.64 ? 235 ASP B CG  1 
ATOM   4541 O  OD1 . ASP B 1 235 ? 37.613  1.126   -15.225 1.00 56.21 ? 235 ASP B OD1 1 
ATOM   4542 O  OD2 . ASP B 1 235 ? 39.709  1.561   -14.771 1.00 62.97 ? 235 ASP B OD2 1 
ATOM   4543 N  N   . SER B 1 236 ? 35.969  5.792   -13.581 1.00 38.97 ? 236 SER B N   1 
ATOM   4544 C  CA  . SER B 1 236 ? 35.594  6.798   -12.606 1.00 39.48 ? 236 SER B CA  1 
ATOM   4545 C  C   . SER B 1 236 ? 34.095  6.779   -12.305 1.00 38.92 ? 236 SER B C   1 
ATOM   4546 O  O   . SER B 1 236 ? 33.641  7.473   -11.395 1.00 40.18 ? 236 SER B O   1 
ATOM   4547 C  CB  . SER B 1 236 ? 35.989  8.182   -13.112 1.00 39.53 ? 236 SER B CB  1 
ATOM   4548 O  OG  . SER B 1 236 ? 35.069  8.623   -14.080 1.00 41.80 ? 236 SER B OG  1 
ATOM   4549 N  N   . ILE B 1 237 ? 33.321  6.032   -13.085 1.00 38.92 ? 237 ILE B N   1 
ATOM   4550 C  CA  . ILE B 1 237 ? 31.888  5.880   -12.784 1.00 38.02 ? 237 ILE B CA  1 
ATOM   4551 C  C   . ILE B 1 237 ? 31.755  4.973   -11.558 1.00 32.76 ? 237 ILE B C   1 
ATOM   4552 O  O   . ILE B 1 237 ? 32.113  3.809   -11.614 1.00 36.05 ? 237 ILE B O   1 
ATOM   4553 C  CB  . ILE B 1 237 ? 31.101  5.260   -13.946 1.00 37.75 ? 237 ILE B CB  1 
ATOM   4554 C  CG1 . ILE B 1 237 ? 31.229  6.119   -15.216 1.00 38.31 ? 237 ILE B CG1 1 
ATOM   4555 C  CG2 . ILE B 1 237 ? 29.628  5.131   -13.551 1.00 38.91 ? 237 ILE B CG2 1 
ATOM   4556 C  CD1 . ILE B 1 237 ? 30.633  5.475   -16.449 1.00 40.37 ? 237 ILE B CD1 1 
ATOM   4557 N  N   . ALA B 1 238 ? 31.276  5.537   -10.458 1.00 31.64 ? 238 ALA B N   1 
ATOM   4558 C  CA  . ALA B 1 238 ? 31.044  4.801   -9.218  1.00 31.41 ? 238 ALA B CA  1 
ATOM   4559 C  C   . ALA B 1 238 ? 29.764  3.988   -9.354  1.00 32.66 ? 238 ALA B C   1 
ATOM   4560 O  O   . ALA B 1 238 ? 28.702  4.560   -9.625  1.00 32.59 ? 238 ALA B O   1 
ATOM   4561 C  CB  . ALA B 1 238 ? 30.905  5.773   -8.074  1.00 32.76 ? 238 ALA B CB  1 
ATOM   4562 N  N   . VAL B 1 239 ? 29.871  2.674   -9.160  1.00 33.68 ? 239 VAL B N   1 
ATOM   4563 C  CA  . VAL B 1 239 ? 28.745  1.752   -9.290  1.00 32.82 ? 239 VAL B CA  1 
ATOM   4564 C  C   . VAL B 1 239 ? 28.650  0.790   -8.096  1.00 32.15 ? 239 VAL B C   1 
ATOM   4565 O  O   . VAL B 1 239 ? 29.571  0.005   -7.845  1.00 31.82 ? 239 VAL B O   1 
ATOM   4566 C  CB  . VAL B 1 239 ? 28.888  0.884   -10.550 1.00 33.39 ? 239 VAL B CB  1 
ATOM   4567 C  CG1 . VAL B 1 239 ? 27.663  -0.026  -10.721 1.00 34.47 ? 239 VAL B CG1 1 
ATOM   4568 C  CG2 . VAL B 1 239 ? 29.101  1.753   -11.782 1.00 34.85 ? 239 VAL B CG2 1 
ATOM   4569 N  N   . SER B 1 240 ? 27.516  0.822   -7.408  1.00 31.35 ? 240 SER B N   1 
ATOM   4570 C  CA  . SER B 1 240 ? 27.208  -0.121  -6.311  1.00 30.42 ? 240 SER B CA  1 
ATOM   4571 C  C   . SER B 1 240 ? 25.821  -0.738  -6.542  1.00 31.52 ? 240 SER B C   1 
ATOM   4572 O  O   . SER B 1 240 ? 24.878  -0.037  -6.885  1.00 28.82 ? 240 SER B O   1 
ATOM   4573 C  CB  . SER B 1 240 ? 27.264  0.581   -4.953  1.00 31.57 ? 240 SER B CB  1 
ATOM   4574 O  OG  . SER B 1 240 ? 28.622  0.828   -4.568  1.00 33.72 ? 240 SER B OG  1 
ATOM   4575 N  N   . ALA B 1 241 ? 25.725  -2.049  -6.324  1.00 31.40 ? 241 ALA B N   1 
ATOM   4576 C  CA  . ALA B 1 241 ? 24.530  -2.826  -6.646  1.00 31.33 ? 241 ALA B CA  1 
ATOM   4577 C  C   . ALA B 1 241 ? 24.087  -3.672  -5.467  1.00 31.74 ? 241 ALA B C   1 
ATOM   4578 O  O   . ALA B 1 241 ? 24.912  -4.059  -4.621  1.00 28.04 ? 241 ALA B O   1 
ATOM   4579 C  CB  . ALA B 1 241 ? 24.802  -3.732  -7.830  1.00 29.31 ? 241 ALA B CB  1 
ATOM   4580 N  N   . THR B 1 242 ? 22.766  -3.904  -5.427  1.00 30.97 ? 242 THR B N   1 
ATOM   4581 C  CA  . THR B 1 242 ? 22.138  -4.928  -4.622  1.00 30.94 ? 242 THR B CA  1 
ATOM   4582 C  C   . THR B 1 242 ? 21.335  -5.769  -5.585  1.00 30.73 ? 242 THR B C   1 
ATOM   4583 O  O   . THR B 1 242 ? 20.446  -5.253  -6.282  1.00 30.54 ? 242 THR B O   1 
ATOM   4584 C  CB  . THR B 1 242 ? 21.167  -4.351  -3.577  1.00 33.63 ? 242 THR B CB  1 
ATOM   4585 O  OG1 . THR B 1 242 ? 21.846  -3.427  -2.727  1.00 31.45 ? 242 THR B OG1 1 
ATOM   4586 C  CG2 . THR B 1 242 ? 20.572  -5.495  -2.700  1.00 35.49 ? 242 THR B CG2 1 
ATOM   4587 N  N   . CYS B 1 243 ? 21.635  -7.060  -5.628  1.00 30.65 ? 243 CYS B N   1 
ATOM   4588 C  CA  . CYS B 1 243 ? 21.018  -7.950  -6.585  1.00 31.57 ? 243 CYS B CA  1 
ATOM   4589 C  C   . CYS B 1 243 ? 20.127  -8.952  -5.884  1.00 33.08 ? 243 CYS B C   1 
ATOM   4590 O  O   . CYS B 1 243 ? 20.582  -9.680  -5.006  1.00 30.60 ? 243 CYS B O   1 
ATOM   4591 C  CB  . CYS B 1 243 ? 22.083  -8.646  -7.440  1.00 33.05 ? 243 CYS B CB  1 
ATOM   4592 S  SG  . CYS B 1 243 ? 22.951  -7.476  -8.526  1.00 35.61 ? 243 CYS B SG  1 
ATOM   4593 N  N   . VAL B 1 244 ? 18.848  -8.978  -6.283  1.00 31.11 ? 244 VAL B N   1 
ATOM   4594 C  CA  . VAL B 1 244 ? 17.841  -9.720  -5.560  1.00 31.22 ? 244 VAL B CA  1 
ATOM   4595 C  C   . VAL B 1 244 ? 17.070  -10.612 -6.526  1.00 32.28 ? 244 VAL B C   1 
ATOM   4596 O  O   . VAL B 1 244 ? 16.713  -10.199 -7.623  1.00 32.36 ? 244 VAL B O   1 
ATOM   4597 C  CB  . VAL B 1 244 ? 16.861  -8.772  -4.829  1.00 32.29 ? 244 VAL B CB  1 
ATOM   4598 C  CG1 . VAL B 1 244 ? 15.848  -9.548  -3.994  1.00 32.35 ? 244 VAL B CG1 1 
ATOM   4599 C  CG2 . VAL B 1 244 ? 17.610  -7.778  -3.957  1.00 33.31 ? 244 VAL B CG2 1 
ATOM   4600 N  N   . ARG B 1 245 ? 16.832  -11.850 -6.118  1.00 28.41 ? 245 ARG B N   1 
ATOM   4601 C  CA  . ARG B 1 245 ? 16.041  -12.765 -6.904  1.00 29.33 ? 245 ARG B CA  1 
ATOM   4602 C  C   . ARG B 1 245 ? 14.597  -12.718 -6.411  1.00 27.94 ? 245 ARG B C   1 
ATOM   4603 O  O   . ARG B 1 245 ? 14.338  -12.748 -5.202  1.00 30.04 ? 245 ARG B O   1 
ATOM   4604 C  CB  . ARG B 1 245 ? 16.602  -14.172 -6.786  1.00 31.23 ? 245 ARG B CB  1 
ATOM   4605 C  CG  . ARG B 1 245 ? 15.971  -15.179 -7.733  1.00 32.76 ? 245 ARG B CG  1 
ATOM   4606 C  CD  . ARG B 1 245 ? 16.594  -15.144 -9.119  1.00 32.71 ? 245 ARG B CD  1 
ATOM   4607 N  NE  . ARG B 1 245 ? 18.012  -15.505 -9.076  1.00 32.94 ? 245 ARG B NE  1 
ATOM   4608 C  CZ  . ARG B 1 245 ? 18.859  -15.455 -10.104 1.00 34.43 ? 245 ARG B CZ  1 
ATOM   4609 N  NH1 . ARG B 1 245 ? 18.490  -15.001 -11.305 1.00 34.55 ? 245 ARG B NH1 1 
ATOM   4610 N  NH2 . ARG B 1 245 ? 20.120  -15.811 -9.901  1.00 34.29 ? 245 ARG B NH2 1 
ATOM   4611 N  N   . ILE B 1 246 ? 13.652  -12.661 -7.338  1.00 28.52 ? 246 ILE B N   1 
ATOM   4612 C  CA  . ILE B 1 246 ? 12.243  -12.648 -6.979  1.00 29.29 ? 246 ILE B CA  1 
ATOM   4613 C  C   . ILE B 1 246 ? 11.485  -13.662 -7.788  1.00 30.84 ? 246 ILE B C   1 
ATOM   4614 O  O   . ILE B 1 246 ? 12.021  -14.190 -8.781  1.00 31.22 ? 246 ILE B O   1 
ATOM   4615 C  CB  . ILE B 1 246 ? 11.618  -11.240 -7.126  1.00 30.43 ? 246 ILE B CB  1 
ATOM   4616 C  CG1 . ILE B 1 246 ? 11.654  -10.775 -8.589  1.00 30.11 ? 246 ILE B CG1 1 
ATOM   4617 C  CG2 . ILE B 1 246 ? 12.345  -10.276 -6.205  1.00 30.76 ? 246 ILE B CG2 1 
ATOM   4618 C  CD1 . ILE B 1 246 ? 10.768  -9.578  -8.847  1.00 30.93 ? 246 ILE B CD1 1 
ATOM   4619 N  N   . PRO B 1 247 ? 10.229  -13.952 -7.376  1.00 33.23 ? 247 PRO B N   1 
ATOM   4620 C  CA  . PRO B 1 247 ? 9.496   -15.019 -8.023  1.00 33.84 ? 247 PRO B CA  1 
ATOM   4621 C  C   . PRO B 1 247 ? 8.904   -14.606 -9.372  1.00 34.36 ? 247 PRO B C   1 
ATOM   4622 O  O   . PRO B 1 247 ? 7.672   -14.570 -9.549  1.00 33.55 ? 247 PRO B O   1 
ATOM   4623 C  CB  . PRO B 1 247 ? 8.423   -15.390 -6.987  1.00 35.40 ? 247 PRO B CB  1 
ATOM   4624 C  CG  . PRO B 1 247 ? 8.858   -14.748 -5.700  1.00 33.88 ? 247 PRO B CG  1 
ATOM   4625 C  CD  . PRO B 1 247 ? 9.531   -13.498 -6.163  1.00 35.30 ? 247 PRO B CD  1 
ATOM   4626 N  N   . VAL B 1 248 ? 9.803   -14.307 -10.310 1.00 33.19 ? 248 VAL B N   1 
ATOM   4627 C  CA  . VAL B 1 248 ? 9.477   -14.004 -11.701 1.00 32.41 ? 248 VAL B CA  1 
ATOM   4628 C  C   . VAL B 1 248 ? 10.185  -15.065 -12.545 1.00 33.62 ? 248 VAL B C   1 
ATOM   4629 O  O   . VAL B 1 248 ? 11.352  -15.397 -12.294 1.00 34.66 ? 248 VAL B O   1 
ATOM   4630 C  CB  . VAL B 1 248 ? 9.966   -12.590 -12.097 1.00 33.07 ? 248 VAL B CB  1 
ATOM   4631 C  CG1 . VAL B 1 248 ? 9.725   -12.315 -13.577 1.00 33.76 ? 248 VAL B CG1 1 
ATOM   4632 C  CG2 . VAL B 1 248 ? 9.295   -11.521 -11.238 1.00 33.54 ? 248 VAL B CG2 1 
ATOM   4633 N  N   . LEU B 1 249 ? 9.495   -15.625 -13.535 1.00 36.70 ? 249 LEU B N   1 
ATOM   4634 C  CA  . LEU B 1 249 ? 10.136  -16.645 -14.380 1.00 40.28 ? 249 LEU B CA  1 
ATOM   4635 C  C   . LEU B 1 249 ? 11.125  -16.025 -15.358 1.00 36.77 ? 249 LEU B C   1 
ATOM   4636 O  O   . LEU B 1 249 ? 12.264  -16.454 -15.423 1.00 38.29 ? 249 LEU B O   1 
ATOM   4637 C  CB  . LEU B 1 249 ? 9.107   -17.512 -15.115 1.00 45.32 ? 249 LEU B CB  1 
ATOM   4638 C  CG  . LEU B 1 249 ? 8.314   -18.501 -14.248 1.00 48.54 ? 249 LEU B CG  1 
ATOM   4639 C  CD1 . LEU B 1 249 ? 7.724   -19.600 -15.127 1.00 50.37 ? 249 LEU B CD1 1 
ATOM   4640 C  CD2 . LEU B 1 249 ? 9.176   -19.123 -13.155 1.00 49.99 ? 249 LEU B CD2 1 
ATOM   4641 N  N   . SER B 1 250 ? 10.703  -14.985 -16.069 1.00 36.29 ? 250 SER B N   1 
ATOM   4642 C  CA  . SER B 1 250 ? 11.567  -14.313 -17.023 1.00 36.38 ? 250 SER B CA  1 
ATOM   4643 C  C   . SER B 1 250 ? 11.369  -12.799 -17.037 1.00 34.98 ? 250 SER B C   1 
ATOM   4644 O  O   . SER B 1 250 ? 10.252  -12.320 -16.826 1.00 33.40 ? 250 SER B O   1 
ATOM   4645 C  CB  . SER B 1 250 ? 11.343  -14.896 -18.422 1.00 39.46 ? 250 SER B CB  1 
ATOM   4646 O  OG  . SER B 1 250 ? 12.283  -15.936 -18.658 1.00 45.12 ? 250 SER B OG  1 
ATOM   4647 N  N   . ALA B 1 251 ? 12.466  -12.097 -17.342 1.00 31.21 ? 251 ALA B N   1 
ATOM   4648 C  CA  . ALA B 1 251 ? 12.576  -10.625 -17.449 1.00 31.82 ? 251 ALA B CA  1 
ATOM   4649 C  C   . ALA B 1 251 ? 13.051  -10.048 -16.137 1.00 31.87 ? 251 ALA B C   1 
ATOM   4650 O  O   . ALA B 1 251 ? 12.407  -10.262 -15.093 1.00 29.19 ? 251 ALA B O   1 
ATOM   4651 C  CB  . ALA B 1 251 ? 11.272  -9.965  -17.898 1.00 32.87 ? 251 ALA B CB  1 
ATOM   4652 N  N   . HIS B 1 252 ? 14.223  -9.381  -16.177 1.00 29.71 ? 252 HIS B N   1 
ATOM   4653 C  CA  . HIS B 1 252 ? 14.759  -8.679  -15.024 1.00 27.65 ? 252 HIS B CA  1 
ATOM   4654 C  C   . HIS B 1 252 ? 14.247  -7.251  -14.965 1.00 27.53 ? 252 HIS B C   1 
ATOM   4655 O  O   . HIS B 1 252 ? 14.129  -6.586  -15.997 1.00 28.59 ? 252 HIS B O   1 
ATOM   4656 C  CB  . HIS B 1 252 ? 16.303  -8.602  -15.076 1.00 28.38 ? 252 HIS B CB  1 
ATOM   4657 C  CG  . HIS B 1 252 ? 17.003  -9.911  -14.949 1.00 29.89 ? 252 HIS B CG  1 
ATOM   4658 N  ND1 . HIS B 1 252 ? 16.367  -11.071 -14.570 1.00 29.64 ? 252 HIS B ND1 1 
ATOM   4659 C  CD2 . HIS B 1 252 ? 18.318  -10.227 -15.065 1.00 30.89 ? 252 HIS B CD2 1 
ATOM   4660 C  CE1 . HIS B 1 252 ? 17.246  -12.051 -14.486 1.00 29.87 ? 252 HIS B CE1 1 
ATOM   4661 N  NE2 . HIS B 1 252 ? 18.440  -11.564 -14.780 1.00 30.03 ? 252 HIS B NE2 1 
ATOM   4662 N  N   . SER B 1 253 ? 13.993  -6.761  -13.754 1.00 25.69 ? 253 SER B N   1 
ATOM   4663 C  CA  . SER B 1 253 ? 13.625  -5.379  -13.529 1.00 27.62 ? 253 SER B CA  1 
ATOM   4664 C  C   . SER B 1 253 ? 14.684  -4.736  -12.644 1.00 29.00 ? 253 SER B C   1 
ATOM   4665 O  O   . SER B 1 253 ? 15.274  -5.401  -11.782 1.00 28.88 ? 253 SER B O   1 
ATOM   4666 C  CB  . SER B 1 253 ? 12.264  -5.251  -12.877 1.00 27.31 ? 253 SER B CB  1 
ATOM   4667 O  OG  . SER B 1 253 ? 11.261  -5.952  -13.592 1.00 28.17 ? 253 SER B OG  1 
ATOM   4668 N  N   . GLU B 1 254 ? 14.946  -3.457  -12.868 1.00 28.17 ? 254 GLU B N   1 
ATOM   4669 C  CA  . GLU B 1 254 ? 15.933  -2.730  -12.048 1.00 29.57 ? 254 GLU B CA  1 
ATOM   4670 C  C   . GLU B 1 254 ? 15.469  -1.333  -11.654 1.00 27.35 ? 254 GLU B C   1 
ATOM   4671 O  O   . GLU B 1 254 ? 15.056  -0.529  -12.489 1.00 28.90 ? 254 GLU B O   1 
ATOM   4672 C  CB  . GLU B 1 254 ? 17.280  -2.613  -12.758 1.00 31.46 ? 254 GLU B CB  1 
ATOM   4673 C  CG  . GLU B 1 254 ? 17.791  -3.905  -13.356 1.00 34.09 ? 254 GLU B CG  1 
ATOM   4674 C  CD  . GLU B 1 254 ? 18.964  -3.732  -14.290 1.00 37.18 ? 254 GLU B CD  1 
ATOM   4675 O  OE1 . GLU B 1 254 ? 19.037  -2.700  -14.997 1.00 36.86 ? 254 GLU B OE1 1 
ATOM   4676 O  OE2 . GLU B 1 254 ? 19.781  -4.677  -14.350 1.00 38.00 ? 254 GLU B OE2 1 
ATOM   4677 N  N   . SER B 1 255 ? 15.607  -1.034  -10.384 1.00 27.06 ? 255 SER B N   1 
ATOM   4678 C  CA  . SER B 1 255 ? 15.456  0.330   -9.884  1.00 25.75 ? 255 SER B CA  1 
ATOM   4679 C  C   . SER B 1 255 ? 16.849  0.986   -9.923  1.00 29.42 ? 255 SER B C   1 
ATOM   4680 O  O   . SER B 1 255 ? 17.753  0.606   -9.178  1.00 27.92 ? 255 SER B O   1 
ATOM   4681 C  CB  . SER B 1 255 ? 14.914  0.316   -8.477  1.00 26.38 ? 255 SER B CB  1 
ATOM   4682 O  OG  . SER B 1 255 ? 14.780  1.642   -7.989  1.00 27.16 ? 255 SER B OG  1 
ATOM   4683 N  N   . VAL B 1 256 ? 17.000  1.945   -10.818 1.00 27.40 ? 256 VAL B N   1 
ATOM   4684 C  CA  . VAL B 1 256 ? 18.293  2.541   -11.144 1.00 31.12 ? 256 VAL B CA  1 
ATOM   4685 C  C   . VAL B 1 256 ? 18.290  3.992   -10.727 1.00 30.54 ? 256 VAL B C   1 
ATOM   4686 O  O   . VAL B 1 256 ? 17.358  4.709   -11.040 1.00 32.00 ? 256 VAL B O   1 
ATOM   4687 C  CB  . VAL B 1 256 ? 18.566  2.537   -12.652 1.00 31.26 ? 256 VAL B CB  1 
ATOM   4688 C  CG1 . VAL B 1 256 ? 19.941  3.139   -12.932 1.00 31.11 ? 256 VAL B CG1 1 
ATOM   4689 C  CG2 . VAL B 1 256 ? 18.462  1.134   -13.203 1.00 31.77 ? 256 VAL B CG2 1 
ATOM   4690 N  N   . TYR B 1 257 ? 19.332  4.380   -9.991  1.00 29.85 ? 257 TYR B N   1 
ATOM   4691 C  CA  . TYR B 1 257 ? 19.550  5.741   -9.597  1.00 29.67 ? 257 TYR B CA  1 
ATOM   4692 C  C   . TYR B 1 257 ? 20.891  6.154   -10.152 1.00 31.33 ? 257 TYR B C   1 
ATOM   4693 O  O   . TYR B 1 257 ? 21.871  5.427   -10.028 1.00 32.52 ? 257 TYR B O   1 
ATOM   4694 C  CB  . TYR B 1 257 ? 19.583  5.867   -8.077  1.00 29.80 ? 257 TYR B CB  1 
ATOM   4695 C  CG  . TYR B 1 257 ? 20.006  7.244   -7.619  1.00 29.73 ? 257 TYR B CG  1 
ATOM   4696 C  CD1 . TYR B 1 257 ? 19.111  8.282   -7.653  1.00 30.71 ? 257 TYR B CD1 1 
ATOM   4697 C  CD2 . TYR B 1 257 ? 21.310  7.517   -7.187  1.00 30.14 ? 257 TYR B CD2 1 
ATOM   4698 C  CE1 . TYR B 1 257 ? 19.461  9.551   -7.253  1.00 30.27 ? 257 TYR B CE1 1 
ATOM   4699 C  CE2 . TYR B 1 257 ? 21.672  8.803   -6.780  1.00 29.43 ? 257 TYR B CE2 1 
ATOM   4700 C  CZ  . TYR B 1 257 ? 20.742  9.808   -6.824  1.00 30.82 ? 257 TYR B CZ  1 
ATOM   4701 O  OH  . TYR B 1 257 ? 20.995  11.105  -6.413  1.00 32.46 ? 257 TYR B OH  1 
ATOM   4702 N  N   . ILE B 1 258 ? 20.927  7.324   -10.761 1.00 34.43 ? 258 ILE B N   1 
ATOM   4703 C  CA  . ILE B 1 258 ? 22.154  7.864   -11.310 1.00 32.92 ? 258 ILE B CA  1 
ATOM   4704 C  C   . ILE B 1 258 ? 22.320  9.304   -10.863 1.00 33.45 ? 258 ILE B C   1 
ATOM   4705 O  O   . ILE B 1 258 ? 21.339  10.015  -10.564 1.00 33.09 ? 258 ILE B O   1 
ATOM   4706 C  CB  . ILE B 1 258 ? 22.152  7.832   -12.854 1.00 33.66 ? 258 ILE B CB  1 
ATOM   4707 C  CG1 . ILE B 1 258 ? 20.979  8.642   -13.412 1.00 33.29 ? 258 ILE B CG1 1 
ATOM   4708 C  CG2 . ILE B 1 258 ? 22.081  6.389   -13.350 1.00 33.60 ? 258 ILE B CG2 1 
ATOM   4709 C  CD1 . ILE B 1 258 ? 20.982  8.788   -14.917 1.00 35.90 ? 258 ILE B CD1 1 
ATOM   4710 N  N   . GLU B 1 259 ? 23.573  9.730   -10.822 1.00 32.83 ? 259 GLU B N   1 
ATOM   4711 C  CA  . GLU B 1 259 ? 23.883  11.139  -10.802 1.00 34.03 ? 259 GLU B CA  1 
ATOM   4712 C  C   . GLU B 1 259 ? 24.735  11.456  -12.033 1.00 32.89 ? 259 GLU B C   1 
ATOM   4713 O  O   . GLU B 1 259 ? 25.805  10.877  -12.248 1.00 35.84 ? 259 GLU B O   1 
ATOM   4714 C  CB  . GLU B 1 259 ? 24.571  11.536  -9.496  1.00 35.31 ? 259 GLU B CB  1 
ATOM   4715 C  CG  . GLU B 1 259 ? 23.580  11.685  -8.344  1.00 34.75 ? 259 GLU B CG  1 
ATOM   4716 C  CD  . GLU B 1 259 ? 24.224  11.749  -6.973  1.00 36.72 ? 259 GLU B CD  1 
ATOM   4717 O  OE1 . GLU B 1 259 ? 25.465  11.893  -6.891  1.00 38.63 ? 259 GLU B OE1 1 
ATOM   4718 O  OE2 . GLU B 1 259 ? 23.487  11.639  -5.958  1.00 34.96 ? 259 GLU B OE2 1 
ATOM   4719 N  N   . THR B 1 260 ? 24.245  12.390  -12.829 1.00 34.52 ? 260 THR B N   1 
ATOM   4720 C  CA  . THR B 1 260 ? 24.912  12.799  -14.045 1.00 33.70 ? 260 THR B CA  1 
ATOM   4721 C  C   . THR B 1 260 ? 26.017  13.827  -13.711 1.00 38.13 ? 260 THR B C   1 
ATOM   4722 O  O   . THR B 1 260 ? 26.143  14.278  -12.561 1.00 35.32 ? 260 THR B O   1 
ATOM   4723 C  CB  . THR B 1 260 ? 23.884  13.413  -14.989 1.00 32.04 ? 260 THR B CB  1 
ATOM   4724 O  OG1 . THR B 1 260 ? 23.232  14.490  -14.325 1.00 31.20 ? 260 THR B OG1 1 
ATOM   4725 C  CG2 . THR B 1 260 ? 22.846  12.369  -15.383 1.00 31.96 ? 260 THR B CG2 1 
ATOM   4726 N  N   . LYS B 1 261 ? 26.817  14.185  -14.709 1.00 39.08 ? 261 LYS B N   1 
ATOM   4727 C  CA  . LYS B 1 261 ? 27.846  15.223  -14.512 1.00 44.05 ? 261 LYS B CA  1 
ATOM   4728 C  C   . LYS B 1 261 ? 27.282  16.625  -14.664 1.00 41.69 ? 261 LYS B C   1 
ATOM   4729 O  O   . LYS B 1 261 ? 27.723  17.547  -13.998 1.00 43.28 ? 261 LYS B O   1 
ATOM   4730 C  CB  . LYS B 1 261 ? 29.040  14.977  -15.428 1.00 46.60 ? 261 LYS B CB  1 
ATOM   4731 C  CG  . LYS B 1 261 ? 29.938  13.913  -14.819 1.00 51.15 ? 261 LYS B CG  1 
ATOM   4732 C  CD  . LYS B 1 261 ? 31.072  13.462  -15.723 1.00 54.91 ? 261 LYS B CD  1 
ATOM   4733 C  CE  . LYS B 1 261 ? 31.860  12.332  -15.067 1.00 58.06 ? 261 LYS B CE  1 
ATOM   4734 N  NZ  . LYS B 1 261 ? 32.215  12.622  -13.645 1.00 59.70 ? 261 LYS B NZ  1 
ATOM   4735 N  N   . GLU B 1 262 ? 26.276  16.765  -15.512 1.00 41.59 ? 262 GLU B N   1 
ATOM   4736 C  CA  . GLU B 1 262 ? 25.575  18.018  -15.692 1.00 41.48 ? 262 GLU B CA  1 
ATOM   4737 C  C   . GLU B 1 262 ? 24.103  17.723  -15.515 1.00 40.18 ? 262 GLU B C   1 
ATOM   4738 O  O   . GLU B 1 262 ? 23.671  16.599  -15.768 1.00 38.73 ? 262 GLU B O   1 
ATOM   4739 C  CB  . GLU B 1 262 ? 25.817  18.556  -17.112 1.00 42.96 ? 262 GLU B CB  1 
ATOM   4740 C  CG  . GLU B 1 262 ? 27.287  18.683  -17.503 1.00 48.75 ? 262 GLU B CG  1 
ATOM   4741 C  CD  . GLU B 1 262 ? 27.996  19.828  -16.797 1.00 51.01 ? 262 GLU B CD  1 
ATOM   4742 O  OE1 . GLU B 1 262 ? 27.321  20.817  -16.442 1.00 56.20 ? 262 GLU B OE1 1 
ATOM   4743 O  OE2 . GLU B 1 262 ? 29.232  19.741  -16.603 1.00 59.52 ? 262 GLU B OE2 1 
ATOM   4744 N  N   . VAL B 1 263 ? 23.334  18.738  -15.132 1.00 40.25 ? 263 VAL B N   1 
ATOM   4745 C  CA  . VAL B 1 263 ? 21.904  18.578  -14.908 1.00 42.06 ? 263 VAL B CA  1 
ATOM   4746 C  C   . VAL B 1 263 ? 21.201  18.210  -16.212 1.00 40.65 ? 263 VAL B C   1 
ATOM   4747 O  O   . VAL B 1 263 ? 21.314  18.914  -17.200 1.00 40.21 ? 263 VAL B O   1 
ATOM   4748 C  CB  . VAL B 1 263 ? 21.259  19.849  -14.306 1.00 43.41 ? 263 VAL B CB  1 
ATOM   4749 C  CG1 . VAL B 1 263 ? 19.741  19.719  -14.250 1.00 42.16 ? 263 VAL B CG1 1 
ATOM   4750 C  CG2 . VAL B 1 263 ? 21.822  20.129  -12.919 1.00 43.36 ? 263 VAL B CG2 1 
ATOM   4751 N  N   . ALA B 1 264 ? 20.460  17.108  -16.191 1.00 37.34 ? 264 ALA B N   1 
ATOM   4752 C  CA  . ALA B 1 264 ? 19.760  16.623  -17.368 1.00 37.37 ? 264 ALA B CA  1 
ATOM   4753 C  C   . ALA B 1 264 ? 18.253  16.805  -17.213 1.00 37.21 ? 264 ALA B C   1 
ATOM   4754 O  O   . ALA B 1 264 ? 17.619  16.080  -16.443 1.00 38.46 ? 264 ALA B O   1 
ATOM   4755 C  CB  . ALA B 1 264 ? 20.100  15.164  -17.590 1.00 37.37 ? 264 ALA B CB  1 
ATOM   4756 N  N   . PRO B 1 265 ? 17.673  17.790  -17.924 1.00 36.90 ? 265 PRO B N   1 
ATOM   4757 C  CA  . PRO B 1 265 ? 16.222  17.981  -17.908 1.00 37.59 ? 265 PRO B CA  1 
ATOM   4758 C  C   . PRO B 1 265 ? 15.489  16.666  -18.179 1.00 34.62 ? 265 PRO B C   1 
ATOM   4759 O  O   . PRO B 1 265 ? 15.833  15.963  -19.126 1.00 36.73 ? 265 PRO B O   1 
ATOM   4760 C  CB  . PRO B 1 265 ? 15.986  18.992  -19.048 1.00 39.02 ? 265 PRO B CB  1 
ATOM   4761 C  CG  . PRO B 1 265 ? 17.276  19.724  -19.158 1.00 38.42 ? 265 PRO B CG  1 
ATOM   4762 C  CD  . PRO B 1 265 ? 18.351  18.760  -18.810 1.00 36.65 ? 265 PRO B CD  1 
ATOM   4763 N  N   . ILE B 1 266 ? 14.503  16.335  -17.355 1.00 37.83 ? 266 ILE B N   1 
ATOM   4764 C  CA  . ILE B 1 266 ? 13.872  15.022  -17.431 1.00 39.16 ? 266 ILE B CA  1 
ATOM   4765 C  C   . ILE B 1 266 ? 13.208  14.804  -18.786 1.00 39.94 ? 266 ILE B C   1 
ATOM   4766 O  O   . ILE B 1 266 ? 13.250  13.690  -19.312 1.00 38.07 ? 266 ILE B O   1 
ATOM   4767 C  CB  . ILE B 1 266 ? 12.875  14.783  -16.273 1.00 39.89 ? 266 ILE B CB  1 
ATOM   4768 C  CG1 . ILE B 1 266 ? 13.627  14.665  -14.946 1.00 38.54 ? 266 ILE B CG1 1 
ATOM   4769 C  CG2 . ILE B 1 266 ? 12.037  13.520  -16.504 1.00 39.39 ? 266 ILE B CG2 1 
ATOM   4770 C  CD1 . ILE B 1 266 ? 14.618  13.518  -14.894 1.00 40.10 ? 266 ILE B CD1 1 
ATOM   4771 N  N   . GLU B 1 267 ? 12.606  15.840  -19.369 1.00 40.83 ? 267 GLU B N   1 
ATOM   4772 C  CA  . GLU B 1 267 ? 11.967  15.641  -20.679 1.00 44.98 ? 267 GLU B CA  1 
ATOM   4773 C  C   . GLU B 1 267 ? 12.994  15.334  -21.778 1.00 40.88 ? 267 GLU B C   1 
ATOM   4774 O  O   . GLU B 1 267 ? 12.723  14.558  -22.688 1.00 38.85 ? 267 GLU B O   1 
ATOM   4775 C  CB  . GLU B 1 267 ? 11.026  16.795  -21.041 1.00 50.06 ? 267 GLU B CB  1 
ATOM   4776 C  CG  . GLU B 1 267 ? 9.782   16.846  -20.142 1.00 56.95 ? 267 GLU B CG  1 
ATOM   4777 C  CD  . GLU B 1 267 ? 8.923   15.569  -20.175 1.00 61.50 ? 267 GLU B CD  1 
ATOM   4778 O  OE1 . GLU B 1 267 ? 8.548   15.137  -21.293 1.00 61.90 ? 267 GLU B OE1 1 
ATOM   4779 O  OE2 . GLU B 1 267 ? 8.608   15.004  -19.083 1.00 54.85 ? 267 GLU B OE2 1 
ATOM   4780 N  N   . GLU B 1 268 ? 14.191  15.895  -21.656 1.00 40.03 ? 268 GLU B N   1 
ATOM   4781 C  CA  . GLU B 1 268 ? 15.282  15.570  -22.571 1.00 38.65 ? 268 GLU B CA  1 
ATOM   4782 C  C   . GLU B 1 268 ? 15.840  14.166  -22.330 1.00 38.10 ? 268 GLU B C   1 
ATOM   4783 O  O   . GLU B 1 268 ? 16.246  13.472  -23.270 1.00 36.39 ? 268 GLU B O   1 
ATOM   4784 C  CB  . GLU B 1 268 ? 16.406  16.606  -22.464 1.00 39.88 ? 268 GLU B CB  1 
ATOM   4785 C  CG  . GLU B 1 268 ? 15.997  17.977  -22.992 1.00 42.56 ? 268 GLU B CG  1 
ATOM   4786 C  CD  . GLU B 1 268 ? 17.060  19.046  -22.793 1.00 43.97 ? 268 GLU B CD  1 
ATOM   4787 O  OE1 . GLU B 1 268 ? 18.260  18.730  -22.678 1.00 45.12 ? 268 GLU B OE1 1 
ATOM   4788 O  OE2 . GLU B 1 268 ? 16.689  20.230  -22.768 1.00 49.77 ? 268 GLU B OE2 1 
ATOM   4789 N  N   . VAL B 1 269 ? 15.891  13.752  -21.068 1.00 36.62 ? 269 VAL B N   1 
ATOM   4790 C  CA  . VAL B 1 269 ? 16.370  12.399  -20.742 1.00 34.28 ? 269 VAL B CA  1 
ATOM   4791 C  C   . VAL B 1 269 ? 15.448  11.366  -21.378 1.00 32.89 ? 269 VAL B C   1 
ATOM   4792 O  O   . VAL B 1 269 ? 15.911  10.408  -22.019 1.00 33.94 ? 269 VAL B O   1 
ATOM   4793 C  CB  . VAL B 1 269 ? 16.454  12.199  -19.214 1.00 34.74 ? 269 VAL B CB  1 
ATOM   4794 C  CG1 . VAL B 1 269 ? 16.667  10.727  -18.878 1.00 34.81 ? 269 VAL B CG1 1 
ATOM   4795 C  CG2 . VAL B 1 269 ? 17.586  13.050  -18.634 1.00 33.55 ? 269 VAL B CG2 1 
ATOM   4796 N  N   . LYS B 1 270 ? 14.141  11.582  -21.222 1.00 32.22 ? 270 LYS B N   1 
ATOM   4797 C  CA  . LYS B 1 270 ? 13.124  10.740  -21.848 1.00 32.80 ? 270 LYS B CA  1 
ATOM   4798 C  C   . LYS B 1 270 ? 13.292  10.692  -23.361 1.00 34.01 ? 270 LYS B C   1 
ATOM   4799 O  O   . LYS B 1 270 ? 13.265  9.603   -23.947 1.00 31.31 ? 270 LYS B O   1 
ATOM   4800 C  CB  . LYS B 1 270 ? 11.714  11.225  -21.529 1.00 34.27 ? 270 LYS B CB  1 
ATOM   4801 C  CG  . LYS B 1 270 ? 11.242  10.988  -20.092 1.00 35.39 ? 270 LYS B CG  1 
ATOM   4802 C  CD  . LYS B 1 270 ? 9.898   11.663  -19.860 1.00 37.58 ? 270 LYS B CD  1 
ATOM   4803 C  CE  . LYS B 1 270 ? 9.402   11.518  -18.430 1.00 38.55 ? 270 LYS B CE  1 
ATOM   4804 N  NZ  . LYS B 1 270 ? 8.005   12.014  -18.302 1.00 37.19 ? 270 LYS B NZ  1 
ATOM   4805 N  N   . ALA B 1 271 ? 13.456  11.861  -23.993 1.00 32.69 ? 271 ALA B N   1 
ATOM   4806 C  CA  . ALA B 1 271 ? 13.658  11.911  -25.437 1.00 33.61 ? 271 ALA B CA  1 
ATOM   4807 C  C   . ALA B 1 271 ? 14.946  11.173  -25.843 1.00 31.67 ? 271 ALA B C   1 
ATOM   4808 O  O   . ALA B 1 271 ? 14.952  10.405  -26.812 1.00 33.12 ? 271 ALA B O   1 
ATOM   4809 C  CB  . ALA B 1 271 ? 13.665  13.360  -25.935 1.00 34.66 ? 271 ALA B CB  1 
ATOM   4810 N  N   . ALA B 1 272 ? 16.027  11.381  -25.100 1.00 30.18 ? 272 ALA B N   1 
ATOM   4811 C  CA  . ALA B 1 272 ? 17.306  10.738  -25.406 1.00 30.64 ? 272 ALA B CA  1 
ATOM   4812 C  C   . ALA B 1 272 ? 17.229  9.202   -25.315 1.00 30.35 ? 272 ALA B C   1 
ATOM   4813 O  O   . ALA B 1 272 ? 17.758  8.480   -26.157 1.00 30.60 ? 272 ALA B O   1 
ATOM   4814 C  CB  . ALA B 1 272 ? 18.395  11.258  -24.472 1.00 30.28 ? 272 ALA B CB  1 
ATOM   4815 N  N   . ILE B 1 273 ? 16.581  8.704   -24.280 1.00 31.69 ? 273 ILE B N   1 
ATOM   4816 C  CA  . ILE B 1 273 ? 16.358  7.254   -24.161 1.00 31.36 ? 273 ILE B CA  1 
ATOM   4817 C  C   . ILE B 1 273 ? 15.454  6.716   -25.282 1.00 31.83 ? 273 ILE B C   1 
ATOM   4818 O  O   . ILE B 1 273 ? 15.762  5.695   -25.907 1.00 30.46 ? 273 ILE B O   1 
ATOM   4819 C  CB  . ILE B 1 273 ? 15.804  6.916   -22.769 1.00 32.26 ? 273 ILE B CB  1 
ATOM   4820 C  CG1 . ILE B 1 273 ? 16.906  7.163   -21.729 1.00 33.10 ? 273 ILE B CG1 1 
ATOM   4821 C  CG2 . ILE B 1 273 ? 15.295  5.479   -22.701 1.00 31.97 ? 273 ILE B CG2 1 
ATOM   4822 C  CD1 . ILE B 1 273 ? 16.394  7.197   -20.301 1.00 33.41 ? 273 ILE B CD1 1 
ATOM   4823 N  N   . ALA B 1 274 ? 14.356  7.411   -25.552 1.00 33.77 ? 274 ALA B N   1 
ATOM   4824 C  CA  . ALA B 1 274 ? 13.484  7.048   -26.657 1.00 34.80 ? 274 ALA B CA  1 
ATOM   4825 C  C   . ALA B 1 274 ? 14.244  6.987   -27.992 1.00 34.55 ? 274 ALA B C   1 
ATOM   4826 O  O   . ALA B 1 274 ? 14.033  6.080   -28.774 1.00 35.71 ? 274 ALA B O   1 
ATOM   4827 C  CB  . ALA B 1 274 ? 12.313  8.020   -26.745 1.00 36.05 ? 274 ALA B CB  1 
ATOM   4828 N  N   . ALA B 1 275 ? 15.185  7.898   -28.204 1.00 36.86 ? 275 ALA B N   1 
ATOM   4829 C  CA  . ALA B 1 275 ? 15.960  7.959   -29.452 1.00 37.26 ? 275 ALA B CA  1 
ATOM   4830 C  C   . ALA B 1 275 ? 17.069  6.897   -29.572 1.00 35.43 ? 275 ALA B C   1 
ATOM   4831 O  O   . ALA B 1 275 ? 17.573  6.655   -30.661 1.00 33.02 ? 275 ALA B O   1 
ATOM   4832 C  CB  . ALA B 1 275 ? 16.561  9.351   -29.613 1.00 37.62 ? 275 ALA B CB  1 
ATOM   4833 N  N   . PHE B 1 276 ? 17.438  6.262   -28.459 1.00 32.33 ? 276 PHE B N   1 
ATOM   4834 C  CA  . PHE B 1 276 ? 18.552  5.316   -28.448 1.00 33.15 ? 276 PHE B CA  1 
ATOM   4835 C  C   . PHE B 1 276 ? 18.123  3.947   -28.963 1.00 32.91 ? 276 PHE B C   1 
ATOM   4836 O  O   . PHE B 1 276 ? 17.117  3.402   -28.503 1.00 33.37 ? 276 PHE B O   1 
ATOM   4837 C  CB  . PHE B 1 276 ? 19.120  5.179   -27.041 1.00 33.01 ? 276 PHE B CB  1 
ATOM   4838 C  CG  . PHE B 1 276 ? 20.479  4.532   -27.000 1.00 33.47 ? 276 PHE B CG  1 
ATOM   4839 C  CD1 . PHE B 1 276 ? 21.603  5.242   -27.374 1.00 33.62 ? 276 PHE B CD1 1 
ATOM   4840 C  CD2 . PHE B 1 276 ? 20.627  3.219   -26.564 1.00 31.85 ? 276 PHE B CD2 1 
ATOM   4841 C  CE1 . PHE B 1 276 ? 22.868  4.656   -27.322 1.00 33.66 ? 276 PHE B CE1 1 
ATOM   4842 C  CE2 . PHE B 1 276 ? 21.880  2.626   -26.511 1.00 33.89 ? 276 PHE B CE2 1 
ATOM   4843 C  CZ  . PHE B 1 276 ? 23.005  3.348   -26.892 1.00 35.32 ? 276 PHE B CZ  1 
ATOM   4844 N  N   . PRO B 1 277 ? 18.864  3.386   -29.929 1.00 34.44 ? 277 PRO B N   1 
ATOM   4845 C  CA  . PRO B 1 277 ? 18.527  2.053   -30.441 1.00 34.07 ? 277 PRO B CA  1 
ATOM   4846 C  C   . PRO B 1 277 ? 18.593  0.928   -29.388 1.00 34.05 ? 277 PRO B C   1 
ATOM   4847 O  O   . PRO B 1 277 ? 19.588  0.802   -28.662 1.00 33.99 ? 277 PRO B O   1 
ATOM   4848 C  CB  . PRO B 1 277 ? 19.571  1.812   -31.540 1.00 37.03 ? 277 PRO B CB  1 
ATOM   4849 C  CG  . PRO B 1 277 ? 20.130  3.147   -31.877 1.00 38.20 ? 277 PRO B CG  1 
ATOM   4850 C  CD  . PRO B 1 277 ? 20.007  3.988   -30.647 1.00 36.69 ? 277 PRO B CD  1 
ATOM   4851 N  N   . GLY B 1 278 ? 17.538  0.123   -29.343 1.00 32.63 ? 278 GLY B N   1 
ATOM   4852 C  CA  . GLY B 1 278 ? 17.395  -0.958  -28.368 1.00 34.34 ? 278 GLY B CA  1 
ATOM   4853 C  C   . GLY B 1 278 ? 16.686  -0.547  -27.079 1.00 30.76 ? 278 GLY B C   1 
ATOM   4854 O  O   . GLY B 1 278 ? 16.320  -1.407  -26.283 1.00 32.79 ? 278 GLY B O   1 
ATOM   4855 N  N   . ALA B 1 279 ? 16.499  0.756   -26.867 1.00 30.98 ? 279 ALA B N   1 
ATOM   4856 C  CA  . ALA B 1 279 ? 15.785  1.269   -25.697 1.00 31.55 ? 279 ALA B CA  1 
ATOM   4857 C  C   . ALA B 1 279 ? 14.401  1.766   -26.119 1.00 32.71 ? 279 ALA B C   1 
ATOM   4858 O  O   . ALA B 1 279 ? 14.268  2.500   -27.106 1.00 31.90 ? 279 ALA B O   1 
ATOM   4859 C  CB  . ALA B 1 279 ? 16.568  2.381   -25.051 1.00 32.82 ? 279 ALA B CB  1 
ATOM   4860 N  N   . VAL B 1 280 ? 13.378  1.328   -25.409 1.00 29.60 ? 280 VAL B N   1 
ATOM   4861 C  CA  . VAL B 1 280 ? 12.011  1.832   -25.623 1.00 29.78 ? 280 VAL B CA  1 
ATOM   4862 C  C   . VAL B 1 280 ? 11.529  2.584   -24.407 1.00 29.84 ? 280 VAL B C   1 
ATOM   4863 O  O   . VAL B 1 280 ? 11.516  2.045   -23.297 1.00 29.82 ? 280 VAL B O   1 
ATOM   4864 C  CB  . VAL B 1 280 ? 11.030  0.725   -25.938 1.00 29.17 ? 280 VAL B CB  1 
ATOM   4865 C  CG1 . VAL B 1 280 ? 9.601   1.267   -26.079 1.00 29.99 ? 280 VAL B CG1 1 
ATOM   4866 C  CG2 . VAL B 1 280 ? 11.444  0.035   -27.227 1.00 32.07 ? 280 VAL B CG2 1 
ATOM   4867 N  N   . LEU B 1 281 ? 11.090  3.817   -24.632 1.00 30.17 ? 281 LEU B N   1 
ATOM   4868 C  CA  . LEU B 1 281 ? 10.478  4.629   -23.592 1.00 31.55 ? 281 LEU B CA  1 
ATOM   4869 C  C   . LEU B 1 281 ? 9.037   4.198   -23.350 1.00 33.63 ? 281 LEU B C   1 
ATOM   4870 O  O   . LEU B 1 281 ? 8.209   4.279   -24.252 1.00 34.51 ? 281 LEU B O   1 
ATOM   4871 C  CB  . LEU B 1 281 ? 10.501  6.116   -23.997 1.00 33.08 ? 281 LEU B CB  1 
ATOM   4872 C  CG  . LEU B 1 281 ? 9.906   7.097   -22.973 1.00 35.48 ? 281 LEU B CG  1 
ATOM   4873 C  CD1 . LEU B 1 281 ? 10.805  7.173   -21.755 1.00 35.74 ? 281 LEU B CD1 1 
ATOM   4874 C  CD2 . LEU B 1 281 ? 9.666   8.487   -23.552 1.00 35.69 ? 281 LEU B CD2 1 
ATOM   4875 N  N   . GLU B 1 282 ? 8.748   3.743   -22.132 1.00 31.25 ? 282 GLU B N   1 
ATOM   4876 C  CA  . GLU B 1 282 ? 7.407   3.382   -21.719 1.00 34.60 ? 282 GLU B CA  1 
ATOM   4877 C  C   . GLU B 1 282 ? 7.120   4.129   -20.426 1.00 35.76 ? 282 GLU B C   1 
ATOM   4878 O  O   . GLU B 1 282 ? 7.322   3.608   -19.327 1.00 33.75 ? 282 GLU B O   1 
ATOM   4879 C  CB  . GLU B 1 282 ? 7.293   1.887   -21.479 1.00 36.91 ? 282 GLU B CB  1 
ATOM   4880 C  CG  . GLU B 1 282 ? 6.871   1.095   -22.694 1.00 41.95 ? 282 GLU B CG  1 
ATOM   4881 C  CD  . GLU B 1 282 ? 6.720   -0.371  -22.379 1.00 43.87 ? 282 GLU B CD  1 
ATOM   4882 O  OE1 . GLU B 1 282 ? 7.162   -0.794  -21.293 1.00 47.03 ? 282 GLU B OE1 1 
ATOM   4883 O  OE2 . GLU B 1 282 ? 6.170   -1.103  -23.220 1.00 50.75 ? 282 GLU B OE2 1 
ATOM   4884 N  N   . ASP B 1 283 ? 6.642   5.355   -20.559 1.00 35.30 ? 283 ASP B N   1 
ATOM   4885 C  CA  . ASP B 1 283 ? 6.593   6.249   -19.424 1.00 32.95 ? 283 ASP B CA  1 
ATOM   4886 C  C   . ASP B 1 283 ? 5.477   7.253   -19.648 1.00 33.32 ? 283 ASP B C   1 
ATOM   4887 O  O   . ASP B 1 283 ? 5.655   8.256   -20.316 1.00 35.33 ? 283 ASP B O   1 
ATOM   4888 C  CB  . ASP B 1 283 ? 7.952   6.935   -19.281 1.00 33.21 ? 283 ASP B CB  1 
ATOM   4889 C  CG  . ASP B 1 283 ? 8.187   7.492   -17.899 1.00 34.20 ? 283 ASP B CG  1 
ATOM   4890 O  OD1 . ASP B 1 283 ? 7.213   7.789   -17.198 1.00 33.82 ? 283 ASP B OD1 1 
ATOM   4891 O  OD2 . ASP B 1 283 ? 9.371   7.629   -17.515 1.00 34.29 ? 283 ASP B OD2 1 
ATOM   4892 N  N   . ASP B 1 284 ? 4.317   6.930   -19.114 1.00 34.03 ? 284 ASP B N   1 
ATOM   4893 C  CA  . ASP B 1 284 ? 3.151   7.800   -19.159 1.00 35.52 ? 284 ASP B CA  1 
ATOM   4894 C  C   . ASP B 1 284 ? 2.364   7.510   -17.877 1.00 36.24 ? 284 ASP B C   1 
ATOM   4895 O  O   . ASP B 1 284 ? 1.422   6.703   -17.869 1.00 34.63 ? 284 ASP B O   1 
ATOM   4896 C  CB  . ASP B 1 284 ? 2.337   7.520   -20.432 1.00 35.85 ? 284 ASP B CB  1 
ATOM   4897 C  CG  . ASP B 1 284 ? 1.074   8.344   -20.512 1.00 38.08 ? 284 ASP B CG  1 
ATOM   4898 O  OD1 . ASP B 1 284 ? 0.851   9.216   -19.646 1.00 39.20 ? 284 ASP B OD1 1 
ATOM   4899 O  OD2 . ASP B 1 284 ? 0.277   8.106   -21.434 1.00 41.39 ? 284 ASP B OD2 1 
ATOM   4900 N  N   . VAL B 1 285 ? 2.769   8.153   -16.777 1.00 35.76 ? 285 VAL B N   1 
ATOM   4901 C  CA  . VAL B 1 285 ? 2.172   7.847   -15.470 1.00 35.74 ? 285 VAL B CA  1 
ATOM   4902 C  C   . VAL B 1 285 ? 0.692   8.220   -15.363 1.00 34.44 ? 285 VAL B C   1 
ATOM   4903 O  O   . VAL B 1 285 ? -0.027  7.605   -14.613 1.00 34.36 ? 285 VAL B O   1 
ATOM   4904 C  CB  . VAL B 1 285 ? 2.976   8.434   -14.290 1.00 35.97 ? 285 VAL B CB  1 
ATOM   4905 C  CG1 . VAL B 1 285 ? 4.373   7.804   -14.251 1.00 35.19 ? 285 VAL B CG1 1 
ATOM   4906 C  CG2 . VAL B 1 285 ? 3.060   9.941   -14.375 1.00 37.11 ? 285 VAL B CG2 1 
ATOM   4907 N  N   . ALA B 1 286 ? 0.236   9.203   -16.132 1.00 35.87 ? 286 ALA B N   1 
ATOM   4908 C  CA  . ALA B 1 286 ? -1.178  9.546   -16.154 1.00 37.56 ? 286 ALA B CA  1 
ATOM   4909 C  C   . ALA B 1 286 ? -2.049  8.349   -16.569 1.00 36.20 ? 286 ALA B C   1 
ATOM   4910 O  O   . ALA B 1 286 ? -3.193  8.274   -16.161 1.00 37.55 ? 286 ALA B O   1 
ATOM   4911 C  CB  . ALA B 1 286 ? -1.422  10.729  -17.079 1.00 41.32 ? 286 ALA B CB  1 
ATOM   4912 N  N   . HIS B 1 287 ? -1.502  7.428   -17.376 1.00 36.24 ? 287 HIS B N   1 
ATOM   4913 C  CA  . HIS B 1 287 ? -2.196  6.228   -17.801 1.00 36.42 ? 287 HIS B CA  1 
ATOM   4914 C  C   . HIS B 1 287 ? -1.543  4.968   -17.224 1.00 36.64 ? 287 HIS B C   1 
ATOM   4915 O  O   . HIS B 1 287 ? -1.724  3.867   -17.742 1.00 36.04 ? 287 HIS B O   1 
ATOM   4916 C  CB  . HIS B 1 287 ? -2.258  6.197   -19.332 1.00 40.43 ? 287 HIS B CB  1 
ATOM   4917 C  CG  . HIS B 1 287 ? -2.956  7.389   -19.912 1.00 41.93 ? 287 HIS B CG  1 
ATOM   4918 N  ND1 . HIS B 1 287 ? -2.292  8.393   -20.588 1.00 48.01 ? 287 HIS B ND1 1 
ATOM   4919 C  CD2 . HIS B 1 287 ? -4.257  7.766   -19.867 1.00 46.76 ? 287 HIS B CD2 1 
ATOM   4920 C  CE1 . HIS B 1 287 ? -3.156  9.325   -20.956 1.00 47.27 ? 287 HIS B CE1 1 
ATOM   4921 N  NE2 . HIS B 1 287 ? -4.354  8.973   -20.523 1.00 47.42 ? 287 HIS B NE2 1 
ATOM   4922 N  N   . GLN B 1 288 ? -0.814  5.141   -16.124 1.00 36.20 ? 288 GLN B N   1 
ATOM   4923 C  CA  . GLN B 1 288 ? -0.122  4.048   -15.446 1.00 34.92 ? 288 GLN B CA  1 
ATOM   4924 C  C   . GLN B 1 288 ? 0.704   3.194   -16.410 1.00 32.43 ? 288 GLN B C   1 
ATOM   4925 O  O   . GLN B 1 288 ? 0.678   1.958   -16.341 1.00 31.09 ? 288 GLN B O   1 
ATOM   4926 C  CB  . GLN B 1 288 ? -1.126  3.167   -14.706 1.00 33.46 ? 288 GLN B CB  1 
ATOM   4927 C  CG  . GLN B 1 288 ? -1.989  3.877   -13.672 1.00 34.21 ? 288 GLN B CG  1 
ATOM   4928 C  CD  . GLN B 1 288 ? -3.104  2.996   -13.183 1.00 34.55 ? 288 GLN B CD  1 
ATOM   4929 O  OE1 . GLN B 1 288 ? -4.266  3.146   -13.592 1.00 34.23 ? 288 GLN B OE1 1 
ATOM   4930 N  NE2 . GLN B 1 288 ? -2.758  2.043   -12.312 1.00 34.43 ? 288 GLN B NE2 1 
ATOM   4931 N  N   . ILE B 1 289 ? 1.431   3.857   -17.305 1.00 31.96 ? 289 ILE B N   1 
ATOM   4932 C  CA  . ILE B 1 289 ? 2.311   3.169   -18.221 1.00 33.14 ? 289 ILE B CA  1 
ATOM   4933 C  C   . ILE B 1 289 ? 3.744   3.199   -17.685 1.00 31.55 ? 289 ILE B C   1 
ATOM   4934 O  O   . ILE B 1 289 ? 4.317   4.273   -17.431 1.00 31.25 ? 289 ILE B O   1 
ATOM   4935 C  CB  . ILE B 1 289 ? 2.280   3.797   -19.630 1.00 32.82 ? 289 ILE B CB  1 
ATOM   4936 C  CG1 . ILE B 1 289 ? 0.849   3.809   -20.196 1.00 34.20 ? 289 ILE B CG1 1 
ATOM   4937 C  CG2 . ILE B 1 289 ? 3.230   3.052   -20.568 1.00 36.00 ? 289 ILE B CG2 1 
ATOM   4938 C  CD1 . ILE B 1 289 ? 0.212   2.445   -20.326 1.00 37.74 ? 289 ILE B CD1 1 
ATOM   4939 N  N   . TYR B 1 290 ? 4.307   2.005   -17.554 1.00 30.04 ? 290 TYR B N   1 
ATOM   4940 C  CA  . TYR B 1 290 ? 5.700   1.802   -17.135 1.00 30.43 ? 290 TYR B CA  1 
ATOM   4941 C  C   . TYR B 1 290 ? 6.123   0.406   -17.550 1.00 28.98 ? 290 TYR B C   1 
ATOM   4942 O  O   . TYR B 1 290 ? 5.280   -0.455  -17.776 1.00 30.42 ? 290 TYR B O   1 
ATOM   4943 C  CB  . TYR B 1 290 ? 5.838   1.935   -15.610 1.00 31.28 ? 290 TYR B CB  1 
ATOM   4944 C  CG  . TYR B 1 290 ? 4.624   1.514   -14.823 1.00 31.10 ? 290 TYR B CG  1 
ATOM   4945 C  CD1 . TYR B 1 290 ? 4.305   0.170   -14.644 1.00 30.37 ? 290 TYR B CD1 1 
ATOM   4946 C  CD2 . TYR B 1 290 ? 3.785   2.471   -14.245 1.00 32.01 ? 290 TYR B CD2 1 
ATOM   4947 C  CE1 . TYR B 1 290 ? 3.187   -0.205  -13.925 1.00 31.71 ? 290 TYR B CE1 1 
ATOM   4948 C  CE2 . TYR B 1 290 ? 2.660   2.105   -13.532 1.00 30.74 ? 290 TYR B CE2 1 
ATOM   4949 C  CZ  . TYR B 1 290 ? 2.376   0.762   -13.355 1.00 31.33 ? 290 TYR B CZ  1 
ATOM   4950 O  OH  . TYR B 1 290 ? 1.260   0.394   -12.653 1.00 31.96 ? 290 TYR B OH  1 
ATOM   4951 N  N   . PRO B 1 291 ? 7.431   0.146   -17.568 1.00 29.89 ? 291 PRO B N   1 
ATOM   4952 C  CA  . PRO B 1 291 ? 7.875   -1.180  -17.975 1.00 28.42 ? 291 PRO B CA  1 
ATOM   4953 C  C   . PRO B 1 291 ? 7.396   -2.252  -16.992 1.00 28.11 ? 291 PRO B C   1 
ATOM   4954 O  O   . PRO B 1 291 ? 7.298   -1.990  -15.771 1.00 26.05 ? 291 PRO B O   1 
ATOM   4955 C  CB  . PRO B 1 291 ? 9.406   -1.052  -17.959 1.00 28.72 ? 291 PRO B CB  1 
ATOM   4956 C  CG  . PRO B 1 291 ? 9.683   0.400   -18.106 1.00 29.37 ? 291 PRO B CG  1 
ATOM   4957 C  CD  . PRO B 1 291 ? 8.557   1.081   -17.374 1.00 29.37 ? 291 PRO B CD  1 
ATOM   4958 N  N   . GLN B 1 292 ? 7.070   -3.432  -17.519 1.00 28.61 ? 292 GLN B N   1 
ATOM   4959 C  CA  . GLN B 1 292 ? 6.642   -4.563  -16.674 1.00 29.33 ? 292 GLN B CA  1 
ATOM   4960 C  C   . GLN B 1 292 ? 7.262   -5.834  -17.173 1.00 30.16 ? 292 GLN B C   1 
ATOM   4961 O  O   . GLN B 1 292 ? 7.196   -6.116  -18.377 1.00 30.82 ? 292 GLN B O   1 
ATOM   4962 C  CB  . GLN B 1 292 ? 5.124   -4.764  -16.732 1.00 30.12 ? 292 GLN B CB  1 
ATOM   4963 C  CG  . GLN B 1 292 ? 4.318   -3.695  -16.055 1.00 30.45 ? 292 GLN B CG  1 
ATOM   4964 C  CD  . GLN B 1 292 ? 2.834   -3.997  -16.114 1.00 31.47 ? 292 GLN B CD  1 
ATOM   4965 O  OE1 . GLN B 1 292 ? 2.414   -5.138  -15.872 1.00 32.28 ? 292 GLN B OE1 1 
ATOM   4966 N  NE2 . GLN B 1 292 ? 2.035   -2.985  -16.422 1.00 32.09 ? 292 GLN B NE2 1 
ATOM   4967 N  N   . ALA B 1 293 ? 7.813   -6.622  -16.252 1.00 31.44 ? 293 ALA B N   1 
ATOM   4968 C  CA  . ALA B 1 293 ? 8.435   -7.904  -16.594 1.00 32.41 ? 293 ALA B CA  1 
ATOM   4969 C  C   . ALA B 1 293 ? 7.572   -8.716  -17.544 1.00 33.38 ? 293 ALA B C   1 
ATOM   4970 O  O   . ALA B 1 293 ? 8.048   -9.170  -18.591 1.00 34.01 ? 293 ALA B O   1 
ATOM   4971 C  CB  . ALA B 1 293 ? 8.739   -8.710  -15.342 1.00 32.79 ? 293 ALA B CB  1 
ATOM   4972 N  N   . ILE B 1 294 ? 6.300   -8.902  -17.201 1.00 33.68 ? 294 ILE B N   1 
ATOM   4973 C  CA  . ILE B 1 294 ? 5.462   -9.797  -18.012 1.00 34.31 ? 294 ILE B CA  1 
ATOM   4974 C  C   . ILE B 1 294 ? 5.250   -9.313  -19.457 1.00 34.42 ? 294 ILE B C   1 
ATOM   4975 O  O   . ILE B 1 294 ? 5.090   -10.132 -20.360 1.00 35.04 ? 294 ILE B O   1 
ATOM   4976 C  CB  . ILE B 1 294 ? 4.120   -10.148 -17.338 1.00 34.69 ? 294 ILE B CB  1 
ATOM   4977 C  CG1 . ILE B 1 294 ? 3.245   -8.910  -17.147 1.00 37.07 ? 294 ILE B CG1 1 
ATOM   4978 C  CG2 . ILE B 1 294 ? 4.374   -10.863 -16.014 1.00 33.81 ? 294 ILE B CG2 1 
ATOM   4979 C  CD1 . ILE B 1 294 ? 1.932   -9.232  -16.459 1.00 41.00 ? 294 ILE B CD1 1 
ATOM   4980 N  N   . ASN B 1 295 ? 5.279   -8.008  -19.679 1.00 33.41 ? 295 ASN B N   1 
ATOM   4981 C  CA  . ASN B 1 295 ? 5.152   -7.476  -21.028 1.00 35.21 ? 295 ASN B CA  1 
ATOM   4982 C  C   . ASN B 1 295 ? 6.419   -7.525  -21.853 1.00 33.41 ? 295 ASN B C   1 
ATOM   4983 O  O   . ASN B 1 295 ? 6.341   -7.490  -23.062 1.00 35.40 ? 295 ASN B O   1 
ATOM   4984 C  CB  . ASN B 1 295 ? 4.624   -6.049  -20.982 1.00 37.87 ? 295 ASN B CB  1 
ATOM   4985 C  CG  . ASN B 1 295 ? 3.204   -5.993  -20.476 1.00 40.03 ? 295 ASN B CG  1 
ATOM   4986 O  OD1 . ASN B 1 295 ? 2.501   -6.991  -20.519 1.00 40.15 ? 295 ASN B OD1 1 
ATOM   4987 N  ND2 . ASN B 1 295 ? 2.790   -4.840  -19.951 1.00 43.50 ? 295 ASN B ND2 1 
ATOM   4988 N  N   . ALA B 1 296 ? 7.571   -7.589  -21.189 1.00 30.85 ? 296 ALA B N   1 
ATOM   4989 C  CA  . ALA B 1 296 ? 8.868   -7.563  -21.823 1.00 29.67 ? 296 ALA B CA  1 
ATOM   4990 C  C   . ALA B 1 296 ? 9.281   -8.923  -22.361 1.00 30.15 ? 296 ALA B C   1 
ATOM   4991 O  O   . ALA B 1 296 ? 10.047  -8.983  -23.305 1.00 31.07 ? 296 ALA B O   1 
ATOM   4992 C  CB  . ALA B 1 296 ? 9.916   -7.083  -20.849 1.00 29.19 ? 296 ALA B CB  1 
ATOM   4993 N  N   . VAL B 1 297 ? 8.767   -10.004 -21.760 1.00 30.09 ? 297 VAL B N   1 
ATOM   4994 C  CA  . VAL B 1 297 ? 9.088   -11.358 -22.202 1.00 31.65 ? 297 VAL B CA  1 
ATOM   4995 C  C   . VAL B 1 297 ? 8.827   -11.546 -23.690 1.00 32.60 ? 297 VAL B C   1 
ATOM   4996 O  O   . VAL B 1 297 ? 7.739   -11.245 -24.207 1.00 32.76 ? 297 VAL B O   1 
ATOM   4997 C  CB  . VAL B 1 297 ? 8.310   -12.427 -21.399 1.00 32.19 ? 297 VAL B CB  1 
ATOM   4998 C  CG1 . VAL B 1 297 ? 8.644   -13.834 -21.894 1.00 34.89 ? 297 VAL B CG1 1 
ATOM   4999 C  CG2 . VAL B 1 297 ? 8.647   -12.298 -19.927 1.00 34.22 ? 297 VAL B CG2 1 
ATOM   5000 N  N   . GLY B 1 298 ? 9.832   -12.065 -24.370 1.00 32.25 ? 298 GLY B N   1 
ATOM   5001 C  CA  . GLY B 1 298 ? 9.767   -12.296 -25.810 1.00 34.40 ? 298 GLY B CA  1 
ATOM   5002 C  C   . GLY B 1 298 ? 10.233  -11.137 -26.678 1.00 34.02 ? 298 GLY B C   1 
ATOM   5003 O  O   . GLY B 1 298 ? 10.331  -11.301 -27.882 1.00 35.20 ? 298 GLY B O   1 
ATOM   5004 N  N   . SER B 1 299 ? 10.502  -9.969  -26.094 1.00 33.91 ? 299 SER B N   1 
ATOM   5005 C  CA  . SER B 1 299 ? 10.986  -8.804  -26.863 1.00 33.00 ? 299 SER B CA  1 
ATOM   5006 C  C   . SER B 1 299 ? 12.480  -8.594  -26.651 1.00 32.43 ? 299 SER B C   1 
ATOM   5007 O  O   . SER B 1 299 ? 13.003  -8.770  -25.539 1.00 29.97 ? 299 SER B O   1 
ATOM   5008 C  CB  . SER B 1 299 ? 10.233  -7.523  -26.492 1.00 32.22 ? 299 SER B CB  1 
ATOM   5009 O  OG  . SER B 1 299 ? 10.803  -6.366  -27.137 1.00 31.76 ? 299 SER B OG  1 
ATOM   5010 N  N   . ARG B 1 300 ? 13.138  -8.200  -27.738 1.00 31.32 ? 300 ARG B N   1 
ATOM   5011 C  CA  . ARG B 1 300 ? 14.571  -7.890  -27.748 1.00 30.88 ? 300 ARG B CA  1 
ATOM   5012 C  C   . ARG B 1 300 ? 14.876  -6.522  -27.162 1.00 29.27 ? 300 ARG B C   1 
ATOM   5013 O  O   . ARG B 1 300 ? 16.041  -6.201  -26.912 1.00 28.30 ? 300 ARG B O   1 
ATOM   5014 C  CB  . ARG B 1 300 ? 15.088  -7.896  -29.186 1.00 32.05 ? 300 ARG B CB  1 
ATOM   5015 C  CG  . ARG B 1 300 ? 15.128  -9.273  -29.832 1.00 32.24 ? 300 ARG B CG  1 
ATOM   5016 C  CD  . ARG B 1 300 ? 15.490  -9.113  -31.285 1.00 32.33 ? 300 ARG B CD  1 
ATOM   5017 N  NE  . ARG B 1 300 ? 15.552  -10.378 -32.005 1.00 32.42 ? 300 ARG B NE  1 
ATOM   5018 C  CZ  . ARG B 1 300 ? 14.496  -11.040 -32.457 1.00 34.61 ? 300 ARG B CZ  1 
ATOM   5019 N  NH1 . ARG B 1 300 ? 13.269  -10.574 -32.242 1.00 36.32 ? 300 ARG B NH1 1 
ATOM   5020 N  NH2 . ARG B 1 300 ? 14.669  -12.180 -33.128 1.00 36.21 ? 300 ARG B NH2 1 
ATOM   5021 N  N   . ASP B 1 301 ? 13.842  -5.702  -27.015 1.00 29.88 ? 301 ASP B N   1 
ATOM   5022 C  CA  . ASP B 1 301 ? 14.010  -4.307  -26.610 1.00 30.98 ? 301 ASP B CA  1 
ATOM   5023 C  C   . ASP B 1 301 ? 14.212  -4.243  -25.100 1.00 30.97 ? 301 ASP B C   1 
ATOM   5024 O  O   . ASP B 1 301 ? 13.879  -5.189  -24.389 1.00 31.72 ? 301 ASP B O   1 
ATOM   5025 C  CB  . ASP B 1 301 ? 12.775  -3.480  -27.017 1.00 31.80 ? 301 ASP B CB  1 
ATOM   5026 C  CG  . ASP B 1 301 ? 12.818  -3.001  -28.486 1.00 34.48 ? 301 ASP B CG  1 
ATOM   5027 O  OD1 . ASP B 1 301 ? 13.920  -2.704  -28.967 1.00 34.46 ? 301 ASP B OD1 1 
ATOM   5028 O  OD2 . ASP B 1 301 ? 11.747  -2.876  -29.141 1.00 33.53 ? 301 ASP B OD2 1 
ATOM   5029 N  N   . THR B 1 302 ? 14.740  -3.110  -24.636 1.00 30.08 ? 302 THR B N   1 
ATOM   5030 C  CA  . THR B 1 302 ? 14.889  -2.801  -23.239 1.00 30.94 ? 302 THR B CA  1 
ATOM   5031 C  C   . THR B 1 302 ? 13.986  -1.609  -22.909 1.00 31.72 ? 302 THR B C   1 
ATOM   5032 O  O   . THR B 1 302 ? 14.018  -0.584  -23.610 1.00 33.55 ? 302 THR B O   1 
ATOM   5033 C  CB  . THR B 1 302 ? 16.350  -2.438  -22.931 1.00 30.86 ? 302 THR B CB  1 
ATOM   5034 O  OG1 . THR B 1 302 ? 17.186  -3.569  -23.169 1.00 32.32 ? 302 THR B OG1 1 
ATOM   5035 C  CG2 . THR B 1 302 ? 16.508  -1.969  -21.498 1.00 31.35 ? 302 THR B CG2 1 
ATOM   5036 N  N   . PHE B 1 303 ? 13.191  -1.728  -21.850 1.00 31.18 ? 303 PHE B N   1 
ATOM   5037 C  CA  . PHE B 1 303 ? 12.074  -0.819  -21.637 1.00 32.69 ? 303 PHE B CA  1 
ATOM   5038 C  C   . PHE B 1 303 ? 12.364  0.036   -20.422 1.00 31.70 ? 303 PHE B C   1 
ATOM   5039 O  O   . PHE B 1 303 ? 12.756  -0.477  -19.380 1.00 30.77 ? 303 PHE B O   1 
ATOM   5040 C  CB  . PHE B 1 303 ? 10.755  -1.585  -21.459 1.00 32.69 ? 303 PHE B CB  1 
ATOM   5041 C  CG  . PHE B 1 303 ? 10.362  -2.380  -22.665 1.00 34.43 ? 303 PHE B CG  1 
ATOM   5042 C  CD1 . PHE B 1 303 ? 9.714   -1.762  -23.736 1.00 32.03 ? 303 PHE B CD1 1 
ATOM   5043 C  CD2 . PHE B 1 303 ? 10.669  -3.730  -22.754 1.00 33.37 ? 303 PHE B CD2 1 
ATOM   5044 C  CE1 . PHE B 1 303 ? 9.365   -2.486  -24.860 1.00 33.27 ? 303 PHE B CE1 1 
ATOM   5045 C  CE2 . PHE B 1 303 ? 10.336  -4.453  -23.887 1.00 34.01 ? 303 PHE B CE2 1 
ATOM   5046 C  CZ  . PHE B 1 303 ? 9.674   -3.825  -24.942 1.00 33.79 ? 303 PHE B CZ  1 
ATOM   5047 N  N   . VAL B 1 304 ? 12.188  1.342   -20.573 1.00 30.58 ? 304 VAL B N   1 
ATOM   5048 C  CA  . VAL B 1 304 ? 12.532  2.286   -19.521 1.00 30.03 ? 304 VAL B CA  1 
ATOM   5049 C  C   . VAL B 1 304 ? 11.381  3.202   -19.214 1.00 31.14 ? 304 VAL B C   1 
ATOM   5050 O  O   . VAL B 1 304 ? 10.735  3.744   -20.132 1.00 32.05 ? 304 VAL B O   1 
ATOM   5051 C  CB  . VAL B 1 304 ? 13.758  3.131   -19.918 1.00 32.03 ? 304 VAL B CB  1 
ATOM   5052 C  CG1 . VAL B 1 304 ? 14.263  3.925   -18.727 1.00 32.25 ? 304 VAL B CG1 1 
ATOM   5053 C  CG2 . VAL B 1 304 ? 14.858  2.237   -20.467 1.00 32.16 ? 304 VAL B CG2 1 
ATOM   5054 N  N   . GLY B 1 305 ? 11.154  3.406   -17.915 1.00 28.77 ? 305 GLY B N   1 
ATOM   5055 C  CA  . GLY B 1 305 ? 10.130  4.298   -17.431 1.00 29.76 ? 305 GLY B CA  1 
ATOM   5056 C  C   . GLY B 1 305 ? 10.370  4.715   -15.989 1.00 29.32 ? 305 GLY B C   1 
ATOM   5057 O  O   . GLY B 1 305 ? 11.518  4.636   -15.472 1.00 29.12 ? 305 GLY B O   1 
ATOM   5058 N  N   . ARG B 1 306 ? 9.302   5.204   -15.363 1.00 30.44 ? 306 ARG B N   1 
ATOM   5059 C  CA  . ARG B 1 306 ? 9.363   5.836   -14.032 1.00 29.62 ? 306 ARG B CA  1 
ATOM   5060 C  C   . ARG B 1 306 ? 10.489  6.869   -13.932 1.00 31.92 ? 306 ARG B C   1 
ATOM   5061 O  O   . ARG B 1 306 ? 11.099  7.042   -12.875 1.00 33.09 ? 306 ARG B O   1 
ATOM   5062 C  CB  . ARG B 1 306 ? 9.520   4.799   -12.897 1.00 29.82 ? 306 ARG B CB  1 
ATOM   5063 C  CG  . ARG B 1 306 ? 8.431   3.740   -12.778 1.00 29.43 ? 306 ARG B CG  1 
ATOM   5064 C  CD  . ARG B 1 306 ? 7.050   4.330   -12.417 1.00 28.85 ? 306 ARG B CD  1 
ATOM   5065 N  NE  . ARG B 1 306 ? 7.174   5.492   -11.524 1.00 28.26 ? 306 ARG B NE  1 
ATOM   5066 C  CZ  . ARG B 1 306 ? 7.329   5.436   -10.199 1.00 28.98 ? 306 ARG B CZ  1 
ATOM   5067 N  NH1 . ARG B 1 306 ? 7.331   4.272   -9.557  1.00 29.87 ? 306 ARG B NH1 1 
ATOM   5068 N  NH2 . ARG B 1 306 ? 7.474   6.557   -9.506  1.00 28.85 ? 306 ARG B NH2 1 
ATOM   5069 N  N   . ILE B 1 307 ? 10.762  7.579   -15.032 1.00 30.92 ? 307 ILE B N   1 
ATOM   5070 C  CA  . ILE B 1 307 ? 11.890  8.486   -15.074 1.00 31.02 ? 307 ILE B CA  1 
ATOM   5071 C  C   . ILE B 1 307 ? 11.506  9.773   -14.314 1.00 32.51 ? 307 ILE B C   1 
ATOM   5072 O  O   . ILE B 1 307 ? 10.438  10.339  -14.548 1.00 30.56 ? 307 ILE B O   1 
ATOM   5073 C  CB  . ILE B 1 307 ? 12.292  8.818   -16.519 1.00 31.78 ? 307 ILE B CB  1 
ATOM   5074 C  CG1 . ILE B 1 307 ? 12.680  7.540   -17.277 1.00 33.59 ? 307 ILE B CG1 1 
ATOM   5075 C  CG2 . ILE B 1 307 ? 13.436  9.825   -16.516 1.00 32.61 ? 307 ILE B CG2 1 
ATOM   5076 C  CD1 . ILE B 1 307 ? 12.853  7.718   -18.784 1.00 32.59 ? 307 ILE B CD1 1 
ATOM   5077 N  N   . ARG B 1 308 ? 12.354  10.186  -13.379 1.00 29.82 ? 308 ARG B N   1 
ATOM   5078 C  CA  . ARG B 1 308 ? 12.043  11.322  -12.498 1.00 30.84 ? 308 ARG B CA  1 
ATOM   5079 C  C   . ARG B 1 308 ? 13.263  11.829  -11.733 1.00 32.12 ? 308 ARG B C   1 
ATOM   5080 O  O   . ARG B 1 308 ? 14.196  11.067  -11.453 1.00 31.20 ? 308 ARG B O   1 
ATOM   5081 C  CB  . ARG B 1 308 ? 10.923  10.971  -11.531 1.00 31.72 ? 308 ARG B CB  1 
ATOM   5082 C  CG  . ARG B 1 308 ? 11.247  9.795   -10.621 1.00 31.86 ? 308 ARG B CG  1 
ATOM   5083 C  CD  . ARG B 1 308 ? 9.982   9.084   -10.162 1.00 31.48 ? 308 ARG B CD  1 
ATOM   5084 N  NE  . ARG B 1 308 ? 10.265  8.284   -8.986  1.00 31.30 ? 308 ARG B NE  1 
ATOM   5085 C  CZ  . ARG B 1 308 ? 10.883  7.111   -8.977  1.00 32.53 ? 308 ARG B CZ  1 
ATOM   5086 N  NH1 . ARG B 1 308 ? 11.263  6.501   -10.105 1.00 33.13 ? 308 ARG B NH1 1 
ATOM   5087 N  NH2 . ARG B 1 308 ? 11.101  6.520   -7.802  1.00 32.55 ? 308 ARG B NH2 1 
ATOM   5088 N  N   . LYS B 1 309 ? 13.257  13.135  -11.438 1.00 33.58 ? 309 LYS B N   1 
ATOM   5089 C  CA  . LYS B 1 309 ? 14.334  13.783  -10.670 1.00 36.30 ? 309 LYS B CA  1 
ATOM   5090 C  C   . LYS B 1 309 ? 14.351  13.224  -9.272  1.00 31.59 ? 309 LYS B C   1 
ATOM   5091 O  O   . LYS B 1 309 ? 13.304  12.968  -8.713  1.00 31.30 ? 309 LYS B O   1 
ATOM   5092 C  CB  . LYS B 1 309 ? 14.076  15.294  -10.495 1.00 38.20 ? 309 LYS B CB  1 
ATOM   5093 C  CG  . LYS B 1 309 ? 14.430  16.174  -11.671 1.00 44.15 ? 309 LYS B CG  1 
ATOM   5094 C  CD  . LYS B 1 309 ? 14.284  17.649  -11.303 1.00 45.39 ? 309 LYS B CD  1 
ATOM   5095 C  CE  . LYS B 1 309 ? 14.343  18.580  -12.523 1.00 51.36 ? 309 LYS B CE  1 
ATOM   5096 N  NZ  . LYS B 1 309 ? 15.667  18.728  -13.237 1.00 50.68 ? 309 LYS B NZ  1 
ATOM   5097 N  N   . ASP B 1 310 ? 15.535  13.107  -8.687  1.00 31.03 ? 310 ASP B N   1 
ATOM   5098 C  CA  . ASP B 1 310 ? 15.641  12.923  -7.263  1.00 30.66 ? 310 ASP B CA  1 
ATOM   5099 C  C   . ASP B 1 310 ? 14.978  14.120  -6.575  1.00 31.58 ? 310 ASP B C   1 
ATOM   5100 O  O   . ASP B 1 310 ? 14.951  15.211  -7.111  1.00 32.79 ? 310 ASP B O   1 
ATOM   5101 C  CB  . ASP B 1 310 ? 17.116  12.790  -6.846  1.00 31.94 ? 310 ASP B CB  1 
ATOM   5102 C  CG  . ASP B 1 310 ? 17.263  12.404  -5.395  1.00 33.45 ? 310 ASP B CG  1 
ATOM   5103 O  OD1 . ASP B 1 310 ? 17.265  11.199  -5.110  1.00 33.36 ? 310 ASP B OD1 1 
ATOM   5104 O  OD2 . ASP B 1 310 ? 17.296  13.310  -4.539  1.00 35.22 ? 310 ASP B OD2 1 
ATOM   5105 N  N   . LEU B 1 311 ? 14.421  13.906  -5.394  1.00 31.05 ? 311 LEU B N   1 
ATOM   5106 C  CA  . LEU B 1 311 ? 13.727  14.970  -4.684  1.00 33.45 ? 311 LEU B CA  1 
ATOM   5107 C  C   . LEU B 1 311 ? 14.684  16.005  -4.092  1.00 33.08 ? 311 LEU B C   1 
ATOM   5108 O  O   . LEU B 1 311 ? 14.232  17.074  -3.695  1.00 34.76 ? 311 LEU B O   1 
ATOM   5109 C  CB  . LEU B 1 311 ? 12.849  14.379  -3.571  1.00 32.54 ? 311 LEU B CB  1 
ATOM   5110 C  CG  . LEU B 1 311 ? 11.614  13.596  -4.043  1.00 33.39 ? 311 LEU B CG  1 
ATOM   5111 C  CD1 . LEU B 1 311 ? 10.970  12.888  -2.875  1.00 33.45 ? 311 LEU B CD1 1 
ATOM   5112 C  CD2 . LEU B 1 311 ? 10.609  14.505  -4.750  1.00 36.90 ? 311 LEU B CD2 1 
ATOM   5113 N  N   . ASP B 1 312 ? 15.976  15.681  -4.016  1.00 34.89 ? 312 ASP B N   1 
ATOM   5114 C  CA  . ASP B 1 312 ? 16.970  16.523  -3.328  1.00 37.09 ? 312 ASP B CA  1 
ATOM   5115 C  C   . ASP B 1 312 ? 18.286  16.774  -4.084  1.00 37.51 ? 312 ASP B C   1 
ATOM   5116 O  O   . ASP B 1 312 ? 18.786  17.909  -4.119  1.00 36.67 ? 312 ASP B O   1 
ATOM   5117 C  CB  . ASP B 1 312 ? 17.271  15.904  -1.965  1.00 37.62 ? 312 ASP B CB  1 
ATOM   5118 C  CG  . ASP B 1 312 ? 16.059  15.872  -1.087  1.00 37.81 ? 312 ASP B CG  1 
ATOM   5119 O  OD1 . ASP B 1 312 ? 15.703  16.925  -0.526  1.00 38.37 ? 312 ASP B OD1 1 
ATOM   5120 O  OD2 . ASP B 1 312 ? 15.425  14.807  -0.998  1.00 37.48 ? 312 ASP B OD2 1 
ATOM   5121 N  N   . ALA B 1 313 ? 18.850  15.726  -4.669  1.00 36.94 ? 313 ALA B N   1 
ATOM   5122 C  CA  . ALA B 1 313 ? 20.096  15.822  -5.402  1.00 38.49 ? 313 ALA B CA  1 
ATOM   5123 C  C   . ALA B 1 313 ? 19.842  16.479  -6.754  1.00 39.83 ? 313 ALA B C   1 
ATOM   5124 O  O   . ALA B 1 313 ? 19.090  15.960  -7.567  1.00 36.75 ? 313 ALA B O   1 
ATOM   5125 C  CB  . ALA B 1 313 ? 20.704  14.445  -5.585  1.00 38.61 ? 313 ALA B CB  1 
ATOM   5126 N  N   . GLU B 1 314 ? 20.468  17.628  -6.987  1.00 39.16 ? 314 GLU B N   1 
ATOM   5127 C  CA  . GLU B 1 314 ? 20.254  18.386  -8.224  1.00 39.49 ? 314 GLU B CA  1 
ATOM   5128 C  C   . GLU B 1 314 ? 20.445  17.518  -9.490  1.00 35.56 ? 314 GLU B C   1 
ATOM   5129 O  O   . GLU B 1 314 ? 19.671  17.613  -10.428 1.00 35.34 ? 314 GLU B O   1 
ATOM   5130 C  CB  . GLU B 1 314 ? 21.222  19.571  -8.253  1.00 44.29 ? 314 GLU B CB  1 
ATOM   5131 C  CG  . GLU B 1 314 ? 20.933  20.608  -9.328  1.00 50.08 ? 314 GLU B CG  1 
ATOM   5132 C  CD  . GLU B 1 314 ? 22.016  21.681  -9.423  1.00 54.91 ? 314 GLU B CD  1 
ATOM   5133 O  OE1 . GLU B 1 314 ? 23.218  21.358  -9.256  1.00 59.66 ? 314 GLU B OE1 1 
ATOM   5134 O  OE2 . GLU B 1 314 ? 21.668  22.848  -9.682  1.00 58.76 ? 314 GLU B OE2 1 
ATOM   5135 N  N   . LYS B 1 315 ? 21.480  16.677  -9.498  1.00 31.88 ? 315 LYS B N   1 
ATOM   5136 C  CA  . LYS B 1 315 ? 21.839  15.864  -10.665 1.00 31.74 ? 315 LYS B CA  1 
ATOM   5137 C  C   . LYS B 1 315 ? 21.391  14.391  -10.599 1.00 31.45 ? 315 LYS B C   1 
ATOM   5138 O  O   . LYS B 1 315 ? 21.806  13.578  -11.439 1.00 30.41 ? 315 LYS B O   1 
ATOM   5139 C  CB  . LYS B 1 315 ? 23.373  15.934  -10.849 1.00 34.62 ? 315 LYS B CB  1 
ATOM   5140 C  CG  . LYS B 1 315 ? 23.855  17.315  -11.283 1.00 36.82 ? 315 LYS B CG  1 
ATOM   5141 C  CD  . LYS B 1 315 ? 25.372  17.433  -11.309 1.00 40.38 ? 315 LYS B CD  1 
ATOM   5142 C  CE  . LYS B 1 315 ? 25.827  18.877  -11.549 1.00 41.79 ? 315 LYS B CE  1 
ATOM   5143 N  NZ  . LYS B 1 315 ? 27.310  18.932  -11.593 1.00 42.41 ? 315 LYS B NZ  1 
ATOM   5144 N  N   . GLY B 1 316 ? 20.569  14.052  -9.604  1.00 32.20 ? 316 GLY B N   1 
ATOM   5145 C  CA  . GLY B 1 316 ? 20.118  12.679  -9.381  1.00 30.13 ? 316 GLY B CA  1 
ATOM   5146 C  C   . GLY B 1 316 ? 18.865  12.379  -10.191 1.00 29.48 ? 316 GLY B C   1 
ATOM   5147 O  O   . GLY B 1 316 ? 18.009  13.232  -10.342 1.00 31.69 ? 316 GLY B O   1 
ATOM   5148 N  N   . ILE B 1 317 ? 18.781  11.175  -10.739 1.00 31.07 ? 317 ILE B N   1 
ATOM   5149 C  CA  . ILE B 1 317 ? 17.617  10.739  -11.513 1.00 30.85 ? 317 ILE B CA  1 
ATOM   5150 C  C   . ILE B 1 317 ? 17.346  9.280   -11.159 1.00 30.74 ? 317 ILE B C   1 
ATOM   5151 O  O   . ILE B 1 317 ? 18.286  8.515   -10.999 1.00 30.24 ? 317 ILE B O   1 
ATOM   5152 C  CB  . ILE B 1 317 ? 17.893  10.782  -13.029 1.00 30.75 ? 317 ILE B CB  1 
ATOM   5153 C  CG1 . ILE B 1 317 ? 18.080  12.229  -13.492 1.00 32.27 ? 317 ILE B CG1 1 
ATOM   5154 C  CG2 . ILE B 1 317 ? 16.758  10.131  -13.811 1.00 30.41 ? 317 ILE B CG2 1 
ATOM   5155 C  CD1 . ILE B 1 317 ? 18.613  12.337  -14.902 1.00 32.62 ? 317 ILE B CD1 1 
ATOM   5156 N  N   . HIS B 1 318 ? 16.066  8.914   -11.074 1.00 30.53 ? 318 HIS B N   1 
ATOM   5157 C  CA  . HIS B 1 318 ? 15.651  7.529   -10.814 1.00 32.40 ? 318 HIS B CA  1 
ATOM   5158 C  C   . HIS B 1 318 ? 14.865  7.049   -12.033 1.00 33.76 ? 318 HIS B C   1 
ATOM   5159 O  O   . HIS B 1 318 ? 14.214  7.857   -12.711 1.00 33.01 ? 318 HIS B O   1 
ATOM   5160 C  CB  . HIS B 1 318 ? 14.723  7.430   -9.609  1.00 32.84 ? 318 HIS B CB  1 
ATOM   5161 C  CG  . HIS B 1 318 ? 15.287  7.967   -8.330  1.00 33.70 ? 318 HIS B CG  1 
ATOM   5162 N  ND1 . HIS B 1 318 ? 15.749  7.146   -7.325  1.00 34.01 ? 318 HIS B ND1 1 
ATOM   5163 C  CD2 . HIS B 1 318 ? 15.395  9.234   -7.861  1.00 34.96 ? 318 HIS B CD2 1 
ATOM   5164 C  CE1 . HIS B 1 318 ? 16.143  7.886   -6.303  1.00 35.01 ? 318 HIS B CE1 1 
ATOM   5165 N  NE2 . HIS B 1 318 ? 15.945  9.156   -6.608  1.00 34.00 ? 318 HIS B NE2 1 
ATOM   5166 N  N   . MET B 1 319 ? 14.937  5.747   -12.289 1.00 31.22 ? 319 MET B N   1 
ATOM   5167 C  CA  . MET B 1 319 ? 14.190  5.106   -13.361 1.00 33.54 ? 319 MET B CA  1 
ATOM   5168 C  C   . MET B 1 319 ? 14.023  3.614   -13.082 1.00 32.18 ? 319 MET B C   1 
ATOM   5169 O  O   . MET B 1 319 ? 14.620  3.056   -12.156 1.00 33.60 ? 319 MET B O   1 
ATOM   5170 C  CB  . MET B 1 319 ? 14.889  5.320   -14.708 1.00 33.10 ? 319 MET B CB  1 
ATOM   5171 C  CG  . MET B 1 319 ? 16.284  4.689   -14.820 1.00 34.23 ? 319 MET B CG  1 
ATOM   5172 S  SD  . MET B 1 319 ? 17.085  5.012   -16.408 1.00 36.18 ? 319 MET B SD  1 
ATOM   5173 C  CE  . MET B 1 319 ? 17.527  6.728   -16.138 1.00 35.00 ? 319 MET B CE  1 
ATOM   5174 N  N   . TRP B 1 320 ? 13.219  2.991   -13.927 1.00 32.43 ? 320 TRP B N   1 
ATOM   5175 C  CA  . TRP B 1 320 ? 12.870  1.595   -13.848 1.00 30.15 ? 320 TRP B CA  1 
ATOM   5176 C  C   . TRP B 1 320 ? 13.172  1.002   -15.212 1.00 29.78 ? 320 TRP B C   1 
ATOM   5177 O  O   . TRP B 1 320 ? 12.692  1.511   -16.238 1.00 28.97 ? 320 TRP B O   1 
ATOM   5178 C  CB  . TRP B 1 320 ? 11.383  1.495   -13.534 1.00 30.30 ? 320 TRP B CB  1 
ATOM   5179 C  CG  . TRP B 1 320 ? 10.808  0.117   -13.384 1.00 29.31 ? 320 TRP B CG  1 
ATOM   5180 C  CD1 . TRP B 1 320 ? 9.893   -0.492  -14.198 1.00 30.14 ? 320 TRP B CD1 1 
ATOM   5181 C  CD2 . TRP B 1 320 ? 11.036  -0.773  -12.302 1.00 29.81 ? 320 TRP B CD2 1 
ATOM   5182 N  NE1 . TRP B 1 320 ? 9.568   -1.719  -13.705 1.00 30.55 ? 320 TRP B NE1 1 
ATOM   5183 C  CE2 . TRP B 1 320 ? 10.253  -1.916  -12.534 1.00 29.58 ? 320 TRP B CE2 1 
ATOM   5184 C  CE3 . TRP B 1 320 ? 11.837  -0.717  -11.156 1.00 31.26 ? 320 TRP B CE3 1 
ATOM   5185 C  CZ2 . TRP B 1 320 ? 10.246  -2.994  -11.671 1.00 30.20 ? 320 TRP B CZ2 1 
ATOM   5186 C  CZ3 . TRP B 1 320 ? 11.838  -1.803  -10.298 1.00 32.43 ? 320 TRP B CZ3 1 
ATOM   5187 C  CH2 . TRP B 1 320 ? 11.041  -2.919  -10.558 1.00 31.84 ? 320 TRP B CH2 1 
ATOM   5188 N  N   . VAL B 1 321 ? 13.988  -0.046  -15.225 1.00 28.51 ? 321 VAL B N   1 
ATOM   5189 C  CA  . VAL B 1 321 ? 14.487  -0.645  -16.461 1.00 29.71 ? 321 VAL B CA  1 
ATOM   5190 C  C   . VAL B 1 321 ? 14.152  -2.134  -16.472 1.00 31.79 ? 321 VAL B C   1 
ATOM   5191 O  O   . VAL B 1 321 ? 14.450  -2.845  -15.513 1.00 32.10 ? 321 VAL B O   1 
ATOM   5192 C  CB  . VAL B 1 321 ? 16.023  -0.451  -16.606 1.00 30.95 ? 321 VAL B CB  1 
ATOM   5193 C  CG1 . VAL B 1 321 ? 16.523  -1.029  -17.919 1.00 30.42 ? 321 VAL B CG1 1 
ATOM   5194 C  CG2 . VAL B 1 321 ? 16.394  1.029   -16.539 1.00 33.53 ? 321 VAL B CG2 1 
ATOM   5195 N  N   . VAL B 1 322 ? 13.559  -2.607  -17.569 1.00 31.48 ? 322 VAL B N   1 
ATOM   5196 C  CA  . VAL B 1 322 ? 13.124  -4.000  -17.692 1.00 30.24 ? 322 VAL B CA  1 
ATOM   5197 C  C   . VAL B 1 322 ? 13.530  -4.576  -19.060 1.00 31.68 ? 322 VAL B C   1 
ATOM   5198 O  O   . VAL B 1 322 ? 13.375  -3.925  -20.106 1.00 30.68 ? 322 VAL B O   1 
ATOM   5199 C  CB  . VAL B 1 322 ? 11.590  -4.112  -17.540 1.00 30.18 ? 322 VAL B CB  1 
ATOM   5200 C  CG1 . VAL B 1 322 ? 11.110  -5.540  -17.776 1.00 30.74 ? 322 VAL B CG1 1 
ATOM   5201 C  CG2 . VAL B 1 322 ? 11.147  -3.628  -16.162 1.00 31.08 ? 322 VAL B CG2 1 
ATOM   5202 N  N   . SER B 1 323 ? 14.066  -5.791  -19.047 1.00 30.15 ? 323 SER B N   1 
ATOM   5203 C  CA  . SER B 1 323 ? 14.273  -6.533  -20.287 1.00 30.75 ? 323 SER B CA  1 
ATOM   5204 C  C   . SER B 1 323 ? 14.242  -8.027  -20.035 1.00 30.43 ? 323 SER B C   1 
ATOM   5205 O  O   . SER B 1 323 ? 14.505  -8.485  -18.925 1.00 31.91 ? 323 SER B O   1 
ATOM   5206 C  CB  . SER B 1 323 ? 15.594  -6.170  -20.956 1.00 31.83 ? 323 SER B CB  1 
ATOM   5207 O  OG  . SER B 1 323 ? 15.606  -6.642  -22.309 1.00 33.89 ? 323 SER B OG  1 
ATOM   5208 N  N   . ASP B 1 324 ? 13.943  -8.771  -21.090 1.00 29.75 ? 324 ASP B N   1 
ATOM   5209 C  CA  . ASP B 1 324 ? 13.953  -10.240 -21.055 1.00 30.69 ? 324 ASP B CA  1 
ATOM   5210 C  C   . ASP B 1 324 ? 15.409  -10.661 -20.883 1.00 31.05 ? 324 ASP B C   1 
ATOM   5211 O  O   . ASP B 1 324 ? 16.209  -10.409 -21.772 1.00 32.17 ? 324 ASP B O   1 
ATOM   5212 C  CB  . ASP B 1 324 ? 13.395  -10.783 -22.369 1.00 30.38 ? 324 ASP B CB  1 
ATOM   5213 C  CG  . ASP B 1 324 ? 13.177  -12.295 -22.357 1.00 31.46 ? 324 ASP B CG  1 
ATOM   5214 O  OD1 . ASP B 1 324 ? 14.024  -13.017 -21.807 1.00 31.15 ? 324 ASP B OD1 1 
ATOM   5215 O  OD2 . ASP B 1 324 ? 12.161  -12.759 -22.931 1.00 32.16 ? 324 ASP B OD2 1 
ATOM   5216 N  N   . ASN B 1 325 ? 15.724  -11.319 -19.763 1.00 29.03 ? 325 ASN B N   1 
ATOM   5217 C  CA  . ASN B 1 325 ? 17.113  -11.675 -19.388 1.00 29.76 ? 325 ASN B CA  1 
ATOM   5218 C  C   . ASN B 1 325 ? 17.702  -12.804 -20.249 1.00 29.57 ? 325 ASN B C   1 
ATOM   5219 O  O   . ASN B 1 325 ? 18.915  -13.051 -20.262 1.00 28.62 ? 325 ASN B O   1 
ATOM   5220 C  CB  . ASN B 1 325 ? 17.168  -12.104 -17.913 1.00 30.37 ? 325 ASN B CB  1 
ATOM   5221 C  CG  . ASN B 1 325 ? 16.301  -13.319 -17.639 1.00 30.28 ? 325 ASN B CG  1 
ATOM   5222 O  OD1 . ASN B 1 325 ? 15.084  -13.245 -17.726 1.00 31.05 ? 325 ASN B OD1 1 
ATOM   5223 N  ND2 . ASN B 1 325 ? 16.915  -14.444 -17.360 1.00 33.71 ? 325 ASN B ND2 1 
ATOM   5224 N  N   . LEU B 1 326 ? 16.845  -13.505 -20.962 1.00 30.55 ? 326 LEU B N   1 
ATOM   5225 C  CA  . LEU B 1 326 ? 17.317  -14.527 -21.889 1.00 31.51 ? 326 LEU B CA  1 
ATOM   5226 C  C   . LEU B 1 326 ? 17.459  -14.022 -23.337 1.00 31.41 ? 326 LEU B C   1 
ATOM   5227 O  O   . LEU B 1 326 ? 18.056  -14.719 -24.155 1.00 34.45 ? 326 LEU B O   1 
ATOM   5228 C  CB  . LEU B 1 326 ? 16.416  -15.756 -21.842 1.00 32.32 ? 326 LEU B CB  1 
ATOM   5229 C  CG  . LEU B 1 326 ? 16.335  -16.542 -20.513 1.00 33.27 ? 326 LEU B CG  1 
ATOM   5230 C  CD1 . LEU B 1 326 ? 15.530  -17.803 -20.723 1.00 36.27 ? 326 LEU B CD1 1 
ATOM   5231 C  CD2 . LEU B 1 326 ? 17.702  -16.911 -19.949 1.00 34.59 ? 326 LEU B CD2 1 
ATOM   5232 N  N   . LEU B 1 327 ? 16.946  -12.831 -23.645 1.00 29.89 ? 327 LEU B N   1 
ATOM   5233 C  CA  . LEU B 1 327 ? 17.075  -12.255 -24.991 1.00 29.50 ? 327 LEU B CA  1 
ATOM   5234 C  C   . LEU B 1 327 ? 18.118  -11.185 -24.945 1.00 30.40 ? 327 LEU B C   1 
ATOM   5235 O  O   . LEU B 1 327 ? 19.305  -11.532 -24.993 1.00 31.40 ? 327 LEU B O   1 
ATOM   5236 C  CB  . LEU B 1 327 ? 15.723  -11.768 -25.531 1.00 30.41 ? 327 LEU B CB  1 
ATOM   5237 C  CG  . LEU B 1 327 ? 14.710  -12.907 -25.651 1.00 30.14 ? 327 LEU B CG  1 
ATOM   5238 C  CD1 . LEU B 1 327 ? 13.401  -12.428 -26.251 1.00 29.80 ? 327 LEU B CD1 1 
ATOM   5239 C  CD2 . LEU B 1 327 ? 15.260  -14.094 -26.455 1.00 31.89 ? 327 LEU B CD2 1 
ATOM   5240 N  N   . LYS B 1 328 ? 17.749  -9.903  -24.778 1.00 31.67 ? 328 LYS B N   1 
ATOM   5241 C  CA  . LYS B 1 328 ? 18.775  -8.891  -24.676 1.00 31.52 ? 328 LYS B CA  1 
ATOM   5242 C  C   . LYS B 1 328 ? 19.774  -9.221  -23.581 1.00 34.03 ? 328 LYS B C   1 
ATOM   5243 O  O   . LYS B 1 328 ? 20.935  -8.846  -23.684 1.00 32.30 ? 328 LYS B O   1 
ATOM   5244 C  CB  . LYS B 1 328 ? 18.211  -7.480  -24.471 1.00 34.31 ? 328 LYS B CB  1 
ATOM   5245 C  CG  . LYS B 1 328 ? 19.275  -6.376  -24.493 1.00 32.95 ? 328 LYS B CG  1 
ATOM   5246 C  CD  . LYS B 1 328 ? 20.105  -6.382  -25.778 1.00 34.14 ? 328 LYS B CD  1 
ATOM   5247 C  CE  . LYS B 1 328 ? 21.070  -5.202  -25.868 1.00 34.62 ? 328 LYS B CE  1 
ATOM   5248 N  NZ  . LYS B 1 328 ? 21.910  -5.279  -27.099 1.00 35.87 ? 328 LYS B NZ  1 
ATOM   5249 N  N   . GLY B 1 329 ? 19.332  -9.906  -22.527 1.00 32.55 ? 329 GLY B N   1 
ATOM   5250 C  CA  . GLY B 1 329 ? 20.234  -10.245 -21.429 1.00 33.53 ? 329 GLY B CA  1 
ATOM   5251 C  C   . GLY B 1 329 ? 21.222  -11.363 -21.726 1.00 33.37 ? 329 GLY B C   1 
ATOM   5252 O  O   . GLY B 1 329 ? 22.179  -11.510 -20.986 1.00 35.97 ? 329 GLY B O   1 
ATOM   5253 N  N   . ALA B 1 330 ? 20.988  -12.153 -22.782 1.00 33.27 ? 330 ALA B N   1 
ATOM   5254 C  CA  . ALA B 1 330 ? 21.879  -13.257 -23.135 1.00 34.01 ? 330 ALA B CA  1 
ATOM   5255 C  C   . ALA B 1 330 ? 21.877  -13.623 -24.627 1.00 35.04 ? 330 ALA B C   1 
ATOM   5256 O  O   . ALA B 1 330 ? 22.803  -13.262 -25.356 1.00 35.49 ? 330 ALA B O   1 
ATOM   5257 C  CB  . ALA B 1 330 ? 21.555  -14.492 -22.300 1.00 35.12 ? 330 ALA B CB  1 
ATOM   5258 N  N   . ALA B 1 331 ? 20.850  -14.335 -25.079 1.00 33.31 ? 331 ALA B N   1 
ATOM   5259 C  CA  . ALA B 1 331 ? 20.886  -14.941 -26.391 1.00 32.19 ? 331 ALA B CA  1 
ATOM   5260 C  C   . ALA B 1 331 ? 20.791  -13.907 -27.533 1.00 33.78 ? 331 ALA B C   1 
ATOM   5261 O  O   . ALA B 1 331 ? 21.429  -14.078 -28.574 1.00 33.92 ? 331 ALA B O   1 
ATOM   5262 C  CB  . ALA B 1 331 ? 19.795  -15.979 -26.519 1.00 33.44 ? 331 ALA B CB  1 
ATOM   5263 N  N   . TRP B 1 332 ? 20.008  -12.853 -27.349 1.00 31.10 ? 332 TRP B N   1 
ATOM   5264 C  CA  . TRP B 1 332 ? 19.897  -11.826 -28.388 1.00 31.15 ? 332 TRP B CA  1 
ATOM   5265 C  C   . TRP B 1 332 ? 21.142  -10.972 -28.413 1.00 31.38 ? 332 TRP B C   1 
ATOM   5266 O  O   . TRP B 1 332 ? 21.634  -10.639 -29.494 1.00 32.84 ? 332 TRP B O   1 
ATOM   5267 C  CB  . TRP B 1 332 ? 18.638  -10.968 -28.240 1.00 29.71 ? 332 TRP B CB  1 
ATOM   5268 C  CG  . TRP B 1 332 ? 18.703  -9.672  -28.977 1.00 30.39 ? 332 TRP B CG  1 
ATOM   5269 C  CD1 . TRP B 1 332 ? 18.544  -8.425  -28.453 1.00 30.69 ? 332 TRP B CD1 1 
ATOM   5270 C  CD2 . TRP B 1 332 ? 18.962  -9.496  -30.371 1.00 30.92 ? 332 TRP B CD2 1 
ATOM   5271 N  NE1 . TRP B 1 332 ? 18.695  -7.476  -29.432 1.00 32.44 ? 332 TRP B NE1 1 
ATOM   5272 C  CE2 . TRP B 1 332 ? 18.950  -8.112  -30.624 1.00 31.91 ? 332 TRP B CE2 1 
ATOM   5273 C  CE3 . TRP B 1 332 ? 19.212  -10.377 -31.428 1.00 32.61 ? 332 TRP B CE3 1 
ATOM   5274 C  CZ2 . TRP B 1 332 ? 19.173  -7.579  -31.903 1.00 32.33 ? 332 TRP B CZ2 1 
ATOM   5275 C  CZ3 . TRP B 1 332 ? 19.432  -9.854  -32.697 1.00 33.29 ? 332 TRP B CZ3 1 
ATOM   5276 C  CH2 . TRP B 1 332 ? 19.418  -8.465  -32.922 1.00 33.56 ? 332 TRP B CH2 1 
ATOM   5277 N  N   . ASN B 1 333 ? 21.660  -10.597 -27.253 1.00 31.11 ? 333 ASN B N   1 
ATOM   5278 C  CA  . ASN B 1 333 ? 22.903  -9.851  -27.254 1.00 33.18 ? 333 ASN B CA  1 
ATOM   5279 C  C   . ASN B 1 333 ? 23.995  -10.624 -27.997 1.00 34.59 ? 333 ASN B C   1 
ATOM   5280 O  O   . ASN B 1 333 ? 24.705  -10.042 -28.813 1.00 33.26 ? 333 ASN B O   1 
ATOM   5281 C  CB  . ASN B 1 333 ? 23.363  -9.479  -25.858 1.00 33.56 ? 333 ASN B CB  1 
ATOM   5282 C  CG  . ASN B 1 333 ? 24.376  -8.349  -25.869 1.00 33.22 ? 333 ASN B CG  1 
ATOM   5283 O  OD1 . ASN B 1 333 ? 24.047  -7.209  -26.211 1.00 34.08 ? 333 ASN B OD1 1 
ATOM   5284 N  ND2 . ASN B 1 333 ? 25.617  -8.657  -25.498 1.00 33.25 ? 333 ASN B ND2 1 
ATOM   5285 N  N   . SER B 1 334 ? 24.092  -11.930 -27.745 1.00 33.67 ? 334 SER B N   1 
ATOM   5286 C  CA  . SER B 1 334 ? 25.092  -12.780 -28.390 1.00 35.43 ? 334 SER B CA  1 
ATOM   5287 C  C   . SER B 1 334 ? 24.926  -12.883 -29.904 1.00 35.60 ? 334 SER B C   1 
ATOM   5288 O  O   . SER B 1 334 ? 25.896  -12.771 -30.633 1.00 36.56 ? 334 SER B O   1 
ATOM   5289 C  CB  . SER B 1 334 ? 25.067  -14.200 -27.806 1.00 36.62 ? 334 SER B CB  1 
ATOM   5290 O  OG  . SER B 1 334 ? 25.518  -14.202 -26.468 1.00 37.27 ? 334 SER B OG  1 
ATOM   5291 N  N   . VAL B 1 335 ? 23.700  -13.127 -30.363 1.00 32.92 ? 335 VAL B N   1 
ATOM   5292 C  CA  . VAL B 1 335 ? 23.410  -13.216 -31.782 1.00 33.45 ? 335 VAL B CA  1 
ATOM   5293 C  C   . VAL B 1 335 ? 23.611  -11.851 -32.437 1.00 33.53 ? 335 VAL B C   1 
ATOM   5294 O  O   . VAL B 1 335 ? 24.080  -11.773 -33.562 1.00 31.75 ? 335 VAL B O   1 
ATOM   5295 C  CB  . VAL B 1 335 ? 21.989  -13.764 -32.018 1.00 33.32 ? 335 VAL B CB  1 
ATOM   5296 C  CG1 . VAL B 1 335 ? 21.485  -13.493 -33.431 1.00 34.24 ? 335 VAL B CG1 1 
ATOM   5297 C  CG2 . VAL B 1 335 ? 21.964  -15.260 -31.708 1.00 34.96 ? 335 VAL B CG2 1 
ATOM   5298 N  N   . GLN B 1 336 ? 23.275  -10.783 -31.716 1.00 31.65 ? 336 GLN B N   1 
ATOM   5299 C  CA  . GLN B 1 336 ? 23.470  -9.434  -32.214 1.00 32.79 ? 336 GLN B CA  1 
ATOM   5300 C  C   . GLN B 1 336 ? 24.969  -9.134  -32.370 1.00 33.36 ? 336 GLN B C   1 
ATOM   5301 O  O   . GLN B 1 336 ? 25.390  -8.480  -33.347 1.00 31.99 ? 336 GLN B O   1 
ATOM   5302 C  CB  . GLN B 1 336 ? 22.822  -8.429  -31.265 1.00 34.10 ? 336 GLN B CB  1 
ATOM   5303 C  CG  . GLN B 1 336 ? 22.800  -7.010  -31.771 1.00 36.17 ? 336 GLN B CG  1 
ATOM   5304 C  CD  . GLN B 1 336 ? 22.158  -6.068  -30.765 1.00 37.91 ? 336 GLN B CD  1 
ATOM   5305 O  OE1 . GLN B 1 336 ? 22.105  -6.353  -29.573 1.00 39.86 ? 336 GLN B OE1 1 
ATOM   5306 N  NE2 . GLN B 1 336 ? 21.662  -4.954  -31.248 1.00 36.52 ? 336 GLN B NE2 1 
ATOM   5307 N  N   . ILE B 1 337 ? 25.773  -9.605  -31.419 1.00 32.90 ? 337 ILE B N   1 
ATOM   5308 C  CA  . ILE B 1 337 ? 27.237  -9.521  -31.552 1.00 34.08 ? 337 ILE B CA  1 
ATOM   5309 C  C   . ILE B 1 337 ? 27.685  -10.260 -32.822 1.00 35.80 ? 337 ILE B C   1 
ATOM   5310 O  O   . ILE B 1 337 ? 28.464  -9.729  -33.610 1.00 34.73 ? 337 ILE B O   1 
ATOM   5311 C  CB  . ILE B 1 337 ? 27.971  -10.063 -30.308 1.00 36.39 ? 337 ILE B CB  1 
ATOM   5312 C  CG1 . ILE B 1 337 ? 27.885  -9.050  -29.163 1.00 37.96 ? 337 ILE B CG1 1 
ATOM   5313 C  CG2 . ILE B 1 337 ? 29.442  -10.318 -30.588 1.00 38.04 ? 337 ILE B CG2 1 
ATOM   5314 C  CD1 . ILE B 1 337 ? 28.177  -9.653  -27.805 1.00 40.62 ? 337 ILE B CD1 1 
ATOM   5315 N  N   . ALA B 1 338 ? 27.151  -11.454 -33.039 1.00 35.14 ? 338 ALA B N   1 
ATOM   5316 C  CA  . ALA B 1 338 ? 27.528  -12.241 -34.206 1.00 36.40 ? 338 ALA B CA  1 
ATOM   5317 C  C   . ALA B 1 338 ? 27.125  -11.556 -35.508 1.00 37.37 ? 338 ALA B C   1 
ATOM   5318 O  O   . ALA B 1 338 ? 27.894  -11.550 -36.468 1.00 35.33 ? 338 ALA B O   1 
ATOM   5319 C  CB  . ALA B 1 338 ? 26.946  -13.638 -34.127 1.00 36.29 ? 338 ALA B CB  1 
ATOM   5320 N  N   . GLU B 1 339 ? 25.920  -10.991 -35.555 1.00 36.21 ? 339 GLU B N   1 
ATOM   5321 C  CA  . GLU B 1 339 ? 25.488  -10.257 -36.730 1.00 35.84 ? 339 GLU B CA  1 
ATOM   5322 C  C   . GLU B 1 339 ? 26.396  -9.042  -36.959 1.00 36.61 ? 339 GLU B C   1 
ATOM   5323 O  O   . GLU B 1 339 ? 26.739  -8.720  -38.105 1.00 37.62 ? 339 GLU B O   1 
ATOM   5324 C  CB  . GLU B 1 339 ? 24.018  -9.828  -36.595 1.00 35.91 ? 339 GLU B CB  1 
ATOM   5325 C  CG  . GLU B 1 339 ? 23.038  -10.994 -36.677 1.00 36.94 ? 339 GLU B CG  1 
ATOM   5326 C  CD  . GLU B 1 339 ? 21.577  -10.592 -36.464 1.00 39.76 ? 339 GLU B CD  1 
ATOM   5327 O  OE1 . GLU B 1 339 ? 21.300  -9.450  -36.018 1.00 39.10 ? 339 GLU B OE1 1 
ATOM   5328 O  OE2 . GLU B 1 339 ? 20.697  -11.433 -36.740 1.00 39.74 ? 339 GLU B OE2 1 
ATOM   5329 N  N   . THR B 1 340 ? 26.798  -8.391  -35.871 1.00 35.22 ? 340 THR B N   1 
ATOM   5330 C  CA  . THR B 1 340 ? 27.679  -7.232  -35.954 1.00 38.87 ? 340 THR B CA  1 
ATOM   5331 C  C   . THR B 1 340 ? 29.077  -7.647  -36.478 1.00 39.99 ? 340 THR B C   1 
ATOM   5332 O  O   . THR B 1 340 ? 29.674  -6.965  -37.315 1.00 34.28 ? 340 THR B O   1 
ATOM   5333 C  CB  . THR B 1 340 ? 27.775  -6.528  -34.594 1.00 41.13 ? 340 THR B CB  1 
ATOM   5334 O  OG1 . THR B 1 340 ? 26.450  -6.315  -34.086 1.00 39.71 ? 340 THR B OG1 1 
ATOM   5335 C  CG2 . THR B 1 340 ? 28.514  -5.184  -34.714 1.00 41.80 ? 340 THR B CG2 1 
ATOM   5336 N  N   . LEU B 1 341 ? 29.575  -8.777  -35.991 1.00 37.30 ? 341 LEU B N   1 
ATOM   5337 C  CA  . LEU B 1 341 ? 30.842  -9.339  -36.491 1.00 38.42 ? 341 LEU B CA  1 
ATOM   5338 C  C   . LEU B 1 341 ? 30.776  -9.642  -37.993 1.00 37.37 ? 341 LEU B C   1 
ATOM   5339 O  O   . LEU B 1 341 ? 31.695  -9.320  -38.734 1.00 38.02 ? 341 LEU B O   1 
ATOM   5340 C  CB  . LEU B 1 341 ? 31.216  -10.604 -35.707 1.00 36.92 ? 341 LEU B CB  1 
ATOM   5341 C  CG  . LEU B 1 341 ? 31.586  -10.368 -34.241 1.00 36.65 ? 341 LEU B CG  1 
ATOM   5342 C  CD1 . LEU B 1 341 ? 31.641  -11.693 -33.481 1.00 38.30 ? 341 LEU B CD1 1 
ATOM   5343 C  CD2 . LEU B 1 341 ? 32.911  -9.615  -34.120 1.00 39.35 ? 341 LEU B CD2 1 
ATOM   5344 N  N   . HIS B 1 342 ? 29.671  -10.230 -38.440 1.00 38.51 ? 342 HIS B N   1 
ATOM   5345 C  CA  . HIS B 1 342 ? 29.453  -10.475 -39.865 1.00 38.41 ? 342 HIS B CA  1 
ATOM   5346 C  C   . HIS B 1 342 ? 29.448  -9.169  -40.665 1.00 39.83 ? 342 HIS B C   1 
ATOM   5347 O  O   . HIS B 1 342 ? 30.093  -9.061  -41.705 1.00 37.94 ? 342 HIS B O   1 
ATOM   5348 C  CB  . HIS B 1 342 ? 28.122  -11.187 -40.068 1.00 39.28 ? 342 HIS B CB  1 
ATOM   5349 C  CG  . HIS B 1 342 ? 27.670  -11.235 -41.492 1.00 41.12 ? 342 HIS B CG  1 
ATOM   5350 N  ND1 . HIS B 1 342 ? 28.384  -11.882 -42.477 1.00 38.64 ? 342 HIS B ND1 1 
ATOM   5351 C  CD2 . HIS B 1 342 ? 26.570  -10.723 -42.095 1.00 42.13 ? 342 HIS B CD2 1 
ATOM   5352 C  CE1 . HIS B 1 342 ? 27.746  -11.762 -43.627 1.00 40.62 ? 342 HIS B CE1 1 
ATOM   5353 N  NE2 . HIS B 1 342 ? 26.640  -11.068 -43.422 1.00 40.69 ? 342 HIS B NE2 1 
ATOM   5354 N  N   . GLU B 1 343 ? 28.708  -8.187  -40.170 1.00 39.74 ? 343 GLU B N   1 
ATOM   5355 C  CA  . GLU B 1 343 ? 28.514  -6.928  -40.883 1.00 41.19 ? 343 GLU B CA  1 
ATOM   5356 C  C   . GLU B 1 343 ? 29.802  -6.138  -41.015 1.00 40.42 ? 343 GLU B C   1 
ATOM   5357 O  O   . GLU B 1 343 ? 29.986  -5.396  -41.988 1.00 37.05 ? 343 GLU B O   1 
ATOM   5358 C  CB  . GLU B 1 343 ? 27.447  -6.087  -40.178 1.00 43.26 ? 343 GLU B CB  1 
ATOM   5359 C  CG  . GLU B 1 343 ? 26.045  -6.628  -40.397 1.00 44.33 ? 343 GLU B CG  1 
ATOM   5360 C  CD  . GLU B 1 343 ? 25.043  -6.087  -39.392 1.00 48.33 ? 343 GLU B CD  1 
ATOM   5361 O  OE1 . GLU B 1 343 ? 25.350  -5.062  -38.728 1.00 45.34 ? 343 GLU B OE1 1 
ATOM   5362 O  OE2 . GLU B 1 343 ? 23.944  -6.693  -39.282 1.00 53.22 ? 343 GLU B OE2 1 
ATOM   5363 N  N   . ARG B 1 344 ? 30.698  -6.310  -40.051 1.00 38.17 ? 344 ARG B N   1 
ATOM   5364 C  CA  . ARG B 1 344 ? 31.941  -5.566  -40.026 1.00 39.47 ? 344 ARG B CA  1 
ATOM   5365 C  C   . ARG B 1 344 ? 33.142  -6.348  -40.529 1.00 37.79 ? 344 ARG B C   1 
ATOM   5366 O  O   . ARG B 1 344 ? 34.262  -5.870  -40.402 1.00 39.06 ? 344 ARG B O   1 
ATOM   5367 C  CB  . ARG B 1 344 ? 32.191  -5.018  -38.620 1.00 40.83 ? 344 ARG B CB  1 
ATOM   5368 C  CG  . ARG B 1 344 ? 31.047  -4.125  -38.213 1.00 43.87 ? 344 ARG B CG  1 
ATOM   5369 C  CD  . ARG B 1 344 ? 31.255  -3.402  -36.913 1.00 46.20 ? 344 ARG B CD  1 
ATOM   5370 N  NE  . ARG B 1 344 ? 30.093  -2.542  -36.700 1.00 49.33 ? 344 ARG B NE  1 
ATOM   5371 C  CZ  . ARG B 1 344 ? 30.070  -1.459  -35.931 1.00 48.27 ? 344 ARG B CZ  1 
ATOM   5372 N  NH1 . ARG B 1 344 ? 31.157  -1.065  -35.272 1.00 48.50 ? 344 ARG B NH1 1 
ATOM   5373 N  NH2 . ARG B 1 344 ? 28.942  -0.762  -35.834 1.00 50.37 ? 344 ARG B NH2 1 
ATOM   5374 N  N   . GLY B 1 345 ? 32.906  -7.509  -41.146 1.00 37.47 ? 345 GLY B N   1 
ATOM   5375 C  CA  . GLY B 1 345 ? 33.983  -8.311  -41.706 1.00 38.38 ? 345 GLY B CA  1 
ATOM   5376 C  C   . GLY B 1 345 ? 34.946  -8.891  -40.683 1.00 40.22 ? 345 GLY B C   1 
ATOM   5377 O  O   . GLY B 1 345 ? 36.112  -9.073  -40.985 1.00 39.92 ? 345 GLY B O   1 
ATOM   5378 N  N   . LEU B 1 346 ? 34.454  -9.217  -39.484 1.00 39.31 ? 346 LEU B N   1 
ATOM   5379 C  CA  . LEU B 1 346 ? 35.306  -9.677  -38.379 1.00 38.11 ? 346 LEU B CA  1 
ATOM   5380 C  C   . LEU B 1 346 ? 35.186  -11.173 -38.059 1.00 39.01 ? 346 LEU B C   1 
ATOM   5381 O  O   . LEU B 1 346 ? 35.750  -11.643 -37.068 1.00 40.30 ? 346 LEU B O   1 
ATOM   5382 C  CB  . LEU B 1 346 ? 35.027  -8.848  -37.120 1.00 37.64 ? 346 LEU B CB  1 
ATOM   5383 C  CG  . LEU B 1 346 ? 35.181  -7.333  -37.245 1.00 38.14 ? 346 LEU B CG  1 
ATOM   5384 C  CD1 . LEU B 1 346 ? 34.520  -6.612  -36.076 1.00 38.66 ? 346 LEU B CD1 1 
ATOM   5385 C  CD2 . LEU B 1 346 ? 36.649  -6.942  -37.358 1.00 39.81 ? 346 LEU B CD2 1 
ATOM   5386 N  N   . VAL B 1 347 ? 34.468  -11.926 -38.887 1.00 41.15 ? 347 VAL B N   1 
ATOM   5387 C  CA  . VAL B 1 347 ? 34.374  -13.367 -38.711 1.00 43.72 ? 347 VAL B CA  1 
ATOM   5388 C  C   . VAL B 1 347 ? 35.536  -13.985 -39.482 1.00 46.06 ? 347 VAL B C   1 
ATOM   5389 O  O   . VAL B 1 347 ? 35.410  -14.332 -40.649 1.00 47.40 ? 347 VAL B O   1 
ATOM   5390 C  CB  . VAL B 1 347 ? 33.022  -13.943 -39.212 1.00 43.37 ? 347 VAL B CB  1 
ATOM   5391 C  CG1 . VAL B 1 347 ? 32.977  -15.457 -39.040 1.00 44.03 ? 347 VAL B CG1 1 
ATOM   5392 C  CG2 . VAL B 1 347 ? 31.850  -13.289 -38.492 1.00 42.52 ? 347 VAL B CG2 1 
ATOM   5393 N  N   . ARG B 1 348 ? 36.683  -14.079 -38.829 1.00 50.68 ? 348 ARG B N   1 
ATOM   5394 C  CA  . ARG B 1 348 ? 37.829  -14.766 -39.414 1.00 52.53 ? 348 ARG B CA  1 
ATOM   5395 C  C   . ARG B 1 348 ? 38.736  -15.265 -38.301 1.00 51.38 ? 348 ARG B C   1 
ATOM   5396 O  O   . ARG B 1 348 ? 38.716  -14.708 -37.198 1.00 48.43 ? 348 ARG B O   1 
ATOM   5397 C  CB  . ARG B 1 348 ? 38.589  -13.865 -40.407 1.00 54.39 ? 348 ARG B CB  1 
ATOM   5398 C  CG  . ARG B 1 348 ? 39.305  -12.658 -39.817 1.00 55.97 ? 348 ARG B CG  1 
ATOM   5399 C  CD  . ARG B 1 348 ? 38.334  -11.547 -39.445 1.00 57.03 ? 348 ARG B CD  1 
ATOM   5400 N  NE  . ARG B 1 348 ? 38.981  -10.397 -38.807 1.00 57.52 ? 348 ARG B NE  1 
ATOM   5401 C  CZ  . ARG B 1 348 ? 39.508  -10.391 -37.581 1.00 54.83 ? 348 ARG B CZ  1 
ATOM   5402 N  NH1 . ARG B 1 348 ? 40.060  -9.280  -37.111 1.00 51.13 ? 348 ARG B NH1 1 
ATOM   5403 N  NH2 . ARG B 1 348 ? 39.506  -11.488 -36.826 1.00 56.22 ? 348 ARG B NH2 1 
ATOM   5404 N  N   . PRO B 1 349 ? 39.513  -16.330 -38.577 1.00 54.44 ? 349 PRO B N   1 
ATOM   5405 C  CA  . PRO B 1 349 ? 40.449  -16.875 -37.592 1.00 54.43 ? 349 PRO B CA  1 
ATOM   5406 C  C   . PRO B 1 349 ? 41.423  -15.838 -37.080 1.00 52.49 ? 349 PRO B C   1 
ATOM   5407 O  O   . PRO B 1 349 ? 41.834  -14.950 -37.828 1.00 54.42 ? 349 PRO B O   1 
ATOM   5408 C  CB  . PRO B 1 349 ? 41.197  -17.953 -38.381 1.00 54.73 ? 349 PRO B CB  1 
ATOM   5409 C  CG  . PRO B 1 349 ? 40.220  -18.407 -39.394 1.00 56.60 ? 349 PRO B CG  1 
ATOM   5410 C  CD  . PRO B 1 349 ? 39.446  -17.177 -39.784 1.00 56.21 ? 349 PRO B CD  1 
ATOM   5411 N  N   . THR B 1 350 ? 41.778  -15.941 -35.807 1.00 53.72 ? 350 THR B N   1 
ATOM   5412 C  CA  . THR B 1 350 ? 42.779  -15.058 -35.221 1.00 58.09 ? 350 THR B CA  1 
ATOM   5413 C  C   . THR B 1 350 ? 44.173  -15.521 -35.615 1.00 58.56 ? 350 THR B C   1 
ATOM   5414 O  O   . THR B 1 350 ? 44.399  -16.709 -35.822 1.00 55.90 ? 350 THR B O   1 
ATOM   5415 C  CB  . THR B 1 350 ? 42.676  -15.070 -33.693 1.00 59.73 ? 350 THR B CB  1 
ATOM   5416 O  OG1 . THR B 1 350 ? 41.302  -14.927 -33.332 1.00 67.08 ? 350 THR B OG1 1 
ATOM   5417 C  CG2 . THR B 1 350 ? 43.481  -13.942 -33.087 1.00 59.85 ? 350 THR B CG2 1 
ATOM   5418 N  N   . ALA B 1 351 ? 45.098  -14.572 -35.717 1.00 66.81 ? 351 ALA B N   1 
ATOM   5419 C  CA  . ALA B 1 351 ? 46.494  -14.866 -36.048 1.00 69.83 ? 351 ALA B CA  1 
ATOM   5420 C  C   . ALA B 1 351 ? 47.183  -15.505 -34.856 1.00 70.71 ? 351 ALA B C   1 
ATOM   5421 O  O   . ALA B 1 351 ? 47.657  -16.635 -34.935 1.00 70.71 ? 351 ALA B O   1 
ATOM   5422 C  CB  . ALA B 1 351 ? 47.224  -13.591 -36.454 1.00 72.54 ? 351 ALA B CB  1 
ATOM   5423 N  N   . GLU B 1 352 ? 47.208  -14.771 -33.748 1.00 72.57 ? 352 GLU B N   1 
ATOM   5424 C  CA  . GLU B 1 352 ? 47.887  -15.198 -32.534 1.00 75.18 ? 352 GLU B CA  1 
ATOM   5425 C  C   . GLU B 1 352 ? 46.890  -15.732 -31.501 1.00 73.56 ? 352 GLU B C   1 
ATOM   5426 O  O   . GLU B 1 352 ? 45.754  -15.263 -31.421 1.00 67.57 ? 352 GLU B O   1 
ATOM   5427 C  CB  . GLU B 1 352 ? 48.659  -14.018 -31.949 1.00 76.01 ? 352 GLU B CB  1 
ATOM   5428 C  CG  . GLU B 1 352 ? 49.878  -14.402 -31.132 1.00 77.61 ? 352 GLU B CG  1 
ATOM   5429 C  CD  . GLU B 1 352 ? 50.775  -13.211 -30.858 1.00 79.52 ? 352 GLU B CD  1 
ATOM   5430 O  OE1 . GLU B 1 352 ? 52.011  -13.383 -30.862 1.00 82.41 ? 352 GLU B OE1 1 
ATOM   5431 O  OE2 . GLU B 1 352 ? 50.244  -12.100 -30.651 1.00 76.87 ? 352 GLU B OE2 1 
ATOM   5432 N  N   . LEU B 1 353 ? 47.330  -16.717 -30.723 1.00 72.43 ? 353 LEU B N   1 
ATOM   5433 C  CA  . LEU B 1 353 ? 46.560  -17.246 -29.596 1.00 71.09 ? 353 LEU B CA  1 
ATOM   5434 C  C   . LEU B 1 353 ? 46.967  -16.519 -28.328 1.00 67.44 ? 353 LEU B C   1 
ATOM   5435 O  O   . LEU B 1 353 ? 48.152  -16.478 -27.994 1.00 68.11 ? 353 LEU B O   1 
ATOM   5436 C  CB  . LEU B 1 353 ? 46.837  -18.734 -29.417 1.00 75.18 ? 353 LEU B CB  1 
ATOM   5437 C  CG  . LEU B 1 353 ? 45.983  -19.668 -30.270 1.00 79.36 ? 353 LEU B CG  1 
ATOM   5438 C  CD1 . LEU B 1 353 ? 46.813  -20.840 -30.789 1.00 80.18 ? 353 LEU B CD1 1 
ATOM   5439 C  CD2 . LEU B 1 353 ? 44.774  -20.136 -29.463 1.00 80.92 ? 353 LEU B CD2 1 
ATOM   5440 N  N   . LYS B 1 354 ? 45.995  -15.953 -27.620 1.00 64.90 ? 354 LYS B N   1 
ATOM   5441 C  CA  . LYS B 1 354 ? 46.254  -15.283 -26.341 1.00 63.41 ? 354 LYS B CA  1 
ATOM   5442 C  C   . LYS B 1 354 ? 45.716  -16.078 -25.152 1.00 59.22 ? 354 LYS B C   1 
ATOM   5443 O  O   . LYS B 1 354 ? 45.834  -15.636 -24.011 1.00 60.28 ? 354 LYS B O   1 
ATOM   5444 C  CB  . LYS B 1 354 ? 45.620  -13.889 -26.336 1.00 67.47 ? 354 LYS B CB  1 
ATOM   5445 C  CG  . LYS B 1 354 ? 46.066  -12.983 -27.474 1.00 67.40 ? 354 LYS B CG  1 
ATOM   5446 C  CD  . LYS B 1 354 ? 47.432  -12.371 -27.208 1.00 66.03 ? 354 LYS B CD  1 
ATOM   5447 C  CE  . LYS B 1 354 ? 47.880  -11.496 -28.372 1.00 64.76 ? 354 LYS B CE  1 
ATOM   5448 N  NZ  . LYS B 1 354 ? 46.867  -10.468 -28.734 1.00 63.22 ? 354 LYS B NZ  1 
ATOM   5449 N  N   . PHE B 1 355 ? 45.141  -17.248 -25.419 1.00 55.50 ? 355 PHE B N   1 
ATOM   5450 C  CA  . PHE B 1 355 ? 44.401  -18.002 -24.407 1.00 56.97 ? 355 PHE B CA  1 
ATOM   5451 C  C   . PHE B 1 355 ? 44.953  -19.419 -24.229 1.00 59.97 ? 355 PHE B C   1 
ATOM   5452 O  O   . PHE B 1 355 ? 45.020  -20.198 -25.193 1.00 56.12 ? 355 PHE B O   1 
ATOM   5453 C  CB  . PHE B 1 355 ? 42.918  -18.062 -24.798 1.00 54.50 ? 355 PHE B CB  1 
ATOM   5454 C  CG  . PHE B 1 355 ? 42.354  -16.727 -25.200 1.00 51.25 ? 355 PHE B CG  1 
ATOM   5455 C  CD1 . PHE B 1 355 ? 42.207  -15.714 -24.263 1.00 47.71 ? 355 PHE B CD1 1 
ATOM   5456 C  CD2 . PHE B 1 355 ? 42.003  -16.469 -26.522 1.00 50.28 ? 355 PHE B CD2 1 
ATOM   5457 C  CE1 . PHE B 1 355 ? 41.702  -14.475 -24.628 1.00 46.68 ? 355 PHE B CE1 1 
ATOM   5458 C  CE2 . PHE B 1 355 ? 41.505  -15.224 -26.892 1.00 48.78 ? 355 PHE B CE2 1 
ATOM   5459 C  CZ  . PHE B 1 355 ? 41.358  -14.229 -25.948 1.00 46.13 ? 355 PHE B CZ  1 
ATOM   5460 N  N   . GLU B 1 356 ? 45.336  -19.742 -22.991 1.00 66.87 ? 356 GLU B N   1 
ATOM   5461 C  CA  . GLU B 1 356 ? 45.918  -21.047 -22.647 1.00 69.09 ? 356 GLU B CA  1 
ATOM   5462 C  C   . GLU B 1 356 ? 45.007  -22.213 -23.011 1.00 71.43 ? 356 GLU B C   1 
ATOM   5463 O  O   . GLU B 1 356 ? 43.782  -22.101 -22.920 1.00 73.78 ? 356 GLU B O   1 
ATOM   5464 C  CB  . GLU B 1 356 ? 46.205  -21.125 -21.144 1.00 76.19 ? 356 GLU B CB  1 
ATOM   5465 C  CG  . GLU B 1 356 ? 47.441  -20.373 -20.683 1.00 80.72 ? 356 GLU B CG  1 
ATOM   5466 C  CD  . GLU B 1 356 ? 47.935  -20.868 -19.336 1.00 86.58 ? 356 GLU B CD  1 
ATOM   5467 O  OE1 . GLU B 1 356 ? 47.437  -20.387 -18.297 1.00 89.31 ? 356 GLU B OE1 1 
ATOM   5468 O  OE2 . GLU B 1 356 ? 48.825  -21.745 -19.318 1.00 93.00 ? 356 GLU B OE2 1 
ATOM   5469 N  N   . LEU B 1 357 ? 45.607  -23.332 -23.416 1.00 69.05 ? 357 LEU B N   1 
ATOM   5470 C  CA  . LEU B 1 357 ? 44.865  -24.567 -23.654 1.00 68.19 ? 357 LEU B CA  1 
ATOM   5471 C  C   . LEU B 1 357 ? 44.870  -25.416 -22.380 1.00 70.39 ? 357 LEU B C   1 
ATOM   5472 O  O   . LEU B 1 357 ? 45.919  -25.891 -21.964 1.00 71.06 ? 357 LEU B O   1 
ATOM   5473 C  CB  . LEU B 1 357 ? 45.490  -25.354 -24.807 1.00 66.29 ? 357 LEU B CB  1 
ATOM   5474 C  CG  . LEU B 1 357 ? 45.567  -24.695 -26.186 1.00 65.52 ? 357 LEU B CG  1 
ATOM   5475 C  CD1 . LEU B 1 357 ? 46.091  -25.694 -27.207 1.00 63.15 ? 357 LEU B CD1 1 
ATOM   5476 C  CD2 . LEU B 1 357 ? 44.216  -24.150 -26.626 1.00 65.13 ? 357 LEU B CD2 1 
ATOM   5477 N  N   . LYS B 1 358 ? 43.703  -25.603 -21.764 1.00 75.19 ? 358 LYS B N   1 
ATOM   5478 C  CA  . LYS B 1 358 ? 43.591  -26.372 -20.513 1.00 77.13 ? 358 LYS B CA  1 
ATOM   5479 C  C   . LYS B 1 358 ? 43.054  -27.781 -20.749 1.00 74.85 ? 358 LYS B C   1 
ATOM   5480 O  O   . LYS B 1 358 ? 43.696  -28.603 -21.399 1.00 75.99 ? 358 LYS B O   1 
ATOM   5481 C  CB  . LYS B 1 358 ? 42.680  -25.647 -19.520 1.00 80.89 ? 358 LYS B CB  1 
ATOM   5482 C  CG  . LYS B 1 358 ? 43.200  -24.285 -19.077 1.00 82.59 ? 358 LYS B CG  1 
ATOM   5483 C  CD  . LYS B 1 358 ? 42.762  -23.960 -17.656 1.00 85.00 ? 358 LYS B CD  1 
ATOM   5484 C  CE  . LYS B 1 358 ? 43.295  -22.614 -17.188 1.00 84.89 ? 358 LYS B CE  1 
ATOM   5485 N  NZ  . LYS B 1 358 ? 42.443  -21.486 -17.656 1.00 84.13 ? 358 LYS B NZ  1 
HETATM 5486 NA NA  . NA  C 2 .   ? 17.890  -5.477  18.640  1.00 30.00 ? 401 NA  A NA  1 
HETATM 5487 NA NA  . NA  D 2 .   ? 2.629   3.899   34.086  1.00 31.27 ? 402 NA  A NA  1 
HETATM 5488 P  PA  . NAP E 3 .   ? -8.943  -5.112  3.547   1.00 38.95 ? 403 NAP A PA  1 
HETATM 5489 O  O1A . NAP E 3 .   ? -9.625  -4.829  2.230   1.00 40.27 ? 403 NAP A O1A 1 
HETATM 5490 O  O2A . NAP E 3 .   ? -8.370  -6.465  3.823   1.00 34.12 ? 403 NAP A O2A 1 
HETATM 5491 O  O5B . NAP E 3 .   ? -10.005 -4.744  4.696   1.00 39.78 ? 403 NAP A O5B 1 
HETATM 5492 C  C5B . NAP E 3 .   ? -10.785 -3.560  4.651   1.00 38.36 ? 403 NAP A C5B 1 
HETATM 5493 C  C4B . NAP E 3 .   ? -11.433 -3.402  6.029   1.00 38.79 ? 403 NAP A C4B 1 
HETATM 5494 O  O4B . NAP E 3 .   ? -12.053 -2.122  6.129   1.00 39.79 ? 403 NAP A O4B 1 
HETATM 5495 C  C3B . NAP E 3 .   ? -12.533 -4.418  6.266   1.00 36.59 ? 403 NAP A C3B 1 
HETATM 5496 O  O3B . NAP E 3 .   ? -12.601 -4.726  7.647   1.00 34.66 ? 403 NAP A O3B 1 
HETATM 5497 C  C2B . NAP E 3 .   ? -13.780 -3.676  5.846   1.00 40.71 ? 403 NAP A C2B 1 
HETATM 5498 O  O2B . NAP E 3 .   ? -14.989 -4.173  6.424   1.00 37.90 ? 403 NAP A O2B 1 
HETATM 5499 C  C1B . NAP E 3 .   ? -13.443 -2.295  6.353   1.00 40.60 ? 403 NAP A C1B 1 
HETATM 5500 N  N9A . NAP E 3 .   ? -14.248 -1.262  5.691   1.00 40.60 ? 403 NAP A N9A 1 
HETATM 5501 C  C8A . NAP E 3 .   ? -14.319 -0.955  4.381   1.00 42.81 ? 403 NAP A C8A 1 
HETATM 5502 N  N7A . NAP E 3 .   ? -15.199 0.072   4.200   1.00 41.72 ? 403 NAP A N7A 1 
HETATM 5503 C  C5A . NAP E 3 .   ? -15.679 0.413   5.402   1.00 41.01 ? 403 NAP A C5A 1 
HETATM 5504 C  C6A . NAP E 3 .   ? -16.641 1.393   5.933   1.00 43.42 ? 403 NAP A C6A 1 
HETATM 5505 N  N6A . NAP E 3 .   ? -17.270 2.252   5.107   1.00 45.16 ? 403 NAP A N6A 1 
HETATM 5506 N  N1A . NAP E 3 .   ? -16.852 1.421   7.260   1.00 39.58 ? 403 NAP A N1A 1 
HETATM 5507 C  C2A . NAP E 3 .   ? -16.232 0.584   8.098   1.00 39.60 ? 403 NAP A C2A 1 
HETATM 5508 N  N3A . NAP E 3 .   ? -15.361 -0.344  7.699   1.00 37.25 ? 403 NAP A N3A 1 
HETATM 5509 C  C4A . NAP E 3 .   ? -15.049 -0.461  6.381   1.00 41.07 ? 403 NAP A C4A 1 
HETATM 5510 O  O3  . NAP E 3 .   ? -7.802  -4.012  3.817   1.00 39.62 ? 403 NAP A O3  1 
HETATM 5511 P  PN  . NAP E 3 .   ? -6.594  -4.124  4.907   1.00 41.09 ? 403 NAP A PN  1 
HETATM 5512 O  O1N . NAP E 3 .   ? -5.344  -4.661  4.254   1.00 44.38 ? 403 NAP A O1N 1 
HETATM 5513 O  O2N . NAP E 3 .   ? -7.010  -4.736  6.217   1.00 41.05 ? 403 NAP A O2N 1 
HETATM 5514 O  O5D . NAP E 3 .   ? -6.333  -2.573  5.182   1.00 44.23 ? 403 NAP A O5D 1 
HETATM 5515 C  C5D . NAP E 3 .   ? -7.392  -1.639  5.340   1.00 46.92 ? 403 NAP A C5D 1 
HETATM 5516 C  C4D . NAP E 3 .   ? -6.768  -0.282  5.608   1.00 45.88 ? 403 NAP A C4D 1 
HETATM 5517 O  O4D . NAP E 3 .   ? -5.793  -0.330  6.673   1.00 46.45 ? 403 NAP A O4D 1 
HETATM 5518 C  C3D . NAP E 3 .   ? -6.017  0.255   4.400   1.00 45.94 ? 403 NAP A C3D 1 
HETATM 5519 O  O3D . NAP E 3 .   ? -6.879  0.805   3.413   1.00 43.90 ? 403 NAP A O3D 1 
HETATM 5520 C  C2D . NAP E 3 .   ? -5.066  1.244   5.055   1.00 46.70 ? 403 NAP A C2D 1 
HETATM 5521 O  O2D . NAP E 3 .   ? -5.685  2.510   5.313   1.00 48.91 ? 403 NAP A O2D 1 
HETATM 5522 C  C1D . NAP E 3 .   ? -4.719  0.572   6.377   1.00 45.05 ? 403 NAP A C1D 1 
HETATM 5523 N  N1N . NAP E 3 .   ? -3.443  -0.131  6.230   1.00 43.81 ? 403 NAP A N1N 1 
HETATM 5524 C  C2N . NAP E 3 .   ? -2.312  0.434   6.672   1.00 42.52 ? 403 NAP A C2N 1 
HETATM 5525 C  C3N . NAP E 3 .   ? -1.091  -0.227  6.536   1.00 42.96 ? 403 NAP A C3N 1 
HETATM 5526 C  C7N . NAP E 3 .   ? 0.206   0.365   7.009   1.00 46.70 ? 403 NAP A C7N 1 
HETATM 5527 O  O7N . NAP E 3 .   ? 1.147   0.350   6.227   1.00 51.06 ? 403 NAP A O7N 1 
HETATM 5528 N  N7N . NAP E 3 .   ? 0.330   0.883   8.234   1.00 46.11 ? 403 NAP A N7N 1 
HETATM 5529 C  C4N . NAP E 3 .   ? -1.042  -1.475  5.919   1.00 41.95 ? 403 NAP A C4N 1 
HETATM 5530 C  C5N . NAP E 3 .   ? -2.212  -2.034  5.456   1.00 40.58 ? 403 NAP A C5N 1 
HETATM 5531 C  C6N . NAP E 3 .   ? -3.405  -1.336  5.621   1.00 43.87 ? 403 NAP A C6N 1 
HETATM 5532 P  P2B . NAP E 3 .   ? -15.992 -5.093  5.562   1.00 41.51 ? 403 NAP A P2B 1 
HETATM 5533 O  O1X . NAP E 3 .   ? -15.392 -6.461  5.689   1.00 39.95 ? 403 NAP A O1X 1 
HETATM 5534 O  O2X . NAP E 3 .   ? -17.340 -4.917  6.229   1.00 38.54 ? 403 NAP A O2X 1 
HETATM 5535 O  O3X . NAP E 3 .   ? -15.922 -4.575  4.158   1.00 37.50 ? 403 NAP A O3X 1 
HETATM 5536 C  C   . ACT F 4 .   ? 1.324   -1.497  0.996   1.00 37.00 ? 404 ACT A C   1 
HETATM 5537 O  O   . ACT F 4 .   ? 0.432   -1.471  0.101   1.00 42.22 ? 404 ACT A O   1 
HETATM 5538 O  OXT . ACT F 4 .   ? 2.019   -2.479  1.254   0.50 30.57 ? 404 ACT A OXT 1 
HETATM 5539 C  CH3 . ACT F 4 .   ? 1.548   -0.281  1.808   1.00 39.89 ? 404 ACT A CH3 1 
HETATM 5540 C  C7  . 3JM G 5 .   ? -1.626  1.244   2.762   1.00 49.15 ? 405 3JM A C7  1 
HETATM 5541 O  O19 . 3JM G 5 .   ? -8.439  4.220   2.289   1.00 68.16 ? 405 3JM A O19 1 
HETATM 5542 C  C15 . 3JM G 5 .   ? -7.526  3.895   1.514   1.00 64.12 ? 405 3JM A C15 1 
HETATM 5543 O  O16 . 3JM G 5 .   ? -7.694  3.698   0.288   1.00 66.61 ? 405 3JM A O16 1 
HETATM 5544 C  C14 . 3JM G 5 .   ? -6.159  3.748   2.125   1.00 61.04 ? 405 3JM A C14 1 
HETATM 5545 C  C13 . 3JM G 5 .   ? -5.273  2.904   1.217   1.00 54.82 ? 405 3JM A C13 1 
HETATM 5546 C  C4  . 3JM G 5 .   ? -3.981  2.384   1.823   1.00 51.03 ? 405 3JM A C4  1 
HETATM 5547 C  C3  . 3JM G 5 .   ? -3.169  3.101   2.729   1.00 47.61 ? 405 3JM A C3  1 
HETATM 5548 C  C10 . 3JM G 5 .   ? -3.574  4.472   3.230   1.00 47.52 ? 405 3JM A C10 1 
HETATM 5549 O  O12 . 3JM G 5 .   ? -4.111  4.565   4.354   1.00 45.44 ? 405 3JM A O12 1 
HETATM 5550 O  O11 . 3JM G 5 .   ? -3.412  5.492   2.537   1.00 47.81 ? 405 3JM A O11 1 
HETATM 5551 C  C5  . 3JM G 5 .   ? -3.594  1.115   1.378   1.00 49.34 ? 405 3JM A C5  1 
HETATM 5552 C  C6  . 3JM G 5 .   ? -2.421  0.541   1.851   1.00 49.14 ? 405 3JM A C6  1 
HETATM 5553 C  C2  . 3JM G 5 .   ? -1.989  2.512   3.206   1.00 45.16 ? 405 3JM A C2  1 
HETATM 5554 C  C1  . 3JM G 5 .   ? -1.053  3.188   4.181   1.00 44.89 ? 405 3JM A C1  1 
HETATM 5555 O  O8  . 3JM G 5 .   ? -0.714  2.603   5.210   1.00 46.88 ? 405 3JM A O8  1 
HETATM 5556 O  O9  . 3JM G 5 .   ? -0.568  4.316   3.933   1.00 41.80 ? 405 3JM A O9  1 
HETATM 5557 NA NA  . NA  H 2 .   ? 32.395  9.422   -10.832 1.00 47.05 ? 401 NA  B NA  1 
HETATM 5558 P  PA  . NAP I 3 .   ? 21.175  -24.666 -17.812 0.30 45.68 ? 402 NAP B PA  1 
HETATM 5559 O  O1A . NAP I 3 .   ? 19.909  -23.944 -18.210 0.30 43.96 ? 402 NAP B O1A 1 
HETATM 5560 O  O2A . NAP I 3 .   ? 22.209  -23.979 -16.950 0.30 44.23 ? 402 NAP B O2A 1 
HETATM 5561 O  O5B . NAP I 3 .   ? 21.924  -25.117 -19.160 0.30 47.61 ? 402 NAP B O5B 1 
HETATM 5562 C  C5B . NAP I 3 .   ? 23.310  -25.455 -19.132 0.30 49.52 ? 402 NAP B C5B 1 
HETATM 5563 C  C4B . NAP I 3 .   ? 23.743  -25.957 -20.503 0.30 50.35 ? 402 NAP B C4B 1 
HETATM 5564 O  O4B . NAP I 3 .   ? 25.155  -26.192 -20.517 0.30 51.52 ? 402 NAP B O4B 1 
HETATM 5565 C  C3B . NAP I 3 .   ? 23.079  -27.274 -20.866 0.30 51.04 ? 402 NAP B C3B 1 
HETATM 5566 O  O3B . NAP I 3 .   ? 22.637  -27.227 -22.224 0.30 50.55 ? 402 NAP B O3B 1 
HETATM 5567 C  C2B . NAP I 3 .   ? 24.161  -28.317 -20.693 0.30 51.82 ? 402 NAP B C2B 1 
HETATM 5568 O  O2B . NAP I 3 .   ? 24.018  -29.402 -21.605 0.30 53.44 ? 402 NAP B O2B 1 
HETATM 5569 C  C1B . NAP I 3 .   ? 25.430  -27.528 -20.944 0.30 52.29 ? 402 NAP B C1B 1 
HETATM 5570 N  N9A . NAP I 3 .   ? 26.581  -28.081 -20.196 0.30 54.29 ? 402 NAP B N9A 1 
HETATM 5571 C  C8A . NAP I 3 .   ? 26.709  -28.168 -18.859 0.30 54.15 ? 402 NAP B C8A 1 
HETATM 5572 N  N7A . NAP I 3 .   ? 27.904  -28.725 -18.536 0.30 54.80 ? 402 NAP B N7A 1 
HETATM 5573 C  C5A . NAP I 3 .   ? 28.556  -29.000 -19.682 0.30 55.90 ? 402 NAP B C5A 1 
HETATM 5574 C  C6A . NAP I 3 .   ? 29.859  -29.591 -20.070 0.30 57.00 ? 402 NAP B C6A 1 
HETATM 5575 N  N6A . NAP I 3 .   ? 30.741  -30.021 -19.137 0.30 57.99 ? 402 NAP B N6A 1 
HETATM 5576 N  N1A . NAP I 3 .   ? 30.137  -29.691 -21.388 0.30 56.51 ? 402 NAP B N1A 1 
HETATM 5577 C  C2A . NAP I 3 .   ? 29.277  -29.272 -22.335 0.30 55.44 ? 402 NAP B C2A 1 
HETATM 5578 N  N3A . NAP I 3 .   ? 28.084  -28.728 -22.049 0.30 55.66 ? 402 NAP B N3A 1 
HETATM 5579 C  C4A . NAP I 3 .   ? 27.675  -28.571 -20.771 0.30 55.09 ? 402 NAP B C4A 1 
HETATM 5580 O  O3  . NAP I 3 .   ? 20.735  -26.082 -17.164 0.30 43.05 ? 402 NAP B O3  1 
HETATM 5581 P  PN  . NAP I 3 .   ? 20.836  -26.415 -15.590 0.30 40.82 ? 402 NAP B PN  1 
HETATM 5582 O  O1N . NAP I 3 .   ? 19.897  -25.531 -14.804 0.30 35.91 ? 402 NAP B O1N 1 
HETATM 5583 O  O2N . NAP I 3 .   ? 22.298  -26.548 -15.235 0.30 39.76 ? 402 NAP B O2N 1 
HETATM 5584 O  O5D . NAP I 3 .   ? 20.193  -27.885 -15.479 0.30 43.36 ? 402 NAP B O5D 1 
HETATM 5585 C  C5D . NAP I 3 .   ? 20.707  -28.951 -16.259 0.30 45.16 ? 402 NAP B C5D 1 
HETATM 5586 C  C4D . NAP I 3 .   ? 21.066  -28.368 -17.608 0.30 47.24 ? 402 NAP B C4D 1 
HETATM 5587 O  O4D . NAP I 3 .   ? 22.390  -28.773 -17.959 0.30 50.63 ? 402 NAP B O4D 1 
HETATM 5588 C  C3D . NAP I 3 .   ? 20.118  -28.874 -18.681 0.30 47.68 ? 402 NAP B C3D 1 
HETATM 5589 O  O3D . NAP I 3 .   ? 19.289  -27.829 -19.187 0.30 46.83 ? 402 NAP B O3D 1 
HETATM 5590 C  C2D . NAP I 3 .   ? 21.038  -29.427 -19.745 0.30 49.69 ? 402 NAP B C2D 1 
HETATM 5591 O  O2D . NAP I 3 .   ? 21.261  -28.444 -20.762 0.30 49.79 ? 402 NAP B O2D 1 
HETATM 5592 C  C1D . NAP I 3 .   ? 22.291  -29.770 -18.967 0.30 51.35 ? 402 NAP B C1D 1 
HETATM 5593 N  N1N . NAP I 3 .   ? 22.071  -31.054 -18.304 0.30 53.62 ? 402 NAP B N1N 1 
HETATM 5594 C  C2N . NAP I 3 .   ? 22.139  -31.101 -16.966 0.30 53.02 ? 402 NAP B C2N 1 
HETATM 5595 C  C3N . NAP I 3 .   ? 21.923  -32.283 -16.276 0.30 52.60 ? 402 NAP B C3N 1 
HETATM 5596 C  C7N . NAP I 3 .   ? 22.017  -32.296 -14.772 0.30 52.80 ? 402 NAP B C7N 1 
HETATM 5597 O  O7N . NAP I 3 .   ? 23.055  -31.949 -14.240 0.30 52.86 ? 402 NAP B O7N 1 
HETATM 5598 N  N7N . NAP I 3 .   ? 20.976  -32.666 -14.028 0.30 50.38 ? 402 NAP B N7N 1 
HETATM 5599 C  C4N . NAP I 3 .   ? 21.624  -33.426 -17.003 0.30 54.95 ? 402 NAP B C4N 1 
HETATM 5600 C  C5N . NAP I 3 .   ? 21.551  -33.352 -18.392 0.30 55.29 ? 402 NAP B C5N 1 
HETATM 5601 C  C6N . NAP I 3 .   ? 21.783  -32.141 -19.027 0.30 55.36 ? 402 NAP B C6N 1 
HETATM 5602 P  P2B . NAP I 3 .   ? 23.537  -30.841 -21.061 0.30 54.75 ? 402 NAP B P2B 1 
HETATM 5603 O  O1X . NAP I 3 .   ? 22.029  -30.731 -21.043 0.30 53.33 ? 402 NAP B O1X 1 
HETATM 5604 O  O2X . NAP I 3 .   ? 24.068  -31.829 -22.071 0.30 54.40 ? 402 NAP B O2X 1 
HETATM 5605 O  O3X . NAP I 3 .   ? 24.182  -30.933 -19.701 0.30 54.16 ? 402 NAP B O3X 1 
HETATM 5606 P  PA  . NAP J 3 .   ? 20.981  -24.238 -17.975 0.70 40.06 ? 403 NAP B PA  1 
HETATM 5607 O  O1A . NAP J 3 .   ? 21.218  -25.024 -16.699 0.70 40.67 ? 403 NAP B O1A 1 
HETATM 5608 O  O2A . NAP J 3 .   ? 19.559  -24.028 -18.450 0.70 35.33 ? 403 NAP B O2A 1 
HETATM 5609 O  O5B . NAP J 3 .   ? 21.774  -24.924 -19.195 0.70 40.77 ? 403 NAP B O5B 1 
HETATM 5610 C  C5B . NAP J 3 .   ? 23.060  -25.530 -19.036 0.70 41.77 ? 403 NAP B C5B 1 
HETATM 5611 C  C4B . NAP J 3 .   ? 23.638  -25.881 -20.405 0.70 40.07 ? 403 NAP B C4B 1 
HETATM 5612 O  O4B . NAP J 3 .   ? 25.048  -26.135 -20.295 0.70 41.46 ? 403 NAP B O4B 1 
HETATM 5613 C  C3B . NAP J 3 .   ? 23.035  -27.135 -21.025 0.70 39.78 ? 403 NAP B C3B 1 
HETATM 5614 O  O3B . NAP J 3 .   ? 22.952  -26.984 -22.446 0.70 37.20 ? 403 NAP B O3B 1 
HETATM 5615 C  C2B . NAP J 3 .   ? 24.039  -28.208 -20.662 0.70 40.72 ? 403 NAP B C2B 1 
HETATM 5616 O  O2B . NAP J 3 .   ? 23.995  -29.397 -21.456 0.70 42.21 ? 403 NAP B O2B 1 
HETATM 5617 C  C1B . NAP J 3 .   ? 25.313  -27.421 -20.864 0.70 42.00 ? 403 NAP B C1B 1 
HETATM 5618 N  N9A . NAP J 3 .   ? 26.447  -28.095 -20.209 0.70 45.77 ? 403 NAP B N9A 1 
HETATM 5619 C  C8A . NAP J 3 .   ? 26.592  -28.347 -18.897 0.70 45.36 ? 403 NAP B C8A 1 
HETATM 5620 N  N7A . NAP J 3 .   ? 27.764  -28.984 -18.674 0.70 46.50 ? 403 NAP B N7A 1 
HETATM 5621 C  C5A . NAP J 3 .   ? 28.385  -29.143 -19.859 0.70 48.32 ? 403 NAP B C5A 1 
HETATM 5622 C  C6A . NAP J 3 .   ? 29.655  -29.732 -20.355 0.70 50.33 ? 403 NAP B C6A 1 
HETATM 5623 N  N6A . NAP J 3 .   ? 30.542  -30.307 -19.508 0.70 51.41 ? 403 NAP B N6A 1 
HETATM 5624 N  N1A . NAP J 3 .   ? 29.902  -29.684 -21.685 0.70 48.45 ? 403 NAP B N1A 1 
HETATM 5625 C  C2A . NAP J 3 .   ? 29.047  -29.117 -22.553 0.70 47.20 ? 403 NAP B C2A 1 
HETATM 5626 N  N3A . NAP J 3 .   ? 27.881  -28.568 -22.167 0.70 48.18 ? 403 NAP B N3A 1 
HETATM 5627 C  C4A . NAP J 3 .   ? 27.504  -28.555 -20.869 0.70 47.10 ? 403 NAP B C4A 1 
HETATM 5628 O  O3  . NAP J 3 .   ? 21.707  -22.813 -17.834 0.70 41.45 ? 403 NAP B O3  1 
HETATM 5629 P  PN  . NAP J 3 .   ? 21.406  -21.525 -18.784 0.70 39.21 ? 403 NAP B PN  1 
HETATM 5630 O  O1N . NAP J 3 .   ? 20.542  -20.510 -18.077 0.70 42.78 ? 403 NAP B O1N 1 
HETATM 5631 O  O2N . NAP J 3 .   ? 21.030  -21.934 -20.173 0.70 40.20 ? 403 NAP B O2N 1 
HETATM 5632 O  O5D . NAP J 3 .   ? 22.886  -20.922 -18.719 0.70 42.55 ? 403 NAP B O5D 1 
HETATM 5633 C  C5D . NAP J 3 .   ? 24.087  -21.652 -18.907 0.70 46.21 ? 403 NAP B C5D 1 
HETATM 5634 C  C4D . NAP J 3 .   ? 25.215  -20.639 -18.754 0.70 47.86 ? 403 NAP B C4D 1 
HETATM 5635 O  O4D . NAP J 3 .   ? 25.042  -19.520 -19.636 0.70 49.12 ? 403 NAP B O4D 1 
HETATM 5636 C  C3D . NAP J 3 .   ? 25.252  -20.028 -17.364 0.70 48.13 ? 403 NAP B C3D 1 
HETATM 5637 O  O3D . NAP J 3 .   ? 25.966  -20.828 -16.433 0.70 49.12 ? 403 NAP B O3D 1 
HETATM 5638 C  C2D . NAP J 3 .   ? 25.924  -18.700 -17.600 0.70 48.82 ? 403 NAP B C2D 1 
HETATM 5639 O  O2D . NAP J 3 .   ? 27.346  -18.838 -17.581 0.70 49.83 ? 403 NAP B O2D 1 
HETATM 5640 C  C1D . NAP J 3 .   ? 25.452  -18.305 -18.986 0.70 47.83 ? 403 NAP B C1D 1 
HETATM 5641 N  N1N . NAP J 3 .   ? 24.367  -17.328 -18.825 0.70 46.92 ? 403 NAP B N1N 1 
HETATM 5642 C  C2N . NAP J 3 .   ? 24.657  -16.034 -18.972 0.70 46.28 ? 403 NAP B C2N 1 
HETATM 5643 C  C3N . NAP J 3 .   ? 23.679  -15.064 -18.827 0.70 47.02 ? 403 NAP B C3N 1 
HETATM 5644 C  C7N . NAP J 3 .   ? 24.014  -13.613 -18.994 0.70 46.97 ? 403 NAP B C7N 1 
HETATM 5645 O  O7N . NAP J 3 .   ? 23.884  -12.900 -18.015 0.70 49.84 ? 403 NAP B O7N 1 
HETATM 5646 N  N7N . NAP J 3 .   ? 24.430  -13.136 -20.170 0.70 44.54 ? 403 NAP B N7N 1 
HETATM 5647 C  C4N . NAP J 3 .   ? 22.382  -15.436 -18.505 0.70 46.27 ? 403 NAP B C4N 1 
HETATM 5648 C  C5N . NAP J 3 .   ? 22.090  -16.781 -18.338 0.70 46.44 ? 403 NAP B C5N 1 
HETATM 5649 C  C6N . NAP J 3 .   ? 23.113  -17.714 -18.505 0.70 48.40 ? 403 NAP B C6N 1 
HETATM 5650 P  P2B . NAP J 3 .   ? 23.283  -30.756 -20.921 0.70 44.14 ? 403 NAP B P2B 1 
HETATM 5651 O  O1X . NAP J 3 .   ? 21.818  -30.528 -21.225 0.70 39.62 ? 403 NAP B O1X 1 
HETATM 5652 O  O2X . NAP J 3 .   ? 23.898  -31.870 -21.735 0.70 42.14 ? 403 NAP B O2X 1 
HETATM 5653 O  O3X . NAP J 3 .   ? 23.615  -30.802 -19.449 0.70 40.98 ? 403 NAP B O3X 1 
HETATM 5654 C  C   . ACT K 4 .   ? 26.508  -14.516 -15.748 1.00 52.34 ? 404 ACT B C   1 
HETATM 5655 O  O   . ACT K 4 .   ? 25.939  -14.135 -16.789 1.00 51.83 ? 404 ACT B O   1 
HETATM 5656 O  OXT . ACT K 4 .   ? 27.432  -13.836 -15.239 1.00 49.29 ? 404 ACT B OXT 1 
HETATM 5657 C  CH3 . ACT K 4 .   ? 26.070  -15.807 -15.107 1.00 51.44 ? 404 ACT B CH3 1 
HETATM 5658 O  O   . HOH L 6 .   ? 8.614   -4.023  17.456  1.00 34.13 ? 501 HOH A O   1 
HETATM 5659 O  O   . HOH L 6 .   ? 18.120  10.653  -1.143  1.00 29.67 ? 502 HOH A O   1 
HETATM 5660 O  O   . HOH L 6 .   ? 0.720   -8.586  20.706  1.00 34.52 ? 503 HOH A O   1 
HETATM 5661 O  O   . HOH L 6 .   ? 8.927   -9.704  10.559  1.00 30.07 ? 504 HOH A O   1 
HETATM 5662 O  O   . HOH L 6 .   ? -7.620  -5.622  -1.736  1.00 36.91 ? 505 HOH A O   1 
HETATM 5663 O  O   . HOH L 6 .   ? 4.816   -3.131  24.457  1.00 49.08 ? 506 HOH A O   1 
HETATM 5664 O  O   . HOH L 6 .   ? -14.131 0.781   29.911  1.00 52.99 ? 507 HOH A O   1 
HETATM 5665 O  O   . HOH L 6 .   ? 19.009  2.006   -2.481  1.00 40.30 ? 508 HOH A O   1 
HETATM 5666 O  O   . HOH L 6 .   ? 14.663  4.600   -5.347  1.00 40.49 ? 509 HOH A O   1 
HETATM 5667 O  O   . HOH L 6 .   ? 17.789  1.132   -4.794  1.00 47.16 ? 510 HOH A O   1 
HETATM 5668 O  O   . HOH L 6 .   ? -1.130  -0.064  -4.053  1.00 31.61 ? 511 HOH A O   1 
HETATM 5669 O  O   . HOH L 6 .   ? 11.069  7.921   22.648  1.00 55.75 ? 512 HOH A O   1 
HETATM 5670 O  O   . HOH L 6 .   ? -2.570  7.275   -10.496 1.00 35.30 ? 513 HOH A O   1 
HETATM 5671 O  O   . HOH L 6 .   ? 22.230  3.148   18.304  1.00 37.78 ? 514 HOH A O   1 
HETATM 5672 O  O   . HOH L 6 .   ? 6.769   -7.684  11.894  1.00 28.85 ? 515 HOH A O   1 
HETATM 5673 O  O   . HOH L 6 .   ? 12.989  4.175   -9.940  1.00 37.45 ? 516 HOH A O   1 
HETATM 5674 O  O   . HOH L 6 .   ? -4.552  6.892   -13.543 1.00 39.28 ? 517 HOH A O   1 
HETATM 5675 O  O   . HOH L 6 .   ? 4.220   -14.613 1.387   1.00 37.23 ? 518 HOH A O   1 
HETATM 5676 O  O   . HOH L 6 .   ? 21.684  0.746   19.237  1.00 34.04 ? 519 HOH A O   1 
HETATM 5677 O  O   . HOH L 6 .   ? 20.879  -0.030  -1.875  1.00 39.50 ? 520 HOH A O   1 
HETATM 5678 O  O   . HOH L 6 .   ? 5.223   12.613  15.497  1.00 33.43 ? 521 HOH A O   1 
HETATM 5679 O  O   . HOH L 6 .   ? 4.187   14.979  17.090  1.00 47.55 ? 522 HOH A O   1 
HETATM 5680 O  O   . HOH L 6 .   ? 2.106   10.334  5.295   1.00 32.78 ? 523 HOH A O   1 
HETATM 5681 O  O   . HOH L 6 .   ? 19.488  -16.535 4.978   1.00 36.30 ? 524 HOH A O   1 
HETATM 5682 O  O   . HOH L 6 .   ? 13.041  -12.654 16.192  1.00 36.65 ? 525 HOH A O   1 
HETATM 5683 O  O   . HOH L 6 .   ? -10.077 7.114   26.307  1.00 33.53 ? 526 HOH A O   1 
HETATM 5684 O  O   . HOH L 6 .   ? 6.302   -14.487 2.308   1.00 35.56 ? 527 HOH A O   1 
HETATM 5685 O  O   . HOH L 6 .   ? 16.477  -15.319 7.209   1.00 42.58 ? 528 HOH A O   1 
HETATM 5686 O  O   . HOH L 6 .   ? 20.264  15.370  7.189   1.00 47.33 ? 529 HOH A O   1 
HETATM 5687 O  O   . HOH L 6 .   ? 15.206  -14.241 15.719  1.00 43.87 ? 530 HOH A O   1 
HETATM 5688 O  O   . HOH L 6 .   ? -1.660  -0.240  -20.578 1.00 42.99 ? 531 HOH A O   1 
HETATM 5689 O  O   . HOH L 6 .   ? -4.372  -0.126  -10.227 1.00 35.27 ? 532 HOH A O   1 
HETATM 5690 O  O   . HOH L 6 .   ? 14.758  -19.720 3.908   1.00 39.16 ? 533 HOH A O   1 
HETATM 5691 O  O   . HOH L 6 .   ? 9.687   15.003  -9.841  1.00 38.98 ? 534 HOH A O   1 
HETATM 5692 O  O   . HOH L 6 .   ? 5.635   -16.102 -5.569  1.00 36.62 ? 535 HOH A O   1 
HETATM 5693 O  O   . HOH L 6 .   ? 0.789   -3.943  5.127   1.00 43.67 ? 536 HOH A O   1 
HETATM 5694 O  O   . HOH L 6 .   ? 6.996   -11.903 17.665  1.00 34.26 ? 537 HOH A O   1 
HETATM 5695 O  O   . HOH L 6 .   ? -5.775  19.170  13.611  1.00 36.59 ? 538 HOH A O   1 
HETATM 5696 O  O   . HOH L 6 .   ? 6.629   11.413  -15.939 1.00 34.98 ? 539 HOH A O   1 
HETATM 5697 O  O   . HOH L 6 .   ? -7.058  -18.293 -2.571  0.50 29.92 ? 540 HOH A O   1 
HETATM 5698 O  O   . HOH L 6 .   ? 32.035  5.197   15.330  1.00 51.19 ? 541 HOH A O   1 
HETATM 5699 O  O   . HOH L 6 .   ? -7.665  -2.533  -16.027 1.00 39.58 ? 542 HOH A O   1 
HETATM 5700 O  O   . HOH L 6 .   ? 27.936  -11.161 7.096   1.00 38.22 ? 543 HOH A O   1 
HETATM 5701 O  O   . HOH L 6 .   ? 30.100  -5.519  5.326   1.00 41.59 ? 544 HOH A O   1 
HETATM 5702 O  O   . HOH L 6 .   ? 27.033  -7.984  5.234   1.00 35.52 ? 545 HOH A O   1 
HETATM 5703 O  O   . HOH L 6 .   ? -3.746  5.130   30.926  1.00 47.10 ? 546 HOH A O   1 
HETATM 5704 O  O   . HOH L 6 .   ? 5.371   -16.784 3.532   1.00 39.34 ? 547 HOH A O   1 
HETATM 5705 O  O   . HOH L 6 .   ? -18.673 -5.738  18.568  1.00 36.41 ? 548 HOH A O   1 
HETATM 5706 O  O   . HOH L 6 .   ? 29.447  3.276   -5.619  1.00 36.06 ? 549 HOH A O   1 
HETATM 5707 O  O   . HOH L 6 .   ? 24.909  11.921  -2.084  1.00 36.48 ? 550 HOH A O   1 
HETATM 5708 O  O   . HOH L 6 .   ? 16.240  -20.014 6.005   1.00 37.63 ? 551 HOH A O   1 
HETATM 5709 O  O   . HOH L 6 .   ? -10.485 5.305   2.010   1.00 54.73 ? 552 HOH A O   1 
HETATM 5710 O  O   . HOH L 6 .   ? 11.476  5.916   22.092  1.00 45.10 ? 553 HOH A O   1 
HETATM 5711 O  O   . HOH L 6 .   ? -0.365  10.951  4.505   1.00 41.60 ? 554 HOH A O   1 
HETATM 5712 O  O   . HOH L 6 .   ? -21.112 0.709   6.213   1.00 46.09 ? 555 HOH A O   1 
HETATM 5713 O  O   . HOH L 6 .   ? -19.033 -6.802  21.194  1.00 48.50 ? 556 HOH A O   1 
HETATM 5714 O  O   . HOH L 6 .   ? 32.264  1.408   -8.071  1.00 36.40 ? 557 HOH A O   1 
HETATM 5715 O  O   . HOH L 6 .   ? 21.001  13.119  11.379  1.00 43.23 ? 558 HOH A O   1 
HETATM 5716 O  O   . HOH L 6 .   ? -11.227 -14.078 15.302  1.00 41.30 ? 559 HOH A O   1 
HETATM 5717 O  O   . HOH L 6 .   ? -7.403  -13.320 13.769  1.00 39.86 ? 560 HOH A O   1 
HETATM 5718 O  O   . HOH L 6 .   ? 30.215  4.137   4.866   1.00 33.70 ? 561 HOH A O   1 
HETATM 5719 O  O   . HOH L 6 .   ? 7.913   12.562  15.832  1.00 33.86 ? 562 HOH A O   1 
HETATM 5720 O  O   . HOH L 6 .   ? -10.956 6.234   28.758  1.00 41.67 ? 563 HOH A O   1 
HETATM 5721 O  O   . HOH L 6 .   ? -8.012  -16.778 -4.612  0.50 26.52 ? 564 HOH A O   1 
HETATM 5722 O  O   . HOH L 6 .   ? 1.943   -20.234 -18.793 1.00 62.26 ? 565 HOH A O   1 
HETATM 5723 O  O   . HOH L 6 .   ? 6.753   -18.362 5.283   1.00 35.50 ? 566 HOH A O   1 
HETATM 5724 O  O   . HOH L 6 .   ? 26.944  -21.122 3.245   1.00 42.43 ? 567 HOH A O   1 
HETATM 5725 O  O   . HOH L 6 .   ? -7.413  -19.378 -6.014  1.00 43.03 ? 568 HOH A O   1 
HETATM 5726 O  O   . HOH L 6 .   ? 8.234   17.355  -5.538  1.00 45.02 ? 569 HOH A O   1 
HETATM 5727 O  O   . HOH L 6 .   ? -8.587  -4.713  8.092   1.00 35.97 ? 570 HOH A O   1 
HETATM 5728 O  O   . HOH L 6 .   ? -9.788  -6.224  0.161   1.00 38.66 ? 571 HOH A O   1 
HETATM 5729 O  O   . HOH L 6 .   ? -10.368 -10.820 10.864  1.00 51.12 ? 572 HOH A O   1 
HETATM 5730 O  O   . HOH L 6 .   ? -9.937  -13.146 13.063  1.00 37.87 ? 573 HOH A O   1 
HETATM 5731 O  O   . HOH L 6 .   ? -4.370  -11.303 7.926   1.00 32.76 ? 574 HOH A O   1 
HETATM 5732 O  O   . HOH L 6 .   ? 5.568   -18.987 9.569   1.00 52.77 ? 575 HOH A O   1 
HETATM 5733 O  O   . HOH L 6 .   ? 28.173  -10.154 10.434  1.00 49.40 ? 576 HOH A O   1 
HETATM 5734 O  O   . HOH L 6 .   ? 10.228  -4.616  14.906  1.00 30.28 ? 577 HOH A O   1 
HETATM 5735 O  O   . HOH L 6 .   ? -2.681  -17.668 -21.839 1.00 44.95 ? 578 HOH A O   1 
HETATM 5736 O  O   . HOH L 6 .   ? 35.084  -2.642  13.426  1.00 41.30 ? 579 HOH A O   1 
HETATM 5737 O  O   . HOH L 6 .   ? -20.699 -9.065  20.574  1.00 44.77 ? 580 HOH A O   1 
HETATM 5738 O  O   . HOH L 6 .   ? 27.590  -7.621  15.536  1.00 53.79 ? 581 HOH A O   1 
HETATM 5739 O  O   . HOH L 6 .   ? 26.340  -0.817  19.865  1.00 50.33 ? 582 HOH A O   1 
HETATM 5740 O  O   . HOH L 6 .   ? -5.322  -1.654  -3.462  1.00 52.66 ? 583 HOH A O   1 
HETATM 5741 O  O   . HOH L 6 .   ? -5.271  -2.741  -17.713 1.00 54.34 ? 584 HOH A O   1 
HETATM 5742 O  O   . HOH L 6 .   ? -19.472 1.798   8.162   1.00 47.68 ? 585 HOH A O   1 
HETATM 5743 O  O   . HOH L 6 .   ? -14.508 3.762   30.052  1.00 56.82 ? 586 HOH A O   1 
HETATM 5744 O  O   . HOH L 6 .   ? 32.489  8.216   13.102  1.00 50.13 ? 587 HOH A O   1 
HETATM 5745 O  O   . HOH L 6 .   ? -12.905 -9.349  26.252  1.00 60.36 ? 588 HOH A O   1 
HETATM 5746 O  O   . HOH L 6 .   ? 27.262  -22.815 5.282   1.00 40.72 ? 589 HOH A O   1 
HETATM 5747 O  O   . HOH L 6 .   ? 21.507  18.160  4.981   1.00 51.33 ? 590 HOH A O   1 
HETATM 5748 O  O   . HOH L 6 .   ? -9.274  -15.168 16.738  1.00 48.97 ? 591 HOH A O   1 
HETATM 5749 O  O   . HOH L 6 .   ? 27.116  12.560  4.431   1.00 40.68 ? 592 HOH A O   1 
HETATM 5750 O  O   . HOH L 6 .   ? 29.305  -8.929  6.410   1.00 33.22 ? 593 HOH A O   1 
HETATM 5751 O  O   . HOH L 6 .   ? 31.378  -3.494  3.836   1.00 38.15 ? 594 HOH A O   1 
HETATM 5752 O  O   . HOH L 6 .   ? 9.311   -8.928  0.256   1.00 28.97 ? 595 HOH A O   1 
HETATM 5753 O  O   . HOH L 6 .   ? -3.867  8.651   10.131  1.00 33.82 ? 596 HOH A O   1 
HETATM 5754 O  O   . HOH L 6 .   ? 19.983  -8.653  17.177  1.00 41.30 ? 597 HOH A O   1 
HETATM 5755 O  O   . HOH L 6 .   ? 2.868   17.125  11.234  1.00 34.23 ? 598 HOH A O   1 
HETATM 5756 O  O   . HOH L 6 .   ? -3.019  -8.548  -10.148 1.00 32.14 ? 599 HOH A O   1 
HETATM 5757 O  O   . HOH L 6 .   ? 5.367   3.095   -6.327  1.00 31.25 ? 600 HOH A O   1 
HETATM 5758 O  O   . HOH L 6 .   ? 0.696   -2.397  -6.000  1.00 29.66 ? 601 HOH A O   1 
HETATM 5759 O  O   . HOH L 6 .   ? 10.074  9.434   -2.616  1.00 31.02 ? 602 HOH A O   1 
HETATM 5760 O  O   . HOH L 6 .   ? -3.546  13.693  18.367  1.00 29.76 ? 603 HOH A O   1 
HETATM 5761 O  O   . HOH L 6 .   ? 29.810  10.000  1.194   1.00 43.20 ? 604 HOH A O   1 
HETATM 5762 O  O   . HOH L 6 .   ? -10.023 3.380   9.016   1.00 33.25 ? 605 HOH A O   1 
HETATM 5763 O  O   . HOH L 6 .   ? 6.472   -3.358  7.169   1.00 37.79 ? 606 HOH A O   1 
HETATM 5764 O  O   . HOH L 6 .   ? 23.767  -10.644 5.243   1.00 34.19 ? 607 HOH A O   1 
HETATM 5765 O  O   . HOH L 6 .   ? -4.471  -2.362  2.605   1.00 39.41 ? 608 HOH A O   1 
HETATM 5766 O  O   . HOH L 6 .   ? -8.766  16.757  19.800  1.00 37.69 ? 609 HOH A O   1 
HETATM 5767 O  O   . HOH L 6 .   ? -15.308 13.353  10.783  1.00 39.05 ? 610 HOH A O   1 
HETATM 5768 O  O   . HOH L 6 .   ? -2.103  13.970  7.281   1.00 39.12 ? 611 HOH A O   1 
HETATM 5769 O  O   . HOH L 6 .   ? -0.468  15.303  -6.143  1.00 46.03 ? 612 HOH A O   1 
HETATM 5770 O  O   . HOH L 6 .   ? -5.965  15.824  8.957   1.00 49.30 ? 613 HOH A O   1 
HETATM 5771 O  O   . HOH L 6 .   ? -15.595 -8.700  25.174  1.00 43.71 ? 614 HOH A O   1 
HETATM 5772 O  O   . HOH L 6 .   ? 14.293  -7.058  18.981  1.00 43.36 ? 615 HOH A O   1 
HETATM 5773 O  O   . HOH L 6 .   ? -9.185  -10.465 -8.936  1.00 43.27 ? 616 HOH A O   1 
HETATM 5774 O  O   . HOH L 6 .   ? 33.167  -7.399  14.501  1.00 42.11 ? 617 HOH A O   1 
HETATM 5775 O  O   . HOH L 6 .   ? 8.686   -15.821 11.993  1.00 50.72 ? 618 HOH A O   1 
HETATM 5776 O  O   . HOH L 6 .   ? 10.715  -3.195  20.748  1.00 42.64 ? 619 HOH A O   1 
HETATM 5777 O  O   . HOH L 6 .   ? -6.261  -24.391 -10.018 1.00 44.35 ? 620 HOH A O   1 
HETATM 5778 O  O   . HOH L 6 .   ? -7.184  -14.390 -15.574 1.00 46.37 ? 621 HOH A O   1 
HETATM 5779 O  O   . HOH L 6 .   ? -9.474  -13.127 -7.951  1.00 47.54 ? 622 HOH A O   1 
HETATM 5780 O  O   . HOH L 6 .   ? -5.324  9.841   3.196   1.00 48.75 ? 623 HOH A O   1 
HETATM 5781 O  O   . HOH L 6 .   ? -18.509 0.291   24.298  1.00 49.17 ? 624 HOH A O   1 
HETATM 5782 O  O   . HOH L 6 .   ? -6.602  -1.391  1.575   1.00 43.13 ? 625 HOH A O   1 
HETATM 5783 O  O   . HOH L 6 .   ? 33.295  9.820   -0.574  1.00 46.41 ? 626 HOH A O   1 
HETATM 5784 O  O   . HOH L 6 .   ? -19.791 7.493   19.265  1.00 43.68 ? 627 HOH A O   1 
HETATM 5785 O  O   . HOH L 6 .   ? 7.894   -17.533 8.955   1.00 38.44 ? 628 HOH A O   1 
HETATM 5786 O  O   . HOH L 6 .   ? -10.588 -2.471  -7.620  1.00 47.97 ? 629 HOH A O   1 
HETATM 5787 O  O   . HOH L 6 .   ? 35.127  -5.352  14.465  1.00 43.67 ? 630 HOH A O   1 
HETATM 5788 O  O   . HOH L 6 .   ? 20.322  16.499  2.358   1.00 48.97 ? 631 HOH A O   1 
HETATM 5789 O  O   . HOH L 6 .   ? 29.332  -17.479 1.444   0.40 24.15 ? 632 HOH A O   1 
HETATM 5790 O  O   . HOH L 6 .   ? -9.162  -2.416  1.396   1.00 58.15 ? 633 HOH A O   1 
HETATM 5791 O  O   . HOH L 6 .   ? -3.290  -15.978 19.737  1.00 60.35 ? 634 HOH A O   1 
HETATM 5792 O  O   . HOH L 6 .   ? 20.506  15.790  4.623   1.00 35.93 ? 635 HOH A O   1 
HETATM 5793 O  O   . HOH L 6 .   ? 20.558  -1.034  23.452  1.00 49.86 ? 636 HOH A O   1 
HETATM 5794 O  O   . HOH L 6 .   ? 18.053  18.308  1.853   1.00 58.16 ? 637 HOH A O   1 
HETATM 5795 O  O   . HOH L 6 .   ? 7.476   8.160   -12.403 1.00 31.25 ? 638 HOH A O   1 
HETATM 5796 O  O   . HOH L 6 .   ? 29.168  5.736   7.115   1.00 36.86 ? 639 HOH A O   1 
HETATM 5797 O  O   . HOH M 6 .   ? 21.930  -1.212  -4.149  1.00 38.56 ? 501 HOH B O   1 
HETATM 5798 O  O   . HOH M 6 .   ? 11.578  -8.640  -12.838 1.00 28.18 ? 502 HOH B O   1 
HETATM 5799 O  O   . HOH M 6 .   ? 7.519   -12.541 -16.344 1.00 37.72 ? 503 HOH B O   1 
HETATM 5800 O  O   . HOH M 6 .   ? 10.901  14.457  -12.377 1.00 33.61 ? 504 HOH B O   1 
HETATM 5801 O  O   . HOH M 6 .   ? 9.426   12.840  -14.118 1.00 36.76 ? 505 HOH B O   1 
HETATM 5802 O  O   . HOH M 6 .   ? 23.162  -10.477 -4.820  1.00 32.86 ? 506 HOH B O   1 
HETATM 5803 O  O   . HOH M 6 .   ? 35.491  -4.234  -24.222 1.00 37.19 ? 507 HOH B O   1 
HETATM 5804 O  O   . HOH M 6 .   ? 20.656  15.438  -13.896 1.00 33.29 ? 508 HOH B O   1 
HETATM 5805 O  O   . HOH M 6 .   ? 28.938  -19.994 1.695   0.60 28.68 ? 509 HOH B O   1 
HETATM 5806 O  O   . HOH M 6 .   ? 8.739   -5.231  -14.070 1.00 26.45 ? 510 HOH B O   1 
HETATM 5807 O  O   . HOH M 6 .   ? 30.643  10.795  -17.771 1.00 44.70 ? 511 HOH B O   1 
HETATM 5808 O  O   . HOH M 6 .   ? 22.126  18.867  -5.117  1.00 43.11 ? 512 HOH B O   1 
HETATM 5809 O  O   . HOH M 6 .   ? 18.449  15.468  -11.864 1.00 34.03 ? 513 HOH B O   1 
HETATM 5810 O  O   . HOH M 6 .   ? 28.267  -3.507  -6.526  1.00 27.58 ? 514 HOH B O   1 
HETATM 5811 O  O   . HOH M 6 .   ? 19.805  9.379   -27.760 1.00 32.65 ? 515 HOH B O   1 
HETATM 5812 O  O   . HOH M 6 .   ? 13.263  14.217  0.338   1.00 32.77 ? 516 HOH B O   1 
HETATM 5813 O  O   . HOH M 6 .   ? 12.523  -7.271  -23.070 1.00 27.31 ? 517 HOH B O   1 
HETATM 5814 O  O   . HOH M 6 .   ? 21.326  -25.077 -41.895 1.00 61.44 ? 518 HOH B O   1 
HETATM 5815 O  O   . HOH M 6 .   ? 16.841  16.365  -13.928 1.00 35.00 ? 519 HOH B O   1 
HETATM 5816 O  O   . HOH M 6 .   ? 27.392  14.812  -10.206 1.00 46.71 ? 520 HOH B O   1 
HETATM 5817 O  O   . HOH M 6 .   ? 17.437  -12.774 -33.757 1.00 34.00 ? 521 HOH B O   1 
HETATM 5818 O  O   . HOH M 6 .   ? 15.299  -8.534  -24.237 1.00 31.94 ? 522 HOH B O   1 
HETATM 5819 O  O   . HOH M 6 .   ? 14.818  -26.336 -31.258 1.00 48.14 ? 523 HOH B O   1 
HETATM 5820 O  O   . HOH M 6 .   ? 32.356  9.546   -13.332 1.00 41.41 ? 524 HOH B O   1 
HETATM 5821 O  O   . HOH M 6 .   ? 20.512  19.643  -21.519 1.00 41.96 ? 525 HOH B O   1 
HETATM 5822 O  O   . HOH M 6 .   ? 16.302  12.552  -2.052  1.00 33.13 ? 526 HOH B O   1 
HETATM 5823 O  O   . HOH M 6 .   ? 12.206  -8.424  -30.524 1.00 36.27 ? 527 HOH B O   1 
HETATM 5824 O  O   . HOH M 6 .   ? 13.424  -11.054 1.731   1.00 29.87 ? 528 HOH B O   1 
HETATM 5825 O  O   . HOH M 6 .   ? 22.439  -16.843 -8.273  1.00 39.99 ? 529 HOH B O   1 
HETATM 5826 O  O   . HOH M 6 .   ? 23.634  2.824   -30.591 1.00 51.94 ? 530 HOH B O   1 
HETATM 5827 O  O   . HOH M 6 .   ? 9.355   -28.925 -0.474  1.00 47.82 ? 531 HOH B O   1 
HETATM 5828 O  O   . HOH M 6 .   ? 36.261  -12.744 -3.855  1.00 55.18 ? 532 HOH B O   1 
HETATM 5829 O  O   . HOH M 6 .   ? 5.060   -15.255 -8.990  1.00 34.49 ? 533 HOH B O   1 
HETATM 5830 O  O   . HOH M 6 .   ? 33.797  -12.029 -14.764 1.00 45.46 ? 534 HOH B O   1 
HETATM 5831 O  O   . HOH M 6 .   ? -0.119  -3.910  -19.594 1.00 38.26 ? 535 HOH B O   1 
HETATM 5832 O  O   . HOH M 6 .   ? 14.820  -0.101  -29.845 1.00 44.61 ? 536 HOH B O   1 
HETATM 5833 O  O   . HOH M 6 .   ? 28.427  4.625   -27.254 1.00 39.96 ? 537 HOH B O   1 
HETATM 5834 O  O   . HOH M 6 .   ? 14.290  -22.198 -4.310  1.00 34.36 ? 538 HOH B O   1 
HETATM 5835 O  O   . HOH M 6 .   ? 7.136   -27.107 -13.996 1.00 48.44 ? 539 HOH B O   1 
HETATM 5836 O  O   . HOH M 6 .   ? 22.421  21.042  -18.015 1.00 48.36 ? 540 HOH B O   1 
HETATM 5837 O  O   . HOH M 6 .   ? 37.587  -12.361 -16.930 1.00 50.13 ? 541 HOH B O   1 
HETATM 5838 O  O   . HOH M 6 .   ? 7.917   -14.834 -15.764 1.00 42.80 ? 542 HOH B O   1 
HETATM 5839 O  O   . HOH M 6 .   ? 30.683  -23.570 -14.595 1.00 51.00 ? 543 HOH B O   1 
HETATM 5840 O  O   . HOH M 6 .   ? 21.939  10.353  -26.258 1.00 39.16 ? 544 HOH B O   1 
HETATM 5841 O  O   . HOH M 6 .   ? 38.185  -4.300  -25.557 1.00 51.04 ? 545 HOH B O   1 
HETATM 5842 O  O   . HOH M 6 .   ? 17.623  -4.043  -26.158 1.00 32.62 ? 546 HOH B O   1 
HETATM 5843 O  O   . HOH M 6 .   ? 21.503  -3.597  -0.069  1.00 35.50 ? 547 HOH B O   1 
HETATM 5844 O  O   . HOH M 6 .   ? 4.606   -2.279  -19.833 1.00 45.20 ? 548 HOH B O   1 
HETATM 5845 O  O   . HOH M 6 .   ? 2.136   -0.241  -17.402 1.00 31.57 ? 549 HOH B O   1 
HETATM 5846 O  O   . HOH M 6 .   ? 39.511  -11.751 -27.924 1.00 41.28 ? 550 HOH B O   1 
HETATM 5847 O  O   . HOH M 6 .   ? 32.529  -9.604  -15.135 1.00 35.07 ? 551 HOH B O   1 
HETATM 5848 O  O   . HOH M 6 .   ? 25.143  -31.029 -34.211 1.00 39.54 ? 552 HOH B O   1 
HETATM 5849 O  O   . HOH M 6 .   ? 28.185  1.624   -30.595 1.00 41.11 ? 553 HOH B O   1 
HETATM 5850 O  O   . HOH M 6 .   ? 32.150  -28.040 -38.592 1.00 46.62 ? 554 HOH B O   1 
HETATM 5851 O  O   . HOH M 6 .   ? 18.839  -4.697  -28.592 1.00 31.15 ? 555 HOH B O   1 
HETATM 5852 O  O   . HOH M 6 .   ? 19.656  -1.995  -31.532 1.00 49.04 ? 556 HOH B O   1 
HETATM 5853 O  O   . HOH M 6 .   ? 14.279  -22.940 -29.178 1.00 42.45 ? 557 HOH B O   1 
HETATM 5854 O  O   . HOH M 6 .   ? 14.596  -20.890 -22.846 1.00 42.10 ? 558 HOH B O   1 
HETATM 5855 O  O   . HOH M 6 .   ? 34.498  -1.415  -24.040 1.00 37.30 ? 559 HOH B O   1 
HETATM 5856 O  O   . HOH M 6 .   ? 9.084   -3.291  -28.463 1.00 42.15 ? 560 HOH B O   1 
HETATM 5857 O  O   . HOH M 6 .   ? -4.550  5.121   -15.479 1.00 36.90 ? 561 HOH B O   1 
HETATM 5858 O  O   . HOH M 6 .   ? 33.468  -14.849 -20.979 1.00 41.96 ? 562 HOH B O   1 
HETATM 5859 O  O   . HOH M 6 .   ? 1.979   11.146  -17.631 1.00 43.45 ? 563 HOH B O   1 
HETATM 5860 O  O   . HOH M 6 .   ? 18.508  2.733   -6.759  1.00 37.39 ? 564 HOH B O   1 
HETATM 5861 O  O   . HOH M 6 .   ? 28.962  -17.514 -0.919  0.60 27.58 ? 565 HOH B O   1 
HETATM 5862 O  O   . HOH M 6 .   ? 22.620  -21.115 -2.788  1.00 36.76 ? 566 HOH B O   1 
HETATM 5863 O  O   . HOH M 6 .   ? 26.272  11.189  -4.422  1.00 33.75 ? 567 HOH B O   1 
HETATM 5864 O  O   . HOH M 6 .   ? 16.269  4.240   -7.631  1.00 37.58 ? 568 HOH B O   1 
HETATM 5865 O  O   . HOH M 6 .   ? 7.857   9.254   -14.872 1.00 31.11 ? 569 HOH B O   1 
HETATM 5866 O  O   . HOH M 6 .   ? 17.354  14.684  -25.597 1.00 38.42 ? 570 HOH B O   1 
HETATM 5867 O  O   . HOH M 6 .   ? -6.138  5.524   -17.923 1.00 40.15 ? 571 HOH B O   1 
HETATM 5868 O  O   . HOH M 6 .   ? 32.370  9.094   -8.584  1.00 39.05 ? 572 HOH B O   1 
HETATM 5869 O  O   . HOH M 6 .   ? 22.773  -33.468 -37.288 1.00 52.85 ? 573 HOH B O   1 
HETATM 5870 O  O   . HOH M 6 .   ? 30.024  -22.219 -21.858 1.00 42.63 ? 574 HOH B O   1 
HETATM 5871 O  O   . HOH M 6 .   ? 39.590  -6.042  -19.155 1.00 43.42 ? 575 HOH B O   1 
HETATM 5872 O  O   . HOH M 6 .   ? 20.299  -26.127 1.986   1.00 44.75 ? 576 HOH B O   1 
HETATM 5873 O  O   . HOH M 6 .   ? 6.485   5.431   -15.961 1.00 29.22 ? 577 HOH B O   1 
HETATM 5874 O  O   . HOH M 6 .   ? 27.370  4.712   -6.539  1.00 32.54 ? 578 HOH B O   1 
HETATM 5875 O  O   . HOH M 6 .   ? 5.818   -14.007 -17.871 1.00 38.98 ? 579 HOH B O   1 
HETATM 5876 O  O   . HOH M 6 .   ? 4.393   -12.947 -19.785 1.00 44.21 ? 580 HOH B O   1 
HETATM 5877 O  O   . HOH M 6 .   ? 23.693  16.189  -7.310  1.00 39.25 ? 581 HOH B O   1 
HETATM 5878 O  O   . HOH M 6 .   ? 0.781   -29.668 -7.478  1.00 40.06 ? 582 HOH B O   1 
HETATM 5879 O  O   . HOH M 6 .   ? 5.131   9.695   -17.418 1.00 38.08 ? 583 HOH B O   1 
HETATM 5880 O  O   . HOH M 6 .   ? 22.155  -23.102 -22.375 1.00 40.23 ? 584 HOH B O   1 
HETATM 5881 O  O   . HOH M 6 .   ? 0.415   -5.771  -17.478 1.00 41.17 ? 585 HOH B O   1 
HETATM 5882 O  O   . HOH M 6 .   ? 5.748   6.531   -23.258 1.00 35.69 ? 586 HOH B O   1 
HETATM 5883 O  O   . HOH M 6 .   ? 20.161  -20.643 7.530   1.00 43.48 ? 587 HOH B O   1 
HETATM 5884 O  O   . HOH M 6 .   ? 23.921  -9.276  -40.108 1.00 51.38 ? 588 HOH B O   1 
HETATM 5885 O  O   . HOH M 6 .   ? 39.149  3.890   -17.744 1.00 56.37 ? 589 HOH B O   1 
HETATM 5886 O  O   . HOH M 6 .   ? 32.929  -11.259 -41.673 1.00 47.48 ? 590 HOH B O   1 
HETATM 5887 O  O   . HOH M 6 .   ? 29.667  -7.690  -43.966 1.00 41.07 ? 591 HOH B O   1 
HETATM 5888 O  O   . HOH M 6 .   ? 18.752  -18.516 6.695   1.00 35.41 ? 592 HOH B O   1 
HETATM 5889 O  O   . HOH M 6 .   ? -2.107  8.127   -12.927 1.00 40.56 ? 593 HOH B O   1 
HETATM 5890 O  O   . HOH M 6 .   ? 18.612  -8.558  -19.026 1.00 39.51 ? 594 HOH B O   1 
HETATM 5891 O  O   . HOH M 6 .   ? 19.593  -14.458 -17.639 1.00 48.90 ? 595 HOH B O   1 
HETATM 5892 O  O   . HOH M 6 .   ? 13.680  -13.097 -38.260 1.00 50.09 ? 596 HOH B O   1 
HETATM 5893 O  O   . HOH M 6 .   ? 23.035  -28.071 -40.803 1.00 53.77 ? 597 HOH B O   1 
HETATM 5894 O  O   . HOH M 6 .   ? 34.387  7.011   -21.790 1.00 55.46 ? 598 HOH B O   1 
HETATM 5895 O  O   . HOH M 6 .   ? 7.253   -1.434  -28.081 1.00 39.69 ? 599 HOH B O   1 
HETATM 5896 O  O   . HOH M 6 .   ? 25.443  -19.391 -9.107  1.00 60.13 ? 600 HOH B O   1 
HETATM 5897 O  O   . HOH M 6 .   ? 3.518   5.508   -23.572 1.00 54.82 ? 601 HOH B O   1 
HETATM 5898 O  O   . HOH M 6 .   ? 34.332  10.733  -10.969 1.00 52.12 ? 602 HOH B O   1 
HETATM 5899 O  O   . HOH M 6 .   ? 40.498  -15.256 -18.668 1.00 49.98 ? 603 HOH B O   1 
HETATM 5900 O  O   . HOH M 6 .   ? 36.057  -17.643 -38.115 1.00 38.19 ? 604 HOH B O   1 
HETATM 5901 O  O   . HOH M 6 .   ? 4.217   -26.335 5.932   1.00 41.12 ? 605 HOH B O   1 
HETATM 5902 O  O   . HOH M 6 .   ? 31.251  13.278  -19.170 0.50 34.44 ? 606 HOH B O   1 
HETATM 5903 O  O   . HOH M 6 .   ? 32.664  4.018   -24.941 1.00 51.83 ? 607 HOH B O   1 
HETATM 5904 O  O   . HOH M 6 .   ? 9.822   11.792  -25.047 1.00 51.44 ? 608 HOH B O   1 
HETATM 5905 O  O   . HOH M 6 .   ? 29.308  15.691  -19.371 1.00 54.44 ? 609 HOH B O   1 
HETATM 5906 O  O   . HOH M 6 .   ? 16.097  -15.839 -40.655 1.00 55.47 ? 610 HOH B O   1 
HETATM 5907 O  O   . HOH M 6 .   ? 11.137  4.679   -27.721 1.00 40.10 ? 611 HOH B O   1 
HETATM 5908 O  O   . HOH M 6 .   ? 12.837  3.201   -29.401 1.00 43.16 ? 612 HOH B O   1 
HETATM 5909 O  O   . HOH M 6 .   ? 27.024  -3.493  -37.747 1.00 53.94 ? 613 HOH B O   1 
HETATM 5910 O  O   . HOH M 6 .   ? 12.066  18.540  -18.532 1.00 45.77 ? 614 HOH B O   1 
HETATM 5911 O  O   . HOH M 6 .   ? 13.597  18.108  -15.397 1.00 43.45 ? 615 HOH B O   1 
HETATM 5912 O  O   . HOH M 6 .   ? 24.926  21.249  -14.614 1.00 42.78 ? 616 HOH B O   1 
HETATM 5913 O  O   . HOH M 6 .   ? 29.155  -20.991 -14.716 1.00 54.56 ? 617 HOH B O   1 
HETATM 5914 O  O   . HOH M 6 .   ? 34.244  -6.690  3.860   1.00 51.25 ? 618 HOH B O   1 
HETATM 5915 O  O   . HOH M 6 .   ? 9.274   -6.065  -29.125 1.00 42.52 ? 619 HOH B O   1 
HETATM 5916 O  O   . HOH M 6 .   ? 41.828  -5.536  -27.004 1.00 59.60 ? 620 HOH B O   1 
HETATM 5917 O  O   . HOH M 6 .   ? 15.616  19.682  -1.535  1.00 50.08 ? 621 HOH B O   1 
HETATM 5918 O  O   . HOH M 6 .   ? 26.430  -8.270  2.451   1.00 29.98 ? 622 HOH B O   1 
HETATM 5919 O  O   . HOH M 6 .   ? 8.467   -28.276 -11.652 1.00 53.00 ? 623 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   TYR 3   3   3   TYR TYR A . n 
A 1 4   THR 4   4   4   THR THR A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  GLN 17  17  17  GLN GLN A . n 
A 1 18  MET 18  18  18  MET MET A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  TYR 80  80  80  TYR TYR A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  TYR 83  83  83  TYR TYR A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  ASN 94  94  94  ASN ASN A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 PRO 109 109 109 PRO PRO A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 HIS 114 114 114 HIS HIS A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 HIS 119 119 119 HIS HIS A . n 
A 1 120 ASN 120 120 120 ASN ASN A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 CYS 125 125 125 CYS CYS A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 CYS 128 128 128 CYS CYS A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 MET 133 133 133 MET MET A . n 
A 1 134 MET 134 134 134 MET MET A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 PRO 139 139 139 PRO PRO A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
A 1 142 GLN 142 142 142 GLN GLN A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 TRP 144 144 144 TRP TRP A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 GLN 155 155 155 GLN GLN A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 MET 162 162 162 MET MET A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 THR 168 168 168 THR THR A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 ARG 173 173 173 ARG ARG A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 CYS 183 183 183 CYS CYS A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 HIS 186 186 186 HIS HIS A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 GLY 194 194 194 GLY GLY A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 LYS 197 197 197 LYS LYS A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 TYR 199 199 199 TYR TYR A . n 
A 1 200 PRO 200 200 200 PRO PRO A . n 
A 1 201 ILE 201 201 201 ILE ILE A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 PHE 203 203 203 PHE PHE A . n 
A 1 204 ASN 204 204 204 ASN ASN A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 PRO 207 207 207 PRO PRO A . n 
A 1 208 GLN 208 208 208 GLN GLN A . n 
A 1 209 ILE 209 209 209 ILE ILE A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 ASP 214 214 214 ASP ASP A . n 
A 1 215 ASN 215 215 215 ASN ASN A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 TYR 217 217 217 TYR TYR A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 TYR 219 219 219 TYR TYR A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 MET 222 222 222 MET MET A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 MET 224 224 224 MET MET A . n 
A 1 225 THR 225 225 225 THR THR A . n 
A 1 226 LYS 226 226 226 LYS LYS A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 LYS 230 230 230 LYS LYS A . n 
A 1 231 ILE 231 231 231 ILE ILE A . n 
A 1 232 MET 232 232 232 MET MET A . n 
A 1 233 GLU 233 233 233 GLU GLU A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 ASP 235 235 235 ASP ASP A . n 
A 1 236 SER 236 236 236 SER SER A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 THR 242 242 242 THR THR A . n 
A 1 243 CYS 243 243 243 CYS CYS A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 LEU 249 249 249 LEU LEU A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 ALA 251 251 251 ALA ALA A . n 
A 1 252 HIS 252 252 252 HIS HIS A . n 
A 1 253 SER 253 253 253 SER SER A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 VAL 256 256 256 VAL VAL A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 THR 260 260 260 THR THR A . n 
A 1 261 LYS 261 261 261 LYS LYS A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 ALA 264 264 264 ALA ALA A . n 
A 1 265 PRO 265 265 265 PRO PRO A . n 
A 1 266 ILE 266 266 266 ILE ILE A . n 
A 1 267 GLU 267 267 267 GLU GLU A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 ALA 272 272 272 ALA ALA A . n 
A 1 273 ILE 273 273 273 ILE ILE A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 ALA 275 275 275 ALA ALA A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 GLY 278 278 278 GLY GLY A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 GLU 282 282 282 GLU GLU A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 ASP 284 284 284 ASP ASP A . n 
A 1 285 VAL 285 285 285 VAL VAL A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 GLN 288 288 288 GLN GLN A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 TYR 290 290 290 TYR TYR A . n 
A 1 291 PRO 291 291 291 PRO PRO A . n 
A 1 292 GLN 292 292 292 GLN GLN A . n 
A 1 293 ALA 293 293 293 ALA ALA A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 ASN 295 295 295 ASN ASN A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 VAL 297 297 297 VAL VAL A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 SER 299 299 299 SER SER A . n 
A 1 300 ARG 300 300 300 ARG ARG A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 THR 302 302 302 THR THR A . n 
A 1 303 PHE 303 303 303 PHE PHE A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 ILE 307 307 307 ILE ILE A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 LYS 309 309 309 LYS LYS A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 ASP 312 312 312 ASP ASP A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 GLU 314 314 314 GLU GLU A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 ILE 317 317 317 ILE ILE A . n 
A 1 318 HIS 318 318 318 HIS HIS A . n 
A 1 319 MET 319 319 319 MET MET A . n 
A 1 320 TRP 320 320 320 TRP TRP A . n 
A 1 321 VAL 321 321 321 VAL VAL A . n 
A 1 322 VAL 322 322 322 VAL VAL A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 ASN 325 325 325 ASN ASN A . n 
A 1 326 LEU 326 326 326 LEU LEU A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 LYS 328 328 328 LYS LYS A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 ALA 330 330 330 ALA ALA A . n 
A 1 331 ALA 331 331 331 ALA ALA A . n 
A 1 332 TRP 332 332 332 TRP TRP A . n 
A 1 333 ASN 333 333 333 ASN ASN A . n 
A 1 334 SER 334 334 334 SER SER A . n 
A 1 335 VAL 335 335 335 VAL VAL A . n 
A 1 336 GLN 336 336 336 GLN GLN A . n 
A 1 337 ILE 337 337 337 ILE ILE A . n 
A 1 338 ALA 338 338 338 ALA ALA A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 THR 340 340 340 THR THR A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 HIS 342 342 342 HIS HIS A . n 
A 1 343 GLU 343 343 343 GLU GLU A . n 
A 1 344 ARG 344 344 344 ARG ARG A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 LEU 346 346 346 LEU LEU A . n 
A 1 347 VAL 347 347 347 VAL VAL A . n 
A 1 348 ARG 348 348 348 ARG ARG A . n 
A 1 349 PRO 349 349 349 PRO PRO A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 ALA 351 351 351 ALA ALA A . n 
A 1 352 GLU 352 352 352 GLU GLU A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 LYS 354 354 354 LYS LYS A . n 
A 1 355 PHE 355 355 355 PHE PHE A . n 
A 1 356 GLU 356 356 356 GLU GLU A . n 
A 1 357 LEU 357 357 357 LEU LEU A . n 
A 1 358 LYS 358 358 358 LYS LYS A . n 
A 1 359 LEU 359 359 ?   ?   ?   A . n 
A 1 360 GLU 360 360 ?   ?   ?   A . n 
A 1 361 HIS 361 361 ?   ?   ?   A . n 
A 1 362 HIS 362 362 ?   ?   ?   A . n 
A 1 363 HIS 363 363 ?   ?   ?   A . n 
A 1 364 HIS 364 364 ?   ?   ?   A . n 
A 1 365 HIS 365 365 ?   ?   ?   A . n 
A 1 366 HIS 366 366 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   2   GLY GLY B . n 
B 1 3   TYR 3   3   3   TYR TYR B . n 
B 1 4   THR 4   4   4   THR THR B . n 
B 1 5   VAL 5   5   5   VAL VAL B . n 
B 1 6   ALA 6   6   6   ALA ALA B . n 
B 1 7   VAL 7   7   7   VAL VAL B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   GLY 9   9   9   GLY GLY B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  THR 11  11  11  THR THR B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  VAL 14  14  14  VAL VAL B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  ALA 16  16  16  ALA ALA B . n 
B 1 17  GLN 17  17  17  GLN GLN B . n 
B 1 18  MET 18  18  18  MET MET B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  MET 21  21  21  MET MET B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  GLU 23  23  23  GLU GLU B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  SER 25  25  25  SER SER B . n 
B 1 26  THR 26  26  26  THR THR B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  ILE 29  29  29  ILE ILE B . n 
B 1 30  ASP 30  30  30  ASP ASP B . n 
B 1 31  LYS 31  31  31  LYS LYS B . n 
B 1 32  ILE 32  32  32  ILE ILE B . n 
B 1 33  ARG 33  33  33  ARG ARG B . n 
B 1 34  TYR 34  34  34  TYR TYR B . n 
B 1 35  LEU 35  35  35  LEU LEU B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  SER 37  37  37  SER SER B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  ARG 39  39  39  ARG ARG B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  GLY 42  42  42  GLY GLY B . n 
B 1 43  LYS 43  43  43  LYS LYS B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  LYS 46  46  46  LYS LYS B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  LYS 48  48  48  LYS LYS B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  GLN 50  50  50  GLN GLN B . n 
B 1 51  ASP 51  51  51  ASP ASP B . n 
B 1 52  ILE 52  52  52  ILE ILE B . n 
B 1 53  THR 53  53  53  THR THR B . n 
B 1 54  ILE 54  54  54  ILE ILE B . n 
B 1 55  GLU 55  55  55  GLU GLU B . n 
B 1 56  GLU 56  56  56  GLU GLU B . n 
B 1 57  THR 57  57  57  THR THR B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  ALA 61  61  61  ALA ALA B . n 
B 1 62  PHE 62  62  62  PHE PHE B . n 
B 1 63  GLU 63  63  63  GLU GLU B . n 
B 1 64  GLY 64  64  64  GLY GLY B . n 
B 1 65  VAL 65  65  65  VAL VAL B . n 
B 1 66  ASP 66  66  66  ASP ASP B . n 
B 1 67  ILE 67  67  67  ILE ILE B . n 
B 1 68  ALA 68  68  68  ALA ALA B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  PHE 70  70  70  PHE PHE B . n 
B 1 71  SER 71  71  71  SER SER B . n 
B 1 72  ALA 72  72  72  ALA ALA B . n 
B 1 73  GLY 73  73  73  GLY GLY B . n 
B 1 74  SER 74  74  74  SER SER B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  THR 76  76  76  THR THR B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  ALA 78  78  78  ALA ALA B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  TYR 80  80  80  TYR TYR B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  PRO 82  82  82  PRO PRO B . n 
B 1 83  TYR 83  83  83  TYR TYR B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  VAL 85  85  85  VAL VAL B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  ALA 87  87  87  ALA ALA B . n 
B 1 88  GLY 88  88  88  GLY GLY B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  VAL 90  90  90  VAL VAL B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  VAL 92  92  92  VAL VAL B . n 
B 1 93  ASP 93  93  93  ASP ASP B . n 
B 1 94  ASN 94  94  94  ASN ASN B . n 
B 1 95  THR 95  95  95  THR THR B . n 
B 1 96  SER 96  96  96  SER SER B . n 
B 1 97  TYR 97  97  97  TYR TYR B . n 
B 1 98  PHE 98  98  98  PHE PHE B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 GLN 100 100 100 GLN GLN B . n 
B 1 101 ASN 101 101 101 ASN ASN B . n 
B 1 102 PRO 102 102 102 PRO PRO B . n 
B 1 103 ASP 103 103 103 ASP ASP B . n 
B 1 104 VAL 104 104 104 VAL VAL B . n 
B 1 105 PRO 105 105 105 PRO PRO B . n 
B 1 106 LEU 106 106 106 LEU LEU B . n 
B 1 107 VAL 107 107 107 VAL VAL B . n 
B 1 108 VAL 108 108 108 VAL VAL B . n 
B 1 109 PRO 109 109 109 PRO PRO B . n 
B 1 110 GLU 110 110 110 GLU GLU B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 ASN 112 112 112 ASN ASN B . n 
B 1 113 ALA 113 113 113 ALA ALA B . n 
B 1 114 HIS 114 114 114 HIS HIS B . n 
B 1 115 ALA 115 115 115 ALA ALA B . n 
B 1 116 LEU 116 116 116 LEU LEU B . n 
B 1 117 ASP 117 117 117 ASP ASP B . n 
B 1 118 ALA 118 118 118 ALA ALA B . n 
B 1 119 HIS 119 119 119 HIS HIS B . n 
B 1 120 ASN 120 120 120 ASN ASN B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 ILE 122 122 122 ILE ILE B . n 
B 1 123 ILE 123 123 123 ILE ILE B . n 
B 1 124 ALA 124 124 124 ALA ALA B . n 
B 1 125 CYS 125 125 125 CYS CYS B . n 
B 1 126 PRO 126 126 126 PRO PRO B . n 
B 1 127 ASN 127 127 127 ASN ASN B . n 
B 1 128 CYS 128 128 128 CYS CYS B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 THR 130 130 130 THR THR B . n 
B 1 131 ILE 131 131 131 ILE ILE B . n 
B 1 132 GLN 132 132 132 GLN GLN B . n 
B 1 133 MET 133 133 133 MET MET B . n 
B 1 134 MET 134 134 134 MET MET B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 LEU 137 137 137 LEU LEU B . n 
B 1 138 GLU 138 138 138 GLU GLU B . n 
B 1 139 PRO 139 139 139 PRO PRO B . n 
B 1 140 VAL 140 140 140 VAL VAL B . n 
B 1 141 ARG 141 141 141 ARG ARG B . n 
B 1 142 GLN 142 142 142 GLN GLN B . n 
B 1 143 LYS 143 143 143 LYS LYS B . n 
B 1 144 TRP 144 144 144 TRP TRP B . n 
B 1 145 GLY 145 145 145 GLY GLY B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 ASP 147 147 147 ASP ASP B . n 
B 1 148 ARG 148 148 148 ARG ARG B . n 
B 1 149 ILE 149 149 149 ILE ILE B . n 
B 1 150 ILE 150 150 150 ILE ILE B . n 
B 1 151 VAL 151 151 151 VAL VAL B . n 
B 1 152 SER 152 152 152 SER SER B . n 
B 1 153 THR 153 153 153 THR THR B . n 
B 1 154 TYR 154 154 154 TYR TYR B . n 
B 1 155 GLN 155 155 155 GLN GLN B . n 
B 1 156 ALA 156 156 156 ALA ALA B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 SER 158 158 158 SER SER B . n 
B 1 159 GLY 159 159 159 GLY GLY B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 GLY 161 161 161 GLY GLY B . n 
B 1 162 MET 162 162 162 MET MET B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 ILE 165 165 165 ILE ILE B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 GLU 167 167 167 GLU GLU B . n 
B 1 168 THR 168 168 168 THR THR B . n 
B 1 169 GLN 169 169 169 GLN GLN B . n 
B 1 170 ARG 170 170 170 ARG ARG B . n 
B 1 171 GLU 171 171 171 GLU GLU B . n 
B 1 172 LEU 172 172 172 LEU LEU B . n 
B 1 173 ARG 173 173 173 ARG ARG B . n 
B 1 174 GLU 174 174 174 GLU GLU B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 LEU 176 176 176 LEU LEU B . n 
B 1 177 ASN 177 177 177 ASN ASN B . n 
B 1 178 ASP 178 178 178 ASP ASP B . n 
B 1 179 GLY 179 179 179 GLY GLY B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 LYS 181 181 181 LYS LYS B . n 
B 1 182 PRO 182 182 182 PRO PRO B . n 
B 1 183 CYS 183 183 183 CYS CYS B . n 
B 1 184 ASP 184 184 184 ASP ASP B . n 
B 1 185 LEU 185 185 185 LEU LEU B . n 
B 1 186 HIS 186 186 186 HIS HIS B . n 
B 1 187 ALA 187 187 187 ALA ALA B . n 
B 1 188 GLU 188 188 188 GLU GLU B . n 
B 1 189 ILE 189 189 189 ILE ILE B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 PRO 191 191 191 PRO PRO B . n 
B 1 192 SER 192 192 192 SER SER B . n 
B 1 193 GLY 193 193 193 GLY GLY B . n 
B 1 194 GLY 194 194 194 GLY GLY B . n 
B 1 195 ASP 195 195 195 ASP ASP B . n 
B 1 196 LYS 196 196 196 LYS LYS B . n 
B 1 197 LYS 197 197 197 LYS LYS B . n 
B 1 198 HIS 198 198 198 HIS HIS B . n 
B 1 199 TYR 199 199 199 TYR TYR B . n 
B 1 200 PRO 200 200 200 PRO PRO B . n 
B 1 201 ILE 201 201 201 ILE ILE B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 PHE 203 203 203 PHE PHE B . n 
B 1 204 ASN 204 204 204 ASN ASN B . n 
B 1 205 ALA 205 205 205 ALA ALA B . n 
B 1 206 LEU 206 206 206 LEU LEU B . n 
B 1 207 PRO 207 207 207 PRO PRO B . n 
B 1 208 GLN 208 208 208 GLN GLN B . n 
B 1 209 ILE 209 209 209 ILE ILE B . n 
B 1 210 ASP 210 210 210 ASP ASP B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 PHE 212 212 212 PHE PHE B . n 
B 1 213 THR 213 213 213 THR THR B . n 
B 1 214 ASP 214 214 214 ASP ASP B . n 
B 1 215 ASN 215 215 215 ASN ASN B . n 
B 1 216 ASP 216 216 216 ASP ASP B . n 
B 1 217 TYR 217 217 217 TYR TYR B . n 
B 1 218 THR 218 218 218 THR THR B . n 
B 1 219 TYR 219 219 219 TYR TYR B . n 
B 1 220 GLU 220 220 220 GLU GLU B . n 
B 1 221 GLU 221 221 221 GLU GLU B . n 
B 1 222 MET 222 222 222 MET MET B . n 
B 1 223 LYS 223 223 223 LYS LYS B . n 
B 1 224 MET 224 224 224 MET MET B . n 
B 1 225 THR 225 225 225 THR THR B . n 
B 1 226 LYS 226 226 226 LYS LYS B . n 
B 1 227 GLU 227 227 227 GLU GLU B . n 
B 1 228 THR 228 228 228 THR THR B . n 
B 1 229 LYS 229 229 229 LYS LYS B . n 
B 1 230 LYS 230 230 230 LYS LYS B . n 
B 1 231 ILE 231 231 231 ILE ILE B . n 
B 1 232 MET 232 232 232 MET MET B . n 
B 1 233 GLU 233 233 233 GLU GLU B . n 
B 1 234 ASP 234 234 234 ASP ASP B . n 
B 1 235 ASP 235 235 235 ASP ASP B . n 
B 1 236 SER 236 236 236 SER SER B . n 
B 1 237 ILE 237 237 237 ILE ILE B . n 
B 1 238 ALA 238 238 238 ALA ALA B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 THR 242 242 242 THR THR B . n 
B 1 243 CYS 243 243 243 CYS CYS B . n 
B 1 244 VAL 244 244 244 VAL VAL B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ILE 246 246 246 ILE ILE B . n 
B 1 247 PRO 247 247 247 PRO PRO B . n 
B 1 248 VAL 248 248 248 VAL VAL B . n 
B 1 249 LEU 249 249 249 LEU LEU B . n 
B 1 250 SER 250 250 250 SER SER B . n 
B 1 251 ALA 251 251 251 ALA ALA B . n 
B 1 252 HIS 252 252 252 HIS HIS B . n 
B 1 253 SER 253 253 253 SER SER B . n 
B 1 254 GLU 254 254 254 GLU GLU B . n 
B 1 255 SER 255 255 255 SER SER B . n 
B 1 256 VAL 256 256 256 VAL VAL B . n 
B 1 257 TYR 257 257 257 TYR TYR B . n 
B 1 258 ILE 258 258 258 ILE ILE B . n 
B 1 259 GLU 259 259 259 GLU GLU B . n 
B 1 260 THR 260 260 260 THR THR B . n 
B 1 261 LYS 261 261 261 LYS LYS B . n 
B 1 262 GLU 262 262 262 GLU GLU B . n 
B 1 263 VAL 263 263 263 VAL VAL B . n 
B 1 264 ALA 264 264 264 ALA ALA B . n 
B 1 265 PRO 265 265 265 PRO PRO B . n 
B 1 266 ILE 266 266 266 ILE ILE B . n 
B 1 267 GLU 267 267 267 GLU GLU B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 VAL 269 269 269 VAL VAL B . n 
B 1 270 LYS 270 270 270 LYS LYS B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 ALA 272 272 272 ALA ALA B . n 
B 1 273 ILE 273 273 273 ILE ILE B . n 
B 1 274 ALA 274 274 274 ALA ALA B . n 
B 1 275 ALA 275 275 275 ALA ALA B . n 
B 1 276 PHE 276 276 276 PHE PHE B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 GLY 278 278 278 GLY GLY B . n 
B 1 279 ALA 279 279 279 ALA ALA B . n 
B 1 280 VAL 280 280 280 VAL VAL B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 GLU 282 282 282 GLU GLU B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 ASP 284 284 284 ASP ASP B . n 
B 1 285 VAL 285 285 285 VAL VAL B . n 
B 1 286 ALA 286 286 286 ALA ALA B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 GLN 288 288 288 GLN GLN B . n 
B 1 289 ILE 289 289 289 ILE ILE B . n 
B 1 290 TYR 290 290 290 TYR TYR B . n 
B 1 291 PRO 291 291 291 PRO PRO B . n 
B 1 292 GLN 292 292 292 GLN GLN B . n 
B 1 293 ALA 293 293 293 ALA ALA B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 ASN 295 295 295 ASN ASN B . n 
B 1 296 ALA 296 296 296 ALA ALA B . n 
B 1 297 VAL 297 297 297 VAL VAL B . n 
B 1 298 GLY 298 298 298 GLY GLY B . n 
B 1 299 SER 299 299 299 SER SER B . n 
B 1 300 ARG 300 300 300 ARG ARG B . n 
B 1 301 ASP 301 301 301 ASP ASP B . n 
B 1 302 THR 302 302 302 THR THR B . n 
B 1 303 PHE 303 303 303 PHE PHE B . n 
B 1 304 VAL 304 304 304 VAL VAL B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ARG 306 306 306 ARG ARG B . n 
B 1 307 ILE 307 307 307 ILE ILE B . n 
B 1 308 ARG 308 308 308 ARG ARG B . n 
B 1 309 LYS 309 309 309 LYS LYS B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 LEU 311 311 311 LEU LEU B . n 
B 1 312 ASP 312 312 312 ASP ASP B . n 
B 1 313 ALA 313 313 313 ALA ALA B . n 
B 1 314 GLU 314 314 314 GLU GLU B . n 
B 1 315 LYS 315 315 315 LYS LYS B . n 
B 1 316 GLY 316 316 316 GLY GLY B . n 
B 1 317 ILE 317 317 317 ILE ILE B . n 
B 1 318 HIS 318 318 318 HIS HIS B . n 
B 1 319 MET 319 319 319 MET MET B . n 
B 1 320 TRP 320 320 320 TRP TRP B . n 
B 1 321 VAL 321 321 321 VAL VAL B . n 
B 1 322 VAL 322 322 322 VAL VAL B . n 
B 1 323 SER 323 323 323 SER SER B . n 
B 1 324 ASP 324 324 324 ASP ASP B . n 
B 1 325 ASN 325 325 325 ASN ASN B . n 
B 1 326 LEU 326 326 326 LEU LEU B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 LYS 328 328 328 LYS LYS B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 ALA 330 330 330 ALA ALA B . n 
B 1 331 ALA 331 331 331 ALA ALA B . n 
B 1 332 TRP 332 332 332 TRP TRP B . n 
B 1 333 ASN 333 333 333 ASN ASN B . n 
B 1 334 SER 334 334 334 SER SER B . n 
B 1 335 VAL 335 335 335 VAL VAL B . n 
B 1 336 GLN 336 336 336 GLN GLN B . n 
B 1 337 ILE 337 337 337 ILE ILE B . n 
B 1 338 ALA 338 338 338 ALA ALA B . n 
B 1 339 GLU 339 339 339 GLU GLU B . n 
B 1 340 THR 340 340 340 THR THR B . n 
B 1 341 LEU 341 341 341 LEU LEU B . n 
B 1 342 HIS 342 342 342 HIS HIS B . n 
B 1 343 GLU 343 343 343 GLU GLU B . n 
B 1 344 ARG 344 344 344 ARG ARG B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 LEU 346 346 346 LEU LEU B . n 
B 1 347 VAL 347 347 347 VAL VAL B . n 
B 1 348 ARG 348 348 348 ARG ARG B . n 
B 1 349 PRO 349 349 349 PRO PRO B . n 
B 1 350 THR 350 350 350 THR THR B . n 
B 1 351 ALA 351 351 351 ALA ALA B . n 
B 1 352 GLU 352 352 352 GLU GLU B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 LYS 354 354 354 LYS LYS B . n 
B 1 355 PHE 355 355 355 PHE PHE B . n 
B 1 356 GLU 356 356 356 GLU GLU B . n 
B 1 357 LEU 357 357 357 LEU LEU B . n 
B 1 358 LYS 358 358 358 LYS LYS B . n 
B 1 359 LEU 359 359 ?   ?   ?   B . n 
B 1 360 GLU 360 360 ?   ?   ?   B . n 
B 1 361 HIS 361 361 ?   ?   ?   B . n 
B 1 362 HIS 362 362 ?   ?   ?   B . n 
B 1 363 HIS 363 363 ?   ?   ?   B . n 
B 1 364 HIS 364 364 ?   ?   ?   B . n 
B 1 365 HIS 365 365 ?   ?   ?   B . n 
B 1 366 HIS 366 366 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NA  1   401 2   NA  NA  A . 
D 2 NA  1   402 3   NA  NA  A . 
E 3 NAP 1   403 1   NAP NAP A . 
F 4 ACT 1   404 1   ACT ACT A . 
G 5 3JM 1   405 1   3JM 3PR A . 
H 2 NA  1   401 1   NA  NA  B . 
I 3 NAP 1   402 2   NAP NAP B . 
J 3 NAP 1   403 3   NAP NAP B . 
K 4 ACT 1   404 2   ACT ACT B . 
L 6 HOH 1   501 1   HOH HOH A . 
L 6 HOH 2   502 2   HOH HOH A . 
L 6 HOH 3   503 3   HOH HOH A . 
L 6 HOH 4   504 4   HOH HOH A . 
L 6 HOH 5   505 5   HOH HOH A . 
L 6 HOH 6   506 6   HOH HOH A . 
L 6 HOH 7   507 7   HOH HOH A . 
L 6 HOH 8   508 9   HOH HOH A . 
L 6 HOH 9   509 11  HOH HOH A . 
L 6 HOH 10  510 15  HOH HOH A . 
L 6 HOH 11  511 17  HOH HOH A . 
L 6 HOH 12  512 18  HOH HOH A . 
L 6 HOH 13  513 21  HOH HOH A . 
L 6 HOH 14  514 24  HOH HOH A . 
L 6 HOH 15  515 27  HOH HOH A . 
L 6 HOH 16  516 28  HOH HOH A . 
L 6 HOH 17  517 30  HOH HOH A . 
L 6 HOH 18  518 31  HOH HOH A . 
L 6 HOH 19  519 33  HOH HOH A . 
L 6 HOH 20  520 34  HOH HOH A . 
L 6 HOH 21  521 35  HOH HOH A . 
L 6 HOH 22  522 36  HOH HOH A . 
L 6 HOH 23  523 38  HOH HOH A . 
L 6 HOH 24  524 40  HOH HOH A . 
L 6 HOH 25  525 41  HOH HOH A . 
L 6 HOH 26  526 42  HOH HOH A . 
L 6 HOH 27  527 43  HOH HOH A . 
L 6 HOH 28  528 44  HOH HOH A . 
L 6 HOH 29  529 45  HOH HOH A . 
L 6 HOH 30  530 47  HOH HOH A . 
L 6 HOH 31  531 48  HOH HOH A . 
L 6 HOH 32  532 50  HOH HOH A . 
L 6 HOH 33  533 51  HOH HOH A . 
L 6 HOH 34  534 53  HOH HOH A . 
L 6 HOH 35  535 55  HOH HOH A . 
L 6 HOH 36  536 56  HOH HOH A . 
L 6 HOH 37  537 58  HOH HOH A . 
L 6 HOH 38  538 59  HOH HOH A . 
L 6 HOH 39  539 61  HOH HOH A . 
L 6 HOH 40  540 62  HOH HOH A . 
L 6 HOH 41  541 63  HOH HOH A . 
L 6 HOH 42  542 64  HOH HOH A . 
L 6 HOH 43  543 65  HOH HOH A . 
L 6 HOH 44  544 66  HOH HOH A . 
L 6 HOH 45  545 67  HOH HOH A . 
L 6 HOH 46  546 68  HOH HOH A . 
L 6 HOH 47  547 69  HOH HOH A . 
L 6 HOH 48  548 71  HOH HOH A . 
L 6 HOH 49  549 73  HOH HOH A . 
L 6 HOH 50  550 74  HOH HOH A . 
L 6 HOH 51  551 75  HOH HOH A . 
L 6 HOH 52  552 76  HOH HOH A . 
L 6 HOH 53  553 78  HOH HOH A . 
L 6 HOH 54  554 80  HOH HOH A . 
L 6 HOH 55  555 81  HOH HOH A . 
L 6 HOH 56  556 83  HOH HOH A . 
L 6 HOH 57  557 85  HOH HOH A . 
L 6 HOH 58  558 86  HOH HOH A . 
L 6 HOH 59  559 88  HOH HOH A . 
L 6 HOH 60  560 89  HOH HOH A . 
L 6 HOH 61  561 90  HOH HOH A . 
L 6 HOH 62  562 92  HOH HOH A . 
L 6 HOH 63  563 93  HOH HOH A . 
L 6 HOH 64  564 95  HOH HOH A . 
L 6 HOH 65  565 97  HOH HOH A . 
L 6 HOH 66  566 99  HOH HOH A . 
L 6 HOH 67  567 100 HOH HOH A . 
L 6 HOH 68  568 101 HOH HOH A . 
L 6 HOH 69  569 102 HOH HOH A . 
L 6 HOH 70  570 104 HOH HOH A . 
L 6 HOH 71  571 105 HOH HOH A . 
L 6 HOH 72  572 107 HOH HOH A . 
L 6 HOH 73  573 109 HOH HOH A . 
L 6 HOH 74  574 111 HOH HOH A . 
L 6 HOH 75  575 112 HOH HOH A . 
L 6 HOH 76  576 113 HOH HOH A . 
L 6 HOH 77  577 114 HOH HOH A . 
L 6 HOH 78  578 115 HOH HOH A . 
L 6 HOH 79  579 116 HOH HOH A . 
L 6 HOH 80  580 118 HOH HOH A . 
L 6 HOH 81  581 120 HOH HOH A . 
L 6 HOH 82  582 121 HOH HOH A . 
L 6 HOH 83  583 122 HOH HOH A . 
L 6 HOH 84  584 123 HOH HOH A . 
L 6 HOH 85  585 125 HOH HOH A . 
L 6 HOH 86  586 126 HOH HOH A . 
L 6 HOH 87  587 128 HOH HOH A . 
L 6 HOH 88  588 130 HOH HOH A . 
L 6 HOH 89  589 131 HOH HOH A . 
L 6 HOH 90  590 132 HOH HOH A . 
L 6 HOH 91  591 134 HOH HOH A . 
L 6 HOH 92  592 135 HOH HOH A . 
L 6 HOH 93  593 160 HOH HOH A . 
L 6 HOH 94  594 179 HOH HOH A . 
L 6 HOH 95  595 204 HOH HOH A . 
L 6 HOH 96  596 205 HOH HOH A . 
L 6 HOH 97  597 206 HOH HOH A . 
L 6 HOH 98  598 207 HOH HOH A . 
L 6 HOH 99  599 208 HOH HOH A . 
L 6 HOH 100 600 209 HOH HOH A . 
L 6 HOH 101 601 210 HOH HOH A . 
L 6 HOH 102 602 211 HOH HOH A . 
L 6 HOH 103 603 212 HOH HOH A . 
L 6 HOH 104 604 213 HOH HOH A . 
L 6 HOH 105 605 215 HOH HOH A . 
L 6 HOH 106 606 216 HOH HOH A . 
L 6 HOH 107 607 217 HOH HOH A . 
L 6 HOH 108 608 219 HOH HOH A . 
L 6 HOH 109 609 221 HOH HOH A . 
L 6 HOH 110 610 222 HOH HOH A . 
L 6 HOH 111 611 223 HOH HOH A . 
L 6 HOH 112 612 224 HOH HOH A . 
L 6 HOH 113 613 225 HOH HOH A . 
L 6 HOH 114 614 226 HOH HOH A . 
L 6 HOH 115 615 227 HOH HOH A . 
L 6 HOH 116 616 228 HOH HOH A . 
L 6 HOH 117 617 229 HOH HOH A . 
L 6 HOH 118 618 230 HOH HOH A . 
L 6 HOH 119 619 232 HOH HOH A . 
L 6 HOH 120 620 233 HOH HOH A . 
L 6 HOH 121 621 235 HOH HOH A . 
L 6 HOH 122 622 236 HOH HOH A . 
L 6 HOH 123 623 237 HOH HOH A . 
L 6 HOH 124 624 238 HOH HOH A . 
L 6 HOH 125 625 240 HOH HOH A . 
L 6 HOH 126 626 241 HOH HOH A . 
L 6 HOH 127 627 242 HOH HOH A . 
L 6 HOH 128 628 244 HOH HOH A . 
L 6 HOH 129 629 245 HOH HOH A . 
L 6 HOH 130 630 246 HOH HOH A . 
L 6 HOH 131 631 248 HOH HOH A . 
L 6 HOH 132 632 250 HOH HOH A . 
L 6 HOH 133 633 251 HOH HOH A . 
L 6 HOH 134 634 252 HOH HOH A . 
L 6 HOH 135 635 253 HOH HOH A . 
L 6 HOH 136 636 254 HOH HOH A . 
L 6 HOH 137 637 256 HOH HOH A . 
L 6 HOH 138 638 260 HOH HOH A . 
L 6 HOH 139 639 261 HOH HOH A . 
M 6 HOH 1   501 8   HOH HOH B . 
M 6 HOH 2   502 10  HOH HOH B . 
M 6 HOH 3   503 12  HOH HOH B . 
M 6 HOH 4   504 13  HOH HOH B . 
M 6 HOH 5   505 14  HOH HOH B . 
M 6 HOH 6   506 16  HOH HOH B . 
M 6 HOH 7   507 19  HOH HOH B . 
M 6 HOH 8   508 20  HOH HOH B . 
M 6 HOH 9   509 22  HOH HOH B . 
M 6 HOH 10  510 23  HOH HOH B . 
M 6 HOH 11  511 25  HOH HOH B . 
M 6 HOH 12  512 26  HOH HOH B . 
M 6 HOH 13  513 29  HOH HOH B . 
M 6 HOH 14  514 32  HOH HOH B . 
M 6 HOH 15  515 37  HOH HOH B . 
M 6 HOH 16  516 39  HOH HOH B . 
M 6 HOH 17  517 46  HOH HOH B . 
M 6 HOH 18  518 49  HOH HOH B . 
M 6 HOH 19  519 52  HOH HOH B . 
M 6 HOH 20  520 54  HOH HOH B . 
M 6 HOH 21  521 57  HOH HOH B . 
M 6 HOH 22  522 60  HOH HOH B . 
M 6 HOH 23  523 70  HOH HOH B . 
M 6 HOH 24  524 72  HOH HOH B . 
M 6 HOH 25  525 77  HOH HOH B . 
M 6 HOH 26  526 79  HOH HOH B . 
M 6 HOH 27  527 82  HOH HOH B . 
M 6 HOH 28  528 84  HOH HOH B . 
M 6 HOH 29  529 87  HOH HOH B . 
M 6 HOH 30  530 91  HOH HOH B . 
M 6 HOH 31  531 94  HOH HOH B . 
M 6 HOH 32  532 96  HOH HOH B . 
M 6 HOH 33  533 98  HOH HOH B . 
M 6 HOH 34  534 103 HOH HOH B . 
M 6 HOH 35  535 106 HOH HOH B . 
M 6 HOH 36  536 108 HOH HOH B . 
M 6 HOH 37  537 110 HOH HOH B . 
M 6 HOH 38  538 117 HOH HOH B . 
M 6 HOH 39  539 119 HOH HOH B . 
M 6 HOH 40  540 124 HOH HOH B . 
M 6 HOH 41  541 127 HOH HOH B . 
M 6 HOH 42  542 129 HOH HOH B . 
M 6 HOH 43  543 133 HOH HOH B . 
M 6 HOH 44  544 136 HOH HOH B . 
M 6 HOH 45  545 137 HOH HOH B . 
M 6 HOH 46  546 138 HOH HOH B . 
M 6 HOH 47  547 139 HOH HOH B . 
M 6 HOH 48  548 140 HOH HOH B . 
M 6 HOH 49  549 141 HOH HOH B . 
M 6 HOH 50  550 142 HOH HOH B . 
M 6 HOH 51  551 143 HOH HOH B . 
M 6 HOH 52  552 144 HOH HOH B . 
M 6 HOH 53  553 145 HOH HOH B . 
M 6 HOH 54  554 146 HOH HOH B . 
M 6 HOH 55  555 147 HOH HOH B . 
M 6 HOH 56  556 148 HOH HOH B . 
M 6 HOH 57  557 149 HOH HOH B . 
M 6 HOH 58  558 150 HOH HOH B . 
M 6 HOH 59  559 151 HOH HOH B . 
M 6 HOH 60  560 152 HOH HOH B . 
M 6 HOH 61  561 153 HOH HOH B . 
M 6 HOH 62  562 154 HOH HOH B . 
M 6 HOH 63  563 155 HOH HOH B . 
M 6 HOH 64  564 156 HOH HOH B . 
M 6 HOH 65  565 157 HOH HOH B . 
M 6 HOH 66  566 158 HOH HOH B . 
M 6 HOH 67  567 159 HOH HOH B . 
M 6 HOH 68  568 161 HOH HOH B . 
M 6 HOH 69  569 162 HOH HOH B . 
M 6 HOH 70  570 163 HOH HOH B . 
M 6 HOH 71  571 164 HOH HOH B . 
M 6 HOH 72  572 165 HOH HOH B . 
M 6 HOH 73  573 166 HOH HOH B . 
M 6 HOH 74  574 167 HOH HOH B . 
M 6 HOH 75  575 168 HOH HOH B . 
M 6 HOH 76  576 169 HOH HOH B . 
M 6 HOH 77  577 170 HOH HOH B . 
M 6 HOH 78  578 171 HOH HOH B . 
M 6 HOH 79  579 172 HOH HOH B . 
M 6 HOH 80  580 173 HOH HOH B . 
M 6 HOH 81  581 174 HOH HOH B . 
M 6 HOH 82  582 175 HOH HOH B . 
M 6 HOH 83  583 176 HOH HOH B . 
M 6 HOH 84  584 177 HOH HOH B . 
M 6 HOH 85  585 178 HOH HOH B . 
M 6 HOH 86  586 180 HOH HOH B . 
M 6 HOH 87  587 181 HOH HOH B . 
M 6 HOH 88  588 182 HOH HOH B . 
M 6 HOH 89  589 183 HOH HOH B . 
M 6 HOH 90  590 184 HOH HOH B . 
M 6 HOH 91  591 185 HOH HOH B . 
M 6 HOH 92  592 186 HOH HOH B . 
M 6 HOH 93  593 187 HOH HOH B . 
M 6 HOH 94  594 188 HOH HOH B . 
M 6 HOH 95  595 189 HOH HOH B . 
M 6 HOH 96  596 190 HOH HOH B . 
M 6 HOH 97  597 191 HOH HOH B . 
M 6 HOH 98  598 192 HOH HOH B . 
M 6 HOH 99  599 193 HOH HOH B . 
M 6 HOH 100 600 194 HOH HOH B . 
M 6 HOH 101 601 195 HOH HOH B . 
M 6 HOH 102 602 196 HOH HOH B . 
M 6 HOH 103 603 197 HOH HOH B . 
M 6 HOH 104 604 198 HOH HOH B . 
M 6 HOH 105 605 199 HOH HOH B . 
M 6 HOH 106 606 200 HOH HOH B . 
M 6 HOH 107 607 201 HOH HOH B . 
M 6 HOH 108 608 202 HOH HOH B . 
M 6 HOH 109 609 203 HOH HOH B . 
M 6 HOH 110 610 214 HOH HOH B . 
M 6 HOH 111 611 218 HOH HOH B . 
M 6 HOH 112 612 220 HOH HOH B . 
M 6 HOH 113 613 231 HOH HOH B . 
M 6 HOH 114 614 234 HOH HOH B . 
M 6 HOH 115 615 239 HOH HOH B . 
M 6 HOH 116 616 243 HOH HOH B . 
M 6 HOH 117 617 247 HOH HOH B . 
M 6 HOH 118 618 249 HOH HOH B . 
M 6 HOH 119 619 255 HOH HOH B . 
M 6 HOH 120 620 257 HOH HOH B . 
M 6 HOH 121 621 258 HOH HOH B . 
M 6 HOH 122 622 259 HOH HOH B . 
M 6 HOH 123 623 262 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9740  ? 
1 MORE         -60   ? 
1 'SSA (A^2)'  24280 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A PHE 276 ? A PHE 276 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? A ALA 279 ? A ALA 279 ? 1_555 93.4  ? 
2  O   ? A PHE 276 ? A PHE 276 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? A ALA 274 ? A ALA 274 ? 1_555 126.5 ? 
3  O   ? A ALA 279 ? A ALA 279 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? A ALA 274 ? A ALA 274 ? 1_555 115.0 ? 
4  O   ? B SER 236 ? B SER 236 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 OD1 ? B ASP 147 ? B ASP 147 ? 1_555 175.4 ? 
5  O   ? B SER 236 ? B SER 236 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? B ASP 147 ? B ASP 147 ? 1_555 101.6 ? 
6  OD1 ? B ASP 147 ? B ASP 147 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? B ASP 147 ? B ASP 147 ? 1_555 76.2  ? 
7  O   ? B SER 236 ? B SER 236 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 572 ? 1_555 97.0  ? 
8  OD1 ? B ASP 147 ? B ASP 147 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 572 ? 1_555 87.0  ? 
9  O   ? B ASP 147 ? B ASP 147 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 572 ? 1_555 84.9  ? 
10 O   ? B SER 236 ? B SER 236 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 602 ? 1_555 90.7  ? 
11 OD1 ? B ASP 147 ? B ASP 147 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 602 ? 1_555 91.1  ? 
12 O   ? B ASP 147 ? B ASP 147 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 602 ? 1_555 166.8 ? 
13 O   ? M HOH .   ? B HOH 572 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 602 ? 1_555 98.5  ? 
14 O   ? B SER 236 ? B SER 236 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 524 ? 1_555 79.2  ? 
15 OD1 ? B ASP 147 ? B ASP 147 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 524 ? 1_555 96.7  ? 
16 O   ? B ASP 147 ? B ASP 147 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 524 ? 1_555 91.7  ? 
17 O   ? M HOH .   ? B HOH 572 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 524 ? 1_555 174.3 ? 
18 O   ? M HOH .   ? B HOH 602 ? 1_555 NA ? H NA . ? B NA 401 ? 1_555 O   ? M HOH .   ? B HOH 524 ? 1_555 85.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-12-10 
2 'Structure model' 1 1 2014-12-31 
3 'Structure model' 1 2 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .        ? 1 
REFMAC    refinement        5.8.0049 ? 2 
HKL-2000  'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    512 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    553 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.12 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 36  ? ? -151.80 -149.07 
2  1 LYS A 48  ? ? 52.55   -115.13 
3  1 ILE A 189 ? ? -120.21 -61.72  
4  1 PRO A 207 ? ? -83.24  48.48   
5  1 ASP A 210 ? ? 67.14   -174.08 
6  1 ASP A 216 ? ? 72.03   -0.10   
7  1 ALA A 251 ? ? 90.91   119.00  
8  1 ASP A 284 ? ? -152.17 82.58   
9  1 ASP A 312 ? ? -131.11 -47.81  
10 1 LEU A 327 ? ? -95.99  -94.77  
11 1 ALA A 330 ? ? -156.08 -81.89  
12 1 ALA B 36  ? ? -154.28 -150.07 
13 1 LYS B 48  ? ? 50.97   -124.22 
14 1 ASP B 210 ? ? 64.34   -170.52 
15 1 ASP B 234 ? ? -163.14 97.15   
16 1 ALA B 251 ? ? 94.29   118.97  
17 1 ASP B 312 ? ? -133.78 -44.63  
18 1 LEU B 327 ? ? -104.24 -95.61  
19 1 ALA B 330 ? ? -152.88 -77.57  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A LEU 359 ? A LEU 359 
3  1 Y 1 A GLU 360 ? A GLU 360 
4  1 Y 1 A HIS 361 ? A HIS 361 
5  1 Y 1 A HIS 362 ? A HIS 362 
6  1 Y 1 A HIS 363 ? A HIS 363 
7  1 Y 1 A HIS 364 ? A HIS 364 
8  1 Y 1 A HIS 365 ? A HIS 365 
9  1 Y 1 A HIS 366 ? A HIS 366 
10 1 Y 1 B MET 1   ? B MET 1   
11 1 Y 1 B LEU 359 ? B LEU 359 
12 1 Y 1 B GLU 360 ? B GLU 360 
13 1 Y 1 B HIS 361 ? B HIS 361 
14 1 Y 1 B HIS 362 ? B HIS 362 
15 1 Y 1 B HIS 363 ? B HIS 363 
16 1 Y 1 B HIS 364 ? B HIS 364 
17 1 Y 1 B HIS 365 ? B HIS 365 
18 1 Y 1 B HIS 366 ? B HIS 366 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION'                                       NA  
3 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' NAP 
4 'ACETATE ION'                                      ACT 
5 '3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid'  3JM 
6 water                                              HOH 
#